4ZZ9A

Crystal structure of t75s mutant of triosephosphate isomerase from plasmodium falciparum
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
246
structure length
243
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYSGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the role of highly conserved residues in triosephosphate isomerase - analysis of site specific mutants at positions 64 and 75 in the Plasmodial enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 91
structure length 243
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zz9A00
2FIQA 4HPXA 1MO0A 3P84A 5KINA 4JEQA 5BMWA 1LDCA 4R34A 1JUKA 2ZCGA 2EF9A 3C2OA 2V82A 5HNRA 1NF7A 4K7YA 1OF6A 1Z48A 4XBKA 2X2GA 5LHEA 3B8DA 2QCFA 1TJRA 3NQMA 3JS3A 1ZAJA 3PG8A 3UZ5A 3TFCA 2PC4A 5DXYA 4O1CA 2IQTA 2AQWA 4MYAA 1IGSA 5FEXA 4A22A 3QMSA 3OVPA 3W7NA 3O6DA 2E5BA 3LCHA 4UUIA 3ZS4A 1SO5A 4O14A 2BWGA 2W6RA 4YMZA 4M5PA 4WY0F 5DY3A 3NGJA 1KM0A 4LS2A 3NL2A 4QISA 1KBJA 1I2QA 1F6KA 1G67A 4MPQA 4UR7A 4Z0SA 4LC6A 4MUZA 1NF0A 1W5OA 2C14A 2Z2UA 1QAPA 2CLLA 1TB3A 1ICQA 3LXCA 2DZPA 4ZQNA 5K4XA 4Z1DA 2VKZG 3DI1A 3FIGA 5AHFA 3T78A 4CQ9A 2V81A 4RV8A 1AL7A 4GC4A 1B3OA 1LBLA 3W7LA 3LHWA 1C29A 3QQ0A 3TROA 4MZ1A 4EF9A 1XCFA 5K2ZA 4OHQA 3THAA 4UIOA 2ISWA 3GNDA 1GTEA 5AC6A 1PV8A 2ABAA 2ZBTA 5KZDA 4LW7A 3W72A 3QRHA 2R94A 2Y7DA 3TW6A 2Y7FA 2ZRXA 4BFAA 4O28A 3CIWA 4UTWC 3QJAA 3NQDA 2J27A 3W2KA 3NYZA 5I3FA 4OV9A 1H7RA 1JJKA 3TQVA 3EX1A 5G1YA 2AAMA 2A21A 3EX6A 4TMBA 1KV8A 1YPIA 2V2HA 4CNPA 5J5DA 4NNCA 4NJKA 2QUTA 4UR8A 1OX4B 1YTEA 1AW5A 3WJWA 4UXDA 2FJKA 4GWEA 2QDHA 3F1QA 5LGXA 1XFBA 2Y62A 3BLEA 4UTWA 1OX4A 2YDAA 1IXPA 1OFQA 2XFWA 3TIMA 3MHGA 4BWLC 4RZ5A 2ZA3A 1SSDA 2JBMA 4WY0B 1D3GA 4JTHA 2NLIA 1WBJA 5CKSA 5LZLA 2YYTA 4HKPA 2GVJA 3LLFA 3I7RA 2OZ0A 2NWRA 3S5NA 1OVDA 3QC3A 3QMTA 3PVFA 3B04A 4QNEA 1LRTA 4JYEA 1UBSA 3A24A 3NXFA 2BLEA 1VCFA 4GXMA 5IM51 1JQXA 5EPDA 5HMSA 3PWAA 1FWTA 4JTFA 1OFAA 4LU0A 4L4MA 3VI2A 4CNNA 4IX2A 1LP6A 4TIMA 4Y90A 1XI3A 3ZWTA 3N3MA 4O4WA 3WK1A 3BLFA 4N9BA 5CSSA 1LLZA 3EX3A 5C54A 4Q33A 2H90A 2YX0A 4HSNA 4ADUA 1DV7A 3TH6A 3CLMA 3TA6A 4DO6A 2QEZA 2AGKA 4WOQA 3P60A 3W3OA 3W85A 5LNVA 2GQ8A 2JKEA 3I68A 4AHPA 4OT7A 1UJPA 4EOUA 2ZYFA 4KFOA 1SFJA 5KSWA 3DFQA 1I2PA 5LSMA 2H3BA 3TX9A 1TPFA 5I3KA 4RXFA 5KZEA 4MLJA 1FBAA 2RDTA 4LNYA 5EBUA 3S8HA 1G7VA 3GXTA 1T8XA 3M7WA 3C8FA 2Y70A 1ME9A 3GR8A 3W7RA 5F4XA 5H2ZA 3NEVA 3QZEA 2V0TA 2ZZ4A 4X9SA 3EWWA 5EA9A 2NV1A 3NL6A 3C2EA 4PL1A 1SSGA 3W71A 3HGOA 2GQAA 1TPC1 1WAUA 3HO8A 1GZGA 1P1XA 4OU1A 1TTJA 1P0KA 4UTJA 1JCMP 2VEMA 2WSYA 3MP5A 2VFGA 4JTJA 2ZZ2A 3TSMA 4FX8A 3AO0A 4MZ8A 3EX4A 4LRSA 4N9DA 1VPXA 1PE1A 1YXDA 4L4LA 4IMFA 3CB8A 4HNNA 4UNLA 5MHBA 5CPOA 4O18A 1PCKA 4IOTA 2TMDA 4ZL1A 3EWUA 3YPIA 5AC7A 1EWDA 1SW3A 1SO6A 3W7KA 3IIOA 4A2RA 3G0UA 1KBIA 1M7OA 4ZQCA 3NQCA 3SFKA 5U7SA 3C2FA 2YGYA 3BARA 3U6WA 4NXKA 1S3HA 1EP1A 2NWSA 4PEKA 1MEWA 1I2RA 3SI9A 1GQNA 4D2JA 1MXSA 3EWXA 3LCWA 1GTHA 1N55A 1K8ZA 1QO5A 2DJLA 2WKJA 2JGQA 2BXVA 4DXVA 4RZ4A 4NUWA 2QR6A 4FEZA 2EHHA 4AHQA 1W0MA 3L21A 1O5KA 4GUJA 2QCEA 1VHNA 4NZJA 4N02A 2Y85A 3IIZA 1OFOA 3LCLA 3W07A 5BW6A 4CQAA 1DL3A 4WX2A 1H7PA 4TMCA 3S1WA 4FNPA 1THFD 2C1HA 1KV5A 3FYPA 3TNOA 2Y88A 3DAQA 5K9XA 1X1OA 1JRCA 4AEOA 4XKYB 2ZRYA 5GVJA 4UCGA 1OK6A 3LHTA 2B7OA 3HOJA 4IPIA 1P5BA 1HUVA 4O0ZA 3UXDA 3C4UA 4JTGA 1KM2A 1Z44A 3EX2A 2OT1A 1LORA 3CEUA 4XWUA 2NXHA 3SZ8A 3LHVA 4FNQA 5L6UA 2NX9A 3I6RA 5D37A 3O06A 5I3IA 1A5AA 3UY8A 1CW2A 5D03A 4O54A 1H5YA 4HHPA 1OYCA 4FF7A 4JS3A 5HWJA 2DZSA 3NDOA 1OFRA 5HJLA 4NXSA 3GR7A 2ZZ5A 3WK2A 3BW2A 2HS6A 1W54A 1S5TA 1G4TA 4YXGA 5FEPA 1LCOA 1T0OA 5LNRA 3B05A 1YLVA 1EUNA 3T7VA 3KRSA 3WFAA 3TJLA 3LBCA 2J9XA 2GUUA 4GNJA 4DEFA 1I8JA 2DZXA 6TIMA 2VFFA 4MYXA 1I45A 2QCNA 4P2VA 2WO5A 3JR2A 1LM1A 3G3DA 3RLVA 2A5HA 2QKFA 1K7FA 4I7UA 3TR2A 1W37A 2GOUA 4ADSA 1CI1A 3S0CA 2CLFA 5TQLA 3FEMA 3IGSA 4M7TA 4R53A 3TMLA 5HINA 3IEBA 5FF3A 2R14A 2XN2A 3R12A 4JX5A 1ZY9A 2Y89A 4NJIA 3HJZA 2WPBA 3LCIA 5AN7A 3W1PA 1SQ7A 1X1ZA 2HS8A 1U83A 4PL2A 2RHGA 4LY8A 1K8YA 3ATZA 3LLDA 2G97A 1K3UA 1LBFA 1SO3A 3FJLA 2CZ5A 4UFKA 2CZDA 4CCDA 1TTIA 3ABOA 3BVJA 1AL8A 1OFBA 3PF3A 4UFLA 4UTUA 3DZ1A 4GRSA 4O19A 3E0IA 3M44A 3R13A 4O57A 4O12A 5CZJA 3LDVA 5D04C 3OA3A 3BGJA 2YW3A 3RMJA 4QITA 3QFEA 2ZZ7A 1XC4A 3BK0A 3LTPA 3L5LA 4RX0A 5FEWA 4XKYA 1HL2A 3C6CA 1YTKA 4PC8A 3KOFA 4LS1A 3UD6A 1RV8A 3HG4A 5FF4A 1XL9A 3GVGA 4LTSA 3TQKA 1VYPX 1C8VA 4WXZA 3DGRA 5D2YA 3QEZA 1YXYA 2A7RA 1KFKA 5DCEA 2Z1BA 1AW1A 5D38A 3UY7A 1GYNA 1TRIA 3OHIA 1TMHA 1RQBA 4O1DA 3SGUA 3W7JA 1AMKA 1GVSA 1UB3A 3FJ6A 3TAOA 4JDYA 4A2SA 1SR9A 4HNTA 4LRTA 4AWTA 3R5EA 2YYUA 1FWNA 4IGHA 4BI5A 3GIYA 3NPWA 3TFXA 1W8SA 3U8GA 5LNUA 1JCJA 2LLEA 4QQ3A 5K9DA 5EYWA 2B7NA 4EWND 1R46A 4XQ6A 1HO1A 3PUEA 2WNNA 3PR2A 4N4QA 4TO8A 3EEGA 2P1FA 3LRMA 2E1DA 1KM6A 1JR1A 1JUEA 1O4UA 1G7UA 3NM3A 1ALDA 3PS7A 3UNDA 4GUHA 1OJXA 3NNTA 1GVRA 3TDFA 5CPNA 3O6YX 4IWWA 3PBVA 3BW3A 3OIXA 3P5YA 3PM6A 1TV5A 3V75A 4E2DA 1ZENA 3EB2A 2ZFAA 3NA8A 5H91A 1HO4A 3RLUA 4ALDA 4JY8A 3W1XA 3ZWSA 1VRDA 5D2VA 5G1TA 1TYGA 4YL2A 