4DIAA

Crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
293
structure length
286
Chain Sequence
LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLPKDKFLEVAGRLPAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTNWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-pyrone-4,6-dicarbaxylate hydrolase
publication title Structure and Catalytic Mechanism of LigI: Insight into the Amidohydrolase Enzymes of cog3618 and Lignin Degradation.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 94
structure length 286
sequence length 293
ec nomenclature ec 3.1.1.57: 2-pyrone-4,6-dicarboxylate lactonase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4diaA00
4IG2B 3V7PA 2AQOA 3GTIA 3MJMA 3RCMA 4H9ZA 4PBEA 1UMLA 4GZ7A 3IJ6A 1RK6A 1FWBC 4H9VA 4D8LA 3E2VA 1POKA 2Z2BA 4IGMA 4EP8C 1NDVA 3AUOA 1UIOA 4BJHA 4M51A 1EJVC 3OODA 4IF2A 1E9ZB 3HM7A 1NFGA 1XRFA 4HK7A 3A3WA 4ICMA 2GZXA 2FTYA 4C6LA 2ADAA 4WGXA 1A5KC 4GK8A 5E5CA 1RK5A 4LCQA 4GY1A 3LNPA 5HMFA 1K70A 4DNMA 4PBFA 3QY8A 3A4JA 2PGFA 4CQCA 2Z28A 3LSCA 3S2MA 4XD6A 2FFIA 1EJXC 1PB0A 1M68A 4CEUC 2WM1A 1O5RA 3UPMA 3O7UA 4L9XA 4DO7A 1E9YB 4KF1A 4RDWA 3E3HA 4GX8A 2UBPC 1M7JA 2PAJA 2FVMA 3GTXA 4C5ZA 3IACA 2AMXA 4QSFA 2OGJA 2P53A 3GTFA 3CAKA 3UR2A 2WJFA 3CS2A 4IFRA 3A3XA 3ID7A 3K5XA 1IE7C 4BKNA 3AU2A 1YBQA 4RDZA 3RN6A 4H01A 4C6JA 2PGRA 1PO9A 3TN3A 4RDYA 4C6BA 1V51A 3URQA 1FWFC 4DIAA 2RAGA 2YZ5A 4IG2A 4V1YA 1J79A 3B0XA 3IGHX 2HBXA 4XD4A 2WJEA 4LFYA 3E0LA 4H9TA 4UBPC 1R9ZA 1XRTA 1EZ2A 2W9MA 1KRMA 1I0DA 1A5LC 1P1MA 4XAGA 2E25A 1YRRA 2OODA 4HJWA 4IFOA 2GOKA 4GC3A 3SO7A 1YNYA 3IV8A 4DLMA 3OQEA 4DI9A 3FEQA 3IPWA 1WXZA 4RE0A 3LGDA 3GUWA 4KIRA 3URBA 3N2CA 2VUNA 1KRCC 2Z24A 4LANA 3GIQA 3LGGA 5FSDC 1EJUC 2HNHA 3LY0A 4MUPA 2FVKA 3F4CA 4IGNA 1K6WA 3T81A 4DZHA 2Z27A 4C6FA 4LALA 1FWIC 4LAMA 2KAUC 1W1IE 4H9XA 3LA4A 4H9YA 4C6IA 3HTWA 1PTAA 1S3TC 4C6CA 4PCNA 4B90A 4G7EB 4JOMA 3EWCA 4CNUA 4F0LA 1FWGC 1RA5A 4DI8A 2VM8A 1ZZMA 3MTWA 1PSCA 2IMRA 3C86A 1ITQA 3K2GA 4LAKA 2XIOA 4IH3A 1FKXA 1J5SA 1KRAC 2QT3A 2D2HA 3TN5A 4IQJA 4B3ZA 1K1DA 2DVUA 1BF6A 1HZYA 2BB0A 2EG8A 3TN6A 3EGJA 3OU8A 1RJQA 2E1WA 2FTWA 2O4QA 2YXOA 2QS8A 2CZVA 2UZ9A 3ITCA 2GWGA 2QVNA 3GG7A 2ANUA 2Q09A 2ZC1A 4CNSA 4HA0A 1A4MA 1A4LA 1UIPA 4XAYA 2Z00A 4G2DA 4HK6A 5HMEA 4GYFA 4KEVA 1NDYA 3B40A 3RHGA 3O0FA 4EPKA 4BY3A 3E0FA 3OJGA 4EPBC 3NQBA 1VFLA 3S2LA 4Z42C 3S4TA 3HPAA 3MVTA 1RAKA 4UB9A 4C60A 1KRBC 4C6DA 4C6PA 3RYSA 2OB3A 2R1MA 1DPMA 4QS5A 5A6TC 4KERA 5G4HC 1RJPA 4GBDA 3GU2A 1EJTC 3UBPC 3QY7A 3UR5A 1YIXA 2OQLA 2R1NA 1EYWA 3SFWA 3LU2A 4P5UA 3GRIA 4J35A 4GXWA 4CQDA 3LS9A 1J6OA 3B0YA 4R7WA 3GTHA 1NDZA 4EPEC 2R1PA 4G7EA 3URNA 3MSRA 4NI8A 3WMLA 5LXXA 4KEUA 4KETA 4F0SA 4J5NA 4QRNA 2Z2AA 4ERIA 4LH8A 1FWEC 1EF2A 3LSBA 3PAOA 2YB4A 3QGKC 2ICSA 3K4WA 1J6PA 3QY6A 2R1KA 4AC7C 4AQLA 4GY7A 4ERGA 3URAA 4OFCA 1ITUA 2D2GA 4DZIA 1A5MC 4C6MA 4CQBA 4H9MA 4DYKA 2HBVA 4C6NA 2D2JA 3OVGA 2HPMA 2VHLA 3ISIX 2PLMA 2F6KA 1YBQB 3T8LA 1XGEA 3ORWA 1R9YA 3OOQA 4KESA 3GU1A 2Z4GA 2O4MA 3EWDA 2Z25A 3MPGA 2QPXA 4XD3A 4H00A 3F2CA 3PNZA 1M65A 1R9XA 3TN4A 4HK5A 1EJRC 4LCRA 2P50A 2A3LA 2I5GA 3JZEA 1QXLA 3AU6A 4CNTA 3MKVA 4XD5A 3NURA 3MDWA 3S2NA 4C6OA 4XAFA 4KEZA 3D6NA 4GOAA 4CEXC 2GSEA 3GIPA 1QW7A 4WVXA 4QTGA 4IFKB 2BGNE 1UBPC 1WXYA 4KQNA 3CJPA 4I6VA 2YB1A 1FWDC 2Y1HA 4PCPA 1EJSC 3E74A 1FWHC 2G3FA 4RZBA 2VC5A 4ZSUA 4RDVA 4WHBA 4C5YA 1V77A 2EG7A 4YIWA 5HMDA 3WYZA 4E3TA 3R0DA 5FSEC 4ERAA 4GX9A 4LCSA 1GKQA 4DLFA 1FWAC 1RJRA 5AKQA 4QS6A 4NP7A 3BE7A 3S2JA 1JGMA 4GY0A 2GWNA 3WZ0E 3FDKA 3DCPA 3T1GA 2HQAA 4XAZA 1V79A 2OOFA 1ONWA 4QROA 4I6KA 3GU9A 1I0BA 4F0RA 1NDWA 2I9UA 1P6BA 3IARA 3FDGA 4B91A 4R85A 1FWJC 3F2DA 2Z26A 4B92A 1GKRA 3QGAC 3NEHA 1A5NC 3F4DA 2Z29A 1FKWA 1ONXA 3KM8A 4H9UA 3ICJA 4C65A 1POJA 1GKPA 4NG3A 4V1XA 4PE8A 4ZSTA 4J2MA 1P6CA 2DVTA 1V7AA 2AQVA 3PBMA 4L6DA 1FWCC 4LAOA 1RA0A 4TQTA 1KCXA 3UF9A 4R88A 2PUZA 2VC7A 4C6KA 1YMYA 2DVXA 2HPIA 1XWYA 1ADDA 5CH9A 2Z7GA 4C6QA 2Q01A 2EG6A 2VR2A 3DUGA 1O12A 3DC8A 3F2BA 3TNBA 1V4YA 4INFA 4C6EA 3MVIA 3PNUA 4IFKA 3PANA 4EPDC 1A5OC 2R1LA 3E38A 1EJWC 4LEFA 3IRSA 3G77A 2WJDA 3MDUA
chains in the Genus database with same CATH superfamily
3ZVHB 3TQ0A 3L5LA 3QW3A 1J01A 1VFTA 3HPZA 1LDCA 4PFMA 3W76A 2O55A 3UQNA 3EA1A 4LC6A 4XQ6A 1TPFA 2BSLA 5ECUA 3EKGA 4S3CA 4M51A 3WK3A 1PEZA 1XGDA 4RV8A 3GVQA 3AHZA 5H8UA 2G3NA 2XDFA 3IIZA 1PKMA 3S9ZA 4AVFA 3ZVIA 4HKPA 1YXCA 1UKQA 1ZALA 2CU0A 1SFTA 2ZDRA 1OFBA 1BTCA 4HIBA 3OLEA 4NRSA 3R43A 4Y90A 3W1MA 3AS0A 4LGXA 1V02E 4CCCA 1GZ1A 3BPWA 4MY1A 2NXIA 3VD3A 3CV1A 3H6OA 1JQVA 1DV7A 3WN6A 2D0GA 4DJDD 3M16A 5CC3A 1XIJA 2XIIA 2HSAA 3GVWA 3M6YA 3LTPA 3VOHA 3W4RA 5CAKA 3OG3A 2PI6A 1EC8A 4E6MA 4LOCA 2CLHA 3C5QA 4DAFA 2VXNA 1DHPA 5RUBA 3S42A 3TOPA 5M17A 4W89A 4IG2A 2AQWA 2YZ5A 3IWPA 2XUCA 3AFBA 4L1GA 2O0TA 2J7GA 3LK6A 4TMBA 3WD3A 3UPWA 2VOTA 1G01A 1JZ4A 3UWQA 5FEWA 2E9BA 1A5LC 1R7OA 4PMUA 3V18A 1W9UA 3ZO9A 3V1HA 5HR6A 4W87A 3SN4A 1PVNA 3KXQA 1XLIA 4EXBA 4LRSA 2DJXA 3PFMA 3RNDA 3TZNA 2XFYA 3L4YA 1GOMA 5KZMA 3VFLA 1P5BA 1K9EA 4H9XA 1SSDA 2WNNA 1DTNA 3MI6A 