2FTWA

Crystal structure of dihydropyrimidinase from dictyostelium discoideum
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
484
structure length
483
Chain Sequence
TGTILIKNGTVVNDDRYFKSDVLVENGIIKEISKNIEPKEGIKVVDATDKLLLPGGIDTHTHFQLPFMGTVSVDDFDIGTQAAVAGGTTFIIDFVIPTRGQSLLEAYDQWKKWADEKVNCDYSLHVAITWWSEQVSREMEILVKERGVNSFCFMAYKNSFMVTDQEMYHIFKRCKELGAIAQVHAENGDMVFEGQKKMLEMGITGPEGHELSRPEALEAEATNRAIVIADSVCTPVYIVHVQSIGAADVICKHRKEGVRVYGEPIAAGLGVDGSHMWNHDWRHAAAFVMGPPIRPDPRTKGVLMDYLARGDLDCVGTDNCTFCADQKAMGKDDFTKIPNGVNGVEDRMSIVWENGVNTGKLTWCQFVRATSSERARIFNIYPRKGRIDVGCDGDIVIWDPNQSKTISKDTHHHAVDFNIFEGIKVTGIAVTTIVAGNIVWSDNKLSCVKGSGRFVPRPPFGPVFDGIEQRDKVRNELLRKVDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords dihydropyrimidine amidohydrolase
publication title The Crystal Structures of Dihydropyrimidinases Reaffirm the Close Relationship between Cyclic Amidohydrolases and Explain Their Substrate Specificity.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 182
structure length 483
sequence length 484
ec nomenclature ec 3.5.2.2: Dihydropyrimidinase.
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2ftwA01
4JOMA 1NDWA 1FWAC 4LANA 4QTGA 3PANA 3AUOA 1EJWC 1NDYA 3UPMA 2OQLA 4IGNA 4EPBC 2EG7A 3URNA 4GXWA 3MKVA 2QS8A 4RDWA 1R9XA 2R1KA 3PNUA 2Z24A 4IFKA 1A4MA 3GTHA 2ICSA 3NQBA 1RJPA 2YZ5A 1RJQA 2PLMA 1WXYA 1FWCC 4QS6A 5LXXA 1KRBC 3SFWA 3IRSA 4DYKA 4DI9A 3LGGA 2YB1A 3K5XA 1E9ZB 1W1IE 4EPKA 3CS2A 2BB0A 3LS9A 2HBXA 4G7EA 3KM8A 3TN6A 4ERIA 1FWHC 1XRTA 3E3HA 4IFRA 1FWEC 3AU2A 3IPWA 1ADDA 4DLFA 3F4CA 4EP8C 1A5KC 4PCNA 1KRCC 1V77A 2Z4GA 4IFOA 1RK5A 3E38A 4EPDC 4V1YA 1YIXA 3K4WA 4LAKA 4BY3A 4RDZA 3DC8A 1EF2A 4EPEC 3B0YA 3TN4A 4LEFA 4NG3A 3RHGA 4KETA 3RYSA 4D8LA 3D6NA 5HMFA 1UBPC 4IH3A 2YB4A 1VFLA 4ZSUA 4KIRA 1KRAC 2DVUA 3O0FA 4LCRA 4F0RA 4RZBA 3UR2A 4LCSA 4GBDA 3MTWA 4R7WA 4XAZA 3F2BA 3OU8A 3DCPA 3S2NA 3TN3A 3MVTA 4CNTA 3T81A 4CQBA 2QPXA 1FKXA 1FWIC 4DO7A 1M68A 3V7PA 1M7JA 4CNUA 3R0DA 3MPGA 5HMDA 4MUPA 4GX9A 2I5GA 4DNMA 3F4DA 3HM7A 4XD5A 3G77A 4IF2A 4OFCA 4L6DA 3WZ0E 1EYWA 3LA4A 4C6DA 4CQCA 1POJA 2AQVA 4KERA 2DVTA 3IV8A 1RAKA 3O7UA 1FWJC 2FVMA 4XD3A 3GUWA 2XIOA 3RCMA 4Z42C 4GY1A 4RE0A 3QY7A 3EGJA 2QT3A 4C6KA 1EJTC 2GWGA 2IMRA 2O4QA 3GTIA 4LAOA 2ZC1A 3CJPA 3LU2A 4GY7A 4KESA 2PUZA 1EJXC 2R1MA 2CZVA 2Z2AA 4GY0A 4GOAA 2HQAA 4QS5A 3GIPA 4ERAA 3LSCA 1EJRC 4XAYA 1I0BA 4B90A 1EJVC 1V79A 1BF6A 2GSEA 5FSDC 2E25A 1RA0A 1XGEA 4C6EA 1E9YB 2W9MA 3FDKA 2Z2BA 3S2MA 1O12A 3CAKA 1PSCA 3T8LA 4WHBA 1K1DA 2KAUC 2UZ9A 4F0SA 3E2VA 3OVGA 3MVIA 4PCPA 1A5OC 1P6BA 1XRFA 1FWDC 4GX8A 4YIWA 3EWDA 3QGAC 1RA5A 2R1PA 4IQJA 2G3FA 3OQEA 1XWYA 4KEUA 1V4YA 2P53A 2PAJA 1GKPA 3OOQA 3T1GA 1EJUC 3OODA 2Z00A 4H9YA 4XAGA 2HPMA 4BKNA 1ITUA 3GTXA 3C86A 1P1MA 2FTYA 4H9VA 2GOKA 4C60A 4NP7A 4ERGA 1J6OA 4C5YA 1FKWA 3WMLA 1A5NC 1RK6A 2VC5A 3PNZA 5FSEC 2FTWA 4GC3A 4RDYA 1ITQA 5HMEA 3A3XA 3FEQA 4QROA 1J5SA 5G4HC 2OODA 4HA0A 4WGXA 2VHLA 1YMYA 1HZYA 3MDUA 4H9ZA 4CEUC 1EZ2A 1RJRA 4C6NA 2WM1A 3FDGA 5A6TC 3ID7A 4QSFA 4C6LA 1ONXA 4C6MA 3ICJA 2DVXA 4H00A 1EJSC 1JGMA 4KEZA 3K2GA 3F2CA 1KCXA 4LAMA 4WVXA 2AQOA 1M65A 3GRIA 3IACA 1UIPA 4RDVA 3OJGA 4H9TA 1GKQA 1YBQB 4E3TA 2YXOA 4J35A 4AQLA 4HK6A 4C6JA 1ZZMA 3IGHX 3UBPC 3QY6A 4UBPC 4TQTA 2WJFA 4DZHA 3B0XA 1R9YA 2Z29A 1K6WA 3WYZA 3S2JA 1QW7A 4HK7A 1P6CA 1O5RA 4G2DA 2HPIA 1R9ZA 3QY8A 1YRRA 4LFYA 4UB9A 2Q09A 2OB3A 4LCQA 4XD6A 4C6QA 2VC7A 4C6CA 2R1NA 2Z25A 3IARA 2HBVA 4I6VA 3S4TA 1NDVA 4NI8A 3GU2A 2RAGA 1FWFC 2VUNA 1YNYA 4GK8A 2Z28A 4H9UA 4DIAA 4I6KA 2D2GA 1QXLA 4AC7C 2WJDA 2WJEA 4C6IA 4GZ7A 2Q01A 4IG2B 1PB0A 4R85A 1IE7C 4PE8A 1V51A 2D2JA 4XAFA 1J6PA 3MSRA 2D2HA 4H9XA 3MDWA 1J79A 4B91A 1DPMA 3BE7A 5E5CA 4C5ZA 2ANUA 2A3LA 4J5NA 1A4LA 4CNSA 4ZSTA 4V1XA 3GG7A 4PBEA 4DI8A 3MJMA 4KQNA 3LY0A 3URQA 4CQDA 2Z26A 3QGKC 4IFKB 1UIOA 2R1LA 3HTWA 2GWNA 5AKQA 2BGNE 1NDZA 3UF9A 3ISIX 2QVNA 2E1WA 4P5UA 2FVKA 3PAOA 3PBMA 1KRMA 1FWGC 2HNHA 3SO7A 3RN6A 2PGRA 4KF1A 4G7EB 3GTFA 4XD4A 2F6KA 4IGMA 3S2LA 3A3WA 2Z27A 1YBQA 1V7AA 3ITCA 3GU1A 1A5LC 5CH9A 4B3ZA 2OOFA 2I9UA 2Z7GA 4QRNA 3TN5A 3NURA 2O4MA 4PBFA 3A4JA 3HPAA 4HK5A 3NEHA 4F0LA 1S3TC 4INFA 1WXZA 2GZXA 4CEXC 4BJHA 2FFIA 1PTAA 2AMXA 3B40A 4DZIA 3GU9A 4C6PA 3URBA 4J2MA 3GIQA 1FWBC 3LSBA 2OGJA 4HJWA 1NFGA 2EG8A 2UBPC 3UR5A 3LNPA 4R88A 2VR2A 4H01A 2EG6A 1PO9A 4L9XA 1UMLA 3LGDA 4GYFA 4M51A 3IJ6A 4KEVA 2VM8A 1POKA 3JZEA 3E0FA 3AU6A 1A5MC 3N2CA 2ADAA 4DLMA 2Y1HA 4ICMA 4C6OA 4IG2A 3E0LA 4LH8A 4C65A 3F2DA 3ORWA 1K70A 1GKRA 4C6FA 1I0DA 4H9MA 4LALA 3EWCA 2P50A 4B92A 3URAA 2PGFA 3E74A 4C6BA 3DUGA 1ONWA 3TNBA
chains in the Genus database with same CATH superfamily
