2FTWA

Crystal structure of dihydropyrimidinase from dictyostelium discoideum
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
484
structure length
483
Chain Sequence
TGTILIKNGTVVNDDRYFKSDVLVENGIIKEISKNIEPKEGIKVVDATDKLLLPGGIDTHTHFQLPFMGTVSVDDFDIGTQAAVAGGTTFIIDFVIPTRGQSLLEAYDQWKKWADEKVNCDYSLHVAITWWSEQVSREMEILVKERGVNSFCFMAYKNSFMVTDQEMYHIFKRCKELGAIAQVHAENGDMVFEGQKKMLEMGITGPEGHELSRPEALEAEATNRAIVIADSVCTPVYIVHVQSIGAADVICKHRKEGVRVYGEPIAAGLGVDGSHMWNHDWRHAAAFVMGPPIRPDPRTKGVLMDYLARGDLDCVGTDNCTFCADQKAMGKDDFTKIPNGVNGVEDRMSIVWENGVNTGKLTWCQFVRATSSERARIFNIYPRKGRIDVGCDGDIVIWDPNQSKTISKDTHHHAVDFNIFEGIKVTGIAVTTIVAGNIVWSDNKLSCVKGSGRFVPRPPFGPVFDGIEQRDKVRNELLRKVDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structures of Dihydropyrimidinases Reaffirm the Close Relationship between Cyclic Amidohydrolases and Explain Their Substrate Specificity.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Hydrolase
molecule keywords dihydropyrimidine amidohydrolase
total genus 182
structure length 483
sequence length 484
ec nomenclature ec 3.5.2.2: Dihydropyrimidinase.
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2ftwA01
2D2GA 4KF1A 3SFWA 3TNBA 3AU6A 1XGEA 4HA0A 4C6FA 3MDWA 3PNUA 4V1XA 2Z27A 3URQA 1WXYA 4C6QA 2R1LA 3HTWA 2FTWA 3AU2A 1ZZMA 3TN3A 3E0LA 4GXWA 4WHBA 1BF6A 3LSCA 4ERIA 1W1IE 1EJWC 2P50A 3K4WA 3DC8A 3N2CA 1O5RA 1FKWA 3ID7A 2YZ5A 1K6WA 4CNUA 1RAKA 3EGJA 2WM1A 1YNYA 1FWEC 2QPXA 3GIQA 4DYKA 1R9ZA 3LS9A 4QTGA 3E2VA 1ADDA 1GKQA 4GC3A 1FWBC 4KESA 4RDVA 4UB9A 2BB0A 4C6KA 2R1MA 3IV8A 3BE7A 3GRIA 4LH8A 3RHGA 3GU9A 2VC5A 1P6CA 3LNPA 2VM8A 2EG7A 1FWDC 4R88A 1GKRA 3GTXA 3K2GA 4TQTA 2WJFA 4B90A 4IF2A 4ZSUA 4KEUA 1RK5A 4GK8A 4LCSA 4H9VA 1NDZA 3T81A 4NI8A 3IACA 3E38A 2OGJA 3OOQA 4NP7A 4DO7A 3IRSA 2Z29A 1M65A 3TN5A 3T1GA 2E25A 2G3FA 1POKA 4L9XA 4LANA 2ADAA 3OJGA 4EPKA 4CQCA 3DCPA 2FVKA 3WYZA 3F4DA 3TN6A 3QGKC 4ERGA 1UIPA 3NURA 4CNSA 2D2HA 3URAA 3IJ6A 1J5SA 4RDWA 1J79A 3PNZA 1EJTC 2PAJA 2VHLA 1V4YA 2HNHA 3MKVA 4GBDA 2F6KA 1KRCC 4C6CA 4LEFA 1A5LC 3PAOA 3R0DA 2YB4A 3JZEA 4DZIA 2OQLA 4RE0A 4ZSTA 3F4CA 2R1KA 4DIAA 1J6PA 3CAKA 4IGNA 3GUWA 3C86A 3OVGA 4I6KA 1RA0A 4RDZA 3LY0A 4LAMA 4KQNA 3V7PA 4G7EB 2GWGA 3O0FA 1EJVC 2Q09A 3HM7A 2FVMA 3DUGA 1DPMA 4XAZA 1V51A 2UZ9A 3WMLA 1A5KC 3ORWA 4KEZA 3FDGA 4GY7A 2ZC1A 4PCNA 4LAKA 1KCXA 1V77A 3TN4A 4CEXC 3WZ0E 4XD3A 4I6VA 1I0BA 1UMLA 2ICSA 4GZ7A 1ITQA 3F2BA 3LU2A 4R85A 5HMEA 4C65A 4QS5A 3URNA 2VUNA 4Z42C 2DVUA 3FEQA 3KM8A 1UIOA 4DLFA 4IFOA 4DI9A 2FTYA 3D6NA 3UBPC 3GU2A 3GTHA 1JGMA 4C6BA 4H9ZA 4KETA 2DVXA 4LCRA 4IH3A 3URBA 4B3ZA 2PGRA 3FDKA 1NFGA 2HBVA 4WGXA 2I9UA 4J5NA 1E9YB 1XRFA 4G7EA 5CH9A 3OU8A 2E1WA 2YB1A 1A5OC 4C5ZA 4KEVA 5E5CA 2I5GA 5HMDA 4P5UA 2HPIA 4CQBA 2Y1HA 4HK5A 2CZVA 3CJPA 2HQAA 1EZ2A 1QW7A 1FKXA 3ISIX 4H9MA 4PBEA 4V1YA 2IMRA 2VR2A 1M68A 4CQDA 3B40A 4IG2B 4PCPA 3E74A 1GKPA 1ITUA 3T8LA 1YBQA 4BY3A 4GY1A 4JOMA 1KRMA 4C6LA 4ERAA 3O7UA 3A3WA 4XAYA 1EJXC 3S2NA 4C6JA 4GOAA 1PB0A 4L6DA 4R7WA 4MUPA 4EP8C 5AKQA 5HMFA 4C6MA 1XRTA 3MPGA 4LCQA 1A4LA 3MVIA 4C60A 1KRAC 4LFYA 3GTFA 1V79A 3GU1A 4QS6A 2Z2AA 1S3TC 3AUOA 4GX8A 4NG3A 4E3TA 2R1PA 4C6OA 3G77A 3IGHX 1EJUC 3UR2A 2BGNE 5G4HC 2GSEA 2Z7GA 2O4QA 4PBFA 4KIRA 4G2DA 4LALA 3A3XA 3S2JA 1J6OA 2KAUC 4AQLA 1POJA 1FWIC 2AMXA 2OB3A 4LAOA 4IFKB 1FWFC 4QROA 3QGAC 2PUZA 2ANUA 3OQEA 1P6BA 1A4MA 1UBPC 1KRBC 3K5XA 1RA5A 4QRNA 2Z24A 4HK6A 4EPBC 4J35A 4EPDC 1XWYA 1PSCA 3RYSA 2UBPC 5FSDC 4XD6A 2YXOA 5FSEC 3EWCA 1A5NC 3MVTA 4XAGA 1FWGC 1WXZA 2QVNA 4HJWA 2EG6A 2P53A 3PBMA 3EWDA 3MSRA 4RZBA 4D8LA 1YRRA 4KERA 3GIPA 3MDUA 4UBPC 4H01A 2D2JA 1ONWA 1NDWA 1M7JA 2OOFA 3A4JA 2QS8A 3IPWA 4IFKA 2Z4GA 1NDYA 2OODA 1I0DA 1R9YA 2AQOA 1HZYA 4GY0A 2RAGA 3IARA 4YIWA 4B91A 3F2CA 4IQJA 3MJMA 4WVXA 3RN6A 4HK7A 3NQBA 3LA4A 4H00A 4BJHA 3MTWA 4IFRA 3UPMA 1YBQB 4XAFA 1PTAA 1RJPA 4F0LA 2GOKA 1A5MC 3LSBA 3RCMA 4BKNA 4PE8A 4C5YA 1R9XA 1IE7C 1ONXA 1K70A 2Z28A 3LGDA 3SO7A 1E9ZB 4XD5A 1NDVA 4H9XA 4C6EA 3S2MA 1EF2A 3HPAA 4ICMA 4C6IA 2Z25A 3PANA 3ITCA 1RK6A 3UF9A 1EJRC 4H9UA 4DLMA 1VFLA 3UR5A 3OODA 4IG2A 2W9MA 4IGMA 2Q01A 4RDYA 2AQVA 3LGGA 4AC7C 3QY7A 2PGFA 4J2MA 1RJRA 3GG7A 4DZHA 4H9TA 5A6TC 2HPMA 4GX9A 1FWAC 1V7AA 3QY6A 4F0SA 3F2DA 2A3LA 2HBXA 2FFIA 1RJQA 1FWJC 1O12A 4H9YA 4C6PA 1EYWA 1FWHC 3CS2A 2O4MA 4B92A 3S4TA 3E3HA 2WJDA 1FWCC 4CNTA 4F0RA 3GTIA 4EPEC 1PO9A 4QSFA 3E0FA 2PLMA 4CEUC 4GYFA 3S2LA 1QXLA 5LXXA 2WJEA 1YMYA 1EJSC 3QY8A 4C6DA 1YIXA 2XIOA 2QT3A 3ICJA 2EG8A 4XD4A 3B0YA 2GWNA 2VC7A 4OFCA 2GZXA 2DVTA 2Z00A 2Z26A 4DI8A 3B0XA 2Z2BA 2R1NA 4DNMA 3NEHA 4M51A 4C6NA 4INFA 1K1DA 1P1MA
