3SY1A

Crystal structure of engineered protein. northeast structural genomics consortium target or70
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
229
structure length
229
Chain Sequence
MMNDIAHNLAQVRDKISAAATRCGRSPEEITLVAVSKTKPASAIAEAIDAGQRQFSEHYVQEGVDKIRHFQELGVTGLEWNFAGPLQSNKSRLVAEHFDWCITIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRLRGLSAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLALGQSDDMEAAIAAGSTMVAIGTAIFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0001 protein yggS
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR70
rcsb
source organism Escherichia coli
molecule tags Pyridoxal phosphate binding
total genus 85
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3sy1A00
4BEUA 3LLXA 1QU4A 5GJNA 4LUSA 5GJMA 1TUFA 2J66A 3C5QA 5FAGA 1BD0A 2VD9A 3GWQA 1W8GA 4PB4A 1VFTA 4XBJA 4BHYA 2PLJA 1KO0A 2SFPA 3HA1A 4LUYA 3E6EA 3E5PA 4BEQA 2TODA 3B8UA 4LUSB 5IRPA 4KBXA 3B8WA 1CT5A 1L6FA 1SZRA 3B8TA 4DZAA 1XQKA 3MT1A 2DY3A 1XQLA 4FS9A 2NVAA 4V15A 7ODCA 3WQCA 1KNWA 2RJHA 3KW3A 3SY1A 2O0TA 3VABA 2ON3A 4XG1A 3S46A 3R79A 2RJGA 3NZPA 5BWAA 1RCQA 2OO0A 2NV9A 1VFSA 2PLKA 2QGHA 1VFHA 1NIUA 3NZQA 4A3QA 3N2OA 4LUTA 4Y2WA 1HKVA 2VD8A 4PB3A 3WQFA 4ILSA 3BTNA 1B54A 4WR3A 3HURA 3CPGA 5FAJA 3N2BA 1XFCA 1D7KA 1HKWA 1SFTA 2YXXA 5GJPA 3N29A 4AIBA 1TWIA 4ECLA 2ODOA 3WQGA 4LUTB 3UW6A 1L6GA 3AWOA 1F3TA 3B8VA 4DYJA 4BF5A 3WQEA 1EPVA 1FTXA 2P3EA 3WQDA 3ANVA 4ZGYA 3OO2A 5FACA 4PB5A 4QHRA 3AWNA 3ANUA 1NJJA 3CO8A
chains in the Genus database with same CATH superfamily
3W28A 1WKYA 4JEJA 2FPYA 2XVNA 3R58A 5MKGA 1SZNA 1I60A 1Q6DA 3MP5A 4BQ2A 2ZKMX 4M3PA 4NHVA 3N2MA 2HS6A 3PZMA 3S1VA 3MCNA 4JAWA 1KGWA 1OD0A 2FTWA 4TQTA 2QF7A 2VEKA 2BHUA 1LYXA 3M0VA 4A4AA 4DJDC 5LZLA 1TPWA 3ZR6A 1P6CA 4DQWA 1NWUA 4XZBA 3EWDA 3B40A 4JD4A 3EKGA 2CBIA 4J1OA 1CLKA 3NZGA 3C2VA 3BCDA 4ZQPA 3DX5A 2FZ8A 2GJRA 4Z08A 4WGXA 4H19A 3S6TA 3EPOA 8CGTA 1PHQA 1O5KA 3B04A 1QWGA 5K7JA 3KBVA 2DIJA 3TYBA 3RX4A 4O4WA 1ITCA 3THQA 3ECQA 3SRDA 2WCGA 5IBXC 4LB3A 1RV8A 1PCKA 3SI9A 2C19A 3TTOA 1AL8A 1DJXA 4AYGA 4EANA 4ZSUA 3LENA 3A4WA 4MNLA 4FNUA 2QPUA 5LXEA 1ZJAA 1A80A 4A8NA 1YDNA 1ODUA 1EJ7L 3UZXA 3LCHA 3SRHA 4HIBA 2Y7DA 5HMFA 4L56A 4QDWA 1ECEA 1FXPA 1GHRA 4CGTA 2Z2UA 3SGZA 1F6KA 3EXTA 4XD3A 4EXQA 4JTUA 4O53A 3NL3A 3VCRA 3P0WA 1WKDA 5FJPA 2CZDA 4R5EA 1UR2A 4PE8A 4XQ6A 4W93A 4ZL1A 4GUHA 1S2VA 1LT8A 2BDQA 3FHQA 5C6MA 4WY0B 5A6LA 4C6CA 1ADDA 2ESCA 2QUVA 3I3DA 3WY1A 2G3IA 2RGMA 5LA1A 3BZGA 3O63A 3IUHA 4PRRA 2ZZ6A 1DJGA 3NSNA 4XZIA 3TYDA 4ZA0A 1JXJA 1IIHA 1YADA 1JGIA 2XH0A 3UESA 3CH0A 1VFOA 1EGMA 1BRLB 1VIWA 2W79A 3NZPA 5HPOA 3VNYA 4MYAA 4M6UA 1QRQA 2VZSA 3FYPA 5I2UA 3KOXA 1MW0A 4Q4RA 1N8WA 1U2YA 4D72A 5LHFA 3GC4A 5KTLA 5D32A 3PUEA 5HUOA 3ZT6A 5I06A 4U33A 1LQAA 3XISA 3SM0A 1WDWA 3DBNA 4W9TA 4DHGA 1KD0A 3RCYA 4QJ4B 3GBDA 3R10A 4CEXC 3WQGA 3W00A 2BOEX 2WC3A 5AHEA 1FXQA 3ZLHA 1J01A 2A85A 2V67A 4GY7A 3KOFA 4UTJA 1I9CB 1TPFA 3NQ7A 3P62A 5FSDC 3W0KA 1XD1A 2ZVRA 3N18A 4GJJA 3THAA 1RUSA 1Z48A 2F38A 4MAZA 3WF0A 3WFZA 3CHEA 2FH6A 4KFOA 2WLZA 2EG8A 3OJGA 4R7WA 3KP1A 3QGAC 1FDZA 1OG6A 1XYZA 3LSBA 5EL1A 1N7KA 2TAAA 1GYMA 4IXXA 3SUWA 3D47A 4CCDA 1W3IA 6REQA 3PBGA 2UBPC 1QAPA 1TJ2A 1XLHA 1YE4A 4DZAA 5F2GA 3SY8A 4C1NA 3FA3A 4CQ8A 4UOQA 3GTFA 3DBPA 2OLHA 2WMIA 2CLPA 3WBYA 5LKYA 2OLSA 2IPWA 1GYLA 3A13A 2PDPA 4O19A 1VB9A 3VGFA 2DH2A 1BKHA 5T26A 4J9JA 3REQA 5CPOA 3CPUA 2WVVA 3R7MA 1H0IA 2PP1A 3VDBA 1QPOA 1M6JA 4KCUA 3SSJA 3P2VA 2POTA 3TUUA 4D6GA 1EP2A 4HP5A 4US5D 4P7RA 4LYKA 3B0YA 3VO0A 1CW2A 1A5NC 4Q8UA 4RR4A 3WN6A 2EPHA 1QJWA 4NSBA 3F5JA 3MC5A 5LHEA 3KS6A 3GLCA 3BAYA 1ICSA 2CETA 4NAEA 3SY5A 1CGWA 4UBPC 3GKAA 4YS1A 2CESA 3G6LA 1H1NA 3NO5A 1TELA 3CMFA 4FI4A 1Q6CA 4UUIA 3S1UA 1EJSC 3SDOA 3SAZA 1ZHAA 4J3UA 2C71A 3KCJA 1E3ZA 3EPNA 5EGRA 4O16A 4MZ1A 2CZ5A 4UMAA 1OX4B 2WKJA 5C9RA 2A1YA 1E51A 3GX9A 4E3VA 3W01A 2Z25A 3BK0A 5CLWA 2NUYA 2QPSA 5LNWA 3UWEA 4N2YA 4PMJA 4MWAE 3QKEA 3ABZA 5ECUA 4NJIA 4QDMA 4REQB 3SCNA 5A6KA 1KWGA 1L8PA 3SQMA 1MQQA 3TU9A 2VZOA 3HO8A 1I4NA 3N25A 1CI1A 1VFLA 3DDMA 2VR4A 1TZZA 4PUDA 1KCLA 5F4SA 2KAUC 1WZLA 3C2RA 3A3XA 3VOCA 1I75A 3RILA 3F2CA 2ZCGA 5FEWA 3ANUA 3NPXA 4GI4A 3PZUA 1GVQA 3KBJA 3W2KA 2Q71A 2Z6IA 4HYWA 4MJMA 4H4IA 1LWIA 1HN1A 5KZEA 3GVVA 3WLMA 2DU2A 2Q02A 2ZZ1A 4D6FA 2EJAA 3BSMA 1V3IA 1OX5A 4KBXA 1AJ0A 2F61A 3QKZA 2P88A 1F73A 3NL2A 1OBAA 4CU6A 2NX3A 2TRSA 1XQKA 3IUDA 3RRXA 3H21A 5FJOA 3WLTA 4KW2A 2R9RA 1CB7B 1FCBA 1XLMA 2Q3OA 4JDBA 4DLMA 3ZJ7A 4Q6JA 1H49A 2PDGA 3I6EA 1OYBA 2Y7GA 4YTUA 3W1QA 3W02A 4JTHA 2X1RA 4HMCA 3CGTA 4Z2GA 5LIXX 3TH6A 1YRRA 1E71M 5DCEA 4WDWA 4W86A 1SJDA 4PTDA 3TYZA 4L6OA 5D33A 1L8NA 2HVNA 3ZLFA 2DT1A 1JZ4A 4UTHA 3RYSA 1QPNA 4QP0A 1EC9A 2ACUA 5EB8A 1K6WA 3G8RA 1E0VA 1WDSA 2G3JA 1I6NA 4UC5A 5HMDA 2EAWA 3VMOA 3NGFA 3EX1A 5EKYA 1TFVA 4RXGA 1V0NA 1VLIA 2BWGA 5BWFA 3TJIA 2QYGA 3E9AA 1FQ0A 5HINA 2ONEA 1FWIC 3AUOA 1FWGC 1UD4A 1OIMA 1W56A 4CQDA 4OZOA 1FWSA 4ZB0A 1RJQA 5A5WA 4Q4PA 2XN0A 4YVXA 4HD5A 3EDJA 2F84A 1NH6A 3HGRA 4D6DA 1JIBA 4K8EA 3E0LA 1PKYA 1CBGA 2ZXDA 5A8QA 4H9VA 2R1KA 2DH3A 