2FTWA

Crystal structure of dihydropyrimidinase from dictyostelium discoideum
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
484
structure length
483
Chain Sequence
TGTILIKNGTVVNDDRYFKSDVLVENGIIKEISKNIEPKEGIKVVDATDKLLLPGGIDTHTHFQLPFMGTVSVDDFDIGTQAAVAGGTTFIIDFVIPTRGQSLLEAYDQWKKWADEKVNCDYSLHVAITWWSEQVSREMEILVKERGVNSFCFMAYKNSFMVTDQEMYHIFKRCKELGAIAQVHAENGDMVFEGQKKMLEMGITGPEGHELSRPEALEAEATNRAIVIADSVCTPVYIVHVQSIGAADVICKHRKEGVRVYGEPIAAGLGVDGSHMWNHDWRHAAAFVMGPPIRPDPRTKGVLMDYLARGDLDCVGTDNCTFCADQKAMGKDDFTKIPNGVNGVEDRMSIVWENGVNTGKLTWCQFVRATSSERARIFNIYPRKGRIDVGCDGDIVIWDPNQSKTISKDTHHHAVDFNIFEGIKVTGIAVTTIVAGNIVWSDNKLSCVKGSGRFVPRPPFGPVFDGIEQRDKVRNELLRKVDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords dihydropyrimidine amidohydrolase
publication title The Crystal Structures of Dihydropyrimidinases Reaffirm the Close Relationship between Cyclic Amidohydrolases and Explain Their Substrate Specificity.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Hydrolase
total genus 182
structure length 483
sequence length 484
ec nomenclature ec 3.5.2.2: Dihydropyrimidinase.
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2ftwA01
3GTHA 2D2HA 2OOFA 3T8LA 3T81A 2Z7GA 4KESA 4LEFA 4CQBA 1NDWA 3LGGA 4C60A 4M51A 2YXOA 3CS2A 3MKVA 2QPXA 1M7JA 2UZ9A 3TN3A 2HPMA 3F2DA 3GTFA 4RDWA 3AU2A 1KRCC 3MJMA 1QW7A 2XIOA 4C6EA 2WM1A 1E9YB 3PNZA 3URBA 3LY0A 3E74A 1A5MC 3GTXA 4RE0A 4C6JA 3K2GA 3S2MA 4DZHA 1W1IE 1P6BA 1RJPA 2E1WA 4C5YA 4XAZA 3EGJA 4GY1A 3A3WA 1DPMA 1RK5A 4C6MA 1XGEA 2QS8A 5A6TC 4C6FA 2OB3A 2Q09A 3LSCA 4RDYA 4NI8A 3E2VA 2PUZA 3AUOA 1ITUA 4DLFA 3PNUA 4KF1A 3JZEA 4EPDC 2YB1A 3LSBA 1EJTC 1ZZMA 2WJFA 1KRBC 3FEQA 1NFGA 3GU1A 4XD4A 4EPBC 2QT3A 3OODA 5HMDA 3B0YA 4LAMA 3RHGA 2ANUA 2D2GA 1PSCA 4GX8A 2GWGA 3B0XA 2Z2AA 4PBFA 2PLMA 1K6WA 5HMEA 2ICSA 4LH8A 3PBMA 4IFKA 4GYFA 2DVXA 4TQTA 1JGMA 1KRAC 1YBQA 2EG6A 4R85A 4F0LA 3QY7A 4GK8A 3TN4A 4C65A 4H9YA 4HK7A 4DNMA 4IF2A 4H01A 3F2CA 2R1LA 3QY6A 1RJRA 1KCXA 2P50A 3AU6A 2O4MA 3A4JA 1GKPA 4DZIA 1S3TC 1R9XA 4XD6A 3UBPC 4NP7A 3E0LA 2QVNA 4XD5A 3GIPA 3G77A 4XAYA 2HBXA 4WVXA 2Z4GA 1R9ZA 2FVKA 2Z27A 4INFA 3LGDA 1FWCC 5E5CA 3V7PA 3QGKC 2ADAA 2PGFA 3OU8A 2R1PA 1FWDC 2VM8A 4HA0A 4QS5A 3RCMA 4IGNA 3TNBA 4CQCA 2OQLA 3IPWA 4IQJA 4CNSA 1UMLA 3DC8A 4H9ZA 1XWYA 1M68A 3LS9A 4UB9A 1J6PA 4J35A 3MVIA 3QY8A 3BE7A 4RDVA 2G3FA 2GZXA 3K4WA 4IFRA 1EJVC 2Z28A 1GKRA 1NDZA 3IARA 4IFKB 4G7EA 4H9TA 3E0FA 4IFOA 1R9YA 4HK5A 2Z24A 1A5NC 1YBQB 4DI9A 3RYSA 4WGXA 1EJWC 1J79A 1EJSC 1WXYA 4IH3A 4CNTA 3PAOA 3EWDA 4PBEA 1YIXA 1FKXA 1ITQA 3ISIX 4PE8A 4ZSTA 4ERIA 2VHLA 3FDKA 3GG7A 3F4DA 4CEXC 1FWGC 4IGMA 3MPGA 5FSDC 3URNA 3LU2A 4LAOA 3B40A 4BY3A 3MVTA 4LCSA 4UBPC 4F0RA 2AQOA 2GSEA 3R0DA 4IG2A 4NG3A 2UBPC 1EJRC 4H9UA 1FWEC 2EG8A 3UR2A 1QXLA 3GU2A 2HPIA 4R7WA 3IACA 4ERAA 4DI8A 2FTWA 3HPAA 1FWIC 1HZYA 1A4LA 1O12A 3UPMA 3S2JA 1O5RA 3O0FA 4XD3A 1RA5A 2YB4A 4G7EB 1UIPA 3OVGA 4V1XA 4KEUA 3EWCA 3A3XA 5FSEC 4LFYA 3ICJA 4H9XA 4C6BA 3S2LA 3PANA 3DCPA 2Z29A 1FWFC 2AMXA 2DVUA 3IGHX 3WMLA 1V79A 2I9UA 1V51A 1ONXA 4LCRA 2WJDA 3MSRA 1J5SA 1RJQA 3MDUA 4CEUC 3IV8A 1VFLA 2OODA 2HQAA 3HTWA 4RDZA 2A3LA 4KERA 3N2CA 3RN6A 4LANA 4B3ZA 1UBPC 1YNYA 2ZC1A 3TN6A 4EP8C 2D2JA 4IG2B 1FKWA 4HJWA 5LXXA 2O4QA 1EJXC 2Z25A 4GY7A 4GBDA 3GU9A 2R1KA 3UR5A 1IE7C 2VR2A 1M65A 3NEHA 4JOMA 4GX9A 3UF9A 4B91A 4C6IA 4KEVA 4QS6A 1YMYA 4C6QA 4C6DA 2Z2BA 4AQLA 3WZ0E 3C86A 1BF6A 4QRNA 3KM8A 1POJA 4C6NA 4H9VA 4F0SA 4MUPA 3CJPA 4C6CA 4L6DA 4DLMA 4P5UA 3F4CA 4KEZA 4H00A 4BJHA 4XAFA 1A4MA 3LNPA 4CNUA 1EJUC 3MDWA 4EPKA 4LAKA 1ONWA 4C5ZA 3SO7A 3CAKA 1A5KC 2KAUC 2HBVA 3LA4A 2BB0A 1J6OA 2DVTA 2GOKA 4AC7C 1PO9A 1POKA 2CZVA 2GWNA 5G4HC 1EYWA 4C6LA 4QTGA 4I6KA 3K5XA 2I5GA 3D6NA 1E9ZB 4KETA 2PAJA 1PTAA 4DYKA 4OFCA 4KIRA 2Y1HA 3F2BA 3S4TA 4L9XA 3MTWA 5AKQA 3ORWA 4C6OA 1A5LC 4H9MA 2OGJA 2VC7A 1FWAC 3E3HA 4HK6A 1YRRA 5HMFA 4C6KA 4LALA 2WJEA 3IJ6A 4R88A 2HNHA 2R1MA 1K1DA 4QSFA 1FWJC 5CH9A 1A5OC 4DO7A 2Q01A 4KQNA 4E3TA 4Z42C 4RZBA 4I6VA 4BKNA 1NDYA 4ZSUA 3NURA 4ERGA 1EZ2A 3URQA 4LCQA 2BGNE 2Z00A 4YIWA 1I0BA 3WYZA 1WXZA 3GUWA 3DUGA 1P6CA 3IRSA 1V7AA 2IMRA 4ICMA 3URAA 2FFIA 3SFWA 1PB0A 4QROA 2VC5A 1V4YA 4PCNA 4V1YA 3ITCA 2FTYA 4PCPA 3NQBA 4GXWA 3OJGA 4DIAA 3GIQA 4CQDA 3S2NA 2VUNA 4GZ7A 2R1NA 1I0DA 2Z26A 2AQVA 4D8LA 2E25A 4J5NA 3E38A 3FDGA 1P1MA 1RK6A 3QGAC 3ID7A 1XRFA 4XAGA 4GC3A 2F6KA 2W9MA 3HM7A 3T1GA 2PGRA 1UIOA 2RAGA 4C6PA 3O7UA 2P53A 3OOQA 1GKQA 2FVMA 1K70A 1V77A 4B90A 3GRIA 1KRMA 3TN5A 1XRTA 3GTIA 4J2MA 3OQEA 4G2DA 4EPEC 1EF2A 1FWBC 1NDVA 1FWHC 2EG7A 1RAKA 1ADDA 1RA0A 4B92A 4GY0A 4WHBA 4GOAA 2YZ5A
chains in the Genus database with same CATH superfamily
