2FTWA

Crystal structure of dihydropyrimidinase from dictyostelium discoideum
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
484
structure length
483
Chain Sequence
TGTILIKNGTVVNDDRYFKSDVLVENGIIKEISKNIEPKEGIKVVDATDKLLLPGGIDTHTHFQLPFMGTVSVDDFDIGTQAAVAGGTTFIIDFVIPTRGQSLLEAYDQWKKWADEKVNCDYSLHVAITWWSEQVSREMEILVKERGVNSFCFMAYKNSFMVTDQEMYHIFKRCKELGAIAQVHAENGDMVFEGQKKMLEMGITGPEGHELSRPEALEAEATNRAIVIADSVCTPVYIVHVQSIGAADVICKHRKEGVRVYGEPIAAGLGVDGSHMWNHDWRHAAAFVMGPPIRPDPRTKGVLMDYLARGDLDCVGTDNCTFCADQKAMGKDDFTKIPNGVNGVEDRMSIVWENGVNTGKLTWCQFVRATSSERARIFNIYPRKGRIDVGCDGDIVIWDPNQSKTISKDTHHHAVDFNIFEGIKVTGIAVTTIVAGNIVWSDNKLSCVKGSGRFVPRPPFGPVFDGIEQRDKVRNELLRKVDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structures of Dihydropyrimidinases Reaffirm the Close Relationship between Cyclic Amidohydrolases and Explain Their Substrate Specificity.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Hydrolase
molecule keywords dihydropyrimidine amidohydrolase
total genus 182
structure length 483
sequence length 484
ec nomenclature ec 3.5.2.2: Dihydropyrimidinase.
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2ftwA01
1FKWA 4WGXA 2RAGA 4C6IA 4IGMA 4LCSA 1V77A 2PGRA 2F6KA 4QROA 1POKA 2Z29A 2OGJA 4M51A 3GIQA 3MVTA 4C6FA 3NQBA 3F4CA 3FEQA 1S3TC 3ISIX 1BF6A 2R1MA 1EJSC 1VFLA 1EJUC 5HMDA 3OOQA 1FWHC 4I6VA 3UR2A 1M7JA 1O5RA 2GWNA 3LS9A 1GKRA 2OQLA 3B0XA 3MDUA 2VC7A 4G7EA 4C6CA 4B3ZA 4WVXA 1KRAC 2VC5A 2YB1A 3E74A 4CNTA 2Z26A 1YBQB 4PBEA 3A3WA 3E0LA 2FFIA 3GTIA 3OQEA 2ZC1A 1PB0A 4GYFA 4V1XA 4XAGA 4XAYA 1I0BA 2VUNA 4DZHA 1A5KC 1FWJC 2QVNA 5FSEC 2YXOA 1EZ2A 4LFYA 4GY0A 1RA5A 4DZIA 1RJQA 1ONXA 4QRNA 4KESA 2QPXA 5A6TC 1RAKA 3F4DA 3K2GA 3OVGA 4H9XA 4P5UA 1J6PA 4NP7A 3MPGA 2BB0A 4H9ZA 4AQLA 3O0FA 2OB3A 3CAKA 3T1GA 4HK6A 3RN6A 3URAA 4LAKA 4C6JA 1V51A 4C6MA 3K5XA 4C6QA 3MSRA 1A5OC 3UPMA 3AUOA 1EJVC 4R85A 4UBPC 3IARA 4H00A 2D2JA 4LH8A 4C65A 1RJRA 4BKNA 4DLFA 1UBPC 5G4HC 4RE0A 4DLMA 3CS2A 4CQCA 4C6KA 4IF2A 4D8LA 3LSCA 2QS8A 4KETA 4IFOA 1V79A 1GKPA 2YB4A 4JOMA 1UMLA 5LXXA 4PCPA 3DCPA 3EWDA 1W1IE 2VR2A 3LSBA 4NI8A 4H9VA 4KF1A 3LNPA 3MKVA 2Z27A 2WM1A 4PCNA 3QY7A 3GRIA 4RDVA 2DVXA 4EPBC 3AU6A 4KERA 3QGKC 3HPAA 1J79A 4G2DA 2DVUA 1PO9A 3QY8A 1HZYA 4XAFA 1I0DA 4INFA 3BE7A 1NDYA 4CQBA 3OODA 2OOFA 1V7AA 5CH9A 2WJEA 1UIOA 2O4QA 4C5ZA 4NG3A 1FWDC 2O4MA 4G7EB 1RK6A 1A5MC 3RYSA 4WHBA 1K1DA 4LAMA 3RHGA 1XRTA 3HM7A 4F0LA 4DI8A 4HA0A 1O12A 1ZZMA 2AQOA 3URNA 5HMEA 4R7WA 1KRBC 2BGNE 1NDVA 1XGEA 4GY7A 2FVKA 3R0DA 4L6DA 4C6DA 3E0FA 2Y1HA 1YRRA 3WZ0E 3IV8A 3AU2A 3S2NA 4CNSA 2A3LA 3IACA 2HBVA 4LALA 2E25A 3B0YA 4V1YA 1ONWA 4DYKA 4GX8A 4LCRA 1PTAA 3LGDA 1EJRC 2R1LA 4XD4A 4BY3A 3E2VA 1FKXA 3GU2A 4CEXC 2Z2BA 4ZSTA 4F0RA 4J35A 4PE8A 3V7PA 3F2CA 1J5SA 4C6EA 4ICMA 3LY0A 3PBMA 3LA4A 1UIPA 2D2HA 4QS6A 4TQTA 3WYZA 1K6WA 1KCXA 3TN3A 3QY6A 3S2MA 4IH3A 3T8LA 4LCQA 4C6PA 4GY1A 2AMXA 1ITUA 1NFGA 3FDKA 3PNZA 1E9YB 4CQDA 4RZBA 3GIPA 1E9ZB 3C86A 3MJMA 2ADAA 2HQAA 4C5YA 3GTFA 2D2GA 4HK5A 4C6NA 3ITCA 1PSCA 4CNUA 2FVMA 1RJPA 4IFRA 3F2DA 1RA0A 2GZXA 4DIAA 4ERGA 3ICJA 4H9YA 4I6KA 2P50A 2G3FA 2VHLA 3PANA 1WXZA 1FWGC 3MDWA 1YIXA 2PAJA 1ITQA 4C6BA 4LAOA 5AKQA 4IG2B 1QXLA 1JGMA 1FWCC 1P1MA 3DUGA 4BJHA 3MVIA 2HNHA 3IRSA 2PLMA 3MTWA 3IGHX 2WJDA 2GOKA 4EP8C 4RDWA 3RCMA 4GK8A 2QT3A 2Z25A 1YNYA 3E3HA 3LGGA 1R9ZA 1XRFA 2R1NA 4DO7A 1M65A 2UBPC 4EPDC 3OU8A 2HBXA 3EWCA 1M68A 3GTXA 4DI9A 3PNUA 5E5CA 3CJPA 1RK5A 3UR5A 2HPMA 3KM8A 3GU9A 1GKQA 4H9MA 3A4JA 4QS5A 2I9UA 3S2JA 3B40A 4GZ7A 3QGAC 3PAOA 4J5NA 4XD6A 4EPKA 1FWEC 3S4TA 1EF2A 2I5GA 4KEVA 4GX9A 2EG7A 4AC7C 4XAZA 3EGJA 3N2CA 1IE7C 3URBA 4ERIA 1J6OA 3O7UA 2P53A 3T81A 3SO7A 3LU2A 1EJTC 2PUZA 3GUWA 1QW7A 3WMLA 2IMRA 4ERAA 3GU1A 4C6OA 1A5NC 1NDZA 4IFKA 3UBPC 2DVTA 2HPIA 3D6NA 3ORWA 4B92A 4L9XA 2Z2AA 3S2LA 4QTGA 1YMYA 4RDYA 4XD3A 1ADDA 3FDGA 1P6CA 2EG8A 2Q09A 3IPWA 5HMFA 1FWIC 4GBDA 4C6LA 1WXYA 1R9XA 2Q01A 4XD5A 3URQA 1XWYA 4GC3A 1EJXC 3UF9A 2PGFA 4Z42C 4QSFA 2VM8A 4B90A 2WJFA 3K4WA 1YBQA 1A5LC 4H9UA 2Z4GA 3NURA 2YZ5A 1A4MA 4KEUA 3HTWA 4GOAA 1EYWA 2EG6A 1EJWC 2Z28A 4OFCA 2CZVA 4B91A 1A4LA 3TNBA 1V4YA 4UB9A 2FTWA 1R9YA 2AQVA 2FTYA 2GWGA 4H01A 4IG2A 4GXWA 4DNMA 4KIRA 2R1KA 2W9MA 2UZ9A 1FWAC 3ID7A 3A3XA 1P6BA 1FWBC 1POJA 4ZSUA 4KQNA 3SFWA 4CEUC 4RDZA 2ANUA 3TN5A 4KEZA 2Z24A 4IFKB 4E3TA 4F0SA 4PBFA 3TN4A 3GTHA 5FSDC 4LEFA 2ICSA 3GG7A 3E38A 1DPMA 3F2BA 1FWFC 2Z7GA 2KAUC 4IGNA 4EPEC 3TN6A 2XIOA 4R88A 4HJWA 3JZEA 3NEHA 4C60A 2GSEA 1NDWA 1KRMA 2OODA 2R1PA 2Z00A 3G77A 3DC8A 3OJGA 4H9TA 3IJ6A 4LANA 4HK7A 4J2MA 4IQJA 1K70A 1KRCC 4MUPA 2E1WA 4YIWA
chains in the Genus database with same CATH superfamily
