3GDKA

Crystal structure of the orotidine 5'-monophosphate decarboxylase from saccharomyces cerevisiae
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
260
structure length
260
Chain Sequence
KATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 101
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gdkA00
3W87A 1C9DA 4Z1CA 4E2BA 5EKYA 4IPJA 1Q45A 3S42A 4AWSA 1IXOA 3EB2A 1YXCA 1UB3A 4H4IA 3BVJA 2RDUA 2NV1A 2OJPA 2Q8LA 3V1PA 1SZNA 1LLWA 4K7VA 3TV8A 4O14A 4JS3A 2A4AA 2RDTA 1G4EA 5D02A 3TX9A 4GXMA 4AH7A 3BGGA 1NVMA 5HMSA 3SJ3A 4G1KA 1G69A 2QCNA 1U83A 3P61A 3MHFA 1TPB1 1FWTA 3Q37A 2E09A 4LVGA 2A85A 4UFJA 1FCQA 4X3ZA 2R14A 3PY2A 3PM6A 3MI6A 4OV4A 2EAWA 2H3BA 1JUKA 4HSNA 2YW4A 1H7RA 2C16A 1RZMA 1KV5A 3F1QA 3HPXA 2ZYFA 4LVBA 2QCFA 4RZ4A 3L5LA 3A23A 4JTSA 3W2JA 1ZENA 3NQEA 4S2CA 4W9TA 4P2VA 3ZR4A 4ORMA 4GRSA 2PC4A 1LBLA 4Y96A 5LNRA 3R2GA 5L6UA 1TV8A 1P1XA 1WBHA 3QPYA 1W5MA 5EMUA 1JCJA 4JXCA 4YLWA 4WD0A 1OFOA 3NQ8A 2Y63A 4UTIA 1GEQA 1OYCA 2YSWA 3FKRA 3NPVA 3W7OA 4BFAA 2VEIA 3W7JA 3U8GA 3QMRA 3P8JA 4O12A 3HG4A 3G1VA 1GOXA 3DI0A 4O1CA 4AHOA 3DZ1A 3P80A 1P0KA 2QCDB 2VKZG 4NVTA 3BLFA 1GPWA 4UFMA 3WJSA 3LGEA 2VFIA 2V2CA 4DF1A 1H7WA 3IEBA 3TU9A 1DOSA 5KITA 5FEXA 3W75A 4LT9A 3W2NA 3BG5A 2ATMA 4A22A 1YLVA 4MYAA 1BEUA 3B05A 4DQWA 2X1SA 4JTFA 1UBSA 3LBCA 3GDKA 3GKFA 1J4EA 1QWGA 3NO5A 3IIZA 3IV3A 3ZWSA 2GOUA 3TFCA 5HQEA 4K39A 5H2ZA 1W3IA 5CSSA 3HJZA 2P0OA 1RQEA 2E5CA 1BWLA 3NQCA 5F1VA 1SO3A 4AF0A 4QITA 3HMJG 1WX0A 3PF3A 5LHFA 1MZHA 3JRKA 1QCWA 4N9EA 4N02A 5F4WA 3TIMA 3LHUA 1VGAA 1F05A 2EF9A 1KM5A 4UNKA 5DXYA 1A5AA 2GVLA 4DELA 3QZEA 1KFBA 3W1MA 5KZMA 3FS2A 3M7WA 4JNMA 2DZWA 5F2IA 1XCFA 3O63A 1JCYA 3B8DA 1F6KA 2O7QA 2QCEA 3T55A 5D33A 3P74A 1OVDA 4Y8FA 1XBYA 3BG9A 5CPMA 2Z0IA 1EEPA 3NPWA 1KLYA 2DZUA 4RV8A 3B4UA 3RFAA 1O5KA 2NXIA 3HG3A 3NZ1A 1XDMA 3TW6A 2CLMA 3BARA 2YZRA 1SZGA 3BV4A 1FQ0A 3W74A 3TR2A 4FIQA 3ATZA 1NSJA 1O94A 3L5AA 4AAJA 3MW7A 4RK8A 1K3UA 3TC7A 3DKJA 4AEOA 4DO4A 3NOEA 4JX6A 4OV9A 4RXFA 2DU2A 2ISSA 2A6LA 3S5ZA 3PS7A 1LCOA 5D2WA 5DCEA 1VH7A 2W79A 1OFAA 1A5BA 1ZJIA 1FDZA 1SQ7A 3HQ1A 3NQ6A 4LC8A 4FB7A 5LGZA 5FF7A 1RR2A 4LUIA 1YPFA 4CNNA 3LOTA 3SGZA 5LNUA 3I68A 4IGHA 4MKNA 3IIPA 1A53A 1O95A 4IMGA 4ORIA 2QJIA 1WDWA 1TCDA 3C56A 1UUOA 5A8GA 4QISA 1DHPA 3VNDA 2E1DA 6TIMA 4MVAA 4R34A 2DZSA 3CEPA 2E6FA 4HNNA 1HO1A 3DFTA 2YXGA 3OVPA 2QDHA 3TSMA 2V2DA 2PRMA 1MEWA 4JTLA 4IMDA 3P84A 4RCXA 4XKYA 3PC0A 4L4MA 3W1XA 3TNOA 5U7SA 3W7MA 4UTHA 3G3DA 4TO8A 1V7YA 5KZEA 4DO6A 5MHBA 3S1UA 2VEMA 2F84A 1PS9A 1PL9A 4KWWA 1SO6A 1C8VA 1KM4A 1JVNA 4LTSA 3MMTA 3P5ZA 2YX0A 4UTLA 4OBTA 1VPXA 2G95A 1D3HA 1LM1A 2WQPA 2CLEA 4QJ1A 3TQ0A 4C1LA 3GKAA 5DCDA 2WJZA 4DPQA 1TO3A 3DHDA 1QMLA 1OFDA 2A7PA 1QR7A 5T26A 4EWND 2C0AA 1K03A 4HKPA 2A6NA 3TSBA 2NXGA 4NNBA 3UNDA 5HNRA 1ICSA 1ICPA 3S5NA 1FCVA 3T7VA 1H62A 4JY8A 4YCPA 3NQVA 1R30A 5CPLA 1DV7A 2A1YA 2A7RA 2VFEA 3C8FA 4ZL1A 1TTPA 1YDNA 1ME7A 2I14A 4O13A 4IMCA 2I9EA 3O16A 4PTNA 3EXRA 2GJNA 3LXCA 1G6CA 4POCA 1S5WA 1VYRA 4BF9A 2FFCA 1M6JA 1ICQA 1EP2A 1N55A 4MYXA 3THQA 3DENA 1VC4A 3HGRA 4FX7A 4XKYB 2QEZA 1AL8A 3HBLA 3LTYA 1TTJA 4LS2A 3GXPA 2FIQA 1LBMA 1OYAA 4Z0SA 4MUZA 2WOQA 3E12A 3NYZA 3SI9A 4RR4A 4GBUA 2TYSA 4IMFA 4BI5A 3TMLA 1KTBA 3M5VA 4NJKA 2CZDA 3WFAA 2ZZ3A 3IVTA 4NUWA 3FJ6A 1SUXA 4N4QA 3GR8A 1FUYA 4JEQA 2BX7A 2Y62A 3W7IA 4FHAA 3W6YA 3SR7A 2QAFA 2HS6A 3GNNA 4ZZ9A 3T40A 4JY9A 4M19A 3FEMA 4XUGA 2JKPA 1F2JA 1W3TA 1Z44A 4IJBA 3S1XA 1EB3A 4UFHA 3YPIA 4L4LA 1TB3A 1QPQA 3EEGA 3FIGA 3NNTA 1HL2A 3LCGA 1EIXA 5D38A 3DAQA 4NZJA 3BW4A 3C2FA 4JTKA 2YYTA 2VFHA 2UV8G 1AK5A 2ZRVA 1B4EA 5DELA 5HR6A 1WXJA 3QC3A 5A5WA 3IGSA 4R33A 1KM2A 4UUIA 2ALDA 3BK0A 3A22A 5FF2A 3IVUA 1C29A 2QCHA 3UWVA 4FXRA 4O17A 2V5BA 1BTMA 3PR2A 1WV2A 1GVOA 5I3JA 3P5YA 3O07A 5F2GA 1D9EA 3DU0A 1RQHA 1PCWA 3QM3A 4D2JA 4LVDA 3LX9A 5D2XA 1VJIA 4M5PA 1TYGA 3TDFA 3C6CA 5CZ0A 3QQ1A 3KHJA 1EX5A 2GUUA 3MP4A 3LHTA 4Z1DA 1H60A 3PBVA 5F2LA 1FDYA 2QCLA 1KM6A 1EUNA 3PUOA 4UXDA 3QQ0A 3EX3A 2VENA 1TQJA 2TPSA 5FEZA 3W2LA 3PVFA 1X1ZA 1PIIA 2E68A 1Q6OA 3M1ZA 4FNSA 4MFDA 1KTCA 1F76A 1UCWA 3LM7A 1H63A 4UTUA 4MFEA 1SW0A 3GR7A 1ZY9A 2VFDA 4IUOA 1W5PA 1QDSA 3KXQA 3U6WA 2DJXA 4JTGA 1VCFA 3CHVA 1TTQA 5TQLA 2EPHA 1KV8A 1WQ5A 4ONVA 1FWWA 4WQ6A 2A2IA 4RZ5A 3NQFA 4O18A 4PC8A 2ZRUA 1FXPA 1DVJA 1ZNNA 5AYXA 1RD5A 4PODA 3BO9A 4GUFA 1H7OA 1HFBA 4TMBA 2Y89A 3RF9A 3QF0A 1JUEA 1K7EA 1LOQA 4K8EA 1MEHA 3W73A 4IX2A 3EKLA 3RNDA 3N14A 4FX6M 1XDLA 3LCXA 4FNUA 4GUHA 4O15A 2ZTJA 3DBPA 3LHVA 3M47A 3MI2A 4KKXA 1GTHA 5HWJA 3PWAA 1T99A 2ZZ5A 4ZQCA 1P4CA 1W3NA 3HG5A 1VR6A 4EVZA 2YW3A 2QF7A 3W7HA 4QIUA 1QOQA 4FNTA 2OT1A 2C14A 3GK0A 4N9DA 1TSIA 2DP3A 2C3ZA 2V0TA 1FDJA 3FOKA 1X1OA 5CZTA 3PAJA 5HUOA 1H1ZA 4LV4A 1CI1A 1Z48A 3UWYA 2Q3RA 5G4WA 4JIPA 2QCDA 4KWVA 3JR2A 1OK6A 4BI6A 2F7FA 3N3MA 3E9AA 4NNCA 4UFKA 3BPWA 4EF9A 3WK2A 2VXNA 2J24A 2NLIA 2ZRYA 1IIHA 3W88A 5K9CA 3HGSA 1XUUA 1W56A 4IXHA 1N7KA 1XKYA 1T96A 1LRQA 3S8HA 3NA8A 1SZEA 2RKXA 4E2DA 2Z6IA 3L68A 2NX1A 1OHLA 2NZLA 5F4XA 2A5HA 4NX5A 4O1DA 