2FGZA 2NXIA 3PUEA 5C70A 3NSNA 3SRFA 1VENA 3KOZA 3QOKA 2YDRA 3KOXA 2Y5SA 4H8NA 3WD4A 1QO5A 4FNRA 2YXOA 3W76A 4JCMA 4QAIA 2ZA2A 4PN2A 3GTFA 3VC5A 3P7YA 1AH3A 4XO7A 1IT7A 3N9SA 2XHYA 3WDIA 4Z1YA 1NVMA 2C91A 1G4TA 3AO0A 3FA5A 4V28A 2XH2A 1A5MC 2E6AA 4IPNB 4FX6M 4ACYA 4ONVA 3RXZA 1VJZA 5C0QA 2DIJA 2FVLA 3A3WA 3AYRA 3EB4A 2QCNA 4YWIA 3TYAA 3ZM8A 4FR6A 3QW4B 3DG6A 3ARVA 3CTLA 1SFLA 3CEUA 4DRSA 3E9AA 3NQ6A 5AC8A 2JGQA 3PNUA 4EPDC 3NQEA 1OJXA 3B04A 3S5YA 4DBSA 3GY1A 3WD2A 2WQPA 2F2KA 3PSVA 1AVAA 4V15A 3W7RA 2VFGA 4O8RA 2IKGA 1ICSA 1EH9A 3N13A 1B3ZA 1LTDA 2X30A 3B8TA 1FH9A 3TMQA 3WBXA 4IIHA 1ZP4A 1J0ZA 3GIYA 3B8WA 4O4WA 1XLDA 1DJQA 2WJZA 1G69A 2XSAA 3BAJA 5DF0A 3CXOA 2BGQA 2PODA 2XVNA 3F2CA 4IWWA 5CLTA 2C0AA 1E6QM 1GKPA 2QAPA 2XSXA 1EZWA 5FF7A 1JR1A 1N2VA 3CASA 3EWYA 4GE8A 5BROA 3VK5A 4CN1A 1KR0A 3S1UA 1KQYA 2IKHA 1R9ZA 4NNBA 1OC5A 1FWCC 4UUIA 2VJXA 2YXXA 3E5PA 3DHDA 3L12A 3TNBA 5JH2A 3WNMA 3FW6A 1THFD 1QCWA 4HTYA 1OFDA 3G1AA 1XLAA 4W93A 1IIHA 5CPOA 2ZRZA 2D0FA 3VMPA 3MVIA 1TQXA 4DM2A 3PTDA 4MB3A 3ZR5A 1WDWA 3B05A 1CW2A 1F73A 2PE4A 5K9CA 2B7NA 2C16A 3R79A 1MQQA 1TIWA 4RJEA 1QOPA 2W6RA 5LYRA 2P3EA 1KXQA 2PDPA 5T91A 3EB2A 4PRRA 5CG0A 4OT7A 2HV5A 1I75A 3HQOA 1F9CA 3P84A 3W85A 3NQVA 1B0IA 3QV6A 4S3AA 2X1SA 3EBVA 3PZIA 2XGIA 5A6BD 1VCFA 1XIFA 3MVTA 1JJKA 5K4XA 1XPGA 3W9ZA 4IMCA 2GGIA 3WQPA 2FGBA 4XUYA 3QYSA 3VCRA 1DIOA 2WC4A 4AWTA 3CWHA 1TX2A 4UQCA 2NZLA 3WBYA 2A3CA 2V5LA 4HA3A 3KE0A 4HT3A 1UWSA 1UP0A 2PFHA 4XWUA 4AD5A 3RK8A 4AIUA 1QBBA 3SCUA 1FWFC 4LPCA 3OLIA 2WLZA 3NM3A 5AFDA 2BSLA 4EE9A 3PWIA 4NZCA 3CT2A 1JYWA 3WUEA 4TV5A 3IV8A 2C18A 3TR2A 2C1IA 2REQB 2FTPA 1NOUA 2OSXA 1EWEA 4K1GA 3MMTA 4A3YA 4NU7A 4F0KA 2KX9A 3HG2A 4O52A 1FKWA 2WB5A 3BMVA 2QGHA 1TMHA 3HV8A 3CZJA 4JX5A 2FPYA 3GKAA 4AYGA 4WLCA 1FY6A 1J96A 4PEEA 1CB2A 1W9BM 4JHMA 3CLMA 4C6IA 3WELA 4F3HA 4FLOA 3II1A 1YMYA 1Y5WA 2Z2BA 2A85A 7ODCA 3BOXA 4UTWA 3SUSA 3VC6A 4FI4A 2PDJA 3KS5A 2VD8A 4HPNA 3ABZA 1YDOA 3L4XA 4IIDA 5B7ZA 4XAFA 1S5VA 3XINA 2V38A 2OT0A 3UWYA 4EPKA 1UHVA 4CD7A 1XHGA 2KAUC 3LNMA 2Y7DA 4LV9A 2OU4A 5AZ0A 1YADA 1F3EA 3ES7A 5AHEA 3AICA 3W02A 1J11A 2YGYA 3MSYA 1JRBA 4W89A 5GNXA 3HG4A 2YLLA 2VCCA 2P8BA 3QVQA 5AYBA 3G6MA 2YOCA 1JVNA 2W3ZA 3WLJA 2Y7EA 4YTRA 2XWEA 3DAQA 4EF8A 1HGYA 2ACRA 1YTKA 5G5IA 4Z42C 1VFOA 4S3JA 4KS0A 3TW9A 2XIJA 1BYDA 1KTCA 5C2CA 3RLVA 1TTIA 1CGYA 1GVOA 3U6WA 4DYJA 1Z9AA 5A95A 2X0SA 1VRXA 3R10A 1MRQA 4PR4A 4OZOA 3FGCB 4US5D 2D69A 2R1NA 1ISVA 3CQIA 4D8LA 4HOZA 1K6AA 2YXGA 3L4VA 1P5BA 4AD1A 1GQLA 1CTNA 3DFSA 2DPEA 1XI3A 5EY5A 5AYZA 1TJ0A 4ORMA 4H8HA 3DXIA 1BSIA 3WQ5A 4M6VA 3E2RA 4IQEA 3UT0A 4PYSA 3SRHA 3B9OA 2Y8UA 2OZ3A 1FWBC 1X7FA 3MYOA 1LUCB 2DGAA 5IHRA 2J27A 4GQBA 5C9RA 3EMCA 4XISA 1H1NA 4F66A 2JQXA 1QNVA 5ECUA 4GI8A 1LQ2A 4TIMA 2Y63A 6ALDA 3KLLA 2BHYA 3LHVA 4AIOA 2OG9A 2ZQ0A 2C0HA 1H3GA 4W84A 2WHJA 4B5NA 5LIYX 1K8YA 4IIBA 4GA8A 3HQ1A 1TPUA 3UYIA 3THAA 8CGTA 2BXVA 4R33A 1N8FA 4DEFA 3E2QA 4XZNX 1RJPA 2CWNA 1A47A 4XAZA 2OOGA 3A23A 5DT5A 4URIA 2HSAA 3MP5A 3VZYA 3IANA 2OGYA 4GFSA 1TKKA 4WSJA 3QW3A 1CGXA 2Y5JA 4UTJA 1DJYA 4FX7A 5HATA 1QPQA 5I23A 5XIAA 2OR2A 3QV9A 1OCBA 1ZPTA 1OQFA 2WJFA 3N2TA 4ZEPA 3OEXA 2GGGA 4HIBA 1SJDA 2WKJA 3T0TA 3WLKX 3H2OA 1JDDA 1NFGA 4M24A 3H6OA 3GQYA 3C0JA 4GD0A 2YPIA 2VT0A 1AZ2A 3T40A 1YDYA 5CZKA 3VKAA 4GX8A 2GWGA 3ITXA 3RU6A 4PB3A 1XYAA 4E38A 2GYIA 2WANA 1DE5A 1HKIA 1O1HA 1BEUA 4GO8A 4GVGA 3SGZA 3S8HA 4IUGA 1AUSL 3WJWA 4CNPA 1R2RA 1LROA 5JU6A 3NJ3A 5HPOA 1EYEA 2ISVA 3M44A 1AG1O 1UOZA 1DHPA 2O56A 4NYUA 1ZNNA 1Q63A 4XZIA 3N3TA 5DO8A 3GBEA 1HL9A 3GHRA 4AHPA 4CU6A 3VGFA 4MJMA 3V7PA 4BEUA 1IV8A 3RCMA 1DIDA 1UMLA 3WLRA 3AS3A 4QG6A 3S5OA 3QZEA 1M68A 2I16A 5D2YA 4IFRA 4EXQA 1V02A 3DFTA 5K9XA 5BCAA 4H9TA 1KFLA 5AYXA 4HYWA 3ZWSA 1LF1A 3RYSA 4MJ2A 3VIGA 1JCYA 3ZO9A 1UKOA 3KL0A 3JRKA 4MDPA 4N4PA 1WX0A 1TELA 2X16A 3RAOA 3VFCA 4PBEA 2JBMA 4GXMA 3O1NA 1ZQ5A 2L5HA 1FKXA 3NQFA 2D2OA 1PWMA 3SQSA 3MI6A 1ZENA 4LVFA 3CQ0A 3H55A 5E9XA 5GNYA 4L61A 4YL2A 1AD4A 1E0TA 2OZ0A 4H1ZA 4JEJA 3VNZA 1OG0A 2AL2A 2XFYA 1KWKA 1OCNA 2NX1A 3MUZ1 2PDKA 2D23A 3B9DA 3MBDA 4AU0A 3GVGA 3RNDA 1JD9A 4PEKA 1XGZA 2AKMA 1GVIA 1RA5A 3BDKA 1QASA 3CUHA 3A3XA 1CI1A 5FSEC 3W83A 1JCJA 1GQJA 4JIPA 4LSBA 4GUJA 1ZJIA 1PYFA 2INEA 3M0KA 2VWTA 4LRSA 3D46A 2ZFAA 3AIQA 1XLIA 4RDZA 3VX1A 1OINA 4M1BA 3N2CA 2GQ3A 3W82A 4REQA 1UPMB 3RRAA 3L4WA 1TE1A 4HJWA 3LN3A 4U28A 4GY7A 1LQ0A 4KWSA 1OFPA 3CYJA 3GU9A 4NF7A 3AYTA 3S1WA 1W9PA 1AL8A 3VD9A 4QLLA 4C6QA 1U83A 3W1PA 1TVPA 3VNKA 2BMBA 4AQLA 3LOTA 1Q3NA 3NDYA 1X38A 3FHQA 1T40A 3RM8A 4F9DA 4UOJA 4UFIA 1HVQA 1IR1A 4PMUA 1LJYA 3TNOA 1X1OA 3GYEA 4P8VA 2PTWA 5IBXC 4I7WA 4KFPA 4AAJA 4W8AA 1I9CB 2DVTA 4WSHA 4Z2KA 1XUZA 4B3LA 2BVYA 1GVYA 3QKEA 3IVUA 3S9YA 3K5XA 2QUVA 2V3EA 5I3KA 2BVTA 3ZT6A 4DYKA 1BYAA 4GHRA 3ONBA 3SUVA 3PN8A 2JFEX 4L9XA 4MVAA 1TV5A 3CIWA 4RW5A 1A5LC 4TX9A 3LEPA 1FWAC 4HK6A 2CU0A 3LQGA 3IUDA 1Q45A 1OEPA 2Q01A 4KQNA 4A29A 4DUWA 2W79A 2ZX9A 1N7KA 4YPJA 3VMNA 1OFQA 4FEZA 4PMOA 2ZVIA 1P6CA 3EWUA 3U7VA 4ICMA 3H54A 4ZVJA 4ENLA 3WNKA 4DBEA 1YEYA 1ZY9A 3WLLA 1QO2A 1BKHA 1LRTA 4LVBA 4GI6A 4FF5A 3LDVA 1Z6KA 4EKJA 3T9PA 4TMBA 3LENA 4RZ4A 3SECA 4KCWA 1RP8A 4LUIA 1DWAM 1P1MA 1RK6A 3BLLA 4J40A 3P61A 4M5PA 3VNLA 3OZYA 2VZUA 3DYMA 3IGXA 1TJ1A 5EFFA 3I65A 6XIAA 4PFMA 2VX6A 4IIFA 1JYVA 1TTQA 1TMLA 4KRZA 4ADTA 3SQLA 3IIOA 1QI4A 2ZWZA 1K8ZA 3QMRA 2V0TA 1V08A 1ITCA 2GVEA 2POZA 1RALA 1F05A 1BYBA 1I1XA 5DEZA 2X1IA 3DKLA 5H91A 4GUHA 2OELA 3M0XA 2TSYA 3BG5A 3MKVA 4QLKA 5J8LA 5HR6A 1E72M 4QP0A 1B3XA 4PUUA 1XLJA 4GQGA 4JIEA 2JIEA 2CLOA 2ZVRA 4DAIA 1W37A 1VZWA 2FH6A 3ZLGA 1BXCA 2XM1A 3WBWA 1QI2A 1CLVA 