2C13A 2P0OA 3WJSA 3G24A 1OX5A 4ORMA 4LV9A 4JTIA 1WOAA 3KVJA 2QCDB 5KZMA 3R8RA 1SW0A 4AWSA 4OGZA 2O7QA 4IMEA 1P4CA 2NUXA 3STFA 3LX9A 4MVAA 2DZUA 2FPYA 4NJJA 1ZFJA 3O05A 1FDZA 1L6SA 2C3ZA 1TPWA 1TREA 3LGEA 3PBWA 3NM1A 3QPYA 8TIMA 1QCWA 2JK2A 1WX0A 1VLWA 2WJZA 2WV8A 1LTDA 3I65A 3GKAA 4XZ9A 1KLYA 3L5AA 3A21A 2NX1A 4Z1AA 5AFDA 1JQVA 4WXYA 5K3VA 2ZQ0A 1ZAIA 4GBUA 4NZFA 4AMAA 3MP3A 4S1FA 2D73A 1LROA 3W22A 4S2BA 2C16A 3W1TA 3S5OA 3W9ZA 3MBDA 1KTCA 3MYPA 4O11A 4ADTA 2ZZ6A 3S42A 2QCGA 3VE7A 3G1DA 2CLHA 1LYXA 1JRBA 1NVMA 3ABRA 5G4WA 1FDYA 1J5TA 3O63A 2A2IA 4JNMA 1J2WA 1DBTA 4LV4A 1YPFA 3PUDA 3GAYA 4EIVA 3G0XA 1XBXA 1EP2A 4TR9A 3P62A 1GG1A 3A9IA 2ZDRA 4O17A 1L6WA 3H55A 3L0KA 3M5ZA 4MFEA 3CEPA 3O15A 3F4WA 1J4EA 3STCA 4UMBA 3BG5A 1KTNA 1ZAHA 4JY9A 4O53A 1ONRA 1F2JA 4RZ6A 1MSSA 3P82A 4Y9AA 1EEPA 1XUUA 1PHQA 3GX9A 1JVNA 1B9BA 5LNWA 3GAKA 3G1XA 3RF9A 2H8ZA 4MLRA 4K8HA 4MY1A 4UFMA 4MZYA 4X22A 5CPMA 1F6PA 4UTMA 3KHJA 2QUVA 3BLIA 4RXGA 1W3IA 3OVRA 3W75A 4K8EA 1K8XA 3INPA 1RR2A 3A5FA 1H63A 1VS1A 3C52A 1I2OA 3DI0A 1Q6LA 3CT7A 3DH7A 2WSRA 4GUIA 1KM4A 1H60A 5C55A 1ME7A 2PRHA 2QCLA 2Z6JA 3A22A 5AHIA 1T96A 2RDUA 3LRKA 2YSWA 1VQTA 3G3MA 3QF0A 1XUZA 2BTMA 3GKFA 1L2UA 2W0UA 4ZQRA 1IIGA 1O95A 3MJYA 3PB0A 1XDLA 5CPLA 5AHEA 1G4SA 5LGZA 1KM5A 2X30A 3LTSA 1TSIA 2WOQA 3IIXA 3W1NA 3S9YA 1TRDA 3E9AA 3M43A 3DKJA 5C2XA 2E6FA 1TIMA 3STEA 2TYSA 3RFAA 4K38A 4PA8A 2OT0A 4RCXA 3G1YA 4N6EA 1YADA 2VFHA 2H6RA 5F4WA 1I4NA 3IIPA 1DQXA 2V8ZA 1W3TA 2FQIA 1GPWA 4YCOA 1N7KA 4KKXA 1X6UA 2Y61A 1DVJA 2CLIA 3GNNA 1FCVA 1YYAA 2W79A 3MP4A 5DELA 4Y96A 4KWWA 1GVFA 3NQFA 1R2RA 4LOCA 5D33A 2XN0A 3MHFA 1L9WA 3LBMA 3SECA 2FDSA 1MEIA 3MI6A 2QJGA 3L0GA 4ML9A 4FXRA 1MEHA 3Q94A 4K6AA 4K36A 1SW7A 1TPH1 5AYYA 1TPUA 4WJEA 2EAWA 3SIZA 2GQ9A 2PRMA 3M5XA 1JCXA 3IIVA 3TSDA 1E51A 3WJYA 1ZJIA 2WQPA 3VFLA 1W5QA 4ZZ9A 4E38A 1BKSA 3DU0A 4RJEA 4UFIA 1RVGA 1VLIA 2ZRUA 3AJXA 2P10A 1EPXA 4PH6A 1ZCOA 3WK0A 4QAIA 4G1KA 4UTLA 2XN1A 4ZQMA 2I1OA 5D30A 5KTLA 4WY0A 3G1FA 4M6VA 2NUYA 4XBSA 4H6KA 1QNVA 2WNQA 1ML1A 4Z1BA 2HTMA 2GJNA 4LUIA 4BI6A 1Y0EA 2HSAA 4NNAA 1EB3A 1TCDA 3S5YA 2FLIA 4QJ1A 1LRNA 3QSRA 3VNDA 4MFDA 3LCXA 3N2MA 1OABA 3PSVA 5DCBA 2VELA 1QPOA 1FWWA 1A5CA 2YW4A 2J9YA 1S5VA 1NSJA 1PS9A 1K7EA 1DOSA 3U2OA 3IGUA 3TXZA 5AHMA 2Q3OA 1LOSA 4O50A 4WZHA 4O1BA 3R89A 1QFEA 2BSLA 4FNTA 3UWVA 3P74A 3L65A 3G0SA 3ANYA 2YPIA 3W2JA 5A5WA 1M7PA 1EIXA 3ZFHA 2DZVA 2F84A 3FYOA 2ZRWA 3UWZA 1XDMA 3Q58A 2YCEA 4O8RA 3W7PA 4ZVJA 5LKYA 1KTBA 2FPTA 3FKKA 3NQ8A 4NVTA 4CQ8A 1YTDA 3GB6A 3LV5A 3W2LA 3DFNA 4UNKA 3MW7A 3C56A 4FNUA 3NQAA 3MUXA 3NR0A 3T40A 3IVTA 5AB3A 4FIRA 5E0KA 3MMTA 5IBXA 5EL1A 1SPQA 3NG3A 4DELA 4K7VA 4GUGA 3PB2A 1VR6A 4Z0JA 4J9JA 5L9FA 3PY2A 5TIMA 3E49A 1M6JA 3GDKA 2FPVA 4NJHA 4ZMGA 5SWUA 3O16A 2I14A 4A21A 4UMCA 4M6PA 4MY8A 3N9SA 1UUMA 3C2VA 2VFDA 3NQ6A 1RQEA 1ZHAA 1TPB1 4LUJA 3L67A 1KFJA 1OFEA 4M7SA 3EKZA 3CPRA 4MJMA 1BWLA 3GDRA 4JTLA 2VEIA 4MIMA 1FCUA 1OK4A 3EWYA 1C9DA 5HUPA 1XBZA 4O0KA 3W23A 1DJQA 1PIIA 1YDNA 3PG9A 1DJNA 4JN6A 4R33A 3RK8A 5DXXA 3SR7A 2Z0IA 3K30A 2I9EA 1ICSA 2CLMA 1UCWA 1VH7A 5K9CA 2NUWA 2E77A 1H7NA 3P8IA 3DBPA 4FNRA 4JTTA 2OMAA 2C18A 4N9CA 2Y6ZA 5D2WA 4JTSA 1Z41A 1KM1A 4U28A 4IX0A 4LS0A 1SZGA 5IBXC 3P61A 4QIUA 2X1UA 4KFPA 4CNOA 4I7VA 2GJLA 3CWNA 1QDSA 4HN4A 3BO9A 3GDMA 3HGRA 4POCA 1PHWA 3W7CA 2Y7GA 3UWYA 3B06A 1RPXA 4JTEA 1WBHA 3DXIA 1IXNA 5KMYA 2J88A 4NQ1A 5HULA 3TKFA 2VEPA 4XTDA 2GVGA 5A8GA 3VE9A 3W7IA 4IMDA 1FXPA 3GK0A 1OX6A 4LVBA 5FI8A 1JCYA 1IXQA 4FXSA 3TV8A 5G2IA 3IGXA 4IJBA 4JX4A 1WQ5A 4UTHA 3HGJA 5CZTA 1OHLA 2B7PA 3S1XA 3QW4B 2ZRVA 4U4MA 4YWIA 3IVSA 3DFPA 3DFSA 2NXIA 3W1LA 1Q6RA 1GVOA 1IIHA 1IF2A 3G22A 3HPZA 5F2IA 5BMXA 4FX6M 5K7JA 2E09A 3PSWA 1FDJA 3BPWA 1W3NA 3UPBA 1JUBA 4DPPA 1H61A 3SGZA 5E1QA 1W31A 2PRLA 1O94A 3OBKA 2F7FA 5BRBA 2Z6IA 3CWOX 4GUFA 2CLKA 1KFEA 2DJXA 1GT8A 3HIJA 3G1AA 3H53A 3WJZA 5C5YA 2ALDA 3FA5A 3W83A 2PE4A 3IVUA 4DF0A 1QR7A 4HIBA 1OYAA 5F1VA 4NJGA 4MJZA 3LERA 4NU7A 5BOOA 3MYOA 3L9CA 3H54A 1VZWA 2GVLA 2C19A 3TAKA 5CZ0A 2OCZA 3EXRA 5LHFA 4K39A 2OX1A 3GYEA 4FO4A 5DBUA 2VFEA 1QMLA 5EY5A 3S5ZA 4N2YA 1V7YA 2VFIA 3W2NA 2O7SA 2V9DA 1EA0A 3M47A 1VCVA 1SU5A 1G4EA 1EWEA 3V1PA 1F05A 1FUYA 2E5DA 1DHPA 1LZOA 2QUUA 2R91A 3NZRA 4JR5A 2B4GA 4JIQA 5E93A 4LVAA 3NOEA 3W7GA 5EMUA 1FXQA 4JICA 2E6AA 4K37A 4A3UA 2CU0A 2C15A 5F2GA 4RK8A 1GEQA 3FOKA 3QH2A 3UWWA 4N4PA 1K03A 4GE8A 4E0CA 3W7EA 3CU2A 1ZALA 3TC6A 4OBTA 4IMCA 2TRSA 2H8XA 1JULA 5CZSA 3W2UA 2Q3RA 5ABTA 3OVQA 2VXNA 3HMJG 3O07A 1AW2A 4M6QA 4JXCA 2VEKA 3C3NA 1SZNA 3NPXA 1AK5A 4RR4A 3PULA 2FTPA 3W86A 3B0VC 4M19A 4O15A 3GXNA 3UYCA 4AB4A 3EXSA 5HQEA 5D05A 4O1AA 1T99A 1H50A 3HG5A 2Y63A 3M5YA 4TU1A 1YDOA 3C2RA 4Q32A 4CCCA 1TQXA 3DHFA 3M9YA 4GFSA 4LVFA 3W7MA 1ICPA 6ALDA 1A5SA 1DORA 1EP3A 3FS2A 4HNUA 1OG0A 3L2IA 4I7WA 1M5WA 3HPXA 2ZTJA 4IXXA 3STGA 4C1LA 4LC8A 3UXAA 2ABBA 2V30A 3TUUA 1WDWA 2G96A 4FNSA 1PL9A 1Q6OA 2CZFA 3NQEA 3PBUA 3WJXA 2NX3A 3QQ1A 3N9RA 4X3ZA 2CFFA 3W87A 1TPDA 3BG9A 3NQ7A 1ME8A 2A85A 2CW6A 3W1UA 4BK9A 4QNWA 1QPNA 2YXGA 1IXOA 1VCGA 5AHNA 