3SY1A

Crystal structure of engineered protein. northeast structural genomics consortium target or70
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
229
structure length
229
Chain Sequence
b'MMNDIAHNLAQVRDKISAAATRCGRSPEEITLVAVSKTKPASAIAEAIDAGQRQFSEHYVQEGVDKIRHFQELGVTGLEWNFAGPLQSNKSRLVAEHFDWCITIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRLRGLSAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLALGQSDDMEAAIAAGSTMVAIGTAIFGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0001 protein yggS
molecule tags Pyridoxal phosphate binding
source organism Escherichia coli
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR70
rcsb
total genus 85
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3sy1A00
1CT5A 3ANUA 4LUSB 3SY1A 2QGHA 2YXXA 1VFHA 2VD9A 3WQGA 3S46A 1EPVA 4XG1A 4BHYA 3B8UA 4BEUA 3N2OA 3C5QA 1XQLA 3AWNA 1RCQA 4KBXA 3N2BA 1B54A 2NVAA 4XBJA 3R79A 4BF5A 5BWAA 4PB3A 2PLJA 5FAGA 2ON3A 3WQDA 1BD0A 1KNWA 3NZPA 1QU4A 1D7KA 4DZAA 1VFSA 3WQFA 5FAJA 4LUYA 4WR3A 1HKWA 1VFTA 3CO8A 3KW3A 3WQEA 3NZQA 3E6EA 3LLXA 2P3EA 2NV9A 2TODA 4PB5A 3B8TA 4A3QA 3OO2A 2SFPA 5IRPA 1NJJA 4LUTB 4QHRA 3WQCA 1FTXA 3HA1A 1HKVA 5FACA 2VD8A 3B8VA 5GJPA 3ANVA 4ECLA 1XFCA 3E5PA 1KO0A 1TUFA 1TWIA 3HURA 4Y2WA 2OO0A 1L6GA 1L6FA 3GWQA 2RJGA 5GJNA 1NIUA 3CPGA 4FS9A 3B8WA 4BEQA 7ODCA 1XQKA 1SZRA 3BTNA 3N29A 5GJMA 3VABA 4ILSA 2PLKA 3AWOA 4LUTA 2RJHA 3MT1A 3UW6A 2ODOA 4AIBA 4V15A 2DY3A 2J66A 4DYJA 1W8GA 4ZGYA 1SFTA 2O0TA 4PB4A 4LUSA 1F3TA
chains in the Genus database with same CATH superfamily
3RCYA 4O15A 2QVHA 2VD9A 4CUCA 3CC1A 2WM1A 2GFTA 5E0FA 4BY3A 1W1PA 1X1ZA 4GCXA 3QOMA 1O66A 2Y7DA 7ENLA 1UKSA 2HSAA 2QV5A 4HNLA 4UBPC 4MPKA 1XJBA 4L6DA 4WSJA 3R8GA 1C8XA 1FX6A 4L7ZA 4B91A 1XBZA 3W76A 4FA3A 1E1CA 3NSMA 2D1ZA 1E4LA 1QNSA 3N9SA 2XISA 3R0DA 5TD4A 3SSZA 3C2FA 4UFIA 1EQCA 1WKFA 3MA8A 3H2MA 5F2LA 3MPGA 1AL7A 4GVFA 2HS6A 1V6VA 3QBUA 2GGJA 4UFJA 2X2GA 2QPXA 1TV4A 3THUA 4ZFCA 4N02A 2UY5A 1UKOA 3GVQA 3PZMA 2D2OA 2YW4A 1AD1A 3W7JA 2FGZA 3CPRA 1UH2A 4LY4A 4C6JA 4UNLA 5KZ6A 2HMCA 3LHVA 3BSHA 1BG9A 3UG8A 2WNWA 3LNMA 3MV11 3TMQA 4TO8A 1QTWA 1XICA 4J27A 4Y9PA 3HPFA 3I3BA 1S5VA 2DZUA 5DFAA 1EIBA 1OCNA 5HATA 1H51A 2ONEA 1IWAA 2CBUA 1T41A 3RK8A 2BOFX 4NY2A 4BQ4A 1M01A 3W73A 1HTIA 4B3LA 2R6OA 4AEEA 4QXIA 4UMBA 4UMAA 1JCYA 1NELA 2OYKA 4E4FA 2EPNA 3H2AA 2PCEA 4L6HA 1RLDA 1LQ0A 5A6TC 3LCIA 2QMKA 5DRIA 4B92A 7A3HA 4AD0A 5M17A 2CBVA 1J01A 3NYZA 4PTXA 3WDPP 1ONWA 3VKKA 1ISZA 1GUVA 5LYRA 4OKDA 3OU8A 1H7NA 3FJ6A 5FESA 1TX0A 1QI2A 4FLRA 1W31A 3AC0A 4CN4A 4FNRA 3S5SA 3PWAA 2XH4A 2H9AB 1LBFA 4CQAA 4XD5A 3U3HA 4EAYA 3S1VA 4MUZA 3QV6A 4PMJA 3C4UA 5T8GA 1E6XM 4P8XA 3BAIA 4ADSA 3N4EA 2NQ5A 3EMCA 3XINA 1SJAA 2IQ0A 4MAVA 1XD0A 4O1FA 1Q7QA 4PEEA 3LBMA 1XQKA 4ZBCA 4RUBA 4HMDA 3H2CA 2XIQA 4HNOA 2WKJA 4O4WA 4ZB2A 2UZ9A 1YHTA 4WLCA 3LY0A 3WYZA 4J4KA 4S38A 4KIEA 3EX6A 4KH2A 7CGTA 3WBYA 2XN1A 6ALDA 1QCWA 5ECVA 2CKRA 1ZU8A 2VVSA 1SPQA 4ZQNA 3LU2A 4Z2LA 3EWYA 3K2GA 4UQ9A 2W91A 4FXSA 3WQ4A 1G5AA 1W2PA 5GVJA 2CLEA 4LGXA 5DT5A 4S3DA 5FAGA 4QR6A 3CB8A 3W1UA 1GCYA 1W1B1 5BMXA 3Q65A 1I2OA 2GUUA 3VDAA 4L4LA 1EC8A 1TJPA 3AHVA 1JCJA 1IIGA 4TMCA 1R3SA 1GW1A 5KINA 1SR0A 1U22A 4QROA 1L6WA 1L2UA 3QY6A 1V77A 4DWSA 4Q4KA 3WEMA 5K2ZA 5E9AA 2GPTA 1M03A 3CAQA 3ANVA 4HN8A 3FDGA 4HHPA 3LHUA 2X42A 1RVKA 1W3JA 1XWYA 2P10A 1KBLA 3B8WA 2XSAA 1UUQA 5AHFA 4HPGA 2VGFA 3IACA 2ZXQA 1R2TA 3CQ0A 4PCFA 4GI6A 4PUJA 4O10A 3RRAA 5E6YA 4ALDA 4ZGYA 3O0KA 1ZUAX 3RCMA 3LENA 3RITA 3WO8A 3ITTA 3I7RA 3UWVA 1JI2A 4XTDA 4AY7A 1G4TA 4S3BA 5LIXX 1F7BA 4LWWA 4AX7A 3P3BA 2ZBTA 1A49A 2VFIA 2PTXA 1WE5A 2DSWA 2P8BA 2FMNA 4UTTA 3PBMA 3CO4A 1LL4A 1CWYA 3L2IA 3QHOA 4DY1A 1TX2A 3IIOA 3PAOA 4DJFC 2WSKA 4IL2A 4HSOA 5FJPA 3C0LA 1VP5A 3QMTA 2GYIA 4HQVA 5JMUA 3CQKA 2C1GA 1B3YA 4WKHA 1LRQA 3P62A 3I4KA 1UD4A 1PKYA 4OQVA 2EKGA 4DM1A 3NQMA 1BWKA 1Z69A 2VRJA 3MI6A 3M5ZA 2INEA 3VO0A 4GXMA 4EK7A 4F0SA 3VK5A 4Y2WA 4Z17A 5FJJA 1OYCA 4CVWA 1JG9A 3U2EA 2YBTA 3M6YA 4JTLA 2D0GA 2EO7A 4UNKA 4EPKA 1AG1O 2JK2A 3QYSA 3W71A 2HVNA 1WX0A 1KRCC 4JGDA 1FWHC 3P84A 3K8KA 3UWWA 1XKJA 3KOFA 1I1WA 1ZAHA 4CN1A 2ZZ4A 3D3FA 3LZ5A 5CZTA 5B7YA 2PP1A 4C1NB 1GVFA 1UZDA 3CL6A 1CYGA 4TR9A 4JX5A 2Z6IA 4MKNA 5A2CA 3HGSA 2X7VA 2OCZA 3LSCA 3R5EA 3RGTA 4F4RA 3H23A 4UTKA 3LGEA 4HTYA 1H0IA 3FHQA 3WQDA 1L8PA 3JU2A 1J8VA 3MKCA 4V28A 3WK1A 2D2JA 3CASA 2C15A 1UHVA 4GQ0A 1E6RA 1AJ0A 1GTHA 3QTPA 3W01A 1QW8A 3WQEA 3K1DA 1NWTA 3ARSA 4N7QA 4S2CA 3ZLGA 4PB5A 3DHDA 3NGJA 1TCMA 1PPIA 3M5VA 4UR9A 2SFPA 3TWAA 1G67A 5JVLA 4ZO7A 3UWQA 2V5LA 1OADA 2QUVA 4LRTA 1PZ0A 4JN8A 3NUKA 3NL5A 1QASA 1R85A 1KBBA 3MSGA 2A2IA 3AZSA 2PWEA 2ICSA 4WY0F 1FP8A 5D02A 2HTMA 2QJHA 5E09A 2RDTA 5C9WA 2YXGA 2EG8A 3WD4A 2PD9A 5FI8A 3TYZA 1XR2A 1S1PA 2E9BA 3LV6A 4JQ4A 5FSEC 5HWMA 5BWFA 2VFEA 3LCXA 3LERA 4JYDA 2HE8A 1F6PA 1NOWA 4BA0A 5HPOA 3NDZA 1M1BA 5EMUA 1P0DA 2E28A 1MXDA 3FOKA 1QW7A 3C3UA 4QE4A 4O1CA 3ZT6A 3H2OA 1EJRC 3DC0A 2WPGA 3NQGA 1LROA 3GDMA 2ACSA 4Q8OA 3NAVA 1C8QA 2QCFA 4L4MA 2ZRZA 2ZIDA 4PUEA 2FZDA 1P7TB 3GM8A 4A8IA 4UQBA 3W7MA 3VNMA 3GTNA 2D23A 4JDYA 