3ONBA 1ZUAX 3T07A 3MJYA 4PEKA 1W5OA 2NXGA 1BYAA 2FZNA 4RLIA 2UY2A 4JTQA 2WHMA 3PR2A 4G8TA 3VIPA 4YVXA 1UH4A 5MKGB 3V0TA 1V5XA 3NIYA 1M3UA 4AVOA 4LU0A 2E6YA 2PDLA 4MZYA 1KXVA 2PP0A 1GUVA 4C90A 4O0QA 3VDCA 4XVDA 1SJCA 4B3ZA 4N9CA 2BOGX 5D32A 3OLEA 4DJDA 3CLMA 2PWGA 1O1HA 2E28A 3SGGA 3P93A 3H7VA 4XAYA 1VFHA 4A29A 4L1XA 1QASA 1VFMA 4MJMA 4LY4A 4S3AA 2QPXA 2VDGA 4Z17A 1DORA 3KL0A 2YYUA 4TX9A 1OFAA 5I23A 3TYEA 4RCXA 1X38A 5CAHA 1YNQA 2Z2UA 4WK9A 5E0FA 3QPZA 4N0RA 4CQAA 4TTUA 1VS1A 1I1WA 1QNPA 4DHGA 1JPKA 1XCFA 2E8YA 3BLPX 4S3CA 2YA0A 4E4PA 1OIMA 3OHIA 4DNHA 3FJNA 2VL4A 4QDPA 1TTPA 5D9PA 2PDBA 2ZIDA 1OC5A 3LBMA 4NX0A 5F1VA 1BYDA 1RHCA 1I0DA 4MSSA 3CV2A 4WEVX 2DIJA 4IISA 3ME3A 4LUSB 1V3JA 3N6HA 1EWEA 1P5BA 4MYXA 1CGUA 5C9RA 3C2VA 3C2OA 2R8WA 2H90A 2FLIA 3QN3A 2FVKA 3TIMA 5AC5A 3LCFA 5A6AA 4GJIA 2WKLA 4NQ1A 3P82A 2BWGA 2NVAA 3IACA 5KMYA 1UKPA 4V1YA 1H7XA 3VZYA 4W89A 3KWXA 2PDPA 3SEPA 1QNOA 1XFCA 4QLLA 1ZLPA 1K3UA 6REQA 2PWFA 4JKLA 4K3ZA 1QRQA 3LY0A 2WMFA 5XINA 2G3JA 1XIJA 2DW7A 1OG0A 4C1NA 3PJXA 3DOPA 1BGAA 1ZNNA 1I8JA 4GA8A 5FJTA 4NNBA 1ITUA 4U10A 4D1JA 3PG9A 4C1LA 3T55A 3OIHA 4XUGA 2WSRA 4MG4A 3SECA 5BNKA 3GG8A 4OU1A 4K1WA 3OLGA 1OCJA 3NSNA 3E96A 2FJKA 1K9EA 3R13A 2A1YA 1Q2SA 4HKPA 2DY3A 2VZOA 4A6GA 4DVOA 1HGWA 1T99A 4L4OA 3HQPA 1V02E 4S39A 2QCLA 4G7FA 3W1XA 4Q32A 1CX9A 1IHIA 2NWSA 5K9CA 2C0AA 3MTWA 3FEMA 1QW9A 3FXYA 4ZXOA 2WBKA 2XINA 3RCMA 1GQNA 2VEMA 1M5WA 4WIWA 3BG5A 3ZR5A 1YNYA 3A5VA 4EVZA 2WOQA 3KBWA 2X30A 1Q6GA 1SPQA 4AG0A 3W7RA 3H53A 3I6EA 4NI3A 3SCNA 5HWMA 3ZR6A 3CV6A 4DUVA 4HHPA 1DTUA 4ACZB 1Q8AA 2NSXA 2ZUTA 5K4XA 1JYVA 1GK8A 3K4DA 3F4VA 3T2QA 1PEZA 4PEEA 3NOYA 4UNKA 1XBZA 3A6OA 3B8WA 3WKZA 5I2UA 1B57A 3NR0A 3LOTA 1J93A 3DFNA 3WQOA 2BFGA 1IF2A 1EP2A 3CAWA 4H8NA 2V5DA 3P74A 4L7ZA 5I02A 4BZYA 4E8GA 3BW2A 4ENLA 5FKYA 2Z1SA 3N2TA 2XVKA 3JRKA 1IEWA 4CNOA 2YL9A 1XKJA 3SURA 3NZ1A 4CD4A 3PBUA 1GOOA 1EEPA 2O9TA 4FF5A 3NA8A 5LKYA 2ALDA 3NZQA 1TJ2A 4JEQA 1EIBA 2C1IA 4YTRA 5HA7A 2C1GA 1JZ5A 4GIRA 4JTEA 4L61A 3RAOA 1D7KA 4L4PA 3TC6A 2BDQA 5AYZA 1GYNA 4KEUA 1V0LA 5IHSA 5IFTA 4F2BA 3GYCA 4GE8A 3KBMA 5EMUA 2ZUNA 2KZHA 1R47A 2Y7GA 3GXDA 2VYOA 3R5EA 3W07A 3NL3A 5CPSA 3KDOA 1UWIA 3EMQA 3AMLA 1E9IA 1TPB1 3FHQA 1YW1A 3BK0A 1D2KA 3BGAA 3GXTA 3ZJ7A 1PZ3A 2HISA 3TMLA 4PBFA 2G4FA 2DZBA 4UR7A 3F2BA 1OT1A 3IANA 4IP4A 1B1YA 2NSOA 2IXVA 4HJWA 2OU4A 4GC4A 4UNIA 4C60A 2QCNA 3VGBA 2J27A 3WQCA 3UR8A 3UXIA 4AEEA 4K38A 4AZ6A 2V81A 4OUIA 4ALDA 4JNZA 2ATMA 4NZFA 2J77A 1RCQA 2GJNA 4PSRA 4ORIA 5ABFA 4C6FA 3B06A 2WC3A 5A6LA 2YGYA 4N42A 3CZLA 3PFRA 1RBLA 3OG3A 4DWSD 1JZ2A 3QXBA 3BUVA 5F2MA 4XISA 4CN1A 5CZKA 3E1F1 1XLDA 2OQLA 3NDZA 3MDUA 5HUPA 3PBWA 3YPIA 4B5NA 3AS1A 3VYLA 3OA5A 1REQB 1YBQB 1YTKA 3AIEA 3BSMA 3OZMA 1XLAA 4MFDA 1YXDA 1NOFA 4LFYA 1GVRA 4KCWA 2X1RA 3CQKA 3EMZA 3T78A 5BRPA 1E51A 4O11A 1OYAA 3O06A 3S6TA 1TUXA 4Z2KA 2R6OA 5BOOA 3VC5A 4S23A 5AHIA 2Z1BA 4WXYA 4ATWA 3R43A 5BXSA 1ONRA 4OGZA 4C6JA 1OGSA 3H54A 3MSRA 1VC4A 2BOEX 3MS8A 5E9AA 2YFNA 3P0XA 3OBAA 3BV7A 4UBPC 3BAXA 5EBUA 2BXYA 2Y8KA 5FF3A 3A64A 1AFSA 2Q3OA 3S6OA 3M9YA 4RZ4A 3OYXA 2ZTJA 5BXPA 4JHOA 2V63A 3ELFA 1NOUA 5D9OA 3MKVA 5REQA 3S5NA 3MO4A 4DPPA 1XLJA 3GRIA 2FJUB 1OFQA 1JZ7A 4HNNA 1SO6A 2C0HA 1Z41A 1Z89A 4LW7A 2G41A 5EL1A 2HK1A 1FHUA 4H7ZA 3SSJA 1KM1A 2XIMA 3VX0A 2Z6IA 3UU0A 3ZT5A 1EBGA 1AMYA 3PZVA 4LUSA 1WZMA 2ZYFA 1EC7A 2ZVIA 1D8CA 3I6TA 3L4ZA 1PWLA 1XGEA 1TTQA 1EGZA 2XUCA 4QM1A 1RBAA 1KFWA 1DE5A 1X1OA 4JFVA 4O57A 1RPKA 2AQWA 2DDXA 4CU8A 4HYVA 2XTKA 3NM3A 3P2VA 4US6A 2A21A 1W37A 4O13A 4GPNA 1O1ZA 1UZDA 3N6QA 2NZLA 5H91A 3NYZA 1QI2A 1ICQA 2A4AA 1QBAA 1H7RA 2VELA 3TCEA 4GABA 1N8IA 2E9LA 4TXEA 2P88A 4CKQA 3EEGA 2AMXA 3FDKA 2DH3A 2A2IA 4E6MA 4UZSA 2ZZ6A 1MQPA 3PF3A 1KQYA 4GUGA 1AVAA 1PSCA 1FWTA 3RX3A 1OCBA 3GH4A 5C0QA 5GNYA 4PCTA 4F2UA 1D3CA 2P50A 1ZBCA 4HB7A 3O8AA 2XFFA 1U33A 2W62A 1MVYA 2J4GA 1K9DA 3EOLA 1QHOA 2DEPA 1UQYA 4HOWA 1QFEA 3DU0A 1NVMA 1AJZA 4UOZA 4X0NA 1G94A 5DRCA 1CGWA 1LL7A 3A24A 2PLMA 2P3ZA 2OWXA 2EGZA 4RDWA 4IX2A 4MLJA 2CNCA 3K46A 1JD7A 2DPEA 3O6YX 2ZE0A 2ZZ5A 5DN1A 2YLAA 1R2SA 4IX0A 1R3WA 4P7LA 3S47A 2CLHA 3O6CA 1L6YA 3PZTA 3V3WA 3H55A 1T8XA 2GJXA 4JKMA 1FCUA 1MW1A 3KL3A 5AC4A 2ZBTA 1QW8A 3KM8A 4NVTA 2FFCA 5E6YA 4HTBA 4LEQA 1H63A 4EPKA 3V4BA 1UH2A 5D03A 3SQSA 3W7IA 2PU0A 3AHXA 1RLDA 3JZUA 4IJRA 2EG7A 1OGBA 4JBRA 3SY5A 1E6SM 2PDHA 2IKGA 1RALA 4W5UA 3STPA 2J13A 3FK4A 1IGWA 4IPPA 4KFNA 5D9MA 4NJJA 1EJTC 4CLMA 3KTXA 4K8GA 3UBPC 4YNGA 2OT0A 1OQFA 5C5YA 3F5KA 3DYOA 3EXTA 4MGGA 2XZ9A 1T96A 2Q8XA 3P8JA 4DXXA 2WVUA 2YDAA 4S2CA 4AWSA 2J62A 1EJXC 2BHZA 4R34A 4GIAA 4YVVA 5I00A 1Q7MA 4MOZA 1UWUA 1OSEA 3UWVA 2DT0A 3KTSA 2DUXA 3C5QA 3BG3A 3PZQA 2JBMA 1EJWC 2C16A 2CZVA 2J7BA 2A7NA 1PKYA 2GJPA 1UC4A 2AGTA 1THFD 3SRKA 4PRRA 2G0WA 3M0HA 2ACRA 3GR8A 1W9VA 7A3HA 2C19A 4U2YA 1OD8A 4MMWA 2WXDM 5D9NA 4MWAC 4E38A 1WAUA 4F8XA 5CPMA 2QJJA 4Y9NA 1K7EA 3WK0A 4KEZA 1LLZA 4GQBA 2Z24A 3D47A 1PX3A 1QO5A 3Q2DA 3U57A 2ZX8A 3UWQA 3NSXA 8XIMA 4WX2A 2KAUC 1GW9A 2PEVA 4D9PA 1WKFA 1DBTA 3P61A 1JI2A 4Q7BA 1UC5A 3C61A 3AS3A 1T6MA 2E1WA 3B3DA 1YPXA 3F5JA 2BTMA 2J47A 1QHZA 4WY0B 2E9BA 3WK1A 3CZGA 1Q8JA 4WCJA 3WBXA 2PDMA 3J7HA 5TIMA 3DECA 3C3NA 3DAQA 1PIFA 3VDBA 4Q8QA 1YDVA 3TK7A 1EDTA 5IHRA 1GHRA 1HUVA 4AF0B 3ABQA 3A4WA 2RHGA 5FF4A 4NZJA 2BMBA 5A8OA 4MJZA 2AKZA 5EBAA 1KRAC 3MMUA 1Q6DA 1OWQA 3G2GA 2Z26A 1FHDA 3E0LA 3ZJKA 3IIXA 1JNEA 3UR7A 4LNCA 3KXQA 1KWKA 5FSEC 4QSHA 1XW8A 2WC4A 1UD5A 3VNJA 5C9UA 3PWGA 3IRDA 1UJQA 3TFCA 1B3OA 1J6PA 3HJZA 3M5XA 3HQOA 1W17A 3ZWSA 5LIYX 3QMRA 2C15A 1GORA 2C3ZA 2OQHA 2PDGA 1ZQ5A 3B05A 2F84A 4M80A 1F6PA 2DJXA 3W2KA 3W1PA 1B54A 2E6FA 