3GDKA

Crystal structure of the orotidine 5'-monophosphate decarboxylase from saccharomyces cerevisiae
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
260
structure length
260
Chain Sequence
b'KATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
total genus 101
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gdkA00
2FFCA 1WV2A 2FB2A 1JVNA 3IIZA 4X22A 4IX0A 3M43A 3MHGA 1S3HA 1OK6A 2Y7GA 1I2RA 3MBDA 3DFSA 1M7PA 4K7VA 2QKFA 4A2SA 3LOTA 3B05A 4M5PA 1ZJIA 3W70A 3I68A 3M5VA 3A5VA 2Y7FA 4E0CA 3P8JA 5DCDA 3T44A 3A22A 5TIMA 3N14A 4FX6M 4EF8A 5LZLA 4UFHA 1MXSA 1ZY9A 4UR8A 1W5QA 4GJ1A 4JX6A 1MZHA 4JICA 1DL3A 2ISVA 4DPPA 2ZYFA 3SJ3A 4EVZA 1FQ0A 3BPWA 5KSWA 1IIGA 4R53A 2OMAA 3VNDA 2G97A 4UTUA 5G1TA 4O8RA 3CB8A 3BLIA 3MW7A 3ZWTA 2X16A 1W3IA 5DCBA 2C16A 5F2IA 3P74A 5G1YA 1UUOA 5KTLA 4UTWA 1SZFA 1KLYA 1QR7A 1XBYA 1A5SA 3HB9A 3HG5A 3HG4A 2RDTA 1RPXA 1KM4A 3LHTA 4IQLA 1YPFA 4O16A 1K3UA 3R13A 1Q6OA 1NSJA 4JTIA 4YL2A 3UY8A 4BI7A 4WY0B 5K4XA 2NUYA 5D2VA 2A6LA 1LRTA 3GYEA 2H3BA 3B03A 1OFEA 3NQ7A 2Z6IA 3PB0A 4IXHA 5DLCA 4IMEA 2WQPA 3TFCA 2RHGA 2FIQA 1H50A 3NR0A 3MP5A 3NG3A 2QUTA 4N9EA 1CW2A 2DZXA 4JTUA 1YXYA 4B5NA 1H7PA 2C13A 1PS9A 3E9AA 2QCGA 2CLIA 1F7BA 1TV7A 4IWWA 4UUIA 1PE1A 4YCPA 1A53A 1VH7A 4LC6A 4UFIA 1WBHA 2F7FA 5GVJA 3P7YA 2QCNA 3A5FA 1OYCA 4ML9A 4ZQPA 3NZ1A 1TIMA 4BWLC 2VFHA 3UWQA 4OGZA 3MJYA 4O57A 3QH2A 2CU0A 4XTDA 2GPTA 1PV8A 3W2LA 1U5JA 1KFKA 1AG1O 1D3HA 3C2FA 3DU0A 3ZWSA 5AC6A 1BWKA 3NQDA 4LVDA 4XTIA 1OFPA 4LNYA 1LOSA 5D2TA 4LTSA 3KRSA 5IM51 2H8XA 2E6AA 5CPMA 4LVAA 3W2UA 3PUOA 4X9SA 5LNRA 3LRLA 2GJLA 3SGUA 3STGA 2B0MA 3DZ1A 1WAUA 1W8SA 4LVFA 1XXXA 2TMDA 2BSLA 5CSSA 1BKSA 3T55A 1AW5A 3W83A 2I1OA 1K7FA 3S5ZA 3SSJA 1IXPA 1ZCOA 4BF9A 1LTDA 4ONVA 3CC1A 3THAA 1W5MA 4CNNA 1HUVA 1JJKA 1SUXA 4UFKA 5FF0A 1TPEA 4WOQA 4ZQMA 3L68A 4DQWA 4TMCA 1GWJA 3G0XA 1W56A 1FCQA 5BRBA 3CLMA 2R8WA 1W54A 3E02A 3LBMA 3MHUA 2QCHA 2AQWA 3O06A 3R89A 4LY8A 2YYTA 2ZZ7A 4N02A 3R5EA 1UB3A 3PBUA 4NNBA 5I3FA 3OVPA 3EEGA 2YR1A 2QDGA 3OBKA 5G2WA 3TMLA 3LTSA 3TA6A 5DBTA 1Z41A 1X1ZA 2FLIA 1DBTA 3O6DA 1IXOA 1OFQA 1EUAA 3EWYA 3OA3A 4UFLA 1VJIA 2X1UA 3AJXA 1TTPA 2BWGA 3NQVA 1SW3A 1S5TA 4HSOA 4IPJA 5G2IA 1TQJA 2TRSA 3F1QA 1LZOA 3MHFA 1XBXA 2ZZ6A 3M16A 1K03A 1OK4A 1J4EA 4LW7A 4U4MA 3B8DA 4JY9A 3QSTA 3I65A 1GVRA 3FKRA 3EWUA 1LOQA 2A7PA 3DKJA 2R14A 1VCVA 4MKNA 3D0CA 3SIZA 3NDOA 4AVFA 3BG3A 2E77A 1AW2A 5K9CA 1YLVA 3KOFA 1H5YA 4PL1A 4O10A 1VC4A 3RU6A 3TJLA 2EKCA 1F05A 1EPXA 1AK5A 5KMYA 1AL7A 3UQNA 1IXNA 2E5DA 1YDNA 3W88A 2V9DA 1IIHA 4TO8A 3WFAA 3INPA 1GVFA 4P61A 1TTQA 3NQFA 3TU9A 1A50A 1KFLA 5EBUA 1Q3NA 3TXVA 3W1MA 2A7RA 4IMFA 1K8YA 5KZMA 2GVLA 2ZZ2A 1GVQA 3EXSA 1JCYA 4XUGA 2QJIA 1RQEA 2EGZA 1NAL1 3KHJA 1TJPA 3O15A 2V5LA 3BG5A 4HNNA 4OHQA 1H63A 2ZA2A 1D3GA 2BXVA 3RF9A 5LNSA 3GVGA 2P1FA 3NL2A 5FEXA 3FOKA 4EF9A 4UC5A 3TV8A 3MI2A 4UMBA 2OT0A 3DFPA 4GRSA 4GWEA 3NQMA 4AWUA 4O0KA 3TUUA 3E0IA 4I9AA 1F5ZA 3C2RA 4HHPA 4JNMA 2QUUA 5TQLA 2YSWA 4JTEA 1EP3A 3LV6A 2E6YA 4QQ3A 1VHCA 4A29A 5D38A 1Z44A 1Q6QA 2C14A 4NJKA 2ZDRA 4FNRA 2Q3RA 4H6KA 3PY2A 5I3GA 3G1FA 4GNJA 1H51A 2V2DA 4FIQA 2GUUA 3PSVA 3TKFA 3P81A 1LLZA 4Q32A 1KBIA 4IPIA 4CNPA 3GKFA 1TREA 3TFXA 1R2RA 2FQIA 3W2KA 1AMKA 2WOQA 3GIYA 4O12A 2DJLA 1TO3A 3DFQA 2VFFA 3V1PA 3LCGA 2NXIA 1T8XA 4NT0A 4DO5A 4Z0SA 3UZ5A 3TJXA 3U6WA 4ALDA 2Y89A 2Z2UA 5D2XA 1HTIA 3TR2A 4KFOA 3SFKA 4HNVA 3CIWA 1YTDA 1R2SA 2AGKA 3FYOA 1LORA 2Q3OA 3KVMA 3TW6A 2QJGA 3BW3A 4TR9A 2JKEA 3M44A 3B4UA 2V0TA 2Y6ZA 2B7OA 5BMWA 4JTKA 3RK8A 2EAWA 4FEZA 2TSYA 2B7NA 2OCZA 1JRBA 3W72A 2NX1A 3ATZA 4PA8A 4FNPA 2CWNA 4UFJA 1VPXA 1GVSA 1I2QA 3W84A 1FDJA 5LSMA 5K9XA 4GBUA 3LGEA 5CPOA 4JTTA 2RDWA 1PIIA 5F1VA 4AWSA 2KZHA 1G4SA 3VCRA 2UV8G 2ZQ0A 2CLFA 4NNAA 1XUZA 2RDUA 3KAOA 2A2IA 3ABQA 5IBXA 1UJPA 3A9IA 2WSQA 3UWWA 5F2LA 2EPHA 2FB3A 2NUXA 3T4CA 3PF3A 1RV8A 4LV4A 4MZ1A 2Y70A 4GXMA 4U28A 3UYCA 1GEQA 1EB3A 2CFFA 1BEUA 2ZZ1A 6TIMA 2WNZA 5AHFA 1SPQA 3A21A 3LDVA 1I2PA 1VYRA 5D32A 3Q94A 3GR8A 5CZ0A 3HBLA 4O17A 2NV1A 3GDTA 4NX0A 3HMJG 1ZAHA 2E6FA 1SW0A 2VEKA 3P62A 3W7CA 1EWDA 2ATMA 4ZZ9A 3W7EA 2DORA 3G1DA 1LBLA 3OHIA 3HGOA 5KZDA 1GTEA 4AHQA 1O94A 2X30A 3IIVA 3O1NA 2A21A 1W5PA 1QPQA 4UIOA 3QMRA 1QOPA 1VS1A 5F4XA 3NQCA 2WKJA 4YLWA 2E5BA 4RK8A 5BOOA 2EF9A 1KM5A 1C8VA 1XFBA 4OE7A 2XN0A 1Q6RA 3SR7A 1KTCA 4JD4A 2QCEA 3LCWA 4JR5A 3IRDA 3G22A 4A2RA 1O4UA 3PWAA 4UXDA 2A1YA 3W1AA 3VE7A 2YZRA 3QJAA 4KKXA 4RXFA 4AHPA 3H53A 3TQKA 1OX4A 3FKKA 2VELA 3S9YA 4AWTA 4RCXA 5DCEA 3MBFA 3NL5A 2GOUA 4UTLA 3M47A 2CZ5A 3RLVA 4O53A 1LCOA 3S5OA 5FEPA 4UTWC 3SECA 2CW6A 2TPSA 3MWAA 1ICQA 4DELA 4DBEA 1LOLA 3CU2A 1G4PA 2QCDA 4AMAA 2CZDA 3LI0A 3QPZA 3IVSA 4O15A 2CZFA 3B0UX 3G3MA 3QMSA 1SSGA 1ZHAA 5FI8A 1WX0A 3IVTA 3NM3A 3L0GA 5K9DA 4FXRA 3S5NA 5K4ZA 4ZMGA 1YTKA 1N8FA 3L65A 4NUWA 1DVJA 3W7JA 3GAKA 4RJEA 3UZJA 1TSIA 2ABBA 4C1KA 5CGQA 5HQEA 5SWUA 2OT1A 4Z1CA 1TQXA 3BG9A 2A85A 2ABAA 4L4LA 1WQ5A 4YMZA 5L9FA 3W7PA 4P2VA 4CNOA 4YXGA 4UFMA 3RNDA 1YXCA 3TXZA 3WJYA 2YXGA 1B4EA 3WK0A 3N2XA 4LU0A 2W6RA 3MI3A 