4DIAA

Crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
293
structure length
286
Chain Sequence
LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLPKDKFLEVAGRLPAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTNWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 2-pyrone-4,6-dicarbaxylate hydrolase
publication title Structure and Catalytic Mechanism of LigI: Insight into the Amidohydrolase Enzymes of cog3618 and Lignin Degradation.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
total genus 94
structure length 286
sequence length 293
ec nomenclature ec 3.1.1.57: 2-pyrone-4,6-dicarboxylate lactonase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4diaA00
4MUPA 4H9XA 3ICJA 4DI9A 4GY7A 3NEHA 1EJSC 2HBVA 3C86A 1J6PA 3E3HA 1EJUC 2OODA 3S2MA 4B3ZA 3GU9A 4C6NA 2DVUA 3LGGA 4G2DA 4IG2B 1XRTA 3G77A 4ERIA 3GIPA 3QGAC 4GZ7A 4DO7A 3B0YA 1J79A 2ICSA 3GTHA 1FWHC 1FWJC 4H00A 4C6OA 2HPMA 4INFA 2OGJA 2HBXA 4R85A 4ZSTA 3RCMA 3WMLA 4C6BA 2W9MA 1KRAC 1V4YA 1IE7C 4C6QA 3QY6A 4IQJA 4ICMA 1M7JA 4NI8A 3DC8A 4JOMA 2ZC1A 4PCPA 3AU6A 1UBPC 3JZEA 4DZIA 3S2JA 1KRBC 1NDYA 4KEVA 3QY7A 4H9MA 1M68A 3OVGA 1ONXA 2UZ9A 1RK6A 4DNMA 4EPEC 3LGDA 1A5OC 2P50A 1BF6A 2PGFA 2YB4A 1RJRA 4XAGA 3FDKA 1J6OA 4EPDC 4C6CA 1ITQA 3NURA 1A4LA 1FWFC 4Z42C 3K2GA 1WXYA 4KF1A 4ZSUA 4LAKA 4C6PA 4DI8A 2YXOA 4GYFA 3WYZA 4H01A 3OJGA 4H9ZA 3TN3A 4CNSA 3UPMA 4C6LA 3GU2A 3F4DA 1XRFA 4HK6A 4CNUA 3URQA 1FWEC 2CZVA 1A5MC 1RAKA 3WZ0E 4HK5A 4LCSA 3R0DA 3GTIA 4I6KA 4KERA 3EWCA 4KEUA 2KAUC 4BY3A 3AUOA 4H9UA 3PBMA 4RZBA 3V7PA 2A3LA 1QXLA 1DPMA 2Z25A 4GC3A 3MPGA 3E2VA 4QRNA 4DLMA 3SFWA 1P1MA 2VM8A 4XAYA 2XIOA 1WXZA 3KM8A 2GWGA 3OOQA 1KRCC 4KEZA 2Z2AA 4R7WA 2UBPC 4QTGA 2AQOA 2D2GA 2E1WA 2QVNA 3A4JA 1XGEA 4GX8A 5G4HC 2AQVA 2Z24A 4KQNA 4PBEA 4C6DA 4PBFA 4F0RA 1RA0A 3MSRA 3HM7A 2D2HA 2DVXA 3PNZA 4LCRA 1KRMA 1O12A 4XAFA 2EG7A 3GIQA 4DYKA 3K4WA 4PE8A 1UIPA 2PAJA 1A5NC 2RAGA 4CQCA 4QS5A 2Z7GA 2ANUA 4IGMA 4AQLA 4GX9A 5A6TC 4J2MA 1NDWA 1A5KC 3F2DA 4NG3A 1A5LC 4DIAA 1V51A 4D8LA 2YB1A 4RDVA 1EJXC 3PNUA 4EPBC 1FWIC 2FTYA 3MKVA 2YZ5A 2Z2BA 1NDZA 1RJPA 2Z29A 4GOAA 4G7EB 2GZXA 3UF9A 2DVTA 4KETA 5HMFA 4C6MA 4GXWA 3MVTA 1QW7A 1FKXA 2QPXA 4LCQA 2FVMA 3GRIA 2OOFA 1K6WA 4P5UA 1I0DA 3OU8A 3AU2A 4IFOA 3LNPA 3OQEA 3PAOA 2AMXA 4IFKA 4IFRA 3SO7A 4ERGA 4ERAA 4HA0A 1FKWA 1POKA 1E9YB 2GWNA 3CS2A 4EPKA 3E0FA 3TNBA 1YRRA 4QSFA 3F2CA 2FTWA 2QS8A 1NDVA 1FWCC 3IGHX 2R1LA 3S4TA 2BGNE 4BJHA 3FEQA 2VHLA 3IACA 2VC5A 5E5CA 3QY8A 4XD3A 3F4CA 2FVKA 1XWYA 1V77A 4C6KA 3FDGA 4RDYA 4NP7A 3NQBA 2QT3A 3A3WA 1ITUA 1FWAC 3RHGA 3T8LA 4C5YA 3UR5A 1P6BA 4L6DA 2E25A 3MDWA 2Y1HA 4B92A 4CQDA 4IGNA 1O5RA 1V79A 5FSEC 2EG8A 2R1NA 3ID7A 4C6EA 2GSEA 4DLFA 1RA5A 5CH9A 1E9ZB 1S3TC 3EWDA 4KIRA 4LFYA 1VFLA 3QGKC 4R88A 4CQBA 4HJWA 2WM1A 4CEXC 3OODA 1P6CA 4EP8C 4GBDA 4XD4A 1GKRA 3T81A 4GK8A 2O4QA 3URNA 3IJ6A 2WJEA 4PCNA 4LANA 2Q09A 3D6NA 4V1YA 3UR2A 3GUWA 3GU1A 4UB9A 2Z26A 3MJMA 4YIWA 4CEUC 3TN5A 2EG6A 2PLMA 1GKPA 4H9TA 4B90A 1ADDA 4IFKB 4AC7C 1K1DA 2R1MA 4GY1A 4V1XA 4XD5A 4IH3A 3S2LA 2WJFA 4L9XA 3K5XA 3S2NA 1PB0A 1EJWC 4C6FA 1YIXA 3ISIX 2P53A 2Z27A 1EF2A 4WHBA 3GG7A 4BKNA 4C6IA 1R9ZA 3N2CA 2O4MA 2PGRA 4GY0A 2G3FA 4LAOA 2Z28A 3LY0A 3B40A 5HMDA 1RJQA 1I0BA 3A3XA 4LEFA 3LSBA 3T1GA 3URAA 4LH8A 1NFGA 3O0FA 4OFCA 1FWGC 1J5SA 3BE7A 2VR2A 3DUGA 3IV8A 1EJTC 2VUNA 2Z4GA 3E0LA 4IF2A 4KESA 4TQTA 1EYWA 1UMLA 1KCXA 2WJDA 1JGMA 2ADAA 1YBQA 4H9VA 4CNTA 3HPAA 3EGJA 1HZYA 2Q01A 4RDWA 2R1KA 3LU2A 5LXXA 3LA4A 4UBPC 3UBPC 4LALA 2BB0A 2R1PA 3MVIA 3MTWA 3TN4A 1V7AA 2PUZA 2OB3A 1A4MA 3HTWA 2I5GA 3RN6A 3O7UA 1EJRC 3MDUA 3ITCA 2F6KA 4XAZA 3DCPA 3CAKA 3RYSA 1POJA 2FFIA 4QS6A 4IG2A 3CJPA 4C6JA 1R9XA 4F0LA 2GOKA 1ONWA 3F2BA 5AKQA 4DZHA 1PSCA 4LAMA 3IARA 4I6VA 4RDZA 1PTAA 4C5ZA 1R9YA 3GTXA 3IRSA 4G7EA 2HQAA 2Z00A 5HMEA 1YMYA 4H9YA 4HK7A 1W1IE 3URBA 2IMRA 1M65A 3GTFA 1UIOA 4F0SA 2HNHA 1K70A 1EZ2A 4RE0A 1ZZMA 1RK5A 4E3TA 4WGXA 2D2JA 3LS9A 3E74A 1FWBC 4QROA 1GKQA 1PO9A 3TN6A 4XD6A 1FWDC 4B91A 4J35A 4C65A 5FSDC 3LSCA 3E38A 4J5NA 2OQLA 1YBQB 2I9UA 3IPWA 2HPIA 4WVXA 3ORWA 1EJVC 4M51A 3B0XA 4C60A 1YNYA 3PANA 2VC7A
chains in the Genus database with same CATH superfamily
3G6MA 3NEHA 1QOQA 1I2NA 4GI4A 4WDTA 3S6TA 3UNTA 2G4JA 5L9FA 4WSJA 2WMIB 4DHGA 3QZEA 3H55A 1SW7A 3S1GA 4HOXA 1KBKA 3B9AA 5BXPA 3KOFA 3N29A 4K39A 2OYKA 3F5JA 4UOJA 5D8ZA 5C0QA 3AIVA 8CGTA 1AJZA 2JK2A 1V4YA 4NY2A 4S1FA 2QCCA 1ZLPA 4PCPA 3FYOA 4R7OA 3UR8A 3JW7A 4EWJA 3PHAA 3KS6A 4QIUA 1ZJIA 2CBJA 5A3HA 2EF9A 2PGFA 3OP2A 6XIAA 3L5MA 4D71A 4ATLA 3ECQA 3NURA 3H54A 1FWFC 1U83A 4NNCA 5TBOA 2B7NA 4D1IA 2YXOA 1EJ7L 4ZQNA 4H01A 2V69A 1DORA 2VFHA 4JL1A 1GONA 1H1NA 4Q8WA 4U31A 1IIGA 4CNUA 2WV8A 3URQA 1OFEA 3UPBA 5BNKA 1QPNA 3ZVIA 3R0DA 4URIA 4AXNA 1G4PA 1K7XA 2VJXA 3PJUA 5CGQA 1TE1A 5AECA 3PZVA 1SZFA 3O15A 3RNDA 4Y2WA 4MAZA 1DPMA 3AXHA 5EBAA 3WD0A 2ZC8A 3W28A 2NUWA 4KEZA 2VP8A 3R1ZA 2F61A 1XIFA 1OZMA 1Y65A 3GHUA 4KFNA 3QTGA 1XGEA 5K4ZA 4LJ3A 4D6GA 1S1PA 3W81A 1RCOB 2GOUA 3MSRA 2QMKA 1LF1A 1MUMA 1TJRA 4HZMA 2IKHA 4RW5A 3NM1A 2GK1A 4HPNA 1IEVA 