4ZMGA 1RCXB 3T0AA 1GOIA 2OX4A 1LQ0A 1ZPTA 1LROA 2UV8G 4DLFA 1FWRA 1B2YA 4GMEA 4CVWA 3EPMA 1ADOA 1DIEA 1YYAA 1W3JA 1H7PA 4GNJA 1W9PA 1C3FA 3G1HA 1KCKA 1UKTA 1V93A 3DCPA 4O8RA 3SCPA 4KWWA 3DHFA 4U5IA 2HDJA 4DO5A 1O95A 5LIUX 4JICA 4MFEA 2DVXA 4TU1A 4J3SA 1YLVA 4XZMX 3IAPA 3MP5A 3WF1A 3LX9A 2HXTA 2XPKA 1LLWA 3VUSA 1WQ5A 2PSNA 2WSQA 3ITGA 3GC4A 4NG3A 2O4MA 1OT2A 3SJNA 2I56A 5BRBA 1R5YA 4TVDA 4WHBA 1OX5A 1WZLA 1YE4A 4O1FA 1XRTA 4Y90A 4UTLA 3SCSA 3W28A 4Z1BA 4R7WA 4S3KA 4D6EA 1UUMA 3O9NA 5B7ZA 2XVNA 4Q8VA 2EXOA 3CZEA 4NSBA 4IL2A 3GDBA 2X1SA 1AH4A 3TLQA 2HBVA 1P7TB 3ARXA 1TV7A 3TTEA 1FH9A 3JUGA 4PR4A 2ZDSA 2D20A 4JTCA 3LGDA 4F79A 3CHEA 4D71A 3D5HA 3Q65A 1FRBA 3G8EA 3KHDA 1QOPA 1BLIA 4C6EA 1X8CA 3PBMA 5I3KA 1OC6A 2YW4A 3WYZA 2D24A 3B8VA 1RLCL 3TU9A 4UTKA 4C6PA 3V75A 3BOXA 4H4IA 4RZBA 2VVNA 4N02A 4MAVA 2CETA 1OF8A 1VIZA 4HK5A 3LXCA 1ZP4A 1EGMA 3L4YA 2CEQA 3W76A 1XBXA 3CMGA 3GR7A 3ICJA 1AQ0A 2Y62A 5AVNA 4F2TA 3KBNA 3W7JA 3I4KA 3ZZ1A 1QXLA 3VCRA 1V03A 2X1UA 4JR5A 3CV1A 1P0NA 5EMLA 1V7YA 1BWVA 4U2ZA 2YBVA 5K9DA 1VQTA 3VE7A 2J8GA 3UWUA 3AJXA 3WLSA 1PHWA 1G7VA 3FLUA 3FKKA 2H8XA 3GO2A 3DC0A 1R9ZA 1FHVA 5J04A 1TIMA 3OEXA 3BDKA 4ATLA 2DFAA 1U83A 1ZTVA 2PI6A 3AALA 3OU8A 2W27A 2E3ZA 5HQEA 2V2DA 1S5WA 2HPMA 1JL8A 2WMIA 1OX4B 5A2AA 2QCEA 4A35A 1C9DA 1Q6LA 5I3GA 2XWDA 5LZLA 1JG9A 4L65A 1BVWA 5I24A 3N11A 3SR7A 1IZCA 4ZOCA 1VFFA 4YU1A 5EMMA 3M0KA 3G1DA 2W63A 4ERIA 4CCDA 4DJDD 3DBNA 3T44A 4OT7A 5CC7A 3OTRA 4HU8A 1NDZA 2BY0A 3GFXA 1WPCA 2QCDA 1LBLA 1KTBA 1LBMA 3WCZA 4DUXA 2NVDA 5A69A 2CLMA 5CQ1A 3MYOA 3R0UA 2Q09A 3U6WA 2WKJA 3VC6A 3D0CA 1XL9A 5JMUA 4UFKA 1A0DA 3URQA 1TKKA 2H8ZA 2BXVA 3ARYA 3NYDA 2FKPA 3QSRA 5EY5A 1O6IA 1PPIA 1KLYA 3SUUA 1EQPA 2ZWZA 1E4MM 1EF3A 3H4WA 1A4LA 3BICA 5A8NA 3TC7A 3TVAA 2Y85A 2FTYA 3M5YA 1B4KA 1XLKA 3C0LA 3W26A 2OEKA 1OHLA 3TTSA 1FP8A 1G0CA 5ABFB 3SFWA 4LBUA 5CZSA 4RZ6A 2V68A 4JQ2A 4KRZA 3BMVA 3LCLA 3F4NA 4MNLA 3GTHA 4F0KA 3G1XA 4U28A 3WQ6A 4CD7A 2ACUA 3H6OA 1DJWA 4D8AA 3NDOA 3CL6A 1MW2A 1W9XA 2ON3A 4YTSA 2A3EA 5AC6A 5I07A 1OY0A 3B8DA 3L21A 1QNSA 1Q6RA 5ECVA 3G0SA 1HJVA 3ITLA 4A05A 3W7PA 5XIAA 5DXYA 3HPSA 1Q63A 1VKFA 3V5FA 1FY6A 2HNEA 4IQDA 7ODCA 2HMCA 2QJIA 3SADA 1GEQA 7REQB 2OVLA 2L5HA 1GVSA 2WANA 5D33A 4K8EA 4UTJA 3NQBA 3F7JA 1LQAA 1QHPA 2BY3A 3LD5A 4J3ZA 3PJTA 1TO3A 1FWHC 1NF7A 1SM9A 1FH7A 1TA3A 2JQXA 4JL2A 2WPBA 1ZSXA 3ALFA 1C93A 3QLDA 4WVXA 3MMWA 3P3BA 1D3GA 4R3UA 3BAJA 2YB1A 1YE6A 4OBSA 1XLBA 5C2GA 3SGUA 4MJ2A 3MHFA 2PB1A 3H4XA 1DIKA 1FWJC 1XIEA 1HVXA 2V5KA 4GKTA 3QVQA 1R2RA 3JW7A 4IQLA 1TWIA 1F7BA 5C6MA 4JTTA 4B5VA 3SFKA 1B30A 5REQB 2EHHA 1H3GA 1K8XA 4NYYA 2ZX9A 4D6IA 3MPGA 3CXOA 4H9ZA 4JL1A 3KDNA 1QNQA 3WMCA 4UR8A 2C6QA 4UQDA 4YPJA 3MANA 2FGBA 1TPUA 3UG4A 5LIKX 1W5NA 3RN6A 3KRUA 1PXGA 3DFPA 4UMAA 1DJYA 2YZRA 2QULA 2FZ8A 1TV3A 2X1TA 1DQWA 1A3XA 3PZNA 3ZSSA 1DJQA 1VEPA 1P7TA 2H6RA 2QF7A 2YB4A 3U3HA 1NH6A 4ML9A 4D6HA 2YDSA 3EWDA 1JR1A 1MUMA 3LB0A 1WDRA 3TP4A 3SUSA 3CAQA 4GCAA 3E5PA 2J7GA 1TPVA 2HWGA 3DI1A 3UCDA 5J5RA 3LZ5A 4QNEA 2DZTA 4B5XA 3IGUA 2YBTA 3EOEA 3L67A 3OVRA 2GQ8A 1B9BA 1BG4A 2XM1A 1UWSA 3W74A 4G7EB 4QR6A 1TG7A 3BJTA 3GNRA 2W66A 1FBAA 4S3JA 2FGZA 5HMEA 4RL3A 2XSAA 3F4WA 4FR1A 2R14A 3KLKA 2Y1HA 2A6NA 3GWQA 4IMEA 2WLYA 3WLKX 4HU0A 1R7AA 3I3BA 2IQ0A 2EPLX 1IQ8A 4DUOA 3WNNA 2QLYA 5TF0A 2F2KA 4GX8A 3ANYA 4F40A 3KOZA 2G3MA 1X1ZA 4S2BA 4EAMA 4CEXC 3EAUA 4PRWA 2Y6ZA 3CIWA 4POCA 2Y5JA 3ABXA 3QMSA 3PZUA 2CPUA 4I5UA 5D2YA 2HSAA 3R10A 3UW6A 2XVGA 1H5YA 3PTMA 3MMDA 1ZAIA 2EPOA 3KRSA 4Q4SA 2JKPA 5H8MA 1WUFA 1CT5A 2VVSA 3L12A 1X7FA 2ZQ0A 3PNZA 5GNZA 1VRXA 4MDOA 2HQAA 3KOXA 1GWJA 5B80A 1XLLA 4B3LA 4U4MA 2P3EA 3KS6A 3UZXA 4FB7A 3U2OA 1RJPA 1T41A 1VHNA 4UQ9A 2ISFA 3H2OA 3QPEA 5A6SA 2O0TA 3L4TA 4FXRA 4D72A 3W00A 2C71A 5C8BB 5HNUA 2JKEA 3GKAA 4M7TA 4MADA 3KVLA 4IG2B 1BXBA 3QYSA 4GLEA 4Z2IA 2VEGA 1G67A 2XFYA 2BG5A 4Y6GA 3IRSA 1L0PA 1BEUA 4PMYA 5LGXA 5I3HA 3GD6A 3TR2A 1CLVA 2WWCA 3VM5A 4WSJA 1BXCA 3UG3A 5HJXA 1LDCA 4A8LA 4LS1A 4J3XA 4I8YA 2MANA 2GGJA 4ZEPA 3AC0A 1N55A 1SYTA 2E5CA 1ZENA 3RR1A 3CHCA 5BMXA 2BS9A 4HPJA 5CBBA 3QGAC 5LA2A 1K9FA 1Z32X 4XD6A 3IUIA 2QZRA 1E6RA 5IDZA 4Z1AA 4B4FA 3WQWA 3WLHA 5I06A 1O66A 1Z48A 3WLTA 3M5VA 4J3VA 2CHRA 3LXAA 4NNCA 2PBGA 1KXHA 1IE7C 3RM9A 3TX9A 2XN0A 3SO7A 3G1AA 4PTMA 3WDPP 1QPQA 3FW6A 3GBEA 3ABRA 2LLEA 4IFKA 5AN7A 1F9CA 3LCIA 3OP2A 1QUMA 2Z2AA 4L9YA 4R7OA 5B7YA 5A8QA 3BAKA 3USZA 1FDJA 3IS4A 4TMCA 4FX6M 4UOJA 4DJFD 1TTIA 1OFRA 4C6LA 2KX9A 2RDUA 3BZJA 3QZAA 4CD6A 2VDHA 4TVCA 3I3DA 1VLWA 2D3NA 3TWAA 4FA3A 4LF2A 3LM7A 1A5LC 4JQ3A 1BSLA 1TIWA 2B7QA 3UZ5A 1CBGA 3UNDA 3A4XA 2CZ5A 3BMXA 3WD3A 2EG6A 2A5HA 3DFOA 3TNBA 1V4YA 1S5TA 4AEFA 2FTWA 2PS2A 4H01A 1L9WA 4E3VA 1UPMB 4J3UA 4AMAA 2UZ9A 2C1HA 2F61A 1WCGA 3H2CA 4REQB 3U2ZA 3CGTA 4TX8A 1EEXA 1YX1A 1G4TA 4XBSA 1DTNA 3NQ7A 1F3XA 4ML4A 2Q8LA 4FNTA 2XIBA 5AY7A 4GI8A 3EOOA 1BSIA 1WE5A 3GNNA 2GJLA 4IFKB 3QV8A 1AZ2A 1TVNA 2POTA 3JR2A 1GONA 2Z1WA 2PDJA 3TCSA 1TZ7A 1AK5A 3HF3A 1KRMA 3NQ8A 2Y2WA 5FA5A 4ZCWA 4HT3A 3WH7A 2CYGA 3T40A 4GVHA 2Y63A 1A5SA 1FKWA 4AIUA 4ZFCA 5EFFA 3B9DA 3M43A 1I9CB 1VPQA 4L4MA 4OECA 4WXZA 1OX6A 5TQLA 3NZPA 1XLGA 1GCYA 3GIQA 