3SY1A

Crystal structure of engineered protein. northeast structural genomics consortium target or70
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
229
structure length
229
Chain Sequence
MMNDIAHNLAQVRDKISAAATRCGRSPEEITLVAVSKTKPASAIAEAIDAGQRQFSEHYVQEGVDKIRHFQELGVTGLEWNFAGPLQSNKSRLVAEHFDWCITIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRLRGLSAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLALGQSDDMEAAIAAGSTMVAIGTAIFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR70
rcsb
source organism Escherichia coli
molecule tags Pyridoxal phosphate binding
molecule keywords UPF0001 protein yggS
total genus 85
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3sy1A00
2P3EA 3C5QA 4LUYA 3KW3A 4DYJA 2TODA 4LUTA 3OO2A 1BD0A 1XFCA 1L6FA 3S46A 1F3TA 3WQDA 4XG1A 3VABA 4A3QA 4BEQA 1NJJA 3UW6A 2DY3A 3R79A 2VD9A 3E6EA 4AIBA 1SZRA 3CO8A 3N2BA 1L6GA 1VFTA 3SY1A 2OO0A 3WQGA 2RJHA 4V15A 2QGHA 1TUFA 3E5PA 1W8GA 3B8UA 5FACA 1EPVA 5GJPA 4LUSA 1KNWA 3WQCA 3BTNA 4ILSA 4DZAA 5BWAA 1CT5A 3ANVA 4ECLA 4BHYA 2YXXA 2PLKA 1VFSA 4BF5A 2J66A 2ODOA 4WR3A 5GJNA 3GWQA 3NZQA 4ZGYA 1XQKA 2SFPA 1D7KA 1RCQA 2NVAA 2ON3A 3B8TA 4PB5A 4LUSB 1HKVA 3AWNA 1QU4A 4PB3A 3WQFA 7ODCA 4Y2WA 4FS9A 2O0TA 2NV9A 3HURA 3B8WA 1XQLA 3AWOA 2RJGA 3LLXA 3NZPA 1KO0A 1VFHA 5FAGA 5IRPA 1FTXA 3N2OA 1HKWA 4KBXA 5FAJA 1NIUA 3MT1A 5GJMA 1SFTA 1TWIA 3HA1A 3N29A 3CPGA 4XBJA 3WQEA 4PB4A 4LUTB 4BEUA 2VD8A 1B54A 3ANUA 4QHRA 3B8VA 2PLJA
chains in the Genus database with same CATH superfamily
4Q33A 1X1ZA 1CXIA 3U2ZA 1LWJA 3S42A 3WBWA 1VPYA 2F38A 1FWHC 5D2XA 3W3OA 2Y7GA 1KR0A 4XZMX 3H22A 1XGDA 4DBEA 4AEFA 1XH2A 4AZGA 4FB7A 3IVSA 3W7NA 3H12A 3W7PA 3EA3A 1VBRA 3WUGA 1IZKA 1JYVA 2ISFA 2ZX9A 2OSWA 4J2MA 3LGGA 5FACA 1JPIA 1KNWA 4XD5A 1NARA 1Q6EA 4CD8A 2VURA 2MUCA 3H7VA 3VDCA 4C6LA 3VINA 4I3GA 1C92A 3BLPX 2I1OA 1BF2A 3OLDA 1S3TC 4IHCA 4O10A 4DIAA 4ZB0A 4WJEA 2XM1A 5AYYA 3AWNA 4KEUA 3GG7A 3PANA 4QG9A 5ABFB 4CNOA 3KVMA 3G77A 4PMZA 1FCBA 1KWKA 4PMQA 1JUEA 1QO5A 3VFCA 1JRBA 1XH0A 3MT1A 2CC0A 2OLAA 3ARWA 2B0MA 2ZZ2A 3FLUA 2EG6A 1ZY9A 1EUAA 1QWGA 5D9MA 1HZYA 5LIUX 1AQ0A 3S5OA 2D0HA 1V3HA 3NSNA 3HB9A 4KRUA 2IKGA 1K6WA 1VLIA 2G37A 1VFFA 4UTTC 3NDOA 1B9BA 3EOUA 3LHWA 2WW5A 2WCSA 3OZMA 2BGNE 3RFAA 3HG4A 3MTWA 4GA8A 2J7FA 4CQDA 3VMPA 3VC6A 2PGEA 2HPIA 5HJYA 1PO9A 1XBVA 5BW6A 1UZHA 4ROPA 2J7DA 5G5IA 1OBAA 3CIXA 4C60A 3QTPA 4D72A 2GGGA 2J8FA 3MUXA 3EOSA 3WJYA 4UTHA 4I90A 2E9MA 1E70M 4AB4A 3LCLA 1P43A 1EX1A 2PBOA 3OG3A 2QW5A 1SW3A 4O0ZA 1SQ7A 4DZ5A 1MZHA 3HBLA 2NQLA 3CLMA 4HJFA 1YEYA 2HS8A 1HJUA 3L68A 2GVGA 3T4WA 3QJAA 2NX3A 1YNYA 3TQPA 1VRXA 4LWWA 3WFAA 1GUVA 3GX9A 1S46A 4GC3A 1W9VA 4AQLA 5FOOA 3DH7A 4LVBA 4X9YA 1SZFA 2CETA 4YS1A 1Q7QA 1BXCA 1L8NA 4WY0F 3W1RA 1FWRA 3AUJA 3V3WA 1EGZA 2QF8A 4PMRA 3IJ8A 2Q8ZA 3WBAA 3EEGA 1JXJA 5EBAA 3P84A 4Z2KA 3NQMA 4J27A 4QQ3A 3LPGA 3GG0A 1GQJA 5IBXC 1KBLA 4HPJA 2IPFA 5LGZA 1ECEA 3AUOA 1DJNA 1V02A 2NX9A 2WPGA 3VM5A 1LLWA 4XKYA 5FI8A 2Y85A 3RCYA 4UQAA 1RPKA 2WXDM 1EIXA 3PSWA 1IEWA 3DFYA 1V02E 2J25A 1XSJA 3FW6A 3KUMA 1K7XA 1PIGA 4CU6A 1XLJA 5A5WA 1R47A 1U33A 3T2OA 4HYWA 4JTHA 1PZ1A 1BKSA 3M46A 1S5TA 4RE3A 4AW7A 4PUJA 2O0TA 1I4NA 3WX7A 3G24A 3WLOA 1ENUA 3GXFA 1N8FA 3LHUA 5FAGA 4JOMA 4JPGA 1QASA 1TWIA 4RCXA 5CJNA 3WSUA 3WQEA 3BLIA 3R89A 4DJFA 1ESWA 3ZIZA 1E72M 4FXFA 4WCJA 1V0NA 1VFMA 3WMBA 1PZ2A 1TWDA 1UD6A 3BCFA 1J96A 1DPMA 3R43A 3A4XA 3URBA 4RUBA 4DJDA 4TO8A 4TXEA 5CC6A 1KBKA 2V8ZA 1VYRA 3GTNA 3CMJA 1UWRA 4GZ7A 2Q3RA 3UWEA 1H50A 4DZIA 3MA8A 4GKLA 5JH1A 2CWXA 3CL7A 5IOBA 4EPBC 4GJIA 2Y7EA 1TJRA 3VOGA 3EX6A 3SJNA 2C79A 3SN1A 5C7HA 1B3ZA 2VGGA 2XSAA 4JX5A 1PKYA 5BYWA 2DT1A 4CQ9A 4Z1DA 3LN3A 4PL1A 2OZ0A 3CQ0A 1DHKA 4REQA 3SIZA 2QT3A 4A3UA 4B2DA 3M16A 3CAQA 1AL8A 1W3HA 5K3VA 3VIKA 3LNMA 3NCOA 3S2NA 4ICMA 4BF7A 3SY5A 1H4PA 3OVPA 4PBEA 4O4VA 3UR8A 1SR0A 1LRTA 2HVMA 1E73M 1WOBA 2DSVA 1TMQA 2YCJA 1BYCA 3W53A 2QF7A 1PZ3A 1W17A 1VZWA 5CQ1A 7XIMA 4J7RA 4GFIA 4XO6A 4PCFA 1SVDA 4MPKA 3UY7A 4LF1A 3OZPA 2X30A 3SJ3A 1QUMA 4QNWA 1MMFA 3LM7A 1XPYA 3PJUA 4ZZ9A 4CU8A 4W7UA 3C2RA 3DHUA 3IK4A 3AIVA 3U48A 3CPUA 3W4RA 3NR0A 5XIMA 1A50A 1R38A 3AMCA 4Z42C 1OIMA 4QLKA 4WF7A 3AXIA 3QY7A 5AHMA 4AF0B 3CAVA 1XDLA 1KCXA 3M0VA 3CASA 1B4KA 1LCOA 3B4UA 3QZEA 4U2ZA 4PMNA 3LOTA 1K6AA 3GG1A 2AGKA 4DZAA 5BWAA 4Z17A 3NZRA 4MMWA 1MDRA 2KAUC 2DZUA 1VFSA 1IWAA 2QAFA 4IFRA 3K8MA 4REQB 3VZXA 3TTQA 2VX6A 4L1XA 3HPAA 4MWAB 1ZBWA 2H3BA 2YW4A 4OV9A 2E3ZA 3BJFA 1FHUA 4O1CA 4Q8VA 5F4WA 4AY1A 1UB3A 1F2JA 2WWCA 1FHVA 2YJQA 2VRQA 1VFHA 1BQGA 1K4HA 4KEVA 4WRHA 4G56A 3QW4B 1H3GA 1V0KA 4LUTB 2GLKA 2YR1A 3ANUA 3L7RA 2HBXA 1JG9A 4HTYA 4M7SA 2AQWA 1UD5A 5KINA 1ZPTA 1ZAHA 1CGXA 4JTDA 5DT5A 1OIFA 3RX2A 3OHIA 1EO7A 4M0XA 2LLEA 1NJJA 4GD0A 3UBPC 3AMLA 4ZTYA 1KRAC 5DLCA 1RA5A 2I5GA 3GC2A 3BQ6A 1S5VA 1E1CB 1RZMA 1U5VA 1J93A 2QNEA 4Q4MA 4K39A 1OZQA 1TPUA 2V3FA 2XH0A 3VKKA 3LU2A 1JZ5A 3CC1A 4BZYA 1Q7ZA 3FK4A 4CGTA 3W7KA 1GVEA 3AXMA 1WZKA 1A5KC 5TF0A 1HG3A 2V81A 1R8LA 2Z00A 2PTDA 2QMKA 1TWZA 4HHMA 1OX4B 1FCVA 3BW3A 1NAL1 1TVPA 2PC8A 2EEXA 1C8VA 3KS6A 3O1NA 1W3IA 