chains in the Genus database with same CATH superfamily
2BOGX 2DJLA 1XGEA 5DQPA 1NWUA 3QYQA 3A13A 3O8AA 2B7QA 5I3FA 2PSNA 5AYZA 4Z08A 4DYJA 4WQ6A 1H09A 3VIOA 4Q4OA 1WV2A 3GXPA 3U2EA 2E6YA 3E0LA 1ISZA 2CETA 4F79A 3HMJG 2YFOA 4DYEA 5LSMA 3NQFA 3VM5A 5KITA 1BKSA 2KZHA 3VOCA 3P7YA 4B16A 3AXHA 2WMGA 1GZJA 2PD9A 3MQTA 1AUSL 1RAKA 3EGJA 3HF3A 4N9EA 1V6WA 3I4KA 5I3GA 4MVAA 4DYKA 5GQBA 1VRDA 4PL2A 1BLIA 2A3EA 1XKYA 2E7FA 3WJYA 1QATA 2GJLA 1P7TA 2YDSA 5BOFA 4LH8A 1KLYA 1RZMA 1GG0A 3BV4A 3GTXA 5I3HA 3P5ZA 3W1LA 1EDQA 3RITA 3NCOA 1OX6A 2DDXA 4DUXA 2MANA 4LBRA 4W7VA 3PJWA 4F0KA 3LZ3A 3NG3A 3EOLA 3O16A 2PC8A 2EKGA 1XISA 3H2OA 3OJGA 3FHAA 4RLIA 3RX2A 5A8NA 4X9SA 2D2HA 3A4XA 1QU4A 7PTDA 5FA5A 2DZTA 3S6DA 4AIBA 1A5LC 5CPOA 4PB5A 4ZVJA 5CPTA 3DZ1A 3R4IA 1RBOB 3AMDA 4LSBA 1OYCA 1BG9A 3H23A 2C1IA 1JYWA 4WXZA 4IISA 3MUZ1 3UCDA 3UCQA 4F48A 2PLJA 1LP6A 3A6OA 3VGGA 3TR9A 5DMYA 3CASA 2ZZ3A 4RPPA 1TKKA 1WBHA 5AY7A 4AVOA 2H8XA 4MWAD 4R85A 1SMAA 3UZYA 1PKYA 1CI1A 4GGHA 1TV8A 1K8ZA 2XH4A 2EBNA 4MKSA 2DIEA 2INFA 4GABA 2EO7A 2VGIA 1MUCA 1B3VA 2CNCA 1EBGA 3ITTA 3IVUA 1EEPA 4P8XA 3LHVA 1OF8A 3QW3A 4B3KA 4JIQA 3SCVA 2QKFA 4NYUA 5H6HA 2C71A 2FHCA 1AW2A 1OM0A 2A5HA 2VX7A 4ZB0A 1F6PA 3PTDA 1PHQA 2DGAA 1TPC1 4FXFA 3VAVA 4DZ5A 1X7IA 1W17A 3AOFA 4M8UA 3G2GA 2Z0IA 4NJGA 4PCTA 1F9CA 1FH8A 1FBAA 3RR1A 3W1UA 4IXXA 2Z6JA 4U3AA 3NQAA 5MKGA 3A4AA 4O4VA 4WKFA 4NZ5A 2A3BA 3QF0A 3W00A 2RGMA 4AD0A 1KW1A 2E40A 4BY3A 4LUSB 4IOTA 2VEIA 1QFEA 4HOXA 1R8LA 3G24A 3MMWA 4A3UA 1S1PA 3DHUA 3MMTA 4LCQA 5RUBA 3GXNA 3A5FA 4C60A 3IJLA 4H04A 3E0IA 8XIAA 4O10A 4ZOCA 3WD1A 3RM9A 3R8RA 3ZJ7A 3S83A 4JTEA 4HP5A 3RR4A 1YW1A 3TTEA 2GVGA 3Q45A 1ZGDA 2XG9A 1YEYA 3II1A 4FX7A 3IS4A 3KRZA 4G2DA 3A3XA 4PA8A 3BLOA 3F7JA 4OV4A 3SRFA 2ZX6A 1A3XA 4GQGA 4S3GA 4LVBA 5EA9A 5CGTA 4JTHA 4N42A 3PB0A 4DVOA 3OQEA 4QIUA 3VNLA 4QHRA 1CLKA 2E28A 3DFNA 1XFBA 3R1ZA 1MQPA 2ZUUA 3B9EA 1MW0A 1OGSA 4C1KA 5EBAA 5HPOA 2QVHA 4OIFA 2DZUA 1BTCA 3TNOA 1VHCA 4LT9A 3S8HA 3EWDA 1NFPA 4M82A 1XG4A 4OBTA 3NVTA 1XICA 4UBPC 4Y6GA 4F66A 3VX0A 4O12A 1NDWA 3IIZA 3D0CA 2QS8A 4XO7A 4LAUA 1F4AA 3OO2A 1UBSA 4CQ9A 4FLRA 4ZENA 3ZVHB 4DWSC 2AQOA 2ZX5A 3AHYA 2XJ7A 4DM1A 3BG5A 3NPXA 3EB3A 1LLZA 3CUIA 4MLRA 1MWOA 4GUJA 2WKLA 4KWWA 4EOUA 1E4MM 2Q8ZA 3WEZA 3LSBA 5D30A 4PE8A 3ZXWA 1US3A 2CLHA 4Q4PA 4C6EA 2Z25A 1MZRA 1RK6A 1WAWA 1EPVA 3UXDA 3AZTA 2YL5A 1E1CB 3M64A 4IGMA 3TQ0A 1EHAA 4MOZA 1AFSA 1VBRA 2XSBA 6PTDA 1W3IA 4H9TA 4YVVA 4W5ZA 1XPYA 3GNPA 5I07A 1QCWA 3TFXA 1OGBA 2X16A 2QF8A 3GAYA 4JIPA 5BXTA 4DB7A 1QPRA 3WQOA 1WKEA 1OFBA 3PG9A 1CXFA 2X0YA 1U22A 5F2LA 1SYTA 2D24A 4U4MA 3HQOA 3JU2A 3H2MA 1Q6FA 3UG8A 4LVGA 1BQGA 4MJMA 4Q7NA 4XD4A 2X8RA 3P5YA 1QBAA 2GUYA 3K30A 3S0CA 4D2JA 1XI3A 4JDYA 2REQB 2PDIA 3QFEA 3C56A 2H3DA 4AIEA 4Z1YA 1AJ2A 4DEFA 3KBNA 2BY0A 4E6MA 1C93A 2OYLA 3LERA 4ATLA 1E55A 4QNWA 2WHLA 1A3WA 2V63A 2PWDA 2BGQA 5T26A 2VRQA 2C8NA 4HNOA 2Z27A 2OQYA 1F73A 3D3AA 4PC8A 4WDXA 1JZ2A 1AQFA 3LBCA 3LSCA 3ZLGA 4LV9A 4F40A 2FH8A 4W86A 5BNKA 3W6LA 5HJYA 1O4UA 4E2VA 2GQAA 5M3WA 3KL5A 4UQEA 4QTGA 2W66A 3PPFA 2BB0A 1SO3A 4ZE4A 5KSWA 4YVXA 1PEZA 2DIJA 4TV5A 4OKDA 3QKEA 4PH6A 1J5TA 4PRTA 2QDHA 3RLUA 3S1UA 3OB8A 3KP0A 2XWDA 2WAGA 2VEKA 4QR6A 2G3JA 3T81A 3TVAA 3TYZA 4I3GA 3RX3A 3S5NA 1CNVA 4DXXA 2Z29A 1DWGM 1UPPA 4AB4A 3W9ZA 1K03A 3SGUA 4XZHA 1Y5XA 3S1XA 4GWEA 2PZNA 4D9PA 3TK7A 2E8YA 5JH1A 3VO0A 1BVWA 1J79A 1FOBA 3B8DA 2XIBA 3P81A 5C9UA 4FP1A 2OQLA 1Q6DA 3BLPX 4UTIA 4OVXA 2QIWA 2HWGA 1E15A 2VO5A 3W72A 1TJ0A 4HB7A 3OZYA 3VD7A 1EJVC 1KR1A 4IQEA 4DZAA 3A64A 3CWNA 1NQ6A 4OOUA 1IT8A 3RMJA 5DXYA 3KAOA 1A5KC 4FPSA 4GY7A 4REQB 4D1IA 1XYMA 2VWTA 1L6YA 3KRUA 1Q63A 1H7OA 3TN4A 3G0SA 5ECUA 1ITQA 1KTBA 4D8ZA 3URNA 4HOZA 1FCQA 2FLIA 3WQWA 4MY1A 3SCQA 3AIEA 3KM8A 4ALDA 4MNJA 3P8IA 3TTOA 2ZWZA 4C6BA 3O6YX 1AH0A 3BAIA 1GPWA 1XH0A 1NTHA 2IXVA 3CUXA 5DXXA 4TTGA 1PX3A 3GHRA 3W84A 5CBJA 4EAYA 3QN3A 2C79A 4JFVA 3UXIA 4O1EA 5KZDA 3GR7A 1SVDA 3H2AA 5H8MA 3MMUA 3VD4A 3N6HA 4IZGA 3VKAA 5FJUA 3GM8A 3O6DA 2FFCA 3WG6A 1Q3NA 1J2BA 4PBEA 5EMJA 4G9PA 3GXTA 5IBXC 2OOGA 1B0IA 4W7UA 4H41A 1PZ3A 3T8LA 5XIMA 3UNDA 5B7YA 3KOFA 3DFPA 1KRMA 4D6DA 4EVZA 1ESWA 4LUSA 3VNMA 3C52A 4IQLA 3DN5A 3GO2A 3NAVA 2VTFA 1H51A 1H5YA 3VK5A 2ZZ4A 3LK6A 5LNUA 1HXJA 4MDOA 5D2YA 4QP0A 1V6TA 1ZAHA 3QZEA 1FWSA 2JKPA 1S5VA 4IPJA 3E2QA 1CEOA 4IMFA 3ITGA 3U7BA 3DBNA 3AS3A 4E8GA 3VINA 1L8NA 5KMYA 1TTIA 1ZJIA 3S2JA 2BHZA 1KTCA 1POJA 2HS8A 3WLSA 3UCCA 3C61A 1YNPA 3UXAA 2FQIA 3W7QA 1EWDA 1ISXA 4W5UA 1YADA 3W7OA 5CG7A 1MI3A 3BMWA 1W9BM 1EYEA 3N3MA 3MP4A 1G7VA 4KCUA 1KFBA 4EPBC 4URIA 3VCRA 3WBYA 3RYSA 1QI5A 2WHJA 3RNDA 5FSEC 3MVTA 2W6RA 4HHHA 