4ZZ9A

Crystal structure of t75s mutant of triosephosphate isomerase from plasmodium falciparum
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
246
structure length
243
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYSGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Probing the role of highly conserved residues in triosephosphate isomerase - analysis of site specific mutants at positions 64 and 75 in the Plasmodial enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 91
structure length 243
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zz9A00
5AYXA 2NZLA 1DORA 1DVJA 2YW4A 1QDSA 2CLEA 3KFTA 3W2JA 4PA8A 2B7NA 5D2YA 4IMFA 4ZQNA 2ZZ5A 5I3JA 3DENA 2ZZ6A 2JK2A 5C54A 5E1QA 3G1XA 3KVKA 3P5ZA 3EX1A 1OYAA 2WSQA 4FX8A 1FWNA 1EWDA 2WO5A 5AHEA 4HNTA 1AW1A 5LNUA 4NU7A 4M7TA 4EVZA 2CLFA 4NXSA 1CW2A 4UTTA 4JX5A 1IGSA 5AN7A 1XXXA 3TDFA 4JY8A 1QPNA 4YXGA 4O8RA 5LZLA 4CNOA 3DZ1A 4LVFA 2ATSA 3H55A 1TV5A 2BX7A 4O28A 1Z44A 1HO1A 1V5XA 4N6FA 3PR2A 4D2JA 1FCVA 3S1WA 3QJAA 4S2CA 4WY0B 3P61A 2BWGA 1HTIA 3HG2A 1OX6A 2Y63A 4JTGA 3VI2A 2WNQA 3PSWA 3SI9A 3G1YA 4K37A 1PIIA 4BI6A 1KFBA 1K7XA 1TRIA 1VCVA 1VYSX 2VFHA 3RNDA 1W3TA 2Q8ZA 2QUUA 1ICPA 4POCA 4E0CA 2OT0A 4JTHA 1W1ZA 3OEXA 1VLIA 4OQVA 2ZA3A 1TPB1 4YWIA 3DKJA 5HR6A 1B57A 5DLCA 5SWUA 1EA0A 4GC4A 2ZZ7A 2E5BA 4ADSA 1S5TA 1N7KA 1T99A 1XC4A 3MJYA 1F05A 1S3HA 4LNYA 1YDNA 2V0TA 4CCCA 5T26A 4R7JA 1OVDA 3LCWA 1TJPA 4I7VA 1O5XA 4IUOA 3W2KA 5CG7A 1ZAJA 2O7SA 4KWWA 4GNJA 3HGRA 2V82A 3D0CA 1OFAA 2RH9A 3W3OA 3KVJA 5H2ZA 2E6FA 3T44A 1K02A 1TPC1 5EY5A 2VC6A 3TX9A 3NQCA 2JBMA 1OJXA 2E6YA 2I14A 4JNMA 1F7BA 4DF1A 4CNNA 3LOTA 3PWAA 2A21A 3BW2A 2D73A 2YDAA 2CLMA 3M5ZA 2X1SA 3KOFA 3GK0A 3HG5A 5D37A 3S5OA 2XN2A 4JICA 2G5WA 2BXVA 1TMHA 3I7RA 4MYXA 3NQEA 3H53A 2EPHA 3VE9A 3LCLA 3E49A 4GUFA 2W79A 5FF2A 4WOQA 5IBXA 4O53A 2J9YA 4O1CA 2GJNA 2NX3A 3QFEA 3WJXA 2ISWA 4NJGA 3EWBX 3G8EA 4IMEA 4UNKA 1TQJA 3PAJA 2YYUA 4XUGA 1L6WA 4GUHA 3QQ0A 1XBYA 3GDTA 4YCPA 4MUZA 1I4NA 5E93A 4JTTA 4MY9A 3PBWA 3EB2A 1JCLA 1RR2A 5LHFA 4MZ1A 2QCCA 3W23A 4XWUA 3P67A 2ZRUA 5BMXA 4GUIA 3AJXA 5AHMA 1KTBA 4AHQA 1YDOA 3NAVA 1XDMA 3B0PA 2PC4A 1V7YA 3S1XA 3W72A 4M7SA 1OFOA 2NUWA 4FX7A 4WZHA 3BGGA 3HG3A 1KM3A 4M19A 3W07A 4UFKA 3IIXA 1KLYA 3HPXA 4LVAA 5BOOA 3M5VA 1FX6A 3GVGA 1AW2A 3C52A 3F1QA 1M7PA 3BPWA 3LBMA 3LI0A 1KM5A 5LNVA 5AB3A 4BWLA 3P80A 4AWTA 2X1TA 1TV7A 4O11A 3N3MA 4OHQA 3HOJA 3TMLA 1ZAHA 2FQIA 3W7PA 3IRDA 2YFOA 3IGUA 1JCYA 3SW6A 4N9CA 4O1DA 3STGA 1EUNA 4HKPA 2CLHA 2IQTA 1WBJA 3PUOA 3NQ6A 1JUKA 1OFPA 3G1VA 1TIMA 1WAUA 3TNOA 1T0OA 3T4CA 4LVGA 3TUUA 4IMGA 3BLEA 2QF7A 1JCMP 3I6RA 4QNEA 3T55A 3MP3A 1UUOA 3UZJA 2A6LA 2R94A 4UTWA 4Z1DA 1ICQA 1C29A 2QCMA 3CWOX 1K8YA 2Z2UA 4OV9A 1F6PA 4Z1CA 2QJIA 1SPQA 5EBUA 1MXSA 1LTDA 2PRLA 5I3GA 1GWJA 2E6AA 2VKZG 1J5TA 5C2XA 4O4VA 4NNAA 3FIGA 3MP4A 3HG4A 2BZNA 5CZSA 4O0ZA 4LRTA 1H7XA 1G7UA 3L9CA 5G1YA 3IGXA 1ICSA 4E2DA 4MLJA 5FF7A 5CPMA 1EWEA 3MYPA 2WOQA 5K4XA 4O14A 1KLZA 3A24A 5DY2A 3CEUA 4HN4A 2RDTA 4ML9A 5TIMA 3O6DA 3CTLA 5IM51 1TPDA 3B8DA 3CWNA 2WQPA 3RLUA 4NNCA 4PTNA 1ME9A 1YPFA 3MYOA 4FNRA 5G4WA 1X1ZA 2DZPA 3W7QA 3W85A 4Z1AA 1OX4B 1Z48A 1JJKA 1SO6A 3RLVA 3W2UA 1X1OA 1YXYA 4UFLA 2E77A 5C55A 1OK6A 3W7DA 1XBVA 1GOXA 4O0KA 2EAWA 2H6RA 2J24A 3NQGA 1UASA 4JTIA 2VXNA 5EL1A 3DXIA 4FNQA 4RLIA 3GIYA 3M41A 1OX5A 2ZYFA 1W54A 2Y89A 3M9YA 3LXAA 3UXAA 4JGDA 1SW0A 3MUXA 1Y0EA 4FNSA 2FLIA 1B9BA 1P5BA 5KZEA 1TPEA 2ZRXA 4Y6GA 4JTLA 2I1OA 4Y96A 2HMCA 4OBTA 2P1FA 4S2BA 3NL3A 1M7OA 3S8HA 3MO7A 1FXQA 4IQLA 4O1BA 2C15A 1NVMA 1LZOA 1NF7A 1SZNA 2WNNA 1RQEA 3GB6A 1SSDA 3EX3A 3GNDA 2CW6A 2NX1A 1NSJA 2X16A 1OG0A 4LC6A 3LCFA 1IXPA 1MEIA 1OYBA 2E68A 5DELA 2FB2A 4C1LA 1HFBA 4CLMA 4MZYA 2Y62A 1GTEA 1TTPA 1R2RA 1PV8A 1BTMA 3RK8A 3OIXA 3C2OA 1SFLA 3TU9A 2GOUA 4EIVA 1TV8A 3DFOA 1PL9A 1PS9A 5D09A 1FWTA 1QWGA 4NVTA 4QQ3A 5U7SA 1NEYA 3G0SA 1OYCA 3G1FA 3BV4A 4XQ6A 3QEZA 4RX0A 4MLRA 5G2WA 4UNLA 1A53A 3LLDA 1FXPA 1ONRA 3G3MA 3W1QA 3EWWA 5BRBA 3TFXA 5K4ZA 1W5OA 5DBTA 2J88A 5FESA 2A85A 3W76A 1N8FA 1FY6A 1Z42A 4NJHA 2EHHA 5ABTA 3DI1A 3W7MA 1NFBA 3NQFA 4FIQA 3BG9A 3W1RA 1YLVA 1XBZA 3L21A 2V5LA 3MMTA 3NZ1A 8TIMA 4UIOA 4MIMA 1KTCA 4FNTA 3LXCA 1DV7A 1GG1A 3MHFA 3P5YA 1DQXA 2FPVA 3GDLA 1QCWA 3TMQA 2OMAA 5AHNA 3EX4A 3WFAA 1KM1A 3BG3A 4PL2A 3UD6A 3PB2A 3EEGA 1FWSA 1L2UA 5H91A 1LBFA 2O7QA 3G3DA 1QFEA 2ZCGA 4O16A 3W2MA 1JRCA 1G67A 4R34A 5GVJA 3Q94A 4K7VA 2A7NA 1RZMA 3LDVA 5F1UA 4JTSA 3MWAA 3DGRA 1KBJA 4LVDA 4UTUA 4DELA 4O50A 1PHQA 3L0KA 3TW6A 5CZTA 3HPZA 4FHAA 1QAPA 2B7PA 4JN6A 4W9TA 4LC8A 3LHWA 1TJRA 2YYTA 1OF6A 2ZZ4A 3QZEA 3W1TA 3LI1A 4GUJA 4X9SA 2YPIA 5AYYA 1LORA 4JDBA 4MYAA 3QYQA 2CLOA 3NM3A 4IXXA 3BARA 3FS2A 3TQVA 3I68A 2RHGA 1GEQA 1G4SA 4BWLC 2B7OA 1I2QA 3SFKA 4LS0A 4UR7A 3SGUA 4UTLA 1QPOA 3V75A 2ZZ2A 3N9SA 3G8RA 4GFSA 3M6YA 3NL2A 3CPRA 5I3KA 3W9ZA 4JIQA 3TSDA 3ZS4A 3NPWA 4QNWA 4ZZ9A 2QUVA 2WV8A 1UUMA 4NZFA 1RV8A 4XBKA 4WX2A 3TJXA 1KFLA 3LTSA 4A29A 3NYZA 4MOZA 2WSRA 3LERA 1BKSA 2BLEA 5HULA 3OVQA 1OFQA 1SSGA 1LRQA 3NXFA 3TROA 1TPH1 1UBSA 4M6PA 