2OKTA 4KGLA 4M6VA 1IXQA 1F3WA 3MCNA 4JQ2A 5A6BA 4JYFA 5M1TA 4PEEA 3M44A 5DBUA 1OF8A 1S2TA 1XW8A 3SY8A 3EDFA 4MWAC 3MZ2A 2UV8G 1TPDA 3C8FA 1M7OA 4C6JA 3W2MA 3WF0A 3C6CA 4N0RA 1YTDA 4H1ZA 3H4GA 3IWPA 3U8GA 7A3HA 1VBGA 4JTFA 3OO2A 4O15A 3M9YA 4AIUA 2W9MA 2G3NA 3TV8A 3LLDA 2BMBA 1ADOA 4ZOEA 2DP3A 3FEQA 2OWXA 1PV8A 1Z48A 2FVKA 1I0DA 2E40A 2EPOA 5D2YA 3MKKA 3NDZA 4HT3A 3CBWA 3PULA 5LYRA 1R5YA 4E8DA 3ARYA 4IISA 2X8RA 3LNPA 2QPUA 2FLIA 3WNMA 3E5PA 2H6RA 3ZR6A 1V5XA 3H6OA 1O1ZA 2VGFA 3MUY1 3GNNA 1JNDA 2QUNA 3W7MA 5IXEA 1REQB 3E49A 4N9CA 1EF3A 5DMLA 3DGBA 1OK4A 4JIRA 1UG6A 2PSNA 2ODOA 2VMFA 4GQRA 4NY2A 2ZZ3A 8TIMA 3DG7A 5H8PA 4MSSA 3T07A 3I6EA 3N4AA 1DL3A 3KOYA 5REQA 4OOUA 3L4XA 1UH2A 3MYPA 3QOMA 3UPMA 1DORA 1NFGA 2W62A 1EX5A 4AD0A 3B40A 1J6PA 1JEZA 4FR1A 3IIPA 2I56A 2NQ5A 5DXXA 4P8UA 2A3CA 3PTDA 1PL9A 3IIOA 2BV9A 1GHRA 1S5NA 1GVRA 2KX9A 1A4MA 2WZMA 3ABOA 1E4IA 4E6MA 1WDQA 4YJ5A 4KERA 1ONXA 1XYZA 2YL5A 1QPRA 4IUGA 4RKAA 1CYGA 4XUGA 2HMCA 1N82A 2G3FA 2H9AA 4IPPA 5DEZA 1IXPA 3RM4A 2FMOA 2VD9A 2V5JA 2G4FA 4NG3A 1EP2A 1O12A 3CJPA 3EMCA 4ZR8A 4A4AA 3W85A 4GQGA 4OE7A 4OZOA 2QIWA 3M0KA 4LAZA 3V16A 4R34A 4RNHA 3K13A 1RD5A 3L9CA 3W1QA 1X1OA 4R27A 2VOTA 3EEZA 1CXKA 3UFYA 4GQBA 5HNTA 4J3TA 5C54A 5C9ZA 4L80A 4B5VA 1CECA 1PIIA 4ZOBA 4JX4A 3N15A 5KZEA 1H1YA 4CCZA 3RPMA 3KL5A 5MKGB 2Z2BA 3T81A 1VIZA 3WQWA 5M5DA 1UWIA 3FSUA 4S3AA 5KZ6A 4IFKA 1B57A 3WMCA 1IE7C 4I6VA 3NFUA 2IXUA 4IL0A 1E40A 2WSPA 4X22A 3LBCA 2E4TA 1X6LA 5KZMA 3U3HA 2NXIA 3TZFA 1XLDA 1V3JA 2Q3OA 3OW1A 1RQHA 2HWGA 5B7ZA 1K77A 5F2GA 1NF0A 1VPQA 3N34A 4X0VA 4HVXA 2VENA 1F8IA 4OHQA 3UVIA 3MMDA 2V3EA 5CSSA 3W7IA 2TMDA 1EJTC 2CIPA 4GQ0A 5DY3A 3CO8A 3ME3A 2OLHA 4I9MA 1P0BA 1H51A 1QWKA 2QVHA 1XRFA 2VGIA 2OQHA 1G1YA 1HL2A 8RUCA 4JTEA 2Z2UA 3P14A 2XSXA 4FALA 1TMHA 2FVLA 2VFFA 4YPJA 2QV5A 1V3LA 4HA0A 1NQ6A 2B7OA 4Q6JA 4NZJA 1TKKA 4JDYA 1YW1A 1J0JA 1I0BA 3L2IA 3GZ3A 3VGHA 3HO8A 3PAJA 2SFPA 4EWND 2OELA 5JBEA 2EGZA 3ZT5A 4Q22A 3B04A 1Q8AA 1VRDA 2CBUA 3TUUA 3A5VA 1Y5WA 3N73A 2VX5A 4WKAA 5ECUA 1W9DM 3N6QA 2FHFA 3UG4A 3QV9A 3KFTA 2JK2A 1VFOA 4D6DA 2X42A 2E5CA 1M7XA 3QHOA 5HR6A 4P8WA 1FKXA 3NQDA 1J0IA 4UQEA 3H8AA 3AMKA 1Z3NA 2H8XA 1S2AA 3K4WA 1PDYA 3HMCA 1DKWA 2W27A 3T78A 3KOZA 8XIAA 3WLMA 4MDPA 1IT7A 4A8IA 1XLAA 1GQIA 3OQ8A 1SR9A 4I9TA 4P7NA 4A3QA 1EFZA 1AW1A 3EOLA 1AZ2A 3QV8A 1SZRA 3M47A 2ZXBA 4PA8A 2DEPA 2GGEA 1TPB1 5J5RA 2DORA 2OYMA 3P8JA 3Q58A 4R53A 2YL8A 3KP1A 4ZVJA 1HFBA 4ILSA 1EXPA 4GABA 1LWIA 4MLJA 4OJYA 5G4EA 3QMRA 3A9IA 3V1HA 4A8RA 4BF5A 1EEXA 4DWSC 4AY8A 2Z6IA 1IEXA 4C6CA 2JGQA 2FDMA 3MCOA 3W38A 2A5HA 2ZQ0A 3M7WA 2C19A 1CB7B 5EMUA 1CX9A 3UESA 3KBSA 3S2JA 4C6IA 1WX0A 1XLFA 4D6IA 3TXZA 1AQHA 1W3TA 3VNZA 3NSMA 1UKTA 3CZEA 1XLIA 5IDIA 5LIXX 4FZIA 3GSMA 4NRSA 3UPBA 5FAJA 2E1DA 2YB4A 2G97A 2PLCA 4QFUA 1TPWA 2I57A 1PPIA 5DO8A 2VELA 3FJLA 3FGCA 1YNPA 1ZJIA 3H4XA 1SPQA 2Y8KA 5FL1A 5D9PA 3GXPA 3D0CA 3KVJA 3UG8A 1E6ZA 3PBMA 5T9BG 2QQ6A 4HCLA 1RQBA 1FRBA 3VABA 1SJBA 1S2UA 4M24A 1X39A 1JL8A 5GNYA 1KFEA 1BTMA 3B0YA 1BXBA 1CCWB 1XLKA 3QLLA 1ISWA 2NQHA 4D9PA 1RK6A 3GKAA 2X0SA 4CCCA 4JFSA 2VEGA 3NVTA 3B4YA 3H2NA 4UTWA 4XAPA 2JF6A 2ZE3A 1KRMA 3WEZA 2QDHA 1R86A 2WAGA 3A21A 3GXDA 1KBBA 2ZZ7A 2P0OA 4YTSA 6TIMA 2J79A 2GVYA 4MKVA 2I14A 1OK6A 2ZWYA 4H01A 1EJUC 4KWWA 3FJNA 3RPDA 1JI1A 1S2CA 4MADA 3I3BA 3REQA 5ABEA 4YLWA 4K8GA 5HNRA 1E1EA 1F4AA 2R1PA 2GUUA 1VJSA 2BY2A 4Y9OA 1DE5A 5AZ1A 3ICJA 5EMYA 3PPFA 4I7VA 3AYRA 4YHEA 2CITA 2F9RA 2FZBA 4NU7A 1UR4A 1HO4A 4PCSA 1R3RA 4JXCA 3BMWA 2DW7A 3WJZA 2G4JA 1VYSX 4O8RA 3CS2A 1VC4A 3XINA 4O19A 5LNUA 5JU6A 3WQ4A 8XIMA 3CZ8A 1W6TA 2Y8UA 3UWUA 1FWTA 3LEPA 2X05A 3G8RA 4HZ6A 2Z1XA 2RHGA 1HTIA 5A2CA 1J12A 4TVUA 4ROQA 1WDRA 2PA6A 4LYPA 3PVFA 3ARUA 5CZJA 4NZ5A 4FMVA 1K03A 4WQ6A 2WVVA 3SGUA 3STFA 3VX0A 1L6GA 3PZVA 2XJ7A 4Q32A 4K1WA 3VNYA 4Q8UA 4AYGA 4R88A 1Q4NX 5AB3A 4R3UA 1PSCA 5JBFA 3SUUA 1OYAA 1C29A 3IS4A 5HMFA 1LP6A 3S2CA 5JVLA 2VFEA 5CKSA 4GFSA 4WOZA 2CLEA 3AIRA 3IJ9A 1K8ZA 1S2WA 3AHYA 4XTDA 3G1AA 3W1LA 2WM0A 5EMKA 2J6XA 5AC5A 3ZT7A 2OX1A 4O52A 5A6BD 3PUGA 2PDLA 3W84A 1DHPA 3VC5A 1ISVA 1YDOA 1QNQA 4W93A 4FP1A 1D3GA 5FCZA 4C6EA 1JCNA 3WLJA 4QAIA 4S3CA 3NQ2A 4GWEA 2W0UA 3P62A 1MNSA 1WAWA 1AVAA 4LC6A 3SURA 1JIBA 5EPDA 4A8NA 4GO8A 1ECQA 1Q6FA 4LT9A 4XQ6A 3TA9A 3HQNA 4YCOA 1BG9A 5AYZA 2NW0A 4Q4KA 4KS0A 2CNCA 1F6PA 2YL9A 3AYVA 1GZGA 3I6TA 2G3MA 4M6PA 3NXFA 8CGTA 1SZNA 3QEZA 5F1UA 3QF0A 2VQTA 3CLWA 5CC5A 5BXPA 1A3WA 3F2BA 3R12A 3TYDA 2VXNA 2F7FA 3EWDA 5F1VA 2EXOA 1U22A 3H7RA 1K9EA 2FZNA 3VA8A 4NRRA 1IYXA 2DV0A 5T9CE 3SGGA 1GG1A 4AIEA 1BWLA 4WKHA 5AOUA 1SYTA 4CQCA 3AMDA 2FKPA 3CIWA 4IM4A 2WC7A 3HU7A 1QT1A 1V3IA 4DI8A 2DZAA 4N6EA 3S8HA 1UMYA 4DPPA 5D8ZA 3L4ZA 1H7PA 4D6GA 3SFKA 3V0SA 4CNNA 4F3HA 1XHGA 2R1LA 4KQNA 4LNCA 2Y5JA 5CPQA 4CU7A 1W5MA 3RU6A 4YN5A 1KGXA 4OWGA 3L5MA 1QDSA 1W2VA 4IP7A 3BMVA 1XKYA 5LGXA 2QDDA 3LB0A 5H91A 2PGFA 4XZHA 1AL7A 1EH9A 2GQ8A 4M1RA 4N6FA 1W5OA 3T4CA 5C5YA 2CERA 1CPUA 1B2YA 4KRZA 1GOIA 1JAEA 1E0WA 1XIBA 2ISSA 3TROA 3ZLGA 4HMEA 2PZ0A 2ZRYA 4UTUA 2B7PA 2ZC8A 2CHOA 1R46A 4HNLA 2A7PA 4JTUA 3UJEA 