2C19A 1XBXA 5HINA 1ML1A 4JDBA 2FB3A 4M6QA 1YXYA 3M5XA 2RHGA 1OFQA 3W2MA 2FQIA 3HO8A 5K9XA 4XZ9A 1WOAA 3G8RA 1X8FA 2P1FA 2QUTA 2B0MA 2XN1A 3NL5A 4C1KA 1XI3A 1XUZA 3M43A 2PE4A 3V75A 1OF8A 4BK9A 4LUJA 2CWNA 2YDAA 3O06A 3L0NA 4BR1A 4HPXA 3OVQA 3R12A 4N6FA 3ABQA 2TRSA 4NXSA 4TU1A 4AMAA 3M6YA 1ME9A 1TPDA 3LV6A 4LRTA 4FNPA 2XFWA 4X22A 4PL1A 2E77A 1PHWA 2Y70A 3WJXA 3C52A 4M6PA 3W1PA 3SW6A 3MHGA 4JTHA 5D2YA 1AL7A 1QPNA 2WSQA 3F4WA 3A21A 3CIWA 3GXTA 1A5SA 2ZCGA 1NAL1 1KA9F 1KFLA 4RKAA 1FX6A 2G96A 3TMQA 3W23A 1L9WA 4GNJA 4JTUA 4O28A 3KVJA 2JGQA 2R94A 2QCMA 3NQDA 3UWZA 3C2RA 2FPVA 1N8FA 4GFSA 1OJXA 4UNLA 4BI7A 2Z6JA 5IBXC 3W7PA 1HO4A 1SZFA 4QSHA 1MXSA 2BZNA 2OZ0A 4N2YA 1B3OA 1A5CA 1I2PA 2X30A 4PL2A 1TPEA 4LU0A 4RZ6A 1OG0A 3B0PA 2GQ8A 3PUDA 5G2HA 3IGUA 3CT7A 3PSVA 1WBJA 3W70A 1S3HA 4WJEA 2GQ9A 5K7JA 1W1ZA 1R46A 1O4UA 2YPIA 3A5VA 1GWJA 3ANYA 2ABBA 5IBXA 1V5XA 5J5DA 2ZRXA 3EX4A 2NV2A 3L2IA 1CX9A 5FI8A 5DLCA 3W86A 4UCGA 2WSYA 4IWWA 1M7PA 3STEA 3SFKA 2ZZ4A 3HG2A 2H90A 4MJMA 1Y0EA 1XFBA 1LOSA 3W7EA 4OHQA 5DN1A 4K38A 1VS1A 4DBEA 1DJNA 1KM0A 2O7SA 5DBTA 3ZFHA 4WXZA 2PCQA 1QAPA 5D2TA 1ZAJA 3CPRA 3M5ZA 5D03A 3VI2A 4MY9A 4UTWA 3P67A 5HWMA 2J9XA 3LRKA 2J9ZA 2JK2A 2QUVA 2ZDRA 2WNQA 4LC6A 4CQAA 4WX2A 2X1RA 2LLEA 1XC4A 4PA8A 3PB2A 1TPWA 3VE9A 1H7NA 2H6RA 1A50A 2C13A 5G2IA 5TIMA 2NUXA 5K2ZA 3O8AA 3IIVA 1QPOA 2NUWA 4FF7A 2OT0A 3FJLA 2ZZ2A 3OIXA 4K36A 2H8XA 4QM1A 3TAOA 3TJLA 4Z1BA 3PSWA 3TUUA 3UYCA 5LHEA 3E49A 1QOPA 2CZFA 3W7RA 1JRCA 3BGJA 3PB0A 4FX8A 2FB2A 4ZQOA 3DFQA 4RLIA 4GJ1A 4OE7A 1YYAA 1SFLA 1W54A 4WUIA 5DBUA 3NM3A 4OGZA 1KFJA 4IX0A 3K30A 2QUUA 3W7NA 3S9YA 1HG3A 3INPA 4O11A 5KSWA 3QYQA 3G1AA 4E38A 3OHIA 4LS1A 3DFPA 4CQ9A 2B7NA 4NX0A 4LW7A 1T0OA 4UFLA 2WKJA 1G4SA 2EHHA 3N19B 4WY0A 3KX6A 3UY7A 3UXAA 3TXVA 3CQ0A 5LSMA 5I3FA 2Y7DA 3TFXA 3P82A 5AB3A 3TKFA 1XXXA 2JBMA 1R2RA 3VCRA 1LZOA 1YXDA 4NJHA 5CKSA 5HR7A 2J9YA 3GAKA 3M0ZA 2DJLA 1F7BA 5HJLA 3D0CA 4O19A 5J5RA 3NAVA 4ALDA 4JICA 4LNYA 1JCMP 1TQXA 4CQ8A 5D2VA 4KFNA 3TSDA 2QJGA 2P10A 4Q4KA 1S5VA 1KLZA 1WOBA 1LP6A 5EY5A 5E1QA 1DBTA 1W31A 1YDVA 5AC7A 5K4XA 4DF2A 4X9SA 1WA3A 3P8IA 4WOQA 3L66A 5G1TA 4LS0A 1TRDA 3UY8A 4CCDA 1Q6RA 4FIRA 1B9BA 3ZWTA 2BXVA 5KINA 2CLFA 1FWRA 2XN0A 3LHWA 1RVGA 3C4UA 2FTPA 2YCEA 3NPXA 1FBAA 1XL9A 4MPQA 2BLEA 3MHUA 1JJKA 5LKYA 1DQWA 1F73A 4YL2A 4JIQA 4HNUA 3LCLA 4N9BA 1G7VA 5K9DA 3NQMA 2GVGA 4JR5A 4QNEA 2ZRZA 3S6DA 1K8XA 4AHQA 1VRDA 5AFDA 3CM4A 1XBZA 3A24A 5C5YA 4WY0B 1J5TA 4XWUA 3U2OA 3KRUA 3FYPA 5I3GA 4CNOA 5KZDA 3G1XA 3G1YA 3R8RA 3DFSA 4ZQRA 3GDRA 3G8EA 2YFNA 1H1YA 4GUGA 2GJLA 4IXXA 3CLMA 1QPRA 1UUMA 3W7LA 1KBJA 1ZFJA 5G5IA 3TXZA 1ME8A 5BNKA 1F74A 4NXKA 2V9DA 3I7SA 3NXFA 3G22A 1W37A 3W2UA 1LDCA 5HWNA 5LGXA 1L6YA 3NGJA 2ZA3A 3LERA 3L5MA 3NZRA 1JCNA 3G24A 4HNTA 3NM1A 4FEZA 4A29A 2YYUA 4ADTA 5C2XA 3T4CA 1I2OA 1GG1A 4JX4A 4X2RA 1GJPA 4ZQNA 3LV5A 3LTPA 4UR7A 1TPC1 1SU5A 2W0UA 5HUPA 1SSDA 1LOLA 2PRHA 3A9IA 2Z2UA 1GVRA 3TAKA 4O1BA 3QPZA 4TMCA 4NU7A 1HTIA 1GYLA 4JD4A 3I65A 3LI1A 4JDYA 5AYZA 3QW3A 1LYXA 1EWEA 2NUYA 3F03K 2FPTA 3MP3A 3UPBA 1H7XA 1QFEA 3P7YA 4ML9A 3NQAA 1OFBA 3C2VA 3BW3A 2A21A 2DORA 2C6QA 5LZLA 3ABOA 2D73A 3UZJA 5LNSA 1NEYA 3RU6A 3I6RA 1OFRA 2X16A 3HB9A 3QMSA 4NJGA 3G3MA 1WAUA 4HHPA 3HPSA 1JR1A 3L0GA 1QO5A 5D32A 3PG9A 3O1NA 1Z41A 4ZVJA 1LBFA 3SY5A 4BWLA 4Z0JA 2ISVA 4O4VA 2ZFAA 1THFD 2FLIA 3GX9A 5FEPA 5AYYA 2E5DA 2HS8A 3HGJA 2V8ZA 3O6YX 4DXVA 4AWTA 4UMAA 3BLEA 3UQNA 2YGYA 2J88A 4GE8A 4OT7A 2HMCA 3VFLA 3LLFA 1BWKA 2E5BA 4LWWA 4EF8A 4JYFA 2ZBTA 5AN7A 4DO5A 3OBKA 1JCXA 2RFGA 3MJYA 1D3GA 1GQNA 5BRBA 3USBA 5H91A 4NQ1A 1OK4A 5TBOA 3LDVA 2W6RA 3PG8A 1FXQA 3CEUA 4AB4A 3ELFA 3PULA 2ABAA 2ZA2A 4O0KA 2YFOA 3RMJA 4K7YA 1PE1A 1AMKA 2JGYA 4A2SA 1JCLA 2CLOA 3MUXA 5CZSA 3W1NA 4YMZA 5GVJA 1J2WA 1TV7A 4MZYA 5D05A 1EPXA 5KTLA 1ZAHA 4FO4A 2H8ZA 3LXAA 3QEZA 4CCCA 1FY6A 2EKCA 1ZCOA 2VEKA 3MO7A 3H54A 1I8JA 3DFOA 3LI0A 3MI3A 5CZJA 5I3KA 2OCZA 1G4TA 2VC6A 3QH2A 2Y6ZA 3OG3A 3TQVA 3KAOA 1SO5A 3L67A 3MP5A 3OEXA 5CGQA 3LBMA 4JYEA 3S5OA 2EGZA 4J9JA 3EX6A 4Z08A 1KFKA 7TIMA 3BG3A 4RXGA 1H5YA 2IQTA 1P0NA 5DXXA 1PVNA 4PEKA 3S1VA 1VCVA 4MZ1A 3EXTA 3TK7A 1TMHA 3LLDA 3F4NA 3N9RA 1TV5A 4Y6GA 3W71A 1I4NA 5K3VA 3WJWA 4N4PA 3S5YA 1ALDA 4WY0F 4AHPA 1ZALA 3W84A 3C2OA 2FJKA 4M7SA 4KFOA 4OQVA 3TH6A 1L6WA 2V82A 5EL1A 2HTMA 1X7FA 3KFTA 3ABSA 5DY2A 4I7WA 2J27A 3ATYA 1UJPA 3C61A 2PURA 3WK1A 2R91A 3Q94A 2Y85A 1RPXA 3B03A 4UTKA 1LLZA 3ZS4A 3IIXA 4U28A 1GVQA 4DBDA 1SW3A 4O57A 4UTJA 5AC6A 3EWZA 3NQGA 2E6DA 1S5TA 2AAMA 4UR8A 1MO0A 1SW7A 1XM3A 3CWOX 3KOFA 4JX5A 4U4MA 3FFSA 2ZZ7A 4LV9A 1JQVA 5FESA 1W5QA 2J6XA 3IVSA 2DZVA 1EP3A 3W83A 1B4KA 1I45A 3DI1A 2Y7EA 3SZ8A 1H61A 1OFEA 3W3OA 1TJPA 3BLIA 1GG0A 1VQTA 2DZTA 4UFIA 1MSSA 2E6YA 1VYSX 3W76A 1MEIA 1XBVA 3CTLA 3NL6A 2WNZA 3N2MA 5BMXA 1I2NA 5CPNA 3P81A 1I2RA 3L0KA 1O60A 2VELA 3LTSA 2WV8A 2ZZ6A 4I7VA 4LRSA 4OWGA 1G4PA 4UIOA 1F6PA 2JKAA 3MYPA 1OX4A 3W1UA 3IRDA 5G1YA 4CLMA 3OA3A 1JUBA 4O53A 3A5FA 4P61A 4K8HA 1YTDA 1IF2A 1LRNA 1YTEA 1IXNA 3W1LA 1VLIA 3M44A 3IIOA 