4CGTA 5A8PA 4F3HA 2C1HA 4PUKA 4WIWA 4RW5A 1ONRA 3M9YA 1DJQA 3WNNA 2VX6A 4GXMA 4PN2A 1XUUA 2WLZA 3N9SA 1XCXA 1VCFA 4O1AA 3R79A 4MGGA 4ROPA 2EPMX 1JD9A 4S3FA 3BARA 2VELA 3M0XA 2YSWA 4ZMGA 1KFEA 2OT0A 4IFRA 1SUXA 1QR7A 2E9BA 3RCMA 3SQMA 4C5YA 1ONXA 3M43A 2HXUA 4RPQA 3CPGA 2B4GA 2VC9A 2QF7A 1K7XA 1W3LA 3N2OA 5EGRA 5HMSA 3ITCA 5HNUA 4NT0A 1R3WA 4JTFA 2UY5A 3M4HA 3OG2A 4BHYA 5IXEA 3LGGA 3EDEA 3AXMA 4UFKA 5C7HA 4BZYA 3N4FA 4F9JA 1RJRA 3SDOA 3W7CA 3GG8A 4Y2WA 4NJIA 3VGHA 1FH7A 1W32A 2VNCA 3ZVIA 1RJQA 4V15A 3W7DA 4W88A 3BCJA 4W93A 1J0HA 2A3HA 3KBJA 1J0KA 2OYMA 3SRKA 3IVTA 1WX0A 1LROA 2HS6A 3GTIA 4EPEC 4GUFA 5E70A 3MSGA 5I3IA 1OX5A 2NX1A 1KKOA 3A4WA 3RGTA 5REQB 4G7FA 3H7VA 3AS0A 1CB7B 2PDHA 3T4CA 4FAMA 2JF7A 1YIXA 1MFUA 1UWQA 1JZ3A 2FGLA 2V5JA 3QOMA 1ZFJA 4DWSB 1E56A 3LXCA 2H8ZA 4S3KA 3KW3A 1OFOA 1K1DA 3BAXA 3JUGA 3EOUA 3ES7A 2DPEA 1JI1A 4UR8A 4E38A 1WE5A 3LPOA 3KX6A 4IP4A 2HCVA 3ANUA 3H2FA 1GHSA 1B3WA 3TQPA 4I9MA 1MFVA 3HTWA 4JTQA 2ZXDA 4G56A 2QUVA 3FVDA 1EJWC 4KWOA 4NILA 2ZUTA 2EPLX 4GYJA 3V0SA 1O5RA 5CC3A 4ZZ9A 6XIMA 4BQ3A 1GQIA 3TJIA 3NQGA 1AJZA 4AD2A 4H1ZA 4Y8EA 2H9AA 5H91A 2C0AA 4X9YA 3WNKA 4GUGA 1FWBC 3SM0A 3EA2A 1QWGA 4A2SA 4LBSA 4FXJA 2EJ1A 4ZCWA 5D9OA 4GCXA 2VR4A 1SZFA 3GTNA 3IACA 3E38A 1QW8A 3M0KA 4DJFA 1POKA 4LGXA 2EJAA 3M46A 1JRBA 3VMNA 1V93A 3PFMA 1MMFA 3WF1A 1DXEA 1Z6KA 1EH9A 1TQJA 3S5SA 1WZLA 3T2PA 2VD9A 3HPXA 1P0DA 1O5KA 2QJNA 2HVNA 4IX2A 4QE1A 4JY8A 3CAKA 3OVGA 1RA0A 4HNUA 1TTJA 1RY8A 3K4AA 3PB2A 3VUSA 3NZPA 3STEA 3B8VA 4ZQOA 1GVIA 4M80A 1U1UA 1UH2A 3PBVA 4XO6A 4TMCA 3WQ8A 1FX6A 1V77A 2UV8G 3UYIA 1D8CA 3E12A 1W8SA 3MKKA 3R0UA 2TPSA 4WDWA 2WSPA 1C29A 3W22A 2Y7FA 4ZR8A 1CGTA 3CNYA 4I8DA 1Q6QA 4B9YA 2XFWA 3QPEA 1PKLA 3QZ6A 3H4WA 2ZRZA 5BWFA 2ZFAA 1ODUA 2OO0A 1LG2A 1CLXA 4LCRA 4B3ZA 4EXAA 3SI9A 3CQJA 3UJEA 3RJYA 4GI8A 2PS2A 3B06A 1AW5A 5HUPA 4K6AA 4QJ4B 3SQLA 1YQ2A 1XIDA 2REQA 4GZJA 4CQBA 3GDMA 3GR4A 2XVKA 3QMTA 3GKAA 4B5TA 1TE1A 1K9FA 1FH9A 1XLKA 4LQ1A 4NRSA 2O7SA 4NIRA 4V1YA 4IHCA 1XBVA 4Z2IA 2GL5A 3R25A 2IQDA 3QV8A 1GEQA 3WLOA 1X7FA 2QGYA 3EKZA 3GDLA 1PVNA 4CU8A 1JRCA 2YLLA 4JPGA 3RK8A 1BWVA 1LF1A 4LYQA 2PDBA 1S5NA 5HNTA 4C6JA 1NH6A 3OA5A 1W1B1 1A53A 1SO5A 4RNHA 4Y9MA 3TX9A 2AL1A 4UQCA 1RP9A 2PLCA 4DAFA 3AUOA 2WANA 1XIEA 3D46A 4QEEA 4LUTB 1UP0A 3N9RA 3TYEA 2V81A 3VD5A 1VHNA 2GSEA 2BXYA 2EEXA 1HL8A 1QBBA 3W2JA 4S23A 2DH2A 2WWDA 3EX3A 3SJ3A 2W5FA 2XIIA 1JXKA 3GVQA 1XLFA 4M6VA 3QGAC 3RU6A 2JKEA 2OSXA 1A4MA 1TTPA 4HPXA 1EFZA 2VCAA 3UR8A 4HK6A 4LNCA 3HV8A 5I03A 1CGXA 1QI2A 4FI4A 2C6QA 2QVNA 2YA1A 3SUTA 4Q3MA 1U33A 1UHVA 2FGZA 3GIPA 1GOMA 3CV1A 3LPGA 1M7JA 3V0UA 1AQ0A 1KGWA 1B3ZA 3T0CA 4A8LA 1JDCA 4K3ZA 4MY9A 1EHNA 4XZIA 1YE4A 2Q8XA 1V3MA 1X98A 1JPIA 4CU6A 2VD8A 4OHQA 4EIVA 2XIQA 2ACRA 2ACQA 4H6RA 4NU7A 3L4UA 4DBUA 1WOBA 3OHIA 4FNSA 3AYSA 3GY1A 3LCGA 3OIHA 2QUUA 4XAFA 1WKDA 1PTAA 3F4VA 1KCLA 3WMCA 4LVFA 3L4VA 2V8ZA 5D38A 4GYKA 2XVPA 1W54A 4OUIA 5FD0A 1TPB1 4WY0F 2NXIA 2WMJA 4L9YA 3B0PA 3VIGA 4ICMA 1V0MA 4C6IA 3EWUA 1J01A 1GZGA 1WBJA 4Q8TA 2AQWA 4FX6M 4DLMA 3OODA 3WIJA 4W89A 2NXHA 4H8VA 4Q8NA 3W7IA 2PGFA 3SGGA 1OINA 1F6KA 3U4AA 4TVCA 2X05A 3MP5A 1JCJA 4MWAB 4DAIA 2HBXA 2FFIA 1UR4A 4KRZA 3GR8A 3NYZA 4UTHA 2GGHA 2OEMA 4H9YA 2X40A 3CS2A 4JDBA 4IMAA 1H7PA 2FB2A 5E0CA 1KA9F 1W3NA 2J7HA 4X61A 2WZEA 1ME7A 4H7ZA 1JUEA 4F0RA 3O63A 1YXCA 5AC4A 3EBVA 3CZKA 3G6MA 1X1OA 3BC9A 4WLCA 3WLNA 3CL6A 5GJPA 1Q7MA 3SCSA 2GWNA 4OFCA 2Z00A 3B8UA 2FPVA 3RMEA 2R1NA 2QZRA 4A35A 5JH2A 1QO5A 4M51A 1QPNA 1J18A 2QJMA 2OPJA 1M7XA 3BMXA 4MTVA 3CQHA 3VYLA 3S3GA 1L6SA 4HU3A 2EF9A 4WDTA 4C6QA 2H6RA 2TAAA 1JG9A 3BV7A 1HFBA 4DJDD 3CO4A 1RUSA 1J10A 1A0CA 2BSLA 1E6XM 4CNPA 2HSAA 2X2YA 1Q6EA 1GOOA 2HK0A 9XIAA 4DO6A 3WNMA 1YNYA 5U4NA 4Z1DA 3K13A 4MKVA 2DQWA 1RPXA 3G1SA 3PPHA 1F07A 1R6WA 3BW2A 3IEBA 4P61A 5TIMA 3BE7A 1QI0A 3MWCA 3GRIA 2QMKA 1HQTA 1V3JA 1FWDC 3JW7A 4B5WA 3VDBA 3WNOA 4GK8A 4GJIA 4JTKA 1VCGA 4G8TA 4X22A 5FJOA 2GJXA 4BQ4A 2VYOA 3GBDA 5DRCA 1LG1A 3IRSA 1O5QA 4FR1A 4GG9A 2W3ZA 4Q22A 1EQPA 4NHVA 5E6ZA 2C18A 3WQFA 4AY7A 4CQCA 1IYXA 3U6WA 2PDUA 2NUXA 5A94A 2ZX8A 2PC4A 3LBMA 4LW7A 5FJRA 5KINA 1B90A 4Q32A 3MT1A 4CNSA 4CVWA 2X2GA 4XK2A 4X2PA 1EJTC 3FJLA 2PAJA 2J7CA 2HNHA 4O15A 4GNKB 2QDGA 3WL1A 3FXGA 4DZIA 4HD5A 4XZMX 3K8KA 4PCFA 4ML9A 2PB1A 2WC3A 4AEOA 4DELA 5H8PA 3F1QA 4XTIA 5E6YA 2VI0A 3ARQA 2O7QA 1NWTA 2XFFA 5EMYA 4K2SA 4UOQA 2G95A 3TCSA 1XBZA 1CCWB 2VX4A 1B3YA 1PHWA 2IW0A 4Y8FA 2ICSA 3LU2A 1FXPA 4JY9A 1KWGA 4GGBA 2VUNA 2DT3A 2ASHA 4L56A 2H9AB 2CLOA 1KM5A 3MHUA 3U2CA 3CIWA 3EOEA 2WJZA 1XIBA 3EMQA 3BK0A 2IQ0A 2V5DA 1NFGA 2XSXA 1EB3A 4MNKA 2HBVA 3FJ4A 5HJLA 