4YNGA 2YBVA 2PD5A 3NO1A 4LOCA 4HPNA 4F0SA 3NXLA 3N18A 2GWGA 4UR7A 1R3VA 4LUSA 3CK5A 3EAUA 2GPTA 3Q94A 3M41A 2YDQA 3OQEA 1MW0A 3VCRA 2PLKA 4CN4A 4DYEA 4D1IA 4PSPA 2ICSA 4AD2A 2OYLA 4GBUA 4GJ1A 4QJ1A 1OVDA 4HYRA 4CNUA 3VNDA 3R8HA 3N3TA 3B0VC 3GM8A 1C9DA 5FF4A 2PRLA 4TTUA 4JN8A 5HNNA 2C0HA 4QIUA 3AZRA 3N25A 4GI9A 4M6UA 5A1AA 1RR2A 3R0UA 3KP0A 2DVUA 1H7WA 4JTTA 1GG0A 4H83A 4BF9A 5TBOA 5AC8A 3UQNA 3M0JA 2E67A 4LV4A 4GNVA 5G2HA 3PHAA 4JYEA 3U2CA 2YA1A 4IUOA 5D38A 3KTCA 3V1PA 4H04A 1I9CB 2FDSA 1L6FA 1RCXB 2AQOA 3GRIA 3STPA 3ITXA 1XBYA 3OP2A 4DAFA 4WIWA 2DPEA 3NTYA 4GYPC 1BVZA 2QDGA 2WHKA 1FP8A 3EMQA 3R8RA 2WNWA 4QSFA 1F4HA 3OYZA 9XIAA 2NT1A 4RXFA 4A3YA 3EX3A 1IR2A 4H7CA 5AZ0A 1B1YA 3KRSA 1AJ0A 1P0NA 4WZHA 4U28A 5AYIA 3LK6A 1FHLA 3TLLA 4LB4A 3P61A 1LL4A 1RLCL 5HUOA 4X63A 4NNBA 3G1VA 4GI8A 1Z7AA 2J7EA 2E8ZA 3G3DA 1QATA 5I02A 4H8HA 5FF7A 5TAOA 5BXRA 2ZA3A 1RPXA 5AVHA 1FP9A 4EVZA 2E1WA 3N2CA 2QXWA 2J88A 5L9FA 3H4WA 4DF2A 4BWLA 2VRKA 3QBUA 2DVTA 4LCSA 3ZR4A 3AWOA 2BLEA 3NZ1A 5HK4A 3RX4A 1E5JA 3Q4DA 3WQVA 1I60A 1P7TA 1VEOA 5E0FA 1NM9A 1H0GA 1DOSA 4IFKB 1HKWA 2IQ0A 1VQTA 4DO5A 1ZUAX 1KFCA 1GOWA 5D03A 4S1FA 3GXNA 1XSKA 2ATMA 1NP2A 2NUYA 4DYJA 2OEKA 1CW2A 1RBLA 2CXGA 3LUTA 2BXYA 3M1ZA 1HKJA 1EGVA 5CC3A 1KFKA 3SCOA 2XWDA 3TMLA 1DQUA 2V5KA 3HM7A 5G1YA 1VEMA 1H41A 1KXQA 1ZQ5A 6XIMA 3MSRA 2V5DA 2Y5EA 4JKMA 3UJFA 4JTLA 4AZ5A 3MJMA 3V35A 3W72A 4NP7A 1L0PA 2VTFA 3M0MA 3OYXA 3OGVA 5C9UA 3HJEA 1CT5A 3ITTA 3PZUA 1LROA 3HTWA 2DJXA 1UWTA 3PF3A 3PZTA 1ML1A 3CV2A 3WLHA 1KXTA 1P6WA 3VU2A 4LVAA 3F5LA 2YA2A 2ZC1A 1C8YA 2C13A 2XN2A 3ZO9A 5JQ9A 2QJJA 4FIRA 3GVVA 1W3JA 3O6DA 3W83A 2RGMA 1PE1A 1KFWA 5BMWA 1FWWA 4WUIA 1D2KA 2CLIA 3A4AA 3NQCA 4RV8A 3N29A 1KTNA 4GOAA 1QW9A 2EJ1A 1JPKA 3W6YA 4HZ7A 2VEFA 3O6CA 1NTHA 3QFWA 2VYOA 4AUBA 1EHAA 3KCJA 1XIFA 1ODUA 5BU9A 1LRQA 2TAAA 4IIEA 4DO4A 3W1UA 1B3XA 1THFD 2Y6ZA 4XG1A 5EMLA 3DESA 4CEUC 5FEZA 3JS3A 1GJUA 5M3WA 1O60A 2DZVA 2QJIA 4HHPA 3CAWA 3TN5A 1BKHA 4EANA 4Q7IA 2GSEA 2J9XA 4DJEA 1IGSA 3AU2A 1UR9A 4W5ZA 4FNPA 2I5QA 3RLHA 4KF1A 1W8GA 4JX6A 3U0HA 1R3QA 2EF9A 1XM3A 3ABXA 6CGTA 4CEXC 2XFFA 2OZTA 3W88A 3G6MA 2ZCGA 3QQ0A 1XLLA 4UTMA 1K02A 3ZWSA 2V68A 2ACRA 1F6KA 2ESCA 4M1BA 3TYZA 3BO9A 4HMDA 4OBRA 1E51A 1DJYA 4B5NA 2W67A 1F07A 4NAEB 1EYWA 3L0GA 4H00A 3EMZA 1UKQA 3P3BA 4UTJA 3AIBA 1RY8A 2PWVA 3UD6A 2VO5A 3CHVA 1VJZA 3RX3A 5FEWA 5I3JA 1OCQA 1YBQA 2YCLA 4IIHA 3QW3A 4DJFD 3XISA 1DVJA 2ZUVA 1IZCA 4UB9A 3N2MA 1AQMA 1VEPA 1AMYA 1PKMA 1S5MA 1R30A 2RGLA 2WVSA 3UYCA 2TPSA 3N9KA 3CAKA 1MUWA 3NPUA 3IAQA 4KETA 5DBTA 3UXIA 4Z2HA 2X16A 3VOJA 6TAAA 3T0BA 3QM3A 2DJLA 3GZAA 2PRHA 3SCTA 3HJZA 5AVNA 3IJDA 1KB3A 3C5QA 3AYTA 1QPOA 4H8VA 1P4CA 3CYVA 1ITXA 2V2DA 5E93A 2ZRZA 1PVNA 1PX8A 4HNUA 3WUEA 2B7QA 1TQXA 1H63A 2DQXA 4AAJA 1YRRA 1WNOA 2VDHA 2Y7FA 3T2QA 2ZUSA 2VZVA 3MSDA 2CLFA 1VGAA 3ATZA 3WQGA 4EOUA 3TJXA 4P2VA 1UKSA 4MUPA 3FA3A 2A7RA 2MANA 2E9LA 3VGGA 1FWSA 5FSEC 1UWQA 2IKJA 2FH8A 2PDJA 3MU7A 1TELA 3K1GA 3AIQA 4C7DA 1I6NA 2PDFA 1O4UA 1J10A 1BRLB 3DHPA 3SM0A 2EPNA 5H8UA 3VKDA 1C7SA 1QHZA 4DXKA 3HG5A 3S9ZA 2HPMA 1QI2A 2BY0A 4B3KA 3BAIA 2X09A 2C1HA 3MHUA 5CPSA 3EDEA 3H24A 3KL3A 4RR4A 4Z2JA 3F2CA 4PRWA 2F8QA 1WCGA 4C5YA 5FESA 3GNRA 3GDKA 3SQSA 3NZPA 4JHZA 3QGVA 1GK8A 1SO6A 2OT1A 1Z8AA 3D3FA 4PODA 2Y2WA 4M8UA 1OD8A 2VP8A 1LZOA 4K68A 1E0XA 1JDCA 3IGHX 1F6YA 3L0NA 3HA1A 4H7ZA 4LBRA 1GOMA 3JU2A 1MXGA 4FA3A 2CESA 4NZ4A 5I09A 2BTMA 4HNOA 3GDRA 4MAVA 2Q8LA 3TJLA 1C7TA 5D32A 1KGWA 3SRFA 2BHYA 4NJJA 3RDKA 3WEMA 3LBOA 1CLKA 2HNEA 2OGJA 4QRNA 4EK7A 3WQ8A 2CXEA 4LSBA 4PCPA 1G6CA 3WNNA 2RDUA 1G4PA 1VCFA 3W7DA 4BQ3A 2AAMA 1ONEA 3UP8A 1KTCA 1W91A 2RUSA 1Q85A 3E12A 3M0XA 4OECA 3U2EA 3MW7A 1A5BA 1O5QA 3CH9A 5LSMA 1UIOA 3N12A 2CHNA 5DY2A 1MXDA 1S39A 4MUZA 5BWFA 3C52A 4QS5A 3SUWA 2PDPA 3B05A 3T55A 3OVGA 2PMQA 2CBJA 3L4TA 3UZ5A 4MFDA 3W25A 1K8YA 1VCGA 4IJRA 4ZO7A 3ZJ8A 4I9AA 1ISYA 2P76A 2FTPA 3FKKA 4ZOAA 3LI1A 2BGSA 3NOEA 1KFJA 1C93A 4JHOA 2D1ZA 3RNDA 4DUXA 2QIIA 2VEPA 3QY6A 4ZSTA 2FB2A 3EWUA 1TG7A 5A6JA 1VCVA 3PBWA 4XBJA 3GVRA 3HZ3A 4B4FA 1ITUA 4KRTA 4UUIA 1IZJA 4I5RA 5HJXA 5FIPA 3S47A 1V8EA 1UH3A 2J13A 2XIJA 4MB3A 2ISVA 3S4TA 3W00A 1JD9A 2NQZA 2YZ5A 4O12A 4ADTA 5BXSA 4NYYA 4N4QA 3VVGA 2AMGA 4KIEA 4GUFA 1QCWA 3Q65A 3VAVA 4UFLA 4Q4OA 4KFPA 3FFSA 1TRIA 4OFCA 1XCXA 2GL5A 4GY0A 4KFOA 3BARA 3GFZA 1U83A 4R7WA 2JF7A 4JNMA 1W5QA 2XTKA 4F0HA 3VUSA 2I7GA 3BG5A 5CBIA 1HO1A 2YCIX 2B81A 3WLLA 4US5D 3LI0A 4O1EA 2OOGA 1XS2A 3WFLA 1T96A 4GYPA 4BQ4A 4OUIA 1OFAA 2C1IA 3W2UA 4A3HA 1LOQA 2PTYA 1MW3A 4O4WA 2QS8A 3HIJA 3B8WA 1ZBCA 3BDKA 3GH7A 4Z1BA 4JNZA 3XIMA 2ACSA 3LLXA 1CNVA 4QEEA 3OGSA 2PPGA 5T26A 3LMZA 4WSJA 5DCBA 1VENA 1ADSA 4E4FA 4PRRA 3L12A 5BNKA 4LRSA 1TE6A 3VDGA 2YCEA 4GUJA 3CQHA 1VLWA 4F8XA 1O5KA 3WDPP 1ODZA 3PZOA 4PBGA 1UD3A 4ATDA 2QUVA 3M6DA 1EWEA 4EACA 2WK2A 1PS9A 2VFHA 2DDXA 2ZDRA 3VKBA 3DI0A 4M81A 3QHNA 2H8ZA 3CZLA 3P5ZA 4FXJA 4G6CA 1F7BA 5A69A 2YLAA 2XN1A 3S0CA 2WKLA 3UGVA 2B7NA 2HXTA 1HL9A 1WBHA 4AVOA 5K2ZA 3T08A 1XF0A 3IJ7A 3IJLA 3G1RA 3CT7A 3LRKA 1DIDA 1LT8A 3POHA 3RAOA 4FXSA 2Y24A 4AC1X 2NXHA 