4DYKA 1H3GA 3W2NA 4E6MA 1BFNA 5IM51 1Z32X 4LU0A 4IGMA 4DJEA 1NU5A 2W61A 1P43A 1V51A 4FX8A 1XYLA 3GBDA 4S23A 2J24A 3N4EA 2DVTA 2QEZA 1IXPA 1XBYA 3IGUA 2PCQA 3H23A 4HNUA 5JU6A 3RK8A 4JNZA 1XHGA 1UP0A 3NL3A 1V0KA 2VD9A 2ZX6A 3KWXA 4N42A 1M7OA 2XFYA 2PGWA 1RLDA 1GYNA 4CN4A 5A2CA 3H12A 2YYTA 2QS8A 4A6GA 4ZE5A 3U3HA 3G1AA 2POZA 3GXFA 3A5FA 1KFJA 2VC5A 4U28A 4XD3A 3N2MA 1KGUA 2VQTA 2WZTA 4NXSA 4ECLA 1ZRQA 2FVKA 2WPGA 1VIZA 3FKRA 3SSJA 2G3NA 3HA1A 4M19A 3VC5A 2C79A 3NEVA 3W7IA 1YQ2A 2NX1A 1H49A 2E25A 1DQWA 2YFOA 1PWLA 2F6UA 2X2YA 3GHTA 2PCEA 5HWJA 2QUNA 2OEMA 3FHQA 3CWNA 4IIGA 4LNYA 1JZ8A 3EWDA 5I3KA 3DKLA 1DXEA 3PP7A 2PD9A 4U2ZA 4F2TA 3N9RA 3N18A 1RD6A 3BXWA 3FVMA 3ZIZA 5DELA 1Q3NA 4G1NA 4GK8A 4N02A 4LANA 4L7ZA 3RLHA 3IIPA 4DM1A 5AHMA 4K1GA 4U2YA 4LVFA 4NSBA 1Q6GA 3AS3A 2PWUA 2FMOA 4PMVA 1W9DM 2QGYA 4IFKB 3TC7A 4PGLA 4AC7C 4MY8A 4DXXA 3S2LA 3OHMB 4PB3A 3W7KA 1AVAA 1O66A 2ZRYA 2W67A 4GYPC 1H50A 2PBOA 5JXQA 4Q8VA 4ICNA 1DXIA 5RUBA 4WSKA 5C7VA 5EPDA 5EMUA 4DZAA 4PTNA 3NO5A 4RV8A 4UMBA 3BE7A 1TV4A 1SZRA 3OBKA 4KBXA 1YDYA 1OX5A 2DIKA 1R2SA 2CXGA 2AGTA 3CL6A 3VA8A 3G1VA 5K2ZA 2PZNA 3R11A 2C15A 3R8GA 3EGJA 2PP3A 4IMAA 1W31A 1MW1A 1B54A 4IQDA 4QXIA 3FXGA 3BQ6A 3OEXA 5CPNA 3WUFA 1OC5A 2EJ1A 4YHEA 1Y5VA 3HF3A 2Y5EA 4N9BA 4RL3A 1FRBA 4IMFA 3UXIA 2PDHA 3WL1A 5LIYX 2X16A 2ACRA 2C13A 2NT0A 3OLIA 1UMYA 2PB1A 3CTTA 4M80A 4ICCX 4L56A 4UTWA 1KXVA 5E6YA 3FGCB 4JKLA 2YCEA 2A2IA 4KT2A 1I60A 2ABBA 1HNYA 1AZ1A 1RBOB 5KINA 1H62A 2YR1A 3E2SA 3UXAA 5XIMA 3UZJA 5GNZA 4HGXA 1XBVA 2J7HA 3MHGA 4Z2KA 4HBKA 1DVJA 2QJHA 3W76A 2YDSA 4L4OA 2X1UA 1NELA 3MUY1 3LCHA 3BQ5A 4L9YA 1H2JA 2D2JA 1CGWA 4PUMA 3U2ZA 3QLLA 4O1AA 3IJQA 2CLOA 4NJIA 1PYFA 2QUMA 3FVDA 1ZBVA 2WXDM 5D04C 1NVMA 5LNSA 2P8CA 1NWRA 4YXGA 4ZQOA 3UWUA 2Y7EA 2BXYA 1VYRA 3PTQA 3GNRA 1C8XA 4EOUA 5AHNA 4F8XA 3GDRA 3SGUA 3N14A 4MLRA 2HV5A 4ACZA 3ICJA 3CASA 1FA2A 1UKPA 3C86A 1VEOA 4GVHA 1W5QA 3RU8X 1XIMA 4DYEA 4S2BA 2DVUA 3GIPA 5HULA 2PDMA 1IZJA 4MFDA 1KW1A 3V3WA 1V3HA 4GZ7A 3R0UA 1REQB 3CUIA 2Q3OA 1DWIM 4D8ZA 3C0QA 5T9CE 3CZLA 3AALA 4ORMA 4R27A 3JZEA 3EMCA 4IGSA 4DZIA 5G1TA 4FLRA 1A5UA 3LMYA 2UV8G 3NQAA 2DW6A 1TA3B 3AI0A 4JZ5A 1RQBA 1CCWB 1B3WA 4H19A 3WBAA 4LXFA 4GCXA 5FOOA 3CUZA 1UD8A 1XGDA 5DY3A 1X1NA 2ACQA 3CQHA 3VGHA 1YE4A 4FEZA 3TN3A 4PUJA 1OQFA 2CZVA 1CGUA 4E2BA 4LCSA 4WZHA 4TXEA 2BY2A 1BQGA 2O9RA 1H09A 1S5TA 3DYOA 4RZBA 4YWSA 3M47A 4QRNA 3PVFA 3CMJA 2ONEA 4UXDA 4XAYA 4DAFA 2VDIA 3K4AA 3ARXA 1K4GA 2G41A 3OOQA 5KETA 2W5FA 2EPHA 3DIPA 1XD0A 2D2GA 4NI3A 1D3CA 4GVFA 4F0RA 3VIOA 1QAPA 3L21A 1UC5A 4ZQMA 3LTPA 4J7RA 4HPHA 1PVNA 3ABOA 4U3CA 3WNPA 6ENLA 1I45A 3GVQA 3ZT5A 2ANUA 8A3HA 1U5HA 5DX7A 1XV8A 3G0SA 1BYDA 3AMLA 2VX6A 2VC9A 3GZAA 2YB1A 2NSXA 1ZBWA 4PL1A 3CPGA 4JXCA 2Z1KA 1ZB5A 2HVMA 4KW2A 2NV9A 4DM2A 3T42A 2RUSA 3HJEA 3E5PA 3MZ2A 2VURA 2HVOA 2WVUA 3BWWA 3OQEA 4L1GA 1W9XA 4WRHA 1I4NA 1UD4A 1OIFA 3FHAA 1YRRA 1EPVA 1A5CA 2BBFA 2AMGA 5C54A 3CEPA 4HHMA 2QF7A 4PUNA 1Z8AA 1HKVA 4QDPA 3IJ9A 3N25A 2PEVA 3O16A 1EHNA 1E1CA 4NUWA 4JTKA 4R34A 4C6KA 4K38A 4QGCA 1IZKA 2J25A 2WNWA 2PRMA 3A3WA 1SQ7A 1ITUA 3FEMA 5H6HA 3CT7A 4CQDA 1S5NA 2IW0A 3ID7A 4IL0A 2CLPA 4JCLA 1LORA 3CQIA 1X1ZA 4ZOCA 4LV9A 1TPWA 1OYBA 1JDAA 1O5KA 3W1AA 3R13A 3GD6A 3TXVA 4GBDA 1JZ3A 3ARVA 4ENLA 1ZAHA 4JAWA 2TMDA 2DP3A 2EPOA 2V5KA 1AL7A 3UR2A 2CZDA 1TRIA 3DG3A 3WDHA 3CH0A 3N04A 5BOEA 4IX0A 3T2PA 5DXYA 1Q6OA 2GVEA 4EAMA 5D2YA 2ZIDA 3XIMA 2TSYA 3TDFA 3S1VA 2WJFA 4B4FA 4HNNA 3PZUA 1EUNA 3E2RA 5FJJA 2Z27A 2Z1VA 1EA0A 4JTDA 2ATMA 3N19B 4K3ZA 1DJZA 2YFNA 2XIQA 1E15A 1WZMA 1UG6A 5DLCA 3WQPA 3MJYA 3CUGA 4FLSA 3LHTA 4YWIA 1FH9A 7PTDA 5I3FA 5F2GA 4AYGA 1G6CA 2BHYA 3NQMA 4JKKA 1EYWA 3SI9A 3HZ3A 4H9VA 4DF1A 4UQEA 3SR7A 4EVZA 4V33A 4W86A 5DFAA 3LXBA 1EGVA 4P8XA 3T9PA 3GXDA 4CU6A 2BXVA 4O0ZA 2OB3A 3HTWA 3KBSA 4IX2A 4IPLA 5CZ0A 3M0KA 3M5YA 3ARYA 1XUUA 3I4EA 1T6MA 3BAIA 1DWGM 3HQ1A 2QCDA 4CGTA 5HQLA 1JCJA 2JALA 2BX7A 5ECVA 3W4RA 3BAXA 4O54A 4C91A 4JTAA 5BRPA 1KB3A 3O6YX 1VS1A 4MB4A 3WL0A 3TZNA 1SJBA 3LCIA 3VXGA 1S1RA 5C8BB 3SCUA 2J7EA 5HUOA 3FV9A 2PWEA 3BMVA 1JZ5A 3MZNA 2VEFA 3GAKA 3DKJA 3WELA 2YL5A 2CLFA 5HBFA 5HUPA 3E74A 1FDZA 4FA3A 2FDSA 1VB9A 3TONA 5C9XA 1PPIA 4QFUA 3A9BA 3UWQA 5F4WA 4FLOA 3QPZA 3HG2A 1Z9AA 3NO1A 2RJGA 3SJNA 4J5NA 2CLEA 2FPYA 5I09A 2PDQA 2NUYA 1HKJA 4L6OA 1T96A 3EX4A 3AS2A 4O4VA 4DJEC 1RY0A 4WVXA 2Y85A 2V5JA 2OKTA 1M53A 5A6SA 5BXTA 1WAWA 4GY7A 3JRKA 1GOIA 4JTGA 1YPIA 3PZNA 2FHBA 3FW6A 1XRTA 4BHYA 1XLEA 2DT0A 5E6ZA 1MYRA 1ZGDA 4AIUA 3WMSA 3LLFA 1J79A 4BQ4A 4C6OA 4FX6M 3BCJA 4LYRA 3RM9A 3R0KA 4RNHA 2ZYFA 3N17A 4C6QA 4JL2A 3QY6A 3I7SA 3MS8A 3AU6A 1UBPC 4B3KA 2TODA 3NQ8A 3S2JA 1T99A 3OA5A 4ES4A 4H9MA 1DQXA 3OVGA 1QNQA 3W2MA 1ZFJA 3U9IA 1MMFA 4MNJA 2NQ5A 2VFDA 1H7NA 2ACUA 3WJXA 3WLJA 1RD5A 3ZQ9A 1US3A 3KL0A 5I78A 3F7JA 3WLHA 1A50A 3NL5A 4BWLA 5F4XA 1PKMA 4GI8A 1Z42A 1WDDA 3W74A 2UY4A 4JIRA 3UCDA 1O5QA 4ROQA 3MHFA 4GNJA 4HSOA 1GPFA 1UYQA 3B8TA 4C1LA 2XM1A 5DMMA 5D02A 1KTNA 3GTIA 4I6KA 4KWUA 3CLWA 2V5DA 4QQUA 4Z1CA 3QBUA 2QYGA 1HJQA 2QUUA 5GJPA 2WJZA 4P8UA 2BVDA 4PMJA 4UCFA 3W7EA 