4UCGA 1YDVA 1YYAA 4TIMA 3B0UX 3BLIA 3PC0A 1FCUA 1UCWA 2VFGA 4MY1A 3T78A 5L9FA 1KM2A 4YMZA 1DJNA 2ZBTA 3K30A 2ABBA 2QAPA 2Y7FA 3NNTA 3HO8A 4L4MA 4O15A 5G2IA 4CQ9A 3DU0A 2A7RA 1TYGA 1VZWA 2CU0A 1D9EA 3TFCA 3F4NA 4ZQPA 3M44A 4WUIA 5LHEA 1P1XA 3N19B 2VFIA 3TJLA 3C8FA 3UYCA 3NQ2A 2JKPA 3TIMA 2QKFA 1WOAA 3IIVA 1H61A 3LRKA 4DXVA 2FDSA 4GUGA 4JIPA 4EF9A 1QPQA 3I7QA 2RKXA 3I7SA 2C13A 2PE4A 3NO5A 2RDUA 3HB9A 3MI3A 3VKJA 1I8JA 3TAOA 2YCEA 2QCDB 1AL7A 1XUZA 3WK2A 4EF8A 4H6KA 3E96A 4QIUA 2TPSA 3P82A 2RDWA 1FQ0A 4QITA 4LW7A 4O13A 4IOTA 3UY8A 4ICNA 4CCEA 3QMSA 2ISVA 3GKAA 1GVQA 1ML1A 1DQWA 1G4EA 3THQA 5F4XA 3W7KA 3A9IA 4UFJA 1W31A 3G1DA 4UMCA 5D2VA 4I7WA 1KA9F 4ZQMA 5K2ZA 1IF2A 6ALDA 3B4UA 1LCOA 2Y70A 2P0OA 2NV2A 1EUAA 3EX2A 3NOEA 3NEVA 4TMBA 4PFMA 4ZVJA 3A23A 5LGZA 3EWXA 4HPJA 2B0MA 3M5YA 1AW5A 3MBFA 3CEPA 1EIXA 4FIRA 4O17A 5I3FA 4DO6A 2A2IA 4AWSA 2QDHA 1D3GA 5HJLA 5DBUA 3GYEA 2A6NA 1FCQA 5K9XA 2F7FA 4NX5A 5F2LA 3UY7A 3WJZA 4A21A 3TK7A 5D32A 3W7HA 3IEBA 3W1UA 3VE7A 1EB3A 4FO4A 5D04C 5FEZA 1JUEA 3B04A 3DFTA 5CPLA 4BR1A 3S5YA 5J5DA 3SR7A 1F6KA 2YXGA 3ANYA 3DAQA 3QMRA 1R2SA 1I2OA 3HQ1A 4YL2A 3QRHA 1QPRA 1SUXA 2P10A 4ALDA 4ZQCA 3P7YA 1H50A 1HL2A 3W7GA 3E12A 1AK5A 4RV8A 4A2RA 2B4GA 4Z08A 5KZMA 4OGZA 3L5LA 2G96A 1I2NA 3IVUA 5AC6A 4GE8A 3DHFA 4WOZA 4M6VA 4NJJA 4Z1BA 3O07A 4JYDA 5AC7A 1TCDA 4DBDA 2CLIA 4IGHA 1UJPA 1YXDA 3NQ8A 3AO0A 3GAYA 4DO4A 1M5WA 2GJLA 3G1HA 4DPPA 3GAKA 3FFSA 3TSMA 4RK8A 1XL9A 2DP3A 4FF7A 2GQ8A 2R8WA 4KKXA 2XN0A 4DF2A 4K8HA 5G2HA 1YTKA 1GYLA 1LRNA 2XN1A 1GTHA 3G0XA 3WJYA 3B05A 3W70A 3G0UA 1VCGA 2A5HA 5F2IA 5FEPA 1X8FA 1XDLA 4ADUA 3SJ3A 3U6WA 4AXKA 4WQ6A 3C61A 5D38A 1RQBA 1VH7A 2OT1A 3CLMA 3HMJG 3W71A 3S9YA 1G4TA 3E0IA 4JD4A 4RXFA 1OABA 2VOMA 5HINA 2DJLA 5HWMA 5D05A 1K8ZA 3CU2A 3N2XA 3PULA 1P4CA 1D3HA 3OG3A 4ADTA 2ZA1A 4M6QA 3QW4B 3W75A 1P0KA 5KSWA 4HNNA 3DI0A 1Q45A 4A2SA 5BW6A 3JS3A 1MEHA 4GXMA 1SO4A 4LS2A 1J2WA 4N02A 3CIXA 2X1UA 2NUYA 2F84A 3R13A 4QJ1A 3ATZA 2QUTA 4IMDA 2EF9A 5G5IA 3IGSA 5CZJA 1YADA 3BLFA 5KZDA 4DQWA 4FEZA 3FLUA 5AHFA 3KRSA 3NR0A 4EOUA 4ORMA 1GZGA 3MP5A 3KVLA 3RFAA 1BWKA 1VCFA 3GXNA 1KV8A 3N34A 5D2XA 1GYNA 2FB3A 2GQAA 3HF3A 4X2RA 1B4KA 1O94A 3W7EA 4WXZA 4JDYA 3PVFA 1H7PA 1THFD 3MW7A 1UB3A 1N55A 3OVPA 4LUJA 4RZ5A 3BVJA 3PBYA 4H3DA 3LBCA 2C1HA 4PCFA 4Y8FA 5HR7A 2Y6ZA 3TQKA 5HWNA 2NXHA 3NQDA 1LLZA 5MHBA 1VGAA 4E38A 2Z6IA 4M5PA 5L6UA 1SW7A 3HJZA 1JCXA 1C8VA 4LWWA 2G97A 3S5NA 1RPXA 3DFPA 4MJZA 3PG9A 2WJZA 2NXIA 4MVAA 3EXTA 2C18A 2VENA 4TX9A 4HIBA 3EX6A 1O5KA 2Y7EA 3ABRA 3LGEA 3G18A 3PG8A 1DBTA 4KFOA 3BK0A 3JR2A 4PC8A 3W74A 3CC1A 4UTTC 1OFRA 3S1VA 4ZMGA 1G4PA 3CQ0A 3A21A 3S6DA 1C9DA 3LTYA 3U2OA 3KXQA 1OHLA 3M7WA 2J6XA 2ZTJA 1O4UA 1YXCA 2YW3A 2JKEA 2ZDRA 5BMWA 2NX9A 1TPVA 2ZZ1A 3MI6A 1VJIA 2QCLA 3LCXA 4OE7A 3B06A 4DF0A 2YX0A 2GVLA 3UWWA 3SIZA 3CIWA 5F2MA 4OT7A 2V2DA 3ELFA 1A5AA 5HQEA 3QSRA 2CZ5A 4O52A 1TPWA 4N4QA 1H7OA 3UWZA 5K9DA 1PCWA 3KX6A 2QCNA 1O60A 4N6EA 1LDCA 3F4WA 2Q3OA 3VFLA 5AC8A 2ZRVA 3C6CA 2NV1A 3IVTA 3FA5A 4K6AA 1A5SA 1MEWA 5I3HA 5D02A 4HSNA 2ZRWA 2RFGA 5TBOA 4KFNA 4ONVA 1ZJIA 4DO5A 4LTSA 5EMUA 1FDZA 1WV2A 2VELA 3WK1A 5KMYA 2TMDA 3W88A 3NL6A 4H4IA 1KV5A 1KFJA 3DH7A 1OFBA 2VEMA 3UNDA 3TXVA 3LCGA 4UTIA 2PRMA 1TTJA 1LM1A 2NLIA 4RZ6A 3W7JA 4N9DA 3ABOA 4QSHA 5CGQA 3S42A 1R47A 2FFCA 1JULA 4G1KA 4Q32A 1WYIA 3PUEA 4QISA 4UC5A 4GBUA 4WJEA 3TV8A 2FPYA 4HPXA 1ZHAA 3GDKA 2PURA 4EWND 1SW3A 2NUXA 5DN1A 3GR8A 1TPFA 3BG5A 4XKYA 3SZ8A 1GJPA 3W1PA 4JTFA 5LKYA 5EYWA 2QCGA 2V9DA 3NQAA 3LHZA 4X22A 3PUDA 1GG0A 4GJ1A 1QOQA 3QPZA 3ZWTA 1OK4A 1AG1O 3EWYA 1PVNA 3TSBA 4RXGA 3N2MA 4LOCA 5IBXC 1K03A 3MHGA 4BI5A 4UXDA 1LROA 3PY2A 1X6UA 2WKJA 1W37A 3HIJA 1H1ZA 3GXPA 2YR1A 1U5JA 1TQXA 1X7FA 3PBUA 4Q33A 1KFCA 1SZGA 1LOSA 3FJLA 1W5MA 1A5CA 1O95A 1W8SA 1BWLA 3CB8A 2X30A 4FXRA 5A8GA 1S5VA 4O10A 2FIQA 5CZ0A 1OF8A 1DOSA 4WY0A 3BGJA 3LX9A 2FPTA 3N73A 5K7JA 1L6SA 4LV4A 3ZR4A 2XFWA 3LHTA 3G22A 2Z0IA 2C0AA 3UWVA 2C19A 2V5BA 3W83A 3S1UA 2QDGA 1QR7A 3IIOA 5AOUA 3EKZA 2W6RA 2Y61A 3KAOA 1F2JA 1VS1A 2CZDA 1FUYA 3KVMA 1JCNA 3ABQA 2FJKA 3C2FA 4AB4A 4JTEA 4PL1A 4UFMA 3OHIA 3QH2A 1SU5A 1IXQA 3N9RA 2ZRZA 4IX2A 3LLFA 3GNNA 2V2CA 1A5BA 1FDYA 4CQ8A 4K39A 1Q3NA 1LOLA 2DZWA 4YCOA 4O19A 3W7LA 2V30A 2DU2A 4TO8A 2VFDA 3UWYA 1HO4A 3PBVA 4NJKA 3TC7A 3NGJA 4Z0SA 3R8RA 3W1AA 3NG3A 3NQMA 2GUUA 2QR6A 3UPWA 1KFEA 4UTWC 4U28A 2KZHA 1VHNA 3STCA 1Q6OA 1WX0A 1GPWA 3T40A 3OA3A 2GVGA 4O54A 1FWWA 1LLWA 4K7YA 4Y9AA 3STEA 3NL5A 4FNUA 4XTDA 3TKFA 3NPXA 4IMCA 3DFNA 1GVOA 4K38A 4UMAA 1XI3A 3LV6A 5K9CA 1KTNA 4J9JA 3W73A 3LXBA 4HHPA 4NQ1A 4MFEA 1JRBA 3IV3A 1TPUA 3M16A 1G6CA 1ZCOA 3C2VA 3SECA 1IIGA 1S5WA 1WXJA 4FXSA 4XKYB 2Y7GA 4I9AA 5FEWA 4NT0A 4AAJA 5CSRA 4UTMA 3O6YX 5A5WA 2QAFA 3WK3A 1LYXA 3QSTA 3CT7A 2C16A 1LRTA 2DZSA 3L2IA 3LV5A 3C0JA 5HUOA 3UZ5A 2OZ0A 2VFEA 1B3OA 4JTUA 1WQ5A 3LB0A 3W87A 1Q6QA 1XBXA 4LRSA 1E51A 1LP6A 1K8XA 3P8JA 5CPOA 2Z1BA 1VYPX 1XCFA 2BTMA 2CZFA 3FYPA 1IXOA 3FYOA 4N9BA 4O18A 2YFNA 3KHJA 3P81A 4NZJA 4JXCA 4ZQRA 3IIZA 4AMAA 2Z6JA 1Z41A 1Q6RA 3M43A 4KFPA 5DCDA 5D33A 3G1AA 