3P0XA 2VFHA 1AZ2A 4B16A 2WYSA 3AMLA 5HMSA 4JEQA 3BGJA 1A3XA 2CFFA 1XGZA 2POZA 3E0LA 4H6EA 3TVAA 1HO1A 2PLMA 3TROA 4QAWA 5BU6A 3UY7A 5CSSA 1NIUA 4C6DA 4UOZA 3GC5A 5J5DA 1A50A 3K4DA 3MKVA 1CGYA 2ZZ2A 3SI9A 1FCBA 4D6JA 1DQUA 3R0KA 3A4WA 4DLMA 3LBCA 4JTAA 3QVQA 2PPGA 3AISA 2ZC8A 4XIMA 3URBA 4GQBA 1T40A 1KWGA 4RE4A 4PCPA 3I7QA 4G8TA 3N9KA 1QATA 2VCAA 4FOUA 4G6CA 1UOZA 3MUXA 4JNMA 4Y8FA 1JFHA 1BSIA 3CUXA 2X40A 3PHAA 3W7DA 3L4ZA 3VGEA 1ESWA 4A8NA 1JEZA 5DRCA 1TPUA 3DGBA 4QGCA 1ENUA 4DJDC 1RLCL 2I1OA 3LRLA 1I1XA 4AC1X 1CENA 3RM4A 1J18A 2INZA 2DJLA 3IGHX 2H3DA 2ATSA 1DQXA 4BS0A 1UR1A 4WJXA 2P53A 4Q8VA 4NP7A 2AOSA 2YFOA 1Q45A 3BLLA 1YDYA 1JZ8A 4J2MA 4RW3A 3OA3A 1AQHA 2BXYA 4M7TA 3UJSA 2QXWA 3NPUA 4JTJA 1R30A 3EDKA 3V0TA 2DIJA 1J5TA 4IF2A 5FIPA 4KMQA 2IPFA 2Y89A 4ZZ9A 1A5NC 2J9ZA 4MHBA 1IWBA 2P76A 4DWDA 2GVEA 4HB7A 1MW0A 3HM7A 1T96A 4E2BA 3M1ZA 3G0SA 1XLBA 2QAFA 3S4TA 2OEKA 3TC6A 3TOPA 5XIAA 2YCKX 2XGBA 1XH0A 2WLYA 1S1RA 3WQ8A 1PAMA 3GNDA 1LDCA 2YL6A 3BL3A 4ASTA 1X38A 4BHYA 4C5YA 4GYPA 2E9MA 3REQA 5K4ZA 4PUUA 1GHRA 1E6PA 1I8JA 3DI1A 3F5KA 1KR0A 4MWAB 3BLDA 1J12A 4KBXA 3BMWA 1QHOA 2ACQA 4FMVA 2WNZA 5D2YA 4PTWA 2NXHA 2OLAA 4MVAA 1U30A 3QMSA 2HDJA 1DWIM 2YW3A 3TQKA 2PZ0A 1HVXA 2I17A 3I10A 1XLJA 4JTGA 5AHNA 4UTTC 2OYLA 3LK6A 3H2FA 1H5VA 3UG3A 1R87A 4MNKA 1VBHA 3HQ1A 3PUGA 3MKKA 3VNZA 3CEUA 3GXNA 4BI6A 2VR5A 2VRKA 4DHGA 1S5MA 4Z1YA 3RG6A 1LG2A 2OKOA 3M0KA 2NLIA 3T44A 4CNUA 3W29A 3HQOA 1E1EA 1OQFA 1DVJA 5D9OA 4I9TA 2GUYA 4B5SA 3DG6A 3VMOA 1IR1A 3KWSA 4LQ1A 2FDMA 3MS8A 1OX4A 3DAQA 4FZIA 1XIMA 5HMEA 3P60A 3T08A 1S3TC 3PZQA 2PTZA 4LYRA 1AJ2A 1JXKA 4GYKA 3W72A 1UA3A 1OK6A 1U5VA 3ME3A 1FWNA 4X63A 2QUNA 1G7UA 4LALA 1JQVA 1V6TA 4XG1A 4IX0A 1H7XA 1ZJHA 3KZSA 1QPKA 3MJMA 2WOQA 4GC4A 6CGTA 4YHGA 4WJEA 3WNLA 1BYBA 1ZAJA 2XFYA 5EBUA 2GGEA 3L21A 3WQFA 2A21A 4U4MA 2HISA 2IXVA 3NZRA 4WDXA 5E5CA 4R9OA 1E55A 1QI3A 5C71A 1ELSA 4RZBA 3W1LA 1JCLA 3WD2A 4O28A 3QW4B 3HIJA 2W3ZA 4MFEA 5HWJA 3WDJA 1ZCCA 4O13A 3BH4A 2BV9A 1NM9A 1ALDA 3CUZA 2XIJA 1W5QA 1GQNA 1TWZA 3ZR6A 1H5YA 2YL8A 4JFWA 4C91A 5LIKX 3LYEA 3DYPA 3CZGA 2YDRA 4I7UA 1ZJIA 3W2NA 2A3LA 3DKJA 4P7LA 1TSIA 5D38A 3KRBA 2VC7A 3ELFA 3KDNA 5C9RA 5K4XA 3WH6A 2NWSA 4LYKA 1O4UA 3UG4A 1UMLA 2A3EA 4QDMA 3FLUA 1FH9A 1NARA 3KXQA 2OKTA 5FF2A 2Y85A 4NAEB 1XISA 2QNEA 2RUSA 1FCQA 1Q2RA 3VM5A 2AGTA 1E73M 2R8WA 2E8YA 1DPMA 5EGRA 2FJUB 1WBJA 1C7TA 2G4JA 1NP2A 2PDKA 1KFLA 1HNYA 1QU4A 1RBLA 4AW7A 1RY8A 3WDRA 3GDTA 3L4WA 3FGCA 4UMCA 4ZODA 4M6VA 2ABBA 1TPFA 1WZLA 4QP0A 2YGYA 7REQB 1HKJA 3NJ3A 4GJ1A 5DY2A 2OWCA 3EDDA 1Q6CA 1K8CA 1OC6A 2BXZA 3T0DA 5EMLA 3UJRA 1TQJA 3USZA 5KEZA 3WBWA 1M6JA 5DEZA 4C6CA 2GUBA 1GVEA 5HUOA 1DOSA 1FWCC 5D33A 4JTDA 3MC5A 4UTJA 3LNPA 1V08A 4PUMA 4Q8PA 2Z28A 1OX6A 4JDBA 5GJMA 3B03A 3QPEA 2JQXA 4PULA 1BHGA 1CBGA 3P80A 3PFMA 1C91A 4K38A 2YSWA 3WUEA 3D5HA 1V79A 1CTNA 4D72A 2PE4A 3MVIA 1V4YA 1EBHA 3CV7A 3TW9A 3BAKA 4I90A 2VGGA 3OYXA 3E74A 3G8RA 2CLMA 1BTCA 3LV5A 1VFMA 4W7VA 2X0SA 2OMAA 2Z25A 4AZHA 3UJ2A 1JDEA 1J5SA 3DFPA 4DJDD 2E09A 5HQMA 3WLMA 3LCLA 1CGVA 2FVKA 1OK4A 2C13A 2ZTJA 4RL3A 3GTFA 4GQGA 3VNDA 4GY0A 4W5ZA 5AYBA 3W1QA 1S39A 3OZOA 3OLEA 3N19B 3F4CA 4YVVA 2QJNA 1OB0A 2F84A 4J3VA 3KZPA 4IICA 1IV8A 4CLMA 2ACUA 4JQ3A 3GXTA 4G56A 1YXCA 2BY1A 1W5OA 4B5VA 2FZMA 3G8EA 2VM8A 3IGSA 3P14A 4FXJA 3PBGA 3AMCA 4D71A 3O9NA 1ECQA 5EPDA 5K9DA 4ZENA 1BTMA 4U28A 4W7UA 3AFBA 3E38A 3NPXA 3P93A 4HZ8A 5E1QA 2C7FA 1ODUA 4PB4A 4HMCA 3C61A 1Z89A 3W7RA 3WNMA 4LEQA 4H04A 3KCJA 5D8ZA 5HUPA 4GC3A 3UGVA 4IQLA 4IMCA 5HK4A 4HCHA 4IIBA 2E40A 1JD9A 3CIXA 1VCGA 4W7WA 3PZGA 3ITOA 3PM6A 1YKWA 2OX4A 2B4GA 3CPUA 1QK2A 4XD4A 5TF0A 2W0UA 4Z1CA 4RNHA 1QO5A 4M6UA 3VNKA 3BSGA 3V35A 3GU1A 3TTEA 5K9CA 1E6QM 3N6QA 3LDVA 1GVSA 4A35A 4N6FA 5LNSA 1A4LA 3MYOA 1VBRA 5CPMA 3EAUA 3NZGA 1R3TA 3P7YA 1SO4A 3R58A 4IFOA 3VXGA 5I06A 3DGRA 1FHVA 3GDBA 3FYYA 3KLKA 3FJ4A 2GK1B 3UFYA 5D37A 3UESA 4CQCA 1CB2A 3TV8A 1PSCA 3GHUA 4WSKA 2Z1SA 4M8UA 2Y61A 4BQ3A 1MDRA 2V82A 3AIBA 3BOFA 4LUTA 5D05A 2WZHA 3O1NA 1XINA 4AIOA 2OWWA 1CNVA 3A4AA 1OIFA 3WNPA 2R9RA 4K37A 4NJGA 1SU5A 2J7GA 1YX1A 4XAGA 4Z2GA 1XIBA 4PGLA 4TUFA 4QAIA 4NJKA 3EXTA 1IT8A 2PS2A 3V1PA 3VILA 4NI8A 4HD5A 6TIMA 1DEDA 3NWRA 5B80A 5L9FA 2HWGA 3KVMA 1OD0A 4ZR8A 3NVTA 4QISA 3DFSA 3QZAA 3OZMA 2NV1A 4INFA 2I16A 3ZFHA 2YKKA 4QDWA 2VEFA 4BWLA 3AOFA 1EL3A 1WZKA 5GQBA 1R46A 4HMNA 1QAPA 5DLCA 1VAHA 4K68A 4ZTXA 4O18A 3T7VA 4JTFA 4Y7EA 5G2WA 4V27A 1TFVA 3OLIA 3G3MA 3LPPA 3PZOA 3W37A 3LQLA 3THDA 4C7GA 5JIPA 4LNCA 1CLXA 1XV8A 5I3KA 4XD6A 3CXOA 3O06A 1TJ2A 3KCOA 2PLCA 1UR3M 4BR1A 2CEQA 2ESCA 3VIOA 4QBXA 1A5UA 4GIEA 1Q8AA 3NO3A 1E0XA 1Z7AA 4L80A 1A5KC 4AYSA 1JUEA 5A6BD 4U3CA 3TTOA 3DFNA 4EPBC 4ZXOA 3LLDA 2PBGA 1PDZA 3VOCA 4WD0A 3SURA 1PWMA 1PIGA 4ZSUA 3ITGA 1BEUA 1HJSA 4B2DA 2IUZA 3APGA 4K7VA 4K39A 1I4NA 4M3PA 3KM8A 3EBVA 5EY5A 5FEZA 4QNWA 1UWAA 1WKDA 2WBKA 3RUBL 3EB4A 2WW5A 2ALRA 3GHSA 3GDKA 1O6IA 4F2TA 2J7FA 3HB9A 2RKXA 3IUHA 3OODA 2YBUA 1QMLA 3GR7A 1IWPA 1WKYA 4MIMA 4DWSB 3VDBA 1XYZA 2V5DA 1GOKA 1V02E 3E0VA 4G7EB 1ISVA 4PZVA 2X7WA 2P0OA 2E3ZA 2W62A 1FFRA 