3A47A 4N0RA 4AHOA 2VX4A 1U2YA 2UY5A 2DSVA 1EO5A 3CPUA 4U4MA 3O2LA 3FA4A 4QLKA 1XS2A 3VGFA 4ML9A 2UBPC 3V4BA 1VAHA 2ZA2A 2E1WA 2ZICA 1VF8A 1US0A 5HMSA 3KZPA 2ZRXA 1PKYA 3VNMA 3N1AA 3C56A 4UOQA 2QDGA 1US2A 4ZGYA 3HURA 2NQ9A 1UIPA 3PTKA 2UWFA 2W79A 5GVJA 3DFHA 4CD8A 1SO5A 3TLQA 2QAFA 3KDNA 4BFAA 1EJXC 2NV2A 2XGIA 2PDLA 1QR7A 3S47A 5ABTA 3BSGA 1WXJA 3BGGA 2DZSA 2NLYA 1QW7A 3WD2A 2FVMA 1C8QA 5HINA 2Y8VA 3T05A 4H8HA 4UFMA 3UD6A 1I0DA 3PJXA 3WNLA 2D23A 3P61A 2J13A 1F05A 3SY8A 1IR1A 1QHOA 2FZNA 4DO5A 4FR6A 2NWSA 1XM3A 2R1LA 4GUIA 3NGJA 5BYWA 1XJBA 4LB3A 5HJYA 2F7FA 2BVYA 4MG4A 3H2CA 3VIMA 2VFIA 3Q94A 3NQBA 2QT3A 3STFA 2EEXA 1U5VA 2FZMA 2R24A 5CBJA 3M44A 5I24A 3VOJA 4C5YA 2ZUMA 3QHNA 2B7QA 2Z1SA 2OR2A 4PRTA 3PZTA 1LP6A 1RA5A 2YPIA 4C7FA 1DE6A 1CW2A 1JRCA 1FQ0A 3ZLHA 4XZMX 2ZUVA 4W5ZA 2J79A 4S39A 3WD3A 3T81A 5DANA 4NRSA 3UU0A 4YTQA 5D9PA 1RXOB 3V5FA 1V6TA 5A8GA 1H60A 4XUYA 3LHZA 4O50A 2NWRA 4O1DA 4NZFA 4FALA 1ME7A 4TX9A 5D9OA 1IT7A 1ZALA 1M6JA 3W01A 4PFHA 2A3EA 5HATA 5LA1A 1J5TA 1QWKA 1TJ0A 2J66A 4HPXA 4M6QA 1QRQA 1LZOA 4DEFA 4TOQA 1E0UA 1TZ9A 3KRUA 2G3FA 2XG9A 1XIEA 4UTIA 3TA6A 7TIMA 2HROA 5I3HA 5L6UA 5AHIA 1I0BA 4LUIA 1A47A 4ZXOA 3T1GA 3VDAA 3L4VA 3TU9A 3ZLFA 1IEQA 2OLAA 3H2OA 2ESCA 1JPHA 3AMCA 4I5RA 1ZP4A 2Y62A 1EP3A 3FFSA 2TPSA 2V5LA 4GNVA 1AW2A 1VFHA 1XQKA 2OO6A 1K8YA 4GHRA 4QDMA 1V02E 2OX1A 2YBUA 2VT0A 2JF7A 3E0VA 5F4SA 1WKFA 3DXIA 4HZ7A 4B5TA 3MSDA 1Y5WA 5FACA 5D4YA 1WOAA 4A3HA 3WQDA 3BANA 3PTMA 3C3UA 3GDLA 4TMBA 4JFTA 4BI6A 1W32A 1F3EA 4MLJA 1EL3A 3CO8A 3QLDA 2Y5JA 5FF0A 3TEVA 4XBKA 3T08A 1H61A 4LQ1A 4LV4A 2YW3A 4F0SA 5I7GA 3P81A 3W53A 3WLTA 3HBLA 1JUBA 3WUGA 3CHEA 4D6EA 1H0IA 1CDGA 4GUHA 3VINA 1O1ZA 1ECEA 4I8YA 1QI3A 2XN2A 3B8UA 3QQ1A 3RX3A 3WLOA 1VJZA 2IKGA 1W3JA 4UNLA 3E9AA 3QFWA 2OJPA 3MKCA 5I79A 1F4HA 1T8QA 1SJAA 4GUJA 4LUTB 3UZZA 3RU6A 4HU8A 5K9CA 1PDZA 1K02A 3R4IA 3LLDA 4D6FA 1D8WA 2ALRA 2PTDA 1TELA 1DOSA 1EDTA 1L2QA 3S2MA 4B3ZA 2RKXA 4C6NA 2PC4A 3WKZA 2W0UA 4O0QA 4B2DA 4G6CA 1QI2A 1TREA 4GQRA 3RJXA 2YCKX 4H7CA 3L2IA 3VUPA 1FH8A 1L0PA 2V63A 4YL2A 4WKAA 5CGTA 4GZIA 5AC8A 1W2PA 1LOQA 2YSWA 5J5RA 1G94A 5K4XA 5A2BA 2WQDA 3OGVA 3VFCA 4J27A 1QO2A 5H8UA 5D2TA 1KV8A 1NAL1 3E6EA 1R3WA 5C6MA 1WZKA 2H90A 3AS1A 1FCVA 1YADA 3EXRA 3VDGA 2WHMA 1FP9A 1A4LA 3R6IA 4B16A 1LRNA 3CM4A 3AYTA 1F6PA 2WW5A 3D3AA 1E6PA 4AB4A 4WQ6A 3W22A 3IJ8A 4Q8QA 3FN9A 4RCXA 1KCZA 5F1VA 1OD8A 2CETA 3WJSA 3LXCA 1NWTA 4RZ4A 1FWWA 5FJTA 5AVNA 3GFZA 1FWEC 1PYMA 1GZGA 1PHQA 2D0HA 2WVSA 1WCGA 4PCSA 4J1OA 2XH7A 3EWCA 3MCOA 3OG2A 4BY3A 3P6LA 5JMUA 4BI7A 4R5EA 4WLCA 1W2VA 3DG7A 3MPGA 4QJ4B 5HNNA 3WLKX 1OG6A 4GIRA 3KM8A 3FOKA 4JFUA 2FIQA 4S3BA 4AD4A 3TJ4A 1R30A 2G8ZA 3DHDA 2FH6A 3A13A 3EX6A 4XIAA 2JBMA 4ZODA 1SUXA 2P5NA 1KM5A 2ZX5A 4O53A 1CECA 2F2HA 1B3ZA 1AL8A 2WO5A 3BC9A 2FHCA 3FJLA 3VFLA 3THCA 2XVNA 5TD4A 4QS5A 4AISA 4AC1X 1R87A 2Y2WA 1A5KC 2X1TA 3UQNA 5LIXX 2FB2A 3Q2DA 4GOAA 1P0EA 3W23A 2DGAA 3EOOA 3R94A 4E38A 1HKKA 1X7IA 1A0EA 1KBIA 1UD6A 1Q7MA 4GXWA 1W6TA 3WEOA 1L6WA 3GRIA 3H2EA 3QR0A 1YTEA 1QTWA 3PN8A 4LVGA 3H70A 5D05A 4A2RA 2OOGA 3U2CA 4UFLA 3R8RA 3GC2A 2AMXA 3MC5A 1RQHA 5FJOA 1CB7B 1FDYA 2XH4A 2JIEA 4LYPA 1ADSA 3IANA 3FEQA 5EMJA 3U7VA 1DL3A 2P10A 2Y63A 1GHSA 1J2WA 4GYKA 3CUFA 1W3LA 1JCTA 3ITOA 3NL6A 3O0KA 1JAEA 3V36A 3B4UA 3AZSA 2WK2A 1E73M 4X60A 2DEPA 1NF7A 4ZFCA 3MI3A 4IGNA 3VKDA 1WZAA 2HISA 1QWGA 4C6EA 1HF6A 3K13A 2I57A 1E9ZB 1SGJA 3WQEA 3FXYA 2C91A 4LFYA 1M3UA 4GVIA 4Z2IA 4JX4A 1FCQA 4CQBA 1NH6A 4WD0A 4YTSA 3HMCA 1XW8A 4M82A 4XD4A 1KGWA 4NZCA 5JIPA 1YPFA 3LRKA 3NOYA 3GFXA 2X05A 4V1YA 3WLQA 2HMCA 4DX3A 2XTKA 1JXKA 1Q45A 3DGRA 4EACA 3AFBA 1EDQA 3TN5A 3GYCA 2IPFA 4J2PA 4I8DA 4FB7A 2YJQA 2ZUSA 3QW4B 4W7WA 2NQLA 3S2NA 5HPOA 3V0SA 2YL9A 3WNMA 3QOKA 1G67A 4JTTA 4OUIA 4XK2A 4RNJA 4JQ1A 2HSAA 3GZ3A 5I2UA 5EL1A 2PDFA 5HMDA 5JQ9A 4A3YA 3LSBA 1A80A 2A7PA 3OZMA 5AHFA 3BLIA 4NZ5A 4BEUA 1EOKA 1VENA 1FTXA 4LUSB 3IVTA 3W7NA 2VUNA 3SJ3A 1JCLA 3DI1A 2Z0IA 3PBWA 3FYPA 3N4AA 2Y70A 3TV8A 5IHRA 4PA8A 1BD0A 1M9HA 3JVAA 2PDBA 3O8AA 4NJJA 1ICPA 5ABFB 2DT3A 3PBYA 1MEIA 1HL9A 4BWLC 3TYDA 4M24A 5G5IA 2H9AA 1LG1A 3B8WA 1EC7A 4UZSA 3RCNA 4IJBA 2QV4A 3KHJA 1HO4A 2NXHA 3L9CA 1CT5A 5AKQA 4L4MA 4D72A 2H3BA 3VNKA 3CPRA 3TIMA 1BXNA 1XICA 1MNSA 1W56A 3IRSA 3VUSA 3ITTA 3FSTA 3ARUA 3OGRA 3QMTA 4MPQA 2I7GA 1XFCA 1ME8A 1XLBA 4BA0A 1XRVA 1EP1A 1PKNA 1W1IE 3MY9A 1SFSA 3KDOA 2JEQA 2PWGA 1NFPA 3MANA 2C3ZA 1FWBC 1PS9A 5HAOA 2OXNA 1BWLA 1QJWA 4F0KA 1DIKA 4NZ4A 4AIEA 3BAJA 9CGTA 4J28A 2X1IA 3BTNA 3WK1A 4RLIA 4WOZA 3W83A 3F03K 1C91A 3GXIA 3PZQA 1Q6FA 4AEEA 1BXBA 1AMKA 3MT1A 3N15A 4ROPA 3GKAA 4E8GA 1EJVC 1SR0A 4UTMA 2FLIA 4GMEA 4HOWA 1NIUA 3DFQA 3UJRA 2C18A 3EBVA 1WNOA 4YCPA 4M0XA 2DUXA 2QLYA 2J7CA 4QNWA 3K46A 4QG6A 3A21A 1FWHC 4H00A 3E02A 2JIWA 2GPTA 4P7RA 3QOMA 5KZEA 4ZSTA 3WDJA 3BGJA 3GM8A 4EKJA 4C6BA 4WCJA 2E3ZA 3C2RA 1U1UA 2O0TA 4IQJA 2P8BA 4LUJA 1VEMA 1I2PA 3DDMA 3AXMA 2D73A 5GQBA 3WN6A 1BGAA 2QKFA 2VRKA 2XWDA 3DHPA 4NYYA 3SUTA 2NX9A 3ZJ6A 2GJPA 1KGXA 5FF3A 2GGJA 1XIGA 3BW2A 1UH2A 1EEPA 3P14A 1I8JA 4L65A 1YPXA 1UKOA 4GYFA 