4RE2A 1J4EA 2PDYA 1TCDA 5CPMA 3W02A 2DIKA 3V0TA 1SUXA 1CGYA 1UJQA 4MF4A 1EBGA 4U3CA 1VD6A 3WQCA 2ABAA 3BAJA 4J28A 2Z1VA 4GY7A 1W1ZA 1AJZA 3TWAA 4NZ3A 4BJHA 5E5CA 1EWDA 3IUHA 3TSBA 3WENA 4TX6A 2ZXDA 4NXSA 5FSDC 2GSJA 1XFBA 2R1MA 4U5KA 1W3KA 4C91A 4IGHA 4LUSB 1QAPA 4GUHA 4DI9A 1GVYA 2XHYA 3QOKA 2VC5A 1EDTA 3RLGA 1CLVA 1W2PA 4UCGA 5BU6A 4L61A 1I2PA 1HGYA 3W7CA 1Q2RA 3KOXA 3MC5A 4HU3A 3ARZA 1UOKA 4PTNA 4MZ8A 3G2GA 3W23A 1YBQB 2YCLB 1W31A 5BOEA 2IW0A 3F4NA 2PDWA 1NP0A 2OG9A 1SJCA 2BWGA 3W7QA 1R6WA 3MS8A 4JEJA 1GOKA 4ACYA 3NOYA 3CQIA 1WP6A 3TJ4A 4NNCA 1QRQA 1QOQA 1AA1B 2VR2A 4PSRA 4WGHA 3N2BA 3ZM8A 1RA0A 3PB0A 3M43A 5FJJA 4HZMA 2DT3A 3SB0A 3OJGA 3UYIA 3ITVA 1GVQA 5CPNA 1IQ8A 1OFEA 3RITA 2VEMA 2Q6ZA 2A1YA 2CU0A 3WLIA 2HROA 4UMBA 3WH8A 1BTCA 1FH9A 3MHFA 4XD4A 4RDZA 1WDDA 3TTYA 4UZUA 1P6CA 4ADUA 1GQLA 4NSBA 3F4CA 4TX8A 2Z7GA 3LCXA 4JFWA 3VCCA 4O16A 2CWNA 1JPDX 3GDMA 3W1TA 2YCKX 1YPFA 1GTEA 3QC0A 3VK5A 4XIMA 4Y8FA 2XVKA 4WDWA 3B9EA 3ZMRA 3LENA 2C18A 5IFPA 5FJIA 3LXCA 2GUBA 3Q37A 3B8VA 1XD0A 2MNRA 4MB1A 4DF0A 4G7FA 3HGSA 1A53A 4ZOCA 4DN1A 4D8AA 3EZ4A 3MPGA 4WHBA 4LCRA 1MUCA 2GOUA 3PBYA 2WJZA 4KT2A 2BP1A 4G2DA 1E6XM 3GO2A 4IGSA 1O7AA 1ZS2A 3R0KA 3ZS4A 2ZX6A 1JD7A 3P5YA 4DRSA 3K4AA 4FEZA 2DVXA 3TQKA 3WDIA 3IUIA 2BZNA 4C6FA 1TZ7A 3OODA 5HAOA 1JQXA 3FIGA 4KCWA 1XIDA 4ES4A 3E9AA 4J3ZA 3POCA 4GC4A 4IMDA 1I1WA 1QHOA 4IT1A 3FY1A 2O4MA 3ZVIA 2JIEA 4ZB2A 3PFMA 1DWIM 4CNSA 3C3UA 5D09A 3O15A 5ENLA 5EY5A 3KRZA 1LORA 4AZIA 1R7AA 1D7KA 5AFDA 2Y61A 1OC7A 1UHVA 4MTVA 4PMYA 4WY0A 5CEWA 3HPXA 1X97A 4S3JA 2G3IA 1VH7A 1OCNA 3STGA 2TSYA 2ZE0A 3VMOA 3UG5A 1GT8A 3R4IA 2C8NA 5GPRA 2WC3A 3M64A 3VE7A 4AHOA 2BHZA 5M17A 3VIMA 3CV6A 4NILA 3UNTA 5HA7A 1UR8A 5HBFA 1O5XA 3GBEA 4Q8NA 4TMBA 2DUAA 4QAWA 2X1SA 4WSHA 3M6YA 1O1HA 3MZNA 3COTA 3RIKA 5G1TA 3I7SA 4JZ5A 4QTGA 1LL7A 2VZUA 1F76A 3TSMA 1EOKA 4A05A 3OA5A 1PJ9A 3SQLA 4AWUA 5I3DA 3MI3A 1N2VA 1E55A 1SO5A 5I7GA 1R3TA 2W66A 2V2CA 4YVPA 1W8SA 4YTQA 1Y7VA 3DBNA 3F2DA 1EO5A 3H26A 3GU9A 1E4LA 3AC0A 4ONVA 2CW6A 3UVAA 3PSVA 4H9XA 2ATSA 2OZ3A 4IXHA 3W2LA 1LQAA 3S2MA 4HK7A 4IG2A 1V3KA 4QJ3B 5AYBA 4L4MA 4PCNA 3ES8A 5G1MA 2X41A 3AICA 3B8TA 3E3HA 2QEZA 3MSYA 1YTEA 4K3ZA 3SDOA 3V36A 4BKNA 4F2BA 3I68A 1HGWA 2P53A 5GNXA 1RHCA 4H41A 2DZPA 2WKGA 1M68A 3KL0A 3H2AA 5KZDA 1TREA 5CH9A 3GC4A 3WUFA 1ZENA 3L5AA 4M6QA 3PWAA 4MB5A 4AISA 2WVVB 4ZCWA 5EYWA 5HQMA 1UR0A 5CLTA 1YE4A 2I9UA 4J2PA 3GAKA 4UFMA 1EUNA 1A80A 3T6CA 1UPPA 4LX4A 4P5UA 3S6TA 1DBTA 1NWUA 5H2ZA 1TFVA 1M3UA 3SCNA 2HV5A 1VS1A 3FSTA 1E6PA 1EA9C 2VCBA 4V15A 1ZFJA 4WDUA 5LHEA 1RQEA 2XFWA 4GK8A 4BS0A 1XIJA 1DXFA 3WFZA 4X3ZA 2ZZ1A 3W37A 2UWFA 1ZP4A 1FUYA 1GNXA 1LG1A 5D4YA 1B31A 2INZA 1R3WA 2ZUWA 5KITA 3A4JA 3KDOA 3RILA 1UH4A 1P0KA 2ALRA 1K9TA 2A79A 2HRWA 3I7QA 3QC3A 4D71A 3CHCA 4OQVA 3CB8A 3FYPA 1W3LA 1JJKA 4LQ1A 3O0KA 1SFJA 2VDGA 4CQ8A 5FF2A 4AXNA 1CGTA 1CBGA 3BLDA 3TQ0A 4E3TA 3MSGA 1E9YB 4K7YA 4W84A 1KCZA 3WH9A 1WBJA 2VEIA 3CUHA 4XTIA 3PC0A 5D2TA 4L5ZA 1G7UA 2Z4GA 4M3PA 1R9YA 3KE0A 3WK3A 4IIGA 3S9IA 1MYRA 1DIKA 1Q63A 2GK1A 4DBDA 2OMAA 3C4UA 2FZ9A 4AWSA 3CUGA 1TWSA 3PWIA 2F6XA 3SO7A 4I8DA 4MHBA 1EDQA 2CBIA 1E3ZA 4BEQA 1US2A 5AN7A 4V27A 5M2FX 2GQAA 3QVQA 3WO8A 1DTNA 3DCPA 4ATLA 4H2HA 3VOIA 3P2VA 5IHRA 1JGIA 3R58A 1GKQA 3DHDA 3CGTA 2O7QA 4H6EA 1W9UA 2Z1WA 3LMYA 4LBSA 1WZLA 3AALA 3WD3A 4C90A 4MJMA 1D3HA 3R2GA 2QGYA 1KKOA 1C8XA 4IF2A 1PWMA 3DFHA 3DHFA 2Y1HA 1GEQA 4ICCX 5ABTA 3GTFA 4MNLA 3H2EA 3PJWA 1BPLB 4B5SA 3ABZA 3EB3A 4EAYA 2IQTA 1RJRA 1HN1A 4DWSA 1XG4A 4A6GA 4GJJA 2NV1A 2P8BA 1KFLA 4DAIA 4F79A 4NZCA 1JPHA 5BXTA 4GINA 4GPNA 4HN4A 4IMEA 1NOUA 1B30A 3M5ZA 2DIJA 4BR1A 3H7UA 4GO9A 1K7EA 1RP9A 2VZSA 1K1DA 3O8AA 4O8AA 4UNLA 3SR7A 4H9VA 4PMXA 1BHGA 1CI1A 3M07A 2X0HA 1H5VA 2FTWA 1HIZA 1A5AA 5D9OA 1V6UA 1UPMB 5D2VA 4L4OA 2Z26A 2BG5A 2R24A 5KETA 2YZRA 3DG6A 3RLUA 2PI6A 2ZX8A 4NZFA 1GPWA 4PFHA 5LA0A 4XBKA 4ZB5A 3UCCA 4EF8A 3MDUA 1ZCCA 4NUWA 3KEHA 4MDOA 3RO6A 4JTKA 3W1PA 4I6KA 3UJSA 2PP3A 4GI6A 4S3BA 1QO2A 1W1YA 4J3XA 2WJEA 4QGCA 3GVGA 3U7VA 4JYDA 3T44A 1JDEA 4PEKA 5EFFA 5JBDA 1FCQA 4JL2A 3QKEA 3FDGA 1BLIA 4MY8A 1KW1A 3PK7A 1LRNA 4O54A 3ZJKA 3W2NA 4E8CA 3JZUA 4GHRA 3BUVA 5EA9A 3TN6A 3ZQ9A 5IDZA 4D6EA 7ODCA 3TH6A 4G1NA 2TRSA 3LCHA 1RSCA 2A3HA 3MBDA 4HOWA 2QCEA 3RF9A 4IP5A 4Y96A 1A0EA 4TTGA 2YXOA 1X38A 1XYMA 1NDYA 2YSWA 3FHQA 1Q13A 2XH4A 4Y9PA 2Z0IA 5ECVA 4JGDA 2PTZA 4FAMA 3LSCA 6ENLA 2ZXQA 4M29A 4B3ZA 4DBUA 1UR3M 4Q4PA 4Y9NA 2CHRA 5C71A 4JS3A 3BZJA 1XFCA 3CUZA 1Q7MA 1ZBVA 4LS1A 2FPYA 1FCUA 3DC0A 3H2CA 2QULA 2PRMA 3S3GA 2QCHA 2D23A 2GUYA 1TQJA 4US6A 2BVTA 1FXPA 3IRDA 4JFUA 5K4XA 1W9XA 3P8IA 2I17A 3KM8A 4GQQA 3MKVA 1RUSA 3A4WA 2V69A 3BOXA 4CN6A 1OFBA 2A3BA 3WF1A 3QZAA 3WLKX 4YYFA 4Z08A 5FL0A 2J7GA 3EKLA 2E0PA 1Q6OA 1AG1O 4XB3A 4RX0A 2WQPA 4TVDA 1JYWA 1FDJA 4XZLX 1EB3A 1TTPA 1QBBA 1J79A 4PMUA 2EPMX 3OBKA 4ERIA 2CLLA 4EKJA 3GYEA 5CJMA 4RPPA 4DELA 3CUXA 3VZYA 3RO8A 4ZFCA 4ZODA 4IICA 3GG8A 4IJCA 2V30A 1E6QM 3VGDA 2Z2AA 2R6OA 2W79A 1TX0A 4MJ2A 4HP5A 3TSDA 4QISA 3K4DA 2XINA 4RZ6A 1KR1A 1MFUA 3WKZA 2J7BA 2WM1A 3IIZA 3L4WA 2HBVA 3PPGA 