5ABFB 4ATLA 2CXEA 2ZZ6A 3ERPA 4K2SA 3W7OA 3GU2A 1TZ9A 5A94A 3L66A 3Q67A 3FNDA 1IXQA 3UG5A 4A8LA 4WVXA 3FSTA 2V2DA 4FS9A 2ZX7A 2WMGA 1K9TA 2CWXA 1M9HA 4ADUA 1V3LA 4DXKA 3ARQA 2FFIA 4MYXA 4C6BA 1R47A 1JYNA 2E5CA 4UFMA 1JD7A 3IAQA 4JOMA 1K8XA 3G1FA 2A7PA 2EBNA 2D2GA 4KCTA 1F3TA 3I4EA 1G0CA 1J0YA 2YCLA 5BRQA 1O1HA 1KQZA 1TKKA 3B04A 1C9DA 1GVIA 1Q6FA 5I5RA 1CEOA 3NQ7A 2YDQA 4LUIA 3BANA 4QG8A 1DORA 1UZ4A 8CGTA 1YXYA 3LA4A 3V3WA 1JDCA 3A4XA 4ZOBA 3FFSA 5CLWA 1ZCOA 3AIUA 4L1XA 1QI0A 4CD7A 1P1MA 3R6IA 1C92A 1PHWA 1W1A1 3UCCA 1ME9A 2YCJA 5LXXA 1RXOB 2PWVA 1E3ZA 3KAOA 3G0UA 2A7NA 4DF1A 4HZ6A 2JGYA 5DMLA 1V51A 3OVPA 1D8WA 3AXMA 1TZZA 3CEPA 3EEGA 1H2JA 1V6XA 4XBKA 4H2HA 1QI4A 1PIFA 3BQ6A 3LI0A 2PWFA 4UOJA 1JRBA 5I23A 3OHMB 3IJIA 2J77A 5HDRA 4AF0B 1KRMA 4EANA 2FMOA 1CGUA 3DHPA 1W0MA 2VZUA 4WY0A 4JX6A 4YIWA 3S3GA 4HJWA 3BJSA 3CK5A 3GTXA 1GQIA 1DTUA 3RX4A 4CU7A 3C8FA 3UVAA 3U7VA 2AL2A 5LZLA 5ECUA 1QXLA 2G5WA 4CVUA 1KXHA 3KVJA 5I78A 1EIXA 1XYCA 3LTYA 2IW0A 3FJLA 4FNQA 2O92A 4JQ1A 3IIPA 2ZX5A 3ZMRA 1VYRA 2UBPC 2YIHA 2H8ZA 3MW7A 4MZ8A 4BI7A 1RCXB 2ISWA 2GQ3A 3WBEA 1GZ1A 3BV7A 3WK3A 3GAKA 4TV6A 1W54A 4M0XA 7XIMA 3MCOA 4AHQA 1HUVA 3O07A 3VOFA 2OEJA 3OGSA 1VLIA 3LG3A 4CEUC 7TIMA 4JTQA 4D2JA 3VIGA 1MFVA 1KTBA 2ZZ1A 5XINA 2C16A 3UCDA 3FKRA 2YZRA 4MPQA 3GIQA 3QRHA 1I2QA 3MDWA 4A6GA 3KX6A 3BAYA 1SGJA 2IPGA 2V3GA 3RLHA 1BKSA 2QDEA 3NA8A 3DYMA 2FVLA 3L65A 2IPWA 1F76A 4MFDA 4U31A 1TELA 1UD2A 3DN5A 4NXKA 3LXBA 4NNCA 3UEQA 3VCRA 4XAFA 3N2XA 1VFFA 3BLPX 1SZRA 3BE7A 3TN6A 4RDWA 1VJSA 3NPWA 3D47A 1XBXA 5DMMA 3APYA 2FIQA 3M0MA 1IEVA 3AXXA 4I7VA 3PBUA 8A3HA 4E8DA 4O16A 2YPIA 4JICA 2J7CA 3RCNA 3K30A 4NJHA 2OLSA 2WWCA 4AD5A 3P8IA 1XIEA 3KBMA 4KT2A 1OFRA 3SCWA 3V7PA 1AK5A 1GKRA 4NUWA 3D46A 2PCQA 3DZ1A 3PBYA 4MM1A 3SR7A 2NV2A 4O0ZA 2BVTA 4BFAA 2V3EA 4QQ3A 4A21A 2FPTA 4URIA 4J3ZA 3DXIA 4FR6A 1W5PA 1OSEA 2V2HA 5BROA 3WD3A 1E0VA 1ADOA 2ZE3A 2EPMX 4TV5A 4IIDA 4IJRA 3G1SA 2DIKA 1O7AA 4GLEA 4IJCA 1WP6A 1SO3A 1VBJA 4EXAA 3CIWA 3IANA 3KL5A 5G1TA 3G1DA 4LH8A 2WMJA 1W3TA 3W86A 3R25A 3WUBA 4AFYA 4DBDA 3W2KA 5E0KA 1RV8A 2YA0A 4WUIA 4GX9A 4OTKA 3MUIA 4H8NA 4YCOA 4PYSA 3PVFA 2VEGA 3VU2A 3SUUA 2ZZ5A 4QCEA 4LU0A 4JIQA 2RJHA 4GE8A 1KW1A 4JD4A 4L9YA 3P8JA 2ADAA 3C2OA 1M41A 2J9XA 2P88A 4LC6A 1BPLB 2YXOA 1NFPA 3A22A 1B9BA 4JYFA 3T81A 4MUPA 4TU1A 3W87A 1PX8A 1DQWA 1MW1A 4Q3MA 1DWHM 2JKPA 2Q8ZA 2WKLA 4IIHA 2Y5JA 2BDQA 1E6ZA 5GNYA 4D6IA 1QOPA 1UC4A 1MEIA 4U3AA 1UA7A 1TB3A 3H8AA 3U4AA 2DU2A 2ACRA 1VPQA 1YE6A 5ABFA 4UCGA 3GU9A 4PB3A 3SJNA 2QUMA 4DLFA 1ZBVA 3PAJA 4DAFA 1WAUA 3TR9A 1P6BA 1Q6QA 3W0KA 4M82A 2ZADA 4WR3A 3ABRA 3BG3A 3WJZA 3PF3A 2TPSA 4ZCWA 3E2QA 4ZE4A 1RPXA 4M80A 2F2HA 2J7HA 1TV3A 1TIWA 3VZZA 2QHAA 1BG4A 3OTRA 1U83A 2PU1A 3WH8A 2FH6A 3O8AA 3UF9A 2HPIA 3C86A 5CC6A 2QV4A 1HX0A 3HGOA 1WNOA 4K1WA 4AAJA 2PRHA 3TFXA 3USBA 3U5YA 2OLHA 1B2YA 4JN7A 1P6CA 1R9ZA 1OFEA 1US2A 4S3CA 2QUTA 2VWSA 3SUSA 1PKMA 3CNYA 2CKSA 2DZBA 5FF3A 4FI4A 3N2MA 3I68A 3S6OA 1A5SA 1V7YA 2YCLB 4F40A 3EX3A 3B0UX 4Q7BA 4UTWA 3GVRA 4IPPA 1F2JA 3UZZA 1KM4A 3SCSA 1EJVC 3K4AA 4LOCA 1W3NA 4W87A 4LEFA 3RRXA 3N2OA 1CXKA 1R3QA 5MHBA 3MP4A 1VYPX 5FJUA 1W32A 3BK0A 2A0NA 3DKLA 4RXGA 1XL9A 4XZWA 3U2CA 1Q6RA 5C9XA 2E6FA 3SCNA 5AC8A 3VIMA 2VURA 3N25A 1B90A 4DI8A 3FYOA 5F2IA 4PCTA 1Z3NA 3GS6A 3EWDA 2C1IA 2Y63A 1XYFA 2DT1A 3QW3A 4GINA 2P3EA 4E3VA 4A3YA 3IIZA 3MO4A 1Z41A 3VIFA 4IX2A 1H1NA 3CV2A 1DYSA 4G7EA 1GK8A 4H01A 2J4GA 1M5WA 3M07A 3M46A 3OB8A 3VGDA 1JYVA 2AGKA 4HK7A 3PPFA 1FCUA 2X16A 1MXSA 3CAVA 1ZGDA 1PZ3A 4AU0A 1VENA 3GW0A 3S9YA 3RU8X 1GKQA 3OVQA 4UQAA 3EA1A 3LGDA 1SZNA 1TTJA 1LWHA 2ODOA 4UXDA 1EZ2A 1UG6A 1W3IA 3N3MA 2ZCGA 5GPRA 3EKZA 1I9CB 1XHGA 1Z32X 2Z4GA 1E9YB 4ONVA 4OHQA 3URQA 2PTWA 4KCUA 2BFGA 3TYCA 3WH5A 1NAL1 4OOZA 4W86A 5J8LA 5LIYX 4O8AA 1K6AA 1GOMA 1HJQA 4JFUA 4JN6A 4J3UA 4QM1A 3WL0A 4AVOA 4O53A 4DUWA 3ES7A 3QKZA 3CBWA 2QUUA 3GVGA 2ABAA 1A5CA 1UJQA 3RLVA 1F9CA 2H9AA 3OGRA 3V36A 1GQJA 3CQHA 3FAXA 3NNTA 3EMQA 4W8BA 2E68A 4BI5A 1B57A 1VIWA 4PC8A 1JAKA 3LI1A 4JTRA 3S47A 2DSKA 4GUHA 2P0IA 2JFEX 3A47A 3E49A 3VD3A 2ZUNA 4PL1A 4CCDA 4JTKA 4DUOA 3OIHA 2RDXA 2FDSA 1UH4A 2O9PA 2ZRWA 3CU2A 2X1SA 2DZAA 1MEHA 2VEMA 1ZLPA 2NX3A 1R0MA 3M44A 2OEMA 3DIPA 3SCOA 4WF7A 1FY6A 1J0ZA 2VC6A 7REQA 5BRBA 3N2TA 1FFQA 2VGIA 3N2CA 3NQEA 1ZFJA 1L2QA 3ZO9A 5BZAA 2CU0A 1LT7A 4IQEA 4JIIX 5MF5A 2BASA 2E4TA 2DZWA 4GVGA 3I3DA 4E2VA 4Q32A 1VJIA 1W2VA 1VCVA 2A5HA 5C2CA 4N4PA 6TAAA 4HZMA 4GXPA 1LQ2A 5EBAA 2WZEA 2Q8XA 5D04C 1VFSA 3QY7A 4M24A 1YBQB 1OFDA 1LP6A 2I56A 3OOQA 1XIIA 3ZSTA 1XF0A 1JPKA 1AQFA 4XSLA 2QKFA 5CC5A 2GSHA 3GUWA 1YE4A 2OOGA 5C5YA 3V75A 3UGRA 1SW7A 5DMYA 1H3GA 2OG9A 1QI5A 1DBTA 2Q09A 5A6LA 1XLMA 4WHBA 3ES8A 5A1AA 1Y0EA 1HKVA 4DI9A 1Q6DA 2PDXA 3T78A 1XFCA 2RDWA 3TTQA 3OGVA 3W07A 4U2YA 5JH1A 1M7XA 3CZJA 3RO6A 4CN6A 1EEPA 5BOOA 3HG2A 2VJXA 2Q6ZA 4RE3A 7ODCA 1AZ1A 2HS8A 3GFXA 5C7HA 1T8XA 3RDKA 3VTRA 3O15A 1MWOA 5FF4A 3SEPA 3MUCA 4KGLA 1CECA 2FPYA 4FR1A 1AJZA 1UKTA 1QBAA 4XO6A 5I24A 3E2VA 1EC7A 1TJRA 3W6LA 4IMFA 4PSRA 2YDSA 2PDWA 2PWHA 3LHWA 3GD6A 4H1ZA 2XN0A 1EJWC 3W7LA 2EKCA 