4DIAA

Crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
293
structure length
286
Chain Sequence
LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLPKDKFLEVAGRLPAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTNWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-pyrone-4,6-dicarbaxylate hydrolase
publication title Structure and Catalytic Mechanism of LigI: Insight into the Amidohydrolase Enzymes of cog3618 and Lignin Degradation.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 94
structure length 286
sequence length 293
ec nomenclature ec 3.1.1.57: 2-pyrone-4,6-dicarboxylate lactonase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4diaA00
4WVXA 1ITQA 2D2JA 3E38A 3PNZA 4XD5A 4KEZA 2Q09A 4C6JA 3K5XA 2O4QA 1KCXA 2DVUA 4JOMA 2Q01A 4C5ZA 1UMLA 4RDWA 4B92A 4DNMA 1I0BA 2OB3A 3ICJA 3IPWA 5LXXA 4J5NA 4AC7C 3MVIA 1EJUC 4QROA 4IG2A 2OGJA 3PBMA 2HBXA 2E1WA 1EJWC 3GTXA 3OOQA 3DCPA 1RJQA 2WM1A 3ID7A 4C60A 3URNA 2FTYA 2VM8A 4KQNA 2GWNA 4LAOA 1A5LC 2GSEA 4UBPC 2D2HA 1EJTC 3OJGA 3LSCA 4GYFA 3URBA 3O7UA 2AMXA 4BKNA 1FKWA 3QGKC 3URAA 3IACA 3FEQA 1ADDA 1RA0A 3HM7A 2WJFA 4H9TA 3LY0A 2WJDA 4QRNA 3IRSA 4GY0A 4DYKA 4GY1A 4C6FA 3DC8A 3GIQA 3LSBA 4RDVA 4XAYA 2VUNA 2P53A 4RDZA 4CEUC 4LCQA 4C6NA 4R7WA 5HMEA 4QS5A 3QY6A 3AU2A 2VC5A 4NI8A 3ORWA 2HPMA 4PBEA 4AQLA 1BF6A 4BY3A 4V1YA 1RAKA 3MTWA 1K6WA 3MSRA 4IFKA 3GTIA 4CNTA 4I6VA 1A4LA 4LH8A 1YIXA 3DUGA 2QPXA 3B40A 1PO9A 2Z25A 4CNSA 1P1MA 3E0LA 4R88A 2GZXA 2Z24A 2Z26A 3MDWA 3CAKA 4I6KA 1UIOA 3E74A 3OODA 1PB0A 2ZC1A 5AKQA 1FWFC 1A5OC 2YB4A 3E2VA 4IGMA 2P50A 2PLMA 3GTHA 1M68A 3AU6A 3LS9A 1V7AA 1FWGC 2EG7A 1FWIC 3QGAC 1ITUA 2XIOA 3IGHX 4HA0A 4ERGA 3SO7A 2ADAA 4B90A 4CQCA 1RK6A 4GOAA 2BB0A 4ZSUA 2FVKA 1WXZA 4HK7A 1J79A 1EF2A 1XRFA 3R0DA 2R1PA 1W1IE 4RZBA 3RHGA 3PNUA 2I9UA 4C65A 3TN4A 2DVTA 4H9ZA 1M7JA 3F4CA 3WMLA 2RAGA 4C6KA 4G7EA 1VFLA 4EPKA 4BJHA 1UBPC 3HTWA 4GY7A 1EJXC 1A5NC 1QW7A 4IG2B 4P5UA 4B3ZA 3A3XA 2AQVA 3TN6A 4RDYA 1FWEC 4F0LA 3LGGA 2HNHA 3FDKA 4QS6A 4XAGA 1YRRA 2GOKA 3LU2A 3BE7A 5A6TC 1WXYA 3B0YA 3UR5A 3UF9A 2Z29A 4LEFA 4H9XA 1IE7C 3WZ0E 3WYZA 4GXWA 4CEXC 1P6CA 4PCPA 3OU8A 3T81A 4C6QA 4DLFA 4KESA 4EP8C 4LAKA 4GC3A 2O4MA 4KERA 4RE0A 3D6NA 3G77A 1KRAC 4KEUA 4H9UA 4C6PA 4H9YA 4C6IA 4HJWA 3URQA 4C6LA 4E3TA 1O12A 3PAOA 2CZVA 4C6MA 1YBQA 4C6DA 1POKA 2YZ5A 1QXLA 3OVGA 4GK8A 2QVNA 1UIPA 1RJRA 3SFWA 3T1GA 1ONXA 3NEHA 1I0DA 4EPBC 1RA5A 4ERIA 3UR2A 2Z28A 3HPAA 4DZHA 4PCNA 4IFKB 4PBFA 1R9ZA 4KEVA 1RK5A 2QS8A 2R1KA 3MKVA 4J35A 1FWDC 4J2MA 2KAUC 4LCSA 2UZ9A 4WGXA 1J6PA 4GZ7A 4H9MA 3TN5A 1R9XA 4C6EA 1DPMA 2QT3A 1FWBC 3MJMA 3A3WA 4HK6A 4CNUA 3IJ6A 2Y1HA 1FKXA 3RCMA 4DO7A 4L9XA 3GU1A 4XAFA 3T8LA 1M65A 1A5MC 4C6BA 1GKPA 4R85A 4WHBA 2Z2AA 3F2BA 2BGNE 4F0RA 2PGFA 4ERAA 2PUZA 1E9ZB 1EYWA 2D2GA 3EGJA 4D8LA 5CH9A 4IQJA 2E25A 2R1LA 3ISIX 4GX9A 1NDVA 1ONWA 3O0FA 2R1MA 4V1XA 2VR2A 1K70A 3S2MA 3GIPA 2F6KA 1EJVC 3GUWA 3JZEA 3MDUA 4DI8A 4UB9A 2VC7A 3K4WA 3NQBA 2HPIA 3MPGA 3QY7A 3AUOA 3EWCA 4B91A 3GTFA 1KRCC 3F2CA 2Z2BA 4DI9A 3EWDA 3B0XA 2WJEA 2ICSA 1J5SA 1JGMA 3GRIA 4L6DA 4XD3A 1EJRC 4QTGA 3GU9A 4DIAA 1V79A 2Z00A 1E9YB 4GBDA 1EZ2A 1POJA 4F0SA 2Z7GA 1GKRA 4ZSTA 1J6OA 2HBVA 4G2DA 4INFA 4CQDA 2OOFA 2EG8A 2W9MA 1NDYA 2GWGA 2Z27A 4IGNA 4IFOA 3CJPA 1NFGA 3FDGA 3TN3A 4LAMA 2IMRA 3N2CA 4M51A 3RN6A 2Z4GA 1NDWA 4C5YA 3UBPC 5HMDA 4EPDC 1YBQB 3F2DA 1FWCC 1ZZMA 2G3FA 3IV8A 4TQTA 4PE8A 2AQOA 2PGRA 4XAZA 1GKQA 3PANA 4ICMA 4H00A 4KETA 4LANA 1V4YA 5E5CA 5FSEC 5FSDC 2ANUA 3E3HA 2FTWA 2YB1A 3A4JA 2YXOA 4HK5A 3S2LA 4IFRA 4NP7A 1XGEA 1K1DA 3MVTA 4DLMA 1A4MA 4LFYA 4MUPA 2FVMA 1NDZA 5G4HC 3C86A 3GG7A 1FWJC 3TNBA 3KM8A 4KF1A 3RYSA 1HZYA 1KRBC 2PAJA 1V51A 4GX8A 3OQEA 4IF2A 4LALA 4CQBA 2OODA 1V77A 3LGDA 3GU2A 2UBPC 1XWYA 2R1NA 1P6BA 1YMYA 1PTAA 1FWHC 4QSFA 3S4TA 4C6CA 5HMFA 4IH3A 3ITCA 3LA4A 4H9VA 3CS2A 4H01A 3V7PA 1FWAC 4XD6A 1S3TC 1KRMA 3S2JA 4YIWA 2FFIA 1RJPA 3E0FA 3F4DA 4LCRA 4OFCA 4C6OA 2I5GA 2OQLA 3UPMA 1PSCA 2DVXA 2VHLA 4G7EB 1EJSC 1R9YA 1XRTA 1A5KC 3QY8A 1O5RA 2EG6A 4EPEC 3K2GA 3IARA 4Z42C 3S2NA 4XD4A 2HQAA 4NG3A 1YNYA 3LNPA 4KIRA 4DZIA 2A3LA 3NURA
chains in the Genus database with same CATH superfamily
2D2JA 3ARQA 4NASA 3ARSA 1W1VA 3ZWTA 2O9RA 5A94A 2QGYA 5DT7A 4WKAA 3FNDA 2WHMA 4YCPA 3R13A 3L4TA 1AQHA 4Y9AA 2V30A 4KQNA 5E1QA 2OR2A 4AWUA 1HGYA 4L80A 3UT0A 4NJGA 3TSBA 1QNRA 3WLJA 4AVFA 1F4HA 4LOCA 4X0NA 1S3HA 1SFLA 2BHZA 2Q6ZA 2B81A 3WUGA 4GH1A 2A2IA 3NQMA 3RM8A 4DWSC 2H6RA 4KGLA 4XAYA 5BWAA 4O4VA 5CPQA 4LCQA 1UD3A 1C8XA 1XBYA 3L4XA 3TYDA 3R4IA 1OFRA 1AW5A 1BPLB 3ME3A 3ES7A 4GNVA 3ZZ1A 1PX4A 3II1A 3ORWA 4PBEA 4QM1A 5MHBA 1DORA 4J27A 5DY3A 4XUYA 1Q6FA 4NSBA 3E0LA 2Z0IA 4LJ3A 2J6XA 4TX6A 4QDWA 3TIMA 4AEEA 1WDWA 5BWFA 3WQDA 2P0OA 4O1FA 2WZTA 3W1QA 4CQ9A 3U6WA 1IHIA 3OW1A 3NSXA 1EIBA 5A2AA 2WHLA 4NYYA 1MUWA 1MQQA 3I7QA 4PC8A 5D2TA 3SO7A 4HPHA 3AZRA 1TREA 3IJ9A 2VRQA 2BB0A 2B31A 4UTWC 3GC4A 1EQCA 5CGTA 3KVLA 2ZZ6A 4YL2A 4YPJA 2I1OA 3BAXA 3RHGA 2JKPA 2WNWA 4UTMA 5T8GA 1F3EA 2E77A 3WMLA 2X2GA 2HVOA 3AO0A 4L4PA 1E6ZA 1E6QM 3GC5A 4UQDA 3VDHA 3QTPA 