4JGDA 4LVFA 4MLJA 3S1WA 2A7NA 1GVFA 3QRHA 3W85A 3STGA 1OX6A 1YDOA 3NPUA 3THAA 2Z1BA 3EWWA 4PCFA 3UZ5A 4Q33A 1PHQA 3GXNA 4O4WA 3RK8A 1W5NA 4A2RA 4JYDA 3RLVA 4AWUA 5C6MA 2V81A 2G97A 3RLUA 4ZMGA 4HT3A 4ICNA 4O16A 4Z1AA 4UTWC 1NF0A 3L9CA 4NT0A 4O50A 1OF6A 3L65A 3CWNA 2B4GA 2DZPA 4O52A 2X2GA 2QAPA 3W7GA 1Q6QA 4UC5A 4AXKA 4QAIA 4NJIA 4XBSA 3KVLA 5K4ZA 4CCEA 3H53A 3JS3A 5BOOA 2C15A 2CZEA 5FF0A 3LRLA 4N6EA 1ZHAA 5E0KA 3SGUA 5CSRA 4Q32A 5C55A 3TA6A 1VZWA 4TX9A 2CLKA 2ZTKA 3GDTA 1K7XA 5CPOA 4MOZA 5IM51 2C1HA 3NL2A 3QSRA 1R47A 3TJXA 2GVJA 3E0IA 1FWNA 3E96A 2ZQ0A 1KBIA 3ABRA 2X1UA 3DFNA 1OX4B 3PBWA 1R2SA 3EX1A 3PBYA 3B06A 5FF3A 1DJQA 1LTDA 2B7QA 1EWDA 2Y7GA 1Z42A 1LRTA 1NFBA 3G18A 3M9YA 3MBFA 2RDWA 3O15A 2Q3OA 3Q58A 3CC1A 2NWRA 2V2HA 3DXIA 3G1DA 2QCCA 5SWUA 1K8ZA 4GC4A 1X6UA 2PRLA 1YADA 3HGOA 4N9CA 3M41A 4GUJA 1KM3A 3TC6A 2WNNA 3NG3A 4S1FA 5EPDA 3KVKA 3FKKA 3EWXA 4MIMA 3O6CA 5F2MA 1YTKA 4FNQA 3UPWA 1OABA 5F1UA 2RH9A 2Y88A 1TIMA 1U5JA 3LCFA 3HPZA 1IXPA 4AF0B 3G1FA 3GAYA 4S2BA 3HIJA 3MWAA 4UTMA 5AHMA 3DH7A 4ZQPA 5AC8A 5HULA 1JQXA 4XTIA 3IGXA 1EP1A 5AHNA 2G5WA 5F4SA 4Y90A 4JTJA 3QW4B 3G0XA 4QNWA 3GNDA 1W5OA 1LORA 2TMDA 4R7JA 1GTEA 1KTNA 2Y7FA 3QJAA 3P62A 4B5NA 1RQBA 3SSJA 3KRSA 2QDGA 3B0UX 3NDOA 3OVRA 1SSGA 2HSAA 1O5XA 4MY8A 5EYWA 1IGSA 1I2QA 1FCUA 3TROA 1H50A 1KFCA 4JN6A 4JTTA 3GZ3A 3W7QA 3CIXA 3C3NA 3W07A 4YXGA 1W8SA 5C54A 3STCA 2BSLA 1DQXA 5I3IA 3LRMA 1PCKA 4PFMA 1R2TA 1TPH1 2CZ5A 2VFGA 3W2KA 3EWUA 3FYOA 3TE9A 3NEVA 3M5YA 3KRZA 3UWWA 4DEFA 4FXSA 1TPVA 4OU1A 5EBUA 1K7FA 3CU2A 3W7DA 3W7KA 4UMCA 2E6AA 4R53A 2VEPA 3CB8A 4AVFA 3NL3A 3DGRA 1L6SA 3WJZA 3B0VC 1Q3NA 1SPQA 3QSTA 4RX0A 4YWIA 5L9FA 5BW6A 5ABTA 1H7PA 2B7OA 4MY1A 1VHCA 3AJXA 2ZZ1A 3VKJA 2BWGA 3EXSA 2I1OA 4ZQMA 3WK0A 2TSYA 1K02A 1JULA 3GYEA 4KFPA 2AGKA 1TREA 3LCIA 3SECA 2JKEA 2NX9A 3R89A 6ALDA 3T78A 1EUAA 1TRIA 1DORA 3LCHA 1GYNA 3W7CA 4PH6A 4YCOA 2FPYA 3STFA 1AG1O 2YR1A 5EA9A 3W9ZA 3FLUA 3UWQA 4GUIA 3PUEA 2ZA1A 1ZAIA 3MYOA 1AW1A 3W1RA 2FDSA 1TPUA 4IOTA 2QR6A 3C2EA 1SFJA 4HSOA 2Y61A 4UTTC 1VLWA 5AHEA 4MJZA 3C0JA 3FA5A 3O6DA 3WJYA 2OX1A 3H55A 5AOUA 5AHIA 2C18A 1SO4A 3GB6A 5LNWA 1GT8A 4LY8A 4XQ6A 2ISWA 1FWSA 3Q2DA 4CNPA 4H6KA 4LVAA 5BMWA 5DY3A 4ADSA 1L2UA 2VOMA 4DPPA 1HUVA 1DKWA 1GVSA 3R13A 5D37A 4O8RA 3LHZA 1SR9A 8TIMA 5G2WA 1AW5A 1Q6LA 3W1AA 4H3DA 4UTTA 3EWBX 4NNAA 4EIVA 1TJRA 2ATSA 3GDMA 1UASA 4BWLC 2WSRA 3G1SA 3AO0A 3N73A 3T44A 1YPIA 1EA0A 1K8YA 4O0ZA 5I3HA 1M5WA 3G0UA 5FEWA 4Y9AA 2ZRWA 2CW6A 2CLLA 4IPIA 4I9AA 1F5ZA 1KM1A 5D04C 1T8XA 2WPBA 3O05A 3LCWA 1ONRA 3NR0A 4IQLA 4O54A 1FCBA 5AHFA 4GWEA 3I7RA 1OX5A 4O1AA 4M6VA 2V30A 4A3UA 4XTDA 3SIZA 1M7OA 1B57A 4TIMA 4A21A 1OFPA 3G0SA 1P5BA 5D30A 4FNRA 4O10A 3UD6A 2CU0A 4NJJA 1W0MA 3NVTA 3N2XA 1G7UA 5E93A 1WYIA 2QJHA 2NX3A 1BKSA 4TR9A 5G4EA 2KZHA 5LNVA 1RV8A 2GPTA 4HIBA 3LXBA 3GLCA 2OMAA 3LHYA 2WO5A 4LOCA 5DCBA 1VYPX 1LROA 3GIYA 4WXYA 3LB0A 3QMTA 4HNVA 1CW2A 4DF0A 3BW2A 2QKFA 4JTEA 4WOZA 4ADUA 1KFEA 4XBKA 2CLIA 3S0CA 3W1QA 4NZFA 2AQWA 3G1HA 5FF4A 2H3DA 3HF3A 4K6AA 1ADOA 3L21A 1VHNA 3EX2A 4RJEA 5U4NA 3HOJA 3TCEA 3KVMA 3EKZA 4MLRA 3GVGA 1OYBA 1GZGA 1E51A 4QQ3A 3NQ2A 3W72A 1G67A 2DZXA 2BTMA 2V5LA 2CFFA 4HN4A 2X1TA 2B7PA 3N34A 4WZHA 3W22A 1IXQA 3I7QA 4K37A 2XN2A 4EOUA 3UXDA 5D09A 3PBUA 1TTIA 4E0CA 1DL3A 1IIGA 3DHFA 3VE7A 1PV8A 2A0NA 2Q8ZA 2NXHA 3GDLA 4IMEA 4MZ8A 2QCGA 3R5EA 3TW7A 5KMYA 1VCGA 1QO2A 2VFFA 4HPJA 1H51A 3QFEA 3M16A 5AHLA 4I7UA 1KW1A 4UMBA 3B04A 4M7TA 1QNVA 1AW2A 3N9SA 2GQAA 1NF7A 5CG7A 1TPFA 1JRBA 3WK3A 3DKLA 3P60A 3MBDA 3NQ7A 2CLHA 2NWSA 4JTIA 2R8WA 3UWUA 3TQKA 3W1TA 3EWYA 3E02A
chains in the Genus database with same CATH superfamily
3W87A 1C9DA 4RNFA 3AU2A 3AUOA 4E2BA 4J3XA 5EKYA 3VZYA 1DXIA 3K8MA 1E15A 4PMOA 3EB2A 2IPFA 4H4IA 3RCMA 3WL1A 2Q8XA 2RDUA 2NV1A 3IJLA 3VD4A 3ECQA 4C6OA 1SZNA 2R24A 4S3KA 1FRBA 2V3GA 4O14A 4FI4A 2Y5SA 1NVMA 2QCNA 3U9IA 2CC0A 2V63A 3P61A 2PBOA 4C6LA 1FWTA 3Q37A 1QNPA 2E09A 4LVGA 4IICA 3PM6A 4PZVA 4DLFA 2PDQA 2YW4A 1V0MA 1VEPA 1KV5A 1AA1B 5I06A 3MUIA 1B54A 3WH8A 2ZUSA 2QCFA 3L5LA 3QGAC 3WLHA 3AS1A 2PP0A 3G77A 3NQEA 3W2JA 1OD0A 3AMKA 5EBAA 4P2VA 2X41A 2RGLA 2PC4A 4L4PA 4Y96A 2HZGA 4LUTA 3T0TA 3R2GA 5L6UA 2PTXA 3BJFA 1JCJA 3EBVA 4W85A 5EMUA 1ZBWA 4IJRA 1JZ3A 1GEQA 1OYCA 3HQNA 2YSWA 3FKRA 3W7OA 4O12A 3WBYA 3GXDA 3PJUA 3DZ1A 2IUZA 2VKZG 3A64A 2C79A 4HNLA 3QLLA 3LGEA 2D2HA 1D3CA 3IEBA 1EBGA 3W75A 2EG7A 1MFUA 4MYAA 3B05A 1BG9A 3U3HA 1IEIA 5LIYX 4AZ5A 1UBSA 3LBCA 4AD0A 2G50A 1V6VA 2KAUC 5LIUX 2NT0A 3GU2A 3TFCA 5CSSA 4AISA 4WKFA 2P0OA 2E5CA 3NQCA 1SO3A 1BAGA 1WX0A 4JTAA 3WENA 5LHFA 3CLWA 2ASHA 2I17A 3VX0A 1ADDA 4NRRA 4N9EA 4ZB5A 1ISVA 5F4WA 3LHUA 1VGAA 1F05A 1KM5A 1A5AA 3A4AA 2GVLA 4Q8PA 3QZEA 4FAMA 4DWSD 4EX4A 3W02A 3FS2A 1O5RA 3M7WA 3MMDA 3WFLA 1JCYA 2YL6A 3WD1A 2DT0A 2J74A 1MDLA 3KHDA 3MSRA 1F6KA 1WXZA 2O7QA 2QCEA 3P74A 1GORA 3BG9A 3M0XA 1EEPA 1W32A 3RFAA 1XINA 2IQ0A 1B90A 2ZXDA 4ZA0A 2YZRA 3BV4A 3ATZA 1NSJA 4AAJA 4LF2A 3TC7A 3K2GA 1PZ1A 4DO4A 3CV2A 1KWGA 5DMYA 5DMLA 2A6LA 1LCOA 1VH7A 