1D7FA 4JHZA 1TWDA 2PGEA 1EUNA 3GO2A 4AZGA 4HK6A 3EPMA 3W1RA 3LN3A 2CPUA 2BGNE 4IWWA 3W26A 1KNWA 4A4AA 1UWTA 4P7NA 4R7WA 1OFQA 3LMZA 4ZQOA 3NEVA 1VZWA 4ACZA 1RSCA 5IHSA 3FW6A 3NYDA 4LAKA 2CHOA 4EPEC 3FYPA 4PMQA 1W9VA 5HJYA 3BGAA 1L6YA 3M64A 3NL3A 3HG4A 3K13A 1DJGA 2X1UA 3V5OA 1AL8A 5H91A 3QTGA 3K1GA 1OYAA 4YN5A 1T0OA 3LQGA 4F2BA 4PH6A 3WLLA 2GJLA 1I2RA 2HQAA 3AXKA 3CLMA 2XZ9A 4EKJA 2CZEA 3HQPA 4G5DA 4XISA 3FIGA 2DEPA 1F6KA 1WYIA 4OBSA 4PMUA 1ZL1A 2WV8A 2CYGA 3M7SA 3NSNA 2QIIA 3VD9A 1ZNNA 4IP4A 2J8FA 1I45A 2ZRXA 4V1XA 1KFBA 4M29A 2C71A 4MGGA 3FK4A 2G3NA 2CBIA 1E15A 4XBJA 2X2YA 2VZSA 4M19A 2IKIA 1RZMA 2C8NA 3KWXA 4JTHA 3S1UA 1KFEA 2BB0A 3W22A 3VOIA 4PMYA 1K1DA 1TWWA 4IZGA 3AHYA 3R8RA 3U6WA 4US5D 1BLIA 1QNOA 3WELA 3KOZA 1CIUA 3O6CA 3PFRA 3MP3A 3U57A 4F66A 4IQJA 4AY1A 4RPPA 1BWLA 3SUVA 2G4FA 3FEMA 4MTVA 3BC9A 4Q33A 4S3JA 4ORMA 5HQEA 3SFWA 4NG3A 2OGJA 1ICPA 1E70M 1CZ1A 1VS1A 1LJYA 1RBAA 3U7BA 4EIVA 1EDGA 5FD0A 2MUCA 4E5TA 4J1OA 2E9LA 3SCVA 3COTA 1EJSC 3L5LA 4Z2JA 1MDLA 3WENA 1WPCA 2YX0A 1NU5A 4IJBA 3VCCA 2FKPA 2MANA 1IR2A 3QFWA 1UD8A 1H11A 1IZKA 2HNHA 3WNNA 2HBXA 2ZYFA 5EU9A 3GDRA 3HQNA 1W6TA 5FJTA 4Q4SA 1EOMA 3T2OA 1Y8BA 1F3WA 1VB9A 3PN8A 3UQNA 3HMCA 2QDHA 6A3HA 1GWJA 4O1EA 3MY9A 1B0IA 2TRSA 4P8VA 2PDYA 1V93A 2DUAA 3QV9A 1FWTA 5LHEA 2PSNA 4HIBA 1V0MA 4FNPA 4GJIA 4C6QA 3VIHA 9XIAA 2V5CA 1H50A 3ITCA 1GOOA 3U48A 3F4DA 4W8LA 3VIJA 1ONEA 4PL2A 1JGIA 3PZIA 3KL0A 2J78A 4JFSA 3IJLA 4JYEA 1REQA 4Z2IA 4YYCA 1Z42A 3GHRA 4GCAA 4DX3A 3E6EA 4JNZA 5A8PA 1WZAA 3LOTA 2PU0A 5CC3A 3GBEA 2QMJA 2DSVA 3GNOA 4UC5A 4HHLA 7PTDA 4JZ5A 3AYRA 2GGGA 4YVXA 2PGWA 4WDUA 3AUJA 3VD4A 1VBGA 1RD6A 1J2WA 2F2KA 1EP3A 3C2YA 3ZQ9A 1XLGA 4JQAA 3EKGA 5CJNA 1KO0A 4HKPA 4IIEA 4N9DA 4F0MA 3ZR5A 4RX0A 4Z0SA 4DWSD 3N3TA 3H4GA 4M1BA 1XGEA 4AZCB 1DHKA 4QX4A 3CHCA 4RZ4A 4BCEA 4GBDA 3PNUA 1P4CA 1PTAA 1VKFA 1F07A 3VAVA 4R27A 3T2PA 1H62A 1HVQA 1SZEA 5T26A 3NXLA 4FX8A 2BSLA 3GHTA 4MYAA 3H70A 3KLLA 4H7VA 1EF3A 3JS3A 3WD1A 4ACYA 2WQPA 4S3KA 3WF4A 1OCQA 2EQDA 4HA3A 4J3WA 2HXTA 1NF0A 5CXPA 1B1YA 4WCJA 5C9UA 2R91A 4LVGA 3ARRA 3KVKA 5FOOA 5D2VA 5I3GA 1GNXA 3GNXA 1UD3A 4O52A 4AZ7A 3C52A 3G22A 3II1A 3NQ6A 2Y7GA 1GQLA 2O9OA 4D8ZA 4GIRA 2UY4A 1OHLA 4PUWA 1KFWA 3NSXA 3VKCA 3W7HA 3W7IA 1KB3A 1HGWA 2JF6A 3SCRA 4ERIA 4IH3A 4MDPA 3K5XA 4NYYA 2OZ3A 2X0YA 1UWSA 3MMWA 1GJUA 3UU0A 1IEWA 4B9ZA 4Y9MA 5HOSA 3HFYA 4PODA 5CPTA 3NOYA 4MSSA 1OZQA 3IEBA 1J96A 2C18A 6XIMA 4NVTA 4YTRA 5AHIA 3WZ0E 5ABEA 3LTSA 1PHQA 1MQQA 1GYMA 3UETA 3R89A 3ZLFA 4K8EA 3MI2A 3AXHA 3UW6A 3BCJA 4OV4A 4Y9AA 4UZSA 1JUBA 1YIXA 4NT0A 3ALFA 1FUYA 1SYTA 2VUYA 4F9DA 2ZWYA 1RJPA 4QSFA 1FRBA 3LTPA 2DVXA 3IPWA 1NDVA 1XYAA 4P7QA 4M51A 4E0CA 3BAXA 1QVBA 4JY9A 2A85A 3TDFA 1R2RA 2Y62A 1UR8A 4HU4A 3C2RA 3NEHA 4CQ8A 1AW1A 4HNNA 4CCEA 3NQBA 4OZOA 2QCDB 2KX9A 2OQYA 4HVXA 3KBWA 4BWLC 5D9PA 3AU2A 3T42A 4EX4A 3TSBA 4ZA0A 3BO9A 2ZUUA 3MHFA 2WAGA 3WQVA 5KITA 4N9BA 4O12A 4HHMA 3VFCA 3W9ZA 1FBAA 1NDWA 5KTLA 1DIEA 3I7SA 4D6GA 2HV5A 5CSUA 1Q13A 1KR1A 1XRTA 3TAKA 1R7OA 3HJZA 5E0CA 4J9JA 1ZAIA 2CC0A 3NM3A 3O6AA 5LGXA 1FWWA 2NT1A 3IVTA 4WK9A 4C6PA 5I02A 2BVYA 2DJXA 3BZGA 3N14A 2HNEA 3PG8A 4GYFA 4GOAA 1VR6A 4WGHA 1OGGA 4HNCA 4L4PA 5DN1A 4CNNA 1V02A 1E9IA 2XFRA 1OY0A 4NRSA 2D0HA 3TXVA 3SY1A 4D6FA 4QDPA 1JGMA 3BUVA 4RZ6A 5BXSA 1DJHA 5F1VA 3RM9A 1X6LA 1VC4A 4LV9A 3VUPA 2E7FA 3TR2A 3M5YA 4YVPA 2OSYA 1IF2A 3OQEA 2DUXA 1MUWA 4CD5A 1AH0A 4DNMA 2PDJA 4TX8A 2REQA 2MNRA 1XYMA 1TMLA 5BRPA 4C1LA 1OFAA 1XC6A 2WPBA 1FH7A 3T4CA 4I9MA 2GZXA 3ATYA 4CNPA 4W89A 3MCMA 3SFKA 4LUYA 4HPHA 3UXLA 1IXNA 3L5MA 2J88A 3JUGA 3BLFA 1A0DA 5I3FA 3MMUA 3L67A 4FNUA 3V18A 1H1YA 1ADDA 3VUSA 3IVUA 2E77A 1EXBA 1RPKA 4W85A 2JF7A 1CB7B 1EWEA 2WSRA 1LL7A 1EC9A 4Q4QA 3XISA 1K03A 4JEJA 5I03A 3RJYA 4I7WA 4X2RA 3PUDA 3DC8A 3TA6A 2OO0A 3GWQA 3CUIA 4FX6M 1OINA 3N15A 4I9JA 4GI4A 2QAPA 2VELA 3EDJA 4PRWA 3FA3A 3QYQA 1MQRA 1BYDA 3UNDA 2IXUA 2OELA 1HGYA 3SY8A 4GIAA 4Q7IA 3S5YA 1QNQA 4DBUA 4C90A 3QM3A 4DYKA 5TBOA 3KHDA 4GHRA 1NY1A 1XLAA 1BAGA 2DIEA 2X1RA 4JIRA 4P5UA 5DX7A 1NVMA 1EB3A 2CZVA 2NQZA 3W1AA 2CLOA 3PSVA 1LWIA 4GBUA 5LKYA 4LVBA 5G1MA 1EP1A 2XH7A 2Q71A 2X8RA 3AIRA 4J3TA 2J74A 3SDOA 2DGAA 2W9MA 1V3JA 3UWZA 1GPWA 3OP2A 4ZOAA 2FYMA 3TYDA 1FXPA 4RK8A 3BARA 2PDLA 3MSDA 4HYVA 1ONXA 2RFGA 3DBNA 3WJWA 3CT7A 4KESA 4BKNA 1TVLA 4YTUA 3KTXA 4FNTA 1KGWA 5CAKA 4KF1A 4NIRA 2OTDA 3VNYA 2TODA 3YPIA 3BLOA 2EXOA 3GTHA 4DXXA 5TAOA 3P5YA 3HFTA 4Q6JA 3BXWA 3N6HA 3TP4A 2V8ZA 1TPC1 1UW9A 5CZKA 1UD6A 4GABA 4D6DA 4JKKA 5C2XA 4OE7A 2ZX8A 3ENLA 4QSHA 1EYEA 3MB9A 4PMVA 2QDGA 3BGGA 4PBGA 2KAUC 3H2EA 1XH1A 3MDUA 4RCXA 3UZXA 4KFPA 1JPDX 3PZ9A 4KRUA 2H3BA 4X0NA 1MNSA 1UB3A 4H6KA 2ANUA 4Z2KA 2XU2A 3S1GA 1XUZA 1SZFA 3SQSA 1HQTA 4XBSA 1HW6A 1OZMA 4E4PA 1VRXA 4A3RA 4FLQA 4NI3A 2C14A 3R8HA 1GVOA 3AXIA 1N2VA 2OJPA 1EX5A 1NH6A 3APTA 1OF8A 4R3UA 5G4WA 2ZVRA 3W28A 1R8LA 2PEVA 1QHPA 3GC2A 4H19A 5LNWA 3G0XA 1LZOA 1BXBA 2ON3A 3K46A 2J8TA 4DM2A 2NZLA 3H6OA 2WMIB 2XVPA 3BZJA 3LHZA 2ZA1A 5T9CE 4MF4A 1M65A 4DO7A 2J79A 3AIWA 4Q6XA 3S2JA 3TCSA 4RR4A 4FPSA 1NQKA 3CUJA 1HFBA 5FJRA 2QW5A 