1E9YB 3IWPA 2OJPA 3LRKA 4MWAD 3PBVA 3STCA 1P6BA 5FJIA 3AALA 4YJ5A 4GY1A 3A5VA 3CUZA 4XZMX 3PTQA 2P3ZA 2QS8A 3AIWA 3RPMA 4U3AA 2E67A 2V69A 4NI8A 4ACZA 1IXOA 4ZOCA 1OX6A 3DDMA 1XV8A 3N4FA 1A5BA 1F61A 1WDSA 2DUXA 2GSJA 3DERA 1ZZMA 2NWSA 3ANUA 2WKLA 2E8ZA 5HA7A 4PBGA 3NQ2A 4JQ1A 1WOBA 3P8JA 1JAEA 3RHGA 4L4OA 1SSGA 4QJ5B 3HJZA 1TWWA 3BW3A 5BU9A 5DLCA 1BPLB 3MP3A 4A05A 4F4RA 4NZ1A 1VR6A 3LPFA 1JGMA 3RU8X 4JIQA 1JDFA 4XVEA 2NUYA 4MZYA 1E55A 2QPUA 3LTPA 3SEPA 3B8SA 1Y7VA 3UY7A 1E71M 4QEEA 5MF5A 2RHGA 1IHIA 3WF1A 4JNZA 1EP2A 3GFXA 1US2A 3AUJA 4Q7BA 4TMCA 2OCZA 3APGA 3SUUA 1UP3A 3R25A 2Z27A 1Q2SA 3H22A 3WD0A 1Q85A 1OX4A 1H49A 1FXQA 1CXLA 1AJZA 1R8LA 5FJJA 5BWFA 3GG8A 3N04A 3MYPA 2I56A 4JS3A 3C52A 3S5SA 3LPOA 3OLGA 2PDLA 4G1KA 3IUIA 3SZ8A 3RM9A 5FI8A 3WFZA 1ZAIA 1PVNA 1TRDA 4JFWA 3G3MA 4UQ9A 4O0KA 2B7PA 2Y2WA 3PAOA 4S39A 3UJSA 1XLKA 4IMEA 3SCPA 1YIXA 2BWGA 3N6HA 1Z32X 1DWFM 2OQHA 2VDHA 1XDMA 4ZSTA 2YR1A 3T2QA 8XIMA 1JCTA 3W72A 4CEXC 4MYXA 3DN5A 3TYBA 4MB1A 3TU9A 4LS1A 2H3BA 1BF2A 4UBPC 3BTNA 2AQOA 4EK7A 5BYWA 3SRKA 4PUEA 1EJRC 2OXNA 3VKCA 1KGXA 2EHHA 5A6LA 3HQNA 3STGA 4NILA 5EMYA 3W7GA 3PFRA 2GGHA 5BXTA 1FTXA 4XSMA 4YHEA 3WLNA 2ZC8A 4HNOA 3DIPA 3P93A 2CLEA 3KBNA 3PC0A 4EXBA 3OVGA 4HNUA 4V1XA 2Z6JA 3JUGA 5EFDA 3CPUA 3D47A 1AZ1A 2PDHA 3V5FA 4UQAA 1UD6A 3VDCA 3DCPA 3TZFA 4WJ8A 4IMFA 1E3ZA 1V6XA 2I9UA 4D9PA 5FACA 2CZEA 1T6MA 3GC4A 2VGBA 2Z1SA 4TO8A 2I9EA 4DWSD 4XBJA 4TVCA 1HGWA 2HQAA 3W6YA 4M3PA 2VELA 3BAKA 3L2LA 3WMSA 3ZR4A 3T0CA 3RN6A 3E49A 2ZA1A 4FA3A 2G37A 1J0HA 4GC4A 5CPMA 3ZOAA 2C19A 2ZKMX 4GISA 1UC4A 4QE4A 1Q65A 4H7VA 3D3AA 2R1KA 3LQLA 1Q13A 1M65A 2ZUSA 3OQ8A 3W7CA 3VDHA 3VYLA 4AY1A 3GD6A 4B4HA 2ZCGA 3NO1A 3C86A 1ECQA 3SADA 5G2WA 1WPCA 1KD0A 2F2HA 4F0SA 3I7RA 3DX5A 3Q45A 3U2ZA 4K7YA 3OYXA 4PUMA 3AIEA 5FIPA 4FLQA 1FH8A 3NIYA 4V27A 4BJHA 3DG3A 3BLOA 2D0HA 3UY8A 1E1EA 4LAKA 2CLMA 5LNSA 2A6LA 4RW3A 3V35A 2BB0A 5CKSA 3TKFA 1M53A 1M7PA 4REQB 3EX4A 1FA2A 3WK1A 4ATLA 4QR6A 1EYWA 3GDMA 3CGTA 5A6AA 2NV1A 3D6NA 4KETA 2VFIA 3PPGA 3UWWA 3JR2A 1IEWA 1ZBKA 4GLEA 4MFEA 4ZO9A 4D6CA 3WQ6A 1VKFA 1A5OC 4JZ5A 3SN1A 2Y61A 2FZDA 1JYNA 3TTYA 4PZVA 1KM6A 3QTGA 3W25A 1GZJA 3Q65A 1RY8A 3BQ6A 1TWIA 2FFIA 2X7WA 2Z1KA 1PB0A 4XAPA 1CENA 1V4YA 2VOMA 4Z2HA 1SW3A 4PCPA 1O5XA 1QOXA 1CNVA 3IV3A 3WENA 5CAKA 1P4CA 1R38A 4ROQA 4YVXA 1E6SM 4JTSA 4S3BA 3TXVA 3QGAC 3OBKA 3UGVA 1XRFA 4J3UA 2VFHA 1V6UA 3OOQA 4QFUA 1V77A 5HNUA 2CHNA 1H62A 1E6ZA 5BOFA 3P3BA 5H2ZA 1EF2A 3T4WA 4GJ1A 1JDCA 3S46A 1CLXA 3R13A 3VM5A 2CHOA 1XGDA 1ADDA 2CNCA 1TR9A 5EGRA 5F2LA 1RLDA 1OD8A 3CQKA 4JN8A 4HMDA 2PU1A 3QPEA 4LUTA 3NTYA 4WKHA 4O50A 1L0PA 3PUGA 3HURA 3RDKA 3OVQA 1XDLA 4RDWA 1B54A 4D8ZA 1E5NA 3ABQA 4OGZA 3KL5A 5H6HA 3M6DA 3NXFA 3HGRA 3K2GA 3LRMA 3EGJA 3EYPA 3L0NA 2CHRA 4XZWA 4UCFA 3KRSA 1GQIA 4FMVA 4QQUA 2WVSA 4JFUA 2ZICA 3UU0A 2G4FA 3T07A 3VGHA 5A6BA 5KITA 5IHSA 1G1YA 1EJTC 1GHRA 4H19A 4HMNA 1XLBA 2WMJA 3QQ0A 4HA4A 3GU1A 1SFSA 2Q02A 2Q71A 3VKDA 1B4KA 3PJUA 2QCHA 3UXAA 1QAPA 2QHAA 4JTGA 1QK2A 2DP3A 1XRVA 3WEOA 2BODX 3PBMA 2DVXA 5MHBA 4NY2A 4YCOA 4EF9A 3LYEA 3GBDA 3CIXA 3NM1A 3MMUA 1T7LA 3FV9A 4PTMA 4C65A 5AZ1A 2CESA 2G96A 3W23A 3QY6A 4Z2IA 3VI2A 1BTCA 5KZMA 4ACZB 1RVGA 3NQDA 4WJEA 1EWDA 3ITOA 2Y6ZA 1QI3A 3MCMA 3TJ4A 3UWEA 1GJUA 1YLVA 5DCEA 1YYAA 4A6GA 5E5CA 3QGKC 1R3TA 3OU8A 2R1PA 3NPUA 3Q37A 2OQLA 4PCFA 1LRNA 3QR1A 1M6JA 3FFSA 3LUTA 1UR4A 1K03A 1KFCA 2OYKA 1XF0A 2YLAA 3ATYA 3GNRA 1J5TA 2C3ZA 4G7EA 4LC6A 1NSJA 5F4XA 1Q6EA 4TVUA 1ICQA 4UFKA 3EKLA 1KGWA 4HHLA 5LGXA 1KW1A 2JF6A 5EL1A 1DWIM 5CC6A 1GOIA 2PWUA 4KWOA 8XIAA 4FHAA 5E0CA 1O5KA 3WNLA 1ZHAA 3TTSA 2I57A 4L64A 2PWVA 4LV4A 1R0MA 2OX1A 4IXHA 2CCRA 2CKSA 3UJ2A 1QWGA 3O9NA 2PP3A 3EXSA 4IGMA 4G1NA 5I0DA 3XISA 1JPKA 3KBSA 5AHLA 1TREA 3M7WA 4Z0JA 1WZKA 3GH7A 1SJBA 3HPSA 1MMFA 2PWDA 4HP5A 4IG2A 5GVJA 3TLQA 1OX4B 3BLPX 3Q94A 3UW6A 5D9PA 4MWAC 3NWRA 3QZ6A 4PSPA 4RKAA 1H09A 4ASTA 4HCLA 1OABA 4RXGA 3U2EA 1HKJA 5FF4A 1JPMA 3S2JA 1O5RA 4EWJA 3OG3A 3EWCA 3DFPA 4LFYA 4H9XA 3WCZA 3QQWA 2GDUA 3MUAA 1Z42A 2DVUA 4JTKA 1WB0A 3FX4A 1EO5A 5IOBA 2OZ8A 3DHFA 3M41A 3MSRA 2ZUMA 3GVVA 4QEHA 1UR1A 4JQ4A 3I7QA 4AXKA 2A3AA 1KB3A 4V2XA 3W3OA 4KERA 1TR1A 4GGBA 3IK2A 3CWNA 4ZA0A 1PEZA 4LY4A 1WNOA 1A50A 2V9DA 5I00A 1UR2A 2NSXA 4LT9A 1AK5A 3PZGA 4UWMA 3FAXA 4HNVA 4MMWA 1NH6A 4JOMA 1VS1A 4WDXA 4N7QA 3T8QA 2DZVA 2TYSA 4B9YA 1S3HA 3RO6A 1V6YA 2V5CA 2NVAA 3HB9A 3WZ0E 3IIVA 4UTMA 2QPSA 3EWZA 3SCNA 5G2IA 3W1UA 4JQ2A 3CJPA 3EX6A 3AJ7A 1KV5A 3O15A 5A2CA 1KM1A 3SCQA 2XH7A 1XW8A 4KBXA 4K8GA 4E3VA 5GQBA 4CNUA 4DBUA 1PS9A 2WZHA 1XLHA 3HGSA 2VZSA 2JKEA 5E09A 3GHSA 3J7HA 1EUNA 1VLWA 1OYAA 4GRSA 1CZ1A 3G0UA 1JNEA 1GVEA 1H7RA 3VUPA 4QTGA 2EKGA 3F4VA 3LG3A 3VNYA 3SURA 3W7EA 3WO8A 2PZ0A 3B8UA 2CZFA 4G5DA 1B1YA 3VPLA 3G6LA 1KBJA 3E0VA 4R88A 1K1DA 4NT0A 4A2RA 4FXFA 5TNVA 1CYGA 6A3HA 1MQRA 2HK1A 3GNDA 4QG9A 1I0BA 3UNDA 4XX6A 3LLFA 1SJCA 4XB3A 4H6EA 3URAA 3NYZA 1AQMA 3WQOA 4O8AA 4TU1A 3VUSA 3CPGA 4PCNA 1PZ0A 4GUFA 3LMYA 3TMLA 2NX9A 2J24A 1A49A 2O0TA 3OJGA 5GJMA 3EXTA 4H2CA 3WJXA 4Q32A 3S2NA 2R91A 2WAGA 3W07A 2WMIA 1E6XM 4JL1A 3C0SA 1J12A 2Z0IA 5C9WA 5FF0A 1L6WA 4XAGA 3H2AA 2YA0A 2Y4SA 