3HBLA 4ZL1A 1Q6LA 1H7NA 3GR7A 4DPQA 5HMSA 3MHUA 2YSWA 5HUPA 1SQ7A 3HGOA 3C2EA 1QNVA 5F1VA 5BNKA 3W1XA 4HNVA 1TRDA 1SO3A 3IIPA 2H8XA 4UUIA 1H63A 3S5ZA 2QJGA 1NAL1 4IPIA 5J5RA 3PS7A 3GDRA 1FDJA 3NVTA 1SR9A 4GRSA 5D2WA 1W5QA 3PSVA 3O16A 1F76A 1I2RA 2PRHA 1JVNA 3YPIA 3BW3A 3MI2A 3LHYA 2ZTKA 5FF4A 3I65A 4HNUA 2J27A 2V2HA 4UR8A 2X2GA 1PE1A 3NDOA 3WJSA 3KRUA 3W1NA 1TSIA 3LCIA 1P0NA 2H90A 2QCHA 3C3NA 5EKYA 3HGJA 2C14A 3P60A 1FCBA 4B5NA 1QMLA 3W84A 4IJBA 1VR6A 5EPDA 4UMBA 4RCXA 1K3UA 3OBKA 2GPTA 5E0KA 1H7RA 2A4AA 3R5EA 3QW3A 3R12A 4NXKA 2ZA2A 5D03A 3L5AA 4QM1A 5G1TA 1EX5A 1ZFJA 4S1FA 3EWZA 1KM6A 2A7PA 3C56A 4CCDA 3TE9A 1KW1A 4WD0A 3UPBA 5LNRA 3NM1A 1QO2A 3RMJA 1H62A 5C5YA 2YGYA 4AEOA 1DKWA 3WJWA 3F03K 2TRSA 3G1SA 3P62A 2OJPA 3BO9A 2GVJA 1OFEA 3UXDA 2VFFA 1VRDA 3LHUA 3M5XA 4ZQOA 1H51A 3S0CA 3FKKA 1DL3A 1J4EA 3N14A 3Q37A 5K3VA 2E6DA 4JS3A 1H1YA 3W7NA 3ATYA 3JRKA 4DBEA 2OX1A 3H54A 2Y7DA 2NXGA 4O1AA 5CPNA 3DKLA 3P74A 3KRZA 3W7OA 4CQAA 3GX9A 3QPYA 4JR5A 4LVBA 3ABSA 3VCRA 3W7RA 2FTPA 4HSOA 5DXXA 1W56A 1ZNNA 4AF0A 1WOBA 5C6MA 1EP2A 3L0GA 2VEPA 3L5MA 2YZRA 1YPIA 3LCHA 4PEKA 3V1PA 5LNWA 1U83A 3NQ7A 4GWEA 1OX4A 1R2TA 2CLLA 2H3BA 1HUVA 4N4PA 4AHPA 1KFKA 2ZQ0A 3B03A 4PH6A 4IPJA 3O8AA 4KWVA 1YTDA 1DJQA 3M1ZA 3NA8A 4IX0A 1H7WA 6TIMA 3GDMA 2JKAA 1XFBA 4PODA 4LY8A 3EXSA 4LS1A 3M47A 3QQ1A 1SFJA 2W0UA 3EKLA 2E5CA 1R30A 4UTJA 4JYEA 4BFAA 1FWRA 2A0NA 1MO0A 3ZWSA 3GKFA 1FBAA 1ZAIA 2GQ9A 3EXRA 4LUIA 3A22A 5FF3A 1JR1A 2Q3RA 2HSAA 3GZ3A 3T7VA 2X1RA 4OV4A 3E9AA 3Q58A 5F2GA 4JX4A 3B0VC 1RVGA 1W5NA 4HT3A 3GXTA 1M6JA 1XUUA 3NQVA 3O15A 4NX0A 5U4NA 1MSSA 1MZHA 5AHLA 2WNZA 1L6YA 1XKYA 1QOPA 3UWQA 3W2NA 2VEKA 3MBDA 3STFA 5FEXA 5DY3A 4P61A 1WDWA 4I7UA 5LSMA 3INPA 1SZFA 1JCJA 1QO5A 3W22A 3P8IA 1EEPA 1ALDA 4UFHA 3NPUA 1B4EA 4O57A 3DBPA 5FF0A 4WY0F 3W2LA 3FEMA 4MY8A 4UTKA 1ADOA 1TTIA 1W5PA 4RKAA 1VHCA 2DZTA 3FOKA 3Q2DA 1A50A 4IXHA 1RD5A 3W7CA 1EPXA 3L66A 1EP3A 1GVFA 2G95A 4RR4A 1T8XA 4NUWA 4P2VA 1ZALA 4JTKA 3U8GA 2ABAA 1BEUA 4JYFA 5CSSA 5I3IA 3W1MA 3L65A 5DCBA 2AQWA 4OWGA 4MFDA 1G69A 4AF0B 4E2BA 2C6QA 4RJEA 7TIMA 1GVSA 4N9EA 2C3ZA 2DZUA 1T96A 3QF0A 4FB7A 3R89A 1DHPA 2R91A 3LRLA 4TMCA 1VPXA 4AWUA 1VQTA 3M0ZA 3UWUA 2DJXA 3TH6A 1L9WA 2HTMA 3OVRA 3SSJA 4U4MA 4O12A 1K7EA 3FKRA 2J9XA 1I45A 1GVRA 2J9ZA 1IXNA 3SY5A 1HG3A 2B7QA 3O05A 1ME7A 1AL8A 3R2GA 5KTLA 3UQNA 2BSLA 3E02A 4JX6A 5LNSA 2V81A 2Y88A 3L0NA 4MZ8A 4BF9A 3QM3A 2ISSA 3HPSA 4X3ZA 1LBMA 1CI1A 5EA9A 4AVFA 4MJMA 1IIHA 3LRMA 3C2RA 5KINA 5D30A 4DEFA 2E1DA 2LLEA 4A22A 1AMKA 1KM4A 5CKSA 3W1LA 1TREA 4Y90A 4K8EA 3W6YA 4WXYA 3G24A 3P84A 2ZFAA 2ALDA 1JQXA 4O4WA 2H8ZA 1SZEA 4AHOA 4TU1A 4N2YA 1K7FA 5HNRA 4R33A 2H3DA 1H5YA 2R14A 2I9EA 1JUBA 5DXYA 1VC4A 4QAIA 5F4SA 2WPBA 2AAMA 2HS8A 2ZZ3A 1W3NA 1GT8A 4FX6M 1RQHA 1JQVA 4RZ4A 1VYRA 2QEZA 2PCQA 1PCKA 1WBHA 2DZXA 3SGZA 3LHVA 3PF3A 4LV9A 4UTHA 4Z0JA 3LM7A 3LTPA 1TO3A 2EKCA 4MPQA 3RF9A 3USBA 5AYZA 1I2PA 1TTQA 3PM6A 4LU0A 4UFIA 3THAA 1G7VA 4FNPA 4XTIA 1SO5A 5KITA 5DCEA 4A3UA 2WSYA 4NNBA 4L4LA 1LOQA 1F74A 2E5DA 3A5VA 3WK0A 2NWRA 2VEIA 1CX9A 3TW7A 3QC3A 1NF0A 5TQLA 1ZY9A 3HGSA 3TC6A 4MKNA 3TAKA 4OU1A 2ATMA 1H60A 1ZENA 2E09A 5D2TA 3PB0A 4XZ9A 2V8ZA 1W0MA 3TCEA 1EP1A 2UV8G 2QCDA 3L68A 3ZFHA 2HS6A 1LBLA 3W7IA 3O1NA 3EWUA 3IVSA 1OFDA 5FI8A 4LT9A 1TB3A 5HWJA 5AHIA 4CNPA 5F4WA 3BW4A 3TR2A 3DFQA 2CZEA 2Q8LA 3DHDA 3O63A 1WA3A 2CLKA 2NWSA 2TSYA 1XM3A 1KM0A 3VNDA 2QJHA 4YLWA 1KBIA 4JY9A 3RU6A 4JTJA 2DORA 1VLWA 1GQNA 1F73A 2OCZA 2EGZA 4K36A 5AFDA 1PHWA 4Q4KA 4XBSA 4IWWA 2QCFA 4C1KA 3QMTA 2CFFA 2ZRYA 4BK9A 5LGXA 4ORIA 4NJIA 2CWNA 2JGQA 1R46A 2QCEA 1YTEA 3FJ6A 2AGKA 3W86A 1F5ZA 2TYSA 1W3IA 3TA6A 3DFSA 4TR9A 5G4EA 2JGYA 3L67A 3TXZA 3C4UA 4AH7A 3GLCA 3NZRA 2Y85A 3NPVA 2A1YA 4R53A 3TQ0A 1ME8A 4JEQA 3CHVA 3CM4A 3O06A 3O6CA 3A5FA 4BI7A 2DZVA
chains in the Genus database with same CATH superfamily
4C6FA 1DORA 3WQEA 2CLEA 2QPXA 3W2JA 1WKDA 2B7NA 3WLSA 4ZQNA 5LYRA 5I3JA 3CV6A 1LT7A 1XRVA 2ZZ6A 3IUIA 2GGHA 2GOKA 3TLLA 3G1XA 3P5ZA 4Q8TA 2WSQA 1HIZA 4F9DA 1FWNA 2WO5A 2DVXA 2OEKA 4PUJA 4HNTA 1AW1A 1JZ7A 2NQJA 4NXSA 5AC4A 2PBGA 1YNPA 5BU6A 3TDFA 1QPNA 4YXGA 4O8RA 1QI5A 1TJ1A 3DZ1A 3WNPA 1WPCA 2ATSA 3UCQA 4ZB5A 1QHPA 4CNSA 1V5XA 2C1IA 3S5SA 4AY1A 2EG7A 4DRSA 3M0IA 3DIPA 3EDEA 2VVSA 2PWHA 3HG2A 1IZJA 4MWAC 1B5TA 2Y63A 3T07A 3KTXA 3ZT5A 3SI9A 2WK2A 2PTWA 2HCVA 2HDJA 3EDKA 4QCFA 2Q8ZA 4LYKA 4I9JA 4JTHA 2OYKA 1MW3A 3DKJA 2J7CA 5HR6A 4GVHA 1UIPA 4RW5A 1VAHA 1T99A 4BF7A 3NDYA 1XC4A 4B5WA 1S3HA 6CGTA 3WQWA 3QFWA 2V0TA 4XAZA 4R7JA 5T26A 1OVDA 3LCWA 1G01A 3H26A 3VCNA 4HYRA 5CG7A 2O7SA 4KWWA 3EPNA 1M1BA 3D0CA 3W3OA 1XYAA 5H2ZA 1QK2A 5HQMA 3ARQA 4KCUA 4M6UA 3I3BA 5G4HC 3B8UA 2YOCA 2YCIX 2WHMA 2PAJA 1TWIA 1HL9A 3ZT7A 4PRWA 2WW5A 3KWXA 2QQ6A 4F40A 2D73A 2CLMA 1A3XA 2X1SA 3HG5A 4HHHA 1UA3A 2BXVA 4MYXA 3H53A 2WMHA 3C8NA 1DE5A 4GUFA 3WL1A 4D8ZA 2YCLA 3GG1A 2GJNA 1K9TA 4K1WA 1XSJA 2ISWA 4NJGA 5GJNA 3ZOAA 3EWBX 4IMEA 4WLCA 2OU4A 2VC7A 4EE9A 3M0YA 5A6LA 2J7FA 1OGGA 3QTGA 1AQHA 1JDAA 3E0WA 1DIOA 1I4NA 3VDBA 4AY8A 2HXTA 3RM9A 4EXAA 3SRDA 