4PUKA 2NQZA 3LPGA 4YTRA 1BYAA 4HNNA 4Q8UA 1SR0A 2PDGA 4GC4A 3ANUA 2X41A 4GXWA 4NXSA 3BLOA 2FPTA 1CXKA 3WUBA 2R14A 2W0UA 2V3FA 3RX2A 2NX9A 4GNKB 1BXBA 1M7PA 2WZIA 1A0CA 3CMFA 3STEA 3NIYA 2XVKA 5I3FA 2DSKA 3LGGA 1OFRA 3TTEA 4YVPA 3F5LA 3WK3A 2XTKA 3M0KA 4OIFA 4URIA 4KGJA 2EHHA 1TV7A 4O15A 3ZMRA 3CHFA 3HV9A 3TOPA 1TPWA 2GQ8A 3KM8A 1AG1O 1LWHA 1TX0A 3GH4A 2YYUA 3T0DA 4DLFA 3GD6A 3N3MA 1RK5A 5DMNA 1M3UA 1J93A 7XIMA 4YU1A 5HWMA 3OIHA 2J88A 3WLLA 3LDVA 1JZ2A 4YVXA 3I6TA 5BWAA 1JVNA 5CSSA 4U3AA 1H5YA 4LS2A 4RZBA 4ZB5A 1O95A 1XIDA 3EZ4A 1Z41A 1AMKA 2XM2A 2E3ZA 4QSHA 1L6WA 3O6DA 1DTUA 3CZGA 1KV8A 2RDTA 4QE4A 3NA8A 3WEOA 3V75A 1N8IA 3RMJA 3PJTA 4WK9A 2QJHA 3C0LA 4MZYA 4XZHA 4CQCA 4JIIX 3PAJA 3FIGA 2VT0A 2WNNA 3TX9A 3VPLA 1PUDA 4HMCA 1FTXA 3VILA 4EVZA 5C2XA 3KVKA 1QHPA 2CHRA 1HG3A 1PX3A 4QDMA 4PMVA 1UZHA 5CJMA 2BP1A 4HA1A 3ZFHA 1RSCA 3I6RA 2ZC1A 1OJXA 1V6WA 3JUGA 1TIWA 5XINA 2JIWA 3NZQA 3NDYA 4GPNA 1BF6A 2Y6ZA 2ZRXA 1JAKA 4NIRA 4MDOA 3L23A 1ZB5A 5HR6A 3CASA 4ZZ9A 1B4KA 2JEQA 3AIWA 3S1VA 3T8LA 2YSWA 3QQ1A 4R3UA 4K36A 1HJUA 2HXTA 3AWOA 4DN1A 4GQ0A 5A94A 1AZ1A 2WKGA 2C1IA 5KTLA 2VURA 1MQQA 3RO6A 2CHNA 4REQB 3UJRA 1VIWA 2HV5A 1PL9A 2P53A 4MNKA 1LG1A 3C52A 4EXBA 1V6XA 4S1FA 3YPIA 1ZJBA 1HL9A 3R6IA 4PMJA 5HOSA 3FKKA 3KW3A 2GK1B 3BAJA 5BZAA 3M4HA 4GC3A 2HEJA 1SZNA 1J5SA 3FV9A 1T96A 1HZYA 4CEUC 4XX6A 3NL3A 9RUBA 4QSFA 4DUWA 1N8WA 4QDWA 2V5BA 1YDVA 3GZAA 4CN4A 1E4LA 3VOHA 1DXIA 1EOMA 2WKJA 3W6YA 2PF0A 2VKZG 3VINA 5E0FA 1PYMA 3UWZA 2ZZ7A 1BAGA 5HNUA 4Z2KA 2VZOA 4HK6A 4C6JA 1ZLPA 2PDWA 4OECA 1RY8A 3BMXA 1ICPA 5K3VA 2QW5A 2BOEX 2G41A 5JMUA 1JDEA 2Z29A 5HNRA 3O07A 4JN8A 3M7WA 1O5RA 2VI0A 2YCEA 4IMDA 1TZ7A 1B9ZA 5D4YA 6ALDA 4B2DD 3L4YA 3QZ6A 4Q4MA 2Y88A 1G94A 4AYSA 2GDVA 2ZXQA 1WOAA 4LCQA 2VC7A 2E0PA 3LHWA 3GHSA 3IARA 2QR6A 2WW5A 3ME3A 2WJZA 5F1UA 1OZQA 2PDIA 1DJYA 3V0SA 4I6KA 3PJXA 3W74A 1BWLA 2CLKA 4DXVA 4JX5A 1PDYA 5AC6A 1DWIM 4OOUA 3PJWA 1W1B1 2QXWA 1Z6KA 2PWVA 3POCA 4IQEA 4HTYA 2ZTKA 4QLJA 1J6PA 1J11A 3P8IA 2ZUSA 4H7ZA 1ZUAX 2Z7KA 3BE7A 2O7SA 5I24A 2V69A 3KTSA 3CMJA 4UNLA 4A8LA 1SFLA 1UBSA 1ZGDA 4M1RA 4ZSTA 5F2IA 1DOSA 4L56A 3N13A 3S9ZA 1A47A 5LNRA 2Z26A 4J27A 2QCDA 4NRSA 2ZUWA 1PZ3A 4UIOA 1GVSA 3W88A 3LHVA 1HKKA 5HUOA 3VVGA 2WMIB 1K4HA 1H60A 1JDDA 4HBKA 4RNJA 1LM1A 1EA0A 1F6KA 1HO4A 1KW1A 2YCJA 3KCJA 3VX1A 2WZMA 2F6KA 3S2LA 1H7RA 1REQB 3PTMA 3CQKA 2V2DA 2V5LA 3WNMA 4KWWA 1D3GA 3DGBA 4NNAA 3KOXA 2J7DA 1X38A 4DJED 2I9UA 3QSRA 4GUGA 4ML4A 4J3XA 3O6YX 3PSWA 3RPTA 3WDJA 2ONEA 3HMCA 2WNZA 4F0LA 3VFLA 1QPKA 1K7FA 2WK2A 1JPKA 1TV2A 3KEHA 4W8BA 4XG1A 3APTA 3GH7A 7ODCA 3SB0A 5AYYA 3TV8A 1BF2A 3M7SA 4PCFA 3GWQA 3DHFA 3LRKA 4UTJA 1A5UA 3CAVA 1BG4A 1XSJA 1R0MA 1EEXA 3L2LA 4XK2A 4CD7A 1QNQA 1UMLA 1CWYA 3IJ6A 3G22A 4W5UA 1W9UA 3RNDA 3HA1A 2FMOA 3VAVA 1NWSA 2FH8A 5AC7A 1QVBA 1DJQA 3IK2A 4NQ1A 1FXQA 1RV8A 1WYIA 4UCGA 3GW3A 3K46A 5LYRA 4EXAA 2Y5SA 3ZLFA 1VCFA 3AMDA 5DCDA 3BJSA 3FSUA 1IR2A 3SY8A 4CNPA 3LPFA 4HZ6A 3SN4A 4EPBC 4PMUA 4DM1A 3JR2A 1DJWA 2ZZ6A 3H4WA 4IFKA 3NQBA 2BLEA 1GQNA 1RJPA 1UG6A 4PEKA 1ZSXA 5I77A 1MZRA 4S23A 1G7VA 1ZTVA 2ESCA 3VIKA 1RJQA 1CXLA 3PZTA 1NELA 3OZMA 4LYQA 4HPHA 2E1DA 1MYRA 4AVOA 2VDIA 3WLMA 1C7SA 1YYAA 4ZXLA 3PHAA 3KWSA 3FX4A 3E0WA 2BFGA 2PDNA 4M56A 2YBUA 3N1AA 1YDOA 1VB9A 2XVPA 3MYOA 3BZJA 4TVCA 1PTGA 1G6CA 2VRKA 5FJIA 3G24A 1C8QA 3B0YA 4WZHA 5HANA 1P0KA 2GGHA 3A5VA 2J7FA 4XZWA 3OPSA 3H2NA 2HK1A 4Z2IA 4ZSUA 4Y9MA 4JTSA 5F2LA 2ISWA 1RVKA 4R7WA 2OOGA 2EPOA 2VVSA 3M0MA 3TN3A 4QEEA 2WWDA 4MB1A 3VZZA 2DZUA 1TIMA 3JVAA 2OYMA 2IQTA 4QNWA 1F8MA 4FNPA 4HTBA 1CXFA 1EHAA 3AIEA 3HM7A 4KFPA 3HU7A 2V0TA 5FD0A 1E9LA 5I23A 3LQGA 2XFYA 5EKYA 2VFIA 4GG9A 4XQ6A 7CGTA 2IPGA 4S3GA 3RCMA 1NSJA 3QLLA 3VD5A 4RE4A 4BHYA 1ICSA 2Z1KA 4D6EA 1EJTC 3CB3A 3GTIA 4DM2A 1QNVA 5CAKA 5FJJA 2BVTA 2HQAA 4Q32A 3AZTA 1R3TA 3M0IA 3SIZA 5BXSA 1N55A 3RUBL 4QJ3B 4GWEA 2VR4A 3FDKA 1MW1A 1WNOA 1E55A 3EBVA 3CLWA 1KM6A 2VX5A 3ZJKA 1TZZA 3S47A 2J13A 4ZTYA 1RD5A 3D46A 2J7EA 1JUEA 4HA4A 2ZUNA 3QGAC 3S6TA 3ABSA 3NCOA 3OQEA 1VBGA 1EP1A 3F5JA 2Y5EA 3G8EA 4BKNA 4CCCA 3GTXA 1UR4A 3WQGA 4LU0A 2XN0A 1L2UA 1RP8A 1KM1A 1GOKA 2XG9A 1W1TA 3EPOA 3FW6A 3W7DA 1BWVA 3N18A 1JXJA 3THUA 1ITQA 3TOYA 5HMEA 4HYRA 4QROA 4PB3A 3EEZA 2Y85A 1RBOB 2WLZA 4I5XA 2CBVA 3DOPA 2WHLA 4JFWA 2J74A 5C9RA 1ONXA 3ARYA 2XFRA 1Q7ZA 3D5HA 1S38A 4O57A 1KCXA 4UOQA 4NY2A 2AQOA 4AZGA 3H8AA 3PZVA 3LHTA 2GVYA 3V0TA 1Y0EA 1NWRA 2G4JA 3W53A 4LAUA 4YLWA 1S5MA 1ENUA 1GOMA 3AIVA 1KFWA 1GEHA 5H8PA 2B0MA 3U2EA 1TMLA 3SCNA 5KINA 1XIBA 4HHMA 3N2BA 3VM7A 3P14A 1YW1A 4AD5A 2OGYA 2D73A 3LLXA 4YTSA 1EBGA 2DUXA 1OY0A 4MY8A 1YRRA 1IEIA 4TMCA 2ZZ3A 5F4WA 4YPJA 3CIWA 1K8CA 2NW0A 5CEWA 4DJDA 3GHTA 1O5XA 2XIQA 2PD5A 1JZ6A 2DPEA 4GZ7A 1PB0A 2O92A 3SSZA 1V51A 4S3CA 1P7TB 3MSRA 4JTHA 3H2EA 3AHXA 2OSXA 4PTVA 3WNPA 1DPMA 4BF9A 4C5ZA 1E5NA 5A2AA 5BCAA 2FZDA 1TJ2A 1EO7A 2NV9A 1J96A 4JNYA 1KGXA 1HKIA 3SUSA 1J2BA 5DFAA 4BZYA 5T9BG 4CD5A 2DIJA 1PVNA 3MB9A 4EACA 4AD1A 1QBBA 2GUYA 2GGGA 1K8ZA 1CW2A 3VOFA 2WXDM 4GKLA 2QGYA 4FSAA 4MKSA 4BI7A 4KIEA 2FVKA 1RCOB 4UMAA 4AY8A 2TAAA 1O68A 3TA9A 4R34A 2VEMA 1YXCA 1UR3M 1RCXB 3B97A 1R87A 1IV8A 1O6IA 1EB3A 1UHVA 1H7WA 4A22A 4D9PA 5HPOA 4QX4A 1R5YA 3WLJA 1SQ7A 2OT0A 3W22A 1LQ0A 2X0SA 3PBVA 4BA0A 3LN3A 4L4LA 4AWTA 3C6CA 4DELA 2D20A 3MQTA 5I7GA 3VDBA 5I03A 5U7SA 1J0IA 1TCMA 4R88A 1VLWA 4Y9PA 5AHLA 3BICA 1US3A 3R13A 1BSIA 4E5TA 1WBHA 1QNOA 3KRBA 2NT0A 2J7BA 3K4AA 4Q33A 3M47A 2DZBA 3VNYA 5ABTA 1H11A 3GR4A 1CGUA 3WMCA 4Z2GA 4IG2A 3LOTA 2QCMA 4DZAA 1Y8BA 3EWCA 2DIKA 4DB7A 3E74A 3IAQA 4Q8QA 4HZ7A 3WD2A 1HVQA 3Q4DA 1DL3A 2WQPA 4NJJA 3AXMA 1GG1A 3EMQA 1Q85A 4UQEA 5LHFA 3W7QA 