2QCEA 1W1A1 1IXPA 3W7DA 2NQZA 2DZTA 1BKSA 2VR5A 3EXRA 2OKOA 2WMHA 3P80A 3HPFA 4A8RA 1FVPA 1QUMA 2YYUA 3VIJA 1CCWB 4RR4A 1TPC1 1VIZA 1VB9A 3GKFA 1FWNA 4OTKA 1Q2RA 1E0WA 4C60A 4Y9AA 3UWZA 3CS2A 5HQMA 1QHPA 5FESA 3AZRA 3SCOA 4DJDD 3ZT5A 5CPLA 4HVXA 2R24A 1TRIA 4AD0A 4ICCX 2BOGX 3P8IA 2WM1A 4HZ8A 4ZQNA 4C90A 3GE7A 4DO4A 2BDQA 3CEPA 3O06A 3S83A 4PMZA 1W5QA 3N34A 3NL5A 1IZKA 1O60A 2FZBA 4KFOA 2ODOA 4LUSA 4UZSA 1W5NA 2XZ7A 3AS2A 4WXYA 4JTLA 3C3UA 4CCEA 4EAYA 3GW3A 2R9RA 1UG6A 2PC4A 4LOCA 3KP0A 3U5UA 4YHGA 1OFRA 2PUZA 4NJKA 1P0KA 5AVHA 1GEHA 2J7CA 4R27A 1QHZA 4E8DA 1KC7A 2J79A 4CQAA 1XLEA 3WN6A 2WMFA 1W9XA 1GOKA 1OK4A 3AIUA 2EEXA 3IIPA 4LY8A 3AYSA 4BQ4A 4LUTB 1Z8AA 4Y2WA 4L1GA 2ZDSA 4C7GA 1T5AA 5F7UA 5FF2A 4DBWA 4NQ1A 1TE6A 1S1RA 2YA1A 3A6OA 5DANA 1I4NA 1H7WA 4HPJA 4IFKA 3T42A 2XN2A 1Q6QA 1QDSA 3GO2A 3AISA 2HE5A 3QM3A 1KM5A 5D4YA 3VM7A 3P5YA 3BJSA 5EMLA 4UTHA 5DCBA 2ZIDA 2YBUA 3AU6A 2O4MA 1XRSA 1XIEA 2ABAA 4RPPA 4WD0A 3SY5A 4GBUA 1JZ4A 4NP7A 2VDGA 4HHHA 1QNOA 3DKJA 4BWLC 3H53A 4FOJA 3VVGA 3K46A 5M5DA 2ONEA 2C14A 4IGHA 5A6JA 4INFA 2EQDA 3T7VA 2PF8A 4IGNA 1UH2A 3QN3A 1RQHA 2Y7GA 4UQDA 1XWYA 5EBUA 2DZPA 2Z7KA 1S1PA 3HJEA 1V3MA 3U4AA 2ATMA 4U5IA 4DAFA 3U7BA 4WDTA 3NQCA 5D03A 4LYRA 1OIMA 3U9IA 1PKYA 1OF8A 2PDCA 2Q8LA 4HD5A 4DF0A 5C2XA 3OP2A 5REQB 1KBKA 1RCXB 1JL8A 3FDKA 2QCDA 3C6CA 3F4DA 4N4QA 2E0PA 4GIAA 5TAOA 3CBWA 1E6PA 1VLIA 3URNA 3BQ5A 2G95A 1ZBVA 5H8PA 1U1HA 3F5JA 1E4NA 2BY2A 3WJYA 1CXIA 1UD4A 2WYSA 4Z08A 2DZBA 5BXSA 4KT2A 1AODA 2QCLA 3QOMA 5BRPA 3S6OA 4AMCA 3E02A 4KIEA 1XFCA 3KHDA 2E5BA 2ZXAA 5FJPA 3T0AA 3LCXA 4G7EB 2VI0A 3RITA 1TJ2A 3SFKA 4WGHA 4DX3A 4M19A 2YCJA 5E70A 1EDQA 3W81A 1H7PA 3WEMA 4XZHA 3CNYA 3IVTA 4KWWA 4QJ1A 4O17A 2OVLA 2A7RA 1X39A 2YBTA 1UB3A 4GVHA 5KEZA 3UA4A 3FY1A 4AB4A 1WDRA 3TN6A 1NJJA 3HFTA 4CKQA 2V68A 3B0PA 4IG2B 1W5OA 1SU5A 1M41A 1R2SA 1PHQA 2O4QA 2WCGA 4WOQA 2O9TA 2WMGA 2W27A 5IRPA 3ALFA 2EPLX 4GX9A 2PF0A 3S5NA 3P67A 4J3ZA 4CLMA 3WDJA 3GNPA 3H24A 3LHZA 5CAHA 4IX2A 1HJQA 4UR7A 4LS2A 4O13A 4H9VA 4MLRA 1TPEA 2A3BA 4JKKA 3MSGA 4IL2A 8A3HA 4YXGA 4O0QA 1XINA 3GTNA 3WDQA 1W9UA 1S2VA 1VBHA 3U0HA 5DMNA 2JE8A 2PDBA 3CAKA 5A6SA 3FEMA 5CZJA 3VIOA 1G5AA 1NWTA 3ANVA 1UW9A 5CJ5A 3HU7A 1PE1A 4C7FA 1VFSA 2FJKA 3B3DA 1SFTA 2I5GA 4MWAA 1GOMA 4H7ZA 3QPYA 4B3KA 1YTDA 1R3QA 3S4TA 3TQ0A 1EDTA 1EGZA 1L6YA 3PAJA 4AZ7A 1HFBA 3EOEA 3LCFA 1YRRA 2WMKA 3S9ZA 3N6JA 1X6UA 1QNQA 3W27A 4DO7A 1EA9C 4MUZA 2ISWA 4ZSUA 3NURA 2V2CA 3ME3A 3RLGA 4RNJA 3CUIA 3N9RA 3GUWA 2XFRA 3T0DA 3LRLA 3MCNA 4QROA 1XH0A 2VC5A 3HG3A 4KCTA 1XUUA 3UJRA 3S9IA 1OT1A 3L4TA 3G1VA 3NQBA 4ZZ9A 4GXWA 1CGUA 1BFNA 4BF7A 5AB3A 1MW3A 2YIHA 4O15A 4LEQA 3R12A 2AAMA 4J5NA 3SUTA 3K4AA 1MFUA 4DELA 2YZRA 4YN5A 3E2SA 1PZ2A 1PBGA 3IJ9A 3M43A 2P53A 3PBYA 1K70A 3W7KA 4X61A 5I24A 3LZ3A 1W1PA 3SI9A 3ECQA 2ZRUA 1EA0A 4ZCWA 3W1XA 2BXZA 1R7OA 1MZHA 1IXQA 4U5KA 2FYMA 3W2NA 1RA0A 1KKRA 4QJ3B 3BC9A 4KESA 3GR8A 1F4AA 3PJTA 1MRAA 3LGGA 2W67A 1RBOB 3AI0A 1UA3A 4M51A 2WK2A 5FAGA 4LUJA 1XBYA 3I6EA 1CLKA 1UMYA 1LG2A 2WMIB 3AU2A 5I78A 5DMYA 4DJEC 4PB5A 2A1YA 3E74A 2ZX7A 4DO6A 4CD4A 2YDQA 1WQ5A 4Z0SA 4E6MA 2OEJA 2DUZA 2G41A 4R3UA 4NNAA 4M0XA 3G18A 1XGEA 3W6MA 2Q09A 4F0MA 4D6HA 3RCNA 1EPXA 1YQ2A 1Y5VA 5LNUA 1P0EA 5DMLA 1WDDA 1ADOA 1ITUA 2CC0A 2WNNA 3GXPA 5D37A 2OWXA 1O95A 3PBGA 3VMOA 2GGEA 2AMGA 3TOYA 4JTQA 1XQLA 4CNNA 3LTSA 1KRBC 1FFRA 3TV8A 3FEQA 5D9MA 4XD4A 3OODA 9CGTA 4NAEA 3VZXA 3N1AA 2GL5A 3P81A 3WNNA 2DT3A 1G9HA 2YCEA 2PURA 3EKGA 5AHFA 4MY9A 3C8NA 5F2GA 4NUWA 4B5TA 3SN0A 2XGZA 2Y62A 4LUSB 3U2CA 3ZLFA 2HZGA 3UWUA 1V6TA 3R43A 5KTLA 3B4YA 4E8GA 3CHCA 3VOIA 3LPPA 4OUIA 4F8XA 4RX0A 3GIPA 3L5AA 2JK2A 6REQA 3SGUA 4WVXA 4A4AA 1XLLA 2PI6A 3SUWA 3LCLA 4J3TA 3IPWA 3WH7A 4QHRA 2O55A 1W0MA 5XINA 3LS9A 4UB9A 1AW5A 1BHGA 2A0NA 3EKZA 1I60A 3IARA 4IFKB 3WLSA 3N2MA 2HDJA 4C1NA 3G0XA 3M4HA 4KEMA 4WGXA 3ARWA 1VGAA 1RPXA 2CLFA 3PWAA 1EJSC 1WXYA 1KGUA 1UKPA 3STEA 1Z7AA 1H60A 3AXHA 2WNWA 1DJWA 2V5JA 4DJDC 2RDWA 3DHPA 3EA3A 1TUFA 3H2FA 3U8GA 4H9UA 2PTDA 1NF0A 2FDMA 1VIWA 1DE6A 1TV7A 1KO0A 1RBLA 2VVSA 3UETA 3SY8A 4ZFCA 5FEWA 3TC3A 3GR4A 1X8CA 3WH8A 1K7EA 2DW6A 2RH9A 1E9LA 3ITVA 5HQEA 2RFGA 3ZVIA 3W01A 1JPIA 1DIEA 2Z6IA 4P61A 5K2ZA 1QR7A 3C2OA 3PANA 3W84A 3H4WA 4AWEA 7A3HA 4Q7IA 4R7OA 1M01A 1V79A 4O11A 4OIFA 4C91A 3DGRA 2VEIA 2BX7A 3INPA 4AZHA 2QCDB 3FAWA 3MMWA 4BF9A 4BWLA 2RJHA 5ABEA 1LL7A 2PTXA 1E6RA 5EMUA 3SQMA 1E9IA 4L80A 3W2UA 5I2UA 5T8GA 3OO2A 1HJUA 4C1LA 2QV4A 4ZQRA 4LAZA 3KDOA 4KCVA 3DYPA 3WDPP 2Y0FA 4FAMA 4NJJA 3UZWA 4HU8A 2XFWA 4M6UA 5BRBA 4KFNA 3PTMA 4Z17A 4OBTA 3VNIA 4UTFA 3KZSA 1DXFA 4M7TA 3L66A 2X1UA 3KM8A 1HQTA 4ZOAA 4EIVA 4DYEA 3ARSA 3EWXA 2X1RA 1XSJA 4JIHA 3TYCA 3FJNA 4AZ5A 3VCNA 3U3HA 1AQ0A 2CLKA 1A4MA 4W88A 1D3GA 1KFKA 5CPQA 4GI9A 2Y24A 4DWDA 3WDRA 4KWVA 3UG3A 3TTQA 1J0IA 3B9EA 1H11A 3QLLA 3KS6A 3EMZA 1U22A 3ES8A 1JRCA 2CZVA 4O0ZA 1CPUA 4PMVA 2WVVA 2XVLA 4MTVA 1O94A 1TUXA 1KFJA 1UQZA 1JF5A 3W6LA 2OLSA 4FR1A 1AQFA 2ZYFA 4XO6A 1TTPA 1OD0A 3E3HA 5HMFA 2OO0A 4GH1A 3PUDA 1UR8A 3ZJKA 3PB2A 4ZQOA 4LALA 4WY0A 3MO7A 1N8IA 3QMSA 4QSFA 1FWJC 4E3TA 4DXVA 2Q8XA 4M1RA 2DSUA 3EPNA 3SJ3A 2KZHA 1VFHA 3Q67A 