2ZOXA 3E38A 2G3FA 3BAIA 4GISA 1XC6A 4QCEA 3I3BA 4B5VA 3FN9A 3UG3A 4BKNA 1E1FA 2W0UA 4DYKA 3AI0A 3T0DA 4DRSA 3PF3A 1MUWA 2VKZG 4M7TA 4PSRA 2F7FA 1MEWA 3NPWA 3DZ1A 1SO3A 3KLLA 1PZ1A 4DWSB 3NQ6A 1XDLA 3ARXA 1XIJA 1GOQA 5BXPA 3DI0A 2V8ZA 4ZE5A 4C6LA 1FP8A 3MSGA 3LX9A 4EE9A 2OJPA 3TYEA 2PDXA 1D7KA 4Y9NA 1NF0A 1M03A 3N11A 2VO5A 3I3EA 1Z89A 4IQJA 3DYOA 2AOSA 3T8LA 3C2EA 1PPIA 2J7CA 4PCPA 3G0UA 5FCZA 1M7PA 5BROA 5FACA 4FX7A 2PDLA 3EWYA 3OBAA 3PSWA 2FKPA 2XIMA 3G6MA 4NZJA 4H2HA 1WO2A 5A6TC 1QO2A 1IXPA 3W1TA 1Q6LA 4GMEA 3GZAA 2OB3A 3H7UA 1WKEA 2ZE0A 3TOYA 1M41A 3OGSA 4BWLA 1KC7A 4K36A 3KOWA 4BF7A 4E4PA 1SO6A 3AYVA 1DE6A 1JZ6A 4NL1A 1V51A 4QFUA 2PMQA 4QE5A 2VFGA 1POJA 3B8WA 3EA2A 3AISA 1BWKA 4D6HA 1SZEA 3TE9A 3KM8A 3E0IA 2F6XA 3KRBA 1WXYA 4IP4A 4WXYA 3B0UX 4G7FA 2D24A 2RHGA 4WD0A 3QOMA 1K77A 3B05A 3MU7A 4LVGA 3QJAA 2DW7A 1PKNA 3CXOA 1YE6A 4HMNA 3CNYA 2QCHA 5HUPA 5U4NA 1UB3A 1EJTC 3HFYA 3FX4A 3C0LA 2HPMA 1NFPA 4B3ZA 1UKQA 4EIVA 4CNPA 1VHNA 4K37A 2H9AB 3LI0A 3H2OA 2JIWA 2QCNA 4U4MA 3O0KA 1BQGA 1WX0A 2VHLA 4P8UA 4TV5A 3OVGA 1GQLA 4YCPA 1J79A 1Q6OA 2YR1A 5E0FA 1V3MA 1G1YA 5DRIA 3DYPA 1TJRA 2CC0A 2O55A 1KV5A 2UV8G 2D3LA 5IXEA 5HQEA 1EC7A 1BFNA 4FIRA 1JD7A 3M41A 3ITXA 4HN8A 4ZXOA 5I09A 1NQKA 1B4KA 4AZHA 1QUMA 1O94A 3K1DA 3N17A 3OB8A 4QJ1A 3QV7A 5AHFA 5U7SA 2E77A 3QYQA 1EQPA 4A05A 4FOJA 5GNXA 3W27A 3TN3A 2V3GA 5LGZA 1VC4A 2GWNA 1KA9F 2XG9A 3P61A 4M80A 5K9DA 4DWSA 1TIWA 3VC5A 1ZAJA 1PYMA 2WO5A 3QW3A 4KKXA 5IOBA 3TVAA 4DPQA 4XG1A 2PCQA 2Q01A 1ZFJA 3QVQA 1F3XA 1PZ2A 3TWBA 4LV9A 4WQ6A 1W5OA 2I16A 3MA8A 2IPFA 3CZ8A 1J8VA 1EOKA 1SJCA 2W9MA 1IR2A 1UKPA 3GIYA 3FGCB 3IJIA 4JNMA 2XJ7A 1BXBA 1JD9A 5K4ZA 1KTNA 4H6RA 4IT1A 2P0OA 1MW2A 3FSUA 1BHGA 3NQCA 5JBDA 3NDOA 1TWIA 3VKCA 3C2FA 1Z3NA 4R9XA 4IJBA 4UCFA 2ACRA 2MANA 4JKMA 3AWOA 4WJ8A 2B81A 4UFHA 4CVUA 5D8WA 1XBZA 1U5HA 2FJUB 2FZ9A 4W8AA 3W25A 4RKAA 3I7RA 1ZJBA 1ICPA 2YDRA 2G96A 3L66A 2A0NA 1VF8A 3N6JA 1GVIA 2HCVA 3W72A 1BD0A 3CEPA 3BLEA 1KM1A 4B2DD 4Q4MA 4UTLA 3FY1A 2OQLA 1EUAA 5FF7A 3LMYA 3H2FA 4XUYA 3CHVA 1J6PA 3U48A 2QAFA 3Q37A 1ME7A 1JCJA 3WJSA 1UH3A 2YB4A 5JIWA 2CZFA 1NWRA 4DWDA 3VDAA 1VFUA 3PN8A 4AISA 1GVSA 2HWGA 3VGBA 3GYEA 3CV1A 3NXLA 4JTKA 4K7YA 1A3WA 1E73M 4JZ5A 3MW7A 3P93A 4J35A 2BTMA 3CLMA 2G97A 3VABA 1WDQA 4IIBA 3R5EA 3MVIA 5HMSA 4D71A 3NYDA 3QHMA 1RK5A 1EJVC 1QOXA 3PBUA 2HPIA 5IDIA 2XSAA 3ABSA 2OEMA 3VNIA 3MQTA 5FESA 4QJ3B 4R7OA 2BY2A 1JR1A 2I56A 1SUXA 4UQDA 2XFFA 2Z7GA 2BVWA 4L6DA 4ICMA 5T8GA 4MVAA 1XBYA 4Q3MA 1W1IE 3UR5A 3VCCA 3HTWA 1GJWA 4ERIA 3A4JA 1R2RA 1E4MM 3CYJA 1JPKA 5H2ZA 3O16A 5D2XA 4IXHA 4FA3A 3B0PA 1NU5A 3W7LA 2V3DA 3A21A 1QO5A 1W3JA 9CGTA 1RCXB 3R13A 1UPMB 2QW5A 5A6JA 3KOYA 4JOMA 4Y90A 3YPIA 2V68A 4DIAA 3T1GA 1JCXA 3KVMA 5JMUA 4BHYA 4Z1BA 3OG2A 3VIGA 3KBNA 7ENLA 1FVPA 2YXGA 1DWGM 3WL1A 1PWMA 2FB2A 1PHWA 3WQ5A 3SCWA 4WZHA 3WSUA 2BASA 3EX6A 3CQ0A 4LH8A 1SO4A 4W5ZA 3OVRA 2HNHA 4XZ9A 1IWBA 2JGYA 4JQ2A 2YL8A 3L23A 3VNZA 5AECA 1THFD 1XLCA 4DJFD 1HQTA 2PURA 1IE7C 3I65A 3JU2A 4LEFA 4ALDA 4HPHA 3SY1A 1UD3A 3R79A 4ATLA 3W86A 5HWNA 4BJHA 4GUJA 4CCCA 4P7QA 3B9EA 1XLKA 1AUSL 2ZWYA 3QSRA 1KM4A 2CEQA 3P5ZA 4H3DA 7REQA 1SSDA 2NZLA 1V6UA 2DJXA 3MPGA 4ORMA 1XFCA 4DXXA 2HEJA 3VILA 3VD5A 4C7FA 3BWWA 1EXPA 5I07A 5I3KA 4IZGA 1MXGA 1TQXA 1Q8JA 1XICA 3WH6A 4CEUC 2VUNA 3A12A 2B7QA 3RIKA 2PC8A 3WQDA 2FZNA 2HQAA 4KFPA 3HG3A 4V1YA 3AS1A 4HK7A 4LX4A 3NCOA 2P3ZA 4KQNA 2XIQA 3ANYA 5HPCA 3PUDA 5LNSA 5D05A 3EOOA 3KBMA 3P67A 2XHYA 3GAKA 1UR4A 4LY8A 1BAGA 2OQYA 2DT3A 1IEQA 3UWYA 5CC5A 4L1GA 4BR1A 1VFFA 4BWLC 1MFVA 3KBSA 3WQ8A 1DJZA 4V27A 1PDYA 4DNMA 4U3AA 3NSXA 4JIHA 1KXVA 4DBSA 4O1DA 1KTCA 1Q4NX 4HGXA 3O6CA 2ZA1A 3B06A 1AH4A 1QNQA 2WVUA 2HZGA 1DXIA 1M1BA 3S83A 1L2UA 2QCDA 4FNQA 3LGEA 3P84A 2NV9A 5BW6A 1OYAA 3TFXA 4DZIA 2BVTA 1VRXA 1TCDA 3O07A 1RP8A 1VPXA 5BYWA 1HFBA 4R9OA 1XDMA 3OYZA 3RR4A 4DO6A 4N9BA 4IFRA 3WKZA 3U2OA 5KSWA 2DZUA 3ZVHB 1F3TA 4DI8A 2WZIA 3R6IA 3ARUA 1H7NA 1GZ1A 1JYWA 1QW7A 2BOGX 4EOUA 3KWSA 4PMVA 4M6QA 3MZ2A 4OHQA 1MFUA 4ENLA 4AXKA 5AC7A 4FXJA 2A79A 4UR7A 3LNPA 5DT5A 2HE8A 1FWFC 1A4LA 2Z28A 4H9ZA 3TSDA 3VIMA 4B5SA 3M0JA 4GIAA 4L1XA 4FXRA 3GTHA 2E6DA 3TP4A 2X30A 3S9ZA 2C14A 2E9MA 3AMLA 3QYSA 2GGJA 3LPGA 4F0KA 2YIHA 1Y8BA 5LNUA 3DEQA 1W9PA 4JGDA 4CD6A 4QQ3A 1DJQA 4JFTA 4DWSC 2OR2A 1MZRA 1MNZA 4DO7A 3SGUA 4BS0A 5CKSA 3A47A 4QX4A 2CBUA 2VX4A 3T4CA 3G24A 3KTCA 4NNCA 5HANA 4GYFA 2DT2A 1XISA 1E0UA 3QLDA 9RUBA 3ID7A 1TVLA 3NZRA 4NRRA 2WJEA 4LYRA 4GWEA 3W7PA 1Y5WA 3TC3A 4GJIA 4IL2A 2O9RA 4YL2A 2VQTA 4LVDA 3ARVA 2QDEA 1JCMP 4F8XA 4M6PA 1ENUA 1YPXA 1JNDA 3ZSTA 1HL2A 4GUFA 4MTVA 2O92A 4MKVA 3G2GA 1IHIA 2ZX8A 4IWWA 3HB9A 3ZM8A 5ABHA 2J7DA 2FTYA 4NASA 2IXUA 3S1XA 3MMTA 4AZ7A 3GFZA 3MV01 2Z1KA 3PWGA 1CGUA 3RM8A 3VOFA 4H8UA 3EGJA 5C9UA 1ISXA 2ZA3A 2Q8LA 2PDJA 3TX9A 1W5PA 1QBBA 4D6IA 1L2QA 3AIVA 5CBIA 2HBVA 4ZVJA 1F4HA 3WLLA 5B7ZA 2C6QA 4RZ6A 1DL3A 3QV6A 1M7OA 1GKQA 3U2EA 4Q8NA 3T08A 1UOKA 2FHFA 3B8IA 4H8NA 3MUAA 2J6XA 3WCZA 3T2OA 5EMJA 2V3FA 2KX9A 2WNNA 4RX0A 2VP8A 4KWOA 2UY4A 1Q6EA 1EEPA 1LORA 5D2WA 4PTVA 3M0MA 3LB0A 1YTEA 4EAMA 3UG5A 2VENA 