2OYKA 3CAVA 3IGUA 1VKFA 2J25A 2QPUA 1WZKA 3NL2A 5FJPA 1BLIA 4J2PA 5D02A 1VC4A 3MMUA 4JOMA 2YBVA 1S2UA 2QXWA 4MJZA 3N6QA 4AIUA 3W9ZA 1LZOA 1TG7A 5LHFA 4G56A 3CUXA 4NASA 4GUFA 3QV6A 3VKAA 2V63A 1JZ7A 3STFA 4G6CA 1E40A 2J4GA 4HMEA 3I7RA 2O4QA 1QHZA 2HS8A 1Q65A 2Q09A 1B30A 4RZ4A 2PTZA 4J9JA 1DWFM 4H7VA 1OCQA 7ODCA 3W87A 5AZ0A 1K4HA 2HDJA 4EPKA 2WC4A 2PRMA 3E0FA 3M5VA 1K8CA 1FHDA 1H4PA 1SW3A 4AW7A 3RM4A 1RXOB 5B7YA 3TYZA 1G6CA 3VA8A 3ZLHA 3H2NA 3SSZA 3V5FA 3DDMA 1CBGA 2OB3A 3VE9A 3A9IA 1DWJM 3QY7A 3NYDA 3FXGA 3QXBA 2OQLA 2R1NA 5LA1A 4MFDA 1XYAA 1KBBA 3SQMA 5CZKA 3PM6A 5CZSA 3TR2A 2HVOA 2MANA 5CSSA 3CQJA 4C91A 1CEOA 1VFFA 4KWWA 1TV8A 2X30A 2ZX7A 4I8YA 3WD4A 2ABAA 1D8CA 1UWUA 1OQFA 4KETA 1XC6A 3MS8A 3TFXA 1TV2A 4DUVA 2FMNA 4XKYA 3BTNA 3RU6A 5EU9A 3S9YA 3AIRA 2CKSA 4O1AA 4B5WA 4KFOA 4LNCA 1G94A 4CQBA 1SZFA 3UETA 3PB0A 3QHMA 1O5QA 3OGVA 1TX0A 4JNYA 4NZ1A 2AAAA 1DJQA 3AZTA 3OGRA 4TVUA 2XTKA 4HU4A 1N7KA 4XSMA 2CLFA 2CLLA 2OQHA 3H2FA 5IFTA 2WZHA 3TYDA 1AA1B 2PD5A 3UJFA 3O3RA 3ARQA 3LG3A 4B4FA 1XJBA 4HCHA 1TSIA 4LW7A 2V67A 3U5YA 4QR6A 1E0UA 2PTXA 3OIXA 4L1WA 4XAFA 1F4AA 1ZP4A 3FA3A 4GO9A 1E4LA 3GW0A 5KTLA 1B4EA 5ABGA 3DYOA 3DENA 1B3VA 2OU4A 4YVXA 3BCDA 4J3UA 4I5UA 5DMNA 1FWHC 5FOOA 3SN0A 1SO3A 4GLEA 3M4HA 3MO7A 3ZIZA 2XSAA 2Y6ZA 3I10A 4HPXA 4A3YA 3OLIA 4LCSA 1YPIA 2QCFA 2WHJA 3N2XA 1VFUA 2XJ7A 2NQZA 1KBJA 2BXVA 3EKZA 4JFSA 3NPWA 5K4ZA 4GJ1A 4H6RA 2WWDA 2Z26A 2G5WA 3AIEA 1UR2A 1I75A 1MI3A 4FS9A 2VMFA 4K1GA 4H9UA 3MUIA 2A3HA 4P7OA 1NARA 3N9RA 1GKPA 2G37A 1X1NA 2YCJA 1LBLA 5I5RA 1E43A 1HJQA 2QDDA 4HZ6A 2OEJA 4LYRA 4AB4A 2ZTJA 4ATWA 1RA0A 1E71M 1GPWA 3VOIA 3WF1A 2VC7A 1JCYA 1OM0A 2HPIA 2G3MA 4U5KA 4YMZA 2HZGA 3WEMA 3W6YA 1HUVA 3A23A 3LHWA 3O6AA 2MNRA 2AMGA 4C6EA 2QYGA 1AW2A 4H6EA 1ONRA 2GK1B 3ARUA 4JTRA 1DJIA 2G97A 3RR4A 3SRDA 4RZ5A 2QCDA 3CQHA 1J4EA 2EPLX 1C29A 4CU6A 3L23A 1EP1A 3EWWA 1IT7A 1IZKA 2EJAA 4Y9AA 3ARSA 3H7UA 4IMAA 4QGCA 2H9AA 3H54A 1CXEA 1XCXA 5LNRA 3IS4A 3GYEA 4JQ4A 3RMEA 4JQAA 4LXFA 2BXYA 4LVFA 3RO6A 3BJSA 1RVKA 3ZZ1A 5E09A 5E5CA 3GVGA 3WH5A 1VEOA 3MHUA 2WC3A 1J9YA 4ORIA 3R0KA 4B9YA 2O9PA 4Y9MA 4QLJA 3TVAA 3WNPA 3LSCA 3GKAA 2PDNA 2DSKA 3CMJA 5C9RA 3IVTA 3JVAA 1JR1A 4WDWA 2YZRA 1E6SM 1IEQA 1ITXA 1NFBA 2FZ9A 2UBPC 2V5BA 4LYKA 5FL1A 1O6IA 1B9BA 2PDJA 3GTFA 2YPIA 1OGSA 1KFWA 3CB3A 1OZQA 2J13A 1F74A 2PB1A 3TYEA 1IEXA 1PO9A 1KLYA 3B04A 2IS7A 4GUGA 3MSYA 4RDYA 4B5UA 4KH2A 2E6DA 4L80A 1SU5A 3EOUA 2VD8A 2WWCA 4UNLA 3T2QA 3E0LA 2VELA 4ZGYA 2EF9A 1ECEA 1R9ZA 3NZRA 4NZFA 3Q45A 1GUVA 1OHLA 1I0DA 2ZE0A 4Y7EA 4DF2A 3W7EA 3WF3A 1XDMA 5E0KA 1WO2A 5DXYA 3IVUA 3MSGA 3WLKX 3LI1A 4A8RA 4KGLA 1PZ3A 4JTAA 4IIDA 2CKRA 5GVJA 4A3UA 4IGNA 4H7ZA 3TTQA 3MT1A 1JFHA 4UTMA 9XIMA 3W84A 4YU1A 3QRHA 3XINA 2BZNA 3VILA 1K3UA 4C1LA 3O0KA 1L2UA 3LTSA 2TODA 3PTDA 3FA5A 3OA5A 1QVBA 2FJKA 1NEYA 4Q8OA 1P4CA 1GJUA 8A3HA 1B3ZA 4YNGA 1K77A 1AJZA 3WDQA 3W26A 3TN5A 4RXFA 5F2GA 4B3ZA 1XV8A 2HRWA 5A94A 2WMJA 2PWVA 3NNTA 4RXGA 1ZB5A 3WFZA 3I6RA 4MNMA 4XX6A 1DJZA 1JF5A 3B0PA 2XVKA 1S46A 3T09A 5FJJA 2V2CA 3B40A 3O0FA 1EHAA 2GVJA 3RPDA 3H22A 1DTUA 2OVLA 4M6QA 1CDGA 6ALDA 2A3CA 4HZ8A 4Z42C 3HPAA 2G3IA 2RH9A 5CPNA 4PUWA 2UY3A 1UYQA 1VIZA 1V0LA 3MUZ1 3N11A 4R27A 3GNPA 3H4XA 1FXPA 2OYLA 3MO4A 1CCWB 3KZSA 4J35A 4BA0A 3B4UA 3N2OA 2GVEA 1V02A 4GXWA 1WPCA 4Z08A 1GONA 4GNJA 2W62A 1H41A 3VC6A 3V36A 4X60A 1BWKA 2XWDA 4GKLA 1NWUA 2OELA 4RUBA 3SCQA 3IIXA 4AC7C 1UROA 4CCDA 4O12A 1F6KA 2Z1SA 3KBVA 4TVDA 4IJBA 4ZO9A 5LNVA 2OEKA 2WMIB 1J5TA 4JTQA 4OT7A 4RZ6A 3EOSA 3FHQA 3G6MA 1PS9A 1JF6A 4LVDA 5A8PA 2D3NA 1AUSL 4H00A 3HFYA 3ZFHA 3PC0A 2EQDA 5IOBA 2E8YA 2FZBA 1Y7VA 4LCRA 2BDQA 3RLHA 1EWEA 4OKDA 2BY0A 3BLOA 2YA1A 1ZGDA 3VYLA 2YDSA 3WELA 4GI4A 2PCEA 5IHSA 2XN2A 2WHLA 1H61A 4PCPA 1MNZA 1U5HA 3GB6A 4RZBA 1S2TA 3EDKA 4Y96A 4AZCA 3WYZA 3LGEA 4U31A 4KWVA 4TX9A 1M03A 4OGZA 1RJRA 3TA6A 3WQCA 4I3GA 4W8BA 3WUEA 4YHGA 4QCEA 4DY1A 1AL7A 2NZLA 2VGBA 2XH2A 4IXHA 3MC5A 4MAVA 3T05A 1QWGA 1BYDA 1UD2A 1N55A 3C3NA 4KWSA 3TAKA 1ONXA 2VRKA 1SZNA 4WKFA 4X0NA 1NM9A 1YNQA 3NDOA 1Q8AA 2ZE3A 1H1YA 2QCHA 3H2EA 3UF9A 1IGSA 2GVYA 2PF0A 3HPXA 4NNBA 1P1XA 4UWMA 4Q8PA 5FL0A 3EXRA 1XLCA 1BEUA 3W70A 1TKKA 4F2UA 3A47A 4QHRA 4RLIA 3BXWA 3CPRA 2GUBA 3FW6A 4OE7A 3QYSA 3K46A 2W4XA 3PF3A 1Q6DA 4J3XA 2E68A 4H9ZA 4UR8A 5H6HA 2PRHA 5DMYA 5ABFB 4REQB 1IYXA 3STGA 1POKA 5J5DA 1NDVA 4UQCA 1ICPA 4PSRA 4QAIA 5T9CE 1M41A 3FKRA 3VOGA 4R3UA 3E0IA 1QHOA 3L0KA 4V33A 3DYPA 2YDRA 4Y8FA 3AUJA 1P0KA 2XH4A 1PHQA 4A2SA 3ECQA 5U4NA 4TX8A 4UOJA 2WQPA 2V2DA 3ITOA 4D72A 4DNMA 3FS2A 3QY8A 3U2EA 3VZXA 4CQCA 2Y70A 2FFIA 2PTWA 3HMCA 1XLDA 3BLEA 2E5DA 3WJXA 4EAMA 4DO7A 4HSNA 2ZRYA 2ZUMA 3A12A 1I2PA 5DMLA 4R7OA 3WEZA 4QAWA 4F0KA 5KITA 3PPFA 2P53A 3IJ9A 4GUJA 1HJWA 4CVWA 2WKJA 4FIRA 4IFRA 3G22A 3W6MA 1EGVA 1HVQA 4FXSA 3QQWA 3EX3A 4I9MA 1ENUA 4S3KA 1AJ0A 4LUSA 4R34A 4E2BA 5BOFA 3M0VA 2AL2A 2TRSA 4HNVA 3OBAA 4PEKA 4DIAA 1DWAM 2BV9A 4L4OA 4ATDA 3F4NA 1R3QA 4HBKA 1OFRA 1B3WA 1K03A 1QNPA 2BX7A 5TBOA 5BWAA 4JN6A 3W2NA 4GC3A 4RNFA 2YL8A 2NV2A 2IPJA 3IPWA 3E0WA 4HB7A 5J5RA 2Q8ZA 1C8YA 2QJNA 