5I77A 2BHYA 1K4HA 4C7GA 3VIKA 3G8EA 2NSXA 3UFYA 1ZY9A 4W8AA 1QPOA 3ANVA 3IVSA 1RXOB 2X1SA 4ZQCA 2VR2A 4OT7A 1UKPA 3G8RA 4HSHA 3WDPP 3LCLA 4YN5A 3WSUA 1TE6A 1XH1A 1YBQA 4R27A 4F9DA 1MUWA 3IIXA 5E93A 3CQKA 3G18A 2RDWA 1LL4A 2IKGA 5FACA 5GNYA 5FJPA 3VNJA 3CUGA 1Z42A 1PZ1A 4PMDA 2NLYA 3L7RA 1TA3B 1KBIA 3NQMA 2J47A 2OSWA 3T09A 1DXFA 3LXAA 2E5CA 4MF4A 3GDKA 3XISA 3EXTA 2J7DA 4AZ7A 3AHVA 1AQMA 6TIMA 5E09A 3HFYA 5C2GA 1D3CA 4AWSA 1P5BA 4E3TA 4PMXA 1VFFA 3CQIA 3VX1A 1W9XA 3P0XA 4Z2GA 2KAUC 1QNSA 2PDGA 3ZT7A 2WPGA 2WMFA 1E72M 1FWFC 4CD6A 3CQ0A 2G8ZA 3PZIA 4IP7A 3BG3A 1KRBC 4U33A 1RA5A 4DXVA 4P8WA 1KB3A 5AHMA 4OECA 1OZQA 3E1F1 3IUDA 3TZNA 4ES4A 3AHZA 3DH7A 1J0ZA 3GW0A 3ARPA 1TPH1 2VFEA 1LOQA 1UD8A 3MDUA 2OOFA 4O0ZA 3CTLA 2ON3A 1X8FA 1EXPA 2G37A 4MNMA 4IFKA 3FGCB 4NRRA 3I3EA 5LNVA 1AODA 5FJTA 3WBAA 3WQPA 4H00A 4M81A 2CHOA 3LV5A 1HGYA 1XG3A 3VNDA 5XIAA 4ACZA 2BS9A 3TOYA 4QDPA 4F2TA 2J8TA 4A3RA 4HYRA 4ZL1A 2VL4A 4JTUA 1D7FA 4GQQA 3SCPA 1R9XA 1DQXA 1K70A 2WCSA 1QOQA 1Q6RA 1E71M 3GZ3A 4AHOA 5A6MA 1E0TA 5CXPA 2GVLA 4LUIA 4KPLA 3M0LA 4AX6A 4RE4A 3RX4A 1LOLA 2BXZA 4KWVA 1ICQA 2OCZA 3P80A 3NM1A 1UR0A 3WF4A 2BOFX 4QLKA 5C9WA 4Z1AA 4O18A 3THUA 3OW1A 3GG7A 4GX9A 1I2OA 5I00A 2I5QA 3VGFA 3HFTA 4PUEA 5T9BG 3FS2A 4PUNA 1XRVA 4Z2JA 5A6BD 3FSUA 1H0GA 3ENLA 1ECQA 4OUEA 4WGHA 5FEXA 1LL6A 1JDEA 3HURA 1CZ1A 1AW1A 1A5SA 4C6PA 5F1VA 5G4EA 3S4TA 4K7YA 7CGTA 3CZEA 1XLAA 3CO8A 5I7GA 3FKKA 1S2UA 3WD3A 3L5AA 3E2RA 1YMYA 2A7RA 1EJSC 3UWEA 2WBKA 1AZ1A 1FHVA 4IIFA 1UC4A 2GZXA 4PSRA 3BLDA 2HISA 3UXLA 4AD5A 1E70M 1WDPA 3O15A 3CBWA 2F6XA 4DN1A 4E8DA 5TNVA 3FY1A 1F3XA 7REQA 2HJPA 4IPPA 5HINA 1CBGA 3W24A 3DYPA 2ZIDA 4QAWA 1XH2A 1DJGA 4DRSA 5F4XA 1X96A 4HZ6A 4YL2A 4C6FA 2BP1A 2EAWA 4ZQRA 3IAPA 3VGEA 3CMGA 4V1XA 2G3NA 4YWSA 3MI2A 3F03K 4AZHA 3WFAA 4GIEA 4PULA 1PAMA 4GXWA 1XW8A 4ERIA 1W1IE 3BUVA 2XVLA 3LG3A 3P84A 2J78A 5PTDA 4S39A 4I90A 4YTUA 3K4WA 3P14A 2VXNA 1DQWA 1LDCA 3WQ6A 3EDKA 3PWGA 4L4MA 2ZZ6A 3LMYA 2GGIA 1DWHM 2POZA 3N15A 4JXCA 5G1YA 1W9UA 2R1MA 4OJYA 1DKWA 5HOSA 4UMAA 1Z48A 3G1HA 1K6AA 1TZ9A 2CZ5A 1JDFA 4LCSA 1EP1A 4I7VA 4ADUA 4NI8A 3W7PA 1ZLPA 1ZU8A 4FO4A 3VC6A 2FZ9A 3WD4A 3TN5A 1BXBA 3QV6A 2G3FA 4AG0A 2EHHA 5T9CE 1OD0A 2IKIA 2CLPA 3C0LA 4YS1A 2VZOA 4ZTYA 4HNNA 1UD2A 1NP0A 1N8WA 2GUUA 2TODA 4QBXA 4U3CA 3JZEA 5F4SA 1RLCL 4WKHA 5D4YA 3BAKA 3NGJA 3WK0A 1M53A 1VJIA 3MV01 2HVOA 4UTMA 4L4PA 3GNNA 3ARVA 3R12A 4KQNA 4G7EB 1UWAA 4AXKA 5M1TA 4XZBA 5JMUA 4DPPA 3M44A 3C2RA 4GACA 1L8PA 2NQ9A 3MJYA 4J3VA 3KTSA 4AZ6A 3NO1A 3WZ0E 2EQDA 3FKRA 2OEKA 5TF0A 4J3ZA 1V8EA 3UT0A 4GYPA 4AFYA 2WVVA 1TRDA 4M24A 4ZO8A 3KVJA 2OT1A 1BXCA 4FMVA 2QUTA 3D3FA 3WQ4A 4AZ5A 2VDIA 3UBPC 1EEXA 1IR2A 4PTDA 3NL6A 3F5JA 1A80A 3ABXA 1GORA 1R46A 4L65A 2DZVA 2Y4SA 3OP2A 1ZBVA 2OSYA 3ONBA 4KEMA 2FZMA 3B04A 3WL0A 1XSKA 1HF6A 3NNTA 4K36A 3W53A 3LCWA 3ITXA 4J2PA 3KHDA 4HK5A 2IKHA 2JIEA 1KM4A 3ARTA 3R10A 1MO0A 1UKTA 4ZXOA 4JD4A 3G1VA 3N11A 2DIKA 1M68A 1FUYA 3W7MA 2G5WA 1W1VA 2CBUA 4HBKA 3W2KA 4TVUA 3H4XA 1KWKA 4QGCA 3W71A 4C6LA 4RNIA 2QJIA 3L4YA 4FNRA 3MV11 1XRTA 4WEVX 4HCHA 1XP3A 3A22A 3TE9A 2JGQA 3GU1A 3IV3A 2XN1A 2CEQA 3IWPA 1F74A 1TPWA 3NQVA 3U0HA 3W25A 1JYVA 3T42A 1Z89A 2CBJA 3BAJA 4FLOA 1V6VA 2NSOA 1D9EA 2RJHA 4IICA 1GJPA 2CZFA 3R43A 2WCAA 5K3VA 1DJIA 1ITXA 3M7WA 4YTSA 4KCTA 2W61A 1LTDA 4AC1X 2D23A 4W8BA 2J75A 3GC2A 2QUNA 4M3PA 5EFDA 1W3HA 1V3IA 1C90A 5ABHA 3UP8A 3KWSA 3REQB 1QOPA 3WLQA 3GW3A 1DIEA 4O1FA 2TYSA 1NOUA 4K68A 1TZZA 2EPNA 3M07A 4HJWA 1W5NA 2IUZA 1LBMA 1XBXA 4D8LA 3AYRA 1W37A 3W6MA 3O6CA 2D2JA 2DUAA 2RH9A 1JDAA 3ATZA 5CC5A 1H7RA 3CB3A 2ZZ2A 2V3EA 1XLMA 5LIYX 2BLEA 2O56A 2C15A 3E96A 5KZ6A 2V68A 1E9IA 1XXXA 1UUMA 1IEIA 4MKNA 2VMFA 5G2WA 2NVCA 4XWUA 1PJ9A 3LTSA 2OJPA 4N7QA 2AL2B 3ES8A 2JBMA 3THAA 3UPMA 2WMKA 1KXHA 1UC5A 5LXEA 2BFGA 3NQ6A 2J62A 1EO5A 1WZAA 2OQHA 4D1JA 2QHAA 4XD5A 2DP3A 4YTQA 1VZWA 3PTMA 1ONEA 2YBUA 3WLMA 3WDHA 4AIUA 3PBUA 5C8BB 2NQHA 1A5AA 1LBFA 3FN9A 1RCXB 3W1NA 1I2RA 4JL1A 4ZQPA 5C9XA 4BQ5A 2W4XA 3N2BA 1YPXA 1EUNA 3V5OA 3JRKA 2CLMA 5F4WA 5FF3A 2CXEA 3LBOA 4JN8A 4QDMA 1F8MA 1S3HA 4KRTA 3M0JA 3U2ZA 4EE9A 4CNTA 1OVDA 2P8CA 4QSFA 1XPGA 3NZRA 3MHFA 4JAWA 3CMFA 4V2XA 1L2QA 1VFSA 2WJEA 2MNRA 1WUEA 4I9TA 1HW6A 3NSXA 2PDNA 2QT3A 3PY2A 3H2NA 2VC7A 4K8EA 2QDDA 2V5BA 1SJBA 4F2BA 1X6UA 1XUZA 5DT7A 1LWIA 3C3UA 5GPRA 3P62A 1M6JA 3M5ZA 3ZIZA 2VCCA 1W91A 3CMJA 2JIWA 3BG9A 3AUJA 4HMNA 2F8QA 4ACZB 3OZOA 4WZHA 5DCBA 1Z69A 1G7UA 1T96A 3W7KA 5C9RA 1TIMA 1PYMA 5IFTA 5AC8A 2XGBA 1JAKA 4EXQA 2R1LA 3ZZ1A 3L5MA 1W6TA 1JZ7A 4ORIA 3ZQ9A 3DI1A 3V5FA 3H2EA 2VWSA 3BQ6A 3TCEA 3GYCA 3ZJ6A 5CGMA 5AZ1A 1K6WA 