2C0AA 3STFA 3UPBA 3M9YA 3P5YA 3O63A 1WYIA 4BR1A 3TAKA 4R33A 1R2TA 2G96A 1VLIA 3WK3A 1N55A 1YXDA 3N9RA 3TH6A 1PCWA 1CX9A 4UTHA 1SZEA 3EKZA 1ICSA 1O5XA 1TPVA 3P84A 2VOMA 1GT8A 1TJRA 5KITA 1LP6A 2PRMA 2QDHA 1QPOA 2RH9A 2XN2A 3W71A 3R2GA 1G69A 3QQ0A 4XQ6A 1TYGA 1G6CA 4CQAA 3BVJA 3ABRA 3IV3A 5FF7A 2IQTA 3W6YA 3LXAA 1TRDA 2VEMA 3PVFA 5LNUA 3IIXA 1MEWA 2NWRA 3KVKA 2E6DA 4LVGA 3OIXA 1PVNA 3EWZA 4S2CA 2BLEA 3P61A 1VCFA 3VE9A 2NUWA 2J9ZA 1VGAA 4O0ZA 4A21A 2QCDB 2RFGA 3HG3A 1I2NA 1ZAIA 3HIJA 4I7WA 2ZBTA 2J27A 3PULA 4NJHA 3DI1A 5AC8A 4FXSA 3DBPA 1OFAA 3GDKA 3LM7A 2WNQA 4X2RA 1OJXA 3HO8A 3B04A 1R47A 1Q45A 2PCQA 2ISSA 1W0MA 4Y96A 4BI5A 2YCEA 3NPVA 5AFDA 4GUJA 4N9CA 2DJXA 3TX9A 2DZSA 1YDOA 3O05A 1S5WA 3G1AA 4FB7A 1QPRA 5CKSA 1ME8A 3TMQA 4R7JA 2CLMA 5E1QA 5LNVA 4AXKA 2YGYA 3O07A 1QAPA 3NQGA 4XBSA 5TBOA 1IXQA 1W3TA 1NVMA 2DZWA 4NNCA 3A24A 2Y88A 4PFMA 5EL1A 1OYBA 4KFPA 3UNDA 3N19B 1K8XA 4IX2A 2NZLA 3ZR4A 3W07A 3CEPA 1TPWA 3QQ1A 4O28A 1JUBA 4IOTA 3NL6A 1SZGA 4QSHA 1W31A 3DFNA 5DXXA 3S5YA 4O18A 5K7JA 1VRDA 1KLZA 3R8RA 1LDCA 1ADOA 3TSDA 2DZTA 1FBAA 1H7XA 4A22A 1Y0EA 4CCCA 4JTHA 1TMHA 1F76A 3F4WA 3PAJA 2CLOA 4IXXA 3NYZA 1NFBA 5A5WA 1ZNNA 5T26A 1SR9A 1XBZA 3GDMA 1SO4A 3S42A 2V30A 2ZRVA 5J5RA 3CPRA 2A4AA 2Y61A 1THFD 1W1ZA 3W75A 1KTNA 1H1ZA 3NAVA 3O8AA 1X1OA 1JCJA 2X2GA 2HS6A 2WNNA 3P60A 2DZPA 5C6MA 4W9TA 4L4MA 4E38A 2WV8A 3W1LA 1SFJA 1L6YA 1DQWA 3W7LA 5BMXA 4DBDA 4DPQA 3TK7A 4O14A 4PH6A 2PRHA 2VENA 1W3NA 3LX9A 3LCHA 3IVUA 1VCGA 3W1PA 1FWRA 1J2WA 3QRHA 4UCGA 3M41A 3MP3A 4QAIA 3QFEA 4N4QA 2BZNA 4HNTA 3MYPA 1KBJA 3TSBA 3G24A 3G3DA 2FPYA 3EX6A 4DF1A 3IGXA 5LHFA 2O7QA 1KFCA 4K37A 4M6VA 2V2CA 1G4EA 4AHOA 3QPYA 1B57A 2V2HA 3STCA 1XC4A 5LGZA 4RR4A 4LC8A 2CLHA 2GQ9A 3H55A 3C0JA 3DKLA 3G1XA 3W7HA 2Q8LA 3JRKA 3PG8A 3GAYA 1GG0A 2G5WA 2VXNA 4JDBA 3IGSA 7TIMA 1OFOA 4YCOA 4Q33A 2J24A 1XI3A 1N7KA 3LCIA 1IF2A 3W1XA 2ZA1A 3NVTA 3S1VA 1FCUA 3NXFA 1V5XA 2Y7EA 5D30A 5CZSA 1HFBA 2YDAA 5K2ZA 4WXZA 5DY2A 5ABTA 3I7QA 3G8EA 3OEXA 3USBA 1P0KA 4WJEA 1DV7A 1T96A 2QAFA 3G1HA 3W7DA 2BX7A 4RXGA 4WQ6A 4O11A 1KM0A 5AYZA 5DXYA 1JQXA 3NQ6A 4JEQA 4GC4A 4Z1BA 5F2MA 3L0KA 3PUEA 2NX3A 2ZFAA 3SI9A 2PE4A 4JX5A 2Y63A 1GPWA 4GFSA 3SW6A 5F4SA 4Y90A 2FJKA 2QR6A 1UBSA 2AAMA 3EWBX 3L67A 3E12A 2Z6JA 1V7YA 4JXCA 3C2EA 4MYXA 1M7OA 1FWNA 5HUPA 1LYXA 3WJZA 3PBWA 3ATYA 3LLDA 1ONRA 4WX2A 4LUIA 3BGGA 2LLEA 3VKJA 2ZTKA 1QWGA 1H7RA 1SSDA 2V8ZA 4QM1A 1SFLA 4UNKA 3GXTA 1H7WA 3NZRA 1QCWA 1GYNA 4UTTA 5MHBA 2A0NA 3C61A 2C18A 3LCFA 3W2JA 2C19A 5IBXC 1OG0A 3BO9A 1KM2A 1YDVA 3P67A 4CLMA 1L2UA 3JR2A 3PC0A 5CPNA 4ICNA 1FXQA 2NV2A 3NM1A 2FDSA 5C2XA 3G1VA 1H7OA 3IIPA 5LNWA 3UWZA 4PC8A 4YWIA 3KRUA 4JY8A 1XKYA 5EA9A 1O60A 3BLEA 3WJWA 1OX5A 5KINA 1JQVA 1FUYA 5CZJA 4PEKA 3WJXA 3CWNA 4QNWA 1RR2A 2DZUA 3GXNA 5AOUA 1KFJA 2DP3A 3GNDA 5EPDA 3TDFA 4OWGA 4LV9A 2JKPA 1F73A 3GZ3A 4JTLA 1GTHA 5D2WA 3QC3A 1G4TA 2NWSA 3W7RA 4JX4A 3M7WA 4N2YA 4MLJA 4WD0A 3L5MA 3W2NA 3O6YX 5AN7A 3YPIA 3L21A 3STEA 5F1UA 4JTFA 1U83A 2NX9A 1A5CA 2WSRA 2E1DA 3NOEA 4UMCA 4FNSA 4O52A 3HF3A 4ADUA 3KX6A 4GUHA 5FEWA 2X1RA 4ADTA 1DJQA 3CWOX 4M6PA 5HR6A 2GVGA 1RQHA 3W3OA 1TB3A 2YW3A 4ZQOA 3NNTA 1H61A 1EIXA 4UMAA 3NQEA 3S6DA 3KVJA 4IMGA 1JUKA 4Z08A 1TTJA 4LT9A 3HGJA 1KV8A 4QJ1A 1VLWA 1DQXA 1J5TA 1GJPA 3PSWA 2VC6A 3QW3A 1EX5A 4HNUA 2PC4A 1KM3A 3OG3A 3VI2A 5D2YA 5I3IA 2QJHA 3LXCA 2VKZG 5D33A 1LBFA 1I8JA 5J5DA 1F6KA 1PHWA 1G7UA 2YW4A 1JR1A 2QAPA 3MI6A 3N2MA 1FY6A 3DHFA 4JDYA 2X1TA 1DOSA 5D03A 3HPSA 4AAJA 2YFNA 3C4UA 1YPIA 5D09A 1SO6A 1GVOA 3CQ0A 1LBMA 3L9CA 4A3UA 4WXYA 1KW1A 1TPB1 1KFBA 3DENA 1I2OA 3UY7A 5AHLA 1JCXA 5LGXA 2A7NA 3CT7A 3HPZA 2E09A 3IGUA 3B06A 3WK1A 1AL8A 4O19A 3R12A 3F4NA 1DORA 1WA3A 1KFEA 3V75A 4LVBA 3S1UA 2HMCA 2OX1A 4POCA 2I9EA 3S8HA 3WJSA 3ANYA 3W7GA 4G1KA 5HR7A 2XN1A 2H90A 1EP2A 3C8FA 5EKYA 3W74A 3C56A 1OFDA 4FO4A 3HG2A 2FPTA 4MZYA 3CHVA 4LUJA 3N3MA 4MFDA 3FEMA 3C6CA 2ZRZA 1MEIA 3KXQA 2PRLA 4UTKA 3HGSA 1WOAA 1ZFJA 3QEZA 1F6PA 3GX9A 5AHMA 4PTNA 4K8EA 2JK2A 4AF0A 1Z42A 4OQVA 4ZVJA 3HOJA 1G7VA 1MO0A 2H6RA 1MSSA 1XBVA 1EP1A 4HPJA 1GYLA 3WK2A 3UXDA 4ORIA 1AW1A 5HINA 2VFDA 1NF0A 4OV9A 3NPXA 1P4CA 2QCCA 2HSAA 4MVAA 3LI1A 4R34A 4DF0A 4M19A 4S2BA 4OT7A 4NQ1A 3W7KA 3E49A 4WZHA 3G0UA 3FA5A 2VEPA 4JN6A 3GR7A 4IJBA 1PHQA 1F74A 5DY3A 4FIRA 4LOCA 1Q6LA 3W7QA 4O4VA 3W9ZA 5LKYA 4UR7A 3EX4A 2V82A 1FCVA 1LM1A 2O7SA 4QIUA 3THQA 1IGSA 5EMUA 2JGYA 3NQAA 6ALDA 3I7SA 3FJ6A 2GQ8A 3RLUA 4CQ9A 1JUEA 1QDSA 3I6RA 3GNNA 1P5BA 1XL9A 3EWWA 3DGRA 5CG7A 4CQ8A 2W0UA 2JBMA 3EWXA 3TROA 3K30A 2B4GA 2JKAA 3QW4B 1DKWA 4ZL1A 2YFOA 4MY9A 4UTIA 4HSNA 4IMCA 1OX4B 1VQTA 3CM4A 4HPXA 4GUIA 1M5WA 4RLIA 4DF2A 3G0SA 3PG9A 5U4NA 1NEYA 3C52A 4FF7A 4JIPA 3UWYA 1W37A 1XDMA 4X3ZA 4MZ8A 4N9BA 3KRZA 1TV8A 5G4WA 5U7SA 4QISA 1P1XA 5AYXA 3L66A 2R91A 1PL9A 4NZFA 4BI6A 3TQVA 2ALDA 4KWVA 4AF0B 2CZEA 3U8GA 4MLRA 3EXRA 2WO5A 4N6FA 4Z0JA 3W7IA 1YADA 1SU5A 4OBTA 1FX6A 1GOXA 2FTPA 3EX1A 1S5VA 4NXSA 3OVRA 4JIQA 3QF0A 1SQ7A 1WOBA 4KWWA 4QITA 3M5XA 3P5ZA 3W1RA 4RZ5A 5FF3A 3C2VA 3P82A 5CZTA 