2QPSA 1XYLA 4LNYA 4LC8A 3GIQA 4Y9PA 2HNHA 2GVLA 1K6WA 2Z27A 3RUBL 1JPDX 1QU4A 1NAL1 5F2MA 2OT0A 3NSMA 3HTWA 1VH7A 3PPGA 3UG4A 4C6CA 2ZRXA 1BVWA 5IM51 2V5JA 1XLMA 3BO9A 1N2VA 4DJFD 3QMRA 5D9OA 1H51A 3QH2A 1RQEA 1QASA 3TXVA 2FZ8A 3L4WA 3VPLA 1F6YA 4LAUA 4HOZA 4WXZA 2GOUA 3FIGA 2DVUA 1YEYA 1XIDA 4F2TA 5HWNA 1E5NA 1E0XA 2OLHA 3W6LA 1PUDA 1XSKA 3VCNA 4M6VA 2DZUA 4U2ZA 5CQ1A 2PSNA 2CITA 4XAYA 2VCAA 3GXFA 1GYLA 1VBHA 1G7VA 1EA9C 1NOFA 4IX2A 3CHCA 3G1AA 5G5IA 1VYPX 3CHVA 4C60A 3LB0A 1Y5VA 4Z2HA 5J8LA 2R1MA 5B7ZA 1AODA 3GU2A 1EP3A 4J40A 5AVHA 2PZ0A 3CHDA 2Y89A 1UR8A 3GH5A 2PE4A 1KXVA 5DX7A 1E4NA 3ZLGA 1UA7A 2V5CA 3TMLA 6A3HA 2ATSA 2R1PA 1TREA 4LF2A 2POTA 4RK8A 2R9RA 4DAIA 2PDQA 3BCFA 4IX0A 1MRAA 2NVAA 3R1ZA 4X2RA 3O6DA 1TWIA 3VM7A 3GHRA 1FWRA 3K4WA 3MUCA 3MKKA 1X6LA 5D05A 4KCVA 4DWSD 1N8FA 3PPHA 2Q71A 2ZXBA 4DZIA 2ZUTA 3CUIA 3SJNA 3LHVA 1DWHM 3WNKA 2Y4SA 4LPCA 4YPJA 1XH1A 2PLKA 3C52A 1F3XA 3WQVA 1OZMA 3MW7A 3DGBA 3WO8A 3M5YA 3AZRA 2XIBA 3EWDA 3ZSSA 4AD4A 3C4UA 3LV5A 1Y5WA 5D2XA 1CXFA 1T8QA 2QUUA 3ZWTA 1R3WA 3TJLA 1SM9A 3KRSA 2Y0FA 3AIQA 1R9XA 2QUTA 1XFBA 1WKFA 3TK7A 4B5NA 3AO0A 3N73A 2P50A 1TTQA 4MAZA 3RF9A 1UD6A 1HFBA 4IMEA 3GH7A 3W82A 1A53A 3CPGA 4CQ8A 3WUGA 4IFKB 2GL5A 1L9WA 4RPQA 5IBXA 2AAMA 3CJPA 1GQIA 3FA4A 2R24A 3CZGA 3FHAA 4X22A 5I3GA 6XIAA 3GWQA 3VNYA 5K9DA 2XVNA 4O53A 1PXGA 3M64A 1V77A 1NP0A 3R0DA 3S47A 1Q85A 4GX9A 3AALA 2FGBA 4BQ2A 4DZ5A 5I23A 3U9IA 1ESWA 2OKOA 1LRNA 5MKGB 1O66A 4AU0A 2GGEA 4I5RA 1KTBA 3QTGA 4GIRA 3DIPA 3AMGA 2VNCA 3MP4A 3LX9A 3DU0A 3TV8A 4BFAA 4Z2LA 4IWWA 3V35A 1XPYA 1LP6A 4CD6A 2V5LA 3C2OA 1MRQA 3W7NA 4GIAA 1SJCA 3T44A 1MQQA 1Z32X 2WJZA 2G50A 2E9MA 2OZ3A 4S23A 4NZ5A 1XSIA 3ARYA 5FF4A 1NF0A 1UUOA 1YXYA 1RQBA 1VJSA 5C7VA 2Y2WA 2B7PA 5XIAA 4JTIA 4IXXA 1ZY9A 3U57A 1RSCA 3ITYA 4PUJA 2IKGA 3TNBA 3CEUA 2F2HA 3VGEA 2MUCA 3TWBA 3E38A 1XIGA 4HNOA 1JULA 2XFFA 3NWRA 4S3JA 3CIWA 3UP8A 4I7UA 4FMVA 1KB3A 2E8ZA 3LQLA 3ARVA 2RDXA 3LCLA 3KTSA 2XFWA 2V5DA 2ZDSA 4O0QA 5DLCA 4PRTA 3C56A 1T8XA 5SWUA 3G1RA 4GK8A 4UTIA 2R14A 3R25A 1K70A 2XGIA 4ZOEA 1K9TA 3XISA 4E8CA 2XFRA 4DB7A 3PR2A 2HWGA 2AKZA 4B3LA 2PAJA 4J4KA 2CERA 5KZEA 1CLVA 3NXFA 2ZRWA 1CI1A 3DFTA 2FFCA 1SZRA 3CS2A 3CNYA 5HNRA 1V6UA 1OGBA 4U2YA 5CLWA 1EXPA 3P80A 3SUUA 1BKSA 2GK1A 4NL1A 3AMCA 5MF5A 3TN3A 2LLEA 1V51A 1R86A 4S1FA 3BMXA 3OYZA 3GSMA 2X8RA 3G6LA 4MY9A 2W9MA 4Q8TA 4WJXA 1ONEA 1TRDA 1P1MA 3ABRA 2WLZA 2OODA 4XZ9A 3FK4A 1TVNA 4NNAA 4RE0A 5BWFA 4KCUA 2C19A 4GZEA 1Q6LA 1M6JA 4ZA0A 1DVJA 3TSBA 5HJXA 1SYTA 5FSDC 5A3HA 2CXGA 1ECQA 3CTTA 4WF7A 3WMBA 1DOSA 3LOTA 3UJRA 3NZGA 1KM2A 4UTKA 4C7DA 3MCNA 4LF1A 4JTDA 1TMLA 5I09A 1E0TA 2BNJA 4KRZA 4IOTA 1JNEA 4WXYA 3NG3A 3RX4A 3A4AA 5BXPA 4HNNA 1ITCA 1IF2A 1JZ3A 1VBUA 2XIOA 3CAQA 3DHFA 4PUKA 1TCMA 3VIKA 4GMEA 3M44A 2WXDM 2YLLA 2ZA3A 3MJYA 3W38A 3TJXA 5H8PA 2EG8A 1Y8BA 4QQUA 2QDGA 2PDYA 3WJSA 1XDLA 2QS8A 3ITCA 1UWAA 3WQ6A 1BFNA 2YBTA 4FA3A 1F76A 3IVSA 2XSBA 4D1JA 2Z00A 1A3XA 1XLKA 2X0HA 4WEVX 4AY8A 1K9FA 1NU5A 2ATMA 4N4PA 1I6NA 3L21A 3VM5A 3K1GA 4JXCA 2CXEA 3B8DA 1RAKA 4UTJA 4IL2A 3VUPA 1RJPA 4O1BA 2DDXA 5D03A 1EJTC 3TW7A 3RPTA 2FKPA 4ZL1A 2DQXA 4NF7A 7REQA 3B06A 2V2HA 2QUVA 1T0OA 3H53A 1EOMA 3VIHA 3NDZA 1AFSA 3V0TA 3VKJA 3B03A 1RALA 1IZJA 1EPXA 4IP4A 1MW0A 4ZFCA 4JYEA 1AK5A 4N42A 4UCFA 4ERIA 4CD4A 1FWEC 2R82A 3PN8A 5GJNA 5A6MA 1DQUA 2ICSA 1JPMA 1NELA 1EA0A 3PUOA 4ZFMA 1KXHA 3H8AA 5JBEA 2GDQA 3JU2A 4G5DA 4UFJA 2VGIA 3STPA 4C6MA 2Q8LA 3EX2A 3MI3A 2F6KA 4LUTB 1JYXA 3U4AA 3LUTA 4NKCA 4LB4A 1WB0A 5A6JA 1EDTA 3R10A 3LM3A 1TJRA 1W9XA 3SCPA 3F2CA 4FXFA 3ZT6A 2E1DA 2VUYA 2WCGA 1W17A 2A3LA 3DFPA 4WK9A 2I5GA 2ABBA 3B97A 8XIMA 4JX6A 1QW8A 5I79A 2CBVA 2J7BA 5FEXA 2HE8A 3CO8A 1V6YA 3TP4A 5FF7A 1FUYA 1I1XA 4WY0B 3I3DA 4JDYA 4AWTA 2VC5A 5CGQA 3CLMA 2W67A 1AVAA 1MMFA 2C7FA 5T9BG 2VVSA 1BYCA 3TLQA 4CD8A 2TMDA 4ONVA 2B7OA 2BLEA 4HA1A 4ZMGA 4AZ5A 1V6XA 1OCJA 2UWFA 5BNKA 4Q7BA 1TV7A 1V79A 2OOFA 3VDGA 2V3DA 5EL1A 4MWAB 3W71A 3Q2DA 4JDBA 2Y7DA 1X6NA 2ISDA 2ZYFA 2WMIA 3UWYA 3VIGA 2Q6ZA 2NQLA 4JAWA 2Z29A 3ZJ7A 4OECA 2D0FA 1AQFA 4S3BA 3ZJ8A 4FX7A 3LHYA 1CGXA 2CCRA 3CWOX 2EKCA 4U28A 4MDPA 3MUY1 1V7AA 4DN1A 2AQVA 4Q4RA 3INPA 5DANA 1OFPA 3VIPA 5EPDA 5CKSA 4AZIA 3V16A 5A1AA 4AMAA 4S3AA 3UGVA 1A49A 4GVHA 3G8RA 1VB9A 4ZTYA 2NV1A 2OKTA 3K1DA 3G3DA 4F2BA 4JFVA 3FAWA 1U2YA 4JIEA 1ZQ5A 4HYRA 3K4DA 3P3BA 1A5OC 3HQPA 4N4QA 3ITVA 4RV3A 2VX5A 3N6JA 1Q6FA 4FK9A 3LHTA 4NHVA 4A22A 1BAGA 4E4UA 4AFYA 2GJXB 1ZJHA 1KCKA 1FDJA 3MJMA 4AEEA 1Q2SA 4K68A 2DZXA 1WV2A 3UZXA 4ADTA 3QQ1A 2ALRA 3P5YA 3U48A 1RK6A 3CC1A 4PCFA 4Q4KA 1E0WA 2P0IA 3VDCA 3IJDA 3FSUA 1ZRQA 1EJVC 2DT0A 2IKHA 1XRFA 3A3WA 3QR3A 4ICNA 4ICMA 4Q4SA 1V8EA 4O17A 2Y7EA 1D9EA 3KL0A 4FPSA 3HBLA 4LCQA 4L4MA 1EO7A 2J8FA 3KVLA 4Z1DA 4BI7A 3L2IA 5HWMA 1JUKA 3R11A 3P0WA 3CEPA 3N3TA 1U33A 1Q2RA 2FHCA 5GJMA 1Y65A 2AGTA 1XUUA 2E5BA 4HOWA 2PDHA 3H2CA 3GTXA 4C7GA 3COTA 1OEPA 1B0IA 4C90A 1TA3B 4H6QA 4QSFA 2WZMA 3WBAA 3VIIA 3NZ1A 3TX9A 4I7WA 1FH8A 4EF9A 1GG0A 1OFEA 4LX4A 4P2VA 3TUUA 1DWGM 4IJCA 1M1BA 2HMCA 1DXFA 2A3AA 5D2TA 1OBAA 3LCWA 3MMDA 3CL6A 1CB2A 