2QCFA 1A5OC 3GG1A 2ZC8A 2PF8A 3S6DA 3LPOA 1TA3B 3AMDA 3MUCA 2OYLA 1OFQA 4JTFA 1KXQA 3M0IA 3SADA 1Z42A 1CECA 4ZE4A 2DDXA 5EMLA 3T40A 2QS8A 3UPBA 4EF8A 2BHYA 1K70A 1A5BA 2XH2A 2VC7A 2YBUA 1FWAC 1SFJA 3W70A 4WF7A 3G8EA 5AC6A 1HL9A 3FA5A 1HW6A 5MF5A 4BA0A 2CIPA 5D2YA 1SZRA 2RKXA 3AXIA 5BXRA 5F7UA 1GWJA 3S47A 4M5PA 2HTMA 3L12A 4MDOA 1IQ8A 4A3HA 1WAWA 1XRSA 1TJPA 3GVGA 5AOUA 3PBMA 1R8LA 3H70A 4MGGA 3AZTA 3RFAA 3WEZA 4ACZA 4R88A 4P8XA 4FAMA 4NIRA 1Q2RA 3SO7A 3WFLA 1GPWA 4DBUA 5IFTA 7TAAA 4W7VA 3CTTA 4UTMA 4JBRA 3DKJA 2FTPA 7CGTA 1VCFA 4U28A 3FJNA 4B4HA 3UWUA 1KXTA 4PEEA 3BJFA 1U5JA 3L21A 1UWRA 3K4DA 4M0XA 1ZL1A 1GG0A 3UW6A 4HZMA 4FALA 1DJNA 3CIXA 4AHPA 3WLQA 3T44A 3WQEA 2Y5EA 1TX2A 5D04C 3LY0A 3ANVA 4QHRA 1ZBCA 1G5AA 2FHBA 3PNZA 1W32A 1J0ZA 1ZQ5A 1QT1A 4AD3A 4OTKA 3APTA 1PL9A 2UWFA 3PPCA 1FWRA 1JYXA 2BZNA 1HKKA 4YTRA 1VENA 3L4UA 3TKFA 1GVRA 1TWZA 4RV8A 5M2FX 3GDLA 3EDEA 1ZBKA 1ZGDA 2XN2A 2CKRA 4CU7A 3GB6A 3W9ZA 1BWVA 3GXDA 3HMCA 2YL5A 3MSDA 2PRMA 1US3A 5CJMA 2J62A 1SFLA 4WJEA 2DY3A 7XIMA 4DM2A 1CGTA 2ZRWA 4CN6A 4FLOA 5DCBA 2OGJA 3AZSA 3VX1A 3ITGA 1FWCC 3VZZA 3DGRA 2QGHA 4G1NA 4XO6A 2OCZA 4CQ9A 2J4GA 1TA3A 3MO7A 6CGTA 4ADSA 3OA3A 1ONRA 3ZLGA 3LHZA 2YCLA 3FEMA 3QR1A 1V0KA 2FFIA 1VCVA 3I68A 4GO9A 4I5XA 1B3XA 2YGYA 2WXDM 1I8JA 5LIWX 4JTCA 2NXGA 4I8DA 6XIAA 2ZX9A 1QW8A 4X22A 4Z1CA 1S3TC 1Z8AA 3AWNA 3M43A 5H8PA 3PJXA 4KRZA 1Q45A 2AMXA 4OOUA 4GI9A 2XINA 1ITUA 3ZJ8A 1LLOA 3NEVA 4Q8MA 1UWSA 4EXAA 3FYYA 1H50A 3VFCA 1UUOA 2WC4A 5H6HA 2Z1SA 3WQOA 4AY1A 3L67A 4AWSA 2Z26A 2V69A 1KFBA 2PDBA 4AWUA 1TYGA 4GZ7A 3B8UA 4AF0B 1JDEA 5CXPA 1F7BA 1NF7A 4P5UA 1OGGA 4JFVA 5T9BG 3NQFA 4MLJA 2B0MA 1OIFA 1P4CA 3CL6A 4H6EA 3NQEA 3COTA 4S2CA 4AD4A 1F5ZA 2DFAA 3F4DA 1RVGA 1SGJA 4ADTA 4FB7A 1GONA 4CNUA 2ZZ3A 4LCSA 1HVXA 1V3LA 4OFCA 4CNOA 4YN5A 2ZDRA 3QTPA 1GOWA 4GPNA 5PTDA 4LANA 3NL6A 1TQJA 3PPHA 5EU9A 4ROQA 4R27A 1TPC1 1W5NA 2NQHA 1TTQA 4UZUA 1OT2A 2VEPA 4WKFA 3BCFA 1W3KA 4QEHA 4LRSA 3F5KA 3NO3A 3CV6A 1NWTA 4AEOA 2EPLX 2FVLA 1LOQA 3CH9A 1MEHA 2P8BA 1ONXA 1VBGA 3OA5A 4XBJA 5HR7A 2PTWA 4JQ3A 2WYSA 3DERA 4YTQA 3V16A 4LUYA 3GFXA 3WNMA 3L0KA 3QF0A 5ECVA 4MWAA 5CEWA 3WD3A 3TSMA 2XIOA 3IVTA 3MHUA 1BVWA 2W62A 1LQ0A 1ZENA 1WZMA 4G1KA 3WD2A 5AYZA 3KHDA 1QNOA 2P1FA 1SJAA 4QG6A 3A9BA 4PUNA 3W87A 1VFSA 4S3BA 1O66A 2VX5A 1VYPX 3T7VA 3W1MA 3HF3A 1PWLA 3UA3A 2V38A 1AW2A 5I6SA 3OQEA 2BV9A 4J3XA 1DIKA 2VGGA 4I9JA 2QCEA 4LCRA 1DWIM 4NXSA 4QCFA 4UFLA 2PBGA 4RUBA 3BLPX 3I6RA 5CPLA 2X05A 1XH2A 2BY1A 1ZJIA 3T0TA 3ARYA 3AZRA 1UQZA 2OU4A 1EUNA 4HTYA 2OSWA 3KTSA 4AX6A 3THCA 1TUFA 3O6YX 3MV11 3EB3A 3TJ4A 1AVAA 2IKGA 3P80A 2BHZA 3KTXA 4HCDA 3FJ4A 4FNTA 4Q33A 2PP3A 3CUGA 5I23A 3IAQA 2PGWA 1E9YB 4AEEA 1DHPA 4OBTA 1A4MA 1CXFA 3ORWA 4FPSA 4W89A 4TUFA 4PCNA 2FIQA 1GQJA 4HJFA 4FS9A 4ZQMA 2VM8A 4PULA 5TAOA 1OF6A 2DV0A 3VA8A 3UZZA 4XB3A 2QMKA 2HXUA 2J13A 1S2WA 1GG1A 3CHFA 3VIJA 1HVQA 4INFA 4P7LA 4EAYA 4ZR8A 4Y9MA 4AIOA 2DSZA 4Y2WA 3R89A 1C7TA 2VD8A 3L9CA 2ZWZA 1KGXA 3CMJA 3PBVA 1QNPA 1P0DA 3PB0A 4UWMA 1K8XA 4K7VA 1VCGA 3NQMA 4WKHA 4TX8A 1HKJA 4FZIA 5BU9A 2ACSA 1Q85A 4P8VA 2YJQA 3E2QA 4GGHA 4FOKA 1XV8A 1P1XA 3WIJA 5IHRA 3W07A 2J25A 4UQ9A 2BBFA 4C6OA 4V1XA 4I6VA 3V3WA 1XLGA 8TIMA 1E4IA 4PEKA 2MUCA 5C0QA 1R3VA 2OTDA 2NSXA 1T0OA 4DJED 3USBA 4DN1A 2A6LA 3TTSA 3T0AA 3TR2A 3UZWA 1WNOA 3H26A 1J6OA 1CT5A 4FX8A 1G67A 5TNVA 2ZBTA 3HPSA 1RVKA 3L0NA 3CV7A 1S5NA 2HVMA 3S0CA 1JDDA 4Z1AA 2P76A 5FEXA 3EWZA 2ALRA 5G4HC 5HQLA 4MB5A 3U2CA 2DUZA 1I2QA 1R7OA 3G1FA 3MS8A 1UASA 1U1UA 4PYSA 1ADSA 2E4TA 1KM5A 1VFHA 5DBUA 5TF0A 3NSMA 3RAOA 3MWAA 3OZPA 4M82A 1V0LA 3HG4A 4CD4A 1NQ6A 1LOSA 3ERPA 3M7WA 3W7CA 4RNIA 1E6RA 3B3DA 1NEYA 1V08A 2E7FA 4EWND 1Y5VA 1EL3A 4QQUA 2H3DA 1UMYA 3AC0A 5G2IA 4RJEA 3HGJA 1VPYA 4RZ4A 2H3BA 1JRCA 4G8TA 1LDCA 3E02A 3PP7A 5LNVA 4NZCA 4JICA 3W7MA 1L6YA 3AHZA 1C9DA 1GOXA 4LAOA 4BEUA 1MUMA 4UOZA 1AH0A 3QPEA 4PCSA 1V6YA 2J79A 1I2NA 3Q67A 1GK8A 1RPXA 1GHSA 4U5KA 4XK2A 3PG8A 4PBGA 5AZ1A 4JY9A 2X2YA 3TW6A 4MZ8A 3LERA 3ZWSA 4E8DA 3H22A 7PTDA 1TTJA 4QITA 2D0GA 4ZQRA 3B8TA 1H7PA 3RPTA 3LHWA 3GO2A 5FI8A 1W5QA 2Q3RA 2VURA 3BW2A 1AFSA 1JGMA 3AHTA 1ZZMA 2QJNA 4B92A 3DU0A 2C91A 2ZTKA 4HT3A 2I7GA 3DFTA 1AW1A 4RZ5A 4WOQA 2ISWA 3LRLA 5HR6A 1K8CA 3W85A 3MCMA 3WUBA 1TV3A 2OWWA 1PX8A 4QLKA 1E70M 1JDAA 4GYPA 1PXGA 2YCKX 1XIMA 1DIDA 4TU1A 1I1XA 3PWIA 3MO4A 4DAIA 1J18A 3G77A 1HG3A 3E74A 3EKLA 2G37A 4XSLA 1IEWA 4WUIA 1D2KA 4K1GA 2VZUA 1KW1A 2GUUA 5AKQA 4ERAA 4K3ZA 3FOKA 1AW5A 1WOAA 3FK4A 3F4NA 3UR7A 1IXNA 2QIIA 2PWDA 3W4RA 3URBA 5TBOA 3WZ0E 3SCUA 2VFHA 4GIYA 4I90A 4ZFCA 1TZ7A 3PFMA 4HNCA 3V0SA 4FLQA 4QG8A 1QI2A 4I9TA 1Q2SA 1A0DA 4PL1A 1E5NA 1ONWA 1FHUA 1G4SA 4EWJA 1WZKA 1FY6A 1B3YA 2DZTA 3C2OA 3LHUA 2HBXA 4MWAC 4Q8QA 3CASA 4ROPA 1R85A 3N2CA 4IJCA 4IG2B 3FYOA 1B5TA 3WQCA 4E4FA 3LOTA 4AAJA 3QMTA 3QY8A 3POCA 4TV6A 3NURA 2GOUA 4PUMA 3ELFA 4YWSA 2GJNA 3N9RA 1V3KA 2D69A 2NW0A 3GNPA 4DUWA 3TNBA 4JR5A 1MXSA 4ILSA 1OY0A 3M0HA 3DFOA 2GLKA 2C0HA 4Z1DA 1ZPTA 3OVQA 1XW8A 1R7AA 2C8NA 3UGVA 4QDPA 3ZO9A 1W9BM 1REQA 3KUMA 4LSBA 4NJGA 3BW3A 2OMAA 1WP6A 5HNNA 4G9PA 3VOJA 