1GQNA 1H1YA 1H7NA 1SO3A 4RZ6A 3PBYA 4E2DA 3L0NA 3Q37A 2V5BA 1ZAJA 4K39A 4IUOA 3N73A 3W86A 1I45A 5CPLA 3LRKA 4JTSA 3W22A 2ZRWA 3LB0A 4NXKA 4FNUA 2B7PA 5AHNA 1JULA 5AHEA 1M6JA 4K6AA 1FDZA 1ML1A 1ME7A 1K7XA 4ZQRA 3TE9A 3LCLA 2ZA3A 5F4WA 3QYQA 3TNOA 2C3ZA 3NQ8A 3ELFA 4O13A 3PB2A 5G4EA 2A6NA 4KFNA 1W5NA 5FEZA 2ATSA 3TQ0A 1JRCA 4XKYA 2R94A 3DFOA 4DO6A 3LLFA 2QUVA 3PS7A 4Z1DA 3GDRA 5I3HA 3LTPA 1SW7A 2ZRYA 4O4WA 2RKXA 4PL2A 4AB4A 3Q58A 1XDLA 2A5HA 1VYPX 3T40A 2GJNA 4FX7A 2ZRUA 3LHWA 1QNVA 1A5AA 2I14A 5AYYA 2ZZ3A 2H3DA 4BWLA 3NA8A 4H3DA 5C55A 2VFGA 3LHUA 3TCEA 2TYSA 3HPXA 1FWSA 4H4IA 1B3OA 3P80A 3T78A 2D73A 5E93A 3FJLA 1OHLA 3NPWA 3N34A 4O1AA 1TV5A 3S0CA 4CCEA 3GXPA 2J9XA 1RQBA 3NGJA 3DXIA 4GE8A 2HTMA 1LLWA 4N6EA 1WDWA 1UUMA 1KTBA 1EUNA 4UNLA 1TPUA 1K7EA 1TPDA 4N4PA 3EB2A 1OVDA 3ABOA 2ZTJA 5AC7A 3IIOA 1W5OA 4OU1A 5E0KA 4QNEA 4M7TA 3NPUA 4K36A 2C1HA 1DHPA 3UPWA 4MIMA 3LV5A 4TMBA 4Y8FA 2ZRXA 2OJPA 1LRNA 4NJIA 3VFLA 3NO5A 1SZNA 3HJZA 4O1CA 3W2MA 2P0OA 5DBUA 4TIMA 2Y85A 1FXPA 3MP4A 4PCFA 3S1WA 3FIGA 3W85A 1OFBA 3KVLA 5FF4A 4FX8A 3W1UA 2J88A 2XFWA 3BV4A 2F84A 4LWWA 2X1SA 2QCFA 3CEUA 1F2JA 4UTTC 1H62A 3A23A 3S1XA 5EYWA 1O95A 3BGJA 1OF6A 4MOZA 4NZJA 1TPC1 3G8RA 4ORMA 1RZMA 3MMTA 5CSRA 4JTGA 2BTMA 4HN4A 1C9DA 3T7VA 1DJNA 2NXGA 4NU7A 1PCKA 3M1ZA 3DAQA 4XKYB 1FWWA 1L6SA 3M0ZA 4MYAA 4GUGA 3CIXA 3ABSA 5C54A 1FDYA 1UCWA 4FHAA 4C1LA 1B9BA 5I3KA 4DXVA 1E51A 2Y62A 1VYSX 3GK0A 3OVQA 4K8HA 1TTIA 5F2GA 2VEIA 2CLKA 2VFIA 1JCLA 4TU1A 3O16A 4HKPA 4K7YA 1QOQA 3LRMA 5FESA 5HWNA 1T0OA 3UXAA 4S1FA 1RD5A 3W7MA 1B4KA 1BTMA 2QCLA 1FCBA 3W76A 5AHIA 1KM1A 2PURA 2ZZ5A 3B0VC 1OF8A 4JYFA 5HULA 1HO4A 3GLCA 3DI0A 2ZCGA 1X8FA 3W1NA 3TW7A 3UD6A 1OYAA 3L2IA 3AO0A 1JCMP 3GB6A 2QEZA 3SGZA 4MPQA 1FWTA 4EOUA 1XUUA 3P8IA 1SO5A 4HIBA 4J9JA 1QO2A 3G18A 1EEPA 3RMJA 2NXHA 3DFTA 3PBVA 1ZENA 4I7VA 2P10A 1I4NA 1VZWA 3FFSA 4BFAA 4EIVA 1OABA 5L6UA 3PR2A 3LXBA 1RVGA 1TCDA 2JGQA 5C5YA 1EWEA 4OV4A 1C29A 3FLUA 1LRQA 3JS3A 3I7RA 1P0NA 3NQ2A 1D9EA 5BW6A 3LERA 3BLFA 1BWLA 4LS0A 4Y9AA 1YYAA 5EY5A 1G67A 4JGDA 3F03K 3NL3A 4MY8A 1HL2A 4IMDA 1CI1A 2J6XA 5D37A 4UTJA 3BARA 5D02A 3UWUA 1QFEA 2Z1BA 3H54A 1KV5A 3BK0A 4D2JA 4CCDA 3TC7A 4MJZA 3EXTA 2C15A 2HS8A 4BK9A 2CLEA 1LROA 5D04C 4GUFA 2DZVA 5BNKA 4NX5A 4JTJA 1MEHA 2E5CA 2E68A 5DELA 1X7FA 1Z48A 5HUOA 3W73A 5H91A 3U2OA 1TPFA 2WJZA 3CTLA 1WBJA 2H8ZA 3W23A 3BW2A 3HQ1A 3EX2A 4MFEA 1NF7A 1T99A 3LBCA 1ALDA 2GQAA 4DO4A 3ZS4A 5HMSA 4M6QA 1TPH1 4JYDA 4M7SA 1K02A 3FYPA 4ADSA 5HJLA 4MY1A 2GVJA 2C6QA 3GDLA 4PODA 4O54A 3MO7A 8TIMA 3TIMA 4O50A 4I7UA 1R46A 1R30A 4WUIA 1ME9A 4K38A 3W87A 1KA9F 3EX3A 1XM3A 1A5BA 1UASA 3G1SA 2QF7A 4AH7A 3DH7A 3LHVA 3QZEA 2VFEA 4RZ4A 4XZ9A 5HWJA 5K3VA 4MJMA 3W1QA 4ZQCA 5FF2A 3PUDA 1OX6A 3QM3A 4NJJA 1O5KA 5D05A 2YX0A 2NLIA 2WPBA 4JS3A 5G2HA 1TRIA 4FNQA 3UWVA 4NJGA 4RV8A 1HG3A 3W1TA 3MUXA 3QMTA 2Q8ZA 3O6CA 5DN1A 3E96A 2ZZ4A 3RFAA 5H2ZA 1K8ZA 4O1DA 2B7QA 4WOZA 5A8GA 4RX0A 2Y7DA 3QSRA 3NEVA 1L6WA 3N9SA 3M5ZA 4NVTA 4LS1A 3SY5A 1X6UA 4JYEA 1XCFA 4DEFA 1QMLA 1JCNA 3G1YA 2EHHA 2G95A 4O1BA 2OZ0A 2QCMA 4HT3A 4Y6GA 1VHNA 3IEBA 3M5YA 1HO1A 3TSMA 2FPVA 4WY0F 3L5LA 3C3NA 3LCXA 3HGRA 3M6YA 4LS2A 4ZQNA 3LHYA 4TX9A 2W79A 5HNRA 2Z0IA 5I3JA 4MUZA 3MYOA 3TAOA 3C2OA 2V81A 1QO5A 1YTEA 3PM6A 2DU2A 5LHEA 3EKLA 3LHZA 1ICPA 2J9YA 3BW4A 4FNTA 1WXJA 3W7OA 4XBKA 3KFTA 3L5AA 3LTYA 4Z1AA 2YYUA 2YPIA 3FS2A 4Q4KA 4N9DA 1L9WA 4LRSA 4RKAA 4IGHA 4LRTA 4AEOA 2WSYA 5G5IA 5HWMA 3ZFHA 1GZGA 3SZ8A 3DHDA 4XWUA 4WY0A 3TC6A 5AB3A 2ISWA 1QPNA 1VR6A 1GG1A 3Q2DA 4EWND 1EA0A 1OFRA 3GKAA 3W7NA 3B0PA 4E2BA 5KZEA 1H60A 1ZALA 2CLLA 1KM6A 4UTMA
chains in the Genus database with same CATH superfamily
1C93A 4RPPA 4H7CA 5EGRA 1A5UA 1ZTVA 1X6LA 2XZ7A 1F4AA 4GACA 4R85A 4U3CA 3M43A 3MHGA 4JNZA 6A3HA 4Q4SA 1RP8A 2PP1A 2OWXA 3KTXA 3EMZA 2WMIA 2Q71A 1M7PA 3TA9A 3LOTA 5BXSA 2J78A 1KXHA 3W70A 2Y7FA 3A22A 5REQA 1M7XA 4EF8A 4A6GA 1MXSA 1XD0A 1ZY9A 1FH9A 4GJ1A 5FJPA 4KF1A 4JX6A 1MZHA 2EPOA 4JICA 2D0HA 3LY0A 1UZ1A 4DPPA 1XDJA 1IEVA 3F2CA 3SJ3A 4CN6A 1M7JA 4OKDA 1HP5A 3VNDA 1Q7ZA 4UTUA 3DERA 3FGCA 3VOHA 3CL6A 2DH3A 3ZVHA 3E0LA 1E1FA 4S23A 2CETA 3LSCA 3HG5A 3HG4A 4WSKA 3SM0A 3MU7A 4IQLA 3WBYA 4X60A 1K3UA 4J7RA 2CEQA 1QI2A 4WSHA 1NSJA 1Q63A 4BI7A 2NUYA 1LRTA 4J1OA 3ONCA 3RM4A 4IMEA 4J3TA 3E2RA 4UQEA 4CEUC 2IS7A 1CW2A 4I9MA 4WGHA 2DZXA 3SO7A 5C71A 4B5NA 2E4TA 1ZS2A 2QCGA 1EC7A 1PE1A 1GOIA 1VH7A 4IUGA 2F7FA 4ZQPA 3NZ1A 4RZBA 1TIMA 5IDZA 3K5XA 1UZ4A 1W6TA 4LUSB 4F40A 5A6TC 3CS2A 5A2AA 3VNMA 2I5QA 2ZE0A 1XLJA 4MJ2A 4GI9A 3VD4A 9XIMA 3RM8A 5XIAA 4Z2JA 1D3HA 1XLGA 3C2FA 3K1GA 1ZGDA 2ZUUA 4LTSA 3AYSA 4LVAA 3F5KA 4KMQA 2VR5A 3PUOA 4GNKB 2ZUWA 1L8NA 1Q66A 3STGA 1WAUA 3BE7A 3VKAA 4DO7A 2HV5A 1XXXA 2TMDA 2VZSA 1BKSA 4A3YA 5I24A 3S5ZA 5JUVA 1W9VA 1LTDA 2I5IA 2J75A 4GY7A 4UFKA 1VFUA 1WZLA 4DQWA 1JZ2A 1XIDA 1B3VA 5BRBA 4F66A 5LXXA 1W54A 4J40A 3MHUA 2BASA 4JQ3A 4U5KA 1R3SA 4D72A 2ZZ7A 4WDUA 3SIMA 2J77A 4S38A 4NNBA 5I3FA 3GD6A 3GHTA 4ES4A 3LZ3A 4HNCA 1X1ZA 1DBTA 4A3HA 3OA3A 4B4HA 2X1UA 4P8VA 1VJSA 