5I3GA 3NO5A 2G95A 3M0ZA 1U5JA 3QM3A 3ABSA 3W2MA 4PCFA 4DQWA 4NX5A 1TV7A 4FHAA 4OE7A 4MOZA 1RZMA 2A7NA 1RQHA 3CIXA 3TW7A 5HWMA 1H7WA 5F1UA 1KFBA 2CLOA 1QOPA 2C6QA 3W1MA 3WK3A 1HFBA 3HF3A 4Y8FA 3PAJA 3G8EA 4Y6GA 4AF0A 3NL5A 1Q3NA 1FQ0A 3MBFA 1HTIA 1GVQA 3EKLA 1F5ZA 1VC4A 4AF0B 4B5NA 3G18A 3NL3A 2H3DA 1W5PA 4RKAA 4NX0A 2Q8LA 2ZA2A 1Q6QA 2G5WA 3N14A 2EKCA 1B57A 3LCFA 2X1RA 3C61A 3A23A 1R2TA 2BZNA 2B7QA 4HT3A 4LWWA 5F2MA 4QSHA 4YCPA 4EF8A 4MY9A 1TTQA 4XUGA 1LOLA 1SFLA 3SSJA 3P7YA 2A0NA 1DKWA 1WV2A 1K7XA 3TJXA 3DFTA 3CQ0A 4P61A 2A6LA 2J9ZA 2QF7A 3KVLA 1B4EA 3QYQA 2A4AA 4IMGA 3I7QA 4UMAA 5D02A 4A29A 3L5MA 4JX6A 5HR7A 1ZNNA 3Q2DA 3M41A 4N6FA 4WQ6A 1KFLA 1XM3A 2J6XA 1R2SA 2ZA1A 1VHCA 2JKAA 3F4NA 3G1HA 2R8WA 4EVZA 1H1YA 3O8AA 3HB9A 5G5IA 3ABQA 1AG1O 2QCDA 5FEZA 2V2CA 3TQ0A 4OQVA 2ISVA 3TU9A 5J5RA 1XXXA 3B0PA 3W74A 3P8JA 1FX6A 2BX7A 2PURA 5FESA 1Q45A 3LXAA 3KAOA 2J24A 3RU6A 1QPQA 1F74A 1F73A 3FFSA 3E02A 3MHUA 2QAPA 3S1UA 1SZFA 3IV3A 4R7JA 1GWJA 4BI7A 3UPWA 1WA3A 1FWRA 5DY2A 2ISSA 1F76A 4DPQA 2ATSA 1MZHA 3UZJA 5FF7A 3KFTA 2V5LA 1NAL1 1KLZA 3NPUA 5DBTA 1W56A 3W70A 5FF2A 4Z1CA 3TCEA 3O1NA 1XKYA 4NNBA 1TTPA 3DHDA 5D2TA 5G4EA 5D09A 4UTTA 3CTLA 4I9AA 4UC5A 4YLWA 2TSYA 3N73A 1G6CA 3W76A 3N2XA 1RD5A 2A6NA 4W9TA 4O16A 2X1TA 4O10A 4XTIA 2RH9A 3KVMA 3PC0A 4PODA 3DENA 2VOMA 2FB2A 1FY6A 3QPZA 3SY5A 3ELFA 4JTUA 3L66A 4AH7A 3L68A 2ATMA 4AAJA 4WOZA 3W7DA 2E6DA 4PFMA 3DKLA 3NQ2A 1OFPA 5U4NA 4CLMA 2DZTA 2YFOA 3E96A 1LOQA 1F7BA 5D2XA 3FLUA 1GYLA 3LXBA 2DP3A 1H51A 3M1ZA 3HBLA 3THQA 3W6YA 1VGAA 1TJPA 1OF8A 1R30A 4DO5A 4Z08A 3NQVA 1LRQA 1R47A 3LI0A 5CGQA 3W7QA 1LBMA 2X16A 3KRZA 4H4IA 1A5BA 1HG3A 2C0AA 3S1VA 3HQ1A 4TX9A 1H1ZA 2VC6A 5DN1A 5TBOA 5CSRA 2ZZ1A 4WUIA 4O13A 3W84A 3HPSA 3LHUA 5I3HA 1NFBA 4KFNA 3ZR4A 3BW4A 4BWLA 1BEUA 5K4ZA 2TPSA 4JTKA 2DU2A 1TV8A 4Q4KA 4ORIA 1A53A 3T44A 2JGYA 1CX9A 1NEYA 4AHOA 3GDLA 3A5VA 3QW3A 3ATYA 4O4VA 2E5CA 3GLCA 1S5WA 3TC7A 2GPTA 1OYBA 2RFGA 4DO4A 2FB3A 2QAFA 1TO3A 4OV4A 3LTYA 4JIPA 1UASA 2NXGA 1K02A 3SW6A 4NT0A 4H3DA 3W1QA 1GG0A 3N34A 2QCCA 4JD4A 3RNDA 3BV4A 1WYIA 1VYRA 1V5XA 4MKNA 2DORA 3UQNA 3GDTA 1WXJA 3KVKA 5HWNA 3DFOA 1XBYA 4JYFA 4AVFA 3OG3A 3BGGA 5DLCA 3KXQA 1QOQA 1N8FA 1G69A 1G4PA 3LV6A 1XBVA 1SUXA 1KM3A 1I2NA 4X2RA 5LNSA 3CC1A 2WNZA 3LB0A 3HG2A 2A1YA 4IPJA 4OWGA 4JDBA 2Q8ZA 5DCDA 2YFNA 4DF2A 2RDWA 2UV8G 4N9EA 3HGSA 1PCWA 1X8FA 3CM4A 1VJIA 5D32A 4LT9A 4QM1A 5AOUA 2YZRA 1TPVA 1D9EA 1WOBA 2JKPA 2OJPA 1Z42A 2EPHA 3KRUA 5HR6A 3NQGA 5HUOA 5KITA 3M6YA 1O60A 5BNKA 1FCQA 5AHLA 4LVDA 4WD0A 7TIMA 2X1SA 2QCMA 4UFHA 1EX5A 2V5BA 3VCRA 1QWGA 1DQWA 3QSTA 3G1VA 3LI1A 4HNVA 4IXHA 3W73A 3G1SA 3MI3A 1W1ZA 5F2LA 3LCGA 1W5MA 4BF9A 1P0NA 3GXPA 5I3JA 2HMCA 2NZLA 1EUAA 2B0MA 2DZWA 2PCQA 3LOTA 2KZHA 2E68A 3N19B 3O6CA 2A7PA 1FWSA 4C1KA 3TXVA 5G2HA 3CHVA 4S2CA 4ZQPA 1D3HA 5CG7A 3W1AA 3R2GA 1KW1A 3LHYA 2CLEA 1ADOA 3TMQA 3EWZA 2FFCA 1JCNA 3W7HA 3M16A 5AYXA 5AYZA 4DBDA 3B03A 4AWUA 1SZEA 4UTKA 3VKJA 3P80A 5G2WA 5F4SA 4CCEA 4JYDA 3EXTA 1TPEA 3SJ3A 1W5NA 3NZ1A 4LVGA 1JCLA 3L0NA 3TK7A 3LM7A 3FKRA 3F03K 3S6DA 3UWQA 4DF1A 3GZ3A 2QCHA 4ZQOA 1LLWA 3BG3A 3B0UX 2QDGA 5AC8A 1KA9F 5C6MA 1X7FA 1YDVA 3P67A 3MI2A 3USBA 2CZEA 1BTMA 1UUOA 5T26A 4BR1A 4ICNA 3W88A 1QPRA 1H62A 4RLIA 3UWUA 1SO4A 2YR1A 4ONVA 3NVTA 1FCBA 3LHZA 5FF0A 3T55A 2Y7EA 4O52A 3B4UA 4GJ1A 3HG3A 2RKXA 4UTIA 4FB7A 3TSBA 3T4CA 2NV2A 3D0CA 3M5VA 4IQLA 1QO2A 1O5XA 4KWVA 4FX7A 3OEXA 3EWBX 4UTTC 3PBYA 1KFCA 1B4KA 2QJIA 3I7SA 3C0JA 1H7XA 2ZRZA 3E12A 5EKYA 2EGZA 1TQJA 2V2DA 1GOXA 3JRKA 3NAVA 1YXCA 4FIQA 2CWNA 1H7OA 3MO7A 3PUOA 1L6YA 2E6YA 3KX6A 3W7OA 1GJPA 1VYSX 2VENA 4E2BA 3P81A 3Q37A 3G8RA 3MWAA 2WSQA 1A50A 2QJHA 4JGDA 3TE9A 4PTNA 3NPVA 4HPJA 1BWKA 4HSOA 3LRLA 4IUOA 3IRDA 4AXKA 2ZTKA 1OFDA 3P5ZA 2ZZ3A 1PVNA 3QMRA 3W1RA 4UFJA 4DBEA
chains in the Genus database with same CATH superfamily
2FIQA 2JALA 2HE5A 2Q09A 1QI5A 4JEQA 4R34A 3VABA 2ZCGA 3WH7A 2VZTA 2X2GA 1OEPA 3K4DA 2QV5A 1DIKA 3B8DA 4CCZA 3WQFA 4JKKA 3NQMA 3UZ5A 4JEJA 3NDZA 5C71A 4W5ZA 3BLPX 4O1CA 5DXYA 2IQTA 2AQWA 2XVNA 3OVPA 2PU0A 2NQ9A 2J7DA 4Q7NA 3LCHA 4UUIA 4AUBA 4O14A 2BWGA 3B40A 3V18A 2VR4A 4YMZA 4E8CA 3WLNA 5FOOA 3PUGA 3NL2A 4QISA 3QZAA 4LAZA 1F6KA 4MPQA 2WKLA 3BCDA 4OKDA 3R25A 4JHOA 4KMQA 2CLLA 4W86A 1V93A 4QXIA 2DZPA 2PDFA 2ISDA 3FIGA 4URIA 3T78A 2E8YA 2FDMA 4HHMA 3RPMA 4J3VA 4RV8A 1AL7A 5KZ6A 1XLJA 2FHCA 3AYVA 2PDHA 3FXGA 3EDFA 4R9XA 1OINA 5CJ5A 1NTHA 4UIOA 2CERA 2ISWA 4GPNA 2QIIA 1PV8A 2ABAA 4K2SA 3QRHA 2R94A 2Y7DA 3BLKA 3QJAA 2DW6A 4L61A 4BQ4A 1VIWA 2QW5A 2X8RA 3W2KA 3R1ZA 1QNOA 3NYZA 1UZ1A 3UGRA 1A5OC 2A21A 4BQ5A 4X61A 4QG9A 4ZSTA 4D9PA 4CNPA 2X7VA 4NNCA 1ZL1A 3CH0A 1I9CB 2QUTA 3RDKA 1SM9A 1JNEA 3WJWA 3MS8A 3LGDA 2FFIA 3BLEA 3KRBA 3A4WA 1IXPA 3SURA 2ZXAA 4BWLC 4JFVA 3GBDA 4RZ5A 1TJ2A 4WY0B 4BJHA 1D3GA 1F4AA 4I9MA 4YTQA 3KCLA 5CKSA 3DG6A 3E0VA 3ARVA 3GWQA 3VKCA 5CBIA 1JZ7A 1MW1A 3S5NA 1QNPA 4JPGA 3QC3A 2EEXA 3P2VA 4JTQA 3FSTA 3Q67A 5JUVA 9XIMA 3A24A 3WF4A 3NXFA 2BLEA 2A3BA 5IM51 2OWCA 2YBUA 5EPDA 5HMSA 3PWAA 5D8ZA 4JTFA 3DYMA 4LU0A 1PZ2A 4L4MA 