3SY1A

Crystal structure of engineered protein. northeast structural genomics consortium target or70
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
229
structure length
229
Chain Sequence
MMNDIAHNLAQVRDKISAAATRCGRSPEEITLVAVSKTKPASAIAEAIDAGQRQFSEHYVQEGVDKIRHFQELGVTGLEWNFAGPLQSNKSRLVAEHFDWCITIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRLRGLSAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLALGQSDDMEAAIAAGSTMVAIGTAIFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR70
rcsb
source organism Escherichia coli
molecule tags Pyridoxal phosphate binding
molecule keywords UPF0001 protein yggS
total genus 85
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3sy1A00
1VFTA 1HKWA 2PLKA 5FAGA 3E5PA 1QU4A 1XFCA 3N29A 3AWNA 1SFTA 3MT1A 1NIUA 2PLJA 1VFHA 1W8GA 7ODCA 1BD0A 3GWQA 1B54A 3R79A 4ZGYA 4XG1A 2ODOA 3NZQA 2NVAA 1TUFA 2RJGA 3OO2A 4QHRA 2OO0A 3B8TA 4LUYA 2VD9A 4PB4A 4AIBA 3AWOA 5GJPA 4LUTB 3B8VA 4BF5A 1VFSA 2O0TA 4DYJA 2QGHA 1NJJA 3ANUA 2NV9A 4DZAA 3BTNA 3N2BA 3ANVA 1RCQA 3N2OA 4XBJA 3CO8A 1TWIA 1XQKA 1L6FA 4WR3A 5FAJA 2SFPA 4PB5A 2TODA 3LLXA 3B8WA 3KW3A 1XQLA 3UW6A 1SZRA 1EPVA 4BEUA 2DY3A 4A3QA 3E6EA 3WQGA 1D7KA 3WQEA 1CT5A 4ECLA 5IRPA 2RJHA 1HKVA 5FACA 3VABA 5BWAA 1FTXA 4PB3A 2YXXA 3B8UA 3HA1A 4BEQA 4KBXA 3WQFA 1F3TA 4BHYA 4LUSB 1KO0A 4LUSA 4Y2WA 1KNWA 3SY1A 3CPGA 2J66A 4ILSA 4LUTA 5GJMA 4FS9A 3WQCA 3NZPA 2ON3A 4V15A 2VD8A 1L6GA 5GJNA 2P3EA 3S46A 3WQDA 3HURA 3C5QA
chains in the Genus database with same CATH superfamily
3B4YA 4US5A 4NYYA 4Z2GA 1D9EA 1G1YA 4GCAA 4MNMA 1VFHA 5EY5A 4D6JA 1FOBA 2OT0A 3GZ3A 1C29A 3T05A 4ZFMA 4MHBA 3GB6A 3O6AA 1YDVA 2Z2AA 2XTKA 4A8IA 4DVOA 1POJA 3TQKA 3UT0A 2W0UA 4H9UA 4AXNA 5HANA 4AZIA 5A2CA 3D47A 4QDMA 3P60A 7ENLA 3OVPA 2CLHA 4CU8A 2OGJA 2PRMA 2HNEA 3H12A 4LANA 5G5IA 1YNPA 1Q4WA 4BI7A 1MW1A 5A6LA 4MY1A 1IT8A 1OFPA 2WQDA 1MQPA 1G0CA 5E0KA 1BTMA 1ONEA 3SIMA 3WLQA 2DY3A 1UKSA 4ICMA 4A3QA 1FHVA 2OZTA 4WDTA 1CT5A 3AHYA 1C9WA 3LZ3A 1A0EA 1K8XA 2HNHA 1KFKA 2OT1A 4DWSA 4HK6A 4IX0A 3MUY1 4QS6A 4JXCA 4OU1A 1M53A 2ZX9A 5CJ5A 3UPMA 2ZUNA 1VJIA 3PZUA 3O05A 4RNFA 4HK5A 4TMBA 3MVIA 4HZ6A 2ESCA 1MO0A 1W56A 3NZRA 2JGQA 1ZFJA 2H3DA 4O4WA 4ORIA 2X8RA 3WQVA 3UXDA 2PF8A 1WXYA 2GL5A 3WLRA 3EWWA 1IZKA 2UY4A 4MB1A 1C91A 4CD7A 3ELFA 2DW6A 3TA6A 3GTIA 4AIBA 1UUMA 3CHDA 5F2MA 4LUJA 4KMQA 2QUMA 4DWDA 2EGZA 1WYIA 4R7JA 5A6JA 4OZOA 3WDRA 4DZAA 3FYOA 4OGZA 1SGJA 2O55A 3GHSA 2NQHA 5H91A 4AD1A 1XLKA 1J0ZA 1GZGA 3K8LA 1PUDA 1JUEA 1OYCA 3VIKA 1KLYA 3BJTA 2RDTA 2QQ6A 2EG6A 4BEUA 3P80A 1W3HA 3B9OA 4GI8A 1XR2A 1ZBWA 2A79A 2B7PA 5BW6A 5BWAA 3PK7A 4JTLA 4K1WA 1EJXC 1ADSA 3V1HA 1US3A 2A3HA 2FDSA 3KL3A 1FWSA 4AY8A 5BXSA 5HQEA 1GUVA 4NI8A 4IPPA 1HZYA 5E9XA 3C2EA 2PLKA 3W1AA 4GZIA 2DGAA 4FNRA 2V2HA 2XFYA 1UZ4A 2NX3A 2I9EA 1XKJA 1LLZA 4NX5A 2ZRXA 1PS9A 1TJ2A 2VC7A 4NZ4A 1Z42A 3RX2A 1FKWA 3BWWA 4LAOA 3OW1A 2ZTKA 4PMRA 4EX4A 1Q2RA 2PGEA 1PX4A 1ZSXA 5KEZA 1E1EA 3U5UA 4J3WA 1K8YA 1XYZA 1XM3A 3GG7A 4LUYA 3ZYZA 2VD9A 4HHPA 2QR6A 2CLMA 3AIWA 4GRSA 1W9UA 1KXVA 3KLLA 2PCQA 3IIXA 2VFFA 3ENLA 4P5UA 1A5KC 1IXNA 4NZCA 3RAOA 4S3CA 4PSPA 4K2SA 2G95A 1UH2A 3E02A 2W63A 3NDOA 1O1HA 2EPHA 3E3HA 4DI8A 4IF2A 3EXSA 4Z1YA 4D1JA 1TV4A 1V7YA 4HA0A 1YTKA 1XQLA 2ZBTA 3LYEA 4ZFCA 3L4ZA 2CBVA 2Y63A 3ABOA 1RQBA 2XZ7A 4S23A 3CUHA 1P5BA 3VD9A 4LUSA 3V18A 1R7OA 2J8GA 3SN0A 4LVBA 4QROA 1C90A 4UOJA 3I4EA 1AA1B 1WDSA 2NX9A 4ROQA 2J9YA 3GTNA 3WQ5A 3WQOA 2OYMA 1B3XA 1J8VA 2HVOA 4XAYA 1T8XA 4MYXA 4N9DA 1SFTA 4GPNA 3NQ7A 3PR2A 4PN2A 3WF0A 2Z6IA 1LL4A 3KBMA 5I3JA 3S6TA 1P0DA 3W9ZA 1EC9A 2C1IA 1FH9A 3OBEA 1EXBA 3WLIA 1BTCA 1JQVA 3OO2A 1CXIA 4LVAA 4GI9A 1LLWA 2A7PA 4H19A 1UIOA 1YXYA 1V8EA 4G7FA 1P48A 2I14A 2AKMA 4IFRA 5KZEA 4JX5A 3CTTA 2GJLA 4X61A 2VT0A 3O3RA 4WK9A 4H9MA 2PWFA 4LOCA 4QIUA 2EO7A 3BICA 3CO8A 5HMSA 2SFPA 4CCEA 3MKVA 4DZIA 1US0A 3CZ8A 1JYNA 3SN1A 3NPVA 5HNNA 3U4FA 3EWBX 3L5MA 3CNYA 1Z7AA 1BF2A 1JDCA 3P61A 1EB3A 3WQEA 1CDGA 3ZVHA 5FJIA 5G4WA 4ZXOA 2XGIA 3B8UA 4PCTA 4RR4A 1RK6A 1W3JA 4Q4MA 2Z29A 3NR0A 3PBWA 1V3KA 3MP4A 3W7RA 1M41A 1A5NC 4F4RA 4I7VA 1F6PA 3BG3A 5ABFB 3ABQA 3GBDA 3WF1A 3WQCA 3JZUA 3EYPA 1IT0A 2X30A 4NJGA 1GYLA 2DV0A 1K9EA 3MI3A 1A3HA 2I5GA 4M1RA 4NJHA 3Q94A 6CGTA 1OCBA 3PJXA 1GVFA 5IHSA 3STFA 3ALFA 3R79A 1V6TA 4A8NA 1E51A 4C1NA 1WBJA 5BXPA 4JKLA 4JDBA 3ARSA 2NSOA 4IIGA 4GNKB 2DUAA 4GX9A 3DFQA 3VMPA 3WD0A 1I1XA 2X0YA 4B4FA 3I68A 3RRAA 3IAPA 3PFMA 4H8HA 4NZJA 1MNZA 3L66A 3MKKA 1HFBA 2X1UA 2ZRUA 1KBBA 3RO8A 3C4UA 3ORWA 1TPVA 1OFOA 5IDIA 1GVRA 2FTYA 2NLYA 3T7VA 3VZYA 3O63A 3LPPA 2BZNA 3EZ4A 3QLDA 5CPTA 1YTEA 3PUGA 1DKWA 1GEHA 3GVQA 4URIA 1EKOA 1W2PA 4PULA 4PUWA 1E9LA 3EA3A 1FHLA 1WDWA 3NL6A 2NXHA 3LERA 1K3UA 4O1BA 2LLEA 2Y62A 1HT6A 2QAPA 1U5JA 3AIQA 2GK1A 1NM9A 2VFHA 3DC0A 1XLJA 1GEQA 2MNRA 1UHVA 3M7WA 1B0IA 2QCHA 3CMFA 1KXHA 1AJZA 4LBRA 1B4KA 1DTUA 2DSUA 4WKHA 1DJZA 4A3RA 4QE5A 4DIAA 3FA5A 2DORA 3URAA 4FNPA 1M04A 4CQAA 4G8TA 1O6IA 1FFRA 4CNSA 2Y7GA 3LY0A 3WLTA 2AL1A 1AQHA 4F9DA 3W29A 3LRMA 3FKKA 2Y85A 1LG2A 1SZGA 1FWCC 1XHGA 3T42A 3TYCA 2YZ5A 5CLTA 3F03K 1TJ1A 2V3EA 