4M82A 2ZZ4A 2XIQA 3MKCA 3TYCA 4W85A 2QHAA 3REQB 2QZRA 2FFCA 4L64A 3AXKA 3OZOA 1OC6A 3M0LA 1JUKA 3HPFA 4NJKA 5C70A 1AMKA 4Y9MA 3UA4A 1CXEA 1OT2A 3MCMA 1XL9A 1OD0A 3WQ5A 1A3XA 2J27A 5AKQA 3LA4A 3P0WA 2X7WA 4OTKA 4RJEA 5DMYA 2RDWA 3SCVA 3WK1A 3OBEA 2Y7DA 4UC5A 1RH9A 5LIKX 3MJYA 3BG3A 3TX9A 1H7RA 1O6IA 2HTMA 5HPOA 3T9PA 3DX5A 3DN5A 5F7UA 4CVUA 5HMDA 5DCDA 1CDGA 2PGRA 4C6PA 2OPJA 3EWYA 3UETA 3N11A 3ZZ1A 4PE8A 3CTLA 2AKZA 4D6JA 4GLEA 2C1GA 1ZGDA 2D3LA 5REQB 5BROA 1M41A 4QXIA 4F2TA 1UUOA 4CUCA 1F73A 2YOCA 1QPKA 1FWCC 5EL1A 4NZ1A 3LQLA 1TV7A 2C7FA 3FGCB 1RK5A 1XQLA 2GK1B 4Z0SA 1RCOB 3TYUA 2GJXB 4AD3A 1XIEA 4AF0A 3MHGA 1QJWA 5FJUA 3GXMA 3QXBA 1XCWA 4HSNA 1YHTA 4UQ9A 3M0ZA 2OVLA 3OIHA 4EF9A 1GQKA 3N2OA 2D22A 5FKYA 2XGBA 4XSMA 4RDWA 5GJMA 3VNJA 3BZGA 4S2CA 3AHVA 1W54A 1UZ1A 3I7RA 4JQ3A 4GZIA 4MYXA 1A5LC 5HOSA 3NM3A 2BVWA 4AIOA 5HINA 2JEQA 1XISA 3FNDA 4GH1A 4GMEA 3ECQA 4HU0A 4RXGA 3UZWA 3WH6A 1UCWA 1WZMA 1XH1A 2ZUTA 3SSJA 1DJQA 3AIEA 2Z24A 4N02A 1J0YA 3I4EA 1UC4A 3G0SA 1L6SA 3W82A 2YX0A 2P5NA 3AHTA 1WDPA 1ONRA 3MDWA 3CUFA 3WUBA 3ZWTA 1E4MM 1A5NC 4RV3A 1PCKA 2IXVA 2V82A 4ACZB 4MWAA 3EX1A 3CXOA 1YXCA 3H2MA 3BTNA 3TJIA 1NF7A 2WVTA 4DB7A 1KWGA 4GVGA 4R9OA 3EB4A 2C71A 3CL8A 2CZ5A 2A6LA 5LNSA 3NJ3A 4IX2A 4KPLA 2WSRA 3G1XA 4MZYA 1T8QA 2Q01A 3PUDA 5I3KA 1XBXA 1MQRA 1FWFC 3UERA 1LBFA 5LIYX 1NU5A 4MOZA 1H1NA 4GYJA 4OBSA 3W81A 3H23A 2W91A 4LC8A 1OADA 5C8BB 3MB9A 1LL6A 1BGGA 1N8WA 1DJXA 2O56A 3BLOA 2C0AA 5TNVA 3A64A 1CXLA 1QMLA 3O0FA 1FVPA 3VD3A 1JFHA 4WXZA 4IL2A 1H60A 1I2QA 4WXYA 4BI5A 2FJKA 4US5A 4IIBA 1CGWA 2WMFA 1EC7A 3QHMA 3T0CA 1FKWA 2HNHA 1GKPA 4WVXA 1PYMA 1R2SA 5A6LA 4D8ZA 4LY8A 6ALDA 2GVLA 2ZRWA 5I5RA 1PTGA 3TR9A 2W6RA 4EWJA 3HMJG 4IQEA 1BWVA 4C6DA 5HWNA 1PX3A 3ZJ7A 4UTTA 1A0CA 1R9XA 2ALDA 3N6HA 3JRKA 4GXPA 2CLOA 3ITGA 1V7YA 4GH3A 2OZ8A 1OY0A 4B3LA 6XIAA 2E5DA 2QVNA 4HCDA 1IEIA 3Q45A 4QITA 2JKAA 4XZBA 3WD0A 1T99A 3RCNA 2PAJA 3N19B 4JN6A 5CC7A 3U57A 4GKTA 2VCCA 4QLJA 2VR5A 4PTXA 7PTDA 1SZEA 3VKJA 4FPSA 3WQ6A 5LHFA 2PCQA 5CJ5A 3LHZA 1DJIA 2BY3A 2CEQA 1AZ1A 3P93A 4AD1A 1J8VA 1LUCB 4B5XA 4F66A 1QNOA 4QR6A 3BLFA 4Q4QA 5GVJA 1FWEC 1SSGA 4HD5A 4FLQA 5CGTA 1PHQA 1ISZA 1EQPA 4AX7A 2HXUA 4UOZA 1IV8A 1N55A 1MSSA 2INFA 2GVJA 5GNZA 1Y65A 4UNIA 4AD4A 2ZTKA 1W1PA 5A95A 2ZBTA 3LPFA 3KW3A 1Q45A 5A6MA 1V93A 4ZE4A 1Q5MA 3MVIA 2QCLA 3VO0A 4WY0B 1WPCA 4QDMA 1AW2A 1V79A 1A4LA 1VB9A 1OFPA 1WDSA 3N17A 2PODA 1GPFA 4GIYA 3PG9A 5D04C 2OO0A 2ONEA 3VD9A 4MLRA 2QGHA 3SCUA 4CCDA 2XUCA 1ZBKA 3DFPA 3AS1A 3NPWA 1UP0A 3T0AA 1OFDA 4K37A 3VTRA 4ORMA 4C6KA 3VKAA 2ASHA 3OZYA 1VIWA 4AZ7A 1QNSA 3F4WA 3HN3A 2DH3A 1M7JA 2WKJA 4INFA 3EB2A 3PBVA 5D02A 4GYFA 3I65A 4DM1A 1NDWA 3W2JA 4ZQRA 2R1KA 3WLTA 4YHGA 2A0NA 1OCJA 1WB0A 3E2VA 3EWBX 1JULA 1M65A 2XZ7A 4ZTXA 5SWUA 1S1PA 1HKIA 2WVUA 3LGEA 5D37A 4NNAA 3GUWA 3U5YA 3K1DA 3BQ5A 1J5SA 2WZIA 3M7SA 5C2GA 3AYSA 1EJVC 2GJNA 3EA2A 3GXIA 1UA3A 1XYCA 3R11A 4NJGA 4B90A 4H4IA 3VM7A 2D0FA 1ZSXA 3PJXA 2FZ8A 2B4GA 4R7JA 3UZZA 4UR9A 1XP3A 1VHCA 1X1NA 4PL2A 3IV8A 1B3YA 2YFNA 1OX6A 4K1GA 1MFVA 4Y7EA 4AWEA 3ZOAA 1UD8A 1HT6A 2PF8A 2WC4A 1UASA 3MMTA 4JL1A 1DXEA 3WL0A 3LTPA 3DZ1A 4DLFA 5K9CA 2G50A 4I7UA 3DIPA 1QK2A 5MKGA 3W1NA 1XQKA 4O50A 7TAAA 4JNYA 2Z28A 4IZGA 4UQBA 1RJPA 1W0MA 2CLMA 4GVHA 1TTQA 2ADAA 2C16A 4P8XA 3UWQA 1TMLA 2BASA 2VVNA 4C1NA 4P7QA 1YADA 1VYPX 3NWRA 1V6XA 1LOSA 3TNOA 4YTTA 4O0KA 1GOQA 4KWUA 5FJRA 1HP5A 4XV0A 4I8YA 3O2LA 4XSLA 4PMVA 2AOSA 5IBXA 3UWWA 2VNCA 1DJZA 5FF3A 1F8MA 1JRCA 4KCUA 2A3EA 4IPLA 4PBFA 5BOOA 1BEUA 1FH7A 1W5NA 4DWSB 4AHQA 4FNQA 5DELA 3AS3A 3W6MA 5BOFA 1QI5A 3ONCA 2OCZA 4IMAA 1MWOA 2VT0A 4AIBA 4HHLA 3ATYA 3E38A 5JMUA 1PB0A 2PURA 4ERAA 3M5YA 3RM9A 4S3FA 3RGTA 4I5UA 1J9YA 2C3ZA 5I3GA 3NIYA 2CZVA 2QUUA 4GXWA 1JXKA 1XPGA 3NNTA 3VNIA 4AZCB 3NG3A 4QNEA 3K8KA 1V7AA 2BHUA 2A7NA 2O92A 4FNSA 4XVDA 1XKJA 2BOGX 2WZEA 1A5OC 1X7FA 4HU4A 3SN4A 1KM0A 3GWQA 4N42A 4HIBA 4C7GA 1P1XA 2HVNA 3MWCA 1F61A 1I1XA 3W7LA 4J3VA 2X7VA 4PC8A 2V67A 4JTCA 3PG8A 2ZDSA 2BFGA 4FSAA 1LYXA 3RLVA 2CKSA 3MV11 4EPDC 4GX9A 1XIGA 3WK2A 3LS9A 1Q6RA 2EPLX 4RNJA 1GOOA 3CWOX 4FOJA 4XAFA 4ZEPA 4HNVA 4PYSA 1BSLA 3RU8X 3WIJA 1J6OA 1P1MA 3ORWA 3AMGA 3GDBA 5EBUA 4IJBA 1BD0A 3KZSA 3MI2A 4NT0A 1FQ0A 2GOKA 4HK5A 3T42A 3GKFA 4EAMA 3QGKC 4LVFA 1WZAA 4E2OA 2F61A 2Z1BA 4G8TA 4K38A 5H1WA 4E2VA 3VI2A 4XZWA 3S6OA 4OV4A 3KLLA 1L2UA 3HGRA 4RPQA 1LT7A 5E0CA 7REQA 2VC7A 3ID7A 2DSZA 3P74A 4N7QA 3W1XA 2Y62A 1E9LA 5GJPA 3WNOA 4DWSD 1TIMA 2OB3A 1FDZA 2XGZA 5CZTA 2Y88A 4GIAA 2WZTA 1JYNA 1VHNA 3BV7A 4S38A 4PUEA 2ZUUA 3TU9A 1WXYA 1V6YA 1KGUA 4HBKA 1Y0EA 5A6KA 4PB3A 3IARA 5I3FA 3SW6A 5CPTA 2PC4A 1OB0A 3TOPA 3FA5A 2V9DA 3QFEA 2AL1A 5BRQA 5CZSA 5G2WA 2HK0A 3ZT6A 4TU1A 3QRHA 5C6MA 3DFQA 1C9WA 3B8SA 1Z9AA 4MWAE 2PFHA 1VPXA 3NURA 4HCHA 4IIFA 2XFYA 3M4HA 4RE4A 1MNZA 4LU0A 3AHXA 1CGUA 1LF1A 5K7JA 1CEOA 4H2CA 1GTHA 2EPKX 2ZRXA 3R1ZA 1R7OA 2DU2A 3UEQA 3N2TA 1PZ0A 2WJDA 4CD7A 3ARTA 2FHCA 4B9YA 1TA3A 5A3HA 4NVTA 3TOYA 1U5JA 1Y8BA 2JFEX 1IWPA 1JDDA 1YMYA 3KWXA 1FWBC 1I2RA 4EPEC 1IGWA 1AUSL 4M5PA 3OA3A 1OINA 3FHAA 1G9HA 1V6VA 2XH2A 