1OWQA 4U31A 1J8VA 4PGLA 1E3ZA 3GNOA 1T5AA 1M03A 2YJQA 1DJNA 4ZQNA 2Y7DA 3MC5A 3WH8A 3BW3A 3MU7A 4MZYA 1HG3A 1PWMA 4IM4A 1W5PA 4JTCA 4ZB5A 5FKYA 2VC5A 3LNPA 3W0KA 3W29A 1GKRA 3UEQA 3TQKA 2GJXB 2NXGA 2EXOA 3KHJA 1BVNP 4CLMA 3IUHA 3D47A 2GSJA 6A3HA 1JPKA 1KXQA 2YKKA 1B54A 3ARWA 1VFOA 4LANA 1XGDA 4HPNA 1Q66A 1YTDA 2D0GA 4JZ5A 1TR9A 4JTSA 3IJIA 4RXGA 4ZO9A 5KZMA 3WUBA 1OJXA 4LUYA 2WNWA 4AEFA 3PSWA 3BSMA 2VHLA 4C6CA 4MUZA 3RF9A 3LTYA 2GJNA 1K9TA 1R7AA 1HKMA 1W9PA 1JPDX 3JVAA 4D71A 3NZ1A 4IGSA 1PZ2A 3RAOA 1IIGA 3LXBA 3S47A 3W2MA 4RDZA 3NFUA 4QM1A 3G0UA 5M03A 4DUOA 2Q09A 1QRQA 1IXNA 1RR2A 3PUEA 4UFJA 2MUCA 4LUTA 2BVYA 3FYPA 5K9DA 1LM1A 1R5YA 4WRHA 4GNVA 2E67A 4L61A 2VP8A 2OELA 1IZJA 2ZA2A 3SQSA 4Z42C 4BEQA 1M41A 2BZNA 1Z3NA 2DH3A 2VVSA 4M6UA 2VENA 1PBGA 3C4UA 2OZ0A 3UWQA 4DLFA 4HMEA 5LIUX 3PPCA 3FA3A 3CWOX 3ALGA 5HWJA 1RQHA 4ZOBA 4K37A 4KETA 2YXXA 2PDMA 1VFTA 5HATA 2X1IA 3E5BA 5FI8A 1VR6A 2Y6ZA 4OWGA 2AL2A 2V2DA 3DKLA 5LGZA 2I5GA 3AMGA 4D6CA 2HPIA 3ZSSA 3WELA 4PODA 1AZ2A 2JKAA 2FB3A 3WBEA 3ARZA 4IPLA 2VEFA 4GUIA 1VJZA 3GDTA 4C90A 1U5HA 4E4FA 1ITUA 3QVQA 1H61A 1UZ4A 1LOSA 4CD4A 3SRHA 3G1DA 1U5JA 3VILA 2OR2A 4XSLA 2ZUMA 2GVJA 1VFUA 3R6IA 4GY1A 3ABSA 1SFJA 3B8SA 3VKJA 3SB0A 3Q67A 3S2NA 3QV9A 5AC6A 3KCLA 3EEZA 1XLDA 4EP8C 4XIAA 2B7NA 5AKQA 3WEOA 2OZ8A 1XCWA 4HTYA 4R33A 4NY2A 5E9XA 1VBUA 4FNQA 1V79A 4E2BA 5L6UA 3FV9A 1W31A 1Z8AA 3SCNA 3TEVA 4NG3A 2A2IA 3G77A 1EJUC 4H8UA 2BGNE 3MZNA 2ZRVA 5H1WA 3EMCA 1I2PA 4GPNA 1M3UA 3APYA 2ZXAA 3NO3A 3W2LA 1CECA 1M04A 1TWZA 4LAOA 5LKYA 4LOCA 1TVPA 4IFKB 4Y9PA 3VABA 5D02A 3B0UX 3SN4A 1GYNA 3OBAA 3SY1A 2B7PA 3UNTA 4LYKA 2I14A 3ZR5A 4V33A 1UBPC 1DWIM 2OWWA 2FKPA 2RDXA 3U3HA 1D3HA 3N17A 4J35A 4OGZA 4EPDC 1XYBA 1Q4NX 3THCA 1VCVA 3T9PA 3EWCA 2Z1VA 3A5VA 4L1WA 5GNXA 3NQCA 4MJ4A 4HU0A 3GXDA 1FCBA 3W6YA 4FR6A 4H01A 1CXEA 4E0CA 2DT0A 2NUWA 3GX9A 1CYGA 4N0RA 3L2IA 1NDYA 1WZKA 1HZYA 4Q6JA 2F6UA 3C2YA 3U9IA 4IQJA 1QK0A 4GQBA 3ECQA 3PZMA 7ODCA 1R3SA 3I65A 3KBSA 4NJKA 4B9ZA 1E0UA 1AH3A 1IE7C 3LGDA 4UQ9A 4IL0A 1G9HA 2PCEA 5F2IA 1OG6A 3L66A 2J79A 4H9XA 4AD1A 5A6BA 1EF2A 3HQ1A 1T99A 3QRHA 3UR5A 4NQ1A 1B4EA 2Q01A 2YGYA 4M0XA 2A6LA 4IMDA 4EAMA 3H26A 1F6YA 5HULA 4JQ4A 4WD0A 3GHSA 3GFZA 1CENA 4M6QA 3TWBA 4MG4A 3N2XA 5AVHA 5BU6A 5AFDA 3AWOA 2V6AA 3BICA 1I75A 4O53A 1BSIA 4KRUA 2HVMA 2VJXA 5F2GA 5K9XA 1JCNA 3O07A 1SSDA 1TV3A 1UOKA 2EG8A 3STPA 4QG9A 5KEZA 4EKJA 1WXJA 2CLKA 5LA0A 1VGAA 4R34A 4PRRA 4LAZA 2Z2BA 3EXRA 3N6QA 2BY2A 2HTMA 5I6SA 1JF6A 1KM2A 2XINA 2QPUA 1BD0A 3TJ4A 3TNBA 4UNIA 4ZBCA 4IUOA 1VRXA 3N4EA 3LD5A 1HJUA 4GVIA 1XM3A 3VPLA 1FXQA 2GSHA 1WO2A 5D2TA 3URQA 1RCQA 4QAIA 2OG9A 4O28A 1LYXA 3IAQA 5F2MA 4PUJA 3NXLA 3TA9A 4NZFA 1RLDA 2P50A 1XYZA 2VKZG 1JZ8A 1JCMP 4NAEB 4GO8A 3NM3A 4FNUA 4JHOA 2AKZA 1DJZA 3GIQA 5DCDA 4IP5A 1Q7ZA 5EU9A 3W01A 1UA3A 4S3JA 2Y8UA 3LI1A 4J3WA 2CKSA 4NAFA 5C7VA 2J7EA 2YCLB 1PXGA 3GU9A 3C5QA 1W2PA 1B5TA 1XC6A 3SUVA 3GB6A 4F4RA 2OMAA 4N9CA 1GVSA 2OLAA 2PD5A 5D9NA 3W7JA 5A6JA 3I6TA 3MB9A 4DO7A 2E25A 1PKMA 2GK1A 1HT6A 9CGTA 3QJAA 2WSQA 2XHYA 1BSLA 2EPOA 1GQLA 1W2VA 3EDJA 1TPVA 3UA4A 1B9BA 5CQ1A 1R3TA 3B9AA 5EBUA 3BCFA 3KLLA 4ZSTA 4J3SA 3A12A 1G69A 4M7SA 1KFKA 3NQ8A 1TELA 3M16A 1E6QM 1H5VA 4HA4A 3DGRA 4X63A 5REQA 4HVXA 3V7PA 4Q7BA 2Y7EA 3HPZA 2Y5JA 1GVOA 3VVGA 3AMKA 3DUGA 4PB4A 3CL7A 3FFSA 1S5MA 1V3LA 5CPLA 2ZC1A 3H54A 1XD1A 3CPRA 3DESA 3IGSA 3HZ3A 1U83A 1S5TA 1UMLA 2YCEA 1EOKA 3R8HA 3F2BA 3GDBA 4Q4KA 4QS5A 5C2XA 4OQVA 3CC1A 2YA0A 3GHUA 3L2MA 2QEZA 2BMBA 3VC5A 1CGVA 4H19A 1ZJHA 3OZPA 2WWCA 4B3LA 2NW0A 5A2CA 2VURA 3AHXA 5BCAA 2D3NA 2FMNA 3FJ6A 3VD3A 4HJFA 3PUDA 4LYRA 3H8AA 1G4SA 1RHCA 3LCIA 4E2OA 4AY8A 1MQRA 3S5ZA 1AD1A 3GKFA 3ATYA 4RV3A 1HJVA 3FLUA 1K4GA 3BLIA 3GD6A 4TU1A 4JTGA 2HQAA 4NNCA 2WYSA 4HHLA 3G3DA 4GIAA 4ZFCA 3WBWA 1HJQA 2WCGA 6ENLA 2VGBA 3MY9A 2GGGA 4JOMA 5AHNA 3B3DA 3FIGA 4LY4A 3GFYA 2XFYA 4GJ1A 2J6XA 4L1XA 1H63A 3BGGA 3H12A 2ZQ0A 1JQXA 5CEWA 3LTPA 4FNPA 5CGQA 3GTFA 3KS6A 1PL9A 2OWCA 1SZGA 1GOKA 3W76A 3HGJA 3KBWA 1PPIA 3EWWA 3M5XA 4MIMA 4GI9A 1W5QA 4IJRA 4PUWA 4WJ8A 4DF1A 3PTQA 1EX5A 4KIRA 2JALA 4XVDA 1KQYA 3L0NA 1Q7QA 1TV7A 3TYBA 5I5RA 3AWNA 2BV9A 5I09A 1GYMA 3THDA 2F38A 4U5IA 2I16A 3KTXA 2Y7GA 4UTFA 1DL3A 4ECLA 4QJ1A 3SZ8A 1H3GA 1NOFA 3ZWTA 3KRSA 5DF0A 3B97A 1R30A 3U2OA 3CHVA 2YXOA 3AC0A 5IFPA 1ZENA 5CZJA 4MWAC 1FWGC 4XKMA 4ILSA 2EG6A 2P53A 2R91A 1UR3M 1QPQA 2PWVA 3R2GA 5H2ZA 3CEPA 1Y7VA 4AW7A 2C91A 5DCEA 3I4EA 4GINA 1PS9A 3OYZA 2Z4GA 5TQLA 2HXTA 4A21A 4MPKA 3IGXA 3O05A 3C6CA 1YXDA 3AXKA 3NL5A 3H22A 4MAVA 2NWSA 1XQLA 1V7YA 4KBXA 4UMBA 4L7ZA 1PIGA 2FPTA 3I6EA 3TKFA 2C7FA 4O54A 1Q4WA 