1EYEA 4IX2A 4NZCA 4O4WA 3WK1A 1JYNA 4N9BA 1PDZA 1OADA 4EPEC 2SFPA 5C54A 2PDWA 1OCBA 3QOMA 1B5TA 1K4HA 3PANA 4MKSA 5LNVA 1UA7A 3ID7A 3I68A 5AYIA 3H21A 2E9BA 4OT7A 4M1BA 1UJPA 1BPLB 4EOUA 3N2BA 4P8WA 2CHRA 3DFQA 2OR2A 1A0CA 1I2PA 5LSMA 3TX9A 1TPFA 4KCTA 4NAEA 4HOZA 4XZBA 2YXOA 1FBAA 4MLJA 2RDTA 1P0BA 4LNYA 5BYWA 3V1HA 5I2UA 4J5NA 1BAGA 3K1GA 4OJYA 1BLIA 3W7RA 3CAWA 1TVPA 2V0TA 3EWWA 5EA9A 1J0IA 2NV1A 4Q8WA 1ZGDA 3LA4A 3ITYA 5H1WA 2OSYA 4P7LA 2QUNA 3HGOA 2GQAA 3EOEA 2FKPA 3FVMA 3RX4A 1H0IA 3PZOA 1EXPA 1GZGA 3ZLGA 1TTJA 4UTJA 1JCMP 2PGEA 2WSYA 3MP5A 4KGJA 3OPSA 2BXYA 3AO0A 2J47A 4LRSA 1VPXA 4L4LA 4H8NA 1I0DA 4X0VA 2VCAA 4DLFA 1KGWA 1PCKA 3SGGA 4E2OA 3W01A 4S3FA 1GOMA 1LUCA 2YBTA 3WL0A 2HJPA 3TN4A 1HP5A 4J40A 4W7VA 1H1NA 3VIPA 3CL7A 3W7KA 1EJTC 2DZBA 4A2RA 1M7OA 4C6JA 4Q8OA 4QCFA 4ZQCA 4JCMA 4UQ9A 2YGYA 4B3ZA 1EP1A 3TVAA 4A3QA 4PEKA 2C1GA 1GQNA 3TEVA 4D6JA 1GTHA 2PB1A 3WBYA 1F3XA 1UD6A 2DJLA 2WKJA 1VFMA 2YL6A 2BXVA 4DXVA 3GTXA 4DZAA 3BJFA 4KWOA 1O5KA 2QCEA 4F79A 1VHNA 3TW9A 3V5CA 3MUZ1 4HNOA 4NZJA 7ENLA 2Y85A 3IIZA 1OFOA 1YX1A 2ZOXA 3UR8A 3REQB 3S1WA 2C1HA 4YVVA 3WUEA 3DAQA 5K9XA 3T0TA 4V27A 1NELA 3IAQA 1ZB5A 3WBAA 4NG3A 1OK6A 1JDCA 3LHTA 2WNWA 4WIWA 4HU3A 1HUVA 2BY3A 4O0ZA 2DIEA 3W29A 3MCOA 2E8ZA 2W67A 3QV9A 1E9ZB 5D03A 4JS3A 2DZSA 4K8GA 2HS6A 1W54A 4ZXLA 1IEWA 3QHOA 4YXGA 5FEPA 2G3NA 1T0OA 2F6KA 4JL2A 3GTFA 3B05A 5LNRA 1F07A 2XVKA 1MZRA 3CQJA 2V6AA 4DB7A 2WMFA 3TJLA 3LBCA 1UR2A 2QVHA 1GKRA 2IKHA 2GUUA 2EQDA 2PI6A 3MUY1 3RCMA 4MYXA 2QCNA 4B90A 5TNVA 1A0DA 1K7FA 1MFVA 4B3KA 1MI3A 5C2CA 2A79A 4NZ3A 1E0WA 1A5UA 2F38A 4ZFCA 3AUJA 3KBJA 4DBWA 4R53A 2XTKA 4W88A 4XZLX 3SCRA 2OZ8A 4DJDA 2NT0A 3IEBA 5FF3A 2FMNA 4Q8NA 1KR0A 3T09A 3CLWA 2Y89A 2IPWA 5AN7A 1SQ7A 2YOCA 2ONEA 4PL2A 4LY8A 3ATZA 1Q13A 2G97A 1XRFA 3VDCA 2CZ5A 4UFKA 2CZDA 4H7ZA 3BZGA 1AL8A 3PF3A 4DUVA 4UTUA 4EAMA 4GH3A 3E0IA 3R13A 3N4EA 4A8RA 5CZJA 4C6BA 3LDVA 5D04C 2YW3A 2VTFA 1K70A 1BYAA 2C71A 1AJ0A 2VCBA 3N6HA 2OELA 3L5LA 1RY0A 2I5QA 1NJJA 3B9DA 4L56A 3CMGA 4PCTA 3HG4A 1XL9A 4LTSA 4LUSA 1VYPX 4WXZA 3S1GA 3HPFA 1US0A 4C6MA 3TZNA 4AIUA 3AIQA 3E74A 2A7RA 2ZUSA 1OSEA 1TMHA 1Z9AA 2DIJA 3AICA 3SGUA 3W7JA 1VPYA 4DWSA 1W9VA 4HNTA 4LRTA 5F7UA 4PCSA 4H41A 2DZAA 3RLGA 1FWNA 1IZJA 3SCOA 3NPWA 4EXBA 3N6QA 3FGCA 4ATLA 1JCJA 4QQ3A 4W8LA 4IT1A 1UROA 1JZ3A 3K4WA 4XVEA 2I5IA 4XQ6A 4EPBC 3PUEA 4HMDA 2WNNA 4XX6A 1UOZA 5HJXA 1KM6A 1YBQB 2DUXA 1G7UA 1TWWA 3V36A 5FL1A 3S4TA 1X98A 1YW1A 3NNTA 3LZ3A 4XG1A 2QJNA 1KR1A 5CPNA 4IWWA 3P5YA 1BXCA 3EB2A 3NA8A 3GD6A 1GHSA 1SR0A 5I79A 1WPCA 2Z00A 5G1TA 4R27A 1TYGA 5JBDA 2P3ZA 3WENA 2XPKA 1UWSA 1V77A 1WOAA 5JIWA 4D6FA 3E6EA 3KBVA 4V2XA 3STFA 3GU1A 1V3MA 2DZUA 4NJJA 4H01A 4PRTA 4LCQA 2C3ZA 1RCQA 2REQB 4R5EA 3K2GA 1CXHA 3NM1A 8TIMA 2DY3A 3HPAA 1QCWA 4ZR8A 2JK2A 1VLWA 5ECUA 1M7JA 2BGNE 3GKAA 4XZ9A 5AFDA 2PTDA 4WXYA 1I0BA 3KOYA 2ZQ0A 2PAJA 4BZYA 1A0EA 4IP5A 1LROA 2FVLA 3RMEA 1H11A 2Z7GA 4JTCA 3W9ZA 2WAGA 1XG3A 3I10A 3G1DA 4NIRA 3KHDA 5AC4A 2GJXA 2OLHA 3EMCA 4JQ4A 2VQUA 3G0XA 1Q6GA 1FWGC 2ZDRA 5A8QA 1E55A 3OQEA 3L0KA 3U9IA 3NXLA 2DVUA 4UMBA 3V4BA 3B9NA 5C9RA 3II1A 1SMDA 1TWSA 3GX9A 4L6HA 2P0IA 1GW9A 5IHRA 5HMEA 1C3FA 1E1CB 4MM1A 2YJQA 3RF9A 2H8ZA 3PJWA 4PUJA 4PBEA 3EWCA 2CHNA 4J3UA 1XIBA 4X22A 1F6PA 1ISYA 3BAIA 1Y5VA 2TODA 3RJXA 1WE5A 1XYLA 3KBNA 3OVRA 3SRDA 1K8XA 3VNMA 1RR2A 2VGGA 3E2RA 1H63A 1KXTA 3DI0A 5IOBA 2XH0A 1E9YB 1Z6KA 2QS8A 3CT7A 2WSRA 5JH1A 4GY7A 4E3TA 2UWFA 1M65A 2Z6JA 3A22A 3DDMA 5CC6A 1SJCA 3L2LA 1XH1A 1VQTA 3QF0A 2J4GA 3VD7A 5EGRA 3WEMA 1J10A 2J66A 1XDLA 5AHEA 2QGHA 3W26A 1C8YA 5LGZA 2X30A 2WOQA 3GVVA 4GO8A 3U7VA 3EYPA 5H8UA 3PWIA 2E6FA 2OWXA 1TIMA 3VD3A 4E5TA 3RFAA 4PA8A 4DO7A 1A80A 2XSBA 1YADA 4P8VA 2VFHA 1GJWA 4RW5A 1GKQA 1MW0A 1D7KA 4AQLA 3V5FA 2FVKA 5F4WA 3VCNA 2WZEA 2V8ZA 5EMMA 2Z1SA 4QG8A 1U22A 3GTNA 1EJVC 2Y61A 1FCVA 2W9MA 1W1VA 2W79A 4DAFA 1PTGA 3IJ8A 4V1YA 2FDSA 2W5FA 1ESWA 4ML9A 4LEQA 1HIZA 1OCNA 1MEHA 5GNXA 4K6AA 1SW7A 5AYYA 1TPUA 3OGRA 3V3WA 4WJEA 1ISWA 1LWJA 3FW6A 2VP8A 5GJMA 3M5XA 3IIVA 5C8BB 3LGGA 4QBXA 3VM7A 3WJYA 2UY3A 3W6LA 3CHFA 4DM2A 3DU0A 4RJEA 1DJGA 4F3HA 2ZRUA 5DO8A 1W3HA 1EPXA 4FLOA 1L6GA 3GYCA 3SCQA 3MV11 2G3FA 4G1KA 2XN1A 4K68A 2I1OA 1E5JA 3G1FA 3DFYA 4I6KA 1F61A 2PTXA 4PMXA 3L23A 2D24A 1QI2A 1EB3A 3KOWA 2OZ3A 3S5YA 3OIHA 3VU2A 3QSRA 1I1WA 4MFDA 1HF6A 3N2MA 4WR3A 3S3GA 1K9FA 3PSVA 1YE4A 3UGVA 1AJ2A 1QPOA 3GNRA 2J9YA 3CV6A 1A4MA 3IGUA 1A3XA 2JF6A 4O50A 4WSHA 1R7OA 3VPLA 2YPIA 1EQCA 2PLMA 2Z2BA 1N8IA 4ML4A 2XVLA 1HJXA 3Q58A 1H3GA 5C7HA 4U10A 4E6MA 2VD9A 4L80A 5LKYA 1KTBA 4OVXA 2FPTA 4DJEC 5KEZA 3NQ8A 4IQDA 4NVTA 1R3RA 3GB6A 4FF5A 4P7QA 3W2LA 3VMOA 5FACA 5HDRA 3MW7A 1NIUA 3NR0A 2VC9A 1V0MA 3F2CA 3VAVA 1OIMA 4B5TA 1RA5A 3BDKA 3OBAA 1N82A 5BXSA 5BCAA 4PUUA 1ZJHA 1VR6A 2WHKA 1MYRA 4Z0JA 4AX6A 4FA3A 4DXXA 4J9JA 5TIMA 2FPVA 3PJUA 3TYAA 3O16A 5FJPA 4A21A 4M6PA 4MY8A 2B31A 3URQA 2J8GA 4FOKA 1FWJC 2VFDA 1RQEA 1UOKA 4IGSA 2ICSA 2ZKMX 3GRIA 2CEQA 1OFEA 1BWLA 3GDRA 4MIMA 3W24A 1TFVA 1Q6EA 1FHLA 1R9XA 5CGTA 1EZWA 4Q8QA 3RK8A 4JN6A 3SR7A 5BXRA 