2VYOA

Chitin deacetylase family member from encephalitozoon cuniculi
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
EADVPDVCTNSGMIAINFVDGPVRGVTDRILNTLDELGVKATFSFTVNQKAVGNVGQLYRRAVEEGHNVALRVDPSMDEGYQCLSQDALENNVDREIDTIDGLSGTEIRYAAVPICNGQVNSEMYNILTERGVLPVGYTFCPYDYDDPVGEFESMIEGSDPKHHSFIILMHDGQEADTSRLENMVKIGKDKGYRFVNMDECLQGYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYSACCHARIDE DEACETYLASE DOMAIN-CONTAINING PROTEIN ECU11_0
publication title Structural and Functional Characterization of a Putative Polysaccharide Deacetylase of the Human Parasite Encephalitozoon Cuniculi.
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Hydrolase
total genus 75
structure length 206
sequence length 206
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2vyoA00
3RXZA 2C1GA 1W17A 2Y8UA 2C79A 1XW8A 4V33A 3CL6A 3HFTA 2J13A 4M1BA 4F9DA 2CC0A 2XU2A 3QBUA 2DFAA 1W1A1 5JMUA 4U10A 4NZ4A 1NY1A 1Z7AA 4NY2A 4NYUA 3CL8A 4NZ5A 4F9JA 2VYOA 2I5IA 4L1GA 4LY4A 1V6TA 3VUSA 4NZ3A 4OUIA 3WX7A 1W1B1 4HD5A 4NZ1A 2C71A 2QV5A 2W3ZA 2NLYA 4NYYA 4WCJA 3S6OA 2IW0A 2E67A 2C1IA 3CL7A 5BU6A
chains in the Genus database with same CATH superfamily
4JIPA 4IGNA 3CYVA 4DAFA 3NCOA 3MSRA 1WDWA 3HQOA 2OQHA 1OBAA 2QUUA 3W7QA 1MO0A 1F7BA 1M01A 1CGXA 1F3EA 6TAAA 1GKRA 3W76A 3B8DA 5A6LA 1TPFA 2ONEA 3D5HA 4Y9MA 1GNXA 3GVVA 4NVTA 4CGTA 4JFSA 4F2TA 2PDNA 1JCXA 1R85A 3DHDA 3GDRA 5A8GA 3C5QA 3L0NA 1PDYA 3M46A 4UZSA 1QRQA 3PTQA 4E4FA 5CGMA 5FOOA 3O05A 4KKXA 3LHUA 3VKBA 3WLNA 4JFUA 3IUHA 5T26A 1WDRA 1Z6KA 4JPGA 4TVCA 4FAMA 4MB1A 2GDUA 3KTXA 3ZJ7A 2EPNA 1OC6A 1UIOA 2YA2A 1XD0A 1VJSA 4ZOEA 2E40A 2CLMA 1W3NA 1VBHA 1XH0A 5AY7A 5C7VA 3SADA 5LA0A 1W8SA 2JKPA 1JF5A 1S3TC 2FIQA 4OJYA 3GNDA 3BLEA 4ADUA 1GQIA 2D20A 2X1SA 4Q4RA 3G5EA 4B15A 2VT0A 1YNQA 1W2PA 2ZZ4A 1DKWA 1W9DM 4PMDA 2FTYA 4S3CA 1TX0A 4P8VA 2G3FA 1EJXC 4HKPA 1WUFA 1RV8A 4IFKB 1VFFA 1EIXA 3CUJA 2NVCA 2PGFA 4PUDA 4JNZA 2QCMA 4PCTA 4ZB5A 3CPRA 3WF2A 1EA0A 1NWUA 3DESA 5HQMA 3FKKA 1NSJA 2HK0A 3ZM8A 4RV3A 4S1FA 4F0MA 4RDYA 1K1DA 1K9FA 1Q4WA 4N0RA 4WLCA 1JNEA 2CZVA 2V30A 3HB9A 4ZSUA 4UFKA 3K4AA 2YBTA 2W92A 2XSBA 2YDQA 4L65A 2G37A 3TN4A 1V6XA 1QO2A 1FDYA 5GJMA 3DYPA 1TWSA 1RA5A 3SCPA 1DE6A 3W71A 1RJRA 2C7FA 2V63A 4YNGA 2OEMA 3H4GA 4O50A 5LHEA 5AYIA 1XF0A 2WAGA 2Z1XA 3OVPA 3LCXA 3VUPA 1C8YA 2I9EA 2R1KA 2FB2A 3MMTA 1RP9A 3WMBA 5D9NA 2WSYA 3GC5A 3BARA 4CCEA 4CEXC 3LNPA 1EOKA 2VQUA 1AODA 3B4YA 4IJRA 2VL4A 3EOLA 1W32A 1B3VA 4V1YA 2VCAA 1CGUA 3V5FA 1XBZA 4PCSA 3N4FA 1UZ1A 1JCNA 4FNRA 3SSJA 3TYCA 2NXHA 1R3WA 1UYQA 1CXKA 3CMJA 2X1IA 1XGDA 4R7JA 4GJ1A 4H19A 3JRKA 3ZSSA 3P8IA 4GIYA 1U33A 3HURA 3WD4A 4FXFA 1V6TA 1M7OA 3F4WA 5EMUA 3IPWA 3TFXA 1PZ1A 2KZHA 2W91A 4CNTA 2ZA2A 1ZY9A 4WJ8A 2FZNA 4R53A 1IT7A 1MYRA 1OX5A 1S1RA 1BTMA 3MHFA 3RM9A 3UG5A 1OY0A 1XIMA 2FHBA 4W85A 3K8KA 5G5IA 3ABOA 1NOFA 3U0HA 5DY2A 1CIUA 4Q8VA 3D47A 1R7AA 2R1LA 2E9MA 1DWJM 1PUDA 3OIHA 3BLLA 3W23A 2W62A 1P4CA 5G4WA 3RITA 3CTLA 4AF0A 1JCTA 3CXOA 2G0WA 5G4EA 2HNHA 1EEPA 3UCDA 4UNLA 3HGOA 3F03K 1ISWA 2QF7A 1JGMA 1HTIA 1J4EA 1TPEA 3H7UA 2XM1A 3NO5A 1VBJA 2NW0A 1QHZA 3ARVA 3RLUA 2ALRA 1BVNP 1LF1A 4XD3A 5HINA 4FX8A 1TSIA 2J9YA 4X2RA 1J9YA 3O9NA 4J5NA 1QWKA 2Y88A 2IQTA 3NSMA 1QO5A 3W7JA 1LOSA 3U4FA 5D2VA 3KX6A 3OGVA 1QPNA 4XIAA 1UQZA 1BTCA 4QXIA 4KWVA 1KFKA 3CH0A 4JEQA 3KWSA 4ZE5A 3GK0A 2Y24A 3LBOA 3FGCA 3W7CA 3MHUA 1KRAC 4KWSA 4NI3A 2E5CA 3VD3A 4D6JA 3N6JA 1O5QA 1W5NA 4D2JA 1JF6A 2CWXA 1IIGA 5IXEA 1OYBA 4UNIA 1WP6A 4LS1A 3T4CA 3C8FA 4YHEA 3ONBA 4N4PA 3ALGA 1A5OC 1Z42A 1TPVA 3A3HA 1XC4A 3HBLA 4QDWA 5D33A 2VCBA 4M56A 2BHUA 3DI1A 1Q7MA 1A4LA 1UH4A 3HTWA 3QM3A 1PVNA 3VZXA 1E56A 2PTXA 1LORA 4GBDA 3U7BA 2GWGA 1XLLA 3G77A 3PFMA 2Z2UA 1PX8A 3Q65A 4AZCA 4IICA 1PKYA 1WQ5A 4LYRA 4J3ZA 1TPUA 2WVVB 4GWEA 1HGWA 4HN4A 1CX9A 3GTHA 1CCWB 5EMMA 3QVQA 3R4IA 2Z24A 3WLPA 4M1RA 3UFYA 3VGFA 3SY1A 1BF6A 2YDSA 4H00A 2X1UA 5AYBA 4FR6A 3QBUA 1UZDA 3OTRA 4JFTA 2DUAA 3A4XA 1MQRA 2PP0A 4LAMA 4Q22A 2Z27A 1R87A 3MP5A 1F74A 3WQDA 1R8LA 2GQ9A 5CPLA 1VCFA 1QCWA 3QY7A 1G6CA 2OZTA 2PA6A 3B8VA 1PHQA 2X7WA 2XGIA 1E6XM 2X0YA 3UXAA 3SRKA 2J47A 3C2VA 1BSLA 4O1BA 2VKZG 3CO8A 3K30A 3ERPA 3LTPA 2JF6A 1RD5A 2PSNA 4ZFCA 3WQEA 3PZMA 4XZMX 1GW9A 3IWPA 3NQFA 3NZ1A 5A6TC 3V36A 3ZFHA 2GOUA 2HISA 4RE3A 2F6UA 2A21A 3GTIA 4MY8A 4XISA 3DUGA 1PTGA 1MWOA 2G8ZA 5DXYA 2WQDA 2YCLA 3KOFA 2WZHA 1TJ0A 3WLKX 3TA9A 4GZJA 3ZWSA 4QLJA 3TC6A 2Z29A 3TYAA 1E4IA 4G2DA 1TV2A 1I8JA 3QOMA 1UR2A 1UR3M 3M64A 4GNJA 1XLIA 3DGRA 4U28A 4WD0A 4PUJA 1SGJA 3TCSA 1KGWA 4K37A 4I3GA 8A3HA 1K70A 3K46A 1T5AA 1BPLB 4P5UA 2Y7DA 3DXIA 1EA9C 3DN5A 4UOJA 3TQKA 3G22A 1R2TA 1H0GA 2Y6ZA 1CGVA 1FWRA 1EIBA 1S5TA 1VQTA 1K7XA 5CSYA 4MWAD 1L2QA 3GFYA 3SCUA 1G4TA 2CESA 3OODA 4HN8A 4NAEA 2PWDA 4HZ8A 1F9CA 1QBBA 4DAIA 3FW6A 1XRVA 2RDTA 1NDZA 2JGQA 2OCZA 2QUTA 4L1XA 4D8AA 3TYZA 2O4QA 5BXSA 3NGJA 1V03A 3VDAA 2A7NA 4GY0A 9RUBA 2WC4A 2CHRA 2DPEA 3VO0A 3AS1A 4HTYA 5K4XA 4HOZA 5JMUA 3M6DA 4PMVA 3E3HA 4KW2A 5JVLA 4L61A 4QEEA 1LL6A 4UCFA 4CVWA 4B5SA 2B7QA 3GHUA 1GKQA 1LRNA 1TQJA 3CMGA 3VABA 2O55A 4CQBA 3WQVA 4F0HA 3PF3A 