3GFYA 1GVQA 5HNRA 1BRLA 3ECQA 5C0QA 1X7IA 4ES4A 3E1F1 4X9YA 3W83A 3UZYA 4Q8UA 3KOWA 1MMFA 4MJ2A 4XTIA 1J9YA 2ZUWA 3NIYA 3G6MA 5FCZA 4IMEA 4X3ZA 1UJPA 1DJQA 3N29A 5D30A 2HZGA 2ZX9A 1R38A 3I3EA 1XRVA 4IGMA 4NZ3A 5AY7A 4OUIA 1W1IE 3MI3A 3TONA 2GOUA 1E51A 3G1YA 1E0WA 1JXJA 5M3WA 1GOWA 3AZRA 1ZRQA 3SM0A 1IT7A 1ZB5A 3IARA 4FP1A 3G18A 3F2BA 2GDUA 1JNEA 3BAJA 1ITXA 1S38A 3UR2A 4CQDA 4OJYA 4NL1A 1TRIA 1HF6A 3UJFA 1T5AA 2VQTA 2WK2A 3DHFA 3B9EA 2UY2A 4QS6A 4MJZA 1TZ7A 5HJXA 3QC0A 3LPGA 3ZJ7A 4GH3A 1D2KA 3LZ3A 1OABA 1AQ0A 2D73A 3P6LA 3UCQA 2ASHA 2D3NA 2E67A 3VNIA 5A2AA 3W1MA 4NAEA 2VX4A 1GOQA 4NXSA 3F4VA 4W84A 2VFGA 4GX8A 1REQB 1XYBA 4EPDC 4AWUA 4W4QA 4MWAD 3E96A 1XLIA 5F1UA 3UXAA 2VENA 2EPHA 3M6DA 4UNIA 5HBFA 2WVTA 2RH9A 1KCKA 1EHNA 2V38A 1TMQA 4AEFA 3HURA 4XZIA 4AXKA 5KSWA 3UZ5A 5AKQA 2OT0A 1FWDC 1Q85A 3VD5A 4J3XA 3GSMA 3KTCA 3RAOA 3V5FA 4F0HA 1J6OA 3CHFA 5FEWA 1US3A 6REQB 3E0WA 2QCEA 1A5MC 4V15A 4PMDA 2F38A 4A2RA 4ICMA 4JL1A 2AMXA 1QRQA 4LJ3A 4GACA 4GO8A 3BMVA 4OT7A 1EDQA 5A6SA 1A80A 2QF7A 3M0ZA 4QCFA 2FGLA 2VZTA 1J0IA 1DE6A 2GQ8A 2QQ6A 4HU3A 4I8DA 3WJSA 3MHUA 1DXFA 3MUY1 1MW2A 2AQWA 1P43A 1JPIA 3L0GA 5AFDA 1H60A 1OF6A 2UWFA 3OW1A 4Q7NA 1AMKA 2BBFA 5DF0A 2HVMA 2XINA 4O0KA 1D7KA 1TPVA 3U2ZA 3MUAA 2FZNA 4FOJA 2XVNA 2V81A 2WVVA 4XKYA 1DJZA 2DSUA 2QULA 4OOUA 3FGCB 1S2WA 2I5QA 1PV8A 1FH8A 4AH7A 2P1FA 5HNNA 1CXLA 3GR4A 4ZOCA 5A2BA 5CPNA 4D9PA 3AS2A 3VCNA 3H7UA 1EJXC 4F79A 4PBEA 1F8IA 2PTDA 3T8LA 3F1QA 4PEKA 1FKXA 4PUNA 4ZQRA 2QT3A 3G6LA 1KLYA 3NQDA 5DCEA 3VVGA 4U10A 4WOQA 3EEZA 3V5CA 1M68A 1FWAC 1XG4A 3KVLA 5LIUX 1G01A 1M04A 4Z1AA 2GOKA 1CGTA 3TFCA 3O7UA 2FHFA 1K7XA 3LS9A 4BZYA 1XDJA 2NUWA 4C1KA 2XIBA 4XX6A 4K1GA 3H4WA 4TIMA 4GA8A 4I3GA 2W67A 4AWTA 3ARPA 4DB7A 3S9IA 4LC8A 1UR2A 2WHKA 1OIMA 1O94A 4JNYA 2WXDM 4BEUA 4UFKA 1ZPTA 3BDKA 4DEFA 5G5IA 4UQCA 3ANYA 4J3SA 4LCSA 1B54A 2PDPA 4DNHA 2ZE0A 2PF0A 1O5QA 4MY1A 1YW1A 4AZIA 3TUUA 4S2BA 1ML1A 1WUEA 2YLLA 3DI0A 2ZUTA 1GEHA 2XSBA 1X6NA 1XIJA 4JHOA 1V3MA 1W9BM 3H26A 4E38A 5T91A 1GJPA 2ZUMA 4MKVA 1C90A 4PTVA 2VDGA 2W27A 5LHFA 3B8TA 2EG6A 2XJ7A 2Y0FA 2QVNA 2OZ8A 3WF1A 2ALDA 3TYAA 1VJZA 3DX5A 4PCNA 3ZXWA 1U5HA 1VD6A 1BYCA 1FDYA 2HROA 1TUXA 3CB3A 3SUWA 1TV7A 1TJ0A 2BVDA 2J7EA 5M2FX 1SQ7A 1MUMA 2OX1A 4CD4A 2X30A 2NQHA 3PJWA 1YMYA 3P67A 4I5RA 3TLQA 4BEQA 4K8HA 3ZM8A 3VABA 3H7VA 3W7EA 3C56A 1DHPA 3ARUA 2FJKA 2OU4A 1QPNA 4MLRA 1RQEA 3A9IA 3KCLA 1BYAA 4Q8MA 4DELA 5FKYA 1XLKA 4LAUA 4Y96A 4E8GA 3KBSA 2V3FA 1V8EA 3T2QA 4NHVA 2YXXA 3G1RA 4M81A 2Z7GA 1LLZA 4YTQA 5HANA 1NFBA 5BMWA 4AZCA 3QXBA 3HG3A 1RK5A 5JBEA 1TCDA 2CZDA 5LA2A 2EPOA 3CUHA 1F74A 3AU6A 3SGZA 3M0VA 2BS9A 1W1ZA 3WBXA 5D32A 4Z0JA 2VXNA 2VR4A 1YTKA 2VYOA 3UNTA 2G97A 3EDEA 2JIWA 1PCWA 4AUBA 2J6XA 3O2LA 4RLIA 2J7BA 3MMDA 1VHNA 3VOJA 3C0JA 3LSBA 2ZXDA 1V3KA 3ARYA 3FN9A 4K3ZA 3UWEA 4DJEA 4MKSA 3UT0A 3W23A 4H6RA 2A3HA 1Y5VA 2E6DA 4ZTYA 1IGSA 5H1WA 3PJUA 3HA1A 3PULA 3HJEA 1UIPA 1UCWA 3WNOA 1LORA 3NZ1A 3TYBA 5D2XA 1Q6GA 4DJED 1H7PA 3ABQA 2Y8VA 4IPLA 1T7LA 4WQ6A 5K3VA 2VHLA 1UWUA 2KZHA 3TE9A 4L6OA 4WOZA 1JZ4A 2GVGA 3IJ8A 3CT2A 3ZYZA 2V63A 9CGTA 3NO5A 2Y1HA 5REQB 1ZS2A 2X09A 4GKTA 4JPGA 4F0LA 2WLZA 3SO7A 1B3OA 5AC5A 4AD3A 3UPMA 2JGQA 3CIVA 2QDDA 3WMBA 4IPNB 1YLVA 1J0HA 2JE8A 3IIVA 1PUDA 3G1XA 1TA3A 2ZDSA 4DZIA 2QCCA 3MU7A 1LWJA 3QEZA 5BNKA 4MAZA 4GD0A 3TN5A 3TJIA 4H6QA 4KEUA 1ZBCA 3TTSA 2C79A 4EWJA 4KS0A 3CZKA 4NAFA 1X96A 2Z1KA 1ISYA 5G2IA 3HBLA 3V4BA 4L1WA 2NSXA 5LNVA 1CLKA 4JS3A 2WJFA 3CYVA 3LPFA 2GL5A 3KP0A 4YXGA 1HP5A 3CMFA 2CXGA 2OZTA 3CGTA 3KTSA 4C65A 4DF2A 2ZUVA 1VCFA 1XLLA 4ECLA 3UWYA 1R3RA 4RNIA 2I5IA 4NX5A 1E72M 2ZRVA 1XI3A 1ODZA 4JCLA 1AVAA 1Q6OA 1C7SA 4M7SA 1F3XA 3TC3A 3S1XA 1X8FA 3CM4A 4KRTA 4R5EA 4WXYA 4NYUA 1BQCA 2JBMA 2I5GA 1RCOB 3SGUA 3L2LA 2A79A 2XIMA 3MWCA 3IRSA 4US6A 4B2DD 5A6BA 1N8WA 1K7EA 1E6SM 1DP0A 3EGJA 4ZSTA 4GKLA 4ZL1A 4IL0A 3VC5A 1LUCB 1NF7A 4YL2A 1UPPA 1UOKA 3N4AA 4XV0A 1KFKA 3B0YA 1OG6A 1Q65A 2GJRA 3L7RA 1HKWA 1GYNA 2OWXA 3QPYA 1LBMA 3PBWA 5FF7A 1FXQA 1HZYA 4NNAA 3STFA 2XGZA 3NFUA 3K4WA 3BW4A 4HPJA 4RDZA 2PODA 1PCKA 4TXEA 4XZHA 1RQHA 2VO5A 1XP3A 1J2BA 5G2HA 1U1UA 4OBTA 2DT0A 2J27A 3NR0A 5RUBA 1RP8A 2AKMA 3UD6A 3E02A 1B5TA 4O1BA 3OVRA 4IHCA 3B8DA 1PTDA 4OFCA 4UFHA 4K7YA 1R5YA 2DH2A 4HZ7A 1DWFM 2J62A 1TYGA 3MT1A 4RKAA 3U9IA 3QN3A 3NO1A 3RMJA 5C55A 4U5IA 1KM2A 3MQTA 1NWUA 2VOTA 1K7FA 1UC5A 3B8UA 1U1JA 2P8CA 3SRHA 5HMDA 1B3WA 1DXEA 3IGXA 2WCGA 4YTSA 3BLKA 4PTDA 3QR1A 1OM0A 3B9NA 4JFTA 4NJJA 1UZHA 1WA3A 4C6OA 4B4FA 2WSQA 2EF9A 1C9WA 2PRMA 1W5MA 1WO2A 4PMOA 1XS2A 4TX6A 1RA0A 3U0HA 1WXYA 3KBNA 4JXCA 5BOEA 2HRWA 3S8HA 2J25A 3CWNA 1FWIC 5FSDC 3WFAA 4MG4A 3AMKA 4HA4A 4C6NA 5FEPA 2C91A 3AS3A 3N1AA 1MEWA 2JKEA 3U2OA 4J40A 1E6NA 2BHYA 5C8BB 1Q4WA 3ARWA 3R4IA 3ABZA 3FA5A 1EO7A 3VKAA 1VHCA 4IIFA 4PE8A 3QMRA 1NTHA 5AZ0A 3TQVA 3FDKA 3CH0A 3B97A 2ATMA 2W63A 3EX4A 1U1HA 3UY8A 1FKWA 4XZBA 5LA1A 1NSJA 4MADA 3GY1A 1ZALA 5KZMA 1RAKA 3T9PA 4A8RA 4DVOA 2AL2B 1H49A 3M9YA 4ICCX 5D8WA 1SSDA 5JUVA 2WC7A 3UZWA 1UPMB 3DENA 4HYRA 1Z9AA 2Y88A 1YPXA 3N2BA 2NVAA 1F6YA 3CZEA 5EL1A 1DIOA 1FVPA 1S46A 