3KVLA 4YIWA 3NXLA 3BUVA 4V33A 3M7SA 1FRBA 1LL6A 3L0GA 1MXDA 4HCHA 4W85A 1FCUA 3A21A 3KOYA 3QR3A 1Y5XA 2W92A 2O9RA 1UASA 4LW7A 3U57A 1SZRA 3VU2A 3VCCA 1H63A 1I0DA 4NASA 2XGBA 1HKMA 2JALA 4MWAB 3CWOX 2QUTA 2WCAA 1XYBA 3VKBA 4CQ8A 1L8PA 3S3GA 3WD1A 5AVNA 2X41A 1UUOA 4TOQA 2GUYA 4O12A 3TJLA 1R46A 3IGSA 4IIGA 1XRTA 5BMWA 4G2DA 1W9DM 2PZNA 2Y8KA 2XVKA 2FH8A 2PDNA 2GVLA 3JZUA 1MEHA 4JR5A 3TFCA 3GTHA 4YMZA 4HSNA 2D2HA 2OOFA 4JTEA 4NZ5A 1AFSA 5HNTA 4MG4A 1B9BA 3HIJA 1WE5A 5I7GA 1OY0A 1M3UA 1LRQA 2NQHA 4ECLA 5HQLA 1FOBA 1I6NA 1M7JA 4WKAA 4I8YA 4D6JA 1LT7A 3LCIA 1DTUA 3AXKA 4TVDA 2YW4A 3O63A 3BPWA 4NAFA 2X2GA 2ZX6A 1KQZA 3UP8A 2Q3RA 2E1WA 2ZE0A 3WQVA 1QJWA 1Q5MA 1PKNA 4H2HA 1QPNA 1TIMA 1DPMA 5I06A 3W74A 4C6FA 4MPKA 1H7XA 3LSCA 5C6MA 4PL1A 6PTDA 2UV8G 3VABA 3O07A 1EHAA 2CKRA 2EPMX 3W2JA 2A3HA 1BWLA 3W70A 4O57A 2QGYA 2V5DA 1EP3A 2ZZ3A 1W31A 3VIIA 2EXOA 3B0YA 1GHSA 1W1YA 2ANUA 1O66A 1SYTA 1UUMA 2BGSA 4LVAA 2NXHA 3UZZA 3GDTA 5F2MA 1BXBA 4O1EA 1CT5A 2D22A 1B5TA 1YBQA 2GVJA 2Z1BA 3CUJA 3REQB 4AWUA 2FDSA 1MVYA 4P8XA 2A7NA 5EMJA 1X6NA 4R5EA 1MDRA 4JYDA 3BURA 5E6YA 1XYMA 1XBZA 4L4MA 4LS0A 1DL3A 1ZU8A 4GIEA 1Q6RA 5BZAA 1YXDA 3AMLA 3HA1A 3SB0A 4YS1A 1EC8A 2X1TA 4G9PA 4XD5A 2PGWA 2DJXA 2J7HA 1UC5A 1I1WA 1QATA 3K8MA 3W7PA 4OECA 2V2HA 4HA0A 2JGYA 4NAEB 3DC8A 4OQVA 4TV6A 4N6EA 3QY8A 2VCBA 3BXWA 2WHKA 4F48A 1QW9A 3CHEA 4DJEA 2H8XA 3WLTA 5I3IA 3DECA 3GXDA 4M6QA 1F3XA 2H90A 1A5NC 5FOOA 2ZA3A 1UWIA 5HOSA 4O53A 3FJ4A 4AEFA 4GVIA 2QW5A 3TYDA 4DWSB 4GG9A 1XKJA 2CBUA 4LWWA 1L6SA 4ERIA 1E0XA 1OADA 5LNRA 1GOOA 4BI6A 2GQAA 1DKWA 4ZE5A 4A8LA 3CUFA 1C8VA 4JNYA 1U1UA 1J0JA 6REQB 1GPWA 4F0RA 4X2RA 4OE7A 3UG8A 1JFHA 4W9TA 4QAWA 3W1TA 4Q8OA 1UWRA 1YKWA 3RRXA 1S2CA 2CBIA 3RILA 2HPIA 2ZZ1A 1PX3A 2E9LA 4Y90A 1XIDA 3PZQA 3QJAA 3MBFA 1AH4A 2D3LA 1PIFA 3NGJA 3O6AA 4AZCA 3DC0A 5HULA 2YCLA 3L4UA 1KNWA 3OGRA 3HGOA 3MMDA 1BXNA 1A0CA 5CZTA 2Z29A 3WMLA 4S3FA 4HSOA 1RHCA 2QZRA 3LMZA 1MWOA 1X7IA 1RJQA 3S1XA 4AVNA 3W53A 4YLWA 2EPNA 1WZAA 3BAIA 1L2UA 3T2PA 4NJGA 2G0WA 1XM3A 3AFBA 1V0KA 2ACQA 3STPA 3HZ3A 4DO5A 1EXPA 3G5EA 1SUXA 5GPRA 3ITLA 1UWTA 4B4FA 1YNQA 3TOPA 4B91A 3WLIA 2E5CA 4N2YA 3F4NA 4QS6A 2YL8A 4AUBA 4NZ3A 4XZLX 4UNKA 1LWJA 4KEZA 3BJFA 1AJ0A 4LJ3A 3LNPA 3MDWA 1MO0A 4DJDA 3AXIA 4XIMA 4PH6A 3CL8A 1M7OA 1BVNP 1TQJA 5EU9A 2B31A 1DYSA 1EQPA 3A22A 3DH7A 3HPXA 3WSUA 4KGLA 2IKJA 2CBVA 1OWQA 2DT0A 3BARA 2VRJA 3L9CA 1S5MA 4AYSA 3N2OA 3W1QA 2PAJA 2XPKA 4ZXLA 1TZ9A 2E6DA 2PCQA 5B7YA 3R6IA 4QBXA 3IIZA 3UQNA 3N6QA 4JXCA 3A9IA 1KLYA 2QLYA 3UD6A 1GYLA 5BW6A 2R82A 1VC4A 3EA1A 2BGNE 4R9XA 1XJBA 2PSNA 2HWGA 1H5YA 3NSXA 2CZ5A 3PFMA 2QEZA 4JQAA 2XIBA 2BNJA 3GIQA 2CETA 1YXCA 1SW0A 4QGCA 4GZ7A 3WUBA 3FDGA 3ID7A 5ENLA 5I3JA 1UD3A 2WVVB 3CAWA 1Q6LA 5FJUA 3HM7A 3W71A 4LBUA 1UIOA 3H23A 4GJIA 4JYEA 4C6PA 1B90A 1Q7QA 2LLEA 3UJFA 2OX4A 3LCGA 5JUVA 4R53A 3BZGA 3R4IA 1NU5A 2FQIA 3UVAA 4RE3A 4WY0B 4B5VA 1XIIA 2J77A 3GFYA 2FB3A 2PDUA 3PZ9A 2HISA 5ECVA 4AZ6A 2F9RA 3KTXA 1SJAA 1U1JA 2NX3A 4GIRA 3I3EA 3TDFA 4CQBA 3RX4A 3ELFA 5SWUA 2YDSA 4OKDA 5ABFA 4AVOA 1Q6GA 3BVJA 4CCDA 1FXPA 1H61A 5HAOA 3LD5A 4TX8A 1MXSA 2OEMA 1V3LA 2PU0A 4D6DA 3AQUA 4DBDA 4L7ZA 2WV8A 1CIUA 4C6JA 5BNKA 3UWQA 4ORIA 1DJHA 4W5ZA 3B8VA 1QNPA 2XDFA 1TV3A 2ZZ6A 1XLGA 2DSVA 2XH4A 2V5KA 3W28A 4ZGYA 1XLCA 1A80A 3RUBL 3AUOA 2GQ9A 3FK4A 2J7BA 3JZEA 2NVDA 3BMXA 2HJPA 3MUXA 2A3EA 3E1F1 1HTIA 1O68A 1FP9A 4B15A 3P60A 1QTWA 2F84A 2QT3A 4ZB0A 1SR0A 2NLIA 4YWSA 3UXDA 4RNIA 1TG7A 1Q4NX 1HJWA 4Q8QA 5U7SA 2ISDA 4DNHA 4NJHA 5HWJA 1W32A 1UKQA 4Q22A 3QC0A 1FDZA 4PGLA 5D2VA 2BHZA 4PBFA 4NAFB 5A8MA 1MW2A 3GVQA 3Q4DA 4ZB5A 4N9DA 2R6OA 2TPSA 1PIIA 4R85A 3CB3A 4IP5A 1C8QA 4X0NA 1N82A 3EOUA 4GZJA 1R5YA 2ZZ4A 4LAUA 5IDZA 4GYPC 5KETA 5JBDA 4MNMA 1GVFA 1U33A 1KBLA 3NQ8A 3A4JA 3CL6A 1VD6A 1T99A 4MNKA 4XD6A 3UYCA 3VX0A 3U5YA 4O4VA 3QBUA 1MFVA 3T6CA 3MJYA 4MAVA 4GGHA 3L65A 2Y5EA 2ZE3A 1ONEA 3AS1A 1JCMP 5HUPA 3D0CA 3N2BA 1BRLA 4DZAA 2HBXA 3YPIA 2W0UA 3HOJA 1TTJA 4MZ8A 3T2OA 1V02E 3CV2A 3LGDA 5E93A 5DBTA 1FWDC 1V6WA 2VNCA 3SCRA 2XUCA 3BCDA 1T41A 1BGAA 1VYRA 1J6PA 5CGTA 3ALGA 3W75A 3STFA 5E9AA 1GKRA 3P14A 3CYVA 4J3WA 5HNRA 1QT1A 4DVOA 3OW1A 1YBQB 2CPUA 4HNCA 2UY4A 3MI3A 2QJIA 1YXYA 1PUDA 3EEZA 2J13A 2FGLA 2R14A 2VDIA 5F2IA 3LBOA 4GMEA 3K30A 1R86A 2DSWA 4TUFA 4RPQA 3KRZA 1RP9A 3E0WA 3SCSA 3V36A 5EBAA 4YTUA 1TSIA 3IJLA 4WF7A 1P0BA 2J9YA 5FKYA 1CDGA 1B3YA 2DZAA 4H04A 1FHVA 4JKMA 4UZUA 1VPXA 4K39A 1EEXA 3UA3A 1XCFA 5LZLA 4NG3A 5CC3A 2QCFA 4N0RA 2QF7A 1PL9A 4D72A 3UG4A 2VENA 1ML1A 1FWRA 4XKYA 3RIKA 3K8LA 3U2OA 4FNQA 4KEUA 2INZA 3CIVA 5LHEA 3S2LA 4RUBA 3CZEA 2OWCA 2V3FA 2FB2A 3ANYA 1ZLPA 3G1HA 4WKFA 1YPIA 2OODA 2C13A 3QHNA 3KVMA 3TSMA 3NVDA 2PDGA 1LOLA 3BCJA 1NFPA 4IPIA 1ZCOA 2DFAA 4B3ZA 4N9EA 2ZC1A 4EP8C 4HZ7A 4K8HA 5A69A 5LXXA 1AA1B 3A47A 4QE5A 1HJVA 4AVFA 1YHTA 2GJXA 4MGGA 5DY3A 4MDOA 3UF9A 3PG9A 3GVWA 4D71A 1TPB1 3VIPA 3KTSA 4W5UA 4ZO6A 3N19B 2YCLB 1VEPA 1BF6A 3E0IA 3VD5A 1NELA 1XCWA 3NOEA 3M0VA 3E5BA 5KZEA 1Q6CA 3TZNA 3VGEA 4K68A 3WJSA 4RZ6A 3UWVA 4ALDA 3HFYA 5T26A 3T55A 1DQXA 2YL5A 1JZ6A 3GM8A 2I5IA 4LU0A 1SO5A 4OVXA 4QCFA 2J74A 3WDHA 3TJIA 4YYCA 3AXXA 2TAAA 4QDWA 