3SY1A

Crystal structure of engineered protein. northeast structural genomics consortium target or70
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
229
structure length
229
Chain Sequence
MMNDIAHNLAQVRDKISAAATRCGRSPEEITLVAVSKTKPASAIAEAIDAGQRQFSEHYVQEGVDKIRHFQELGVTGLEWNFAGPLQSNKSRLVAEHFDWCITIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRLRGLSAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLALGQSDDMEAAIAAGSTMVAIGTAIFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pyridoxal phosphate binding
molecule keywords UPF0001 protein yggS
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR70
rcsb
source organism Escherichia coli
total genus 85
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3sy1A00
4BHYA 4ECLA 1HKVA 1KO0A 3HURA 3UW6A 3SY1A 4WR3A 4KBXA 4QHRA 3C5QA 5BWAA 3N2BA 1L6FA 4A3QA 3B8TA 5FAJA 1VFTA 3B8VA 2OO0A 1KNWA 2NVAA 4LUTB 2QGHA 4V15A 3VABA 4LUTA 1XQLA 3AWNA 1L6GA 4LUSB 1B54A 2J66A 2NV9A 4DZAA 1NJJA 4LUSA 3KW3A 1EPVA 3ANVA 2RJHA 3N2OA 2TODA 3WQFA 3HA1A 1XFCA 2YXXA 1HKWA 1NIUA 1W8GA 2P3EA 4PB3A 3WQGA 3WQCA 5IRPA 1XQKA 3S46A 1TUFA 1VFHA 4XBJA 3WQDA 1TWIA 3B8WA 4BF5A 2ODOA 1SZRA 5FACA 3WQEA 4ILSA 3LLXA 1CT5A 3B8UA 3GWQA 3NZQA 3CO8A 4ZGYA 2VD9A 3BTNA 5FAGA 3OO2A 1FTXA 1RCQA 1D7KA 3E6EA 5GJPA 1BD0A 3CPGA 3E5PA 5GJNA 3NZPA 1VFSA 2RJGA 4Y2WA 2O0TA 1SFTA 4XG1A 4PB4A 2ON3A 4FS9A 4LUYA 7ODCA 3R79A 4PB5A 3ANUA 1QU4A 4BEQA 3N29A 4BEUA 4DYJA 4AIBA 3MT1A 1F3TA 3AWOA 2DY3A 5GJMA 2PLJA 2PLKA 2VD8A 2SFPA
chains in the Genus database with same CATH superfamily
1EIXA 3W1XA 4IXXA 3CV7A 1RR2A 2WJEA 3TJLA 2WVVB 3LCLA 4QX4A 3LPPA 1O5KA 4ZTXA 4GABA 4IL0A 3SSZA 2YA1A 3GNRA 4HJWA 2XVPA 3WQPA 1H4PA 4Q8MA 4DWSB 1SU5A 3TR9A 3BAYA 4MB4A 1WAWA 5TF0A 1PCWA 3F4WA 2WXDM 4TX9A 1L8NA 3P93A 1QI4A 1BQGA 1Q4NX 1XLIA 3TQ0A 4Z1CA 3T4CA 1UD8A 3PNUA 4UQAA 4N7QA 1EUAA 3FA4A 5IDZA 3DI1A 3KZSA 1VEOA 3UWQA 4UOZA 2YW3A 5LIYX 3MSDA 2Y2WA 3EWWA 1WXZA 1J10A 3DUGA 5AHEA 2GGEA 3CL7A 1FWWA 1V8EA 1JZ2A 1FHLA 2QF7A 4LOCA 3NO3A 3SO7A 1QOQA 2YA2A 9XIMA 3LHUA 3RX3A 2PZ0A 1DHKA 2W3ZA 2G3JA 5HOSA 2VZTA 1W1YA 3ITGA 2WWCA 5IFPA 1H5VA 3WF1A 1TMLA 4TV6A 4Y96A 5I24A 1DV7A 3HG3A 4MWAB 5A94A 4J28A 2Y5JA 1K6AA 1N2VA 4RKAA 2C0HA 5FJUA 4EF8A 5HQMA 1FDZA 3TW7A 1KFLA 2ZICA 1XBXA 3SCQA 2CLOA 4NXSA 4RZ4A 1A5KC 1M01A 2ZXAA 2JKAA 1C8QA 2R1LA 5AYYA 4B5TA 2RAGA 1OC5A 2J7FA 5I6SA 2Y7FA 3STCA 3PWAA 2FLIA 1FWJC 3HO8A 3LXCA 2BDQA 3M6DA 3HA1A 1EQCA 1EC8A 4JTJA 1E4LA 2VDGA 1OFDA 5G4HC 3GG8A 5A6LA 1XICA 2W67A 2NSOA 8A3HA 3P84A 3H7RA 1Z69A 3ZO9A 4ERIA 3TN5A 3GAYA 3QRHA 5FL1A 3S0CA 3M5YA 3QSRA 1UPMB 2CLIA 4PBEA 1Y5XA 1ZL1A 1HJUA 3LA4A 3VGEA 3PUDA 4KRTA 3UY7A 3LSBA 5H2ZA 1W3TA 1CGXA 3VIOA 3PBGA 1XLMA 2PRLA 2PGRA 3XINA 1F2JA 3EXRA 1OK6A 3T2QA 5D32A 4HHHA 2PWEA 1V6WA 4FNPA 3ITCA 4L56A 2E8YA 2OLAA 3MHFA 4QSFA 4WKHA 3S9YA 3BV4A 5HA7A 4OE7A 4CGTA 4PCSA 3RU8X 4Z2LA 4NUWA 4MMWA 3TC3A 3U2OA 3R10A 3VIKA 4LJ3A 1AQHA 2E77A 3G6MA 4RR4A 3DGRA 3VKBA 3DYMA 2DT0A 3LM7A 4LV9A 3QR3A 3PBVA 2PDBA 4S3AA 3WDHA 3NO5A 2PU0A 1DP0A 3TWAA 2Y4SA 4MDOA 1JDCA 2G3FA 5CAHA 3GK0A 3KCOA 3M47A 3IAPA 4QGCA 4C6IA 1BYAA 3BW3A 5KZEA 4JQAA 4PUDA 7PTDA 5DEZA 4AZGA 1YTDA 2X7VA 3V75A 1J0IA 3G0UA 3WBAA 2UV8G 2D2OA 1P0DA 1H61A 4Z17A 3TWBA 5K9XA 3PAJA 3THAA 1R3SA 2HQAA 1M1BA 3BW4A 3ARPA 1MMFA 2BS9A 4G56A 1GOXA 4RZ6A 3TR2A 3CLWA 3S2MA 4ZFCA 1UP0A 1JZ8A 2NQHA 3T9PA 1NSJA 4IMAA 3UNDA 5HXMA 1SR9A 4UFLA 3C61A 1MRAA 4IIDA 5I3DA 1WOAA 2A3AA 1EJWC 1TRIA 1QUMA 4WXZA 2QUUA 3DXIA 3G3MA 1NP2A 1C8XA 2C6QA 3SRFA 1OGGA 1XYAA 1K02A 1XRSA 3DFOA 4LBSA 2PAJA 3IJIA 2NV9A 1P1XA 3MUZ1 3U2CA 4AIEA 4ADUA 5CSUA 3P74A 3KW3A 3B04A 2XFRA 3URBA 1KRMA 4QBXA 3PG9A 2WVTA 1UHVA 3QFEA 1V7YA 3NTYA 4WF7A 2Z1XA 1REQB 4ZFMA 3PSWA 5JQ9A 3TW9A 2Q6ZA 2PFHA 1E56A 3W01A 3PJXA 1QNVA 4JN7A 1UR2A 1V6YA 3S46A 2D2GA 5CCZA 1GPWA 4FOUA 1TWIA 3VM5A 2V5KA 2PC8A 3OLIA 1GVEA 3W00A 3NQBA 1S2WA 3A6OA 2VYOA 4AD0A 3C2VA 4GINA 1XDJA 2C71A 4D1IA 2DDXA 2QEZA 1VJZA 1V03A 2NQ9A 4HN8A 2DV0A 1X8FA 3DI0A 2BHUA 4KFOA 4ZQCA 1IGWA 1DQWA 1R6WA 2AMGA 1Q2SA 3AC0A 1DQXA 3LCFA 5EKYA 3ABRA 3WN6A 2E1DA 3S4TA 1E71M 3SCSA 4CQ8A 1MQQA 3IV8A 4JQ4A 5G2WA 3RILA 2PLJA 1G4PA 1G69A 1DWGM 5G5IA 3ARWA 1R2TA 3FHQA 4A05A 3SCUA 4JPGA 2UBPC 2NX1A 4JNMA 3W3OA 1M5WA 3BDKA 1GPFA 1ZLPA 2VFEA 2PWVA 2AGKA 2VM8A 2O4QA 1T0OA 4B92A 1TIWA 3KBNA 4RLIA 5C2XA 3B4YA 4NQ1A 3EOOA 4ZBCA 3QHOA 4A4AA 5A8PA 1H1ZA 3PHAA 3P80A 2FFIA 2QUTA 4O54A 1UJPA 4LBUA 4W9TA 2VGIA 4LWWA 2WNZA 4L4OA 3UFYA 1B30A 4LAMA 1F4AA 4OGZA 1I1XA 2YZRA 5FEPA 3WD1A 1W0MA 1PZ2A 3ARYA 3GIPA 1MEWA 4D71A 2F61A 4UTFA 2XGIA 2W0UA 1M68A 3RLHA 2VL4A 3WDPP 4FI4A 3CC1A 2WYSA 1YIXA 3OBAA 1J12A 1TPFA 2RHGA 3PM6A 1E73M 5CJMA 2C1IA 4D72A 4PB5A 1ZTVA 3ONBA 1EHNA 4ML4A 2OG9A 1MNSA 3L68A 2D0HA 1FXQA 1NM9A 4Q7NA 1AODA 4CD8A 1FWTA 1PTAA 3HQOA 3KBJA 2IQDA 5REQB 2XH7A 1KKRA 4ROQA 1Q7QA 4YN5A 2CWXA 4BS0A 3PZ9A 2WMHA 3VO0A 1GT8A 4PUJA 2BBFA 3P8JA 2YYTA 3B97A 1AQFA 4OZOA 1UZDA 1XLAA 4LUSA 2ALRA 2NWSA 2TODA 4NL1A 3BLKA 1UG6A 2FZMA 3BLOA 2EPMX 3SCTA 2C0AA 3V35A 3ZZ1A 1E9IA 5DO8A 3WBEA 2V8ZA 2XFYA 4IXHA 3SR7A 1JRCA 