4G5DA 2V3FA 3B9AA 4H41A 4TQTA 1S3TC 5M03A 3VIPA 1U1JA 1CXFA 5A8GA 2GWGA 3ABZA 4RW3A 4Y8EA 1UWAA 3W75A 1V7AA 4A6GA 2ISFA 3N2TA 4CU7A 4G7EA 4XSMA 2ONEA 1QOPA 6ENLA 3CQIA 4AUBA 5B7YA 3E38A 3KXQA 3O15A 3H2AA 3SY1A 3TTSA 2QCDB 3UA3A 5HINA 1AODA 3L21A 1KCXA 4JDYA 5AYIA 4AZGA 3GY1A 2IUZA 2CWXA 3GDTA 4CCDA 3W7MA 2A2IA 1DJNA 4LY4A 4F0KA 1B5TA 1QW8A 3C8FA 1GGOA 1EC8A 2V5LA 1TWDA 3LXAA 4FIQA 4JTUA 4EXBA 1XUZA 3DAQA 1JGIA 1VD6A 1LBMA 1RPKA 3GH5A 3MMTA 4E38A 2Y70A 2ICSA 4O4VA 2WZEA 2B31A 3DERA 5FF0A 2ZUMA 3QQWA 1UP3A 4XD3A 4P7LA 2E6FA 2ZWZA 3W2KA 4H8VA 3GC2A 4JTJA 1XG4A 3ALGA 1CLVA 1TPB1 1O60A 3BGAA 4L9YA 2PBOA 3WQWA 2J8FA 2WO5A 2OWWA 1E5NA 4BQ3A 1B4EA 4X60A 2PUZA 3CQHA 2QCCA 2E09A 5LXEA 4ZTYA 2BX7A 5BMXA 1V02E 3M0ZA 1XIBA 3RK8A 5A2AA 3WH5A 2J7EA 3EWUA 5DRCA 2BGQA 3PY2A 2VELA 2DJXA 3VFCA 3H26A 1FDZA 4RUBA 2HMCA 2FGZA 3T4WA 3SR7A 4L6OA 1RJPA 4HHLA 2YDQA 3PUDA 1EBGA 1K7XA 5C2CA 4GI4A 4MPQA 5K9CA 4Q22A 5D05A 3ZSSA 1NP0A 4DYKA 3VM5A 1EH9A 5T26A 3Q65A 3SCRA 4XZHA 3M5ZA 3SCOA 1JD7A 2G41A 5E93A 1EIXA 3DC8A 4JR5A 4GNVA 3M47A 3W01A 2G3IA 2XM2A 4LVDA 1IE7C 1XLDA 4I9TA 1EJSC 2PP1A 3O0FA 1KGXA 1GVQA 4GQQA 5KITA 3B04A 3S1XA 3AHTA 4MWAC 2ZXAA 3CZGA 5D9PA 3BXWA 3R25A 1VCVA 1S2VA 3NL5A 4JTAA 3CAQA 3S47A 4LC6A 4AVFA 4QTGA 4LY8A 2ZE3A 3V5CA 1UYQA 1V3IA 3B8DA 2OPJA 4C6QA 4YMZA 3HJZA 3VC6A 1JPDX 2EJ1A 4C6NA 2O9PA 4IL2A 1SZNA 2FVLA 3MZ2A 1F05A 1PPIA 1UR0A 4JEJA 3S1UA 4LBSA 3DGRA 1J01A 5HMEA 3HG3A 1VCFA 4AZ6A 1HP4A 3AICA 3UVIA 5K2ZA 4XTIA 1RBLA 2V5DA 4OHQA 3SAZA 4BEQA 3KCLA 2QJMA 3ARTA 4Q7NA 5CPNA 5DELA 4V1XA 1I8JA 1Z3NA 2QV4A 3OVQA 4MG4A 4HU0A 1DJGA 2WWDA 4H04A 2JKEA 3GNNA 4Z2KA 3AXMA 3CK5A 3SRHA 3SFKA 3TDFA 3QOMA 5XINA 4J3VA 4DQWA 2XISA 1FWTA 2V82A 3QFWA 3LZ5A 3WQPA 3NOYA 4POCA 5K4XA 1SFJA 4Y6GA 1DXIA 1GJPA 1K6AA 1HO1A 3VNKA 1ZB5A 2XYLA 1U30A 3WBEA 4B5UA 4M51A 1E70M 4I6VA 1VPQA 1OCNA 2FZ8A 2PDGA 3P8IA 2WM0A 3KP1A 2R1KA 4F40A 2ZICA 4AVNA 3UG3A 3UWEA 3WLJA 4RK8A 1XCFA 2VC5A 4KEMA 4GGBA 5JQ9A 2AGKA 4MKSA 1IXOA 3KS6A 1E6SM 3AIRA 4UQ9A 1Z32X 5EGRA 4REQB 4KWVA 3IPWA 3PAOA 1BVZA 5A6SA 3S42A 3LGDA 4PMYA 2QF7A 2Z7GA 3TXZA 1G94A 2EF9A 3QV6A 4CQDA 4WD0A 1KV8A 5I3FA 3B9NA 4J4KA 3OLIA 3GRIA 1E55A 1K03A 2V6AA 2ZVRA 4N4PA 5CZTA 1W1PA 4L61A 3B40A 4MZ8A 3SJNA 3GE7A 3TC7A 3IGUA 1ENUA 4E4UA 3M07A 4H6RA 1DIKA 4PUKA 4LUSB 4UQBA 3MSYA 3RN6A 3MBDA 3P14A 3CQ0A 4IM4A 3P62A 2GQ3A 5HJYA 3HGSA 1RVKA 2IQ0A 1E6QM 3M0IA 1BYBA 2WLZA 5DN1A 1RQEA 4V15A 5G2WA 3G0SA 5GJNA 3CAKA 5C9UA 1R3RA 2CZ5A 2GJNA 1S5WA 3BO9A 2X0HA 3N14A 3SURA 4LT9A 3N6QA 1OCQA 2TPSA 1T96A 1XINA 5JBFA 1VZWA 3J7HA 2L5HA 2D3LA 2PF0A 4ML4A 3R6IA 3DFTA 2YL9A 4JQ2A 5EBAA 4IPJA 1ML1A 3CL7A 3A5VA 2XVGA 1UWQA 3NEHA 1Y5WA 1P1XA 5HNTA 3O6CA 3T9PA 4FEZA 2ISDA 4HSNA 2VGIA 4YU1A 2WV8A 1B3WA 3RU8X 3P67A 3PZIA 4MVAA 3PP7A 2E4TA 4DHGA 4R9OA 1EJUC 1VRDA 3DECA 3M7SA 1D2KA 3HTWA 1BRLB 3OA3A 3GXNA 3K8MA 4UR8A 1Q7ZA 5DX7A 2P0IA 4DO6A 4M24A 1NP2A 3CTLA 4AX6A 1ITQA 4HTBA 5FEPA 4W87A 3KRBA 5I5RA 4C5YA 2VGBA 1XDLA 2PA6A 4S3AA 3TV8A 1D8WA 3W82A 4H8NA 1DWJM 1FCUA 3LPOA 2WSQA 4KWUA 3PPGA 3GDKA 4NILA 1QHOA 1Y8BA 4B5WA 1NFPA 1FWEC 3GW3A 4ERIA 4N0RA 3R8GA 2W3ZA 3N15A 1DJWA 3R11A 4X63A 3VIHA 3WQ8A 1B3OA 4V2XA 5DRIA 1W91A 2PWDA 3NJ3A 3APGA 3BLOA 2QGYA 4M7TA 1YHTA 4K37A 4L1XA 4O11A 1EQPA 4PTWA 3DFYA 1UR9A 3SRFA 3QMRA 4NNCA 1TFVA 3S2CA 3GTHA 2YLAA 1PZ1A 2I5QA 1FWFC 3HZ3A 4US5D 3PSVA 1J0HA 2EQDA 3DZ1A 5KSWA 1V0LA 2OEKA 3HM7A 3LBOA 1T6MA 1EZWA 4QXIA 3WJYA 1I6NA 1E1CA 1DQXA 5HNUA 3AIEA 1JL8A 2AGTA 3CAVA 1JPMA 2O0TA 2EHHA 3CBWA 3AQUA 3DBNA 1DJYA 3GK0A 4GG9A 1FBAA 3TTQA 3L23A 3Q4DA 1W5OA 4I8YA 5H8MA 1UD8A 2HRWA 2A4AA 1AQFA 4MKNA 3GTFA 3R2GA 4XZBA 5A2BA 4QM1A 1Q5MA 2ZUVA 3KBWA 2RFGA 3GNDA 3IUHA 3V7PA 1J0JA 1XRVA 2DSZA 2UY3A 3DI1A 3KBSA 3T0BA 1UC4A 1WDDA 4EWJA 4GOAA 3N73A 3C3UA 4FF5A 3CB3A 4Q8TA 4K7VA 3O06A 1MZHA 1K70A 5CGQA 8RUCA 2XM1A 3EPMA 4W7WA 5F1VA 3TN4A 5I24A 2OU4A 4YTRA 1BG4A 3ANYA 3ZVHB 4OOUA 4NJJA 5RUBA 5AC4A 3WMCA 3MCOA 5E09A 1TTIA 2WHMA 2DT3A 1RPXA 4M0XA 4KWOA 2ZRYA 1Q6DA 1E1FA 4S39A 4GINA 2ABAA 2A5HA 3N9KA 3B0UX 3HF3A 3Q45A 1TPWA 1MXSA 4JTRA 4LS1A 4Q8WA 6XIAA 4MDOA 4MY8A 3A9IA 4OUIA 5K9XA 2WMGA 2PDCA 2V5BA 2XZ9A 3R0UA 1SMDA 1JIBA 1V79A 3F5KA 3VNMA 3VC5A 4L7ZA 4LUIA 5EKYA 2FVMA 4FX6M 4O1FA 3OG3A 2PC8A 3BLEA 4GVGA 3UEQA 1GKRA 1CLKA 1NAL1 1FWHC 1JD9A 3FFSA 3WKZA 4UOZA 1CXLA 5CAHA 4W9TA 3ITOA 1CECA 1WXZA 3PM6A 5FJPA 1YDOA 1UP2A 3DI0A 3UZJA 3WQFA 3UR5A 4DJDD 1AL8A 2FJKA 4WSHA 4DUOA 4GIYA 3T8QA 1P0EA 1R2RA 3THDA 2AMGA 3BANA 3VE9A 2CITA 5I07A 1SR0A 1H7PA 3UNDA 1IR2A 1Q13A 3QH2A 3HQNA 1JUBA 3FSTA 1F5ZA 4FALA 4F66A 3ONCA 3VD7A 1I2NA 1BD0A 3EOLA 4XSLA 5D33A 1E0VA 2JFEX 1DJQA 1PIGA 1KC7A 1W5MA 2WJDA 3VFLA 2XUCA 5FD0A 4I5RA 1OIFA 4K3ZA 2BODX 1EEPA 3GHTA 4GHRA 3WD1A 4C6MA 1AL7A 2PTZA 1KQZA 1UPPA 3DHUA 4IQLA 2EKCA 2BY1A 2WPGA 2CFFA 4BWLA 4I6KA 3KP0A 4PRRA 1W1VA 3WCZA 3NL2A 5C9WA 3HG4A 3T2PA 3E0LA 2X0SA 4TVDA 3ZXWA 4GY1A 4CD5A 3PN8A 4OKDA 3LG3A 2BLEA 4AG0A 3OHIA 1H5VA 5BU9A 1Z44A 3RLHA 1B57A 2V2CA 1BSIA 3DOPA 2GUBA 2J79A 5C55A 3I65A 1RBAA 3Q58A 4FXJA 4O1AA 1KCLA 5DFAA 3M1ZA 1VRXA 3G1RA 1YDNA 