1JAEA 2VD9A 3FNDA 4W8LA 1R46A 2PEVA 3N6QA 5I3IA 1XYZA 2GGHA 2XHYA 5I03A 4ZXLA 3VIHA 3CT7A 1QHOA 2PTZA 2DQWA 3NPWA 3TV8A 1XG4A 1FWBC 1GJUA 3M44A 4Y8FA 1I1XA 1EQCA 2WLZA 3DGBA 1XIJA 4FO4A 4DJDD 2ODOA 3LSBA 4US5D 3C2EA 3ZS4A 4L1WA 3S5NA 1HJWA 3SO7A 3NR0A 1JD7A 3TR9A 1B5TA 5HMFA 3Q37A 2IMRA 4JCMA 5EYWA 4GK8A 2C19A 1XGEA 1DWGM 4V15A 4EKJA 4MWAB 3LM7A 4JKLA 5E09A 1BG9A 1JCMP 2UY3A 3C0QA 3UYCA 4M8UA 4URIA 3SY5A 3L12A 4FHAA 3EPNA 3EXSA 5DBTA 2YLLA 3RUBL 3U3HA 2X41A 5L6UA 1M41A 3VOJA 4A4AA 1HT6A 3AAMA 1XRFA 1DORA 3WEZA 5CPSA 5I3FA 3W7OA 3CUGA 3IRSA 1IXQA 2BASA 3NZRA 3UA4A 3C86A 3MV11 4IGMA 1TKKA 2H9AB 4IP5A 1TR1A 1TTPA 1NWRA 3CH9A 4A8LA 5FD0A 2QUMA 1C92A 4NASA 4C6EA 1GYMA 3WELA 3V0TA 3ZR5A 3L4XA 3WK2A 3W87A 4UFIA 5C5YA 2E6YA 1ZALA 1K6AA 3UWWA 1JYXA 4PCFA 4LC6A 2F2HA 2HROA 1UA7A 2DSWA 4DB7A 4GE8A 3H2CA 3BLOA 4PRTA 6XIMA 4FR1A 4A2RA 3PY2A 3T2PA 4FXSA 2WHLA 2QGHA 5TNVA 5IFTA 1QOPA 5ABFB 2PWUA 3K1DA 1UZHA 4YIWA 3S5ZA 3N9RA 4DM2A 2AL2B 4IQLA 2FDSA 3H2OA 1F4HA 3DERA 1ZGDA 4CCZA 4LYKA 2V67A 4LVDA 1QAPA 4AHQA 3KBSA 5GQBA 3P74A 4XD5A 4U5KA 1V93A 4HMEA 3UWEA 3EX1A 1MVYA 2J8GA 3BQ6A 1M04A 1VIZA 2A5HA 2J6VA 1FVPA 1POKA 2ZX6A 2J6XA 3TR2A 1OVDA 3C0JA 3PPGA 3S6OA 4K38A 4HHLA 2HRWA 2J77A 3POHA 3NPXA 2AQVA 3NQMA 3QPYA 5G2HA 2NQLA 2KX9A 1EHAA 5F1UA 3OJGA 3BUVA 4F9JA 1Q6CA 1UUMA 3WX7A 3VIJA 4UTLA 4AC7C 3VOFA 5BCAA 3ZLGA 4DXXA 3UXLA 2DH2A 4GY7A 3N17A 5PTDA 4XKYA 6ENLA 4YWSA 1HP4A 4DBSA 2J7HA 5DY3A 3S1WA 1BXBA 4H9ZA 4JDBA 3J7HA 2ZCGA 4AX7A 3NL3A 3B9AA 3G0SA 3ALFA 2Z1KA 4QSHA 4KF1A 2WXDM 3GX9A 2QCFA 4AMCA 1E6QM 3SUTA 4K39A 3WZ0E 1NARA 4AUBA 3VDCA 2WW5A 4NZ1A 3UETA 3OZYA 6PTDA 1X1OA 5E1QA 1A5AA 1U2YA 3PBYA 4C6KA 4A21A 5DEZA 1OFQA 5T9CE 1Y5XA 5XIMA 3UY7A 3ANUA 3WDRA 2Z28A 1NP0A 2WQPA 1FWCC 2YL9A 4QG6A 3NJ3A 4K8GA 4PL2A 2IXVA 4C1KA 4JTDA 3IJLA 2A7RA 2C1HA 4DJFA 4PUUA 1UHVA 4Q4KA 3TIMA 4Q8TA 1LOQA 3RFAA 3FV9A 1BYAA 1DBTA 1GK8A 3CNYA 2EKCA 1Q5MA 4GCXA 3AYVA 4WQ6A 3W7IA 2F6XA 3G6LA 2OSXA 2WSKA 5IFPA 2D22A 5G1TA 2D23A 1Z69A 2V5KA 1UP3A 1WDPA 3S83A 4GUHA 1E0WA 4DO6A 3W7NA 3D46A 4C6OA 3TJ4A 6CGTA 1RVGA 3R2GA 1YDVA 4X3ZA 3ZSTA 3HZ3A 5K3VA 5FL1A 3UCQA 4MJZA 4MZ8A 4LEFA 1JI1A 1V6WA 3T0AA 5EBAA 3R11A 3UJEA 3C56A 3W7EA 2PDUA 1S2UA 5LNRA 3VIOA 1TPC1 2CU0A 1N8WA 2QNEA 3GXDA 3TP4A 1EJ7L 4CQ8A 1FCBA 3EB2A 3EB4A 3ONCA 1H7RA 2YA0A 4WHBA 3WH6A 1ZRQA 1OFAA 3GLCA 4V1XA 3C61A 4WDWA 3VZZA 1A5LC 3KDNA 3GZ3A 4WZHA 4DY1A 4I9TA 2YXXA 4DXKA 1V3KA 2XZ9A 3W82A 4BF7A 1PCWA 3M0HA 4G1NA 5DMYA 5FEZA 1L9WA 2Q71A 4B92A 4AVFA 1L8NA 4QBXA 1GOOA 3LPGA 3R5EA 3KRSA 3PZGA 4H6KA 4P7QA 4OE7A 1ZFJA 3N2CA 4RDVA 3WFZA 2WMIA 5LA2A 3LPOA 3TYUA 3VINA 2XGZA 3S2LA 2VDHA 3PZQA 3F4VA 4WRHA 1JZ7A 1XIIA 3CU2A 4G56A 4OOUA 2W6RA 2C6QA 1CYGA 2O92A 2RJGA 3PPFA 4UTTA 2Y8VA 1LBFA 3RM4A 1C8VA 1BQCA 3JVAA 4GFIA 1KW1A 1OT2A 5G4HC 3EOOA 3RGTA 3L4TA 3VC5A 3QF0A 1D7FA 2C18A 2B0MA 3UZWA 3BVJA 5FJRA 3UGRA 4XV0A 3WH8A 2OB3A 3GYCA 3C8NA 2OOFA 1FDZA 1PYMA 4E2BA 3JR2A 1TZZA 5LIWX 1K03A 2PRHA 2PI6A 4NKCA 3QPEA 3LGEA 1HKMA 4HYWA 1I2NA 4R34A 1EOMA 3TC3A 3GW3A 1B3WA 1V5XA 4G8TA 1I2QA 3KEHA 4HA3A 2FVMA 3W24A 4JTRA 2WMGA 4NZ5A 5A1AA 1B3XA 3OLEA 4DWSD 4ZB2A 3M0LA 3MSDA 1FWDC 4Z2KA 3WSUA 1DJYA 5EMJA 3RJYA 2ZC8A 3PBWA 3G1RA 3VGEA 5I79A 4G6CA 4XKMA 2DDXA 4QS5A 3BSMA 1JYNA 3U2EA 1FH7A 3TJIA 4Y9OA 5BNKA 3EPMA 4G5DA 2NQHA 1JZ8A 3N1AA 3O63A 1FWTA 2ISFA 3NGFA 3FHQA 4V2XA 4M82A 1LUCB 2HVOA 4HU3A 3O6AA 3ZR4A 3L21A 5A6KA 1ELSA 3CLWA 4XTIA 4DQWA 2GPTA 2DUXA 1QI0A 3C52A 1Z89A 2QQ6A 5KZDA 4GOAA 1W91A 3KP0A 4JYFA 1K9TA 1FH8A 2PGEA 1XIBA 3S6DA 1Q6FA 1AW1A 1PHWA 3WBWA 3L68A 2FGLA 4GX9A 4WXYA 4RXGA 4H2HA 1US0A 2PRMA 3R10A 1PTAA 5ECVA 1JZ3A 1IWBA 4E2OA 3CZKA 1XLMA 1AJ2A 8XIMA 1GTEA 3HU7A 4OBSA 4REQA 3DFOA 3OW1A 4JIQA 3DG7A 1XGZA 4UR8A 3OBKA 1HKKA 3WL1A 4UQEA 1TV3A 2D1ZA 4GY1A 1KA9F 3MDUA 2C0HA 4PMOA 1LQ2A 2VEPA 4PTXA 4MZYA 5AVHA 3QY6A 3CTTA 1B3YA 4GHRA 1EO7A 1XLGA 4HD5A 3QC0A 2KAUC 4NXKA 3S46A 3IIPA 4HNTA 2BGSA 3GWQA 4TMBA 1W5QA 4J7RA 2X0HA 3KL0A 4GINA 4XUYA 1ZJIA 4LT9A 2NSXA 5D09A 4HYVA 1Q6EA 2YW3A 2D2GA 1KB3A 3N6HA 2QCDB 3UR2A 1AH4A 2XWEA 2YBUA 4IM4A 4NRSA 4JICA 3WJXA 3TZNA 3VM5A 2O4MA 1VHCA 1XIEA 2WVUA 3F5JA 1M1BA 2FZDA 2WHKA 4X0NA 4EVZA 5K9XA 3E1F1 3W81A 1FHLA 2XSAA 3S5YA 2QMJA 2DH3A 3KL5A 1PBGA 2OMAA 4AEOA 1O95A 1TMLA 3AYRA 4CD8A 2DZVA 3ZQ9A 1KFEA 3OU8A 5TBOA 2GYIA 3MT1A 2O9OA 3B06A 3O7UA 1TX2A 5F2IA 1XRSA 2VFEA 4POCA 1HXJA 5AHFA 3FJNA 1KXVA 4LAZA 2Z25A 3WKZA 4GZ7A 2ISSA 4DELA 4C5YA 1E0VA 4JBRA 5AN7A 1VRDA 1UD5A 2ZZ1A 1LWHA 2BXYA 4J9JA 3CIWA 1W9XA 3ZOAA 4RNJA 4JIRA 1JFHA 4EF9A 1ISVA 4MUZA 5D9OA 5FJUA 1PKMA 1U1HA 2REQA 1PAMA 5ABHA 4X2PA 3L4WA 3AYSA 3TAOA 2GVGA 1C29A 2PTDA 5D8ZA 3SFWA 4IXHA 3VNJA 4DI8A 2WNWA 3CV2A 1OCQA 3T2QA 3D6NA 4XVDA 4DIAA 2YBVA 2E3ZA 2OKOA 4UMBA 2G96A 4IIHA 3BE7A 1KM2A 1I1WA 1UIPA 1G9HA 1TV7A 1HVQA 2J75A 4JFVA 1UR9A 1X38A 3KW3A 3NG3A 1O1HA 4C6IA 3CGTA 4IXXA 1KQYA 5HANA 2W0UA 5BW6A 4OHQA 4MY9A 4W87A 1DXIA 2EPOA 1XCWA 2PWEA 4WVXA 4RNIA 1HNYA 1YQ2A 2NWSA 2RHGA 2OOGA 3LSCA 2HE5A 1FCUA 4IHCA 5KEZA 2CC0A 5D2WA 3W1UA 1BWLA 4TVUA 1IZKA 3IAQA 3Q45A 2HDJA 1GQJA 2QCGA 3I6EA 