4UTUA 2NW0A 1KWGA 3STFA 3OIXA 3SCTA 1DP0A 3FEQA 4A3YA 1KFLA 3TXZA 1JQXA 3EA1A 1S2CA 2ZICA 4PH6A 3MSGA 2CZFA 3OOQA 4Y96A 2CZEA 2OTDA 3VKJA 3AIUA 2VCCA 2DZAA 3M0VA 1PJ9A 4HZ8A 2VC7A 1O5KA 2A7RA 4RE2A 4ICCX 3BOFA 4UFLA 3GHUA 3EZ4A 4JQ4A 1UD4A 3NWRA 3RLUA 4ATDA 1U2YA 3MUIA 2WHJA 4KWVA 1JZ3A 2AL2A 2NQ9A 5FEXA 1JPHA 3NQAA 4KPLA 1IZKA 4AHOA 2DU2A 3CAVA 4PMOA 1T0OA 4A21A 2ISSA 3L0NA 3VGHA 3PULA 4BR1A 3KAOA 2DZSA 3G1RA 3S5OA 1NFPA 1E6ZA 3BLDA 3QKZA 3M47A 1SO3A 1EJVC 1OB0A 4JHZA 3AHZA 3RPTA 2ACSA 1EX1A 2YR1A 1F8IA 2HS6A 4W86A 4IFOA 1GKPA 3WLPA 1S2UA 2P8CA 2ZRYA 5FESA 5DANA 1PIIA 2OELA 1X98A 3LSBA 4H9VA 4HTYA 2Z27A 2WM1A 3WJXA 1BWKA 5DO8A 3OVPA 3WX7A 3AU6A 3ZR4A 4PMDA 1KFEA 1E73M 1NDYA 4NAEA 4KCVA 2X40A 4KW2A 3OB8A 1DWHM 1KGXA 3FY1A 1P0KA 1YXCA 3SCUA 1T40A 3GDRA 1IR1A 4IL0A 1TRDA 2NLYA 3RM8A 4XO7A 3K1GA 1ZALA 4O28A 4LB3A 1GHSA 1ME9A 1OBAA 3NTYA 3M16A 4OWGA 2EJ1A 3L4UA 4CN4A 2DZPA 3SCOA 1A5CA 1EJRC 2WWDA 4QBXA 5LA1A 1AA1B 4B2DA 1W1VA 3DX5A 5ENLA 4F0RA 1GOMA 3BSGA 3LV5A 4PE8A 4DBEA 4ZQOA 4DJEC 2C8NA 4JDYA 1RBOB 4IJCA 3ARZA 3UPWA 3T9PA 4UFMA 2Z6JA 5H8UA 2X2YA 3UG5A 3VIMA 3PY2A 1E5NA 3WK2A 3LPOA 3GIPA 4GKLA 3SCWA 3PG8A 4DEFA 2D2GA 3PUEA 4BK9A 1PS9A 2OO6A 4QCFA 2YA1A 1X6UA 2GZXA 4Q4QA 2OXNA 4H9YA 3W3OA 4GJ1A 1J10A 5FL0A 1WXZA 5BU9A 4N4QA 4C7GA 3XISA 1ITQA 4C6BA 3AZTA 1JGMA 1UUOA 1QOQA 4NKCA 2OCZA 2VI0A 4AD0A 6XIAA 3W27A 1ZBKA 4JY8A 3H21A 3UCQA 3G1YA 2W91A 3KW3A 1E43A 2ZFAA 1KFCA 1CB2A 3GVWA 1M65A 4DAFA 2FPYA 2UBPC 2VZSA 3FOKA 3H2AA 3K13A 1CXEA 3RNDA 1SR9A 3NZRA 4QP0A 1ZCCA 4L4LA 3GTXA 4IUOA 4IUGA 2Y61A 1KBBA 3W81A 5AYXA 1S1RA 4KCTA 4US5A 1W9DM 1SMDA 2YPIA 1KFBA 4H2CA 3V5CA 1OEPA 3LCXA 5EB8A 3E02A 1Z6KA 4WSHA 1TPH1 2WC7A 3WJZA 4UTWC 1WKEA 1XSKA 2GOUA 1QW7A 2W3ZA 3UVIA 1G9HA 4JHMA 5HJLA 2WZEA 3D6NA 5T9BG 5IBXA 1VB9A 2GVEA 4UFIA 5LGZA 1XYBA 4LGXA 3W2UA 5D37A 3OA3A 3LUTA 4UC5A 5FOOA 5HMFA 3GH5A 4XD5A 1Q2RA 2AL1A 3W7LA 4Z42C 4DXKA 3KOYA 3CHFA 2Q8ZA 3O6AA 3RLGA 3WUBA 4W8AA 1KLZA 2CU0A 1PCWA 2D0FA 3I10A 4RXGA 4UB9A 2CKRA 1R9YA 4NY2A 2HS8A 2CW6A 2PLKA 2QKFA 2CIPA 1EL3A 1MUWA 1MXDA 4NYUA 4GGHA 3E6EA 2ZRWA 2Y5SA 1UMYA 2PDKA 2ANUA 1VENA 4HU3A 4WY0A 3OLIA 4IQEA 2CXEA 4FOJA 4RW3A 3H70A 3MBDA 2PRHA 4Q7IA 1RH9A 2X2GA 5FD0A 1W1B1 1A5UA 1TJ0A 4LSBA 4LRSA 2XIOA 4XIAA 1HTIA 1OINA 2WAGA 3CB3A 3BJSA 3SIZA 3CIVA 1AQFA 4JTUA 2OT1A 4HK7A 3PPFA 4WGHA 4Q8NA 3GVQA 3FA4A 1XSIA 3R0KA 4LS2A 3TYUA 5D4YA 2PP1A 3THDA 2J79A 4E4UA 5AB3A 4OOUA 4ZQNA 3VKKA 3TA9A 1JEZA 1LRTA 1R3TA 4GGBA 4QXIA 2DZVA 2H9AA 5F1UA 3PHAA 1LM1A 2CKSA 4XG1A 3ITXA 2ESCA 3N2XA 5GJMA 3UXAA 4DBSA 4DELA 5D2VA 2HROA 1Z8AA 3SGZA 4I6VA 4HYRA 1NEYA 3LS9A 4LJ3A 1KM4A 2WZIA 4GJJA 3E12A 2WZTA 1KKOA 1SVDA 3GAYA 5MKGA 5BWFA 2ZC1A 1XYMA 4V1XA 3S6DA 4AIBA 4DZHA 4F9JA 5KZMA 2VENA 2CESA 1LOQA 1Q6OA 3A21A 3H2MA 3V36A 3AXMA 4P8VA 1H1NA 3NQEA 4P5UA 4R5EA 4PL1A 3PSVA 5CZJA 2DZWA 3WQFA 1MMFA 1LL4A 2VX6A 4I9TA 4MIMA 5G1TA 4LAKA 2J24A 2XG9A 5FF0A 5AYYA 2BODX 4QLJA 1KM3A 3NQCA 3DKJA 1N7KA 3TOYA 2OGYA 3GW3A 3WNPA 4JEJA 2A79A 1RPXA 1OM0A 3P60A 4CQCA 1GOXA 3MV11 4CD5A 4MDPA 3W23A 4MJ4A 2PU1A 1W9UA 4OOZA 3ES7A 5LXXA 4HNVA 3S2CA 2CLIA 3LPGA 4KF1A 4QISA 4PUDA 3LNPA 1QNRA 8XIAA 1PVNA 1J2WA 5FJOA 1M6JA 3AZSA 1J0JA 5FAJA 1EO7A 3PUOA 2G37A 2DVUA 4JD4A 3VAVA 1KV8A 4M6QA 4JY9A 2EPHA 3FVDA 2WJEA 1UIOA 2ZOXA 3S83A 2QJHA 3PWAA 3SBFA 1IWAA 3UYIA 3PBVA 1K9TA 3UG8A 4W7UA 4XX6A 4B3KA 1XHGA 4L6DA 1R46A 4IZGA 3OG2A 1IR2A 4LVBA 3AU2A 4WD0A 3AI0A 5SWUA 3CYVA 3MUXA 4QE1A 3IJQA 5LXEA 3LNMA 4P2VA 1PTAA 5KSWA 2NUXA 3KZSA 1ISVA 1C8QA 5G5IA 3WJYA 4F3HA 3KOWA 3UERA 3W9ZA 3A4AA 1OFPA 4KCUA 3TSBA 2BGSA 2PE4A 3GK0A 2QW5A 4GRSA 4W88A 3TEVA 1JZ4A 2HK0A 3L4WA 3IIZA 4IH3A 3QH2A 4MVAA 3N1AA 4M82A 1W1TA 2PTZA 1XCXA 5HWJA 4CU7A 4JZ5A 1IWPA 1E9ZB 2E0PA 3C86A 4S3GA 5C9XA 2ZUUA 4FNUA 4IP7A 4D6FA 4O52A 1D7FA 3EOUA 2G3NA 1X96A 4ZE4A 4XKYA 3VKBA 1DKWA 4GZIA 1MNSA 2G3FA 4OBRA 3CMFA 3U5YA 1UW9A 3BXWA 2VC6A 1ZJIA 4P61A 4GQ0A 3V18A 1K8CA 3ZWTA 5LIWX 4O8AA 5A6KA 1Y5WA 1ELSA 2G96A 3GLCA 2ONEA 2QCHA 4BEQA 4K1GA 4LV9A 4AZ5A 3WUGA 5EMJA 2DQWA 3LN3A 5CPOA 3WQ5A 1I60A 1FDZA 1A0CA 2FQIA 4AH7A 2F6UA 2PFHA 2CLKA 3LGGA 1FCQA 4FAMA 2PWEA 3W75A 2ZXBA 3HV8A 3SIMA 3A22A 8CGTA 1M68A 4MKNA 3I65A 2V0TA 4HHLA 3GU9A 3HPZA 4QS5A 7TAAA 3WD2A 5FJPA 3PAOA 4AX7A 2VRQA 1I2NA 3AUJA 3LTYA 1JUKA 2PCQA 1LG2A 2VX7A 5E9XA 3TAOA 3ANUA 2WSPA 4XAZA 3RDKA 1O60A 1R6WA 1A3WA 3RR4A 2FH8A 1PTDA 2VR4A 3OZYA 5FJRA 4M5PA 3U48A 3PJWA 2INFA 4Q6XA 3ORWA 4X22A 1RUSA 3AO0A 4QX4A 2PDWA 1YMYA 4KIEA 3MKKA 3FDGA 3IPWA 4PGLA 1HKJA 3DYMA 1EZWA 3V0SA 3M5ZA 1OYBA 1XWYA 5CPNA 3UF9A 1U22A 1DL3A 1YBQA 3AAMA 4IICA 4PUUA 3B4UA 1LYXA 3VZXA 4FXJA 2PWHA 1A3HA 2ZZ2A 3T42A 4W7VA 4UTWA 4MB4A 4RUBA 5CG7A 1RP8A 3GHTA 2AQVA 4AHQA 1HW6A 2W9MA 1ALDA 4GCXA 5AZ1A 5IBXC 1E1CB 1P6BA 5BZAA 1XYZA 3NPUA 4KQNA 2DSKA 2O9RA 1E3XA 3CUJA 5DLCA 3WO8A 1W3NA 4EF9A 4TVUA 2J7FA 3TN5A 3N34A 3G6LA 1J5TA 1GVEA 2OR2A 3AYVA 1VZWA 5CSRA 4C7FA 1P0EA 3TTQA 1CNVA 1X7IA 3S1VA 3ZO9A 1LL6A 5CC6A 2VZTA 1XYLA 3MHUA 4MNMA 1M53A 5ABEA 5GQBA 2OODA 1JUBA 1AMKA 5DT5A 1YTEA 4H9TA 4HVXA 1WV2A 4LANA 3M64A 2C7FA 1FHLA 5HATA 4AZ7A 2AL2B 2QCMA 3S1GA 1AW2A 2B4GA 2ZVRA 3WNOA 