1JGIA 1GPFA 3RLGA 2PDYA 4N9DA 1JIBA 1QPKA 3WDJA 3DXIA 1H11A 3PANA 1OZMA 4WOQA 1H1ZA 5HR6A 3LRKA 2CBIA 2W92A 3TAOA 2A7PA 1H4PA 2DSVA 4J2MA 1MQQA 3YPIA 1AL8A 2ZCGA 4RUBA 4CD5A 1TFVA 2NUYA 3RM8A 3WENA 4J4KA 4QE4A 2PTZA 1FWHC 4UTTC 4NZ1A 1L6FA 4MSSA 1IZKA 2A21A 3IUIA 2YBVA 4DBEA 4JYDA 5MF5A 2J77A 2PRHA 3AS2A 5IDIA 4DJDC 3RLVA 2YA2A 3H7UA 1UUOA 2VRKA 2DVTA 4E3VA 1PTDA 3UG4A 1XLJA 1OEPA 2PDKA 1GOWA 1GW1A 2VFDA 5HDRA 1OADA 5BMWA 3KZSA 1P1MA 3OPSA 3A21A 2YXGA 3GVVA 5FF7A 3WJXA 2AGTA 3GLCA 3P6LA 3ZMRA 1OK6A 3MDWA 3LUTA 5D9MA 1BGAA 1ZBCA 3PM6A 4S2BA 1WB0A 3R0KA 4C1LA 2Z6IA 2Q3OA 2V38A 3GUGA 1LBLA 3OZMA 1BRLB 1EF3A 1NAL1 1UD6A 3H2CA 2D1ZA 5D33A 3EPMA 3BCDA 3PULA 4AWEA 4ZGYA 1WYIA 1LQ2A 4DO4A 1A0EA 5A8QA 1S38A 5G2HA 2X0SA 2A0NA 1P43A 1KFWA 1ELSA 3FOKA 3MA8A 2CHNA 3K1GA 1F3TA 5IM51 4FB7A 2E68A 2CESA 4BS0A 4UTTA 1PZ0A 3DYOA 3RHGA 3CHCA 2Y85A 1G01A 4BI5A 4MB4A 4TQTA 3FA4A 4B90A 1XSIA 4B5SA 5I06A 3LCXA 2QW5A 3SN0A 4Y9NA 1NSJA 3R13A 3P0WA 4MYAA 4CNNA 1OSEA 3MYPA 1EZWA 3F4NA 4MMWA 2FVKA 4ZFMA 1ZSXA 4R7OA 4X0NA 1TTQA 4B2DD 2B81A 2X1TA 2WQPA 4ATWA 1R86A 1BEUA 3M0HA 1Z32X 1V4YA 1YNQA 4HNLA 1FP8A 2QUMA 1UWTA 4LS2A 1NY1A 2PDCA 1PWLA 1TJ2A 1M1BA 2R1KA 2FZBA 3BZGA 1FWWA 4S2CA 1D3GA 4JKMA 4QJ5B 3M0ZA 3VFLA 2V67A 4PMUA 1EDGA 3NUKA 1MNZA 2BTMA 2ALRA 4N02A 1KD0A 1DJXA 1Z41A 2YW3A 1KLZA 3N12A 2PWEA 2UZ9A 2V0TA 4M19A 3UZ5A 4PCNA 2D0FA 2F7FA 3SCOA 2FHBA 4B5VA 3I68A 3PBGA 2HNEA 5CLTA 1GTEA 3SSZA 2RDUA 1DTNA 3M0MA 1C8YA 7TIMA 3VOGA 3POHA 4Z2HA 1E4NA 7REQB 4RV8A 3CEUA 3K4DA 4PMRA 4DM2A 4IFOA 3O1NA 5DY2A 3B4UA 1W3KA 4O16A 3WQCA 1JGMA 3KEHA 4PSPA 1Y65A 1JNDA 3IJ8A 4PRWA 2NZLA 2FMOA 1XJBA 4GXPA 3MHGA 2Y2WA 2ISDA 4GI4A 4DPQA 4HNTA 4O0KA 2Z1BA 4QEHA 2OZTA 4P5UA 2NQZA 1JI2A 2CZVA 3CJPA 3DKJA 3QPYA 1TIWA 3WUFA 1FFQA 1FP9A 5D8ZA 3BSHA 4ZXLA 2Z1KA 1FKXA 4UFMA 4O13A 2NV2A 2VC6A 3BWWA 3R8GA 1Y5VA 4GBUA 4J9JA 5EPDA 4GC4A 4NNAA 1J11A 3IIOA 3TLLA 2YL8A 2CLIA 3FX4A 3W07A 3TROA 4GIRA 1KFCA 3AFBA 1X38A 1KBKA 2ZRYA 5HMFA 1QHOA 1C3FA 4WSJA 3MPGA 5HWNA 4JCLA 4GUHA 1I60A 3KRBA 1N8IA 1KRAC 1P4CA 2HK1A 3QZAA 2PGEA 5JIPA 1V6YA 4QS6A 2Z2AA 3FYYA 2A1YA 4JFSA 4KH2A 2VQTA 4XUYA 4LRSA 5CC7A 5BWAA 4OV9A 4W87A 1LJYA 2QCCA 4EACA 5HJXA 4W84A 1MVYA 2XIJA 4A8RA 2GDUA 4NYYA 1S1RA 1W5MA 5CZ0A 3QOKA 1OT2A 4MADA 2ZZ5A 2Z24A 4UCFA 1ZAJA 1KFLA 1ZS2A 3PVFA 3N13A 1QNVA 4IX0A 2VOMA 4JIIX 4B5XA 3QTPA 1ZCOA 1VF8A 3BW4A 1V0NA 3MBFA 2AMGA 5GVJA 4KWSA 1ZL1A 3ELFA 1RQBA 5I02A 1W1YA 2CHRA 1DORA 4RK8A 1ZCCA 1WKFA 3QQ1A 1XLGA 1KBJA 5D2XA 1M5WA 3HOJA 3MJMA 4WVXA 4BCEA 3NQBA 3R11A 2PF8A 1BGGA 3PUGA 5AYBA 3EWXA 4IQDA 3UXKA 3B8TA 5AHEA 3L67A 3DECA 3VIJA 1XIJA 2WQDA 4A22A 1KTNA 3MO7A 3VE7A 1N82A 4HTBA 3P67A 2YOCA 3UF9A 3NGFA 4IG2A 3MANA 3P2VA 4HPGA 1XV8A 1XLEA 3O0KA 4ZOEA 2DSZA 2XVNA 1OFDA 4G1KA 3VA8A 4TVDA 2ZXQA 2D2OA 1ZJAA 5A6SA 3ONCA 1O12A 3N2TA 2XH2A 1GVRA 3E3HA 1CX9A 1EQCA 1WKYA 3IANA 1YYAA 2PDQA 2WJDA 3G5EA 1X6LA 1XDLA 4PMNA 1YTEA 1J93A 1YDNA 2PLMA 5FJJA 1U2YA 1C9DA 2G50A 3AO0A 4PB3A 3IJDA 2PGWA 4J3XA 3QY8A 5XINA 1TPFA 1NQKA 3S6TA 3PZVA 1RALA 5JU6A 5CSUA 1DHPA 3SGZA 2Z26A 3LM7A 3WLJA 4MJ2A 4DNMA 1EO7A 2QXWA 1QHZA 2Q71A 4C6NA 2D3LA 2ZUNA 3W37A 2PF0A 3GNDA 3OVQA 4M6PA 3AU6A 2GOUA 3VXGA 1QDSA 2QCHA 4X2RA 5I3JA 3WH6A 2GLKA 5E0KA 1KXTA 1UP3A 2QPSA 2CLLA 1OIMA 2Z7KA 5TAOA 3CV6A 1JCYA 1HGWA 1DE5A 1E4IA 3OVPA 1ZZMA 3W83A 4UFHA 1US0A 3PPGA 4MFDA 3BJTA 4JCMA 3DC8A 1LWHA 3V4BA 4WKAA 1MRQA 4PUDA 4Y7EA 1FWEC 2QPXA 3B9NA 2BVWA 1P6WA 3E2VA 1ADDA 1RH9A 2YCLA 4YTRA 3UY8A 3IV8A 2VUYA 3N34A 2VM8A 4CCCA 2J7FA 3IIVA 2WJFA 4K38A 4XKYA 4L64A 2FDSA 3RM4A 3CV2A 4J28A 1WDDA 3W02A 5I3DA 3W1XA 2P10A 1Q13A 3T0BA 4JX6A 1CXLA 3WYZA 5ENLA 3F4DA 1HO4A 2PBOA 3E6EA 3PJXA 4HSOA 3L4TA 4ERGA 1BYBA 1UIPA 4ICCX 3N2MA 4RDWA 3W86A 2J13A 1KCKA 3CU2A 1Q65A 3EX4A 2XGIA 3PAOA 2YB4A 3PHAA 1IZCA 2W27A 3Q4DA 4E5TA 1PDZA 4WUIA 2VQUA 3TH6A 3TC6A 1V6UA 3C86A 1VAHA 1E6ZA 1GTHA 1UASA 1PX8A 3CB8A 3UVAA 4WR3A 2PMQA 2DZBA 1UD3A 2I9EA 3UJSA 1ADOA 1V51A 1C8QA 3A47A 1T8QA 4R3UA 3R89A 4KEZA 1TJPA 3HG3A 1T7LA 3EKGA 3U7VA 3LRLA 2ZX9A 2DZPA 4JFWA 2WPBA 3UERA 2J74A 3BL3A 2V30A 2G4JA 3LX9A 5E1QA 3M6YA 4LX4A 4Q8UA 2WNNA 1BG4A 5DO8A 4NUWA 1KNWA 3EZ4A 3EWBX 5D09A 2PPGA 3GTHA 7TAAA 2V9DA 2DVXA 2RGLA 1SFSA 4BFAA 3ZO9A 4JHZA 4ZE5A 4W7WA 4BF9A 1G4EA 1VP5A 1SJAA 2B31A 5HAOA 2Z2UA 3W7LA 4C5ZA 4KEVA 3B8WA 5AOUA 8XIMA 4MZ1A 4JGDA 2OO6A 3UWWA 2R94A 2YDRA 1UYQA 3SECA 1H49A 5DMLA 1G4PA 3CZ8A 4MWAE 4P8UA 3WFZA 5AYYA 1LL7A 5D8WA 2A6NA 3B03A 3OIXA 1IT0A 2FIQA 3BGAA 4WJEA 4L5ZA 1ZRQA 2BGSA 2ESCA 1VLWA 1AG1O 3UJFA 4ZOAA 2FH6A 4O1DA 4YJ5A 1EJXC 1BFNA 4L6DA 3SEPA 1UZDA 1UWUA 5TBOA 4MFEA 