1OX6A 1FWSA 4GYFA 4TX9A 2ISWA 5HJYA 4LUJA 3ARPA 3QLLA 1BAGA 4KERA 3RILA 4ZCWA 1KQZA 2CEQA 4E2DA 1TELA 4YL2A 3O6CA 3T05A 2ZDSA 4B3LA 3A22A 4QR6A 2V81A 2V2HA 4JTCA 3R0KA 5FKYA 1Y5WA 3CUIA 2YXGA 1G4PA 2BWGA 2YLAA 5FAJA 4GVGA 2ACQA 3W7RA 4ERGA 2F7FA 3CL6A 4CNOA 3TW9A 1J5TA 3RR4A 1V3HA 4L9XA 1GVFA 3WUGA 4E4PA 3FVDA 4Z2LA 3KOXA 4J35A 4AD2A 3E0IA 1NDWA 2NZLA 5E6YA 2X2YA 3WK1A 2FKPA 3LA4A 3NZQA 1TTQA 2ISDA 3R7MA 1FWEC 1OD0A 4XZIA 2I17A 3NDZA 1DQXA 3QZEA 3ZXWA 2DIJA 1H5VA 1RJQA 3ORWA 3W3OA 3AIUA 3H7VA 3ICJA 3LENA 3SRHA 2A3EA 3UG4A 4FP1A 3CZEA 3ABSA 1Z3NA 5M03A 1LWJA 4QNWA 4JTAA 3ITGA 3AO0A 1BYDA 3MS8A 1PXGA 3RLHA 5IBXA 4DBUA 3GH4A 1FP9A 2OWWA 2V3GA 2X8RA 4CCDA 3L4YA 3GB6A 3M1ZA 3KOWA 4LVAA 4J3XA 1FOBA 1JPHA 4AF0B 4P8WA 5LXEA 1UD6A 3IVUA 4O1DA 2G3NA 4DUOA 3EBVA 5EBUA 3H4WA 5CH9A 2P88A 3VNKA 4I7WA 1YKWA 1OK6A 4HNNA 1EGZA 3W02A 4UTFA 3IGSA 2VX5A 3DI0A 1KWKA 1L6FA 4AWUA 5E0KA 2BY0A 3BLKA 4XAPA 4C1LA 1RBAA 4AC1X 1Q6QA 1G69A 4LVFA 5M1TA 1LRTA 2OYLA 1LT8A 2HQAA 3HG2A 3B8SA 1IXNA 4ZO8A 3WL0A 4MKVA 4KEZA 1K8CA 3QJAA 1XC6A 1YEYA 4S2BA 4D72A 4JD4A 3QKEA 3WNLA 2NSOA 3HO8A 5GJPA 3VYLA 4L64A 3FYYA 4B90A 2NLYA 2Z6IA 1IEQA 3FGCB 1EDTA 4O4WA 5ABTA 3CPUA 3WLOA 2WC3A 2V5LA 1AQ0A 2Y7EA 3C2RA 5FF2A 2BY2A 3B0PA 2HZGA 3TC7A 5TQLA 2X0SA 2FZ9A 3STGA 2WYSA 1XL9A 3O6DA 5HR7A 4GYKA 3VIKA 2CITA 2Q01A 5BRPA 1SSGA 3DH7A 2HK1A 5A6AA 3ZJKA 3I3DA 3AZTA 4MB5A 2XM2A 3WLMA 1ZS2A 4AVOA 1EF2A 2GOKA 4IQJA 4QX4A 2ZZ5A 1Q2SA 4H8HA 4F8XA 4E8GA 1ZQ5A 1R9ZA 2ATSA 3W88A 3N4AA 3E9AA 4E4UA 4C91A 1DYSA 4ATDA 5FF0A 3QGVA 3KVMA 4DJEA 3DFNA 5I07A 1NELA 1VJIA 5CAKA 1CENA 1HFBA 5D30A 3NQGA 4JQ2A 1P0BA 1W3KA 3BTNA 4V27A 4JKKA 3QN3A 4GC4A 1MZHA 2NT1A 1DJIA 3SUWA 3VGBA 4OOZA 4IFKA 4MG4A 3AIEA 4H7VA 4C5ZA 1ME9A 4WKFA 3U48A 3O1NA 2PC8A 2DJLA 1OGSA 4ROPA 3AHZA 4NJJA 3V5CA 4WXZA 3W70A 3M07A 4XO6A 1MEHA 3NIYA 4AMAA 4Z1AA 1B30A 4W93A 1TQXA 4QQ3A 3NVDA 5HNRA 3T44A 2XN2A 2GVEA 5C6MA 4LY4A 1TVNA 2OJPA 1VPQA 4LNYA 4PBGA 3QOKA 4O0QA 3FHAA 1IYXA 2VDGA 4MFDA 3BZJA 3VM7A 1A3WA 1E4MM 1QNPA 1MRQA 3A12A 4IMCA 1DEDA 3R58A 5AOUA 4YPJA 1XKJA 1EKOA 4QG9A 1EUAA 2PDFA 2CPUA 2P76A 1F5ZA 4LUSB 3O0KA 4CQDA 2QULA 1N8IA 5U4NA 3LGGA 4I7VA 1QDSA 1JL8A 5IHSA 3TONA 3W6MA 4A05A 1W9BM 5DMNA 3FAXA 3U5UA 4C6QA 3T0DA 2CZ5A 3B0VC 1OCJA 1VYRA 3MUIA 3NWRA 3W72A 3E6EA 5LNVA 1BXNA 1PIIA 4C6NA 5C9ZA 5KITA 1W6TA 1M6JA 3FS2A 3CK5A 4C6DA 2G3JA 3TSBA 1AG1O 1FY6A 4KH2A 3MA8A 1J8VA 3TN3A 5AHEA 2HBXA 3A23A 1KO0A 4EE9A 2HS6A 2XVPA 3AXIA 2D24A 4QRNA 3GSMA 3KVJA 3FJ4A 1JQXA 5CG7A 1U83A 3VNYA 5AC6A 3WBEA 1C90A 5BU9A 3PC0A 3LN3A 4IMGA 3T42A 3F4CA 4YVVA 4DI9A 3C2OA 4UMAA 2BS9A 2BSLA 1A49A 4RLIA 1QT1A 3OA3A 1AQMA 3VMNA 4GFSA 1XD1A 2D73A 1ISZA 4AB4A 3GHTA 4NAEB 2AKZA 1F3XA 1E3XA 2QJHA 4CN6A 2VRJA 3LHZA 1GYNA 3AHTA 4FNQA 3EGJA 4TVDA 3FDKA 2VM8A 1XW8A 4FA3A 2F84A 4XB3A 1UP0A 3WQ4A 5A8NA 1IQ8A 2QUNA 3GXPA 3VE9A 3DFHA 4QJ3B 4DRSA 4EAMA 1TTIA 4N9DA 1A5KC 2VOMA 2GVJA 3LQLA 4XO7A 3T1GA 3LOTA 1XR2A 2A4AA 1KRMA 5C71A 3EX2A 4B91A 3PANA 4MAVA 5FESA 3IV8A 1ONEA 3KCOA 3W2UA 3UG3A 1CXIA 5I78A 1UWAA 3BDKA 1XLBA 1H49A 1FX6A 3QR0A 3XISA 1WAUA 3AU2A 1QWGA 2EG6A 4F0KA 4Y7EA 3STPA 1BGGA 2YPIA 5A8OA 3RCMA 2OEKA 3GBDA 2YR1A 1AW2A 3RLGA 5TF0A 2Q8ZA 3BLPX 3DFPA 2DT1A 4UCGA 4WIWA 2I57A 4X9YA 2DZXA 3SGZA 3PZOA 5I6SA 3NSXA 4JX6A 1UOZA 4NZ4A 3AXMA 2DQXA 3OHIA 4M7TA 3CEUA 3M43A 3EWCA 1IE7C 3CLMA 5F2MA 1IXOA 1OZQA 3VIIA 2VX4A 2JBMA 1XG3A 1ZP4A 1W9VA 4I7UA 1WPCA 4ICMA 3MKCA 3MW7A 2DSVA 4N9CA 4AU0A 2EJ1A 4HOWA 4I6VA 2R6OA 1WZKA 4HSHA 3TMLA 4DZAA 2GLKA 1GYLA 1AZ2A 3PG8A 1PWLA 5H8PA 2QGYA 3F2DA 3ABQA 2ICSA 1O5XA 3EWZA 3WBAA 3PBGA 4UTJA 2EXOA 3NL6A 3H24A 4MM1A 8TIMA 1E0XA 5DMMA 1UZ4A 4S39A 3U8GA 2ZUNA 4I9AA 3LHVA 1T0OA 1A5NC 4FNTA 3W85A 2V3FA 4GUJA 2WVVA 3BAIA 5CSUA 3PB2A 3KBJA 5K9DA 1SJBA 1Q6RA 4FB7A 3U7VA 2CLHA 4UC5A 2B7PA 1LYXA 1XYFA 4JIEA 3QGKC 1VH7A 1TZ7A 2I5GA 5GVJA 3W83A 2A3AA 2VMFA 4O0ZA 1KTNA 3SCNA 4S23A 3TQ0A 4Q33A 1CGWA 1RQBA 4P8XA 1YBQB 3LHYA 5HPOA 2ZRXA 4WX2A 3ARTA 3AMKA 3EZ4A 4P7NA 2I5QA 2F38A 4S3JA 4WY0F 4DJFD 1Z41A 1PZ3A 1OFEA 3IIOA 5E5CA 5H6HA 2UY5A 1TJ2A 3DECA 3UT0A 1ZBCA 3TSDA 3SQLA 3ARXA 4L56A 4IX2A 4L7ZA 1M7JA 3NYDA 2QCHA 4AXKA 4XD4A 2PTYA 1QI4A 4H3DA 2DUZA 1SR0A 3A21A 3UA3A 1WA3A 3A9BA 1Q13A 1T7LA 1H7XA 4AG0A 3VCCA 2NV2A 3BV4A 1PDZA 1YDOA 2Y7FA 3KVKA 1IZJA 3DEQA 1N7KA 3LEPA 5BOOA 3LPFA 5E9AA 4J3UA 4UNKA 4DWDA 3LXAA 3I6RA 3Q58A 4PRRA 4IZGA 1Z44A 2Q02A 3KBNA 2E77A 4ZO6A 1V3IA 1H0IA 2NQ9A 3LV6A 2BY1A 3AROA 2V6AA 2DJXA 4PYSA 3STEA 4JN7A 4K68A 1KFJA 3APGA 4NRRA 3WQ6A 4S3AA 5FACA 4U33A 4ZA0A 3OOQA 1IT0A 2V5CA 4WOQA 1OF6A 3T0BA 1DJQA 3P67A 2MANA 9CGTA 2BOEX 3UZ5A 2CERA 4CQAA 3WIJA 4GYPC 2OGYA 2PDMA 3CAKA 1PKLA 1XCFA 2XFFA 3UXDA 3S4TA 1JR1A 4NNAA 1YIXA 1ZBKA 4O19A 3FA3A 3QYQA 3PBVA 3AIBA 4Z2JA 4MF4A 1KBJA 3NZPA 5CCZA 3YPIA 3TN6A 3QSTA 5DRIA 2ACUA 4BCEA 1SFJA 4LW7A 2WOQA 4AH7A 2ZZ7A 3TQPA 3M0MA 1ME7A 1XFBA 3K4WA 1D3GA 1CZ1A 3GDMA 3EAUA 3O06A 1WBHA 3CC1A 3URBA 3WBXA 2BODX 1FHUA 2WV8A 1VJZA 2QVNA 1XX1A 4JN6A 1SW0A 1TG7A 1V0MA 3APTA 2YOCA 2NT0A 1E6PA 1H5YA 5J5RA 3VD5A 4KCUA 4B9YA 3CAWA 1WO2A 3SZ8A 1JDAA 