3RPMA 3WYZA 1JFHA 3ENLA 1CGXA 3GR4A 3LM3A 2E6YA 3R79A 2VKZG 1A5MC 1BGGA 5D38A 3RR4A 2X1SA 4GI9A 2PDKA 4HP5A 1QDSA 1C90A 1NP2A 1VR6A 4O1FA 3V7PA 2A3LA 1SO6A 3E2VA 1IWAA 1IEIA 4JX5A 5ABHA 5FEXA 4GZEA 1KRCC 2OSXA 3LCFA 3QQWA 4GO9A 3VD7A 1HJWA 3V75A 1WB0A 3CZJA 1SJCA 4B3LA 3T0DA 1OFDA 3MO4A 3W07A 4LBSA 3SCTA 3HM7A 5C2XA 3W38A 1O12A 3RIKA 2E5CA 3LBCA 1IXQA 5M3WA 3I3EA 2JGYA 2PDNA 2G5WA 3K4WA 3SQMA 2PAJA 1A5NC 1SYTA 3SUSA 2ASHA 2RAGA 3W6MA 5FA5A 4CQCA 2XZ7A 3SURA 4B5UA 2WZEA 4MFEA 5TIMA 4M1RA 4J2MA 3ZSTA 4D8LA 3MA8A 1FWIC 2YZ5A 4AU0A 2KX9A 4Q7IA 1Q6LA 3UXLA 2EPMX 3SY1A 1UROA 2VMFA 3WLNA 4FOKA 2A7NA 3UF9A 1JJKA 4KRUA 1FDJA 1EO7A 4N9CA 3QKZA 1NOFA 5G1YA 4GKTA 4PMNA 1FKXA 2I5QA 3MV01 1Q4NX 4WGHA 3RRAA 5GJMA 4DJFC 4NHVA 1K6WA 2E6FA 3YPIA 4ZA0A 4ZZ9A 3CQKA 4KRTA 4ERGA 4EE9A 4A8NA 3GVGA 4HMDA 5A8MA 4DXKA 3WF3A 4QSFA 1FFQA 3RR1A 1FWCC 3DG6A 3ARRA 2VWTA 3W7GA 2BGNE 3VD9A 2VHLA 1M03A 4WIWA 3W7QA 4F79A 4S3AA 1GOMA 4H83A 1T41A 5D2VA 1HJUA 4W7VA 1RBLA 1IEXA 2OZ0A 1E9LA 5CPLA 3RM8A 3PWGA 1I1XA 1TCMA 1IGSA 1VHNA 2F8QA 4EXQA 1L6FA 3LTYA 1XLGA 2R1NA 4JYDA 2J77A 4YN5A 4LY4A 4TUFA 4NZ3A 2AL2B 1WDSA 3POHA 7XIMA 3SUVA 1ESWA 4QG9A 4O12A 3NSMA 4UCGA 1R0MA 3S9ZA 3CV6A 1UR2A 3KOXA 3URNA 1G7UA 3LHUA 3AIUA 3DFNA 1OCNA 2WJEA 4NRRA 5DY2A 1ONEA 3D3FA 3EPMA 1JCXA 3ZVHB 4OWGA 1R47A 3V16A 5CZKA 5HNRA 1E3XA 1BLIA 2IPWA 3UG5A 6TIMA 2Q8ZA 4O1CA 1Q65A 1UCWA 1OB0A 1LG2A 1UUOA 4RJEA 1EGMA 4IIDA 3S2CA 4AFYA 3ISIX 1CWYA 4LB4A 5TQLA 1V3KA 1KD0A 5LGZA 4X63A 2XZ9A 4QR6A 3OIHA 2DZUA 2VFFA 1CLKA 4G56A 3QZAA 1V3MA 1E5JA 1XSIA 3W2JA 1CXHA 2VVSA 4C90A 1WX0A 3UGRA 3KZSA 3WQFA 4KESA 3TFCA 4TQTA 5A6LA 5I3IA 3TOPA 1MEWA 4CNTA 5I3GA 1WBJA 3EDFA 2NVCA 5CLTA 2G37A 1RVKA 1S2WA 3VM7A 5LXXA 1AW1A 3LK6A 4DWDA 5CPSA 2GVJA 3P7YA 1RV8A 3UBPC 4GD0A 3MVIA 4ZB5A 1D9EA 1NY1A 1J0ZA 1V08A 3E5BA 4C1KA 5G2WA 3U2EA 1GHRA 1LROA 2F6KA 4JBRA 1FHDA 4MWAB 4IUGA 1E5NA 5DF0A 2XFRA 5FJRA 4QG8A 4OJYA 4C5ZA 2YDAA 3F1QA 2UY2A 1S5VA 1YEYA 3N11A 3CQJA 1TE6A 3LV6A 2WCGA 1J2BA 1LLZA 2HQAA 4R9OA 3TTSA 2DW7A 5D9MA 1E70M 3GW0A 4FNUA 3ABSA 3QRHA 1O1HA 3S5NA 1EC8A 1K70A 5A1AA 3QTPA 4RE0A 3RMEA 3WD1A 3NPUA 3GH4A 2DSZA 1YE6A 3R2GA 1TTJA 1IEWA 1W3IA 3B9EA 1RCXB 3VX1A 1DBTA 4DJFD 3LSCA 1TJ1A 2OWWA 1NQKA 3QMRA 4Q7NA 5AY7A 2O7SA 1EBHA 2WMFA 3FY1A 9RUBA 4JHZA 4TR9A 3W27A 3APYA 4M51A 2Y6ZA 2QHAA 4POCA 4F9DA 4KFOA 4E3VA 3KOZA 4H8UA 3GIYA 1M04A 4XKYB 3WBEA 5MKGB 4QJ3B 5LIUX 2BSLA 3LBOA 3WQGA 1EGZA 4JN8A 1W1YA 3VGGA 3BLDA 3B0YA 1CEOA 1EF3A 1EA9C 4YMZA 2CLLA 4O13A 5IRPA 2D0GA 4H7VA 4GXPA 2PWVA 3FX4A 1J96A 1R46A 2ZX7A 5D03A 5CBBA 5IXEA 1IHIA 4YTRA 4YVXA 1L2UA 4JOMA 5LNRA 4JTEA 2FZDA 2C7FA 1XDJA 4AZCA 5HA7A 2CW6A 1BHGA 1OYAA 3CIWA 4HB7A 3ZO9A 2QF8A 2O55A 1R38A 1H7RA 4XAGA 3UA4A 2X8RA 4I9MA 3FS2A 1GEHA 3SZ8A 4CCZA 4R53A 3DFPA 1Q8JA 3AHXA 1JZ6A 4RUBA 1O94A 1WZLA 1S46A 1XPYA 4PC8A 5E93A 3WZ0E 1YTKA 5FESA 2X42A 2KAUC 2GUUA 3HV8A 3V0UA 4KPLA 3WQ4A 3IIXA 4MSSA 4JR5A 3TWAA 4CVUA 4GC3A 2RDXA 2XSBA 1A3HA 3I3BA 1XPGA 3TYAA 1P1MA 1DWFM 1ML1A 4LS0A 4LAZA 4H04A 4AAJA 1F61A 3PUDA 4AW7A 4MY9A 3CWHA 1ZQ5A 2CESA 4DAIA 5XINA 3W6LA 4MWAA 1OC6A 4HCLA 1HO1A 4LUYA 2CITA 3R10A 4GG9A 5AOUA 1NOWA 5M17A 1TMLA 3NDYA 4LCRA 3AUJA 2J74A 3S9IA 3L23A 4CD5A 2FHFA 2FQIA 2P0OA 4F4RA 1UD2A 4AHQA 4TVDA 4JIEA 1MWOA 4BI5A 5E9XA 4GX9A 3ANYA 2QULA 1VPXA 5DRIA 1NTHA 4D6IA 3W2KA 1N7KA 3N6JA 2ZXBA 2GZXA 4MNLA 1XLAA 4KETA 1B1YA 5HMFA 3ERPA 3H4XA 2BHUA 1SW3A 1R5YA 1WKYA 3VC6A 2PWHA 4OBSA 2NQZA 2BG5A 4OQVA 4ZO7A 3WUEA 4QDWA 4PH6A 5MF5A 3H4WA 4JQAA 3KLKA 4D1JA 1GOXA 2Q8XA 4GACA 3EMQA 4AWUA 1OHLA 2J27A 4M6PA 2OX4A 4H2HA 4XKYA 3IJLA 5A8OA 1W54A 1GOKA 3DC0A 1Q6CA 5BXRA 2SFPA 4PMQA 4XZIA 4J3UA 4V27A 4UFKA 3MUZ1 2NX3A 4L6DA 3TAKA 5B7YA 3BPWA 4B92A 2GQ8A 2JGQA 3M0MA 4F66A 3MUIA 2XPKA 1SZGA 2PP0A 3KBWA 3GO2A 3MI6A 4JQ3A 4HOZA 4B5XA 4PBGA 1ZNNA 2G96A 4FK9A 3QGKC 2R91A 2YBTA 3GS6A 2XGZA 4S38A 2Q3RA 3ZR4A 4DN1A 2PDWA 2PMQA 1S2TA 1V6VA 3OHIA 1IXNA 4ADUA 4CKQA 3S8HA 3TW6A 3WQCA 1XG3A 3OYZA 5EFFA 4IPIA 1NARA 1S2UA 4GYJA 4NT0A 2NLIA 2GJLA 2B7OA 2E1DA 4H9TA 5LNWA 1ADDA 2VZUA 1X39A 4CNPA 1GQNA 2ATSA 1JNDA 1MQQA 1ECQA 2EHHA 3MUAA 1PB0A 2A3CA 2Z2UA 3T09A 1UP3A 5BXSA 4CD6A 4AZHA 5I02A 1LQ2A 4WKFA 4RNIA 1AUSL 5LXEA 4L9ZA 1OCQA 1U1JA 2R94A 1RVGA 1TO3A 4IUOA 3URAA 1RLCL 4QCEA 3NPVA 1I9CB 3NVDA 4I7VA 3GHSA 1W1A1 1J4EA 5H8PA 3IV8A 1BYBA 2EBNA 4XUGA 1L6SA 3VABA 1JGMA 1YBQA 2XHYA 4NAFB 2ZA1A 3DYMA 4MF4A 5HNUA 4EXBA 2VTFA 3BLKA 3LU2A 1Y8BA 3VI2A 3IVUA 1I2QA 2EO7A 3Q58A 2QIWA 2BB0A 2R1PA 3GDBA 1V7AA 4G1KA 3RN6A 3O7UA 3QJAA 2GQAA 2MANA 1E4IA 3W75A 2PDUA 1C9WA 2YBVA 4QS6A 4IG2A 2WNZA 4F0LA 1EBGA 3P84A 3CL7A 3SGZA 4JKMA 2H8ZA 3BOFA 4P7OA 3ONBA 2J78A 2ZDSA 1ZTVA 1XD1A 3K1GA 1R85A 3BG5A 1AZ2A 2GJXA 1IV8A 3ZR5A 3WNNA 3RITA 1QW9A 1YDOA 3MW7A 4M6VA 3NJ3A 4WGXA 3DI0A 2Y8UA 2VC6A 1E43A 5CSRA 1KM3A 2BXZA 2WCAA 3TR2A 4DWSD 1PO9A 3DFYA 3BJTA 4Q8NA 3ZOAA 1L9WA 3NIYA 4B91A 4J35A 2D3NA 3LM7A 2IKIA 3GNDA 4GINA 3UJEA 3VNJA 1UW9A 1XXXA 2I9UA 1BG9A 3PFMA 4Q6JA 3TQKA 3USBA 4FIRA 3WFAA 4CCDA 3IV3A 1P1XA 1UR0A 5A8NA 1VGAA 4LF1A 1LRTA 2WAGA 2A0NA 3AO0A 