3UVAA 1A5NC 4AG0A 1TPVA 1DYSA 4ZO6A 1G01A 2PI6A 3H7UA 5IHRA 3QV8A 3TK7A 3RLGA 2OX1A 1YE4A 3GNRA 1QDSA 4FLSA 1UP0A 1PKYA 1JZ2A 3ONCA 1ZRQA 2PS2A 3L67A 3VKAA 1DJWA 5FF0A 1I75A 3KL5A 4V28A 1Y5XA 2BSLA 6TAAA 3MP5A 4S2CA 4C6QA 4CN6A 4DF2A 1I2PA 3TW7A 1AW1A 3TYCA 2ABAA 3CC1A 3GO2A 4UR9A 4C7DA 1P0KA 2QR6A 4LYRA 3DYPA 2C1HA 4EE9A 1VYSX 3RCYA 3UG4A 2WC3A 3HJZA 2IXUA 4D6JA 2PP1A 3ANVA 1PUDA 4FOKA 4LY8A 4JY9A 2Q8LA 4DZHA 4PCNA 4IFKB 2OU4A 3QMRA 3GNNA 3NL6A 2GDUA 3C56A 2QPUA 4WGXA 3ZFHA 4N9CA 1LP6A 2XG9A 3CUXA 3SRHA 4UZSA 1OY0A 7TAAA 3ZIZA 3EDJA 2J13A 5C2GA 2HXUA 5LNWA 2GDVA 3GWQA 1DV7A 3QQ0A 4JTQA 3SRDA 4WHBA 1CLKA 2E6DA 4AWTA 1JXJA 1O4UA 4GYPA 3F4WA 5HQMA 4E4FA 1UA3A 2FDMA 3BGAA 4FP1A 2QF7A 3QV7A 4GX9A 1D3HA 4IMCA 2OYKA 5ABTA 3B3DA 2ZA2A 3CQHA 4F79A 2RJGA 2CNCA 3O15A 3LERA 2BXVA 2BY0A 4MIMA 1GOWA 3NQDA 4HOWA 4QE4A 1RPKA 3MKKA 3T2PA 2V5LA 3NZPA 3TV8A 1C7SA 1DJGA 1MNSA 3W7HA 5DBTA 5GJNA 4XSMA 3F2CA 3WUEA 1TPH1 1CNVA 3AIEA 1XUZA 4HHHA 2PBGA 1RR2A 3E49A 2IPGA 2JKEA 1GEQA 3LB0A 2DJLA 2OZ3A 3U7BA 2PD9A 3UY8A 4FALA 3VD3A 2OSYA 1BG9A 3DYMA 3QQWA 4O0QA 3KOWA 2DPEA 2H90A 4UNIA 4O0KA 3U5YA 1K6AA 4ATLA 2FDSA 3TYUA 2J7HA 2RDUA 3AC0A 1OT2A 3TSMA 5FSEC 5FSDC 1EHAA 1BTMA 3L7RA 4AFYA 3WBXA 1W5PA 4LUTB 4TX9A 3N19B 3NGJA 4QFUA 1GZ1A 3M5ZA 1K1DA 3FFSA 1RZMA 2G8ZA 1JGIA 3DENA 2PLJA 4QLLA 1QK2A 1NF7A 1HKJA 2AAAA 2G37A 5LIKX 1SM9A 1U1HA 4GX8A 1UMYA 4MB4A 3TE9A 1W8SA 2VGGA 3GZAA 3L0KA 3VOJA 5KITA 2XM2A 1RY0A 3G2GA 3ABSA 5E0CA 3S4TA 1REQB 1FDZA 2DSUA 5G2IA 1CI1A 2JF7A 4KEMA 4B9YA 5M1TA 2V6AA 2PD5A 4IPJA 4RE4A 2ODOA 1PPIA 1RUSA 3TSDA 1B2YA 1W3IA 4NZJA 1UUQA 3FHQA 4FEZA 1DEDA 1R9YA 3KOFA 4NZFA 1XRVA 2OMAA 4RL3A 1NWSA 4PRWA 3GXNA 1S1PA 5FF7A 4HA3A 3VD7A 1X7IA 3O2LA 5DCDA 3C61A 4LY4A 3IUHA 3SURA 4J3XA 3WQVA 2DQWA 3RF9A 1Q6OA 3C2EA 5EKYA 2ZRXA 3DKLA 4K68A 3APTA 3LLXA 4LV9A 1I0BA 3U4AA 2OB3A 4F0KA 3MV01 4AX7A 4J5NA 4MJZA 2BXZA 4AC7C 4EF8A 1EJUC 3QC3A 4JIIX 4B5WA 3SGUA 4TVUA 4LVAA 5C0QA 1TCDA 3A9IA 3JRKA 1O5QA 3I3BA 5A5WA 1UZDA 3ARZA 4JICA 4Q7BA 5AZ1A 2E6AA 9RUBA 3LPGA 2OT1A 5CAHA 1EJTC 4H2HA 1UR1A 2EPMX 3HIJA 3HM7A 4F2UA 3CYVA 2BS9A 4MB5A 4GQ0A 3HQ1A 5BOFA 4DYKA 1XQLA 3KOZA 4I3GA 4GY1A 2BY3A 4FHAA 3I68A 4H7CA 2VMFA 5KZDA 2VUNA 2P53A 5CPTA 3UP8A 4R34A 1JVNA 1OCBA 2CWNA 1OFQA 1O95A 5BXSA 3E2RA 1RP8A 2RKXA 2PTXA 3QFEA 2C71A 5HPOA 1YNPA 3L23A 1F8IA 4PRTA 1PZ0A 4GI6A 3JVAA 4ES4A 4IJRA 1DJZA 3QZAA 3MTWA 1GUVA 3RPDA 1V6TA 3BAJA 5H6HA 1UJQA 2Z25A 2IW0A 3G3MA 1UWAA 3LHUA 1HW6A 3VIPA 2Z24A 8XIAA 3VAVA 2VGFA 5EYWA 1G7UA 1IQ8A 2VCBA 3MYOA 4C7GA 1T7LA 3MCMA 1SO5A 4IQLA 2ZZ5A 3MCOA 4HZ7A 3FXYA 3ECQA 2B7NA 2VZTA 3F5LA 3MUCA 1X39A 1UA7A 1OM0A 4BQ3A 6ENLA 3AOFA 2VNCA 1SVDA 4P7QA 3DIPA 2HE8A 2ADAA 3T55A 1WP6A 4L56A 1TFVA 4EXBA 4WDTA 2HVNA 4NUWA 1KQZA 3PK7A 1ZALA 4AXNA 4CLMA 1SMDA 1PKLA 3PNUA 1LL6A 1HJVA 2XM1A 1VFLA 3NIYA 4GE8A 3A5FA 1XCXA 5HNTA 3QYQA 4IG2B 3L5AA 4K38A 4B3ZA 3WLLA 1GCYA 2PBOA 4MZYA 5HUPA 2ZIDA 1LQ0A 2E5BA 4W8AA 1J0HA 1WXYA 3BSMA 3W1PA 5AC8A 4WQ6A 3ZQ9A 2D3LA 3W7RA 2LLEA 3W7MA 3BPWA 3KZPA 5FJIA 1ZJHA 8XIMA 2OO6A 1VIWA 4Q8PA 2H9AB 1GK8A 1TSIA 3N04A 2VO5A 4HMNA 4C6IA 1Q4NX 1ONRA 4JN7A 1W56A 1KCKA 1A53A 3VIMA 3PAOA 3PFRA 3R8GA 2V3DA 4J7RA 3IUDA 4IPIA 2V5CA 5G4EA 1PV8A 3KRUA 5J5DA 1I0DA 4N02A 2VEGA 1FWWA 3HPAA 5AYYA 4I7UA 2DZTA 3SIMA 4AZBA 1R9ZA 4JN8A 4X22A 1V3HA 1Q8AA 1C92A 1CGVA 1R7OA 1VF8A 3W76A 3PS7A 3WG6A 3EDKA 3EX1A 4DJED 4JTKA 3TXZA 3GHUA 3MB9A 4LEQA 4FNUA 1C29A 3A3WA 1TX0A 4CVUA 2B7QA 1E0WA 3N6HA 3STEA 1VC4A 3VYLA 4UCFA 3PPHA 4IQEA 1Z7AA 3LCHA 4JY8A 3RUBL 2F6UA 2ACRA 1R30A 2NUWA 4YYCA 2PRMA 1QI3A 3LPPA 2XGZA 4L9ZA 3ISIX 4AISA 3WD2A 4J40A 3H22A 4MJ2A 2QCMA 4LS0A 2PZNA 1Q2RA 1V7YA 2TRSA 1EWDA 4AY7A 5DMMA 3EWZA 2Y85A 3RX4A 1CW2A 2HEJA 3TFXA 1HIZA 2YYUA 4OBRA 3TP4A 3VDCA 1O68A 4GISA 1EPVA 3OZPA 3VINA 5G4WA 2IPFA 4GCXA 3CUGA 5AVNA 4GUJA 2WNQA 1WZKA 5I78A 3HG3A 3SCTA 4PZVA 5DRIA 1VJZA 3TR9A 1YLVA 3MUY1 4Q6JA 2YA1A 3B05A 4XQ6A 3BLEA 1FCBA 1EBGA 2AQOA 1TJ2A 2HWGA 4ZL1A 2J79A 5M17A 1OWQA 3ZSSA 4MADA 4O1DA 4CNOA 2YXOA 1LF1A 1GJWA 2X7WA 4C7FA 4JTRA 1S46A 4DWSB 2DT1A 3CAVA 2CWXA 4TR9A 5C5YA 1J4EA 4LFYA 1EDTA 2PWDA 3ZM8A 3T40A 4PMVA 1QFEA 2CEQA 1TTPA 4UCGA 3GDRA 5LIXX 3VIKA 3N29A 1UR8A 3ALGA 1ZJIA 2UBPC 4JR5A 1CZ1A 1XYAA 2VR4A 2ASHA 4ZEPA 4WJXA 2WMGA 1B0IA 3C0LA 1GG0A 4H4IA 2PMQA 1KRMA 3M0IA 3W4RA 4DBEA 2PDXA 5EA9A 4DQWA 3WJWA 1TWIA 2J8GA 4PBGA 2E09A 3AHYA 3R8HA 5LNUA 4FOUA 1A5KC 2CZ5A 3EWYA 3W7DA 1TIMA 1WNOA 4ENLA 4D71A 3S2NA 1WBHA 3B8UA 3AZTA 4M6QA 2YPIA 5E6YA 2VELA 3KTCA 4LRTA 3MZNA 3KVJA 3UZXA 1D2KA 1NIUA 2QJIA 5I7GA 3NA8A 1VHNA 4EIVA 1YW1A 3C8NA 5ABFB 4JS3A 3NL5A 3GFZA 5D38A 4WSKA 4N4PA 1MZRA 4YTSA 1H7OA 3BSGA 3EOOA 4E0CA 1FCQA 2PTWA 3KE0A 5HATA 2BGSA 2G3MA 5K9CA 1N8WA 4YS1A 3HA1A 1GT8A 1ADDA 2WBGA 2BY2A 4Q33A 3ZS4A 3H2CA 1OQFA 1CTNA 4OGZA 3PZNA 1A3WA 5FJPA 2C19A 1T40A 1HX0A 4HU0A 1D7FA 3NYZA 3B97A 3WNNA 2VZUA 1OF6A 4O1AA 3W22A 4QS5A 1P48A 3F5KA 4YXGA 1H7XA 3UETA 1XIHA 3U9IA 4JHMA 2E5CA 2WLYA 4QP0A 2V68A 3ZMRA 2EKGA 4J9JA 1S5VA 4MNLA 3UGVA 4C1NA 4M0XA 3MS8A 3OODA 1JUBA 4ORMA 3M16A 1CGWA 