4CCEA 4F3HA 3DFSA 4REQA 1Z9AA 3EPOA 1QR7A 6TAAA 3CK5A 5CPOA 4ASTA 5DBUA 3GC5A 4HJWA 1VFOA 4LUIA 1TWWA 3MU7A 4DI9A 3UY7A 3BGJA 5C2GA 1M04A 2RDTA 1PWLA 2OX1A 1W54A 4LANA 3CLWA 1EJUC 1KFCA 3KS6A 4JNZA 1FBAA 4NAEB 2Q3RA 4D6FA 1GQNA 3SCRA 2PURA 2OWCA 3W2MA 2BVYA 2WYSA 4OZOA 4XK2A 3VKKA 3NQAA 1TPVA 1V3KA 1LLWA 5LNWA 2VFHA 4Y8EA 4MNKA 3UYCA 2G4JA 2B7QA 2VI0A 4YWSA 3SY1A 4ZXLA 4LTSA 5D8WA 3UWVA 3AIBA 5LIYX 5HJYA 1UR1A 4GHRA 3GDKA 5D33A 1ITQA 1NOUA 4NXSA 3K2GA 4MIMA 2R94A 5CC7A 3TA9A 1VBGA 2VRJA 1H60A 2NVCA 4XKMA 3F5JA 3AIUA 4XB3A 4DRSA 1F73A 2E1WA 2E09A 1OJXA 4DXXA 2GWGA 2QVNA 4NYYA 4Y9OA 3QHNA 1XD1A 4UCGA 4QLLA 3MB9A 5F2LA 2OLAA 1XRVA 1GVRA 2YYTA 2NUYA 3RHGA 1YPFA 3EAUA 3KTCA 1XIFA 4CKQA 2CZFA 4IIGA 1KRBC 4HVXA 4MKVA 5PTDA 3IAQA 3BAWA 3PS7A 1UPPA 2BVWA 2J75A 5TAOA 4IIFA 1Z48A 1KQZA 4Q8QA 3SM0A 4M7SA 1MZRA 2PP3A 1VHNA 2DFAA 3GX9A 2XN0A 4NI8A 4GZIA 2GUUA 4Q6XA 1BKHA 2DT2A 2YB4A 3WH9A 5DQPA 1K8ZA 3D0CA 3W7PA 3WF0A 4D6GA 4WKHA 2ODOA 4GY7A 4IM4A 1SR9A 1F3TA 3C8FA 4H9MA 2Y5EA 1W91A 3T4WA 1CXIA 2D2JA 4R33A 1UJPA 4GRSA 1XG4A 4PUNA 4CGTA 1KFKA 1FQ0A 4MWAE 4H2CA 4AISA 2QIIA 3PY2A 2WHMA 1JDCA 2Z4GA 4ENLA 3EX6A 3MPGA 1JCNA 1JYWA 3CHEA 1JPIA 4NNCA 5AHFA 3GHUA 2ZX9A 3UA3A 4JTLA 4X61A 3ARZA 1GOKA 1JAKA 5AYYA 1H2JA 3VIMA 2GVGA 1XH0A 3SRKA 4C6OA 4WLCA 3W7QA 4WVXA 4C7FA 2NXHA 2DU2A 1R7AA 4GPNA 4NVTA 5I06A 1HKMA 4X0VA 2WB5A 3R5EA 4IHCA 3MCOA 4YWIA 3M0YA 1EJSC 3E74A 1ZJIA 1C92A 4UQEA 3K8MA 1QI2A 1R8LA 4LRTA 5FSEC 3KRZA 4WRHA 4S3FA 1HKJA 2D23A 5AKQA 3BW2A 1ZAJA 4XZBA 5A6BD 1JI1A 1ISVA 1W56A 1EUNA 1JGMA 5I2UA 2YLAA 1W1PA 2NX9A 3HG2A 4E4PA 2J7CA 1Q5MA 3KAOA 4FXJA 4GCAA 5EYWA 1L8NA 4QX4A 2DZPA 3TXZA 2VEIA 3KL5A 2O7QA 2HJPA 3LRKA 4CD5A 3EWXA 2CZ5A 1NP2A 4ZSTA 4J2MA 2OSXA 1VCVA 1ZFJA 1W0MA 3N25A 3L66A 1FWCC 1BGGA 1VAHA 3LLFA 3EB3A 3TKFA 1KC7A 2P3EA 3G0XA 3P74A 1XWYA 4GYKA 3UVIA 3IUIA 2VDIA 2RGMA 3O63A 3AC0A 3RAOA 3W2JA 1QW9A 4W7UA 2EXOA 3G1XA 1W5OA 2WC7A 4IFKA 5FJRA 3PANA 4AX6A 4S3EA 2J62A 2ZCGA 1EJWC 2X7VA 2ZZ5A 3T6CA 5GQBA 2WLYA 1CYGA 3RR1A 4HHMA 2PWGA 2BHYA 3CUHA 4TUFA 1GGOA 5ENLA 3SIZA 3FOKA 4A2RA 2OZ8A 4FX8A 3OODA 2WPGA 3HM7A 1NFGA 1JAEA 5MKGA 2J7EA 3VIJA 2I1OA 3DN5A 2X05A 1V6TA 2ADAA 4KCTA 2VP8A 4LY8A 5BYWA 4QP0A 2DIJA 2VWSA 1KV8A 1SW0A 5IHRA 2D1ZA 2DIEA 4QXIA 3G1VA 1OCNA 3EMQA 1ZBKA 4FF5A 4GWEA 1QMLA 2RDWA 3I6TA 3W86A 3WH8A 5HA7A 5CGTA 1VZWA 4TX6A 1G7UA 1PIFA 4OU1A 1V7YA 3LXAA 5TF0A 3WUFA 3WQFA 1NQKA 3WK1A 4FALA 2QJGA 1ZSXA 2FB2A 3NL3A 4MZ1A 4BKNA 3QC0A 3Q4DA 2BOFX 4AXKA 3HIJA 4I9TA 8TIMA 3WH6A 2QIWA 1OY0A 2EHHA 2XZ7A 2PGRA 2PLCA 1EBHA 4GZJA 4MMWA 3VVGA 3QHOA 1Q6GA 3VD4A 4XD4A 2XN1A 3U0HA 1WA3A 1KM3A 3N17A 3QFWA 5EFDA 2E7FA 3BW3A 1JZ6A 3NJ3A 2PA6A 1MYRA 2WKGA 1SO4A 2XH7A 2RJGA 4L6OA 1KO0A 1GQKA 4E8GA 2X2GA 1E9IA 2POZA 2Z24A 4JN7A 4LVBA 5E6ZA 3TCSA 1HJXA 1ICSA 2W66A 3L68A 4CU8A 3TYBA 1OCBA 3W7RA 4JEJA 1KBLA 1Z3NA 2DH2A 1W1IE 3AAMA 4A05A 1PTAA 2XPKA 5A2BA 4XZMX 3KZPA 4XTIA 4MZYA 1O5KA 2PDGA 3QZAA 3VMOA 1FRBA 1FWGC 1ZTVA 4DEFA 1OC6A 1PSCA 4J1OA 4MJMA 1BXCA 4X2PA 4GACA 4LEQA 2NLIA 4ZVJA 2QT3A 4PMRA 2D2HA 1KM5A 4A3RA 1LCOA 4HHHA 3W1QA 4IPIA 4MSSA 3B05A 3OU8A 2DW6A 2UY2A 1LOQA 2JF6A 1RPXA 1DXIA 5BU6A 1H62A 3GG7A 4BQ5A 4GH3A 3S83A 3DGRA 2PBGA 2QCDB 3GR8A 3T78A 2H3DA 3PG9A 4MYAA 5HMEA 5EMLA 5AHLA 1LWJA 4W86A 4NYUA 3LPGA 4AZHA 1GCYA 4DYJA 1EPVA 4DVOA 5A6TC 4KERA 2ZZ7A 2ONEA 2VFEA 4FNUA 4QDPA 1E6RA 1GVIA 3VNZA 2VL4A 1HKVA 3VOFA 3E6EA 3HF3A 4JY9A 2BGQA 3N13A 1GEQA 1V3JA 1J10A 3AYTA 4N7QA 1RP9A 1QDSA 3OVQA 5M03A 3AISA 1V93A 3URNA 3UZWA 3ZOAA 3T4CA 4UR7A 4GD0A 4CVUA 4UIOA 3RM8A 1OYAA 3WCZA 2QZRA 3EOLA 3QY6A 2E40A 3DBNA 5A2AA 3RG6A 3TE9A 2JIEA 2W91A 1TVPA 3TTYA 1VS1A 1O95A 3EDEA 2PMQA 3FYYA 4YTUA 1TR1A 2KX9A 1TTJA 1TUXA 3ORWA 4MJ2A 2A7RA 4LQ1A 1RBLA 3IJIA 3HN3A 4NY2A 5LIKX 5DFAA 1UQYA 3GR7A 3H26A 4TMCA 4NI3A 3VD7A 4BEUA 1M65A 3CZJA 4HK5A 3BJTA 4DUOA 1SFLA 5BZAA 1JYNA 1QXLA 2V0TA 5LXEA 3S6TA 1XXXA 1PX3A 3WBEA 2P88A 1XS2A 3UXKA 1U30A 3GIPA 4JQ1A 3W88A 4ZODA 2BGNE 4M29A 5KZ6A 3CUGA 3QMSA 1ME7A 4A6GA 4PUUA 4AMCA 3I7SA 1W5QA 4GJIA 4MPKA 4DBDA 4GH1A 4JICA 4O52A 5JVLA 4QEHA 2X0YA 1AD4A 1VJIA 3UNTA 1W9VA 5KETA 2GJLA 5FF2A 1QI4A 4JTEA 2GQ8A 3HG5A 2IQDA 6TIMA 1PX4A 4HNLA 1ZENA 4MKSA 3SUTA 3ZJ6A 2PLJA 3B9DA 3BE7A 5BRPA 3FDKA 1R3RA 3VCRA 3MP3A 2GJPA 2ISFA 3O6YX 4PTWA 4W85A 3U5UA 2WSKA 3LLDA 3H2MA 3NEHA 4LUTA 3UJEA 1OD0A 3APYA 4IL0A 2ZXAA 4PCTA 1EIBA 4PEEA 1RD6A 4JGDA 4GQ0A 3VNIA 2FPVA 2PP0A 1J12A 2CETA 1JD9A 3L7RA 2QEZA 4NG3A 1VR6A 3NQCA 4JTHA 4W4QA 4AD5A 2WNQA 3B8IA 3PSWA 1KWKA 1VF8A 4L6DA 5DXXA 1BPLB 4EACA 3FV9A 1ZU8A 3BAKA 3TAOA 2VR2A 2GUYA 3UERA 1KLZA 3WQWA 1E4MM 2ZZ6A 5JMUA 3ERPA 4INFA 5C70A 3U2ZA 3ATYA 5AOUA 3M1ZA 2W6RA 3PNUA 2PWFA 1VYSX 5C7HA 2Z1XA 1XLJA 4GI6A 4HSOA 1TIMA 1VJZA 8RUCA 3V7PA 1REQB 3BV4A 1M3UA 5EMMA 4OJYA 4YCPA 2VZOA 3I68A 2V82A 4AWSA 3M0KA 1FWBC 3E2VA 2V6AA 1J2WA 4MLRA 3U3HA 2PWUA 4JTFA 1EB3A 3S6OA 1UWSA 3PUEA 3NZPA 4MADA 1J18A 3NQFA 3APGA 1A5KC 4MWAA 3STCA 4ZZ9A 3BLLA 1E0VA 1NWTA 5GNXA 4GY1A 1H09A 4Z2IA 4UTLA 1H0IA 1W32A 2VEGA 4H8VA 3SGZA 3NM1A 2NUWA 1HW6A 1L6WA 1O5RA 1KCLA 