1DHKA 2X41A 1P0KA 3L67A 2V3FA 3QYQA 2GQ9A 4H9XA 2QR6A 3TW7A 5KITA 2E6DA 1AH3A 4CD4A 1ZCCA 1EHAA 3TTYA 4G2DA 4WY0B 5EB8A 2QCEA 2HRWA 4Z2HA 4YJ5A 1PZ1A 3L2LA 3UGVA 3TOYA 5A6AA 1QNRA 4UOZA 5KSWA 3CZEA 5BWFA 2VI0A 3W73A 2HPMA 1ZCOA 3B03A 3EWUA 2BVWA 4A35A 4O57A 4B4HA 1O95A 4UNKA 5CQ1A 4XZNX 4G8TA 1U5JA 1THFD 2GFTA 2FGZA 1KM2A 3AROA 3OQ8A 2YLAA 1MXSA 2XIJA 3E0WA 3PM6A 4KCUA 2WMGA 3EWZA 1JAKA 1HQTA 4NF7A 1DJNA 6XIMA 4R3UA 1Q2RA 2PI6A 3T2QA 4ADSA 1HKMA 3BSHA 2VXNA 2A1YA 1W1B1 2WQPA 3EX1A 1E4LA 1W5MA 1KBBA 4DNMA 4JTRA 3U5UA 3LGDA 5BRQA 4ATWA 1A49A 1BF6A 1CBGA 3STGA 4HTYA 4C6CA 1YDNA 3TNOA 1YXYA 5LA0A 1VFUA 3PC0A 5G2IA 2ZRVA 1F4AA 3VIFA 4CNSA 4HMEA 1BRLA 4C6LA 1UP2A 1TPFA 1TMQA 2ZA3A 1VBUA 1S2AA 4WJXA 5CCZA 1CB2A 3F4WA 3OBAA 4D9PA 3IIZA 4S3JA 1XKYA 2OLSA 3RGTA 4E8DA 4NAFA 3RO8A 2G95A 1LQ0A 2Y7GA 3W1RA 3BW4A 5LKYA 5M2FX 1XC6A 5EY5A 4WDUA 2ABAA 1XC4A 2E28A 3CTLA 2Q02A 3EPOA 3GNXA 1F6KA 4OE7A 4DQWA 2PDXA 3GFYA 2DZWA 3L4WA 4HD5A 2O9OA 3GSMA 1XLFA 3WMCA 3L68A 4PMXA 3AICA 5BZAA 2GSJA 4PTDA 5BROA 1G7VA 2XN0A 2MNRA 1MQPA 2YL6A 2WC4A 4HNOA 3RUBL 3BUVA 4IPPA 3S5ZA 2ZWZA 3VNYA 1SFTA 1JCNA 4S3KA 3B8IA 3EKZA 1MRAA 3UR7A 1HP5A 3UZWA 3IUDA 4PMRA 2Z29A 3O1NA 4DYJA 1GT8A 4KKXA 2ZOXA 3ZMRA 1C9DA 3VAVA 4LVBA 1XLMA 4DWSA 1KFBA 4ZQCA 3EA2A 4YYCA 2IUZA 4UNIA 4FF5A 2VDHA 2VX5A 1F8IA 1EXBA 3EZ4A 1QFEA 1VBGA 1DV7A 4O19A 4OT7A 5F1UA 1QASA 2HCVA 3HG3A 1WYIA 4JIHA 1M5WA 3CMGA 1C8YA 1A5BA 3CQ0A 4FSAA 3VE7A 2PDYA 1Q4WA 3KE0A 4RXFA 1LLOA 1TV7A 1GZJA 2BY3A 3KCJA 4PN2A 1B30A 2GK1B 3OTRA 2E6AA 3MYOA 1SU5A 1GVOA 1KFEA 2A6LA 5XIAA 2V3GA 3VKKA 2YA2A 5CH9A 3PJWA 5C7HA 4KIRA 2QUTA 1W8SA 5BU9A 1LLWA 4CEXC 1WE5A 4M1BA 5FF7A 2DZAA 2V2HA 2FKPA 3CGTA 1R2TA 1XIBA 3OW1A 4F0HA 4GUGA 4PCNA 1X97A 4Q4MA 5AC6A 1OT1A 1GQLA 1TWDA 4I90A 4LRSA 4UB9A 6A3HA 5U4NA 5KEZA 1VFSA 1H5YA 1HTIA 1D7FA 4JYEA 4Q4OA 4O28A 3BOLA 2EPLX 1UKSA 2O56A 3BG9A 4XD5A 2YLLA 4DVOA 5DO8A 3LCGA 3RLUA 5K3VA 1TPC1 4NNBA 4FNTA 3TLLA 3FLUA 3CZGA 2VWSA 3NQVA 4S3CA 3NZQA 4GY0A 3TP4A 1AW5A 4BQ5A 4E4FA 3MQTA 1JVNA 4UQAA 4H41A 1CGVA 3LPGA 1BYAA 2GGEA 2WBGA 3GVWA 4PULA 3CIXA 4NNAA 3CAQA 3E49A 5ABEA 5FI8A 2WB5A 5HJXA 1F9CA 1HT6A 1VC4A 4JCMA 4W93A 3WF2A 3S46A 3USZA 2J4GA 1EQCA 2PP1A 1K9TA 3CHVA 3EPNA 1DEDA 2WVVA 2I5GA 3HPFA 4GO8A 1JPMA 4ONVA 1DJHA 4MUZA 3M7WA 3FAXA 4XTIA 4QJ5B 4UWMA 3AIWA 4LWWA 1R9XA 4LTSA 1JD9A 2E67A 4ZQRA 3KVKA 4LVDA 1CYGA 4KWSA 4WSHA 1YYAA 4L80A 3WBWA 5DCBA 2HS6A 4FPSA 3WLLA 1G0CA 1ADOA 1Q6DA 4LS1A 4DJDD 4OTKA 3BLOA 5LZLA 2CZEA 1JEZA 3GTFA 1KQZA 1BTMA 1G69A 3XISA 4MJZA 4MWAC 2HDJA 3K4DA 2OSYA 3LX9A 1PJ9A 3M5ZA 5BOFA 2Y0FA 3BLFA 4MNMA 2DORA 4GQBA 1F76A 3G6LA 4H2CA 3WLMA 3NM3A 3M9YA 3H7UA 3GTNA 4P7QA 3VD3A 3AWNA 2ISSA 1QNPA 4CLMA 3QR3A 1PV8A 4PUWA 3BICA 1TTQA 1EJSC 2FFCA 5A2AA 2DU2A 2HBVA 4N9DA 4K7VA 1EJUC 4P8VA 2QCGA 1OF6A 4FXFA 3M64A 1XKJA 3GG8A 4HMCA 1SSDA 2ISFA 4EIVA 2AQWA 4IIEA 3VIIA 4LC6A 3LPPA 4O52A 3ZYZA 3C2FA 1LBFA 4I5XA 3HQNA 3DN5A 3TE9A 3GDTA 1H0GA 4YYFA 1PX8A 3D47A 3LI0A 3TW9A 5LGXA 1YTDA 3PZIA 3CB8A 1XSJA 1GPWA 4ZENA 4KEVA 4NVTA 2RDTA 1KXQA 1IF2A 4A3RA 3A12A 3UVAA 3GHRA 3TSMA 5ENLA 1DQUA 1VJIA 1HVXA 2WC7A 5D8WA 2J6VA 1R6WA 3PPFA 5BOOA 1BF2A 1RJRA 4JHOA 3OZOA 1DTNA 4W89A 1JZ4A 1HJVA 5FEZA 1I75A 3AXKA 3OZYA 4Z42C 1TZZA 3UWWA 4ZSUA 2CXEA 2VR4A 3M46A 4HPJA 1PKLA 4M5PA 1CXIA 5CBIA 1JCYA 4AWEA 3W1NA 4LOCA 3A4XA 2RJHA 2DUZA 1D8CA 3W7PA 4Z2LA 4ACZB 1SR9A 2PF8A 1E6SM 1AJ2A 3ARTA 1V3IA 1I2RA 3O06A 4AH7A 4H9UA 1H51A 4L1WA 3M43A 1QXLA 1LL4A 5A69A 2VCAA 4EWND 4X2RA 3DFTA 3FSUA 2YXGA 4A21A 1CTNA 4A2SA 5IDZA 1NP0A 3SAZA 1VH7A 3AIEA 3W7HA 4CCCA 2AQVA 4ZFMA 4C6DA 3QQ0A 1OX4B 1OFPA 1ZL1A 2QJMA 2XIMA 3M0HA 3LZ3A 1E6XM 4PE8A 3MB9A 4M6UA 5FAJA 4B5SA 1TJ2A 4CCEA 1WPCA 2Q71A 4A8LA 2A21A 4N7QA 4E2OA 5F2LA 1NDWA 3PUGA 1N82A 1RHCA 2OKOA 2BV9A 4B5NA 4NL1A 1XISA 1QMLA 5JIWA 4G7EB 1PX4A 4V2XA 2WPBA 4MKSA 3PBGA 1QHZA 5JBDA 1VBHA 3OLEA 2D2OA 3MMWA 2DSWA 1PIFA 4P5UA 1JDDA 1N8WA 3VGDA 2I17A 4XO6A 3PAOA 4GCAA 4H7ZA 3VNLA 7TAAA 3KOYA 3RLVA 1GQIA 2PODA 3S4TA 1ZBCA 1F07A 4NAEB 3CO4A 3W82A 1ZENA 3AHYA 1EH9A 4TVCA 2INEA 5HWNA 4V15A 2WLYA 1MO0A 4Q6XA 4V28A 3PFRA 2PTXA 3RHGA 2G50A 3UR5A 5ABGA 4EX4A 1RH9A 5C70A 2FPTA 3DHFA 3AQUA 2CLMA 1NJJA 3I6TA 4QLLA 2QW5A 1UR1A 4O1EA 4DLFA 2XVKA 2Y5SA 3WK2A 1E6ZA 3P8JA 4L61A 3H53A 1B2YA 3I6RA 3LRLA 2PLKA 4JDYA 2BY1A 4Q4RA 3G3MA 1QOXA 3ELFA 5H1WA 5FL1A 4QP0A 3E12A 3ZWSA 3D6NA 3CV2A 3GUGA 2INZA 3GUWA 4MZ8A 4KWVA 2HXUA 5JH2A 4G5DA 2CNCA 4BF7A 3D5HA 3DECA 3HGRA 4X0VA 4CEUC 2F9RA 2ZTJA 1Q6RA 4B15A 3TFXA 3G8EA 1DYSA 2WZIA 4M56A 4LY8A 1OCJA 3TROA 5LHFA 3T4WA 4BF9A 4BZYA 3KVLA 3NYDA 2XVLA 2ZXAA 3GWQA 2PGRA 4K8GA 3BW3A 3M0VA 1E1CB 5IHSA 4RE4A 1K77A 3WQWA 2HVNA 4E2VA 3ZXWA 3A3XA 3THDA 1CXKA 3Q65A 2I9EA 3EOEA 3W9ZA 3A4AA 3DUGA 3ITLA 2ZX9A 2XIIA 3IJDA 2OG9A 1GZ1A 3W1UA 3PF3A 1Q7ZA 2NZLA 4CD7A 3N3MA 2PTWA 3LA4A 4QAIA 2XU2A 3WMBA 1OX4A 3TKFA 2ZX8A 2BDQA 3L2MA 1X6UA 2VX7A 1Y0EA 5C55A 2VZSA 4CQ8A 1VBJA 3SY5A 2WVTA 4C1NA 1S2VA 3M41A 5D30A 5DMNA 1HUVA 4FR1A 3B3DA 4NZ1A 3POCA 2XSAA 1W5PA 1UH4A 3GXTA 2FTPA 3THQA 1VCFA 4PUUA 1GQKA 2IKJA 4MMWA 