3V1PA 5CAKA 3OLGA 2EPKX 2OCZA 3E12A 3F4VA 1KM0A 4E8GA 3E2SA 3W7CA 2X05A 2XINA 2QIIA 3L0KA 1ZBVA 4DUXA 1EJTC 2VEIA 2P5NA 1Z69A 2QEZA 2EXOA 3CYVA 4PMOA 1QPRA 2CLLA 1F3EA 4H9ZA 1WAUA 4HNCA 2NZLA 2R6OA 4Q4OA 4E4FA 4MM1A 3LOTA 3NTYA 3AJXA 3W83A 5CC6A 2AAAA 3PZOA 1L9WA 1AW2A 1HKIA 2E28A 1EYEA 3U9IA 5KETA 1QMLA 5F2LA 4OIFA 1ODUA 1CYGA 1ZENA 1X39A 4XZWA 1X6UA 3MUXA 3W28A 4C6BA 3P8JA 2NLIA 2PEVA 4UTIA 4L65A 4M80A 2IQTA 3K5XA 4DZHA 3QTGA 4DF0A 3H2EA 2B7OA 3WLOA 3KBNA 4CU6A 2DT0A 4LAUA 4X9SA 3I6RA 2C14A 6PTDA 3M6YA 4Z2HA 1JRBA 1GPFA 4KFOA 4INFA 1XIFA 4NAFA 1XYCA 3RFAA 1QUMA 3W74A 4ROPA 1BWKA 4P7NA 3SFWA 4KEZA 3H4GA 1AMYA 2VDIA 3BARA 3LHWA 4M6UA 3DFNA 1HJUA 2VKZG 3URNA 1Q3NA 3EWYA 4KCVA 2JKPA 1EJ7L 3WQGA 4IIFA 3FAXA 1CTNA 1R38A 3CPUA 5BWFA 1UR1A 2CHRA 1GHRA 5KZDA 3II1A 2I7GA 4LFYA 1S1RA 2HCVA 5A6TC 4ONVA 2QLYA 1ZBKA 1E72M 4JCMA 3S0CA 2ZC8A 3NDZA 4MKVA 1SJAA 4S2CA 1M68A 2HXUA 4GO8A 1HG3A 4FLRA 1KRAC 3KE0A 3HQPA 4ATWA 2HSAA 1GQKA 1QWKA 2Y5JA 3BAJA 2V68A 2IXVA 1F3WA 3COTA 5KZMA 3NA8A 3MVTA 4IIEA 4KESA 4RNJA 5BRQA 1YXCA 1LJYA 1OABA 1V6VA 3CGTA 3U2OA 4DNMA 2Y0FA 3W7OA 3JS3A 3B8TA 1JPIA 4UFHA 2DSVA 3WH6A 5HULA 1VS1A 2GVGA 4MB3A 3KEHA 2WNNA 1LBLA 2DP3A 5TNVA 4EPBC 1PX3A 1JVNA 3C3NA 2WVUA 2QJIA 3NQMA 4S3KA 2FPTA 1LQ2A 1RBOB 3HJEA 3M0JA 3ZJ7A 2O9TA 1R2TA 2J88A 2VGFA 3NQ2A 5H8PA 3UGRA 2A6LA 4PZVA 4ZOBA 4KETA 1P0KA 2WNZA 1JZ4A 4Z42C 3R4IA 4JZ5A 1J96A 4P7OA 2PDMA 1A0DA 3VNJA 4BK9A 3PS7A 4J40A 4G9PA 3G1DA 4I5XA 1KO0A 2Z27A 1SJDA 2WZTA 3TOYA 4B3KA 3VNZA 5B80A 5JU6A 1YIXA 4H9VA 1QHPA 1QNOA 2Z1XA 3WF2A 5AYYA 1BFNA 2FGLA 4I7WA 2OQHA 2E9MA 4AEEA 3S9ZA 3AIUA 3A4XA 3KDOA 2FPVA 3PTDA 3S5OA 3PPHA 2PPGA 3K8KA 1KFWA 1TUFA 4BZYA 2WMIA 4CCCA 4GC4A 1LM1A 1I2PA 4U28A 2CKRA 4E2BA 1KBKA 3P0WA 3UPBA 2HDJA 4C6IA 4RZ4A 4O19A 1OGSA 1VFLA 2RH9A 3W0KA 1HKMA 2RHGA 4ZB5A 3KOYA 3VOJA 4F2BA 1OHLA 3CV2A 1UMYA 1RHCA 2YCJA 2R1MA 1PIIA 1OC5A 1UG6A 4QNEA 3IJDA 2ZRWA 1I0BA 1W1A1 1TCDA 4IX2A 3KRUA 3WBAA 1FDJA 1V3MA 4O1EA 3JZEA 1UB3A 3DYOA 2BVWA 2OEMA 4H7VA 3N19B 2X1RA 2QCMA 3LSBA 4JHZA 3RUBL 1E6RA 4JX4A 5EA9A 4KCWA 3OBAA 4KIEA 1EJRC 3ZJ8A 2VRKA 4Q4RA 4BCEA 3T0DA 4HOWA 2A1YA 4EAYA 1GOKA 4P8XA 5I3DA 1E6ZA 1PX8A 2ZDRA 2DU2A 4ZO9A 3BCJA 1TRDA 3W1QA 3VOGA 1ADOA 4JTIA 1ZUAX 5D2TA 3WJZA 2WJFA 5F4SA 1MEIA 2WB5A 2C71A 5GNZA 2YBUA 1F4HA 3IK2A 2BVYA 3AMGA 1XS2A 1QPKA 4M29A 4KWWA 4RXFA 5LIYX 3UR7A 4NVTA 4FNUA 3CZLA 3ZQ9A 4L64A 2VC9A 2C1HA 4DO7A 4KS0A 1PHQA 3PC0A 1E5JA 3VO0A 1A5LC 3I3EA 1YNQA 2IPWA 4G7EB 1Z89A 1HL2A 4GACA 3W25A 2PDHA 5ECUA 3DHFA 3N4FA 3RCNA 2CZEA 4MADA 5A8NA 3B8VA 1F7BA 4UWMA 3STPA 1VC4A 4UTJA 4PBEA 3RX4A 1W9XA 3FS2A 3QHNA 2B7QA 1FH7A 2DUZA 3WFLA 1SW3A 3BLDA 5FF7A 4PTXA 1UWRA 4ZQPA 1L0PA 4ACYA 2DZBA 3VDBA 4M3PA 2G3JA 4NQ1A 4JQ1A 4D71A 5D09A 2H3BA 4JYFA 1SVDA 3B3DA 3C0LA 3NQGA 2VO5A 3E0VA 3M44A 3BQ5A 1F07A 4C6FA 5A8PA 1XI3A 3NQ6A 4DBWA 3GG1A 5D9NA 4ERGA 1FX6A 4Z1AA 4YYCA 3E0FA 2WVTA 3UESA 5LIKX 3RR1A 1XH2A 1GQJA 4JD4A 1RAKA 3ZIZA 4XZIA 4QSHA 4JIIX 4Y9PA 1VHCA 2P3EA 3HURA 1S3HA 4PTDA 2E6DA 2CU0A 1F8MA 1UR2A 4MF4A 4QP0A 2D2OA 4QITA 4S3BA 3DFHA 5F2IA 3APTA 3DG7A 3ZJ6A 1MRAA 2OSXA 3LV5A 3GSMA 1VP5A 4JIQA 4ALDA 3GVWA 1V93A 3W7EA 4JTSA 2ACSA 3EB2A 3EB4A 1M7XA 2OSYA 2OLSA 3H7RA 3N2MA 2XG9A 1RK5A 4L5ZA 4HP5A 1UWIA 1XYMA 3FVDA 1DJXA 4MWAD 1MXDA 1PZ3A 1EOMA 2V0TA 5DANA 3GIYA 4B5XA 4HZ7A 8TIMA 2BWGA 4P8UA 3CHFA 1HX0A 4EKJA 4A05A 1HKJA 3NVDA 2CZVA 3HOJA 1U5VA 3EA1A 4O52A 5IFPA 1J5SA 4IP4A 5H8UA 3CHEA 4W8AA 1N55A 1G7VA 2QZRA 1WQ5A 3TZNA 4IIBA 2ALDA 2YKKA 4E8CA 2DZSA 4JIRA 3ICJA 5DBUA 1TMQA 2I16A 4ZOEA 4MFEA 5LNSA 4KGJA 3I4KA 1H1YA 3WJSA 1NARA 4MFDA 4CEUC 3NG3A 3T07A 3HG5A 2XHYA 4IG2B 4NZ3A 2VM8A 1NEYA 3MSGA 1D3GA 4AIOA 4XD5A 4AWSA 2V2DA 3UVAA 4BF7A 4QLLA 3BLPX 2PWUA 1F3XA 5FJUA 3HPXA 2TAAA 2RKXA 2G3NA 1GHSA 1CENA 1OYAA 4QQUA 3GC5A 2QW5A 2P8CA 1BGGA 1HJWA 1R86A 5BMWA 1TSIA 4L4MA 4EF8A 2FKPA 1Q8JA 3SY8A 4FXFA 1CGUA 1K9DA 1K1DA 2C13A 1T8QA 2OWXA 3VNDA 3VD3A 4BF9A 2NVCA 2P10A 1B3ZA 4HSOA 3IIVA 3RR4A 4ES4A 1EGZA 4GIAA 5F4XA 1OG6A 4AD4A 1MSSA 2PSNA 3GLCA 5I3KA 4M81A 1QOXA 2XN0A 3QY6A 3FYPA 4D72A 2PTYA 3V0TA 2ZX5A 1DE5A 2REQB 4AYGA 4S3JA 3KAOA 2C7FA 2BS9A 1TIWA 1QJWA 4UMBA 4U10A 1EHAA 2FH6A 3BVJA 1GZJA 4F0LA 1BQCA 3DX5A 4HNLA 3VDCA 3OP2A 4AIEA 1S5TA 1CEOA 2HVMA 3PBGA 3AFBA 1EYWA 4GQBA 5LHFA 3MW7A 4NF7A 3P3BA 4K1GA 3KVMA 2XVPA 5AHLA 5JIWA 2BOEX 3OZPA 3MUZ1 2EAWA 3LCIA 4IG2A 4IJCA 3GXMA 3C2FA 1P6CA 4OOZA 1K9FA 2CLFA 3P82A 3R10A 5A8MA 2YCLA 3RCYA 4IP5A 3EMCA 3MMUA 2YOCA 3LHVA 4CNUA 1P6BA 2OQLA 4XUYA 4UFLA 1EIBA 4NSBA 4NX0A 1A49A 4LCSA 3N9SA 4ZOAA 3TR2A 3AALA 3TLQA 3G0UA 4XBJA 4YWSA 1YBQA 3W86A 4H8UA 3OPSA 3EKLA 4MAZA 1KKRA 3MMWA 1V3LA 4QE4A 1XLCA 4J27A 3TWAA 5AB3A 5EFFA 2H9AB 5E9AA 4FR6A 3IAQA 1R2SA 3L0NA 4PCNA 3EPOA 3HV8A 4QCFA 5MF5A 1TPEA 4AEFA 2OZ8A 2NQZA 3PTQA 1GVOA 1EJWC 3UXIA 3WELA 2GPTA 4FMVA 4F2TA 4FX8A 1XRSA 3MO4A 3M43A 4JCLA 4PL1A 4QLJA 3LPGA 1I2RA 1YQ2A 4TV6A 4YVPA 1NWRA 4A3HA 4C5ZA 4EF9A 2POTA 4D6GA 4LYPA 1NFBA 4QR6A 4CN1A 3QSRA 3CWHA 4JN6A 2BASA 3CHCA 3NFUA 1TO3A 1IGWA 1DORA 4MJ2A 3NPXA 3N29A 1OBAA 2Y8VA 3M4HA 2JE8A 