3KTSA 1TZZA 3P60A 3W6LA 1GWJA 3ANYA 2GFTA 3MP3A 3CHFA 4C1NB 3BOLA 4LYKA 3E0FA 1AH3A 5I24A 4MNJA 2J66A 3AFBA 3QH2A 4D1JA 2C14A 4JKLA 1SO3A 4LUJA 3VNKA 2F84A 2G5WA 3TDFA 2RAGA 2ON3A 1YLVA 3C61A 4F4RA 1HKMA 4DVOA 2JGYA 1AD1A 4N4PA 2XFRA 5A8MA 4UZSA 1TVLA 3LCWA 2V38A 5D33A 4TV5A 4J3WA 4J9JA 3ABSA 2E77A 4B91A 2WJFA 2XGIA 4XZIA 1TV2A 5EMJA 3PZ9A 2PZNA 1KV5A 3RM8A 5I3HA 3GR7A 3CO4A 2EJAA 2JALA 3L65A 4Z2GA 2UY4A 2YGYA 3C2VA 2WMHA 1A3HA 1YX1A 1UZDA 3PJTA 3THDA 3EDDA 1SO4A 2YLLA 1XGEA 1LTDA 1G4EA 2ZA1A 1N7KA 3B8UA 4H9MA 3IGSA 1XYFA 1IEVA 4YWSA 3K46A 5T8GA 3IGXA 1QTWA 3CM4A 1KFBA 3SN0A 4DNMA 3V0UA 3A47A 4R33A 4XAGA 2AL2B 4POCA 2BSLA 1RALA 3GVQA 5I07A 3WQFA 4OT7A 2QCCA 2CZEA 4HMCA 2RJGA 1JDAA 4AZ6A 3WBEA 2A2IA 4R9XA 2DT0A 3DYOA 1YQ2A 5LNVA 3UJRA 3DG3A 5A8NA 1O66A 3W73A 4KBXA 4WJXA 5B7YA 1W1B1 2I9EA 9RUBA 3AQUA 2QMJA 3W7EA 3STEA 1RLDA 3VIOA 4X9SA 3TN4A 5LXXA 1Q6DA 4AMAA 1DIEA 3ZR5A 1W1IE 4UTLA 4PTWA 3QSRA 4F0KA 4GIEA 1NFBA 1NSJA 1Q6LA 2OEMA 4AX6A 2WWDA 5DX7A 3WQPA 2TYSA 4LS2A 4KCVA 4Z1YA 1A5MC 4URIA 1POKA 4DBWA 1HF6A 1XDMA 4D6FA 1JCJA 2UZ9A 5K9DA 1QK0A 1MRAA 3BG9A 4G1KA 3R13A 4YMZA 3B3DA 4UTFA 4QEHA 3O3RA 4PUMA 4HNNA 3ZFHA 3FAWA 1UBPC 3NL6A 4JTGA 2FZMA 3CQKA 4AVFA 1WXZA 1UOZA 2BODX 4H19A 3S5ZA 4P7RA 1AD4A 4IMCA 1QOXA 2NXGA 5LA2A 1XG3A 3J7HA 3AZSA 2NVDA 4PB5A 3PTMA 4JTJA 2X2YA 3QY8A 5I79A 4S3DA 3NM1A 1TRDA 4RW5A 3GHRA 2E8YA 4UIOA 4JR5A 2AL2A 3L5LA 2C91A 2H9AB 1UKOA 5J5DA 4RK8A 3RYSA 1ZB5A 5GQBA 2BY1A 3A24A 2Y0FA 1MRQA 1HKKA 3LRMA 4JTQA 4F0LA 2A3LA 2JQXA 2ZTJA 3MANA 3A3HA 3NPVA 4P61A 1SSDA 2PP1A 3WZ0E 4EPKA 3A6OA 1OGSA 4QCEA 4DM2A 2UY5A 2D24A 2W63A 3F7JA 1YKWA 1H11A 1W1A1 5IFTA 3VPLA 3KVLA 1L9WA 4BA0A 4MZ1A 4BQ5A 3QPZA 1JCYA 3VFLA 4FX8A 5C2XA 4QG6A 3CH0A 4JIQA 4J40A 4MGGA 4HNTA 3MQTA 3KHJA 3VKCA 4L7ZA 4N9BA 1XLEA 3RMEA 1ZJAA 2VM8A 2NV2A 1UUQA 3GXTA 3ARRA 3WMLA 3T0DA 1B9ZA 1V4YA 3EXSA 2ZVRA 1IWBA 3LERA 2QPXA 3MP4A 3L4YA 3HFYA 1EPXA 4IGNA 4Z1CA 2DSKA 5CG7A 3LYEA 5EU9A 3WF3A 1KO0A 3CZJA 1FWJC 4D8LA 2PDQA 4HU8A 3PZIA 3LTYA 1SFLA 3VXGA 2R9RA 4H9TA 2OEJA 3R5EA 4QG8A 4Q7NA 5C0QA 1LUCA 1ZNNA 3WNKA 5D05A 1YXDA 5CZKA 1TJPA 3W28A 1XRVA 4AEEA 3APGA 3TAOA 5KTLA 4GUIA 4PUKA 5I03A 3WD2A 1TPH1 2JIWA 4AXKA 2F2KA 2V6AA 4EXBA 4UNKA 3NGFA 1V03A 3KLKA 5HR7A 1GVOA 1CB2A 2HEJA 3N9SA 1WAUA 2Z1KA 3AAMA 5A6TC 2NX1A 3BV4A 3N13A 2PGWA 2UBPC 3VIPA 5CBBA 3SCSA 4HK6A 4B5UA 2BS9A 3BSMA 4V28A 3L66A 3UY8A 4ZFMA 1GW1A 1A0DA 1XIMA 3LBMA 4AYSA 3UA3A 3WDRA 3WD1A 2V3DA 2V0TA 2ANUA 2QV4A 4TQTA 4XD6A 3DC8A 2HJPA 1XD1A 3F4DA 3MY9A 2CFFA 3DI1A 3WYZA 2GJLA 2DZTA 2YKKA 3E74A 1HKVA 5TQLA 4B5WA 4DO7A 4IMFA 4DY1A 4EIVA 1NFPA 1OGBA 3TVAA 1RP8A 3HURA 2QUTA 3WBXA 5AC6A 1B90A 2XVNA 4G7EB 3W7GA 4QE5A 3MMUA 3VZZA 1VF8A 2JE8A 1DIOA 2QUMA 3GIYA 3VX1A 1EIBA 2X1RA 4L9ZA 1PX4A 5EMMA 1TWWA 1UUMA 1OEPA 2DH2A 4W8BA 5HDRA 3AO0A 4LUYA 2TODA 3QMTA 4LUTA 3OVRA 3URNA 1KCLA 2GDQA 5CPLA 1GGOA 2F6UA 1JDFA 6PTDA 4MY9A 3EYPA 3R79A 4WKFA 4H9ZA 1JR1A 4O17A 3V5FA 5HATA 4FLOA 3LRLA 3BSGA 4G5DA 1GJWA 3O6YX 3AXHA 5HANA 4X61A 4HNCA 3USZA 4FLRA 2J7HA 1OWQA 4F48A 2PCEA 1IIHA 1UWUA 1TTIA 1CWYA 3WG6A 2HE5A 3ZLFA 3FS2A 2HQAA 1G69A 2W5FA 3PPCA 3LPPA 1EJ7L 3NQBA 1B3WA 1F74A 5IM51 1E4NA 4GACA 3HQ1A 4B92A 3KBJA 1NWRA 3JZEA 4O11A 4O14A 3GNPA 5JXQA 2QCMA 1GCYA 5AHIA 1C8QA 3TW9A 3KRBA 5TIMA 4HTBA 3F5KA 4DNHA 1H0IA 1XLMA 3TQVA 4NYUA 3S5NA 1EC9A 1TV4A 2D2GA 3P80A 1GJPA 1RBOB 4IWWA 1XX1A 1KM1A 3GHTA 4PTVA 3OLGA 3BAYA 3W27A 1AH4A 2CYGA 3QR0A 4RNFA 2VUNA 1UC5A 3UG3A 4ASTA 2ZX7A 3QYSA 3H70A 1V0LA 3TCSA 4UTWC 4FOKA 4S3KA 4GNJA 2XH7A 4OIFA 3RRXA 2PU1A 3G0XA 4WDXA 2ZKMX 3N9RA 1VAHA 2G8ZA 3BMXA 5FA5A 3GC5A 1NOWA 1UR1A 1WOAA 5LZLA 3DBPA 1XYLA 3W24A 1CXHA 3EKZA 4WX2A 1G5AA 2RJHA 1BRLA 2WYSA 2E09A 1DJHA 3O05A 1JI2A 2J77A 2VKZG 2CBVA 3KBWA 3CU2A 3S2LA 1G67A 4C6OA 1ZLPA 4H9YA 4UFJA 2AKMA 1J2WA 3FYOA 3G0UA 1HX0A 5DXYA 4LTSA 4F0RA 1UWSA 1M5WA 1CTNA 3EOEA 3R25A 1RD6A 1BSIA 1EL3A 1M7PA 3A13A 3BAKA 2ZA2A 3OIXA 1UROA 4EXQA 1LOLA 1Z41A 1MQPA 4HPGA 3VGEA 3MVTA 3E1F1 4HJWA 1MUMA 3HG2A 1DWGM 5AC7A 1KLZA 2ZRUA 1YXYA 1TYGA 3IPWA 2IKHA 4L6OA 3TYBA 4HGXA 2ZUMA 3C56A 3PB2A 3TXVA 3R6IA 2QCDB 2DQWA 3LTSA 5CAHA 1E9IA 4GI4A 1KM6A 3VIFA 1K9DA 4QJ4B 2UY2A 3MMWA 2FHBA 4JIHA 3CT2A 1XCFA 3D46A 3I6RA 1QPNA 5ABFA 4IQJA 5F4SA 1KXVA 3DFSA 4WSKA 4U31A 1OF6A 4KKXA 1ZZMA 1UA7A 1X6NA 3QR1A 3GNOA 3SCRA 3SY1A 3TW7A 1WO2A 1UMLA 3EOOA 4F9DA 3ZYZA 3VGFA 1PUDA 4AVNA 2GJRA 1XBZA 1S5WA 3S5YA 2PEVA 2NQ9A 2ISDA 1TJ2A 3UU0A 4BHYA 3LQGA 1B5TA 3GW0A 1MEHA 3OOQA 1TX2A 3IEBA 2XN0A 1CLXA 2J75A 3S1XA 2PF0A 1FA2A 4GCAA 1EZ2A 4ZGYA 2P1FA 1ME8A 2PS2A 5CBJA 5HMEA 1US3A 4ADSA 3EDKA 3LM3A 1QNVA 2J9ZA 3W26A 3G1YA 3V75A 3QV6A 2XYLA 2YBTA 2YDRA 4MKNA 3FN9A 3D3AA 5LNRA 3MUIA 2YPIA 4L6DA 1MXSA 1PAMA 1ICSA 4LBUA 2FIQA 1XGZA 4F0MA 1HJSA 2AMXA 1H61A 2VFDA 3SGZA 4JTSA 4O1BA 3QV7A 2NSOA 5DN1A 2Y63A 2EO7A 3CV7A 1QVBA 8A3HA 3UXDA 3GNXA 4TVCA 3QKZA 3KCLA 3ZXWA 1DJWA 3WDHA 4NKCA 5E6YA 1LG2A 1TZ9A 4QP0A 1ISXA 3HGOA 1DWHM 5KSWA 3BLLA 2OQYA 2CLPA 4LV9A 3MBFA 3WLSA 3WJSA 1VFTA 3O6AA 1UD2A 3WELA 1XR2A 3GTHA 1JUBA 4EP8C 3KOFA 5AC4A 2VC6A 1CENA 