4HPGA 2Z7KA 2FHCA 4WY0B 4YWIA 3QY8A 4U3CA 2HWGA 2G3IA 3MU7A 1H7PA 3W1QA 2PU1A 3OGRA 3WUFA 1WDDA 4QQUA 1QK0A 1PV8A 3IJ9A 4YYFA 1P1MA 1WKEA 4GIAA 1F6YA 5HR6A 5CJ5A 2OODA 4O52A 5JBEA 1PWMA 3LMYA 4B5NA 5E6ZA 1Z8AA 4FOKA 1OFBA 2PZ0A 1CLKA 2YCJA 3N25A 3MP3A 3EA2A 4HTBA 1XRTA 1K4HA 1HJVA 4A8IA 1W9PA 1SFSA 4IPJA 3RX4A 3ZZ1A 3UZZA 4TO8A 4TXEA 2J8TA 4M6QA 1W37A 4A2SA 1UWSA 1A4MA 3HQNA 3VOGA 1DL3A 2NV1A 3EDDA 4PTVA 4AAJA 4C1NB 4AIUA 2UV8G 4C60A 4I8DA 3VVGA 4B3ZA 4DO5A 3MUXA 3ZT5A 3AXHA 3N2OA 3MJYA 1VP5A 4N6FA 2GQ3A 4DPPA 1ONXA 1J6OA 5FJIA 3OVGA 5HATA 1N2VA 3GXMA 2YX0A 3FEQA 4LANA 4OV4A 2DORA 1H7OA 1IHIA 2H9AA 2QCCA 1NFBA 4K1WA 1QNSA 1H50A 1TCDA 3H8AA 3MUCA 1BYCA 4HCLA 2QXWA 4D71A 4HJFA 3URQA 2A6NA 5B7YA 3FDGA 1UWTA 3K1GA 1RLCL 4GZEA 1IR1A 2X1TA 4C6LA 3KHJA 4M24A 4AZ7A 1XUZA 1BVWA 3D3AA 3SECA 1QU4A 3WJSA 4I6KA 2JQXA 2E6AA 3S1VA 1MEIA 2AL2A 3EX6A 5C2CA 4UQCA 3H53A 2IPGA 4IP4A 3NM1A 3PB0A 1RXOB 2WWDA 1OT1A 4KS0A 4H1ZA 4HK7A 2GJNA 3S2CA 1KFCA 4FLOA 4HGXA 5IM51 1H7WA 4P7OA 2NX1A 1OCBA 2V8ZA 4IMFA 1ZTVA 3UWQA 4DZIA 3LGDA 5MF5A 1J6PA 3FX4A 5D38A 1J10A 3C3UA 3VD7A 1ZAHA 4W4QA 2I1OA 4O53A 1B4EA 3A24A 2CWNA 3TYDA 1RAKA 2E67A 5BU6A 1G4SA 4CD6A 2ZRZA 3SCTA 5DFAA 3N18A 2J9ZA 3UJSA 1YE4A 4ZQRA 3VK5A 3QV9A 3LHTA 3TVAA 2OZ3A 2XZ7A 3KRZA 1HG3A 4MJMA 3GFXA 4H4IA 2ZOXA 3FK4A 4RNFA 3TROA 1GOKA 3A5VA 2O9PA 3B8TA 5FEWA 3ECQA 2PLKA 2EHHA 2MNRA 1ISXA 1XH2A 1TWIA 5U7SA 3TTSA 4B9ZA 1GPWA 1XLDA 4ZE4A 1XWYA 5E93A 5J8LA 4AFYA 3S6TA 5EY5A 3SGUA 1EZ2A 4RPQA 3A3WA 1FKXA 3SCRA 1F2JA 4REQB 3XINA 4LX4A 3TZFA 1EJVC 1C9DA 4JTFA 4PUNA 3VPLA 2WKJA 3K5XA 1ITUA 3I3EA 3P0WA 4D8ZA 3NURA 2CZDA 4PH6A 2YFOA 1E5JA 1TV8A 1EPXA 4ICNA 3VUSA 1IWPA 5D37A 4UTKA 2JE8A 3QZ6A 4HNVA 2QCEA 4HIBA 3G1XA 3UQNA 2TMDA 1UWIA 4PEKA 1Q8JA 1WBJA 3M0IA 3NA8A 5HNUA 4PMRA 2WHMA 1C91A 4A29A 1E4NA 4JQ3A 3BSGA 1E72M 1X96A 2PC4A 4JR5A 3ITVA 3TDFA 4YTRA 1XFCA 4HNLA 2ZZ6A 3MV01 3LZ3A 2O56A 2WCAA 5FAGA 1OJXA 4Z1YA 2HVMA 5SWUA 4QFUA 2VC7A 2AGTA 1HKIA 1HJXA 1W5MA 2WM0A 4GI6A 3T2OA 4LSBA 4GXMA 1MNZA 2ZVIA 2D69A 1ZCCA 4PCNA 1I4NA 5FJJA 3NO1A 3BZGA 1DOSA 1GZGA 4GD0A 2OGJA 3UR5A 3G6MA 3V75A 1J2BA 3P2VA 1JXKA 3GFZA 3Q4DA 3VGGA 1MI3A 3ARYA 3ITOA 3OQEA 3QXBA 4HMCA 1H3GA 3T6CA 5FJTA 1B90A 1NDVA 5BRBA 2ZUTA 3TWBA 2PDBA 4C65A 4LUTA 1PO9A 4AY8A 1KR0A 4GXPA 4ATLA 1KM5A 2W27A 3AZRA 3PULA 2FJKA 4GUGA 3R89A 3AHYA 3TNOA 3CV6A 2EQDA 2YYTA 1C8XA 4EXBA 3L2IA 1MQQA 4PB3A 2BY3A 1KTBA 5AKQA 4W84A 4PFMA 4XZWA 2VR4A 4J3WA 2OWCA 4J40A 1KM1A 1YYAA 2HEJA 1WKFA 5AVNA 1OFPA 4NZFA 4CN1A 2X40A 4YTSA 3SGGA 2REQB 3C2YA 5LYRA 3IGXA 1MXGA 1VC4A 4G7FA 3PS7A 3F5LA 1OADA 1Q6LA 1ZNNA 1SR9A 3ZT6A 4GQRA 4M7SA 5KZ6A 1KGUA 3HGJA 1XSKA 3JS3A 4FSAA 4AYGA 4V33A 2A3HA 4KPLA 2VFDA 1NP2A 4J3VA 3GH7A 3NPUA 4GRSA 4ZQOA 1ADOA 3P60A 3LCWA 3RF9A 4HP5A 3LLXA 3EEZA 4ZEPA 5HOSA 4E8DA 4HPHA 5I0DA 1HJQA 2DU2A 1UR0A 3PJUA 3AHXA 4Y9AA 2PP1A 4JTUA 1PZ0A 3B97A 4ZSTA 2GUBA 3NSNA 4DXVA 3CWHA 4AQLA 1K4GA 1M7XA 2I16A 4LOCA 4KGJA 4MNJA 2VJXA 4X9SA 3M7WA 1JPKA 3WD0A 4UTMA 4NY2A 4LVBA 4FZIA 2RKXA 4UQAA 1TPWA 3W00A 3N11A 4FNUA 4WJEA 4K1GA 2XVNA 2PUZA 3II1A 4AY1A 5JU6A 3E5PA 4HSNA 1XISA 4O14A 2PDYA 1TJ1A 2NQJA 5HNNA 5FF3A 1A5SA 2IXUA 5DMLA 1D8WA 2Q3RA 4N2YA 1U5JA 4MGGA 2RDUA 3WDPP 1J5SA 1KCZA 4PBFA 4TQTA 4FEZA 1J01A 1DQUA 3B4UA 3EWWA 2WZIA 1GOWA 3AIRA 1U5VA 1GOQA 1TE6A 3LMZA 1R47A 2HNEA 1RPXA 2CBVA 1FP8A 1LUCA 1BHGA 3WEOA 4DM1A 1RVKA 3W1LA 2YW4A 3GIQA 1O68A 4NZ3A 1AQFA 5I00A 3W2LA 2ZZ3A 1Y7VA 1V6VA 3SCVA 3NEHA 3N2MA 4GMEA 4JXCA 1HJSA 3QLDA 2ZUMA 1VYSX 3QMRA 5BROA 1GOMA 1ZP3A 1I9CB 4IPNB 4ECLA 4O18A 3H2MA 1JIBA 3NQAA 1CI1A 4CU6A 2P8CA 1UD8A 4LWWA 3PVFA 1T99A 1MEWA 4K8HA 4JS3A 3R8RA 2EJAA 3GD6A 2E6DA 3EA3A 4YLWA 3VGDA 3RMEA 1A5CA 3JZEA 5G1YA 1W8GA 1Q4NX 3H55A 4PE8A 4DBDA 3VDBA 2JALA 2Z00A 4FF7A 3VCNA 4XTDA 1LLWA 1H11A 3W07A 4X0VA 4DJED 1ITCA 3UGVA 3DAQA 3ZJ6A 4CNPA 3UG8A 3TTOA 4MLJA 1DJWA 1JG9A 1B9BA 2JF7A 4YS1A 3N34A 2QV4A 4HMNA 2NX3A 2QW5A 5HQLA 5IHRA 4X61A 4UFJA 2V2DA 3IJIA 2GQ8A 1WOAA 2NLIA 1G0CA 1OHLA 4WK9A 4HMDA 1EX5A 2GWNA 4AWTA 1ZU8A 2GUUA 4UR7A 3CHEA 3W7KA 4UTWC 1SZNA 3B40A 2OLAA 3THCA 3V0UA 4LALA 3E12A 4LS0A 3FY1A 3KP1A 3HM7A 1BKHA 2Z26A 5DANA 2J79A 2W66A 3B04A 4O10A 5JIWA 1XCXA 5DELA 5AHIA 3S5SA 5JBDA 5I23A 4H9MA 2G95A 1V7YA 4U3AA 1SUXA 3T55A 2XH0A 1IIHA 4ML4A 3WMCA 1V02A 4KMQA 1V02E 1UROA 1TB3A 4KWUA 5HMEA 3HG4A 2FPVA 3CV1A 1PIGA 1NWSA 4H6EA 1UOKA 4GQQA 3SJ3A 3BPWA 3WDIA 5JXQA 5CZTA 3EA1A 3M4HA 3WD3A 2EAWA 3E0VA 2E1DA 3LZ5A 2L5HA 1RPKA 3OQ8A 2JK2A 3A47A 3MVIA 3GNOA 5T91A 3ARUA 1UR1A 2OYKA 2PWHA 1KV5A 1PB0A 3C4UA 5F1VA 2VEFA 4AZ5A 4Z2IA 3BL3A 3KDOA 4OV9A 3URAA 3ZVHB 1F61A 1K3UA 4YCPA 1B31A 3T8QA 2J4GA 1EXBA 4H7CA 1KCXA 2WSQA 4B3KA 4CKQA 3GU2A 5BWAA 2X30A 4TUFA 1WZAA 2H3DA 4QE1A 3VDHA 4HT3A 2ZBTA 3CQKA 1RD6A 4CVUA 1FBAA 5CBBA 1S46A 2PWGA 3GDTA 4XWUA 1K8YA 4IIDA 4W88A 2X2GA 2AMGA 2Q8XA 1GONA 4HNOA 3PR2A 4MDOA 3V1PA 2E5DA 2X05A 2OELA 1K77A 3PFRA 3AMCA 3M0XA 3WMLA 1UQYA 1JYVA 3S1GA 3GE7A 5AYZA 3RRAA 4LF2A 2R1MA 4TX8A 2IPWA 1POJA 1M68A 4NAFB 1EJUC 2POTA 2VZSA 2EO7A 4FI4A 5A69A 2CZEA 3TH6A 3TLQA 1UB3A 4R7OA 4IQDA 