4HMDA 1R30A 2DV0A 5HINA 1JCTA 2Z24A 4E0CA 2DT1A 4G56A 4WGHA 1S5TA 1ZFJA 1OFAA 4ZFMA 2CHOA 1C91A 3CIVA 4NKCA 3UNTA 3IRSA 3WLRA 1KA9F 2QLYA 3WH9A 4AEEA 3OVPA 1IWBA 2I56A 2MNRA 4QIUA 3FNDA 3TK7A 3W25A 1JPIA 5AVHA 2PURA 1QOXA 1JI2A 2XIBA 4IPIA 4QFUA 1MW0A 4ACZA 2VYOA 1B1YA 4AH7A 3BGAA 1NWTA 4QNEA 1YIXA 4ADTA 1VFHA 3KVMA 3UZXA 4LAKA 1OFPA 2PTYA 3QMTA 1XYMA 3T42A 4QG6A 3BOFA 4S39A 4GA8A 1Z7AA 3CQHA 4X63A 1KO0A 4PUDA 5HMFA 5D2XA 4LVBA 4DUXA 1IYXA 4UCFA 2HCVA 4M80A 4DBEA 4N42A 1TQXA 1SSDA 1IGWA 1NFBA 3HGSA 4JTDA 1ZAJA 5CPNA 1W3HA 2C19A 4ZTXA 1JGIA 3HGJA 5AN7A 1UA7A 2J9XA 2OT1A 4Q7BA 9XIAA 2B81A 2CNCA 3AS3A 4M7SA 4U31A 2WC7A 2F8QA 2P5NA 2AAAA 4A3QA 1Q65A 4KCWA 1UC5A 2RH9A 1SJBA 3CPGA 3GC2A 4PBGA 1XIIA 3U2ZA 2TYSA 1RPXA 3C2YA 2GQAA 4DWSC 3QOKA 2PRLA 4IL0A 2UWFA 1FWJC 5E93A 4XZBA 5FI8A 3GUWA 1TWIA 1EQCA 4Z42C 1T8XA 1XGDA 1KC7A 3BK0A 1BGAA 4JKMA 3U2OA 3NGFA 2Z2AA 4RLIA 2BNJA 4ERAA 4MYAA 4OBTA 4F40A 2E25A 3CWOX 3MWCA 5A1AA 3U9IA 1KD0A 3CT2A 2Z2BA 3L4UA 1HKMA 3ERPA 4HPNA 4HKPA 1UUMA 3W1NA 4NILA 2KAUC 4ZOCA 5BYWA 1CTNA 1IT0A 1W9DM 3NO3A 3AIBA 5C2GA 5EY5A 1O5QA 4YIWA 2R82A 1R3SA 2QMKA 3TJIA 3K1GA 3QXBA 5FOOA 4MDPA 8TIMA 4DNHA 3B9AA 4XAGA 1I1XA 2WPBA 1H1ZA 3WNKA 1DBTA 1LOLA 4GGBA 3W7EA 3UWVA 3LXBA 4UUIA 4YCPA 4PRWA 1RK6A 3DKJA 3KBVA 1XC4A 4MWAD 3NR0A 4FHAA 1VHNA 4BF7A 5TNVA 1YMYA 2E6FA 4CGTA 2OZ3A 3AMLA 2ABBA 1XUUA 2Q3OA 3V0UA 4ES4A 2C1GA 1QATA 2PGWA 2G96A 2ZXBA 4Z2JA 4KT2A 2GOUA 1VPXA 2P0OA 3W7PA 2DSVA 3U2CA 3IJDA 2VJXA 2VRJA 1EQPA 2INEA 4OWGA 1YBQB 4AEFA 1XLAA 3ARQA 1TV5A 3VDGA 1K9TA 5CSRA 1WOBA 2VTFA 5A6JA 1FH7A 3K1DA 4IIGA 1AD1A 1GT8A 2BODX 4KCTA 3EXRA 4A29A 2WJFA 1TR9A 4TMBA 1HX0A 4P7OA 2V5DA 4K8HA 1MQRA 1QW7A 3N9KA 3GNRA 1XBVA 3N3TA 3NSNA 1R9ZA 2Z1XA 1NQKA 4LFYA 1QO5A 2Q09A 3GTNA 2YZRA 1DYSA 4LC6A 3EXTA 2VDGA 3LMYA 2FJUB 3BURA 3E96A 2A3HA 3DU0A 1VFFA 1MW3A 4CCDA 1XGZA 3SURA 3VNIA 3SZ8A 1LLWA 4U33A 1W17A 1E0UA 5U4NA 5HAOA 3DXIA 3B03A 1IE7C 2KX9A 3VDAA 1E43A 3N9SA 1ZY9A 2CLFA 4IPLA 3UU0A 3QJAA 4QP0A 3PK7A 4F4RA 2X30A 1LBLA 1Q7MA 1EA9C 2GK1A 4PBEA 3EA1A 1Q8JA 3MBFA 3TP4A 3PM6A 3QGKC 1A5CA 1UP0A 2BGNE 1NDZA 3DBPA 1YE4A 2E1WA 5LZLA 4L1XA 2FKPA 4H6QA 3WD4A 3SCQA 3SECA 1CGXA 4JTFA 1XIHA 3VOJA 2PGRA 4RJEA 1MZHA 4RNHA 4YS1A 4O1DA 3WF3A 2V6AA 1O4UA 3W0KA 3CHEA 1H7XA 5D37A 3SCUA 4CNOA 3PFMA 3TSMA 1E72M 4O10A 4PBFA 3W1XA 1KBJA 3PUOA 2NWSA 2HISA 4OQVA 1WXZA 4CEXC 4ICNA 2X16A 3ZVIA 1QW9A 3LSBA 4GACA 1F8IA 3CPRA 4HJWA 1B3ZA 4O1CA 2Y63A 3OP2A 2X1RA 4P8VA 2YR1A 4PTWA 3UXIA 1Q2SA 3JZEA 2WWCA 1H4PA 4IICA 2VWSA 4UFMA 4XZNX 3AU6A 2G0WA 4DVOA 3BV7A 2OKTA 4FO4A 4LH8A 4C65A 1LG2A 3WUFA 2ZDRA 3BW4A 2E7FA 4C6FA 4UNIA 1YLVA 5EU9A 1PIGA 5PTDA 1S5NA 4PC8A 1NDWA 1ZS2A 4PUNA 2VQUA 1A49A 1OG0A 3UJFA 1X8FA 5I07A 4GZEA 4Z1DA 3CUFA 2GJPA 3IIZA 3RLGA 1DWFM 1XLEA 1J8VA 3GW0A 4CVWA 4PTNA 4ICCX 3G6LA 2WMIA 1U5JA 1W32A 4H04A 3PB0A 3C3NA 4DJFC 2Y0FA 5CGTA 2AOSA 4OJYA 4JKKA 3VIJA 4U2ZA 1L6GA 2ACQA 3E3HA 2QPUA 3NZRA 2CEQA 1GCYA 1REQA 1OG6A 3IPWA 3UXKA 8CGTA 1S2UA 3ZR5A 4O13A 1M04A 2XGBA 4H6EA 3W1LA 1I2RA 1Y5VA 3SGZA 2YX0A 1W91A 4KKXA 1XQLA 4HNOA 2DEPA 4FXRA 3II1A 4Z1CA 1UB3A 3H2MA 1MUMA 4FOJA 2XSAA 1TWSA 1KRAC 3B9OA 1TPFA 3UG4A 3BLFA 2VX7A 3DCPA 4KWOA 3VD9A 2CZFA 4LOCA 4B5NA 3T81A 4PMYA 3WLTA 2WVSA 2Q3RA 2QPXA 3P93A 3FN9A 3E2QA 2ZTJA 3IJQA 3UFYA 3S5ZA 4MY9A 3GSMA 1K3UA 1K03A 3F4DA 3PZIA 2A7RA 1LUCB 1SSGA 2RHGA 4PUWA 3L4ZA 3TQ0A 4G1NA 3RU6A 2BY2A 3G1RA 3STPA 2J6VA 3ZS4A 2ASHA 4XZIA 3UCCA 1G7UA 3VU2A 3LYEA 5I3IA 1C8XA 5HDRA 3KUMA 3QY7A 1GVYA 1B54A 3W82A 4L6OA 3GO2A 1IEXA 4UTMA 4A8NA 3DFPA 3B9NA 3TFXA 3V5CA 1NFPA 1YEYA 2ATSA 1EIBA 1XYZA 4N6FA 1JFHA 4R5EA 4ZE4A 3TYAA 3L0NA 3PP7A 3MMDA 3WLKX 2PDMA 3DHUA 3EDDA 3UA4A 2GYIA 5EGRA 4AZ6A 1E6SM 5CLTA 4R33A 5HPCA 4HNLA 3OVGA 1FHDA 1QASA 2FB3A 4X60A 3WMSA 1OGGA 4D6FA 3ENLA 3DGRA 3NQCA 4D72A 4WXYA 3KFTA 1UWUA 4ZCWA 3F1QA 2DZWA 1EJUC 4GHRA 1YQ2A 3C2OA 4Q4SA 1E3ZA 2E9LA 3MSYA 2EXOA 2PB1A 1UOZA 3AAMA 3CUIA 3QSTA 1KGUA 4UQAA 1UH2A 4KPLA 4HA3A 2FHFA 4JQ3A 5D9PA 4JAWA 3SN0A 2XH4A 3VZXA 2ABAA 1LBFA 3PZGA 3TUUA 1FP9A 1OX4B 4AWEA 4WVXA 1IZJA 1TO3A 1YPIA 3ZIZA 4PTMA 3TWBA 3XINA 2ZICA 4F2UA 3KDOA 1Q2RA 2A2IA 2NVAA 3SQSA 1OFOA 3MI2A 2DSUA 3FJ4A 4HK7A 3CO8A 3OZOA 1NAL1 2HPIA 3LEPA 2BASA 2WLYA 1BTCA 2WHMA 1W5OA 2XH7A 4C6CA 3MKKA 5K7JA 3N04A 4I6VA 3G1AA 1PZ2A 3WENA 2OTDA 1I2NA 1UKQA 4LYRA 1UMYA 2RAGA 3WUGA 2E40A 3C56A 3LCFA 2XZ7A 1WA3A 4PFMA 1EPXA 4JFSA 2D2JA 3ARZA 4I8DA 4BEUA 3QBUA 3VM5A 1PKMA 2BXVA 1K9EA 1X96A 1LT7A 3BG5A 3TW6A 3TC3A 3VUSA 1UR9A 1YDYA 1E6ZA 4W4QA 4ZOBA 2A3BA 4LXFA 1BG9A 1UIOA 3DI1A 3HTWA 2BX7A 1JUBA 3FHQA 4X2RA 4UR8A 5FJTA 2E8ZA 1XC6A 3TJLA 1LWJA 4K3ZA 4CU8A 3PC0A 4CU7A 1IXQA 3RN6A 1PPIA 2TODA 2XWDA 1JFXA 4G7EB 1XJBA 2AL2B 3GDRA 3WJZA 1W8SA 2OXNA 1NOWA 1S1RA 5H8MA 2P3EA 1HIZA 4JR5A 4HVXA 4ZVJA 3T0AA 3GG1A 2PDJA 4HT3A 3EX4A 2YJQA 3ARSA 3CV6A 3SUVA 4TU1A 5CPLA 3BVJA 1R6WA 1LRQA 1S3TC 2ZZ4A 3I7QA 1V6UA 2LLEA 3ALFA 2A6NA 4KS0A 3ITVA 2J9ZA 4O54A 1E6XM 1AZ2A 5C9XA 4GH1A 3E0IA 4O52A 2YYTA 4UQBA 3VOIA 1E1CB 5M5DA 1PX4A 1EL3A 4P7QA 1YTKA 3LGDA 2BOFX 4MB4A 1GOQA 3WFLA 4GQGA 3APGA 4CQ9A 4LC8A 3WK2A 1FFRA 4K1GA 4JHOA 3ORWA 1E6QM 