3CO4A 3P8IA 1S3HA 1GW1A 1X8CA 2RHGA 3W25A 5HQMA 3BOXA 2JEQA 3BANA 3CAKA 4NT0A 2HK0A 3LD5A 1TTPA 3K5XA 1YTEA 1IE7C 4U5IA 2HVMA 4D8AA 3CV7A 1CGWA 1NF7A 1UR9A 1YBQA 2Z6IA 4XZWA 4M6PA 3RN6A 2UY5A 4MY8A 4UZSA 3A5FA 2PDKA 4U33A 2Z0IA 4E2OA 1IV8A 1W5PA 1KW1A 2GJXA 1A3WA 1F3WA 3KOXA 4MTVA 1B5TA 3W7KA 1FCVA 1UWTA 4URIA 1PZ1A 3L5MA 5C2CA 4JFWA 1KRMA 1XIMA 3WQEA 1HKKA 1W5MA 5C9ZA 5BOEA 3ZR5A 4XAGA 3G1FA 3RRXA 3IV8A 3MBFA 1VFMA 2L5HA 3GUWA 2VUNA 2E9LA 3WLLA 4NJJA 4M6UA 2VX4A 3FY1A 3T81A 1ZBCA 4ACZB 2PWEA 1QI5A 1CIUA 3UR8A 3CUZA 3LCGA 2DT1A 4JYDA 4GQBA 1HXJA 3QV8A 5AFDA 3ES8A 4CD7A 3TTEA 3EYPA 4QJ3B 3W7CA 3KBJA 2FPTA 1UWIA 4JKLA 2V9DA 5DRIA 2G95A 1W8SA 3ZS4A 1I2NA 3PTQA 3W1RA 4FAMA 3M0HA 1TA3A 1GORA 2PDMA 3UJ2A 1TCDA 1EWDA 2IXUA 5EMYA 3H23A 4IQJA 5CG0A 1GHRA 1CGTA 1PIIA 2FMOA 3EPNA 3GFYA 3W28A 1QOQA 2YJQA 3UVAA 5AYIA 4O10A 3WKZA 5CZJA 5CZ0A 2A6LA 3AS2A 4IPPA 4L9YA 2WNWA 3FX4A 1QO5A 5FD0A 1R85A 3RJYA 1W3LA 5FEPA 4K36A 4PUMA 3UY8A 4KEVA 2BWGA 2QR6A 5JUVA 2XG9A 2Y8UA 1J2BA 3W2KA 3WFAA 3TSDA 3WDIA 2ZADA 4LT9A 4NUWA 2ZFAA 3PG8A 3AROA 4MWAC 1H7WA 4ZQNA 3UBPC 3S3GA 4AXNA 1EYWA 4NAEA 3PZVA 2ZXQA 3TEVA 1EGMA 1D2KA 1VBJA 3E49A 3SADA 1FWSA 5FI8A 1L0PA 2HS6A 3R89A 3FN9A 1YKWA 3O6CA 3P60A 1N8WA 2WSRA 4QJ5B 4QDMA 4JIRA 3VC5A 1QT1A 2Z2AA 2I16A 1DE6A 3LSBA 1U1HA 2P8BA 4NQ1A 1Z44A 3QR0A 5HUPA 1DKWA 3HGOA 4OTKA 2HBVA 2VEKA 7A3HA 2VHLA 1YNPA 5D32A 1QBAA 3T8LA 1ISZA 2G3JA 1S2VA 4E4FA 4O14A 1Q45A 3W7JA 3GLCA 1M01A 1FCQA 5HULA 4W84A 3WL0A 1E6QM 2ZICA 1XGZA 3PK7A 1J0KA 1JVNA 2EPKX 1A5UA 3BJFA 3HPFA 3BL3A 4FXRA 1MZHA 3GH4A 4CNTA 1JZ2A 1RLCL 3WF2A 4AEOA 5M5DA 1I45A 1VD6A 4EKJA 4FB7A 4PA8A 3E12A 5I3DA 2WBGA 2CBJA 2DZWA 4TV6A 2AL1A 1H1NA 1UWRA 2HROA 3RX3A 1UD3A 2ACQA 1UC5A 1XHGA 1KTNA 1D7FA 1SO5A 1XH2A 2Y1HA 3OGSA 4CNNA 4M8UA 3UCQA 5LIWX 3BQ5A 5AC6A 2QMKA 4H8HA 2W61A 5HMDA 4LYPA 3SUVA 4JY8A 4DLFA 3A64A 2EAWA 5ECVA 3LENA 1OFOA 3WDHA 1TPC1 3DFHA 3ONBA 4O50A 3S1UA 2HQAA 2P0OA 4QROA 1M53A 1I0BA 2YXXA 4YL2A 3NM3A 3IARA 4O16A 4R85A 3F2DA 2XVLA 4O1EA 5I7GA 2GSJA 1EQPA 5G2WA 4NX0A 3UT0A 2VT0A 2YCIX 2X2YA 4UQ9A 4GINA 5I00A 4N9DA 4WDUA 1LBFA 2OXNA 3CQ0A 3V0SA 3PULA 1JL8A 4ZB5A 2J66A 2PWHA 1JGIA 4XTDA 3SRHA 1GEHA 2W27A 4HTBA 4K38A 1LOSA 2DVXA 4WZHA 3RU8X 1DEDA 3AHYA 4D2JA 1OFAA 4UTTC 1W3JA 2A6NA 2DH3A 1HL2A 4PB5A 1QOPA 3TYAA 3FVDA 4ZR8A 3PZTA 4LEFA 3POCA 2GPTA 3G77A 3N2BA 1SJAA 3RMJA 1LWHA 3THUA 4TXEA 3QLLA 3PBYA 3Q67A 3GTIA 3E0VA 4M7TA 3WQ5A 4D6IA 3BSGA 1PV8A 3EBVA 3NQGA 1YE6A 1GYNA 5CAHA 2VC9A 4M1RA 3ANVA 1HTIA 1MDLA 4H9VA 2QQ6A 2PDCA 2EEXA 4WKAA 4BI5A 1TV3A 2CNCA 5FAGA 2F7FA 2Y8VA 1ZPTA 2YL6A 3JZUA 3WNMA 3PZNA 2VOMA 1CLKA 4F48A 1HGYA 3AS3A 4O0ZA 3N14A 1FWNA 1J0JA 4IJRA 5CPTA 1CX9A 5HXMA 2JFEX 5BXTA 2F61A 5CPSA 1EJXC 2E0PA 2OFJA 4C1NB 4JTGA 4R9XA 4OV9A 2DEPA 3OLDA 5FF0A 3GAKA 4NZ3A 1B3XA 3A13A 1G4EA 4Q4PA 3HQNA 3KCLA 2DZBA 4AVNA 1KR1A 3TH6A 4L56A 4NILA 4NAFB 1K7EA 2VFIA 3H2OA 3A3XA 1FTXA 4OUEA 1SSGA 2JGYA 1EUAA 5FF3A 3UG8A 3GZAA 3AU2A 2WNZA 4RDZA 3VMNA 4C6JA 4ORMA 1LM1A 3TIMA 1QFEA 3CASA 4JTSA 1GHSA 3I4EA 3TU9A 4V1YA 1NVMA 5LNSA 3HGRA 3VIOA 4IICA 5CSUA 1E3XA 4HPHA 2XGZA 3W1XA 1JRBA 4OVXA 3QR1A 3CV2A 4AZGA 4ZENA 2GOKA 3DHUA 4ZQMA 3L4ZA 1BG4A 3EMZA 4LS1A 1I4NA 4A21A 1C93A 2INEA 2WVVB 3AYVA 3ARWA 3VNMA 1XDJA 1FCBA 3WIJA 4MUPA 1CB7B 4UFHA 1O7AA 4KIEA 5EBUA 2WSYA 1R3YA 3LA4A 4BQ3A 1WBJA 2H8ZA 4C6IA 2Y24A 3OG2A 2OOGA 3PJUA 2WZTA 3CT2A 1RLDA 2Z1KA 4KMQA 2BHUA 3KX6A 4B90A 4NIRA 2D20A 1WAUA 2EO7A 2PC4A 1WZMA 1G0CA 2OSYA 4M1BA 4IMFA 3QKZA 4O19A 1GWJA 1AQMA 3C86A 1JPKA 4MDOA 4GABA 3DG6A 4LUYA 2DZAA 1KRAC 4XO7A 1DJYA 3MA8A 4D6EA 3L0NA 3VX0A 5LNUA 3PAJA 1HZYA 4PUEA 3ZYZA 1LWIA 2C13A 1J0HA 1SFSA 1TPB1 3PZIA 1O68A 4OOUA 1A4MA 4F0MA 4D6DA 1B57A 2VEMA 4DX3A 3K4AA 3F4WA 2NQJA 4UXDA 3NQBA 1TRIA 2Q02A 3IJLA 4GBUA 1P6WA 4BF7A 3WLNA 4A8IA 2DIKA 3VX1A 2PC8A 3N19B 3F4VA 3GAYA 4WOQA 4J3SA 4QFUA 1M7OA 3FNDA 2CZEA 5A69A 3A21A 1JIBA 3BMWA 3SFWA 3S46A 4JKMA 4S2BA 4WSKA 3WK2A 1JZ5A 4Q8VA 3MYPA 1S2AA 3A6OA 1W1YA 4GQGA 3CXOA 2Y8KA 3WMLA 1VPYA 4G8TA 5CBJA 2WSQA 4HCDA 3V4BA 1PWMA 3QGKC 2WMKA 1UC4A 1F8IA 4R53A 2VCBA 1TVLA 1AD1A 1EF3A 1ITUA 3TSMA 1BWVA 3BG3A 4C6NA 3LCXA 2HPMA 5EFFA 3U7BA 3UPBA 3JUGA 1XGEA 1R9YA 1R6WA 2GGHA 5KEZA 1X98A 3G0SA 1DQWA 3GXDA 3B4YA 2VZSA 4L7ZA 3PNZA 3OIHA 1D8WA 2BBFA 1ODZA 1EJRC 1GOOA 4PULA 5CG7A 1PX8A 3P84A 1PDYA 2VRQA 3SDOA 3H21A 4A29A 5LZLA 1XICA 1ZAHA 4CEXC 1QNRA 3UG3A 2ZXDA 5EMUA 4UNIA 3N9SA 1R0MA 2ZZ3A 3IIOA 1JEZA 1H0GA 2WMGA 3GXMA 3BC9A 2ZZ1A 3MHFA 3LZ5A 1U83A 1O1ZA 4O8AA 4QNWA 1ZHAA 1X97A 4RDVA 2E5CA 5CZTA 4XO6A 4YIWA 1RCOB 1IXPA 2GGGA 2XZ9A 3IJ7A 3OZMA 3TC7A 3ABSA 4Q22A 4E8DA 3W07A 1MSSA 1R47A 4I8DA 1UA3A 3DCPA 3T1GA 2PEVA 1NQ6A 2WO5A 1V0NA 3NPXA 4I6KA 2C91A 3I7QA 4GQQA 5CEWA 3QGAC 5DN1A 4PCSA 3GO2A 4TOQA 2JKPA 1KFJA 5AVNA 1BRLB 4B5TA 4KGJA 1HKIA 2GYIA 3NIYA 3KWSA 1XIHA 2J88A 2ON3A 3RITA 2ISVA 5HQEA 1OFQA 3EA3A 3GM8A 3LYEA 2REQB 2J78A 2VFFA 2QCMA 4GFIA 4FEZA 2FH6A 2EBNA 3W22A 3AOFA 2PUZA 4YS1A 3HV9A 5E93A 1YX1A 2HV5A 2PZNA 4W9TA 4C1KA 2HVNA 5HNNA 4GA8A 1V4YA 3P81A 4M19A 3N4FA 5EMJA 4M24A 1BSIA 