4GQGA 2QS8A 3L23A 4IMEA 5EGRA 3RK8A 5C55A 2W3ZA 3M47A 3FA5A 4AEFA 3HPSA 2G97A 4Q4MA 4EWND 1XQKA 4NILA 1Q2RA 2DZPA 5D32A 1V77A 2FZMA 4PUMA 3KHDA 3V3WA 3MTWA 3R8GA 3VZYA 2RGLA 1JZ5A 5CZSA 3FEMA 2R94A 3RYSA 4LV9A 1AVAA 1MFVA 1QPRA 2H8ZA 5GNZA 4RDWA 2WNZA 3H21A 4NUWA 4WDXA 1JDEA 5CLWA 3MJMA 2WMFA 4NIRA 3G3DA 1C7SA 4LTSA 4Q7IA 4ONVA 3G1SA 1MNSA 3M16A 1LP6A 3MVTA 3GKAA 3T08A 3TXZA 4JYDA 2QAFA 1IEXA 4M51A 1TPH1 2XFRA 2IPFA 4AEEA 4BI5A 3GVWA 1AK5A 1IEIA 3TN5A 4HZMA 4LY8A 3SJNA 3NDOA 3TX9A 1EUNA 2WSRA 4Z0JA 1V08A 2BGQA 3G0XA 3GQYA 2O7SA 2ZWYA 3GYEA 2WCGA 1QNRA 1B0IA 2PCEA 4PMYA 2AOSA 3L4ZA 4H7ZA 4O15A 1ZSXA 4HA4A 4EP8C 1XXXA 3N14A 2EG8A 2PDJA 3AYTA 3LDVA 1XPYA 2G4FA 4UXDA 4LJ3A 9XIMA 1BF2A 3LERA 1NFGA 1DQWA 1GWJA 3H2FA 5F4XA 3K2GA 2C15A 4MNLA 5BMWA 3G24A 1XLHA 1EDQA 1FWNA 3NQEA 1RJPA 5LZLA 3TTEA 1RLDA 1SZEA 4H6QA 5AFDA 1RA0A 3BK0A 2A1YA 2J24A 4LCQA 4ZO7A 4L6OA 4C7DA 1BSIA 3W1MA 1ICPA 4J3TA 3MZ2A 3P3BA 3F4NA 4YTUA 2OO0A 2VGBA 5E0CA 2CKRA 2OVLA 3VGHA 4QLKA 1K6WA 5FEPA 4PC8A 3V1HA 1FQ0A 2HTMA 3BAJA 2ZUSA 1ADDA 2P0OA 3WNMA 4J2PA 3WQFA 3WNOA 3L9CA 3WLHA 2I5IA 3C6CA 4QCFA 4UOQA 3KM8A 3N2XA 1HVXA 4IGHA 1XBXA 3O6YX 5L9FA 1JCLA 2GL5A 4UB9A 1VPYA 1R9YA 4YTTA 1MDLA 5G2IA 3NQVA 3TUUA 2Z2AA 3QPZA 4YHGA 3WEMA 1NF7A 3LM3A 1SO3A 3Q94A 1KGXA 3GXFA 3EDKA 4L5ZA 1K8XA 3U2OA 3ISIX 1RQHA 4NJHA 2C1GA 5REQB 3WUBA 1X6UA 1BFNA 5TIMA 1JQVA 1OG0A 3FIGA 3RCNA 2Y4SA 3E0WA 4IUOA 2BTMA 2JIEA 2GDQA 2A3CA 5CGQA 1RCOB 3VMPA 4AXNA 2GGIA 1FUYA 1VLWA 1EQPA 2HE8A 4MJ2A 4AISA 2BVWA 2VGFA 3NPVA 2AAMA 1WE5A 3H4XA 1NM9A 4JYEA 3W1PA 5KINA 4KT2A 3ELFA 4QISA 3PK7A 1WXJA 1A5BA 4ZGYA 1ADSA 1XIDA 2D0GA 5CPTA 3LBCA 4HU4A 2FH6A 2B4GA 5HA7A 4LF1A 3VX0A 2E9LA 1P6WA 1NJJA 2E68A 4JTEA 1FCVA 3FSUA 1WYIA 4DLMA 3WJYA 3S1XA 5LGZA 4LUSA 1WZLA 1GQNA 4X63A 5C2GA 2V69A 4UWMA 1I60A 3WYZA 2G5WA 1WKYA 1Q6OA 2DVXA 3P61A 4IIGA 4GI9A 4U2YA 3GG7A 1VF8A 1UCWA 4S3FA 4UTUA 5F7UA 2I9UA 2FHFA 2PGRA 3LS9A 4DO7A 2WKLA 1PCKA 3G1FA 2Y70A 4DNMA 1XBYA 3N29A 2GGJA 1DWIM 2H90A 4Z2HA 1OD8A 1QXLA 3QMTA 3CJPA 3RU6A 1UPPA 1DXFA 2WSPA 2FYMA 1SJAA 1DIDA 3THQA 2JFEX 4O1FA 2I14A 1P43A 3CASA 1FFRA 5DN1A 4L9YA 4LBSA 1XP3A 4DZ5A 1ALDA 3CB3A 3EYPA 3CAVA 4EPKA 4MUPA 4MDPA 3I6TA 2D3LA 4Z2GA 3W73A 5JH2A 1LBLA 2OT0A 4HPXA 2GQAA 3P82A 3E2QA 1IT8A 2Y0FA 2R1PA 1E43A 1YXDA 1W3TA 3TEVA 1TWDA 3GXTA 4LUYA 4GUFA 4CQCA 4O8AA 2Y2WA 3F4DA 1TZ9A 1GORA 4XBSA 3MBDA 3S5OA 1EP2A 4K8EA 2BVDA 2VTFA 1CBGA 4LH8A 3WH5A 3K4DA 3DFQA 1LZOA 1E6ZA 5LIXX 3ABRA 4MKSA 3LTYA 1X8FA 2J7GA 3OPSA 3TYEA 2HSAA 4KBXA 4HPJA 1UKPA 3IJ8A 2AAAA 2BZNA 4GNKB 3GKFA 1UR8A 5CGTA 3LTSA 4XK2A 3KS6A 3OGSA 1V0NA 3V16A 1AA1B 4ES4A 3NOYA 3SCOA 1R86A 4ZBCA 4J4KA 1I2PA 2PD9A 4Q8PA 3FVMA 1GT8A 3MCOA 1HF6A 4IIEA 1MW1A 2PF0A 3VU2A 1F8MA 2PDHA 3EMCA 2HV5A 4AIEA 5GPRA 2GVYA 1OFRA 1JNDA 1HKWA 1TIWA 2WLYA 1H7NA 1VIWA 4PSPA 2CXGA 2I56A 3AIVA 1ZB5A 4A3HA 3GTFA 1ZPTA 4N4QA 2YYUA 4YVXA 4R7WA 5A94A 4RZ4A 3SEPA 3BW4A 2ZRWA 1A5MC 2OXNA 3AUOA 1XKYA 2XG9A 2RUSA 3IIVA 3MUZ1 4CD5A 1UKTA 2YIHA 4KFNA 5AHNA 1XLKA 1G67A 4NHVA 3IJ7A 2G41A 4YYCA 1B3ZA 2VRKA 2E7FA 1F3TA 4H2CA 4A3RA 3TK7A 1TA3A 1DJNA 1OWQA 4DEFA 4CNUA 4ZQPA 1YADA 3TTYA 5I3DA 3FOKA 2FPYA 5DCDA 1GJWA 2VGGA 4RW3A 4F2BA 1GOXA 3QHNA 2DP3A 1WKDA 1V3MA 3KZSA 3UY8A 5A8PA 1EB3A 1UUOA 3T4WA 2ADAA 1B9ZA 4DF0A 3QW3A 4XBKA 4MOZA 2WVSA 1TTJA 1P5BA 4L4OA 1VS1A 5EL1A 3S9YA 3PNZA 3RLVA 4HCDA 3MHGA 4DPQA 4FNPA 3CIVA 3EKZA 3BMVA 1EYWA 1FWAC 1HJUA 5BOEA 3DX5A 1FH9A 5GJNA 2YL6A 3L0GA 2ZC1A 5DO8A 2B31A 2PDKA 4TIMA 3LXCA 5H91A 1N82A 3IJDA 3HV8A 4DLFA 5C9RA 1S2AA 2Z7GA 1HX0A 3PWGA 1H2JA 1YE6A 1RK6A 4UIOA 5I3JA 1UMLA 3THDA 4S38A 3RO8A 2PLMA 1LL4A 1AFSA 1O5RA 2FTWA 4DYKA 4ERIA 4AYSA 4QJ4B 4IQEA 5FF4A 1YBQA 4FALA 1S38A 2JEPA 4XZ9A 4GVFA 4GKTA 4NI8A 5HK4A 4DUVA 3VTRA 4BR1A 3W2MA 3QV7A 4Q7NA 4AZHA 1EC9A 3OZOA 3WMSA 1QASA 2DV0A 2PLJA 3CBWA 3DHFA 4KCTA 1LLOA 3QHMA 1YW1A 3L5LA 4B5VA 3PUGA 3AS2A 3MCNA 2BX7A 3QR1A 4GGHA 4JTTA 4JHOA 4IL2A 4U2ZA 2QJMA 4LRTA 1ECEA 4DBEA 1RY0A 1EP3A 1JUBA 3DG3A 4G1KA 1JI2A 4ORIA 4XVEA 1DV7A 5CZKA 4HVXA 3RJXA 4RUBA 4TV6A 2D2JA 5F4SA 2BP1A 1FHVA 5I3HA 2VR5A 3QH2A 3E02A 2Q8LA 1UP2A 4CQ9A 1JZ4A 4ZMGA 1SU5A 1J96A 2NWRA 3P8JA 4KQNA 1BYBA 2Q09A 1U22A 1GVIA 2R8WA 1EDGA 1FWFC 1QUMA 3W7PA 1S5WA 4RKAA 4E2VA 5E70A 3H54A 3C0LA 2DZBA 4LC8A 1J0IA 4P7RA 4FK9A 2HJPA 2UY2A 4IL0A 1V0KA 1GTHA 7TIMA 3U5YA 3GU9A 4YJ5A 1DJHA 1UASA 3GBEA 4A6GA 4W5UA 1X7FA 3QSRA 3UPMA 4N7QA 1FWIC 1TJPA 4JTKA 4HNUA 2QIIA 3QQWA 3G3MA 2QJIA 3AWOA 2OSWA 4IISA 3OYZA 2FFIA 3RMJA 4Q8OA 1ENUA 1E6NA 4JZ5A 3P81A 5LIYX 4EOUA 2WHJA 5I7GA 3N4EA 1OZMA 2VUNA 1R3QA 3FJ6A 3I7QA 1T6MA 3CB8A 1E1CA 2RGMA 1VGAA 4JY8A 4DF1A 1XJBA 3QEZA 4O12A 1TPB1 3V35A 3VDGA 1BGAA 4UBPC 1GVRA 1VBUA 2WJZA 2XGBA 1PTDA 3RG6A 2GK1B 3RIKA 4B5UA 3IANA 3FLUA 3NOEA 3SUSA 1GG1A 1VB9A 2BMBA 4WY0A 5HBFA 1ZBWA 5HWMA 2ZRYA 3BGJA 1OG6A 3BG5A 3AOFA 1E70M 5GNYA 2XTKA 4WKAA 3SCQA 2EF9A 4LUTB 1VD6A 1E71M 1XYLA 3BAXA 1TFVA 1LQAA 2XYLA 1E9IA 2BB0A 1KFLA 2J74A 1XSJA 2SFPA 3MANA 4K2SA 3BMWA 3V5OA 3KCJA 5CPNA 1NWTA 1X8CA 3AMGA 1KBBA 1U30A 5DXXA 2Z6JA 4Y9PA 3DBPA 1TYGA 4UTIA 