4AXKA 2J13A 3CEUA 1N82A 3BPWA 1LDCA 3B0XA 3RITA 3TN6A 2YXGA 4JTKA 3ZLHA 4A22A 3AHVA 4PTVA 2PLMA 1MNSA 4BY3A 2VI0A 4EOUA 2NT0A 3I6EA 2PD9A 1GOOA 3M5YA 4MNJA 3VXGA 4D6HA 1Y7VA 3VTRA 3CXOA 3G1HA 3IJ6A 4QCEA 1FWAC 4BF5A 1JCXA 1D7FA 3W84A 4GYKA 3C2YA 4PODA 1E73M 4MUZA 3LPFA 3TWBA 4B3LA 4IZGA 4GXMA 5TIMA 1GG0A 4TUFA 2CPUA 4DI9A 2WSKA 4EIVA 3L12A 2ZZ7A 1Q63A 4WVXA 1YDYA 3TMLA 4AISA 1RD6A 1KTBA 3E6EA 2J25A 3TYDA 4YVXA 3HQOA 4ASTA 3TAKA 5M17A 1JZ2A 3OJGA 3NDYA 2HV5A 5I23A 2YFOA 4UFKA 1XIJA 1H7XA 5HXMA 1L6YA 3LA4A 3WEMA 4FP1A 4MOZA 1Q85A 4ZQOA 1C8VA 4AD3A 1L6GA 2Y8KA 2D3NA 4N2YA 2MANA 4UXDA 4PEKA 2WYSA 5M5DA 1W8GA 2IKGA 1PKLA 3UU0A 5CEWA 2NWSA 4ZL1A 2XSBA 3LM3A 3V16A 2GOKA 5CZJA 3GXDA 1S39A 5E0FA 5EYWA 2X1TA 1OB0A 1VR6A 3R12A 4GVIA 3W00A 2Y88A 1DYSA 1QI3A 3AHXA 3MQTA 3L4TA 1KTNA 4WY0F 2NUXA 1KFEA 2FPYA 1EGMA 2WAGA 2AMXA 4MWAA 1U22A 1TELA 1X1ZA 1WZLA 1BVWA 1SJBA 2X09A 4YS1A 4TO8A 1MDRA 4AC1X 3BV7A 3FOKA 1L6FA 4CNTA 1UWTA 4F0MA 2PDIA 4DLMA 2CC0A 1O66A 1EC7A 5XIAA 2IKHA 4G1NA 3DUGA 4DELA 3EDJA 4ZQMA 3LUTA 1OM0A 2FJUB 2J7DA 4IGNA 3I7RA 4QG6A 5DY2A 2WW5A 4CNPA 1JCNA 3TR9A 1Z9AA 5BU6A 1TE6A 3LTYA 4ATDA 1ZGDA 3UCDA 2DQWA 3P6LA 1R9ZA 2VL4A 3PJUA 3H22A 1X1NA 4E5TA 3TEVA 2J7FA 3GIQA 3TKFA 3QYQA 4ZO7A 1SMAA 2ZZ2A 4MYAA 3UR2A 3H55A 4GFIA 4AWUA 1XGEA 4RE4A 4RZ5A 3B0VC 2PP3A 2DSWA 2FZNA 1GOMA 1XLMA 2Y89A 2Z26A 5GNYA 2G4FA 2ZUSA 1J18A 3V0SA 2ZRZA 2J4GA 4D6FA 3RPDA 3T55A 1XLBA 1YE4A 1IEWA 3V75A 4RZ6A 2Q8ZA 4KRUA 1IV8A 3QKEA 2F8QA 3PZ9A 1OK6A 2HROA 3LQGA 1QBBA 5ABGA 2JGYA 4C1NB 3ERPA 4Z1DA 2PWEA 1R30A 4S3GA 4AEOA 3GXIA 3GFXA 1QDSA 1M3UA 5FEXA 1ZBCA 1MW0A 2QVNA 3I7QA 3AYTA 4AD5A 4X3ZA 3QGAC 1QNPA 3K1GA 4CCZA 3WBXA 1ZJIA 2IKJA 4R33A 3GM8A 3SRDA 2VURA 4J1OA 4RV3A 5BOOA 2J66A 3UG8A 5FCZA 1NFGA 1THFD 3BMWA 4JIHA 4PL2A 4H6EA 1H2JA 3MS8A 2BY2A 7REQA 2QVHA 2B4GA 4W85A 3BSMA 1OVDA 1VEMA 4EWND 5A8QA 1WPCA 3M0XA 4Q4PA 3BW2A 4UNLA 2RGMA 3CQJA 3VZZA 4UFMA 5A8OA 5JXQA 1WO2A 1W3TA 5C9XA 1K02A 2QS8A 3SI9A 5FJTA 2PGFA 1KM4A 1J6OA 4JTHA 2DDXA 4O53A 3PZGA 1GORA 2C15A 1WKDA 1Y65A 2C19A 1G01A 4L4PA 1IR1A 3F2CA 2WC3A 4QG8A 5CJNA 4HT3A 2J27A 3G8EA 2WBKA 1FWWA 1PBGA 4MNLA 1B3YA 3CMGA 1LOLA 1V5XA 3CUZA 3VA8A 3QR1A 4UTHA 1MRQA 2XU2A 2DVTA 1QI4A 2ZX8A 1U1HA 2EPOA 3WH7A 1S2AA 4LAZA 5A3HA 4AQLA 4GVHA 2RDWA 2FHBA 3LX9A 3BW3A 4U33A 3AMKA 3W27A 3OQEA 2Y24A 3O07A 2C0AA 2H6RA 5DMMA 3CIWA 3CUXA 4JTDA 3OQ8A 3ZLGA 1XRFA 3D46A 5DCEA 1X1OA 4N7QA 3S46A 1LORA 3RRXA 3TTOA 4HYWA 4MTVA 3F4WA 1MFUA 3LXBA 4XO7A 1UA7A 5BXTA 1JXJA 5G1TA 4S2BA 3G22A 2DH3A 2VUNA 4KRZA 2OFJA 4LC8A 3AZRA 3S1WA 2QPXA 3TJ4A 1EUAA 1GW9A 4B15A 1F6YA 2X40A 2BGSA 2ZDSA 3DYMA 5C71A 4BWLC 1KBIA 3W87A 1KV5A 1KM5A 4FX7A 1Z8AA 3UCCA 5I79A 5I02A 2W62A 1TPUA 3C56A 3IVSA 3K4WA 3WZ0E 1ISZA 1OINA 4YIWA 2BOGX 4O8AA 1SZFA 4JFTA 1RCXB 2VCCA 3T40A 3FIGA 3TIMA 3U3HA 3SUVA 1CGTA 5FAJA 3NO5A 5LA1A 3V5FA 1HVQA 3EWZA 1SO3A 1S5VA 2PDYA 3WUGA 3OVRA 1J93A 4AWEA 3CV7A 1EZ2A 3QSTA 2YXXA 3VKDA 3N4AA 1LWHA 1QWGA 3H2FA 2E40A 3QW3A 2AQVA 4Q4QA 5MHBA 4XIAA 4P8VA 2HS8A 3HBLA 3O7UA 3W7IA 4CNOA 4DUVA 2PDWA 1S1PA 2CBUA 3KLKA 4JTEA 3FVMA 1JYXA 1W9DM 3C5QA 2WLYA 2I57A 3PPCA 2PU0A 2G96A 3VUSA 5I2UA 4RZBA 4O1DA 1BF6A 2QJHA 1FY6A 3S5ZA 3WNOA 5B7ZA 1R3WA 4LWWA 1O68A 4XIMA 3C2RA 5BNKA 1E4NA 2W79A 1QK2A 4UNKA 4IHCA 5LZLA 2NXIA 1W5PA 3QW4B 4ZCWA 3G1FA 4LUTB 3GU1A 1ZTVA 1R85A 1T5AA 2P8BA 4K8EA 4LS2A 3ONBA 1JZ6A 2QT3A 2JALA 4J3TA 3BSHA 5FEZA 2NXGA 2JEQA 3ZT5A 1CPUA 3LHZA 2TSYA 3WDHA 1ZAHA 3VD5A 3A9BA 3CH9A 4XBKA 1B9BA 1G4TA 3L0GA 4D6IA 4H00A 4PMDA 6A3HA 2D2HA 4C7FA 1E4MM 2F38A 5A69A 1SSGA 3BGGA 4REQA 3PB2A 2RUSA 4WQ6A 3UETA 4N02A 1LRNA 3WENA 3T2QA 3EX2A 2VTFA 1UWUA 3BOXA 2FMNA 2WZMA 4V1YA 3N3TA 1JAEA 1EDTA 3FXYA 1ZNNA 3RXZA 1NU5A 1XIDA 1N8IA 3WO8A 4ILSA 2BMBA 5HK4A 4LV4A 2HE5A 4GZJA 2D2GA 4IGSA 1QK0A 4B2DD 3SGZA 1A5AA 4W8BA 1E71M 4ACZB 1GG1A 5F2GA 2WC7A 3Q2DA 3VIOA 1HNYA 3PUOA 3H7VA 5LIUX 2D69A 2PTWA 1WCGA 4AD0A 5I6SA 2GK1B 4TMCA 4DJEA 4WY0B 2ZKMX 3IUIA 2BNJA 3TFCA 3R5EA 3FAWA 1PWLA 3P81A 1V3JA 1AZ1A 9RUBA 3MANA 3E2QA 3XIMA 5AZ0A 4GYJA 3GR7A 2XIQA 1ZY9A 4GJ1A 1EL3A 3VGBA 3EXRA 1YW1A 1RCQA 4US6A 3QR3A 1KWKA 4PB5A 5CQ1A 3W73A 4JQ4A 1R47A 3UBPC 1W54A 2WVVB 4PE8A 3UJRA 4IQDA 1MZRA 3AISA 1OF8A 3UZ5A 5LA2A 5LNUA 1BVNP 2GDVA 3SB0A 3MYOA 1S46A 4L1GA 1VBGA 1PL9A 3W6YA 3N1AA 1K8ZA 3E5BA 4WSJA 4GJIA 5BZAA 4OV4A 1FRBA 2GGJA 2X1SA 4XKMA 4Q8PA 4K6AA 1P1MA 2NV2A 4WXYA 2FYMA 2A3CA 5AHNA 4EE9A 3JVAA 4K8GA 3NL3A 3ZR5A 3HFYA 2ODOA 4XVEA 3A47A 3EBVA 5HQLA 4JTGA 3PZVA 3K2GA 3NQCA 1P4CA 1A5UA 4W4QA 2XIOA 2INZA 2QCLA 2H8XA 4AAJA 4JFWA 2OQYA 2J7CA 2C91A 2FQIA 2CLKA 3EDDA 4AF0B 5AC7A 2E5CA 2ZX7A 1W37A 4NY2A 1S5MA 4UOQA 4MGGA 4JQ3A 1KRBC 4HHMA 2JF7A 3CIVA 3OZOA 3AU6A 3SN4A 2QPSA 3TQ0A 3PANA 4M7SA 4GQ0A 3QMSA 4PH6A 5AY7A 3CWNA 3MY9A 2CW6A 3I6TA 5A6AA 3CZKA 2EKGA 2PI6A 4E2DA 1UD2A 4O12A 1F3TA 4HHHA 3PFRA 1V02A 2QCGA 4PUDA 3AXHA 1ZRQA 2JKAA 5M1TA 1OK4A 3GFYA 3WD4A 2X1IA 5HWMA 4ZA0A 3BG5A 5U7SA 4LNYA 3D6NA 5D38A 1DXFA 3GU9A 1VQTA 4ZO6A 3UP8A 3W7QA 1KGUA 3MSDA 5I0DA 3TC6A 1PSCA 4AH7A 4X0NA 3A3WA 4LRSA 1GZ1A 3RGTA 3LM7A 3V0UA 