2QIWA 4R33A 3D3AA 2QPSA 4A3HA 1F2JA 1UCWA 1PDYA 2B31A 4S38A 1J01A 4DYJA 4RNHA 2R1MA 5DMNA 5HUOA 1JZ6A 4QIUA 4P7QA 3ZVIA 2PTWA 3HMCA 3R4IA 1MUCA 2ZRUA 3MUCA 2GSJA 5F4WA 2OYLA 4GI4A 2J9XA 2PDXA 1BPLB 1NARA 2XVLA 1Y0EA 4DWDA 1CLXA 1FWSA 1XDJA 2FYMA 4P8XA 3W70A 1UHVA 4E5TA 5C9ZA 1F4AA 1R87A 2UY5A 4W93A 3S9ZA 3ITTA 3TW7A 5C2CA 5TNVA 3N2MA 3VGFA 4KGLA 3OVGA 2F2HA 4FR6A 4IIDA 5GJNA 4QG6A 3O3RA 4HMCA 1SO4A 4Q4MA 1NWUA 3DEQA 1AL8A 3EXSA 3LMZA 3QOMA 4HZ6A 1SUXA 3CBWA 4RE4A 4JQ1A 4N4PA 1BQCA 4IIHA 2PWUA 1EOKA 3HPFA 4H8HA 3AMCA 2XM2A 3PPGA 4X2PA 4R85A 3W88A 3NG3A 1PCKA 4PN2A 4O53A 3QZ6A 5G4HC 4DLMA 4GUFA 2YCLA 4B9ZA 1QTWA 1X39A 1M04A 4V2XA 4PCPA 4NASA 1JDDA 4JIIX 1B3WA 5KZ6A 1XI3A 1A47A 2MUCA 1CYGA 3MMTA 3VPLA 3CWNA 1MZHA 2IKHA 1MQQA 1R3VA 1R0MA 6A3HA 3WEOA 1EX5A 3HOJA 1REQA 4UCGA 4WY0F 2RKXA 4JQAA 5EFDA 3LLDA 2B0MA 3TNOA 4KFPA 3EEZA 3TJ4A 2WJZA 3RIKA 4NHVA 4LS0A 3DG7A 4NIRA 1A5MC 2D2OA 1XDLA 1VFOA 3IGXA 2YW3A 1UOZA 3UY7A 5JH2A 2YXGA 1BHGA 1XYAA 5CZ0A 5DMMA 3R0DA 1DJGA 3SSZA 3NXFA 1DYSA 3G3MA 3BLKA 3KX6A 4BI7A 3GZ3A 3IV8A 4BWLA 4M1RA 2V82A 1TJRA 3FAWA 2I9EA 3ZFHA 2WMJA 2XFWA 3HBLA 2W4XA 3FYOA 3B8SA 2EPKX 1F07A 4FLOA 1KBKA 2CBJA 4B2DD 1JDEA 3M0XA 4ORMA 3MHGA 4GD0A 1BRLB 3L2MA 2D2HA 3BZGA 3B8UA 3G18A 1XIBA 4W8LA 4OKDA 4WLCA 5CC5A 1DQUA 1ME7A 4B15A 3ES8A 1NFGA 1YADA 8A3HA 5AHLA 1C8XA 1LT8A 3DN5A 3V1PA 3WDJA 3JVAA 1XPGA 1S39A 1CXLA 1HNYA 3QV7A 3UZYA 2FB2A 2A85A 3AYRA 4A8IA 1T7LA 4AWTA 4PC8A 4GI9A 1NWSA 4R27A 2VHLA 1KM6A 1W9BM 2J8FA 3MDWA 1XCWA 2PAJA 5BMWA 2J7EA 2NXHA 4M6UA 3CHVA 3LBOA 4RZ5A 1RVGA 2QCGA 4IIEA 1W3TA 2HNHA 3UT0A 2WQDA 2GLKA 3P8IA 2Y88A 3N4EA 4EP8C 5BU6A 3WL0A 2GPTA 2FHBA 3GHRA 1QPOA 2REQA 2Z25A 4O4WA 4NJKA 4E0CA 1ISYA 1P1XA 3QV6A 5TAOA 4NZ1A 7TIMA 3LBCA 3UWYA 3LZ3A 2HBXA 3U8GA 4EIVA 3PWIA 4O1BA 4AZBA 3P81A 4HMNA 1KA9F 3E0IA 3RXZA 4JYDA 1BD0A 1ECEA 3SB0A 4Y8FA 1TMQA 2VGFA 1GZJA 3HB9A 1EF2A 3LDVA 3NQ2A 3BO9A 3GSMA 1W0MA 3EX1A 3N2CA 4HGXA 1P48A 1HQTA 3PZOA 4W9TA 1H1YA 4GISA 1XIHA 5DRIA 1Y7VA 1CB7B 2TSYA 3T4CA 3GW0A 3SDOA 4C6OA 1WKDA 4KGJA 1JF6A 1MYRA 1Z9AA 4BWLC 5A1AA 4LUTA 4PCFA 3P5ZA 1VAHA 1JXJA 3CV7A 1M9HA 1ZGDA 3M0LA 4QG9A 5BXRA 1MW3A 1IWBA 4WKHA 4MLRA 4WR3A 1H2JA 3OGVA 4MY1A 3EPOA 3N3TA 3O2LA 3II1A 3P84A 1FX6A 2VM8A 4IT1A 3OPSA 4AAJA 1EPXA 3VXGA 3M7SA 3NURA 4AY8A 1KCLA 1MNZA 1XR2A 4QE5A 1C9WA 2IPJA 4RPQA 3VIJA 1OVDA 3GY1A 4TV6A 1SGJA 3FGCA 4IG2A 1ENUA 3ID7A 1RD5A 1L8PA 2H9AB 5BCAA 4EWND 3WN6A 3MWAA 4GXMA 2J7CA 3W7NA 1TE1A 4GYKA 4HNTA 4HHHA 2ZZ7A 1ZHAA 2ICSA 1VYPX 3GG7A 3H2FA 3LQLA 5FJJA 3NDYA 2B81A 3WQVA 1LBFA 3WQ8A 1HVQA 3JZEA 1BQGA 2VOTA 4DJDC 2GUUA 1M7OA 3G77A 1XC6A 1XX1A 1SSDA 2A3CA 4PMZA 4WDXA 3G1SA 3HZ3A 4ROPA 5E0CA 3CUIA 2NWRA 1TELA 2E6DA 3ONCA 2I57A 3ISIX 3MO7A 4XZIA 2FH6A 4NL1A 3ZT7A 4YWIA 1HX0A 1ZFJA 4RK8A 4QDMA 2PLCA 2WSYA 3E0VA 5C54A 5F2LA 3LG3A 2OJPA 5DY2A 3T0TA 4YXGA 1I2OA 3R8RA 1ODZA 4Q8PA 4I9AA 4MB5A 2BP1A 3GTIA 4W5ZA 1SR0A 1EZ2A 3U2EA 1JVNA 4PCSA 3PZIA 4Z1DA 5U4NA 5F7UA 4ZZ9A 1EPVA 5L6UA 1XGZA 5HULA 1CXHA 4NUWA 3NL5A 4ZVJA 4AQLA 2VOMA 3DZ1A 4HK6A 2V3FA 4PUKA 4C6MA 3BMWA 2IKIA 1S2WA 3UPMA 1GG1A 4MKSA 3ANVA 2PTDA 3LHTA 3ITOA 1V3MA 5I3JA 3RCNA 2AMGA 4IP5A 4H8VA 1KXTA 4S1FA 3UJ2A 1SFTA 3WG6A 3WLOA 2YDQA 1Y65A 5ABTA 4GVGA 1C8VA 1U1HA 3GS6A 2NUWA 1R38A 2J9ZA 1XSJA 4A4AA 1KC7A 2NUYA 4PCNA 3QPYA 1GOWA 3B04A 3PC0A 3PSWA 4LAUA 3WJWA 1HKMA 1XICA 2RDWA 3TJLA 1PO9A 3SN0A 1XLEA 3AYSA 3OODA 4PYSA 1HO4A 1IEVA 2VC9A 3EKZA 4K39A 1TWWA 1AW5A 1AH0A 4GYPA 4ZODA 4UFJA 4F0LA 2FZBA 4IPJA 1JCTA 2EF9A 5JVLA 3VD4A 3TMQA 1JCXA 2DUAA 4JTSA 1XH2A 3NM1A 1NF0A 3Q67A 3WELA 3EWZA 2A3LA 4JTFA 4PRTA 1PV8A 1WOBA 1CCWB 5C9WA 2E5BA 2PDNA 3N4FA 4BY3A 2ZRZA 1B9ZA 4GVFA 4HNCA 1FKXA 3QV9A 3GU2A 2FDSA 4R7JA 4X60A 4RNFA 2YCIX 4A8NA 1MEWA 4KKXA 1U1UA 1TV8A 3QRHA 2SFPA 1K6WA 4O1DA 3USBA 3BG9A 3T8LA 3G0XA 2PGWA 3HFTA 3CZKA 4DQWA 2P0OA 1VPYA 1TV5A 4GVIA 1PKLA 3MJMA 3VINA 3B0PA 4C5YA 3THCA 5CLWA 1I4NA 4CNUA 5EKYA 1SU5A 2Y8VA 2FTPA 4JTJA 2WYSA 2XHYA 1CZ1A 3NSMA 3OQ8A 4O4VA 1ZCOA 1UJPA 2NX1A 1U1JA 3CT2A 1A49A 5AHMA 3S5ZA 1O4UA 3EDDA 3SRFA 1NSJA 2X09A 5K9XA 2OZTA 1C7TA 1E71M 3U9IA 2YL8A 5T9CE 1S1PA 2ZA2A 1H51A 1XH1A 3W1AA 3RMJA 1CENA 1YHTA 4GQGA 1TX0A 3I3EA 1OFBA 2WJDA 3RITA 3QYQA 3REQA 1SFJA 2OO0A 4GYJA 3R89A 3UJFA 1LJYA 2PTYA 1J0YA 3WEMA 1UWQA 1K02A 3MI3A 3T6CA 4Z2JA 3ARVA 3OYZA 5H6HA 4UTIA 3CJPA 6PTDA 2WLZA 3W2MA 4Z2HA 2ACQA 2V69A 4KBXA 3SY8A 4B5TA 4L9ZA 1U5HA 4FNRA 3S2JA 2A6LA 5BROA 3WH9A 4QJ4B 4H83A 3AOFA 3M41A 4QLKA 1VCGA 4NZ3A 4HSOA 3AYTA 3VNZA 4MB1A 4QQ3A 1GYLA 4AEOA 4IPNB 3WQDA 4ZB2A 1LG1A 2RJHA 2V9DA 3EXRA 3LU2A 1H1ZA 2FZ9A 1X6LA 2B7PA 2I17A 4HMDA 1PTGA 1EH9A 2VCAA 1W2VA 3L4VA 1I2QA 3S2LA 4WF7A 1HXJA 3IV3A 4G6CA 4Z0SA 3QTPA 3LTPA 3GX9A 4XSMA 3NUKA 2OX1A 2VGBA 4PUNA 2V8ZA 3T2PA 2I1OA 2OFJA 2J25A 3VI2A 2XFRA 5DF0A 4B90A 4Q8MA 1WOAA 2Z0IA 5E6ZA 2WKGA 3PK7A 3WFLA 4YTTA 1DWJM 1SJDA 1N82A 2DUZA 3OGRA 2QVHA 3FKRA 5CPQA 3CYJA 2R1KA 2BX7A 1V0NA 2FIQA 2GL5A 4H04A 5D09A 4O54A 1E4IA 4Q8OA 4HPHA 2YXXA 4IIBA 4DPQA 3KLLA 4JTGA 5CBJA 2P1FA 5MHBA 1V08A 3TN4A 1CW2A 1Q5MA 4H3DA 3WQPA 1JPMA 5LNVA 3ZJ8A 4FMVA 3AS0A 5AOUA 3W7GA 4DJFA 4ZO6A 2HVMA 3P14A 5JBDA 