1KXHA 1GVFA 1QO2A 4HN8A 2CCRA 4ZQCA 3I6EA 5IDZA 2EG7A 4LNYA 4BR1A 3N4AA 1A49A 1SO3A 2ZADA 2NSOA 3VABA 4H7ZA 4KCTA 1JCTA 1W3KA 4GQBA 4FI4A 1FXQA 3L2MA 3NQGA 3RX3A 2YXGA 4AIBA 2GJPA 4GKLA 2Y7GA 2GGHA 4LVBA 4B3KA 3WD0A 2INZA 4GUGA 4PCSA 3R5EA 3AIQA 1IYXA 3DHPA 5CBJA 1EDGA 4D8AA 3ZT7A 3GXDA 1NARA 4MWAC 3LXCA 3GH4A 3TMQA 5HAOA 2FB3A 4UQEA 4WF7A 1LL4A 1QPKA 1YRRA 2DIJA 4FLQA 2CYGA 2OQYA 3FYOA 4GXWA 2ZFAA 2PTYA 4IMFA 3UA3A 3EDEA 2XVGA 5CGMA 5LNSA 3M0ZA 4RE0A 2VI0A 4O1CA 4OU1A 3A47A 3QW3A 3S6TA 2ISDA 4WY0F 5D33A 1VQTA 4ZBCA 3B9AA 2ZZ4A 3EX3A 3LENA 1PDZA 1R5YA 3BAYA 3CMJA 1B54A 2YYTA 3USBA 3HGSA 3VMOA 3T08A 3GAKA 1X6NA 5M2FX 3O06A 5CSSA 2QCDB 2VRJA 1BQGA 2HCVA 1X7FA 4QAIA 2YX0A 1TKKA 1KXQA 1UOKA 1XBVA 2QYGA 1XINA 4C6EA 2J4GA 1QHOA 1US2A 3GUGA 4HPGA 3UZJA 4IP5A 1Q7MA 1Z42A 1M65A 1WQ5A 4F9JA 1V03A 1VBUA 5A8PA 3SW6A 3NL3A 5DXXA 4D8LA 5CH9A 2HROA 2E25A 1UROA 3HPXA 4UQBA 3KP1A 1EJVC 4REQB 3UWEA 4I9JA 4IOTA 1W37A 1US0A 2QIIA 1KM6A 2ZZ7A 3MC5A 1PVNA 2CXEA 4L5ZA 1LOQA 3V36A 2J66A 1L6FA 3EWDA 3VZYA 4KRTA 4JIHA 3LD5A 4OQVA 1JGMA 2R24A 1EJRC 1E6XM 2Z6IA 3P80A 1TA3A 2ZZ3A 1ZBVA 3RMEA 4KCWA 3UNDA 4MNJA 1OK6A 1KM2A 1UOZA 1UR0A 3IUIA 5FEPA 4XSLA 3CJPA 4LAMA 4M51A 5REQB 3TYAA 1KM1A 3QXBA 1VHCA 3P93A 3JZUA 1BRLB 1ZZMA 2ZUWA 5G1YA 1BKHA 3TTEA 4KETA 3GDLA 4JCLA 1OSEA 4CGTA 1W54A 4ILSA 3G3DA 1D3GA 1G69A 3NZ1A 4NP7A 3TJ4A 3ANYA 3LCLA 4GFIA 3W83A 4AYGA 1PYFA 1O5KA 2A7PA 1XLMA 4XISA 3UZ5A 4AD3A 3GG7A 4AZHA 3TNBA 2E7FA 3WF2A 4AIEA 1KO0A 4BEQA 2PDYA 4I9TA 4X9YA 4AX6A 4RNJA 4A8IA 4XBKA 3RJYA 3VUSA 1WO2A 4IXHA 4LVGA 5C54A 2TODA 1WZMA 2NLIA 3L2LA 2W3ZA 5I3GA 1QBAA 2GJXB 4OOZA 4HPNA 5HINA 4FMVA 3N4EA 4U5KA 4GZIA 3MW7A 1R2TA 4UTJA 4EPEC 5DMLA 1PHWA 2V2DA 4E2BA 1K9EA 2YFOA 2YR1A 4X9SA 4EX4A 3QM3A 1TRDA 1JCJA 3CAQA 4AD1A 5AFDA 3ZWSA 2Q09A 4AWSA 3V5FA 3QR3A 3QOKA 2GVJA 3EA2A 4JOMA 2HTMA 4RXFA 1SW3A 3VD5A 3OQ8A 4JHZA 4OE7A 3SECA 1L2QA 4QSHA 1EB3A 3PBMA 2PDKA 4K8HA 3GXIA 2XDFA 2ZQ0A 1FWTA 4TV5A 4HZ8A 3IIPA 1ISVA 3W02A 1RY8A 3LSCA 1H61A 1EC7A 2FH8A 5AYIA 1JCNA 3W2LA 3W86A 3KWSA 2WQDA 2WJDA 3RM9A 1MDLA 4UUIA 4Z1BA 2FPVA 1OEPA 3VX1A 2ZZ2A 2JE8A 3QHNA 3RDKA 4KFOA 3TNOA 3WLOA 5HMEA 2NXIA 3UWVA 1YDYA 2Y7EA 3AU2A 1RLDA 1J8VA 1ZGDA 5I6SA 5KMYA 1PTDA 1XH1A 2ZXQA 2HJPA 2ZX5A 3DUGA 1ICQA 2BWGA 4A6GA 1JL8A 1IEXA 3BMVA 2EGZA 4V15A 2VDIA 1UD2A 3VGFA 2A3HA 1EPXA 2P50A 9CGTA 1RBLA 4PL1A 1ITUA 4QIUA 3DBNA 3ZR6A 4Q8TA 2OOGA 3CTLA 1OF8A 1L6GA 1ZPTA 4AAJA 5FEZA 1AJ2A 3P81A 4GUHA 1WXZA 2Y5JA 1J79A 1EF3A 4IT1A 1EF2A 5AECA 1VPXA 4N6FA 1JXKA 2QUTA 4FX8A 3I6TA 2AKZA 2OJPA 3I3EA 3FSUA 3S9IA 4KMQA 2XZ7A 4G8TA 3TW9A 3CASA 3H7VA 3HTWA 4U10A 2D22A 3W1TA 4PUMA 3W28A 4HP5A 3WFAA 2C13A 2QCGA 5EMYA 3UFYA 2ZX9A 2CIPA 1U1UA 4X60A 1GEHA 3PB0A 1HKIA 4IUGA 3DGBA 1VIZA 2J7CA 1XG3A 3OVPA 4W5ZA 3TC3A 3TQKA 5HMSA 1S5MA 2JKAA 3HURA 1TJ0A 4DLFA 1NTHA 4LAKA 3EWUA 2PDUA 3T2QA 5C8BB 1XI3A 5FJTA 2CHNA 4JTAA 3U8GA 3IANA 2J9XA 1TV8A 4C6DA 2DSWA 1UWUA 3W1NA 4WSHA 4XZIA 2XSAA 1MYRA 1UWSA 1HQTA 1LUCB 3W2UA 2P3EA 1K77A 4XKYB 2O55A 3CUZA 1TJRA 4B5SA 4G9PA 3IIOA 1OHLA 1KGXA 5CEWA 3H54A 3UXKA 3TA9A 3FJ6A 2VFDA 4NY2A 3CLMA 1CXKA 2ACQA 2MANA 4D6IA 3MJMA 1QNPA 2VR5A 2WW5A 1RQHA 3UR8A 3VIOA 2W5FA 2Y1HA 3VIFA 1OK4A 3UWUA 3M5VA 4PMUA 5I24A 3SUUA 2GGGA 1PS9A 2GSJA 2Y5EA 5G1MA 4IP7A 1BGAA 3KUMA 3NEVA 5JBFA 1H49A 3DBPA 3R6IA 2QDHA 4JTJA 3W38A 3OLGA 1QI2A 5CSUA 3GXPA 1JF5A 1GOQA 3UWQA 1UPMB 2BVTA 4DI8A 1IR2A 1NWRA 2QJGA 2BLEA 3QY7A 3AUOA 1TMQA 3KLKA 1XLHA 2O9PA 4NYUA 5AVHA 4MDOA 1N7KA 1W9PA 4AHOA 4PEEA 4PUEA 4O13A 4AHPA 4EXAA 3K8MA 1GQJA 3BG5A 3VNIA 3USZA 5LNRA 5IXEA 4Y8EA 1UKTA 3WFZA 1DWGM 3AS3A 2F7FA 5M3WA 3IIVA 2NZLA 3N2CA 4JIEA 1SZNA 2Z4GA 1Q65A 2VKZG 2ZE3A 3F2DA 1IR1A 4GINA 2G3FA 3IV8A 3SGZA 4S23A 1B5TA 3DFSA 4D1JA 3GC2A 1BXBA 2YB1A 4F3HA 4JHOA 5D09A 3CUHA 4XG1A 3R11A 2X1TA 3CXOA 4TIMA 5T26A 2GPTA 4FB7A 4GMEA 4HVXA 3DG6A 3NPVA 1EYEA 4K8EA 1TVNA 5XIMA 4MWAE 3TW6A 2VD9A 3E5PA 3KCJA 3WY1A 2CW6A 1CPUA 3GR8A 1BQCA 4HB7A 4ONVA 1W3NA 2PAJA 1V51A 4K1WA 3OQEA 2WMFA 4EK7A 2RJHA 3TYZA 3LCXA 3TAOA 1P6BA 4D6CA 3WH9A 1UCWA 1TUXA 1S5NA 1G6CA 2PDIA 4Q4MA 3W1MA 1L8NA 3LA4A 3CZ8A 3R8RA 3NTYA 3WQGA 3QYSA 1JUEA 2HDJA 3HN3A 3H2OA 2X0HA 1RJPA 3F4NA 3F4DA 2VZOA 4OFCA 4HNCA 1ADSA 4U5IA 2DP3A 1AUSL 1JD9A 4M8UA 2PTDA 1NQKA 2VVNA 4ICNA 3TROA 2X1SA 1GORA 4L1XA 3V5OA 1EHNA 4PSPA 2CLIA 1AQ0A 5DY2A 4DWDA 3GFYA 2EHHA 1TWSA 2DVUA 1WKDA 4AEFA 2Q8XA 5KINA 1B9ZA 4D2JA 1J0KA 2HZGA 4GGHA 5E0KA 1QBBA 3AS0A 4DUVA 1SFJA 4MWAB 5EMUA 3AS2A 2D2HA 3EPMA 1NJJA 3OJGA 1UUOA 4OUEA 3VNMA 2ZA1A 1RA0A 4PTMA 2TPSA 3ES8A 5BROA 1F3TA 2DZUA 2NWRA 3BLFA 3ABZA 4M6UA 3DC8A 2CLMA 3C2FA 3RR4A 5LIYX 1KD0A 5FAGA 2RDWA 4H8HA 2QKFA 1X38A 1Z89A 2DZPA 4JD4A 3BOLA 3M9YA 3UXAA 4Z1CA 5I02A 4N4QA 3DHDA 3GFXA 2VCAA 1K6WA 4G1KA 3GW0A 3KLLA 3PULA 4IFKA 4AF0A 1I2QA 1XDMA 4O17A 1BTCA 1FY6A 3A23A 3AMLA 1K4GA 3R2GA 1AL8A 3PR2A 4W7WA 2BVYA 4UXDA 1A5OC 3NL2A 1JRBA 4MZ8A 5FJRA 2BOFX 3GHSA 1V3KA 3I10A 4DPPA 2I7GA 4A22A 1SYTA 3ZJ7A 1GYNA 1SPQA 1P6WA 1Q6CA 3TQ0A 3UWYA 2PFHA 3VIHA 2ZRZA 1YTKA 2V67A 1EGVA 3P8IA 3BLKA 4Q22A 4TXEA 1GPWA 