1D3CA 1KM3A 3OU8A 1MEIA 3O06A 1PIFA 4W88A 3S1WA 5AHFA 4MAZA 2EAWA 4FNTA 4C6NA 3DECA 1TJ1A 4NXKA 3GDLA 5AY7A 4ZL1A 4KWVA 4PGLA 1TUXA 4MJZA 3C0JA 3L21A 3BWWA 1OT1A 1GVSA 4MJ4A 4PMJA 3W7JA 4O53A 4LAOA 3WNLA 2PE4A 2V5LA 4LAKA 4E8GA 1K8CA 3F4VA 4ZXLA 4CNTA 5H6HA 2DFAA 3KCOA 3TONA 3W9ZA 5D8WA 3U4FA 1E0TA 3KAOA 1P0EA 1PHWA 3OPSA 3C0SA 1NIUA 1OYBA 4QE1A 2VWTA 5CXPA 5CGMA 4AEOA 2JBMA 4DPQA 3URAA 3OLEA 5BRPA 1KRCC 1EBHA 2IMRA 1UD4A 2AQVA 4X2PA 3RG6A 3V7PA 2O9OA 4RZ4A 2ZFAA 3NUKA 1UW9A 3WBYA 4MNKA 2Y89A 1IR1A 4S3GA 1E6NA 1FWGC 4FF5A 2ZX5A 1TJ0A 4QROA 4GVFA 2E6DA 1KBIA 1PBGA 2NWRA 1OHLA 3G1DA 4M19A 4GY1A 3GVWA 5I06A 2J9YA 1Q2SA 1GQNA 3NL3A 5D2WA 4NI8A 1J18A 2NVCA 3NO5A 4DUOA 2AAAA 4ECLA 3BXWA 3G8EA 3CZGA 5FJTA 3G6LA 4H6KA 4P7OA 1OC5A 1ZCOA 2D3NA 4ZQMA 1EJSC 3SBFA 3A3WA 3QTGA 1YNQA 3VIIA 1L2QA 3NQFA 4HSOA 4K2SA 3E2QA 5HQEA 1BG4A 3T1GA 1VBHA 4W89A 1JCXA 3IVTA 3KZPA 2V5CA 1DWFM 1HW6A 2VI0A 2WMJA 1XLGA 5IRPA 3WMSA 3EXRA 4LEFA 4TMCA 1J01A 3LGDA 6A3HA 2DGAA 1OX5A 2VD8A 3FEMA 2PLJA 4C6BA 3EWWA 3UWYA 1EF2A 4YCPA 3NQ8A 3RRAA 4XKYB 2FPTA 3OEXA 4ACZA 2CKRA 3APYA 4U5IA 1UZ4A 3CV1A 2PWFA 4EXAA 4JY8A 1GW9A 2ZRVA 4W7WA 1GOXA 4TX9A 4Y90A 3S46A 1PCWA 2X1IA 1TR9A 5AECA 1X96A 2DT2A 4Q8QA 4IPNB 4CD5A 4LW7A 4GZJA 1D7FA 4PFMA 2HCVA 3PP7A 3LCIA 1H49A 2F6KA 5E9AA 3ISIX 4FNUA 2Y5SA 4A35A 2Z27A 4JICA 4W9TA 4ZE5A 4H7VA 3WL1A 1PTAA 3LXAA 3W7OA 1UBSA 3E0IA 1OCBA 3TCEA 4ZENA 5ABHA 4E2BA 4GISA 4D6HA 4KW2A 2O9TA 5FJPA 1R3SA 4MIMA 1OFQA 4H6RA 1M01A 1LLZA 2OO6A 3EPOA 4W4QA 3GB6A 3GY1A 1JFXA 4PUDA 2CLHA 3II1A 3BANA 4QDWA 4BK9A 4KH2A 3GUGA 4H9UA 1L6YA 3FAXA 2VUYA 3TIMA 1DTUA 3WY1A 4V33A 4QBXA 3W07A 3W87A 1SZGA 1ZALA 3L4VA 4UR8A 3THCA 3U4AA 2J6VA 5DT7A 3TAKA 3R7MA 3EBVA 4IOTA 4LANA 1C91A 4MWAD 4AY7A 1FWIC 4BY3A 1TR1A 5B80A 3C86A 1E0UA 2CCRA 1V08A 2YYUA 4KWSA 1H7XA 2OKOA 2EG8A 3DGRA 5I78A 1I75A 4NAFA 3AXXA 1PTDA 1JGMA 3TLQA 2P88A 3U5UA 1MVYA 3WEOA 2WNQA 4LGXA 3M0HA 1SU5A 3MYOA 2VR4A 4Y6GA 3UJ2A 4B4HA 5HJLA 3NVDA 2NUWA 3UF9A 4H6QA 2VX4A 3H2FA 1KRBC 2PWEA 1VBUA 3W0KA 1SMDA 4J3SA 3THQA 2WZHA 2IS7A 5CG0A 1BYDA 3M5XA 4HMNA 3GHSA 1U2YA 3GHUA 1A49A 4LF2A 3AI0A 3UR7A 5E9XA 3L2MA 2OOFA 1OM0A 1U1JA 3ZLHA 2FTYA 3P7YA 2BVDA 1E9ZB 4PZVA 2OQLA 4L1GA 2VFIA 2PDBA 3KS5A 3QQWA 2BVYA 1I2OA 1WUEA 2YDAA 1C90A 1KM5A 2VDIA 3GS6A 4U4MA 2WNNA 4B9ZA 4GRSA 3QR3A 2E6YA 3HV8A 2QYGA 1XYBA 4IPJA 1KBJA 3UGRA 5I3IA 3VDAA 2ZUNA 2VWSA 2DSUA 3KBNA 2PDXA 2G96A 1E15A 1XINA 2QJMA 2ZXAA 2DZSA 2GGJA 1QPQA 2XIOA 3A9BA 4JTRA 1EYEA 2GQ9A 4E2DA 1ICQA 3HQOA 3S6DA 2PD9A 1NQKA 1XLHA 3OVQA 1JCMP 3LV6A 2FMNA 3FXGA 2DSWA 3Q2DA 4YU1A 3NSXA 3UR5A 3H54A 1WE5A 3RR1A 5D9NA 3AIWA 4KCTA 3FVMA 1ZAJA 1TPC1 3A22A 3WCZA 1DJGA 2DW6A 3ELFA 3IIVA 3LHYA 3SFWA 4FLSA 1REQA 2ZIDA 2ZOXA 1HQTA 1NWSA 4GE8A 3T7VA 1JYXA 4W8AA 1Z6KA 2CZFA 2FZDA 1ZRQA 4WD0A 1MW1A 2G3JA 3BW2A 3UZYA 1AQFA 3PBGA 3GBDA 3SZ8A 3UWVA 3CQJA 4WR3A 1RVGA 2PP0A 3D5HA 1LQ0A 1GKRA 1DV7A 4X60A 4Q8MA 5G2IA 4OOZA 3UXAA 4IIDA 4N2YA 1XDJA 3DEQA 1QU4A 3NQEA 3FA4A 3EWXA 3AROA 4XBSA 2PDCA 2YFOA 4UXDA 4XAYA 2BXVA 4LFYA 5KMYA 3B0XA 4JTIA 3NYZA 3BVJA 1Q66A 5IHSA 3NZGA 5E09A 3AHZA 4B16A 1R87A 4O13A 3QSTA 2NSXA 4QDPA 3U6WA 4XKMA 4CNPA 3VNLA 1LWHA 3V5OA 5CSUA 2XIBA 1KLYA 4HA3A 4ENLA 4H3DA 4JCMA 2WMKA 1K70A 1UQZA 2W4XA 1IEQA 1QR7A 3PZMA 1RY0A 3HOJA 2J62A 3LHTA 1A5UA 3ARXA 4KWOA 1EP3A 3GFYA 2DUZA 4UTIA 3WLQA 4L4PA 4NHVA 3A5FA 1F3XA 4XVEA 3NDYA 3DU0A 3WJWA 3WF2A 3QZ6A 3EWZA 5JUVA 1B4EA 1G4SA 1VP5A 5CAKA 4DLMA 1VJIA 4NAFB 5K9XA 2VZOA 3BOFA 4PUWA 3JUGA 3PFRA 1YPIA 4LXFA 2F2HA 1F05A 3E96A 4FHAA 3IVUA 4GUGA 1BAGA 2POZA 4DHGA 4LUIA 1WQ5A 1GYMA 3ZVHB 2WHMA 4Q6XA 2A3AA 5HWJA 2POTA 3GIPA 1ITQA 1QNPA 3LDVA 4Y2WA 3KX6A 3SRHA 3V4BA 1CXFA 1RAKA 3LD5A 4Q7BA 4NX5A 4Q3MA 4F40A 3VMNA 3LZ5A 3NQ6A 2P10A 4LJ3A 1ZJHA 4JD4A 4ZO9A 3W2KA 3B97A 4NJIA 1LBLA 3KOWA 1M1BA 3NQAA 4A21A 4YXGA 1XI3A 1WXJA 4LS0A 2G95A 4W8LA 1H5YA 1FDYA 4DWDA 1XYAA 3G1SA 4YVVA 2YXGA 4XZNX 2HISA 3ITOA 3LLFA 2Y8VA 1R0MA 4O18A 1RJQA 1S3HA 3CMFA 2PDMA 5DRIA 3DXIA 4HZ8A 1V6TA 1Y5XA 3ITLA 1J5TA 3S1VA 3ZJ6A 3MV01 1O95A 4A29A 4IXXA 2FPVA 3IACA 1S38A 1MZRA 1RBAA 2D0GA 4ML4A 1WKDA 2PWGA 1G7VA 1QW8A 2WNZA 1TV8A 3GU1A 4B15A 5HULA 5K4ZA 1H09A 3CUJA 5GJNA 2WB5A 4GNKB 1E56A 4U3AA 4C65A 1TSIA 3E2SA 3RUBL 4I9JA 4HOZA 4EE9A 1IXNA 3LG3A 2D20A 3EWCA 2VOMA 2QDEA 3VNMA 1PYFA 4WLCA 4S3EA 4NQ1A 1TV3A 3RPTA 3E02A 1W1VA 4NI3A 3RK8A 2I16A 4PB4A 1JNEA 1VBJA 2VZTA 1G94A 4LH8A 2OSXA 2FQIA 1BFNA 3KRUA 1J11A 1FWAC 5C55A 1E71M 1G0CA 3AJ7A 1Q6QA 4OBTA 1IT8A 3EX4A 5H8MA 4C7FA 2O9PA 3NEVA 4L9YA 4ICNA 2X1TA 3SAZA 2VGBA 1X8FA 3IV3A 2ZADA 3TTSA 3C2EA 3WLNA 1SW0A 3PY2A 2PWHA 1JF5A 4LAUA 4W5UA 4S23A 1TUFA 2DUXA 2WMIA 3GYCA 1JZ3A 2BDQA 1JZ4A 3UNDA 2E5BA 4L1WA 3GR4A 4BI6A 1BGAA 3SSZA 3BE7A 1HVQA 4MY1A 2VQUA 5DF0A 3NAVA 3GNDA 3KBVA 2FVMA 2PUZA 5C9XA 2VL4A 5E70A 1OSEA 5JIPA 2B31A 4MKSA 1JCTA 1ZTVA 4XAZA 4QX4A 3U7BA 3URQA 3DUGA 3MUCA 4W7VA 3VD4A 1QOPA 1T7LA 3BLEA 3W1MA 1JZ8A 4IQDA 1B3VA 3IJ6A 2D73A 4Q4SA 4KMQA 4AWTA 4M7TA 4LALA 2WCAA 4C6QA 3QN3A 1XSIA 3W7RA 4GGHA 1AH0A 4IFOA 1M53A 4I7WA 1QW7A 5MHBA 1XLCA 2Y70A 1BYAA 