2HXTA 4ROPA 1JD9A 1E71M 2BWGA 1TG7A 1SW3A 4LYQA 1S5TA 1GVYA 3BSMA 1LZOA 4HMEA 2ZZ6A 3R10A 3M16A 3ARYA 3GHSA 1CEOA 4LW7A 3I4KA 3MV01 2DW7A 3KBWA 2D0FA 4LCSA 1FFRA 3GVRA 3KBMA 4QG8A 1REQA 1Y65A 3BOLA 2R14A 1VCVA 2FVLA 3GUGA 3EWCA 3VDGA 4AVFA 3BG3A 1X6NA 2E77A 2G50A 1YLVA 1UH2A 3KOFA 1QNQA 3H24A 3QV9A 1TUXA 1H5YA 4PL1A 2FTWA 1UIOA 1JPHA 2HBVA 2EKCA 3CLWA 3BOFA 2VDGA 4HGXA 5A8MA 3UQNA 1IXNA 2V5KA 1YDNA 3GG7A 1IIHA 4TO8A 4NZCA 4P61A 2VQUA 1X98A 1A50A 3TXVA 3DG6A 4IMFA 1K8YA 5KZMA 1GVQA 2REQA 1OGGA 4XUGA 2V5LA 1F8MA 4JTAA 1H63A 1UWSA 3U5UA 4AMCA 2XSBA 1OT1A 3GVGA 3AXXA 5HOSA 3FOKA 3IACA 3PJTA 3DFPA 4GRSA 4GWEA 4IF2A 3NQMA 4AWUA 4O0KA 2CZVA 1WDPA 2BP1A 4GY1A 2ACUA 3C2RA 2Y0FA 4QXIA 2PDIA 3T42A 1NIUA 2YSWA 1TA3A 2IQDA 2E6YA 1Q6QA 2C14A 4KWOA 4NJKA 2PD5A 2ZDRA 4FNRA 1UYQA 4H6KA 3PY2A 2VI0A 1FOBA 5I3GA 1R9ZA 2PI6A 1Q4NX 2PTWA 4FLSA 3MVIA 4FIQA 2OZ3A 2W9MA 1UW9A 3MB9A 1KBIA 2PAJA 3EWDA 1A4LA 3NTYA 1GQIA 1XSJA 2INZA 3VZYA 2FQIA 2PU1A 1TV2A 3W2KA 3GIYA 4U2ZA 3H4XA 3DFQA 3V1PA 1XLEA 3LCGA 2NXIA 1T8XA 4NT0A 4DO5A 1IWPA 3KL0A 2Z2UA 2CESA 4QTGA 4KEUA 2X0SA 3EBVA 2O55A 3UZXA 3FYOA 1SR0A 3KVMA 5I7GA 2Z1WA 4PUUA 4CU7A 3DC0A 1C8QA 2EAWA 2F6XA 5HMEA 2TSYA 7TAAA 3W72A 4HA1A 4PCSA 4Q22A 2Y8UA 3FK4A 1XR2A 3ZOAA 2AQOA 5LSMA 4W93A 3RXZA 1W1TA 1GPFA 2B81A 1C3FA 3IWPA 1M41A 4CCZA 2UV8G 2ZQ0A 2CLFA 1UJPA 3II1A 3RPMA 3AS3A 4KPLA 2WSQA 3UWWA 1OIFA 5F2LA 1XPYA 5CCZA 3WENA 2NUXA 4DLMA 4E3TA 4U28A 3ALGA 1EB3A 2CFFA 1BEUA 1N82A 3G6MA 4RNIA 4W86A 6TIMA 5C9RA 5AHFA 2WMHA 1T6MA 3FW6A 3GTXA 3QLDA 2GK1B 4LF1A 1YBQA 3GDTA 2E6FA 4UOQA 2PCEA 3P62A 4D6HA 1V51A 4QX4A 2DORA 3G1DA 3SUSA 3WDQA 4YTRA 2YBTA 1CB2A 4PRTA 3EEZA 2PDMA 4AHQA 1DQUA 2DEPA 2ZX8A 3H2EA 1QPQA 5F4XA 4MTVA 4C90A 3S9IA 2E25A 2O4MA 3BLOA 4M80A 4YTQA 3SR7A 1GOMA 2QCEA 1US0A 2FGLA 2A1YA 1XP3A 3WH5A 2CXGA 3MDWA 5JQ9A 2J47A 1H1NA 1Y8BA 1OX4A 1NARA 3S2MA 4AWTA 4RCXA 3NZGA 1XGDA 2GOUA 4UTLA 4HU8A 4UNIA 3MO4A 2DGAA 4GX9A 2TPSA 2WWDA 1JD7A 4DELA 3CU2A 1R3TA 2BGNE 3UP8A 4O15A 2CZFA 2J62A 2WHJA 3WUFA 4CN4A 1ZHAA 5FI8A 4P7RA 2XZ9A 3WLSA 3UZWA 3NM3A 5HATA 3L0GA 1D3CA 1PX3A 3S5NA 3BUVA 1I0BA 1S5NA 1YTKA 3L65A 1DVJA 3W7JA 4GZJA 4HD5A 5SWUA 3A9BA 4D9PA 1WQ5A 2QV5A 3GW3A 3W7PA 4P2VA 4CNOA 2KX9A 1HP4A 4QDMA 2ZC8A 1H0IA 4JIHA 1EYWA 3OLGA 3SQMA 3MUAA 2R1PA 1X8CA 4KIEA 3F7JA 4LU0A 4HCLA 1WYIA 5T8GA 1OZQA 1C90A 1W32A 1PCWA 4JQ4A 3BANA 1O5XA 4ZEPA 2A79A 2VOMA 4O1EA 5HANA 2QDHA 3GNOA 1UWTA 2XN2A 3EPNA 1EJSC 2QW5A 4YHEA 4LXFA 5A6JA 4BF5A 1TRDA 2VEMA 2DT2A 3IIXA 1MEWA 2NWRA 3KVKA 2E6DA 3OIXA 2VWTA 4DI8A 1AZ1A 3W37A 3EWZA 1HJUA 2BLEA 3OU8A 2GJXB 3S6TA 3CYJA 1UP2A 2QCDB 2RFGA 1I2NA 3VOGA 4I7WA 4JOMA 2X41A 3PULA 4WJ8A 4MWAD 3AS1A 4FXSA 1GK8A 1S2UA 4X2PA 1YKWA 1CLVA 3VC5A 3LM7A 2WNQA 1R47A 4MKVA 4LAMA 1WUFA 5AFDA 4N9CA 4LANA 1YDOA 3F5JA 3ZVIA 1S5WA 1QPRA 5CKSA 1ME8A 1KR0A 4R7JA 1BWVA 5E1QA 3GG0A 5LNVA 1TR9A 2NVAA 4V15A 1NTHA 1QAPA 1W3TA 4GIYA 3A24A 2Y88A 1IT7A 2F61A 4GYFA 2H9AA 1P7TA 3CHDA 4KFPA 4GIAA 1E43A 3N19B 1U5VA 4YIWA 4KGLA 3ZR4A 5DMLA 3W07A 3T2OA 1TPWA 3B9DA 4B3ZA 3ITXA 1F3WA 3ABXA 3DFNA 3ITVA 4O18A 1UR3M 1VRDA 3TR9A 1E6SM 4Y9PA 1ADOA 1OY0A 3CMFA 3VIGA 4IPPA 5C9XA 4PMZA 3GVWA 4CCCA 4JTHA 4H9TA 1TMHA 1F76A 3PAJA 4OTKA 3KW3A 1ZNNA 1SR9A 1R85A 3LUTA 5I07A 3GDMA 1SO4A 4XAGA 3S42A 2V30A 1W1VA 4P8WA 3ID7A 3NZPA 1ISVA 1FWJC 1OQFA 5JIWA 1J0JA 1JCJA 3GW0A 4ACZA 2GLKA 3GU1A 1SFJA 2VURA 1EJVC 1DJYA 4GYJA 3FHQA 3HMCA 3VIOA 1CGTA 3GH4A 3M0JA 3WLJA 2DUAA 3BJSA 1VCGA 1W9UA 1FH7A 2C71A 1Z6KA 4CD7A 5FJRA 1KBJA 5JMUA 1DTUA 2W66A 2FPYA 2V3DA 3S3GA 1XLDA 1FA2A 1KFCA 2NQHA 1G4EA 1J01A 4AHOA 2V2HA 3UGVA 5CC6A 1YQ2A 3C0JA 3G1XA 2WMKA 2Q8LA 1KC7A 3JRKA 3PG8A 1KBKA 1UKOA 2G5WA 4JDBA 7TIMA 1VBGA 1OFOA 3BZJA 4YCOA 3CZGA 3M64A 1N7KA 3LCIA 3V7PA 3PJWA 4KW2A 3NVTA 3S1VA 2PD9A 2Y7EA 3ARPA 5CZSA 1HFBA 2YDAA 1A80A 3WH7A 5DY2A 2DSUA 1F3EA 4B92A 1H4PA 1H11A 3AICA 4CNUA 1VF8A 5FACA 3AWOA 1UWQA 1P0KA 4QDWA 1U33A 1UR2A 2VZOA 4ZB2A 4DAFA 4LNCA 3SRHA 3VKBA 4FLRA 4WQ6A 4ZODA 2Q8XA 4JKKA 1B3ZA 4JEQA 4BZYA 4LF2A 4E6MA 5F2MA 1UBPC 3PUEA 4HPGA 4PSPA 3SI9A 4M6UA 4GFSA 3P6LA 4AZ5A 4IL2A 4DYKA 2NQJA 4A05A 2AAMA 3EWBX 3L67A 2GGIA 1V7YA 3FDGA 5CJ5A 4JXCA 1PKMA 1RLDA 3OA5A 1HN1A 1TWSA 4EP8C 5ABEA 2ZX6A 1FKWA 1ONRA 4IZGA 2DQWA 4LUIA 3MMWA 2YL8A 3N6JA 2LLEA 2ZTKA 4G2DA 2D24A 3PFMA 5HPCA 4B91A 1SFLA 1H7WA 8A3HA 2VGBA 2CKRA 1GYNA 3B8WA 3LLXA 4UTTA 3ISIX 4C91A 4LAOA 6REQB 4HPNA 3BLLA 3HA1A 1FWIC 3BO9A 1KM2A 1JCTA 1XIEA 5CPNA 4AZ6A 1K9EA 1XYFA 3ZMRA 3G1VA 3AMKA 2D1ZA 4YWIA 1BQGA 1VFSA 2WMFA 4JY8A 2OWCA 1XKYA 3G77A 3QR0A 5EA9A 1O60A 1PB0A 3BLEA 1XW8A 1JQVA 1QU4A 1FUYA 1LWHA 3LPOA 3U2CA 2XWDA 2ZWYA 4QNWA 1V8EA 5AOUA 4CKQA 3GNDA 2CIPA 1V03A 5EPDA 2BVWA 4LFYA 4OWGA 2X05A 4LV9A 4OECA 3B3DA 2P50A 1LUCA 3PJXA 1FP8A 1HF6A 3B9EA 3UT0A 1WUEA 3VOJA 5AN7A 1K8CA 1V6VA 2QHAA 1NDZA 3UR8A 1H0GA 4JTFA 1U83A 3L4YA 3U5YA 1N8IA 4QROA 4ATLA 1WDRA 3KX6A 1YNQA 1D7KA 3GR4A 5A6SA 1HJQA 2X1RA 4ADTA 2GVGA 1RQHA 2YW3A 3RO8A 3RX3A 3FY1A 4REQA 3S6DA 3KVJA 2BY2A 4AZGA 4IISA 3IJ7A 4Z17A 