3PTQA 2E0PA 1S39A 3CT7A 3DU0A 3TN4A 3IV3A 2DVTA 3QQ1A 3B0UX 1ZY9A 4OV9A 3ZJ6A 4HYWA 4N7QA 5D8WA 3DFHA 4GXPA 4KPLA 1KTCA 4HOZA 1E40A 1IXQA 3G0XA 1BFNA 1R3QA 5I23A 2HE5A 4LC8A 3W0KA 1Q45A 1Y5VA 5HNRA 1E70M 1XIBA 5JBDA 3RU8X 4PCPA 4HPXA 1XYCA 4KESA 2V69A 3BJSA 3T0CA 3G77A 5BYWA 1FP9A 3P84A 3EB2A 1ODUA 1F6YA 4WY0B 4C6LA 1VFSA 4Y9MA 2O7QA 1FCVA 1KFBA 3INPA 3MI2A 3KCOA 2YZ5A 1KGWA 4JDBA 1DIEA 1QI0A 3TVAA 3GM8A 1H1YA 5FEXA 3T2OA 4UNLA 1N8IA 3OGSA 3R94A 3LCIA 3CAWA 2PDMA 4MTVA 4UTKA 2KAUC 1DKWA 3QMSA 5IDIA 5MKGB 1A5SA 2WANA 3G1XA 4GYPC 3RPMA 3U2CA 2XIBA 3W81A 3Q4DA 4YTRA 2NT1A 1E4NA 3CNYA 2INFA 4P7NA 5TD4A 3G1RA 3ARUA 4DO7A 1GONA 4CN1A 4C6BA 2XU2A 1EJ7L 2X16A 3PBYA 3E2SA 4WRHA 3LQGA 1REQA 3FX4A 3OBEA 1IGWA 3WLPA 4NX5A 4IX2A 1GQNA 4DO5A 1O7AA 4L4OA 3O0FA 2R1MA 5A69A 2VR2A 3WDRA 1GQLA 4A3HA 4R7JA 1GGOA 3W7IA 2J74A 3S1VA 3WQ8A 4IIGA 1W1TA 4A8LA 1ME8A 1ME9A 3E1F1 2QMJA 3HFYA 2ZRVA 4XO7A 5D4YA 3B8WA 4W9TA 9XIMA 1F5ZA 2WJEA 2H8ZA 3AMKA 1H2JA 1V79A 3CEUA 1MSSA 1WYIA 5GPRA 2VWTA 5LHFA 2EXOA 5CPSA 1YDVA 3H2NA 3PUOA 2F6XA 3SCOA 4A2SA 3BXWA 1E6RA 3S0CA 3CQ0A 1EXBA 1VFFA 3PM6A 4W93A 1T8XA 3VOGA 3ZXWA 3UVIA 2HVMA 2IMRA 1B3XA 1CGYA 2IUZA 1QASA 3VDBA 4MF4A 3DAQA 1SMAA 2FZMA 4DXKA 4OT7A 2Y8UA 2CBIA 3PANA 1SJDA 4H00A 4QJ4B 3U57A 3IJ8A 1XLEA 3A4JA 4TMCA 1OGBA 1CDGA 5DLCA 1DE6A 3M6DA 4Z2LA 1XCFA 3DI0A 3QGVA 3QHMA 4HSOA 4S3GA 2YCEA 4B5UA 3PUGA 4GVIA 2VYOA 4JTCA 1HZYA 3MO4A 3M44A 1A5AA 1EUNA 3UW6A 1R0MA 3L65A 3GU2A 3OP2A 4MJMA 4F2TA 2R1NA 4EOUA 1E0VA 4RLIA 1FWHC 1I2OA 4X61A 1WB0A 4BF5A 3POHA 1XRSA 3V7PA 2XFFA 1FWAC 4XD6A 2G3JA 2WSPA 2JEQA 4BEUA 3DXIA 2DIKA 4C6OA 3XINA 2QCEA 4UTLA 1T0OA 4ZB5A 3W2KA 4IGSA 4GRSA 3VM7A 1QPOA 4TVCA 4F2BA 2BMBA 4FNRA 1B3YA 4RV3A 1EKOA 1LOSA 3VNYA 3NGFA 3LNPA 3OB8A 4GFSA 2OEJA 3E38A 3WLRA 3K5XA 3LZ5A 4ZA0A 1G7VA 1YTDA 4YWSA 1VCVA 5D9NA 3BJTA 4IG2A 3V0SA 3IIXA 1S5WA 4IGHA 1TQJA 1HG3A 3GTXA 3PBVA 4JKKA 4ZQOA 1A50A 4W5UA 1A47A 3URNA 3WF1A 4ACZB 3K1GA 3GHTA 3V1PA 2PP3A 3GNOA 1XBZA 3UNTA 3WDJA 3WD4A 2GFTA 2AQWA 1J93A 3WDHA 1R2SA 1KM3A 2PWVA 3M5YA 1L8PA 3SBFA 1W9XA 4MNKA 3BANA 1KXTA 5E09A 2HXTA 5FF2A 3ZR5A 2UY2A 3SCPA 3UA4A 4C6FA 2I16A 1NU5A 3GIQA 5FF4A 3ZT6A 4FF5A 5AZ0A 4NQ1A 3WH5A 2O0TA 4KFPA 2XGBA 2I57A 5F2MA 5I3JA 1ZBCA 3LDVA 2P5NA 4HNUA 2CHRA 4D8ZA 2DFAA 1RAKA 1W91A 3N3TA 4WCJA 1MW0A 4OBTA 4PRRA 4ZE5A 3NNTA 3NO3A 3AZSA 1LZOA 4AY8A 2GZXA 2DU2A 3N9KA 1C7TA 2YCLA 4DM1A 3TONA 2ZC1A 2INEA 1VB9A 4Z1DA 4IGMA 2G97A 1TCMA 2PC4A 1QRQA 5I3IA 4MLJA 5IM51 4P7LA 3OO2A 3BMWA 2FHFA 2Y7DA 3TTSA 4JDYA 4ERGA 2ALDA 3AAMA 3W01A 4Y96A 4GOAA 3B06A 3L12A 3WLTA 4E4UA 1TX2A 4TUFA 5TF0A 1Z48A 4UOZA 1X98A 3TOYA 2J78A 1E6NA 4HSNA 3P6LA 2BY1A 3BO9A 3LN3A 2OYLA 3S8HA 1QATA 2H3BA 3SEPA 5I5RA 1OCQA 1Y0EA 3KL3A 4QX4A 1AH0A 5BRQA 5I06A 2WVSA 1M9HA 1UBPC 4MOZA 1QI5A 4U31A 3DDMA 4E2VA 2Q71A 3EPNA 2J9YA 6REQB 3WNKA 4JTDA 4ZZ9A 3VX0A 3B8TA 4KRZA 1JYVA 5AC6A 2D1ZA 3BE7A 1IE7C 3DFYA 1DQWA 1JULA 1ZQ5A 5J8LA 1E1EA 2ATSA 2VX7A 4E8DA 4JAWA 1L6YA 2A6NA 2JQXA 3W29A 2XVKA 3WK3A 2EKCA 1R87A 4Y9NA 3V18A 1IXNA 4QITA 5EMMA 4XTIA 2BFGA 1EO7A 1KFLA 2RDXA 3OVGA 2QVNA 1QNVA 1K8YA 4EF9A 2VFGA 5FAJA 2D23A 3FA5A 4KT2A 3B8DA 3WUBA 2ZC8A 4OECA 1HJSA 3M5XA 2YFNA 2NQJA 1SUXA 3H23A 2Y0FA 1ZBKA 2VFFA 3UERA 1OC5A 2AL1A 2E6FA 3W87A 3C52A 1ZHAA 3PZIA 2EBNA 3GD6A 2YCIX 4HHPA 5JMUA 3S6OA 2GUYA 3B9DA 1R6WA 3AICA 3UY7A 2OQHA 4J3TA 4CNUA 9XIAA 3UU0A 4J4KA 3P2VA 2QAFA 1A5MC 4OV4A 3NVTA 1IXPA 3I3DA 1Z69A 4Z2KA 3F1QA 1TPFA 2WAGA 2XWEA 2BGNE 3LM7A 4IQDA 4AMAA 3EGJA 5FKYA 2A85A 1Y7VA 2WLZA 3UYCA 2IQTA 1K70A 4P2VA 3H7RA 2C91A 3SJ3A 3QR0A 5LYRA 1EP1A 2VC7A 2XYLA 1AH4A 3MPGA 1DWHM 4UTWA 4DI9A 3WFLA 1MI3A 1X97A 2GJRA 2EPHA 4QDPA 4S3BA 3WLQA 3GRIA 1QPRA 3QLLA 3G18A 3W7KA 4F0SA 3QW4B 4GHRA 1BXNA 5ABFA 1JZ8A 2OSWA 1Q66A 3STFA 2AOSA 5HULA 1KTBA 1H11A 4GH3A 4PB5A 4FR6A 5KEZA 3VCNA 1VD6A 4Q4QA 1A0CA 4CU8A 1RCOB 1V08A 1FH8A 1QHZA 1OFBA 1ESWA 1Q6DA 1FX6A 5FCZA 2PGRA 1GKQA 4ICMA 1V4YA 4BS0A 3KP0A 2QMKA 3RILA 4FNTA 2D0FA 1OG0A 3S2LA 2OKOA 1FDJA 1TVPA 3L5MA 3VMPA 4CN4A 3GKAA 3WUFA 4LS1A 2PWGA 1I2NA 1VAHA 1GVYA 3A22A 2E9BA 4S3KA 4WSJA 2FVMA 2PRHA 2YL5A 3S46A 1JZ6A 4E2DA 3RR1A 3KM8A 2IKHA 3R0KA 1L6WA 2DZWA 3MWAA 2QCHA 5DANA 3PZUA 3WEMA 4XV0A 1EC8A 1XGDA 4FLOA 4PUWA 4M56A 3RPTA 4WD0A 3KEHA 5CZTA 1EGMA 3NO5A 1UWIA 4AHQA 2J7EA 4YIWA 3VI2A 3A64A 4HTBA 4AYSA 2PC8A 1GVOA 3LLFA 4ICCX 4S3AA 3TJXA 1JG9A 3R7MA 2XN1A 3STCA 4IIFA 1XYLA 2ZVRA 2DSVA 3XISA 3SRKA 3N1AA 3F4VA 2A0NA 3W7NA 2X1RA 5FJOA 3QZ6A 2HSAA 4DZIA 2A3LA 2GVYA 4YYFA 4A3QA 4XD5A 4KEZA 3CPGA 4C6JA 1DWJM 3VKJA 2OWCA 4JQ1A 1FFRA 2JFEX 2Z1BA 2YCJA 2G0WA 4FO4A 1W1A1 3A6OA 4BF7A 3TKFA 1AD4A 1G5AA 2Y7FA 1NOUA 5KSWA 3W27A 1J2BA 4GI9A 3WLMA 4U33A 4H6RA 4K36A 8A3HA 3OIHA 1IZJA 4LVFA 1CXEA 3G1DA 3ID7A 4KFNA 3BAKA 2W6RA 3LQLA 3SUTA 2EO7A 2C0AA 3WH8A 3W37A 3IACA 5FJJA 1P1XA 3A4WA 3EYPA 2C7FA 2V63A 4H9TA 4Y6GA 5KETA 3G22A 3NM3A 1BYDA 5PTDA 2DY3A 5A6BD 1RLCL 1I8JA 2CITA 3E0VA 4L61A 4R7WA 3GG1A 3DN5A 3S2CA 3XIMA 2OEMA 3H4XA 1WX0A 4S3JA 4W8BA 2W63A 3I7RA 2V2HA 4S38A 1BF6A 4NHVA 3PUEA 3RRXA 1A4LA 2QCDA 2D2OA 