4HB7A 2QLYA 1OFRA 3RJYA 1NJJA 2F8QA 4P7NA 1TV7A 1QK0A 4O50A 4JNZA 5AHNA 4MY8A 2QUTA 2PRLA 4WRHA 5AZ0A 1PSCA 3BJTA 2GUYA 1OABA 3QQWA 5HJXA 5EA9A 5L9FA 3WLRA 3RM9A 2PF0A 4O8AA 1IZKA 4F0LA 1SZFA 3QOKA 4PMNA 3RU6A 4LUSB 2VL4A 3I7SA 2OT1A 2OX4A 4GYKA 5HWMA 3AAMA 2D2GA 3SRFA 4TO8A 3N4EA 3TW9A 3K5XA 1M65A 1JI1A 2AAAA 3UXIA 4BI6A 3GVWA 1IV8A 1O68A 4M81A 3F4VA 4JKLA 3DESA 4B5UA 2WMFA 2EPMX 2YB1A 1RCQA 2J7GA 4M51A 3M5ZA 1HGWA 4UMCA 3CHCA 3WH7A 3CHDA 3QBUA 4KT2A 1DWFM 3V7PA 3BLDA 3OW1A 3KRUA 2E0PA 5LIUX 2QKFA 4N9CA 1JAKA 3BH4A 1QOQA 3GNXA 3MCOA 3RPDA 5F1UA 1SYTA 1HUVA 2Y89A 1KBBA 3B8VA 3AXMA 1ZJHA 3ITLA 1W54A 1FOBA 4O1AA 2POZA 3B9AA 1I45A 1RAKA 4E8GA 1ZAIA 2D3NA 4HNUA 3CIWA 4LALA 2YYTA 1PE1A 4GE8A 4GYJA 1FH9A 1RZMA 4P2VA 4GUGA 4A2RA 3C0SA 1XINA 1X98A 2CLIA 3QR0A 4BCEA 3NQBA 1H09A 1B90A 1KM3A 4XKMA 5A69A 5A1AA 5A95A 6XIMA 4Y7EA 4O1FA 3GVQA 2WHKA 2EBNA 4MM1A 4J3VA 3TN5A 3KX6A 1MEIA 2QUMA 3DUGA 2ZRUA 2PDMA 2ISDA 3ZFHA 3OYXA 5KEZA 2XTKA 3TA9A 1AA1B 5A94A 1M7XA 4LGXA 1M53A 1O5QA 4Z2IA 2O0TA 1VYRA 4PFMA 4RDVA 2ISVA 1H62A 2O7QA 2R91A 3EMQA 2PZ0A 3H4XA 3B9DA 3WQFA 3GR8A 1JCLA 4NILA 3KL5A 3D3AA 1ZP3A 3NAVA 4TVDA 4NT0A 1XS2A 3BLIA 3J7HA 2QF8A 4AD5A 1P0BA 1JRBA 2VTFA 4QG9A 2AQOA 4FF7A 2QJHA 4ECLA 5C7HA 1XGEA 3PG9A 1V6TA 3TSBA 4DVOA 4X0NA 3P8JA 4GIEA 1RCOB 4C6PA 5I5RA 1VEPA 4C6BA 4V33A 2P50A 2XH7A 2GVLA 1BKSA 1YMYA 2YCEA 4NX0A 1N55A 5ABTA 4ASTA 3U7VA 3AROA 1ADOA 4JFSA 2EF9A 3PZTA 2CHOA 4LUSA 4Q32A 3CC1A 4XZMX 5FAGA 2V5LA 4PB4A 5LIYX 1B30A 4GZEA 1J0KA 1DTNA 1VR6A 4JIRA 1R3RA 3GE7A 4M56A 4LAMA 4E4UA 1D3HA 1D3GA 3VPLA 2X42A 4Z42C 3MYPA 3ZS4A 4XIAA 2VCAA 4IGHA 5HJLA 1S5TA 3PWAA 4JTDA 1UROA 1XPGA 3CS2A 4YXGA 1VAHA 2BP1A 4JTGA 1GOMA 3TJXA 2Z27A 3OP2A 1FH8A 5I0DA 2GVGA 1L9WA 3VIOA 1SW3A 4NAFB 1PTAA 3OEXA 5DN1A 3SCTA 4JIPA 3IIXA 1XSJA 1WZAA 1W8SA 3QPYA 1HP4A 3W82A 5HNUA 3STPA 4CN4A 1P0NA 3STEA 5A8PA 1AQHA 3IGXA 2ATSA 4F48A 4EP8C 4J2PA 4ATWA 4GYPC 1TRDA 2QULA 3KVLA 1W1TA 4D2JA 2QT3A 2ZC1A 1XIGA 2PODA 3DN5A 1QI5A 5IFPA 4IP7A 3XIMA 4C6FA 2JF6A 2PWHA 3ONBA 1XLDA 2GQ9A 1RLDA 4WHBA 4MFEA 3ISIX 2GGIA 1B4EA 1KGUA 1J96A 3P14A 2EXOA 3L5AA 1XYCA 1W2VA 3BURA 2VRJA 4DB7A 2PUZA 3U2ZA 4B15A 1CX9A 5K4XA 4H83A 3VNLA 1DPMA 5CPNA 3LLXA 3QR3A 3MI2A 2PI6A 4UTKA 1EGZA 2XYLA 1UP3A 2DSKA 2EPNA 3IRSA 1TV8A 3M1ZA 1XH0A 3VGHA 2P8CA 1RXOB 4HCLA 3TCSA 4XBKA 4IMAA 5BZAA 1KRAC 4B91A 3WUFA 4GKTA 3RO6A 1I2PA 1P7TB 3QLLA 3NM1A 5EYWA 3QZAA 3LMZA 3U0HA 4IMFA 4HA3A 1PBGA 4QLJA 3GKFA 4PTNA 3UG8A 4M7SA 1IGWA 3LPFA 4HNLA 1F3WA 3PY2A 4HOXA 1GEQA 3AS0A 3W7OA 4C91A 4OUIA 1K7FA 1T96A 4N6EA 3R0UA 3VTRA 3OVPA 4MMWA 3QPZA 5BXTA 3VVGA 1BTCA 5A6BA 4JTJA 2QR6A 3MBDA 4G7EB 2VXNA 4OUEA 1KB3A 2WZMA 3VUPA 1CGXA 4I7WA 1GNXA 1VBUA 1MZHA 4BQ5A 3OQ8A 4L7ZA 2WKGA 3BZJA 5GQBA 4P61A 5AN7A 2FLIA 2ZUNA 3AYSA 3MKCA 4LXFA 2CITA 3L0GA 1GKPA 1O60A 4IPNB 1EC8A 3VIFA 5LSMA 3TLQA 3PJUA 2PGFA 4UTTA 1OF8A 5J04A 4NI3A 2DQWA 2KZHA 3A4AA 3CAKA 2J66A 2WM0A 4DZHA 4AHQA 1PUDA 4D8LA 2B7OA 1CEOA 5AVHA 1M9HA 3P60A 1WCGA 4UQCA 4ZENA 2RDXA 1W3LA 3GIQA 3DI1A 1JL8A 1R3SA 4QE1A 1HKMA 1QFEA 3HPZA 2EQDA 4C6MA 3GH5A 3PJWA 5XIMA 1U30A 1UUQA 2REQB 1SW7A 5HBFA 2WNZA 2I1OA 1DJHA 2NX9A 3B03A 2D73A 2PD5A 3CL8A 3QFWA 2GSHA 4GKLA 1A3XA 2GOKA 3M6YA 1J4EA 2TPSA 3M5YA 4XZWA 1UQYA 2WANA 4QS5A 3DYMA 4H9UA 4DY1A 1UD2A 1H41A 3CWNA 1TKKA 3H2CA 5HWJA 3ES8A 4XUGA 4LUTB 1O12A 4MIMA 4TVUA 3SSZA 5M1TA 4S3JA 4HHPA 4C5ZA 4XVEA 3ENLA 1RQBA 2A7RA 3L65A 1K02A 1G6CA 1F6PA 4UQEA 4QISA 1DJYA 1E5JA 3HGOA 5AYXA 2D0FA 4YYFA 4IX0A 2CPUA 1WQ5A 4YTTA 4LBRA 3DHPA 5M3WA 1XSIA 3HJEA 1JNEA 1RBOB 1TPDA 1GGOA 1K7XA 3S5SA 3TN4A 3UPWA 8A3HA 4IX2A 2I57A 1XCWA 3BGGA 1ZSXA 1QPQA 3CZKA 1OFAA 4JQAA 1XBXA 2CCRA 5E09A 4DJDD 3LLFA 3GD6A 3EWCA 4KCWA 3AQUA 1H5YA 2P0IA 1CENA 3FDKA 2X1SA 3IV8A 1XLIA 3VZYA 4B90A 2ZIDA 2WM1A 4Q7IA 3WUEA 3WJZA 2I5GA 3UGRA 2WOQA 4PB3A 3RF9A 2PS2A 1ISZA 3N6HA 4HNOA 3SZ8A 5K9XA 4GVIA 4CKQA 4M24A 3T42A 5BXSA 1X1OA 2GGHA 1CNVA 2YA0A 2NQLA 2BS9A 4H01A 3WNPA 5CC6A 4PR4A 4CNNA 1K8YA 4UIOA 3GNRA 2PLCA 3BLOA 1LG2A 3R2GA 2E40A 2ZE3A 3S5NA 2QJIA 3IAPA 4BFAA 4YIWA 5CCZA 2J77A 3QV9A 4LPCA 2YBVA 1ELSA 1LL6A 2E28A 3RK8A 4CNSA 3JRKA 3E96A 4N6FA 5I24A 1E55A 3CT2A 1XCXA 1VFMA 3GNDA 3UCDA 3NQAA 4WSKA 4C7DA 8XIMA 2F6KA 5EMKA 3TEVA 1FKXA 1ISVA 1MRAA 2A3AA 5E0CA 2XVKA 3EKZA 2FZBA 4O13A 5HDRA 1PZ0A 4NNAA 3DH7A 4MF4A 1TIMA 2JFEX 3FAWA 2VWSA 3RMEA 4TX6A 4NJJA 2ZZ4A 2Y61A 4Q4KA 1W1VA 1JZ2A 1RBAA 2EPKX 4DX3A 1EFZA 4AZCB 3WLHA 3BMVA 3HPAA 1OADA 4D9PA 2P5NA 4LUTA 5ENLA 4O0QA 5C9ZA 6A3HA 3GG0A 3F7JA 4KEZA 3HURA 2V5JA 2WV8A 1K3UA 3HFTA 4IMGA 2J27A 2OVLA 2PZNA 2F6UA 1UC4A 4N4PA 2PDUA 3BICA 3MYOA 1S2AA 3TROA 5C9WA 1WV2A 4X2PA 3U4AA 4X3ZA 1QI0A 3V0TA 2NT1A 3DXIA 3VCNA 1TB3A 1YBQA 3BGAA 1D9EA 3AXXA 2BLEA 2Z6JA 3W81A 4C6DA 5E9XA 3B8SA 4OV9A 4PTWA 2PDYA 3TK7A 3CWOX 1MSSA 1G4EA 5TD4A 2JEPA 2Y2WA 3S2JA 4ZFMA 3W83A 4O54A 1NELA 3S9YA 1AQMA 1IWAA 3H54A 3PZOA 5D9OA 3GR4A 4IQDA 4RNFA 1LT7A 3KVJA 4DF2A 2OOFA 1UW9A 1HKIA 1AJ2A 5D9NA 1F8IA 3LCGA 4LAZA 4MAVA 3MVTA 3KW3A 1EQCA 3VNJA 1XKYA 2A3CA 3S2LA 3FKKA 3KHJA 1H1ZA 1LL4A 3A3HA 5FJTA 1KTBA 