4ZQOA 2O7SA 9XIAA 2CLKA 4AYGA 1ML1A 7REQB 2HE5A 3TR9A 1FWTA 3FYOA 3GK0A 1WUEA 2PU1A 3LTYA 3SCNA 4E2DA 1UMLA 3PSVA 1P0BA 1DIDA 2F9RA 4EP8C 1MQPA 4DO6A 3OPSA 3BAJA 2I56A 1GYMA 1ADOA 4BWLA 4JX4A 2YKKA 4IUGA 3M7WA 3N04A 1LLZA 1Q4WA 3GZ3A 5ABTA 3HURA 5ABHA 1KFEA 2J24A 3H55A 3L2LA 2YW3A 4WGXA 3P67A 3S8HA 1RK5A 1LUCB 3IUHA 3IGXA 2V3EA 4UTUA 2P10A 1OX5A 2G4FA 3SW6A 5DF0A 3L4UA 3P5ZA 4HPJA 4AHOA 2GDVA 1Q6QA 1EP2A 1UWQA 1XBYA 2ZVRA 3O7UA 4WY0F 2YGYA 1W3IA 4CU7A 5JIWA 3DG3A 3DKLA 3E9AA 5LGXA 4C5ZA 4P8XA 3IACA 4QITA 5C55A 3NCOA 3BMVA 2J8GA 3WQGA 3IJQA 1NH6A 5BROA 3N3MA 3SFKA 4DBWA 1KFBA 1UKSA 3LRLA 4JTKA 2QV5A 3BZGA 4Q8MA 3L9CA 4HYVA 2J79A 1TJ1A 4FLOA 3AWNA 3SURA 4C6BA 2QCEA 2QAFA 2HISA 2RAGA 1C8QA 3PZ9A 1AZ2A 1REQA 4HCLA 4DJFA 1WOAA 4JQ2A 3FYPA 1H11A 1H5VA 3KE0A 4UBPC 2ACUA 4O1FA 3UU0A 4B9ZA 3DERA 1QNOA 1HP4A 2DSVA 2E25A 5C0QA 4QQ3A 3W74A 1Q7ZA 4DLMA 4V28A 3RPMA 3A9BA 3E5PA 4AX7A 4MFEA 2CLIA 2QJHA 1TR9A 1MQRA 1PCWA 4JHOA 5A6KA 3OLGA 4A35A 5IDZA 1FWIC 4YYFA 3WQ4A 3OYXA 3WUBA 1VCFA 3HB9A 4V2XA 1S1RA 2VGFA 4DM2A 4FNSA 3WLSA 4KT2A 1K4GA 3KDOA 3VZZA 4RCXA 5F4SA 4BZYA 2CFFA 4F0LA 4HYWA 3T8QA 1RA5A 5CJ5A 1PPIA 1W1B1 3T0DA 1WUFA 3ARRA 3KBWA 4RNIA 3HFTA 1PE1A 2J7HA 2E3ZA 4AIEA 3IV3A 2C0AA 2BB0A 4EVZA 5FCZA 5K9CA 4IPJA 3GNDA 1HN1A 1Q4NX 2DGAA 3VKBA 2JKEA 2CESA 2PDPA 3IJ8A 3LPFA 4Y6GA 4M82A 4CNSA 3NQEA 1BVZA 5BW6A 1UH4A 1BG9A 3BQ6A 1NDYA 4UQDA 2EGZA 1UP0A 4DJED 4BWLC 4E0CA 3TW9A 3S2LA 3N6HA 5I6SA 1UD4A 2HTMA 2B0MA 1SR0A 3IK4A 3CH9A 2H90A 3QMTA 2PU0A 1KXQA 4MNJA 5I24A 1P48A 3D5HA 4ACZA 2H6RA 3TJIA 4OIFA 1BWLA 2B81A 3MWCA 4OBTA 4AG0A 3BAXA 1WCGA 3QW4B 4GGBA 4RJEA 3S5SA 5E0FA 1KBKA 4OOZA 4EPEC 2C1HA 1R2RA 3QKEA 3HZ3A 5LXXA 2ZRZA 1EQCA 4W8LA 4Z17A 4F9JA 3RK8A 4LY4A 1OD8A 4D6JA 2P76A 5KZDA 1WQ5A 4UMCA 1Y0EA 4FSAA 1J6PA 1ZUAX 2PGWA 2ACRA 3HGJA 2VVNA 4DF1A 2CBUA 2F6XA 3QVQA 4ATLA 2PD9A 3NTYA 3OVGA 3BURA 4S3DA 1TWDA 3VNLA 4D6HA 1JYVA 3ZLFA 2BVTA 4HTYA 3P0XA 1IWPA 5LYRA 4LV9A 5F2IA 2O4MA 2Z25A 4ACYA 4V15A 4FO4A 1EXBA 2WM0A 3WMCA 1XLEA 1PYMA 2DQWA 4DF0A 1MXSA 2A4AA 4Q4OA 3LPOA 2QF8A 2I14A 4GYPA 3MANA 1FDYA 1JZ8A 5ABEA 1VFSA 2WV8A 4Q7IA 1OF8A 4N02A 4PZVA 3NVTA 1ZL1A 4L1XA 1G4SA 1JG9A 1TJPA 1JXKA 3C6CA 1OT1A 3GVVA 3NUKA 1J0IA 5AY7A 3WNOA 3DZ1A 1R46A 2XWEA 2EG7A 4E3TA 4PMOA 1SMDA 3BLPX 1E72M 1EJ7L 3LCHA 1FWAC 4RX0A 2W63A 2W92A 1EBGA 3C2FA 5F1VA 5LA0A 1OT2A 4Z2GA 1L8PA 3F7JA 1B4KA 2J7FA 1H63A 1E56A 2FDMA 5C9WA 3GU9A 2I5IA 1YPXA 2FQIA 1RCXB 1WDPA 4BQ4A 1R2TA 2PTDA 1OK4A 3OB8A 4O1CA 1LL7A 5G1YA 2AKMA 1FP8A 5DELA 1FHUA 3AYSA 4F8XA 1WXJA 1PKLA 4QG6A 3WBXA 2VZUA 1POJA 1TZ9A 1XLGA 1CECA 3BLKA 3W7DA 5D04C 1S2WA 1I2RA 4FNQA 1F9CA 4HZ7A 4DO4A 4AWEA 3SGGA 3ZT7A 1QUMA 3P62A 3KEHA 4WR3A 2CHRA 2PBOA 1J93A 3LRMA 1WP6A 1C90A 3M9YA 3MMTA 3W1AA 2A21A 3NO1A 4JX5A 4GUHA 2X42A 2R6OA 4LSBA 3EWBX 3IRSA 3MDUA 1IHIA 1A0EA 4US5A 1D3CA 2VURA 3EB4A 1QCWA 4RE3A 3VD5A 2OQYA 5AYZA 1CGVA 4H41A 1I2QA 2A5HA 2I5QA 3MBDA 2FJUB 3O16A 1VRXA 3M5ZA 1XR2A 3OQ8A 4UMAA 3W7GA 4IF2A 1IWBA 1MW2A 3R79A 1DXEA 5CPQA 5G1TA 5HMSA 4EF8A 4CLMA 3EMCA 1VPQA 3QBUA 3CIXA 4PUDA 1J11A 5CSYA 4ZO7A 3LNPA 1JNDA 2JEPA 1P0EA 3A4JA 4JKKA 2PGFA 3WSUA 1CGYA 4JQ3A 3PBUA 1VLIA 3M07A 1PB0A 2OT1A 5CJNA 1PIGA 4L5ZA 1T7LA 1EDGA 3BK0A 1JPHA 1NOWA 4XWUA 1M7JA 1L6FA 3B9OA 4HMNA 3SSJA 4ZO8A 3UESA 5A8GA 3NQMA 5E0CA 4ZB0A 3UXDA 4GYPC 1QK0A 3LZ3A 3O1NA 3QF0A 5LHEA 1UKTA 2YR1A 3L65A 1D3GA 1MNSA 3GHTA 1T6MA 1O1HA 1XX1A 3GBDA 3AXIA 4JTTA 2OO6A 4I9JA 2QDHA 3BARA 1THFD 2J9XA 3KVJA 1FWFC 3H7RA 3QFEA 2PPGA 3TQVA 1HIZA 3ARTA 3THAA 3HMJG 3U7VA 9CGTA 5FJUA 5FJTA 1P7TA 2FH8A 2NT0A 1DP0A 1GJWA 1V5XA 1GOIA 5I77A 2B31A 5IFPA 4N0RA 4PTXA 3VINA 4JEQA 4LVGA 2E4TA 5I0DA 3OQEA 3LEPA 3PUDA 4R9OA 3SZ8A 2VYOA 3BGGA 6REQB 4H8NA 2Y88A 4MB1A 4DZHA 2IQ0A 4HPNA 5FKYA 4LAMA 2OX4A 3MP5A 4H9YA 3GXPA 1WE5A 1A0CA 2VKZG 4WDTA 3HPSA 1S39A 1UP2A 4C1NA 1BQCA 4F4RA 3W1TA 3WJWA 2ZX5A 1LTDA 2YX0A 4US6A 1LJYA 5DY3A 1FKXA 3RM9A 4JTUA 4NAFA 3W27A 1VFHA 4WJEA 1J5SA 3DXIA 4B2DD 2WBKA 3VMPA 1VEPA 4W88A 3E5BA 3U2CA 3PZUA 1S5NA 5I02A 3KHDA 1H49A 3HU7A 3EGJA 3EEZA 5I3KA 2FTWA 2JF7A 3KL3A 4ZO6A 1B31A 2UZ9A 3DECA 5CSRA 3DH7A 3R6IA 1MW3A 3AMDA 1GG1A 3VK5A 2OZ0A 2VDHA 1UIPA 4HK6A 2YCLB 3T2PA 3UWZA 2VC6A 4EPBC 1Y5XA 2PDBA 3M7SA 3Q37A 3CM4A 1E1FA 4MWAD 2WVVA 1UZ4A 1IWAA 5G4HC 5L6UA 4GBDA 2XH0A 3VOCA 1FA2A 2IUZA 4JIHA 3WMSA 2AOSA 3T0AA 2VR5A 5E70A 4PMDA 3LU2A 3TW6A 4XUGA 1XIEA 4PTMA 4RR4A 3WLTA 3B8WA 1TMQA 7PTDA 3GNNA 2UY4A 4QE4A 4G1KA 2OWXA 3PZOA 1V0MA 3MMWA 4F0SA 4MM1A 3UW6A 4XZLX 2GDUA 4JCLA 4FR1A 2FGZA 4O18A 4MOZA 4QJ1A 1V3LA 4OFCA 1OVDA 3W24A 1WDDA 1UMYA 1Z69A 4DO5A 3OVPA 4ES4A 4LS2A 3O8AA 1BGAA 2GFTA 4BR1A 3W3OA 3DOPA 1P0DA 3AJ7A 1YXDA 4RW5A 3GBEA 2VZVA 4OV4A 2QPXA 3AI0A 3PP7A 2QKFA 1O60A 1GVQA 3TN4A 4XIAA 3VKCA 1KM0A 1EKOA 3W00A 3JZEA 2A7PA 3K13A 5EGRA 3ABZA 1AMYA 1V08A 1XF0A 1EH9A 4HJFA 3U4FA 3FSTA 1A0DA 3ZWSA 3V1PA 1JQXA 1TQJA 1R5YA 3DHDA 3RXZA 4AC1X 2PGEA 4KWUA 1US2A 4DWDA 4ADSA 2YB1A 2W79A 3B0UX 4QISA 4XZIA 4GE8A 1W9DM 3QLDA 2R8WA 4K37A 4XISA 3BSMA 5CPMA 4I7VA 4PTVA 1CLXA 4HQVA 1TWZA 4HPGA 4DM1A 