2YW4A 1QO5A 3CMGA 3EPOA 3D3AA 3MDWA 3DG3A 3CAKA 1IWBA 1XIGA 3QRHA 1U2YA 1IIGA 4JTGA 5A6AA 1OGGA 5XIAA 1GW1A 2XH7A 1XFBA 4RE2A 3GYEA 2CFFA 5DT5A 3L5LA 3DFQA 1XL9A 3ITXA 1MFUA 1YX1A 3SCUA 3A24A 3SCNA 3UJEA 1DE5A 3G8RA 1EIXA 3KW3A 2QDGA 2CKSA 3FV9A 3PWGA 4PH6A 2X7VA 2YDSA 3GXMA 3AXXA 3DOPA 4PMQA 2BHYA 2FVKA 1XIIA 2ZX8A 4D6GA 1GWJA 1XRFA 2J62A 4JQ3A 3S5ZA 4PMXA 4DELA 3HQNA 3VKDA 3PTKA 3BOFA 3NR0A 3VNDA 3OG3A 3AMCA 1WOAA 2GUUA 1LG2A 1GOXA 4N0RA 4FS9A 4XO6A 4WEVX 1FHDA 4M81A 3A3XA 3NDYA 3OYXA 3TN6A 4HNOA 3W1LA 3BLIA 3IWPA 3VGBA 3G1HA 3FDKA 1TO3A 3W1RA 2J8FA 4XKMA 4JTSA 1NFPA 3T7VA 1UW9A 4LBSA 1UD4A 3SADA 3QPYA 5CC5A 4BQ2A 4FXFA 4E8CA 1UD6A 4DO6A 3WLKX 2QZRA 1GTEA 1HO4A 1N55A 3DFOA 3ZR4A 3URQA 1M03A 4ZQRA 4E3TA 2PCEA 1TV3A 4PTXA 1BRLA 3QTGA 4LTSA 5EU9A 4PN2A 1UIPA 4JEJA 3WENA 1TV4A 4UFKA 3WNLA 5CPLA 1RA5A 1YXYA 1XG4A 1W6TA 4UOJA 2FLIA 3C2VA 3B9OA 4IMDA 1FWDC 4TU1A 4HD5A 2A5HA 1GOKA 1CXHA 1XM3A 2DJXA 4XB3A 2WSYA 4N9DA 3AIUA 5F1VA 3AWNA 5FJUA 4HCDA 3BLOA 4LX4A 3BCJA 5DEZA 4HK6A 3IJ6A 3UCCA 1CYGA 4FPSA 4PTVA 1XH0A 1P0BA 4ZQNA 3SCWA 3ITOA 1IWPA 4JGDA 4CD7A 4R85A 2Z2AA 4F0RA 1EYWA 4N9BA 3TTQA 2NSXA 3NO1A 1AH3A 4CVWA 2ZXDA 6PTDA 1VPYA 3R0UA 5JIPA 3LTSA 5D9OA 3VE9A 3SCVA 3HGJA 3I65A 3REQB 1XJBA 4Q32A 1XD1A 3N12A 2D69A 4LUSA 4GJ1A 3MMDA 1RHCA 3OZMA 5DFAA 1RD6A 5A8GA 1U5JA 4L6DA 4NJKA 2HV5A 1KBJA 4RXGA 4DIAA 3C4UA 2VURA 5IHSA 1F9CA 3BV7A 3LMYA 4UFLA 4QISA 4RR4A 2CETA 4UMBA 3S5OA 2W9MA 3BLLA 4P8UA 4IFOA 3MSYA 1W32A 1DJYA 1KBLA 3HB9A 3CZGA 3UPBA 1WKFA 4BCEA 2PDLA 1X1OA 2GGEA 1E51A 4Z2JA 2AKMA 1ZLPA 2PDQA 3UBPC 1F7BA 4LW7A 1HL2A 1WXJA 4TQTA 5K3VA 1R2RA 2O7SA 3CPRA 2CZDA 5BMXA 1CX9A 1T41A 3MHGA 3C2RA 5TNVA 5A8OA 1Z6KA 3ARWA 3IAQA 4O8RA 1LWIA 3LX9A 1XGEA 4MB3A 4DAIA 4WKFA 3FOKA 3L4WA 3WK0A 2HISA 3H6OA 4MGGA 1F6PA 2A79A 2PDJA 4W88A 4WK9A 4JKMA 1QOXA 3IVUA 2FIQA 4UNKA 4ZR8A 3V75A 4BQ4A 1UQZA 3KTSA 3L68A 3PC0A 1DTNA 2GQ9A 1UWTA 4W86A 2YBUA 1ICSA 1VFHA 3VK5A 1JZ3A 2C16A 1DWIM 6TIMA 2Q3RA 3SSZA 3ABRA 2I9EA 3MUXA 3T0AA 5RUBA 1K9FA 5SWUA 1RQBA 1VH7A 5HMFA 4TV6A 1DJNA 3VZXA 3NQ7A 1H4PA 4I7VA 4BQ5A 2UWFA 1X6UA 3U3HA 4U2ZA 2F61A 4PUNA 1NOWA 1DOSA 5K2ZA 1IIHA 4DX3A 3HBLA 3QY8A 4NT0A 3TUUA 3ZVIA 3K2GA 4Z42C 2DV0A 4MHBA 1E4MM 4XBSA 3VCCA 2V3FA 3PZQA 4AZCB 3NQ2A 3CYJA 1P0NA 2CBVA 3I7SA 3SM0A 1AZ2A 1A0DA 5AB3A 1UMLA 1TPDA 5D2YA 5GJPA 1V0LA 3HPZA 1AVAA 2YCKX 4Q8WA 3RU6A 5JQ9A 5BNKA 1VLIA 1DJQA 4E4PA 5D05A 3LBCA 3WD3A 2XHYA 5K4XA 1XYFA 1X8CA 1EL3A 4O10A 4LAOA 2VFHA 4JNZA 4Z2GA 1H50A 1AD1A 3URBA 2C6QA 3AXKA 3CHCA 1F2JA 3W00A 4A4AA 1V6XA 1UR4A 5C7HA 3BUVA 4J3ZA 5CC7A 2DZSA 3QBUA 1J0IA 3L2IA 5H91A 2E5DA 4QRNA 3IAPA 4GY0A 1AFSA 2NV9A 1GW9A 3G0UA 3LPOA 1NAL1 3M46A 3KDOA 4MDPA 3AIRA 4K2SA 1GYLA 4W87A 2PLCA 1C3FA 4X0VA 2V3EA 4U28A 3SR7A 4DZ5A 4HZMA 1Q63A 2FFCA 2OTDA 4PUDA 1DIOA 3N18A 2C1IA 1QPNA 4CNTA 4I6VA 4LH8A 4I5XA 4DJFA 1YIXA 4CNSA 2EEXA 3AS1A 2WV8A 1JZ5A 1UIOA 4B2DD 1L2UA 2E1DA 1FWFC 1C8VA 1OC6A 5H8PA 4CQAA 3ZJKA 1VS1A 4LGXA 3P5YA 2P8CA 3T6CA 1TV2A 3QGAC 4O8AA 1Y8BA 4QE5A 4C91A 3ENLA 1U5VA 2BX7A 3GDTA 4GWEA 4ZSUA 3AISA 3ZT5A 4HN4A 2ZX6A 3W82A 3OBAA 4HK7A 3SCRA 4NZ3A 3N11A 2R1PA 3SY5A 3GZ3A 4MKSA 5DN1A 3BZJA 2BOGX 4P8WA 1K3UA 5H8UA 4H9ZA 4WIWA 3WLIA 3BURA 4ZXOA 2DH3A 3MJYA 4EPKA 4Q6XA 2NW0A 4RPQA 4AD0A 3VM5A 2DORA 4Q3MA 1YPIA 2ZKMX 5HQEA 3H2AA 5I3HA 3PZVA 3PAJA 4FA3A 3UF9A 4DJDD 4IUOA 3WZ0E 1B1YA 1XIJA 5BXTA 2E40A 5F7UA 1LQAA 4JFVA 4AIUA 4EP8C 1KV5A 1KCZA 4GC4A 2WPGA 3T78A 4H9UA 4C6PA 1JR1A 1BXCA 4UIOA 1VEPA 1DIKA 1VENA 1K8CA 4PGLA 1WOBA 3I4KA 3B4UA 2Z1WA 1JDEA 1LRQA 4GIEA 1QXLA 1RJRA 2QCLA 1JRCA 1AJZA 3NEHA 4QDMA 3MWCA 1ZU8A 2E6YA 1UZHA 5JU6A 4S1FA 5A6MA 5I09A 4JTLA 1CLVA 2QS8A 1UC4A 5A6KA 3KRSA 3SUWA 3JR2A 4GO9A 1ALDA 3VA8A 4D6FA 2IXVA 4GZ7A 1RVGA 4LPCA 4UFIA 1BWVA 4ML9A 3WDQA 1KQYA 1WAWA 3CWNA 1DBTA 2VFIA 3TOPA 4B2DA 5A2BA 1UYQA 1JPKA 3LBMA 4KWOA 3IJQA 1CEOA 1CIUA 1L0PA 4JPGA 2YL6A 3RITA 1MFVA 2CHOA 1PZ1A 1UBSA 2WNZA 3MA8A 3B0VC 2PUZA 4LYQA 1PL9A 3EX6A 4M24A 4XZMX 2CZEA 1C91A 4YHEA 3ARTA 3PZGA 2R1LA 4GG9A 3GIPA 3UG3A 3VGEA 1DJHA 3JUGA 1F05A 3JZEA 4O19A 1B57A 4HT3A 5CXPA 5U4NA 3KBNA 2ACUA 3H2FA 1G67A 4GABA 4TTGA 2E3ZA 4UMCA 5AHLA 2PWEA 2GVGA 2Y4SA 4MM1A 2X05A 3MHUA 4R9OA 1OB0A 1O66A 3EKGA 3STGA 2WSKA 4MFDA 1LBFA 4DJDA 1W5NA 1XX1A 3STPA 2I17A 1I4NA 1NDYA 4K3ZA 4IJBA 3CTTA 3CH0A 5I2UA 4MWAA 5H8MA 4ADSA 1NDWA 3SAZA 4ZE4A 3W73A 2WZHA 1T6MA 5C9XA 3CL8A 5TIMA 1FWCC 4DHGA 3QFWA 4ZO7A 3BICA 1O6IA 2O92A 2BP1A 1CXLA 3M41A 2ANUA 3WELA 3KS6A 3CGTA 3ARXA 3KOYA 1C90A 1UKOA 4GIRA 4B4HA 3SJNA 1TR9A 3V5CA 4CCDA 1GOOA 1KM5A 4QLJA 3MSDA 2CU0A 2ZRYA 3L9CA 1EC9A 3SY8A 3TCSA 4KBXA 4C1NB 1ZB5A 1RVKA 1AL7A 2C1GA 3BV4A 3LGEA 4XVEA 2QUUA 4KF1A 1KRBC 1TUFA 4CQBA 3UQNA 4WJEA 3UZZA 2CBUA 3RNDA 5CZKA 4CD8A 3AXIA 1TWDA 2OT0A 2O9TA 4V2XA 3CZEA 1ZUAX 3TWBA 3CZJA 1MW1A 3CIVA 5F4XA 3DEQA 3KBVA 2FJKA 2J25A 4M7SA 4L9YA 1XRTA 4XUGA 3FAXA 5K9XA 1O5RA 3KTXA 4DY1A 4XD4A 4YMZA 1EX1A 4JL2A 1M68A 3WNPA 1DIDA 4MVAA 1S2VA 4AVOA 4MPKA 3CV1A 5D9MA 4O28A 4LSBA 1N2VA 4DNMA 3CL7A 3DFPA 2QDEA 2YSWA 3M7WA 2WPBA 3Q67A 2ZUNA 4JBRA 1N8FA 