3DFOA 4XBKA 5KZ6A 2PGFA 2V67A 4C6BA 3DUGA 1GEQA 5BRPA 3LCHA 1GORA 4R53A 2YKKA 3QPYA 1X98A 3WELA 3TYUA 4S3AA 1ISXA 3S5SA 2ACRA 3WSUA 3T05A 1SU5A 6TAAA 4O4VA 1JD9A 5HBFA 4DI9A 2ZXAA 4X0NA 3CLMA 4LUSB 3TH6A 1G1YA 3F4WA 4ZO8A 4LVDA 2WYSA 1NWUA 3IVTA 5J5DA 2WNQA 4XVEA 1ADDA 3NQEA 2VGGA 4G5DA 5I5RA 4IMGA 3IIPA 2PDHA 3LNMA 3S6DA 3OVQA 1DE5A 3R2GA 3DC8A 1FBAA 3RU8X 4HIBA 1SUXA 1RBLA 4J3ZA 4U5KA 1F3WA 1AFSA 2J77A 2QYGA 5C0QA 4KH2A 3RFAA 1KFLA 5LIKX 3ABZA 1QMLA 2QNEA 4GJJA 1I9CB 2F9RA 1KCKA 2GVLA 3TYEA 1NJJA 2PCQA 1UKSA 4CNTA 3U5UA 1E0WA 1OABA 3WLIA 5D03A 4S3DA 4O0KA 4MF4A 3UW6A 3KZPA 1ZJHA 3HQNA 1B3WA 1M41A 3ZR6A 1X8CA 2WCAA 4B5WA 1W5PA 1M03A 4QAIA 3M5XA 1EUAA 3QZAA 1KCZA 3HJZA 2ALDA 4DYJA 4GZJA 1RAKA 1D3HA 4Q6JA 2ZVRA 1LORA 1Z42A 2YCLA 3VZYA 5A6BD 5DXYA 1PIIA 3QPZA 2ZE3A 3EGJA 4S3FA 3LU2A 1B2YA 2W62A 1IZKA 1THFD 3EX1A 3VGHA 4KWSA 2QDDA 5F4XA 2ZRWA 3G1HA 5DF0A 3Q37A 1KM0A 2J8GA 1Z44A 1RCQA 4C6EA 2WVVB 4Z0JA 4ADUA 1X7IA 3TQKA 1JDFA 1IEWA 3M5ZA 3W2KA 2PA6A 4FNUA 4HU4A 2V3GA 1M7OA 1KLYA 3MWAA 1EKOA 5GJNA 1D2KA 1TZ9A 5DCBA 1OT1A 3CTTA 2BHZA 2FZ9A 4AAJA 2NXIA 2I14A 2YBTA 3WQFA 4G9PA 2VUYA 4PODA 3VE7A 4KFOA 4MNLA 2YL5A 4DAIA 3TROA 1VAHA 3WBYA 3TFCA 2XFFA 2PFHA 4XAPA 3FYOA 3MP3A 4NHVA 2HE8A 1UA3A 3DN5A 3NZ1A 4QCFA 3D47A 4R7JA 3FEQA 1I6NA 5A2BA 2JGYA 1JG9A 2BY0A 2OODA 3CUZA 4QGCA 4IZGA 1Z3NA 4EWND 1BFNA 1EZ2A 4HNCA 4R9XA 2CW6A 2EPNA 2WM1A 3UWQA 1GQJA 1PXGA 4HSOA 1ISZA 4C6MA 4FXJA 5GVJA 5D2TA 1HNYA 3F2CA 4Q4RA 4AYGA 3GRIA 4MPKA 1P0NA 4RDVA 4K8EA 3VKAA 5ENLA 2OYLA 3IJ8A 4E3TA 2FHBA 3I65A 1NARA 1IHIA 5D04C 1ISVA 1W3LA 3NYZA 3B0XA 2ZUUA 4HNUA 2ZWYA 3KVJA 1TA3B 3TNOA 5CXPA 2F6UA 1CLVA 3IGXA 4D8ZA 5K2ZA 4F2BA 3UXLA 3SRKA 2CETA 4Q8OA 1DP0A 3VD3A 3MBDA 3SCSA 4ZR8A 1AD4A 1GTEA 1UKPA 1ALDA 2Y5JA 5CJNA 2IKJA 2FZ8A 3KVLA 1UZ1A 3MKCA 4MTVA 1W56A 2NUYA 4WD0A 4GKTA 1R3VA 2ANUA 4U10A 4PL1A 3UWYA 2NQJA 5I2UA 2J75A 4N2YA 3IIOA 1AL8A 2C18A 1J12A 3CXOA 5AC8A 4JY8A 1V8EA 1XLHA 1J4EA 4ZOEA 2WB5A 4A8IA 1HFBA 3G1XA 3PTKA 5HQLA 2W61A 2W63A 2YOCA 2NZLA 2BVDA 3A22A 4UR9A 4ZO9A 3S42A 5CCZA 4ZEPA 3EDJA 3K13A 1PHWA 3UJEA 4AZ5A 1YBQA 4P7RA 3HGOA 1HF6A 1TPH1 5C9UA 4O28A 4JIEA 1G4PA 1OINA 1RPKA 1EWEA 3DI0A 1XLCA 1KFJA 3AZSA 3KWXA 4E4FA 1MXSA 1TPDA 5IRPA 1T6MA 3L4TA 3R1ZA 1BD0A 4IOTA 1HUVA 4ZBCA 1EX5A 4OT7A 3M07A 3M16A 4AZIA 1VBRA 1EFZA 2XGIA 3BCDA 4XSMA 3FLUA 1PAMA 5GNXA 4M5PA 6PTDA 1Q6EA 4IM4A 1BLIA 1PCKA 2OLAA 1WDSA 4QXIA 4RCXA 1KB3A 5EFFA 5BXRA 2PDXA 5LGXA 5LNSA 4W8AA 2YDAA 1BRLB 2DJXA 1ZP4A 2QF7A 4FIQA 2O9TA 2SFPA 3SN1A 4LANA 3MHUA 3AUOA 2BV9A 3BLPX 1Q6FA 3B05A 1DJXA 5JBEA 3N6JA 3GIYA 3VGEA 5DT5A 3OZPA 3O0KA 5A2CA 2BWGA 2HJPA 1A5BA 3U5YA 1WXYA 5A3HA 3RLHA 4DYKA 3PN8A 2V2HA 1E9ZB 3XIMA 1XYBA 3TQPA 4JTJA 4R9OA 5AYIA 7TIMA 3BCFA 5DX7A 1FWHC 1AVAA 2XN1A 3N29A 3OLDA 1CXIA 2CZDA 4K8GA 4V1YA 3OBKA 8XIMA 1HGWA 1G5AA 2TRSA 4ATDA 1DQWA 1TVNA 1VYSX 3DEQA 4OTKA 4XTDA 4WSKA 4OUIA 2WSYA 3OIXA 1IQ8A 3THDA 3NM3A 4D1IA 2XISA 4A8RA 4CNNA 2QCNA 2DVUA 4FK9A 3KS6A 3PZQA 4M29A 4X61A 2WVUA 3VNJA 4XAZA 2HVMA 3H2AA 1UD4A 4Q4KA 3TZNA 2QCFA 3R79A 4OKDA 1K7XA 4C91A 5JXQA 4IJRA 2YXXA 4CNUA 1VFOA 5CPTA 1RALA 4C7FA 2Y61A 3ZYZA 3PG9A 1DJGA 4E2VA 1HP5A 4A3YA 2E68A 5LKYA 3A9BA 5AHFA 2V3DA 2QIIA 4EKJA 3DC0A 1V3JA 3QLDA 5XIMA 3GVGA 4A21A 1GG0A 2CKSA 2CXGA 3A47A 4XWUA 4X2PA 4WY0F 2BG5A 5A6SA 4BFAA 1LL4A 1UPMB 2DU2A 4XZMX 4A6GA 4C6KA 1UWRA 4FEZA 4KESA 3G3MA 1EJXC 1M7XA 4GOAA 1KM5A 4EF9A 3BGJA 4S3BA 4V2XA 4ZENA 1VBUA 1KKRA 2A79A 4B90A 1DHKA 4PCTA 3LM3A 3AHVA 4YVVA 1BXNA 2PWHA 3BH4A 3Q67A 1GOXA 4NXKA 4UZUA 2VFFA 5FF2A 3CMGA 5IBXA 1PYFA 1QBAA 1C9DA 3UERA 3E5PA 2JGQA 3QTGA 3PZOA 5KMYA 3A4AA 3B8WA 8RUCA 4GX8A 3M46A 3QR1A 5DRIA 3E49A 2QGHA 4M6QA 4GRSA 3KRSA 3STCA 1ELSA 4PFHA 2GDUA 3OOQA 3AMGA 3BMVA 2HPMA 4QE1A 3QF0A 4B3LA 4FS9A 3WFZA 1P1XA 4DBWA 5DO8A 4F9JA 2G95A 4A3UA 1FKWA 4WKFA 5EPDA 4DJFA 1BGGA 3QOMA 3UP8A 4JIPA 3OTRA 1XP3A 4QQ3A 2IKGA 2DT0A 1MEIA 1UWQA 1TX2A 5C6MA 3DDMA 3VABA 2NX3A 1A3WA 3K8LA 1LUCA 3WBWA 1W5QA 4H00A 1JGMA 1T8QA 3BLEA 4O1EA 3ARUA 3GNOA 3QFWA 3NPXA 4ORMA 3DENA 2QCEA 3MANA 1GKQA 3LGEA 1JZ7A 1WP6A 2WO5A 2PWDA 4GGHA 1VQTA 2IUZA 3E5BA 2GQ9A 2WZHA 1MRQA 5I3DA 1SFTA 4UBPC 1QWGA 2L5HA 1PCWA 4F9DA 4JGDA 3MC5A 1JZ4A 2ISDA 4AEOA 1V6TA 4YNGA 3WO8A 3PY2A 4AUBA 1I75A 1W0MA 1Q66A 1YPFA 3IVUA 5A8OA 1OGSA 2WM0A 3RLVA 3GBEA 1EDQA 2X7VA 3CZKA 3KAOA 5A6KA 4QEHA 2G3NA 1B57A 3R12A 1GZ1A 3WH5A 2WJEA 2VOMA 3R8GA 1O66A 3R94A 1G67A 2EBNA 2X8RA 3Q94A 2QDEA 3UESA 3AJ7A 1W9VA 3IAPA 2PDKA 4AVFA 2BY1A 2DZVA 4B91A 1FHVA 3WF2A 1LLOA 2NV1A 3ZJ6A 1J5TA 5G1MA 2VO5A 4Y9OA 3A4WA 1KGWA 1MXDA 4WDUA 3TCSA 5EBUA 2V81A 3H7RA 2ZWZA 3CYJA 1XXXA 3BC9A 4TX6A 1VH7A 3KHJA 1UP2A 4FNRA 5AECA 3RMEA 2YPIA 3V1HA 3BXWA 4F0MA 4KF1A 3W85A 3TYDA 1GVEA 1OX4A 1U1JA 1W9BM 4LRSA 3NZPA 1CBGA 3EOOA 3PZ9A 5KETA 2ZOXA 4AW7A 1W3TA 3T6CA 3KE0A 3NSXA 2VGBA 1TTIA 4MSSA 5CH9A 4B3ZA 2ZVIA 3HPAA 1Q6RA 1SMAA 1VFMA 2WNWA 4H83A 4BK9A 3WKZA 4BJHA 4HPGA 1AA1B 2ZCGA 3TKFA 3MS8A 1F4HA 4UFHA 1W2PA 2E8YA 3DG7A 4O18A 3BOXA 4GQRA 1V08A 1GYLA 1BPLB 1FUYA 2CBUA 3IIVA 2UBPC 4W5ZA 1T41A 2O7QA 3T40A 1J9YA 4NJIA 3AYTA 1SW0A 3W70A 4C1LA 5LXEA 1POKA 3NQ7A 4YTUA 2C6QA 