3SQSA 4ML4A 1SFTA 3HGJA 3E2SA 3WBEA 1VLWA 3ECQA 4DVOA 3QW3A 3THCA 2PC4A 2D2GA 2QV4A 1J5SA 1YRRA 4DRSA 4KRTA 3BMXA 4QE5A 2YL6A 3LXCA 2VKZG 1KBBA 5J5DA 5DRIA 4QDPA 3QC0A 3VKDA 4JIEA 1J11A 4MUPA 3IJQA 1DYSA 2ZOXA 4ERAA 1UH4A 3EDDA 3C4UA 1GOKA 5JBFA 3L9CA 2Z26A 4B2DD 4WXYA 1IZJA 3UY7A 1ITUA 1G94A 2YL9A 4RPQA 5LGXA 3CT7A 3KBJA 4GI8A 4C6EA 1CGYA 3MSRA 4UWMA 2I9UA 4KEVA 1VBRA 4LVBA 4QJ4B 2HMCA 2OX1A 3AAMA 4AY8A 3ANYA 4NYUA 2OX4A 3UF9A 3MSGA 1IHIA 2XISA 5CPTA 2VHLA 4P7OA 4MZYA 4LUJA 3TTQA 2YDRA 3MCMA 4ZR8A 4B15A 2PRLA 1JGIA 1ZFJA 4QEHA 2Z4GA 3GX9A 4YU1A 3MMUA 1YE4A 3QKEA 1Z42A 2QF8A 3T2PA 3Q67A 2G3IA 2OSXA 3TTSA 3WQ5A 4ZVJA 1S2AA 3ZR5A 1MSSA 1EKOA 1XBVA 4UBPC 2GJPA 1XCXA 1GYLA 3WK2A 1ZBCA 1AW1A 2VFDA 5DX7A 1KKOA 4PUMA 4CD6A 4LH8A 1YE6A 2JALA 4W7UA 2QCCA 2HSAA 1EFZA 4S2BA 3TP4A 2VRQA 2VEPA 3GR7A 4IJBA 1F74A 5DY3A 1Q6LA 4F8XA 1HKJA 3W9ZA 1A3XA 3EX4A 1CGWA 4PBEA 1PUDA 2E40A 4MWAA 4CUCA 5LA2A 1KCKA 4CQ9A 4Q4QA 3NJ3A 1UMYA 2W27A 2PC8A 1TX2A 4CQ8A 2JBMA 3VNJA 4JZ5A 1D8CA 2JKAA 4UTIA 3CM4A 2XM1A 4HPXA 4FOJA 1C7SA 3CZJA 1F3XA 1FWDC 1XLIA 5U4NA 3BQ6A 3TLQA 4MDPA 3C52A 4FF7A 3RUBL 2HNHA 3OHMB 1XLBA 4QJ3B 4N9BA 3S6OA 1CENA 3OB8A 1TV8A 5U7SA 2VD8A 1P1XA 3L66A 1WB0A 1C92A 3TQVA 2GVYA 4KWVA 1G5AA 4AF0B 4B5SA 2CBUA 3U8GA 4FSAA 2P53A 3VVGA 4NZ3A 5M3WA 3D3AA 4V1YA 3OGVA 1FX6A 2FTPA 4F0LA 2V5DA 4JIQA 3M46A 4G9PA 4WHBA 4KWWA 4IIGA 1E1EA 3M5XA 4I8YA 4RZ5A 4ZA0A 5FF3A 3P82A 1SO3A 4AD4A 4E2DA 3Q37A 4MAVA 2V5BA 4XUYA 2D23A 1QK2A 4QFUA 2PWDA 3VGFA 4FNUA 2B7PA 5AHEA 4PUWA 5LA0A 7REQA 1I1XA 5A2BA 2JEPA 2XJ7A 2ZA3A 1P0DA 4IL0A 1TCMA 3IJ6A 1GYMA 3APYA 4KFNA 5TD4A 1KCZA 1W5NA 3AIWA 3ES8A 1JRCA 1QNOA 3LLFA 4F2BA 1YIXA 1AODA 1Y5VA 4QAWA 5LXEA 4TOQA 3KUMA 3QYSA 3PWIA 1SW7A 1MXDA 5XINA 1ENUA 4US6A 3VNZA 4UQBA 5AYYA 4ATDA 3JVAA 2VUNA 3JUGA 3EDFA 3NA8A 3TLLA 3D6NA 5A1AA 2F2KA 5AC5A 3QKZA 1FWSA 4GQBA 3UBPC 3FJLA 3S0CA 4JFWA 3GXPA 2J9XA 3EB4A 3DXIA 3DYOA 4GE8A 3R0KA 1LLWA 2OFJA 1WDWA 4U33A 1PEZA 3LS9A 3UJEA 2XPKA 3RILA 4N4PA 1AJ2A 1OVDA 3EB2A 1MWOA 3GC4A 3IIOA 2WZEA 3GYCA 4QNEA 4GI6A 3NPUA 1B3WA 1MQQA 3W6LA 1AH0A 2OJPA 2YCLB 1MQPA 4ZFMA 2Z7KA 3HJZA 4H41A 4H6EA 3W2MA 2P0OA 5DQPA 2Y85A 2V3EA 2HCVA 3V4BA 4PCFA 3N2TA 3S1WA 3FIGA 2X40A 3W85A 1OFBA 3WO8A 3F4DA 3AALA 3H21A 5GNXA 4EAYA 1BYBA 2J88A 3BV4A 2EJ1A 2X1SA 3U7VA 4M24A 5EYWA 1O95A 2CXEA 1V6YA 3IK2A 4P7NA 3AJ7A 3GU9A 2BTMA 4LBSA 1POJA 1PCKA 3BTNA 1M9HA 3DAQA 1FWWA 2I16A 1KGUA 4ZOBA 4FHAA 2VOTA 4DXVA 5I3KA 1VYSX 1JI1A 4Q4MA 3GK0A 4Q6XA 4K8HA 3OBEA 1WDDA 3PANA 4DZIA 5FESA 3WQDA 3UXAA 4S1FA 1RD5A 4L9YA 5FCZA 1LG1A 4XD6A 2WKGA 3A3WA 2J7BA 5E0FA 1XH0A 5AHIA 3B0VC 1OF8A 5HULA 4Z2LA 3GLCA 1Q6EA 1DJZA 3TW7A 2P88A 2BDQA 4W88A 1JCMP 4R9XA 1KR1A 3SGZA 3L4VA 3P93A 1FWTA 2QMJA 4L9XA 4YTTA 4EOUA 1XUUA 1JPKA 1UZHA 4W89A 1H2JA 2GJRA 3G18A 4A4AA 1I4NA 4YNGA 3DIPA 2HISA 3FFSA 4LYRA 5L6UA 2O56A 5C5YA 1TCDA 1OIMA 4QP0A 1EWEA 2EPNA 4OV4A 3PHAA 1UP0A 5HDRA 4PMDA 1AD4A 3JS3A 1D9EA 4F0HA 3BCFA 4JHZA 2YCJA 1L8PA 1BWLA 1KCXA 4LS0A 2QJMA 1YYAA 4NAFB 1Q5MA 2OSWA 1FWEC 3DG3A 1HL2A 2BOGX 4IMDA 5D37A 5D02A 3UWUA 3ANVA 1QT1A 3BK0A 3TC7A 4MJZA 3AU2A 5JIPA 3BJTA 2VCAA 1J93A 4RDVA 2CLEA 1LROA 2DZVA 1AJZA 2XU2A 4NX5A 1PIGA 7ENLA 4JTJA 2E68A 3W73A 2XDFA 3CTLA 3W23A 3OGSA 3BW2A 4PBFA 3GDBA 3EX2A 2QNEA 4K68A 1ALDA 2GQAA 4DO4A 4EPEC 2AMXA 1K02A 4PMVA 4L5ZA 2C6QA 3GDLA 4O54A 4TUFA 2ZUNA 3MO7A 3BZGA 3RIKA 1R46A 1HW6A 4B2DA 4K38A 2YLAA 5FSEC 2CHRA 4D6DA 1KA9F 3G1SA 4WSJA 3TOYA 1BRLA 5CLTA 5B80A 4J4KA 4XZ9A 3W6MA 5FF2A 3PUDA 3QM3A 1CXFA 1O5KA 1YDYA 2VP8A 1FH8A 1CECA 4JS3A 1TRIA 1O6IA 1UOZA 3SUTA 4WLCA 4NJGA 4RV8A 1HG3A 4PULA 2ISFA 3DHPA 3O6CA 1XICA 4F9JA 4R7OA 3A4JA 5IFTA 3IJ8A 5FJIA 5H2ZA 2B7QA 2RDXA 4ZB0A 1BXBA 3KZPA 3NEVA 3N9SA 4NVTA 3CAVA 4LS1A 3KCJA 4CQDA 4DEFA 4XB3A 3W0KA 1FRBA 2G41A 1X7IA 4HT3A 3I3BA 3GH5A 4F4RA 3M5YA 2PDGA 4S3JA 2PTZA 4LS2A 4ZQNA 3VINA 3LHYA 1JPDX 3IPWA 1JFHA 2YXOA 5BRPA 2O9PA 1YTEA 3B9NA 1GNXA 4G7EB 2W92A 5DO8A 1CB7B 4FR6A 5A8OA 2VZVA 3GG8A 4PMOA 2FDMA 4RKAA 3PNUA 1K9FA 4IGHA 5HK4A 1UD5A 2C79A 5FIPA 3DHDA 4XWUA 1YNYA 5AB3A 2ISWA 1D7FA 3Q2DA 4EWND 3B4YA 3JZEA 4IICA 4E2BA 1ZALA 5I0DA 1ESWA 3WSUA 2FFCA 2DFAA 4TVCA 1XCWA 3HN3A 3UJFA 5BWFA 3WDHA 1U1UA 4M1RA 1V02E 4HTBA 4HTYA 5I06A 3TW9A 1A5OC 1A49A 3DFSA 3UFYA 4B5TA 4NAEA 4A2SA 3B05A 4M5PA 1ZJIA 4EANA 3M5VA 1FWCC 1JPMA 2RGLA 4E0CA 3K4DA 3ZLHA 2PDUA 5TIMA 3G1RA 3A64A 5D4YA 3ZJKA 4UFHA 4CVWA 4UR8A 2XGBA 2XFFA 3QHNA 3K8MA 4H00A 1DL3A 2ISVA 1MW1A 2J6VA 2BG5A 3FV9A 2GSHA 1FQ0A 3BPWA 5KSWA 2OOGA 1IIGA 2G97A 5G1TA 4IFKA 4HOZA 2X16A 2D2JA 2QIWA 1W3IA 3KL3A 1W2VA 2C16A 1W1YA 5F2IA 3P74A 1UUOA 5ECUA 1N2VA 4LAZA 3TN3A 6XIAA 4MNJA 1A5SA 2GOKA 5FL0A 4DUWA 2RDTA 1RPXA 3OODA 4RNJA 1YPFA 4O16A 2WHLA 3WF1A 4F0KA 3Q4DA 3K46A 3UY8A 4HU3A 5D2VA 3UCQA 1OCBA 1FTXA 1IZKA 2Z6IA 4IXHA 5DLCA 4DX3A 2JFEX 1XIFA 2WQPA 2RHGA 2FIQA 3NR0A 1RPKA 1EHNA 1PXGA 3MP5A 2QUTA 4N9EA 2VZUA 1H7PA 1MDLA 4NG3A 2OODA 4H8VA 3E9AA 3AFBA 1F7BA 1TV7A 1PKYA 4AZ7A 1VPQA 1WBHA 3P7YA 1LQAA 4ML9A 2WMIB 3VGDA 4HCDA 2ZWZA 