1JCLA 2PU0A 4MZ1A 1MNSA 3R58A 2Z4GA 2PUZA 4ZE4A 1MW1A 3NAVA 3V5FA 4E2VA 1XDMA 4AMCA 3TA9A 3ZO9A 1VRXA 1V7YA 4NSBA 1EGZA 3S1XA 1OFOA 3RMEA 4FX7A 1LUCB 2VMFA 3ITGA 1CENA 3QHMA 3IIXA 1NFPA 3VNKA 1FX6A 1Y5XA 3C52A 4LALA 3F1QA 1CB7B 3LBMA 4HYWA 2CBJA 4M51A 3N3MA 4KCVA 2NW0A 2FQIA 3ITLA 5FJIA 1IT8A 3IRDA 1C8QA 2Q8XA 1JCYA 4N9CA 3STGA 1EUNA 4HKPA 1TZ7A 3V5OA 5DRCA 1YBQA 1YRRA 1WBJA 3PUOA 1FWGC 1GKPA 1NOFA 3LA4A 1TFVA 1FKWA 1JUKA 1OFPA 3NQ6A 4YVVA 5JVLA 1TIMA 3K1DA 3N17A 3T4CA 3TUUA 3ARSA 3BLEA 1UUOA 2R94A 1BXCA 3HA1A 2ALRA 1EA9C 1HJXA 4LF2A 4ZXLA 4Z1CA 1MDRA 3B8TA 4MUPA 6XIAA 3CUXA 4M8UA 5I3GA 3QTPA 4GLEA 1J5TA 1UWQA 4NAEA 4D71A 3BICA 4O4VA 4DJDA 5A1AA 2GUYA 3QV6A 2QIIA 1VP5A 5J04A 1G7UA 4UB9A 1UP0A 1OC5A 4UWMA 3IGXA 4MLJA 1WE5A 1JIBA 2VZUA 1YNYA 4Z1YA 4HN4A 5T91A 3B8DA 3U57A 3U2ZA 5BRQA 1X1NA 2DUXA 1EO5A 1ENUA 2QV5A 3CJPA 3VILA 1X1ZA 3W7QA 1E3XA 4L56A 1BTCA 1NH6A 3NSXA 1Z48A 1K6AA 1JYXA 1X1OA 2E77A 1JG9A 5JXQA 3MC5A 1XBVA 1GOXA 4XZWA 4IGSA 2EAWA 3B0XA 1DJHA 2VXNA 2V38A 3M0JA 2RJGA 3M41A 1OX5A 5RUBA 3M9YA 4JGDA 3MUXA 1GQIA 1PXGA 1P5BA 3GTXA 1GZJA 3UT0A 1UWSA 4JTLA 4KRTA 4Y96A 4M29A 4S2BA 3NL3A 1M7OA 3WD1A 4UZSA 1FXQA 4IQLA 4O1BA 4NZ3A 1NF7A 1SZNA 3PAOA 4ZBCA 2WNNA 5CPSA 5TD4A 4QROA 3EEZA 4BY3A 3GNDA 2CW6A 3VABA 2NX1A 2X16A 3V5CA 4FOKA 3TZNA 4ENLA 4H6RA 1HFBA 1JD7A 1GTEA 1E4IA 1BTMA 4B2DA 3OIXA 4U3CA 3TU9A 4MJ2A 3SN4A 1PL9A 4HU3A 1ONXA 1FWTA 4ZSUA 4QQ3A 1BF6A 1JDDA 7REQA 3QEZA 3VM7A 1A53A 1ONRA 3H4XA 1V03A 3OA5A 1R3WA 5CBJA 5K4ZA 1VFSA 4YN5A 5DBTA 5FESA 2A85A 3W76A 1Z42A 2CNCA 2EHHA 2FH6A 3W7MA 5D4YA 4UQBA 3NQFA 2H9AA 3S9IA 1QNQA 2V5LA 3GW0A 4L80A 4ECLA 4MIMA 3R6IA 4W7VA 3QQWA 3WY1A 3UCDA 3LXCA 4H9MA 4L5ZA 2J62A 3RX2A 2HPIA 1FTXA 3WFAA 3UD6A 3S2NA 4A3RA 1V8EA 1FWSA 1UH2A 1W1TA 3CK5A 1TX2A 3DYPA 3G3DA 3SUVA 3AIBA 1G67A 1GKQA 1W3KA 3OW1A 2EJAA 1RZMA 1F6YA 3N1AA 3MWAA 3ARWA 4UTUA 1TMLA 4ZOAA 4O50A 3L0KA 5CZTA 2HBVA 3UF9A 5C9RA 4GIYA 4JN6A 4W9TA 3AUJA 1TJRA 1OF6A 3W1TA 4GUJA 2G8ZA 3PZOA 4WDTA 5AYYA 1Q7QA 4JFWA 2O4MA 4RL3A 3FS2A 5E6YA 1ZSXA 4XVEA 3OJGA 3WLOA 2O0TA 2D0HA 3QR0A 5FSEC 1XX1A 3EDFA 4FR1A 2RGLA 1UR2A 3PWIA 4I8DA 3CZKA 3M6YA 3NL2A 3UJEA 3I4KA 1E72M 3N2BA 3TSDA 4Q4RA 3S83A 1XRFA 4QNWA 3VU2A 2GGEA 4ZZ9A 2QUVA 2WV8A 1UUMA 1RV8A 3S2MA 4Z42C 4I8YA 3A3XA 1DJGA 4HK7A 2CEQA 3NYZA 1EC9A 3QR1A 3OVQA 1OFQA 3TROA 2WMKA 2I5QA 4MJ4A 3CUZA 1RALA 4L1WA 2DW7A 5CBIA 2FFIA 3B0UX 4YTQA 2XHYA 1LQ2A 3BLIA 4MKSA 1FCUA 4MY1A 1PDYA 1KM2A 3AHTA 1DJNA 3OODA 1KBBA 4L4MA 1J9YA 4O15A 3DU0A 2HPMA 2BMBA 1VFMA 3TFCA 2O4QA 2XH7A 3CQJA 3F4NA 4ZQPA 3CL7A 4A8IA 2ZXAA 3AAMA 1P1XA 3VDHA 3B0YA 2VFIA 3TJLA 1J2BA 3DEQA 4L65A 3UYCA 3NQ2A 3TIMA 3NO3A 3O0KA 1CEOA 4I6KA 2QKFA 5HNTA 2AGTA 2QJMA 3LRKA 4R9XA 1PX3A 4DXVA 3W01A 4MB4A 4GUGA 2Z00A 4EF9A 1QPQA 3P2VA 4W5ZA 4QJ3B 3MMDA 4O0QA 2VD8A 2PE4A 2RDUA 3NO5A 3GFXA 3MI3A 1XIHA 1I8JA 3MPGA 1XUZA 3WK2A 4EF8A 4H6KA 2TPSA 4C6QA 3TOPA 1W9XA 4LW7A 3VNJA 4AIUA 3VZZA 3EWDA 6TAAA 2ACUA 1CWYA 2DEPA 3GKAA 1ML1A 3CUIA 1LL4A 2FZMA 4L4OA 4UFJA 1CB2A 3W38A 2Y8VA 4FZIA 1W31A 3ZVIA 1DWHM 4I7WA 1WKEA 4ZQMA 5K2ZA 3UJRA 4UQEA 6ALDA 4NRSA 1LCOA 4J3WA 1LT8A 4ZVJA 5AVHA 3A23A 5LGZA 3EWXA 3CUGA 2D23A 4J2PA 3MBFA 2DSKA 3FNDA 4DO6A 4LY4A 4AWSA 2XVPA 3E38A 1VPYA 5DBUA 3GYEA 5K9XA 4A21A 3S2CA 5F2LA 5EBAA 1OM0A 1MWOA 5CPLA 2V3FA 3IJQA 3ONBA 1RH9A 2Z24A 4R9OA 2YXGA 2HQAA 5D9MA 1QPRA 4QHRA 3R0UA 4CN4A 1QVBA 3E2QA 2G0WA 1WZMA 2OLHA 4O8AA 1WUFA 3W7GA 3EKGA 1AK5A 2E7FA 4RV8A 4L7ZA 2TAAA 1XJBA 2ASHA 2WAGA 5BOEA 4Z08A 1MXDA 2Z1VA 1UKPA 4OGZA 2ACQA 1V6XA 4M6VA 4ICMA 4NJJA 3KRBA 3THDA 2J7EA 3S6TA 4DBDA 4WIWA 3NQ8A 3AO0A 4AZBA 2GJLA 1J01A 3N6JA 3G1HA 1A0CA 3A12A 3GAKA 3PBGA 1GW1A 3BWWA 1XL9A 3MUY1 4GIRA 2YKKA 3GVVA 2XN0A 4GI4A 2YB1A 4K8HA 3NSMA 3NTYA 1LRNA 4GI9A 5I23A 1AD1A 4HMEA 2OFJA 3LGDA 4W8LA 1X8FA 3BL3A 1XDLA 4ADUA 4LCRA 1CBGA 1Q4NX 3U6WA 1Z3NA 1RQBA 1EXPA 1VBRA 3HMJG 4RXFA 2PDQA 3BTNA 2ZXQA 2OTDA 4E4PA 4QX4A 3N2XA 3PULA 4JQ3A 4Q8PA 1LWJA 3STPA 3ARTA 3AS3A 4HNNA 4EPBC 3RCNA 5BW6A 3JS3A 1Q8AA 1MEHA 3LMZA 1PAMA 4GXMA 4N02A 3CIXA 3R8HA 3VUSA 4C5YA 2D2OA 4A8RA 3V18A 3ATZA 2I9UA 4B5VA 1C91A 4R3UA 2NQZA 4GKLA 4ORMA 4AU0A 3AZRA 1BQGA 4PMZA 1RVKA 1JD9A 3GXNA 5CSYA 1T8QA 1KV8A 3N34A 1Q7ZA 2BNJA 3VIPA 1W1IE 1AJZA 4NAFB 2GQAA 3HU7A 4X2RA 3GNRA 1B4KA 1BAGA 4WXZA 4UOQA 3VVGA 3BSHA 4JDYA 3GU9A 5CC6A 1HL8A 3O2LA 1N55A 4LUJA 3VMNA 3PBYA 3UJSA 1I75A 4CCZA 2OELA 3TYZA 4PYSA 1MUCA 2E40A 1V77A 1NOUA 2Y6ZA 2ACRA 3RCMA 3VC5A 3CPUA 1HP5A 1LLZA 1DTNA 5I78A 2RDXA 1C8VA 1TR1A 1DIEA 1RPXA 1U30A 3CHEA 3PG9A 3EXTA 5HXMA 3EX6A 3LGEA 2Y7EA 4K1GA 4HCLA 3JR2A 3W74A 4UTTC 4NILA 4ZMGA 3M46A 3S4TA 1C9DA 1UR1A 3LTYA 1RPKA 2BVWA 3M7WA 4ZO9A 1REQA 4XIMA 2ZTJA 2YW3A 3HM7A 5BMWA 1TPVA 2HNHA 3REQB 2POTA 4JKKA 3QGAC 3LCXA 4DF0A 2YX0A 3POCA 3UWWA 5B7ZA 1UZ1A 3IK2A 5F2MA 4OT7A 1DYSA 2V2DA 3OYXA 1HP4A 3OOQA 3UEQA 5HQEA 3QSRA 1KXVA 4TUFA 2CZ5A 1ITQA 2BY3A 3T2OA 3VZXA 4IUGA 3UWZA 1PCWA 4FMVA 4ZEPA 1FFRA 4MNJA 5AZ0A 2ZRVA 4K6AA 2VVNA 1EOMA 4ZTYA 4GY7A 4N42A 5D02A 4KS0A 4AXNA 3AUOA 3BMXA 4IL2A 1AD4A 1GVIA 4JHOA 4LUSA 