5D2TA 4C6NA 4BF9A 1CIUA 3QHNA 3DFNA 1EPXA 3WK3A 1OC5A 2RGLA 3SUUA 4O28A 3FKRA 4KWUA 4OBSA 3LGGA 2Z1BA 3HOJA 2E5BA 2WB5A 3DC0A 3LSCA 1JZ8A 4AU0A 3ARQA 1W1B1 3U3HA 4C1LA 2OELA 3OBEA 2ZTJA 1XHGA 5I78A 1TV2A 4MUZA 3EWUA 3NGJA 3TZFA 3AIRA 7A3HA 2IPGA 2JKEA 3FV9A 4BF5A 2NLYA 3W6LA 3W7GA 3POHA 3IVUA 4AC7C 4MNKA 1EA0A 1G01A 2NVDA 1V03A 2QVNA 3RXZA 4WGHA 2CNCA 5AHIA 2X0HA 4N02A 4LVAA 4UTTC 2XGIA 3UJ2A 1QNRA 4WEVX 3GWQA 4LBUA 3G1AA 3TAOA 1UIOA 1WBJA 2QDDA 5M5DA 1CCWB 1NFBA 2GFTA 4DF1A 1ZAHA 2PWGA 1E4NA 1V7YA 2HK0A 3ITTA 5G4WA 1F4AA 3E5PA 2W4XA 4Q6XA 3VFLA 3OTRA 2CW6A 1XGZA 2OPJA 4BY3A 3QN3A 3G1YA 4AZCA 5FF0A 1QXLA 3MT1A 5CGMA 3R8RA 2GPTA 4ATDA 4IPIA 5B7YA 5DELA 3W37A 1UMLA 4PMOA 1EYWA 3KS5A 3MTWA 4IMCA 3STCA 3S5ZA 1QHOA 1JG9A 5CZ0A 2QMJA 1UR9A 4G56A 4U2ZA 3EOSA 1X7FA 1QW9A 4F40A 4WY0A 4DELA 1EKOA 2J8TA 4H1ZA 4KGJA 1PKMA 1EZWA 1E56A 1X96A 4O10A 2DSWA 5FD0A 1ALDA 3G0SA 1VYSX 3H4WA 1GTEA 2QJMA 1OC7A 1P48A 2WVTA 3TQ0A 3UWQA 3M5VA 4PODA 4UNIA 4L9XA 4ZGYA 1J2WA 2Y7EA 4PUJA 4CD8A 4US6A 1C8YA 2VFFA 3GW0A 4B9ZA 1BRLA 3MY9A 1OX6A 3C6CA 2OXNA 1IWPA 1JPHA 2VDGA 4OU1A 2PLMA 3GG7A 4HSHA 2OZ3A 3JUGA 4JKKA 3VIIA 2DVTA 3FHAA 4YVPA 1W8GA 3SW6A 4AWTA 2WMHA 4JQ1A 3GUGA 4TVCA 3NEHA 4MSSA 3GDKA 4JPGA 4TXEA 2TYSA 1XX1A 2QVHA 1J2BA 1U22A 2WWCA 1FH7A 3RNDA 1IEVA 2W27A 4J3WA 2ZRZA 4X9YA 4C5YA 2JKPA 2OFJA 4AFYA 1XLFA 3AS3A 3EMZA 4HQVA 2BG5A 3INPA 4ZTYA 1BLIA 2G4JA 3TONA 4AYSA 3P82A 3N3TA 4FXFA 1Q6RA 2V6AA 5BWAA 2VJXA 1DBTA 4GFSA 2QZRA 2R1NA 4IFOA 3N9SA 3OZMA 1BGAA 4UXDA 3NG3A 4TIMA 1RD5A 3QC0A 3WMLA 2C0AA 3VGGA 2AKMA 2YL6A 3S4TA 1S39A 3WG6A 3LPPA 4UQBA 4AZBA 3EOEA 1EBGA 3ITOA 4E2VA 3SCOA 1Q63A 1J93A 3N9KA 3V0UA 2G41A 2NUWA 3GK0A 5D37A 3GM8A 3SCRA 3N4AA 1B57A 3F4CA 3E2RA 3PFRA 3II1A 4QXIA 3TC6A 2EG7A 1OM0A 2A3BA 3TCEA 4AD2A 1CXHA 1KR0A 4S3CA 1OHLA 5DX7A 1W1ZA 3NQ8A 2Y62A 3GTIA 1E6PA 4POCA 1SO5A 5EMYA 5K3VA 1J11A 2J9ZA 4Q8TA 1KKRA 1B9BA 4CQCA 3HQNA 1U1JA 3KDOA 3PR2A 4OKDA 1BG4A 1EP3A 4J7RA 2E9LA 4LCQA 4XAGA 2F2KA 3S8HA 4J3TA 1LBMA 3BW4A 2YW3A 4HU8A 4A6GA 1E6NA 4KWVA 1JYNA 3SN1A 2ZVIA 2CWNA 4JX5A 2QUNA 3GDRA 4XD4A 2GQAA 2INZA 2WBKA 4OWGA 4Y96A 3NDYA 4JCLA 4D8AA 3GC5A 1EO5A 2NXIA 2A6NA 4GBUA 5T9CE 4YVVA 3VDGA 1C7SA 3LBOA 1OCQA 3E49A 4Q8WA 1FCVA 3S2MA 3WYZA 4RW5A 4XO7A 4Z0SA 3EEGA 1FKWA 1MXDA 5CSUA 1TPB1 3WQ4A 4RE0A 4R34A 4WKAA 2A21A 1XGDA 2PTYA 4K2SA 3LXBA 1SM9A 1OX4A 1IT7A 4AW7A 1S5WA 2YYUA 3E2SA 1VIZA 5JIPA 1C91A 4NVTA 1PS9A 4JIQA 1BTMA 5CZJA 1X8CA 4JTIA 1TTIA 3D6NA 4R53A 1RP9A 3MWCA 3MUZ1 3THDA 1RA0A 4LWWA 1ZALA 3OPSA 3UR2A 2PDWA 3S3GA 1IEXA 4REQA 3SECA 1FUYA 2OSXA 4JL1A 2Y6ZA 5A6AA 4JL2A 3VX0A 1Y65A 2V63A 2EHHA 1MUCA 1XIBA 1E6ZA 1O7AA 2XSXA 1I1WA 4H04A 2J9XA 5BOOA 2QDGA 5JH1A 4IFKB 1BVNP 1DWAM 2I9UA 3HIJA 2JBMA 2BGNE 4Q4QA 3PPGA 4EVZA 2VFDA 4AIUA 3W7DA 3W22A 1N2VA 3MKKA 2AGTA 2YZ5A 4H00A 3QY7A 1PKLA 3QTGA 3UR8A 1B3ZA 2HSAA 3P3BA 3W2UA 3NR0A 4WSHA 3ZVIA 3M46A 5C71A 3HU7A 2X7WA 1B3WA 3CWHA 2WSPA 5FAJA 4C6QA 3LRKA 2GJXB 1OINA 2FZDA 4UMBA 4X63A 3PTDA 3V75A 4XBSA 3O15A 1X1NA 2ZXQA 1SR0A 1BWLA 3PSVA 4U2YA 5LYRA 2QDHA 3WJWA 1A0EA 4NI8A 4KGLA 4GY1A 2E1DA 4HYVA 4GC3A 3DG7A 1LRQA 1R3TA 1WXJA 1X8FA 3BJSA 2NSOA 1VH7A 2YDSA 1XIDA 3CAQA 2INEA 3QY6A 3RX3A 2P10A 3T8QA 2FZMA 1AMYA 1KWKA 3BSHA 1E9LA 4TTUA 3LM3A 2EJ1A 2VFEA 3CK5A 1NTHA 3UWWA 2Y1HA 1G7UA 2IQDA 5KZDA 4B3LA 4S1FA 4O4VA 2E8ZA 4AZIA 2AGKA 2J7BA 1XRVA 3K46A 1EIXA 4KEVA 4Q8VA 3RM4A 2WZHA 4ZZ9A 2JE8A 2VGFA 4UB9A 1RBLA 2ZYFA 3S9IA 1CXLA 1GVFA 3SUSA 2XVPA 4YCOA 2V2HA 4QSFA 1HTIA 3ARSA 3MBFA 2PA6A 4WR3A 4PUKA 4X61A 3UY7A 1QPRA 4U3CA 1UKTA 2OT0A 1JQVA 1DORA 5GJPA 1D8CA 2VVNA 1TPUA 2RFGA 1H5VA 1H1YA 2ZQ0A 2DZVA 1EWDA 1DIEA 1OCBA 1JFXA 3EPMA 1KCXA 1A50A 3LS9A 4XTDA 2OWCA 1W3HA 3UXLA 4R33A 2QPXA 5FF4A 3VNDA 1KRCC 3CTLA 1EX1A 1QCWA 2R1PA 3DKLA 1OC6A 1J0YA 4AY8A 1AZ2A 4NZ4A 3UYIA 4TOQA 2CYGA 2Y7FA 2BGQA 1XUUA 4JTRA 4EXBA 3BG3A 3WL0A 3OG3A 2VGIA 1JULA 4X2RA 1MDLA 3NA8A 2O7SA 2OG9A 1PDZA 3W74A 3GU2A 6TAAA 4NJHA 3BXWA 2PGEA 4ZOCA 1FWHC 1BYDA 3G1XA 3OLDA 1MI3A 3V5OA 1QNSA 1VEOA 1KM0A 3PBYA 4ACYA 3G3DA 5HULA 5LXXA 4OVXA 3HJZA 2J88A 1WE5A 4C6IA 2NWRA 4L64A 3VI2A 4CLMA 3SCVA 4LAUA 3KLKA 1OZMA 4HHLA 4K6AA 3SJ3A 3HN3A 3O2LA 4IUGA 2NUXA 4GJ1A 3QXBA 4PCFA 2PE4A 4QAWA 1HKWA 3P0XA 3W2LA 2Q8ZA 4CN1A 3OOQA 3LDVA 3PTKA 3Q45A 1PIIA 1L6GA 3GH7A 3SN4A 1Y0EA 4A29A 4DYJA 2Q6ZA 2VNCA 3UJSA 2CLHA 1ZY9A 4BI5A 2P3EA 4H8VA 3ZIZA 2O9OA 2WQPA 1RK6A 4NG3A 2QCLA 1QVBA 1TX0A 2I9EA 5DANA 2EG6A 1UJQA 3QEZA 1W9VA 2QCCA 1BXNA 2DORA 4MB1A 2VR2A 1XLBA 1KXHA 1FCQA 2YFOA 2VD9A 3ES7A 4E3TA 3U4FA 2VT0A 4RE3A 2W3ZA 5D4YA 1K6AA 1NFGA 4PMUA 3UD6A 4UTFA 3CO4A 4RV3A 5FJJA 1A5AA 1GQIA 3VOGA 4L4LA 1KLZA 1W3TA 4OOZA 3WDIA 2H9AA 2PSNA 3APYA 1D8WA 3FFSA 1SQ7A 3FS2A 3WQWA 1GOKA 5TIMA 5A8OA 3VYLA 4MB3A 1F05A 3CUFA 4E2DA 1YPIA 3WBWA 3KWXA 4GG9A 5FEZA 3WLPA 1F07A 5CC3A 4XAZA 2VRQA 3TMQA 4J5NA 3PULA 3ZZ1A 4NYYA 2DP3A 2PDIA 3RGTA 3ARPA 5MKGB 3WFAA 2C13A 2I14A 1Q5MA 3QZEA 1TV5A 4EF9A 2ABAA 3GH4A 3ABOA 1DOSA 4KFNA 1PTGA 2DPEA 3EWWA 3MDWA 2O9TA 3A4XA 1V77A 4O8RA 2HROA 2D1ZA 1OFPA 3L7RA 1JPMA 2IKJA 1Q7QA 2XH4A 3KAOA 2YCJA 