3K30A 2I9EA 2PDYA 4JFWA 1KXHA 2VX5A 4PSPA 3BGAA 2QMJA 2OMAA 5DMLA 5J8LA 3ZM8A 3WLPA 4N9CA 1Z8AA 5D2WA 4KERA 2EO7A 3DYPA 4JTSA 4C6FA 3H4XA 3D5HA 1KM1A 4GO9A 4JFSA 2X1UA 3WQOA 1O66A 4DWSB 4S3BA 3U5YA 2GJLA 5LXXA 1EPVA 1JI1A 4ZB5A 3R0DA 3BO9A 3DFHA 3GDMA 3HGRA 4GBDA 1XYFA 3BL3A 3H2CA 3VIIA 4Q6JA 3UWYA 3B06A 1RPXA 4JTEA 1F8IA 4MADA 1WBHA 5KMYA 2CCRA 3EA3A 3WMSA 1BWVA 5FL0A 5HULA 3GG7A 3TKFA 3UW6A 2VEPA 2WWDA 3GXMA 4QROA 4S38A 4ZB0A 3VE9A 3T2PA 4IMDA 3GK0A 3KL5A 1JCYA 1TCMA 1IXQA 3A3WA 4GYPC 3MTWA 1W8GA 3H26A 3H2MA 3VKDA 4XAGA 4IJBA 1GONA 3WQ4A 3QY6A 3WFLA 1DE5A 3GW3A 1I1XA 4TTUA 1XIHA 2PP3A 2ZRVA 4N7QA 4U4MA 4ZO9A 3VNKA 1GZJA 3DFPA 1BYBA 2NXIA 5A2BA 1XG4A 2JEQA 3KS6A 4S3GA 4GJIA 4WLCA 3G22A 3HPZA 4HZMA 4QDPA 3SSZA 3PSWA 4HOWA 4U2ZA 1TA3B 3T8QA 1ONXA 3C86A 4IGNA 4HHLA 1FWIC 3WLKX 4REQB 3CO8A 4IF2A 3RIKA 5CAKA 3FN9A 4JHMA 2DJXA 4PZVA 1GT8A 3WJZA 4TQTA 2ALDA 4MG4A 1N2VA 3BSMA 3WX7A 1QR7A 4HIBA 4US5A 3OGVA 2QYGA 4P8UA 3UWEA 1VZWA 5CZ0A 5LHFA 4HP5A 4K39A 2OX1A 4FO4A 4B2DA 2BBFA 5EY5A 3S5ZA 2NQZA 3W2NA 1EA0A 3VINA 1F05A 1FUYA 2XIQA 2J78A 1LZOA 1UH4A 4Q4SA 3W7GA 4QAWA 5M2FX 4GYJA 2Z27A 2I7GA 3JZEA 4XAPA 4A8LA 3OZMA 4C60A 4RK8A 5A2AA 1TMQA 3WDHA 3RRAA 3L4UA 1Q63A 4E0CA 3W7EA 3CU2A 4OBTA 3MANA 4KS0A 2H8XA 3WLOA 4DVOA 2CBJA 2GDQA 1CGWA 1NFGA 4WKAA 2VXNA 4D6IA 1AW2A 1JYXA 1PKYA 1HKKA 3I4EA 3NPXA 1AK5A 3P0WA 2DGAA 3B0VC 1P0DA 4M19A 2ACSA 4M29A 4EX4A 3GVWA 4WSKA 3WNNA 5D05A 3FDGA 4DN1A 4O1AA 1BXNA 1R3QA 2PA6A 4KRUA 3CUXA 1GNXA 4TU1A 1TQXA 3DHFA 1IHIA 3M9YA 3AIUA 3W7MA 1EP3A 3FS2A 3UG5A 3EEZA 1EJSC 1GQLA 4DNHA 1M5WA 2HEJA 1ZLPA 2DSZA 2ZTJA 3CUIA 2BOGX 2VZSA 2Z1VA 1TZ7A 1NDZA 1PUDA 3UXAA 2ABBA 4YTUA 3K8KA 2G96A 1E6NA 3S6OA 4JKMA 3PTDA 2FVMA 3LS9A 2CFFA 3OJGA 1H0GA 4CUCA 1XLCA 5BWFA 3W1UA 4BK9A 2G95A 3WUBA 4MSSA 3ABSA 3NURA 3WH8A 4MJ2A 3R4IA 1X6LA 3WELA 1EC9A 4MOZA 1QRQA 4YPJA 2A7NA 1RQHA 4ZOCA 5HWMA 5F1UA 5DEZA 2V3EA 2CLOA 4B4HA 2D1ZA 4Q4PA 4CEUC 3WK3A 4EXAA 3HF3A 3AMCA 3IJDA 4Q8MA 1QOXA 2EG8A 4HTBA 1VC4A 1NOFA 3NL3A 4PGLA 4RKAA 3FHQA 3GVRA 2ZIDA 2ZA2A 1JPIA 2G5WA 4I5UA 3ZJ6A 4D8AA 4NAFA 4KWSA 3RLHA 3KOXA 3GTIA 5A95A 4GQ0A 2B7QA 2Y1HA 4LANA 3AS3A 4WGXA 4PMOA 3MDUA 4EF8A 3PPGA 3W82A 5D9NA 4C6KA 3P7YA 2A0NA 1WV2A 1KCLA 3BAYA 1XQKA 2OYMA 4LY4A 3CQ0A 3IRSA 4P61A 2QF7A 3OW1A 1HJSA 2A4AA 3AMGA 4IMGA 5I02A 4A29A 1W91A 1UKPA 4PUMA 4N6FA 3IJIA 5BRPA 3QGVA 2QDEA 1U30A 1YRRA 1GJUA 2ZA1A 3F4NA 1EIBA 4QRNA 4EVZA 3O8AA 3WNPA 2V2CA 3VGGA 2FHFA 2ISVA 3TU9A 4EAYA 1XXXA 3P8JA 1VFUA 3N11A 3ARSA 3VIHA 3S5SA 4JFUA 3O3RA 1VBRA 1F74A 1F73A 2YCIX 3E02A 1XCXA 3H23A 2QAPA 4GVHA 1G01A 4GACA 3LQGA 1HJWA 1J96A 4GMEA 1N8WA 2XIIA 1AQFA 1MZHA 3D3FA 5DBTA 1NAL1 3VOIA 1EFZA 3ONCA 5FJOA 4Z1CA 3BAKA 1UP3A 5D2TA 2PLCA 5G4EA 2BV9A 3CV7A 5A94A 2A6NA 4ACYA 1E4NA 4TVDA 4O16A 1BYDA 4UR9A 4O10A 3VGHA 5I78A 3KVMA 4UQEA 3DENA 2BVWA 2FB2A 4LB3A 4W7WA 2WK2A 2GYIA 3ELFA 4LAMA 3HV8A 1WNOA 4WOZA 3PP7A 4US5D 4WDTA 1IZKA 4CLMA 2YFOA 1XLMA 2XVPA 4X60A 1H51A 3M1ZA 4FPSA 3HBLA 1RBLA 2OEKA 4QG6A 4HGXA 1OT1A 3NQVA 2VRJA 2NVCA 5CPSA 3LI0A 3WMLA 3UERA 2VZVA 4W8BA 1XGEA 1ZP3A 3SCUA 5DN1A 1H1ZA 2IUZA 2VC6A 8XIMA 2O4QA 7REQA 2AL2A 1IEXA 4FAMA 4O13A 4Z42C 1ITQA 1JZ5A 4M51A 3ZJ8A 1NFBA 2VJXA 4I9JA 2D3NA 4ERGA 2TPSA 2QLYA 1E9LA 3HFTA 3T44A 1TV4A 3PTMA 3VGFA 2EPMX 1R9YA 1E40A 4V1XA 2E5CA 3GLCA 3WY1A 4D72A 1OYBA 1BSIA 1AQMA 4H04A 1TO3A 4OV4A 2YXXA 4C6LA 1RA0A 2HDJA 2O4MA 1HL8A 3N34A 4JD4A 1TA3A 1K1DA 1V6XA 1XPYA 3VUPA 3CO4A 3GDTA 4YNGA 3MSYA 3DFOA 1UP2A 4KH2A 1XBYA 2QVNA 3RPDA 4AVFA 5DF0A 1DP0A 1G4PA 1XBVA 1EDTA 4CU7A 1KM3A 1VFHA 5FD0A 2WNZA 3HG2A 5HNTA 3NVDA 2Q8ZA 4LBRA 2VEGA 4H9ZA 2RDWA 3HGSA 2I9UA 1PCWA 1X8FA 1R0MA 4CN1A 1V0KA 2EPLX 3WD0A 1WOBA 1IE7C 1Z42A 2PD9A 1C7SA 2GJPA 1XINA 3M6YA 3VDHA 5AHLA 3OBEA 2X1SA 1WCGA 1A5MC 3WDQA 1E4MM 3CUJA 3MY9A 4HNVA 4B5WA 5F2LA 1W1ZA 3ARQA 3LCGA 3QV7A 2PF8A 4WKHA 1B9ZA 2HMCA 2DZWA 4H8UA 1HVQA 1FWSA 4C1KA 4TOQA 3KEHA 4JAWA 3CWHA 3EWZA 3WD2A 2R9RA 3QKEA 3S46A 3M16A 1XKJA 3VNZA 3ANUA 3GUGA 3AHTA 3Q45A 4DBDA 2HNHA 3A4XA 3WQ5A 4R88A 4HHHA 3WSUA 1CXIA 3VKJA 2CXGA 3ZVHB 1M7XA 2AL2B 4U5KA 3EXTA 3ZYZA 3TJ4A 3GBEA 3L0NA 2PBGA 3UWQA 1B54A 3URBA 2POZA 4DF1A 3E3HA 2QCHA 3VTRA 1QK2A 3BG3A 4OFCA 1Q5MA 1E56A 5AC8A 4RDWA 3G1RA 1EXBA 3MI2A 3B8WA 4UBPC 2GQ3A 5T26A 4X0NA 4UZSA 1CEOA 2BNJA 1RK6A 2E3ZA 2YA0A 3UWUA 1SO4A 3GG0A 1XLEA 1HKJA 3NVTA 5A8MA 3LD5A 4AISA 4BF7A 3HG3A 4FB7A 4GQQA 1XIFA 5BZAA 3D0CA 1WDPA 3M5VA 1R3YA 4PN2A 4FR1A 3XIMA 1WKYA 3C0JA 3I7SA 3U0HA 5MKGA 2EGZA 1FWCC 4NF7A 7CGTA 3JRKA 4IPPA 1XLBA 1L6YA 1GJPA 1XCWA 2ZICA 2O9PA 3MWAA 2PSNA 3TYDA 4J2MA 1JI2A 4RZBA 3TE9A 1HGWA 4UOJA 4HSOA 3H2NA 2DVTA 4ZTYA 3POCA 2ZVRA 1W9DM 4CD6A 5IFTA 3N18A 1E72M 1UR9A 4AXNA 4PBGA 3W1RA 2D3LA 2CC0A 3HA1A 3FY1A 3M0IA 3UFYA 1VBGA 5BMWA 2HNEA 2EF9A 2V82A 1NF7A 4K7YA 3UZYA 4XO6A 4I6VA 3BLOA 4XBKA 4F9DA 1H49A 2PWFA 4LAUA 3VYLA 1WKEA 3JS3A 3PG8A 3F7JA 4C65A 1KNWA 2PC4A 3DC8A 1IGSA 1GYMA 5FEXA 3FAXA 1UR1A 3NO3A 2CZVA 2AQOA 2X7WA 1POJA 1SO5A 4DXKA 1UKQA 2W6RA 4M5PA 4WY0F 3OG2A 3F4VA 1I2QA 4AZIA 4TV6A 4UR7A 3QHNA 