3DH7A 2VEMA 4L61A 3UNDA 2AAAA 3LCGA 1Q63A 1F8IA 3VDCA 4RZ6A 2VP8A 2GL5A 2WB5A 3TV8A 3N4EA 2FPYA 4GCAA 1X6LA 4PZVA 3PZ9A 4GI6A 3QZAA 4EWND 4HQVA 2NT0A 5DN1A 3ZR5A 5FL0A 3BG5A 1V3LA 4JTFA 3A4AA 3WBEA 1HGYA 2V9DA 3TN3A 4X22A 2YDRA 1DXEA 3BJFA 1OK4A 3SJNA 2WMFA 1P0DA 4IGMA 3N2MA 3BUVA 1K03A 4YVXA 3BLDA 4PMRA 2J7DA 6REQA 3CV7A 1X7FA 2JALA 4EXBA 1A4MA 3PBUA 1NWTA 4Q33A 4CD8A 3UERA 4A8LA 3FJLA 3T0BA 4IPLA 1A5CA 1O95A 3WX7A 1EYWA 5EU9A 1BWLA 3MKCA 1S5VA 1C7TA 4O10A 4IICA 5CZ0A 3A47A 3W27A 3L7RA 4G56A 4NRRA 2PWEA 3VD7A 4IP7A 3LHTA 1JAKA 4XSLA 3UWVA 3VKBA 3W83A 1RUSA 2IPFA 5C2CA 1F2JA 2F2HA 1M04A 2FZBA 3KVMA 3EOSA 5CJMA 1OIFA 3VDAA 4UFMA 1HJVA 2V69A 3CASA 2WZTA 3A6OA 1HF6A 1XINA 2XIOA 3FA3A 3SCUA 2ZRZA 5ECVA 4JL1A 1L8NA 2V2CA 3GVQA 1TUXA 1L6GA 1FDYA 1DEDA 1Q3NA 4QE4A 2Y5EA 1K77A 2FTWA 1GONA 3BJSA 2DU2A 3WLLA 1XH1A 3UWYA 4NJKA 4Z0SA 3THUA 3R8RA 2VOTA 4PMOA 2GUUA 1UA7A 4QCEA 4H9XA 4DVOA 1UD3A 4U28A 3S46A 1Q6OA 1WX0A 1TZ9A 1EQCA 1D8CA 4O54A 3MANA 8A3HA 1FWWA 4Y9AA 4FNUA 2GJPA 1B0IA 2OZ8A 1XI3A 3GHUA 3LV6A 3OLDA 1S2UA 3WQ8A 4MFEA 1JRBA 1B54A 3M16A 3OB8A 4Y2WA 2ZUMA 4NT0A 3PJTA 4UTMA 1GCYA 1P6CA 3WK3A 1LYXA 2D22A 1VFLA 4BJHA 2DZSA 1ZJBA 5HUOA 3UZ5A 4HVXA 1B3OA 3WLRA 3LB0A 3W87A 4AZGA 1Q6QA 3ARRA 2VZOA 4LRSA 1M41A 4GQRA 1M01A 2OLAA 3FYOA 2YFNA 3P81A 4NZJA 4JXCA 4KBXA 4QGCA 1GNXA 3IIZA 1GUVA 4H41A 3UESA 3UZWA 1Q6RA 1LLOA 5DCDA 2DH2A 4LGXA 5GNXA 1F9CA 3AIQA 2JF6A 4DPQA 5BWFA 2D2GA 2W62A 4HNVA 1SO3A 4Q4OA 1NARA 1NAL1 4DI8A 4EKJA 2GGJA 1KD0A 3LNPA 4IMAA 1VENA 4UR9A 3O16A 4URIA 3QXBA 5CC5A 5A2AA 5FSDC 3I65A 3J7HA 1PE1A 4GISA 2I7GA 3W1NA 3LCIA 4B5TA 2X41A 2QCHA 4DBWA 1RLDA 3T81A 2A3CA 3UFYA 3W84A 1Y65A 1XPGA 4YJ5A 1K3UA 4GYPC 1O12A 4GFIA 1TJ0A 3QW3A 1KXTA 4EACA 4F4RA 1XQLA 5D03A 2Z28A 3WBWA 4QM1A 5G1TA 2PWVA 1ZFJA 1NWUA 1KM6A 2A7PA 1M53A 1KW1A 2DSUA 4AD2A 1U2YA 3UPBA 3NM1A 2VWTA 1QO2A 3RMJA 1DKWA 4NI8A 5DT7A 5CG0A 2TRSA 2VGGA 4PB5A 2CWXA 1CLKA 1GKRA 2VFFA 4ZQOA 3Q45A 1J0YA 2BGNE 3FK4A 3Q37A 4S3CA 2BHZA 1H1YA 2XSXA 3ATYA 3H54A 4QFUA 3GHTA 4O1AA 5CPNA 3DKLA 1KRAC 3P74A 3W7OA 1XSIA 3QPYA 3TN6A 1XLHA 2ODOA 1Q6FA 3NJ3A 1EO7A 1GJWA 4UOJA 5C6MA 3L0GA 1S2VA 4PEKA 3WNMA 3GXDA 4AZCA 4PTMA 2H3BA 3ERPA 3C0LA 1JPDX 1MW0A 1Q85A 4CVWA 1JPKA 3SCNA 1SJCA 2VRQA 2HRWA 3B03A 3O8AA 3SCRA 4GIAA 1DJQA 3M1ZA 4IX0A 3GDMA 1BVWA 1HVXA 4GA8A 2BGSA 4LY8A 3EXSA 3VYLA 1AZ2A 1OCQA 1DTUA 2XVGA 4F9JA 1QW9A 2PWGA 3EPMA 1R30A 3KCOA 4GXPA 4JYEA 4K68A 2YL6A 3VINA 4S3EA 5D9OA 1Q13A 4Y8EA 2FGZA 4P8XA 2AL2A 1KGUA 1Z8AA 1CGTA 4INFA 4LUIA 4LH8A 1JR1A 1HW6A 3MDUA 3TTQA 2Q3RA 1ZLPA 2INZA 2X1RA 5BWAA 1N2VA 1KWKA 4JX4A 1I0BA 3B0VC 4XO6A 1E4MM 3GXTA 1O1HA 2DT2A 1A5MC 3UPMA 1YNQA 5U4NA 3ZT6A 3LUTA 2VNCA 5I24A 1XCXA 3VNLA 1QOPA 3UWQA 3L4TA 2VEKA 3MBDA 2Y2WA 2B81A 3UZXA 5FEXA 5A6TC 1UD8A 1QOXA 3INPA 3LZ3A 3LSCA 1BGGA 4PTWA 1JCJA 1PZ1A 2E28A 2X7WA 3CNYA 3AXIA 4YVPA 4O57A 2FDMA 3T0CA 4WY0F 1JXJA 3W2LA 2PDPA 3BZJA 3FEMA 3DN5A 4UTKA 1ADOA 3BANA 1TTIA 1W5PA 4GQGA 2PD5A 4CN6A 3WNNA 4IXHA 2PDIA 1E5JA 4X9YA 1EP3A 2W66A 4RR4A 3RDKA 3EYPA 9CGTA 4P2VA 3MSYA 1XYZA 4JTKA 3U8GA 4OVXA 2JFEX 4B91A 4P7NA 3ZQ9A 3L65A 3MUIA 4FK9A 4Q8QA 3RIKA 7ENLA 4I90A 4N9EA 3QF0A 4C1NA 1DPMA 3VTRA 3R89A 2R91A 1YKWA 1VPXA 3W25A 4A3QA 3M0ZA 3GTHA 2HE5A 5IHRA 4FXFA 4O12A 1WXZA 1E6RA 2J9XA 1GVRA 1HG3A 4FLRA 4PUEA 4JTQA 3BAWA 2ISDA 1FH9A 4TTUA 4HZ8A 2XH0A 5C70A 4H8VA 2Y88A 4IQDA 1E6NA 4U31A 1HNYA 3E0LA 1SM9A 2PWDA 5EGRA 1J5SA 4DHGA 2DSZA 3PTDA 3LRMA 3C2RA 5KINA 2BGQA 3HFYA 5KETA 4A22A 9XIAA 3W6YA 3EMQA 2F61A 1PB0A 3P84A 2Y1HA 1NQ6A 2ZFAA 1QASA 1JQXA 2H8ZA 2HV5A 1XF0A 3JVAA 1H5YA 5I09A 1JZ2A 3CMJA 5DXYA 4QAIA 3TTOA 2AAMA 1GT8A 4Z2GA 4HTBA 2ZUTA 1RQHA 3OQEA 4MDPA 2Z1WA 1HKIA 1V6TA 2HVOA 3BLOA 3VGBA 3PF3A 2VCCA 3LM7A 1TO3A 2PZNA 3KLLA 1I2PA 3EMZA 1A5NC 2ZADA 2OZ3A 3M07A 1CGUA 1G7VA 3PNZA 2VJXA 1G0CA 2QPSA 3N2OA 4NNBA 3HV9A 1LOQA 3QOMA 1P43A 4WSJA 1PZ2A 3HGSA 1CXEA 3TC6A 4XO7A 3TAKA 4OU1A 3AHVA 1ZENA 1VFFA 3PZIA 1CIUA 2GLKA 2WWDA 3I4EA 1E0VA 2UV8G 4BS0A 2W67A 1QI2A 5LIUX 2HJPA 3W7IA 1PTAA 1E6SM 4HBKA 4LT9A 3WQ5A 3TR2A 2CZEA 3BJTA 3DHDA 2J7GA 2BVTA 1XR2A 1A47A 5BXTA 1RBAA 4HD5A 1V93A 2YLLA 2YXOA 4V1XA 1AA1B 3VNDA 3T6CA 4JTJA 5DMMA 3AHXA 2DORA 2VRJA 4K36A 1PHWA 4Q4KA 4OUEA 4DWSA 2PC8A 4IWWA 2QCFA 2EXOA 2WNWA 4ORIA 4TV6A 5C9UA 2Y4SA 1R46A 3XISA 5FOOA 5M3WA 2NVAA 1W3IA 3DFSA 3R4IA 1ELSA 4TR9A 5LA2A 4YTRA 1V6WA 4AH7A 3GBEA 2Y85A 3CUJA 2XVKA 2XWEA 1V0KA 4CUCA 3E1F1 4BZYA 3O6CA 1H41A 4BI7A 1EXBA 1XG3A 3GS6A 1DVJA 1XYLA 4PA8A 1AUSL 5D2YA 2ZZ5A 4ERIA 1DJZA 4B4HA 3B8VA 3DENA 2JK2A 2XIQA 4AZHA 3KVKA 4R5EA 1OYAA 2VX7A 1QK0A 4FX8A 5AHEA 2G4FA 5LNUA 2X42A 1P6WA 1V6YA 2VC9A 2ZKMX 3NQBA 1WKFA 4JX5A 1IGSA 3ITYA 5AN7A 4LCQA 4GHRA 2FYMA 4OJYA 5HA7A 1OINA 3H4WA 4NL1A 3H55A 2BX7A 3B9AA 4O28A 3CZEA 4JKMA 4N6FA 2V3DA 4IH3A 3ZJKA 2DGAA 1B1YA 1RD6A 3OZYA 5XINA 4C6KA 1VF8A 4Y9NA 4AVNA 5REQA 3WLTA 1BLIA 1LUCA 2ON3A 3VD9A 3G1YA 3NIYA 4K37A 6A3HA 2VT0A 3KBSA 1TRIA 3ALFA 1ICPA 1W1ZA 1QRQA 3OEXA 4OQVA 2EG8A 5DLCA 1EA0A 1V6VA 4GC4A 1RY8A 3FJNA 4W88A 1D7KA 4AD1A 3MJYA 1F05A 