1GW9A 1A5BA 3HQ1A 2RJHA 2GJRA 3T8QA 2VRJA 3ITYA 5LNUA 3H70A 1T8QA 1VENA 2OO0A 4MKNA 3AC0A 2FMOA 1O6IA 4J5NA 1CGUA 4IMGA 4CNTA 1WPCA 5FSDC 1KKRA 1TCDA 4QE1A 1UUOA 3OODA 1M9HA 2Z26A 2BVDA 5C8BB 3TN3A 4MVAA 1ZGDA 4V28A 2E6FA 4HNNA 3KZPA 4H01A 4S39A 4NRSA 3A12A 1P0EA 2E28A 4IMDA 4HZ6A 3NO1A 1LJYA 4RCXA 4XKYA 3PC0A 4L4MA 4AZGA 1QATA 3W1XA 3WNMA 1JF6A 2BGQA 1TJ0A 3G3DA 4DO6A 2EPNA 4W86A 3S1UA 1ENUA 3WMLA 4AZHA 5JH2A 3MV01 1C8VA 3OOQA 4BQ2A 3GG8A 3P5ZA 1SFTA 4F9DA 1XIMA 4OBTA 2G95A 1D3HA 1JD7A 5JVLA 3B4YA 3MS8A 3GKAA 3LGGA 2V3EA 2VVSA 2DH2A 1A47A 3WNKA 2WJZA 3KDOA 5A2BA 1WKDA 1MI3A 1RP9A 3UFYA 3MKVA 5T26A 2E9MA 3T09A 3GFXA 4PMZA 2A6NA 4OFCA 3TYDA 3WBXA 4M24A 3UNDA 2F6XA 3POCA 3ZQ9A 1GJUA 3T7VA 3CAKA 2EJAA 2J7BA 3SCQA 1H2JA 1HP4A 4KRTA 2W4XA 2VFEA 4BHYA 2YB4A 1KRBC 1TTPA 3UESA 4PTNA 3EXRA 2FDMA 4US5A 5FD0A 1S5WA 1EP2A 3DENA 1VC4A 1FWCC 3WBEA 5JXQA 1W1B1 2FIQA 1LBMA 3O7UA 3MU7A 4Z1YA 3E12A 4OECA 3DERA 3NYZA 1TUXA 1MRAA 1YX1A 3EGJA 2I9UA 3M5VA 4ZB2A 2EO7A 3WFAA 3ARUA 3RR1A 3WQDA 1SUXA 1V8EA 3WBWA 3VFCA 3PFRA 4XAGA 1RLCL 4JEQA 1ZSXA 2BX7A 2Y62A 4LB4A 1R3TA 4HOWA 4UWMA 4U31A 4KRUA 1SJBA 1HJXA 3IAPA 4M19A 3ZYZA 2ZUUA 5E6ZA 4JN7A 2JKPA 1W3TA 4XZHA 1R3QA 4IJBA 2XYLA 2CXEA 4AEEA 1OD8A 1RCQA 1EO5A 3NNTA 1QUMA 5D38A 3RGTA 3GHSA 2ZXQA 4KH2A 2D3LA 2VFHA 4D6JA 2VGFA 1F3EA 3NCOA 2ZRVA 2ZUWA 3D6NA 2QPXA 4UUIA 4DBUA 1NDVA 2VGGA 3BZJA 3U5UA 2ALDA 3IVUA 4PGLA 2QCHA 5E0CA 1H49A 2VURA 4B16A 4DIAA 2GUBA 2J8TA 4W87A 4UR9A 4ROQA 2ACQA 3HM7A 1DJHA 1S1PA 3SUTA 4WSKA 1S1RA 4M5PA 1BXNA 1CGVA 1HKMA 3H23A 3QQ1A 3KHJA 1EX5A 3OZYA 3VKBA 4NZ5A 1KM6A 1EUNA 5D8WA 4CEUC 4PUDA 3PUOA 2Y8VA 3QQ0A 3EX3A 2VENA 5PTDA 1PSCA 4NYUA 4Y9NA 3W2LA 3M1ZA 1QNRA 4FNSA 1FTXA 3EPMA 1UCWA 3DFHA 2FZMA 4UTUA 4MFEA 3WDIA 1K6WA 4IIDA 4QLLA 2VFDA 4FZIA 4IUOA 1E40A 1IEQA 1CXIA 2DSKA 4AVNA 2J7EA 1VCFA 3V1HA 3HN3A 3ME3A 2XINA 5A6BD 1TTQA 5CAKA 5IFPA 3NZGA 3T81A 4QR6A 1NU5A 4J7RA 1SJCA 3ZIZA 3NQFA 4PC8A 2PWEA 3IARA 3CUFA 1FXPA 1DVJA 2OQYA 3UCCA 4LAMA 1BFNA 1SVDA 3S1GA 4TMBA 2Y89A 3RF9A 1CB2A 1JUEA 2F2HA 4MF4A 4K8EA 3ZSSA 1MEHA 3W73A 3EKLA 3S5SA 4DX3A 3RNDA 1IQ8A 3KL3A 2Z2AA 3BQ5A 3E1F1 1XDLA 3ARSA 2ZTJA 1DWIM 4KKXA 4FS9A 1T99A 1W9UA 5A8OA 4GHRA 1VR6A 3MSGA 1YPXA 1R85A 2QF7A 4FNTA 4H7VA 2OT1A 1JZ8A 1CTNA 3DC8A 3GK0A 3DYPA 2POTA 4XG1A 3SURA 2FYMA 1H1ZA 1KQYA 1Z48A 1NARA 5G4WA 4MB3A 4GC3A 3WQPA 3ITTA 2QCDA 2F7FA 2E8YA 3CK5A 4UFKA 3CZGA 1W3KA 4MPKA 3W88A 4UB9A 2OOFA 2V68A 1N7KA 4UZUA 5EMLA 1PWLA 1T96A 1E1CB 1CGWA 3RR4A 5B7YA 3S8HA 2Z1KA 2Q02A 2WVUA 3L68A 5CJ5A 1OHLA 5LA2A 5F4XA 2WVSA 4O1DA 1XBXA 1JGIA 2ICSA 3BAJA 4M6QA 4QG6A 3M5XA 1OFQA 3HO8A 2PDYA 4J3ZA 1WOAA 2TAAA 2QUTA 2P1FA 4CU6A 1QRQA 1XI3A 1XUZA 3M43A 2W27A 4HVXA 1OF8A 2GSHA 1KCLA 1M7XA 4LUJA 3WNLA 2HBVA 3LQLA 4HPXA 1ISWA 1QK0A 3R12A 1P1MA 4N6FA 5D9PA 2DT3A 1CB7B 4D6HA 4LYQA 3TZNA 1RVKA 4IIBA 3M6YA 2Y4SA 1O1ZA 1TPDA 2TODA 1TWDA 4FNPA 4U5IA 4XZNX 1W6TA 3NIYA 4GLEA 2Y70A 1SMAA 4FOKA 3C52A 3SCNA 4M6PA 1PZ3A 1JFXA 3CIWA 2XSAA 2YB1A 3M0JA 1BGGA 1REQA 2ESCA 3RM9A 2J7CA 1KA9F 5CSYA 1FX6A 2G96A 3TMQA 4NF7A 1AQHA 2FMNA 4JTUA 3P2VA 2XVPA 1O1HA 4MNLA 1EF2A 3C2RA 2FPVA 1XYFA 4PB3A 1L8NA 2WM1A 3MCOA 4BI7A 3UJRA 5I24A 1VFFA 1I2PA 2BMBA 1TPEA 1WZKA 3VGDA 3B0PA 2GQ8A 4IP7A 2I5QA 1S3HA 4QDWA 2VP8A 1LT8A 2I5GA 3GC4A 3V0TA 5A2CA 3A5VA 1GQIA 2QJJA 4BKNA 2ABBA 2O0TA 3VABA 1A49A 1X6LA 7XIMA 5BWAA 2Y24A 4LFYA 3TZFA 2CYGA 5FI8A 4UCGA 4NASA 3STEA 3SFKA 1PZ0A 3HG2A 5CGTA 5AVNA 1Y0EA 1LOSA 1VBJA 5DN1A 5G1MA 1W9DM 1CXEA 2CBIA 2Y1HA 3CZ8A 1XQKA 3B0XA 1U5HA 3OQ8A 1J0JA 1AH3A 4AC7C 1ZBVA 2WNQA 4JOMA 4LYPA 4FA3A 4WX2A 3H2CA 2LLEA 1XC4A 3VE9A 3T1GA 2J77A 1VBUA 2OSWA 1TV4A 3CUZA 3UR7A 4FLSA 4DYJA 4QFUA 1BYDA 4FF7A 2QMJA 3SO7A 2CXGA 1T5AA 4Z1BA 4RZBA 3TUUA 3UYCA 2WC7A 5DRCA 4GZ7A 2FB2A 4OE7A 1JL8A 4AVOA 3CUJA 4GIAA 5B80A 4IX0A 1J96A 1R9XA 4GZEA 3R58A 1ZQ5A 4AD4A 3DYOA 5IHSA 3S9YA 1HG3A 4G7FA 1MWOA 2VD8A 1CENA 4QXIA 4KBXA 1V08A 3OZPA 5A6TC 3OHIA 4LS1A 2NSOA 3W38A 3SAZA 2QGHA 2B7NA 2R82A 1VAHA 1A3WA 4UFLA 2EHHA 2FKPA 3KX6A 4KQNA 3HU7A 3UXAA 3TXVA 4YTSA 1GOWA 2Y7DA 1XP3A 3P82A 1XXXA 1R2RA 3GTXA 1LZOA 1YXDA 4NJHA 3WEMA 3W0KA 1VB9A 2PWFA 5CKSA 4CVUA 5M2FX 3ZMRA 1XD1A 4ALDA 1NFPA 2YJQA 5DQPA 4HK5A 1XYZA 3GHRA 2WWCA 3QGKC 3SY1A 2XIIA 5D2VA 2VRQA 4KFNA 3OQEA 5BXPA 3LK6A 1LP6A 4B3KA 5AC7A 1WA3A 4WOQA 3VO0A 4A8LA 1R9YA 2Z1XA 2VX5A 1LF1A 2XN0A 3LHWA 3H4XA 1AD1A 4WVXA 4R7OA 2XFYA 4R9OA 1V6WA 3UCQA 3F4VA 2IPJA 3MHUA 4LEQA 3TC3A 4N7QA 5LKYA 4A3QA 4HNUA 4AIBA 3LCLA 3VIKA 4N9BA 4KEZA 4QEEA 1U2YA 3AZSA 4AHQA 5AFDA 3CM4A 1XBZA 4I9MA 4WY0B 1J5TA 4XVDA 3KW3A 5I3GA 1YQ2A 2VGIA 3PNUA 1P0DA 1XICA 1RALA 3G1XA 2VD9A 1OZQA 1DPMA 5D4YA 3ARVA 3BJTA 3GDRA 4ZQRA 3GNPA 4GUGA 2GJLA 2PD9A 3CLMA 2BY0A 1FWBC 4C7GA 3B8IA 3CNYA 4YVXA 3KOZA 3TXZA 1ME8A 3NDZA 4NXKA 2V9DA 3I7SA 4X2PA 1LDCA 5HWNA 3IS4A 3NGJA 2ZA3A 3AIQA 2X0HA 3LERA 3AIUA 3ARWA 1JCNA 1ISXA 5EMJA 3MUAA 3UWEA 5C2XA 3T4CA 1TUFA 4JX4A 3H24A 4GCXA 2OOGA 1HKWA 3LTPA 4JTCA 2W0UA 2PDUA 3PZTA 1GYMA 3TNBA 6REQB 4PSPA 3CH9A 1GVRA 4XX6A 