2DZVA 4MYAA 4L6HA 4G7EA 1Z44A 3AAMA 1UA7A 1RPKA 3STEA 3QXBA 3NPXA 4IHCA 4WX2A 3URBA 3PPHA 5DBTA 1KKRA 5DMYA 1DWAM 1AG1O 1RSCA 3PG9A 3HGJA 1F3XA 3N6HA 3SCSA 4B9ZA 5AC4A 3TN6A 3NZGA 4XISA 2C71A 3SRHA 5JBEA 4RZ6A 2ZUUA 1ITCA 3BURA 7CGTA 2X7WA 4NAEA 4Y6GA 1DP0A 4AF0A 3C5QA 3ZR6A 3JUGA 1EEXA 3V5OA 4KRZA 4MWAE 1WOBA 3KEHA 4WUIA 4MB1A 3JS3A 4FIQA 1VYSX 3R5EA 4NQ1A 4K1WA 4JICA 4BQ2A 3W84A 1VBRA 1GWJA 4J3WA 4L4PA 2QDDA 1R3TA 1JULA 4GVGA 4O18A 1OFOA 2C14A 4KMQA 3WDQA 2J7BA 3M0YA 2YZRA 7REQA 1W1VA 2QCDB 4W8LA 1C8VA 3M7SA 2Z1BA 3QSRA 4HA3A 4U10A 5DT7A 3LQLA 3BV4A 1O68A 1A0CA 3WLIA 4WR3A 5H2ZA 4TU1A 3DC8A 4XZHA 1MSSA 1VYPX 4GWEA 1A53A 3DERA 2V2CA 4MTVA 1ONXA 5A6BD 3P2VA 1TV3A 1DWJM 3PZOA 1CENA 2W91A 4MKNA 3W7OA 1I2OA 3I4KA 4M3PA 1E51A 2HNEA 1WDQA 5A6MA 4KF1A 4RE2A 3GXPA 3F4DA 1TIMA 2JQXA 2C1IA 1MUCA 2HE8A 3BJSA 3NO3A 4BK9A 4W8AA 3B06A 1JQXA 4RXGA 3CU2A 1OD0A 3WQVA 1AQMA 1XYCA 1WAUA 4KIEA 1ISYA 3S6OA 3AIBA 1LDCA 2WWDA 2E09A 4X0NA 4ZO9A 3LHWA 2TAAA 3KXQA 4PYSA 4O16A 3CK5A 1DJIA 3CXOA 4IISA 4IM4A 3RAOA 2AQOA 3O63A 2NXIA 1QPKA 4NKCA 1PIIA 3A4JA 4KQNA 2X40A 1B9ZA 1FX6A 3NZ1A 3SN0A 4WXZA 2R8WA 1V3JA 2D2HA 1KFLA 3G22A 4ZR8A 5DEZA 3BV7A 3WJZA 2I1OA 1NEYA 3O3RA 1OY0A 1EP2A 3OLDA 4O8RA 5I0DA 4BR1A 3WQ8A 5EFDA 1TUXA 1MZRA 4LSBA 2GGIA 3T78A 4AQLA 8XIMA 1GVIA 4IJRA 3ATZA 1A5LC 3EB3A 4XSLA 4F40A 1KXHA 4AY8A 5DT5A 2P3EA 1PXGA 4A29A 1D3GA 3U7BA 3SCPA 4N9EA 4OU1A 4JNMA 4MDPA 4NJHA 1LUCA 4K36A 4R7JA 3VMOA 3N9KA 4HVXA 4JD4A 5KTLA 1QNSA 1TTPA 3QV7A 3RRXA 4HHHA 1BWKA 3UZXA 2GWNA 4AWTA 2CU0A 2PURA 4H4IA 5CJ5A 2E68A 2BFGA 4RPPA 3QY8A 5HQEA 4AZ6A 3KAOA 6CGTA 1S38A 3B9NA 1J0KA 1XWYA 1AFSA 4S2CA 3H2NA 6PTDA 5REQA 2PRLA 3RCYA 1TRDA 4GH1A 1F5ZA 2Y1HA 4X9YA 3K8LA 4DUXA 1VFTA 1BXCA 3KBNA 2YCLA 5IBXA 3EKGA 3FKKA 3Q67A 2OLHA 4H8VA 2GLKA 4R88A 2J88A 2P76A 3TC6A 1ZJHA 3B04A 1KTBA 4ZO8A 1PX3A 4EP8C 3ITYA 1XDLA 1M01A 2REQA 1GW1A 3EB4A 3EDEA 3CIVA 3P0WA 3HGOA 5A6BA 1GG0A 3T55A 3IK2A 3A6OA 3LXAA 3L5AA 1J93A 1QPOA 1FUYA 4YIWA 1TQJA 5IFTA 4PTXA 2VDGA 1UUMA 1O60A 3WEMA 4QAWA 4KH2A 1K1DA 1BKHA 4HU0A 3HFTA 1C92A 4HZ8A 4K8HA 1YXCA 1EQPA 3THAA 4AX7A 1QI5A 3T40A 1IGWA 1BVWA 3FJ6A 3WH5A 4HZ6A 1P48A 1J0JA 2OT1A 5MHBA 1OIMA 2VEKA 3SM0A 1FWGC 3WNKA 1AK5A 2C0AA 2VR2A 3NL2A 4J3ZA 3MHUA 2X0YA 2WNQA 4ZOAA 2A85A 2ZQ0A 3FJ4A 2ADAA 1OG0A 1EWEA 1V6WA 1YDVA 4AVNA 3NTYA 3MKKA 1XIJA 3TMQA 3OVPA 1BSLA 2A6NA 2VO5A 6ALDA 1Z41A 1JL8A 1WUEA 3MBDA 2V0TA 1QVBA 4HCDA 3BCDA 2CKRA 1JG9A 3GR8A 4W4QA 2A7RA 1EJRC 4QX4A 5JH1A 3DCPA 3CAKA 4YHGA 2ZUNA 4W88A 2PWDA 1OGGA 4AD2A 1EIXA 1Q7QA 3UA3A 2OZ8A 1KR1A 1EPXA 1PTAA 2XM2A 1FWTA 4ZB2A 2TRSA 1IR2A 4OUEA 4HJFA 1F73A 3NZPA 2ZCGA 2MUCA 1P5BA 2XVGA 3IGXA 2BGQA 1LBMA 1R7AA 4OKDA 1WDRA 1XBXA 3N2XA 4IZGA 5FJUA 3U5YA 4MVAA 1UIOA 2HNHA 1Z69A 3RPTA 4XB3A 3NWRA 1D2KA 3O07A 3A9IA 4LVAA 4XD6A 2GL5A 7ODCA 1A3XA 5TAOA 3LUTA 1GOWA 2J75A 5BWAA 2BWGA 3W7RA 1UZ4A 1Q6QA 2X30A 2HPIA 1KM1A 3N4FA 3UXKA 2WHKA 1J18A 3LPFA 4F9JA 4PEEA 1RP8A 3EX3A 2QJIA 3NUKA 3BSMA 5CPQA 3W1XA 1PTDA 1K9FA 1TIWA 3SRDA 4ERIA 2PGEA 1W3HA 1PDYA 5CG0A 2J8GA 1UKQA 2W6RA 2ICSA 3BAKA 4RE3A 3TJLA 2F38A 4HSHA 4REQB 2V30A 1MNZA 3PAJA 3QPYA 4RR4A 3UT0A 3RCMA 3F4VA 3HQOA 3W7DA 3R12A 1IE7C 1N2VA 1J11A 2GUYA 2FDMA 1HIZA 1KRBC 1JZ7A 3QY7A 4OHQA 2VQUA 4O11A 1H41A 2PDJA 7A3HA 5HWMA 2GDQA 4JN6A 4DXVA 4HU4A 4EPEC 1SMDA 2HK0A 2PE4A 4XKMA 4ZMGA 5EKYA 3WD4A 1MFUA 6REQB 2P50A 3RFAA 3FDKA 1FHUA 4UTWC 1G1YA 1ITQA 1MVYA 2Y7FA 2GGHA 3NSXA 3GC5A 4DJED 3AWOA 1BVZA 3W2LA 1K4HA 1XRFA 5I3JA 4I7WA 3ARSA 4F3HA 4ZEPA 1XF0A 1TWIA 5CC5A 4NILA 2WCSA 2Z1XA 2BMBA 3LV5A 2VEMA 4HN4A 4DO4A 2PDCA 4N4PA 1ISXA 4Q8PA 5D2XA 4DBSA 3WH9A 2IXVA 4K2SA 3PBMA 2YOCA 3SCOA 1KR0A 1SFJA 3UZYA 2XIOA 1EC9A 3WH8A 2POTA 1AA1B 1GOOA 3H24A 1XH2A 3EXSA 5KZ6A 2DV0A 3MP3A 4HA4A 5G4HC 5AYYA 3BZGA 4W8BA 1FHLA 1E0XA 1KRMA 3H7RA 4Y8FA 5IOBA 4TV5A 3E96A 1X8FA 1JPDX 2WKLA 3M0LA 3A22A 1Z6KA 4AX6A 3R25A 2ZZ2A 5A6TC 3ABQA 2DSKA 2B81A 1GEQA 1RR2A 3HPSA 4AY7A 2G97A 1W17A 2CWXA 4XSMA 3L12A 3WY1A 1MUWA 4PMYA 3NDOA 2RH9A 3ITGA 1ISWA 2XVPA 1V02A 5FL0A 1KFWA 1TX0A 4C6MA 3ZSSA 5HR6A 2QNEA 4FF7A 2Q8LA 2PDIA 3LPOA 4DRSA 1OFQA 1V6UA 3OU8A 3S1XA 1TV8A 4AMAA 3HG4A 4FOJA 3LI1A 2CKSA 4IFOA 1SMAA 2PFHA 3LNPA 1XYMA 3FK4A 4FMVA 4HA0A 5J04A 2B7PA 1POKA 5HR7A 2PU1A 2D0FA 5A94A 5E5CA 2QGHA 2ISDA 4Y9MA 3MWAA 3NYZA 1OM0A 4ZVJA 3VNDA 3TMLA 3C2YA 3IUHA 3FDGA 4MKVA 1O7AA 3HJZA 2E77A 3I7QA 3N73A 4IQEA 4M29A 1K8ZA 3ZM8A 3M6DA 4AYSA 4AXKA 3TUUA 4XTDA 2QCLA 4UMCA 3LHVA 5I5RA 1V79A 3UWEA 3RPDA 4IMGA 1YW1A 4FNQA 1LT8A 4GI6A 3TK7A 4REQA 3AYVA 1S3TC 2IXUA 2GVGA 4QE5A 3ARQA 4GGBA 1XFBA 5DMLA 3EDKA 2GJRA 4K37A 4GE8A 3LMZA 3UY8A 4J3VA 4PMOA 2O4QA 1P7TA 3GH7A 5CPTA 3UG4A 3KRBA 4C7GA 5K9DA 1K9EA 1O6IA 3DYPA 3ZFHA 3GU1A 3QHOA 3COTA 1PWMA 1VKFA 2FGBA 6REQA 4UTTA 1KLYA 2PLMA 1VD6A 1EDGA 5CLWA 1JD7A 4GC4A 1A5SA 4MIMA 2ZVIA 3CNYA 1PCWA 3K5XA 2WKJA 3N13A 1KBJA 3AISA 2WHLA 2A3BA 4NYUA 1TWZA 1JF5A 3H2AA 4TX8A 2P53A 2O4MA 3S83A 3VOIA 4WJ8A 3QR1A 2NV1A 4LAOA 1R2RA 2V6AA 2CZ5A 1TUFA 2XSXA 1T40A 3GLCA 2E4TA 3G18A 3O0FA 1TR9A 4XVEA 3UWVA 3SRKA 4OFCA 2WSQA 