3NZQA 3R58A 4IIDA 3UWUA 1BYAA 1GVQA 2WXDM 3W1PA 4AMAA 2DW6A 3WD0A 3VZZA 5T91A 5D03A 1SW7A 4GNJA 4TMBA 3VKBA 1F76A 2QCDB 2WV8A 3CYJA 2P76A 2OWXA 4TIMA 4KWUA 2BHUA 2WW5A 1W8GA 3KUMA 4BEUA 5LNWA 4LALA 4AQLA 3UZZA 2OB3A 5A6KA 1S5WA 1XGZA 3EMZA 3WLTA 5LHFA 2PUZA 4CD8A 4AXNA 3ITYA 4N6EA 3ARXA 4IUGA 4MAZA 5F1UA 1D7KA 4O17A 3RRXA 4W9TA 3O3RA 1LRNA 1O60A 1UOZA 3WF2A 4FHAA 3UZJA 2ZZ7A 4WXYA 3ABQA 3UGRA 4MYXA 4PTXA 3EWZA 3QGVA 4I5UA 3T7VA 2JEPA 1JCTA 3SCUA 2ALDA 3PBMA 5KTLA 3AMCA 4RZBA 1AMYA 1L6WA 1A5BA 1K8XA 3IPWA 1TMHA 2DU2A 4Q8VA 3BDKA 1I0DA 2HROA 3AHTA 3PWIA 1DQUA 3IK4A 2X7WA 2VOTA 1BQCA 3QBUA 3F2CA 2J9ZA 3JZUA 3ZT5A 4HSNA 4LNYA 1ISWA 1FWTA 1E0WA 1X6NA 4HZMA 4JX5A 3OYXA 2J25A 1UMYA 3NTYA 1BF2A 4IWWA 4ML4A 4FALA 5ABGA 1EXBA 5IHSA 3SO7A 2QV5A 1V03A 3GVWA 5AYXA 3WH7A 4P7NA 1MEIA 1Q6LA 1IEVA 1HKWA 1XRSA 5C9ZA 4YVPA 3WEMA 1GVYA 1B3OA 1S2CA 1WCGA 3QY7A 1MEWA 1UD5A 1QUMA 3GH4A 2OGYA 3W88A 3MWAA 4DJFD 1X1NA 1WDSA 2C13A 3AIUA 4X3ZA 1W5OA 1IEQA 1TWSA 3B8IA 2V5KA 1XIIA 4DF2A 1HP5A 4HQVA 2PP0A 3HU7A 4IIHA 3W38A 2CERA 2PTDA 5JQ9A 3GK0A 3E0FA 3CUZA 1WDWA 4CEUC 3QHNA 5LXXA 3EEGA 3VCNA 3BAWA 1YTKA 3OLDA 4RE2A 4U28A 2WMIA 1PTGA 4R5EA 3GYEA 1H41A 5C55A 4LPCA 4JICA 5FAGA 4ZODA 5CSSA 3WK1A 3G1RA 4UR9A 3KCOA 1HKKA 3S5YA 5G1TA 3E0VA 5AHFA 2ZICA 3CWHA 1ZBWA 5IRPA 4HA0A 5FJIA 3S9IA 1HKJA 4JFTA 1F8IA 3TA6A 3ZYZA 1P0KA 4M5PA 3E0WA 1ODZA 5AHLA 1DE6A 3LNMA 4R9XA 5DBUA 5ABFB 3AU2A 4GVFA 3LHTA 5JXQA 3CXOA 1DXIA 2PWFA 4Z1CA 3AISA 1SFTA 5LIWX 4N2YA 3SADA 4RJEA 1LT7A 2Y61A 8TIMA 1FKWA 4YHGA 4CNUA 1KR0A 2WM1A 5EFFA 5IBXA 3T07A 5M5DA 4HZ7A 1DBTA 1E6PA 4EWND 3LI0A 2G3IA 2BX7A 6CGTA 3HQNA 1BTMA 4WY0B 3USZA 2VRJA 1FWRA 2FDMA 2VVNA 4HZ8A 5FESA 3T08A 1R47A 3CH9A 1W1A1 4KEUA 3GH5A 3G1XA 3EXSA 1PIFA 3TAKA 1E1EA 4IIEA 4XISA 3OGRA 3SN1A 4R7JA 1G94A 4PBGA 2PRMA 1M65A 1O1HA 4GCAA 1TQXA 3APTA 4UTWA 1QJWA 2PU1A 5HNNA 4PEEA 1J0JA 3ZVHA 4DY1A 3USBA 4L1GA 3GH7A 3NURA 3WCZA 3ARYA 2WVSA 4DF0A 1HJSA 1E1FA 3LCFA 4Q4SA 3EAUA 4DHGA 1G0CA 2F84A 1JZ5A 1OF6A 4XBKA 3BQ5A 3N4AA 5H8UA 4DIAA 3W74A 2E9LA 4ZB2A 3WN6A 1FHUA 3BOFA 1XLHA 2GWGA 3O0FA 3HM7A 1VJSA 2CXGA 1LLOA 2YCIX 4UOJA 3RLHA 2CW6A 3V16A 3FDGA 4JTIA 3LCHA 1GEHA 3PZUA 2QLYA 4AISA 4D8AA 1MDRA 4IJBA 1KCXA 4UWMA 3WLIA 3HN3A 4R53A 3PC0A 2ZRXA 1VEOA 1REQA 4JHMA 3T2QA 2PURA 1JPHA 4Q7IA 5IDZA 3DX5A 3TSDA 4C65A 3KL3A 4MB1A 1SZEA 1QWKA 5HK4A 1MW1A 1P0BA 1K3UA 1ITCA 3ABZA 2WM0A 4PUMA 2Y8KA 3F5KA 3B9OA 3I10A 4PMYA 4GVGA 1XKJA 2Q02A 3C2OA 3FEMA 3MCNA 1R3YA 1XIHA 3KE0A 1I1WA 3MKCA 3S1VA 3VNKA 4QG6A 3WQVA 1IWPA 4DX3A 3V5CA 4FF7A 5CPMA 3BLLA 4Z2KA 4NI3A 4E4UA 2ZTKA 4S38A 2PE4A 4NNBA 3OU8A 2CIPA 3W28A 5C5YA 4GLEA 1SSGA 4EWJA 2QCMA 1G5AA 1WDQA 3ZJKA 2Z1SA 1M9HA 4QQ3A 3GAKA 4XB3A 2ABBA 3UQNA 3AQUA 2GGEA 3PJTA 1YDYA 4TX6A 1WZMA 3WLPA 2ZA3A 3DFYA 3P3BA 2J66A 1KGUA 1JQVA 3WNPA 2DZXA 2HE8A 1R87A 3SRDA 5LIXX 4BI6A 4XAYA 1HL2A 1EC9A 4LB4A 4FOKA 3TYDA 1SO6A 4MUPA 5J5RA 3DHDA 3LB0A 3CPUA 1QK2A 3QW4B 3RCNA 5MHBA 3EB4A 1XDJA 3LHUA 2V3GA 4FS9A 5A5WA 3SUUA 1JJKA 5CPNA 3AJXA 1D2KA 3P93A 4KFNA 3KDNA 4J3TA 2NQJA 2PWHA 3N14A 4OBRA 3S1WA 3WDRA 1HKIA 4FX8A 2Y5EA 1AQHA 4JIHA 3NDYA 1NARA 4QCFA 2CC0A 4JNYA 4CQAA 4JQ1A 4H8HA 3ZT6A 1YDVA 1U5VA 4LY8A 3LMZA 5FSDC 1A5NC 1RD5A 4XAGA 2IPGA 2ONEA 3MSRA 5CBBA 2HDJA 2PRLA 1T40A 3REQA 2DUXA 2O92A 3NO5A 2G96A 4H7CA 5LYRA 4NX5A 3T55A 1KC7A 4Y9OA 3UD6A 1G67A 1SR0A 5AHIA 2ZUWA 2XN0A 3VKDA 3IARA 4DJDA 3U48A 1TVNA 4HK7A 2A3CA 2GYIA 4DQWA 2NT1A 3RRAA 4PTNA 1RJPA 1UP2A 4XIMA 3CZLA 3L9CA 1SO4A 1T8XA 2VR5A 4BKNA 1GQKA 3DI0A 1E9ZB 2ODOA 3GBEA 4UTLA 4GVHA 5C70A 3KZPA 2W9MA 1REQB 4LTSA 3E02A 1SW0A 2BVTA 1VEMA 3WH5A 2FHFA 2XU2A 5J8LA 4DBDA 5CPSA 4TXEA 2PDFA 2QJJA 2Y8VA 1FWJC 4K8GA 2F61A 3SCTA 3TTQA 1Q8AA 4RZ5A 1RBAA 3QQWA 3KOZA 3WK2A 2AGKA 4O14A 4KGLA 5K4XA 1TZ7A 1ENUA 4TO8A 1QXLA 2ZXBA 3BOXA 1FVPA 3NPVA 3DDMA 4PTVA 3MSDA 3G22A 4A8IA 3SCRA 1HKVA 4B4FA 2XIOA 1VS1A 2QCNA 2NT0A 3SR7A 3ZOAA 3LHWA 3ITOA 3NYDA 3CUHA 1QTWA 4GHRA 2YDAA 3OLEA 3QPZA 3S9ZA 2ZRUA 3KTCA 2IPFA 2WSYA 3NWRA 2O9RA 4NAFB 5DRIA 1DIDA 4INFA 1JYXA 3QV7A 1CGYA 5U7SA 4U10A 4C7FA 1EDTA 1MXSA 3HGSA 4B4HA 1V6XA 4K8HA 4AY1A 4GIYA 5A2AA 3WO8A 1A3HA 3N29A 5ECVA 3UPWA 4WHBA 3AXIA 3VOIA 4US6A 3KOYA 2I56A 3ID7A 4CCZA 1SJDA 4QG8A 1KCZA 3I7RA 3UVIA 1PDYA 3NSMA 2XPKA 3PSVA 2J27A 3LS9A 1NEYA 3OGSA 1TV5A 1VYPX 1TSIA 3R5EA 4ZA0A 2GJPA 1MRAA 3PR2A 1JUKA 1NM9A 3BPWA 1NF0A 4HNVA 3PG8A 3TYAA 3N6JA 2L5HA 1EIXA 3W85A 2B0MA 4JIRA 3SBFA 1FFRA 4US5A 3VIIA 4YNGA 5FEZA 4DJEA 2XISA 2VFGA 4YTTA 1OFAA 4EPKA 2BASA 2X0HA 6ALDA 5FF2A 5HQMA 2C14A 1RPKA 3IJ6A 1ZB5A 4LWWA 2EGZA 3S6OA 1PV8A 3BURA 3SY5A 3NQ2A 4IGHA 4QITA 