4NU7A 3NEHA 3DBPA 1H09A 3APGA 3GXMA 1XIIA 4UQCA 4JYEA 1EJ7L 1ZJAA 3RO6A 3ITVA 3LHUA 1AQMA 3ECQA 4FP1A 4FXFA 4BQ5A 3NQVA 4O19A 4BKNA 3TH6A 1GJWA 3KFTA 4WGXA 2PDQA 5A8PA 4M56A 5BOFA 5KTLA 3PTKA 1ZL1A 1C90A 2F6KA 4Y9PA 5BYWA 2QEZA 3SRDA 1ECQA 4U3AA 3CC1A 5HOSA 2FHCA 4M51A 1MO0A 5FAGA 1IIHA 1TWZA 1S3TC 4HSNA 3L5AA 4DM1A 1K7FA 1R7OA 4KRTA 3IUDA 3BURA 3CWHA 3CQJA 3W82A 4JKKA 3FXGA 1QI4A 2XSBA 2NV2A 3LCWA 1YQ2A 3BLLA 1ISXA 3RM4A 1PB0A 1TVLA 4H6QA 5E1QA 1EWDA 2QMKA 3RG6A 1G5AA 4F66A 2JALA 4LYKA 2QUNA 4Z2GA 3C56A 3BW4A 3RX2A 1FCVA 3W7HA 3K2GA 4H9XA 3DGBA 3O0KA 2RJGA 1TE6A 3VNIA 1G1YA 4FOUA 4ES4A 1W8SA 2W0UA 3UGVA 2Y8UA 1KNWA 1ZS2A 4U3CA 4C6QA 1EXBA 1H41A 6CGTA 3EDFA 3B9EA 1LF1A 1SO5A 3WLQA 1P0BA 3W86A 1TR1A 3PFMA 4WOZA 3KWSA 2YKKA 1Z3NA 1RQEA 1R3SA 2D2JA 2I14A 2IPFA 3G1FA 4NNAA 1IYXA 4H7CA 1RY8A 3LSCA 3W37A 4M7SA 3ALGA 3LTSA 2WPGA 4JFSA 3B03A 2W61A 3CUZA 1YKWA 1B3ZA 4NI8A 5CCZA 4MY9A 3SN4A 3RFAA 4L64A 4CCCA 4RDVA 3CT7A 4EPBC 2WCSA 3UETA 2Z7KA 4F0MA 4HSHA 1J79A 4Y2WA 3PZGA 3VOIA 1RZMA 1UROA 4ZQCA 4CQBA 4HN8A 4QAWA 2ZRVA 1HKKA 4P8WA 1P43A 3W25A 3A9BA 3VOJA 1RK6A 1UZ4A 5KZEA 1QK2A 2GUYA 2O92A 5M3WA 2FDMA 4O16A 4Q4KA 3WIJA 2GQAA 1E0VA 1XUUA 4D2JA 1NDVA 1QI0A 3WD1A 3FSTA 1HFBA 2OLHA 1H61A 4AVNA 1NOWA 3BJFA 4I90A 2R82A 1UR9A 4DYKA 1BVZA 4WKFA 2GVLA 1DJXA 3H4GA 4E2BA 1LRNA 1TUFA 4YJ5A 3AQUA 1CGXA 2PODA 2WM0A 4WDTA 4FNSA 4QJ5B 3DHDA 4YN5A 1HL8A 1WDPA 3QY6A 3G8RA 1F4HA 2V3DA 3DHUA 4NXSA 1HP5A 3W7EA 4JS3A 3BV4A 4PUJA 4ZOEA 3GTFA 4DF0A 3ITCA 2QYGA 2FVMA 3B9OA 4HHMA 1TWDA 2ZUWA 4XZ9A 1HT6A 2ODOA 1UH3A 3N9KA 3WQ4A 1RA0A 2ZADA 3DGRA 3G0UA 2PD5A 4AZHA 4JPGA 5FL1A 3WH8A 1F3TA 4ASTA 5TBOA 1W5PA 1F8MA 3VIFA 5DX7A 3QHOA 4I8DA 1JFXA 2BGQA 3AMGA 1MEIA 3WNKA 1TA3B 2A3BA 3KP1A 4AD5A 3L66A 3POHA 2GQ9A 3IIVA 3LEPA 3TR9A 4WJXA 1TRIA 4GQQA 2TPSA 2FB3A 1EA0A 3B8TA 5CC3A 3AIWA 1TJ1A 4NILA 4EPDC 4ZB5A 3M07A 3ARPA 5AC8A 3TUUA 1VD6A 2ISWA 3M0ZA 4GFSA 1ZRQA 2YBUA 2R9RA 2X8RA 3B40A 4C1KA 3D46A 2C18A 5I6SA 3QM3A 1RXOB 1UD6A 1WDDA 4Q6JA 3IAQA 3W22A 1E6PA 1OFDA 1UA7A 3KP0A 4M3PA 4TTGA 4DWSB 4X9YA 4L80A 5AC7A 4I5XA 1W6TA 3VD3A 3WMLA 4ERAA 2DT2A 4HNLA 4ZENA 3NOEA 4K8HA 3VK5A 1US0A 5CSUA 5LHEA 2HPIA 4QAIA 1E72M 2PDYA 3WF2A 5I3FA 2ZWYA 2X0YA 1J18A 1CIUA 2J7DA 4DM2A 1JZ8A 2XDFA 2EG8A 4F48A 2YYTA 2YCEA 2AAMA 2WMKA 1JFHA 3GNXA 4JFTA 3CWOX 3NPWA 2O55A 2TODA 4FSAA 3WUFA 4EACA 3N3MA 4RXFA 3O6DA 1TZZA 2E67A 4PODA 4AF0A 3PP7A 1TSIA 1ADSA 1KFKA 4TIMA 2QQ6A 3SCRA 5ABHA 5I77A 1N2VA 1JF5A 1P4CA 5C55A 1O5XA 5KEZA 5AVHA 2ZUSA 1I6NA 3Q94A 3GVVA 4M1BA 2QAFA 1JIBA 3S9IA 3AWNA 4Y9AA 3UXLA 4O15A 1O94A 1IV8A 3CTTA 3UCCA 3COTA 3M0YA 3M4HA 4LEFA 1JJKA 5T91A 2V5BA 2VGGA 3PAJA 2ZC8A 2P0IA 3UESA 1ML1A 3NAVA 6ENLA 4FX7A 3TN6A 3QKEA 4QGCA 3S5YA 1RY0A 2XIJA 1NDWA 2CC0A 3BPWA 3DC8A 3SQMA 4JTDA 2NXIA 4X2RA 2D0GA 5CAKA 5K4ZA 4UMCA 4G1NA 1JXKA 3VM7A 1V0KA 1VGAA 4IGMA 4LCSA 2VFGA 4W84A 1IXOA 1OGGA 1VH7A 2X0SA 4PTWA 3MZNA 4ZE5A 1BYCA 4ACZA 4CCZA 4D6GA 3WDHA 2OGJA 1HP4A 4IMAA 2P8BA 3MVTA 3AZRA 3OO2A 2G97A 4E8CA 1R3QA 3BGGA 4DWSC 4HPXA 1VJSA 3IVSA 3TA6A 1EJUC 1I1XA 4PTXA 1W5MA 2DZXA 4LYPA 1G4EA 2CBIA 2GDVA 5FI8A 1M7JA 5DMLA 1XBYA 1GKRA 3B0XA 1TFVA 2XVPA 1DWIM 4G7EA 4C6CA 3DESA 4JTIA 3QTGA 2PDIA 3CO8A 3GR4A 2DSUA 4MPQA 2C13A 2R91A 3K4AA 1FOBA 3E74A 1KQZA 1SFSA 4H7VA 4O18A 1L6WA 4AZGA 1QT1A 4RJEA 3W1RA 3CL7A 3HMJG 3N4AA 3RU8X 4I7WA 4ZBCA 5HQMA 4Q8WA 2IPWA 1E6QM 4JNMA 3H2NA 3LCGA 3FS2A 4HA4A 3RRXA 4YHEA 5IOBA 4KH2A 4PMXA 4YMZA 3CAKA 3TV8A 1C29A 3KOFA 1H4PA 3K1DA 1EIXA 1WP6A 1CXFA 4YYFA 3GVRA 1SW7A 4OIFA 1BRLA 1BTMA 1CI1A 3UWWA 1LUCA 3LI0A 3SUWA 4OBTA 4AY7A 4J1OA 1UYQA 3AIRA 4FF7A 3WF4A 3DG6A 3PB0A 3CS2A 1S46A 2P5NA 4C6KA 1V79A 1M7XA 3VE9A 2Z1XA 3CUFA 3PN8A 4GHRA 4DJED 1G4PA 4UTFA 5A8GA 5DELA 4GIEA 1WA3A 3TW6A 3WD0A 1YDOA 3O16A 5D38A 5DT7A 4PMQA 1PUDA 1KO0A 1C91A 3EPNA 3FN9A 3QGKC 4IXXA 4LYRA 1VLIA 2PDUA 4AUBA 3SCQA 1HZYA 1E4NA 4N6EA 3STCA 2VRKA 3W7DA 4GG9A 4W4QA 3LLFA 3REQB 1V7AA 2PTXA 1KB3A 4EXAA 2O4QA 1SZGA 2G95A 1K7XA 5GJPA 3I68A 3MT1A 5GVJA 1K1DA 1D3HA 1XFBA 1UOKA 4CQ8A 4PMJA 3W4RA 1ZZMA 2BGNE 3IJLA 4GY7A 4C6DA 1EDGA 3P6LA 4Y9OA 4NAFB 4JX4A 4LUTB 5I7GA 4O0ZA 4OHQA 5JU6A 1ZP3A 4IM4A 3CU2A 4M19A 4FZIA 3VD7A 1ONWA 3I7QA 5FF2A 4LCRA 4J7RA 4YL2A 1JPIA 2DH2A 5CXPA 1XLMA 4L6HA 3NQFA 1XISA 4J35A 4WOQA 3ZOAA 3EX3A 4ICMA 4OJYA 2I7GA 3N2OA 2A0NA 1LOLA 1Q6FA 1RR2A 3WFZA 3TN3A 2PCEA 1H7WA 3FJ6A 1NWRA 1XG4A 3BLEA 5J5DA 4MHBA 5I03A 3VVGA 1YEYA 3GG1A 2E1DA 3QC3A 3WK3A 4CCEA 3ARSA 1GOKA 1DWFM 2Y24A 5BRQA 2W6RA 3NL2A 4IFRA 3VX1A 5HBFA 4MWAA 4I6KA 3G22A 5T26A 5CKSA 3PANA 4MYAA 4JYFA 3W1QA 4EXQA 4LAOA 2BV9A 3DERA 3K8MA 3HN3A 1HGYA 2CWNA 1HKIA 3OHMB 4JXCA 2PLJA 1JULA 3UJSA 1V8EA 2WNZA 3B0VC 3MCOA 4U33A 1UP2A 1TVPA 1Z42A 5GNXA 2VJXA 2NQZA 3KBJA 3VOGA 1F3WA 3QFEA 3W6YA 1GVFA 2V6AA 3E0WA 3KCOA 4HZMA 3VZZA 2HEJA 2PZ0A 1JYNA 2O56A 4DO7A 3C3UA 3IVTA 1AZ1A 4LVDA 1IXQA 1JD9A 4IMCA 4NZCA 1Q85A 2J75A 2V2HA 3LRLA 5D2TA 2ZZ1A 3C2FA 1WYIA 4IJBA 1UR3M 3BC9A 4FK9A 4BF9A 2QUVA 5E09A 3VDHA 3CUGA 3S4TA 1BF2A 3CH9A 3LCHA 5FJUA 3WFAA 1YDNA 1F05A 3TQVA 4PFMA 4AIOA 2E40A 1MRAA 4XK2A 3UXDA 1W3LA 2V5CA 3URBA 3O1NA 2DIEA 4GO9A 3R7MA 