4LNYA 3W82A 4CCCA 4RNFA 3TYDA 4RNHA 3ZVHB 1XIDA 3TEVA 1NELA 1R3YA 4IIBA 1O5XA 3CBWA 4IUOA 4NZ1A 1OCJA 1ZAJA 3JZEA 4GNJA 3HGRA 4CD6A 2RH9A 5CH9A 3NZQA 2O9TA 1K02A 2ZVRA 4HK5A 4AW7A 3E2RA 1NU5A 4IM4A 3WMCA 2E6YA 2I14A 4JNMA 3VKCA 1IWBA 3PJUA 4H7CA 4PR4A 2PDGA 5HPCA 3U7VA 4BKNA 5FA5A 2L5HA 3LOTA 1F61A 4PN2A 1FWIC 2A21A 3H2AA 3WELA 4NIRA 3VAVA 3M5ZA 5D37A 4GVIA 2XN2A 1NDYA 3CZ8A 4C91A 3IPWA 2E8YA 3E49A 3KBJA 1I6NA 2Y0FA 4WOQA 5IBXA 4G9PA 2J9YA 2KAUC 4O1CA 4XZIA 4J3SA 4BHYA 2ZVIA 1XLGA 4C6JA 1L6WA 4FOJA 1W1VA 1XBYA 3GDTA 2P8BA 3D3FA 4YCPA 3O9NA 4JTTA 2BDQA 1TVNA 2PF0A 3PHAA 5HAOA 5A8QA 1PYFA 2ZC1A 4AHQA 5I07A 2DPEA 3KL0A 3WQDA 3B0PA 2PC4A 3K2GA 3O6AA 4XAPA 3IARA 5BOFA 1B3ZA 4BCEA 1QT1A 2V6AA 5G1MA 3HG3A 1KM3A 4PUUA 3OBAA 3OO2A 4M19A 1UKTA 1KLYA 3HPXA 4MADA 4NASA 1KRMA 2A3LA 1A80A 2XVLA 1AW2A 2I5GA 1HKKA 1B9ZA 1KM5A 5AB3A 1SFSA 3OZOA 1IZKA 4AWTA 2RJHA 1EPVA 2WKGA 4I5XA 2X1TA 1RBLA 2QF8A 4Q7IA 5AVNA 1FA2A 3AIWA 4M0XA 1ZRQA 5A2BA 3FVMA 2BY0A 5DMLA 5A8MA 3GZAA 4XISA 4GK8A 5EB8A 3E2VA 2FMOA 4CNTA 1WKYA 4LVGA 1W3LA 4GMEA 3UZJA 2PLJA 2DDXA 4KEMA 2VR5A 1ICQA 2VCBA 1C29A 2PEVA 4PMNA 2VGFA 3UU0A 1XG4A 3ZSTA 1GQKA 3L4ZA 1W1A1 2QJIA 5EBUA 1WAWA 3T08A 1MXSA 2V5CA 1O1ZA 3R94A 1GWJA 2E6AA 3B4YA 1M3UA 4TVDA 4HNLA 1FHDA 3ARVA 3OBEA 3MP4A 2BZNA 1Q8JA 2HK1A 3PJWA 1UR4A 3DERA 1ICSA 4DJDD 3AROA 5ABGA 4IQJA 3A24A 3EB4A 4W8BA 5DY2A 5A6BA 1S5MA 3VPLA 2RDTA 4ML9A 5TIMA 2PTZA 2ZX5A 3O6DA 3MY9A 3CTLA 1TPDA 4JIRA 4D6JA 3COTA 3CWNA 4YYFA 4PTNA 4EPEC 3MYOA 4FNRA 1J0IA 3WH9A 2DZPA 2FKPA 3W85A 3SCSA 4IFKB 3U0HA 1JJKA 1SO6A 1DXFA 3FXGA 2QW5A 4B16A 1MVYA 4O0KA 4DLFA 3G77A 3NQGA 3IJ7A 5M03A 2QXWA 1W1PA 3H2OA 1CT5A 3H2CA 1GK8A 1VFTA 4GGBA 4KCTA 5DFAA 1WP6A 2Y89A 3VC6A 5C71A 3UXKA 4W7WA 3LXAA 3UXAA 5HBFA 1SW0A 4FNSA 1TPEA 2ZRXA 4WRHA 1TZZA 3BOLA 5A8PA 5JH2A 4E8DA 3WMBA 1NVMA 1LZOA 1S2AA 2OGJA 3GB6A 1SSDA 3EX3A 3F5KA 1MQRA 1NSJA 4LC6A 3LCFA 1IXPA 3H7VA 5CQ1A 2OO0A 2Y5SA 3LEPA 4CLMA 4MZYA 1UC5A 1AH3A 3A4XA 5E5CA 1R2RA 3MUAA 1FWBC 1PV8A 3GE7A 3T09A 3GU1A 3C2OA 1SFLA 1W32A 1UC4A 3L2MA 4PE8A 2XIJA 3VNIA 4NVTA 1UKQA 2DY3A 1OB0A 3UZZA 1NWRA 4XQ6A 1LL6A 2ACSA 2OR2A 2A79A 4DJFC 2NSXA 3RJXA 1DJXA 4IIGA 4UNLA 5PTDA 1FXPA 5FJRA 4S38A 1T5AA 3G3MA 3W1QA 1BRLB 1A5UA 1S5NA 2BY1A 1HN1A 2J88A 4PCTA 4KEVA 3KOYA 5ABFA 4D1IA 4NJHA 5ABTA 4FIQA 3W1RA 3RM4A 4QJ4B 1KRBC 3D46A 3L21A 4LQ1A 2TODA 2EKGA 3MMTA 3PZMA 1KTCA 1E1CB 4E3VA 3P5YA 3MHFA 1CNVA 2FPVA 4R27A 5DX7A 3ARYA 4D9PA 3TMQA 3EX4A 1KM1A 4PL2A 3PB2A 1VB9A 5CEWA 1MRQA 4MTVA 1WNOA 4GH3A 2O7QA 1QFEA 1UR8A 1QATA 4G2DA 2ZCGA 1A5OC 1DWAM 2GK1B 4R34A 1SYTA 5F1UA 2X8RA 4RE0A 1BXBA 4LVDA 4KQNA 4DELA 3M64A 1PHQA 3ZIZA 4FHAA 4ROPA 2MUCA 1XIMA 3LHWA 4LAMA 2YYTA 2D2JA 3DDMA 3QZEA 3LI1A 1OD8A 3LM3A 4H9VA 2YPIA 1LORA 2OQLA 4HU8A 3QYQA 3NM3A 4AIEA 1JF5A 1HJSA 2J77A 2Z29A 1R86A 4A3YA 3I68A 2RHGA 4M56A 2PDBA 3SGUA 1ZBKA 3NCOA 1RA0A 1MFUA 3TW9A 3VIGA 3FHQA 2ZZ2A 5HPOA 3G8RA 3UXLA 3OQ8A 3CPRA 5I3KA 1J93A 3WF0A 1JPHA 3OLIA 3ZS4A 3NVDA 4GO9A 4NZFA 3TJXA 5C2GA 3P93A 4MNLA 2Z25A 1YE4A 1BYBA 3ME3A 3KTCA 1JF6A 4MOZA 2WSRA 3LERA 2BLEA 3GH5A 3NXFA 1QNOA 3EA2A 1XYBA 4M6PA 1YDVA 2WJDA 3FHAA 3RHGA 1YPXA 2VFGA 4P7RA 2ZBTA 3ARPA 2QAPA 2Y7FA 3L4WA 3NNTA 2VUNA 2A7RA 3WUFA 1TYGA 1VZWA 1D9EA 4AVOA 1E6XM 1QPKA 2OYMA 3GG8A 4I9TA 5LHEA 1HT6A 2QUMA 4HMNA 1IEVA 2JKPA 2PLKA 3TNBA 5FJOA 3WNLA 4RPPA 4LBSA 3THCA 5BRPA 3VX0A 2DVTA 4WSHA 3RGTA 3N12A 3I7QA 3P3BA 1EBGA 4FLOA 5FD0A 2YBTA 2QCDB 3MO4A 2FVLA 3N11A 3P82A 2RDWA 3CZJA 4QITA 2ZDSA 5I0DA 3UY8A 4CCEA 4C6BA 1WO2A 1DQWA 1G4EA 3V0TA 2GJXB 5F4XA 5B7YA 4U5KA 3A9IA 3QGVA 1PTDA 3G1DA 4UMCA 2G50A 3WIJA 4JFUA 5TAOA 2P0OA 4NZ4A 2WWCA 4TMBA 3IWPA 3C5QA 2QMKA 1XFCA 1EIXA 1J0ZA 4ZXOA 1FWEC 4NI3A 3H21A 5I3FA 2A2IA 4DYEA 3GW3A 2QDHA 4NAFA 1FCQA 1R3SA 4NX5A 4DLMA 1TA3A 3ARXA 2R82A 2MNRA 4FO4A 3AJ7A 3DFTA 1JZ6A 3S5YA 1W91A 3SR7A 5J5DA 3FW6A 1F6KA 4L9YA 3OZMA 3QMRA 2D0FA 3FSUA 1XLBA 1UOZA 4ZQCA 1QUMA 3P7YA 4OFCA 2PWUA 3BXWA 5LA0A 1H50A 3VGDA 3E12A 4JTCA 4A2RA 1UP2A 3K4AA 3RX4A 2QMJA 4CEUC 3BLPX 3DHFA 3EZ4A 3G2GA 3UG3A 4WOZA 1GJUA 3SN0A 4DJFD 3GY1A 3GC5A 3O07A 4ZOCA 2CLIA 1BYAA 1UQYA 4ZTXA 2CHNA 3VMPA 4DO4A 2HISA 3CYVA 4PTVA 2W9MA 3WYZA 1JZ8A 3FFSA 3TSMA 4RK8A 3O7UA 4WDUA 4EANA 2J4GA 4KKXA 5T8GA 2O9PA 3HPFA 1AH0A 2XN1A 3G0XA 4ACYA 3WJYA 3B05A 3REQA 1W17A 3SADA 2A5HA 5F2IA 2YCKX 2WSKA 3K13A 2WLYA 5D38A 3VIHA 3CLMA 1CGXA 4I5RA 3W71A 4XZHA 1G4TA 5HINA 2WVSA 5HWMA 1O5RA 3H2NA 1D3HA 3OG3A 4PB3A 4ADTA 4DX3A 2EO7A 3QW4B 3W75A 1W2VA 1EF3A 3DI0A 3RR1A 4H6EA 4XAGA 4A2SA 4XAYA 5HK4A 2XFYA 3KOZA 1S2WA 2VEFA 3R13A 4RDYA 1UWUA 2QUTA 5TF0A 4M80A 2EF9A 5G5IA 2VUYA 1YADA 5KZDA 1XLEA 4DQWA 1JDFA 4FEZA 1ONEA 2X1IA 3GH4A 4EOUA 1GZGA 5H1WA 1TWDA 1VCFA 3MT1A 3SBFA 1GYNA 3HF3A 3MJMA 1DE6A 5CGMA 5D8WA 3EGJA 3PVFA 2OZTA 3MW7A 2Z7GA 2R1KA 1PTGA 3BVJA 1UG6A 4PCFA 3WQ6A 5JBEA 1CECA 4PMUA 4Y8FA 3H7RA 5KZ6A 1UKSA 2E9MA 3TQKA 5HWNA 1I1WA 4JIHA 4H9TA 1UZHA 1I9CB 4CEXC 1VGAA 1ZBCA 2J78A 2OSXA 3DG7A 1SW7A 3PUGA 1JCXA 3CUHA 4LWWA 2XDFA 2YCLB 1KQZA 4MJZA 4HOWA 5LIKX 3U2CA 1O5KA 4PMQA 