3SN4A 2WVTA 4TMCA 4JD4A 1PDYA 2P3EA 2QXWA 4ZO8A 3NQAA 3BW3A 2WNWA 2DORA 3ABOA 5A6JA 1Q63A 4FLRA 2GDUA 3G3MA 1A0EA 1Y5WA 3W27A 3GUGA 1VFTA 3LUTA 3PG9A 5D32A 1MMFA 5E5CA 2XGIA 2E9BA 1V7AA 1XLKA 4W5ZA 2E5DA 3BSHA 1I1XA 2YOCA 3HURA 5T9BG 5BRQA 3UQNA 4GE8A 4OT7A 3VOFA 2HMCA 4LWWA 2SFPA 5CC3A 1JDAA 3NZQA 1BF2A 3OBAA 3DG7A 5A6AA 1JCXA 1X38A 3EKGA 4CGTA 2ZX7A 3ZJ7A 4AZ6A 4B2DA 5TBOA 1XYLA 2WSPA 4W84A 4AB4A 2ZA2A 3K5XA 4RNHA 2YCJA 1JCLA 2CLOA 3MUXA 2OEKA 5HA7A 4YMZA 1KWKA 1GKRA 1J2WA 4AW7A 3O6AA 5D05A 4KW2A 4H19A 3CL7A 1K70A 1FWAC 3ES8A 4Y8EA 3HQPA 1UC4A 3R1ZA 2JQXA 3E0FA 1BXBA 2VEKA 1I8JA 3LI0A 3K8KA 4QS5A 3CQJA 2HVMA 1G4TA 2VC6A 3N15A 3TQVA 4Q6XA 4MTVA 3KE0A 2WCGA 1AZ1A 1C3FA 1TV3A 3LBMA 5CEWA 4S3JA 1OSEA 2EGZA 4D6FA 4J9JA 3GZAA 4D6DA 1KFKA 4B9ZA 4HMDA 2IQTA 4F0MA 5DXXA 4XVEA 3P0XA 1VCVA 4MZ1A 4DVOA 3B8UA 1R3WA 3FDKA 3TN5A 3UYIA 3N9RA 4Y6GA 3W71A 4MKVA 4G9PA 3WJWA 3S5YA 4BF7A 4WY0F 1VBHA 2YLLA 3QYSA 4GNVA 2FJKA 3SCUA 3RX4A 1PDZA 2BOGX 4OQVA 4MWAB 4ZOEA 3STPA 1QW7A 4I7WA 3ATYA 1VFLA 2QW5A 3WQ8A 4HPHA 2WVVA 4BQ5A 2R91A 3Q94A 3BCFA 1YMYA 2O4QA 3N04A 4UTKA 1LLZA 5DMMA 1SW3A 3BL3A 4O57A 3GY1A 3Q45A 5AC6A 1JNEA 1A3HA 3EWZA 1SW7A 1H3GA 5ABFB 2FJUB 2E8ZA 3W82A 4V1XA 2ZZ7A 1W5QA 3IVSA 1UMLA 3R94A 2D24A 3W83A 2YZ5A 3O3RA 3HJEA 4S23A 1H61A 1OFEA 2YCLA 3W3OA 4IPPA 1H5VA 4I9TA 1GG0A 4V33A 1UROA 2DZTA 3WH7A 2E6YA 3A9BA 1OIFA 1MEIA 1XBVA 5BMXA 3S47A 1I2NA 4LGXA 4HP5A 4C6IA 1O60A 4I7VA 3K13A 5XIAA 3ID7A 1VP5A 2YBTA 1F6PA 2JKAA 3R7MA 3MUY1 3W1UA 3OA3A 1JUBA 4O53A 4B92A 3TEVA 1PB0A 1LRNA 1IXNA 3W1LA 1XLMA 3AISA 4MLJA 3CJPA 1GVFA 3M64A 3L4ZA 3W85A 4GBDA 3NPUA 1GZ1A 2Z1BA 2DZBA 1UIPA 3UZ5A 4Q33A 1W5NA 3ARXA 4JYDA 3RLVA 5C6MA 2DFAA 4Z1AA 4UTWC 4AY1A 4DBSA 1K6AA 3IJDA 3H26A 3BH4A 2DZPA 1J0YA 1WZLA 2QAPA 2Z24A 4UC5A 4OJYA 4NJIA 4ZE4A 2CITA 3OHMB 1TR9A 4E4UA 3BGAA 3P14A 4XBSA 2VZTA 1DWHM 4L5ZA 2CZEA 1KB3A 3GVVA 4GI4A 4ERIA 4Q32A 3TA6A 1BLIA 2ZTKA 1K7XA 3VD9A 3PBMA 5IM51 1JDEA 2G8ZA 3MANA 4IG2A 1LUCA 3E96A 3BV7A 3W28A 1EGVA 1MUMA 2X1UA 1IWPA 3QY8A 3ZR5A 4MM1A 1R2SA 4BJHA 5DRIA 5EFDA 2CBJA 2PD5A 1LTDA 2Y7GA 1LRTA 3M9YA 3V0SA 1BVZA 2Q3OA 2FGLA 3FEQA 3Q58A 2OYLA 1F8IA 3PZMA 1SR0A 2OEMA 1LQ2A 3WUBA 4I8DA 3HGOA 4GXWA 1KRCC 4RE4A 4OZOA 1POKA 3EWXA 2HBXA 4MIMA 3O6CA 4GD0A 5F2MA 4FNQA 4AY7A 1LLOA 5F1UA 5F7UA 1TIMA 4M1BA 1IZCA 4PMXA 3B3DA 2MUCA 4XTIA 4DM1A 3IGXA 5JBEA 5D9NA 3OLEA 5F4SA 3QW4B 1W5OA 1RLDA 2V5KA 3G1RA 2Y7FA 3P62A 2YCKX 3KRSA 1VFMA 3GU9A 3B0UX 2IKJA 3WQ6A 1O5QA 1W9XA 2IKGA 1GKPA 5EYWA 4FALA 1FCUA 2XPKA 2AKZA 1KFCA 4JTTA 1Q2RA 4H2HA 1XLHA 1QI2A 3W26A 4XZMX 1Z89A 2Y2WA 3C3NA 5H8MA 4YXGA 1JYWA 1V6YA 3M0KA 4PRWA 4NHVA 5I3IA 1PCKA 2OB3A 1TPH1 4B91A 1UD3A 3W2KA 2D2JA 1QW8A 3N29A 1TJ1A 3UWWA 1WKFA 5HK4A 1M7JA 4KWSA 3U2EA 4AEFA 4UMCA 1I60A 1HZYA 4I6KA 5CBJA 4F4RA 2QULA 4AVFA 3WJZA 1Q3NA 1SPQA 4L1GA 2FVLA 4ZO9A 2F6UA 4A6GA 4C6KA 3PHAA 1A5LC 3VKJA 2BWGA 3EXSA 1XGEA 4ZQMA 3M07A 3KBJA 4FSAA 1UIOA 2PTZA 2JKEA 1E0WA 3C86A 3T78A 1TRIA 1I9CB 2PWVA 3QOKA 3GXFA 3R0UA 1AH4A 5CGMA 1PKLA 1XLAA 1ZAIA 3MYOA 2I57A 1JAEA 1EGMA 1KXHA 4UNIA 4HSOA 2D20A 3OIHA 5AHEA 5CZKA 2X2YA 3O6DA 1ITQA 2WCAA 3H55A 2GL5A 3OLGA 2REQB 3B9NA 1FWSA 4CNPA 4HD5A 3R13A 2O92A 2H9AB 3MO4A 3ITLA 3VC6A 8TIMA 3H2OA 3PBGA 2FH8A 1Q6LA 4H3DA 3LM3A 3EWBX 4NNAA 1TJRA 3GDMA 1UASA 1US2A 3G1SA 3AO0A 3N73A 3AOFA 3FYYA 4TVUA 4OKDA 5FJUA 5I3HA 2Q01A 1K77A 2CW6A 2CLLA 3TTSA 1RXOB 1F5ZA 4FLOA 4PULA 3SDOA 1HN1A 1ZU8A 1KM1A 1RD6A 3O05A 1ONRA 3NR0A 3PPCA 4IQLA 4R85A 1X6NA 4L80A 4O1AA 4M6VA 1DE5A 3SIZA 3O2LA 1D8WA 4A21A 3OLIA 1J79A 3KS6A 3UD6A 3MUCA 1MW1A 2NQLA 1WYIA 2C8NA 3QV7A 2PU0A 2NX3A 4HMNA 2GGIA 1K9TA 1WDQA 4WF7A 2ZADA 4Z2JA 4HJFA 1B0IA 2XM1A 3LXBA 3GLCA 1JDCA 3LHYA 1I1WA 1VYPX 1UR4A 3LB0A 3QMTA 4YNGA 3WDQA 3WQFA 1CW2A 3RPDA 4AD5A 4DF0A 4JTEA 3S0CA 3W1QA 4GX8A 3QHMA 2DT2A 4FF5A 5FF4A 4K6AA 1ADOA 1T41A 3EX2A 4RJEA 5U4NA 3ARRA 1VRXA 4K3ZA 2WAGA 3GVGA 3B9AA 1OYBA 1DJGA 1XG3A 3VUSA 1DXEA 6XIAA 3BSMA 2IQDA 2DZXA 2V5LA 1S5NA 2CFFA 4HN4A 2RJGA 2INFA 4M8UA 4JL2A 1HXJA 3W22A 3GC5A 3TYUA 5FJOA 3RRXA 3UXDA 5D09A 4E0CA 4XIMA 1DL3A 1YRRA 1GW1A 1IIGA 1PAMA 4QHRA 3DHFA 3VE7A 4V2XA 3GDLA 2CNCA 5REQB 3R5EA 3VOIA 1VCGA 2VCAA 1H51A 2AQVA 8CGTA 3M16A 4EPBC 1KW1A 3UP8A 4UMBA 4M7TA 1QNVA 1AW2A 3CUGA 3N9SA 1NF7A 1XHGA 1TPFA 5EB8A 3DKLA 3NQ7A 2CHNA 1HVXA 4KWUA 1GUVA 2R8WA 1KCZA 2DPEA 3VA8A 1GVEA 2EG6A 3LMYA 3EWYA 3E02A 5RUBA 4IPJA 4PB5A 1IXOA 3FXYA 3LPOA 4HCLA 1UB3A 2CKRA 4D1JA 1GOKA 1RCXB 3OZMA 4DJFC 1LLWA 3TV8A 2IKIA 3HPAA 5D02A 4GXMA 3G2GA 5M1TA 2HK1A 1U83A 1E6PA 1TPB1 1EKOA 4NY2A 2O55A 2AQOA 4UFJA 2PDIA 1FCQA 2R14A 4DYEA 5MF5A 3QV9A 3WQCA 5A94A 1LL7A 2YXXA 1M65A 2HISA 4HSNA 4PCSA 1NIUA 4XZLX 2ZUVA 4MWAE 1LQAA 4ZCWA 1ZJHA 2OR2A 3A23A 3VGGA 3KOYA 3KBMA 2QHAA 1I75A 1E0XA 4YN5A 4W9TA 3FV9A 4PMRA 4ORMA 1F3XA 3KCJA 1XRVA 3WMCA 1TV8A 1P1XA 3MSDA 1YE6A 4YPJA 2I16A 3ZVHB 1W5MA 3R10A 4OOZA 4JXCA 4Q7IA 3T8LA 3N11A 1OFOA 4LALA 3GNXA 2VEIA 3BAYA 3HG4A 3L2LA 4EKJA 8XIAA 1GOXA 3DI0A 2FVMA 1EHNA 3SM0A 4JQAA 1RSCA 4PBEA 4J4KA 