2D69A 1J4EA 4LS1A 1HXJA 3CZLA 5U4NA 5F4SA 2O4MA 4GUJA 4O50A 3T6CA 3UERA 4AB4A 3WFLA 4L9ZA 2QJMA 2X05A 3VYLA 3WLJA 4ADTA 5ABGA 3FS2A 2Z24A 4Q4RA 3VNJA 2R1KA 5DCBA 2WC4A 1VF8A 3DYOA 5JU6A 1KKOA 1XIFA 4YU1A 1JZ2A 1WBHA 3POCA 1BGGA 1S5TA 3A12A 3V16A 4KFNA 3WEZA 2ZKMX 4LVDA 3GNPA 3EPNA 4O0QA 5LNUA 4PTNA 1SW3A 2O55A 3WQCA 2Z26A 4JTSA 4LV4A 2WJEA 1CLVA 4LCQA 4ATDA 1V03A 2B7QA 1V6WA 2GGHA 3S0CA 5IBXC 1E71M 3BW3A 2GJNA 3WLSA 1TUFA 4HNUA 3MBDA 1XDMA 4GYJA 3DFHA 1P0NA 1ICQA 4HSHA 4ZVJA 3TEVA 1XX1A 2GDQA 4ILSA 1H63A 3WMCA 3WBAA 3BWWA 4Z08A 2DW6A 1E1CB 1B9ZA 1NWSA 4AYGA 1PYFA 1A0CA 3RO8A 3WLHA 1QPQA 1QT1A 1RVGA 5CGQA 4DXVA 3SCPA 6REQA 1LM1A 3QQ0A 1RR2A 2VVNA 3S2MA 4WDWA 5IFTA 1I0BA 2I57A 1F5ZA 4R85A 2BG5A 2I14A 4AVFA 4OUEA 4NILA 3P81A 4H8HA 1BSLA 4EACA 1EA9C 1W8SA 1AW2A 3KP1A 4PCSA 3VKJA 1PWLA 4PBFA 2Q3OA 3ZIZA 3UBPC 4RPQA 1EH9A 3NQCA 3LHTA 4IQDA 3STEA 3R2GA 2ISSA 5B7ZA 1G6CA 4H9MA 1W9UA 4IMAA 2YJQA 3W82A 1YDNA 4EXQA 3B0XA 1CX9A 3B8VA 3CUFA 1OX4B 1MVYA 1FOBA 4M6PA 1DIKA 1GYLA 4TVCA 1O5RA 1JZ5A 4FIRA 4NZ5A 3R94A 5REQA 1P48A 2P3ZA 3R11A 4DO5A 4P61A 3NQFA 4UFLA 3VMPA 3B8IA 2XH0A 2VCCA 3FKKA 1FHDA 2AMGA 3M47A 4D8LA 2PGRA 3EKLA 1TG7A 3IRDA 4IGSA 3W1XA 3IGUA 4LYQA 5BXRA 4C6LA 5GNXA 2NT0A 2GK1A 2H90A 3NCOA 2PURA 5A6MA 1D9EA 4LRSA 4JIHA 3S2LA 2VCBA 4GH1A 3VI2A 3DU0A 2G0WA 2G37A 1D8CA 1M3UA 4HA1A 1XLHA 4ZFMA 1T6MA 1H09A 1J10A 1JQXA 1NWRA 3W3OA 3VX1A 4DRSA 3L0NA 3AUOA 4AZBA 2OOFA 3W6YA 4BJHA 5DELA 1A53A 5I3JA 4TVDA 1AFSA 4ZEPA 3V0SA 3QJAA 3GXDA 3OPSA 4GZIA 2Z7KA 3NQ2A 2HVOA 1ZP3A 3W7QA 3MCNA 2CBJA 4PMZA 3WQ5A 5CBIA 1SVDA 5BW6A 3STGA 5FACA 2VD8A 4G1NA 5CGTA 1UWRA 2IPJA 1SR9A 3SN4A 4C60A 2ZX6A 3TJLA 3ABXA 1EYWA 4WJ8A 4V33A 1GW9A 1UQYA 1W17A 3L12A 4XZ9A 4L65A 3ITVA 5ENLA 3GFZA 4DQWA 4L5ZA 3PPGA 3CH9A 1XSJA 1Z44A 3ZR4A 2B7NA 1SZGA 1W56A 2DPEA 4PRTA 4PMXA 1A47A 4IXXA 1OFBA 3NDYA 2BY0A 3VZYA 4AWSA 3KRZA 1PZ2A 3PWGA 2XYLA 3TOYA 3DH7A 2DZXA 4S3AA 4LVAA 4RNFA 1NOUA 2G3FA 1CGWA 1KM5A 3W38A 3QSTA 4XSMA 4PRRA 3NURA 1A5BA 4KCWA 5KZDA 4MNJA 2WMHA 4AY8A 4DPQA 1W3KA 3HPSA 3L4YA 3EWCA 5I09A 5BOFA 1XD1A 1IZJA 1C8VA 4WKFA 2XGIA 1SMDA 1VGAA 1YTEA 4U2ZA 5L6UA 3H54A 2G3JA 3P0WA 2PC8A 4Q4OA 4UZUA 1KM1A 4LAOA 1OWQA 1UZ1A 3OHIA 2Z2AA 1YRRA 2ZUSA 2PF8A 1GORA 2QZRA 2C0HA 2GQ9A 2BHZA 2AAAA 4MJMA 4CNOA 2V6AA 3LXCA 4GNVA 3TWBA 1GEQA 1EQPA 4GFIA 2PRLA 3P5ZA 3DFOA 2RAGA 2CIPA 2F8QA 3RYSA 3E9AA 2BMBA 3NQ8A 4IOTA 1AW5A 5JBDA 3I6EA 2ZA3A 5LIWX 4XAPA 3WG6A 3WUFA 2VGBA 3LCGA 3PUOA 3M5XA 4QLLA 1HJVA 4KWUA 3BOLA 4DBWA 5J04A 4J2PA 3IV3A 1UP2A 2J7DA 5DBUA 4BQ2A 1XBYA 2INFA 5DY3A 2QF8A 1JPHA 3HMJG 3WIJA 1UWIA 3VE7A 1EWDA 4W5UA 1EHAA 3ZT5A 5HINA 2EG7A 9XIMA 1NOFA 2WWDA 1XPYA 3FCPA 3R10A 3W84A 1KV5A 3WQOA 2V0TA 2E1DA 3VE9A 5TNVA 1Y65A 3E0FA 2XH2A 3STPA 5DANA 1RHCA 3KBJA 1IXPA 3THAA 2ZFAA 2Q02A 2AQOA 2VL4A 4DBSA 4TTGA 2GVJA 2YA1A 2WNNA 4LF2A 3O05A 3OVGA 1B30A 3LLXA 1C8YA 3CZ8A 1QBBA 2TAAA 3CV1A 3OBKA 4HOWA 5A8NA 5FJOA 2ZZ7A 3VX0A 2F6UA 3ORWA 1XC4A 2WMIA 1UP0A 3UZJA 1VRDA 2G3MA 1XDLA 3GDLA 1EJTC 1XCXA 4I6VA 5D9MA 1XKYA 1FWRA 1OFOA 3T4WA 3R13A 4PN2A 3KRUA 4YS1A 4LX4A 3WNKA 4GYPC 2GVLA 4A3HA 1F8MA 4ZO6A 4HNVA 1SM9A 3SQMA 2NW0A 3W2JA 1DJYA 4KEMA 3WF0A 1EP2A 3CWOX 3EOUA 1BVZA 2CZFA 2NX1A 2VC9A 5TQLA 1GG0A 2VMFA 4I5UA 3KOXA 5EMJA 3UA3A 2PWUA 3BV4A 2BY2A 3EB2A 6XIAA 3L0KA 3NG3A 3AHTA 4JAWA 1RH9A 1ME7A 1ZENA 2DV0A 4M5PA 1AODA 5AHEA 4AXNA 3C3NA 8XIMA 1XLEA 1S2VA 3VKDA 4KPLA 1XRSA 2JEPA 2ZWZA 3GZ3A 2I9EA 5AZ1A 1M7JA 1POKA 4HPNA 2NQ9A 1G94A 3C0QA 3GXFA 5FEXA 2IMRA 4GNJA 4S1FA 2DVTA 1TWSA 4DJEC 3QKEA 4IT1A 1BFNA 2YLAA 4CCCA 2HCVA 1G4SA 3R7MA 3T0CA 3A4JA 3KL3A 2WHJA 3RFAA 1IZCA 2GJXB 3WK2A 4QE1A 1PBGA 3B4UA 1UQZA 5FL0A 3MSYA 1POJA 2PUZA 4EWND 3Q45A 3MVTA 2ISVA 1B3VA 3UXKA 4B9YA 1IQ8A 1FWJC 3RNDA 5HWNA 3T05A 3W2MA 5D9NA 3GG8A 5LGZA 1WDWA 1JIBA 1KKRA 5I77A 5AYYA 5U7SA 2PI6A 3BTNA 5DCDA 1UIOA 4R7OA 5CC7A 5TIMA 3RJXA 4N6EA 2OT1A 4JTUA 3SN0A 1KTCA 3POHA 1RA5A 2WZTA 3RR1A 4GVIA 4LNYA 3O3RA 4F0RA 5LA0A 4Y8EA 3WMSA 1MRQA 2BGSA 3PTKA 4IM4A 3SUTA 1V6YA 1CI1A 3LBOA 1U33A 3EMZA 1GT8A 3T55A 3TH6A 1F61A 1T8QA 4WRHA 3FVMA 1W9PA 3FXGA 1RP9A 1TPB1 2B0MA 4GQQA 3M0HA 1O5KA 1E1FA 2QCLA 3PTQA 1GZGA 3QPZA 3EA3A 5G4HC 2WQDA 1PKLA 4OBRA 1X1OA 3FHAA 3QOKA 1ZJAA 1HL2A 1VIZA 3PG9A 4U33A 2PDMA 3GNRA 4JX4A 2Q8LA 3TMLA 4MZYA 4XUGA 1U5JA 1ITCA 2NV9A 4K36A 1DWAM 1IEXA 1NQ6A 4BF9A 3IIXA 4CQBA 4HHHA 4CEXC 2C6QA 1V7AA 3WLIA 3BLIA 2A7RA 5CGMA 2REQB 2X1TA 1ZBKA 4ENLA 5FA5A 3NQAA 2DFAA 1E5NA 2RJGA 3AICA 1WQ5A 4O1AA 1PIIA 3IK2A 3TYEA 1I2NA 3SRDA 8XIAA 2XSXA 1ZZMA 4EOUA 4W9TA 2PD5A 2YL5A 2O7QA 1V0KA 3F4WA 4KEVA 4N0RA 2R1NA 2YBVA 1Q4NX 2WSPA 4JR5A 1YEYA 2FGBA 1ONRA 2EEXA 3L4XA 4GG9A 1LQAA 4YYFA 1P7TA 1KXTA 1A5LC 5A95A 4FXFA 3RMEA 4B15A 5AN7A 3GKFA 5C54A 1MNZA 1W37A 3WL1A 5A69A 3M4HA 3ZLHA 3KRSA 1RJRA 1Q2SA 4H9ZA 1X39A 2XFFA 1DJXA 5CH9A 4I8YA 4NAFB 5LNRA 3GRIA 3SIZA 2XWDA 3SGGA 3U8GA 4B4HA 5IM51 3JZUA 3WY1A 2EHHA 1L9WA 3M43A 1CW2A 4F0KA 4QTGA 2BODX 3T40A 1LYXA 3PR2A 2Y24A 4P8WA 4DN1A 3TNOA 2YYUA 5GNZA 1YQ2A 3TW7A 1K8YA 3CMGA 3DHUA 1TRDA 3L9CA 1SUXA 4GY7A 3GC4A 3TKFA 2R1MA 