1E6XM 1LG2A 4XTDA 5IOBA 2Y24A 4GX8A 5REQB 1PV8A 3TYDA 1RA5A 3DU0A 3UEQA 1UD2A 2A3BA 4LVDA 4XTIA 2DDXA 1RY8A 1V3JA 4LNYA 2BS9A 4CU6A 2H8XA 3AI0A 5CPMA 2C91A 3W2UA 2HQAA 1JGMA 4OUEA 3KS5A 4HVXA 4R7WA 3ZZ1A 2GJLA 3SGUA 2E28A 1RALA 3A4XA 1W8SA 1XIBA 4LVFA 3FGCB 4XAYA 2L5HA 2ICSA 1AW5A 4B3KA 1LLOA 3AHVA 4CNNA 1HUVA 2BY0A 1JJKA 2PDHA 2DVXA 2ZX5A 1TWWA 2YLLA 3BAWA 4WOQA 3HV9A 2MNRA 3CH9A 1GWJA 3CLMA 3LBMA 3W28A 3VUSA 2AQWA 2YYTA 1R9XA 5GNYA 3AXKA 3PBUA 1EOKA 3WNMA 1O5RA 4HJWA 4QS6A 3OVPA 5G2WA 3TMLA 3E74A 1UR0A 3TA6A 3N1AA 3CUZA 1MW0A 2FLIA 1OFQA 1KKRA 3EWYA 1VJIA 3W02A 4GJJA 3AJXA 3HURA 4GQQA 4IIBA 4Q8QA 1PKNA 4PE8A 3R25A 3CMJA 1TQJA 2TRSA 4RDZA 3V36A 2BFGA 2INEA 4LB3A 1Y5WA 1XBXA 4CNSA 3Q65A 1EF3A 3VGBA 4Y7EA 1OK4A 3B8DA 4JY9A 4BEQA 4YYFA 3I65A 1X96A 3FKRA 3T0AA 1LT8A 4JFVA 4HMCA 3D0CA 5DMNA 3VD3A 4D71A 2BOFX 2WSPA 3E6EA 3TJLA 2O0TA 3GFZA 3U0HA 3EGJA 3WQ8A 3W88A 1RVKA 3INPA 3OOQA 3NQFA 3I3EA 1Q3NA 3V0UA 3ZJ7A 1V7AA 1XINA 2ZZ2A 3BSHA 1JCYA 3GNXA 4Z42C 1WXYA 5DRCA 1EJUC 1EO5A 3RF9A 3ZSTA 5LNSA 3NL2A 5FEXA 4UC5A 3N04A 2HVNA 1NWTA 2OT0A 4LCRA 3SN0A 4GA8A 1BGGA 1VFFA 4AD2A 1KRAC 2PGFA 1F5ZA 4JNMA 3B8SA 2XH0A 3T2QA 4UCFA 4MMWA 2OYMA 4JTEA 3GUWA 4QQ3A 4A29A 1Z44A 2UY4A 1M03A 3O0FA 2ZDSA 4Y9MA 2PP0A 4GIEA 3G1FA 2VRKA 5C9UA 2HPIA 3CUXA 2SFPA 2VVSA 4IPIA 3RO6A 4CNPA 2W91A 4HU0A 3TN6A 3WF0A 4A8LA 1REQB 4K2SA 4O12A 3E0FA 1CXLA 3SJNA 2VFFA 3ARXA 3H4GA 4Z0SA 4ZE4A 4ALDA 4B4FA 3SFKA 2PDQA 1XYBA 4AD3A 4DJDD 4INFA 4CU8A 2QJGA 4JTQA 1OZMA 1FKXA 1QWKA 3B4UA 2Y6ZA 2REQB 3AROA 3HM7A 1HX0A 1J0YA 3H23A 4FEZA 1W3HA 1JRBA 5E9AA 4PA8A 3SADA 1W3KA 1IQ8A 2CWNA 2YJQA 4UFJA 4IFRA 1VPXA 1I2QA 2YA0A 1RJQA 5K9XA 3EOEA 2QLYA 7CGTA 5CPOA 1LWJA 2X7VA 4JTTA 2VCCA 3DFYA 4DB7A 1ZBKA 1DWJM 1PIIA 3VCRA 1G4SA 2MUCA 2RDUA 2A2IA 3ABQA 4IP5A 2QXWA 3A9IA 3KEHA 4S3AA 1TA3B 2DH2A 3M6DA 3POHA 2OSYA 2IMRA 2QQ6A 3T4CA 3EOOA 2WMGA 2E9LA 1RV8A 2GVEA 4LV4A 4GXMA 1JDDA 1TE1A 3VOIA 3A4WA 2X0HA 2Y5SA 1DWGM 1BXCA 1XKJA 3Q94A 3GR8A 4IGSA 1XD1A 1DE6A 2WC7A 4H9VA 3HBLA 2OKOA 1EDTA 4NX0A 1TELA 1VFMA 2J8TA 5EMLA 3W7EA 3UCDA 3OHIA 3GC5A 5KZDA 2ISDA 6CGTA 3AMLA 1OCQA 4UIOA 1JNDA 1E6ZA 2WKJA 4YLWA 2E5BA 5BU6A 2V63A 3CV7A 2F38A 4OE7A 1KTCA 1ZZMA 3LCWA 4KBXA 1LL7A 3KE0A 5E0CA 4AC1X 3VE7A 2YZRA 1M01A 4KKXA 5CC7A 4AHPA 1MZRA 2GGGA 4HA3A 3TQKA 4DJEC 1ISWA 2XVGA 3B8UA 2VELA 3T09A 4WF7A 3WLOA 3S9YA 1FWFC 3MTWA 4RE3A 5DCEA 3MBFA 3GHRA 3RLVA 1G01A 1UC4A 2JIEA 3SECA 3RAOA 1A0DA 1CLKA 3OBAA 1LOLA 3VILA 2CZDA 2VC7A 2EG8A 3BJFA 3B0UX 3IVTA 3WN6A 5K9DA 2R1NA 2WJEA 3MKCA 4ZMGA 3ZLFA 4XD5A 3CWHA 4RE2A 4FXJA 4NUWA 2DQXA 3UZJA 1MW3A 1YBQB 1DJIA 3FA4A 4Z1CA 1TQXA 4JIRA 5GJNA 3AU6A 3AS0A 2YKKA 3AIUA 1DJXA 5A95A 3WLLA 1C91A 3QY8A 1QNSA 4L4OA 4A8NA 3STFA 3UPBA 5CC5A 3RCNA 4R33A 3WMSA 4U2YA 3WH9A 1YHTA 3TH6A 3WZ0E 4DHGA 1CYGA 3U3HA 5I03A 4UTHA 3LMZA 1ICSA 2AL1A 1TPVA 1O68A 4JQ2A 1GT8A 1TJRA 1LP6A 3W71A 1QPOA 1GW9A 2VGGA 3H22A 3KOZA 1XS2A 2D3LA 2VD9A 4Z2KA 3IV3A 4AD1A 1E3ZA 2QUNA 3PVFA 3LM3A 4YJ5A 1WNOA 4LBUA 4LVGA 4H6QA 1PVNA 3XISA 5A6MA 2ZXBA 3VE9A 2J9ZA 4O0ZA 4Q4OA 3T81A 1IWBA 2J27A 4YWSA 5AC8A 4J27A 4XZIA 3GDKA 3VGHA 4X2RA 3SCPA 1OJXA 3HO8A 3B04A 1DIDA 4ZXOA 4Y96A 2YCEA 4D1IA 4GUJA 1EDGA 3G1AA 3QV8A 3CAQA 4YTSA 1R9YA 4F9DA 4ZXLA 3OPSA 4GABA 1E40A 4IIHA 1NVMA 5DEZA 3WF3A 4KESA 3PZGA 2YCLA 3S4TA 1PYFA 1K8XA 4H8NA 1EHAA 3CEPA 3WNKA 2ZE3A 1PBGA 1JUBA 3S2JA 4YN5A 2P3ZA 1FFQA 2HXUA 3SBFA 4HN8A 1ZRQA 1PWMA 3OYZA 1R0MA 1T41A 4HNLA 1H7XA 3FXGA 4A22A 4RW5A 1XYMA 3AYRA 1W2PA 4XVDA 5MKGA 3A3HA 3FAWA 3R6IA 2EXOA 4MHBA 1XBZA 3IJ9A 1MNSA 2ZRVA 3LG3A 1THFD 1W1ZA 2XH7A 3W75A 1AQMA 1H1ZA 2QJJA 3NAVA 1G9HA 4AY7A 5CPQA 1RBLA 1TZZA 5CC3A 1CIUA 1MFVA 2HS6A 1UP3A 4W9TA 8XIAA 3WCZA 1EL3A 4AYGA 4DBDA 4QHRA 4PUJA 3LX9A 4HQVA 3ALFA 4Q8PA 2ZC1A 1J2WA 3N25A 4PUNA 4UCGA 3M41A 4QAIA 3MYPA 3FJNA 4C6JA 3TSBA 4TTGA 3CUIA 1EXPA 4U3AA 3CQKA 3CV1A 4BA0A 5E6ZA 4K37A 2JEQA 3DG7A 4MNLA 1B57A 3STCA 1XC4A 1CXKA 3PZUA 3CZEA 5LGZA 2H9AB 4LC8A 1P7TB 3CL8A 1JYVA 1RJPA 2RJHA 1LF1A 4PMQA 2AMGA 4KEMA 5T91A 1RHCA 2J24A 4DUXA 1IF2A 3VIHA 3W1XA 4FPSA 3L4WA 1FCUA 4BHYA 1QW7A 4H04A 3O9NA 3QBUA 3WQPA 5MF5A 3QZ6A 1HXJA 2X09A 1GOOA 1IEIA 1CXHA 3V5FA 1JAEA 2CYGA 3L4ZA 4RXGA 5M5DA 1NELA 3RLGA 3F4VA 4GC4A 1X1NA 3U57A 4G6CA 3VGEA 4AIEA 1E6QM 2DSVA 4XIAA 2VRJA 2NX3A 2PSNA 3HFYA 2ZFAA 3H4WA 2PE4A 2XTKA 5F4SA 3L4UA 3VGGA 4AEEA 4ACZB 1JF5A 2BOEX 1QHPA 2XYLA 3APTA 2DZAA 4MYXA 1FWNA 4M3PA 5HUPA 3USZA 4DJDA 3WJZA 2YDSA 8RUCA 3DCPA 4WX2A 1ITCA 3W4RA 1ZBWA 1QWGA 2ALRA 2EKGA 3ES7A 1SSDA 2V8ZA 2P3EA 1W9DM 2EPLX 4CQBA 3WQWA 1FWGC 3KBNA 4Q7BA 3CL7A 3C61A 4M0XA 3UXKA 2XVLA 3R43A 4QSFA 3PPHA 7A3HA 1YDVA 4FS9A 4XZLX 1IV8A 1L2UA 3PC0A 3WQGA 3CTTA 1FXQA 4QCFA 2FDSA 3UWZA 4QR6A 2VX7A 4GZIA 4DBUA 1UR9A 3AXHA 1R7AA 3AMDA 5ECVA 3WG6A 2BHYA 4AX7A 4JKLA 3WJXA 2VR4A 1Q8AA 3GXNA 1B90A 2DP3A 3TDFA 3T8QA 5C2CA 1K6AA 4LGXA 2JKPA 3TZFA 1F73A 2VEGA 3GZ3A 2PDBA 4H7VA 5D2WA 4AZIA 1GHRA 1UOKA 4N2YA 4WD0A 3L5MA 1AJ0A 3O6YX 3BSGA 3MZ2A 4C6LA 1F61A 3SAZA 3YPIA 3GQYA 3PPFA 2ZXDA 3S9ZA 5F1UA 