4BI5A 3V1HA 1SO4A 4HTBA 1IWAA 2AQWA 1SFJA 1H0IA 3QPZA 3Q2DA 3AIVA 4WXZA 4EACA 2R8WA 4AMAA 3M5ZA 4IP7A 1I45A 4Y6GA 3LCWA 2OGJA 3PZVA 2Z1WA 4UTUA 3EEGA 4RZBA 4HNLA 3B06A 3FKRA 4JDYA 2BOFX 3SN4A 3WD3A 3W37A 4YYFA 1F2JA 2IXVA 4KH2A 3H2CA 3W73A 4ATWA 1GUVA 5HANA 3O05A 2PC8A 3Q58A 3BLDA 5C9UA 4M82A 2VEMA 3GH5A 3QHOA 3EDFA 5A3HA 4RXFA 2AQVA 1YPFA 4PCSA 1C93A 2ZXQA 3WQGA 5D32A 1K4HA 2IQ0A 4AISA 1F6PA 3SCWA 2PP0A 1GKQA 4Q8WA 1OBAA 4TXEA 1KFWA 3C4UA 1QRQA 1EDGA 1WDPA 4N42A 3L2IA 2W66A 3FSUA 1C7TA 3OA3A 2BTMA 3W1RA 3MZNA 2YZ5A 4H7CA 1XBXA 3R2GA 2EF9A 4J9JA 3QMTA 1G4EA 3HQPA 3WNOA 1OZMA 1W6TA 1LP6A 1ODZA 1OZQA 5K3VA 1JXJA 4RE4A 3WY1A 3I4KA 4GUIA 4LQ1A 1GZ1A 3G1XA 4M56A 3LXBA 1CB7B 2CYGA 3MJMA 3IJ8A 4C6EA 1AMYA 4S3GA 1NWRA 2Y8VA 3MI2A 4IQDA 5BOEA 5DN1A 2B7QA 1Z3NA 4FK9A 3RJXA 2QDHA 1KFEA 1RK5A 3B8IA 5A6TC 4O16A 2ASHA 1KCKA 1X8FA 1E73M 1D7FA 4UR8A 5C55A 4OV9A 1PX8A 4UNIA 2HEJA 4S23A 4L1WA 3E96A 3D3FA 1NEYA 4B5XA 5ABFB 3GB6A 3DI1A 4WZHA 3H26A 3EWBX 3TWAA 1IEIA 1QK0A 2VX4A 4HYRA 1D7KA 4JFTA 3TJXA 2JIWA 2EPHA 4GUGA 3VIKA 4XKMA 1R3RA 2VGGA 3ZIZA 2PP1A 1PX4A 1B30A 2WSPA 2W5FA 3L4ZA 4JCLA 1DTNA 2ACUA 4H9YA 4B16A 4P7QA 3VINA 4H8UA 1PZ3A 1S3TC 4L9YA 4LB4A 1AMKA 4NKCA 3EOLA 2FVKA 1F6KA 4DQWA 1US3A 3R7MA 1LBMA 2ADAA 1EEPA 4QS5A 3W1AA 1OFEA 2CLIA 3VGBA 1Y8BA 4IQJA 1HKVA 4UIOA 3B0UX 4MJ4A 3TQVA 3BE7A 9XIMA 4XSLA 3UCDA 3KBWA 2GK1A 3KW3A 2VCAA 1NDZA 2ZDRA 3QV7A 5EPDA 3LBMA 1WUEA 2IPGA 3FIGA 3ARPA 1OGSA 2HCVA 4BS0A 3OIHA 1QFEA 2RGMA 2O7SA 2ZXDA 3KP1A 3QLDA 1K9EA 1ITQA 4MM1A 1XDJA 2VHLA 3NAVA 3TUUA 1FWGC 3BAWA 5FF3A 4MLJA 3MPGA 4F79A 1FDYA 2FHFA 4BY3A 1BRLB 2GUUA 3VZZA 4YVVA 1DWGM 3ZT7A 3R0DA 3H70A 3GDLA 2WCSA 3S47A 3I3DA 2BLEA 2FTWA 4WSKA 1M04A 1RV8A 3UPMA 2ZXBA 2E5DA 1JULA 3BANA 1L6FA 4DF1A 4LTSA 3KCLA 4Y9PA 4DUXA 3KXQA 4UC5A 3TTOA 1JPHA 2PTZA 5CSUA 2J25A 3ATZA 3KWXA 3MUCA 3BCFA 4IJBA 4GYPA 5E6ZA 1UCWA 4LF2A 3ZS4A 2VYOA 1OG6A 4UR9A 3UVIA 2PWHA 7TIMA 2WNZA 3SY1A 1WUFA 1W1ZA 3I6TA 1PAMA 1XSKA 2Y89A 4S3KA 1REQA 1X1ZA 4QG8A 4GO9A 2A4AA 3QFWA 4P7LA 1EJ7L 1Z41A 1MQPA 4O10A 2OWWA 4WUIA 3W24A 3BJTA 1A3HA 3VD4A 3P0WA 3N12A 4RCXA 4NIRA 4XKYB 3PG8A 5K9DA 3W29A 5BWAA 2ZUNA 3GYCA 1KR1A 1LL4A 5CPSA 1XKYA 1GJWA 1K7XA 2E40A 4P5UA 3M0LA 4JPGA 1SZNA 3W7OA 4H00A 3MANA 2OSWA 4GXPA 3GG1A 2VMFA 3TW7A 3WLQA 1HN1A 1TV4A 1PV8A 3BSHA 1J2WA 1W3TA 3BL3A 4FIRA 4PMQA 4BA0A 1MDLA 3BV7A 1K02A 4UMAA 3OZMA 1GWJA 1HP5A 3TX9A 3BLFA 2Y1HA 2GJXB 1DJGA 1IZJA 1ZBCA 1P0NA 3NZ1A 4C6OA 3FOKA 1GOXA 4CD5A 4C6KA 3GLCA 2CBJA 4WEVX 4ZQMA 4KWUA 3A3HA 2B4GA 2Q8ZA 2C8NA 1UWQA 4MB5A 5HUOA 1LG1A 3H2MA 3WYZA 2A21A 2FHCA 1U5HA 2IPJA 4BI7A 3O6YX 3NPVA 4XTIA 2BV9A 4V1YA 3ITCA 4PSRA 3HMCA 5K4ZA 4LRTA 2E09A 1JI1A 1QW8A 2GOUA 1VH7A 4CN6A 5KZ6A 1JFXA 7ENLA 3UPWA 1IWPA 3B9NA 4MHBA 1OCQA 4RNHA 3TQPA 3M5YA 2RAGA 1JZ7A 1MZRA 1C9WA 3W7QA 2VRKA 4B90A 3GRIA 4RV8A 3OQEA 1T8QA 1WCGA 3VE9A 5C71A 3LM7A 5A2BA 3R58A 4JTAA 2PDFA 3EX1A 4GOAA 4IM4A 2GSHA 3CU2A 5PTDA 3H12A 3A5FA 3OA5A 3QF0A 4QIUA 2WSRA 1J2BA 3PHAA 3NO3A 4CQ9A 3VOGA 3L4YA 1R47A 4AEOA 3K1GA 3G2GA 2GJRA 4HGXA 3F2DA 3R8GA 2C7FA 2FIQA 2XISA 1QW7A 3T08A 4DXXA 2QJNA 2OFJA 3FGCA 4X22A 4EOUA 2FFCA 4P8UA 3LLDA 3GTXA 4RE0A 4XUGA 6CGTA 1F8IA 1W1IE 1QPOA 3W88A 1ADSA 1EGVA 4MKSA 4JFSA 1HNYA 1VBRA 3GH4A 3BAYA 4UOQA 3CH0A 5F4WA 4RDYA 4AZGA 3RFAA 5A8QA 3BW2A 3W22A 4D6GA 4RL3A 4KF1A 2FZMA 2YB1A 1EL3A 5K7JA 5CBIA 1M7XA 4WJXA 1TYGA 3DFNA 1H5VA 1KCLA 4S3CA 3KCOA 4EPBC 1RUSA 4PULA 1KTBA 5TIMA 3MUIA 4LAMA 2CLHA 2QUNA 3CLWA 1VHNA 4A8IA 2D2GA 4QLJA 5IDIA 2IW0A 2UY2A 3KUMA 4UTKA 3EMQA 4JN6A 1NF7A 4PRTA 2AAAA 1H50A 5DY2A 1GVRA 5TBOA 1H4PA 3CHVA 2NV2A 3THUA 1KRAC 1TB3A 1AH0A 2R94A 2EPKX 1QWKA 4ZQCA 3EDJA 4H01A 3TW6A 5I5RA 4IJCA 3WLPA 1R9XA 4MSSA 2FPVA 3M5VA 3GX9A 1Q8JA 1PCKA 3PPCA 1HKKA 4IMDA 1G0CA 1BGGA 3KTCA 2AL2B 3NZGA 1HG3A 4FXRA 2Q6ZA 1G4SA 5CEWA 1RQEA 3P2VA 3B9AA 3O16A 4A35A 3M1ZA 1OSEA 3H7RA 3VFLA 1D3HA 2P8CA 4X63A 1R7AA 4IP4A 3TA6A 2X0YA 4DM1A 2DSZA 2DV0A 3LZ5A 1MI3A 3H21A 1OYCA 5E1QA 2GVYA 1VQTA 4HK5A 3TA9A 1JF6A 2BVWA 3GZ3A 3TK7A 8TIMA 4GACA 4I90A 2GFTA 4FF7A 5I77A 4ICNA 3EWDA 4CUCA 4FO4A 1KXVA 4PE8A 4LF1A 2UY5A 3FA4A 3N11A 3HN3A 1FP8A 2V8ZA 2X42A 1V3HA 4LCSA 4PA8A 4XZBA 3B8DA 1KBBA 2C79A 3WF2A 3BLKA 3GU2A 1NFBA 4ERAA 4KCUA 4B5WA 1F4HA 1XYFA 1Q4WA 3CAVA 1HZYA 2GK1B 4ADSA 3WH9A 3BSGA 4XD3A 3QSRA 4Q33A 1M9HA 3MW7A 3B0VC 4GZIA 2GDQA 4NI3A 3PK7A 1IGWA 1MEIA 4NYYA 1EQCA 5DXXA 3GXIA 2AMXA 3VD3A 3WFAA 1ONXA 5LIKX 1V6VA 4H83A 1TCMA 3GR7A 3H4GA 4H6QA 3G22A 3DG7A 4CEUC 3EOOA 2BASA 3MUY1 2ON3A 4OBRA 4NJIA 4LANA 3GW0A 1VJIA 1W3KA 2DIEA 2VURA 5D04C 2G4JA 3H7VA 3LCHA 3RLHA 3T44A 4LNCA 3UFYA 1WBHA 4JBRA 1ELSA 2B0MA 4GBDA 1BG9A 1E0UA 1FCVA 3ZJ7A 3OG2A 4Y8FA 1E56A 3WLMA 1J01A 3F5KA 3KOWA 2G3NA 5I02A 2QJHA 1CX9A 2A2IA 1SVDA 3TYZA 4QRNA 3G1FA 3QHMA 1POJA 2PPGA 1SZFA 2ISSA 1CBGA 1X98A 2DIKA 2TMDA 4U2YA 4DLMA 4NRSA 5IBXA 1OF6A 3GAKA 3PY2A 3WBAA 3PJWA 3ARRA 4HHPA 5HJLA 3WL1A 2MANA 1YPXA 1OM0A 3S1GA 1WXJA 3KVJA 3SO7A 5AC7A 4E4FA 1JYXA 1XXXA 5D09A 1REQB 4W8BA 2NXGA 2ZZ7A 1J6OA 2WC3A 2D20A 5CZSA 1EBGA 4AC7C 3WIJA 3HGJA 3NA8A 3DFQA 4I6KA 2BXYA 3UZYA 1XG3A 5GJPA 3WK0A 3N17A 1FX6A 3M47A 1JPDX 