1A3HA 2Y2WA 3PZNA 1I2PA 2W79A 1TPWA 4QFUA 3TX9A 4GY1A 2FB3A 1MO0A 1F4AA 2X41A 4H3DA 3SW6A 3FY1A 4DZHA 3G5EA 3FAWA 3OLDA 4DYJA 5EMMA 4HOXA 3ZJ8A 1HP4A 4H9TA 3UA4A 1F3EA 3PZVA 3DDMA 4BF7A 3AMDA 4QJ3B 2Q01A 2D20A 1XW8A 4L4OA 1TMHA 3ONCA 2GDVA 2BGQA 3B9AA 2JEQA 4ZQCA 1YADA 1L0PA 5H8PA 2CHRA 1XG3A 1QJWA 1HKMA 4N9EA 3I65A 3GG1A 2PFHA 4E6MA 1G1YA 3GG0A 2D24A 3LMYA 3W1TA 3DG7A 2CLKA 1OVDA 4FF7A 4DZAA 3LUTA 3CO8A 3SCUA 2YCEA 2XWEA 5C9ZA 2OSWA 2E8ZA 4IGHA 1BQGA 3L23A 1CXEA 4GRSA 4TX9A 1K70A 3FX4A 1E40A 1AD4A 4N9CA 5CZ0A 1QW9A 3B06A 2A6LA 3DFQA 1DTNA 4H4IA 2WKGA 3O6DA 2J13A 4PR4A 1YDOA 4OV9A 1PTGA 1V5XA 3UYIA 4H9XA 1PJ9A 2Y70A 1CXHA 3W88A 3F2CA 2OPJA 2XVKA 3OJGA 1PB0A 3O0FA 4KWOA 1CGXA 3TIMA 3RXZA 3XIMA 3PP7A 3FV9A 4LPCA 4KRZA 2R24A 3FSUA 1TQXA 3UWUA 4DYEA 2ZDRA 3UP8A 4JIPA 3W1PA 4AISA 2J66A 3AO0A 3NDOA 3VIIA 3MHGA 3OZPA 4JY8A 1KCXA 4XKMA 4B90A 3AHZA 4G9PA 1G4EA 4J7RA 2AQVA 4UR7A 2ZXAA 3CL8A 3A21A 4HOZA 1JCMP 3CHVA 1YTDA 1X7FA 3EOLA 5G4EA 3VA8A 3EOSA 1GZJA 4HMEA 3H55A 1ECEA 2VTFA 1RUSA 3R79A 4A29A 5A8OA 2C0AA 3F5JA 3RX3A 3WLOA 4QQUA 4IUOA 4MWAC 2WC3A 5IXEA 3T0BA 1UUMA 3MV01 4CU8A 3NL2A 2VRQA 3QQ1A 4W88A 3W7NA 3B9OA 5AECA 2PWGA 1KBJA 2PDBA 1I75A 3LM3A 3N13A 4R34A 4QIUA 1DJNA 3DOPA 3DECA 4JBRA 5F2MA 1MFUA 4FK9A 1VEOA 1E3XA 5A5WA 4NKCA 5DXXA 2GQAA 6ENLA 2WBGA 2BNJA 1T99A 2W66A 1PDYA 2YL9A 1YYAA 3MSRA 5EA9A 4G1KA 4C6MA 4C1NA 3C8NA 3PS7A 4OGZA 2WCAA 2EGZA 2YB1A 5CBJA 4S23A 5GJNA 3RR4A 4JCMA 1XIHA 3CHDA 3M0LA 3SECA 1W3HA 4Z42C 3CHEA 2GVYA 4D6HA 1K4HA 2PGFA 1GTEA 3DG3A 3RILA 1P0KA 3WH7A 1ZJBA 4KGJA 3PB0A 3O16A 3LCHA 5AB3A 4IG2B 2BVWA 2Z6JA 2QPSA 3BG5A 5I3HA 1BF6A 2C3ZA 1XLFA 3ABSA 5CPLA 3WLTA 3LX9A 1SW0A 2VKZG 4PA8A 3GH4A 3OA5A 1YNPA 3P61A 4S3FA 4AHPA 4S3EA 2PLJA 2Y7EA 1KM6A 3CQIA 4J28A 1L6SA 1HN1A 4AZ5A 5I3IA 4QLJA 3AMGA 3AZTA 1GHSA 4CKQA 1S5NA 1X1NA 3HOJA 2V68A 3SAZA 4YWSA 3DFYA 4GI9A 4XK2A 1Z48A 3QLDA 1LT8A 3VGFA 5CSRA 5C6MA 1HJXA 2AAMA 3W25A 1PL9A 3RU6A 2NXIA 2DVUA 1ISWA 1TVPA 2ZVIA 4ICNA 2NLYA 4EF9A 4P8UA 3RPTA 3EWUA 1YNQA 3VINA 4A22A 2CLLA 4RE0A 2CLHA 3WKZA 3BW2A 4ZE5A 1CDGA 5BXTA 5CZSA 2ZZ3A 3A6OA 4POCA 5EFFA 1Q6LA 3GB6A 5CCZA 1O60A 3MWAA 4DJFA 1XLCA 1Y7VA 4JHMA 5AHMA 3ZVIA 1IYXA 1I0DA 4ROQA 3C0SA 4QJ5B 3Q37A 4K8GA 4LBRA 2DZVA 5HR7A 3HG5A 4HCLA 1B3ZA 3N11A 4LUSA 3VGBA 5AYXA 3RX2A 1OYBA 1UR4A 4CU6A 4PFHA 3E12A 4O19A 3LPOA 2NVDA 1UR0A 1N8IA 2NXGA 1OJXA 4ZQPA 3GXIA 3H12A 2VP8A 3GXPA 4CD8A 3ISIX 4BK9A 1HL9A 2VFFA 3H2NA 5I7GA 1QO2A 2ZC1A 4MJ4A 1KFJA 1UR9A 1JYWA 4ZOEA 3U5UA 3IAPA 1IXOA 3VM7A 1LOSA 2E6YA 1AH4A 1UWQA 2FZ8A 5FL1A 3EB3A 3TN4A 1BVWA 1UP3A 1W1YA 2GWNA 2O56A 2G95A 4ERGA 3PZTA 1X97A 2CWNA 3N04A 2DZPA 4YCPA 3WLRA 4PUKA 4FSAA 3REQB 1JCXA 2VUNA 3ICJA 1EDTA 4X22A 3BPWA 1E4MM 3W00A 4GZJA 4AX6A 4TOQA 2IKGA 1TR1A 2B31A 2JIEA 1XIDA 2C19A 4CGTA 2ZOXA 1Q7ZA 2DDXA 2L5HA 3ARXA 1MI3A 5D4YA 1KGXA 1GGOA 3WN6A 4KIRA 4QE5A 3Q94A 2Y5EA 2PMQA 4E2OA 4R9XA 3B0PA 3EWBX 1QOQA 3VIPA 4WIWA 2Z0IA 3OLGA 3T0AA 4LSBA 5EMYA 1SFLA 4NZ4A 1ZY9A 5DMNA 4MLJA 4Y9NA 2QR6A 3GH7A 5D2WA 5CG7A 1K02A 3LEPA 3IV8A 4MY8A 5I2UA 3UR5A 1VFUA 3WDHA 5EFDA 4LYPA 4L9XA 4AG0A 2XPKA 1E9LA 4XZMX 2VEIA 4Y90A 2ISDA 5EYWA 4H2CA 2WMFA 2PDGA 2RGMA 4GPNA 1X8CA 3AJ7A 1X6UA 3AJXA 3NM1A 5IHRA 3TCEA 3HO8A 1B4KA 4DF0A 1KD0A 1NDYA 1DWJM 3K8LA 1ITUA 1TIMA 1FWGC 2YA2A 1PYMA 3NVDA 1O5XA 1J11A 3E0IA 2QJGA 4LF1A 2IQDA 5H8UA 1WUFA 1L6GA 4UWMA 1OT2A 3L4UA 5C7VA 3S2CA 2UY3A 1OFPA 1K9EA 4YNGA 2FTYA 2ZXBA 2OODA 4YMZA 1K6WA 1QK0A 2EAWA 1W9XA 4RW5A 3PJXA 5HXMA 1KTNA 2A3CA 1SFJA 1UROA 4EAMA 1B3XA 1TTPA 3AALA 1CPUA 1NEYA 2CLPA 4LUSB 1Y5XA 3D6NA 3RLUA 3G1HA 3NPVA 2QS8A 5A8MA 2PZNA 3PPHA 1E0TA 2WB5A 2PB1A 2EPLX 1RCQA 4XZLX 5CLTA 2XDFA 3A3WA 3M16A 4H7CA 4R88A 5DBTA 5I6SA 3VMNA 1KCLA 5DO8A 2G96A 1JR1A 2XM1A 2JKAA 1JF5A 3WLKX 5FJIA 3WD0A 3WLPA 1DIDA 1UD5A 2PDCA 4JKMA 3LM7A 3TNBA 3KFTA 2EJAA 2OQHA 3G1AA 3AIVA 4QJ4B 3NOEA 2FB2A 3Q2DA 3SB0A 1IEQA 3AYTA 1YPIA 3N6JA 4CQ9A 1P5BA 1Q3NA 3GBDA 1G7VA 2B7OA 3IVSA 3DBPA 2WHMA 3WK0A 1GQKA 4RZ5A 2HE5A 4LUTB 2PDUA 4ZQMA 4QHRA 4AQLA 4H41A 1AUSL 1BXCA 2QLYA 3RM8A 1EEXA 1WAWA 5CPQA 3TU9A 4L64A 2DH3A 3JR2A 4YPJA 1UH3A 1LRTA 1VH7A 3A24A 3P74A 4C6IA 3PANA 3IJ7A 3EWWA 3E2RA 1G9HA 2VEPA 2J9YA 4DPPA 2DP3A 4Y6GA 1WDQA 2JALA 2W5FA 3I6RA 2RGLA 2VX7A 1JAEA 1XH2A 2QCNA 5CQ1A 2TYSA 5I3DA 4U5KA 4NZ1A 1CT5A 2QGHA 4OU1A 1RY0A 3B05A 2WJZA 3A5FA 3CLWA 4H8UA 4D8AA 3NGFA 1O12A 1XQLA 3PZUA 3VC6A 3S6TA 3S1WA 1SO5A 5IBXA 3TQ0A 5FF0A 4Z1BA 4FALA 3CL7A 3OEXA 4AWEA 3UYCA 3RPDA 1IT0A 4MDOA 3M41A 4RNJA 1OCJA 2YCIX 5K9XA 4GZEA 2VR2A 4A05A 3AQUA 4IGNA 3VPLA 4HNTA 3VOGA 4MB5A 4H7ZA 1P1XA 5E9XA 1KRAC 1UBSA 4A3QA 3IUIA 3ID7A 1IEIA 3EWXA 3ITYA 1PO9A 5HMFA 2GGIA 3SJ3A 1FTXA 3VFLA 2V67A 4H8VA 1LUCA 5EKYA 1XCWA 2HK0A 4J35A 3H7RA 3NTYA 2GJPA 1IGWA 2D22A 3VDHA 2YR1A 4KEZA 4XQ6A 1VLWA 3C6CA 4HSNA 1S5WA 4KQNA 3UXIA 5M5DA 3PWIA 3S42A 5C70A 4CCZA 1Z8AA 3QGAC 4RJEA 4IUGA 1H7WA 2O4QA 3WQ6A 2XIIA 4UTIA 2A4AA 3W70A 3URAA 1P0BA 4JFVA 1KA9F 2Z00A 3GNNA 1FHUA 4REQB 3HF3A 1EPVA 1EUAA 5HNTA 5HULA 3BVJA 3AAMA 1TVNA 2W61A 2F7FA 1EO5A 2WNQA 2XFWA 2V3DA 5AHLA 4MB4A 