4UFHA 1B54A 3W74A 1AFSA 4IPIA 4IX0A 1VFLA 2ZWZA 3PAOA 4TV6A 1IHIA 5C7VA 4FXRA 3T05A 2Y4SA 1EJWC 4Z0JA 3TWBA 1MI3A 1SJDA 2DZXA 2D2OA 5FJOA 3NYDA 1JVNA 4CD4A 2PTXA 2NT0A 3SUSA 4A8LA 4Y8EA 3VIHA 2W3ZA 3ONBA 3WQOA 4JBRA 3W1AA 5LKYA 2E9BA 2WMIB 4RLIA 4R85A 3ARSA 2HDJA 3BCDA 1X7IA 2XU2A 3ALGA 2A6NA 4O57A 3UXKA 2R94A 4DYKA 1EPVA 4AC7C 3QMSA 3JW7A 2IPGA 1ZL1A 1UKPA 5A8GA 1NDVA 4WOQA 3IIXA 1GZ1A 4OGZA 3IUDA 4XWUA 2P3ZA 1GORA 3C2FA 2OYKA 2PDKA 4AG0A 1SJAA 1D9EA 2NWSA 3DFOA 4M51A 2O7SA 2E6FA 3BW4A 1KC7A 3WH7A 4NAEA 1V6WA 1BVNP 2NV9A 3KVKA 2D2HA 3TC3A 3K2GA 4K8HA 3W29A 2FYMA 2NUXA 3FOKA 2A85A 4UTKA 4HQVA 3C2YA 1E0VA 1F9CA 4G9PA 4L65A 1UJPA 4C6MA 5A2BA 2QPSA 4JQ1A 2QLYA 5HUPA 1SM9A 2WSQA 2YYTA 4PN2A 1I45A 4QLLA 4B2DD 2GVEA 3PTKA 2P3EA 4KEZA 7ENLA 1S2VA 1P5BA 2PDUA 3CHDA 3G5EA 2WCGA 1SMAA 4ZMGA 2HSAA 1FH8A 9XIMA 1ME7A 4TR9A 3NEHA 3TP4A 4KEMA 3G1FA 4DJFC 4YVXA 5A2AA 5I2UA 3DOPA 4UCFA 3RJYA 1R3YA 2WANA 1TO3A 1WKYA 3OGRA 3RN6A 4UMCA 1B0IA 5XINA 6REQA 1E1FA 1QI4A 5T91A 3OLIA 4DUVA 3SIMA 1TPVA 2EHHA 3SUVA 2O9RA 3UPWA 2WOQA 2XSBA 2WQDA 3N4EA 3VILA 3ERPA 1CIUA 3DKLA 1A5SA 3T2PA 1KM4A 4RZ5A 4CKQA 4UOQA 3PM6A 4ZQCA 3GDTA 3NO3A 4FK9A 1DYSA 1KCKA 4UQDA 2GGHA 4JY9A 3T09A 4LCQA 1KTBA 3TEVA 2VVSA 3AJXA 2IUZA 3C3NA 2QCGA 5U7SA 3NL2A 4GCXA 5I0DA 3WN6A 2WSYA 5D30A 5G4WA 1K3UA 3HPSA 2X1UA 2E68A 3SUTA 4QSHA 4HN8A 2GQ3A 1P0DA 3NQVA 1QFEA 2E28A 4PRTA 4I5XA 3BLKA 4G7EA 2PDHA 3IK2A 3PS7A 5AYXA 1AW5A 1T40A 3BC9A 1E1CA 2CPUA 3N2XA 4HHHA 3KWSA 4PTMA 1W9BM 3AIUA 2GSHA 3IJQA 3M0YA 4CVWA 1TPFA 4A22A 1W37A 4AMCA 2ABBA 1MO0A 4NX0A 4PTDA 2XVPA 4E4PA 1GVIA 4IH3A 1HVXA 1W3NA 5FD0A 2GGIA 3MI6A 2VJXA 1D8WA 4ZQOA 2ACUA 1WKFA 2WMGA 3TFCA 3PNUA 1FWNA 4RW3A 3ZSSA 3O9NA 5HNUA 3H21A 1ITCA 1ALDA 1E6RA 2NZLA 4PUNA 1OG6A 4LRTA 5LIWX 1ELSA 3U2OA 3RJXA 2OU4A 4NJHA 5CPOA 3BAXA 3TA6A 3ITCA 3IJIA 4C1KA 1ME9A 2Q09A 1OFOA 5FF0A 4U33A 4KESA 1O68A 1XV8A 2Z29A 1Q65A 1XRTA 3BSHA 4H8UA 2VRJA 1TE1A 2WHLA 1UQYA 2R8WA 5HXMA 4GX8A 1KA9F 4YIWA 1UWAA 2OODA 3T8LA 3NQGA 2O55A 1G4TA 2VCAA 1QI0A 2J24A 3THAA 1EQCA 1KXHA 2DZBA 2IQDA 1ZJBA 2L5HA 1QNRA 2WHJA 4FF7A 5I00A 2OR2A 1DQXA 7REQB 3TZNA 1ZAIA 3UCDA 1PEZA 4ZA0A 4J5NA 3O7UA 5I77A 3EA1A 4MB4A 4AHPA 1TCMA 4L56A 3PR2A 3DENA 3L0KA 3C0LA 3V18A 1NY1A 1OFRA 1EDGA 1EEPA 1NOFA 5AHLA 3PBUA 1WUFA 2OTDA 3B8IA 3AOFA 3RXZA 4BI7A 4DJDC 4AZBA 4CD6A 1M03A 1Q8JA 4AFYA 4N9EA 2FB3A 6REQB 4WGXA 4DEFA 2REQB 1WA3A 2J7CA 4BCEA 1HJVA 4LEQA 3CTTA 1OJXA 4IGMA 3GK0A 3P67A 5AHEA 2VC9A 3VOHA 1JZ7A 1JPMA 4DF1A 3GTXA 1XLBA 3IRSA 1MQQA 1YE6A 5U4NA 4DZHA 2V2HA 4LAMA 3HFTA 2Z1SA 1ONWA 3PPHA 2XZ9A 3HQPA 3BPWA 1FXQA 1JAKA 4BFAA 1A47A 3OBAA 2QCFA 4RDYA 3M0IA 4CLMA 2EG7A 4RZBA 3SADA 2OGYA 1AK5A 1GONA 4RNIA 3TN3A 3UWZA 4ZSUA 5XIAA 4XD3A 2A21A 3NGJA 1NELA 2J74A 1P7TB 1T6MA 4LPCA 1R85A 1KD0A 1PDZA 3P82A 5A6AA 2ZZ6A 2V3GA 1ADDA 1FFQA 2WV8A 1BVWA 3GE7A 3SI9A 1TPEA 3S1UA 4JHMA 4F9JA 1LM1A 2ZZ5A 4O1FA 3UW6A 3JR2A 4JTAA 4J35A 2AGTA 4E5TA 4LVDA 1EC8A 2BBFA 3CMGA 4JEQA 2XWEA 1O94A 4NL1A 3DDMA 3DFTA 1AODA 3RCMA 1XRSA 3ES7A 4ATWA 4E4UA 3CWNA 1Q4WA 1R2RA 1LQ2A 4HKPA 5CSYA 5DFAA 4MVAA 4RDVA 4GVIA 1DP0A 2PTWA 4MYAA 2V63A 5PTDA 3C0QA 5RUBA 3B0UX 1AJ2A 4KGJA 4CCEA 4NF7A 2RFGA 3FCPA 3FVDA 3PZGA 4LB3A 3A3XA 1DEDA 3CUIA 3DFNA 4N9DA 1M6JA 4A2RA 3B9OA 2EQDA 3ZVHA 2JKPA 1S1RA 3MO4A 3STCA 1XICA 3ALFA 1DE6A 1V51A 2J47A 3O63A 5FEXA 1XUZA 4NASA 2JKEA 1U1UA 1SFTA 4Q8WA 4S39A 3T40A 5I23A 4JIEA 1KM2A 3D6NA 2YBUA 3N6JA 4QHRA 4OVXA 2KZHA 4XX6A 1K7FA 3G3MA 4EX4A 3I4KA 5CZ0A 3EKGA 3DKJA 4WEVX 2PDNA 3WJXA 3W7HA 1UIPA 3UZXA 4UFKA 2Q02A 4DX3A 1OYCA 3ENLA 1XJBA 3APTA 2FGBA 2CLKA 4ERGA 1JCLA 3PN8A 1YTKA 4GXMA 3MP5A 3FX4A 1JQVA 1N8IA 4OKDA 4P7LA 1U5HA 4PMOA 1F5ZA 2BXZA 3R0DA 1EOMA 5A6SA 1HUVA 3SCWA 1LBMA 4LNYA 3PNZA 5EFDA 2EPHA 3B9AA 1G01A 3MWAA 4V1XA 1YIXA 1H7NA 3SCQA 1E3XA 1X8CA 4M80A 4PH6A 2WSKA 1BXNA 3L4UA 3W76A 3TFXA 5J8LA 1HJXA 1KQZA 4W86A 4AU0A 4TIMA 5F4XA 1KKRA 1Z69A 3V5CA 2RKXA 2XVGA 1YDNA 4K8EA 5C9WA 3RHGA 2QJNA 1LJYA 2XISA 5F2LA 3A23A 3TMQA 1LLOA 3N04A 4GZEA 3WK0A 1J2BA 3BICA 3GTIA 2R91A 1DQWA 4CQBA 3KTXA 4IQLA 4UQCA 3DERA 3S83A 1K4GA 4L6HA 2WLYA 1NEYA 4HOXA 1E5NA 3QGAC 3GU2A 4JFVA 1BYBA 2D2JA 5I6SA 2G0WA 3LPOA 3YPIA 1B3OA 4MPQA 3ABQA 1W56A 3VUPA 1OQFA 1BF6A 4LYQA 4WJ8A 3R94A 3WNPA 5A94A 3W71A 1L8PA 1VR6A 1POJA 3WQDA 3N4FA 2ZICA 3HG3A 3D47A 3I3EA 3H2OA 3LHVA 1PKNA 1F3EA 3PUOA 4W87A 3WLPA 3TC6A 3N14A 5LNWA 2PWDA 3SEPA 3B0PA 2QR6A 3ITYA 4QJ5B 2YXXA 1T5AA 1ZP3A 1EHNA 1MDLA 3ZSTA 4JCLA 3BURA 4Q8PA 2INEA 3JVAA 1EA0A 4FO4A 1UP3A 5C2CA 3AISA 2NVAA 4ZXOA 1I2NA 4QE4A 4HB7A 5HQLA 1IF2A 4H8NA 4RL3A 1QI3A 3CPRA 2WBKA 4L4LA 1UP2A 3PUEA 3DYMA 3AU6A 1U1HA 1W5PA 2I5IA 4O0QA 1SW7A 3TE9A 2P50A 3CHEA 4WDTA 1OZMA 1W9PA 3E5BA 3AS0A 4AZHA 1J0ZA 3BH4A 3QPYA 3L2LA 1HP4A 1Z42A 2NQJA 4O1DA 2BOEX 4MM1A 5E6ZA 3EPNA 5BRBA 2HE8A 1C3FA 3F03K 4UMAA 2XM2A 1SFSA 5CSRA 4JDBA 3CB3A 1MEWA 2YL6A 1H1ZA 5E0KA 3TKFA 1FOBA 1QBAA 1RV8A 5DMMA 3E6EA 3QQ1A 1P48A 2GZXA 4ZO6A 4FIQA 4CQAA 1M9HA 3I10A 3EGJA 1V0MA 2WLZA 1R9ZA 4ML9A 2R82A 3HV9A 2O4QA 4IP4A 4UWMA 4FX6M 2IKIA 1XC4A 3ANVA 4HSHA 3F5J