1MXGA 1WP6A 4HU0A 3N3MA 4Q8NA 5AKQA 3PP7A 1TJRA 4FZIA 4US6A 2PRHA 3OVPA 3ZFHA 1OC6A 2ALRA 3W1LA 1EIXA 4LBSA 3W7HA 2OZTA 3DU0A 3UR8A 3QKZA 4YCPA 5G1YA 5CBBA 9XIAA 4I5UA 4HPGA 4I5RA 3B97A 1WO2A 1KXHA 1XX1A 2VZVA 3UXIA 1V8EA 1JAKA 2XH0A 2ZOXA 3IJDA 4DIAA 2DY3A 4GQQA 2F8QA 4CQDA 1UD8A 3WMBA 5A6KA 2VUNA 1NARA 2XIMA 4O1AA 3BWWA 3GNNA 2PS2A 4YNGA 3BLIA 5F1UA 4MKVA 5AHNA 5DRCA 1H1YA 2PDYA 4EAMA 1Q6DA 3W87A 2DT1A 2W9MA 3BOFA 1E40A 2E9BA 1E70M 2WWDA 1SGJA 1ISWA 1Z48A 3ARUA 3W2LA 2HK0A 1RLCL 1SZGA 1ZSXA 3G0SA 2J62A 4J2PA 2OTDA 3CZKA 2WBKA 2WSYA 4Y9NA 3I6RA 3AHZA 4H9MA 1VEOA 1VFUA 3T8LA 4H4IA 1T96A 4LEFA 4J7RA 3V4BA 3DOPA 4XVDA 1J4EA 3SM0A 4G56A 4PUNA 2VGFA 1GW9A 3IGUA 4DJFD 5L9FA 3M0HA 3GC5A 3TC7A 3CZLA 4MADA 3MHUA 2NT0A 1JUBA 3EA2A 5JBFA 5AHMA 3PNZA 3C56A 2V6AA 1Y0EA 5CPNA 2YCIX 4PUJA 3L67A 1F76A 4JY8A 4JD4A 1PDYA 1J0YA 3BICA 2HTMA 1S2WA 1ZJHA 5BXRA 1TVLA 3N2XA 5DMMA 2W91A 3E2VA 1DQUA 1ODUA 4UQEA 4A3QA 1UQYA 3I10A 3OLEA 4B5UA 4JTTA 5DXYA 7TAAA 1A0EA 3PM6A 1V3JA 3RJYA 5D9NA 2F61A 3I7SA 4PMJA 5HMDA 4PTWA 1WAWA 4PC8A 4MB4A 3UR7A 1WBJA 2VEFA 3R11A 2FLIA 2GVGA 3V1PA 3SGGA 4AEEA 1IXNA 4GYFA 4PB4A 1EOMA 4U3CA 2J75A 3PF3A 1E4IA 1VBUA 3IRDA 2EG6A 3TP4A 2V67A 3VDBA 3WQ4A 3A4AA 2VEGA 1KCXA 2P5NA 3A64A 4HCDA 3WH5A 1D3CA 1H0GA 3T05A 1K8XA 1EOKA 2VZOA 3PPHA 2Z4GA 3ONCA 4K7VA 4MIMA 4YU1A 3ARTA 4CQCA 1GONA 5KSWA 2QMJA 3AHTA 2WHMA 1H7OA 4H9ZA 4ZO7A 4U2ZA 2OPJA 4HZMA 3ZXWA 3UXLA 4OWGA 4DJED 2G3FA 2GZXA 3K4WA 1KA9F 1R30A 5HPCA 3W2KA 2CIPA 1K7FA 3S42A 4HU3A 2D73A 1ZALA 4N02A 1WA3A 4HJFA 1R9YA 1GZGA 5D8WA 4LVGA 3WQFA 2D1ZA 3P0XA 4A8NA 1RCQA 2OKTA 1VFTA 2J8TA 1UD2A 2VKZG 3W7MA 2DDXA 2X0HA 1K9TA 3PB0A 1X1NA 4POCA 2WNQA 4A3UA 1NP0A 1QVBA 2VOTA 1CXEA 2E28A 4F40A 4Z2JA 3VOJA 5HINA 3ARQA 4ZE4A 1DQWA 2H9AA 2E7FA 3HMJG 4HYVA 4HSHA 4UQBA 3GUGA 4GKTA 4M81A 2J66A 4UFHA 5DQPA 1XIBA 1BQCA 1YDVA 3CC1A 3FSTA 1YW1A 2VX7A 3HV9A 2QVHA 2WSKA 3UPBA 4DF2A 5G4WA 4L5ZA 3UGRA 3IGHX 3VOFA 2PLKA 4E4PA 4IISA 3VDGA 1VCVA 2WJDA 4IPPA 1AJ2A 1E4MM 3WH6A 1AQHA 1OYBA 2P0OA 4Z1AA 1B3OA 4F0HA 3RF9A 1I2PA 2FPTA 3PZTA 1XR2A 3CTTA 4HN4A 4J3VA 3ARZA 1JCXA 1LOQA 1G7VA 1HL2A 1UBPC 1VEMA 4PL2A 4U31A 3B03A 3LBCA 3RPDA 1OX5A 3OVRA 4HBKA 5D02A 3W7LA 3GNOA 5CLWA 1BLIA 5H8UA 5HBFA 3AAMA 2C6QA 5IXEA 4KEVA 2OO6A 4H3DA 3V16A 1XBVA 5A2AA 1UD5A 3NPWA 1L2QA 2ZRWA 1IT0A 4Q8VA 4O1FA 3NL3A 1QU4A 2XWDA 2NWRA 2WLYA 3USBA 3WQCA 3WBEA 1QI5A 4H6KA 3F4CA 1Q66A 5F1VA 1SMAA 2QAFA 5M03A 1QHOA 2E4TA 4MWAE 1EJUC 3CH9A 1I2NA 1D8CA 3JW7A 1BSLA 2B7OA 5A1AA 1BVWA 4GPNA 1JEZA 3H2NA 4NZJA 3PZNA 5G4HC 3T78A 1S39A 5D8ZA 2GQ8A 3AYVA 5IFTA 2AL1A 3R5EA 1J8VA 1LBLA 3CMGA 1GVSA 2QNEA 4FLRA 1HKWA 3WF4A 4S1FA 2VC7A 1MUWA 3KL3A 5D2XA 1X6LA 3VILA 2C15A 3MB9A 2HNHA 2BG5A 3GS6A 3DEQA 1MW1A 5DX7A 4BKNA 1NDYA 5CJMA 1OT2A 3M6YA 1LLWA 1L9WA 2F38A 3MV01 2ZTKA 1W9VA 2INFA 3BGJA 4QE1A 1Q7MA 3NQMA 2IQDA 1Q7ZA 2QDGA 3R89A 2FTYA 1V93A 2WKGA 4LBRA 3QV8A 3H8AA 1J0KA 4TR9A 4WY0F 3G1YA 1C29A 4AZBA 1ISXA 1SO6A 2BY3A 1GORA 4QJ4B 4Q4QA 1PPIA 2QKFA 4ZBCA 5CC5A 1N55A 1UR9A 1ZGDA 1KRMA 4Q4OA 1U2YA 3C2FA 3TN5A 1XICA 5EKYA 4ZODA 3WX7A 2NQ9A 4I7UA 2OT1A 4P7NA 2E8YA 3ABOA 1YX1A 3MQTA 4FNTA 4Q4PA 1TWDA 4IL0A 4H8VA 4J28A 1B9ZA 4D6FA 3MSDA 3OHIA 1YTEA 4JL2A 4Z2LA 3LERA 1SMDA 2QPXA 3V5CA 1ESWA 5J04A 4X0VA 1BWKA 3GDRA 2QR6A 1XIHA 1MUMA 1FCQA 3PWGA 1W2PA 4JHZA 5EB8A 1S5TA 2RDUA 4C5YA 5CSYA 1TWSA 2AOSA 1GTEA 1HT6A 3EAUA 1G7UA 3FHAA 4ZL1A 1W3IA 1ME7A 1XQKA 3HPZA 4K2SA 3A13A 3OGSA 1C7SA 4S3EA 2GPTA 5CCZA 1FCBA 1EX1A 3WKZA 4MZ1A 1VHCA 4CD6A 2YSWA 2HVMA 4K6AA 1TMQA 2XZ9A 3AMKA 1HUVA 1T8XA 3GHTA 2J78A 1TV8A 3G3DA 2I17A 4RNFA 1RVKA 4NHVA 2WWCA 3B0XA 4P2VA 5C8BB 1WKYA 2EPOA 4YTSA 2GUBA 2PBOA 1TZZA 4TQTA 4IXXA 3OZPA 3RMEA 4IIEA 2DH3A 4Q4SA 3GWQA 3VNJA 4GK8A 5HDRA 3A12A 4HK7A 4Q8TA 1LOSA 4O1CA 4QXIA 2W62A 1GEQA 2RUSA 1HJXA 4JIRA 4Z2GA 1OVDA 4DZIA 5E0KA 1H2JA 3UBPC 1V03A 2HVNA 5I09A 2NUWA 4CD8A 5BU6A 3BG9A 4B2DD 2A79A 3HG5A 2PGFA 5D05A 2P0IA 5CPTA 1W5PA 3LTYA 5EMKA 3KX6A 4CNSA 4NRRA 2QMKA 2OLAA 4HKPA 1K4GA 3ABXA 2PDIA 1EC9A 4RDVA 1WV2A 3CMJA 2PA6A 1J18A 1FHUA 5M2FX 3N18A 3MO4A 4GFIA 3MS8A 2VUYA 2XYLA 1JI2A 4KPLA 4HA1A 3NCOA 5FEXA 4JNMA 5DBUA 4FXJA 1EXBA 3UCCA 4AXNA 1ZJAA 2YBVA 4YTQA 4HMEA 4ROPA 3U48A 4FIQA 3WFLA 5M3WA 3GG7A 4DJFC 1LT8A 1V0NA 3W4RA 5CC7A 1JUEA 2OYLA 1WDQA 4UNLA 2ZZ5A 3ZR6A 1B3VA 4AG0A 4JN7A 1UH3A 3KFTA 2PLCA 3UR2A 1QXLA 2XVGA 5C54A 4U10A 1JDEA 4PFHA 3GDKA 1O12A 2FZNA 3H4XA 3O0FA 2YB4A 2YL6A 5D9OA 1XLMA 7XIMA 2NSOA 5I3GA 3CAQA 1YE6A 3LI1A 2XTKA 3HF3A 3G1RA 1TO3A 1FBAA 4DY1A 4F9JA 1C3FA 2QYGA 3RO8A 4LCRA 3NZQA 2WPGA 1QNRA 3DFOA 3MDUA 4MAZA 3N9KA 1VFLA 4E4UA 4X60A 2CEQA 1J93A 1F3TA 4I7VA 4E8CA 3XIMA 4H41A 4NL1A 1JZ8A 4HB7A 1XYZA 2PBGA 2E1DA 3VKJA 2D2JA 2E6FA 4JIIX 4Q7NA 2Z25A 3SJNA 1UKTA 3EPMA 5EYWA 3IS4A 5J5RA 3UR5A 4DPQA 4B5SA 3UXKA 1NOFA 1ZB5A 2H9AB 1U5VA 4UTTC 3LHUA 2X8RA 1PTGA 1JQVA 1DWHM 1BG4A 4JDBA 5DFAA 2ZADA 3ZJ8A 5LXEA 4GH3A 5H8MA 1HIZA 1M1BA 4RLIA 4C6NA 4OBSA 1HXJA 4NXKA 2QJGA 4Q3MA 4C6CA 4AW7A 1PWLA 1NP2A 1I8JA 1OB0A 2WZTA 5A5WA 1CEOA 5LA2A 5CJNA 3GAYA 3W00A 4C5ZA 2JEQA 4I9AA 2HBVA 3VE7A 1OIFA 1QMLA 1EB3A 4HU4A 4CGTA 3GXTA 3NQAA 3CM4A 3PR2A 