1W5OA 4LF1A 2C14A 2EKGA 1V6UA 5FIPA 3LXCA 3AZRA 4ZQNA 5K4XA 2VKZG 3DI1A 4UTFA 2VDGA 5AHFA 3AZSA 4M56A 3KW3A 2V81A 3EB4A 3SCPA 4GC4A 1R3WA 1NDYA 4TXEA 1B3OA 1RD6A 1PAMA 5I07A 2D0HA 3W7LA 3LHWA 3QQ0A 1XCFA 1UUQA 4DYKA 2PZ0A 4L9XA 5AC6A 4LW7A 3ANVA 3WIJA 2BB0A 1MFUA 2INFA 2ZRXA 3RRXA 3VDBA 1V4YA 1JZ6A 4UTWC 1UD8A 1CXFA 3UNTA 3NZQA 1Z89A 2VX7A 5I3FA 1SFSA 4OV9A 1H7RA 1JJKA 3TQVA 4QX4A 2GOKA 5G1YA 3BQ6A 3EX6A 1P6BA 1KV8A 5TAOA 3AWOA 1MW2A 1PDYA 4UR8A 1OX4B 1UZDA 3A12A 3GM8A 4CEXC 2G50A 2WCSA 2Y62A 2HK1A 1OX4A 1OFQA 3MHGA 3UG4A 1SSDA 2JBMA 2C1IA 2PS2A 3SCVA 4GVIA 3VZYA 3VMPA 2E25A 5LZLA 3U2ZA 2YYTA 4AIOA 3B9OA 4HKPA 4QJ4B 2GVJA 3O9NA 3COTA 2FH8A 1OVDA 2P50A 3PVFA 4S23A 4HTYA 4HZ8A 1UZHA 2OQHA 1LRTA 4Y2WA 4LPCA 1UG6A 1VCFA 1PPIA 1GOWA 4JL1A 5AY7A 1GORA 1FWTA 3AIWA 4U3CA 4HOXA 3CTTA 3VI2A 4Y9NA 3ZWTA 3N3MA 3BLFA 1LLZA 3WN6A 2XIOA 4Q33A 2H90A 4PTMA 3TH6A 3CLMA 2PC8A 4PMVA 3TA6A 2NQLA 1PEZA 3ZXWA 4G8TA 1J0KA 2VOTA 3LQLA 1BG9A 1E4IA 4C5YA 5KSWA 4M1RA 1BD0A 3T2OA 3SRFA 4LBSA 1V51A 4RXFA 5I06A 2OYLA 1MW3A 1GQJA 1O5QA 2PGWA 5EBUA 3AMLA 3GXTA 3M7WA 3C8FA 3CL6A 2V5DA 2VI0A 1KGXA 3GR8A 1RBOB 3WD3A 4CN4A 2VZOA 3WF0A 2ON3A 1EC7A 3NL6A 3SY1A 3K46A 4PL1A 2G0WA 2E40A 4HZ7A 2D22A 1K9TA 1TPC1 1FHDA 1P1XA 3KP0A 7A3HA 3C3UA 1P0KA 4DAIA 3QKZA 1KCZA 2ZZ2A 1HKMA 4JTJA 3TSMA 3VILA 1XGDA 1PE1A 2NSOA 2FZ9A 3CB8A 4HNNA 3E2QA 5CPOA 5MHBA 2FZMA 4O18A 3ZJ7A 3NZPA 4CD5A 4M24A 5RUBA 3N13A 3VIJA 3EWUA 3YPIA 5AC7A 2HXTA 4J1OA 3BJSA 3IIOA 5EFDA 2XM2A 2MNRA 4F0HA 3NQCA 3SFKA 3C2FA 3PFRA 4JKLA 4NXKA 2J7HA 1TIWA 4UOZA 2NWSA 3AALA 3EWXA 4JN8A 1N55A 2J7CA 1QO5A 1JYWA 1XYBA 4RZ4A 2BGQA 2EHHA 3MWCA 1YKWA 4R85A 5E5CA 3LCLA 3W07A 3OA5A 3ALFA 3A6OA 4FNPA 3L7RA 1THFD 4F48A 1KV5A 1X1OA 1JRCA 4XKYB 5GVJA 4UCGA 3AS2A 2B7OA 2ZUUA 1TUFA 5E6ZA 3ZIZA 3HOJA 1P5BA 2VHLA 3C4UA 4JTGA 1Z44A 1PZ0A 3EX2A 4MAVA 4AY1A 3TTEA 4XWUA 1E6XM 1UH2A 1UKTA 3LHVA 3ZT7A 3NSXA 5L6UA 3NGFA 5EU9A 5D37A 1CW2A 4FLSA 4O54A 4FF7A 2GGEA 3RM9A 2ZZ5A 4H7CA 1E43A 1XFCA 2O56A 3UZXA 3OOQA 1G4TA 5DMYA 4CN6A 4PMUA 1E6ZA 1U1JA 1YLVA 1TWDA 4JTRA 2GVEA 3FV9A 4C91A 6TIMA 1LWHA 4P2VA 1MRAA 1YNYA 4JBRA 4DWSC 1LM1A 4WJ8A 5BWAA 2R1MA 3M0KA 3WYZA 4I7UA 2JFEX 2GOUA 3CGTA 3KTSA 4ADSA 3PWGA 2CLFA 4G7FA 2Y0FA 3ECQA 7TAAA 3U7BA 1MRQA 2X1IA 1MQRA 1UKOA 1IZCA 2W92A 2OU4A 5HINA 3ZQ9A 2R14A 1RHCA 4BS0A 1V8EA 3R12A 1H41A 1DYSA 2WZHA 4GOAA 4JX5A 4A35A 3VUSA 3DC0A 4NJIA 3I3BA 2MUCA 5EMLA 2HS8A 4R3UA 3GHTA 4NASA 1K3UA 1LBFA 1SO3A 1M68A 3UR5A 4IG2A 3R43A 1OFBA 5JU6A 4UFLA 3HN3A 2Y2WA 4GRSA 4O19A 3LSBA 4O57A 4JTDA 3OA3A 2OVLA 4GXPA 3BGJA 3RMJA 5E0FA 1DJWA 3SUUA 3WEZA 3B4YA 3LY0A 1XC4A 3BK0A 3TNBA 5FEWA 1YTKA 1RLDA 3DG3A 4PC8A 3UD6A 1RV8A 2OX4A 1E1EA 2EPNA 2CITA 3AISA 2FGLA 3VKBA 1C8VA 2POTA 4IQEA 3QEZA 1YXYA 5DCEA 4J3SA 1UQZA 4MDPA 3TAOA 4A2SA 1Q6DA 4AWTA 3R5EA 3AHZA 1QVBA 1FA2A 3T07A 2PDBA 2PUZA 3TFXA 1XLLA 4A6GA 9RUBA 5LNUA 1XV8A 4XISA 1J18A 5K9DA 5EYWA 2BHZA 3GHUA 1WP6A 2VZUA 1HO1A 3PR2A 1ADSA 4TO8A 2YL8A 2W66A 3CHCA 4HBKA 1JR1A 1O4UA 1LL6A 3NM3A 1ALDA 5ABEA 3ALGA 3VXGA 4QDWA 3BOLA 1OJXA 2WZTA 4BY3A 4RW3A 2XYLA 3BW3A 1HX0A 3WH6A 1X7IA 5LIXX 4K1GA 4HMEA 4FP1A 5EMKA 3TTSA 3WJSA 4ORMA 4LV9A 1KWKA 1IT8A 3N25A 4JTIA 2DIKA 3R8RA 1SW0A 1XYZA 4AWSA 4OGZA 2O7QA 1XYCA 4IMEA 1P4CA 2NUXA 3VD9A 3LX9A 3KOZA 1O1ZA 4W5UA 3ISIX 2FMOA 3NIYA 1L6SA 1TPWA 3LGEA 3PBWA 4JQ3A 3BCFA 2WJZA 1U1HA 2WV8A 1PYFA 2XG9A 4PB5A 4CNTA 4LEFA 3A21A 5A8NA 2CXEA 5A6MA 4ZA0A 4AMAA 4S1FA 2D73A 3C0QA 4FS9A 3P0XA 3GQYA 3WQVA 4Y9MA 3S42A 3MPGA 1Z7AA 4PMRA 3H12A 2A3AA 1LYXA 4GYFA 3TTOA 4LV4A 4I9TA 4I8DA 3GAYA 4EIVA 1CXLA 4CU6A 3LMYA 2EBNA 3EKGA 3D47A 1US3A 3BMXA 3AI0A 3M5ZA 3JZUA 4HPGA 2W63A 1AODA 3VMNA 4GNVA 2ZADA 5H6HA 5CQ1A 4E4UA 1J6PA 3BG5A 4H8HA 1KTNA 3P82A 2PWUA 5G4HC 1XLGA 4QE5A 2OEMA 3ARPA 3D3AA 1B9BA 5LNWA 3GAKA 1I75A 4EWJA 3T9PA 1KKRA 4MLRA 4PTXA 3IUDA 1ZUAX 4K8HA 1XLIA 1KQYA 4UQDA 1V7AA 4LXFA 4W84A 4Q8PA 1B3XA 4RXGA 1W3IA 3W75A 3INPA 1J0JA 3R58A 1REQA 3C52A 4E2VA 1HJUA 4LJ3A 1I2OA 5AECA 3L12A 4FOUA 2QCLA 3OTRA 5FAJA 3VO0A 2J7BA 3CUHA 3RX2A 2X0YA 3LRKA 4IP4A 1XISA 4ZQRA 4AZ6A 2A3CA 5T9BG 3MJYA 3PB0A 3WLTA 1S2UA 3V0SA 3GC5A 3GHRA 3S9YA 1TRDA 1J8VA 1VFLA 3FX4A 1EDQA 3M43A 3DKJA 3PBMA 3STEA 2TYSA 1V08A 4RCXA 1HZYA 3G1YA 4N6EA 3AJ7A 3I4KA 4W4QA 3BUVA 1ECQA 4F0KA 4LCSA 2C79A 4ATDA 2CETA 2V3DA 3BANA 5CPTA 4AFYA 1TZ9A 2CLIA 1YYAA 3THCA 4XBJA 1F3EA 1JAEA 4OOUA 3E0WA 4FK9A 4WF7A 1MMFA 1R2RA 1V3LA 4LOCA 3ME3A 2XN0A 2WBGA 1DJIA 3QGAC 2E0PA 2QJGA 3ITOA 3L0GA 3DHPA 4FXRA 1QBAA 1YDYA 1TPH1 4YHGA 3SIZA 2PRMA 1S2AA 3L4WA 6PTDA 1JCXA 3TSDA 4P7RA 1E51A 4KIRA 1M3UA 1ZJIA 4JZ5A 3PBGA 1BKSA 4PTVA 5BXTA 4IIFA 3OYXA 4ES4A 3AJXA 1HGYA 5CPQA 1O7AA 4UTLA 2W91A 1P0EA 1T40A 4M6VA 2Y5JA 3NSMA 2E67A 1KD0A 2YL5A 3N4AA 2WSKA 1ML1A 4N42A 1WKDA 2HTMA 2GJNA 1Y0EA 2FLIA 1MQQA 3TP4A 1UH3A 2I56A 3LCXA 1FHUA 3VGDA 1GK8A 4KRTA 1OGSA 2VELA 2Y4SA 4HK6A 3M0HA 1A5CA 1DEDA 1K7EA 1PS9A 3U2OA 3CZGA 4IFKA 3TXZA 4RV3A 3CV1A 1KC7A 4O1BA 3R89A 3LMZA 4GX8A 4JTAA 1QUMA 3P74A 3G0SA 3ANYA 4TX8A 3RILA 3W2JA 1CB2A 1M7PA 1EIXA 3ZFHA 