2VZUA 5A2BA 4Q4OA 1GHRA 3R1ZA 2BXZA 5CG0A 1MSSA 4KCWA 1NH6A 2J7FA 3GW0A 6REQB 1KBLA 1F6KA 3ZT7A 3NFUA 1ZZMA 2C3ZA 1CTNA 3UPWA 3WF3A 4MWAC 4C1NA 3EWBX 4ALDA 1D2KA 4W8AA 3HG3A 4R9XA 3CWOX 3CM4A 5BXTA 5F2LA 1UWQA 2NXIA 1ESWA 5C7HA 3ITXA 3NZGA 2WK2A 4O28A 2QPSA 3UZYA 3PPCA 5LNUA 1QOQA 4NZJA 4JX5A 1GVEA 2QR6A 1VFOA 2XPKA 4A8NA 3H6OA 3IJ6A 4GI4A 1Q7QA 4KWOA 1DIEA 4L80A 3AI0A 4EXQA 4O1EA 1XLFA 2ACRA 4IX0A 3MB9A 1TUFA 4QAWA 4D8LA 3OB8A 2Y62A 3VC6A 4XZNX 3WF4A 2C16A 4ATWA 4ZOCA 1SVDA 4N02A 1JULA 3IVTA 1MW0A 2UY4A 3UERA 1F07A 3CHCA 4PTDA 4BI6A 1R30A 1W3IA 2IPJA 4R3UA 5E0FA 2DGAA 3IV3A 1XLCA 3UF9A 4ZL1A 1KM0A 1E51A 3Q67A 4DJDC 3TQVA 4QM1A 3OA5A 3GVRA 3VNLA 1W1TA 2EPMX 1HGYA 2WZEA 4GO8A 2YA1A 3CO4A 1UC5A 3W7GA 4D6GA 5FCZA 1R6WA 1BD0A 5JIPA 2OZ0A 2A2IA 1FFQA 3WJZA 1D7KA 5HUPA 4JDYA 3SBFA 2TSYA 3TXVA 1CPUA 2D0FA 4PRWA 3BW2A 3P80A 3T40A 2E5BA 3PNUA 2EPHA 4R9OA 4NG3A 3RR1A 1MMFA 1GZ1A 3GDKA 3W2NA 2A3BA 1YPIA 3I7RA 3HJEA 2E09A 5BYWA 1JD9A 3GH5A 4DN1A 1V6YA 1EBHA 3VIGA 3BWWA 1MW3A 3EXTA 1QR7A 1D3HA 3WUEA 3LB0A 2D2HA 2J7EA 3ANYA 1RY8A 4WEVX 3ZVIA 2C8NA 1PJ9A 1HIZA 2C14A 3TA6A 3EDFA 2FMNA 4JNMA 1L2UA 4FMVA 3WQ5A 3VIPA 4YXGA 4H8VA 4JOMA 3WK3A 1JRBA 3DZ1A 3W84A 4GZIA 3LPPA 3S1UA 3BLIA 4NQ1A 1I0DA 1RZMA 3SIZA 3WF1A 4M6PA 3TW7A 3SAZA 3VKJA 3H2NA 5BWFA 3FKRA 1EWEA 5DF0A 3S42A 3LV5A 3KLKA 5D2YA 1XICA 4B4HA 2D0HA 2INEA 3I3BA 3SRDA 3L65A 2Y1HA 4OECA 2ZDRA 3ARWA 2POZA 3VKDA 5EPDA 2Y5JA 3SUUA 3E5BA 3W38A 5A3HA 1MUMA 3UNTA 4H8NA 3PZ9A 1FCQA 3WLJA 1X7IA 4PB5A 1SMDA 4BQ4A 2DVUA 2CKSA 3INPA 5LHFA 1KLZA 4Q8UA 2VURA 3HPZA 4OUEA 4QJ5B 3M9YA 2QAPA 1GKPA 1DE5A 1P0EA 3WLLA 2PBGA 4E0CA 3P7YA 4QGCA 3E49A 3SN0A 3CV7A 3CPGA 2E1WA 1IR2A 3SN1A 1E15A 4H9YA 3GIPA 3IARA 3UU0A 1BKSA 3IVSA 3CL8A 1J93A 3NDYA 4Q4SA 1KBKA 2Z4GA 3R94A 1XQLA 4AD0A 3P0XA 2ZX5A 2Y61A 2H8XA 2PZNA 1M9HA 4JKMA 2YB4A 4DF2A 2PF8A 4PUWA 1TIMA 4CU7A 4PMQA 3IK2A 1VEOA 3EB3A 2OT1A 4U10A 2D2OA 4OBTA 5A5WA 4JQ1A 2DVTA 3PUEA 3OLDA 4JTHA 4OUIA 3PZVA 3HA1A 4MTVA 2WZMA 1A50A 1VCGA 2VNCA 2A0NA 1KKRA 6ALDA 4UQBA 2QPXA 5KMYA 2OX4A 1FKWA 4QE5A 2Z0IA 3P62A 2GSHA 3PPHA 3GHSA 4IUGA 4RZBA 3IRDA 4GJJA 4F48A 2FJUB 3CT2A 5GNXA 3OO2A 4B5WA 1U1JA 4F9DA 4R5EA 4OWGA 3B9OA 5A8QA 2V5BA 4RPPA 1VFUA 1VFTA 2V82A 2J8FA 3LCFA 2DZSA 2GJLA 1X6NA 5DQPA 1A3XA 1GHSA 3SY8A 2H3BA 3QV8A 4ZZ9A 1M3UA 3HOJA 3OVQA 3WQ8A 1WZMA 1G4EA 5DCEA 2DFAA 1J0JA 3BG3A 2D3NA 3FXYA 1VENA 3MMWA 5G2WA 3CHDA 1AJ0A 2LLEA 1O12A 4QIUA 1W3HA 2VZVA 1VEMA 2HXUA 3KUMA 1GVYA 3DENA 1UBSA 4JIIX 3L4UA 1RUSA 3OZPA 4CN4A 3WFLA 4FXRA 1BG4A 3UJRA 5CJNA 3UZJA 4QCEA 1P0NA 1NEYA 2WM1A 4Q4QA 1J11A 3WK0A 1K7FA 3MYOA 4BEUA 1MUCA 1WOBA 1G01A 4F66A 2ZUWA 2ZADA 2MUCA 1SJDA 3TWAA 4BQ3A 2PP3A 3GC4A 3BCFA 3STCA 1L8PA 3WNPA 1BRLB 1DJGA 4H83A 1VHNA 1AZ1A 1A3HA 1GGOA 3OBEA 4IIFA 3Q2DA 4F79A 4PCPA 3NL5A 1YNYA 3M5VA 3RAOA 1F76A 1KXTA 4M6UA 4QITA 4BWLC 1BWKA 4OBRA 2DIEA 2BLEA 1ME8A 1XBVA 3S2NA 3T09A 1F3WA 1QI5A 3NXLA 3W1XA 1MW2A 4QAIA 3VKAA 2PDXA 2Z2BA 4LNCA 4PTNA 1N55A 4IMDA 3ITYA 4H6RA 4QP0A 3LQGA 2DEPA 4CU8A 2QCLA 1A53A 1KFBA 3BANA 3M5YA 3PJTA 4CNSA 3P84A 1B2YA 4C6PA 3AICA 2XU2A 3CWNA 2IQ0A 4QSFA 5EMKA 4GKLA 1F05A 4F4RA 4L4PA 4DWSC 1OYCA 4QNEA 5HAOA 4H9UA 2PE4A 1YXCA 2IKGA 1UPMB 1VFMA 5BMXA 3NQCA 1ZAJA 1V0LA 1TO3A 1VLIA 3NQ7A 1RBLA 4BF9A 4FOJA 3PSWA 4S3BA 3KCLA 3HGRA 3RHGA 3MP4A 3VA8A 4Q7BA 1TV4A 5C70A 3IK4A 1M53A 3AWNA 4U4MA 4MYXA 1OX4B 3EWXA 3CZ8A 3ZIZA 2GSEA 2HCVA 4TOQA 2H6RA 3G18A 4P7LA 2V3EA 2ZXDA 2FZBA 4ACZA 1KXQA 3G2GA 2EGZA 3SSZA 5HQEA 3CQJA 2A85A 1K02A 3KOYA 2EG7A 4CD4A 1I45A 1KC7A 5A6BA 3K8LA 3P93A 1UMYA 3KBWA 2GJXB 4C6FA 2OSYA 2VZOA 1UH3A 2XWDA 1REQA 3OZMA 4M81A 1VEPA 3QC3A 1T96A 2Z1WA 1Z9AA 1TCMA 4ASTA 1EJTC 1A47A 3LUTA 4AZBA 1W1ZA 1KRCC 3OLGA 4MAZA 1G94A 3A4AA 1EC8A 2Z1BA 4INFA 1L6YA 2ZE3A 1UKOA 4HA1A 2QIWA 1JEZA 1W0MA 2QUVA 1UWUA 4R27A 3GAYA 3MUY1 3U2CA 3VD4A 1QVBA 2NQZA 2XVKA 7CGTA 1NTHA 3ZR6A 3BICA 4EANA 3N73A 3E0LA 4GYPA 3W4RA 4WCJA 4MNMA 2QPUA 1DTNA 1YRRA 5D2XA 1JCYA 4FLRA 3UPBA 4GXWA 5IDZA 5C9XA 4B16A 2GUYA 4H8UA 4R85A 2ZTKA 3O2LA 1PL9A 5ABGA 4FIRA 3ZVHA 2JKAA 3PZTA 4AZIA 5HXMA 3OYXA 2BVTA 1FWJC 2OZ8A 1TUXA 4MSSA 1R2RA 2E0PA 1U1UA 3RCYA 4J28A 1H1YA 1QNVA 3NQDA 2W63A 1UKQA 2YDRA 3I4EA 4JL1A 3NQ2A 3DKLA 4R88A 3NEVA 3GG1A 1ECQA 1GEQA 2JGYA 1G7UA 4LFYA 4Z1DA 4HQVA 3WLSA 2ZVRA 4GQ0A 2EPKX 4JQ4A 2NUYA 1GQKA 3OG3A 1CB7B 4DUWA 1SSDA 2PBOA 2XVLA 3MQTA 3SRFA 4UTHA 3I68A 3PWIA 2DW6A 4OT7A 5EMLA 4PGLA 4G7EA 1EO5A 4L4MA 1O5KA 4ZQCA 2AQOA 5C2XA 1J12A 1QW9A 3WNKA 1GOIA 4HZ6A 4NAFA 1V4YA 1ZCOA 4D6EA 5HDRA 3LHWA 1SZGA 5RUBA 5I02A 1YXYA 2GJRA 8RUCA 4OIFA 2NXGA 2QF8A 3MO7A 4MFEA 2J66A 3CMFA 2Q3OA 3AQUA 1YLVA 2FTPA 2DT0A 2JEQA 3IJQA 3W9ZA 2YJQA 1AMKA 2CZFA 4PMXA 1GVQA 2PWVA 4IWWA 1VZWA 1DVJA 3H23A 5FSDC 1KWGA 1W1YA 4H9XA 2DT2A 1WV2A 4D6DA 3PBUA 3BJTA 4GI8A 3BO9A 2PDCA 1E6SM 3GHRA 2PS2A 4Y96A 4ERAA 3CZJA 3PP7A 3CUZA 2GVLA 3O0FA 3NUKA 5EKYA 1YMYA 4NJIA 4ZR8A 3AFBA 5H2ZA 2QV5A 3COTA 3KVLA 2E6FA 3W6LA 5I06A 1X98A 2G50A 1IGWA 2FFCA 3N9SA 2O7QA 4MY1A 4LEQA 5CC7A 3USBA 1QHPA 4K36A 2EPLX 3N3TA 4ZXOA 1O4UA 3O07A 1OIMA 5JQ9A 4Z1BA 1Z7AA 