1GK8A 3K4DA 3P80A 4LAKA 3BLFA 2DH3A 2UY3A 4X0NA 4H7CA 2VFIA 2V2CA 2OFJA 4M1RA 1JXKA 4LB3A 1H7WA 3XIMA 2PDKA 5FEXA 3WNPA 3BG5A 2ATMA 4JFTA 4A22A 1YLVA 5BU9A 4PCTA 4DQWA 1G1YA 3RX2A 3KP0A 4QE5A 1VPYA 1XR2A 2DW7A 3MZNA 4LAZA 1TMQA 1B5TA 4C6DA 3BANA 3AS3A 2PDGA 1QWGA 4PUKA 1QK2A 1NM9A 1Q7ZA 1YHTA 2OEJA 3VMOA 3HJZA 4L9ZA 5D9MA 1BWLA 1HL8A 1SYTA 1YIXA 2ODOA 4AF0A 3HMJG 4J2PA 4GQBA 4EP8C 3TWBA 3JRKA 2FHFA 4PMQA 4LUTB 3TIMA 2A79A 2QDEA 5IXEA 1O66A 4FOUA 3FK4A 2XTKA 4DNHA 1UD6A 1V02A 3W1MA 3LZ5A 4XAPA 5C7HA 4I6VA 3QY6A 3T0BA 2VT0A 2DZWA 1XCFA 2Q6ZA 3O63A 4J35A 4D6IA 3DFYA 2DV0A 3KM8A 1B3WA 5JBDA 2Z0IA 2VDIA 5DT7A 1EOMA 4RV8A 3VCNA 1W9VA 2NXIA 4DJEC 2CLMA 4D6GA 4LPCA 2A3CA 3M0IA 4IMAA 3NOEA 4JX6A 2WJDA 4PB4A 2DU2A 4S3FA 5A69A 2ZWYA 4B90A 5DCEA 2W79A 5IHRA 3CAVA 4AD2A 1ZJIA 4C6FA 1FDZA 4Z2IA 6ENLA 1RR2A 4B5XA 1EXBA 4LUIA 4NAEA 2NSXA 4CNNA 3LOTA 4C6MA 3UEQA 3IIPA 3PWGA 4DJEA 1WB0A 2R1MA 3UW6A 3TLQA 3VPLA 1D7FA 2X09A 2D69A 3KCLA 4DNMA 2QNEA 1WDWA 3LSBA 1XISA 1DHPA 3CEPA 1KGWA 3OVPA 3PN8A 1VFUA 4Q4SA 2RAGA 2EPLX 2IS7A 2V2DA 3CMGA 3RLGA 2PZ0A 5U7SA 2OLSA 5MHBA 2VEMA 1KRMA 3WZ0E 3A13A 4KWWA 2B81A 1KM4A 3BQ6A 1M53A 1WO2A 3VGFA 1OT2A 4L6OA 2DW6A 3MZ2A 1LM1A 2WQPA 3AMGA 3L2MA 3TQ0A 4H41A 4JCMA 3RPTA 5BCAA 4KETA 5DCDA 1EH9A 1VEMA 1E4IA 4DPQA 1FA2A 1TO3A 1ISYA 5TF0A 1EJTC 1OFDA 3TLLA 2YL8A 1DEDA 3I3DA 4F66A 9CGTA 3IAQA 2XWEA 2FZDA 4DO7A 1K03A 3WLIA 2NXGA 4NNBA 4ES4A 4GJIA 3VDGA 3SCVA 4ZBCA 5C71A 2EJ1A 3NQVA 1R30A 1DV7A 2A1YA 2C1GA 4WKAA 2AGTA 3C8FA 2WLYA 1YDNA 1ME7A 4IUGA 4O13A 4CNSA 4IMCA 4I5RA 1E73M 3I10A 3WLSA 1NDWA 4ACZA 3SFWA 1VYRA 4J3VA 3UA4A 1E4NA 2FFCA 4MYXA 3QGVA 4FX7A 5I23A 4XKYB 1AL8A 2WSKA 5A6SA 2AAAA 1TTJA 4Z0SA 2WOQA 5C9RA 3VK5A 1UD8A 3M0LA 4GBUA 2TYSA 3N3TA 4IMFA 2G3JA 4NYYA 2BY1A 3ITGA 3WF2A 3IVTA 1JYNA 4NUWA 3HQOA 2OKTA 4N4QA 2RGMA 5HAOA 1PX8A 3ALFA 2V3FA 3T40A 3GO2A 4JL1A 4XUGA 4W89A 2BVTA 1F2JA 4HK7A 2WBKA 3WLNA 1XLCA 5BXSA 3YPIA 1TB3A 1QPQA 2BB0A 1C8YA 3UZWA 3FIGA 4W93A 4Q4QA 1U33A 3LCGA 2VYOA 3IWPA 4NZJA 4GY1A 3BW4A 1TWZA 1BVNP 1GOOA 1AK5A 2ADAA 3H22A 2ZC1A 5DELA 3LNMA 1WZAA 5C9WA 5EGRA 5FF2A 3AYRA 3ITVA 4BCEA 5JIPA 1OBAA 5C70A 4O17A 1BTMA 2BY3A 3MCMA 3XINA 3O07A 3S2CA 1RQHA 2X0SA 3QM3A 4D2JA 4LVDA 4CD5A 1TYGA 3C6CA 2O9RA 1BD0A 2GUUA 4BZYA 2VX7A 3LHTA 4J3TA 2XM2A 5F2LA 4GFIA 1JEZA 1KBBA 3PPFA 1L6FA 3USZA 4R3UA 3AFBA 2WC4A 1PIIA 2E68A 4C6EA 1KTCA 2DQWA 3LM7A 1H63A 1EFZA 4R5EA 4UOZA 3GR7A 1JYVA 3VTRA 3EOEA 2WLZA 1W5PA 1QDSA 1D7KA 2C0HA 2DJXA 1OEPA 4W7VA 5TQLA 5LIXX 1WQ5A 3CS2A 3ICJA 4LH8A 4DUVA 3BZGA 2A2IA 5I7GA 3U2ZA 3OB8A 1W1YA 4O18A 4GQGA 3OO2A 1ZNNA 5AYXA 1RD5A 3BO9A 4GUFA 1F3TA 1E6QM 4XSLA 3BOLA 1K7EA 4RNJA 5AZ0A 3P93A 4FNUA 1AQMA 1JI2A 4CD6A 3DBPA 1JD9A 2XWDA 3LHVA 3MI2A 5HWJA 3SCSA 2PDNA 2ZZ5A 1ODZA 1P4CA 4IF2A 2DIKA 4EVZA 2IXVA 4O0QA 1QOQA 2GDVA 3OTRA 3L4YA 2C3ZA 2V0TA 1FDJA 2XFRA 1X1OA 3PAJA 4JAWA 3UWYA 3QBUA 1XLDA 5I6SA 3B40A 4GGHA 4KWVA 3NEHA 4DJFD 4HTYA 4BI6A 3NDYA 3E9AA 3F5JA 4XUYA 1B1YA 1ZPTA 4U2ZA 2OXNA 2VDGA 4ICMA 3EDEA 3AIVA 3UGVA 2YA2A 5DT5A 2ZVRA 1I6NA 2J6VA 2RKXA 2Z6IA 2PODA 3ARTA 4NX5A 2C19A 2FB3A 3QKEA 4ERGA 1YXYA 1UD5A 3S2MA 1IEVA 3S6OA 4A3HA 4XZ9A 3RMEA 1XYBA 1A5OC 1UKOA 3V75A 4R27A 5C9UA 3IK2A 5GJPA 2YDAA 1EJWC 3L0NA 1VJSA 3OVQA 4GZJA 3CMFA 3CYVA 2YKKA 4NXSA 3T0DA 3LPGA 4V15A 3SSZA 3VILA 4ROPA 1UOKA 4YWSA 3GNRA 4LRTA 3CHCA 4O1FA 2XFWA 4X22A 4Z42C 3SCTA 7REQA 1XLIA 1PHWA 3VKDA 1XRFA 3VGBA 5D2YA 1QPNA 5GNXA 3F4WA 3A21A 3GXTA 2ZCGA 4YVVA 2J7HA 4RKAA 4DUWA 4HU3A 5CPSA 1L9WA 4GNJA 2G41A 4O28A 1L6GA 1A4LA 4QDPA 2BNJA 4GFSA 2WZTA 3R25A 5IBXC 4L6DA 4F2UA 1HO4A 3CV6A 3KOXA 4KEVA 1MXSA 1UP3A 2BZNA 1X8CA 1ZZMA 1B3OA 3NWRA 2X30A 3W37A 3UG3A 1P6WA 3PJXA 4WEVX 3CT7A 3PSVA 1WBJA 2W92A 4WJEA 1SMDA 1YDYA 2GQ9A 4F2BA 5K7JA 3U48A 1R46A 2A3EA 3CO4A 3T0CA 1GWJA 4GG9A 2HVOA 2J8FA 3F5KA 5IBXA 1V5XA 5J5DA 3DOPA 1FWFC 3L2IA 1CX9A 3W86A 4UQ9A 3RDKA 1J11A 2ZZ4A 4A8NA 2H90A 4JKMA 2VVNA 3QPEA 4A4AA 1XFBA 2E9LA 3E0LA 5DEZA 3BWWA 3EMQA 1VS1A 1PTAA 1KM0A 4GYPA 2O7SA 1EJSC 3SCOA 4WXZA 1ZAJA 5D03A 4DWSC 1E9IA 1E43A 4AC1X 2JK2A 3U7BA 4CQAA 4AX6A 5FACA 1VIWA 2HCVA 3CL8A 3SADA 4GMEA 4XD4A 2NQ9A 4J27A 2H6RA 1QI0A 1V79A 4UQBA 2NUXA 3OG2A 5K2ZA 3O8AA 4YS1A 3KRBA 1FH7A 2G3FA 4DWSA 1YW1A 4AWEA 2H8XA 3TAOA 4AFYA 3HV8A 5JMUA 3W7RA 1JRCA 3BGJA 3AHVA 3AS0A 4ZQOA 1YYAA 1ZL1A 1A5MC 5E0FA 1TA3A 1W54A 3NM3A 4HCDA 4OGZA 2WYSA 1E6SM 1ZTVA 3K30A 5A2AA 2QUUA 3CHFA 3IRSA 2XVKA 2OSXA 3PJWA 1RJQA 1Z69A 3QYQA 1V6XA 3G1AA 4X63A 3VNKA 4E38A 4AIEA 2P3ZA 3DFPA 1ZBCA 1V3MA 4K8GA 1SFSA 4NX0A 4QLKA 5FAGA 3N19B 3MKCA 3DGBA 3MY9A 5LSMA 1V3LA 2CZVA 3TFXA 1BSLA 1OC5A 4FP1A 3VDHA 3CZLA 4CKQA 3MT1A 2J9YA 4L1WA 2J66A 3GAKA 3L4UA 4XISA 3SY8A 2GSEA 2QIIA 4LCQA 4EAMA 5HJLA 3NAVA 3AROA 5I79A 4LNYA 1AMYA 1JNDA 1TQXA 4G5DA 4EACA 4IL2A 3TTOA 2QJGA 2P10A 4Q4KA 1EJXC 4C5YA 1WOBA 5EY5A 5FJIA 5E1QA 5LIWX 1DBTA 2VC9A 4G7EA 4QE4A 1KFWA 3WQ4A 3GBDA 1TRDA 4CCDA 4GK8A 5FL1A 1B9BA 4JZ5A 5KINA 2CLFA 1FWRA 2WZHA 2QUMA 2BDQA 5GQBA 1BRLA 5AC5A 1KGXA 1QNSA 3VNYA 4LBRA 