2ZUTA 3FVMA 4C60A 2VM8A 1ZJAA 3KDNA 4CKQA 1BEUA 1EO5A 1BD0A 1OFOA 3PZOA 1JDFA 4PUKA 3QGKC 3GNPA 2NWSA 1HKMA 3MCNA 2GK1A 3WQPA 1O94A 1HXJA 3LHTA 3IRSA 4JTUA 2WBKA 4PMDA 3TH6A 4RDVA 3NPXA 2OEKA 2YW3A 1M04A 2OELA 3B8IA 1KFKA 1S2TA 2B7PA 2IPWA 5CLWA 1Q6QA 1V0MA 1GHSA 2I14A 4AQLA 2YA0A 4CQ8A 4V1YA 1WKEA 3TLQA 4HNTA 3E0IA 2I5IA 1SO4A 2QPXA 1S2WA 1R3SA 2JK2A 3PBUA 3D3FA 4US6A 4ZQPA 4FOJA 1W31A 2WVVB 2E28A 4MSSA 5D9PA 5CSRA 1JI2A 5AKQA 1EX5A 1MZHA 3DG7A 4S39A 2FGZA 2SFPA 3LM3A 4E6MA 4Z0JA 4EAYA 3W6LA 4B4FA 1FWIC 4JTIA 4G7FA 1CXIA 4A8RA 2GVEA 3S5YA 4NRRA 1RK6A 3QPEA 1J01A 1R3TA 3LI0A 4I8DA 1D9EA 4GZEA 3WF3A 3R0DA 5HK4A 3TZNA 5GQBA 3NVDA 3RK8A 4H8VA 4UWMA 2P3ZA 3O8AA 2DT0A 3NQ6A 1TA3B 3BOXA 1KBKA 3B8VA 3P82A 1KLYA 3HPSA 4H1ZA 4ZFCA 1JIBA 4B5VA 2GYIA 2UV8G 3MUIA 1V6UA 4LBUA 1QW7A 1E5JA 1CENA 1TQXA 4X63A 3H4GA 5LHEA 2XIJA 1FWEC 4CCEA 1VPQA 3GNXA 3GHRA 3FN9A 7PTDA 4ZGYA 1HP5A 4BWLC 1B3VA 3N34A 4IX0A 2GQ3A 4OZOA 2NQ5A 1KFCA 4TO8A 1R46A 3OPSA 3WYZA 4UR8A 5DQPA 2GJNA 3M0XA 5FEWA 1P6CA 3B0PA 4FF7A 2PGEA 1Z8AA 3BW2A 4ZXLA 4MJ4A 4KEUA 3OGVA 4Q8UA 2Z1VA 3P0WA 1RV8A 3PPFA 5F1UA 4O4WA 4HQVA 1W1YA 4GK8A 2GQAA 1B9BA 4S2BA 5LA2A 4OHQA 2A7RA 4AD5A 3LV5A 3SDOA 1IZCA 4IIBA 4KEVA 5AHNA 3Q2DA 4NZ4A 4YWIA 1SJBA 2C15A 2A3CA 3V4BA 4RE3A 3KZSA 3QJAA 5D02A 2PU1A 3MUZ1 1Q13A 5T91A 1KXVA 2TMDA 2VTFA 1R86A 1VRXA 4Y8FA 1QT1A 4Q8VA 1SR0A 2NLYA 1MRAA 4RUBA 3PVFA 5GNYA 3VMNA 1EH9A 4RK8A 2NV2A 3EXSA 1H7PA 2ISVA 1NDVA 1ONWA 4K39A 3PZMA 3WLNA 1VCFA 4ORIA 3WDPP 4AZIA 4DVOA 4LF1A 4GYJA 4K37A 3OA5A 1AMYA 3NQBA 2OYMA 5L9FA 4ADTA 3FKKA 1BWLA 3GS6A 2V5KA 5EFFA 3AMDA 3VGHA 2ICSA 1K7FA 4XD3A 4QEEA 1TMLA 2OO0A 3M0VA 4GBDA 1J5TA 1UC5A 1BVNP 3FW6A 4QJ3B 4GQGA 3DERA 3N2OA 4ZSTA 3O05A 2AGKA 3NPWA 4INFA 4CQDA 1H60A 2A3AA 3WL0A 2WMIB 3MKCA 1F76A 1VEOA 4NXKA 3S5NA 3W7JA 2XINA 5EL1A 2O9OA 3NDZA 4ACZA 1HT6A 1XW8A 1E1FA 2VQUA 3M0KA 3TEVA 3T0BA 2IPJA 5DO8A 2ON3A 4D1IA 1PHQA 5I3DA 4G6CA 4LAZA 4MZ1A 3GDMA 3W7GA 1HKVA 2FTWA 2JF6A 1TR1A 4OKDA 2DQXA 2VQTA 2XZ9A 1Q4WA 4RNIA 2VOTA 2VDHA 3T07A 3S6DA 1HGWA 5HR7A 3MVTA 2EPLX 5BZAA 5JXQA 1IXOA 5IFPA 1OD8A 4RX0A 3VPLA 5CPMA 2H3DA 3VE7A 3FA3A 5EMLA 4HOXA 2NX1A 1XLLA 1KV8A 1TTIA 1LTDA 1ZP4A 3RX2A 4JQ2A 3R58A 3BSHA 3A12A 5AOUA 1XP3A 2WSQA 4C90A 2W66A 1QK0A 2VGBA 4ZOAA 3OLEA 3NZQA 3SCQA 4KH2A 1K8ZA 4HYVA 4S3CA 4IH3A 3BG3A 3ITCA 3C0SA 4GUFA 2XPKA 2CLHA 3CS2A 5FIPA 4WJ8A 3SIZA 1EA9C 3S2JA 3UJFA 1SZEA 2QNEA 4NAEB 4FAMA 4Z1AA 3G6LA 4BFAA 3BW4A 3BCFA 4WOZA 2WZMA 3W2MA 1LJYA 5ABGA 1KM4A 3SRFA 3S42A 4W4QA 4O1BA 2VCCA 3PBWA 1KCXA 5EB8A 2NUYA 5FACA 5B80A 3A4AA 5BU9A 2NQ9A 3OA3A 4IPPA 1NWTA 4NAFA 2ATMA 2BV9A 2YDRA 3RLVA 2WHJA 2HBXA 5CJNA 1H5YA 3CM4A 6REQA 3OOQA 3OYZA 2VX6A 3QN3A 3BZGA 2NXHA 1HJWA 2FMOA 3GG8A 4MB1A 1LLZA 2XH0A 2AMXA 1U33A 1P4CA 2CZFA 2BVWA 4LC6A 3CBWA 3M6YA 1PCWA 4Q7NA 2REQB 1HKKA 1R8LA 2VX5A 3N6QA 3GG0A 1IEVA 4AH7A 1JF6A 2VUYA 5JH1A 1PWLA 1JPDX 3FJLA 4FIQA 4GJJA 3NAVA 3NXFA 1FWSA 4C6NA 5D04C 4I8YA 2EPNA 1UKSA 3A4XA 3IGUA 3KRBA 4HU8A 3BAIA 1I2RA 1MEHA 5BRPA 2DT2A 5K7JA 2V9DA 4J28A 3GBDA 4NI8A 2YDAA 3GIYA 1R85A 3MI6A 3MSRA 1W8GA 1W3LA 4DBUA 3W72A 1CWYA 4UR7A 3ITLA 4PB3A 1P1MA 1MMFA 4R88A 1OYCA 1PX3A 4CU6A 3HV9A 2VZVA 2QIWA 3U2OA 1VCGA 5H1WA 4DZAA 2Z2UA 3OZOA 4XBJA 3AU6A 4QAWA 3LS9A 4WXZA 5KZMA 2R6OA 5IBXA 1YTEA 2F84A 1AQMA 2Y63A 2VEIA 5KZEA 4B90A 4I7WA 1XLGA 1S2UA 5FL0A 1T8QA 1VLWA 4MY1A 4ALDA 1OFAA 3QPZA 2V81A 2BASA 2XFWA 4EAMA 2XIMA 4AD2A 1U83A 1UP3A 3AJXA 2AQVA 1G9HA 4PSRA 1YPXA 4ZO9A 1JAEA 3NSMA 1RP9A 4M6PA 3VO0A 3LU2A 4RNHA 5A6TC 1EXPA 5EGRA 3CUJA 2Z7KA 2OSXA 4HA1A 4LUJA 5DF0A 8CGTA 3WH6A 4JFUA 1TV7A 3LTYA 1EUAA 3ANUA 1ODZA 4NZ1A 3T81A 3D5HA 2G50A 4Y9PA 4MPQA 1WZLA 1AZ1A 2WC4A 2VEKA 1NVMA 4PEKA 4H9YA 5E70A 4NZ5A 2FZ8A 5CLTA 2QVHA 2R82A 2OPJA 2FKPA 4GI8A 3G1SA 1KTNA 2R9RA 4C6MA 3QV6A 3CQKA 3H24A 2WSRA 5I77A 1G4PA 3P0XA 2YZRA 5MF5A 3M0JA 2GOUA 1OCNA 1TZ7A 2ISFA 4A8NA 2JEPA 1UH3A 3P67A 3W88A 3BTNA 4IMAA 3W7CA 3AMGA 1SO6A 3F5JA 3WJYA 1LWJA 1BSIA 5KZ6A 3BH4A 2VC6A 1CCWB 3SQLA 1WPCA 3QSRA 3RAOA 3VD9A 3I4EA 2BXYA 5A6LA 1HF6A 4O0ZA 3FK4A 1QW8A 1FKXA 3MT1A 1ECQA 4PL2A 4XAFA 6XIAA 4QJ1A 3AIWA 3VZZA 4RCXA 3UG5A 1UD5A 3UPWA 1XKJA 1DVJA 4Q4OA 3CU2A 5CCZA 2AGTA 1RBAA 2PDNA 4W7UA 1QVBA 2NT0A 5ABEA 1THFD 3G8EA 5EFDA 4JFTA 2OX4A 1UP2A 1B3ZA 3D0CA 1C9DA 2WWCA 3CV2A 1PTGA 3W7OA 5IRPA 3MYPA 3K4WA 1HVXA 4GA8A 4O16A 2KZHA 3PBGA 2GGJA 3VXGA 1RCQA 1OX5A 3TMLA 3GTFA 2Z1KA 1KRCC 4Q4SA 2D73A 3RLUA 2NVAA 2C0HA 5C9RA 1J5SA 4W7VA 3GY1A 3HFTA 2WZEA 4PODA 1Q6EA 3ARVA 2BODX 4QCEA 1BWKA 1X96A 2WB5A 3AIBA 7TIMA 1JDDA 2QF8A 2J6VA 4POCA 3H55A 2OOFA 1D8CA 3ABOA 2GWGA 1BGGA 4AU0A 2Y70A 1I45A 2QPSA 3LV6A 5F2LA 1NOFA 3S1WA 3O63A 6ALDA 3FGCB 4DRSA 4UTTA 3U2ZA 3M0LA 2QV5A 3H8AA 3VNLA 5HMDA 4ADUA 1YBQB 2WWDA 1ME7A 4QG6A 3FHAA 1ZP3A 4JCMA 2YJQA 3EMQA 4KCVA 3PB2A 4LWWA 4QXIA 4HK5A 4AF0B 3BGJA 3FYPA 4HU3A 3N2XA 1UKPA 2XFYA 3D47A 5LZLA 4ACYA 2NX9A 3SB0A 3ZJ8A 4S3DA 4CCCA 1HTIA 3IVTA 3BGGA 4ZQMA 2PWHA 3PZ9A 4HIBA 3VNKA 1TB3A 1ECEA 2G3NA 1W1B1 1VJSA 3AYVA 1V77A 2DUXA 3CB8A 2BGQA 3GSMA 1EA0A 1NSJA 2G41A 2V5BA 