3LLXA 2ZRWA 3A64A 2YCEA 3EPOA 3W7PA 4ZVJA 4AD4A 4WSJA 4N0RA 1JNDA 4LUTB 2R1PA 2OWWA 2WB5A 1YTDA 3DFNA 3C56A 3UVIA 1E70M 3T40A 3IVTA 3BAXA 5E0KA 3MMTA 5IBXA 5DRCA 3CK5A 1SPQA 1UMLA 3PB2A 5L9FA 1XQLA 3TWBA 1JDAA 4ZMGA 5SWUA 2I14A 4NYUA 2D2JA 1OD0A 1CLVA 3TYZA 1UUMA 2G4FA 1FWFC 3T0CA 4UWMA 1JXKA 3N2OA 1DIDA 4ZOEA 1EJWC 1B90A 3VNIA 3EKZA 4DYJA 5CBBA 4JTLA 3OGSA 1FCUA 1RCXB 1OK4A 4PUKA 1VD6A 4LFYA 3W23A 3HQOA 1U2YA 4W8AA 1PIIA 4P5UA 2AQVA 1D7FA 4NYYA 3KTCA 4IIEA 2YB4A 1A3WA 2CLMA 1UCWA 1VH7A 5K9CA 3MC5A 2E77A 1H7NA 4KCUA 5HBFA 4JTTA 1FHVA 2XINA 4LGXA 2VVSA 3IPWA 3MT1A 3N17A 3CUFA 2IQ0A 4IX0A 4LS0A 3P61A 4QIUA 3R0KA 3CL8A 1ITCA 2J13A 4HN4A 4UOQA 4POCA 1PHWA 3W7CA 3VIFA 1O1HA 2DSUA 1W9PA 1IXNA 4PMZA 1UP0A 3G2GA 4JQ1A 3KL3A 3S9IA 1LQ2A 5CCZA 3W7IA 2AAAA 1NDWA 1OX6A 4LVBA 4OECA 5LIUX 1E3XA 3L4XA 4FXSA 2GGGA 1LT8A 1PKLA 3U48A 4GD0A 3HGJA 5CZTA 4GI4A 4NILA 2WLZA 2X42A 2VRQA 4YWIA 1QW9A 3DFSA 4IUGA 1Q6RA 1H2JA 2VGBA 4J3WA 4GVFA 4LYPA 3UVAA 5K7JA 1VB9A 1FDJA 1J6OA 1W3NA 4J27A 3N15A 3UPBA 1OIFA 4DPPA 1H61A 3F5LA 5BOEA 2ESCA 2ANUA 4DZIA 3NJ3A 1JD9A 3SJNA 1D3CA 1IGWA 3WLSA 1J0ZA 2Z6IA 2FTWA 4GUFA 2G41A 1MDRA 4AD1A 1BYCA 4W87A 1REQB 1KB3A 3FXYA 5F1VA 4MJZA 3LERA 2R1LA 3ARZA 5BOOA 4GZEA 1V3IA 3L9CA 1XIIA 3H54A 2QULA 2OCZA 1RK5A 1JYVA 5DBUA 1ZZMA 2VFEA 2VFIA 3CZEA 2IW0A 2ACQA 1IT0A 1GVEA 3NZRA 3DYOA 3WD1A 4LVAA 3W25A 5EMUA 1M53A 4JICA 2HROA 1FWBC 4AZ5A 2CU0A 1XRTA 4OIFA 2C15A 2ACUA 2YDRA 4MWAA 1DXFA 3BZJA 4HYWA 2YKKA 4N4PA 4QJ3B 4C6EA 2FZDA 3AYTA 5HNUA 1ZALA 5DT5A 3TC6A 4QTGA 2TRSA 3M64A 1XIJA 1RP9A 1V3HA 2PDLA 1JULA 3S6TA 4CNSA 3GXIA 1CXKA 3OVQA 3VC5A 3O07A 1VBHA 4Y9PA 2VEKA 3H70A 2NT1A 3SDOA 3G6MA 4ZO6A 3PULA 2FTPA 3V16A 1E5NA 1FOBA 1ZS2A 4HZ6A 2NQ5A 4BQ2A 2YA1A 1PZ3A 3JW7A 2VWSA 3LPFA 1T99A 1H50A 2NQHA 1SJBA 3HG5A 2Y63A 5AVNA 3C2RA 4Q32A 2D2GA 5KETA 4GFSA 6ALDA 5JBEA 4QFUA 1W3JA 3ES8A 1FVPA 2PFHA 2DW7A 3R6IA 1H09A 1EF2A 2QQ6A 1R7AA 3HPXA 3CHEA 1WAWA 4JOMA 4HD5A 3W27A 4IXXA 3STGA 1X6NA 4LC8A 2V30A 3ARRA 2G8ZA 4Z2KA 1WDWA 1ZBCA 3XISA 4DWSD 1LLOA 3FSUA 5HAOA 3VCCA 3NQEA 3PBUA 2CBVA 2NX3A 1L8NA 3EMZA 4PR4A 1FWAC 3IUHA 3VIOA 3W87A 3NQ7A 1BSLA 1ME8A 2PP1A 3RPTA 2A85A 1H5VA 3HU7A 4QNWA 3DGBA 4X63A 5AHNA 1VCGA 5I3GA 2GSJA 1U5JA 4ZE4A 4PCFA 2I57A 4MB5A 3RJYA 4FSAA 2P88A 1S1RA 4EP8C 5JH2A 3B0XA 1RZMA 3HV9A 3UF9A 3DHUA 3TW7A 3OO2A 4PE8A 5REQB 3HM7A 1VKFA 3R8GA 1R3VA 3W1MA 3QGKC 1HFBA 3PAJA 1NWSA 3NL5A 1Q3NA 1V3KA 3MBFA 5A6LA 5LA1A 2OLSA 1HTIA 1UW9A 1FFRA 3RAOA 5AYBA 2H3DA 5A6SA 3PN8A 5IFPA 4HSHA 4NX0A 1S5MA 3RXZA 1Q6QA 1IQ8A 1E71M 3N14A 1PTAA 2INEA 5JIPA 1B57A 3C61A 2OO0A 3VOCA 2BZNA 3B8UA 4HT3A 3CMJA 4FI4A 3A47A 4WDWA 1GVYA 2ZX9A 4XUGA 5EMJA 4U2YA 3B8SA 1DKWA 1K7XA 4I8YA 3TJXA 3DFTA 3QY8A 2A6LA 1SVDA 2WMIB 1B4EA 3I7QA 4UMAA 4HNCA 3Q2DA 3LNMA 1KFLA 1RJPA 4PSRA 2JKAA 3G1HA 2R8WA 1RPKA 4MWAD 4IG2B 4KCVA 5G5IA 3HQNA 4ERIA 2QCDA 3POHA 3NO1A 5M1TA 4HU8A 5J5RA 3W74A 4NRSA 1KBBA 5D9MA 3AZTA 1Q45A 4RDYA 1E6RA 2J24A 1Q65A 4AD5A 4L4OA 3R79A 4QEEA 3UPWA 3CAVA 1FWRA 5DY2A 1UKSA 1C8XA 2GL5A 4HA3A 1J0HA 2VDHA 1KLZA 3NPUA 4GI9A 3CV2A 1W56A 3E0LA 4A3RA 5FF2A 5A8PA 1T6MA 3QTGA 4UCFA 1T41A 2DH3A 3DHDA 4YLWA 2TSYA 3N73A 2PTYA 5GPRA 3N2XA 4WJXA 1G9HA 4HA1A 4W9TA 4DIAA 3WLIA 2PDXA 4DJFC 3QV6A 3BLLA 4XTIA 2RH9A 3D6NA 3QPZA 4AH7A 2WYSA 4JTUA 4R7WA 3FCPA 3PJTA 4ATWA 1Q6FA 3L68A 3IACA 3DKLA 1F7BA 3SO7A 1UR0A 4I3GA 4YTSA 3BAJA 5JVLA 1R9ZA 1ZTVA 1VENA 1EQPA 3WNKA 1OF8A 1PYMA 3BC9A 2P5NA 1LRQA 3I6TA 2PTWA 4W89A 4QEHA 1LBMA 1EL3A 3KRZA 1FKXA 4A8NA 4KW2A 5CJMA 3HQ1A 4TX9A 5CSRA 1E0TA 4CKQA 4WUIA 7PTDA 1X1NA 4XV0A 4H00A 1BEUA 5K4ZA 1AFSA 1LT7A 3OHMB 4Q4KA 3MZ2A 3LU2A 4ROQA 1NEYA 4AHOA 2PDPA 4U5IA 3QW3A 3QBUA 1WZMA 3BURA 3IJ7A 2ODOA 2P53A 3UCDA 1XIDA 3B8TA 2QAFA 3LTYA 4M81A 4G7EB 2RJHA 2NXGA 2OPJA 1K02A 3QFWA 3SW6A 4H3DA 4GQBA 3RNDA 2BASA 1HL9A 2GK1A 3CZ8A 2DORA 2WW5A 3UQNA 1POKA 3BAWA 1WXJA 4YTTA 2VM8A 4JYFA 3OG3A 5DLCA 1W1B1 3H2OA 1QOQA 4AWEA 1Q6CA 2WC3A 1GOKA 4LYQA 4R7OA 1S2WA 3LB0A 1WDQA 1SZRA 5AZ0A 1EJRC 4F0RA 4IPJA 1QI4A 3KP1A 4DF2A 4MWAC 1VJIA 4HPHA 3TYEA 2F6UA 4LT9A 4QM1A 2VVNA 1D9EA 1JFXA 2EPHA 4PULA 3NQGA 1GW1A 2WJEA 5KITA 3VGEA 2O9OA 2Z1KA 3G6LA 3LEPA 4CD8A 3Q4DA 2BP1A 3LI1A 5A6BA 3W4RA 3MI3A 4ZSUA 4XAFA 5IDZA 1P0NA 2NZLA 1EUAA 1JG9A 3L4VA 4XAZA 4BEQA 3VD5A 5MKGB 3TXVA 4PMNA 5CG7A 3W1AA 3LHYA 2QPUA 4UZUA 3AROA 5G1MA 5DT7A 4AWUA 1JPDX 1SZEA 4UTKA 3BH4A 2XFRA 5F4SA 4CCEA 5IRPA 3SJ3A 3NZ1A 2OG9A 3GNPA 3LM7A 1UIOA 3F03K 4HA0A 2WZIA 1W17A 4XSMA 1G94A 4ZQOA 1LLWA 3B0UX 2HVMA 1P6WA 1KA9F 1X7FA 1YDVA 3P67A 4RL3A 3RYSA 4KF1A 1UUOA 4MB1A 4U3AA 2KX9A 4BR1A 4YTRA 4DJEA 1H62A 2DVXA 3M0LA 2WVUA 3AFBA 4ONVA 5LA2A 3LHZA 3GUWA 2XDFA 4AIEA 1IYXA 3VIKA 3CZLA 1K6WA 2NV2A 2GK1B 2VGIA 3WDJA 5HOSA 4FX7A 3QR1A 4UTTC 4M6UA 4AZ7A 3DX5A 2D0FA 2QJIA 2ZRZA 2FJUB 1TQJA 1S2CA 1JXJA 3NAVA 1YXCA 4FIQA 3KX6A 4QJ5B 4E2BA 3P81A 4XIAA 1M1BA 4NRRA 4JGDA 1P43A 1NWUA 5EBAA 4GY0A 2ZTKA 1OFDA 4KQNA 1SYTA 3R7MA 3UJFA 3SUVA 4UFJA 2QF8A 1MO0A 2EG7A 3EDDA 2VNCA 4IHCA 5KINA 5I23A 3SIMA 5B7YA 1OZQA 1Z48A 3PPCA 1MNZA 3AMDA 3WBEA 