1ODUA 5J5RA 1E1CA 1BKSA 1PHWA 1OSEA 4HPGA 2F8QA 1E0VA 2A7RA 4PFMA 1XIGA 3PPCA 1OGBA 3C0QA 3FSUA 2DVTA 5HNTA 1S2CA 5AN7A 2QQ6A 3MP4A 2WHLA 5DLCA 1ECEA 2ATMA 2IKIA 1LBFA 4Z2JA 2AL1A 4UZUA 1MWOA 3TFXA 3WF3A 1FXPA 3EWBX 1EYEA 4FHAA 1BEUA 3PF3A 3FGCA 4IQDA 4PULA 1D3HA 4KCVA 4TV5A 1WCGA 1U1HA 2F2HA 4BQ2A 2G37A 5CC3A 3NQVA 3S1VA 5HWMA 4H9YA 4KPLA 4CLMA 4QISA 3TW6A 1ZENA 3ZSTA 1K9FA 1NOWA 4I6VA 1H7XA 3OBEA 1DL3A 1JR1A 1H2JA 2W27A 2IQTA 3JW7A 5DFAA 2JQXA 2VWTA 1UJQA 4H01A 5D09A 1F3EA 4EF9A 1ISZA 3NDYA 5I02A 3CGTA 5A2AA 1Q6DA 3GR7A 1GJUA 1YHTA 3QTGA 1KM4A 5BMWA 3P62A 3NGJA 2PDJA 1UR3M 1RBOB 1GVYA 2P88A 3PS7A 2A3BA 4MG4A 1CBGA 4LCQA 1WQ5A 2NQJA 1DJWA 5LYRA 2QZRA 2WC7A 2QVHA 5LHEA 4UR8A 2R82A 3TC7A 1XL9A 1EIBA 1H11A 2AOSA 3UNTA 2DUXA 1K77A 5C0QA 2GDUA 2PDFA 3NL2A 3QLDA 3GQYA 4HK7A 2YX0A 2F84A 3HQ1A 1R85A 1K4HA 3NL6A 3TQKA 4J3TA 2NX3A 2NV2A 4QJ3B 3DFNA 2DY3A 4LUIA 2BVYA 1JFXA 5I23A 5I79A 1BVNP 4K8GA 2V0TA 3ITVA 5T9CE 3PTKA 3S6OA 2PS2A 1S5TA 1V3KA 1W9UA 3DU0A 4Y8EA 2CW6A 3OZPA 1GJWA 4HA0A 3RR4A 4Z2IA 1ONWA 2EPOA 4M19A 3AOFA 4ZA0A 1MW3A 3HMCA 1L6SA 3FYOA 3QV6A 1HO4A 1RA0A 3EEZA 4LX4A 5CSRA 5GPRA 2ISVA 2BOGX 1EJVC 3BJFA 2GUBA 4BJHA 5D4YA 3WD2A 2A3EA 2NLYA 4O19A 3WH6A 4AHQA 1P7TB 1OYBA 1XLKA 3G1VA 4PA8A 3IJ9A 3T0DA 3QVQA 4CD7A 1H60A 3L23A 3NZGA 2X09A 1VH7A 3V1PA 3PANA 4L9YA 4FXRA 2DH3A 3POCA 1KRAC 4DZIA 1ZSXA 2QJGA 4HMDA 1G1YA 3EWXA 3SN0A 1WBJA 2ZUVA 2D24A 1HN1A 4KESA 7TIMA 5BOFA 1SO5A 3U2ZA 2W6RA 2CLKA 5H1WA 4NZJA 4KRZA 3DAQA 2AAMA 1U5VA 3B9EA 3NAVA 3RX4A 3W7RA 4HNNA 4H8HA 4BEUA 4XZ9A 2RGLA 4L4LA 4FXSA 2DSVA 3CHFA 4ZSUA 1YW1A 1R0MA 1RP8A 2R9RA 1F7BA 1V3MA 3K8MA 4PODA 3PZVA 7REQA 1KBIA 4ZB5A 4H9VA 1H09A 1O6IA 1MFVA 3EDJA 4QR6A 2E09A 4N4QA 2WV8A 3T81A 3OVRA 4Y9MA 4QSHA 3PK7A 2BHYA 4X0VA 3MI3A 1SZNA 1Y5WA 1HVQA 1XFCA 3W22A 4UCGA 5HR7A 2A4AA 2OXNA 3WLTA 4Z08A 4GFSA 4CQDA 3QJAA 3SFWA 4JX6A 4FZIA 5AY7A 1Q6GA 5HULA 1XIBA 1Z9AA 3NUKA 4WSHA 3W7GA 4NILA 2J88A 2VCCA 2DVUA 4UTUA 3W7MA 3N17A 4EPKA 5EFFA 3LCHA 3G1FA 2BOFX 5DMLA 4PFHA 3TYCA 1B9BA 2GJRA 1AD4A 5FAGA 3Q37A 5D05A 4AC1X 4XO6A 2IPJA 4HMEA 2INFA 3TVAA 4H7CA 1BD0A 5D2YA 2ZZ3A 3S83A 4Q6XA 4C6JA 2MUCA 2QJMA 1T41A 4IJBA 1MI3A 1SM9A 4IPJA 3LDVA 1SUXA 2OX1A 2PGWA 3WNKA 3DFQA 1WZAA 1RY0A 4M6PA 1GEQA 4B5UA 3G1RA 4IP4A 4GO9A 4H19A 3N3MA 5AYIA 4AY7A 3REQB 3SY8A 3UWZA 4CNOA 2G8ZA 4CVWA 2WO5A 4AZ5A 4C1NA 1ITQA 2PDXA 2E9MA 2FZ9A 1CEOA 1EH9A 1KCZA 3BUVA 3QZEA 3ARZA 4A3RA 1K70A 4OBSA 5DT7A 4QJ5B 3IGSA 5MHBA 4U4MA 3E02A 3UXLA 2RDXA 1E1EA 5F2LA 3PZGA 3V1HA 2PDKA 1RBAA 2RGMA 3ZVHA 2WHKA 5MKGA 5FI8A 5ABHA 3R94A 3ITYA 1OYCA 3K5XA 2VUYA 3O1NA 4L6HA 4F0MA 2ZZ5A 4ZTYA 1SJAA 2ZRYA 4DO6A 3BGAA 3BTNA 4A8RA 4YTQA 3OTRA 2FZNA 4XIMA 1W2PA 1R8LA 3CUXA 3HFTA 3L0GA 2IPGA 4W86A 2RUSA 1GOOA 4QTGA 2EKGA 2J24A 3EOUA 3PNZA 1O1ZA 1XIHA 4Z1DA 4HOZA 1W1B1 4PTMA 1XDMA 4IG2B 1OD8A 2QIWA 4GJIA 3NM3A 3BLFA 5AHMA 3TK7A 2FGLA 2QV4A 4IX0A 4LRTA 5EBAA 2J4GA 3MB9A 3TSBA 5HQLA 2PLKA 3M1ZA 1O1HA 1UB3A 3IIPA 3MWCA 4JGDA 3ZLHA 1VBRA 2GDQA 3B3DA 1ITCA 2GL5A 4RV3A 3W2UA 1YADA 2NUXA 1BHGA 5C54A 1B57A 1IXQA 1UW9A 4NT0A 4I9MA 4J9JA 3A4XA 3VOFA 4ZO7A 3LK6A 4H41A 4LCSA 4D9PA 3LGEA 3FN9A 1E51A 3PPGA 4IT1A 3GIYA 1QBAA 2E8ZA 2E5BA 1Q6CA 2VHLA 4HT3A 4UFKA 1CXFA 1U5JA 3RLGA 2PDYA 4F66A 5JH1A 3DC8A 3OVPA 1W9XA 5FJJA 3VOJA 1R9ZA 3CXOA 3LY0A 3OEXA 3W28A 1A5SA 1W9BM 4YVPA 2EHHA 4IGMA 3ALFA 1PZ1A 1K1DA 3OO2A 4JOMA 5M1TA 4NAEB 2PURA 3B05A 5E93A 3W1LA 1RLCL 3C3NA 4RDVA 4DUWA 1UP2A 1Z44A 3N14A 3VE9A 4AD3A 5KSWA 1RJRA 2ZZ6A 5A1AA 4E5TA 1LDCA 5CEWA 4XD6A 1TO3A 3N29A 3SGZA 3QXBA 3ARVA 4S3EA 3R43A 2H3BA 4AIBA 3NEVA 5AZ0A 1NOFA 5GJMA 2Z00A 5AYXA 4C60A 3ME3A 1UR9A 2P76A 4QS5A 3BARA 3M0XA 5FA5A 4X2PA 1RBLA 4ICMA 2DORA 4H6QA 2X8RA 4WY0A 4JIHA 3GB6A 4XB3A 1XBZA 4M6QA 1FX6A 4DZAA 3LOTA 5GQBA 3OGVA 4JHZA 5FEWA 1ZAIA 3N2TA 4IGSA 4G2DA 1TV3A 2ZXQA 3HPAA 3SQLA 4F0HA 4U3CA 3CUFA 1UROA 4CQAA 3M41A 3K4AA 4DHGA 5C7VA 3R25A 3TN6A 2CXGA 3LV5A 2R14A 3VINA 3CB8A 4N4PA 4U5KA 2ZUNA 3BSHA 3W1MA 1X39A 2WBGA 1UD2A 4IFKA 1DQUA 3VTRA 2EGZA 1C90A 4PUUA 4WJXA 3ABSA 1XS2A 3T4WA 1M65A 3EZ4A 4NHVA 1UBSA 2WCAA 4L5ZA 3LQLA 3MKKA 2WZIA 3SIZA 1TWDA 3RJXA 4DO4A 1ECQA 1BWVA 4CEXC 1BYCA 1TVPA 4LVGA 1BQCA 3BAIA 4AD4A 2OSYA 5DMNA 2VFIA 1OF8A 4PBGA 4QQ3A 3H8AA 1A0EA 2IW0A 4IICA 1K7EA 1N8WA 5BU9A 2P3ZA 3V3WA 3ZR4A 4CU7A 1K7FA 3IJ7A 5K4XA 2CBJA 5PTDA 4K1WA 2ZUUA 4TMBA 1YDNA 4GE8A 5GNZA 3IIVA 1MFUA 5DCEA 3B4UA 3KVMA 4MY8A 3GVVA 1VFTA 4RNJA 3VMNA 5JVLA 1VP5A 3WKZA 3TN4A 2VZVA 4ORIA 3AICA 3DG6A 4S3FA 1W1VA 2VGBA 2IPFA 3PUGA 3AXXA 1EBHA 4I6KA 1GVOA 4GIYA 3G77A 5LNSA 4DBDA 4RXGA 3W6MA 2A21A 1UWSA 3LEPA 3TA6A 3M43A 4QEEA 4WHBA 1GZJA 4J4KA 1XINA 4LPCA 4UTTC 4IIFA 1W1IE 4L6DA 3FX4A 3RFAA 1MZRA 1XD1A 3HMJG 4HHPA 1B3WA 3PFRA 1UQYA 5E6ZA 1IEXA 2GDVA 3PSVA 2C8NA 3EEGA 4YMZA 3I10A 3UGVA 3W86A 4YWSA 2GUUA 1ZBKA 1EDGA 1G9HA 3UVAA 4BQ3A 2ON3A 4HCHA 3L5AA 4HOXA 2BLEA 4GJ1A 3JZUA 4S3DA 2VT0A 4D6GA 2NUYA 1GHSA 1NF0A 4H00A 3W74A 4TR9A 1QHPA 4Y9AA 1CYGA 3ONCA 1HF6A 4HU4A 4X60A 3BV7A 1BXCA 1D3CA 2FKPA 1XD0A 3NWRA 3E2VA 4ZOCA 3LHTA 4H7VA 3KWSA 2IKGA 3SQMA 4RZ5A 4FOKA 