2UY3A 3DG3A 4WHBA 1ISWA 5ECUA 5CPTA 5M2FX 1V3IA 3S6DA 4B5UA 5DMNA 5HQLA 3RM8A 3KXQA 4OKDA 3WDRA 3HQOA 2WVVB 3HPAA 3GXFA 3DG6A 4GYKA 4MWAA 1VJIA 2Z2BA 4OE7A 1V3KA 1GORA 1XYCA 2DT3A 2EPLX 3CIWA 1Q6EA 3QLLA 2EJ1A 1UYQA 3ELFA 1ZJHA 4MDOA 1TPWA 2WMIB 4PSRA 3T9PA 4Z2KA 2QCNA 1TV2A 1PX8A 4N6EA 3F4WA 1AH4A 3U48A 3VFCA 3C6CA 4GABA 2IS7A 4WDXA 3GC4A 2O9RA 1A5SA 3PN8A 1MXGA 4HSNA 4X63A 4AY7A 1KNWA 3F5LA 4DO5A 4IP4A 1RP9A 2IKGA 3KCJA 1WV2A 5DMYA 4P8WA 4IJCA 4JTRA 4HYVA 1TWZA 3GIPA 2Z2AA 3NL6A 4H4IA 1KFJA 4D8LA 1OFBA 2VHLA 4XG1A 1UBPC 4DNHA 5CGQA 4Q6JA 4Q32A 4OTKA 2QUNA 1V08A 3WF2A 4YHGA 3WQPA 4QISA 2VX5A 4QRNA 4GBUA 3VIMA 3OIHA 3GDKA 1TELA 3VOCA 2GDQA 2XVNA 4EPDC 1TPFA 3SZ8A 1GJPA 5C7VA 4RW3A 2QCGA 1UR3M 2WHJA 3LHZA 4JFVA 3PUDA 4GI8A 1EJXC 4GJ1A 4LUYA 2DFAA 4JQ2A 1PVNA 1US3A 3D6NA 3QY7A 4BI5A 2CITA 3GDBA 3PY2A 1X6UA 2WKJA 1W37A 3ANUA 3NOYA 3GXPA 4S3AA 3N25A 1U5JA 1TQXA 1UWAA 1KFCA 2W63A 1W5MA 5I00A 3CB8A 2X30A 4QQUA 5A8GA 5F7UA 2DT1A 2FIQA 1OF8A 4WY0A 5K7JA 1L6SA 2GVYA 4LV4A 4MM1A 4KIRA 2F8QA 3G22A 1N8IA 1UZ4A 5CCZA 2QLYA 4LUTB 3S1UA 3DYOA 1QR7A 3VXGA 1XIJA 2Y61A 4ZA0A 1UOKA 1W8GA 1J0JA 1FUYA 4LAZA 5CAKA 3ABQA 4NHVA 1JI2A 2FVKA 4AB4A 4JTEA 4LB4A 3QH2A 3M0XA 1QW8A 3WF3A 4IX2A 3LLFA 1SMDA 3L23A 1A5BA 4DO7A 5T9BG 1DJIA 4Z2IA 2NVCA 4O19A 4TO8A 2VFDA 3LBOA 1TJ2A 2XZ7A 1H2JA 1O6IA 1R9YA 1V02E 4ZSTA 3URAA 1C90A 3L4YA 1L2QA 3WKZA 3H6OA 3W1AA 3NG3A 1SGJA 3NQMA 4LBUA 3QN3A 3WLIA 1EOKA 1UD6A 4DN1A 4UTFA 2VGBA 2VZVA 3P0XA 1NOWA 4UTWC 1VHNA 1R0MA 1GPWA 4AX7A 1Y5WA 3CS2A 4ZGYA 1NQKA 2VX4A 3DHPA 4IT1A 3NPXA 2WBGA 3MS8A 5CZKA 4RNIA 1F07A 1JFXA 5FJJA 4J9JA 3W73A 2CYGA 4E8CA 1G6CA 1ZCOA 1S5WA 1WXJA 3ONCA 4XKYB 2Y7GA 3VOJA 1YQ2A 1VIZA 1VPQA 5EMLA 5CC7A 3RJYA 1PZ0A 1R38A 4EP8C 1UROA 4D1JA 4AD4A 1RCQA 3C0JA 4NYYA 1WQ5A 5CSUA 1CZ1A 1E51A 3P8JA 1EC7A 3ID7A 1VYPX 1XCFA 2BTMA 2CZFA 4JZ5A 4U10A 3KHJA 2WCSA 3PANA 1GHRA 2PDCA 2PLMA 1W6TA 3UXIA 1A3HA 3M43A 3GNOA 2V63A 4B5XA 1Q6LA 1H7NA 1R9XA 2FZ9A 3GR7A 3SQLA 5HUPA 1SQ7A 1AZ1A 5F1VA 5FCZA 4C6DA 5BXPA 2NVDA 2HE8A 5I79A 1H63A 3S5ZA 2QJGA 3PS7A 5HMFA 1WDDA 1SR9A 3L4VA 1JL8A 4G6CA 3CLWA 3OLGA 3WF1A 2ZUNA 1F76A 2PRHA 3L4UA 2XGIA 4G5DA 2ZTKA 4DJEC 2HNEA 5FF4A 4AFYA 2J27A 2V2HA 4UR8A 2X2GA 4D6HA 4AD5A 3C3NA 3KOWA 2ANUA 1UWRA 3TYBA 2C14A 4B5NA 1QMLA 1NP2A 1US2A 4UNIA 1VR6A 4UMBA 3WNKA 4CU6A 5IHSA 5E0KA 1K9DA 4KIEA 2ZA2A 3L5AA 3AISA 4S1FA 3EWZA 4IIHA 3TE9A 4WD0A 2QGHA 3XINA 4XV0A 1H62A 3MMUA 1R9ZA 1YDYA 2D2HA 5A6MA 1M65A 3G1SA 5ABEA 1POJA 4EPKA 3LK6A 1VRDA 3LHUA 3M5XA 1H51A 4YHEA 1DHKA 4GACA 4WEVX 3N14A 5FAJA 2E6DA 4JS3A 3CTTA 3VOHA 1JDEA 1C8YA 3JRKA 4DBEA 2OX1A 2NXGA 4CQAA 4XD4A 2V67A 4LVBA 3WD3A 3AIUA 3T42A 4HSOA 5EMYA 1W56A 1GZ1A 1WOBA 2CBIA 1YPIA 3WDJA 3RUBL 5LNWA 3NQ7A 1H0IA 1OX4A 1FP9A 3G6MA 4H9UA 1HUVA 4N4PA 1XD1A 3TN4A 6PTDA 4WDWA 4PH6A 4BQ4A 4KWVA 3ZR6A 1PIGA 2OQYA 1SFTA 4WGHA 3A64A 1XC6A 4L6OA 4D8AA 1EJWC 4LS1A 3UCCA 2V5KA 1RJPA 3GHSA 1Q5MA 3EKLA 2E5CA 2VR2A 4UTJA 1W9UA 2FHBA 4ZE5A 4BFAA 1FWRA 3ZWSA 2PP0A 4LB3A 3PNUA 2FHFA 3TYCA 3EXRA 3BQ5A 5FF3A 1Y5VA 2HSAA 4J3TA 3Q58A 4H1ZA 1CXLA 1W5NA 1ISZA 2PDHA 1MDLA 2J79A 1US0A 1FRBA 4NX0A 1MZHA 2G4JA 3QY8A 4IG2A 1L6YA 1ODUA 1XKYA 2C91A 3RLHA 4Q4SA 1CYGA 4P61A 1WDWA 3SCTA 1L6FA 5LSMA 2IPJA 3W22A 3P8IA 1EEPA 1ALDA 1HGWA 1WUEA 4GC3A 4UFHA 1B4EA 5H6HA 3WZ0E 4HHMA 3UWEA 3QGKC 4RKAA 1BYDA 2DZTA 4FS9A 2UBPC 4CKQA 4PEEA 1RD5A 1ITXA 1ZU8A 1EPXA 3L66A 4GH1A 3T1GA 3GIQA 3AOFA 1BPLB 3KOXA 1GVFA 2G95A 4NUWA 2ABAA 3EA3A 1BEUA 2P5NA 4JYFA 5DCBA 2AQWA 4DZ5A 4AF0B 4RJEA 2XISA 4BQ3A 1XWYA 1T96A 4Q4PA 1YX1A 1R5YA 1UWIA 3EMCA 1AODA 1GGOA 4AWUA 1VQTA 3LD5A 4JEJA 2D20A 4C65A 1L9WA 4HNCA 1EHNA 1OCBA 3TYUA 1K7EA 2ZWYA 2AQOA 4UQAA 4IPNB 3OZPA 3SY5A 1JZ3A 4AZIA 1KCZA 4PBEA 3EWCA 4Q6XA 3R2GA 3BMWA 3UQNA 3E02A 5I03A 1NDVA 3W26A 4A6GA 3QM3A 2ISSA 4PUMA 1OGSA 4X3ZA 4AZ6A 2E25A 2OQHA 4V1YA 4ZOBA 5H8UA 3F4CA 4AVFA 3AHYA 4MJMA 3WH5A 4U2YA 5FAGA 1UR0A 3IACA 5BXRA 4DJED 3FGCA 3IJ9A 2EPKX 4FR6A 2QT3A 3N2TA 4GJJA 1SZEA 3SRKA 3BH4A 4PCNA 4N2YA 1TKKA 2H3DA 1AQMA 1BHGA 1ESWA 1IR1A 1VC4A 3U9IA 2ZZ3A 1H49A 1W3NA 4FX6M 1VFHA 3MB9A 2PCQA 2DZXA 3GU2A 1C92A 3OGSA 3GYCA 1TMQA 3LHVA 3AXMA 4LV9A 4UTHA 4J4KA 2FTYA 3LTPA 3HURA 4PMVA 3LLXA 3DC0A 5AYZA 1TTQA 1P0BA 4LU0A 4HHLA 4FNPA 2DSWA 4WF7A 4A3UA 2WSYA 2YLAA 4ES4A 2Q71A 2E5DA 2YDQA 3W6MA 1REQB 1Z6KA 2NWRA 3WK0A 4FALA 4B90A 3TW7A 3QC3A 4MKNA 2ZC8A 4HA1A 5D2TA 1F3EA 1XLAA 4XZ9A 4HOZA 1EP1A 4F2TA 3V4BA 3ZFHA 3O1NA 2Y5JA 3EWUA 3BE7A 1UMYA 5FI8A 4HZMA 1TB3A 4GD0A 2HK0A 3E5BA 4CNPA 3BW4A 2YBUA 3C86A 1M68A 3BDKA 5ABHA 4PMJA 2TSYA 1KM0A 1ITCA 1B3VA 2QJHA 4YLWA 4EAYA 2CXGA 2R24A 5FJPA 3K1GA 2INEA 4XBSA 4NF7A 5IFPA 5BCAA 1HZYA 2CFFA 2IKHA 2ZRYA 2EBNA 3ZVHA 2CWNA 3VD5A 4LUSB 2OEMA 1W1B1 2AGKA 3W86A 3ARZA 1HKJA 2WVTA 2C79A 1M9HA 5LA1A 5G4EA 2JGYA 4QS6A 3TXZA 3GLCA 2JIWA 3NZRA 2DT0A 3APGA 4R53A 3VGHA 2X2YA 2E3ZA 3C0SA 3KCLA 2HVMA 4MPKA 4JEQA 4LYQA 3LNMA 3IS4A 2PDKA 1Q6CA 2NZLA 1D8WA 2GJRA 3KW3A 3M7SA 4TTGA 1QDSA 3KFTA 5JH1A 2PDFA 4IMFA 3R25A 5C54A 4M3PA 4MNMA 4WGXA 3EX1A 5I6SA 2WJEA 4PRTA 1V3MA 