4DJDC 4WOZA 2WZEA 1RXOB 1XIFA 3U0HA 4AY1A 1U1UA 4LAZA 3E0LA 1AW2A 4EK7A 5F4SA 1TQJA 1PV8A 2PDPA 4ZA0A 5I3GA 1XINA 5H8UA 4QTGA 3UPMA 4M8UA 3NSMA 1XL9A 3UVAA 3ANVA 1IT7A 1WAWA 3UG3A 4AD2A 3PZNA 1VF8A 4GE8A 4QS6A 5LXXA 2IPWA 2OEMA 2CESA 3WQ6A 4ZQPA 2OSYA 3BW2A 9CGTA 3E9AA 3O6AA 3CWNA 3K5XA 3K8KA 2RJGA 3UVIA 4B4HA 5DY3A 4G7EA 2Y8UA 2AL2A 4K37A 4UTLA 2ZX5A 3PZUA 2PDQA 4E8GA 3AZRA 1JZ5A 1S2AA 2GJXB 4EP8C 1A5KC 4US5A 5E09A 3OB8A 1ZALA 1V77A 1XS2A 2J66A 3AIRA 1EF2A 4PN2A 3PPFA 3CL6A 1E56A 1YADA 1V6YA 1XF0A 1XIMA 3GDLA 3QYSA 4RUBA 2JEPA 4W7UA 1VGAA 2W3ZA 2ZRYA 3BQ6A 1E1CA 3OU8A 4UMCA 4KWUA 1C3FA 2HSAA 4LX4A 3O1NA 3WLNA 4F3HA 1LP6A 2QUVA 1FFQA 3R11A 3R43A 4DNMA 5A95A 1W31A 2GJNA 3VC5A 4O1BA 3S1XA 1HJVA 3NNTA 1EYWA 3LA4A 2ZRZA 3BLDA 3VO0A 1LLZA 3GKFA 4M6UA 3VIIA 1UQZA 1EH9A 4X0VA 1EP2A 3LQLA 4JQAA 1BSLA 1OD8A 3IJ9A 3QN3A 1P4CA 2ZE0A 2NUXA 2X2GA 4EXQA 2BGSA 4H7CA 4DUVA 2PDFA 5DN1A 5A5WA 1H49A 3D0CA 1WE5A 2R1MA 3GAKA 2PPGA 3LSCA 3BO9A 1ME8A 3KLKA 4XSLA 4MY1A 3ZJ7A 4GCXA 2AMGA 3DG3A 1TPVA 1E9YB 1UPPA 2A21A 3VCCA 3F4VA 2A3CA 1XD1A 1OF8A 3RPMA 2OELA 4GMEA 1VR6A 2E4TA 3HV8A 3GDTA 5H2ZA 4JTEA 3I6EA 3OYXA 2OWXA 4RE3A 3G1FA 5C55A 3EWDA 3E0VA 1UQYA 4C7GA 2W4XA 1V4YA 1LDCA 3OA3A 1A50A 4RV3A 4GVGA 2FTYA 3MUZ1 4CVUA 3MJYA 3N34A 3BQ5A 4HSHA 5T9CE 2J6XA 1XLMA 4CQAA 2FLIA 1TTQA 4UFKA 4FNQA 1S2CA 3MHGA 3EDKA 4XVDA 3WNOA 2OEJA 1D7KA 2WHJA 1XFBA 5K9CA 1WZKA 3O8AA 4AB4A 2WPGA 4C6LA 2YXGA 1UD6A 2PTZA 5LA1A 2OMAA 2V2CA 3VNDA 1M01A 3P5ZA 4L6HA 4I5RA 1L6SA 1E4IA 1EJSC 4YN5A 1U1HA 1OT2A 1EO5A 3U7BA 1OHLA 1JDAA 5CC7A 4HN8A 4LSBA 1WDRA 3VIPA 1R2RA 4HU0A 2FGBA 3QY6A 2D3NA 3W9ZA 1ZCOA 4H19A 4DY1A 3HO8A 1R86A 4I9JA 3WYZA 4WKHA 3C61A 3COTA 4AY7A 4DF1A 4XV0A 2IXUA 1Q6LA 1I2OA 4NUWA 4L80A 4DXKA 5DQPA 4JDYA 3W26A 3W7GA 4DF2A 3L65A 2CYGA 3TA6A 2PEVA 1TSIA 3O3RA 2HBVA 4J3UA 3IUDA 4MJZA 4J3VA 1DTNA 2QULA 4AZBA 1JNEA 4HGXA 4DIAA 2D2GA 4JN7A 4O11A 2CWXA 4PMDA 3B8UA 3EOEA 1JI1A 1XH2A 2Q01A 5M17A 3BG3A 1UWIA 2EGZA 2D2HA 3ELFA 3LLDA 1TTJA 3AQUA 4QISA 3W3OA 3QV8A 1NP2A 3VIMA 2ZA2A 4OE7A 4D6IA 3CBWA 2JBMA 2XGZA 3LY0A 3FXYA 1QRQA 4D6JA 3QR3A 3BJFA 4JEJA 2DIEA 1BQCA 3AFBA 3UQNA 5EB8A 3K30A 4XKYB 2ZADA 3E1F1 4PRRA 4LUTB 2YGYA 2BVYA 2C79A 4QCEA 1F3EA 1FWGC 2X1SA 4L9ZA 3GTFA 4W8LA 1UH4A 1TJ0A 2PS2A 2OPJA 3AHTA 1QO2A 9XIMA 3CEUA 3TTQA 3NURA 2O4MA 2H90A 3L21A 2RGMA 1TV4A 1CGYA 2V8ZA 2QDGA 1OFDA 1BVNP 4DZIA 4P8WA 1TA3A 3PVFA 4J2MA 4GI4A 4DO4A 2WOQA 4YTQA 4A3RA 2WMJA 4Q4QA 5XIAA 1IR1A 4F79A 3UJ2A 5EMUA 3FS2A 4P7LA 1PO9A 4LBRA 1ECQA 1M9HA 3TXZA 1CT5A 3GXIA 4RPQA 4DPQA 4WY0B 2VX4A 3UG5A 3HOJA 3S9YA 1DHPA 1H1NA 4OGZA 1KBBA 2PSNA 4LS1A 5LSMA 3KBNA 4JS3A 2PRMA 1VIZA 1I0DA 4LB4A 4LALA 1H63A 4WKAA 2G3JA 1W5NA 1WUFA 2C0HA 4JY9A 2FDSA 4Z08A 3GXFA 5TIMA 3QRHA 5HQEA 2EG7A 2OO0A 4YHGA 3B8VA 4QJ1A 3P74A 1V0MA 3ONCA 1J01A 5BRQA 1LL7A 1R8LA 3L2MA 1X6NA 2Z6JA 1OX5A 3EOLA 4OV4A 3N19B 4J7RA 1WKFA 4IPNB 2YB1A 2ZX9A 1ZP3A 3GXMA 4F48A 2YIHA 2HDJA 3T07A 3THCA 3B8DA 1I4NA 1AJ0A 1S1PA 3M41A 1W3KA 1DWJM 2FTPA 4I9MA 3GH5A 1XRTA 2F84A 4IFRA 2Z1SA 3AU2A 2J62A 2GGEA 4ML9A 3AIQA 4DZ5A 1HQTA 2ZYFA 4PCNA 2Z4GA 4EPDC 1AH3A 2Z1BA 4W87A 1D3CA 3HG2A 4RR4A 1WCGA 1X7FA 5K4XA 3NEVA 3PG8A 4RV8A 1JZ8A 5JU6A 4NI3A 3SGUA 1MMFA 3OZYA 3D6NA 5AZ1A 2QKFA 4IH3A 2YB4A 3KLLA 3VIOA 1DV7A 3W7KA 1OVDA 3ZT6A 3IGSA 4YYFA 2ZRUA 2XN2A 1MEHA 1W1PA 2FMNA 2I7GA 3LENA 2YA2A 1SM9A 3QPEA 4U3CA 3S2NA 5D09A 1EZWA 5D38A 4O0QA 1FWIC 4LUJA 2J24A 4DHGA 2QUTA 1CXHA 3APYA 3W7NA 4UTTA 2XVNA 1BRLA 3N2OA 2F38A 4MNJA 3QKEA 5EYWA 1E9IA 2B7OA 4H8NA 1D7FA 4PUJA 2XINA 3W00A 3BZGA 1PIFA 1F6YA 3RG6A 2PLJA 4GISA 3MSGA 3W7HA 1DQUA 4F2TA 3SDOA 4PSRA 3EB3A 1QUMA 2JE8A 1OFEA 3W4RA 1GNXA 1TV8A 2P10A 4XAYA 1I0BA 1EBHA 3ZM8A 2BTMA 3GM8A 1HT6A 3GB6A 3NQAA 3TLLA 4N4QA 4B5UA 2W9MA 2D0HA 3TYZA 2R8WA 3G3DA 2GSJA 5LNUA 3U6WA 3ZR4A 3QW3A 1FDZA 3MVIA 1UR8A 1XRFA 2P8CA 2VZTA 2ZA3A 2A4AA 2CKRA 4ZE5A 4W93A 2B4GA 3I3EA 1OX6A 4YL2A 2VFGA 2DUZA 1HKWA 4XB3A 1K6AA 4C60A 4NP7A 4ERGA 3CZEA 3L4VA 5D2YA 3CEPA 3PNZA 4N0RA 5FSEC 3VIHA 4OBSA 2Y7DA 1ISWA 4PMZA 1EEPA 3MMTA 3M0ZA 1RBAA 4G8TA 1RJRA 4HHLA 5TBOA 2CWNA 5C2CA 1JZ3A 3ID7A 2W92A 4X3ZA 4H8HA 1GK8A 4LS0A 1MRAA 1R3QA 4CKQA 1Q4NX 1R3RA 3ITLA 3WMBA 2C0AA 4L4OA 4O0ZA 3THQA 5LGZA 1DXEA 3EDEA 3M9YA 5BWFA 1I2PA 3G8RA 2YXOA 1TPC1 2PCEA 3O9NA 4QQUA 3VA8A 1MSSA 8A3HA 1C8VA 1QNRA 4TQTA 3GFXA 2DQWA 1FQ0A 5FAGA 1U5HA 3IRDA 1VJSA 2CCRA 3H7UA 1KWGA 2QIWA 3MW7A 5CLWA 4IP4A 4Y8FA 2PTDA 4UB9A 3CGTA 5IDIA 5EFDA 5CGMA 3UYCA 4HOZA 4HP5A 5AY7A 2I16A 3TLQA 4A05A 3H26A 2PODA 1G4SA 2QCHA 1Z8AA 1TPEA 4NI8A 3GU2A 3OLEA 4OZOA 4Q8WA 3EX3A 3FY1A 4RZ5A 3HFYA 1OEPA 1IIHA 2RGLA 2X40A 4HOXA 4JXCA 1XSKA 2RJHA 4JL2A 4S3JA 2G3IA 1G4EA 4D1JA 1WZLA 3ARXA 1MQPA 1UZ4A 5DANA 4XKMA 1SO5A 3WQCA 4GUFA 2D22A 4JIHA 5CZ0A 1FY6A 4UNKA 5E1QA 4CQ8A 3KBMA 1TB3A 2VRQA 2YDRA 2ZFAA 3AYSA 3WDPP 2I9EA 5FEPA 4LW7A 4Q8TA 3GC4A 3V4BA 3GK0A 4M82A 3G1VA 3WX7A 3VIFA 1J0ZA 3WH7A 2NQHA 6TIMA 3QQ0A 5G4WA 2XUCA 2NV2A 3SUUA 4IQLA 1OQFA 4GIYA 2OO6A 2AKMA 2YDQA 3EKGA 4IQDA 3NZGA 2YLLA 1ITCA 2VEKA 3GG0A 8XIAA 3LPPA 3LV5A 4QM1A 2J7HA 1HL8A 3LBOA 5CPSA 4E4UA 2QQ6A 1ZHAA 1XW8A 1WB0A 2G5WA 3AUJA 