1W17A 2VR2A 2VX4A 5EB8A 3VAVA 4O52A 3RJXA 4MG4A 1E0WA 3CWOX 1X39A 1MUWA 5I02A 4HSHA 4JFSA 3GXDA 4IMGA 1TZ7A 4LT9A 2ZXQA 2EPMX 1E1CA 4QJ1A 1GJPA 3PSWA 1IR1A 2VC6A 1EX5A 4HNUA 1NP2A 3GXMA 2PP3A 4EX4A 2E8ZA 3AZRA 3VI2A 3TOPA 2FJUB 4B3LA 1G7UA 4IQJA 3M0MA 5LIWX 2QAPA 3MI6A 3N2MA 5FAGA 5B7YA 4B5XA 1DOSA 3VCCA 3HPSA 3WBAA 5CBJA 3ANUA 4AAJA 4AU0A 1ADSA 2IW0A 1RUSA 1A3HA 4Q8MA 1BSIA 4UQCA 4GY0A 2E9BA 1KFBA 2QYGA 3MWCA 1W1B1 3M0LA 3QPEA 1BLIA 4GJIA 5RUBA 4W4QA 2WXDM 3HPZA 1YPXA 3QHOA 3AYTA 3B06A 3WK1A 1AL8A 4O19A 3R12A 2WCSA 1B30A 4LEQA 1LUCB 3BURA 3FSTA 3V75A 3SCVA 4PMRA 1IT0A 1GQLA 2I9EA 4POCA 3DN5A 3WJSA 4G1KA 5HPOA 5IRPA 1NM9A 2XN1A 1CGXA 1UZDA 2CPUA 2H90A 1PAMA 3C8FA 3W74A 4FA3A 4NF7A 1BHGA 1NOFA 1RA0A 3AIQA 3CHVA 2A3AA 5CAKA 2NSOA 3WQCA 3HQNA 3KXQA 2GSEA 4DBWA 3VUPA 3HGSA 4S3KA 1R3QA 3QEZA 4WDXA 1F6PA 3SDOA 4AG0A 4K8EA 4FLOA 1XG4A 4OQVA 3DYMA 2GUBA 1J96A 4L56A 3W24A 4WEVX 3DFHA 3HOJA 3A4AA 2H6RA 4XAPA 1EP1A 2WPGA 1CLXA 1NF0A 3UPMA 1ODZA 3N18A 2Q02A 4P8UA 4RNHA 3L4XA 3LI1A 1FWBC 2WJDA 4M19A 3FX4A 4NL1A 5EMYA 4OT7A 1HKIA 3W7KA 3G0UA 4JN6A 1J0IA 2Y5EA 1U2YA 4O4VA 4UR7A 2V82A 1NOUA 1LM1A 2O7SA 1IGSA 1BAGA 4H8UA 5EMUA 6ALDA 3I7SA 2GQ8A 3RLUA 4JFUA 1QDSA 3I6RA 2Z27A 3GNNA 2VQTA 2FGBA 2YZ5A 4W7VA 5ABGA 3EKGA 4L6HA 4R27A 4ZOEA 3L12A 2B4GA 1DKWA 4ZL1A 4MY9A 3PZTA 4G56A 2YIHA 3O7UA 1VQTA 2HDJA 4MB1A 2G4JA 3G0SA 3MKKA 1RH9A 4JQ1A 3ZM8A 1NEYA 4JIPA 2GGHA 1UQZA 4IG2A 4MZ8A 4PMNA 4JTRA 2BBFA 2HK0A 2Y8KA 2FZBA 4QISA 5AYXA 3E5PA 4XZNX 3IANA 2XSXA 4BI6A 2QVNA 2CZEA 1JZ7A 3EDEA 4N6FA 3HZ3A 4DJED 1SU5A 2GDUA 2VVNA 1GOXA 3UR2A 4NXSA 3OTRA 3DX5A 1UG6A 1WOBA 2EEXA 2YDQA 3P5ZA 3W1RA 3VYLA 4H8HA 4GINA 3N17A 2G37A 1HKVA 5CZTA 3W81A 3CAKA 4RZ6A 3PZOA 4PRRA 1M04A 3QOKA 1ZAJA 2AKZA 1W3JA 1V3HA 3IUHA 3LRKA 3MANA 3W22A 1VD6A 3LB0A 3VD7A 4IFOA 4EPKA 2DW6A 4RL3A 1RCQA 1UWUA 1QHZA 5HJXA 4MWAB 4GVIA 2UBPC 4W87A 1K7XA 4JL2A 3TE9A 2QJNA 4UOJA 5FAJA 3PB2A 3VPLA 3HTWA 1K4HA 1KGWA 2OZTA 4AVNA 4L80A 5FEZA 4YYCA 4XKYA 5CQ1A 3CZLA 4GISA 3N9KA 1ITXA 1SJAA 2AGTA 5EBAA 3LTPA 3T9PA 3UCCA 2NT1A 1MFUA 4PL2A 1J79A 2A5HA 3T40A 2GJNA 4FX7A 3WYZA 3EAUA 2ZRUA 3UA4A 3LHWA 3ZT7A 4J3UA 1A5AA 2I14A 1MVYA 4A35A 2H3DA 3SRFA 2YB4A 2VFGA 3C0SA 3LHUA 4A8RA 2WZHA 2W62A 2PLKA 2VM8A 3T78A 2D73A 1HJSA 1RK6A 4S3DA 4O1AA 1TV5A 5CSUA 3R0UA 3NGJA 3WLPA 3PPCA 2HTMA 3ITLA 4ACYA 1GKQA 1EUNA 4UNLA 4EPBC 1IZCA 1JF6A 1K7EA 3SCOA 3AIRA 1TPDA 2D3NA 4GH3A 3WF2A 5AC7A 1MYRA 2HWGA 3AQUA 3H2NA 5E0KA 4M7TA 2IPFA 4K36A 4P7QA 4MIMA 4TMBA 1L6GA 4DUOA 1B2YA 1WZKA 4NJIA 1KNWA 5A69A 2XIBA 4O1CA 1R3YA 5DBUA 4TIMA 3RHGA 3F5LA 1VFOA 3KM8A 4DXXA 3VXGA 1HJWA 1NDVA 2D20A 1PSCA 5C7VA 3WMBA 4MM1A 5FF4A 1UKQA 4FX8A 3M4HA 2PZNA 4LWWA 2F84A 4P8XA 7REQB 1PKLA 2JQXA 2QCFA 3CEUA 2UY5A 2F8QA 4IM4A 3K4AA 3S1XA 4M8UA 5PTDA 4PTMA 1KFWA 1UQYA 4Q7NA 4AXNA 5CSRA 2D0GA 3MMTA 4HN4A 1C9DA 1GOQA 2NXGA 3M1ZA 2CWXA 4GUGA 4R9OA 1XC6A 4AC7C 2Y62A 4LYKA 1UWIA 1ZP4A 3E38A 2ODOA 5F2GA 2VEIA 2VFIA 1JCLA 4K7YA 4IQEA 3T4WA 3COTA 1BTCA 3BMVA 1QW9A 3W7MA 4AY1A 4Q3MA 3T1GA 3WQ4A 3LEPA 1ELSA 1XGEA 3DUGA 4NP7A 1KM1A 2PURA 2ZZ5A 4JYFA 3NO1A 1HO4A 3BC9A 3DI0A 5I23A 4D8AA 3UD6A 3JZUA 3SCWA 1FHVA 4PSRA 1OB0A 1OYAA 3N2OA 2AKMA 4LB4A 4WKAA 2VGIA 4QS5A 4GCXA 4N0RA 1UA7A 4HOXA 3L2LA 2CERA 1E73M 3P8IA 1SO5A 3UJRA 3QFWA 4HIBA 1MUMA 1QO2A 4U5IA 2NXHA 3DFTA 2PWVA 4I7VA 2P10A 2NQZA 1D8WA 4BFAA 4E4UA 2OQHA 1QI5A 3LXBA 4Q8UA 3OZMA 4IT1A 3FLUA 1LRQA 3BAIA 4GI4A 1V0MA 2CNCA 3NQ2A 2G0WA 5BW6A 2DIEA 3BLFA 1V3MA 1G67A 2UWFA 4JGDA 4MY8A 1Q2SA 1CI1A 3PN8A 2E0PA 3H54A 2HROA 3RX2A 4CCDA 1QNRA 3PZ9A 4YS1A 1L2QA 3EXTA 4J3VA 2HS8A 3ZR6A 3B9OA 1RJRA 2Y5JA 2BHUA 4BK9A 4JCLA 2XIIA 4DY1A 5D04C 5BNKA 1XRSA 1XPGA 5AVNA 2E5CA 5DELA 5HUOA 3WQVA 5H91A 3WNOA 2ONEA 3I4EA 1WBJA 4OZOA 3HQ1A 2Z1KA 3UESA 4JYDA 5HAOA 1C9WA 1HQTA 2B31A 3G6LA 4A3RA 4ADSA 4QJ5B 2IPGA 1F4HA 3HQOA 3VKKA 3QOMA 1R30A 1GGOA 2C0HA 4O8AA 3EX3A 1XM3A 2BVDA 4WKFA 3IRSA 1POKA 3QZEA 5HWJA 4MJMA 4ZQCA 4NJJA 3Q45A 1B54A 3E0VA 1SZRA 2NLIA 3HV8A 4J3ZA 2BY3A 2WPBA 3VX1A 3RU8X 5H8MA 5G2HA 1O1ZA 2PB1A 3W1TA 3QMTA 4NYYA 4DWSC 4W84A 1EJXC 3LENA 3RFAA 3P2VA 3MV11 3VIMA 4S3GA 5A8GA 1E70M 2AL2A 4QE4A 3E2QA 3U2EA 3KZSA 3SY5A 3M5ZA 4PCNA 1K9TA 3KBSA 4UZUA 4A8IA 1XCFA 5HMFA 3G1YA 3QTPA 4MB4A 4AX6A 3BLPX 1HO1A 3TSMA 1EA9C 1F9CA 2FPVA 4WY0F 3L5LA 3WD4A 4IMAA 3M6YA 5D9NA 2OPJA 1F3TA 4C6BA 5HNRA 4Q8NA 2V3GA 5FL1A 5HNUA 2J4GA 1QO5A 1VB9A 5A6LA 3THDA 3L2MA 1DWAM 2DU2A 4WIWA 5CXPA 5G4HC 3SUUA 1VBJA 1ICPA 2J9YA 1YEYA 3BW4A 2NW0A 4FNTA 1WXJA 4EPDC 3LTYA 5DANA 4PUDA 2Y1HA 2YPIA 3OZYA 1L9WA 2XVKA 1OC5A 4LRSA 1K77A 4LRTA 4AEOA 2WSYA 4OFCA 5HWMA 3ZFHA 1DWHM 1V08A 2FZNA 3CASA 3GSMA 3J7HA 1FVPA 1I1WA 4S39A 3SZ8A 4WY0A 2ESCA 3H70A 4JIIX 1GG1A 2YBUA 3AC0A 3W7NA 1PDYA 1J12A 5KZEA 3UW6A 1BRLB 1KM6A 2J13A 3CB3A 3R1ZA 1GJUA 4HZ7A 1WV2A 1OG6A 5C9WA 4I5UA 1JVNA 1V0NA 3PZQA 4BQ4A 4IX0A 1S3HA 3SN1A 1OK6A 4MB5A 2Y7GA 1I2RA 1KO0A 2PGRA 3MBDA 2XUCA 3I3DA 4I9TA 2INFA 1XYCA 3NDZA 2QKFA 4XO7A 1FHUA 3BGAA 3PBGA 1P0BA 4ZE5A 4FX6M 1E4LA 3VTRA 3KOYA 