4XAGA 4U2ZA 4C6LA 4DF1A 1SW0A 4Y90A 1P6WA 4UNKA 1CDGA 1RALA 3U6WA 3FKRA 5ECVA 1WX0A 4DELA 3LZ5A 4UTHA 4RCXA 1UWQA 2CWNA 3QLLA 2DGAA 1W56A 1UBPC 3QF0A 3VMOA 3MUXA 3O05A 3RCNA 1K6WA 5A8QA 6XIAA 3SQSA 3RHGA 1UP3A 1P0EA 5C8BB 4HZ7A 4OBTA 4R33A 2QJIA 3BW2A 3WF4A 2TMDA 4HA3A 3TMLA 2PDNA 5HBFA 1B2YA 4UQEA 1JEZA 3GW3A 1ZJHA 3UBPC 4K2SA 1EEXA 2ATSA 2J62A 8XIMA 1BFNA 1N8FA 3EKGA 5FCZA 2JIEA 1Z42A 3GE7A 2OYLA 3GVGA 3PTDA 2PWFA 3OJGA 4O1CA 2YCIX 2PE4A 3QQ1A 3MI6A 1WZMA 1MDLA 4JCMA 4LVFA 4C5YA 3R13A 3RX2A 2IS7A 3JS3A 4D6FA 3N2BA 4C6FA 1E70M 2R1MA 2Z6IA 4F3HA 3WMLA 5C6MA 1V7AA 1TR9A 2EJ1A 4LRSA 3NL3A 4D8LA 4D6IA 4QG6A 5HNNA 4HNTA 1H7PA 2VENA 5K7JA 3M46A 4B90A 4D6JA 2QCEA 4M1RA 2QV5A 4YXGA 5C9UA 1MVYA 3VFLA 3R0DA 4E8CA 1GQLA 5FSDC 2Z6JA 2PDCA 3GDRA 2VQUA 4JTTA 4JHMA 3UZJA 3QKEA 2FB3A 2OKOA 4WD0A 4ADTA 4AX7A 2NSXA 3RLVA 1OYAA 2A6NA 3QOMA 4UTIA 5DX7A 4UWMA 2C1GA 1ITUA 1WDPA 1AMKA 1GOKA 3NXLA 1YE4A 3E12A 1K8CA 1H7WA 1EGVA 1XDLA 4LC8A 4RV8A 3NA8A 4WX2A 1HP5A 3LN3A 5D9NA 5HWNA 4BA0A 2ZXDA 5DRCA 1VGAA 2AQWA 2R6OA 3N4AA 4XTIA 3BH4A 1ISVA 3H22A 1EDTA 1G01A 3MUCA 1XISA 4TVUA 1XYCA 3VKCA 2E5DA 3W7EA 1AJ0A 2QCFA 1TJ2A 4MJ4A 3VNKA 1A4MA 1WAUA 3LG3A 4OJYA 4WUIA 1XG3A 4AD5A 2HXUA 4U2YA 2GK1B 4BI7A 3GAKA 4EXBA 4MLJA 4AZIA 1I45A 1RH9A 4JFVA 3E74A 1RK5A 3KBMA 3GDLA 3V5CA 2OEMA 2KZHA 3ARQA 1HKWA 1B3YA 3FSTA 1W1TA 3LCGA 4QE5A 2CZFA 1VS1A 4O1EA 4GH3A 4J40A 2OWCA 1VEMA 5FJRA 1RSCA 3U5YA 4F8XA 1AA1B 1X7FA 1H1YA 5FACA 3FJLA 5KITA 3AS0A 4X63A 1UC4A 4JBRA 3T0TA 3AIQA 5G2IA 1S38A 3M9YA 3PBWA 2J77A 4QAIA 3NM1A 3W2LA 4Q6JA 3VGBA 4ERAA 2ZQ0A 1F8MA 4O1FA 2GJXA 1JI1A 2P0OA 4R85A 3D46A 4H2HA 2GQAA 1A5NC 1HL9A 1QR7A 1RV8A 1F6PA 4K39A 5HQEA 1FWFC 4TVCA 1DWAM 4JICA 4DJDD 3NQFA 3QW3A 5H8UA 4LV4A 3U4AA 3R11A 4R3UA 2W63A 1KGWA 1GOWA 3M0MA 1YPXA 4BI6A 2A5HA 3QH2A 4H1ZA 3IIZA 3B9OA 1OIMA 2C79A 2YYUA 1EOMA 1EA0A 2P50A 3N2CA 4DF2A 4UTWC 4MB1A 2PCEA 3IJLA 1GW1A 1LQ0A 1XX1A 5D8ZA 2WZMA 2PLCA 1C9WA 1TV8A 5H91A 5BXTA 4XSMA 4LVDA 2Z1VA 4EKJA 1IXOA 3LM3A 4AEFA 3GDKA 1ZUAX 5I5RA 1YPFA 4H6RA 5A8GA 3LQGA 3WLKX 3A3HA 3USZA 1EGMA 3T44A 3INPA 3TNOA 4CN6A 4Z0SA 1OD0A 4GXMA 1DOSA 4ZODA 1JF5A 3IGHX 4WZHA 4GUJA 2ONEA 4XG1A 4C5ZA 1FWNA 1GTEA 3MUY1 1A0DA 2EG7A 4TUFA 4AG0A 4Q4QA 3NQMA 4TX6A 3W1UA 2OGJA 1V3JA 1XLJA 3BICA 3L4UA 1VJIA 3KFTA 3MT1A 2VFDA 3RXZA 3C8NA 4AWSA 1JUKA 2G4FA 3A3XA 4Q7IA 1PS9A 1GVRA 3W23A 3K1GA 3AUJA 1DIDA 2QJJA 3VDHA 1JCLA 2BY1A 1VCGA 4GI8A 3VZXA 5F7UA 4LB4A 1XXXA 4H9ZA 2X1SA 4FNTA 1AQ0A 2AQOA 1B54A 2GZXA 5FF2A 5IM51 1CXIA 1TPUA 3GU1A 4LXFA 1SFSA 2WNNA 1TMHA 1E5JA 4UTTA 1D8WA 1AW2A 3FEQA 3AAMA 1HIZA 5FJTA 1CENA 1ZBCA 3RUBL 1OFEA 4PB3A 1Q45A 5EMYA 4PMOA 5HATA 4M7SA 4S3JA 1R3QA 2NQZA 3EGJA 2DZPA 2YBVA 2FPTA 2VC6A 5AC4A 1SJCA 4AMCA 4FR6A 2X41A 1EJTC 3NQ8A 4DJDC 2HXTA 5FF0A 2D73A 4MOZA 4X2RA 1QNOA 1UD6A 1GYLA 4QXIA 3NQ6A 3ZVHB 3TJ4A 3GG1A 3GRIA 3CAVA 3L0NA 4FO4A 2D20A 3V7PA 3LBOA 4K3ZA 3VVGA 3W29A 3W81A 1QPRA 3S47A 2HMCA 4C6DA 2I5GA 4U10A 1IT0A 2J75A 1J5TA 2INZA 3M6YA 2C91A 3OZOA 2FHCA 1NU5A 1WA3A 3VGGA 3ZT6A 1CB7B 3ALGA 3GTHA 1C8VA 4NJGA 1BRLB 1B9ZA 1RPXA 4JTQA 3KVLA 3MHUA 1OFQA 3DFPA 1JYVA 1ME7A 2EPKX 2Z27A 3OYXA 3CZGA 3SB0A 2OO0A 2PF8A 3W73A 3Q4DA 1CPUA 4G9PA 4PRRA 2ZXBA 4K68A 4NI8A 4IX2A 1ADOA 1JXJA 3LZ3A 3WD3A 2E1WA 3ZSSA 1JYWA 2VFFA 1IEWA 3KOYA 9RUBA 3W7PA 1XJBA 2Z4GA 2VOMA 3NJ3A 1FA2A 4LU0A 3ARXA 1BSLA 3N6JA 1J9YA 1B4KA 4C7DA 1A0CA 3B8WA 2VOTA 2Z7GA 1SZRA 2W62A 1V0MA 1E0WA 2PGFA 4N9EA 1MZHA 3MMTA 4UOJA 1W91A 4V27A 4KEZA 4B5SA 1QI2A 2XSAA 1DXEA 2Y61A 3FW6A 4W7WA 1S3HA 2GJLA 2YDSA 3W7DA 4GI9A 3GTNA 1FCQA 2OEKA 4R7WA 4O13A 5E1QA 4GXPA 3VCRA 4W5ZA 5K3VA 2O9RA 4KW2A 3O0FA 4D6CA 4L9XA 3GC4A 4Z42C 4XIAA 3OIHA 3UW6A 3V36A 3QR0A 4WR3A 4NXKA 4IQJA 3MSGA 4X3ZA 5FAJA 3TQVA 3N12A 3OBKA 2OEJA 3F4DA 4GIEA 1E1FA 1WP6A 4GYPC 1MXSA 1VQTA 4TXEA 2NQLA 1KQYA 4E38A 3NURA 1OX4B 4UXDA 4AVOA 1FCVA 2ZC1A 4W87A 3O16A 3VIIA 2XDFA 1TR1A 1O5RA 4QLJA 4G1NA 3URQA 1J6PA 2QDDA 3UG4A 2OVLA 4JIPA 4EXQA 4FF5A 2FH8A 2W79A 2WMIB 1MRQA 2Y0FA 3LCWA 1WZKA 3H4XA 3LERA 1XLBA 4D8AA 3G1XA 1KLZA 4FMVA 4CQCA 1UQZA 4H83A 4R7JA 4E3VA 3FJ6A 3O6AA 4Q4PA 3EOEA 4LYKA 3BAWA 1KV8A 4IJRA 3ZT5A 5A6BD 3CPGA 1IR1A 3WH8A 2ACSA 4IFKB 2ZZ1A 4QDMA 3RR1A 2R94A 2B7NA 1MNZA 3NYZA 1XLCA 3IARA 4IMGA 4OUEA 3WDQA 3VNIA 3GUWA 4CCCA 4BF9A 2Z26A 3O15A 1R30A 4GYJA 3WNLA 1B3XA 2C1HA 2PRHA 4DXVA 4I8YA 3QGVA 2OELA 1KM2A 5HANA 1JZ3A 3H6OA 1JCNA 1UASA 4JQ2A 5D02A 4PMRA 1KLYA 4H9TA 3BANA 1IZKA 3IVSA 5C70A 2J6VA 5G1TA 4HN4A 2QPSA 2WMGA 4P2VA 2O9TA 2HS8A 1G7VA 3PZIA 1I2QA 2ISSA 1DJZA 4K7YA 5GVJA 4XZWA 2RDWA 5KTLA 5RUBA 4A21A 2GGJA 3WQGA 1QNRA 2E0PA 3TUUA 3T0AA 1EFZA 1HT6A 1VRDA 2I7GA 3H12A 3UWEA 3VK5A 4C7FA 2GUYA 3PZUA 3HPZA 4JTEA 4UNLA 4LAOA 4LSBA 5IDIA 4D8ZA 2YB1A 3UWWA 5BRBA 1OFBA 2PLMA 4AVFA 1IE7C 3OHIA 4DPQA 3CQ0A 4NJJA 4M6VA 4YLWA 2HK0A 4CN1A 3BMXA 1KC7A 1TWSA 3KDOA 2OZ0A 3MYOA 1HKMA 4YHGA 2PDQA 4ZXLA 1ADSA 3FVDA 2C3ZA 4O4WA 3D47A 5K9DA 4E4PA 3R0UA 4Q3MA 1LG1A 1EHAA 3RM4A 1SO3A 3GZAA 2I56A 1M53A 2NZLA 4DYJA 4CN4A 1EB3A 4DUOA 4DXXA 5HK4A 4B3KA 1FRBA 1KO0A 2C18A 2ISWA 5ABFB 1H41A 