5FJPA 1XBZA 3KOWA 4UTWA 3B40A 4Z2LA 1U83A 1R46A 2HXUA 3S5OA 3USBA 3UCQA 1EUNA 2EG8A 4ONVA 4O14A 1RQBA 3OG3A 4DJEC 3ES7A 3CTLA 4Q22A 2JIEA 4KEVA 2PBOA 2VM8A 3E0FA 4PA8A 3N4AA 3RR4A 3CZLA 3GHRA 3NQ6A 1Y65A 3EKZA 4FPSA 1NTHA 4DLMA 3REQA 4C6OA 1SFJA 1GVOA 3W6LA 3SADA 1PKYA 2TPSA 4H9MA 1Q6QA 1GGOA 3SW6A 1TE1A 3ATZA 2VCCA 3TNBA 3AS1A 2P1FA 3CZ8A 3QH2A 3NTYA 1NDYA 3RM4A 4ASTA 4XZ9A 1QOPA 5D9NA 3WJWA 3GFZA 3PNUA 2EPLX 3F7JA 1TR1A 1YPXA 3BSGA 3UR7A 2QUMA 2BZNA 1QWKA 1X1NA 2PLMA 4JHZA 2CIPA 1FWCC 1UASA 4MFDA 3GHUA 3TR9A 2VFEA 1W1IE 3CS2A 3C2EA 4D6HA 4KWVA 4NZ1A 1RVGA 3EOUA 2NLIA 3FGCA 1SJAA 2HVNA 2OKOA 1OIFA 4UFLA 3UGVA 3P2VA 3F4CA 4NYUA 4IFOA 2ZRVA 1US0A 2YCIX 1Q6DA 5D30A 5M2FX 1DWAM 1XISA 4RDZA 4YYCA 1TJRA 2PU0A 3E6EA 4AZHA 5ABEA 1QCWA 3TDFA 1O94A 3IJLA 1XCXA 2CPUA 4FIRA 5C7VA 2F2HA 4OVXA 4NRRA 4HCHA 2PZ0A 4Y90A 2O9OA 3PPGA 4MG4A 4IL2A 2IQDA 3O0FA 1JNDA 4FNSA 3L4XA 3NPUA 5AVNA 4DJDD 3SIMA 2DT2A 3OG2A 1WO2A 2B7PA 1FOBA 3UGRA 3W7JA 5EL1A 1KFKA 2E67A 3DFYA 1TREA 2PWGA 4Y6GA 3HQOA 3RRAA 2EKGA 5CPMA 2YL8A 1W3IA 1XCFA 1DVJA 2OEKA 2I5GA 5C9WA 1DJIA 4XD5A 3SCOA 4TV5A 3O05A 1HL2A 4XISA 4LYKA 5CJ5A 1HTIA 4Q4PA 1DORA 3AIUA 3WQ4A 4O8RA 1MEWA 2XFWA 2NWRA 1QHZA 3OGVA 5AYBA 1UUQA 2QJGA 2WSPA 3W1TA 2PI6A 1H7PA 1PTDA 3UZWA 4M24A 5AYXA 1WQ5A 3C0JA 3P3BA 1UD5A 3GLCA 1L9WA 1JXKA 1QI3A 4LAOA 3TAOA 3SCPA 2FGLA 2QEZA 3MHFA 3AXXA 3Q65A 4W7WA 1V79A 2V5KA 3NQMA 3B9EA 5FSDC 3TSBA 1W3JA 1MVYA 1RA0A 4UZSA 3HQPA 2UY3A 3NM1A 1XGEA 1EPVA 4J40A 4PCSA 4GJ1A 1C90A 1W37A 5J5RA 2QCLA 2E6YA 3SEPA 5IM51 4JFVA 1GQLA 2D0GA 2GJXA 3N2MA 3EWWA 3ZLGA 5HUPA 1ISYA 3H22A 3M0XA 3I4KA 1D8WA 1RA5A 4LVGA 4MJMA 3H12A 3OBEA 3LG3A 1ICQA 4JICA 3A9IA 3R58A 4C5YA 4H1ZA 3N25A 3S6OA 1A5NC 3GVQA 3TYBA 1AH0A 3FVDA 5GNYA 1EGVA 1UUOA 1F74A 4HA0A 4GVIA 5G1TA 3ALGA 5E9XA 3W24A 2VNCA 4AFYA 5A6TC 1DIKA 4WX2A 1K8XA 1C93A 3N6HA 5T8GA 4HCLA 2O0TA 2FDMA 4KEZA 4UTFA 4LAMA 4QLKA 1M65A 4A35A 2GVEA 2DFAA 3W1RA 4UOJA 1W1A1 4IIDA 1XR2A 4UMBA 4I7UA 4ZL1A 1X6LA 2VD8A 2DQXA 2D3LA 4FR1A 4LTSA 3U48A 2X0HA 2VFDA 5K4ZA 2C3ZA 4MOZA 2BHYA 3GG8A 5E6ZA 1J2WA 4XD6A 3R25A 2J79A 2O56A 3LHYA 5AZ0A 1GVFA 5I78A 3DFQA 4GO8A 1RD6A 1NDVA 3KXQA 3UZJA 3VD7A 1S2WA 1SPQA 1J0JA 1OCBA 2VUNA 3STGA 3QHNA 1M6JA 4H9UA 2X0YA 1XD0A 4AC7C 4C6IA 1HJQA 4JYDA 3U3HA 3M5YA 4R85A 3WD0A 3UD6A 3BANA 3KP1A 3LTSA 2QAFA 3KCLA 1VBJA 2J4GA 4HZ8A 1J79A 4AISA 4WF7A 3WL0A 3WBXA 3VDHA 2WCSA 1UC4A 4V1XA 3AICA 2PE4A 4K6AA 3M6YA 2CFFA 4RZ4A 5AOUA 2HTMA 3M0JA 1XG3A 4F8XA 1B90A 2OWWA 3GYCA 2BXYA 4ENLA 4P5UA 5BW6A 5A6AA 1KXHA 2NXHA 2RDWA 3CQJA 1ODUA 1OCNA 4IT1A 4PMRA 3VUPA 3G0SA 4E4PA 5HULA 2VC6A 3SRFA 4LRTA 2VR5A 4ZXOA 2PLKA 1P43A 1QI4A 1IF2A 3WNLA 3GU1A 3MY9A 3A4XA 1XI3A 4PSPA 2OOFA 3WF0A 2O55A 3ABXA 1LOQA 3P0XA 4HNTA 4UWMA 5HNTA 3GVVA 4J3WA 2AMXA 1XLIA 4S3EA 4E6MA 3KL3A 3ARWA 3TTOA 4MMWA 1IGSA 4R27A 4MAZA 2ISFA 1ZBVA 3UR5A 4DPPA 3BMWA 4GYKA 3HG4A 4GJIA 4H01A 3VDCA 1UZDA 4ZGYA 5L9FA 2Q71A 4NZFA 3BAYA 3BV4A 3EA2A 2TMDA 1BKSA 2E9MA 1SJDA 5G2IA 5T91A 2HRWA 2ATMA 1OWQA 3URAA 3DIPA 3NOEA 3P82A 1LZOA 4AZ7A 4C1NB 2ZXDA 3MCOA 5C8BB 1WX0A 5AHNA 2PWEA 3LB0A 1V03A 4MPQA 4GABA 4AD4A 3E2SA 4RDWA 2PDLA 1A4MA 3H4XA 5FESA 5CSYA 1XQKA 4H4IA 1XYFA 4XKYA 4JTCA 2NQ5A 3WBEA 4HHPA 1KRBC 3UY7A 4LUTA 3ZXWA 1GPFA 3S46A 1H09A 3H4GA 2V38A 3UY8A 3GQYA 5CG7A 1Q6GA 2Q02A 3H70A 1QJWA 3KOZA 4IXHA 3LPOA 4LJ3A 1CLXA 4Y8EA 5E70A 1I60A 4JQ1A 4W84A 4GH3A 3HQ1A 1L8PA 4E8DA 3PWIA 3RO8A 4FALA 1S5WA 5I3HA 3WL1A 4B15A 1JCLA 4JTRA 1UBPC 1VFLA 1KM3A 3TU9A 2JF6A 1I45A 1F6PA 2FZMA 4FLRA 5LNWA 5D33A 4ZQNA 3F2BA 1QI0A 1X1ZA 3JW7A 1IXOA 2V5JA 3KDNA 3WY1A 3NO1A 1R3YA 2R94A 4O12A 1PBGA 3MCMA 7PTDA 1K77A 3FXGA 4DBUA 3V7PA 4H2HA 4WY0A 5LHEA 2V3EA 1F76A 1TRDA 2BXZA 2NT1A 4O4WA 3W29A 1IEVA 3MPGA 5HMDA 4BQ4A 4JHMA 4WJXA 5FEZA 2G37A 3KL5A 2Z0IA 5GPRA 3N17A 3I3BA 2G4FA 4L6DA 1WZAA 4Z2HA 3V35A 1DE6A 1YKWA 2YW3A 5DBUA 3L2IA 4WQ6A 7REQB 1VEPA 4MADA 1LOSA 3A24A 3SCRA 3V18A 1SO4A 1QT1A 1F4AA 1FDYA 5G2HA 1MNSA 4FLSA 3H6OA 3WIJA 3PWGA 5LIUX 2PUZA 1QW8A 4IGHA 3RAOA 4IP7A 4FAMA 4EIVA 4TXEA 3C0SA 4M3PA 4EF8A 1MO0A 5IHRA 3WBAA 1JEZA 1G9HA 2EAWA 1VJIA 1R85A 1DIOA 2PTXA 2GGIA 4NNCA 1FWTA 1H62A 3QC0A 1GJUA 3RJXA 1V0NA 3C4UA 4REQA 2WAGA 3UZ5A 1PSCA 1E0VA 4C7DA 3G1YA 1K1DA 4QG8A 5CPOA 2UZ9A 4HN4A 4LGXA 2HNEA 1FWRA 3AMCA 1K4GA 2W6RA 4Q7IA 2WCGA 5EMMA 3WK0A 2Y8VA 4FI4A 3S1GA 4N4PA 3R4IA 3P60A 3VKJA 2ALRA 2XVLA 2VD9A 3EOSA 4AHPA 4N7QA 4H9VA 1TV3A 4WCJA 1LJYA 3GS6A 5DEZA 5D32A 4Q8PA 1JF6A 3UWWA 2VC5A 4JTUA 4ZQMA 3UYIA 1Q45A 5I00A 4OBRA 5G4HC 2GVGA 1XKJA 5C70A 3MDUA 4H9ZA 4HHHA 4LBUA 4C6NA 4WSHA 1OK4A 4QBXA 3ZZ1A 1TPUA 3VKDA 1X39A 3GNDA 4TOQA 1EIXA 3VMPA 3N73A 1E51A 2R6OA 4US6A 1JRCA 2X05A 1KBIA 4MWAC 1EXPA 4H9TA 3M0YA 3EB2A 4ADSA 2WSKA 3LHUA 4LEQA 1SZEA 3OO2A 1XDJA 1UWTA 1NOFA 1NY1A 1F3TA 2DW6A 3E2RA 3SM0A 1JAEA 4XUGA 2NLYA 3TAKA 3CH9A 3P7YA 3OA5A 3HF3A 3EMCA 3FYYA 3GR7A 3DX5A 3QM3A 1SFSA 1PZ1A 4E38A 1H2JA 1KR1A 2D24A 3HPFA 4TX8A 3UPWA 2ZUMA 3RK8A 3QYQA 4N9DA 4NSBA 3IJIA 5CG0A 2ZX7A 1XDLA 3VGFA 4MWAB 1GTHA 5D05A 3RGTA 5IBXC 1WDWA 3WD1A 3VE9A 2WJDA 3B4UA 3CM4A 4IIEA 4EX4A 4UQ9A 3P67A 1TPB1 1A80A 4JX6A 3H2FA 3HPXA 3FAWA 3PUGA 