3VIIA 1GVYA 1KKOA 4RJEA 1T99A 2Z1WA 3OU8A 1P43A 3P74A 3MDWA 5KMYA 3CEPA 4FSAA 4PMZA 1EPXA 1OFEA 3E2RA 1E40A 3WBWA 2VOTA 1U1UA 5TD4A 1XYBA 2C0HA 4CD8A 1WKEA 2OOGA 2FZDA 1JDEA 3MC5A 6TIMA 3STCA 4F79A 3GVGA 2VQUA 1ZCCA 5FESA 2X2GA 1X97A 4WR3A 4JPGA 1CGXA 2RGLA 2XWEA 3CS2A 2CETA 1MEHA 1RXOB 1GT8A 3UR8A 4Z17A 5HWJA 3QGKC 4YHEA 4GABA 1JI2A 1E0WA 1VB9A 2KX9A 1Q45A 3AS2A 3PHAA 3APYA 1CW2A 2FTPA 4M82A 3FEMA 3OTRA 2YCKX 1GKPA 2YBVA 3T0TA 3GG8A 2Y4SA 1PKMA 1QTWA 3LXCA 4LEFA 1H1NA 2YIHA 2BVTA 3RM4A 4N4QA 1ELSA 2E3ZA 1FUYA 4GX8A 3PJWA 4RDZA 5AVNA 3GBEA 3R94A 3O8AA 3L5LA 3AMCA 2X16A 3M0MA 3VKKA 3AUJA 2CYGA 4ZZ9A 4AY1A 3LHUA 3VK5A 2YPIA 3PTMA 4RCXA 3B97A 3QOKA 2D2JA 2DZWA 3SQLA 5CKSA 4NG3A 3A4AA 3DH7A 5D9MA 1QATA 4XZMX 1LL6A 1DWFM 1EJVC 3RU6A 1OJXA 4TXEA 2GJRA 1ZZMA 1EA9C 3O9NA 1WX0A 4C6KA 5ABTA 1VEPA 1UZDA 4O54A 4WSKA 2DVXA 4AVOA 4AYSA 2QCNA 1H5YA 3TYBA 3G18A 1XLHA 3BE7A 4S3EA 1NQ6A 5TBOA 1T7LA 2TODA 2Z6JA 4XV0A 2WHJA 2Z2UA 2FVKA 5C2GA 3WEZA 2QDDA 3NCOA 1MUCA 3VAVA 3LBMA 2NUYA 2UBPC 3V4BA 3URQA 1OX6A 3EOUA 4O0KA 4GK8A 3QPZA 4P8WA 2Z1KA 4IQEA 1XBYA 4AMAA 1FH8A 3HGJA 2H8ZA 3SCNA 4R5EA 3QEZA 2WPBA 5C5YA 1ISVA 4GC3A 3OZMA 4GA8A 4UR7A 1BWVA 4LV9A 4PUMA 1CXEA 1E0TA 5I09A 3ITTA 4I9AA 3B03A 1KFCA 1PWMA 1OSEA 3CM4A 4ZBCA 4Z2IA 2V81A 3P84A 5AC6A 1LUCB 3B9DA 2FH8A 4IPLA 1EF2A 1Q6LA 3TNOA 5D02A 1EQCA 1M01A 5CBJA 1FP8A 4Q8VA 1J0YA 2R14A 3FEQA 4UTKA 4UZSA 1ZAJA 4UUIA 5H6HA 3LRLA 1KFLA 4AMCA 5D04C 5EFDA 1E3ZA 3FHQA 1TV8A 4JY9A 1H7NA 1PJ9A 1DIOA 1C3FA 2QAFA 2XDFA 4NASA 3ZM8A 4PB4A 2CXGA 2PZNA 4X22A 1GYNA 3FGCA 3W2NA 1LQAA 3QM3A 1E4LA 2WSPA 3N4EA 1RALA 3WL0A 5T9BG 3CZEA 1UIPA 1F74A 5DMNA 2ZA2A 1HJQA 2GFTA 3ECQA 2W92A 3AIBA 1QI0A 3E74A 4WKAA 4QQ3A 3ITXA 1KXTA 1SZEA 4GGHA 3MWCA 3FDKA 4KERA 2CKSA 3GAKA 3GKFA 4A29A 4H6KA 1DIDA 2OZ0A 1ZHAA 3SADA 2NQJA 4PUNA 2VCBA 4LTSA 1RZMA 1SYTA 1CGWA 3KOFA 3NO1A 1XYLA 1QPOA 7REQB 4PMVA 2IPJA 3VGFA 5F1UA 1GONA 3W1MA 1XIGA 2HISA 3THAA 1R7AA 5CLWA 4R85A 5LNVA 1TR1A 1W1ZA 4L4OA 3O6YX 2E25A 4YL2A 1LP6A 1PCKA 4GYPA 3G24A 1AUSL 1A4LA 1VFTA 2Z28A 3BAKA 4LPCA 3DCPA 4M19A 1OADA 2HJPA 2VNCA 5D8ZA 3NO3A 1UR4A 1W5NA 1XSKA 4GIEA 3NSXA 4EXQA 1OWQA 2RJGA 2ATMA 4AB4A 1U2YA 3BK0A 3XISA 1X6NA 1HUVA 1SO6A 4DXVA 4J28A 3ZR4A 4V27A 3I10A 3N2XA 2PDJA 1R3VA 3IARA 1GWJA 3EDKA 3VIGA 2YLLA 4B90A 3ANUA 2OYLA 1P0BA 1V6YA 5JIPA 2J74A 3BUVA 3IIZA 5AECA 3M41A 2G8ZA 1G7UA 3Q37A 2ZXBA 1UR3M 2J8TA 4U3AA 2GGGA 2ISSA 1XBVA 2YJQA 5HOSA 1TV2A 1TPH1 4IWWA 1DJIA 4QNWA 4HSHA 3MTWA 5MKGB 4W86A 2C3ZA 3W7NA 1IIHA 1US2A 4CN4A 3FJLA 3R8RA 2O9OA 3V5OA 4I9JA 1HKVA 1OFBA 1O5RA 2ANUA 1E0UA 3MV11 1W2VA 1A50A 1DPMA 1H7OA 3GVVA 3CZJA 3KOWA 1V03A 1PTAA 1TX2A 3S4TA 3WLSA 2ZZ5A 3W81A 2D1ZA 3E2VA 4IXXA 4HVXA 5BXRA 2PGWA 4NZ1A 3LI0A 1AG1O 3WDIA 2VEGA 3F4CA 5JH1A 3W07A 2O9RA 3NQVA 1FWJC 1DQUA 1WOBA 4AZCA 4R27A 1ITUA 1WBHA 1YNYA 4EPDC 2VDGA 1UJQA 3FJ6A 4DM1A 3YPIA 4GYFA 1HW6A 5G2HA 1T40A 5E6ZA 4X2PA 2ASHA 5DBTA 4D6CA 3PBMA 1Q65A 4Z08A 2REQA 4WOZA 1J4EA 3IVUA 4ACZA 4JYEA 1E15A 4PSRA 2XSXA 1ME8A 4B2DA 2HPMA 2O4MA 1NF0A 2XH2A 3MMDA 2Y7FA 4LS0A 4D2JA 1TWIA 2E5BA 1BG9A 2ZUTA 4DF1A 4CD6A 2VFDA 1XLIA 4JL2A 3B0PA 5G2IA 3CH0A 2GOUA 3TJXA 5CC7A 2XFRA 2GZXA 3QPYA 4XBSA 1W1YA 3I3BA 3IS4A 4DNHA 3W1TA 3NGFA 5REQB 3CUJA 4F0SA 3A6OA 4WY0A 4XQ6A 4Y9NA 3LGGA 5CCZA 2PFHA 3TYUA 2PC4A 4LB3A 3ITCA 2INEA 4C65A 3P5YA 2BY3A 4NNAA 5C6MA 4I8DA 4ATLA 3UWUA 2CZDA 2E8YA 2WCSA 3UXLA 3ZR6A 4YCOA 2XGZA 1JYWA 1XX1A 3RMJA 1DHPA 2PWVA 3LHYA 3L2IA 4B5VA 1A47A 4C60A 3W38A 3OODA 1K6WA 4JIPA 1GNXA 5HPCA 4JNYA 4GVFA 2PLJA 3I3DA 5F4WA 3S2MA 5AHIA 3OBKA 4HU4A 4H3DA 4R7WA 2DEPA 3UD6A 2WVSA 3IV3A 4Y9AA 5ABHA 3BMVA 5I3HA 1VENA 3LTSA 5GPRA 4PUUA 1K7FA 1NDYA 4PBFA 1F6KA 4LJ3A 3QN3A 4LW7A 1UASA 1TVNA 5FJJA 4FLQA 1HGYA 1R9XA 4H7CA 2GLKA 3NQEA 3W23A 4TIMA 1ESWA 1NOFA 3IVTA 3PNUA 4HJFA 2NQ9A 4HN4A 3PG8A 2CXEA 2GWNA 4DF2A 3WLLA 3G1SA 3N04A 3GFZA 3RILA 4JNMA 4AZBA 3SCUA 4R7OA 5CSUA 3UW6A 1SZRA 3PZTA 3TLLA 1TUXA 3DXIA 4N9BA 1XCWA 3NQBA 1TVPA 4QGCA 2AQOA 1XYFA 5EMMA 4JQAA 1PYFA 4BR1A 1BLIA 4IICA 1S2CA 4X0VA 1H11A 1AH0A 2PDLA 1NWTA 1JEZA 3QJAA 3VKJA 3PSWA 4WJEA 3RPMA 1FFQA 4UIOA 1M03A 3QHMA 4LF1A 3VD4A 2PAJA 1LTDA 1ISYA 4RE3A 3OYXA 2VOMA 3WYZA 3RM8A 3V3WA 3M9YA 1FXPA 2DJLA 1JFHA 3JW7A 3BSGA 4ZGYA 3S9IA 2Q3RA 5EMUA 3L7RA 5D30A 2IPGA 1XC4A 4B91A 4NT0A 3UZWA 2W27A 1Q6OA 1K4GA 4M6VA 4NU7A 4FR1A 2YA0A 5E6YA 1XGZA 2EJAA 2DFAA 3S5SA 1M9HA 5EMKA 3TTEA 4RNIA 5I06A 3RIKA 4FIRA 3L4VA 3T08A 4M8UA 5T9CE 4FAMA 4MMWA 1H0IA 1KA9F 3WSUA 2VX7A 1AJ0A 3QC3A 3MB9A 5AHFA 3RYSA 2CLPA 1OF6A 1WDRA 2PRHA 3EKZA 4JAWA 2ADAA 4XISA 5CG7A 1B30A 4M56A 2V9DA 1OT1A 3UQNA 4GO9A 2PDUA 2VEFA 3LGEA 1EP3A 1QBAA 4GMEA 3ZZ1A 2X2YA 1CI1A 1PCWA 3U8GA 5F7UA 4DBEA 3ITYA 5FL1A 2DQXA 3GNRA 5I77A 3TX9A 1H7RA 4KF1A 4EP8C 1O12A 2JBMA 4O13A 4GJJA 1XYAA 3SCQA 2WBGA 1Z41A 1R3QA 3G8RA 5FA5A 3GNPA 3UJEA 3PF3A 4XUGA 3ABSA 3VDHA 1IQ8A 1JR1A 1I2QA 3BGJA 4DWSB 5DO8A 1S5NA 4H01A 3LD5A 3KWXA 2YCLB 1A5MC 1ODZA 1OCJA 3WH9A 4DJDC 2TMDA 4QG9A 1FA2A 3U7VA 1SUXA 1VGAA 4YTUA 1EUNA 3LRKA 4FOJA 4OBSA 1UOZA 3B9EA 3KHJA 4IL0A 3CJPA 