3PPFA 5LA1A 3AHXA 4UTWA 4REQB 4MGGA 3M0IA 4LQ1A 4AZBA 1YEYA 5CLTA 3WLJA 1K03A 2V81A 5LNWA 4Z2KA 4H8VA 3EA1A 4IMDA 5A6TC 4BQ5A 3APGA 3I6EA 3EKZA 4JFUA 1V5XA 1MXDA 3PB2A 3S2CA 2JIWA 3FJNA 4LNCA 4UQCA 3VDAA 3A5FA 1O5XA 4GFIA 5I3IA 1Q65A 4OBRA 3T7VA 1NP0A 3MVTA 3GX9A 2V3GA 3H24A 3T40A 1KV5A 1V6TA 4WRHA 4XZNX 3BG3A 3LCXA 2VDIA 4ACZB 3UETA 3VD5A 1Q6OA 4PEEA 1R9XA 3AXKA 4LS2A 4NRRA 5AC6A 1XV8A 1UKQA 2EG6A 1A5OC 1SQ7A 4JX5A 2FZBA 1WB0A 2HV5A 4G7EA 1OX5A 1JUEA 4PB4A 5DY3A 5J5DA 3CV6A 2DJLA 5DBUA 3IUDA 1FWHC 3WY1A 2EQDA 4DJED 3WJZA 3AIWA 3CL6A 2E4TA 6A3HA 1ISYA 1TA3B 2ACRA 1OC6A 3O06A 2SFPA 4GBDA 4IOTA 3DEQA 5ENLA 4NP7A 3B0PA 3HN3A 1UA3A 3KZPA 1C7TA 3C2EA 1V6VA 1TV4A 5BU6A 3FXYA 3CIWA 3LI1A 3VNYA 1TPEA 1XYZA 2YXOA 2YLAA 2A1YA 1PV8A 2QCHA 3GXPA 5TAOA 4A35A 2YL5A 4PE8A 3FY1A 1UR1A 3A22A 1U22A 4M80A 4J2MA 1TZ7A 5I3KA 2NXGA 1RD6A 4NAFA 3M0HA 2DSKA 4DJDA 4L1GA 3MMUA 3WH7A 2VCBA 4LY8A 4NSBA 2WAGA 4OUIA 2OZ8A 2OKTA 5LXEA 3OP2A 1SZEA 1BF6A 3NQDA 2JEPA 5AVHA 3ZJ6A 2Y89A 1EX5A 5BXPA 3M7SA 1C9DA 1IGSA 1OB0A 3I68A 2C15A 2PDUA 1X6LA 4GCXA 2PDLA 3ARRA 4BFAA 4UTMA 1TJPA 1TB3A 2YKKA 1L6YA 3CUIA 4GUHA 4AYGA 4JEQA 2GJPA 1QWGA 1XIMA 4NZ5A 1JZ7A 3U3HA 4B16A 3H4GA 3FDGA 3MY9A 1VEPA 3W2NA 3IIXA 3G1HA 2ZWZA 3SSJA 3I6TA 3MBFA 4ADSA 1FWRA 4FSAA 3W71A 1E6PA 1SR0A 3AMGA 1X8CA 3TJIA 1H51A 2OB3A 2Z28A 3H2AA 3VNDA 4LUTB 5E6YA 3CWNA 5JUVA 1QT1A 1QNSA 5GNXA 4F79A 4XKYA 3U48A 1RD5A 3S9IA 4AEOA 3E0VA 5DCBA 4K38A 4LNYA 4MNKA 2Y5SA 3KBSA 2HDJA 2CBVA 2BTMA 4IPIA 4KF1A 3FNDA 1VFMA 1JGMA 3A4JA 4X22A 5HNUA 2BMBA 3VC5A 4U3AA 4MWAD 2ZRUA 4ZOEA 4DJEC 5CZKA 1XYLA 1AG1O 5DMYA 4ILSA 3HU7A 3I3DA 2VNCA 1ENUA 2G3MA 1Q63A 3FHAA 3S8HA 3AZRA 4F2UA 1J2BA 3GXTA 3UJEA 3KRSA 1QTWA 4NNBA 4HYRA 3W1TA 5ABGA 4N42A 1X1NA 2PEVA 2X1RA 5K2ZA 2PP1A 4CD4A 2Q3OA 4PH6A 2GVJA 4JTRA 4Q8NA 1KFCA 3TE9A 3W7NA 1IR2A 3CUJA 3PWIA 1OEPA 3SURA 3PG8A 5CBBA 2BB0A 2PP0A 2V3DA 1OZMA 5CZJA 4N9BA 3AHVA 4LEQA 3MKCA 1YDVA 1J0KA 4HHLA 4WJ8A 5EMUA 4GYPA 7XIMA 2Y8UA 3A12A 2PDIA 3GXMA 3W25A 4O1AA 4PTDA 4AZ6A 3PJTA 3GXDA 1B5TA 3QEZA 4PMYA 3P67A 1PWMA 4UOQA 1E6NA 2DIKA 1TREA 1Y0EA 3ABXA 3E2RA 3PTMA 4C6PA 1XYBA 3STEA 4GG9A 4OOUA 3GBDA 1DORA 4JFWA 1THFD 1GNXA 4QP0A 3STGA 1CXHA 2PC4A 4CNNA 3SI9A 2J47A 1AMYA 3ERPA 3PAOA 4RK8A 1V3IA 1P4CA 2OLSA 3CJPA 4MB5A 3B0UX 3FAXA 4WIWA 2F6XA 5DQPA 1KKOA 1YBQB 2VC5A 5DY2A 2DZVA 3FFSA 5FEXA 1ME9A 2OJPA 2W61A 5E9XA 3GUGA 2CLMA 4NZCA 1V79A 4GIAA 3PN8A 4QDPA 3TCEA 3BLPX 3G0XA 3GSMA 3NQGA 4CD6A 1Q3NA 1F4HA 1LRTA 3E2SA 4KWOA 3UA4A 5CGQA 5DT5A 3F5KA 4LYQA 3MVIA 1C92A 3ANUA 3W85A 3T0BA 4F9JA 1QPKA 2Y88A 3LMZA 2OQYA 5LXXA 1BYDA 1FH9A 1F3TA 2PA6A 4M6UA 5CBIA 5CZSA 4MWAC 3NQ7A 1R3YA 1GYNA 1H0GA 3QZ6A 2QCMA 2V5BA 3L4VA 3IJQA 3VKAA 2X1UA 4UMCA 4PZVA 1CI1A 1XIIA 4FX6M 4HMCA 2J79A 4FAMA 1TSIA 1TPH1 3W2KA 4KETA 1GEHA 2J9YA 2ZUMA 3OODA 1FWSA 2VR4A 3MP3A 3V4BA 4GACA 2QUVA 2ZCGA 1I6NA 4E6MA 4WLCA 3LUTA 1UKOA 4KMQA 1ZCOA 3LX9A 3CAKA 2A79A 1IXNA 4IPLA 4RW5A 4WGXA 1TV2A 3WQDA 2BY0A 3UEQA 5DN1A 1WKYA 2WZHA 3N04A 4S3KA 1X1ZA 2E25A 1KCKA 4QLKA 4YWIA 3SCRA 4W5UA 1RXOB 2POZA 3EOSA 1NTHA 2EKCA 4MKVA 4NI3A 1BG4A 3B9AA 3SM0A 3VIPA 3M16A 2V5CA 5F2MA 1S2VA 2J78A 1Q7ZA 2PB1A 1JQVA 3MV01 3G1YA 1TELA 2G4JA 1F05A 2GSJA 5GNYA 1PHQA 1EP3A 5A6AA 1E6RA 1UD5A 1QU4A 4BEQA 4C6QA 3R8GA 4EPEC 5FOOA 4IPPA 1EL3A 4RX0A 1UWAA 4EE9A 3RMJA 1XF0A 4O4VA 1FFRA 2EPNA 3W1QA 1I8JA 1HKVA 4H3DA 2BWGA 4KBXA 4IFOA 3O6CA 3TOYA 2OMAA 4ONVA 1W37A 3UG3A 1S5WA 1XC4A 2Z7KA 1TUXA 4NVTA 5A6BA 4MAZA 2OQHA 3AWNA 4FLOA 5KETA 2E68A 1XCXA 1TIMA 1TZ9A 2QULA 4HA1A 3C2YA 1M7JA 5DBTA 1BXBA 3TTOA 3DENA 1FKWA 4JL2A 4FEZA 4DRSA 1YXYA 4B3ZA 4HSNA 4J3UA 3WLNA 3I3EA 3VIGA 3L4XA 4I9JA 1FH8A 1JPDX 1YE6A 4DXKA 4R53A 4CQ9A 2H9AB 4JTHA 4TIMA 5SWUA 3B0YA 4E4UA 3LLXA 3GWQA 4A6GA 1TE1A 4IMCA 3URNA 3CV2A 2V63A 3QSTA 5LNVA 2OYMA 5BRPA 5TQLA 3NSMA 2F6KA 4JIRA 4UR7A 1LWIA 2FB2A 1XSJA 3W07A 1PYFA 3ATYA 1JL8A 1UUOA 1JUBA 5JBFA 4KH2A 3MDUA 4Z2GA 4Q8QA 2BV9A 1JPKA 3HPXA 3R0KA 4GISA 4FPSA 3D6NA 3BQ5A 4ROPA 1VYRA 1T99A 1QAPA 1CLXA 2VR2A 5B7YA 4E2BA 1YTEA 3U8GA 3BAJA 2QGYA 2XZ9A 3W0KA 1LQ2A 2AL2B 1GVFA 4XD4A 2QPXA 1XIJA 3QTPA 2QMKA 4DEFA 1OQFA 3HIJA 4LC6A 3TTYA 3UZWA 2G3IA 5EMKA 3AI0A 1Y7VA 3UQNA 1OFOA 1JULA 5CLWA 2QCCA 3GVRA 2V6AA 4IIBA 2QAFA 4H6KA 3H55A 3ID7A 3L4YA 2PZNA 3C3UA 4JIIX 4Q8WA 5U4NA 5I07A 4JZ5A 5C7HA 3GU2A 3B8IA 1YX1A 2FHBA 1E9LA 3N2MA 3WNOA 2QUMA 3GNXA 3VDGA 3SZ8A 1XGDA 3AHZA 3H7UA 3BOLA 4OIFA 1CIUA 3WQEA 1AH3A 2XZ7A 1WKDA 1XR2A 3N9RA 1BYBA 4S2CA 4GVHA 1RVKA 1QHOA 1UOZA 4LYPA 1IV8A 5XINA 1VKFA 3P81A 2HK1A 3E96A 3O0KA 2YIHA 2J7HA 4Y2WA 3EX2A 2YDQA 2TAAA 3JVAA 5HUPA 4JKKA 5IHRA 2Y24A 3NPXA 1UH3A 4P7RA 3O3RA 3FS2A 1OT1A 2IQ0A 1W31A 3GKFA 3K8KA 3GH5A 4MLRA 4AW7A 3S2JA 2VMFA 3O7UA 1E40A 2J6XA 1OY0A 4G5DA 4JNZA 1AQMA 4AD1A 4V1YA 5D8WA 4YJ5A 3SRKA 3TXVA 1TPDA 3A9IA 3MWAA 4IFRA 3H2MA 5XIAA 2YFOA 3UCDA 1V0NA 1NEYA 1MEHA 3GU9A 4UQDA 2J74A 1OX6A 1ZBWA 1ADDA 1PYMA 3UYCA 1EXBA 2NXIA 1Z8AA 3MZNA 4DJEA 1XP3A 2CC0A 4UTLA 3KS6A 2P8BA 4HK6A 1KRBC 1W9VA 1AJZA 1TVLA 1L6WA 3ZFHA 3EB2A 3MMDA 2I5IA 2IUZA 3H23A 4A29A 4RW3A 4M51A 3TYUA 