1XH1A 3EB4A 4KCUA 5D8WA 3P81A 5IDZA 1E5JA 3MUXA 4J2PA 3U4FA 3ABQA 1B31A 3M1ZA 4MAVA 5CSUA 3MJMA 2CLMA 4U28A 3UWUA 1VC4A 2R24A 3MUIA 2PBGA 3CUHA 1OYBA 4Z17A 1UD8A 1T0OA 1H1YA 2ZQ0A 3KL0A 4PGLA 5DY2A 4ZO6A 3D3FA 1ZL1A 1KRMA 4BF5A 1GYMA 3AXIA 1B5TA 1LRTA 6REQB 3EX2A 3IANA 1VKFA 4B5SA 2G3MA 2P76A 4JYEA 2O9PA 3FVMA 4FF7A 3ITCA 1A5LC 4JFUA 3I3DA 4TIMA 1Q8AA 3GKAA 4N9EA 1XHGA 1KM2A 3AYRA 4MKVA 1QAPA 1WAUA 1B4EA 1C92A 3EA3A 1AW5A 3URBA 4F0HA 1VEMA 2IS7A 2J25A 3L9CA 5FJOA 1HJXA 3OGSA 3RDKA 3W1UA 2VR2A 1H3GA 2EG6A 4L9XA 4GYFA 4NJKA 2QF8A 3S0CA 4GI9A 1TJ1A 1BKHA 1E0XA 1LBMA 4HSNA 1A5MC 1E0TA 3N2CA 3M43A 2Y2WA 3FHAA 3LM7A 1K70A 3O6CA 1GKRA 1GOIA 4AD3A 1KFEA 4XIMA 5CBBA 2PP1A 2VL4A 4J1OA 4BWLC 3KBSA 1XLGA 3OYZA 1EC9A 1WZMA 3MZNA 2VVNA 4IGNA 3N15A 4FOKA 3HN3A 3PWAA 3TONA 1KFCA 3ITTA 4KRZA 4RW3A 1DJZA 3HBLA 5AB3A 4DRSA 2E5BA 4B2DA 4EPKA 5TQLA 3USZA 3T9PA 4W88A 2CLPA 4PB5A 3E38A 3DYOA 4MIMA 3T4CA 3L68A 1I1WA 4BY3A 2YA0A 3PPHA 3ONBA 2GFTA 2E5CA 2AL1A 2CBIA 3TN4A 4LEFA 4NG3A 1VP5A 4TV6A 4HZMA 3TQVA 1XCWA 3UJSA 3NYDA 5I6SA 5D9OA 3RX3A 4JNMA 4LCRA 3ZQ9A 4GBDA 3V3WA 3TW7A 1PEZA 1W1VA 5C5YA 3LLFA 1BVZA 2QJJA 3T09A 2VEPA 2Y7FA 3L4WA 3NXFA 1F5ZA 4CQBA 1QDSA 1FKXA 4UFJA 1E4NA 3KTCA 4OUEA 4GX9A 4PL2A 4FB7A 1ZQ5A 3N6QA 5BU6A 3U4AA 4EE9A 5CC3A 4Q3MA 3UETA 4OFCA 2FVLA 3BW3A 2AKZA 1FCBA 1BEUA 1CPUA 1ZRQA 1KXVA 1V3KA 1WKDA 4ECLA 1WPCA 1NP0A 5HK4A 2FVMA 1WDDA 1E1EA 2PWFA 3O15A 4GY1A 4H41A 3GX9A 4POCA 4DJEA 1JQXA 4GY7A 2J78A 1XIEA 2CZVA 3MU7A 4RE2A 3TTSA 3CL8A 1OC5A 1A5AA 1CB7B 1EJVC 1EYEA 3OW1A 4K2SA 1HXJA 2WSRA 3MI6A 4UC5A 2EJ1A 4Q6XA 3T0BA 3KBJA 5JUVA 3RCYA 1QI5A 4PMOA 4QR6A 1XLLA 4GFIA 4JQ2A 1SW7A 3G0UA 3W1AA 3GXDA 2W67A 1CB2A 2R1PA 1XWYA 3R7MA 2WC4A 2PAJA 3F03K 1DIDA 1PDZA 4H9YA 4KEMA 1DWHM 3W7IA 1QK0A 1UJQA 2GOKA 2ZZ2A 3UPBA 4CD4A 1A53A 1J6OA 1W1YA 1JPMA 4E3VA 5BU9A 3EYPA 1QU4A 1HW6A 3PPCA 1XLFA 3W7RA 1JCXA 2G97A 4PZVA 3INPA 1Z89A 1FWSA 1VS1A 3VGDA 1TWZA 2FFCA 2OX4A 3POHA 4M6PA 5FEXA 4O53A 4L5ZA 2QPSA 4AHOA 4TTUA 3VCRA 1W5MA 3PFRA 4J35A 3ABOA 2C71A 3L5MA 4NVTA 4BR1A 1FA2A 3GC5A 1W6TA 3THAA 1S5VA 1F2JA 4YWIA 1GYNA 2DGAA 1P6CA 4B5XA 2EJAA 5B7YA 3R89A 3QY8A 3CHCA 2GUBA 2ODOA 2BS9A 1Z32X 1OK6A 4C6QA 4JTKA 4NX0A 2R1NA 3H54A 4PUUA 5D02A 1CX9A 1FWFC 1ML1A 1P7TA 1HN1A 1EDGA 2Z28A 2OSWA 1QXLA 1R2SA 3BJTA 4U5IA 2NQLA 3AALA 2YDSA 1BWKA 1NOUA 2XHYA 3IV3A 3MDWA 1TMQA 2A3LA 3MP5A 3NFUA 1ODZA 4P2VA 2PDCA 1TFVA 4M6VA 1WBJA 4DBSA 1KBKA 4KQNA 3IWPA 6XIMA 3DFTA 3DESA 1AJZA 1CGTA 1SVDA 4GIEA 5M1TA 3MV01 3WLPA 2HE5A 3WH6A 2QVNA 1VLIA 3NPWA 5JBFA 3WQWA 1EP3A 4AIOA 1A3HA 1SGJA 1OM0A 3OBAA 4H2CA 3WN6A 1E4MM 3I7RA 2B31A 3WNNA 3DERA 5AHMA 4QG9A 1TVPA 3AROA 3AI0A 1V7AA 6CGTA 4IWWA 4WLCA 2YA1A 1P0DA 4XTIA 3ARVA 4ACYA 2X1UA 3GU9A 3PZMA 5HWJA 1SZFA 2OGJA 2DZAA 2VGFA 2WKLA 1SO3A 3MSDA 2FQIA 4UR7A 4NAFB 5FAJA 1H5VA 3TEVA 3AMKA 2QMJA 5FACA 1Z48A 4X22A 3A3HA 2VEGA 1VFUA 2PF8A 5HA7A 1EXBA 2I1OA 1OB0A 5FKYA 2Y1HA 4LVAA 5I3JA 3QHOA 4GNJA 2A7PA 1L2QA 1U2YA 1ONWA 1XV8A 3WQ8A 1FWAC 4LNCA 4NASA 2ZZ5A 1FHLA 4HYVA 3DHDA 2PP3A 3VXGA 3LERA 3LMZA 1OFBA 2YZ5A 3H2CA 3SFWA 1LT8A 2E6DA 1O1HA 2RKXA 4FA3A 3WDHA 4JD4A 3B0UX 2FPYA 1Z69A 2DSWA 1KR0A 1XM3A 3TMQA 5JIPA 3C2RA 1RQEA 4AU0A 1Q6CA 2GVJA 2GGJA 4KMQA 5CGQA 3K4WA 4MKNA 1NM9A 1M53A 2UY4A 4CCZA 4NZJA 1TMHA 3RHGA 1XDMA 3GXTA 4Z0SA 3NQ8A 3EDFA 1CGVA 5FF4A 4IHCA 3T8QA 3LCWA 3TC7A 2WMGA 1JCMP 2REQB 3UCDA 4V33A 2PLCA 3AHYA 1EC7A 4DWSD 1C9WA 4JTAA 4K38A 3RRXA 2AGKA 2YW4A 4GYPC 4O50A 3NQ2A 4S2CA 1MFVA 3A13A 4UTKA 1O7AA 2C7FA 1VD6A 2WC3A 3CV7A 2GJRA 4JQ4A 1MXGA 1F73A 4QAWA 1UKOA 2GSHA 2DDXA 6XIAA 4C1NA 4MGGA 3GFYA 2PDBA 4D71A 2I5QA 2POTA 4DF0A 5H1WA 1POJA 3PTQA 1CCWB 1T5AA 4NZ3A 2DH3A 3EWZA 4O8AA 4AXKA 2XIOA 4AMAA 1RQHA 1H0IA 2A7NA 1S2VA 3RX4A 2O4QA 4PR4A 2PMQA 3W84A 4FX8A 2VC9A 2YCLB 4Q8NA 1NEYA 4GUHA 1N82A 3QV7A 2VZVA 2Y89A 4ZQRA 2NX1A 4L65A 2YBVA 4YMZA 2ZUTA 4I3GA 1HJWA 2P0IA 4V28A 1CIUA 6ENLA 2XIMA 1QK2A 3LX9A 1H41A 4GXMA 2XU2A 3U8GA 3N11A 1O12A 3CAKA 3TWAA 4AIUA 3FA5A 3CPUA 1SR9A 3QTPA 1X6UA 3VKKA 5DCEA 2OCZA 1V0LA 2WSQA 3E2VA 1EC8A 1QOQA 1A5OC 1H51A 3ATYA 1RZMA 3BSMA 1J10A 1TKKA 4RX0A 2WANA 3WDRA 3I10A 3P84A 1BXCA 1GKPA 2I57A 2V30A 1WDQA 2E28A 2E5DA 2W91A 1P1MA 4GFSA 3M0LA 2C15A 5JH1A 3NJ3A 1XH0A 2ZX8A 2JALA 1HO1A 4MHBA 3FJLA 4MUZA 3A5FA 4DEFA 3OLIA 3W83A 3A3XA 1Y5WA 2PDUA 3TE9A 2VDHA 4Q8VA 1OC7A 5DMLA 4DO5A 3G5EA 3IEBA 3UG8A 3AJXA 1V5XA 2QJMA 3LBCA 3QR0A 4EANA 3WLOA 4HYWA 2XPKA 4RNIA 3WG6A 3V1PA 3ICJA 4UTTC 4J4KA 1F05A 3RM8A 2WMKA 1UIPA 3OJGA 3UXDA 3AYVA 7REQA 1DWGM 2WBGA 3BL3A 1E3XA 1ZZMA 1YDNA 3IGHX 2VWTA 4GQQA 4S38A 2VCBA 4DYEA 1CI1A 3TW9A 3N4EA 3TTYA 1R9YA 1Q5MA 4KFNA 3B8SA 1K6WA 5BNKA 4H6KA 3BLKA 1Z9AA 3WD3A 1B3OA 3CUJA 3W7OA 1W9PA 1KFBA 1U5VA 3GYEA 1KTCA 3AS0A 4HU8A 1UJPA 5E9AA 1E15A 1ZJIA 2XDFA 3WLQA 3NPVA 1E6NA 3SSJA 3M5VA 1UR0A 4FNTA 3SRDA 5FJUA 3SGGA 2JF7A 1YNYA 5BROA 1C8YA 1T40A 3NDZA 4GK8A 5FL0A 3W76A 3QW4B 4LUYA 4OOZA 3CV1A 1OYCA 1JPHA 3HG3A 4DWSB 2VZUA 4J3SA 1SW3A 4DAFA 5DLCA 4GIRA 2C16A 3WLHA 3LUTA 2DJLA 3LTPA 5C7HA 2HZGA 1PWMA 1BYCA 5GJMA 4I9TA 1LWIA 2CC0A 5EMLA 4CQDA 3MT1A 3ZT7A 4UXDA 2E77A 4QLLA 3NL5A 5B7ZA 4AC1X 