1P0KA 3WNNA 1X97A 4A8IA 1VZWA 3CB3A 1LBLA 4X9SA 4XVDA 5I02A 3S1WA 4GNJA 2AQVA 2VX7A 2ZZ7A 4S3AA 4WDXA 1NP0A 5DMNA 4B5XA 3WLNA 1WUFA 3KRZA 3AS2A 1UIPA 1YQ2A 3IGSA 1UYQA 2OEJA 5HXMA 1XRFA 4D6EA 3ARRA 6PTDA 3RU8X 2WJDA 4XD6A 4O0KA 1XPYA 1V6VA 4GGBA 3E2VA 3FGCA 4F2TA 1GVOA 4DBEA 1VBJA 4EK7A 1SR9A 4UTUA 2PTZA 4BEQA 3LBMA 3TR9A 2BODX 4DNHA 1CWYA 3MP3A 3OZYA 4NF7A 1UD5A 4ZOAA 4ZODA 4JTLA 2NVAA 4MUPA 1FHVA 2WWDA 3JS3A 1K9EA 3QZ6A 3L2MA 4DXVA 3OBKA 1BYBA 1JFHA 3HV8A 4US5A 3JR2A 1JJKA 3WJXA 1MW1A 2PU0A 2Z2BA 1DJIA 3C52A 5E6YA 4JXCA 1I2OA 1OK6A 1UA3A 3NL5A 1TTPA 1GQNA 2P53A 2XFRA 4D8ZA 3H55A 1H2JA 2WJFA 4JY8A 3O3RA 4HMEA 3SQSA 5E5CA 1UZDA 1GEHA 4WJXA 3WH5A 2HV5A 3RX2A 2FGBA 3H2NA 4MY1A 3SN0A 1TWSA 4IUOA 1LG1A 7TIMA 1ISYA 2VZVA 1TR1A 1JZ3A 3EB4A 4LNYA 4O14A 2XGZA 5DBTA 3OLGA 3I4KA 2YW4A 1SMAA 1YW1A 3BOLA 3L5MA 2E1WA 2XFYA 1ZCOA 1W9UA 4ZQOA 1KR1A 5H8MA 1LCOA 1T99A 1S5VA 1FWNA 3SEPA 4HPNA 3DOPA 2VEMA 1KV8A 1FBAA 2CFFA 2E9BA 1OGBA 1UOZA 2QHAA 1UKSA 3MI3A 3RG6A 3AHYA 3P81A 3S46A 4DUVA 3CIVA 3CLWA 5CJNA 3WX7A 4QM1A 2JIEA 2VOTA 1PX4A 2BVYA 3W6MA 3TTQA 4EPEC 4DWSD 1HIZA 4ZO8A 3UCCA 1OZQA 1O95A 3SGGA 1YIXA 2H90A 4AZ5A 1UZ1A 5LA0A 6REQB 4H9MA 1G4PA 4QTGA 2CZVA 4ZBCA 4ML9A 4XWUA 3OLEA 4AVFA 1KFCA 4C1NB 3IJ6A 1EIBA 4K8GA 4C6JA 5J8LA 5CG0A 4HA4A 5KZMA 4DF0A 5C2GA 1KFEA 4FOUA 1Z9AA 2WMIB 3CYVA 3LXAA 4PB5A 1NP2A 1ZS2A 3UVAA 4Z17A 3NNTA 1OFBA 3QQ0A 2FPTA 4QNEA 2QNEA 1ICQA 3VIKA 2HS8A 5GJNA 3REQB 3C5QA 2WVVB 1RR2A 5D8ZA 2DEPA 5AB3A 4G6CA 4MY9A 5JBFA 1POKA 1ESWA 1ME9A 4LS2A 3MB9A 3U6WA 4GCXA 1GVYA 4GQ0A 4JHOA 3ATZA 3LK6A 1GYNA 2X2GA 3DFHA 3VD7A 4KIRA 4ICNA 1M01A 4IHCA 1OB0A 1A5UA 1EJWC 3VMPA 2OYMA 3AJXA 3LZ5A 2X0YA 4LF1A 1YDVA 1S38A 4NAEB 3VKDA 3GFYA 1CGVA 2PRHA 5CZSA 1SU5A 2DZSA 1QMLA 3GG8A 3QGKC 3V18A 5A6MA 1V3JA 4O57A 3R8HA 3GHTA 2PTXA 1ZCCA 2Y5SA 4PMDA 5HATA 2J24A 4UTIA 5EFDA 5JH2A 3MHFA 1T41A 4DO5A 3LYEA 4HSOA 4G5DA 1JDFA 4HSNA 4C7GA 1RJPA 4AHOA 5FJRA 1EDTA 2YDAA 3FDGA 1QOPA 3AMGA 3LG3A 4KPLA 4N4QA 3UXAA 1W9DM 3PZVA 5AHLA 4DBWA 4V2XA 4NXKA 1HX0A 2C1IA 1ZLPA 1LBFA 5ABEA 3PAJA 4HA1A 3DCPA 1IZJA 2A3EA 1R86A 2QV5A 3BG5A 5D2VA 1RPKA 2E8YA 3UJEA 2PLJA 1W17A 4XZHA 1BEUA 3ARTA 3U8GA 2EEXA 1LUCB 1UH2A 1CTNA 2PPGA 1BPLB 4HZ8A 5IRPA 4ZO6A 1DWHM 1L6FA 3M6DA 5J5DA 3WBXA 1HO4A 4F0RA 3IWPA 1BSIA 3HPFA 3ZVHA 4Q7BA 4IJRA 3LEPA 1EOMA 2BXYA 4A8RA 3GDMA 1M3UA 1XJBA 3IIOA 4Y9OA 1XYMA 1OD8A 2ON3A 4F0MA 1D3CA 1KRBC 1FWBC 2FDSA 2ZX5A 3B4UA 3WNOA 2XIIA 4KCVA 2PDCA 1H11A 3W1UA 2AL1A 3OIXA 1YHTA 4DAFA 3GU1A 3SCPA 4Q22A 2WBGA 2PWFA 5K9CA 4DEFA 2C18A 2I5IA 3FW6A 3CQJA 1W9XA 3TYUA 4C60A 4Z0JA 5F2IA 5CPQA 3C0QA 2OSYA 4XKYB 1HJXA 1X6NA 1EPVA 4GX9A 2FH8A 3CV2A 1JUEA 4F2UA 5I3FA 4GQGA 2WPGA 5I7GA 1JUKA 5KZ6A 2Z1WA 1E6SM 4MDPA 3CUHA 3S2NA 4DM1A 1RQEA 1K9TA 4N9EA 3KL0A 1R9XA 3GHUA 4E2BA 1KFJA 1OVDA 1P0EA 3DHFA 1GUVA 3PAOA 2OQHA 2Y24A 2J7HA 2J8GA 1Y7VA 3NUKA 4LBSA 3VKKA 2R1MA 1CGYA 4HNNA 3WDQA 1WAUA 4JYDA 5CQ1A 1VEMA 3I10A 4HZ7A 1Q65A 1G69A 2MNRA 1S2TA 3L4ZA 2W92A 5I79A 3VXGA 1E72M 5I3HA 2NV2A 1EX5A 2VGBA 2X7VA 3EBVA 3PZQA 3C3UA 4PMXA 4MB4A 3RRAA 1KBKA 2Z0IA 4ICCX 4W84A 4LUIA 4MADA 4IOTA 1UBSA 1IR1A 1DEDA 3CPGA 2L5HA 4F0SA 3HG2A 1U33A 1I0BA 4CCEA 4AY7A 2QV4A 3GSMA 1VD6A 2CXEA 4F9JA 1IGSA 5HNTA 2QIWA 1VBHA 3CAWA 3EXRA 1Q6FA 4HK5A 2ANUA 1EZ2A 3PANA 2R94A 2E67A 3SURA 1OWQA 1XUZA 5CPSA 4GUIA 3GW3A 5AY7A 4FIQA 1AQFA 2Y63A 3B9NA 1E6QM 1J9YA 1LUCA 1AQ0A 1R30A 2Y4SA 3TA6A 5AYYA 4N0RA 4MG4A 2W63A 1VPQA 3LM7A 3LCXA 4GXPA 4ES4A 1H3GA 1XIHA 1LM1A 1TMHA 2AAMA 2YDQA 1W2PA 1G0CA 1YXDA 3L4XA 4GXMA 3FXYA 3H53A 1NSJA 4LV4A 1MO0A 4UCGA 4A2SA 2Z1VA 3C2YA 5EMMA 3WF2A 3OHMB 3NM3A 3P5YA 3T6CA 1LL7A 2YSWA 4E5TA 3WDPP 3DG6A 1JVNA 3QM3A 4O1EA 4NZ1A 3NFUA 3K4AA 2ZRVA 5FA5A 3DECA 1TJ1A 3CB8A 4O15A 4PL2A 3IJQA 2TSYA 4ZB2A 1HKVA 1Z41A 1HJUA 3UJRA 1HT6A 4XKYA 2PU1A 3IARA 1V93A 1BSLA 4CD7A 4NRSA 3TZNA 3CUZA 4JTSA 3NQGA 2XIBA 1NDZA 3W2JA 4L80A 1BG9A 2H8XA 1XF0A 4AB4A 1KM6A 4S3KA 3NOYA 4B2DA 2DZPA 4D1JA 4ZMGA 1OYCA 1C8VA 1VKFA 2GJPA 4IIGA 4UTWA 5CAKA 3QQ1A 1R9ZA 2WSYA 3CZJA 1RD6A 3NJ3A 1PVNA 4QLLA 4JX4A 2CHNA 4OT7A 3TQPA 4GI6A 2BXVA 3KDNA 1S3HA 2Y8VA 3SUTA 3VOIA 1OQFA 1E40A 3BQ5A 2VVSA 3WQVA 1DQXA 1ME8A 2OO6A 3PC0A 3VU2A 1A5CA 2Z24A 3AFBA 2GDVA 3SQLA 2J74A 4AD0A 2VC5A 2ZRXA 4HHMA 4JN7A 2VMFA 2YLLA 3L5LA 4L4PA 4GQRA 4IICA 3ZYZA 3W7QA 4K39A 1U1HA 1RQHA 2QCMA 3GY1A 4NKCA 3UZYA 2PDFA 4H2CA 4H7VA 2YA1A 3LLDA 3TIMA 2GSEA 2B7PA 3L2IA 1XD0A 2WMKA 3H12A 3FXGA 3T4WA 3F2DA 3BTNA 3IIVA 4HNTA 1EYEA 1TR9A 4NQ1A 5D30A 2NQJA 3PPFA 1RY0A 1QI4A 1FHLA 3GXMA 4MKSA 2GQ3A 4JIIX 4B16A 5BRPA 4JN6A 4IPJA 4OGZA 1EJRC 4AMAA 1J0HA 3W1XA 2YBTA 4H6QA 3DIPA 5BU6A 3MANA 2XIJA 3V1PA 2H6RA 1EO7A 1NY1A 5EBAA 2Q09A 2C1GA 3C4UA 4S3GA 2YXOA 4E6MA 4J4KA 3LHVA 1VS1A 2WNQA 4IMDA 3ALFA 2HE5A 3T78A 5G4EA 2DZBA 4DJFA 3O9NA 2V5DA 2VOMA 1XSKA 2HNEA 2FFCA 4M1RA 5DT7A 1MW3A 3T2QA 3GR7A 3BANA 5K2ZA 2F2HA 4MFDA 1TVNA 3HMJG 1E9ZB 3R1ZA 1NDYA 1LRTA 1QWKA 3BAXA 5CC7A 3FLUA 4V15A 2JEQA 4EX4A 2YKKA 4FLSA 3T81A 3GZ3A 1XFBA 5M17A 4R3UA 1LP6A 1JF6A 1OFEA 4UQAA 2XM1A 3JZUA 3MMUA 1AD1A 1T7LA 3EOLA 3ARZA 