1AH3A 3SRFA 2XVLA 3ARTA 1THFD 4PSPA 4BF5A 3SY5A 2GJXA 3EDFA 4LXFA 5T9BG 3W2LA 2DW7A 3T0TA 1VFTA 3WJXA 1QPRA 1BXNA 1E43A 3QR3A 4B5WA 1W3LA 1XIGA 2WM0A 4LTSA 4LB4A 2CERA 2QCMA 3PUEA 2C1HA 4FB7A 2W4XA 2PA6A 3BCFA 3ITXA 4O11A 1KC7A 2XVGA 5JH2A 1ISXA 1SMAA 3W7KA 1I6NA 4FX7A 5SWUA 1V3IA 1U2YA 4O14A 3CPGA 2WSYA 3INPA 5HNUA 3PSWA 1QFEA 4LVFA 2F6XA 2VX6A 3UPBA 2TMDA 1WDPA 4S39A 3AWOA 4PFMA 1XXXA 4YLWA 3CTLA 3VGHA 5EB8A 3O63A 2VEKA 3ALGA 3A3XA 3S9ZA 1UKQA 1VFHA 3RIKA 1D3HA 3SCQA 1E0UA 1E9ZB 4IFKB 4XAYA 1Q5MA 4BQ5A 1JDAA 4DBEA 4D6EA 5BCAA 1TA3B 1K77A 4O8RA 4MNLA 3FA4A 5CBBA 1V0NA 2R14A 4HJFA 5K7JA 4FEZA 1LOQA 5A6AA 2QCDA 1SJDA 1YPFA 4GVHA 2QGYA 3CWHA 4HK5A 5XIMA 1OG0A 2HEJA 3PJTA 1M7OA 2CW6A 4ACZB 3T07A 4GO9A 1L8NA 3ZVHB 3HPAA 3N12A 4NSBA 1YDVA 5KETA 3OG3A 5I07A 1A4MA 4UTWC 4UQEA 1QNVA 1Q66A 2FZ9A 1LTDA 2YDAA 1C93A 4C6EA 2I9UA 3BAWA 1LBLA 2F9RA 3QLLA 4XO7A 3SBFA 3THCA 3DFTA 3NL6A 3AYVA 4UIOA 4UUIA 4V2XA 1JNDA 1V6UA 3QGKC 3TAOA 3L5AA 4AHOA 4B5NA 2BOGX 1TPH1 3LLFA 1N82A 4YHEA 1A0EA 4FIQA 2V30A 4DO6A 4KKXA 5ABTA 4HTBA 7TAAA 1VEMA 2IQTA 1TREA 3W6MA 2E0PA 4G7FA 2WHLA 4KERA 1JPMA 1OCBA 1HKKA 1R6WA 1ZHAA 4EF8A 3S46A 4H83A 4F9JA 1KM3A 2EJ1A 1J93A 5HJLA 4AD1A 1DWGM 1RBOB 2WMKA 3L2MA 3W27A 5J5RA 5CKSA 1YNYA 3FJNA 3URNA 2CCRA 1JCNA 1E4IA 3BICA 2YZ5A 4CNTA 3B8SA 1DJIA 4AD4A 2PDNA 3R1ZA 4M56A 3ZVHA 4AIEA 4US5A 2X1IA 5JBFA 3KW3A 3IWPA 1NP0A 1C3FA 1GPFA 3GIYA 3KS5A 1MYRA 3KS6A 2OXNA 4Q8QA 1OC7A 2RHGA 4LY8A 3QC3A 3KE0A 5AOUA 2Z1XA 3PY2A 1KQYA 2A3AA 2ZA2A 3D3AA 3R0UA 3OBEA 1ZQ5A 2Z1VA 1PX3A 1QHZA 1ZSXA 3N34A 2UV8G 4GI8A 5A3HA 3HV8A 1JCTA 5E70A 4P7RA 4RE2A 3S5OA 3GW3A 5G1YA 4XB3A 1BVNP 3EA2A 4N42A 3ZJKA 3V1HA 4NF7A 4KETA 2CLIA 4GK8A 1QR7A 2XTKA 3ZWTA 1SFTA 2FTWA 3TJ4A 4MY9A 3W2UA 3AYSA 3WQGA 1FWEC 4GZ7A 2PAJA 3SSJA 3N18A 2DSZA 3VNLA 1UUOA 1EZWA 3GYEA 3LRKA 1EGMA 2BLEA 3TLLA 4Z2HA 1O68A 1EJUC 3OZYA 1WDDA 1H1ZA 3GQYA 5CPOA 5BWAA 5A6KA 2OO6A 3Q58A 2HJPA 1D3GA 2CNCA 3GG7A 5DXYA 1F73A 3M0XA 5A8QA 3W24A 3WCZA 1TV5A 1OX5A 2BWGA 4L56A 8TIMA 3KDOA 5I00A 4IP5A 6PTDA 4DZ5A 4ATWA 1R3WA 3KOYA 2D0FA 2IKJA 3W7GA 2NUYA 5IDZA 3CAWA 3N73A 1S3HA 2PDHA 2B81A 3P82A 4Z1DA 3GZAA 3TK7A 3QH2A 2VFDA 3LHYA 3STCA 1XBVA 1YXDA 5C2GA 1S2CA 4PMRA 1OC5A 1UYQA 4LAMA 1W9DM 2D3LA 1TV2A 3W85A 4B5UA 1NFGA 3ATZA 5AYIA 5AC6A 4Q4MA 3LCWA 2VNCA 4PTMA 4IFRA 2IS7A 5HPCA 1ICSA 1R7AA 4GXWA 2OR2A 2I7GA 2NWRA 2HPMA 1FWFC 4GQRA 2V5KA 3WEOA 2DUZA 3HTWA 3N9RA 2WVUA 4NASA 1Q8JA 2Y5SA 5F2GA 3KUMA 3QV7A 4GFSA 1G69A 1LRNA 2V9DA 2YOCA 1DXIA 1UBPC 4I6KA 3WQPA 1XGDA 1B31A 1H61A 2H6RA 1QNRA 2CETA 2YYTA 2R1LA 4GUGA 3AI0A 2PTYA 3PB2A 4AMCA 4LCRA 1US0A 5HR6A 4C7DA 2FPVA 4AD2A 2A3BA 4NZCA 4H9VA 1M7PA 1ME8A 1DE5A 4LS2A 1PS9A 4LS0A 2V69A 1PE1A 3HGJA 1WZMA 4RDYA 3KBVA 3OG2A 2OYMA 4X0VA 3U4FA 5D09A 2A1YA 4B5TA 4R53A 4O54A 4F3HA 4OECA 1UASA 4QEHA 1O1ZA 2QIWA 3DESA 3S5ZA 3GXMA 3GE7A 2FFCA 4MB1A 3EOEA 2WJDA 1K8ZA 1BF2A 3S2NA 2Z2UA 3WQWA 1A5AA 5BXPA 2G50A 1A5OC 3G2GA 3HGRA 1ITQA 3GKAA 2OFJA 4KCVA 4V1YA 4LT9A 4GUFA 1MW3A 3TC7A 1FDZA 5CAHA 2PLKA 4UQDA 5BU9A 1TR9A 3FVDA 4MWAE 3BJTA 3VIKA 3TXZA 3UR8A 3M7WA 3GAYA 2Z2BA 3ARZA 3GLCA 4Q8WA 3TQPA 3LGGA 1E56A 2WVSA 2Q3RA 1JYXA 1MZRA 3LB0A 1JI1A 3VZXA 2NSOA 1ZBWA 2ZRUA 3MBFA 1P6WA 1N7KA 5HAOA 4CD6A 1JF6A 4C5ZA 2V5JA 2P50A 2HK1A 3H24A 2YB4A 4IP7A 1EF2A 1RJQA 3RPMA 2NVCA 2LLEA 3KHJA 2CHNA 2A6NA 4W8AA 2V2CA 1LCOA 4YTTA 4ML9A 2QCGA 3G77A 1K9DA 3W02A 3WSUA 4FF5A 2QYGA 4QRNA 1OEPA 1FDJA 3OO2A 1X98A 4UCFA 1TO3A 4TMBA 1CXFA 3H4XA 1JULA 4JTIA 2VZVA 3UVIA 2J6VA 1DL3A 3CMJA 4Y9OA 3S5NA 3EX1A 1TV8A 3N17A 4RXFA 1JZ7A 1WDSA 3ZT7A 3GX9A 1BRLB 4O4VA 5I0DA 3GUGA 5F7UA 5HQLA 5AC7A 3WMLA 2CITA 1XPGA 3BJFA 1J0KA 2FVMA 3MANA 1KXVA 1DJWA 8RUCA 4IPIA 5M03A 1XSKA 1DKWA 2DZTA 2E6AA 4FNSA 1L6FA 5CZJA 4LANA 1Y5WA 2Y8UA 3PNZA 2E1WA 1B4EA 3GVVA 3C5QA 3EZ4A 4YJ5A 1XRFA 3TN3A 3OYZA 1VYSX 4O57A 1LG1A 1W5NA 5D03A 1WXZA 3PC0A 3SIMA 1PVNA 2WANA 3HV9A 4FLOA 3WF2A 1FP9A 1C29A 4NQ1A 4RDVA 2IKHA 3T1GA 1PEZA 2BXVA 4NX0A 1ZTVA 1H0GA 4HCDA 1WKEA 3UR7A 2FHCA 1QPOA 3SN1A 1PKNA 4L1GA 3MZNA 4C7FA 1XSIA 2EPKX 1RD5A 4XUYA 2WVVB 4XKYB 4WXZA 1S2UA 4UTHA 1WXJA 4UTUA 3PTMA 2R82A 2CESA 4DWSC 3MZ2A 4O17A 2QPUA 3WLNA 1NDZA 5H2ZA 1HT6A 2FTPA 1HG3A 3ABOA 4JKLA 1HJWA 1LLWA 4WX2A 2NQLA 4WY0B 3QZ6A 2DT3A 3QV8A 4GIYA 3OIXA 4E2DA 2E5BA 3Q4DA 4GJJA 4WKAA 2HXUA 3MMTA 3TZNA 5HA7A 1I60A 4MZ1A 5IFPA 1GKPA 4OWGA 1TE6A 3QY8A 3I6TA 4AIBA 3T8QA 4AVNA 5BYWA 3M0IA 2DQXA 1HO4A 1UKPA 3E2SA 1E4NA 3EYPA 4DUXA 2PWDA 4J5NA 3H21A 3ZWSA 2Z27A 2BHUA 1JRCA 3MTWA 3CUGA 2TSYA 4AIUA 3LRMA 2ISFA 1EKOA 1V3HA 4FLSA 4C6FA 2E25A 4AC7C 4XD3A 1EOKA 2PDQA 3TTYA 3QZEA 3NZQA 3BURA 3HPXA 3B0VC 3CAKA 4E4UA 3AROA 2RDUA 1EPXA 4EXBA 1JFXA 4IG2A 3W7PA 1RALA 1PX4A 3BLEA 1MRAA 2POTA 2VC5A 3H53A 3AS1A 3HU7A 5PTDA 4UR8A 5GJPA 3IJDA 3MJYA 1QWKA 5JXQA 3AS0A 3EXSA 4JL2A 2AKZA 4UTLA 2J75A 4DJFD 2OZ0A 2R1PA 3DEQA 3OBAA 1TPDA 4ORIA 1HL8A 1FCVA 4KWVA 3QQWA 2PDIA 5CJMA 1LOLA 4ZO9A 4Q8NA 1JDDA 3ZOAA 3CJPA 1GOXA 3PBVA 4ZXLA 3JVAA 3EWZA 4WGXA 3WUGA 3RN6A 3W53A 2VDHA 2VDIA 9RUBA 2Z1BA 3D0CA 4HU0A 3GTIA 4EVZA 1WOAA 2AL1A 3GIPA 3QHMA