4IIHA 2GWNA 1KWKA 2PRHA 1P48A 3MO7A 3TJ4A 4A4AA 3BTNA 3PAOA 3W28A 1LROA 3VKBA 3CUGA 5ABGA 1V6VA 1VFTA 4GYJA 3L0KA 1NF7A 3KTXA 1Q4WA 1RH9A 2ZDSA 4AVNA 3P8JA 2BSLA 1QPRA 1E70M 3KZSA 2D0FA 1RLDA 1SMDA 4BQ3A 1ZNNA 2INZA 3N9RA 1N2VA 5CC6A 1FRBA 1LF1A 2R91A 2HMCA 3NEHA 2B7NA 5LA2A 2CZEA 1PTAA 4H8VA 4C6PA 3ITOA 3BOLA 1OD0A 2WBKA 1N7KA 3GIQA 3L5LA 5LIYX 4ZODA 1ADOA 1GVIA 4B5VA 4D6DA 3PBYA 1ZBCA 2NVDA 1E71M 1A0DA 3KRUA 3W6MA 1FCQA 4L4PA 4M51A 5REQB 1TUXA 1JYVA 2A85A 4MWAA 4XUYA 4XBJA 4WRHA 2VELA 1OFQA 3IK4A 5IHSA 3OHIA 4FX7A 4PMXA 2BGQA 2VQTA 3WQDA 3V36A 4V15A 4FP1A 2OU4A 3KP0A 3UA3A 5BOOA 2GL5A 3RLUA 5DRCA 4JCMA 4JOMA 3L66A 4IGSA 4DJFD 3LI0A 1EGMA 4GCAA 1DEDA 2OQLA 4JN6A 3RPDA 4HB7A 3D3AA 4Q4OA 3W1MA 3ES8A 3MKVA 3DFHA 2R1KA 1YTEA 1GUVA 2ISSA 4HMNA 1B30A 3LCXA 3C8NA 2HROA 2VCAA 4B5TA 4D6GA 4HCDA 1IWAA 4LT9A 1ZAHA 1U22A 1CGWA 3IS4A 4X9SA 6REQA 1GWJA 3ARTA 3LS9A 3AISA 4S3KA 4LWWA 3FA3A 3RILA 3TN6A 1TVLA 2BOGX 2X42A 4V27A 2GLKA 3P80A 3GVRA 4GXPA 4MJ4A 1XRSA 3SFKA 4GVHA 3VGBA 4GD0A 1OGBA 3LI1A 3SCWA 4RXGA 4UTUA 2X2YA 5KEZA 2H9AB 3HJEA 3QV9A 3NOYA 4D8LA 1KCLA 4G1KA 4IIBA 4I7VA 4NNBA 3DH7A 2Z6IA 3GVWA 4UTWC 3Q58A 1OBAA 1O1ZA 1Q6OA 3L5AA 1KV5A 2A6LA 3QV6A 4LCSA 7A3HA 2OR2A 3MTWA 1JF5A 3A23A 3CUXA 3JZUA 4FR6A 5HATA 5CZJA 3AWNA 1W1ZA 2QUNA 4TO8A 3MVTA 1ESWA 2XJ7A 5I0DA 1G69A 4LV9A 4DO7A 2PP0A 4ATWA 2KZHA 3K8MA 2W27A 3EEGA 2QHAA 2H6RA 1YX1A 1GONA 1AUSL 3W1PA 3G77A 3P6LA 4IF2A 4WUIA 2DORA 4M0XA 2FYMA 2XVGA 1QNPA 3G6MA 3WQVA 4C6DA 3QMRA 3NVDA 3ZO9A 5DT7A 4KERA 3O7UA 2CITA 3KRZA 3H7VA 3WDIA 3T55A 2Y70A 1EJ7L 2QT3A 1XKYA 3VMOA 1O60A 3BAIA 3EWYA 4UQDA 2JKEA 4NJGA 3GIPA 1ZENA 3E12A 1XLDA 2H3DA 1GPWA 1MFUA 2CXEA 1XBYA 5CBIA 4J3TA 3FA4A 3T44A 5FF3A 4EAMA 3LZ5A 2D23A 2J9YA 7ENLA 4XO7A 5FL1A 4GINA 2Y62A 4EOUA 3SBFA 5IFPA 4BWLA 4U4MA 2DZTA 1LYXA 1P6BA 3ANYA 3BDKA 5F2GA 3JU2A 4JBRA 5H91A 4KEUA 4XIAA 3ITGA 2J47A 4R7OA 3PB2A 1MUWA 3JS3A 2Z2UA 4LF1A 3CNYA 4W9TA 5ECVA 3N4FA 1TE6A 1NQ6A 3V16A 2JKAA 1SYTA 2CLEA 4ZFCA 3HMJG 1DXFA 2I5IA 1LL6A 1WKYA 3KOFA 1FVPA 3T2OA 2WQDA 3WLSA 1PZ0A 3FDGA 5CPQA 2WVTA 2A1YA 2EF9A 4IX2A 3RF9A 2X1IA 5E0KA 2CLIA 1JUKA 5J8LA 3BLIA 1IXNA 4EWJA 2W5FA 1ONEA 1CDGA 5F1VA 3SJ3A 1VFSA 5A8PA 3J7HA 4XBSA 1BHGA 1UROA 4HPXA 3T0CA 5G5IA 3CQIA 1Q63A 2YL9A 3VOCA 4JX4A 1VZWA 1GW9A 3W87A 2V5CA 1J18A 2X09A 2YFOA 4UOZA 4G2DA 5CZSA 1D9EA 3EPNA 2NXGA 4AWUA 3QC3A 1B3YA 1DIEA 1DJHA 4CCEA 2JKPA 2Z25A 1IT8A 1CENA 3V5FA 4WJEA 3HURA 4AD0A 4US5D 2IKIA 2IW0A 2QV4A 4YHEA 4JKLA 1QI2A 1VPQA 1ZPTA 4DO6A 4P8XA 3CZJA 1KLZA 3WEZA 2WZTA 1UR1A 1IEQA 1W54A 2OZTA 3W27A 4B4FA 4ZB0A 5EMKA 2Q8ZA 3CWHA 3U7VA 4BQ5A 1HGYA 3PBUA 1GOOA 3ZWSA 1ZJAA 2FB2A 4J9JA 2ZUVA 5T26A 5K9XA 4LYPA 2DW7A 1EHNA 1TCDA 2FGZA 2CU0A 3L0GA 4ZOAA 1AQHA 1T7LA 2EPHA 3N12A 3LBMA 1DKWA 4IPJA 3B9DA 1NF0A 2J7GA 3R0KA 4L9YA 3R5EA 3TIMA 1AMYA 3KS5A 5LIXX 4NT0A 3PBMA 3L12A 4JDBA 1GJWA 1R38A 3NO5A 3EWXA 2EPMX 4KCVA 4AX6A 1F07A 3HGRA 3W2UA 1OCQA 4DX3A 3DAQA 4TVUA 1S2TA 2WMHA 3TSDA 3VD4A 1PKLA 3WFAA 1VYPX 3B8IA 1U30A 1ZU8A 1M5WA 2Z7GA 4QRNA 3CB8A 4WR3A 3IVSA 3I4EA 3A4JA 4HK5A 5FA5A 3B8TA 1VENA 4W85A 2GPTA 1ME7A 1XIJA 1W2VA 2FFIA 4EAYA 5M3WA 4E8CA 5C54A 3IJ7A 5C9ZA 3S1UA 4IX0A 2FH6A 3R8HA 3NQGA 4D8AA 5HR7A 5AYZA 2QAPA 3QHMA 1GQIA 4RNFA 5FCZA 3NL2A 6A3HA 3RITA 1OC6A 3H55A 1OIMA 4M1BA 1RR2A 3SCVA 4ICMA 2VOTA 4IIFA 4HU3A 2D1ZA 4K68A 3UXAA 4WDWA 2PU1A 5AHEA 5G2WA 1R47A 1TG7A 3CAQA 3DFNA 3VNLA 3PANA 3DHPA 1EJWC 3GY1A 1FDJA 2C8NA 4RZ6A 3VC6A 3UT0A 1FWWA 3AXHA 3H24A 4LUSA 4I8YA 3NUKA 4ZQCA 1JYNA 3PJUA 1ZBKA 2BY3A 3P62A 1ZBWA 3NGJA 2V82A 3IUHA 4ROPA 4A3HA 4RK8A 3ZVHB 2IXVA 2QDHA 1XYCA 3DZ1A 3B3DA 1PJ9A 3BUVA 3FAXA 1UKTA 1FWEC 3RR1A 1VCVA 4NAEB 2UY5A 2OQHA 3GAYA 2VXNA 3TZFA 4HD5A 2QJIA 3LCGA 1M1BA 3RYSA 1O5KA 1G4TA 4LB3A 4BI6A 1U33A 3BGGA 3U57A 1Q13A 2EO7A 5A8QA 2PDYA 3EKLA 4LNYA 3QGVA 1IZCA 3G0XA 3SUTA 5BXPA 3CV2A 4NAFA 1UWSA 1JYXA 3HPSA 4ALDA 3ZWTA 4WSJA 2VEFA 4W89A 3VMNA 2H3BA 2XZ9A 3CHVA 1M68A 1DQXA 3SAZA 1VPYA 3BAKA 3BWWA 4B16A 4MUPA 4RKAA 1YNPA 2PWUA 2ZIDA 2ON3A 2RDXA 2P88A 5HWNA 3LD5A 3TCEA 3PSVA 4MJ2A 1VJZA 4HQVA 1E73M 2AQVA 2QZRA 1JULA 5CKSA 1KXQA 1F9CA 3CQ0A 3KX6A 3OVRA 3MMUA 4PH6A 1JQVA 3P5YA 2WVVA 4K39A 3W37A 3WQEA 1RLCL 4QS5A 4PB4A 4NF7A 3W7MA 3W86A 1R7AA 2GSEA 1QR7A 1GZJA 1QPNA 3RJYA 3GNNA 4B9YA 4LY4A 2OVLA 3I7SA 5ABFB 2DZXA 2MUCA 2RUSA 3C2VA 2B7QA 3AO0A 3ARRA 1KBLA 3WJXA 3E02A 3DFSA 4K7VA 3DG6A 3VTRA 5DMMA 4X9YA 1BTMA 5FJRA 1X97A 5F7UA 1FWDC 5LA0A 2IQ0A 1H50A 1QPQA 4IQJA 3EWUA 4UQCA 4ROQA 3W1QA 5MHBA 3HPZA 1QTWA 3T1GA 2VFHA 4LUIA 1UH3A 3C86A 3WF1A 4HOWA 3W02A 3F4NA 2REQA 5IXEA 2VZSA 3WMLA 4AMCA 5IOBA 2FTWA 3BG9A 5DBTA 3GE7A 3QEZA 3W01A 2VMFA 4AF0B 2PC8A 3TXVA 3OQ8A 1GOWA 2BVWA 4CD6A 2VHLA 1AK5A 2DH2A 1K02A 2NVCA 1UOKA 3S5YA 4ZO7A 1B9BA 3PS7A 1JD7A 1W8GA 2DVXA 4PMNA 1A0EA 3A21A 3NAVA 4IUGA 3C3UA 1IWPA 3LRMA 3ZT5A 4AZCB 4OHQA 5HJXA 2FIQA 4D2JA 2Q8XA 4MWAE 1C7TA 3KOYA 1WXJA 4FXSA 3N2XA 4DZHA 1B0IA 2QVHA 2BBFA 4QE5A 1NVMA 3VNZA 5CAHA 2VX6A 2MANA 4E2OA 2A0NA 1Y7VA 2J7CA 4DXXA 4NL1A 5BOFA 4GYPA 4WJ8A 1XUZA 3CAWA 2F7FA 4IJBA 3FJ6A 4AXNA 2Z1VA 5D8ZA 3C0QA 3LRLA 1KM4A 4W7VA 5HXMA 2F61A 2XH0A 3N2TA 5MKGB