1A50A 3YPIA 2WQPA 2G96A 3SUUA 3O6DA 2XN1A 3WK0A 5D9OA 1GONA 4GA8A 1FDJA 5FD0A 4LF2A 4FB7A 2FZ8A 3RO8A 1PUDA 5LA2A 1KFWA 2I14A 4P5UA 3G1DA 5CC7A 4EACA 4PTNA 3RCMA 3SRDA 8XIAA 1E3ZA 3CH9A 3S5NA 1N82A 1E6QM 1GVSA 4FNSA 1P1MA 3F2BA 5EFDA 2YLLA 1TPWA 2OOGA 4EPDC 1EJSC 4P61A 1J5SA 4C1KA 4ECLA 1Z89A 2QUNA 1H5YA 1PVNA 4DZ5A 3BVJA 4NNCA 3BAXA 3TA9A 2WVVA 2E6DA 2WKLA 2X1TA 4ICNA 4PCFA 4RDWA 1BWKA 1X1OA 4RPPA 2WMJA 4FIRA 4QROA 3OB8A 4DM1A 3CEUA 4MNJA 2Y5EA 3CQIA 1VHNA 2WVSA 1A5UA 4ZENA 1TG7A 3S42A 4MPQA 3M0JA 4ZVJA 3F1QA 3CQKA 2OX4A 4MJ2A 5EU9A 1S1PA 2XPKA 2ZRXA 3UR8A 3DFSA 1XPGA 5F2GA 4WDTA 4WVXA 3C0JA 1TTJA 3DHFA 2H8ZA 4Q22A 2ZVIA 1Z32X 4PL2A 1R2RA 1TVNA 5AC5A 4B2DD 1IXPA 2NT1A 4N9CA 1GYMA 4E4FA 1K8XA 3DKLA 4B15A 3ENLA 5FL0A 4CNSA 3A13A 4FLSA 4GQBA 3DFYA 3ZJ8A 1X98A 3AJXA 5LIXX 4MFDA 1O7AA 5ABEA 2FTYA 1QI0A 3KDNA 4K8HA 1R3TA 1WXYA 3LXBA 1ISXA 4LFYA 4V28A 5JMUA 1FP8A 4XZMX 4L65A 4MWAA 1Y8BA 1HZYA 4LT9A 2GQ9A 3MCMA 3WK1A 4FX7A 3R5EA 2QAPA 4GGBA 1RVGA 1X6UA 1K8ZA 3IS4A 2VEFA 4TX8A 1FWCC 1M3UA 1O68A 4AZHA 4L4MA 4WOQA 4BHYA 5CPNA 5BZAA 2HTMA 4PR4A 3LGGA 4YTUA 3USBA 3OIXA 5BXRA 3F03K 1FDYA 4GUFA 3W24A 1US2A 3QKZA 1UH4A 2Z2UA 3WUEA 1JD7A 1S2UA 2OWWA 5C2CA 1O60A 4XBSA 1Q7MA 2C16A 2D0FA 4JTSA 3WFAA 5I0DA 4HPNA 3GNOA 3PC0A 4J3XA 1QVBA 3LHYA 3BWWA 4DLFA 5EMLA 2XVLA 2Y7DA 2OODA 4IH3A 4XWUA 3K2GA 2FJUB 2I5QA 3OA5A 4MKNA 4Q32A 3W02A 4JTGA 2CBUA 2E6AA 4AZCA 4OU1A 1NDWA 1NARA 1A4LA 2D2JA 1VCFA 4O1BA 3TZFA 3AS1A 5CC5A 1JCTA 1B3OA 2OCZA 4GHRA 3UWUA 3ZR6A 1GUVA 4I3GA 2AKMA 2H90A 3T09A 1QCWA 2GVYA 1FCBA 2CYGA 4QDWA 4F40A 1DVJA 4L61A 4KKXA 3VC6A 1OF6A 4YU1A 3GHUA 2MANA 1LYXA 2G5WA 3Q65A 1Y5VA 5C5YA 4FOJA 1XRVA 1EP1A 4I5XA 3E0LA 3WLIA 2OFJA 5IBXC 4Q4MA 2EPHA 1XRFA 1YMYA 1E72M 1CZ1A 5HWJA 4W7UA 1UWRA 5CPMA 1TFVA 3ORWA 4YTTA 1IWBA 4E0CA 3EPMA 3R58A 3S5SA 1O12A 4YTSA 5C9RA 4Y7EA 3TTQA 3EWCA 1FP9A 1W3NA 2WNQA 3WDIA 1SZGA 3RLUA 2PWUA 2V5JA 1ZP4A 3CNYA 4R27A 4P8WA 5DCDA 1FHUA 1S5MA 4GH1A 4PSPA 2PTXA 1EZWA 4PMQA 3FKKA 3MBDA 4HYWA 2ZVRA 2DFAA 1EWDA 4YNGA 2PD5A 3MTWA 3AYVA 4CKQA 1MSSA 2DIEA 3CK5A 5KZ6A 2B81A 3DKJA 1S5NA 2WB5A 4WQ6A 1VBHA 5EB8A 5EL1A 2ZZ4A 4W88A 3EMCA 2DP3A 2P10A 3G3DA 1HTIA 1EJXC 4ASTA 3OLGA 3E0WA 3WLOA 4AISA 4W8BA 4QRNA 3OLDA 3CHDA 4ACYA 2X7WA 3TQPA 3W2MA 1K9EA 3E0FA 2X0SA 4AFYA 1US3A 3QBUA 5A6SA 3CPRA 1C91A 3RK8A 2A6LA 3KCLA 3WDJA 4RNFA 2QCDA 3TTEA 2WC3A 3SCWA 2REQA 1B3VA 1VBJA 4I7VA 4MUZA 4X0NA 1XIDA 1KXHA 4Y9PA 5B7ZA 1E6XM 2A3HA 3NZ1A 1BG9A 3QY6A 2X40A 2CHOA 4J3VA 3P2VA 1I2RA 2JBMA 4GWEA 1KQZA 3GDBA 1QATA 4KT2A 7A3HA 4QG9A 3ECQA 4DX3A 4IQEA 4PTXA 2D1ZA 3IWPA 1OCBA 2I17A 5AYBA 1VAHA 2DZWA 1PXGA 2W5FA 3CZ8A 4DNMA 2V2DA 1REQA 1WYIA 3VGHA 2P0IA 1TUFA 3UZZA 1QK0A 2B31A 1N8IA 1R3RA 2VO5A 4EAMA 5C71A 1H1NA 3OG2A 1FBAA 4HBKA 2YCLB 4XK2A 1F6KA 1LP6A 4MY9A 3GTIA 3IACA 1JDFA 3H53A 1SVDA 4FP1A 2YGYA 4PMNA 5IXEA 5IOBA 3CHVA 1QK2A 3MJMA 4N6FA 3WUGA 4P8XA 3QFWA 2V9DA 3CO4A 2NXHA 1EJ7L 1W32A 3LCIA 1J4EA 2YDAA 2NLIA 3W76A 4GNVA 2VGFA 2PRMA 1XH2A 3WENA 3GXFA 4PRTA 1AL7A 3DOPA 4PMDA 4M5PA 1V93A 3DBNA 2PCQA 4I5RA 4CU8A 3DBPA 1D3GA 4KWUA 3VKJA 1JPIA 4MDPA 3V0UA 4AMAA 4GGHA 3FAWA 1KM1A 6CGTA 1ME8A 3CZLA 5D38A 2A7NA 3WLHA 4WSJA 4BWLC 4R34A 1KWGA 1EO5A 3WF0A 3QMTA 5AC7A 4FNRA 2BY2A 2EO7A 2WCGA 3GYEA 1VPQA 1OG6A 4UBPC 3SECA 2CZVA 1EYWA 4ZL1A 4DBEA 4CNUA 2HVMA 1ELSA 4P7QA 3QPZA 2VZUA 2DPEA 4XUGA 3KXQA 3MMWA 3ZYZA 3VKDA 3HPSA 4EAYA 3BOXA 4YL2A 2ZZ2A 4FK9A 4AAJA 1OK4A 3HG2A 1YDOA 1EZ2A 3SCPA 3HGJA 3MUIA 5A8OA 1SYTA 4JTIA 2GWGA 4B5NA 5I03A 4JTDA 5TIMA 2PDHA 1AJ2A 1A53A 1W17A 3UG8A 3CTLA 1KXQA 3VPLA 6REQB 3VZZA 1BPLB 1UWUA 1PTGA 4KFNA 5LNRA 3SADA 4P7NA 2DZXA 2QJNA 4ZZ9A 5AOUA 3SY5A 2ZE0A 3VNMA 2BY3A 4L64A 3BC9A 4C6NA 5REQA 3MQTA 4GCAA 4MYXA 2WMFA 2GSEA 1V0LA 1TTIA 3GR4A 2TYSA 3V5OA 3NG3A 3ZJKA 5E9AA 3VCCA 2J9ZA 1UIOA 3F5JA 1OC7A 2P8CA 4ZQOA 3WFLA 4GNKB 1DWJM 2UY4A 1OJXA 1EWEA 4K37A 5AECA 4JR5A 1K9DA 4U28A 3W7OA 1KBKA 3AU2A 3IIOA 2HNEA 2CESA 2C14A 3EA3A 1JDEA 3LGDA 4GKTA 4IP5A 3RJYA 3VUPA 3SUWA 6XIMA 1HGYA 3TYBA 4IGNA 3EWZA 4S3BA 5L9FA 2RH9A 3EWDA 2O55A 1R9YA 1Z41A 4DUXA 3P14A 1BTCA 3PBYA 3R4IA 4JHOA 4GC3A 2TSYA 4IMEA 3EX3A 3B8DA 1PE1A 1XC6A 3WMSA 6ENLA 2FJKA 4IPNB 5LGXA 3IVUA 3ZLGA 3QV7A 3O07A 5F4WA 1YNYA 2AKZA 2PPGA 1PIFA 3DX5A 1DEDA 3VDCA 5CPTA 3WQOA 4B4HA 3MA8A 4H04A 4E8GA 4US5D 1IQ8A 3OOQA 2ZYFA 4I9TA 3W6YA 6PTDA 3EBVA 2CITA 4PRWA 3EB4A 2ZX6A 4KGLA 3S1GA 3TTSA 1GJPA 3CUZA 3S5ZA 3SFKA 2ISDA 2QKFA 2P3EA 3CQHA 4XZLX 2V5LA 3WQWA 1RY8A 4KEMA 2A7PA 3VILA 1VFHA 3CUGA 3P5ZA 4M3PA 2V38A 3GO2A 1XM3A 3ITLA 4WCJA 1CNVA 3IK4A 1VCVA 2VDHA 2Z2AA 3AZSA 1OCJA 4ZGYA 4R7OA 3IANA 2E9BA 5FF4A 1YXCA 1QJWA 3HG5A 4XVDA 2WM0A 1L9WA 4MUPA 3UZXA 3NZPA 3TNBA 4PMVA 3NFUA 4M24A 5CBJA 3PBMA 7ODCA 5CQ1A 3AMKA 3W1NA 2VZSA 4IJCA 4MNMA 2H8XA 2CNCA 1ITXA 5IBXA 2ZTJA 4W8LA 4K8EA 5AHFA 2ASHA 3H21A 4B2DA 4GJJA 3UCQA 4FXFA 2D23A 3BLEA 1ALDA 1HX0A 3W7QA 1U5HA 3KTSA 3LPFA 1FCUA 3F5LA 4HPXA 1ONEA 1R47A 3ANYA 3QV8A 5H8MA 1A80A 4ZCWA 8TIMA 3VABA 3HPFA 3B40A 1TRDA 1W3JA 1AK5A 3KLLA 1XLDA 3GC2A 1KA9F 4OKDA 3RPTA 2I57A 3W75A 1RJQA 4GI6A 1K7XA 