1M1BA 4EK7A 1XQKA 2OQYA 2B7OA 1DJHA 1NIUA 5HNRA 3EX6A 4AWEA 3E2QA 4XZNX 5A95A 4RDYA 4XD3A 1P6CA 1KKRA 4ROQA 1FWIC 1E1EA 4FNQA 2YX0A 5KETA 4QJ1A 4D6CA 3ERPA 3WDRA 1QPKA 3RX4A 9XIMA 1GVIA 1U30A 1FCBA 1RVKA 2WJFA 3L0KA 1VIWA 1E40A 3MI6A 2RDTA 2CLOA 5D2WA 2A7PA 3M0IA 1B3VA 3UP8A 3ZM8A 5CGTA 8TIMA 1GJUA 4I9JA 5CPTA 3WF0A 5A6JA 1UQZA 2NVCA 2GWGA 1D9EA 1S5VA 1FWAC 2X05A 2AGKA 1CXIA 3T05A 5A6BA 1POJA 3KL5A 4AYSA 3CUXA 7ENLA 1NWTA 5JIWA 4UQBA 4IIGA 4XVEA 2XWEA 5EGRA 3O07A 3CPGA 4JDBA 4PZVA 1QNVA 3OBEA 2RGMA 4TR9A 4C1NB 3T2OA 3L7RA 1E4LA 3O15A 4LNYA 1FH8A 3WJSA 2DSVA 3KCLA 1K70A 1PAMA 1VBRA 2VDIA 3L5MA 1KRCC 1FXQA 3KBSA 2NQJA 2RAGA 2IS7A 3N25A 3G5EA 4O14A 2VZUA 3VTRA 1K4HA 2OZ8A 3CZJA 1M7PA 1A80A 4UTMA 4JAWA 3F4CA 5CGMA 4LBSA 2ZZ4A 3GDLA 1J12A 2HTMA 3VMOA 4AD4A 1E9LA 4IXHA 4J3WA 4JIRA 4F4RA 2CHOA 2YCJA 2BY2A 4O17A 5A5WA 2I5IA 4BQ3A 4G9PA 2FFIA 4PB5A 2OKOA 4XAGA 2E7FA 2BY1A 2YXOA 3GE7A 3CEUA 5A8MA 3E2RA 4QG8A 4QRNA 2BVWA 5HPCA 1EC8A 3VUPA 3LI1A 1ISWA 3F4DA 1US2A 4NZ5A 4Q4OA 5AYBA 2WO5A 1XM3A 3OZOA 4UUIA 1WZAA 4HN4A 3AMKA 5XIMA 2YJQA 3WNLA 3CQIA 4BI5A 3PJUA 2A3AA 4L1GA 5FIPA 2XGZA 4GNKB 1HJXA 4GINA 4BF7A 3ENLA 4EX4A 1B31A 1JRCA 2OMAA 3P5YA 4C65A 3L5LA 1UBPC 3TROA 5HAOA 5EYWA 4FALA 4RR4A 4ADSA 1OZMA 2OSYA 3M46A 3DH7A 4JOMA 2WVVB 1Q13A 1JCJA 3EDEA 4S3EA 5HMSA 1W1IE 1HJQA 2VR2A 4N7QA 1DJIA 3VGEA 2VFHA 2EAWA 1K8ZA 4M8UA 1F61A 4NZ4A 1R30A 3HPAA 4WJ8A 3EDKA 4G2DA 2DT1A 1PBGA 4INFA 3BE7A 2GVGA 3U4AA 3TOPA 4J9JA 1LTDA 1NP2A 2YFOA 1FWDC 1KBIA 2VRJA 3N17A 3RYSA 3L9CA 3THAA 5CJ5A 4H19A 3TQ0A 5C2XA 3LHVA 3EWXA 2AQOA 2RUSA 1KRBC 1OIFA 4DRSA 4EKJA 3H22A 4GBUA 1OCQA 2OLSA 1QPRA 2WHLA 1DWAM 4K68A 1F5ZA 4BA0A 2YLLA 3MYPA 4M6PA 1VP5A 2V5LA 3BL3A 2E25A 3W53A 1E0UA 1FWNA 2JEPA 4XD4A 1OF6A 3O05A 4ZSTA 3WLLA 1WUEA 4O12A 1HL2A 1P6WA 3TDFA 3T0DA 3UEQA 3F2CA 1J5SA 2UY4A 5D30A 4DBUA 5BOEA 3CO4A 1KGUA 2UWFA 2ZXAA 1S5MA 3GZAA 1VYRA 1VF8A 4B5SA 1NFBA 3K30A 1Q7QA 2ADAA 1XIMA 3H8AA 3MU7A 4XO6A 3ARRA 3IVUA 2GK1A 3B9AA 3RRAA 5BWAA 1QO2A 3AXXA 2X1IA 3S9YA 2OZ0A 4BS0A 3PTDA 7CGTA 1JQVA 3W01A 3WD4A 3VDGA 3OGSA 5LSMA 4GUJA 2ZZ3A 3N9RA 3TSMA 3L68A 1AH3A 3PZ9A 2QIIA 4N2YA 5CLTA 3T0CA 2V38A 3FAXA 1GZGA 1XDMA 4LAZA 1X1NA 2QF8A 3GNPA 4N6FA 1ZB5A 3W85A 5F4SA 3TYAA 2R24A 4MB3A 1B3XA 2VX5A 3AJ7A 3KCJA 3IJIA 3GAKA 5FEPA 3PNUA 4XTIA 2XISA 4MWAD 3TFXA 4YHGA 2OPJA 4XBJA 1SZEA 3MB9A 3PUGA 4ZL1A 1Y5VA 4MTVA 1UWAA 1W5QA 3ITYA 2JGYA 2Y7EA 1FWEC 1RD6A 4GIYA 3VGGA 4C91A 2V2CA 2I5GA 1TCMA 4B4HA 3XIMA 3PTQA 8RUCA 4FIRA 3NNTA 3OLDA 4BEUA 3RJXA 4AIEA 2J6XA 1V3LA 3WL1A 3GU1A 1A5NC 2DVTA 2BVDA 4B92A 4HCDA 3NPXA 4IHCA 1H0IA 2DV0A 2D22A 2BLEA 2F9RA 1DEDA 3L2LA 1W2PA 2XSXA 2Q01A 4DXVA 1B0IA 3R25A 1V3IA 3I7RA 3UXKA 2FMNA 4DO4A 1MWOA 2RH9A 4UQEA 3B4YA 4PUEA 3KS5A 2PGEA 3CIXA 2YZ5A 1JAKA 4JFWA 2RFGA 3T4WA 4GOAA 5F2IA 1V6XA 3P62A 3W73A 1RCOB 1WAWA 5CBIA 4IPIA 4ADUA 2PMQA 2BBFA 3LM3A 1I45A 1HF6A 5M17A 4JCMA 2G3IA 4KS0A 2QCFA 3H2EA 2O9PA 4GNVA 4FI4A 3N29A 4AB4A 4UXDA 1VJIA 4QEEA 1XUZA 4GO8A 4K7VA 2DJLA 5C7HA 1XD0A 3TZNA 2UY3A 5I78A 5HK4A 4URIA 4E3TA 3MCNA 4PUWA 2XN1A 4BHYA 1HJWA 3WBWA 5G2HA 4RX0A 1QK0A 2O9OA 1L6GA 2WNNA 5DCDA 4W8BA 1OG6A 4QITA 5DMYA 4A3QA 1FXPA 4IGHA 4M6VA 4X63A 1JCMP 3BANA 2NX3A 1QJWA 1X97A 1V3KA 3S3GA 3IJ6A 1Q4WA 1NTHA 4AD2A 4YIWA 3W0KA 1PZ2A 1GQKA 1B3YA 3W2NA 2PGRA 1R86A 2VQTA 1POKA 4JTHA 3DFSA 4YTQA 2QV4A 3MCMA 2E6AA 2EQDA 5MF5A 1LQ2A 3W1UA 4KRUA 4OTKA 4PTDA 1FVPA 1ZY9A 4LF1A 1VFLA 4AX6A 5G4WA 3VKCA 1NP0A 2GWNA 1DV7A 4OUEA 4ONVA 4K2SA 1DOSA 3R58A 4UFHA 2FZDA 2BSLA 4DY1A 3QHNA 4Z1CA 1ZJBA 2PC8A 3WNMA 1WO2A 1A5KC 5CEWA 3UYCA 1LOSA 1G7UA 4XKYB 1Q6EA 4DZIA 3CTLA 3G3DA 1RJQA 1ONXA 1M41A 5K7JA 2D0HA 5F4XA 1CGYA 1M03A 2CLLA 4XZWA 1W91A 3TAKA 4QEHA 1A5AA 2QPUA 3L65A 2CBUA 3NGFA 2ASHA 2OB3A 6TAAA 3VCCA 4L5ZA 3GC5A 2XGBA 4YLWA 2VFIA 1ESWA 1XV8A 1EXPA 3ABOA 4CN6A 1GGOA 2POZA 3UNTA 4EANA 2PWDA 3IARA 4NJGA 4Q8UA 3VMNA 1O7AA 1XLHA 5T8GA 4IIFA 5G2WA 4V33A 4IMFA 2QR6A 1V6UA 3FIGA 3APTA 1AJ0A 3ABZA 1ZJHA 3QF0A 5LA0A 3CM4A 2FPTA 2VURA 3LYEA 4J27A 1BFNA 2D73A 1GQJA 3Q37A 3GM8A 4X61A 4CU6A 5BW6A 3ZJ6A 3CLWA 5AHNA 3C4UA 3Q4DA 3WSUA 2BVYA 3EA2A 5FACA 3PBYA 5D8ZA 1CLKA 3W7OA 3ZIZA 3QMTA 1US3A 2YDRA 1UKSA 2X7VA 3EWBX 5HWNA 2WZMA 5AZ0A 4AWUA 1GJPA 1VBUA 3QZEA 4O1EA 6ALDA 4MUZA 2PWVA 1XRSA 3MI2A 1YRRA 1GTEA 3M1ZA 1V0MA 3BCDA 1IZJA 1ICPA 3NZGA 4JX6A 2ZA3A 1XJBA 4UTTA 4LUYA 1YDYA 3C2EA 3M6DA 1F73A 1IXNA 3VGDA 2PP3A 3WDIA 5PTDA 3F5LA 3E2VA 1DJNA 3RK8A 3KVMA 1VHCA 2VD8A 3TZFA 4QS6A 3WF3A 3KVJA 4FO4A 5JIPA 5HXMA 3LENA 1UB3A 2EKGA 4D8ZA 3W7QA 4W87A 2WHKA 1S2VA 1UPPA 4GY1A 4CQDA 3T7VA 3KHJA 1SMAA 4BI6A 2PRLA 5AHFA 1TCDA 2Q71A 1W3KA 4MY8A 4P8UA 1NAL1 2ZUVA 1NY1A 2XN2A 1AJ2A 1SZRA 3ARUA 1TPDA 1TQJA 3VA8A 3BOLA 4FPSA 3A5FA 4HJFA 1QMLA 3C8FA 4QHRA 5AHEA 1P1MA 3VDAA 4BJHA 4JIQA 3OW1A 3VFCA 1NU5A 2X41A 1WBJA 4ZQPA 4AVFA 1MQRA 3EWYA 3BAWA 2A3HA 1FDYA 2BHYA 2P10A 3AIVA 1GG0A 1BAGA 2XH2A 1EDQA 4Q3MA 1G4SA 2QDHA 1QWKA 5A6BD 5I3DA 4RPPA 2QJGA 4XKMA 4LVAA 1E3ZA 2YOCA 3VKDA 3WY1A 1SJBA 1GKQA 5H1WA 4CNNA 4JTLA 2I9UA 1BG9A 5HR6A 2ALRA 3SAZA 4J2PA 1NQKA 2VCBA 1V02A 3EGJA 3MKCA 2WMGA 3QSTA 3KEHA 1VFSA 4AC1X 2PUZA 4BCEA 