1TA3A 1M6JA 3AS3A 2XFFA 1N7KA 5GJPA 3ZJKA 2R1LA 4PFMA 3IK4A 3ARXA 4W5ZA 3TN5A 3UGVA 3VOHA 1NJJA 3K4AA 1LT7A 2DIJA 3VE7A 3ZT6A 1GJWA 4LCRA 2BV9A 3QLLA 4GH3A 4ERAA 3WLNA 3BLLA 3W6MA 3ZVIA 2J7HA 4QJ5B 5CZSA 1RCOB 2HXTA 3ZS4A 3LK6A 1IIGA 3H23A 1QW7A 4R34A 3TVAA 1I45A 3KBVA 3UF9A 4NZ5A 1MW3A 5LXXA 4DEFA 1ALDA 4A8RA 2OXNA 4RDVA 4K8HA 2DT2A 2VFIA 3T6CA 6ALDA 3GVRA 4DAIA 2OVLA 4MDPA 3MSRA 1JDFA 3H6OA 1AH4A 4L9ZA 1AQ0A 1TPFA 2J62A 3KTSA 3W7LA 4UCFA 4LEQA 3UY8A 2QKFA 2J9XA 2Z7KA 1W31A 4D8LA 3IUDA 1JZ3A 1M7PA 3T2OA 1O4UA 4DYEA 3QVQA 1J2WA 2EPMX 1UR8A 4P7RA 1KXQA 5FF2A 2BG5A 3S1VA 4GIRA 2PE4A 4IMAA 1XPGA 4DJFC 1JFXA 1PDZA 2E6YA 1CX9A 3BH4A 5DCDA 1MQRA 4A2SA 1TZ7A 3ANVA 2F6UA 1JCYA 4C7GA 2JIEA 2ACRA 3NQ8A 1PYMA 4B92A 4DJFD 2ABBA 3NWRA 2V3GA 3M0KA 3ZLFA 1BEUA 1A5BA 1E9YB 4HNVA 2PRLA 1FWDC 4ZB2A 1CLXA 3F5JA 3LMYA 4IP7A 4MY9A 1HJVA 4BS0A 4TU1A 5TF0A 1NDZA 1O5KA 3GKAA 2CWNA 4MWAB 2V5JA 4ZQNA 5D37A 3FY1A 4UB9A 2J7BA 3VCRA 3QPEA 1EWDA 2PP0A 3K30A 1XC6A 3H8AA 3ZFHA 5DXYA 1XD0A 1IYXA 1W32A 4H2HA 4O16A 4C7DA 1VLIA 4UNIA 3W85A 1B54A 4B9YA 1HP5A 1KD0A 1MQQA 2Y8UA 3KCJA 3P93A 1W9PA 2KAUC 3KZPA 4MWAE 3C6CA 3PBYA 4V28A 4WOQA 2W67A 1G4EA 3P0XA 1UD4A 3W1NA 1ZCOA 1LT8A 3O6DA 4PMNA 3TP4A 5H1WA 2Y7EA 2V30A 3KWSA 2JQXA 1JZ8A 3BJSA 3W4RA 2WZIA 3WBYA 1UZ1A 4HA3A 3MP5A 2D0FA 1W0MA 1J2BA 3VINA 7TAAA 1H49A 3K46A 2D73A 4F48A 3V35A 3AIVA 3OVGA 1XG3A 1DOSA 1X8CA 2FFCA 1MXGA 1OYBA 4RE0A 2WANA 2A7NA 4FF7A 2HK1A 2HEJA 1KM6A 3RM9A 4GUGA 4DXXA 3H4WA 4JNZA 2R94A 1J0KA 2E77A 4YHGA 5ABFA 3JR2A 3UYCA 3WDQA 3TQPA 2E67A 4Z0SA 2PGRA 4MLRA 1A3WA 2D23A 4C91A 1VEOA 2PURA 1NWSA 2P53A 1UBSA 3THCA 1G67A 3VMNA 3W1LA 3GR4A 1ZPTA 4JN8A 3W72A 2VZOA 5IHRA 3USZA 7ODCA 1XUUA 1HL8A 1XSIA 3NSMA 4ZOCA 1OIMA 3SCPA 2IS7A 1PXGA 2GYIA 1ONRA 3P2VA 2OO0A 4PUEA 5M3WA 1ITCA 1C9DA 3BOLA 2F2KA 1JRCA 1K7EA 4ZSUA 4DWSD 3GNXA 5XIMA 3W6LA 1J5TA 4ZB0A 2QV5A 1PV8A 4D6EA 4Y9MA 1J79A 3JU2A 3OB8A 4IJBA 1XRTA 1S38A 1JPKA 4UR9A 4QS5A 3VKAA 1XIHA 1F8IA 4XB3A 4DPQA 3H2OA 1CZ1A 4AWTA 1EOKA 1K8CA 1R9YA 4KFNA 4A21A 1E9IA 1IXQA 1M65A 3UPWA 1GTEA 5L9FA 3KUMA 1WXJA 4IFKA 3WG6A 3LCHA 3C86A 3W7PA 1RJRA 3CPRA 3QQ1A 3W02A 4W7UA 1PAMA 4ENLA 3BAYA 5FI8A 2FZMA 4CQBA 1PZ2A 4N9CA 2VHLA 3SUTA 1IWBA 3PB0A 4DO5A 1TYGA 1XFBA 2CHNA 5LIXX 1XBXA 2CLEA 3GAYA 2HBXA 4LU0A 3KVJA 1F73A 4RE2A 3HPAA 1ZP4A 2EG8A 3VGDA 4S38A 3UNTA 4GUJA 1E9ZB 1R6WA 3KL0A 3EX4A 4UTFA 3GG0A 5A95A 2ZOXA 3R8HA 1F9CA 2WZHA 4RKAA 4MNKA 1WKYA 2ZA1A 1GW1A 2ZX6A 1LL7A 3R1ZA 4OFCA 3V36A 3L9CA 4OJYA 2DIEA 1JDAA 4GLEA 5HUOA 1YE6A 3FV9A 4KW2A 1TR9A 3W2JA 4MB4A 4D8ZA 3EDEA 4IOTA 4XKYA 2PS2A 1W6TA 4CD4A 1FCBA 4AU0A 2FDMA 5CSRA 3LLXA 3WF3A 1UOKA 4PRWA 3LCLA 1DVJA 4AZHA 3QMTA 3MDUA 6REQB 3FLUA 2QXWA 1DE6A 5DCBA 4O18A 4ADUA 5DT5A 4NJKA 1W8SA 1FWGC 4FK9A 4ORMA 3GNOA 3QBUA 4YLWA 3ATZA 3EEZA 3WQ6A 1REQA 4NKCA 3M5XA 4HMDA 2ON3A 3TN3A 4I7UA 1R8LA 3GYCA 5FAGA 1X7FA 2E68A 5A6BA 1XLFA 3SRKA 2OKTA 3KTXA 3S2LA 1JCTA 4S3FA 5AFDA 1BHGA 1AFSA 3ZT7A 1K77A 3NYZA 3O16A 3UY7A 3WMSA 4V33A 4NUWA 5IM51 4UTWA 2YW4A 1ZJHA 4Z2JA 2YL5A 1UA3A 3LSCA 3MBFA 2BP1A 2QUUA 3UZXA 1DEDA 1TRIA 3TE9A 4HCHA 3EB3A 3NYDA 4L6HA 1N2VA 3QV8A 3FK4A 5HA7A 2OJPA 4P7QA 1G9HA 4QE1A 4H9TA 4JL1A 1UZHA 1GPWA 1ZS2A 3PBVA 2NT1A 4HPGA 3L67A 2X7WA 4Q32A 3BQ6A 3GQYA 3TFXA 3W71A 4E3TA 2CERA 5PTDA 1EO5A 1ZL1A 2OO6A 3AXKA 3IJIA 3S2NA 4JFVA 5G4EA 2GSEA 2VR4A 1WB0A 3WNMA 4KBXA 3TZFA 1V08A 1DWIM 1ONWA 1WV2A 4QEEA 3UFYA 4LAMA 3SBFA 4HMNA 2IPFA 2Z24A 3S2JA 1C93A 2Z1BA 4YTSA 2J9ZA 2D20A 3E9AA 3FSUA 4ZE4A 4E2VA 3NOEA 1CXHA 3LI1A 4QDPA 1H09A 3IRSA 4PTMA 4LYKA 5CH9A 3SCTA 1POKA 3MHGA 4F9JA 5I03A 2OGYA 3PBUA 5A94A 1OD0A 3HB9A 4WHBA 5REQA 3AC0A 3QF0A 1NY1A 1HIZA 5FKYA 4MJMA 4E0CA 1UP0A 3WMBA 1YTDA 3EWCA 3S3GA 1OG0A 4QX4A 2UV8G 5CSSA 5I3IA 1JF6A 2G50A 3NZGA 1IEXA 2OX4A 4ADSA 1CWYA 1Q7QA 2CIPA 4O8RA 1S2UA 3BLIA 1KRMA 4O14A 1TB3A 3EWXA 3KBJA 4PC8A 1BGAA 5HR6A 1PTGA 1UW9A 3ITLA 4IH3A 2OR2A 4HCLA 2WVVA 1UQYA 3DFSA 3GXFA 4OT7A 3M6DA 3AOFA 3H24A 4GZEA 3TXVA 1DHKA 1UKTA 4YTQA 4IJRA 4WX2A 3VOCA 4HU8A 4IT1A 4W7VA 3NQFA 3HA1A 1AD4A 1IEQA 3G2GA 1H51A 3DFPA 2Y7DA 8A3HA 3QQ0A 4IIHA 4TR9A 3H53A 3KX6A 4JICA 4IGHA 4NNBA 2AAMA 1W1B1 4UTWC 1UKOA 4GNJA 1B9ZA 4KT2A 2XVLA 4HZ8A 2PDKA 3SECA 5E0CA 4XKYB 3C2VA 1MI3A 4YWIA 4UQCA 1TJPA 1TJ0A 3PWAA 2YDSA 3A4WA 5AN7A 5TAOA 4PTNA 3W37A 3IWPA 1E43A 2E7FA 5CC3A 3TAOA 2PU1A 1V4YA 3HPFA 1HO4A 3TSMA 2RDXA 1NVMA 1IXPA 1VYPX 4AY7A 1O94A 2QUVA 3UXKA 1X7IA 1JJKA 3W24A 3PPFA 3NVTA 2NV9A 1JG9A 4GQRA 1B90A 3TCEA 1UJPA 1Q7MA 3TROA 4N6EA 3WDJA 1UCWA 2VR2A 3VVGA 1UROA 2BHUA 1EDGA 4FXSA 4Q4KA 3F7JA 3DKJA 4CLMA 2OWCA 1NDVA 4CEXC 5HR7A 3TMQA 4OBRA 1OX4A 1FTXA 2QCEA 5IOBA 1G6CA 3DGBA 1RLDA 3G77A 1XBZA 1KCZA 5IBXC 2ZIDA 1JZ5A 3VX0A 4XZ9A 2O56A 5BROA 3NM1A 3TJIA 3WX7A 4PUJA 4ZQRA 3QC0A 3AO0A 3U2ZA 1QI2A 2ATSA 1LCOA 3POCA 2I56A 2B0MA 3CO4A 1GOWA 3C61A 4Q7BA 4KIRA 1V3HA 1E6XM 3WJWA 2ACUA 2CHOA 3EOSA 2GJXB 1LYXA 5EMYA 2NUWA 3BAXA 5ABEA 3IGHX 4JOMA 4HCDA 5CG0A 2VUYA 4UCGA 4GBUA 4MJ4A 2F6KA 1KM3A 5T8GA 4MPKA 3VIMA 3TYZA 4GUFA 1XIEA 1J10A 2J78A 3A13A 2XIMA 3QRHA 1EXPA 5AYBA 2AOSA 