4E4UA 3KWSA 4Q4PA 1F6YA 1L6YA 4IF2A 3E0LA 3NAVA 2OU4A 3NSNA 2PBGA 3WBYA 3QW3A 4UQ9A 2AL1A 3H26A 1JDFA 2OEKA 3QC3A 3LYEA 1HZYA 1VCVA 4LALA 3HPXA 2YA1A 2PUZA 3KL5A 1H4PA 3SN4A 3NR0A 3ITCA 4L64A 4XBJA 4XAZA 1UR8A 4BQ3A 1RCQA 1G01A 3WG6A 4GIYA 1F2JA 4QQ3A 3CJPA 2O9TA 3HOJA 1K3UA 2WMIA 1PSCA 4DZHA 1GGOA 2AKZA 4GPNA 4FNPA 4WOQA 1X6NA 1AODA 3O6CA 2E5BA 2XYLA 4JTHA 4ILSA 1OGSA 2A5HA 2WMHA 3NDZA 4EAYA 4HK7A 1JF6A 1CGTA 3NQDA 1VFMA 1N8IA 1X8CA 1BG4A 1DJWA 3FYYA 3MO7A 3DGBA 1F3WA 1KFCA 1UBSA 2GUBA 5E9AA 1B4KA 3GDKA 3IRDA 4N6FA 2YGYA 4AD3A 5ECUA 4I5UA 5CZJA 3BJFA 2OQYA 4L4LA 1E9IA 2D20A 3CUJA 3GY1A 2ZADA 7ENLA 1FWSA 4W7UA 1UQYA 1BQCA 2X09A 2Y24A 4TIMA 1YNYA 4RK8A 4MUPA 2H9AB 3VIKA 2QXWA 1UPMB 2GVLA 3KUMA 3II1A 1ONRA 4F2UA 1UHVA 1JXJA 2WSRA 1ZUAX 4UTLA 3N6QA 3BLLA 3CL8A 4L5ZA 1TPDA 1KM6A 3M0XA 1XYFA 4JTQA 1LM1A 2WLZA 4HKPA 4O14A 3UFYA 4JTFA 9XIAA 5CJNA 1J10A 3VIGA 4INFA 1SW0A 4L1XA 3TYBA 3OG3A 5T9BG 5F7UA 3L4TA 4UTFA 1KRAC 1EWDA 2XN1A 2HJPA 4TX6A 4KWWA 2WZHA 5GJNA 5GPRA 1E55A 1NDYA 3INPA 4TTGA 2Z6IA 1FCUA 5T26A 1J9YA 1RK6A 3T8QA 3GK0A 4XZWA 1ICQA 3GVVA 1VQTA 4WJEA 1QPQA 3U48A 3S1UA 3XINA 5IBXC 4IIBA 1WXYA 4FS9A 4HHLA 2ZE3A 5SWUA 1VZWA 4ATDA 1P6WA 3CB3A 3UPMA 3QFEA 4X2PA 3NXLA 4XV0A 1JCMP 4QEEA 3W1TA 2WM0A 3T0AA 2C0HA 2G3JA 4FNSA 4MADA 2IQDA 3PBUA 3BAWA 3EEGA 1F74A 3VOGA 1K7FA 2C1GA 3SADA 1VPQA 2OWCA 1G4EA 2H8XA 3G1RA 1V6XA 2VM8A 4AD1A 3QC0A 1UWSA 2OTDA 2PSNA 4MGGA 1JDCA 2RDWA 5D37A 4QTGA 3IWPA 2CCRA 4JIPA 1QHPA 4N4QA 4XZLX 5M1TA 3AIQA 4QBXA 3LENA 1B3VA 1ODZA 5AC5A 4GQQA 1ZAJA 2QCNA 4NX0A 1MQRA 3KRZA 2DZTA 4WEVX 3PNUA 1E4NA 3MSYA 1NDZA 4Z0SA 1RJPA 4CUCA 4PB4A 2B4GA 4Z1DA 4W84A 4UMAA 3AMDA 1UD5A 2OWXA 4Z1BA 4LCQA 3B0UX 2AAAA 1GUVA 1Z3NA 1N8FA 2PWFA 4J3TA 3B05A 2YL8A 2VOTA 4IFKA 1UZDA 5EU9A 1LRQA 2V81A 3E0FA 3RO6A 4AWSA 3STCA 3IGHX 1NDVA 4ZXLA 5I00A 1BYCA 3EXTA 4TV6A 3RDKA 3VD5A 3IACA 1OABA 1LYXA 3JU2A 3N3TA 4Q7BA 2UY3A 4IWWA 1OX6A 1TB3A 3FJNA 1HJXA 3QHMA 4P7NA 1SJDA 1K9DA 2GJNA 3RX4A 1AQHA 3C0JA 3KFTA 1VP5A 4PCTA 3SCWA 4M7TA 4YCOA 2EG8A 4UFHA 2J7GA 1TVLA 3WX7A 2YYUA 4JTSA 1HW6A 1QW8A 3EWWA 4ZE4A 2L5HA 4PRWA 3CAWA 1DHPA 1UZ1A 3E2QA 3QPEA 4HJWA 4W9TA 2NQJA 1E3ZA 1P6CA 4QNEA 1GKRA 4FXJA 4Q8TA 1TVPA 4XZBA 4K6AA 1G5AA 1WA3A 3LDVA 4GJIA 4CN1A 3VOCA 5LHEA 3QV8A 1XLCA 1B90A 1AH0A 4PB5A 1GJPA 1A3WA 2NUXA 1GKPA 4MAVA 3VOFA 1PZ3A 2OFJA 4B90A 3CWOX 2ZUTA 4IQLA 3H21A 3CLMA 4PODA 3FGCA 1HXJA 1IWPA 4H1ZA 3WH6A 2ZVRA 1YIXA 3BH4A 4C6IA 1AQFA 3V1HA 5CEWA 5LYRA 4X3ZA 1R86A 4DNHA 2EKGA 3V0TA 3IIOA 5AYIA 3W6YA 3PZ9A 1ISZA 3TA9A 1SM9A 1NM9A 4DUOA 1OT2A 4GISA 3R58A 2CPUA 3L0GA 3LD5A 3EOSA 3TAOA 2ZZ3A 4RNFA 3VU2A 3RF9A 1KCXA 3UEQA 4Q4QA 4WY0F 1GYLA 3VVGA 3IJIA 2YW4A 4UQDA 4DY1A 1TR1A 5HNTA 3WDIA 3HPAA 3MMDA 4A05A 4E2DA 4HCHA 4XBSA 2ZZ6A 4E8CA 1H7XA 3LBMA 1JI1A 3EDDA 1MDRA 1SO4A 1HGWA 3TSDA 4W5UA 1CX9A 1POJA 3CYVA 1W9VA 4O1BA 4Z2GA 2CBIA 2OCZA 3IVSA 3Q45A 2D1ZA 1ONWA 5GNYA 4GLEA 3TCEA 4NJKA 1REQA 3DHUA 1LWIA 3PB0A 4OECA 4U5IA 4D6HA 1TTIA 2RDUA 2I16A 4D6JA 2BY0A 2XFFA 3MCMA 3GAYA 2DFAA 1R3SA 4IP4A 5EMKA 3VKAA 3APGA 4YTTA 2LLEA 1PEZA 3B4YA 5I03A 1JYVA 5DN1A 3LS9A 1TA3A 4FXSA 4P2VA 3H6OA 4CU7A 2ZXQA 5M5DA 1TJPA 1UASA 3QH2A 2WC3A 2C16A 1H7WA 3AJXA 2CBVA 1B9BA 1QO5A 4PTMA 2ACSA 3B0XA 4CQAA 3CHCA 2E7FA 1OYCA 2YCIX 3VD4A 4KCTA 3DBNA 1RPXA 4PUKA 1YX1A 2VFEA 3WFZA 5C2GA 4HIBA 2BHZA 3OO2A 2ZZ4A 3V18A 4CU8A 2G3MA 4MNKA 4QISA 1E4MM 1BVNP 4JPGA 3SFKA 1KO0A 2HBXA 1KFKA 5AZ1A 3KW3A 3UW6A 4RZ5A 2IQ0A 1VJSA 4XAPA 3SCNA 3UCQA 3EWXA 3P8IA 2ZC1A 3GDMA 4H3DA 2B0MA 1TZ7A 4W85A 4JGDA 2C19A 2OZTA 1TV5A 4FZIA 3NVTA 3LEPA 5KZMA 2NXGA 1SZEA 3P74A 4GFIA 3B0VC 2P1FA 2BNJA 4GXMA 2V9DA 2OPJA 1WKEA 4FAMA 4C6PA 5F2IA 3SQLA 4Z2JA 3WF0A 4GJJA 2RGLA 4LF2A 3A4WA 4H9ZA 5TNVA 3GU2A 4MPKA 1GVQA 2BOGX 1UR9A 1KBLA 2VUYA 2BOFX 4KERA 2OSWA 4MYXA 3OA3A 1QPRA 1ODUA 1VFOA 3GR7A 3SN1A 3KRSA 1LWJA 2Y4SA 4H6KA 1G9HA 4UTTC 4DLMA 3B9OA 5E1QA 5E0CA 5FKYA 3H4GA 3VDBA 3VZYA 2ZE0A 2FZ9A 3RMJA 5LSMA 3A3HA 1V03A 3LB0A 4TMCA 3GB6A 2RGMA 2I14A 2FYMA 1PHWA 1KV5A 1RA0A 1CLXA 2DVXA 3AXIA 2H3DA 1GW9A 1XSKA 5G1MA 4U5KA 4AZCB 1WUFA 2BLEA 3GIQA 5DXXA 4I9AA 3IK4A 3G1DA 4OOUA 2Z7GA 4B9YA 4UTKA 1UJPA 3PUOA 3WO8A 4NZJA 4JQ2A 1RZMA 3W00A 4AIOA 3VTRA 4JX6A 3W02A 1PZ0A 1OBAA 1MZHA 1XLIA 4Q8OA 4WF7A 3PWIA 1NF0A 1L8PA 4MZ1A 1XYAA 4OZOA 8XIAA 2B31A 3LQGA 3QF0A 1DJGA 3MVTA 3LHYA 3OVRA 2OOFA 3OBEA 2VNCA 3P0XA 3NA8A 4Z1YA 3TYUA 1GVSA 3QV9A 3SSZA 3DEQA 4PZVA 4YPJA 4HQVA 4NJGA 2G0WA 1AJ0A 4JTLA 3SCVA 1VLWA 1ZJBA 2FTWA 1LL6A 1SFLA 4BJHA 3I10A 5C2CA 5AHLA 4QE4A 1RQEA 4Y9OA 3KP0A 3GXMA 3KL3A 5CZTA 4JTUA 4Q4KA 5BU6A 3W86A 1DIOA 1R3RA 1NQ6A 1O5RA 3L66A 1XLDA 3U6WA 3ARWA 3CV7A 4IP7A 4JNYA 5CPOA 1L6GA 2GSEA 1IT0A 1Q8AA 1ZJAA 3BARA 1JIBA 2EXOA 3BK0A 1Q13A 4JFWA 3CC1A 3B8VA 2AGKA 1EOMA 3N12A 3U4AA 4CNNA 2FJUB 2CHNA 4K68A 3S3GA 1AQ0A 1Q6EA 4DF2A 2NSOA 1F3TA 2DJXA 5LIWX 2JE8A 3LZ5A 3G2GA 4UQBA 1KWGA 3W72A 3FAWA 1ITXA 4Z0JA 1DJYA 3ZWTA 2DT1A 3K8MA 2ZFAA 3VCNA 2PF0A 5CKSA 1AH4A 4RW3A 2EJAA 1OFRA 1M7XA 2W62A 3C4UA 4A8IA 1K8CA 2HEJA 1EX5A 1EIBA 3GG7A 4JEJA 3M0IA 4G7FA 1DIDA 1ZS2A 