3LXAA 3NZRA 3FK4A 4YVXA 5KMYA 3L7RA 3RU6A 4F9DA 3BCDA 5A8NA 2BSLA 2WSPA 4OVXA 1XQKA 3ZMRA 4KCTA 2DZTA 2E9LA 1JGIA 1FQ0A 4C6MA 4K7VA 3KL3A 1IWPA 1P7TA 1US0A 3A24A 1YDYA 2VI0A 1KTNA 4PMZA 5JBEA 2ZDSA 4PL1A 1VHCA 4CNPA 2P1FA 1M6JA 3K4WA 1QO5A 3BURA 4GQGA 2PODA 3QMRA 3VI2A 4GY1A 1M7XA 3TKFA 5XIMA 3W1PA 2Q3RA 4U5IA 1SMDA 1W1A1 4FXJA 3BGGA 4M81A 2FVLA 3WD0A 4JQ3A 4ZO9A 5DMMA 3R12A 3MI2A 2JGQA 1MO0A 2V69A 1SGJA 4O0QA 5I3FA 2YB4A 3UPMA 1JYNA 3NEHA 2CHRA 2BXZA 1T7LA 3GZ3A 4JIEA 3ITXA 3GNPA 3IEBA 1GKPA 2Y8KA 4ORMA 3V18A 4IISA 1PWLA 4UQBA 2RDTA 2YDRA 1NJJA 3UXDA 3SBFA 4TTGA 1KFBA 4AWEA 4LY4A 3DYPA 4AUBA 2DSUA 1ZRQA 4DN1A 1FH7A 2BZNA 2V3FA 5I7GA 2YBTA 5JU6A 4ZMGA 3NOEA 1P0NA 3N19B 3CH0A 4AD2A 3IPWA 1PKLA 1Q6EA 3CS2A 4HYVA 4XAPA 3H70A 4DYEA 3IUHA 2PU1A 1UKSA 2PDMA 4I7UA 1SO4A 2GLKA 4QS6A 1ZALA 2XH2A 2XIMA 2OU4A 3U57A 3DCPA 2DIJA 4PYSA 1KR0A 1X7IA 4FS9A 4O11A 4C6OA 1HKKA 1CB2A 1GHRA 5B80A 3GTXA 2XTKA 1R38A 1XBVA 1B0IA 4GMEA 4DBWA 2PUZA 4LTSA 3IK2A 3B9NA 4M1BA 2ZTKA 4AZ7A 2HZGA 2QDEA 3QR1A 4Q4OA 5D04C 4NJKA 4UUIA 4BWLA 3SY1A 3W6LA 4JL1A 3C86A 3REQA 3VD7A 4HA4A 1PCKA 1UZ4A 2BX7A 3P5YA 3N9KA 3GDTA 2VGGA 2CZDA 1VR6A 4O10A 2XM2A 3TLQA 1EPXA 1U2YA 1HL2A 3R89A 2ZRWA 3A3WA 1G5AA 4P7LA 2J7BA 4J27A 1E6SM 1LORA 3SIMA 3BXWA 3LRKA 2FVMA 2XH4A 3BJTA 4ZSTA 3VIHA 3HFYA 1F76A 3AIBA 4N0RA 4GZJA 3KHDA 4O12A 4HJFA 4HVXA 3S1UA 3AMLA 3N3TA 2O7QA 1SMAA 4WGHA 1I0BA 2DW6A 1OFRA 3ELFA 4J35A 1H49A 4S1FA 4P7OA 3VX1A 1HP4A 4DBSA 1HUVA 4DB7A 4AZCB 1TPC1 3PVFA 2QW5A 3T2PA 3KCJA 1LROA 4KIEA 1RQEA 2VP8A 1UMLA 1NDZA 2WCSA 4KWWA 5AKQA 2D69A 4IG2A 1QDSA 4ZQNA 1I0DA 4XAZA 1QXLA 3LBCA 2PBOA 2DUAA 2ALDA 4MJMA 4MJZA 1DJXA 3PZQA 3KL0A 3T8LA 2F2KA 4O50A 2ZFAA 1QNPA 3NXFA 3N9SA 3VNLA 1T8QA 4XD5A 3MS8A 3QHMA 4QHRA 4MB3A 4DJFD 2A0NA 2Q09A 3KEHA 2ZDRA 1EF3A 3LBMA 2EF9A 3PY2A 2Z2BA 5G4WA 4CQBA 3L4WA 2ICSA 4W4QA 3S2LA 1P6CA 3RYSA 1MW0A 1P0BA 1KD0A 4L6OA 2NT0A 1VPYA 3QGKC 1CGTA 4AY8A 1TWWA 1W6TA 2BODX 4MYAA 3IGUA 3OGRA 3RIKA 4LVAA 4FALA 3JU2A 3GVQA 1DYSA 1EC7A 3UWVA 3GNDA 4XAYA 2X0HA 1W5QA 4HU8A 5JIWA 3PJWA 2Z1WA 4INFA 4QITA 4J7RA 2PSNA 4GC4A 1JPMA 3L21A 1Y65A 2D0GA 1GTHA 4JYEA 4ZXOA 2O56A 3VCNA 1OADA 4PGLA 4NAEA 2WPBA 4RE3A 4K1GA 2JF6A 1H3GA 3Q45A 1C3FA 1VFSA 1DIKA 4PBFA 4WSKA 4AXNA 4QCEA 3SN4A 2WM1A 1BLIA 5M2FX 4AX6A 1C93A 2QDGA 3WSUA 1OHLA 1PJ9A 3WQ4A 4XKMA 3AWOA 3TC6A 4B5VA 2G50A 2ZA2A 1E4NA 2E6FA 1PSCA 1V08A 3VIFA 1FWEC 2VX4A 1E9YB 3BMWA 4QQUA 3JUGA 3WIJA 5LA0A 1YLVA 4HPJA 2PTYA 1JCYA 1KBBA 4DI8A 4NNAA 3VM7A 4V15A 1VC4A 1CGYA 1W9DM 4WDUA 3VDBA 1JAEA 1G94A 3DHUA 4LUSB 5LSMA 1G6CA 3GHRA 4MHBA 3OHMB 5CJNA 2D3LA 5HMEA 1QPNA 2GWNA 3IGXA 3WF2A 2QCDB 4RZBA 1F3WA 2REQB 2V68A 3UJFA 3HQNA 2O4MA 1UC5A 1ICSA 1EKOA 1XLFA 3VMPA 4GX9A 1ZBVA 2JEQA 4UB9A 3EXTA 2YCJA 3LS9A 5FEZA 5D03A 3APTA 1XGZA 3O2LA 3TAKA 3E38A 3IJ8A 1E1CB 2ODOA 3WUBA 4O8RA 1LL4A 4AC7C 3VIJA 2R8WA 3NQ2A 4YYCA 1NQKA 4WOZA 1V77A 1S5VA 3N25A 2NUWA 3MU7A 1VLIA 4DJFC 4B3LA 4PUEA 1E4MM 4RDZA 2F38A 3FOKA 2F9RA 2QPUA 4GKLA 4MY1A 3I7SA 1UWIA 3ICJA 2ZBTA 3SGUA 2GGIA 2PI6A 3BGJA 4PC8A 3QC3A 2WSQA 3UPBA 3M5ZA 5FF7A 3CUHA 1W9PA 4GLEA 3N1AA 2W66A 1VBGA 2Z24A 3FGCB 3EWUA 2VFHA 3CASA 1V51A 3PPHA 3F7JA 1QW9A 1I75A 3FYPA 4PUMA 3H54A 3K8LA 4PMUA 3B8VA 4AYSA 3RGTA 5FKYA 1PDZA 5AB3A 1H7RA 3UGRA 1GOMA 3TDFA 5E0CA 1SFJA 4QE1A 2WHJA 4HP5A 3ZQ9A 5BXSA 2YPIA 3BSMA 1G67A 2OT1A 3MANA 3TH6A 4HPHA 2B0MA 3C2FA 2QCGA 2G97A 1YNPA 1EP2A 1JXKA 3SCOA 3W7LA 1ZNNA 3CLMA 4BI5A 3UA3A 4PTVA 3WBXA 2X42A 3WELA 2VX7A 4CEUC 1QMLA 5F1VA 4GUGA 1CT5A 4US5A 4HNUA 4LB3A 2WHMA 3HGRA 1NELA 3VE7A 4Q8OA 1Q6FA 2FPVA 4ERGA 4A8LA 1DWHM 1Z6KA 1XGEA 4NZ1A 2ZWYA 5M3WA 1Z7AA 4HK5A 1WDQA 3H2CA 4NY2A 4MZYA 3AALA 4BK9A 4JTKA 3VYLA 3R6IA 2I9UA 3D3FA 4MFEA 5LIUX 1R5YA 1IIHA 3M07A 5G4EA 2XIOA 1HVXA 3UP8A 2V67A 1P43A 3AROA 2ABBA 3KOFA 2ZADA 2GOUA 3Q58A 1WDDA 1KCLA 4DQWA 3P61A 3NYDA 2DSZA 2XVGA 2XIJA 1PPIA 3LMYA 1T40A 1L6FA 1HNYA 2GSHA 3UXKA 2AMXA 3GDMA 3M0VA 4URIA 3IAQA 5EY5A 3VZYA 3PUEA 9CGTA 1QNQA 3B0VC 3UZYA 3N18A 5HMFA 3GG7A 3G0SA 1P0KA 4QE4A 5T91A 2NWRA 1IF2A 1SJBA 3RDKA 5G2HA 1UR4A 4G1KA 3CHEA 5U7SA 1ZQ5A 3W70A 3WJSA 1O5QA 2XYLA 5E0FA 3OA3A 1D8CA 2WSYA 4RXFA 2OT0A 4UMAA 2WC4A 2VRKA 1LLOA 1AH4A 3LHZA 1LT7A 5CKSA 3L65A 2J13A 4UMBA 2VEKA 3GIQA 2R1PA 3W37A 3TYDA 4RE0A 5HR6A 1A49A 1UH2A 2CKRA 3II1A 3WLRA 1MW1A 4YPJA 1J0HA 3OVGA 2XWDA 2Y7GA 1R2SA 2GPTA 4ENLA 4O0ZA 3AFBA 1OVDA 2ZE3A 2RKXA 2HRWA 4Y9NA 4LUJA 7REQB 3A4AA 1YPIA 4L9ZA 2ADAA 3WZ0E 3GFXA 1DPMA 2HPMA 3THDA 2B4GA 4AU0A 1W3IA 3V0SA 3S2NA 5A69A 4FIQA 2FHFA 4OECA 1QRQA 1BVWA 1A3WA 2GYIA 4O53A 3SUVA 1EUNA 3VOCA 1WBHA 3RRAA 3VD9A 3E49A 3WNMA 1OM0A 2X2YA 3WQFA 5LIWX 3KTXA 3PZTA 1OGSA 3GNNA 4RNHA 2JFEX 1HFBA 4QLLA 2E3ZA 2ISFA 2QHAA 4RE4A 4XBJA 3KBVA 2ZX7A 3O63A 2JK2A 1GVIA 3FYYA 4L1XA 2PDGA 3AYTA 5BW6A 3WK2A 1PX3A 2VCAA 5BOOA 3E5BA 4J2PA 1NH6A 4RJEA 1GVQA 2WNWA 2G0WA 1LWJA 4YTRA 1ZFJA 1D7KA 2DW7A 2CLEA 4JAWA 4NF7A 4BKNA 2XIIA 2BG5A 1U30A 2INEA 4CNTA 4DO7A 2NVDA 5A2BA 1GKRA 1HXJA 3RF9A 4DAFA 2X2GA 2QXWA 3UJ2A 3NO1A 4GYKA 2BHZA 3Q94A 5BRQA 2XIQA 3WNNA 4BCEA 3LSCA 1F07A 1O94A 1UMYA 