3WD3A 1QXLA 1ISWA 3UWQA 1FCQA 1NDWA 1RY8A 3EWDA 4JX6A 1E0XA 3WFAA 3KRZA 1TZZA 3FXGA 3MI2A 1J9YA 2DW7A 5HATA 3BCDA 1QPNA 3REQA 1I2OA 2DZXA 4PRTA 1ECEA 3GU2A 3B8WA 4AF0A 1TTQA 1AQMA 1UPMB 5CPOA 1BKSA 3SCWA 4ZXLA 2ALRA 3USBA 2OB3A 3GD6A 1RP8A 2Y2WA 4OBTA 2WCGA 3LMZA 5AKQA 3ZO9A 4NAEB 4BHYA 4WDUA 3MU7A 1OEPA 1WA3A 4UTTC 4A2RA 1NELA 1VBJA 3QV7A 3ISIX 5HUPA 1XV8A 2ACQA 2QUNA 3IJLA 2VD8A 2BXVA 3DHDA 3RF9A 2PZ0A 4O0ZA 3HGOA 2DZAA 4BI5A 3BLKA 4Y90A 2A3LA 4CVWA 3C0QA 1XIIA 1AJ2A 3W1XA 3CMJA 4BFAA 4DAFA 3VKBA 4GD0A 1BKHA 1U5HA 4OVXA 1GKQA 3LBCA 1I9CB 1O1ZA 1H0GA 5AYZA 5CJMA 1X96A 4GQGA 1JXKA 2RDUA 2QPUA 5DT7A 3O1NA 3REQB 3NXLA 3TSBA 1WAWA 2Z1VA 3EX3A 4JFSA 1Q2SA 4H83A 3KHDA 1VHNA 1O7AA 3W7KA 3FX4A 4QSFA 3NEVA 2DIKA 2EG7A 4F2UA 1LF1A 4D1IA 3WK0A 2GQ8A 3A12A 1EO7A 1XQKA 4UBPC 5FJRA 1S2WA 2PDNA 3A23A 3VNYA 2HTMA 1P0NA 4JHOA 2XIBA 3F1QA 4P2VA 1V0MA 2WSRA 4QJ4B 1TJRA 5C7HA 3R89A 5BRBA 2CCRA 4XD4A 3WLHA 2GVLA 2VRQA 1FVPA 4NIRA 3TW6A 1RVGA 3CASA 4WUIA 5LGZA 3MUCA 4Q7IA 2CLIA 2YXOA 4PR4A 3KFTA 1P7TA 1SPQA 2OLAA 4J3UA 3F2DA 1EP1A 3IJQA 2VCAA 1PTDA 1XISA 2VVNA 3KVLA 1J0IA 3EMZA 1QASA 5D2WA 2I5IA 1ICSA 4EXAA 3S9YA 3UJFA 3T44A 3GYEA 5A6KA 4OE7A 5J5RA 1IT7A 4PYSA 3QY8A 1XXXA 4QHRA 3LV6A 5C54A 4CN6A 3NAVA 2TRSA 1V6UA 3CU2A 1EF3A 4DLFA 1HL9A 3WNNA 3H4XA 3G1VA 3KOXA 1SFSA 3OG2A 3K13A 3UYIA 2PCEA 2GDUA 3IV8A 3M0YA 3QZEA 4XZLX 3N13A 1BYDA 4TX6A 1VCGA 4GH1A 1R3YA 2HE8A 4NRRA 1H7WA 1TV5A 2I1OA 4ZEPA 4RPPA 3W22A 3AUOA 4FPSA 2FTWA 2R82A 5CBBA 4UZUA 2EPNA 3WMLA 4FHAA 3VABA 5JH2A 3MUAA 1OY0A 4UC5A 2DUXA 2OKOA 2QYGA 1LQ0A 5CPLA 2VDHA 5DMLA 3B8IA 5BYWA 1KBJA 2ZRVA 1PO9A 7XIMA 5SWUA 4JKMA 1QW9A 2Z0IA 2QMKA 1FXQA 3DKLA 1JI1A 4FA3A 3EOOA 3ES7A 2VZTA 5C7VA 4LVFA 2W61A 4HQVA 4O15A 5FF4A 4UMAA 8XIAA 1W5QA 2W66A 2Y5EA 3D0CA 2F84A 1U83A 4UTTA 3GH7A 1BQGA 3HGRA 1SQ7A 3NZQA 3U5YA 3N12A 3KM8A 2QHAA 3VYLA 3QV9A 1LROA 4FOKA 4DZ5A 2NX1A 4Q33A 2FHFA 2O92A 3GXPA 5C8BB 1VFSA 2ZXQA 3WQ4A 2PDXA 3MA8A 3G6MA 2XSAA 2FZBA 1TZ9A 1KR1A 2FGBA 2VENA 1XLAA 2J77A 3SCSA 3VGGA 5A6BD 4AHPA 4WRHA 2YSWA 5CPMA 1MMFA 4LYRA 4DXKA 1TQJA 3C0SA 1M5WA 1TG7A 1J6PA 3SEPA 3C2OA 2PLCA 2PTXA 5ECVA 1LG1A 3WLMA 1W9VA 3ITVA 4I5UA 1QO2A 3GDLA 4ICCX 3NZ1A 1RJQA 3L65A 1R5YA 2C18A 3KVKA 4EPKA 1RR2A 1RQHA 4R88A 3PAJA 2DZUA 2PBGA 2HVNA 4LX4A 4FXRA 3FJNA 4U5KA 1OT2A 2HQAA 3CHVA 1Q8AA 2J6XA 2OOFA 3G1YA 2QDGA 1GQIA 1CCWB 1KW1A 4HPXA 4HK7A 1JULA 3VMOA 4UTUA 1QVBA 3AWNA 3OGSA 5CZKA 3TOPA 3NNTA 1X6LA 4YXGA 3LTPA 4X9YA 5LHEA 1SSDA 1VJSA 4JKKA 2QDEA 4WDWA 3OGVA 1SM9A 3B06A 1KCKA 1TQXA 4AC7C 4HMEA 3GHRA 3PWIA 4O50A 1F61A 1SO5A 1OGGA 3FN9A 4IFKB 4UQDA 2W4XA 3B8SA 5AOUA 1QT1A 4F8XA 2FZ9A 1WKFA 2Y61A 3JRKA 3EPNA 5AHMA 4NRSA 1FWIC 1NH6A 5D4YA 2VXNA 1H4PA 3N2OA 3RLUA 6TAAA 1XW8A 3IJ9A 3TSDA 3MO7A 2Q6ZA 2E1WA 2VZSA 4TX8A 1LZOA 4UTLA 5D2XA 3GUWA 3G0XA 1GVIA 1PVNA 1UH4A 4W8LA 1ZJBA 1W1IE 4DO4A 5DQPA 3LCGA 1Y0EA 2WMIB 1NOUA 1C7TA 3XINA 3G5EA 3QFEA 3OZYA 2F7FA 3HO8A 3CIXA 1JF5A 3LHTA 4RPQA 2QCDA 4RNHA 5EMJA 3EA2A 3FA4A 2HK0A 1XIMA 1C7SA 4NZFA 1TV3A 4KQNA 1IF2A 1CBGA 4WIWA 2VX6A 3A64A 1E1CB 4AIUA 1OFDA 2XGBA 4DB7A 4GWEA 2OODA 1A53A 9XIAA 3LEPA 5JMUA 3TC3A 4E3VA 1R3SA 3A21A 1H60A 3H21A 2C16A 1LBFA 2QCFA 7TIMA 5KTLA 3CT7A 2V8ZA 2D22A 5K4ZA 2V3DA 4J7RA 2A85A 1W3NA 2CEQA 2E5DA 2IXUA 2OSWA 4DYJA 3A22A 2WOQA 4QDWA 4MB5A 3C0JA 5TQLA 3U2EA 1VFFA 4IMFA 2FIQA 3DFOA 4HPNA 1DP0A 4PBGA 3VDGA 5IBXA 2C1GA 4XX6A 1E4IA 3DU0A 1WUFA 1W17A 4B3ZA 2E9BA 2V67A 1JAKA 1DWGM 2A3EA 2C6QA 2ZVIA 3GZAA 2ISWA 3FNDA 5C2XA 1NQKA 3NPUA 5EU9A 2YGYA 4N42A 3TTYA 1HGWA 1AH3A 3RJXA 1G4PA 1GVEA 2B7NA 3AAMA 3LDVA 3DBPA 4XO6A 2F9RA 2QJNA 3JUGA 4N9EA 2WC4A 3TONA 4DBSA 5DY3A 1I1WA 4HYVA 2ZZ1A 5JUVA 1UUQA 3T0CA 1A5OC 3EX1A 4R53A 1QOQA 5HAOA 1LWIA 3CV6A 4GXPA 4PCFA 3VU2A 4B5NA 1UD5A 2BTMA 3M0LA 3PUEA 1UD6A 4G6CA 2WKGA 3SCVA 1LRTA 2R1PA 4Q3MA 3VUPA 2WKLA 2OX1A 1EGVA 3EX6A 2VMFA 2E0PA 1HN1A 3TNBA 5J5DA 1YRRA 2XIJA 5BCAA 4QJ1A 3N2BA 3N6JA 5HMFA 2BY0A 5I78A 4KH2A 1OX5A 3ARWA 3RLGA 2ZQ0A 4JIEA 5K9DA 3AROA 1Q6FA 2UY5A 3VX1A 5D03A 4JTCA 1O95A 2XN2A 4M6QA 1H3GA 2BB0A 1RSCA 3MZNA 3FKRA 3NSNA 1BPLB 3LCFA 2DH2A 2P0OA 2OMAA 2ZC1A 2YFNA 4PFHA 4DY1A 1YYAA 4WJ8A 1TVLA 4DBDA 4GY7A 2X41A 1BXBA 1XLGA 1X38A 4HIBA 5MKGA 1WNOA 4C6PA 5CGMA 4JHMA 2A21A 1PIFA 4W93A 2MUCA 3KCOA 3ID7A 3FHAA 1W1TA 2ZZ6A 3TUUA 4HKPA 5DEZA 3IIOA 4HOZA 1HJSA 2QJGA 3AYRA 3QGVA 1TWSA 4K7YA 3DYPA 2XIIA 3P7YA 3GWQA 1FCVA 1KWGA 4CKQA 1LUCA 3NQAA 2YA1A 4L4LA 3U57A 1WP6A 2HWGA 4JYDA 3IIPA 4DJDA 1R0MA 5GQBA 2PDQA 4DJED 2WMFA 3ZWTA 3AWOA 1W3KA 3UERA 1OD8A 3QYSA 5EB8A 2GJXA 4WKFA 1BYCA 1PKNA 2X42A 4BKNA 5H2ZA 1Y5VA 5BOEA 3B05A 4IQJA 3LS9A 1CIUA 2YYUA 3IEBA 2O4QA 3BMXA 3AS1A 1VPYA 5KINA 1F2JA 3UWYA 3ES8A 4OWGA 4O1CA 4QBXA 3OIHA 3W2LA 4IISA 1JZ7A 2EBNA 4KWSA 3LENA 4B5SA 2ZFAA 3LCWA 2GSJA 1ONXA 4YCPA 4C6JA 8CGTA 3I7SA 2YX0A 5CXPA 3WUEA 2VZVA 4JTQA 3QTPA 2WJZA 2TYSA 3EEGA 3SQMA 2G37A 4NL1A 5GVJA 3LCXA 4DN1A 4WF7A 1IHIA 4I90A 6REQA 3M5VA 3GW0A 5EPDA 2NWRA 4B4HA 4AZ7A 3W88A 1JQXA 1DBTA 3MUIA 1W3IA 4FO4A 3ZMRA 3S6OA 1O5QA 3T1GA 3SGUA 1YKWA 2EPLX 1RA5A 1WDPA 3KTCA 2XVNA 