3E38A 4XZIA 2QCFA 4BEUA 2Z26A 3TFCA 3WG6A 3VFCA 4PMQA 1TV3A 4A22A 1CGXA 4I5RA 3L4ZA 2XIJA 4GH1A 5A6AA 1UR4A 1ISVA 4QCEA 3R10A 4L9YA 4S3CA 1ODUA 5DY3A 1R5YA 3QLDA 4LS2A 4IGMA 4H2CA 2Z29A 3UPMA 2XGZA 1BGAA 4A8IA 1VEOA 4LC6A 3QOKA 2YL9A 1NF0A 2Z2UA 1QAPA 1WB0A 3W02A 3WH5A 4WCJA 4CQ9A 1UWAA 2PTZA 1L0PA 1W9XA 5DQPA 4H9VA 1HN1A 5HNNA 2HBXA 5K2ZA 4EF9A 4OHQA 2CBIA 2BGSA 4HCLA 1GTEA 1S2TA 3T0BA 3TW6A 4A4AA 5H8MA 4BFAA 1J9YA 3NTYA 3NQDA 4HA4A 1TJ0A 4L4PA 3VA8A 2J27A 2XZ9A 1E6SM 3TZFA 1PWMA 1PX4A 4IIGA 4DUOA 3EX1A 5JBFA 1NU5A 1AH4A 4S3KA 1MNSA 3DN5A 2BHUA 1CB7B 2V2HA 5I00A 4F2TA 4HJWA 3PAOA 3GHSA 1YTEA 1AW5A 4TVUA 4UXDA 4H19A 1ODZA 2QDHA 4GWEA 2QXWA 5LGXA 5XIMA 4QQUA 1XFBA 3RX3A 2EG6A 4Q7BA 2YDAA 3UT0A 1EDGA 3QZ6A 1ENUA 2DUAA 1EHNA 4JTHA 4IJCA 2NLIA 5LA0A 3C0SA 3UR7A 3EOSA 1J01A 4Q8VA 1JDEA 4PCPA 4TX6A 3QHMA 3I7RA 3ZSTA 4DBSA 3H8AA 3EOLA 2R24A 2OZ0A 2NWRA 4GG9A 4NL1A 1XC6A 3B04A 1LG2A 3UJRA 4QNEA 4JYEA 1UBSA 2ZVIA 4AMCA 2QZRA 1JQXA 4DNMA 4PMJA 4YHEA 5CSUA 4PMDA 1GUVA 1GZ1A 4CNNA 1UR8A 2DEPA 1LP6A 3DBNA 1K6AA 2O92A 3EX3A 4ACZB 1V6VA 2YX0A 4LCRA 4ADUA 1DV7A 2QEZA 3RCYA 3SUSA 2GQ8A 2JKEA 3QC0A 4X9YA 4AHPA 1SFJA 4P7OA 1YHTA 2H3BA 5I3KA 1ZCCA 5KZEA 2Z2AA 2J7FA 1LWIA 3S8HA 2Q6ZA 2Y70A 2PBOA 3QQWA 3E2SA 2NVDA 3BSGA 5H2ZA 2J8FA 3NEVA 1BF2A 4OBSA 4YYFA 5GJNA 2ZZ4A 4X9SA 3T4WA 1MVYA 3TOYA 3UESA 1B2YA 3T6CA 3ABXA 3MSRA 3ARYA 3W71A 2I17A 3BJTA 2XZ7A 3PZUA 3KCOA 4D1IA 3RG6A 1WAUA 1QASA 2VEMA 1F3TA 1DJZA 4FX8A 2XSAA 3OVGA 3EX4A 4N9DA 2X40A 3VOHA 4PEEA 1YXDA 4GY1A 4U33A 1BQCA 4LQ1A 4MGGA 3RO6A 5AVHA 1EWDA 1SW3A 4L1XA 2VDIA 1SO6A 3G0UA 3RM8A 1KBIA 2ZE0A 2O0TA 2WMKA 3AHXA 5ABGA 4XSLA 3PZVA 1W3LA 3BARA 1I2RA 4D2JA 3R0UA 1MXSA 4AEEA 1NH6A 1K8ZA 1WKFA 3EOOA 1VRXA 5AZ1A 5IDIA 2OB3A 4ZOBA 1ADDA 2BVDA 2OZTA 5FSEC 1W0MA 2BVTA 4GUJA 4CQCA 4N02A 2DT1A 3T08A 5BW6A 4WX2A 4GLEA 4GX9A 1ZQ5A 1CGTA 1M03A 3BE7A 4S3AA 3TNOA 2Y88A 4ZEPA 2Z7KA 3U2CA 5CSYA 2RGLA 1XPGA 2Z4GA 4NHVA 3UXDA 1KM2A 2OT1A 4JIEA 4XK2A 3CNYA 1LORA 3GU2A 1NY1A 1R86A 3SZ8A 4FNQA 2NX9A 3I6RA 3O06A 2V5KA 3UY8A 3CMFA 3NDOA 1OFRA 5HJLA 4NXSA 3GR7A 3WK2A 3BW2A 4RPPA 2REQA 2BOEX 3DEQA 1LCOA 2WCGA 4H9UA 2FZBA 3V7PA 4XD5A 4IL0A 4ERAA 4NKCA 3L4YA 1EUNA 2WXDM 3ARTA 1EBGA 3QY7A 8CGTA 2OSXA 1W1YA 1EGVA 1QT1A 2AOSA 3KRSA 1GHRA 2ZWYA 2J9XA 4GNJA 1I8JA 2VFFA 4FZIA 2QNEA 1XWYA 2E7FA 1QPKA 5AKQA 4B2DD 5BU9A 1MUWA 2A5HA 2QKFA 1OC7A 3K13A 3TR2A 3T8LA 1PKMA 1CI1A 1A3HA 1PX3A 5TQLA 2J6VA 3TMLA 3QYSA 2XN2A 1W2PA 1D8WA 3GDBA 2AKZA 2AMGA 2UBPC 1W9BM 1E9IA 4ECLA 3HJZA 4QSFA 3W1PA 3EAUA 5C9XA 2RHGA 3EZ4A 3OLGA 3CZKA 8XIAA 4B5XA 3LLDA 3KL0A 3FJLA 1VJSA 4QDMA 2W3ZA 4YYCA 1TTIA 3ABOA 3M0XA 3BTNA 3BVJA 1G0CA 1A47A 4H83A 1WZKA 1PJ9A 2DT3A 3M44A 2XH7A 1XRVA 4O12A 3KZPA 1CPUA 1KXQA 2ADAA 4WVXA 4UQBA 2ZZ7A 4KIEA 2VMFA 4CNUA 3NSNA 3MCNA 1J12A 1NP0A 2WMJA 4XKYA 3C6CA 1ZBVA 4AD3A 4J3XA 1KRAC 4GA8A 3KOFA 4LS1A 5FJRA 3EPNA 3GVGA 3BV7A 2QDDA 3W00A 2V3FA 3DESA 4F8XA 4EANA 5EMYA 2ZC8A 3DGRA 5D2YA 4F2UA 4O1FA 3GSMA 3THUA 3MKVA 2Z1BA 3ORWA 3W53A 1OC5A 1AW1A 5D38A 3UY7A 1GYNA 1TRIA 4A05A 1RQBA 4JNZA 3ITTA 2IPFA 1Y65A 3IJLA 1GVSA 1UB3A 2DSKA 2ACRA 4PTWA 4C90A 4IGHA 3SFWA 4EACA 1F3WA 1W8SA 3GFZA 2NLYA 2WHMA 4GZJA 2B7NA 4EWND 1R46A 1TZZA 5J04A 2VL4A 2R6OA 2WHLA 4N4QA 4XO7A 2P1FA 2OOGA 1VIZA 4AU0A 2GDVA 3UNDA 3B9EA 3WQGA 1GVRA 4IICA 4KEVA 1S2VA 3WBWA 3UXKA 3A4JA 3IANA 1OWQA 4NSBA 3AXIA 3OIXA 3PM6A 2W4XA 1ZENA 3N6JA 3N9KA 5H91A 1B30A 4MHBA 4ALDA 3ZWSA 3IJ6A 1VRDA 5D2VA 2C13A 2IKIA 3M4HA 1OX5A 1J0YA 3AIEA 7REQB 3S2NA 2DFAA 2QCDB 3BMWA 1EGMA 3TN6A 1BTCA 2FPYA 3O05A 2XWEA 1RALA 4G2DA 2Y8KA 3RUBL 1PWLA 1TREA 1VFSA 3QPYA 2RAGA 1X96A 3N29A 1ELSA 1WX0A 1KRCC 1B3WA 3P93A 1C92A 2NX1A 2PDMA 1JQVA 2WM0A 1ZAIA 4MKVA 3MP3A 1FKWA 3O0KA 1M41A 3S5OA 3W1TA 3KM8A 2DV0A 1KTCA 4O11A 4ADTA 2CLHA 3GIQA 3LPOA 1A49A 3ABRA 1NVMA 8RUCA 1JZ8A 1FDYA 1TV2A 1J5TA 3O63A 1J2WA 1YPFA 4G5DA 3PUDA 1MDLA 3DIPA 2GGJA 1EP2A 4NY2A 4TR9A 3P62A 1GG1A 3UXLA 1BKHA 3S2JA 1L6WA 4HMNA 2XJ7A 3H55A 4MFEA 1TWIA 3GU9A 2WHJA 3CEPA 2CIPA 1ITUA 1Q85A 3W0KA 1M9HA 2ZX7A 4O53A 3O7UA 4RZ6A 3OZYA 4J4KA 1MSSA 3FA4A 3UU0A 1EEPA 4AYGA 2VR2A 4B15A 2VCCA 4HYRA 3NDYA 2V5JA 1W2VA 3G1XA 1IEQA 1J93A 5C2GA 4H6RA 5T9CE 4MY1A 4UFMA 3VX1A 4MZYA 4LX4A 1LUCB 4UTMA 3XINA 1Q2RA 3KHJA 3E5BA 2QUVA 1Q4NX 2JIEA 3EDEA 3VOGA 4K8EA 3S83A 3H4GA 5A6JA 1VS1A 3CQIA 2Y8UA 1KRMA 1Q6LA 1XHGA 1GKPA 3HMCA 5C55A 1KM4A 1H60A 1ME7A 2PRHA 2R1NA 2WMGA 4HB7A 3JU2A 2F61A 2RDUA 3G3MA 3GKFA 1L2UA 2W0UA 1LQ0A 1O95A 1LG1A 5BROA 1CCWB 1TSIA 2ZUVA 4J28A 3W1NA 1AQ0A 1NOUA 4XZHA 2HQAA 4E4PA 2VUYA 1VFOA 3UR2A 1UWTA 1UWQA 4RE3A 4K38A 5E09A 2OT0A 4CQBA 3GS6A 1AUSL 1LL7A 1XP3A 4IJRA 1OCQA 2XVGA 1DQXA 3U5UA 2FQIA 4YCOA 3WCZA 1C8QA 1N7KA 4KKXA 1DVJA 3GNNA 1UR3M 2PMQA 1XX1A 4BHYA 3CPUA 3MP4A 1T7LA 5I09A 3UJEA 4UQAA 4E8GA 1GVFA 1ISZA 4JNYA 1A5KC 5BRQA 5DRIA 3LBMA 1MEIA 2FGZA 2VEFA 1QNQA 1P7TB 5C70A 1AZ1A 1J5SA 1LL4A 2EAWA 4FLRA 4IIHA 3ITGA 3AC0A 1NM9A 1ISXA 3WUFA 4E38A 2PDIA 4D8ZA 3MA8A 1RVGA 3L4TA 4Q4RA 4WDUA 2P10A 1ZCOA 2OGYA 2FGBA 3APYA 2XWDA 4ZQMA 3SRKA 5D30A