2W4XA 2NLYA 4PN2A 1ITQA 1MDRA 2ZYFA 3GH7A 1XYAA 2OMAA 1HT6A 1V3IA 4DJEA 4O8RA 3CB8A 3MW7A 1E0XA 4DAIA 2GFTA 3S2NA 3URAA 5DCBA 1XISA 2Z2AA 1TJ2A 1XH2A 5KTLA 2KAUC 1UR8A 1G1YA 1SZFA 1KLYA 4J2MA 1Q6GA 3IJLA 1KRCC 3HB9A 1KM4A 4FF5A 4NZ5A 2YOCA 1A47A 1Q6OA 4WDWA 1JDEA 3WQFA 5K4XA 2O92A 3GYEA 2H3BA 4S3BA 1OFEA 3LYEA 2VTFA 4GQRA 3SY8A 3WUBA 1H50A 3VNLA 2J79A 1Q6FA 5BU9A 2QGHA 3WFLA 1EBHA 5E6YA 3ZT5A 1BPLB 1XLLA 1IE7C 4P5UA 4ZSUA 2ZVRA 4QG9A 5IFPA 2CLIA 4O0QA 3WD2A 4IWWA 6TAAA 5A6BD 4UUIA 1OD0A 4UFIA 4DJFC 5BOFA 1JZ4A 4NAEB 3V5CA 3MJYA 4O57A 3QH2A 1UJQA 2GPTA 4DZ5A 1D2KA 3QY6A 3W2LA 1KFKA 1AG1O 3I10A 3ZWSA 5AC6A 1TFVA 1BWKA 1TIWA 3NQDA 1OFPA 3NIYA 5D2TA 5CSYA 1T8QA 3KRSA 2E6AA 3B8IA 4X9SA 4NHVA 4M56A 1RP9A 3HFTA 5LNRA 3C86A 3LRLA 4IFKB 2B0MA 1AQFA 2WHKA 2OKTA 1KD0A 3DZ1A 3W38A 3NQBA 3OQEA 3F2DA 2BSLA 1V77A 5CSSA 4BQ5A 4OOUA 3W83A 2EBNA 1ZCOA 2IQ0A 4BF9A 1BKHA 3LSBA 4ONVA 4U10A 3CC1A 3THAA 1SUXA 3OLDA 5FF0A 1TPEA 1XSKA 3H2AA 2QUMA 4ZQMA 4TMCA 1FCQA 2R8WA 3E02A 3O06A 4LBRA 1SM9A 1UB3A 4RE0A 3GBEA 4L64A 2BXZA 3EEGA 1JDCA 4NZ4A 3OBKA 4GYPC 5DBTA 1ISYA 1GHSA 1Z41A 5C70A 2XFYA 5AKQA 3O6DA 4UFLA 3GTHA 4N7QA 1EXBA 4EXAA 3D5HA 1TTPA 2XINA 1KXVA 3REQA 4HSOA 3PTMA 1OT2A 1J18A 3RRAA 5G2IA 4EACA 2J8GA 1BYDA 1K03A 1J4EA 4HCHA 4HU4A 4LAUA 4U4MA 3H26A 3QY7A 4ZFCA 5EMKA 2PLCA 4H7ZA 1GVRA 3QHMA 4GVGA 3EWUA 1LOQA 4IIEA 4C1NA 1UWAA 2VC5A 3VIJA 1PYMA 3WLRA 3H2OA 1H49A 2WWCA 2R9RA 3VIKA 1O5QA 3IARA 2QPXA 1B3YA 3RU6A 1CCWB 3GFXA 3WNNA 9XIAA 1S46A 2P8BA 5I77A 2V9DA 4IHCA 4J28A 3WFAA 1GVFA 3EOLA 4KCUA 5AY7A 5LYRA 1KFLA 5EBUA 1J8VA 4ZTYA 3W1MA 3BCJA 1W9PA 2GVLA 3EXSA 2FMOA 4DYJA 3RMEA 2QJIA 5KZ6A 1NAL1 3O15A 1S5MA 3BG5A 2ZA2A 3AHYA 3KHDA 1DTNA 2P1FA 4DIAA 1UKSA 2ZXAA 5HNTA 1DXEA 5C9ZA 4K3ZA 4UMBA 1I9CB 3TYBA 2R1LA 1DIKA 1XYZA 3VNKA 3TUUA 2CHNA 3E0IA 3BV7A 4I9AA 1PPIA 4YHGA 4X0NA 2BHZA 1E3XA 1OCNA 2QUUA 2X2YA 3CHCA 1ZLPA 3CNYA 5TQLA 4XVEA 3TC3A 1EP3A 3WKZA 1US2A 2Q3RA 2J74A 3O3RA 2EQDA 1H51A 3AYVA 4XSMA 2FYMA 1R8LA 2ZUMA 1TREA 4XD4A 1ZUAX 2VUYA 2BY1A 3M7SA 2G8ZA 3RCYA 2J7HA 4AZCB 4OIFA 2FHCA 2WZMA 1TO3A 4I6KA 4WRHA 5KETA 1EC8A 4GK8A 5DFAA 3TJXA 3U6WA 1J0HA 1B31A 3TR2A 5CG0A 3K2GA 4KFOA 2X42A 4HNVA 1R2SA 4KCTA 4C6MA 4BY3A 2XIJA 3M0VA 2Q3OA 3KLLA 2JKEA 2P8CA 9RUBA 3VDHA 3MCNA 1BXNA 3VDBA 2V0TA 2B7OA 1I75A 5FJJA 1AQ0A 3RK8A 3VDAA 1QI0A 1MNZA 2B7NA 2OCZA 5CAHA 4WVXA 2NX1A 4BS0A 3ATZA 3K8LA 5LIUX 1PO9A 4FNPA 2FZ8A 2XVNA 3V5OA 3RCMA 4Z2IA 2GQ3A 4GBUA 3GTNA 4M82A 2RDWA 5IXEA 1DIOA 5I3DA 5IHSA 1WCGA 1ZL1A 2KZHA 2WC4A 4NNAA 2Z28A 3S5SA 1OD8A 2IPWA 3H2FA 1DXFA 1E72M 3M0YA 1CBGA 1U5HA 3GIPA 1Y7VA 4MSSA 4MZ1A 2Y70A 4V27A 2CBJA 3R7MA 3XIMA 6ENLA 1GEQA 1J6OA 3WH8A 1BQCA 3A21A 3P0XA 3LDVA 1I2PA 1VYRA 2Z25A 1B3XA 5CZ0A 4ZO7A 1DJHA 2QVHA 1QHOA 2NV1A 3HMJG 1SW0A 3W7CA 2ZKMX 1EWDA 2ON3A 3WLHA 3ARVA 4NILA 4FP1A 1LBLA 2VX5A 3EMCA 2VC9A 3QGVA 4C7FA 4D1JA 1O94A 3KBVA 3CO4A 3PZMA 2A21A 4QQUA 3QMRA 1QOPA 1VS1A 1CT5A 3NQCA 5ABFB 3GTFA 3CYVA 5BOOA 1C8VA 1OINA 2XN0A 4DXKA 1Q6RA 1OGBA 5HJYA 1LL4A 5DMMA 4JD4A 4ECLA 1DWFM 4JR5A 1V6XA 3IRDA 3G22A 2DVTA 3TTYA 1O4UA 3PWAA 2E8YA 1C8XA 4UXDA 2A3LA 3W1AA 1LT7A 1CPUA 3QJAA 4PMJA 5BXRA 4RXFA 1R5YA 3ARRA 1W1A1 1ZP3A 3H53A 3LN3A 3N4FA 4NRRA 4J3WA 2J25A 4RUBA 3LQGA 4XK2A 3SCUA 4AIOA 1TMQA 3M47A 1CGVA 2CZ5A 3RPTA 1M65A 3PP7A 3S5OA 4UTWC 4WK9A 5BROA 3UWEA 4IIDA 3H6OA 3MWAA 1ICQA 4DLFA 3NVDA 4DBEA 4RE4A 2W63A 3HQPA 4AMAA 3LI0A 1ZQ5A 4ZCWA 3IVSA 3MUY1 4K8GA 1VFTA 4LUTA 3QMSA 2PBGA 3GFYA 1H3GA 3GY1A 1WX0A 2PGWA 2UY3A 1JPIA 5DT5A 5A6KA 3N29A 1N8FA 3ARTA 3DOPA 2NVCA 2FFIA 3BAXA 1X97A 2J7EA 5A3HA 3GXIA 3GAKA 3MMDA 4AIUA 1EQCA 4RJEA 1KXTA 1TSIA 2ABBA 2Z1SA 4LSBA 4C1KA 5CGQA 4Q8TA 2UY2A 3CO8A 2OT1A 1HJVA 3ARSA 3R0DA 2A85A 3FA3A 4UR9A 4NY2A 2X8RA 3KS6A 5L9FA 1QVBA 3GHUA 3RNDA 4GH1A 1V6TA 1EQPA 3QN3A 4DWSD 4Q6JA 3WJYA 2YXGA 4ZBCA 3WK0A 3CHFA 3N2XA 4LY4A 2XSAA 2C0AA 3WQEA 5A6BA 3RJYA 3V0SA 3M9YA 2BMBA 4BR1A 5BOEA 4L1WA 5TF0A 1XG3A 1TUFA 1R2TA 2G96A 5E09A 1E15A 3UG3A 3WK3A 1YXDA 3KLKA 4IQDA 3MDUA 4F0SA 5CLWA 1VIZA 1EX1A 1SZEA 1J0ZA 3EKZA 3UG4A 3P84A 2VWSA 1OBAA 3I6EA 4XQ6A 3QQ0A 3WFZA 3NOYA 1DE5A 4CQAA 1UA3A 4FOKA 3LGDA 4TV5A 2PF0A 1ONXA 4H9ZA 3DDMA 4DNHA 1NQKA 5LNUA 5CBBA 1UD6A 3VZZA 4H9MA 3E0WA 4HK7A 4XKMA 1EJTC 1VGAA 4W7WA 4A21A 4C6QA 4DM2A 2G3NA 3EPOA 3HIJA 3TCSA 3CAWA 3DI1A 3DBPA 1OFAA 3HPAA 4HYWA 3AZSA 3ZIZA 2I57A 2PF8A 4QRNA 1Q45A 2PCQA 3MUCA 4J3SA 1W0MA 4BI5A 4PTVA 1WP6A 3NPVA 4J3XA 1P1MA 1KCLA 2DJXA 2DZSA 4ZO9A 3O05A 2HE8A 4FB7A 2Z7GA 4AXKA 5AECA 3O07A 3NQGA 4XBSA 4C7DA 1IXQA 2EG6A 3CUJA 3QVQA 3V35A 1GQKA 1JDAA 5EL1A 4R3UA 1R86A 4C6FA 1S3TC 1J0KA 4IX2A 4PB5A 2J8FA 3GNRA 2NZLA 4HYRA 4F48A 3QQ1A 2OO0A 4O28A 1MW2A 1VEMA 3ZT6A 3NL6A 4I5RA 1SZGA 3B97A 5EMMA 5DXXA 3S5YA 2ADAA 5K7JA 4E3VA 4KS0A 3R8RA 1LDCA 1P43A 1FBAA 2F9RA 4Z2HA 1F6YA 3KTCA 3F2BA 1V02A 3F4WA 3NYZA 5A5WA 4D8LA 3RITA 4LAKA 4C5ZA 3CPRA 2A4AA 4NKCA 3KTSA 2XWEA 3CH0A 1KTNA 1VBUA 1OWQA 3FAXA 3U4FA 4D6CA 2P76A 1X1OA 2X2GA 5E5CA 4GIRA 2OU4A 4L4MA 2WV8A 1L6YA 3W7LA 2J66A 4GVFA <