1GJPA 3WLOA 3PVFA 1C8VA 3UZYA 3NO3A 3II1A 4EIVA 3I3EA 1MUWA 3TTOA 3WZ0E 2VENA 5AC7A 3KBNA 1XP3A 4O4WA 1SPQA 1R3TA 5FA5A 3H24A 3T40A 2IKIA 4DBUA 4XZNX 3C2RA 1W5NA 1OFDA 3HG4A 4BK9A 1V6VA 1FKWA 1YADA 5IBXC 1TB3A 4WDXA 3ICJA 3G24A 4C65A 5LSMA 5HWJA 2A1YA 3WJZA 2XIMA 2C15A 2D3LA 3GIYA 4OBSA 1F8MA 3DAQA 2J47A 4R5EA 4TQTA 1KCXA 4ILSA 1XIBA 1FDZA 4UNKA 1OK6A 2BG5A 4UFKA 5HJLA 4GGHA 3DC8A 2H8XA 1E1CA 3SECA 1NIUA 5E1QA 5BU9A 3B8SA 3M0ZA 2C79A 3IAPA 3THQA 3CMGA 1PHWA 3M0JA 4TU1A 1V03A 2J6VA 3IJ6A 3QN3A 3WLQA 1X7FA 1GW9A 3BG9A 3LLXA 3CQIA 1JUEA 1CXHA 3KRUA 4IP7A 3FGCB 1AMKA 4HNTA 2QGYA 3KOZA 1G4TA 3QYQA 1OADA 1DBTA 4M0XA 4E3VA 2QHAA 4FOJA 1XM3A 1QJWA 4XV0A 5F1UA 2A3BA 3ME3A 3VUSA 3DHPA 1E55A 2YL9A 4PBFA 5HOSA 1T99A 1TQXA 1BRLA 4PRRA 4W7VA 1M68A 1SMAA 1XINA 4CEUC 4GNVA 5HR7A 5JBDA 1BD0A 3QV7A 4W5UA 3VDBA 2X7WA 3NR0A 4P8WA 1A3HA 2REQA 4U3CA 3T08A 1VCGA 4LWWA 1YDVA 1MXDA 2FVMA 3QPYA 1X7IA 3BUVA 4KS0A 1DYSA 3MZNA 2ZBTA 3NAVA 3AQUA 3M46A 3EWZA 2NWRA 2P1FA 3G18A 2FHBA 4OHQA 1RQHA 1Z89A 3D3AA 4J3ZA 1VENA 4DQWA 4TVCA 3APTA 4EWJA 3PBWA 2ZTKA 3CL7A 3W75A 1EZ2A 3OTRA 1FH7A 3OHIA 1F3EA 4Q3MA 4JHMA 3DI1A 3LBMA 3CPUA 3LGDA 3LGGA 3OP2A 2B4GA 4GIEA 2FVKA 1LUCA 2WQDA 1QATA 4P7NA 4Q8NA 2KAUC 5A8QA 3ZSTA 3NXLA 2XIQA 4GISA 1UUMA 3UCCA 1Q8JA 1DJHA 1YHTA 8XIAA 1RCQA 1BYBA 4HHPA 3TQKA 3QV9A 4G7EB 2CHNA 1OX6A 3BWWA 2XVGA 3EWCA 3D47A 3OVRA 2NSXA 4YTSA 3GS6A 1XLFA 3KUMA 3MTWA 1OX4B 4LBSA 3WL1A 3SJ3A 5EY5A 5JIPA 1L6YA 2Y61A 5LKYA 4JYFA 2D2OA 1PYFA 2TSYA 4UOQA 1L6GA 1XW8A 3M47A 3ABXA 4RE2A 4F0HA 4FLRA 1W1VA 3EKLA 2ZA1A 4FOUA 1BXBA 5A95A 1ICQA 2PFHA 3ABOA 4UR9A 4PYSA 4JIQA 1G69A 4ICCX 4ZBCA 3PPCA 2Z1WA 3S5OA 4ZB2A 5AYXA 1TZ7A 4BY3A 1TO3A 3CYJA 4KPLA 3RLUA 2DJLA 2QW5A 3BVJA 1LBMA 2PDUA 3SY8A 4LS0A 3G8EA 4A3QA 3UG5A 1VLWA 3LERA 4C6DA 4C6PA 1WNOA 2GQ9A 3BOLA 2PDFA 3PJXA 3RGTA 2Q3OA 3FJ6A 1ZAIA 5KINA 3UGRA 2OCZA 5K9XA 4OWGA 3LS9A 1J6OA 3LV6A 1UW9A 5E6YA 6CGTA 5HQLA 1XSJA 1NTHA 3ZR6A 3R12A 3N2MA 4H83A 3I4KA 4AD3A 1CW2A 4J5NA 1PL9A 4KEMA 1JDAA 4POCA 1ZP3A 3RO8A 2R1KA 3UWWA 4AQLA 5T26A 1YQ2A 2D2GA 2OZTA 1RUSA 2BY1A 3NSNA 4HSHA 2ZWYA 2WKLA 5L9FA 1CT5A 4ZQCA 4GQRA 1LL6A 1QPQA 3DEQA 3WG6A 4DNHA 3QJAA 3NPVA 1YBQB 1KWGA 1QNVA 3Q94A 2C71A 4EX4A 1J8VA 4K3ZA 1OB0A 5D8ZA 4ADUA 2DW7A 3ITTA 4MYXA 1TX2A 4F79A 5A6BA 3WLJA 5K4XA 2PRLA 1EEPA 1Q6CA 3UD6A 4IPLA 1X1OA 3QZEA 3NQ2A 1E73M 2F8QA 2YDAA 3LDVA 3VGDA 2OPJA 4YJ5A 5HPCA 3T2OA 3GDRA 2O92A 3W72A 1B2YA 3MDWA 1KM4A 3EXTA 1SVDA 2BOEX 2F84A 4GOAA 3TTSA 3N12A 2YIHA 1EX5A 1VPXA 2QUNA 3E1F1 1GQLA 2WOQA 4W8AA 5A2CA 3GNXA 1RH9A 4AZ6A 4CN4A 3B3DA 4TO8A 3R94A 3KFTA 5LA2A 2PDIA 1HQTA 2INZA 2XINA 5TIMA 1JCXA 3OZOA 3S2JA 2DZSA 2VFDA 3AS1A 2PDLA 4JTCA 1QNSA 3CUFA 4IZGA 5D09A 3LM7A 3VI2A 1L2QA 3BW4A 3WJYA 1NDWA 1RY8A 1I8JA 4H3DA 3AHXA 3FDGA 4I5XA 3CT7A 1W3HA 3AHVA 4QE5A 2XM2A 1A5NC 3F4DA 3NFUA 4WSHA 4ZCWA 4M3PA 4H6KA 1H50A 4MGGA 5D9NA 2C1IA 4YLWA 1KGXA 4PE8A 4EANA 1AZ1A 3S1WA 2QNEA 3QZ6A 4E2VA 1B3YA 1E5JA 3B9EA 3AWOA 1YMYA 3W85A 3VXGA 3GFXA 3C61A 4C6QA 1HG3A 3G3MA 1XLBA 2EG6A 3S2CA 3BOFA 5REQB 1P0NA 3PZMA 6ENLA 2C6QA 1V0KA 4TTUA 3LCIA 5U7SA 2VEPA 4L4PA 1IXOA 2ZRUA 3KOWA 1H1ZA 1XCWA 4V27A 3CL8A 3F03K 3DFNA 2P5NA 1ZS2A 2X0SA 2XU2A 2Z6JA 4PBEA 1OGGA 4Z1AA 1KFLA 4YTQA 1OIMA 5DT7A 4G9PA 3A24A 2GJRA 4N2YA 1UIOA 4BJHA 1OWQA 4HK7A 4GVGA 4O57A 4HU8A 1SZGA 1Z6KA 2JGQA 2OSWA 3DYMA 5D9PA 3FEMA 4S39A 1HL8A 1DJXA 3N9KA 3WF4A 1ZBVA 3AMKA 1S5VA 2DP3A 4GI8A 4QNEA 5M2FX 4O1DA 1YDOA 3LXBA 1PBGA 4I90A 1GVEA 4PMJA 1GOQA 4RPPA 2JKAA 2HEJA 4PMYA 4UOZA 4JFUA 1R3VA 1PZ0A 4KF1A 4RDWA 1BTMA 2X40A 1W1ZA 3QOMA 3TDFA 3CWNA 4DPQA 1VP5A 3UXIA 2V69A 3RLVA 4ZEPA 2DT3A 5C2XA 4H19A 5C8BB 2WJFA 2NXGA 3ID7A 3TJ4A 3WLRA 3GC4A 4H01A 2ZWZA 1WDQA 5FEZA 3URQA 1U1JA 2IW0A 3B0XA 4Q32A 2EPNA 2RJHA 1K7XA 1RR2A 5A6LA 3TROA 1MW1A 1Z42A 4OBRA 3NEVA 4GFSA 2CBIA 1NFPA 3S5ZA 3OBEA 1Q3NA 1XLLA 1W9BM 5I78A 1UJQA 1XKYA 1XYZA 2BTMA 4DUWA 4IFOA 3SO7A 1QPNA 1SGJA 5FAJA 2TPSA 3GDTA 1EZWA 1TPH1 3AIVA 1AL8A 4KIRA 3URBA 1FCUA 2QVHA 3F4CA 4AZ7A 3P2VA 3SIMA 3SGUA 1OIFA 4C6FA 1G9HA 1KD0A 2YCEA 2XIJA 1W3KA 3GNRA 5IDIA 2ZKMX 4HMDA 3LCFA 3S1VA 2R91A 4Q4QA 4DELA 2WVUA 5BRBA 4PODA 5AB3A 2YOCA 3EOOA 5AC8A 2BY2A 1UD8A 1XLAA 1YTKA 3KBMA 3IK2A 2OYMA 4PRWA 2EPOA 5HPOA 2ZQ0A 3ES7A 2O9RA 4JIPA 1SW7A 3E2QA 4PH6A 3NOEA 1D3HA 6PTDA 5FESA 1K1DA 5C9XA 2PCQA 4GIYA 2D73A 2FB3A 4ZQPA 1UH3A 2YXOA 3N15A 3DG7A 4XSLA 4QG9A 2C18A 2JE8A 1O4UA 3SCTA 2QCNA 1EHNA 1IZCA 4K6AA 4HOXA 5EA9A 3J7HA 4LBUA 3HG3A 4PB3A 4HA0A 1PTDA 1A4LA 4BI6A 5BRQA 1IR1A 1E4IA 3NGFA 3NQ7A 3GUGA 4Z2JA 1FY6A 1W31A 4HMCA 1GNXA 3THDA 1W3TA 2YW4A 7XIMA 5FJIA 3XIMA 4UB9A 2G41A 1X6UA 6REQA 3GXIA 4KWOA 4UFLA 3UR5A 4NX5A 4A3HA 2XISA 3ZVHA 1KM6A 2GQAA 1EEXA 2ZOXA 4PN2A 2DUZA 3P61A 4PL1A 1FFRA 1NDZA 3SR7A 4EE9A 4AVOA 2J6XA 1H7NA 2FDSA 1F05A 5M3WA 3VGGA 2RUSA 3M5XA 4QSHA 3PB2A 5CC5A 3RX2A 1UASA 1HO4A 4R7JA 1A5MC 1U22A 3P14A 1OYBA 1JCLA 2OEMA 4ZOBA 4PMZA 4RKAA 4GNKB 7ENLA 3ZT5A 2A3EA 4MB3A 1MEIA 2QCLA 1WAWA 3PWAA 2X09A 3ABQA 4IMDA 5AHMA 2SFPA 3KWXA 2DY3A 2OLSA 1G67A 1YW1A 3TFCA 5JBFA 5CJMA 4QIUA 4AWUA 