4L6HA 1R3QA 3M0YA 3W53A 2PWVA 3GUWA 3UG4A 4J40A 1M68A 1AD4A 4FLRA 5SWUA 5D9MA 2J9YA 2HRWA 3UA4A 4KERA 4A35A 1JCYA 4AF0A 3QH2A 1LRNA 5EMUA 3N6QA 2ZUVA 4Q4OA 3A9IA 1XP3A 2AMGA 4IPLA 4YPJA 4KIEA 1DXFA 5FOOA 3ZXWA 3VOHA 2PDKA 3GXTA 1SMDA 4UFMA 1T40A 3TOPA 3K30A 4JTTA 1LROA 1BQCA 4R85A 3RO8A 3GDTA 1KFKA 2VFIA 4OIFA 2JKAA 4DZ5A 1GQKA 1UC5A 3LCIA 5D03A 3MDUA 1K1DA 4HZ6A 4I5RA 1R9YA 4MPQA 5LA2A 4D6CA 3NVTA 2IUZA 1E4LA 2XDFA 4HK6A 4JHZA 3EYPA 3UERA 4Q4SA 5G2HA 2OGYA 3T0CA 5A2AA 3W1NA 5AYBA 1VLWA 5BRBA 4J27A 5KINA 1PTDA 1UR0A 2I5QA 3S1GA 3ITYA 1XLJA 4J3ZA 3R43A 3E12A 3O8AA 4WIWA 4A3YA 1DHKA 3FNDA 5I03A 4YWIA 1B1YA 4XX6A 1TG7A 1QNVA 1DKWA 4GBDA 5D9PA 3BLKA 2ZRYA 4FR1A 4RPQA 4A3QA 1KM2A 2ISFA 1DYSA 3ITCA 4CVWA 1QHPA 5GPRA 3FA4A 3GRIA 1CXKA 1QTWA 2XGBA 2CLEA 2Z7KA 3S42A 1B3OA 4JFWA 9XIMA 4WDTA 1FWJC 3N15A 2XUCA 3EDFA 4D6JA 1K4HA 3N4FA 3ZWTA 3RCMA 4WK9A 4A22A 3FVMA 2WPBA 2ZICA 2PWUA 4Z2HA 3DAQA 3LA4A 4S39A 3WBEA 1SVDA 1FX6A 3O6DA 1EJXC 2FGZA 1R46A 1FWTA 1XYFA 3SFKA 5AC5A 3T2PA 4LVBA 3W29A 3LGDA 1IYXA 1OJXA 3GXNA 1OK4A 1Q3NA 1T8QA 4L61A 2FMOA 4XZNX 4AIEA 4HYRA 1E3XA 1KBJA 5GJMA 3AIQA 2OWXA 4RNHA 4IGMA 5G1YA 2OLAA 2FDMA 3P7YA 3HV9A 3GYCA 7REQB 4ZOEA 4FNRA 3T0BA 4TX9A 4ZQNA 1CB2A 3TFCA 1E43A 5D38A 3MJYA 3R0KA 3WUGA 1ZBVA 2EKGA 1KKOA 3CUXA 4HJWA 2XPKA 3KP0A 2GJLA 2ALDA 1B9ZA 1YLVA 3CZLA 2GUBA 4YHEA 1GKRA 3STGA 2O4MA 3BL3A 2W5FA 3WDJA 4KMQA 1NDVA 4QROA 5HQMA 5AFDA 3B9OA 4NZ3A 3TTYA 1E9IA 4W8BA 2PD9A 1U5VA 4FXSA 3IJ9A 4O1BA 3N1AA 4JNYA 2V82A 4MKNA 3N2BA 4QE4A 2HK1A 2IMRA 5G2WA 1X6UA 4I9AA 1YDYA 1UWIA 4H41A 2XZ7A 4O18A 1YTDA 3PZ9A 4PCTA 3N2TA 2X41A 2OX1A 4AEFA 1JAEA 2HISA 2DZXA 2QJGA 2D22A 1AJZA 1GVEA 2BFGA 2G0WA 1P5BA 3H6OA 3N13A 1JZ5A 4HBKA 2QCDB 3FCPA 2DIKA 1VJIA 4BZYA 1B0IA 3UXDA 3VM7A 4PMYA 4UTWC 3G3MA 3GXIA 3RUBL 3UVIA 4DUOA 1B31A 1EJUC 4GQBA 1A5MC 3A64A 4ORIA 5F2LA 1DWJM 3HG5A 3UWZA 3MSRA 1XI3A 4KS0A 3GHRA 3BLFA 2VELA 5FIPA 4IIEA 2CLLA 1OFOA 3CAVA 2Z00A 1S2UA 3BMWA 3OIHA 2W6RA 1VRDA 1TV4A 3WQ6A 2J7EA 2ZUMA 1F74A 2DZAA 1K9FA 5DLCA 5I3JA 5G1MA 1DTUA 2VCCA 1XG4A 4PUWA 1E0XA 2O9PA 2G50A 3GHSA 5HAOA 3BQ6A 3NTYA 5FJUA 1DXEA 4MWAD 2GZXA 2J6VA 3UNDA 3G0XA 1V8EA 1FRBA 2JF7A 4F9DA 2BOFX 3NZQA 1PX3A 4R7JA 2ZDSA 5DXYA 4DO4A 1Z7AA 3KZPA 3G1HA 4AQLA 3AU2A 1YXCA 4JIEA 1UR3M 4WXZA 3C86A 4AIBA 1LZOA 1UCWA 2Y70A 3E5BA 1XKJA 1GTHA 4O0ZA 3BAKA 3IJ8A 3WK0A 2FPVA 9XIAA 4DLFA 1HJSA 2R82A 2GK1B 3R94A 5BOFA 1X7IA 3LQLA 3SUVA 4YJ5A 4GD0A 2A2IA 4RK8A 1V0MA 2UY3A 3W23A 2FJKA 2IXVA 3NQVA 5DRCA 4HKPA 1A0CA 3OLIA 4MPKA 1OCNA 3BARA 3GNOA 3N34A 3O6AA 2R1LA 3EB2A 3L4VA 4K38A 1XRTA 3GTXA 4JTAA 1XLAA 4XAFA 3WMBA 2J75A 3HA1A 2VDHA 2Y5JA 4HNVA 2E68A 4I7UA 4RLIA 4HPGA 4DJFC 4B4FA 4XTIA 2BY0A 3OZOA 5CBBA 1NDWA 4H7ZA 1UJPA 3NDZA 3ZT7A 4M8UA 4S3FA 3EX2A 1M5WA 2IKHA 4PUEA 1IZCA 2J8FA 4ML4A 4HPXA 1QDSA 4LTSA 3OGRA 2C7FA 4JTEA 5H91A 4CU8A 3VKBA 1EP1A 2ZFAA 1BF6A 1V6WA 3AU6A 5I3DA 2BSLA 4H9TA 4IP5A 3WK1A 1UA7A 1XL9A 2OYKA 1R2SA 4TR9A 1K03A 4ZXLA 3NXFA 1SFTA 5EFFA 4PC8A 2NVCA 5HK4A 3QMRA 2IQTA 2NV1A 1OG0A 5HA7A 3TC7A 3AOFA 1L0PA 5E93A 4B9YA 4WOZA 2QGYA 4IQEA 4KRTA 1MWOA 5CGQA 4LB4A 3KEHA 2CLKA 1O5XA 2V2DA 4WDUA 4L9ZA 5FEPA 2WZTA 4F2BA 3W73A 4ZEPA 3W1AA 3W1LA 1OGSA 4MNMA 3N19B 2ADAA 5DF0A 3TW7A 4DUXA 4V28A 3TJLA 4AMCA 3TDFA 3RLUA 1XYBA 2BXZA 1JYVA 4JTQA 4LNCA 2VC9A 5J5RA 4P8WA 2ZUUA 3W7RA 2J7FA 1TPEA 2R24A 1CXEA 4O11A 2X09A 1W5MA 3U9IA 5BOEA 3AUJA 3CJPA 4YMZA 3KBWA 3O0FA 1FWWA 3ABQA 3AXHA 5JQ9A 2D2HA 3BOXA 2G5WA 2FVKA 4ZO9A 2FB3A 3NWRA 5I3GA 4PBFA 3BGJA 3UNTA 3AIWA 1LLWA 2GK1A 1TJ0A 3N12A 1GJPA 4QIUA 3BPWA 5FL0A 2WW5A 4GIRA 4PSPA 4L9YA 5GNYA 4UNKA 4QR6A 3ABRA 1UHVA 4LOCA 3UP8A 5AC8A 4HU4A 1CXIA 3RCNA 1D7FA 2PGRA 5E0KA 3N3MA 4IG2A 4ACZB 3B97A 1JUBA 3V1HA 1BGGA 3HQPA 3M64A 3W38A 3VK5A 2JK2A 3VGEA 2E6YA 1HP5A 1YX1A 2PDHA 1BVZA 1LLZA 1ML1A 2ASHA 3H24A 1EHAA 1SJBA 3P6LA 3BDKA 3SFWA 3UCQA 4ADUA 1JI2A 3DGBA 1VGAA 1A3HA 2TODA 3FVDA 3AALA 3W71A 2F9RA 4JYEA 3G5EA 2H8ZA 2E25A 3GU9A 3VINA 5IM51 5CLTA 5FF3A 4WLCA 3CT7A 4PMRA 5DQPA 1J12A 3FSTA 5G1TA 3RJXA 3IJ7A 1V02E 4C90A 1IF2A 2OODA 3O7UA 2QJJA 3V35A 4PFHA 2FQIA 4WVXA 4F0HA 2WZEA 1FWDC 1A5LC 3WF3A 1QHZA 2HVOA 1UWQA 4MZYA 5BRQA 3ZR5A 1QATA 5A3HA 4GVGA 1JPIA 3ZR4A 2W91A 2Z29A 4DXKA 1KBLA 3LCWA 2WCAA 4ZSTA 4Q8PA 4Q8OA 1H0GA 3IVSA 2V5CA 3OU8A 2FGLA 3AIUA 1K4GA 2RDUA 4YTSA 3GAYA 3LTYA 1MYRA 1N8FA 1PCWA 2D20A 1T6MA 3DHDA 3IANA 3QGVA 4OECA 1VHCA 4KH2A 4GOAA 1C8XA 6ALDA 3UF9A 5BCAA 1AK5A 2FVMA 1F3EA 2XU2A 1US2A 4XAYA 3I6TA 4IMEA 4FMVA 3WEMA 4JEQA 4W7UA 4AXNA 3M47A 3V36A 1H7XA 3T09A 2WC7A 2VQUA 3KZSA 2X8RA 4S2BA 3BO9A 4XD5A 1XH1A 2YCLB 3IIPA 3M5XA 3MKVA 4YLWA 2R6OA 1W31A 2X40A 3MI6A 2A3LA 2NWSA 5EPDA 3IRDA 4S38A 4W7WA 4B5TA 3CEUA 1FP9A 1Q6GA 4C65A 4DBDA 2AQWA 1UBPC 1LQ2A 3VM5A 4GACA 4L1WA 3M4HA 1CLVA 2RJGA 4F66A 3DHUA 4ERGA 2BX7A 3PK7A 3WDRA 1KBIA 4GZIA 2YLAA 1ONEA 3M7SA 3WENA 3DC8A 2ZX7A 2JALA 3B0VC 4AZ6A 1JEZA 3ARWA 3AHXA 2CLFA 2VR5A 1C93A 2XVGA 4RPPA 1C9WA 3CL7A 3OODA 3PM6A 3C56A 3PNUA 3URNA 2XVLA 3VZXA 3EDKA 4MOZA 1YNPA 1GORA 2PCEA 3HPXA 2PB1A 2GGGA 4ONVA 1XCFA 4RW3A 2RDTA 3RDKA 