4M82A 1DWFM 4O0KA 1JZ6A 1TZZA 4HOWA 3QQ0A 3VKKA 4C1NB 2A85A 4OQVA 4NYUA 2D3NA 1O95A 2GQ3A 3VNJA 2GK1A 3MCOA 4MSSA 1CXKA 5CGTA 3DERA 1AZ1A 1KCXA 1LL7A 5KINA 1GORA 2VXNA 1OFAA 4DLMA 3BQ6A 1ZZMA 1OIFA 3KAOA 1X97A 1UD4A 1W3KA 4BQ4A 5MKGB 4RDYA 2XFWA 4S3CA 4UFJA 3NDZA 1X38A 3P8IA 1MUCA 2ZA1A 3W87A 2L5HA 1XUUA 3MYPA 1P5BA 2E6YA 4B9ZA 2HPIA 1DXFA 1I4NA 4ZE5A 4S38A 1MEIA 2WW5A 3CMJA 5L6UA 5T9BG 1LUCA 4WJEA 4JYFA 4NX0A 1NFGA 4ATWA 3UXIA 1LTDA 3TP4A 2V2CA 3QYQA 2PMQA 1XLHA 1JG9A 1SFTA 2WBKA 3PWGA 2VEGA 1H0IA 4HTBA 3R79A 5CPQA 1W3HA 2J7CA 3ZWSA 1I2NA 2WKJA 2YOCA 3PFMA 2Z1KA 4O28A 5A95A 5C9XA 3G2GA 3UERA 1J2WA 4Q4RA 1YQ2A 1WXJA 3W38A 1PDYA 1W1PA 2HE5A 3B8TA 4IIHA 4AF0A 3DFHA 1KNWA 4JTCA 3WH5A 1DWIM 4MVAA 4S2BA 1AW5A 3OPSA 5AC8A 4A8IA 4DZHA 1R87A 4H7ZA 3ZJ7A 2ZUTA 2Z0IA 3UT0A 3F4CA 3RMEA 1FHDA 4C6CA 3AIUA 3AHYA 4EOUA 4DAIA 5E5CA 3GR8A 1OABA 1VIZA 3R7MA 3WL1A 1EX1A 1UCWA 1FWBC 2DT3A 2R24A 3JZEA 3AISA 1HJSA 2AGTA 1TCDA 4DJFA 3I7RA 2QF8A 2CEQA 1E0UA 5A6MA 3PZNA 3S3GA 3WH9A 2DQWA 3KVKA 3HM7A 4J3ZA 3LB0A 4HGXA 4AIOA 5HINA 4CUCA 4LAZA 3VX0A 5I00A 1QWKA 1A5AA 1J0ZA 3W7KA 3EOLA 1KWKA 1LRNA 5AZ1A 3MJYA 4WK9A 3WJXA 4ZQPA 3THQA 5D9PA 2VEMA 4KWSA 2VC9A 3PB0A 1HQTA 5HMSA 3FXGA 1UA7A 1UIPA 1JPHA 4R88A 1E9ZB 3N4EA 1ZAJA 1KXTA 3CHCA 3GKAA 1DTUA 1VIWA 4IGHA 3MSRA 1KGXA 5G1YA 4MNLA 4Q33A 2DVXA 1K9TA 2BVWA 1W5MA 4B9YA 2IPWA 3C2OA 5BWFA 2FMOA 3RITA 4QIUA 3C0SA 1TTPA 4WY0B 1LT8A 1EF2A 1GW9A 1UKPA 3G18A 2W9MA 1A5BA 2XIBA 1YKWA 5EA9A 4JFSA 3KX6A 1TV7A 1ODZA 1E3XA 3RCYA 3HGSA 3EB3A 4D6EA 2XVKA 1YRRA 3RN6A 3P60A 5JH2A 4U33A 4XO7A 4MPKA 3AMDA 4MZ8A 2H6RA 3WQCA 3VD3A 1DIEA 2Q8XA 3UXAA 3U5UA 3E0IA 1YXDA 1XW8A 4K6AA 1B4EA 3EXSA 4TVDA 3COTA 3WCZA 4DUVA 2BGQA 3ATZA 4C7GA 2QLYA 4JTUA 3A4WA 1GOQA 4NG3A 3STFA 3TMQA 5BCAA 3BG9A 5JXQA 1RCQA 3OVQA 2GQ8A 3W4RA 3H2FA 3TYEA 3P7YA 1KTCA 3KOZA 4EPBC 5GJNA 3D5HA 2BFGA 5HPCA 3L2IA 4MIMA 3IUIA 2CETA 1VFOA 3LLFA 4N6EA 3HTWA 1NFBA 3W7CA 3TJXA 1QBBA 1OBAA 2CCRA 4DBUA 5D2VA 3W1AA 3F2DA 1NOUA 4ZO6A 3L12A 4F0LA 4KS0A 4ZE4A 4AWTA 1WKFA 2J7DA 2Y85A 3G1SA 1RCOB 3G1AA 4O14A 1PX4A 2DU2A 7TAAA 3CTTA 2Z1SA 1BRLA 1CW2A 2VEIA 4ES4A 1BWLA 3W82A 2VVNA 1XLEA 5T26A 3CAQA 4A2SA 1G4TA 3T05A 1TV5A 3BZJA 3CEPA 2QGHA 2YA0A 4OT7A 3TLLA 3M0LA 4MM1A 1PKNA 2CLPA 1L8PA 1GQIA 4JY8A 2FGZA 2HROA 1S39A 1A5MC 1PL9A 3CT2A 1POKA 3AHTA 4EK7A 3I4KA 3EPOA 2Q71A 3H2NA 4PN2A 2VRQA 1LOQA 3GS6A 3CB3A 4Q4SA 1Q6LA 5LKYA 3B8SA 4XISA 2JF7A 5I3HA 2QCLA 1OG0A 1TCMA 1POJA 2QMJA 4KQNA 2I16A 2WANA 3U4FA 5KZDA 4LS1A 3JR2A 4NU7A 3CV1A 4AVNA 3W1RA 4KEUA 3TOPA 1EQPA 4TO8A 4AH7A 4Z1AA 3CBWA 4HTYA 2NV1A 3AIVA 3BAKA 1L2QA 1DXIA 3RAOA 2G95A 3ISIX 3LI0A 1F5ZA 1DIOA 4ZB2A 1EDQA 2PTDA 4DI9A 5TNVA 2Q8ZA 4KWVA 4W89A 3UD6A 4AQLA 3I3BA 3NPUA 4F2BA 3N13A 2HSAA 1AD1A 4OHQA 1Q2RA 2HNHA 4IWWA 2AAAA 3W7JA 1K4GA 1XQLA 1ZJIA 4Z1YA 3L2LA 1UUQA 1SW7A 3AIRA 3ABZA 4Q4KA 2BXYA 1OX4A 3DHPA 3B03A 3THCA 3DG7A 1OT2A 2UY2A 3CT7A 1F61A 3P3BA 4CD5A 3ZLFA 3JRKA 2XUCA 2VJXA 2Y7EA 3WEOA 1S2AA 2WMIA 4H2CA 1QW8A 3F4VA 4QAWA 1UUMA 1JIBA 3QYSA 1JD9A 6ALDA 1GGOA 2BXVA 3MSYA 3W7IA 3HJZA 1T6MA 4BR1A 1QOPA 4W93A 1VJSA 1PB0A 4M7TA 3N6HA 1FTXA 2PBGA 2O92A 1XLGA 2WVUA 1HJXA 3LENA 4WKAA 5D33A 1QHZA 4NZ3A 3AYSA 5CH9A 3QOKA 4GVFA 1AH0A 2HVOA 3E2QA 4XUYA 2YZ5A 4R9OA 2PGEA 4U31A 3KTCA 2FYMA 1IWAA 3K30A 5HAOA 1JDAA 4L7ZA 4JDBA 3WD4A 5FJIA 4CU6A 2W92A 2DT2A 2JKPA 2X30A 1V3HA 3V5FA 3VA8A 1KXVA 3FDKA 2FIQA 1KGUA 1BKHA 2J66A 1LM1A 4YCOA 1H50A 3RPMA 3TAOA 3AS2A 3TXZA 1VYSX 1EA9C 2Q01A 2VR5A 4HNCA 1RP9A 2WSRA 3DG3A 2RJHA 5AHLA 3KWXA 1P48A 3KHJA 3LTSA 3CU2A 4HSOA 1JCJA 1NIUA 1DJYA 2VURA 2PWHA 4GPNA 3LRLA 2EJAA 2PD9A 4UQ9A 1JCXA 2BVDA 1LOLA 2BNJA 2HVNA 3MO4A 3ZR5A 1M04A 4JEJA 3OQEA 4DM2A 3P6LA 3R8RA 3G8RA 1TJRA 1IT8A 3HV9A 4E2VA 4DWSD 3RG6A 1BAGA 3B0XA 3FIGA 5FJOA 1DE6A 3C56A 1MYRA 1A5LC 1GKQA 3WX7A 1HG3A 1CGVA 3N34A 1V0KA 3CZKA 3J7HA 4E8DA 1I2OA 3NL5A 4EX4A 1Q6RA 4ML9A 1XG4A 1JDDA 4GK8A 4GZ7A 2YBUA 2XU2A 2CU0A 4A2RA 3FV9A 3H2OA 3VGDA 3GYCA 3GY1A 3PR2A 3T2OA 2HCVA 3UJRA 3BSGA 1GG1A 3C6CA 2UY3A 3NSXA 1ZY9A 4G8TA 4KEVA 5ABFA 3LTYA 1HJVA 3FJ4A 2X05A 3CZJA 1EJUC 3QM3A 3V0TA 4PCNA 1RHCA 3CMGA 5G1MA 4BZYA 4HMNA 4JD4A 2V5DA 4REQA 4TQTA 3TONA 1J8VA 4R5EA 3TIMA 2QIIA 4DVOA 2BOEX 5D2XA 5CG0A 3NSNA 4M8UA 3GFZA 2PP3A 3OU8A 3AS3A 3W26A 1KW1A 1BXNA 3ES7A 3OZMA 1L0PA 4LANA 4PEKA 1MUWA 4XAFA 1BTMA 3EKLA 3ES8A 3OGSA 5F2IA 3WJYA 3UJSA 3CQJA 1J6OA 3T6CA 3MC5A 1M41A 3NZQA 1KFKA 4J1OA 4Y6GA 3A5VA 1W5OA 4ACZA 3KOWA 4HU3A 3UR5A 3CPUA 2GJXB 2J27A 3BPWA 4KFPA 3M44A 3EX4A 2OPJA 2ZUSA 1NDYA 3S6TA 4H9MA 2Q02A 4GQRA 1Q6QA 3MZ2A 1DE5A 3KL5A 1IEVA 1XI3A 3NDOA 4D1JA 4Y9OA 3IJDA 1R86A 1KFJA 4H4IA 3PP7A 3DFTA 4Q8UA 3N11A 3EDFA 4JFTA 1MQPA 3KOXA 3M5VA 2CIPA 2A3CA 1E4IA 5E70A 3ABOA 2XJ7A 1VF8A 1TA3A 1ZCCA 2B7QA 1TJ0A 5CJ5A 3G5EA 3GG0A 3H4WA 1RK6A 1GZGA 1AVAA 1J0JA 3KBWA 4GX8A 4Z0JA 4DWSC 4I5UA 2UY5A 1SFLA 3DHDA 4ZO8A 1A47A 4XTDA 5JBDA 4MWAE 4W7VA 1FUYA 1W2VA 3AJ7A 2WZTA 1XSIA 3H2EA 3IJ6A 1RQHA 4A3UA 3NPVA 5CAKA 2JKEA 4HKPA 3T42A 1I60A 3BLIA 2QR6A 3U9IA 3RRXA 1J93A 2IXVA 2O9OA 2XISA 5LIKX 3E1F1 3M7WA 2XH0A 