4C1KA 2J24A 4YPJA 1A0CA 3L4YA 1E3XA 1ME9A 1H63A 3NQDA 2P3ZA 3WK2A 4H1ZA 3R58A 2V5KA 4Q8QA 3NXFA 2YA2A 4NI3A 4EAMA 1E56A 2QJJA 3VDAA 3BTNA 1VIZA 3HFTA 5JBDA 5IFTA 2D24A 4JTTA 1JCMP 3HG2A 3WDPP 1SW0A 3LNMA 3POHA 5C0QA 4L56A 5AZ1A 3QHOA 3T0AA 3ARPA 2WQPA 3IANA 2HPIA 2VEPA 4ZVJA 1FWBC 4B5TA 3IJ8A 2ZADA 1MW2A 3EMQA 5JBEA 2Q02A 4W84A 2OG9A 3UJ2A 4LNCA 4NXKA 4E6MA 1V77A 1CGVA 3PTKA 5HDRA 2INFA 3OLEA 4BJHA 3T78A 4OTKA 4AD2A 3BV4A 2XJ7A 4Q4SA 1Q6RA 3E5PA 5D32A 1XFCA 3SUSA 4XZNX 3T09A 3M16A 4K36A 3E96A 1L6WA 1TPC1 1KBLA 3VM7A 1DQWA 3MI6A 1D3HA 5CSYA 1Q4NX 1HXJA 4MAVA 2GQ9A 4OUEA 2WJEA 5FL0A 3MPGA 4ICNA 1D8CA 2P76A 2VFGA 1TMLA 4G56A 3TH6A 5CPQA 3Q67A 1CGYA 2O7SA 5K7JA 4U5IA 3B0YA 4RL3A 2G3FA 3G6LA 3DG6A 4FLOA 1EA0A 3R13A 3DEQA 3E0WA 4C6CA 2VZUA 3QZAA 3INPA 1SJCA 4HGXA 3TJLA 3NIYA 5CPSA 3BAIA 1H50A 1XSJA 3CUFA 1B2YA 1OX4B 1XH1A 3FW6A 3THUA 4HNTA 1RD5A 3GH4A 2GUUA 1JNEA 3S6DA 5G1MA 4N6FA 4Q8NA 3E0IA 3RPTA 1N8FA 1EPVA 5DLCA 4GUHA 4DJEC 2QUTA 3MWAA 2YR1A 4NP7A 2AL2B 2FHCA 2VYOA 2BOFX 4OV9A 2POZA 1T41A 2E9LA 5LA0A 1RP9A 4HN8A 1J11A 1ITXA 4J35A 4K38A 1HJXA 1ZQ5A 1KNWA 4HYRA 4QEHA 4HZMA 3LNPA 1I4NA 5KZ6A 1GOXA 1VFUA 4E2OA 3VI2A 4U2ZA 4CVUA 1WZAA 4IUGA 4XAFA 2VEMA 2AQWA 4IPIA 2BHZA 3RNDA 1FP9A 4RLIA 4A8LA 1H61A 5LGXA 2ZZ4A 3MT1A 1VFOA 1AW5A 3PJTA 1YADA 3TU9A 1ZJAA 3U2CA 3DDMA 4A35A 4S1FA 1H1ZA 1PEZA 2QDHA 1I0DA 1GQNA 3WJXA 1XKYA 3OLDA 2J7GA 2OLHA 4HBKA 3MHUA 1E6PA 3GDBA 1LWJA 2PDBA 2NVDA 4KKXA 3W7HA 1OFAA 3STGA 5HJXA 1H41A 3WNKA 4RV8A 3HPZA 4LB4A 3HU7A 4Q8UA 5AC5A 4CQ9A 2VQTA 1RV8A 3RHGA 1AMKA 3SM0A 1NTHA 3AHZA 4ZQCA 2VEKA 4HNNA 3SO7A 4ZSTA 3IJ7A 2Z25A 4UFJA 2GJPA 1A3XA 1X8FA 2WXDM 3EXTA 4PCSA 2RJHA 4Y9OA 5GNXA 1MUMA 2PODA 5LNRA 2QF8A 4DPPA 2F61A 1QAPA 3MYPA 2A6NA 2GDQA 3BDKA 1XP3A 2E8ZA 9CGTA 2YL8A 1YPXA 1YMYA 4LRTA 3N9RA 1WZMA 2GQAA 4FS9A 5FF3A 2FB2A 4YN5A 1ECQA 3VKCA 4J3XA 4F3HA 3A5FA 5E1QA 3ARRA 4L6DA 1BXNA 1L8PA 4TTGA 4C6LA 4GBDA 7CGTA 3W2UA 1C92A 1UUOA 1OZMA 2FMOA 5A5WA 3BL3A 3BLFA 3KL5A 2BBFA 1QNQA 2P50A 3CC1A 1FWRA 1VBUA 3OYZA 1DXEA 3CWOX 2OZ3A 5D9OA 3WFZA 2NSXA 2WHKA 3AZSA 3C8NA 5E5CA 2R24A 4XK2A 2UY2A 4S3DA 2Q3OA 2WMKA 5HJLA 4EANA 2VX5A 1DIEA 1AVAA 2WNWA 4MJZA 4GYPC 2H9AA 2PTDA 1B3VA 3L4XA 2BXYA 4DBUA 1G69A 1EFZA 5EMLA 2BGNE 4WCJA 3TW9A 1YBQB 3OEXA 4I3GA 5LKYA 1BYAA 2XPKA 1EX1A 2R8WA 2VFEA 3VOIA 3K4DA 2CESA 4GISA 2YYTA 4J3SA 3RLVA 1SFLA 4LAKA 3IRDA 5IRPA 3MJYA 4NAFB 4O10A 2ZTJA 1L8NA 1TTJA 1I75A 2HS6A 3URBA 3SY5A 3EGJA 2G4JA 1X98A 1XDJA 2CBIA 4RW5A 3UWZA 5C9RA 2YCIX 3AJ7A 2GGIA 4ZE5A 4LUTA 5I3GA 2JIWA 1V6XA 4CGTA 1XDMA 3TCSA 3ZSTA 4PMXA 3WUBA 4AFYA 1Z6KA 2KZHA 2VP8A 4YNGA 4G1KA 1Q66A 4DJFA 4QISA 4AZ5A 4GKLA 1NIUA 3FCPA 4HA1A 3UG5A 3AS0A 4K39A 1KM1A 2YBTA 2VR5A 2YB1A 4AHQA 2J75A 1GOIA 1QPQA 1TMHA 2NQLA 3L4WA 1CXKA 1KQYA 3CV1A 3VCNA 4TVCA 3QY7A 5J8LA 1QCWA 3W76A 5LSMA 3QZ6A 5J04A 1FKXA 1TA3B 2WNQA 1JDDA 1LOQA 4LALA 2JF6A 1IGSA 4YTTA 1PKYA 3R7MA 1UKQA 1RH9A 4MLJA 1WE5A 2G97A 1ZALA 2C79A 3RMEA 1TE1A 4MZYA 3N3MA 1MVYA 1LOSA 4KGLA 1C8QA 2Q71A 2CZFA 3UXAA 3WNPA 2DPEA 3BW4A 2PDFA 2A3AA 2YW3A 3LQLA 2VC6A 5M2FX 3WF4A 2V69A 4PB3A 2E6AA 3ABXA 1L6SA 2XH4A 3G3DA 2V5CA 5I7GA 4L80A 1UH3A 1TWZA 4Y7EA 4RDWA 4I9MA 3FYYA 4H7ZA 4XAPA 2G3MA 3E1F1 4J2MA 5A1AA 3CPGA 4FNTA 3BJFA 3DENA 1Q6EA 3FDGA 2NV1A 1DWAM 4D9PA 2YCEA 4ZR8A 3BOFA 1UWSA 3U0HA 1XD1A 1KB3A 4L1WA 1KFBA 1BWLA 3CB8A 4AHOA 4NXSA 1XWYA 1WUEA 1WOAA 3L4UA 4CNNA 1D3CA 1HF6A 4U4MA 4GI6A 4AW7A 3CL8A 2YDAA 5DF0A 3OA5A 1Z48A 3AMLA 3F5LA 1EBHA 1IZCA 1DWHM 2J47A 3CLWA 4ADTA 1JUKA 3EKGA 4C6OA 3B4UA 4IMCA 4KPLA 3SZ8A 4HB7A 2H90A 2P1FA 4BA0A 4LSBA 4RXGA 1RY0A 4QLKA 6XIMA 1UQZA 3UG4A 4U3CA 3AXXA 2ZUUA 3R43A 4Z2LA 1ZLPA 2WCAA 3RX3A 3UZYA 3A3HA 3BG9A 1UKPA 7A3HA 2ZYFA 7PTDA 4JBRA 4BQ4A 5K3VA 4Q6JA 3M64A 3A3XA 4Y8FA 1WZKA 4IXHA 2CNCA 4LXFA 4ZMGA 5FIPA 2IMRA 3K1DA 5HNRA 4FOUA 1PB0A 4QRNA 5E70A 4LGXA 1W9BM 2XH7A 2J6VA 4XAZA 1B31A 1C8XA 1W3LA 4DX3A 4TX9A 2QULA 1FHUA 3CUIA 4JN7A 1TX0A 4GFSA 5DXXA 5AHEA 1TREA 3AYSA 3HMJG 3ZWSA 2WM1A 4CQCA 3NZPA 3BAWA 3VOFA 2C8NA 3AU2A 3KDNA 4LQ1A 1XH0A 3CLMA 3SUUA 1QU4A 1CNVA 3AI0A 1GJUA 2IKIA 3C52A 3F4NA 3LLFA 3S8HA 1F76A 4HNUA 2XFWA 2ZUWA 1I60A 5EL1A 3IGSA 4W89A 5HPOA 1G4SA 4LYQA 3BURA 4PMQA 5G1YA 3SSZA 2YB4A 3MV01 3ATYA 1M7JA 1VLWA 3QKZA 2A3BA 3CAWA 3N2CA 3GTXA 1Q6GA 4FB7A 3M0VA 1QNSA 3S1GA 3RDKA 3WLPA 2UWFA 4Z1CA 3W1PA 5BRPA 3N11A 2VGGA 1KGWA 5LIWX 4LF2A 3MP3A 3ARUA 3WN6A 3O2LA 3KOZA 4NHVA 1UMLA 4XD6A 1PZ0A 3DESA 2Z2BA 4L9XA 4KCUA 2V63A 5HQMA 3HPSA 3STEA 1RUSA 2DSKA 3NUKA 4U31A 2VWTA 3T4CA 2XWDA 3S5NA 4GE8A 1LRQA 1XPYA 2NQ5A 1YEYA 3TYAA 1WDQA 5FACA 1TV7A 3GS6A 3W7GA 1TIMA 4Y2WA 3ZOAA 4FLSA 1BAGA 3GR8A 3GUGA 2Z4GA 4C6EA 5JVLA 3MKCA 3F2BA 1VFMA 3UCQA 3RG6A 2YZRA 2G0WA 3HMCA 4H9YA 3A4JA 1GCYA 2XVKA 4UMCA 3VGEA 2I9UA 1SO4A 2D0GA 3MJMA 3THQA 1AZ2A 2PB1A 1MEWA 3VIJA 1VIWA 4WJXA 5C70A 1XLEA 4XG1A 4ML9A 1LLOA 1DTNA 1B1YA 1JCLA 1NF7A 3OIXA 3H2NA 2ZCGA 3W2MA 4HA4A 3TYEA 2BFGA 4H2CA 2VVSA 2ZE0A 4Z1BA 4DM2A 3VNLA 1IZJA 3A24A 1R3TA 2R91A 3FJ4A 2R9RA 2HBVA 3W3OA 2BHYA 3KS5A 1GQLA 2X7VA 2W9MA 2JEPA 1NWUA 1EDQA 2A7RA 5G4H