1LCOA 3LY0A 3TVAA 2ZDRA 4GIEA 3KVMA 3ABXA 4LEFA 3G8RA 1OADA 4CQ9A 1NFGA 3QGVA 1VCGA 2XISA 3GW3A 1HGYA 4JHMA 4LEQA 1OC7A 1V3LA 2J9ZA 1YKWA 2EQDA 3AYRA 4C7DA 2IS7A 3MMTA 1MFVA 3PSVA 2C1HA 2J62A 4LS2A 1UKTA 5AYZA 5EGRA 2DIEA 4QSHA 3D0CA 1R8LA 3O9NA 1B57A 1MW3A 2ZXDA 1W3NA 1LWHA 4PUEA 3KOWA 3I65A 3RYSA 3P5ZA 4GIAA 3AZTA 2XUCA 3PSWA 4UZUA 3N9SA 3PS7A 5T8GA 3WIJA 1W3KA 1DJXA 2ZZ1A 4EF8A 4JS3A 1E40A 1UUQA 1R9YA 3GTXA 3NG3A 3WCZA 4BS0A 4B2DD 4ALDA 2V82A 3SB0A 3GG0A 2QIIA 1EX1A 2V67A 4LBRA 3RILA 4S3DA 1CI1A 5HPCA 3KX6A 1GG1A 3ARZA 1K7EA 2FPVA 3EMZA 3SDOA 3AJ7A 1TPUA 4Q32A 2DDXA 5HANA 4FO4A 1EKOA 1FWDC 1TCDA 2DZPA 4OV9A 2ZZ5A 3NXFA 2YCJA 1YBQB 3T7VA 3WF1A 1HJSA 3SW6A 1KXTA 4N6EA 5IFPA 2QVHA 3VK5A 2E0PA 3H8AA 3KBVA 1OF8A 4AZIA 3BLPX 4C60A 1JI2A 1MXDA 1FHVA 3WH7A 3E1F1 1P4CA 4DI9A 3UXDA 4HA1A 1J6PA 2CYGA 3DFOA 2Y88A 2OODA 4O8AA 2VZOA 4IG2B 2OEJA 3G77A 1R7OA 4AD5A 5BMWA 3TSBA 2CZFA 1W37A 4DO7A 3N2TA 4QE1A 1FWJC 3BZJA 2OGYA 2YIHA 3GNPA 3PWAA 3G0XA 4PL2A 4YVVA 1M41A 3CAVA 1V0NA 3WMLA 4JFSA 3N2OA 1W5NA 4OVXA 2ZRZA 2GJXB 3W0KA 4IICA 4EANA 4UQCA 1UWUA 2HWGA 4DJFA 3GYEA 1M68A 1GCYA 3BLEA 4HSNA 3M0JA 5A95A 3VOHA 2ZRUA 3APTA 4QEHA 1A5OC 4LBUA 4AD0A 3ZS4A 4O15A 1QNOA 1RP9A 1GJUA 5DBUA 3LN3A 3QEZA 3HV9A 3ITVA 2PS2A 3LOTA 2G4FA 4LAKA 1GVYA 1UR4A 2DSUA 3G3DA 2XFWA 1JGIA 3TZFA 2XH0A 4YLWA 4HK6A 1MRQA 3NQGA 4DBEA 4GRSA 4PTWA 1KTCA 3JR2A 1FWRA 2W92A 3UJFA 4ZTYA 2QAPA 3KBJA 3STPA 2Y89A 4AZ7A 4P61A 3WLRA 3QZ6A 1WXZA 1PIGA 1H1ZA 1GVFA 4K7YA 3HPZA 4CN6A 3LGEA 3QVQA 4ML4A 2CHOA 4KFPA 2CERA 4D8AA 5EBUA 4G9PA 1ZSXA 2VRQA 1J01A 4PBFA 1V8EA 2OT0A 4KGLA 4JY8A 1HFBA 1JNEA 1X7FA 4BCEA 3EOLA 3TTQA 4QHRA 4RV3A 3HB9A 2JFEX 2EG7A 3GBEA 2E9BA 1TX2A 3M4HA 3TJXA 3NQEA 4X22A 2DQWA 1OEPA 2YXXA 4PEKA 3VZXA 4IPNB 2OYLA 4RDVA 4F48A 3H7VA 1XYBA 2IPGA 2J7FA 2V68A 1LOLA 3ZT6A 2F6XA 3GVRA 3VE9A 1BRLB 2YDQA 5A6JA 2WZMA 4XX6A 4ZQPA 1M1BA 3UJSA 1UD3A 3S5SA 3M16A 2P3ZA 3W87A 3C61A 3SUWA 1LL7A 1KKOA 4ERAA 4F2BA 1JPIA 2NVDA 1DJQA 2EPNA 3TNBA 3CHDA 3KHDA 1CGYA 5CAKA 3LERA 2R14A 3RX2A 3C0SA 1UC4A 3RXZA 3TJIA 2DZXA 2VGIA 1TPVA 3J7HA 4ACYA 5HK4A 4OGZA 1VRXA 1V0LA 3CZKA 1BWVA 1QT1A 2WSKA 1HP4A 1ZPTA 3K30A 2Q6ZA 1P6BA 2WNNA 3MDWA 2J7DA 5EMYA 4HNCA 4JYFA 2V2DA 3AHTA 4BF5A 1CLVA 3UWYA 1QOPA 3BL3A 3ZJKA 1WO2A 4HPGA 1W3TA 4IJCA 1V0MA 2AOSA 5FF2A 1JRBA 1OGBA 1T7LA 2V8ZA 4TO8A 5AYXA 2QCFA 2Y7DA 3IJ6A 4LT9A 1XP3A 2QDHA 3OYXA 4US5D 3TTEA 3T07A 3UYCA 4DWSB 1X6LA 2DH2A 4IMEA 2QQ6A 1U33A 4Q8UA 3MCNA 1B3OA 1TKKA 3R8HA 5AHEA 3AIRA 4GY1A 5GNXA 4V1XA 3AOFA 3CUHA 4PCFA 2EAWA 2CBUA 1PAMA 3KCOA 1P0NA 1TPB1 5A5WA 3C3NA 4HT3A 1V6YA 2O7QA 1LTDA 1VIWA 4U33A 5AN7A 4S3GA 2EGZA 3F5KA 3P67A 4HU3A 4Y9AA 5G4EA 3G24A 3MP4A 1X98A 5C9WA 2RHGA 1EJTC 2OZ3A 4AVFA 4KCVA 4IMCA 3AYSA 3UPWA 1TVNA 4RDWA 1R3YA 2R1KA 1HX0A 2EPKX 3EX2A 4A3QA 2QZRA 2DT2A 4LUTA 3W7JA 2R9RA 4FHAA 4JQ4A 3G1XA 3B9DA 5DQPA 2FMNA 3PG8A 5FJPA 5LIKX 4TTUA 1F7BA 2GSHA 4H6RA 5E70A 2D69A 4B5VA 4Z1AA 3W71A 1FVPA 6TAAA 4LAMA 3IARA 2JEPA 3LCWA 3ZZ1A 1P0DA 3K8KA 5J5DA 3MUCA 4LYQA 2PA6A 4NX5A 3AHZA 3AC0A 1XLJA 3S5YA 1JYXA 4MY1A 4PRRA 5HMEA 3TYZA 3TQVA 5JUVA 3SIZA 3VKCA 2IMRA 5CJMA 3G0UA 3NZRA 2J6XA 1UA3A 1CPUA 1YHTA 1YLVA 1EZ2A 1K6AA 5I6SA 5K9XA 3AMKA 2PDGA 5HOSA 1GKQA 3QYSA 1DE5A 3PPCA 5DRCA 3BGAA 2WBKA 3DFSA 1NOUA 1J0IA 2A4AA 3MV11 1WP6A 2HE5A 2XH2A 4A8RA 3GXNA 8TIMA 3UY7A 2J9YA 2W3ZA 2J9XA 2VCCA 3WQ6A 1SO3A 1T0OA 2OQHA 3PB2A 4OBTA 5I77A 3V35A 3WK0A 4DBDA 4RX0A 2XDFA 4J9JA 3W1QA 2VZVA 2WVVB 1OINA 3PANA 5CSUA 2DIJA 1SSGA 3S6DA 3KTCA 4UFJA 3LLXA 2CFFA 2VELA 5I07A 3LCLA 2QJGA 1NFBA 3WQOA 1GNXA 1X1OA 3O05A 4CNOA 4AMCA 2VEIA 2ON3A 2OGJA 1ENUA 5FCZA 3E0IA 5M03A 1XBZA 3WK3A 1LQAA 5FEWA 5U7SA 1IQ8A 1E71M 4US5A 4AY1A 3F5LA 2UZ9A 4NASA 4HNTA 3VNZA 3B97A 2QMJA 3ES8A 2YB4A 5CSSA 1GQJA 3G5EA 1E6NA 5C71A 2ALDA 1FXQA 4JN7A 3GH5A 1TV2A 1J0HA 5B80A 4JTJA 2JF6A 3L4YA 4UUIA 5T91A 1BSIA 4HK5A 5G2HA 3SCQA 3UESA 4K8EA 1XYZA 3ZJ7A 1PTGA 3SGGA 5E0FA 3L0KA 4YNGA 1XIDA 1XH0A 2Z25A 1EYEA 3LG3A 4CVWA 1MW2A 5CAHA 4D6CA 1CZ1A 2PLCA 1H7OA 3HQPA 3MSGA 2V3DA 2BGSA 3G1SA 3MBFA 4PBEA 1QI4A 4ZCWA 4Y96A 2X0HA 3A23A 3CH9A 5HXMA 3PZMA 4UIOA 4XAFA 3NFUA 2NQHA 3QMSA 4ZOEA 1Y7VA 2WSYA 4PUDA 1LT7A 4PSRA 3W88A 4JY9A 3EWYA 1VHCA 3M6YA 3T44A 2OYMA 3K1DA 3DAQA 4NG3A 4DIAA 1GTHA 4QCFA 3HN3A 4AEOA 1UWIA 1XG4A 4WDWA 5CC6A 2HTMA 2CLKA 1EZWA 3VKBA 2PC8A 2V3EA 3IIVA 5FEPA 2BOEX 3NOEA 1XCXA 1TWSA 1QBBA 1XR2A 1J8VA 2VGGA 2QDEA 5CSYA 4FX7A 1S39A 1DXFA 4IFRA 5FD0A 3W1MA 1QUMA 3CS2A 4EPKA 1TWWA 3F2CA 1KCLA 3L7RA 3RJYA 2ISWA 4Q3MA 3UG8A 1TPEA 4P8WA 4NU7A 1ZU8A 4IMDA 3RG6A 3U0HA 5F2MA 1I1WA 3FA5A 1PUDA 5FF4A 2VZTA 5E0KA 5BMXA 3W70A 1H5VA 1DTUA 1V77A 1NSJA 4NP7A 2WOQA 2VVNA 1W5OA 2PPGA 3M07A 3ES7A 3W24A 4LUSA 5A8QA 3TXZA 1JYWA 3DU0A 3BOXA 2OO0A 3TQPA 1Z89A 2WWCA 3OGSA 5DCDA 2ZRWA 2ZBTA 3VO0A 1QU4A 5ABFA 1W1PA 1UWQA 1WDWA 5EMMA 2Z6JA 3BVJA 9XIMA 1F8MA 2Q09A 1XLHA 4GBUA 1LJYA 4A4AA 1UB3A 1XINA 4M7SA 2IPJA 1OK4A 1UR3M 4OIFA 3IAPA 1XIIA 2BASA 2Z26A 2A3AA 4HYWA 4UR8A 1FH7A 3IAQA 4KCWA 4MB5A 4ZO6A 2VD8A 5CC7A 1NWUA 3QKEA 3TR9A 2VL4A 3OLGA 2R1MA 4IH3A