2IMRA 1ITXA 2XGIA 1HJSA 1WXJA 4AXNA 4EE9A 3HA1A 4FXSA 3N13A 3NL6A 2V5JA 1HL9A 1FFRA 3DYPA 1L8NA 2VEIA 4UTTC 3VCNA 1QATA 5IRPA 4GBDA 2ABBA 3N9SA 2NLIA 1EFZA 3HIJA 1QVBA 1S2AA 2JE8A 1CGVA 3WH5A 2QUTA 4Z0JA 2Q02A 1J8VA 3HGSA 1F6YA 3M44A 3CUHA 1AUSL 1K77A 1EKOA 2YL5A 4MWAE 3AHTA 1CPUA 5RUBA 2DGAA 4MZ1A 1TB3A 4V28A 1FQ0A 3U5UA 1VCFA 2GGHA 4DNMA 3HU7A 1LWJA 4GXWA 4KIRA 3WLIA 4XWUA 4LRTA 2ZUMA 3ARWA 1JGIA 3B0UX 5JXQA 3GDKA 1HO1A 4E8DA 2HRWA 5D2XA 2Y4SA 4LUIA 2VWTA 2IQDA 3NO5A 1WDSA 1QBBA 3WEZA 1FUYA 4ZTYA 4AD1A 1HN1A 1XIFA 5EPDA 4WJEA 2WCAA 2Z7GA 5FF7A 4O1AA 2QGHA 2WV8A 5A2BA 3QR3A 5L9FA 2MNRA 2OYMA 4PULA 3SRHA 4C7DA 1TJPA 2CERA 1MDRA 4MUPA 1CEOA 4IMGA 1IT7A 4GUHA 2HV5A 3PM6A 3I6RA 4QROA 3NQGA 2Z29A 1TV2A 4D6JA 1IT8A 1PHQA 4W85A 4O50A 1U5JA 3CH0A 4KEMA 4QCEA 5M5DA 1TZ9A 4BQ4A 3GB6A 3SM0A 3KRBA 3B9NA 1J11A 3OBKA 3ZLFA 3ZYZA 1XYCA 1G01A 3DHPA 3CPRA 4XV0A 4ZTXA 2QNEA 4CNTA 3A3WA 3TW9A 3QLLA 3IIPA 3CPUA 1Q3NA 4UIOA 1WKYA 4M24A 1E0WA 1I0BA 1VCVA 1QAPA 1RA5A 4AZIA 3LV6A 4N9BA 2DQXA 5A6TC 1JYWA 1XIDA 4FX8A 3N19B 3RPDA 3UWZA 1H62A 4FLRA 1H50A 3FYPA 4W7WA 3W6LA 2BB0A 5CPLA 2VFDA 4B5UA 4I7UA 3QGVA 4ZXLA 3W71A 1V51A 4DZ5A 5K3VA 3JS3A 1PZ0A 2VEKA 2I16A 3W7CA 4AZCA 5CJMA 1UD8A 2BHUA 4TO8A 4N9EA 4O1CA 4KETA 4Q8TA 4ZGYA 1UMLA 3A3HA 2NV1A 1E56A 3S1WA 1E1CA 3GNDA 3WBAA 3CEPA 3I4EA 3QQ1A 2JK2A 3TQPA 5FJIA 2GJXB 3SCVA 5DFAA 3VIKA 1BKHA 3E9AA 1QR7A 1ZBWA 4JIEA 2BXZA 1UASA 4KT2A 3RPMA 1UKQA 1TV4A 3V35A 1ZAHA 4HMEA 2E9MA 4HP5A 3VU2A 3TLLA 3SI9A 1PX8A 3S46A 3FFSA 1KM0A 5J8LA 3FVMA 4IGSA 6TIMA 3RHGA 4DI8A 1O68A 1ZU8A 1GPFA 5I5RA 4P7RA 4U5KA 4ZOAA 1Q66A 4Y8EA 3WZ0E 2WZHA 7REQA 1NQ6A 3S2NA 3LMYA 4X0VA 3WQEA 5F2GA 1GTHA 2BOFX 4CNSA 4EOUA 3THQA 3RF9A 4F9DA 1KM5A 5DQPA 6XIMA 3B0YA 1WDQA 5E93A 3SUTA 3W02A 3AICA 4X9SA 3UQNA 4OV9A 1C8YA 1W31A 2IPGA 3V7PA 3EA3A 4US5D 4Z1YA 3HGOA 2EKCA 1D8WA 3EB2A 1BWLA 5JH1A 1XKYA 4RNIA 2NV9A 3GDMA 3VNLA 1XBVA 4MF4A 2CZDA 1GOQA 3IEBA 4C6NA 5AYIA 3E2SA 4A2SA 4NJIA 1UP0A 3BW3A 3NO1A 5KITA 3C0QA 3MA8A 1TQXA 3KZPA 4IPLA 1ONEA 5U7SA 1GNXA 4XTDA 1FWGC 4LC8A 3W87A 5CGQA 1BGGA 3GIYA 3GDTA 3MW7A 3QR1A 4O0KA 3K8LA 3ARTA 2OWWA 1SW3A 3AIBA 3MSDA 1FWCC 3GBDA 1EBHA 3STEA 2BVTA 4Y9MA 4LX4A 2QDDA 3IGHX 4ZO8A 4ACYA 4U31A 3QEZA 4I3GA 2GFTA 2GOKA 2PBOA 4E2OA 3M7WA 4ECLA 1G69A 1F76A 2VUYA 3HG2A 2J74A 4KWSA 1XRFA 4AY1A 2R1NA 1OJXA 1VBGA 4FHAA 4V15A 1WDWA 3UA3A 1V6TA 5LNWA 4DF2A 1IIGA 2J6VA 3A13A 1TREA 3TONA 4Z08A 3QBUA 4GH3A 2INZA 1JCLA 1RQHA 1LCOA 3VIIA 1BKSA 1DE6A 4GWEA 4EXBA 1A53A 2GSHA 2VX4A 3Q58A 1TPEA 1YNPA 3MP4A 4PMUA 2P53A 2ZXDA 4UMBA 1ICSA 4YTUA 3ZVHA 4G56A 1AG1O 2VT0A 4PMVA 3BQ5A 1KTNA 1ADDA 1TYGA 4FLSA 4NF7A 3VFLA 4MAZA 3RMEA 1WXYA 1R9XA 4B9YA 3MSYA 1HKWA 1J0ZA 5D05A 3AHYA 3ATZA 3GH7A 1WBHA 2PGFA 1LRQA 2GDQA 4FNPA 4KFOA 4ZQRA 3VOFA 3S8HA 1E6XM 3U0HA 1EYWA 3TXVA 2J66A 1BTCA 3H26A 1IEQA 5LIXX 2Z28A 3N12A 1XC4A 4B91A 1Z69A 1XLFA 4DBWA 3VIHA 3DXIA 5JBEA 3A3XA 1DWGM 3P7YA 2EPNA 4GUIA 4MNJA 2GVJA 3AWOA 4RDZA 3CASA 2OLAA 1RV8A 3RLHA 4HOZA 3RCYA 1KV5A 5FSDC 3BLFA 1IEIA 3E38A 3DDMA 1EQCA 4QE4A 1VRDA 5DY3A 2X7WA 4UR9A 3G1VA 3AXIA 3MUZ1 1Q6QA 3TWBA 4R53A 3LK6A 3PUDA 2W79A 4UWMA 4XQ6A 1VEMA 4QFUA 4DUWA 1LLOA 2INEA 1E0XA 1AODA 4WQ6A 3GXNA 3A47A 4TUFA 2QUMA 4UOQA 5FCZA 1HIZA 4XAPA 4B5WA 2E4TA 3GTNA 3NQ6A 3ATYA 4MZ8A 3MP3A 3WLNA 3EBVA 3PPCA 3TYBA 1BF6A 4B16A 2XIQA 3U7VA 1R3YA 2FPVA 1XXXA 4NRRA 3PBGA 1V3HA 3UR2A 4D6DA 3OVQA 2DSZA 1E70M 4CGTA 1MZRA 4JIHA 3T0BA 5G1MA 1K03A 2ZE3A 2QJMA 2VC5A 3H24A 1LWHA 4PBEA 2G8ZA 4FEZA 1GQLA 3HG3A 3IJ7A 5FEZA 4NRSA 5LNSA 2VUNA 3U4FA 7PTDA 2QVNA 1JDCA 3CNYA 3R2GA 4WUIA 4KESA 2Q3RA 2VNCA 2NQ5A 4HNUA 1RAKA 2EO7A 9CGTA 2NX9A 5FEWA 2CFFA 4UCFA 4LT9A 3O0FA 3LLXA 2HVOA 3R8HA 5KINA 2OG9A 3E5BA 3DG3A 1KM2A 2F7FA 3NQDA 2J8TA 3LRMA 1EGVA 2JF7A 3W24A 4LTSA 2FGLA 1J0KA 2Y7DA 1W3IA 4D1IA 1E6NA 3IJ8A 1OX4A 3CL8A 1GYMA 3V0UA 4LH8A 1RJRA 4QDWA 1OK6A 4XZBA 2QCCA 1PZ1A 2XH7A 3VO0A 4NJHA 4IF2A 2F38A 4GXPA 5I79A 3VNDA 4D8LA 1CECA 3N6JA 3WLRA 2D69A 3A9IA 4YS1A 1XS2A 4K6AA 1DVJA 3LPFA 4RV3A 4JFUA 3H23A 3HGRA 1EUAA 1XP3A 3QW3A 3L0GA 2DP3A 4KWOA 3R79A 3WDQA 2PURA 3TYCA 4RE3A 2YCKX 4HCLA 1SSGA 2VQUA 3DIPA 1J0IA 5CH9A 1OK4A 3VIGA 4ZFMA 3WUEA 3FHAA 1RP9A 1K4GA 1UR4A 1CWYA 4LAMA 3B8IA 3HM7A 4HA0A 5EA9A 1O12A 2WBGA 1UR0A 2QGYA 3URNA 3LHYA 2E5DA 3NEVA 2ZCGA 3FYYA 1Q6CA 1M01A 2NQLA 2QDGA 2JEQA 3W7MA 3UGRA 5DEZA 3UZWA 1XPYA 1F6KA 1J96A 4Y7EA 5D02A 3VMPA 4DYEA 3MC5A 3NQMA 3KUMA 1LORA 1S3HA 1TPFA 3SQLA 4HD5A 2XJ7A 2Z2BA 3R6IA 5CSYA 1P0DA 3ZQ9A 1S5NA 1B4EA 3ARQA 3LA4A 1ITCA 1UIPA 4ZQMA 5HANA 1H11A 5C70A 4V27A 3EYPA 3LRKA 1W1A1 2XU2A 4OE7A 1E9YB 2CLFA 4Q33A 4KWUA 3LXBA 2VXNA 4G1KA 4REQA 4S3BA 5CJNA 3EWUA 4ZA0A 3P67A 4S3DA 4WRHA 3IJ9A 4RV8A 3MQTA 3IWPA 5HJYA 3B97A 3QOKA 3QQWA 1LZOA 4YCOA 2IUZA 3CMJA 3C0SA 4GACA 3THUA 5KZDA 1O5QA 1YTDA 1C92A 3WMSA 1GEHA 2DW6A 1JI1A 3H7UA 4JTRA 3DUGA 1H60A 1W8GA 2HJPA 3EB3A 3RLVA 4DJEA 4E2DA 3GFZA 1Z7AA 4HCHA 2PF8A 1JNDA 2JIWA 3OZPA 1W1ZA 3UZJA 4UNLA 4DN1A 4I9MA 3WBYA 1XRVA 2TRSA 1X6NA 2ZXQA 1E0TA 3FJ4A 4PMNA 3EWCA 4TMBA 5G4EA 4PBGA 5JBFA 2GK1B 1RK5A 3GXPA 3NGJA 2W92A 2VWSA 3UR5A 1TTJA 3A4JA 1MEHA 4AISA 5LYRA 4GZ7