5JBEA 3V0UA 4IOTA 2YL9A 1PTAA 3GVRA 1MEWA 4D6EA 1XIJA 4B9ZA 3F2BA 2VGIA 2FMOA 5FEPA 2DU2A 2V5BA 1PIGA 3FYPA 3OBAA 2BY1A 5CSRA 4W7VA 4W4QA 1EIBA 4LGXA 3VNMA 2XSBA 1LYXA 4NSBA 4GVFA 3URQA 4LCQA 3QSTA 4N6FA 4ZO8A 3K13A 4E2DA 2VEKA 1S5NA 4PODA 3NPXA 4LNYA 4BHYA 4L56A 5D38A 1ME9A 5CQ1A 3NZRA 4Z1BA 1F5ZA 1UJQA 1FWSA 3C2RA 5FJRA 3C8FA 3OIXA 4Q4RA 4GC3A 2H8ZA 1UZDA 1ISYA 3V3WA 1P1XA 4J2MA 2YDAA 3S1VA 3OZOA 2VL4A 2XINA 5JXQA 1GPFA 2VXNA 3E12A 2PDXA 1K8CA 3M0IA 1XIGA 2PTYA 4XBSA 5D2TA 3KAOA 2J7EA 5LKYA 1RSCA 1MNSA 3T81A 1E3XA 2Z7GA 1DORA 1X97A 2QCCA 1C8XA 2HXUA 1NDWA 3ZYZA 4N9BA 3UZJA 5ABGA 4AY8A 2FZ8A 5AN7A 4WX2A 1TZ7A 1XC6A 3R0KA 2Z1XA 4KRUA 3PSWA 2HPMA 3L5LA 4AF0A 1KFBA 1CECA 4BF5A 4S2CA 3CK5A 4GYKA 5HK4A 4X9SA 1ECEA 1CGVA 1JGIA 3WK3A 4AX7A 1LZOA 1H7NA 3FJLA 5C2GA 4C6MA 1J10A 2IS7A 1O5QA 1ONRA 2E6YA 1TPDA 5LGZA 3QQ1A 2H6RA 4BFAA 1LDCA 1UWAA 3UEQA 2GJNA 3PJXA 4O19A 3AMCA 1UZ4A 3MP4A 1K3UA 3LSBA 3CV7A 4OJYA 1R85A 3EPOA 3NG3A 4ADUA 1QPKA 7CGTA 4A22A 4O28A 4J27A 1ZS2A 1TA3A 3LLXA 2Y88A 3LI0A 1RQBA 2C71A 4UFLA 3LXCA 1W91A 5IM51 4UOZA 2Z2AA 2PLJA 3GHUA 2GLKA 2PLMA 1K6WA 1VFFA 2WBGA 2ICSA 2TODA 4LH8A 2ZUVA 5E0FA 3UERA 3NYDA 3VDAA 1FH7A 2HVOA 2BOEX 1AL7A 3GSMA 1S5WA 1G4PA 5FJTA 1CXFA 3CT7A 4MY1A 4HHMA 1BD0A 2P50A 2E3ZA 4TX6A 3LB0A 2V30A 3QEZA 4W8LA 3WG6A 6TAAA 1CXKA 1IGSA 2P88A 2FKPA 3G24A 1PCWA 3VAVA 1GOQA 1RCOB 1UUQA 1W8SA 5DT7A 1O1ZA 3KWSA 4JTJA 3KZPA 3MA8A 3L21A 2V3DA 2WXDM 2HS8A 2F7FA 2OSYA 3G1DA 3VIFA 3TSDA 4BQ3A 3COTA 3ITGA 1E15A 4J35A 4NXSA 3UZ5A 4MOZA 3M0YA 1W5MA 1HO4A 2CITA 2AGTA 3VOHA 4AIEA 1PTDA 1BWVA 1HP4A 4GQRA 2Z24A 4LYKA 3ZMRA 4KRTA 3HO8A 2HMCA 4DUVA 3S6TA 1J79A 2YYTA 1F74A 1DXIA 2EKCA 3I68A 4JGDA 4BQ5A 1DJNA 4M6PA 4ZQPA 2D24A 5I03A 2H3DA 4WCJA 5M1TA 1DV7A 2DZWA 3C0LA 3LU2A 4OHQA 1C90A 2ABBA 3APYA 3B40A 2DORA 2EG8A 1E1CA 4WDUA 1DJZA 2EJAA 3NDZA 1NWUA 2A7PA 3UESA 3JVAA 4DI8A 1PYMA 1A4LA 3BGAA 3RMJA 1C92A 1UBSA 2BFGA 1UIPA 3NL2A 4C6BA 2ZBTA 2YFNA 2Z2UA 1L8NA 3AMGA 4K36A 1Q6FA 4KMQA 2ZUWA 2ALDA 1W56A 2GDVA 3VTRA 3BZJA 2AGKA 2ESCA 4IHCA 1OCJA 4RE2A 1EC7A 3HTWA 2EJ1A 4IMAA 1XSIA 1EKOA 2A3LA 5REQA 2WOQA 1AW1A 4IGSA 3JS3A 2PWGA 1ALDA 3OLDA 4MKNA 3SIZA 1A3WA 3F1QA 4JFVA 4XG1A 4FP1A 1ZFJA 3SAZA 1EPVA 3FS2A 3BH4A 1QOQA 3QR0A 1IWBA 3FXGA 2VD9A 2QDDA 3M9YA 2FMNA 3ZVHA 1SPQA 4JTFA 5AYIA 1KWGA 4Q6JA 3QGVA 4Z1CA 1YDNA 1RD6A 4E2VA 2NQLA 4OU1A 2WVTA 2O9OA 1PJ9A 4KGJA 2PDQA 1DWJM 4TTGA 4HZ6A 1WYIA 4WIWA 5EMMA 2BY0A 4DJFA 3KHJA 4GCAA 1Q6OA 1G94A 1DOSA 4F2BA 1UH4A 2Z1VA 3R1ZA 3OPSA 2GOKA 4M29A 1POKA 2GWNA 3S6DA 4DXKA 3SCVA 4G7FA 4L6HA 4OV4A 1E9ZB 3KRBA 3S2CA 4KIRA 2XVPA 2OQYA 1HO1A 2V63A 3MTWA 3SIMA 4FNSA 5ABTA 2JEPA 3EB3A 5GNZA 3DZ1A 2ZRVA 4HNTA 4JTDA 1U5JA 5MKGA 2ZZ2A 1XP3A 1K77A 2XJ7A 3FLUA 3IJ6A 2WSQA 2RDTA 4MPQA 4W7UA 3T4CA 1LLOA 1DHKA 3CO4A 4MF4A 1Y65A 4ERGA 1ZUAX 1GNXA 2CERA 2HRWA 3TYEA 3W86A 1K9DA 4FNUA 5HWMA 4TTUA 4QSHA 2DUAA 1VJSA 1GW1A 3NZPA 1PHWA 4IPJA 3SFWA 1R6WA 1KM3A 3VO0A 2PWFA 3ARXA 3DGBA 4Q8UA 2UY3A 3A9BA 1B31A 1VYSX 2BS9A 3GZAA 4GINA 4BZYA 4NZ4A 5BXPA 4JHOA 5LA1A 2QJJA 1IT8A 4US5A 4MNLA 4GI4A 3TONA 1FWTA 4U33A 1IEXA 4KKXA 3THCA 4HN8A 2JF7A 2QUUA 2PD9A 3IJQA 5AOUA 5AC5A 4UTTA 5CBJA 1A5AA 1IQ8A 2IPFA 1A5SA 4Q6XA 3WK2A 3PULA 3EX2A 2VZTA 4G8TA 2YKKA 1FWHC 2J7FA 4PUDA 1MYRA 1E51A 4HOXA 2EG7A 3IUHA 4QDPA 4LB3A 4CVUA 4HPHA 1WOAA 2XU2A 2X09A 1VBGA 2VEPA 1P7TA 3I3BA 1JNDA 5XIMA 3MT1A 3WLHA 2G50A 2NVCA 3NGFA 2CXEA 2WPBA 4X9YA 3VA8A 1XH2A 1BAGA 1OK6A 1KRCC 3TE9A 3HBLA 5LSMA 3GXMA 2QF8A 3W7JA 1IIGA 3O2LA 3MZ2A 3OGVA 1E43A 1F6YA 1G67A 4QCEA 3S2MA 4XIAA 2DQWA 2ZRXA 3W2MA 3THDA 4J3SA 2CWXA 4E0CA 4JTHA 4ZTXA 3NUKA 2P1FA 2OB3A 4O54A 1W3NA 2G5WA 2BVDA 2ZTJA 2VQTA 3AROA 4MJZA 4FXSA 3ABSA 1FFQA 2J88A 3CUXA 3BSMA 5FD0A 1ICPA 2A5HA 2HROA 1WKDA 2GJLA 2OYMA 1MSSA 1OGBA 4Z1DA 4AF0B 1SW7A 1NQKA 3CQJA 4LYPA 3EWWA 1PSCA 2PGEA 3PVFA 2D3NA 4C1NB 2QXWA 5HMEA 2ZX5A 3SSJA 1WZLA 3O8AA 3G8EA 3W7IA 5HJXA 4F0LA 1W1B1 3QY7A 2JKPA 1XC4A 2CZDA 4DNMA 4IF2A 4Q4KA 2R1LA 1EX5A 4H6RA 1P43A 4DWSC 1XG4A 5DELA 1VF8A 1TCDA 4K3ZA 1W3LA 3MCOA 3VIHA 1VP5A 3E6EA 5I07A 3G8RA 3IAQA 3R8HA 3FKKA 5FCZA 3PZMA 2JKAA 4XAYA 3WUGA 3FN9A 1ZAJA 1ZP3A 1F3WA 2F6UA 3TC6A 3TWBA 1TA3B 2PCEA 4ML9A 2I7GA 3N4EA 4AFYA 2Z28A 4GNKB 3AC0A 3E0FA 4IFOA 3K1DA 4L1XA 1FHLA 1EJWC 6TIMA 3N29A 3FA3A 3N15A 3VIMA 4CNTA 2Y70A 2X7VA 1MW0A 4DB7A 1E0VA 4QISA 1DVJA 3ISIX 3GC2A 4GCXA 5HJYA 2E68A 2YA2A 2EBNA 1R3WA 1XD0A 3CQHA 5FSDC 2VTFA 4RK8A 2VRQA 3W0KA 4JKLA 3S0CA 1S2TA 2O9PA 4G6CA 4Y7EA 5LIUX 1FWEC 1HL8A 4P7RA 1R3YA 3P74A 4GJJA 4R7WA 4W7WA 3OBEA 1T0OA 4I9MA 3IACA 2D0GA 3S5ZA 1TVNA 3ITYA 4JEQA 3W1MA 5I6SA 1R3SA 2I14A 2EGZA 1R87A 1JXKA 1UZ1A 3DHUA 4ZOEA 2POTA 1D9EA 2O7QA 1OFAA 1V51A 2CLLA 3CUGA 3IK4A 4WOZA 3LV5A 4K37A 1W3JA 1XS2A 5I3DA 1V5XA 2Y85A 1LQAA 1TV2A 2QUMA 2PDMA 1UPPA 3IEBA 4PMYA 1EO7A 4LUYA 3GFZA 3M64A 1MNZA 3TCEA 4JTRA 4IX0A 1XIMA 4CCCA 1E1CB 1W3HA 2HXTA 4FB7A 5GJNA 4A3HA 2VR2A 1NY1A 3SW6A 5H1WA 1E4LA 3ZSTA 3VNDA 1JCLA 3ZSSA 5M17A 4C6DA 1A5UA 3K4DA 2V3GA 5FAJA 3SDOA 4JX6A 5A8OA 1PXGA 1ZL1A 3WNPA 2GGJA 3EZ4A 2ZUTA 4L6DA 1GQKA 3VXGA 2OLHA 2QIIA 3TH6A 1F07A 3GG0A 3KVKA 1NIUA 2RKXA 2RDXA 5F4SA