4I8DA 1ZPTA 3KUMA 4PMJA 1G4EA 5BNKA 3ITOA 4LH8A 3RM8A 4JTFA 1VZWA 1QO2A 1LLWA 4BF5A 3RNDA 1O66A 1HJQA 1E55A 2ZRZA 3HJEA 3BOFA 2FZDA 1BVZA 3KLKA 3CYVA 3QN3A 1RAKA 1XH0A 1UD3A 3CO8A 3UG5A 5D2TA 4O15A 1JZ5A 3T07A 4UFIA 2D2HA 4WDXA 1PAMA 1ZAHA 3NOYA 4A3YA 4ZEPA 3E5PA 5TD4A 3M0ZA 1Q13A 3GH4A 2O0TA 4X61A 2VVSA 5F4SA 1UKTA 3QY8A 4LAUA 3MP5A 4GRSA 3NQCA 2QNEA 3W9ZA 1FFQA 1ONRA 4FLQA 1QPQA 1D2KA 3QQWA 3UR2A 3KM8A 4QJ4B 1V02E 3M64A 3NIYA 1FWIC 3UF9A 3KS5A 5I77A 1TX2A 4HQVA 4O52A 3SEPA 1HL8A 2DSWA 4JQ1A 4HD5A 4DY1A 1GZ1A 1XYFA 4GD0A 4Z2HA 4AXKA 4WKFA 1PKMA 1BGAA 2X16A 1IHIA 1K8YA 1ZU8A 3W88A 3TN3A 1PEZA 3VXGA 4LUTA 4ZQRA 2V2HA 3W27A 2ACQA 5LNUA 2CHNA 4YIWA 3BJSA 1ONXA 2XINA 3ABQA 2Q8LA 1XPYA 2X1IA 1XYMA 1PBGA 1WV2A 4IMFA 5CZTA 3HV8A 4JDYA 1S3TC 3WYZA 4JXCA 4JTLA 3LD5A 5AFDA 4J3SA 3U0HA 3MKVA 5HPOA 2ZC8A 3RO6A 3SJNA 1O4UA 4C1LA 3I65A 1E0TA 5AHIA 4DO5A 1LBMA 3IVTA 4LS0A 4H8UA 3C8FA 8RUCA 1OFPA 1XFBA 5I06A 2VD9A 1J79A 4ATLA 1PO9A 4N02A 2E28A 4PCTA 1VB9A 2RFGA 1U1UA 1RUSA 3DECA 2VWSA 1FWDC 3EMQA 1J01A 1F8IA 4Y8FA 3EDDA 3MV11 3T0CA 3M0KA 3VNZA 3LHWA 1LUCB 1ZS2A 2ZZ7A 3CL8A 3WBWA 5A8MA 3QC0A 2P53A 3VAVA 3SDOA 2D22A 1TPVA 1FY6A 1NAL1 1M7OA 4O57A 1IZJA 1DJIA 1IT7A 2YXGA 3D0CA 1F73A 3QY7A 1LBLA 2QJHA 1MDRA 1V3LA 1UZ1A 2VC7A 3QPEA 3POHA 3W53A 4HHMA 2NVAA 5C9ZA 4IUOA 2C19A 3MDWA 2CZEA 2VRJA 3A23A 2A2IA 2OYKA 4GUIA 1Q4WA 4MTVA 2O7SA 1FHVA 1RZMA 3MCNA 1OCQA 4D6HA 3THUA 4O17A 3QV9A 1ZP3A 2PWGA 3ARTA 3N2OA 4HZ8A 4JKLA 4HNLA 2ZX5A 4AF0B 2YCKX 1W8GA 4HU0A 1EGZA 1RJPA 4LF1A 2BASA 4YHEA 3B9DA 4HB7A 3TU9A 4EWND 1ZB5A 2YW4A 1XIEA 4C6BA 4XZIA 1M9HA 3VU2A 1ISWA 5CGMA 1DTNA 4LBRA 1CXLA 4F2TA 5K4ZA 2HJPA 5F1UA 3CMFA 3GTFA 4AEEA 5J04A 4ZOBA 3HGOA 5AYZA 1G7UA 1KM5A 1YBQA 4UZSA 1NF7A 2POTA 3N73A 5IHSA 2FTPA 4ZB0A 2LLEA 3S1XA 2RDUA 4NASA 3T08A 1TKKA 3SGGA 4V33A 2Z1BA 3FVMA 4IIGA 3OYZA 1Z48A 4PUWA 2RJGA 1ESWA 3OW1A 3S6DA 3IRSA 3ZIZA 4GZIA 4Q8TA 1RCXB 3CYJA 1WDSA 2ESCA 3O9NA 4LYRA 1LWHA 2A3LA 1PZ3A 1AW1A 3WNPA 5A5WA 3WLQA 3CM4A 5CZ0A 5CXPA 4S23A 2G3NA 3F2CA 3AXMA 1L2UA 1WO2A 3C5QA 1UZHA 4A3QA 2I1OA 1GWJA 4TTUA 4L1WA 2OQLA 3GFYA 3IRDA 1WZLA 3O8AA 2DT1A 1VFLA 1D7FA 3NQEA 3A47A 4BY3A 1P6BA 1EPVA 5I3JA 3WJWA 5HMDA 2DZBA 2OWXA 1F74A 4YVVA 1CGWA 4FA3A 3BL3A 2XG9A 5AVNA 3A9BA 3WFZA 2BP1A 1T5AA 2QVNA 5CSSA 2ZKMX 3LPOA 2DJXA 5IRPA 5HDRA 3UR7A 2PTWA 3QW4B 3VOHA 2VTFA 3KE0A 4P8VA 3FCPA 3U7BA 3PZOA 3HZ3A 3KRZA 3C4UA 3WQVA 4I9AA 3Q67A 2H3DA 4FR1A 4X9YA 3TX9A 2FH6A 1GOIA 4GQQA 4WEVX 3T55A 2EG8A 7ENLA 2VELA 4QNEA 3KRUA 3PUOA 4UR9A 5CSYA 5EMJA 5ABTA 2XSXA 1IIGA 3LLDA 3VD4A 1I9CB 4HCLA 3C52A 1B31A 3AIEA 3UYIA 4PCPA 1LRQA 2WMKA 3BLLA 4OV4A 2IKHA 5IFTA 3A21A 2GGHA 4WXYA 5LGZA 1Q66A 3HOJA 1S2TA 1PIIA 5BWAA 3G22A 1JYXA 4E2OA 4KCUA 2PWDA 4B5XA 2V3EA 4MKSA 5T8GA 4CCEA 2QCNA 3K46A 1EEPA 4HNVA 1TX0A 5A3HA 1I2PA 2TRSA 3CAWA 1XBYA 3G8EA 1C7SA 1HKIA 4TMCA 3SUSA 2KX9A 5A2CA 3CZEA 1G4SA 2VKZG 1VFUA 2AQVA 5M03A 1WUEA 2HS6A 1XSKA 3EWYA 1WUFA 2OZ3A 2H9AA 4IZGA 1GG0A 4CCZA 2XGZA 4RPQA 3TYZA 1X96A 5BOEA 2GOKA 2XSBA 3UZ5A 3WLPA 2IMRA 1LZOA 4LEFA 1FKXA 2KAUC 5CC6A 3E6EA 3IV3A 3WDRA 1MQRA 3SCVA 3XISA 2GVGA 5EPDA 4V2XA 1U33A 2JALA 4HIBA 5DXYA 3VFCA 3AUOA 3L66A 2Y6ZA 3T78A 3SN1A 3TSMA 1LCOA 4JN8A 1QASA 2ACUA 5E09A 4EIVA 1VLWA 5A6JA 3E3HA 5CPSA 3UCCA 1QFEA 2PDPA 2XVNA 4FF7A 4K36A 1RLDA 5D37A 3WLLA 4DWSA 3P0WA 3P0XA 3BG5A 1WOBA 1WPCA 2PDWA 1W5NA 1H7NA 4OFCA 1EXPA 1AFSA 2AL2A 2FTWA 2YL9A 3S5OA 2CLHA 1ZGDA 1LF1A 3C0LA 3L4ZA 3WK3A 2B7PA 4KCWA 3SRHA 3PZMA 2X0YA 2VQTA 3UPWA 2HBVA 2HEJA 5HJYA 5M5DA 4XVEA 3TSDA 4GY0A 3GXNA 4F0RA 5HJXA 3RPDA 2UWFA 4C6KA 4HZ6A 4I90A 3ZWTA 2V30A 4WY0F 2NQ5A 1KM6A 4AB4A 4MF4A 1KBLA 1T96A 4AIUA 1PIGA 4V1XA 2HISA 5M17A 4M56A 3UWYA 1XWYA 4GVGA 1TE6A 3B8UA 3N6QA 2BGSA 1FWAC 3D3AA 1AUSL 2ZUWA 3NQAA 1R46A 4GYFA 2DUZA 2XFFA 1JQXA 1UR8A 3APYA 4XV0A 4G7EB 1R7OA 2IKJA 1M7PA 5HJLA 4GI4A 4EP8C 2GVLA 3PTQA 2XGBA 3DDMA 4AWUA 2GFTA 4UTKA 1IEIA 2EXOA 3A64A 1CXEA 3EDKA 2WWDA 3EX6A 3F4NA 2XN2A 3QZAA 1OINA 3BCFA 3WLMA 2J7GA 3MPGA 2DZUA 3WUFA 2DZSA 4EWJA 3HBLA 4AHPA 2E5CA 3STPA 2QDHA 5LZLA 1TPB1 1NWTA 3WQ5A 3K1DA 1DBTA 2CLFA 3HF3A 4QEHA 2QYGA 3QPYA 1EOKA 5DRIA 4WDWA 3R8HA 4QG8A 4PUNA 1UOKA 1QPOA 4P8UA 2UZ9A 1Q85A 3W7HA 2QS8A 2VX6A 1KBJA 3WG6A 1W5PA 1QOXA 1ZHAA 3ARUA 4NAFB 4W84A 1V02A 3L5MA 3FLUA 4ZOAA 1JFHA 3WL0A 1DJQA 1CTNA 4QFUA 4G7FA 4G6CA 5KZMA 3GD6A 2DQXA 5H8PA 1MXGA 2B7OA 2YSWA 1IEQA 1BSIA 2W4XA 1I1WA 2Y1HA 3I7QA 2EPLX 2XM1A 4GBUA 2HBXA 2ZX8A 2NX9A 3Q2DA 3ZVIA 2J8GA 3T8QA 1A5CA 3PULA 3L4TA 1NWSA 4F48A 2JE8A 1PX8A 3BZGA 3VGFA 3EAUA 4F4RA 2FDMA 1QW7A 4RE2A 3OQ8A 4JKMA 2EEXA 2FQIA 2ZA3A 4O18A 1FVPA 1H63A 1NQ6A 1DJHA 4N2YA 4NX5A 4LAKA 4NKCA 1OWQA 1RQBA 2ZRVA 3UY8A 4HSHA 1SO6A 3WLSA 5D2WA 4UTJA 2PTZA 4B4FA 4UIOA 1AZ2A 4EVZA 4UFHA 3W83A 1GK8A 3ZOAA 5KEZA 4XKYB 4ICCX 1SJDA 3SCNA 4Q8PA 3OZYA 4JX4A 2WJDA 1CLKA 4LCRA 1UPPA 1H62A 3O6YX 4XZHA 1CLVA 1GQJA 1PKYA 1W3LA 3FA5A 3BMVA 1XH1A 3NVTA 2YXXA 3NR0A 3NGFA 1C8YA 3N15A 3PBUA 3LYEA 2CPUA 1OCNA 3S1WA 1UR0A 1DJGA 4RNIA 1JRBA 2R91A 3DGBA 1YNQA 5A6KA 6TIMA 2Y62A 4RUBA 3TFCA 4YS1A 4ZQMA 2WZEA 1JNDA