1TE1A 2GL5A 4G5DA 3VDGA 3PG9A 3SN4A 2F38A 1JYNA 2WCAA 2DDXA 4QSFA 2A3EA 3IJ7A 5DXYA 3AXHA 4ATDA 4RZ5A 4EANA 2OZTA 2VJXA 1LRNA 3PUDA 1M7PA 2PB1A 3YPIA 4BI6A 1FBAA 3LUTA 2DVXA 3SQMA 2J47A 5B7YA 1IZKA 3IARA 3OZYA 3HV8A 2BTMA 3SUSA 4XZ9A 2VX4A 1OZQA 2NQLA 3MI3A 2W27A 1ITQA 3PNZA 1DL3A 2O4QA 3P74A 3NUKA 4B92A 2ESCA 1Q7QA 1EOKA 3RXZA 1B4KA 1RPXA 2G3IA 1HJXA 4QROA 3HZ3A 1OIMA 3T05A 3AALA 4M1BA 1W1PA 1ISWA 3JS3A 3W1XA 5F4SA 5AY7A 4GQQA 3KWXA 1XYMA 4YN5A 3EKLA 3VOIA 2PWUA 5C70A 3P62A 2ZICA 2X2YA 3AXMA 1W9DM 2WJFA 3FY1A 3QOMA 3M1ZA 3NWRA 1GVRA 2C14A 2J88A 3LY0A 2C79A 4AWEA 3O9NA 1XYBA 3MU7A 1GJPA 2Y6ZA 1R3WA 5I79A 3CH9A 1NFBA 1PKNA 1X1ZA 1DJXA 3WJXA 4AY1A 5GNZA 1E9LA 1GOIA 2PSNA 4NIRA 3LZ3A 1TPC1 3EWXA 3IK4A 4GGBA 1PE1A 4Q4PA 4L64A 1K9TA 1MEIA 1OFDA 3S1UA 1KB3A 2C18A 2IKIA 5LA1A 4BY3A 2F9RA 7REQA 1XIMA 1E6SM 4GNKB 3W26A 1CLXA 3BK0A 2MUCA 4QQUA 5FF3A 7CGTA 1ELSA 1UZ4A 1H51A 2NV1A 3E74A 2E9LA 5BXRA 2XUCA 4FNSA 1JAKA 3MBDA 4HU4A 1JPHA 5D30A 2QJNA 2EAWA 3VOFA 4H6EA 5C9ZA 2FGLA 3N25A 2PDGA 1V93A 2AL2A 4TTUA 4K8GA 2V38A 2XIOA 1I1XA 1DQXA 4URIA 4IMEA 2E4TA 2DZXA 2ZZ1A 1G4TA 4MKNA 2ONEA 5FD0A 1XV8A 5KTLA 2VGIA 1EWEA 2G4JA 5A95A 4HNLA 4HMDA 3GVRA 1UKQA 1WV2A 4C65A 1V0KA 3EOLA 5JBEA 2ZUSA 3REQA 3DI1A 4G7EA 5G2HA 4IICA 4JFWA 1EP3A 4MUZA 1LWHA 4QNWA 4N42A 2X30A 2HNHA 3SI9A 4PTDA 3V1HA 2V2CA 3UR5A 2V8ZA 2ZOXA 1RBOB 2JGQA 3OVRA 2W67A 1NH6A 2R94A 1E0TA 3F7JA 2PWFA 4UQCA 4OIFA 5EBUA 1JNEA 4FX6M 1E15A 1LL7A 2O4MA 3OGRA 4Y90A 4D6DA 3D6NA 4MYAA 1BF2A 4LF2A 1GVSA 3DGRA 4GVHA 2CLKA 5HA7A 1KGUA 1ADOA 3RO8A 1DXIA 1ZS2A 3WEZA 3LG3A 5EMJA 1XSIA 3EEZA 4I5UA 3UR2A 2QUNA 5A2CA 4PBFA 4EKJA 2YLAA 1GVQA 2POTA 4L1GA 1DWAM 2X42A 4JTHA 4J35A 4R5EA 1R38A 4NI3A 3T09A 6CGTA 3THAA 2FZ9A 1J6PA 1Z41A 1XKYA 3E6EA 4KS0A 1LDCA 3M07A 2IS7A 3GB6A 3MP3A 3RIKA 1KLZA 1LORA 4GVGA 3VUPA 3RCMA 4L9XA 2Z1XA 4F48A 4AIOA 3E9AA 4GI4A 3CZLA 1E71M 3WN6A 1VFMA 3F2BA 5LSMA 4L65A 2ZTJA 1XICA 3FSTA 5CZJA 4IQJA 3BG9A 1E5NA 1GHRA 2ZVIA 3OHMB 3CWOX 4JX4A 4GUIA 4JKLA 2F6KA 3AHTA 2ZA3A 4UB9A 4PYSA 3QC0A 3TTYA 1GYMA 4IM4A 2PP0A 4GPNA 1OFEA 4RJEA 2ZWYA 3RCNA 4WXYA 4WR3A 1ZBWA 3BMXA 2DT3A 4AZCA 5FESA 2J75A 3NPUA 1TWZA 4QTGA 2ZE0A 1WDQA 1E3ZA 1NF0A 3RJXA 1GNXA 5IFTA 1B3OA 2D3NA 1MVYA 3IGXA 1V6VA 2Z27A 1WCGA 2A21A 5C6MA 2CBJA 1V6YA 1WA3A 2DUZA 2VEMA 1H63A 5HOSA 1K8XA 2BVDA 3RN6A 2CLEA 4XTDA 4C5YA 5LIUX 3FAWA 3LCFA 1HO1A 3OEXA 5ECVA 5HBFA 3HO8A 2F2KA 2KX9A 2ZBTA 1UWQA 2CESA 3VGGA 4MYXA 3R1ZA 3KBJA 3E5BA 2DZVA 4XAZA 4Z1YA 3GVQA 5J04A 4LANA 3C8FA 1M41A 3TU9A 3TCEA 1JEZA 1V3MA 4LAUA 1E56A 4ML4A 1M6JA 4LB3A 1W17A 1PAMA 1ISYA 3G1AA 4OJYA 4IHCA 4DLMA 1B90A 2YCLB 3NQ8A 1JQXA 3WLHA 1NDZA 1IEQA 1ITXA 3IRDA 3RYSA 1VYPX 1R7AA 1H7RA 5A6SA 3FJ4A 4JX5A 3EWBX 1LYXA 4ZMGA 4XK2A 2HRWA 5DX7A 1YMYA 1OJXA 3N13A 1PTAA 2WVUA 2Q02A 4DPQA 4OVXA 4JTTA 4H9VA 3AYTA 3DX5A 4MLRA 1YXCA 2ALRA 2QCFA 1YYAA 1TTJA 2I5GA 3FIGA 1PSCA 1SGJA 4HCLA 5HANA 2WM0A 1TYGA 3OG2A 4R7OA 3QHOA 4Y9OA 5DMNA 2PODA 1OBAA 4F40A 3H2EA 1YNYA 1P7TB 4LS2A 4P7OA 3GE7A 1ISZA 3O6AA 4H04A 3A13A 3UEQA 3R89A 1V0NA 4RDWA 3S1XA 4IP4A 3IPWA 4H8NA 3IJIA 3MVIA 4M19A 3LOTA 3LXBA 2E1WA 2XGIA 1EJWC 3GAYA 1F07A 4IIEA 1Z9AA 3EB4A 4PMNA 4ZTYA 5LXEA 3HGRA 4AZ7A 3E0WA 3CIWA 3KBMA 3SZ8A 3EA3A 3WJZA 1SR9A 4UQAA 2PF8A 2QAPA 3CZKA 3SQSA 4O50A 4OOUA 2UY5A 1CGUA 4P7RA 4DJFC 1JPIA 1J0YA 1U1JA 4ZB2A 3WLSA 3C0QA 4CEUC 1ZENA 5I00A 2QJHA 3MHFA 4US5D 3EOSA 4KIEA 4OWGA 4RPPA 3QY6A 2YL8A 4J3UA 1XLJA 4QQ3A 3OVQA 1CB2A 1IEIA 1A5UA 1Z32X 3W23A 2TYSA 3THUA 4DJEA 1XIDA 5LGXA 4LUTA 1DWFM 5HJXA 3ZVHB 2C3ZA 4AZ5A 4UFHA 1H0IA 1PO9A 2QV4A 1ZCOA 3K30A 3PWIA 4I6KA 4LXFA 1PB0A 3A3HA 4HCHA 1W5OA 3DHUA 1OX6A 3VIJA 1V7AA 1CGXA 2Y8VA 3WQ4A 3GXFA 1QMLA 2CLOA 1RD5A 3DESA 2PU0A 1V02A 3CHVA 5GNXA 1XC4A 1AK5A 3WMCA 2Z6JA 3WQ5A 3ZYZA 4AC1X 1KFWA 1H09A 3DYOA 3B03A 4J3SA 3WF0A 4RZBA 5HPCA 4Y2WA 4XZLX 2I9UA 4U3AA 2XFRA 2Y89A 1M7JA 3F4CA 3SN1A 4BJHA 1TELA 2HK1A 2XSXA 2CLFA 2FPYA 1W1ZA 1MUMA 1DHPA 2BG5A 4K1GA 3E2QA 4FIRA 3WEOA 4WKHA 1TJPA 2Z29A 4M29A 1YADA 5EY5A 3L21A 3TZFA 3W7EA 2HMCA 1UR3M 4GC3A 3BC9A 4X3ZA 4IISA 5D2VA 3LBOA 1BHGA 1GJUA 3KFTA 5TQLA 4M1RA 2CKRA 3GK0A 4IMGA 3WIJA 1KM0A 4HHLA 4HA4A 2PDCA 4Z2HA 3T42A 1PBGA 4US5A 4EPBC 4IIHA 3WBEA 4ERIA 1CT5A 5A8MA 4HGXA 4XAPA 5TBOA 4JQAA 1JI1A 3T8QA 2NX3A 1QI4A 2OLAA 4MY9A 1J9YA 1HP4A 5CSYA 4BA0A 1U22A 3KX6A 1KBBA 1E9IA 1PXGA 2W61A 1PZ3A 4PMOA 4H19A 1DPMA 3G1YA 2ZWZA 1FVPA 3BLDA 4KRUA 1TTQA 1XCWA 3NQFA 1NY1A 1RH9A 3GU1A 3Q45A 4MKVA 1KBIA 1TJ1A 4HBKA 1J2WA 2W4XA 3B4YA 3U7VA 1GQIA 2CPUA 5BCAA 1O1HA 2UY4A 1T99A 3E12A 4OUIA 3O6YX 1UPPA 1P5BA 3MUAA 4EWJA 3S2MA 2RH9A 3NOYA 4UQ9A 3E02A 2DSZA 4CD6A 3N9SA 4P8VA 1FDYA 5C7VA 4DJDC 2HPIA 5FOOA 4CCZA 5CC6A 4IZGA 3W6YA 2DUAA 3TQPA 3AYSA 2Q8ZA 3V0TA 1SQ7A 6XIMA 3LMZA 2X09A 2Z7GA 1JD7A 5I3KA 4NXSA 4WX2A 5FI8A 3CEPA 1VEMA 3W7QA 1FXPA 3C2YA 4WUIA 1ZFJA 1XPGA 3CHDA 2EG8A 4PUUA 1V3IA 4X2PA 3FDGA 3RO6A 2WMHA 1FWNA 1E1CB 1QWGA 3P8JA 1V3LA 5EMKA 1EDQA 2NVDA 4EVZA 4F0HA 4ZOCA 3BW3A 4EPDC 3L4YA 5AYXA 4RW5A 1S38A 1VGAA 1IWAA 4RZ4A 1FP8A 2WJZA 2A4AA 2H9AA 2W92A 4JYDA 1QR7A 