3BCJA 3R2GA 4UQBA 4P7LA 1QWKA 1O94A 3NSXA 2NQ5A 2YCLA 3GG8A 1B3OA 3M0IA 1XFCA 3CU2A 4D9PA 4NXKA 1W6TA 3U2OA 3CB8A 1FHVA 3WFLA 3W1UA 2C14A 3L0GA 3K30A 4KQNA 2ESCA 1SQ7A 5CPLA 4MG4A 3O2LA 1VGAA 3TYCA 1GOXA 3DKJA 3MWAA 5HINA 3TWAA 2ZX6A 4O28A 1PJ9A 3GG0A 2J9YA 4RNJA 3VE7A 1W9PA 5GNZA 3GTNA 3UJSA 1XIIA 3CGTA 3A3HA 1X38A 2H3BA 2WANA 2Y62A 3KTXA 3BICA 1HJSA 4GY0A 4K7VA 3DFOA 1OYCA 3A5VA 4NJKA 1CPUA 1E9LA 1AW1A 3FXYA 2WK2A 3MV11 5I3HA 4F0RA 1KGUA 1AJ2A 4WUIA 4M56A 2YCKX 5G4WA 4BF9A 4AYSA 1E15A 4KFPA 3ITGA 1E6NA 1UCWA 3S5NA 2DZTA 2QLYA 5HNUA 2FZNA 3FVMA 4LAOA 4C6KA 3GFZA 2ZRVA 2FIQA 2WZEA 3E2SA 3HOJA 5A6SA 3DUGA 5EBAA 1O12A 2FLIA 4CNPA 3LXCA 1JUBA 5AHEA 3SCWA 1GPFA 4HT3A 2YXGA 2JIWA 4FI4A 3MQTA 3VNKA 2W3ZA 3KOFA 9RUBA 1UOZA 4P7QA 4J7RA 2WJDA 1BQGA 3FFSA 3LMZA 2ZVIA 3WQOA 1V3MA 5CLTA 4BS0A 4JR5A 1LQ0A 1IQ8A 1PKNA 1X96A 1XYFA 5JXQA 1M9HA 1E9ZB 2Z2UA 2X16A 3BH4A 1IXQA 1AG1O 1XUZA 2FTYA 3GW3A 1AH4A 2NT1A 5CC6A 3JW7A 1FXQA 1KXTA 3PHAA 2NX3A 4D71A 3IUDA 2PDWA 1DIKA 1VIWA 4G1NA 4WJ8A 1A5AA 3LHZA 5HMFA 4IIBA 1HO1A 4J28A 3UCDA 4DYEA 4D8ZA 3WDPP 1UOKA 3KVMA 3V3WA 3FKKA 3WNNA 1R30A 3TYUA 2E6YA 4WOZA 2YL5A 3BGAA 1E9YB 5D2VA 4CQAA 2XSXA 3E3HA 2NUXA 2BHZA 1M5WA 1E70M 2P3ZA 1I2OA 3B8TA 1R2SA 4D1IA 4JTJA 3ZQ9A 2GGJA 2NSOA 3WX7A 3W02A 2W5FA 4QE1A 3GC2A 4HZMA 4B5XA 4FX6M 4A4AA 1YDYA 2VQTA 3R58A 7TAAA 1TV5A 2WZIA 4KW2A 4WD0A 3VU2A 1E1EA 3CAWA 1XKJA 1MUCA 1ZJBA 1OABA 4MZ8A 2QV4A 3SUWA 3C2VA 3IGHX 3CQKA 3EXSA 3HO8A 3UXLA 1HP5A 1G1YA 4LFYA 2JQXA 4EXAA 3RCYA 3U8GA 1IIGA 2FZDA 1PCKA 4B3KA 1Q13A 2C8NA 1JFXA 4WQ6A 3FGCA 5I3FA 1YYAA 2E6FA 4DBSA 5CXPA 1EDQA 3R7MA 1BHGA 1WXZA 5LIUX 3DESA 2P8CA 1CNVA 3CTLA 1KRCC 2ZZ4A 4L9ZA 4NJIA 5C9UA 2J9ZA 4QM1A 3E2RA 4LALA 4PC8A 3DFQA 3W53A 5TNVA 3VO0A 4B5SA 3PJTA 4HD5A 1P43A 1H3GA 1S3TC 4HNUA 1UB3A 4PCNA 3ARPA 1N82A 2PTYA 4QLKA 3WH7A 1B1YA 3N4EA 3G1YA 4N9BA 1GQJA 1ZZMA 4Q4MA 2A85A 1Z8AA 4A8LA 4IH3A 2F2KA 3TOYA 3O9NA 4JHZA 4L4LA 2FPYA 4DXKA 4JS3A 5D37A 5A6AA 4TTGA 1AQHA 3AHTA 3OA3A 4AF0B 3TN6A 1XQKA 2QCCA 1RJQA 4H04A 4US5D 2D22A 3IGSA 2I17A 1MO0A 3C0JA 4J27A 3W7OA 1H7PA 1MFVA 2CWXA 5FIPA 2ZC1A 3L67A 4MB5A 4B5VA 2OMAA 1YE4A 4CCZA 5HNTA 1WKYA 3AXHA 5T91A 4E5TA 4GI9A 3WDRA 4FNTA 5AN7A 3R0UA 2EJ1A 4J3TA 3EDFA 3WENA 1SZEA 1UKPA 3KRBA 1QPOA 1TE6A 3S4TA 3H2AA 4J3VA 3LI0A 1KBIA 2X1UA 1ADSA 4GXPA 1T96A 4PBGA 3L5AA 3R13A 1JCJA 4G7FA 3K8KA 2HK1A 4CN1A 4QG8A 3FJNA 1R38A 2V30A 3IANA 3AMLA 2C3ZA 1IIHA 1HT6A 3B0YA 4Q33A 2FZMA 4R7WA 4AY7A 4WCJA 4YN5A 4G7EA 4X3ZA 3MSRA 1J96A 2CLOA 2FTPA 4QRNA 5K2ZA 2Y7FA 2J27A 5AYBA 3PBGA 5E9XA 1EFZA 3H4GA 1MEHA 3T55A 1OX4A 4ERGA 1UR4A 3PJWA 1U5VA 3AXMA 5TD4A 3W2LA 3TONA 4PMXA 3CUJA 4AUBA 3OHMB 1HNYA 2PLMA 3QEZA 1Z41A 4Z0JA 3SI9A 3KHJA 1FFQA 2QULA 3GU1A 5JQ9A 3F5KA 2BXZA 2Z1VA 5DY2A 2ZUUA 4XD3A 1DE5A 2A79A 1G4PA 3M41A 2VFGA 6XIMA 1DIEA 2DUAA 1MWOA 3EWYA 4HU3A 4MLJA 4UUIA 4DJDA 4XBJA 3UZJA 2GSEA 3S1GA 4NU7A 4O4VA 4XG1A 3W7LA 2XVPA 3W1LA 1VYRA 1SUXA 3B9NA 1RZMA 1MUMA 4TIMA 1GK8A 1ISWA 3MHGA 1OF6A 2PDXA 1UHVA 2VEFA 2XM1A 5BMXA 5H1WA 2CWNA 5GNYA 1TPDA 4WHBA 1JD7A 1NSJA 3CHFA 4ERAA 4MB4A 5D4YA 1GKQA 4TV5A 4MUZA 1YDNA 3G2GA 4X63A 3RCNA 4JFTA 5EB8A 4P8UA 1E3ZA 3CH0A 4FOKA 3DX5A 1GVSA 4L61A 3CZKA 4XAZA 3CWHA 1HVXA 2YBUA 3W0KA 4PMVA 4N9EA 1R3SA 1TYGA 1C7TA 1E6XM 4IUOA 1W3NA 3VCCA 1IT8A 5BOOA 4DUXA 1WYIA 2BODX 3CMFA 4X9SA 5CH9A 5AC5A 3AJXA 1EGZA 1IT0A 2V68A 5CCZA 5D38A 2X1SA 1SJBA 4X9YA 4DWSB 5D30A 1XLHA 3W29A 3LN3A 3REQB 3UNDA 2RKXA 1LT8A 3C2EA 4O11A 3S0CA 3R8RA 1M7PA 4ML9A 1XBZA 3THCA 4KBXA 4IQEA 2AQOA 1A47A 2WW5A 2QJMA 2B7NA 3C2YA 3M0MA 3SCVA 2ZUSA 4D8LA 2DZVA 2Z2BA 3W73A 3T07A 5D9MA 1TUFA 3EEGA 3M43A 4GUIA 4ZXOA 3EZ4A 3W1NA 4Y9NA 1TFVA 1IEVA 4L65A 1RY0A 4AHPA 1B54A 1W2PA 3O15A 4M5PA 4P8VA 1LG1A 1XBVA 3LPPA 1GZGA 1C9DA 4MF4A 4YXGA 3GE7A 4J3WA 1QK2A 3STEA 1LL4A 4HP5A 2Y5SA 1JDFA 5IXEA 1WKEA 3AICA 2ZA2A 2ZUWA 2Z28A 3S2MA 2CPUA 4U3AA 4HA3A 4GKTA 2OGYA 2E77A 3UPMA 3OBKA 1JRCA 3N29A 1EX1A 1A50A 3V0UA 1W8GA 2V3GA 5DCEA 1ELSA 3M0LA 2CLMA 4DJDC 5REQA 4UFIA 3H70A 4IGSA 4M80A 4F40A 1TPWA 1TIWA 4MKNA 4IQDA 1HJUA 3LBOA 4O8RA 3GDBA 3MI2A 3T42A 1UD5A 1UR0A 2F6UA 2ACSA 3C0LA 3Q65A 3T9PA 2WAGA 3PTMA 4H9TA 5CBIA 1TMHA 3WDJA 2YFOA 4ECLA 1S2CA 2EPMX 4Z1CA 3SUSA 4UTFA 1YRRA 1N8IA 1YNYA 1DJWA 5FACA 1US0A 2D0HA 3ONCA 4YVVA 3SCOA 3VTRA 2PODA 1OSEA 3VDHA 2NX1A 4YVPA 4PTDA 1SO6A 2C16A 3VDAA 4JL1A 4DXVA 4QEEA 3WLHA 4K8HA 3UWEA 1F6PA 3PUGA 3CYVA 5DCDA 3F5LA 3TQPA 1MEWA 1UP3A 3NVDA 5F4WA 2WVSA 4PMNA 2XYLA 3KCJA 4Q7NA 4LYQA 1GTHA 4CNUA 2FYMA 3N18A 2ISWA 1QPKA 4DI8A 1FP9A 2IMRA 1K6AA 1UG6A 2YDQA 4RW3A 3BAYA 1F4HA 1EC7A 1UBSA 3QSTA 3UXAA 1FWWA 1Q7MA 1K02A 1LT7A 4AD2A 1IEIA 4O0KA 3TLLA 5BXSA 4AEFA 2CYGA 3MSDA 2EKGA 1FX6A 2BS9A 3N2TA 3KLKA 3M6DA 2CZVA 3YPIA 2QF7A 2W0UA 1BVNP 1TJ2A 1H7OA 1XC4A 1C8XA 2ZIDA 2Z1BA 2ZUNA 4HGXA 3AIWA 4YTTA 4IPNB 4G2DA 2HNEA 3OO2A 5AC4A 2WMHA 5GJPA 3T0BA 5I07A 5C54A 3OJGA 1D7KA 4AHQA 3HJZA 3QQ0A 5HUOA 1ALDA 2Y7GA 1XL9A 1S5WA 2G8ZA 5AHIA 4AZBA 3P6LA 3QTPA 3KP1A 3CV6A 5DRCA 2O9TA 4LBRA 4I9AA 3AZSA 4XVDA 1C91A 3VIFA 5ABFA 2IPWA 5JH1A 4EOUA 2J7DA