3URQA 3QVQA 4C7FA 1XH1A 4HQVA 1DQWA 1E6NA 1F73A 3AU6A 3W4RA 4QNEA 2ZRZA 3CPUA 1VRDA 3OGSA 2FH6A 3KRUA 1RP8A 2P5NA 1QPKA 3G1YA 1OGGA 3R8RA 3OJGA 4H00A 4H2CA 3EPOA 2E4TA 3OW1A 1GHSA 2VHLA 4IXXA 4PUWA 3SRKA 3W7LA 2PP1A 1ZFJA 3NOYA 5G5IA 1R0MA 3NXFA 3QHNA 3W2UA 5LGXA 4DZIA 1GGOA 4HNOA 4OBRA 4HB7A 3L5MA 5ENLA 3NM1A 2OZ3A 2YYUA 3OPSA 1UR0A 4ADTA 2CLPA 4ZTXA 3LV5A 4UR7A 1KD0A 3QOMA 1BKHA 2V6AA 5HUPA 3UVIA 1SSDA 1LOLA 1RK6A 1FWEC 4A05A 1EA9C 3QPZA 4Q8UA 1HTIA 3SN0A 3LI1A 3QW3A 1LYXA 4H83A 1EWEA 3F03K 3GTIA 4M0XA 3M6DA 3MP3A 4KRZA 3P3BA 1H7XA 3P7YA 4ML9A 1OFBA 3VNIA 3C2VA 3CT2A 5MKGA 3CPGA 5LNSA 3I6RA 1OFRA 1WDPA 4NJGA 8XIMA 3VX1A 3BOFA 1JR1A 3L0GA 1IWBA 2HNHA 1Z41A 1MW3A 4ZVJA 1Q6CA 2A3HA 3WLJA 2PWUA 4Z0JA 3WLOA 4E3VA 4YU1A 3O6YX 2V8ZA 4DXVA 4RPPA 3BLEA 4NAFA 5FJRA 1BWKA 2E5BA 3ABZA 3WLQA 4TXEA 3WL0A 4EF8A 4B5UA 2ZBTA 5AN7A 4LY4A 2RFGA 1GQNA 3S83A 1AD4A 1FKXA 5BRBA 3FW6A 3FAXA 1E1CA 1P6CA 3V36A 3PG8A 1FXQA 3CEUA 2DIEA 4L1XA 2MANA 3AHZA 3ELFA 3PULA 2ABAA 1O68A 3E74A 2YFOA 4O0KA 2ZXBA 1AMKA 3KL0A 1OWQA 1J0IA 3W1NA 2V69A 2PDPA 5GVJA 1TV7A 4MZYA 1EPXA 4C90A 2C1IA 5LA1A 1RPKA 1SJAA 3QEZA 4CCCA 1FY6A 2O9OA 2UY5A 2BASA 3MO7A 1B3YA 4TV6A 3QH2A 4H6RA 3OG3A 3RXZA 4D6CA 2PSNA 2OELA 2D0HA 1KQZA 3AIWA 7TIMA 5A6BA 4P7RA 3BG3A 4WSHA 3VM5A 1P0NA 3B8WA 4BEQA 2OVLA 4PFHA 4ENLA 3PZ9A 1CDGA 4M80A 4RDZA 3TK7A 4C6NA 4F3HA 3LLDA 3F4NA 1TV5A 1TE6A 5K3VA 4N4PA 4UOJA 1HF6A 3PJTA 5CJNA 2R1NA 4Q8VA 4I5UA 3BLLA 1TCMA 1ITUA 3P0WA 1ZP4A 5C7VA 1ZCCA 4EAYA 2AL2B 2V82A 1CXKA 1X7FA 3TVAA 5DY2A 1GQLA 3SRDA 2J27A 4QTGA 1CLKA 5JUVA 3W24A 3D3AA 2Y85A 1U1JA 3VIIA 1OZMA 4HA1A 4H9MA 4ZSUA 4QSFA 4DJDC 4U28A 2NT1A 4KMQA 4DBDA 4Z2GA 4UTJA 1S5TA 1XM3A 4JX5A 3PZQA 4J1OA 5DFAA 1JQVA 5FESA 2J6XA 4FPSA 2YBUA 2VCCA 1LWIA 1HT6A 3VAVA 1EIBA 5HJYA 3SZ8A 1S38A 1GZJA 4MNMA 3LBOA 1TJPA 1AJ0A 2PDFA 3UXIA 2XUCA 1JI1A 2HEJA 1F9CA 4UFIA 3AYSA 1VEOA 1YNPA 2JF6A 2WHLA 3NL6A 3WO8A 2DSZA 3VNLA 1I2RA 3L0KA 2ZZ6A 4UQEA 5HPOA 3WLTA 1G4PA 3V35A 3MYPA 4A3YA 3ERPA 3W53A 4OUIA 3IRDA 5J8LA 5DANA 3MA8A 1YTDA 2DZAA 3W81A 1VLIA 3APYA 3IIOA 4JGDA 1JZ7A 3MV11 3S1WA 2A7NA 5CBIA 3WLKX 2VJXA 1FFRA 3STGA 4C60A 3Q4DA 4ASTA 3EWWA 4O4WA 1CPUA 2GWGA 2AOSA 4AWUA 4ZMGA 1XV8A 1EYEA 4A8IA 3L9CA 4NT0A 1OF6A 3L65A 2VZOA 4O52A 1PIGA 1AQ0A 5CCZA 1Q6QA 1N8WA 4C1NA 3DG3A 2WBGA 3V5OA 2J7GA 2YCLB 3H53A 4TTGA 5BOOA 2C15A 4MNJA 4N6EA 3A4XA 1ZHAA 2D0GA 1MZRA 2PDMA 3QFWA 3I4KA 5E0KA 1Q65A 3EMCA 3BMVA 1RBLA 4WDTA 4J3WA 2CLKA 4JQ4A 6CGTA 3GDTA 4IP5A 4HOXA 1EHAA 2C1HA 3V7PA 2CCRA 1Z3NA 3M4HA 1PXGA 3CV1A 1KBIA 3ABRA 1B3VA 3DFNA 5LIKX 4TVCA 3PBWA 3IGHX 3EX1A 2E67A 5FF3A 1QNQA 2B7QA 3G18A 1NFBA 1R7AA 2EQDA 3F2BA 4MB5A 1XLLA 2XHYA 3O15A 4DXXA 1R3SA 3CC1A 1CWYA 2VR2A 1XYAA 5LA0A 4N9CA 3M41A 4HA3A 4XZIA 4GUJA 1BG4A 2FTWA 3NG3A 3IJ6A 5EPDA 2RDXA 1TELA 2PGWA 1ZJBA 1A0CA 4IIEA 1QWKA 1A80A 4A3RA 2Y88A 3GW0A 2ISFA 3C3UA 4LAOA 4WDUA 3GAYA 4CQCA 4UTMA 4MJ2A 1E9ZB 4S3GA 4ZQPA 5HULA 1JQXA 5A8QA 1E6RA 4Y90A 3B0YA 4L4OA 4QNWA 3GNDA 1DYSA 7TAAA 2TMDA 2VC5A 1GTEA 3QJAA 3GVQA 2VWSA 1Q6FA 3NUKA 3AAMA 3PNZA 1QU4A 4E6MA 3NDOA 5JU6A 1M04A 2HSAA 4IG2B 2GVYA 4XBJA 1LUCB 3BLKA 4JNZA 4E2VA 4JN6A 5JIWA 3QQWA 3PTDA 3CIXA 2IKHA 3VU2A 4AYSA 2L5HA 3STCA 1DQXA 3LRMA 4PFMA 1WDDA 2VO5A 3M7SA 3EWUA 3FYOA 3NEVA 3FCPA 3R8GA 5CAHA 1UWIA 4DEFA 4OU1A 3I3EA 3A6OA 4TUFA 5E6YA 3W7KA 5DO8A 2E6AA 4R53A 2BXYA 1DJZA 3AYVA 1L6SA 3S6TA 1W1VA 3QSTA 4YWIA 5L9FA 1CLVA 1V93A 2B7OA 1VHCA 1NH6A 3ZT7A 3GYEA 1JULA 4UQDA 2AGKA 5IRPA 4AXNA 4FR6A 1BQCA 1R87A 2GQ3A 3BOXA 2GFTA 1U22A 6ALDA 1EUAA 1DORA 1EO7A 4C6JA 3T08A 1UH4A 3B9EA 4LCRA 2YR1A 5EA9A 3W9ZA 3UWQA 3GH7A 2E0PA 4FXFA 2ZA1A 1RA5A 5C0QA 4HZMA 1QI5A 4IOTA 4NSBA 2W62A 2QR6A 2Y61A 4UTTC 1QNOA 4YHGA 3FA5A 1PTGA 2OX1A 5AOUA 1JCTA 3GB6A 1TVLA 2UZ9A 1FHUA 2ISWA 3Q2DA 3KOWA 4H6KA 4LVAA 1HX0A 5AZ1A 1SJDA 6XIMA 1DKWA 1MNZA 4B15A 4IFKB 1UZDA 3LHZA 1JPIA 5JQ9A 5G2WA 3ITOA 4K2SA 3W1AA 4UTTA 4BWLC 3T6CA 1YPIA 3KL5A 3GR4A 1A0DA 5A8MA 4RW5A 3PZOA 1MYRA 4LAUA 3G0UA 1C7SA 3QV6A 1D8CA 2Y5JA 1R8LA 4IPIA 1DJIA 3WMSA 4OOUA 3T9PA 4GI8A 5T9CE 1N2VA 5D04C 1T8XA 4O54A 1R3RA 3MSYA 3CHDA 1OX5A 5CG0A 5A8PA 4DZHA 3WX7A 1UWRA 1M7OA 1OGBA 1B57A 4AZCA 1OFPA 3G0SA 4KGJA 3BLPX 1J5SA 1EDTA 3N2XA 3ZSTA 4AQLA 4XZBA 2QJHA 3GFZA 1UKQA 4TR9A 5G4EA 4CN6A 4PE8A 3PZNA 5DCBA 1UH2A 3GIYA 1S2TA 2UY2A 2DT1A 1YEYA 1UZHA 1GNXA 4U5KA 4GQRA 4BQ4A 4GOAA 5A1AA 2YXOA 3THCA 5AVHA 4Q3MA 3WSUA 2AQWA 3VC5A 3L21A 1P7TA 3HOJA 3TCEA 3KVMA 3EKZA 5J04A 1TVPA 1SM9A 1W1PA 4IT1A 1Y8BA 2NLYA 4ZFMA 2BTMA 3VIJA 1YKWA 4LQ1A 2B7PA 2CHOA 3ITXA 1IEWA 3WDHA 3MKKA 4K37A 3TYCA 4EOUA 1QHOA 3PBUA 1TTIA 1Q2SA 2PBGA 2O9TA 3SIMA 4A8RA 4MGGA 4Q8WA 2Q8ZA 1CXLA 2NXHA 7PTDA 2GGHA 3BICA 3TW7A 4N0RA 1QI3A 4HPNA 4YYCA 4EPDC 4WCJA 4LYRA 1XIHA 3QFEA 4LXFA 5AHLA 4H8NA 1QTWA 3KUMA 2DVTA 2GQAA 1J10A 5EU9A 5CG7A 5B7ZA 4W7WA 4M3PA 3MBDA 4Q22A 2CLHA 3UWUA 3W1TA 4NG3A 5DX7A 2VTFA 4Z1CA 3NJ3A 1H11A 3DX5A 1X96A 3TN4A 1NOWA 1Q45A 3S42A 1YXCA 2I7GA 3LS9A 3D3FA 4NILA 1C7TA 1IT7A 1GOMA 2Q8LA 3V1PA 1SGJA 5HQMA 2A4AA 