5HJYA 1GQKA 3LRMA 2FB2A 5LNVA 2I5QA 1KNWA 3B9EA 5HJLA 1UD8A 3N2TA 2E8YA 3UWWA 1QNSA 2DH2A 3HPFA 4DWSD 5JUVA 1UG6A 1OCJA 4JNYA 3PJTA 2FHCA 3PPCA 3TTOA 2XN0A 2VL4A 1OYAA 4IF2A 4ZTXA 4LALA 2WC7A 2FVLA 1DP0A 3GR4A 3HOJA 3PN8A 1PIIA 2WVVA 4O53A 3GX9A 4M3PA 4H01A 3L0NA 1BLIA 3JU2A 1S3TC 3ARRA 2UY3A 3GVGA 4J3VA 2FFIA 2EQDA 3WQEA 1G0CA 1PKMA 1XUUA 4YTQA 3PTDA 3W3OA 1HL9A 5HNNA 4JFSA 4JZ5A 3SY1A 3PFMA 3PHAA 5HWNA 1QPQA 5CZSA 5JIWA 2JALA 2QEZA 4AZ6A 3KHDA 5C9UA 2DGAA 3DFTA 2Q01A 4UTFA 3VGDA 4YU1A 1R47A 4GZJA 3ICJA 3NCOA 2AMGA 1XBXA 5LXXA 2ISSA 4AXKA 4LB4A 1QOQA 4NX0A 1F74A 4ZCWA 1KKRA 3L4UA 3GKFA 4R33A 4B9ZA 3COTA 1C93A 4XVDA 1UHVA 1KFJA 4A29A 3T0TA 3LCGA 1VFUA 4DF1A 4L1WA 2GWNA 3PG8A 1SU5A 4J1OA 5AHIA 4DXXA 3O7UA 4BKNA 4JTEA 3D46A 1DTUA 1Q85A 1KR0A 3TR2A 3GDBA 1K7XA 4CD5A 4UFMA 4B5NA 2E9MA 2CXGA 3W53A 1A5CA 4Q8NA 3JW7A 3LSBA 5LGZA 1OYBA 3APYA 4J2PA 4Q7IA 4Z0SA 4TX8A 5G1TA 1W0MA 3LHVA 1V8EA 3VOCA 4KGJA 1JUKA 1OX4B 4GIAA 3IJDA 3GTIA 3MP4A 4NNBA 4DWSA 1M01A 4O12A 2WO5A 2XIIA 3V35A 4FSAA 4Z08A 3H4WA 1LLWA 4B3LA 3KCLA 1RQEA 2IKGA 1NM9A 1D8WA 3PPGA 7A3HA 4FK9A 4BI7A 3S5SA 2PEVA 3APGA 5BRBA 1FWGC 4D72A 3ITGA 3NQCA 3UJSA 4HA0A 4LYKA 4CQCA 4WOQA 4LUSB 1L9WA 4TMBA 3W7LA 1K03A 1E55A 1PYMA 2VFEA 3WKZA 3WBWA 3C3NA 4HTYA 4ZOBA 4I9AA 1BAGA 1W3HA 3FA4A 4H6KA 1GVEA 3UZWA 3ZLGA 3H12A 1TVLA 2OGYA 1EJXC 4P5UA 4E38A 4I5RA 3G0SA 3H26A 4GO8A 2A1YA 4RDYA 1OT1A 4XIAA 3TC7A 3MBFA 5CJ5A 4DYJA 3TA6A 1VFOA 4QS6A 1OC7A 2C8NA 4XAGA 4GXMA 4RW3A 4UOQA 4LUIA 4NVTA 3QKZA 3BARA 1KW1A 4M80A 2FH6A 2I56A 2P8BA 2YBTA 3B04A 5ECUA 2J77A 2P1FA 3W74A 3FCPA 1MDRA 4JYFA 1QCWA 1JCLA 3QV9A 3OU8A 2WMIA 3T0DA 2ZYFA 4KERA 2X0SA 1JDCA 2QQ6A 4MY8A 3MSGA 3P7YA 1G4SA 3G1FA 3N3MA 2PF0A 4LNCA 1J96A 3UJ2A 1W3TA 1ISXA 3CUIA 3PY2A 3VILA 3CQJA 4WLCA 2PRLA 1K4HA 1QOPA 2VDGA 3HGOA 4YLWA 2A6LA 1UUMA 5M5DA 4XIMA 1F8MA 2R8WA 3VFLA 1H7NA 2GQ8A 4L7ZA 1K7EA 1G4EA 3Q37A 4XZWA 3K46A 2WHKA 4R27A 3S47A 2XJ7A 3R10A 1Q5MA 4DUOA 1PWMA 1W5QA 1QU4A 4H9MA 4U4MA 3EAUA 1R9XA 2XN2A 1FA2A 1RCXB 1G1YA 3TJLA 2GSHA 2YL9A 4P61A 3N6JA 4QNEA 5A1AA 5BOEA 4CNPA 1PZ2A 1M53A 3AROA 1GKPA 1JQVA 1MUCA 1I9CB 1SW0A 3C5QA 2PZ0A 3EX4A 1YXDA 4PMJA 5C2XA 4W85A 2FZBA 1JFHA 3GTNA 1AODA 2ISWA 4HMCA 1EFZA 3MZ2A 1TPWA 1TPUA 2XSBA 4U2YA 4V1XA 1WZAA 1P0DA 1NWUA 1O1ZA 4NAEA 4L6OA 5T9BG 5E9AA 3MDUA 3ZSTA 2WMJA 3W2NA 3WQFA 1OIFA 1XPYA 3CLWA 3W7PA 3W2JA 3ITYA 3GH5A 3B0XA 4CNNA 1UWRA 3VDAA 3GU9A 3UXDA 2Z00A 2RUSA 3U2EA 1S1RA 1EZ2A 1POJA 3CL6A 4NJJA 4IWWA 1ZCCA 4IIDA 3EDFA 4V27A 4NKCA 3NDOA 1BVWA 2ZDSA 1WDPA 1NFGA 1AW2A 3TYEA 4O11A 4W84A 3DFNA 1SZFA 2D20A 3N2MA 4LBRA 4HZ6A 4YVVA 1TMHA 1I60A 1VBJA 4DBWA 2G95A 3THCA 2Y62A 5E5CA 2REQA 3H21A 4ZO8A 3RRAA 5JVLA 2V3GA 4RZ6A 2V5DA 3G24A 5BU6A 2BHUA 1DQUA 2WK2A 3CWHA 2YBVA 4EXQA 1XGZA 2PPGA 3V0UA 2HS6A 2EJAA 3MANA 5AHFA 1H1NA 3C0JA 3C86A 5G4HC 4FZIA 3T4WA 4TOQA 1FWJC 4PB4A 3OLDA 1CGTA 4E2OA 1FH9A 5DRCA 3T44A 2QXWA 4BI5A 1XWYA 2ZXAA 3LNMA 4HNNA 1U30A 1I1WA 4BK9A 4F0MA 1RALA 1TV5A 3PSVA 3Q65A 5AC7A 4DF0A 3ZLFA 4QG8A 1MEWA 1F73A 4XWUA 3KAOA 1H7WA 3AI0A 8TIMA 4G56A 4E5TA 4QGCA 4LCRA 4LU0A 4M5PA 3KVMA 3UPMA 2PTZA 3WQWA 4F4RA 1X1NA 4DN1A 4PA8A 1WDRA 3AHZA 3CT2A 4L4LA 1MQRA 3MMTA 2RDTA 2VVSA 4DBDA 4WDXA 3BQ6A 3NURA 4DEFA 1UR2A 1ML1A 1HJUA 5DCEA 3LXAA 2WYSA 3W1UA 4C5ZA 4REQA 4YTUA 1LG1A 1SSDA 3N9RA 4R3UA 5HUOA 2B0MA 1CECA 5D37A 5A8QA 4QCFA 3IIZA 5K9DA 5I0DA 5BOOA 1MQPA 2BDQA 2GUBA 3G5EA 4D9PA 2B7OA 3WQ6A 3QF0A 3HG5A 1H1ZA 2OG9A 4NNAA 1LROA 4IPNB 1MO0A 3P3BA 1QW9A 1WE5A 1O60A 1F3XA 5CZ0A 2YKKA 4AVNA 1BSLA 3HQPA 1FKWA 5LA0A 4HYRA 4P8XA 3VIIA 2G96A 3PZTA 1NP2A 3LK6A 4PMRA 3WDIA 3V16A 5REQA 3U48A 4UTHA 1M7OA 3CV7A 4RDZA 2XVLA 1XYZA 3WMBA 4K6AA 3MMUA 5L6UA 2VC5A 3PJWA 2OZ8A 4YTTA 4JIRA 3BDKA 1UR9A 5IBXC 1ITCA 1P0EA 2HS8A 3IS4A 1OD0A 5JH2A 3B40A 4NRSA 1Q3NA 5G2WA 1YDOA 1QUMA 5HWMA 3H2MA 3CHFA 3UG8A 3VC6A 1UH4A 4HMEA 3GDKA 1XSJA 3O16A 2GGIA 3N73A 3WCZA 1LRTA 2VEPA 1N82A 3WMSA 1DXEA 1K02A 3OHIA 1VBGA 4UTIA 1OFPA 2HK0A 3HJEA 4DNHA 3NG3A 2ZX7A 3FVDA 1JFXA 3B9NA 1TWWA 3LHZA 3QMTA 4GJIA 4JIQA 1XISA 4GIYA 4AMCA 4GCAA 3NQEA 2GJXA 1XDLA 4GD0A 1XLAA 2RFGA 1Q2SA 1JCXA 4HSHA 2ZUMA 1C8YA 1V3JA 1UH2A 2R91A 2EPOA 3RLHA 4A35A 3MY9A 2F2HA 3PTMA 1ZAHA 4GY7A 4MG4A 3EDDA 5TAOA 3QLDA 3PJXA 1AMKA 1JJKA 2OWXA 4QE1A 5AC4A 5U7SA 3P5ZA 3UXLA 5I03A 3B0YA 1HVQA 2G5WA 1SFSA 1O5XA 4OBSA 4Z2IA 3L66A 1M3UA 1US3A 4JTFA 2BNJA 1GVIA 3W25A 1SJAA 4F9DA 3BAWA 4Q8MA 1WAUA 1X6LA 1LM1A 5E6ZA 4A3UA 3KBSA 2QUVA 1A80A 4S3EA 3VC5A 1UZ1A 2Q3OA 4FLRA 4ROQA 4Z17A 4FR1A 3LYEA 4DUXA 3EXRA 3FGCA 1LLOA 4N6EA 3NXLA 1ZL1A 3CIXA 1YBQA 1FQ0A 3M7SA 4GYKA 3M64A 1L6SA 3FS2A 3MMWA 1ONXA 3TYBA 5FA5A 4IL0A 4HPJA 4Q4RA 1Z3NA 2ZDRA 3AUJA 1KWKA 1BYBA 2FHBA 3CB3A 2QLYA 1AA1B 1FRBA 3WX7A 2R1KA 3MKVA 4KWUA 4J2MA 5A6JA 4LCSA 2UZ9A 1W9BM 2WKGA 4C1LA 5I3FA 1H41A 2QUMA 4KCUA 3TN5A 2V0TA 1Q8JA 5J5RA 4DJFD 2VT0A 3PP7A 1JPMA 3VVGA 3G1VA 3N4FA 3IJLA 4UMAA 5F4WA 3UYIA 1KA9F 3T8LA 4ZVJA 3AFBA 3QH2A 1MXSA 4C1KA 3WK1A 3VKKA 3T9PA 1E9ZB 1JNDA 1TE6A 2P88A 4MMWA 2VRKA 1CBGA 4O18A 3RMJA 4TVDA 2YXXA 5I07A 1EP2A 3HQOA 2W62A