4CNTA 3LD5A 4EPBC 1IXOA 4Q7NA 4U5IA 4F79A 1TREA 2NXHA 3AYRA 1ODZA 3TYCA 2PC4A 3V4BA 1UPPA 1X39A 2OZTA 1YKWA 3LCLA 1AH3A 4E2OA 4E8CA 3VIHA 4PGLA 3HZ3A 1LF1A 5E9AA 2PTDA 4S3EA 3H23A 3W76A 4RZBA 3G22A 5DEZA 3IK4A 2AKZA 1H61A 2GWGA 3F03K 5CZTA 4H9XA 4AG0A 4JX6A 3FJLA 3SCSA 3QFEA 2OO0A 2DGAA 1J0JA 1FCUA 2Y8UA 2EGZA 4QSHA 1XC4A 2YZRA 2CBVA 3TV8A 1H63A 3A22A 3VMNA 5IDZA 1K8ZA 2NLIA 4W8LA 3M0KA 4M1BA 2BB0A 2DUXA 2B4GA 3CPRA 4L5ZA 8RUCA 3W6YA 3PTQA 3UQNA 1PV8A 3BG9A 4MWAB 4DPPA 3V5CA 1KRMA 5AHMA 4URIA 3MMWA 3VD4A 4U31A 1XYAA 2BMBA 2ZUTA 2DUAA 5BNKA 2IS7A 4GZJA 1TPVA 1DIOA 2HDJA 3OHIA 4GCAA 3PVFA 5CJ5A 2YFNA 4LU0A 1UUMA 2GDQA 4DJEA 4YNGA 5LIKX 5RUBA 4I5UA 4GXWA 3LBCA 3KRSA 4NAFA 5C2XA 4N7QA 5A8MA 1Q8AA 4RE2A 5CBJA 2V3EA 1NOFA 4H7CA 3DG3A 4GI8A 1B3VA 1A53A 4MJ4A 1LWJA 3TTEA 3UY8A 4HTBA 3CQHA 4O12A 3UEQA 5REQB 2ZZ2A 3S5OA 1PIGA 4FF5A 4XV0A 3IUIA 1F8MA 2D0HA 3QC3A 1F61A 2OKTA 3A24A 2WJZA 4OJYA 2R14A 3GNNA 1EDQA 4M19A 1UKOA 1BF2A 5A8GA 4KESA 1TUXA 1QPKA 3U5UA 1QK2A 4FR6A 1EHNA 1WKFA 5E70A 4MLRA 3IK2A 3ZMRA 4X0VA 3WH8A 1B54A 3TLLA 5EY5A 3WMCA 1XIIA 5F4WA 4RE4A 4B5NA 3KE0A 3QRHA 1Q7ZA 3BV7A 3SB0A 1MQRA 1S1RA 4QRNA 4I8YA 4Z2KA 4FEZA 3AMKA 2BGSA 1UZHA 1K7EA 3PJTA 1P7TA 4HVXA 1EEXA 4ZTXA 3LRMA 4IISA 4HPJA 3KCLA 1EF3A 3GS6A 5E1QA 4A3UA 4UOJA 3VGDA 2ZADA 4PRTA 3NOEA 4LEQA 4GA8A 2JGQA 2LLEA 3DFYA 3BLLA 4JDYA 2OZ0A 8XIAA 5HNRA 1OSEA 2IPJA 1JZ7A 3CUJA 4E38A 1MMFA 3EDDA 3Q65A 3AXKA 5D02A 3MP4A 1WDRA 4N42A 4AZGA 1ZBWA 1OFDA 2CLOA 3GTNA 4G7EA 2FMNA 3VC6A 3PTMA 4PMQA 2J78A 4YU1A 3VAVA 3NYZA 2Z2AA 3USZA 4TTGA 1XLEA 1CLXA 3AJ7A 1DJWA 2A4AA 3GVRA 3RLGA 4LYPA 1AL7A 3CU2A 1G4TA 1DP0A 4RXFA 5L6UA 3TQVA 2EKCA 1DQUA 4GVHA 4GY0A 5F1VA 3A6OA 1IIGA 2AL2B 3AIEA 2VRKA 3LN3A 1RHCA 2DW6A 2PWEA 1T5AA 4J28A 4IF2A 3R25A 4WY0F 3BC9A 2DVUA 1EWEA 2Z1XA 4QEEA 3H7VA 1E6XM 2DJLA 1VQTA 5AYIA 1RH9A 5IHSA 2ODOA 1FDYA 5GNZA 4I6KA 3JZEA 4RDZA 5MHBA 4UZSA 1UP2A 3K8KA 1V4YA 1R5YA 4NX5A 3B8DA 3KXQA 2REQA 3OO2A 1SSGA 2W61A 1R2TA 3GC2A 1GW1A 1NM9A 2RAGA 5REQA 1F76A 1UD6A 2VZTA 4BQ3A 1E1CB 2CHRA 4L4OA 3WBAA 3PHAA 1I0DA 4QGCA 5JU6A 4UFJA 4CD5A 1UP0A 3H2AA 2WAGA 3W7NA 3AMCA 3RITA 3O06A 4GABA 1RA5A 2WK2A 4GHRA 2ZA2A 4WCJA 3SRKA 3L68A 3ATYA 1PAMA 3BAWA 1S5MA 2OOGA 1TE1A 4GLEA 2UZ9A 1Z44A 1U83A 3G1VA 1R3WA 1HL8A 3PB2A 3LI1A 4GQQA 4GNVA 5DO8A 4AVNA 1Q4WA 2CKSA 1FDJA 3C8FA 3JW7A 4HCHA 5ABFB 1ITQA 3VKAA 3QMSA 3VKJA 2VX6A 4C6EA 3Q58A 2G95A 1J5SA 1WOBA 1V79A 1MQPA 3E0VA 4LS1A 4KWSA 2FHCA 4H9YA 2ACQA 3EA3A 5GVJA 2Y88A 1AODA 1O5RA 1K9DA 2VEGA 2X1UA 1BXCA 1NWSA 2INFA 1H4PA 1OT1A 1JXKA 1J5TA 3UYCA 3BOFA 1KFLA 4GC4A 5A6BD 1PJ9A 3K13A 4A21A 2ZXBA 3APGA 2NQ9A 3BAJA 3FAXA 2CU0A 1DVJA 2Q8XA 3VNMA 3WQPA 4AUBA 4K8HA 4CUCA 4LFYA 3K8MA 3P74A 5TQLA 3NIYA 1VFTA 4ZO7A 3C0JA 5D09A 2RDWA 5JVLA 4PN2A 2D2OA 1IEIA 1AZ1A 1EF2A 3K2GA 1Q6QA 2BVDA 2VUYA 3PZGA 1NVMA 2AL2A 5A6SA 5C55A 1XQLA 2Y8KA 3H7RA 1A47A 2X0SA 1Y5XA 3SR7A 4HOWA 1P1MA 1S2CA 5HMEA 1J10A 3WNLA 3NPVA 3ZT5A 3P8IA 5XIAA 4Z1YA 5A8NA 3V5FA 3L4WA 4KF1A 1WA3A 3SIMA 1AG1O 1KCKA 1ZUAX 1XWYA 5CSYA 3O1NA 4HMDA 1X38A 1ZB5A 3GBEA 2ATMA 1O4UA 2GVJA 4MJZA 1VP5A 3EMCA 3W7KA 2C16A 1XDJA 4GO8A 1OCJA 1NAL1 3LUTA 4K68A 2C79A 1B2YA 4Y6GA 2V2CA 4EPDC 1IT8A 1UD8A 4JYFA 2WHJA 4RCXA 3TQKA 5HJYA 3IJDA 1NOUA 3NQ2A 2GYIA 2PAJA 3LHTA 1MNSA 1E1CA 2YX0A 1YEYA 1C29A 1P6BA 1MRQA 1Z32X 3U57A 3UZJA 3WDHA 4DJEC 2HXTA 3A5FA 3DFPA 4UR8A 3T9PA 1EXBA 4IM4A 2YA2A 2XWEA 3F1QA 5E6ZA 1KFWA 3M0LA 2IW0A 1Q7MA 2QEZA 3RLHA 3URQA 3ABXA 3IGUA 4LVFA 1HJQA 4DI9A 5M03A 1NARA 3FJ6A 4JHMA 5A2CA 4QNWA 3EZ4A 2WSRA 5B80A 3L4YA 3NZ1A 3UZ5A 3E6EA 3QW4B 3F5LA 3ME3A 1LJYA 3O05A 1GOOA 1REQB 3Q4DA 1YTKA 1Z69A 1FWEC 3G1SA 2ZXAA 3N73A 5ABFA 1LOLA 1UZ4A 2B7NA 1GJUA 3T05A 1ZU8A 4O17A 1KNWA 1R38A 4W5UA 3STFA 3S6OA 3MZNA 3GXFA 2G4FA 2W66A 4EKJA 3L2LA 3B0XA 4CQAA 3ALGA 2CXGA 2TMDA 1LTDA 4IH3A 1UWAA 2Y85A 3W3OA 1GCYA 1V5XA 2ABBA 2YXXA 1DQWA 3N29A 2WMGA 4Y8EA 4LT9A 4BQ4A 1R3YA 4ZOBA 4PH6A 3AO0A 1RY8A 3WLSA 3BSGA 3UU0A 4O52A 4C6KA 4AX7A 1FTXA 1PIFA 3ICJA 5LGXA 4IIHA 5FJIA 4GH3A 4LF2A 3K1GA 4GINA 4XIMA 1ISWA 2G8ZA 1WYIA 2O4QA 2CBJA 3VE9A 3WLIA 3R0DA 3F2BA 5AVNA 3R4IA 4NJKA 2WVSA 1KO0A 1VBRA 3ZSSA 1Z6KA 4I9MA 3IV3A 3MUXA 4YYCA 3H2EA 3PZNA 2FYMA 3TYAA 3FIGA 3BE7A 2OZ8A 1TWDA 3QV8A 2GVEA 2B31A 4FSAA 5C9XA 3K8LA 3S5YA 4CQBA 3LTPA 4GVFA 4F4RA 1V7AA 2VI0A 2RUSA 3HQOA 2PLKA 2PFHA 3PZIA 2OEKA 4DYEA 3WK2A 1R47A 1QBAA 1W6TA 4PTMA 1WXZA 1TE6A 3ZJ6A 4FK9A 3K4WA 4P7OA 4ZQCA 2ICSA 3IIZA 3W84A 1FFQA 3CMGA 4X60A 1S1PA 4UR9A 3N2XA 1W1PA 4L65A 4JFUA 1H51A 4N9DA 5DY3A 5LNRA 3LNMA 2DVXA 2XISA 4W85A 3ZOAA 3UFYA 3JVAA 2E6FA 1GPFA 1TMQA 3N14A 4I7VA 3W24A 5DY2A 4UFIA 5JXQA 1C92A 4OV4A 1FHDA 3XINA 2WNWA 3EAUA 1DV7A 2PDQA 3MJMA 4PBEA 2VDIA 1TO3A 3ZJKA 3W88A 1EDGA 4HA0A 1UH4A 5C70A 1WDDA 1R0MA 1XBVA 3EXSA 4JCMA 4LS0A 1GT8A 1HXJA 4OQVA 2SFPA 1BYCA 3MUY1 3C61A 3MHGA 4O1CA 1O1ZA 1TPH1 2QAPA 3UBPC 1HO1A 4GH1A 3VUSA 1JCNA 4FNPA 1H7WA 2EO7A 3M9YA 2NT0A 2GSJA 1TZ9A 3Q94A 4B5WA 4KEUA 1MVYA 3M0ZA 2E6AA 3GXPA 2WSQA 3W1RA 3KVKA 3F4WA 2GGEA 4GK8A 4D1IA 4AH7A 1TSIA 2E5CA 2QCGA 3U7BA 4FX6M 1PYFA 1ZTVA