3G1HA 1Q85A 5TD4A 1O94A 4FLQA 2WVTA 1V3LA 1Q66A 4UOZA 1OF8A 1E1FA 1FDJA 2PDLA 3NAVA 2VVNA 3M5XA 2IQDA 2VEKA 4XZBA 1HL9A 3HFTA 2YGYA 2ABBA 5I77A 2YFNA 1XIGA 1B54A 1US2A 1Y65A 5B80A 1P7TA 4E38A 4K3ZA 3A9IA 3FCPA 1MDRA 2UWFA 4XAYA 3F2BA 4Z17A 4WSHA 1PEZA 4EF8A 1S39A 3B8WA 3FJLA 2CCRA 3E38A 3L7RA 4MB4A 3RXZA 4JGDA 2V3DA 2RAGA 1OEPA 2XFWA 3BGGA 4ZOAA 1XDJA 5I09A 1CXEA 4WJXA 1QBAA 2BOGX 3N2BA 1AL7A 5D4YA 1S1PA 2XIJA 4AWEA 1W3JA 1OM0A 1R3TA 1EJWC 4YTQA 3W28A 4BJHA 3L67A 1L6WA 1JVNA 2CLKA 3GNRA 1SZRA 1KCKA 4JFWA 1R3YA 4AD5A 3UVAA 3KBVA 4IPPA 3NL2A 1ZJAA 3HG5A 2E9BA 3SUVA 4J1OA 1QATA 3DKJA 4C7GA 4EWJA 3UD6A 3TFCA 4IFRA 3LCGA 1Q65A 4K7YA 1T41A 2WWCA 2FLIA 1QW8A 5FIPA 4WGXA 3RDKA 2RDXA 2CFFA 2OX1A 1ISYA 3UXKA 4Y9NA 3G8EA 3PTDA 4ZVJA 2Y8KA 1PZ2A 3DC0A 3L66A 2W9MA 3GTXA 1YTKA 2VZTA 2CYGA 1JXJA 3VXGA 1HKJA 4TTUA 3MI3A 1B4KA 4FOUA 2DZWA 2ZRUA 4QTGA 3UXIA 2OPJA 1J0KA 4F3HA 4MYAA 3SQMA 3B9NA 3AXXA 5CBIA 1CNVA 4NYUA 5F4WA 1TA3B 2OFJA 5CPMA 1J18A 1XLJA 1E4LA 4HK5A 3PAOA 1ODUA 4WGHA 3TAKA 4ADSA 4JTGA 2R24A 3NVTA 3E2VA 2YL5A 5CXPA 1H62A 1R7OA 3NYZA 2F6KA 4BA0A 3LCIA 5IDIA 1KV8A 4Y6GA 5KSWA 5HWNA 5REQA 2C71A 1CB2A 5CZJA 2VFGA 4XIMA 1NQKA 3BLFA 4MMWA 1W1A1 4L6HA 3KFTA 2VENA 2VFFA 2XH2A 3EWDA 2VOTA 3R43A 4UMCA 4PUEA 3W7MA 3AIWA 2AL1A 4US6A 3CS2A 1XSIA 1RCXB 4RNHA 4N6EA 1Z32X 1JUKA 2WPBA 4PR4A 3GZAA 3SCWA 4Y2WA 3MKKA 3BC9A 4XAFA 6A3HA 2PGWA 3DOPA 2CW6A 3TSMA 3AJ7A 4TV5A 1H63A 3UWUA 2CBJA 4A35A 2PU0A 3MPGA 5AC8A 1LBMA 4ORMA 1JUEA 8XIAA 4BZYA 1EGMA 1DHKA 4PFHA 2VVSA 4NJKA 5KZEA 3GU1A 3LI0A 2ISVA 3ITCA 3PUOA 4PULA 3CZGA 5C9WA 1GPFA 1JDCA 3N9KA 3W2KA 4V28A 3WLIA 1WDQA 5IOBA 1SZFA 3SB0A 3RNDA 2E8ZA 3LLFA 4UUIA 3DIPA 2F8QA 1WXZA 3B9EA 2P10A 1I6NA 1UG6A 3PZNA 5ABEA 5XINA 3MWCA 4GNVA 3TJLA 3LXBA 3WDJA 4GIRA 2QT3A 4MPQA 3W1TA 3VD9A 3REQB 3CL7A 4UQDA 4KIRA 1HL8A 4TU1A 3LK6A 1KXHA 2OO6A 1GUVA 4F2UA 3O15A 1RR2A 2HVNA 2CLLA 2ATMA 4G9PA 2B7OA 3WDHA 5J5DA 4LCSA 1W1B1 4AHOA 1L0PA 1GQLA 7REQB 3TU9A 3TE9A 2WO5A 1Q7ZA 2ANUA 1LT7A 1ZL1A 3TOPA 3ZJ8A 3OP2A 4L9ZA 4LU0A 3VKCA 1JZ6A 2VFHA 1P6BA 1I75A 4FX7A 2FDMA 4E5TA 1XYCA 3W37A 1JAKA 4AZGA 3OBAA 4OZOA 3HGSA 4BFAA 2VXNA 3A4WA 5I3GA 1KLYA 1LCOA 1CWYA 4HSOA 4O17A 2YL8A 4OU1A 3DDMA 5DRCA 4LAOA 3DFSA 3AU6A 3W53A 1ZJHA 1VBRA 1AJZA 4Y90A 5M2FX 3KWXA 1SFTA 3FXGA 4AVNA 1FWGC 4E6MA 3U57A 1E1CB 3TTQA 5FSEC 3ZLHA 3M6YA 1TPDA 2YXOA 4Y8EA 1TJRA 1ZENA 3EX4A 3WD1A 4MIMA 7A3HA 2ON3A 1K8ZA 5IRPA 2O0TA 2J9XA 1UD2A 4JTIA 4JAWA 2WJDA 1UC4A 5A8MA 3BCDA 2C0AA 5FF7A 3SIMA 3GS6A 1IZCA 1LJYA 1QPQA 1UW9A 4QDPA 1KFWA 5HJLA 1YX1A 5HPCA 5AHLA 4O8RA 1IV8A 2CHNA 2ZX7A 5AC5A 2PLCA 4DVOA 1JCJA 1B1YA 4GACA 1QPKA 2WJFA 4Z42C 4YVPA 1P0KA 1YHTA 1WNOA 1FWHC 3W0KA 1TMHA 2CBUA 3GO2A 4BQ5A 3AHVA 2V0TA 4NL1A 3K8MA 2PD5A 4U31A 3HQPA 1PX3A 3UW6A 4GUIA 3WJWA 3GUWA 4RR4A 4C90A 4P2VA 1AL8A 2O9TA 3HMCA 2OLSA 3EMQA 3E74A 3UJFA 1WCGA 2Y8UA 1ITQA 3MSGA 5CAHA 2ZX9A 4WDTA 3WFAA 3HF3A 4LAUA 3G1VA 4RE2A 1SPQA 4IG2A 3E2SA 2G3MA 2VDIA 4DBWA 1Q45A 3KTSA 1XLAA 2ZFAA 1WAWA 4D6FA 2X42A 4XUGA 2YSWA 2C13A 1LDCA 1NVMA 2WMHA 1EX1A 5MKGA 1D3CA 5DT7A 4QEHA 4ZFMA 3M0JA 1PS9A 2CBIA 1KM3A 1OINA 2ZXBA 2NQ5A 1CECA 3BXWA 4KESA 2C79A 2VFIA 4DWSB 3B03A 3VAVA 5MHBA 3GRIA 5K2ZA 1US3A 1UUQA 3MWAA 4KETA 2CHOA 4GX8A 1W5PA 3VFCA 4Q6XA 4RE0A 2CXEA 1HQTA 2CLFA 4CLMA 4LYPA 3A3XA 4Q8MA 3RX3A 3GR8A 1BEUA 5DX7A 1V8EA 4UTWA 2BDQA 3KAOA 2XIQA 4P8UA 4QLLA 4JNYA 1S2CA 4UFHA 1IF2A 4EAYA 4KRZA 4AWSA 3HPXA 1J0ZA 1TREA 3VNZA 2TRSA 4DX3A 3QTGA 2VRQA 3GVGA 4RV8A 4Z08A 4PTMA 4GIEA 3QRHA 2UZ9A 3W7HA 4DUXA 2BGNE 1CLVA 3RPMA 4Q8QA 2VR2A 1U5HA 1EC7A 4HHMA 2F9RA 1R9XA 3U4AA 5LIUX 4ROQA 3IIZA 1XYAA 3WQCA 2E28A 2FQIA 4N9EA 1K7EA 2XIOA 3JW7A 1JPDX 2WMJA 1H4PA 1SQ7A 3WCZA 4W7UA 2XH4A 2J7DA 1R0MA 4LB4A 2IW0A 4NX0A 4S3KA 4D6HA 4GPNA 5JBFA 1ICQA 2VC6A 3QQ0A 3AS0A 5CKSA 2UBPC 1SO4A 4H9TA 3FYOA 1SO6A 4LRSA 4P61A 3KZPA 2AQWA 2XN1A 5H1WA 2ESCA 4IJCA 3AJXA 5T9BG 2RDWA 4HBKA 2W5FA 3UBPC 3IEBA 2VC9A 1GVSA 4UFLA 1LLZA 1OC7A 4FXJA 1O66A 4M80A 3A64A 3G1AA 2HXTA 4GABA 4A3UA 2YKKA 4XZHA 2ZA1A 5FA5A 1QMLA 5KZMA 2QJNA 4DJFC 5C8BB 1XS2A 3HMJG 4LQ1A 2INZA 1CGTA 2V2CA 4IFOA 3CQIA 1LG1A 1LROA 5A6SA 3CQ0A 4FNSA 3SFKA 1RP8A 2P5NA 1EPVA 5D9PA 4U5IA 4S3DA 2GK1A 2QJGA 4HB7A 5DT5A 2VHLA 2VD8A 4O16A 1NFPA 4LPCA 3TOYA 1A0DA 5AC7A 4XSLA 1X1NA 1TE1A 1OGGA 3LY0A 1QTWA 3JZUA 3U6WA 1UJPA 5ENLA 4M3PA 3GAKA 4PUKA 3BOFA 4NNCA 4X22A 1LL7A 1EF3A 1XDMA 1RK5A 3AALA 1QK2A 3RRXA 3H7RA 3APYA 2BNJA 5EFDA 1C93A 2E8YA 1DWHM 2P3EA 2ZUUA 4IMAA 1QPOA 1FWWA 3F2CA 3WY1A 5M5DA 3E2RA 4J2MA 3C2FA 6REQA 4B2DA 3D3FA 5H8MA 3HFYA 4PN2A 4JX4A 1W1VA 3UWYA 3T9PA 3ENLA 1WUEA 3BJFA 1QI3A 4WF7A 3K13A 4M0XA 1F8IA 3QKZA 3NXFA 2VI0A 3N19B 4AIOA 2J62A 2CLIA 4RX0A 1NDYA 2CLOA 1O60A 4CEUC 2A79A 3GVQA 1XPGA 3EOEA 1QNQA 3AIQA 4A3QA 4AIBA 3T8LA 2WNNA 1YPFA 2OG9A 1XYMA 4HYRA 3R0DA 3CUHA 3KRBA 2XN0A 4BS0A 1SFLA 2QKFA 3S3GA 1R3RA 2ASHA 1JFXA 3URNA 2VX7A 4UTTC 4MNKA 1NQ6A 1QFEA 2CETA 2VC5A 4Q8WA 3B8UA 1MXSA 3IIXA 3VE7A 3WNNA 1EBGA 3GG0A 5AZ1A 3VX1A 3KL3A 4ACYA 4D1IA 4FLSA 4O4VA 1OFDA 3WO8A 2VEIA 4JL2A 1SM9A 4JEJA 1E5NA 5BXRA 4H01A 1DHPA 