2PMQA 1WDRA 3KZSA 1GW9A 1H5VA 1K4HA 3GVRA 1T7LA 2CLFA 4IZGA 1CW2A 2HROA 3CZLA 4UTTA 3RX3A 5I3DA 1XXXA 2I57A 4HZ6A 1KRCC 4LVFA 1S3TC 4AC7C 3WF4A 1Z44A 1HO1A 1RSCA 1V4YA 1M7XA 1CLVA 1FCVA 4Q22A 4P5UA 3S1WA 1V6UA 3P61A 2BWGA 1SMAA 4WKHA 1HTIA 4RNJA 1OX6A 1E0TA 4JTGA 1ADSA 3UR8A 4Y9OA 3PSWA 4Q3MA 8RUCA 1K7XA 3GBDA 4WR3A 1VD6A 4ZB2A 1VCVA 1VYSX 3RNDA 1W3TA 1FWJC 2QUUA 3PTMA 2X40A 1VLIA 2ZA3A 4YWIA 1JEZA 4K2SA 5XIMA 4H01A 2PP3A 3DFHA 3V35A 3WCZA 2E5BA 1S5TA 1N7KA 2A3AA 1NP0A 5CJ5A 1YDNA 4UBPC 3VOIA 4S3DA 2XM1A 1DIKA 1KCXA 2C1GA 4B3KA 1VEPA 2V82A 1OFAA 4O1EA 3KVJA 3T44A 4ZO6A 1XLDA 1R7OA 5EY5A 4YTUA 2VC6A 3TX9A 2JBMA 4QAWA 5CJNA 1OJXA 3N2CA 1R3RA 1F7BA 4PBFA 4CNNA 3BCDA 1OBAA 3PWAA 4U2ZA 4ZFCA 1MMFA 1EKOA 2G37A 1PYMA 2ONEA 3GK0A 3RN6A 1SJBA 3S5OA 4JICA 2G5WA 1JCTA 1TMHA 2J7HA 3A4WA 3NQEA 4C6NA 3LCLA 5FF2A 4AD0A 2Q09A 5CLTA 2ICSA 2NX3A 3QFEA 3CHDA 2P0IA 3G8EA 1E9LA 1TQJA 2YYUA 2PD9A 1ISYA 4TXEA 3QQ0A 4GVGA 4AWEA 1H3GA 4C90A 3DUGA 3RPDA 2D0GA 3MV01 3PBWA 3EB2A 4J27A 1X98A 1RR2A 1EH9A 2QCCA 4BA0A 3W23A 3APYA 2XYLA 3ORWA 3LPPA 4GYJA 2PDUA 1XP3A 1OQFA 4D6GA 3H22A 4DXXA 3W72A 1AQ0A 2NUWA 4B4FA 3AALA 4UFKA 2BVYA 2PB1A 3WDQA 3WBAA 1XRTA 3GVGA 2C8NA 3LI0A 2VWSA 5FL1A 1U1HA 1G5AA 3VIJA 1TV7A 1YIXA 2BHUA 4O11A 1KR1A 2DIEA 4QLKA 1U33A 3HOJA 2PGEA 3RU8X 4D72A 2REQB 1OT1A 1JZ5A 2YFOA 3IGUA 3LPFA 3SW6A 4O1DA 2J8FA 3OU8A 2CLHA 5ENLA 2HXUA 3B97A 3RR4A 1WAUA 4U3AA 4QNEA 3MP3A 2RAGA 4GVFA 4GNVA 1E1FA 3WLNA 1W9BM 2Z2UA 2AQVA 3VDGA 1F6PA 1PWLA 4QP0A 2G3NA 4C6OA 1LTDA 2F2KA 2PRLA 1M7JA 2VKZG 3SCWA 4L1GA 2VO5A 3HG4A 4QEEA 4YIWA 2RGMA 4LRTA 1H7XA 4E2DA 3RPMA 5CPMA 1EWEA 1B3WA 1Z32X 2WOQA 5K4XA 4O14A 2VQUA 3CEUA 3UJFA 1F4HA 3AWNA 5IM51 4JKLA 4PTXA 3ITTA 2WQPA 4QG8A 3RLUA 1ME9A 5G4WA 2PZ0A 3VD3A 3T0AA 3VIOA 4RE3A 4AZCB 3MCOA 4NYUA 3W2UA 1QNSA 5C55A 3WQOA 4LYRA 1OK6A 4LCSA 3RAOA 1WZKA 4PUKA 2H6RA 1X8CA 1NJJA 2ZE3A 1UASA 4JTIA 1R6WA 7ODCA 2NQ5A 4HK6A 3DXIA 1OIMA 2NT1A 3GIYA 1W54A 2YBVA 1EJTC 4F3HA 4C6MA 4KGJA 2FLIA 5KZEA 3H2MA 4H7ZA 2I1OA 3KP0A 4OBTA 2P1FA 3E5PA 5BZAA 3K4WA 2C15A 5IDZA 1RQEA 3E6EA 3GM8A 4LPCA 1OSEA 3UBPC 3C2YA 1ZZMA 3OGVA 1OG0A 1IEWA 4B9YA 1MEIA 1OYBA 2E68A 5DELA 2FB2A 4C1LA 2FGLA 4F8XA 2CKRA 3IRSA 3FV9A 3RK8A 1UJQA 2GYIA 4GYPA 3MU7A 1Z9AA 4ZFMA 2GOUA 4P7QA 1LQ0A 4JCMA 1J0HA 3DFOA 4DYJA 4KT2A 1PSCA 4J1OA 4IFRA 1EJSC 1T41A 1QWGA 3ALGA 5D09A 1V79A 2GDUA 5A6JA 4XIAA 3T4WA 1NEYA 1OYCA 3G0SA 4RDZA 1RY0A 3BV4A 1W9DM 4RX0A 1KKRA 3WD2A 2XFFA 4OBSA 5LIWX 5G2WA 4XZMX 3LLDA 4JN7A 3W53A 3GQYA 5JQ9A 1PKMA 3EWWA 2J66A 5BRBA 3TFXA 1A0DA 3CWHA 1RJRA 4LYPA 4LXFA 2W3ZA 4AEEA 1N8FA 1TR9A 1DWFM 4JNZA 3BG9A 1YLVA 4C6PA 1XBZA 3AMCA 3LYEA 2BASA 1VJSA 1DV7A 1TE6A 3CIVA 3GDLA 4YYCA 2OMAA 5AHNA 3IUHA 1IQ8A 1EQPA 5H91A 4S3BA 2VDGA 4HA3A 4O16A 1JRCA 3Q94A 2A7NA 1GQJA 3WDPP 4JTSA 3DGRA 1KBJA 3WUGA 3TW6A 1TUFA 4KEZA 3HPZA 1H09A 1UR9A 1QAPA 3VKDA 4H6QA 4ZCWA 2GJXA 4JNYA 4MF4A 1EBHA 4X9SA 4IGNA 1Q2RA 4JDBA 4MYAA 4MB3A 3BARA 4J2MA 3TQVA 3U3HA 2FZ8A 2CLPA 1OY0A 2B7OA 1ZQ5A 4HJWA 1F8MA 1EC8A 2CKSA 3FXYA 3V75A 1UP3A 5DEZA 2UWFA 5FACA 1YE6A 1HQTA 1M03A 1SZRA 4GO8A 4L9XA 4YWSA 3CL6A 1UIOA 2VCAA 1UH3A 5I02A 1KFLA 4KGLA 3LZ5A 2ZICA 3LTSA 3CYJA 1BKSA 1LRQA 3SCQA 3CQIA 4CQDA 1TPH1 1UBSA 1YYAA 3MVIA 4PGLA 4PUWA 3TVAA 2VYOA 3PC0A 5L9FA 4GJIA 3BZGA 5C0QA 3K30A 2XPKA 3I6EA 3HO8A 1Y8BA 3OP2A 4X60A 4YS1A 3RCYA 2ZE0A 1FKXA 4US5A 4XD5A 2J13A 3UGRA 3M44A 4DZAA 4WUIA 1V7AA 4YTTA 1WOAA 1XLFA 3IIVA 4I9MA 1H61A 2WC7A 2JE8A 3SUUA 2CIPA 2FDSA 3GWQA 1TCMA 3HB9A 2PCEA 2BOEX 3TAOA 2D1ZA 3AMDA 4QIUA 1KO0A 4PMYA 1R3QA 3WQ4A 1FQ0A 2OX4A 4W87A 2W27A 4PUDA 4ICNA 2ISVA 1GVQA 2HZGA 3W7KA 2ZUWA 4HMDA 4PCSA 1UPMB 4MMWA 1TX0A 3MSGA 2ZUUA 1QI4A 4RPQA 5XIAA 3B4UA 3XIMA 2NV2A 3NOEA 4DWSB 1E1EA 4PFMA 1EIBA 3ZJ6A 1EX1A 2XSAA 2B0MA 3BURA 3CEPA 3BC9A 4FIRA 3VA8A 1D3GA 5BYWA 2YCJA 2A6NA 3UY7A 3WJZA 2F7FA 2CHRA 4HU4A 2E4TA 1Q7MA 1LG2A 3W1UA 3JZUA 1EB3A 5D04C 3AYVA 3HZ3A 2GZXA 1JUEA 3WENA 3GHRA 4BR1A 1EL3A 3M6DA 3DAQA 3H8AA 1X97A 3HQ1A 2UY5A 4M1RA 1SUXA 2OKTA 4G1NA 2P10A 4ALDA 1U22A 1E15A 3N9KA 1UZDA 2B4GA 3DECA 3KBVA 5KZMA 1BG4A 3OLEA 3EDDA 2G96A 4C7FA 3WDHA 2GSEA 3BAKA 4Z1BA 1TCDA 4C6IA 1YXDA 3D5HA 1U1UA 3GAYA 3LENA 1M5WA 1IT7A 2DH3A 3A9BA 1RK5A 4C6EA 1UWTA 1OADA 3GR4A 2DP3A 2GQ8A 3V3WA 4EXQA 2GDVA 2R8WA 3CH9A 2WVVA 4DF2A 5G2HA 3IGHX 1YTKA 1TWWA 1GYLA 4DM1A 2XINA 1GTHA 2XIBA 3V36A 5REQB 5MKGA 2VRKA 3NZGA 1VCGA 1KCKA 3VGGA 3MDWA 2SFPA 1Q65A 2OSYA 4HZ7A 2XUCA 4AXKA 4CD7A 4WQ6A 3C61A 1VH7A 3AI0A 3BAXA 2P88A 3F4DA 1CGYA 3E0IA 4JD4A 4CD4A 3ITCA 2WMIA 4C7DA 3VIKA 4JQ1A 2DJLA 2GWNA 5D05A 1GOWA 1W1YA 5I7GA 3WDIA 1P4CA 1Q6DA 3W37A 2ZA1A 3RRXA 4M6QA 1XH2A 2PDNA 5BXSA 1Q45A 3R79A 3T2PA 1W9PA 4LS2A 1E40A 4DBSA 2NUYA 1UKOA 2QGYA 2F84A 1OZQA 2OWCA 4IMDA 3ES7A 3IGSA 5CZJA 3W81A 2X0SA 3WUBA 3FLUA 5AHFA 4JIIX 2DZBA 3NR0A 4KCWA 1JYWA 4FXJA 3MP5A 3U4AA 4CGTA 3AMLA 2PDWA 1XGDA 2FB3A 1O94A 4PTDA 1P1MA 5M1TA 3SIMA 3VO0A 3NUKA 1XRSA 2YL9A 1H4PA 3WLPA 1H7PA 3TONA 1QNRA 4XZNX 1UB3A 4I5UA 1PO9A 3E0VA 4H3DA 2C1HA 3UVIA 1CXIA 1V3HA 4NG3A 5HR7A 1B30A