2RDTA 1GPFA 3LNPA 3QN3A 3VIGA 3TX9A 2NQZA 5BYWA 3SJ3A 1G69A 5ECVA 1JG9A 2YCIX 1J01A 1E71M 3RILA 2QZRA 2A85A 3WH6A 1E9YB 4OV4A 4DJDD 2H3BA 2HNEA 3N2TA 1JUKA 1JDFA 4HZ8A 1H7RA 2C16A 4ZOBA 1E70M 1RZMA 2VI0A 1EZWA 4F40A 3EYPA 1GQJA 2EXOA 3GBEA 3F2CA 4FLQA 1OCBA 4IIFA 3ZR4A 3IUDA 3A3HA 3DHPA 4GRSA 4JKKA 5LNRA 2CKSA 4ZODA 2OQHA 1TJ2A 4YLWA 4WD0A 3NQ8A 4RE3A 2Y63A 4UTIA 1MRQA 3VIOA 4UTFA 4J3SA 4BFAA 3W7JA 4HU0A 3FGCB 3QMRA 4RDWA 3BJSA 3G1VA 1RH9A 2PAJA 2DEPA 4O1CA 5A6KA 4AHOA 1P0KA 4NVTA 2WQDA 2DUXA 1GPWA 4IQJA 3DG6A 4ZSTA 1V51A 1Y7VA 2EEXA 4P7LA 1DOSA 5KITA 4LT9A 3W2NA 1RA0A 1EJ7L 1BEUA 4GCAA 1M01A 4JHMA 3G5EA 4QJ4B 2GK1A 4JTFA 4V1YA 4LYKA 1W17A 1E6ZA 3GKFA 4E4FA 2WC3A 4AY8A 4XSMA 3IIZA 3ZWSA 2GOUA 3SQMA 1M3UA 4MNKA 4IFRA 5H2ZA 1W3IA 2HJPA 1RQEA 3VXGA 3KBVA 1VPQA 4WJ8A 4NI3A 4QITA 3PF3A 3BMXA 1MZHA 3MB9A 1J0ZA 1QCWA 1OINA 1ZJAA 2MNRA 4GPNA 3VOCA 2VR4A 5DXYA 4DELA 1IWAA 4GQ0A 1JZ6A 2HE5A 3WLMA 3DN5A 4ZEPA 4C91A 5KZMA 2QV4A 2CHRA 4JNMA 5F2IA 1C93A 4PUJA 3AXMA 1POJA 2ZX5A 4TQTA 1GONA 3T55A 3PK7A 4MUPA 1FH8A 4F9JA 1XBYA 5CPMA 2CBVA 3R4IA 4E3TA 1T7LA 2WKLA 4PMJA 4Q8TA 4P8XA 1XDMA 3SRFA 1JZ5A 1XIEA 1EC8A 1SZGA 3TR2A 1NP0A 4FIQA 1O94A 2PMQA 3L5AA 3SRHA 4E8DA 3T05A 3LMZA 4RK8A 5HNUA 3DKJA 1E72M 4AEOA 1E0UA 1NWTA 4OV9A 2XZ9A 2ISSA 2YIHA 3S5ZA 5D2WA 1OFAA 4LC8A 1SQ7A 3NQ6A 1W1IE 5FF7A 1A5UA 2P0IA 1YPFA 1DWJM 3SGZA 3I68A 4GI9A 4IGHA 2EPMX 4WIWA 1U5VA 4P7OA 3OBEA 1RK5A 1O95A 2CEQA 1DIOA 3QTGA 4ORIA 2QJIA 1W3LA 3CWHA 3J7HA 1O12A 1O7AA 4XK2A 4QISA 3KBWA 3VNDA 1HL9A 2VZSA 6TIMA 2EKGA 4R34A 1HO1A 1E6XM 4MB1A 1FP9A 1JPHA 3TSMA 2PRMA 4QQUA 1OC7A 1P43A 4JTLA 3CUXA 3TNOA 2W67A 4PUNA 3W7MA 4UTHA 1KRAC 1V7YA 5GJNA 2VQTA 1KC7A 2F84A 3TYEA 3TQPA 1SO6A 4P8UA 1JVNA 4LTSA 2CESA 3RG6A 1XS2A 3MMTA 3R8HA 2YX0A 1XFCA 4UTLA 4LANA 3RIKA 1VPXA 2DSWA 4QJ1A 3SQLA 2QGYA 3WUFA 3WNOA 3VOJA 2ZX8A 4X0VA 3UT0A 3CYJA 3SB0A 2VUYA 3E0VA 5XINA 3NURA 3WEZA 4NAEB 2A7PA 2JEQA 3WD4A 4EWND 3WLPA 1IHIA 3AS2A 3KTXA 4QCEA 4QBXA 4KCWA 4B9YA 1QHZA 4DN1A 4KWOA 2BHYA 1ICSA 1PEZA 3S5NA 4GI6A 4R9XA 1FCVA 5BOFA 1H62A 4JY8A 4CEXC 3C0SA 4WRHA 2GJXA 5AECA 2I9EA 3O16A 2GJNA 4CD4A 2E1WA 4C6CA 1G6CA 3ZM8A 4A35A 1BVWA 2F61A 1KGUA 1ICQA 1M6JA 4EE9A 1N55A 3THQA 3T2OA 1RUSA 2P8CA 1UBPC 3EA2A 2QEZA 4PMVA 3VKKA 1AH0A 3O9NA 1PYFA 4LS2A 3GXPA 3VYLA 1OYAA 4ZXOA 3RM4A 4MUZA 3SI9A 4RR4A 2YDSA 1N8IA 4BI5A 1XPGA 1HKJA 4NJKA 2CZDA 2ZZ3A 5HQLA 4LX4A 1VBGA 4RE0A 3FJ6A 4JFUA 3GR8A 3UETA 1FUYA 1CBGA 4M56A 3WBAA 3KCOA 4KEUA 3UR5A 1SZRA 2WZMA 4FHAA 3SR7A 2HS6A 3KP1A 2HPIA 3WQVA 4ZZ9A 1W9BM 4JY9A 3FEMA 4INFA 2OODA 1Z44A 4B5SA 3S1XA 1EB3A 4UFHA 4GYFA 1XCWA 1HL2A 1EIXA 4ACYA 3DAQA 4PBFA 3C2FA 5IDIA 4JTKA 1E5JA 4H9XA 4D8LA 4B5WA 2UV8G 1UKPA 1B4EA 1P48A 5HR6A 1EC9A 3QC3A 2J75A 2XH0A 4R33A 5C2GA 2PF0A 5BWFA 4PUMA 3A22A 3B8VA 4ACZB 1UA3A 3OU8A 1C29A 4GQQA 3UWVA 4FXRA 3H2NA 3PR2A 5CC5A 1NP2A 3KBNA 1WV2A 5I3JA 3P5YA 5F2GA 1D9EA 4MWAD 3M0YA 4JQ1A 5EMMA 1TV2A 3DU0A 3DECA 1UWSA 1PCWA 1WZMA 3LX9A 5D2XA 1VJIA 2C71A 3BURA 5H8PA 3TDFA 2IPWA 4DI8A 4DHGA 1B9ZA 3GH5A 4GKTA 3MP4A 5FAJA 3CQIA 4Z1DA 2ZE3A 1AFSA 3PBVA 3L23A 2QCLA 2GZXA 4NIRA 5G4HC 3EEZA 1TQJA 3PVFA 1F76A 1Q85A 4EK7A 3ARZA 3GH4A 1ECQA 1TWIA 4ATWA 2EPOA 4WK9A 3KXQA 1OIMA 4JTGA 4GYKA 2OZTA 1DQUA 2BFGA 3VOGA 5CC6A 2EPHA 3BAWA 4ONVA 1CEOA 4CN1A 5BROA 4KIEA 2EG8A 3BAKA 4WQ6A 4RZ5A 4AG0A 2YL5A 1PPIA 1RY8A 4PODA 1S2UA 1H7OA 4LUSA 4GABA 4BY3A 1J0KA 1FWGC 1LOQA 4UZSA 4BQ3A 2XISA 4FX6M 1FHVA 3WDJA 3IJ7A 4IQEA 3ISIX 1FH9A 4QX4A 3WDRA 3LCXA 4GUHA 4FOJA 1J18A 1V6UA 3F7JA 3WFZA 1HVQA 3M47A 4Q6JA 4IPLA 3ZVHA 1F4AA 4YIWA 4ECLA 1NWSA 4ZQCA 3HG5A 3NVDA 2YW3A 5E9XA 4QIUA 1CXHA 2ZC8A 4Q8QA 2P88A 1UPMB 4N9DA 3QY7A 3FOKA 1UW9A 3ANUA 5CZTA 5HUOA 3S4TA 4S3BA 4LV4A 1Z9AA 1NDZA 1OK6A 2GVEA 2ZUNA 3H7RA 5GPRA 2NQJA 3BPWA 3WK2A 2VXNA 1MXDA 4IIHA 5K9CA 3HGSA 2G3NA 1XUUA 1RCOB 1XKYA 1LRQA 1MXGA 4IPNB 1DTUA 1KXVA 1NQ6A 3GXMA 3NA8A 1KBLA 5XIMA 2F6KA 1IT8A 1EEXA 1CECA 3WYZA 3LA4A 1J6PA 3AHXA 2A5HA 3KZSA 4DAFA 4X60A 1UKTA 3F5LA 4QDMA 5HMDA 1IZJA 2VCBA 1V3JA 3W2MA 3M0MA 2FQIA 3W29A 5K9XA 1JIBA 3G8RA 5I02A 3WQOA 2Y0FA 3PZUA 4FMVA 1X8FA 3NL5A 1A4MA 3AHTA 4H8UA 3N4AA 4C1KA 4QAWA 2PE4A 3CV7A 4JTRA 4M29A 2BHUA 4DYKA 4BK9A 2CWNA 3N2CA 3O06A 4O8AA 3DCPA 1J2BA 1AJ2A 2QMKA 2OWXA 4Q8MA 3UBPC 2TRSA 4DUOA 4U33A 1HJVA 3URAA 3I4EA 5I3DA 5ABGA 2G3IA 1UR8A 1L8PA 2E77A 4GIYA 3WJXA 4UOQA 4L64A 1V0NA 3ZJ8A 1UQZA 1A5SA 1YBQA 1NAL1 2WMFA 1W3JA 4PBGA 3PANA 2OWCA 1NTHA 2QT3A 1QBBA 5BRPA 2Y5EA 3VIHA 3NQDA 3UWZA 2DVUA 1WP6A 1OJXA 4UNLA 2Z6JA 3ONBA 3MUZ1 2UBPC 1HKIA 1SZFA 2JIWA 4NZ4A 4QSHA 3WD2A 1G0CA 2QDDA 3N6QA 2Z25A 3W6LA 1A5CA 4QEHA 4PL2A 4LU0A 4RZ6A 1OG0A 3E2RA 3VD3A 2ZX9A 3W70A 2HXTA 9XIMA 4KPLA 4REQB 4KS0A 5HATA 4HPGA 2YPIA 1OCJA 2BHZA 1C90A 4W8LA 2ZRXA 1UWTA 4HNCA 3EX4A 1CGYA 2ZWZA 2NV2A 3WH5A 4Y9MA 4HU4A 5CLWA 5DLCA 2WSYA 3JW7A 3N4FA 4JIIX 3FY1A 3UGRA 7REQB 4QROA 4DBEA 5I5RA 1R9ZA 1M1BA 3H8AA 3VD5A 3VDAA 3VKCA 3VI2A 4ILSA 4GX9A 4MY9A 4UTWA 5HWMA 3LRKA 2QUVA 4KEMA 2ZDRA 4NZCA 3GQYA 4LC6A 3LGDA 1TZ7A