1F4AA 2DZUA 2WBGA 4JY9A 5H8UA 4IPIA 1TWZA 3BURA 1PE1A 2R9RA 1DWAM 1OABA 4ML9A 1R3SA 1X1ZA 3LD5A 1HKVA 3B05A 3JUGA 1KM4A 1OIFA 1ITXA 1DPMA 4PL1A 3TMQA 4J3SA 4JN8A 1AD4A 2V9DA 4RK8A 5LKYA 3W7LA 3IGUA 2GDVA 1FA2A 3WQOA 1GJPA 1S2WA 1EP1A 2HMCA 1W1PA 1HP5A 2PURA 2V38A 2PDWA 2R91A 4H04A 1F6PA 1X6LA 3LI1A 4LAKA 1XUUA 2QCNA 5BRQA 2DSZA 1HUVA 2WKGA 3FFSA 5M3WA 4HU8A 2DSKA 4W86A 4W7WA 2WBKA 1Q6DA 2OU4A 2IKJA 3UWZA 5A6BD 1M5WA 3W22A 1EZWA 2YCIX 4F40A 3P6LA 1JYWA 1FTXA 3I4KA 7ODCA 3A6OA 3M0ZA 3MSYA 1IGSA 1DJZA 1K9DA 2VX6A 3IGHX 2VCCA 1H61A 4GVIA 1JDDA 5T8GA 2Y5SA 1KNWA 1VAHA 1Y5VA 4HK6A 3BAWA 1LOLA 4AZCB 1UWRA 2OYMA 2PWFA 1W54A 1Q3NA 5E9XA 4PMJA 2CNCA 5A6JA 3BW3A 1E9YB 1QI2A 1TRDA 3AXKA 4E8CA 1W9UA 1L6SA 3NQ6A 1JPIA 3ABZA 1YNPA 4JTLA 4OFCA 3OHMB 2R14A 4GLEA 3M5ZA 2DY3A 1TR9A 4RZ5A 3T78A 4O11A 3BQ5A 2IKIA 3U9IA 2VWSA 5B7ZA 3RPDA 1MQPA 4IF2A 2ZUVA 3WN6A 4ZOBA 2IKHA 1IEVA 4HHPA 4O57A 2Y7GA 3WLTA 3GXNA 2J25A 3SCSA 4NT0A 5FJPA 2WB5A 1FXQA 5CPQA 7PTDA 1D9EA 3UCCA 4M29A 3UYIA 3VILA 5D04C 4J27A 1H60A 4KEMA 2VEMA 4ICCX 4BY3A 2BXVA 1XI3A 3QR3A 5LA1A 4WUIA 3CHVA 2V5JA 5D05A 1UA3A 5I3KA 4OQVA 1RBOB 4MJ4A 3AS3A 1E9ZB 4ACZB 4XG1A 1J0HA 1YTEA 3GNPA 4LBUA 1NIUA 2VP8A 2OLHA 3BAYA 3ME3A 1X39A 4ZQMA 1MXDA 2XUCA 2TYSA 3SM0A 4HPNA 2XIBA 4LB3A 3PBMA 2GGEA 5TAOA 2YCLB 7XIMA 3AMLA 4C7FA 1BQGA 2B81A 3NQ8A 2A3LA 1ONWA 1VCVA 4IOTA 2Y63A 1XV8A 2VGIA 3DG6A 4BKNA 1ZJBA 3KE0A 1RALA 3TLLA 9XIAA 3RU8X 1REQB 2B7NA 1G1YA 4ZB0A 3I65A 1PKNA 3DHPA 4OVXA 4JTJA 4XBJA 4QG8A 2W67A 2WMKA 4GQBA 2P3ZA 3GNNA 3WH7A 2PPGA 2W79A 2HPMA 6XIAA 3DU0A 1W56A 3EEGA 5LNWA 4O0KA 3RX2A 4JHZA 1M7PA 4X60A 4AY7A 3E0FA 1S5NA 2DT3A 1WXYA 3SN4A 5EFFA 3GDLA 4M1BA 5CSSA 5HMDA 3PG9A 1F73A 2A6LA 2Z1VA 1EFZA 3WG6A 1UR4A 3TYBA 1VFHA 2NVDA 4B5XA 3LRKA 2GSJA 5CC3A 3W75A 3L5MA 1HL2A 3S47A 3PAJA 1HZYA 4TR9A 3THUA 5CZ0A 3NNTA 3NO3A 3S9ZA 2OTDA 3P5ZA 3AC0A 4WSJA 3NQBA 3VNMA 3M0KA 3CAQA 4F0RA 1SMAA 3B8IA 2RJHA 2J78A 5AHMA 3KS5A 1I2RA 2VO5A 2VEGA 3S8HA 4YCOA 1RCQA 3IS4A 7ENLA 1AQHA 1S5MA 3O3RA 3TNBA 3A5FA 2INFA 1V79A 3W6YA 2DZTA 1A0CA 4YN5A 2WZTA 2XVGA 4G7EB 1XH1A 3H70A 1KCLA 3EX3A 3DCPA 3ZO9A 3EOSA 3VKKA 1ZAIA 5HJXA 3S2JA 5M17A 1DTUA 4QE4A 1GCYA 3SDOA 5A95A 4O1CA 2WJEA 3GNXA 4AHPA 3ZLFA 5CEWA 3OVRA 1ICSA 3HV9A 1LWIA 3CUFA 5KETA 2FGZA 4N42A 4GO9A 4EPBC 3C3NA 1E73M 3PM6A 1BRLA 1W1IE 3N13A 4NNBA 1RSCA 1TVLA 4GH1A 3VI2A 1MZRA 4MHBA 4EXAA 1YDYA 5C0QA 1XDLA 2VUYA 2ZIDA 1Y8BA 3W27A 4RXFA 1W17A 1VKFA 1CW2A 2ZX8A 2ZRVA 5DCBA 3DFTA 2P50A 3WLQA 1TMQA 4M19A 4W9TA 5D03A 2DZAA 1SW3A 1CDGA 2EEXA 3RPTA 2QYGA 5BZAA 4AD3A 3DC8A 3WD2A 4YU1A 2GZXA 4GG9A 3BGAA 4GH3A 1LM1A 3QW4B 4E3TA 4FF5A 3HIJA 1V3JA 2I7GA 4S3GA 2XJ7A 2Y5EA 1OFOA 4PMZA 5HUOA 3GM8A 3F7JA 1E3ZA 1P7TB 3CUXA 2XDFA 4PZVA 2QLYA 4HJWA 2ZZ2A 4O1AA 5CC6A 3KBMA 3BOLA 4W8BA 2NVAA 4I9JA 5IBXC 3BSHA 1M65A 3L0KA 1AD1A 1S2VA 2CLEA 4NU7A 4L1GA 1EL3A 3WQPA 1P48A 3W01A 4KWWA 3PN8A 2BVYA 2OWXA 4Q3MA 2PDIA 1AMYA 1TV5A 4JIHA 4YMZA 2IS7A 1QNOA 1X97A 3ZMRA 5LGXA 4JTSA 2PRLA 1EGVA 2VWTA 3ZWTA 3QHOA 1XIHA 1HW6A 3CIXA 2F2KA 1VR6A 1LG2A 2A7PA 3MYPA 2BG5A 4MZ1A 1I0BA 5CBJA 1S5VA 3STFA 2NUXA 5LIKX 1UD4A 1FHDA 1PYFA 4CD7A 3VOHA 3VCRA 3XIMA 4Z0SA 3EKLA 3PHAA 4C6CA 1OX4A 5HMSA 3PTKA 3MZNA 1EJSC 1BWVA 3A13A 3OG2A 3R0UA 1O6IA 3T7VA 2ZTJA 3W1RA 4PMNA 4LGXA 5A2AA 2WPGA 4RZ6A 4DHGA 3PUDA 3CHFA 5EU9A 3PSVA 4GBUA 2GJXA 3UESA 3H2AA 4DYJA 3ATYA 3W1AA 1W3LA 2XIIA 2J27A 4XAGA 3WDQA 4XKYB 4A3YA 2AMXA 3LX9A 4KFPA 1D8CA 2PMQA 3NM3A 2Q6ZA 3GY1A 1NAL1 1H09A 3U2ZA 2OQYA 3LYEA 3EWYA 4D6IA 2QVHA 1E55A 3B3DA 4EACA 1RHCA 2XSXA 4PMUA 1A0EA 3WBYA 3IUDA 5AYYA 5G1MA 2VQTA 1XINA 3GC2A 3I10A 3POCA 4LCRA 4AX6A 1CEOA 1EXPA 2AKMA 2P0IA 5I24A 4DJEC 2WCSA 3QYSA 3BV7A 4WSKA 3MBFA 2Y89A 5CC5A 3R6IA 4IGSA 1EH9A 1JGIA 3CZLA 1EJRC 2G4JA 3RN6A 1K9EA 3SI9A 5ECUA 3ARZA 3E96A 2TAAA 3TW6A 3TCEA 3V0SA 3ATZA 4I8YA 4KCVA 3MMDA 3PTMA 3T0CA 3FSTA 1AH0A 3LG3A 5A6MA 3ES8A 4JHMA 1KM6A 3M0VA 4PTWA 3USZA 3N15A 3QV6A 1NOUA 1VFSA 4QDMA 3UZXA 3UR8A 4HHHA 4RE4A 4EX4A 1C7TA 4KIEA 2EBNA 4BHYA 1C3FA 2J7BA 3ARRA 3HJZA 3RO6A 3UP8A 2X16A 1GW1A 4QS6A 3VNIA 4NX5A 2PTWA 4O13A 3MY9A 5HNTA 2WNQA 1AH3A 4PODA 3BG9A 1V6UA 5AC4A 4DO4A 1ODZA 2QDDA 3MI2A 1VYPX 2ZE0A 3G8RA 5EMYA 5BOFA 3ANVA 4L4LA 4AW7A 5CQ1A 1R2SA 4LUIA 2TPSA 3VMOA 2XFYA 2PB1A 4EPDC 2ZYFA 3FYPA 3ITTA 4TX6A 7TAAA 4ZENA 4Q8NA 3WQWA 1HO1A 2X1RA 4RDZA 4O54A 4QROA 2BBFA 2X09A 1ONRA 2HS8A 3FAWA 2YDAA 2GFTA 2QDEA 4IT1A 1Q6GA 2OR2A 2FVKA 4MWAA 3GR4A 4PA8A 1OB0A 3EOUA 4MWAE 5I2UA 1VPXA 4MADA 4IP7A 2J7CA 4Q32A 3BJSA 4OKDA 2XISA 1FXPA 4JCLA 4RCXA 3KTCA 3GTNA 2YCEA 2YZ5A 3QMSA 4LV4A 1VFLA 1GG0A 5FL0A 2WANA 5C9UA 3IACA 3W26A 1H51A 3KOZA 5D8WA 2WMIB 4UFMA 2XINA 5BXPA 4HZ7A 2QEZA 2GGGA 3NTYA 1Q63A 3H12A 2TODA 1JZ2A 2BFGA 4NYYA 2E25A 3WF0A 3GXIA 1MRAA 3N04A 1SYTA 3PWAA 2JIWA 2DIKA 3LRMA 1EYEA 3EMZA 1UBPC 2ZXQA 3S0CA 3MO4A 1ZBVA 4MB3A 1B3OA 4TMCA 3LNMA 4GC3A 5ABFA 1B57A 4A22A 3DYOA 4W7VA 5DLCA 3R13A 3V7PA 3BLDA 4E3VA 3H2EA 3G1DA 4DJDA 3L5AA 4US5A 3AISA 4WDUA 1DIKA 3B0XA 3O8AA 1JDFA 1E1EA 1MFUA 4GCAA 3LCHA 3O16A 3IAPA 1BXCA 4BQ2A 2XH7A 3LU2A 3L2MA 4ADTA