4ADSA 3W1TA 5T8GA 2I17A 3QEZA 3V75A 4YLWA 2GUBA 2YIHA 3GUWA 1I2NA 1F7BA 2XM2A 3PZNA 3WX7A 4AWUA 2QGHA 4LC8A 3SAZA 4UTKA 4XAZA 4JQ2A 5A8OA 1DEDA 4CVUA 1RV8A 2UY3A 2XH0A 2Y62A 4I9JA 5DX7A 5BRBA 4K1GA 1E43A 3HBLA 1Q45A 4O50A 3GG1A 1PCKA 4ATDA 1DP0A 3W1RA 4AD3A 4O19A 4JNMA 2FTYA 3VKCA 4EF9A 3TU9A 2POTA 2O55A 1Q2RA 4IH3A 2Q6ZA 1CXKA 3L4XA 4AMCA 3OBEA 4XZWA 3NSNA 1Q85A 4FZIA 4WGXA 3G0XA 4V27A 2I9UA 4K1WA 1EBHA 4PMQA 4J3UA 4DO5A 5CZSA 4JTLA 3NOEA 1O5XA 2DT1A 1LLWA 2DV0A 2P1FA 1CW2A 3NDOA 4L9ZA 6REQA 2Y1HA 2IS7A 4X0VA 2SFPA 1LUCA 4JL2A 4QISA 1ISVA 4DWSD 4H9MA 3AIBA 1LQAA 2O9PA 3P74A 1OFEA 4PCPA 5A6AA 1G1YA 2IQTA 1OT1A 1L0PA 1V0KA 3VUPA 3WD2A 3QFWA 5BOOA 3PP7A 5M17A 1VPXA 1A5CA 4UQDA 4GA8A 4KIEA 1V5XA 5HXMA 2E6AA 5EYWA 2V3DA 4LFYA 3UW6A 1ZP4A 4G5DA 1FDYA 1X1ZA 2HZGA 3W70A 1OC6A 1LCOA 1S3TC 3TW9A 2V82A 4JKKA 5BOEA 1K77A 1LT8A 3M0YA 4XQ6A 2C1GA 4H6KA 3UR2A 5I24A 1K02A 3O6AA 2BOEX 2O4QA 3MUIA 1SJCA 2AMXA 2ZX7A 3M7SA 4RNFA 3O9NA 3OVRA 1DOSA 4OTKA 4HYVA 2ANUA 3CHEA 5AECA 3NEVA 1QW9A 1UQZA 1QMLA 4GH3A 1XLCA 1EIBA 3FAWA 4FOJA 7XIMA 1C8VA 1PSCA 3CT2A 4Q8PA 2ZC8A 4JYEA 5DANA 4D6FA 3JR2A 4O52A 1SZNA 4F0HA 1IGSA 2V69A 3DGBA 1QAPA 3C2VA 3HA1A 1KV5A 3KFTA 2RAGA 3LLFA 2WZIA 4B91A 4XSMA 4R9OA 4BF7A 4NJHA 1UCWA 4FF5A 3MZ2A 1YBQB 4GQ0A 2BY1A 2QCFA 3PK7A 1A5MC 3MUY1 4TR9A 2DW7A 4PFMA 2Z28A 5JBFA 5I3KA 3GNRA 4PMZA 4UZUA 2DZSA 3TC3A 4HT3A 3S2MA 3TIMA 2ATMA 4HHPA 2CZEA 1T6MA 3QSTA 3L0KA 4LXFA 5IHRA 3NQDA 3KVKA 5KETA 1EJRC 1VFLA 3LYEA 3HJEA 4RDYA 3C2FA 1VYSX 2V2HA 4AC7C 2FGBA 5HNRA 4AHQA 4UNKA 2FZ8A 1S2AA 3EX6A 3F2DA 2PDJA 1E9LA 1DJHA 4N4QA 4OE7A 3BOLA 4LS0A 1MXDA 2O4MA 2Y24A 3CK5A 4I7UA 5JBEA 3GC4A 9XIMA 1WUFA 3MCOA 2GVYA 5GJNA 4GYFA 3S2LA 5D32A 3CAQA 3RPMA 3VOFA 2VZVA 4REQA 1JDDA 5ABFA 4C6DA 1C91A 4Y90A 1OABA 2YYTA 3OTRA 3ABOA 2G0WA 3WUEA 3WLRA 4W4QA 8CGTA 2BG5A 2PDPA 1HVXA 1JVNA 3BTNA 1OFRA 3KLKA 3THQA 1VKFA 2X7VA 1VYRA 4B5UA 5JIWA 2RFGA 1GWJA 1QOXA 1XIGA 4PTMA 2QAFA 2DQXA 3PNUA 3W1AA 3U57A 4GZIA 1WXYA 2FJUB 2FTWA 2EPKX 4IPIA 4F0MA 3TMLA 1GOIA 1XYFA 4M1RA 5FF0A 3I3BA 3LPPA 5DELA 1M7PA 4XBJA 3W1QA 2QIIA 1H7WA 2ISSA 2GK1B 4RKAA 4S3DA 4LS1A 2NLIA 1EA9C 4DJEC 1Q8JA 3DENA 4D6JA 3BAYA 3W87A 1Z7AA 3TYUA 1IR1A 4YYFA 4S3BA 1CXIA 3EWYA 3UU0A 1XFCA 3T0DA 4KESA 1LRQA 1PYFA 3F5LA 1OY0A 5BU9A 4FNTA 1E6SM 3M41A 4ZO7A 2EG7A 4LU0A 1R38A 1VPYA 1PCWA 1C8XA 1OX4A 1ME9A 1SMDA 1P1XA 1TO3A 4N9BA 2OTDA 3MW7A 4D6GA 3ZR6A 4LRTA 3TN6A 3QGKC 2FTPA 1MZHA 3HJZA 1J5SA 3CUFA 3LLXA 3URAA 2BY3A 2WSKA 1KRCC 1R2SA 2F6KA 1UR2A 2X09A 1GHRA 1E73M 1E1CA 2GDQA 2OFJA 2RKXA 3S42A 1RVGA 1TYGA 1XC4A 3M1ZA 4X60A 4DWDA 3KXQA 4IGNA 3TUUA 3ERPA 4O1BA 1VBGA 2PODA 4O8AA 4UFLA 1QASA 1RD6A 1DPMA 1GJUA 3ABRA 3EA3A 2IKJA 3WMLA 2V5LA 1R2TA 3LZ5A 1VEPA 2V2CA 4MM1A 2XH7A 4C7DA 4EK7A 1T0OA 3TWAA 3PZQA 3MI6A 1ML1A 1EJ7L 4XD3A 3QSRA 2W67A 1YE6A 1KGXA 3OA3A 2TRSA 4LVAA 5DMNA 3CAVA 1V08A 3EX1A 4L6OA 1E4LA 3U5UA 5AZ0A 3ZJ8A 1N2VA 4DI9A 1Q6OA 1S39A 3D6NA 1ADSA 2X1RA 1CLVA 3MP3A 3FJNA 1MW3A 1IXOA 4HKPA 3DAQA 3GWQA 1W56A 3KOWA 4JKLA 5D37A 5CH9A 1VQTA 4LF2A 2W63A 3DFTA 1VLIA 1NU5A 2WZMA 3B05A 2YB1A 1CGUA 2PEVA 3TSMA 3G1AA 5HMDA 3UG3A 1K9DA 4JIEA 1KXVA 5EB8A 1M01A 4P7QA 2UY4A 1KKRA 4MLJA 1EZ2A 4RE3A 3CIXA 2F2HA 2XWEA 2IMRA 3G6LA 3CAWA 1QT1A 2ZDRA 1YDOA 1HIZA 1P48A 4ZEPA 4Q8OA 4Z0JA 5I0DA 1R0MA 1XINA 4YHEA 1KBLA 3HPFA 3GC5A 4GZEA 1AA1B 4MY8A 1H1YA 4NZ3A 3A3HA 5BYWA 3IGUA 3RO6A 2UY2A 3BJFA 1TV2A 3BSGA 3TSBA 4CKQA 3OGVA 4Z17A 2QCDA 2YLAA 1BHGA 1OG0A 1UKQA 3PBWA 1E5JA 1CT5A 1AVAA 4KMQA 1F2JA 4ASTA 3NDZA 3IGHX 2FYMA 2QAPA 2JE8A 2PDWA 3GVRA 5A3HA 4FK9A 1OYAA 3KVLA 5G1MA 2HMCA 3L2LA 3PZOA 4PTWA 5BRQA 1KQZA 5AYIA 1XR2A 1I4NA 4ZTXA 3EX2A 3DOPA 3AXXA 2XZ7A 2VZTA 5CJMA 4QRNA 2R8WA 3PFRA 1JNEA 3T0AA 5EMMA 4XD6A 2Y63A 1EPXA 5FL1A 2OEJA 4PMVA 3OBKA 5I2UA 1Q6GA 2UWFA 3T2OA 1ONWA 3NQ7A 3FXYA 4B2DA 3SCWA 4IMGA 1PUDA 2DUZA 4S3EA 3KP1A 1OCJA 5LA1A 5LNRA 2ZVRA 3BMVA 4GFSA 4FXSA 4F0LA 4ACYA 4AYSA 3FHQA 4UNLA 2PP1A 4JR5A 2NQLA 1Z44A 4S1FA 4CN4A 3WQDA 5K2ZA 2CWNA 3VIFA 4Z2LA 1QNOA 2FJKA 1ICPA 3A9IA 4C1NA 1DWJM 4FA3A 4H9UA 3DFQA 5ABTA 2VEPA 4LVDA 4US5D 1UR9A 2PWUA 6TAAA 2CPUA 3CM4A 5LA2A 3T4WA 3CT7A 2I5IA 1EOMA 2DSUA 1TA3A 1ZPTA 3UGVA 3VM7A 3K1DA 1UR1A 3TOPA 3SUWA 1AK5A 1FWCC 2Z1XA 5LGXA 2V5CA 3WLHA 2CWXA 5G4WA 1Q5MA 4POCA 1WAUA 2G41A 1MYRA 1C7TA 3C0SA 4LB3A 3N19B 1TVLA 5JVLA 3GVGA 3IJ9A 3VNYA 1V3HA 4HOWA 1TV4A 4BF5A 1G6CA 4PFHA 4DJED 3LV6A 4WOZA 5HWMA 2YX0A 2RJGA 3DC0A 2P8BA 3ALFA 6XIAA 2D2GA 1YPFA 1QI3A 2WNQA 3SFKA 5EMLA 3V1HA 1OYBA 1U1JA 4WSHA 1RP8A 3UPBA 4RXFA 3WJZA 2PZ0A 1I9CB 2Y0FA 4ROQA 2QCGA 2IPJA 1PE1A 2ZADA 4JNZA 1R3QA 3S5OA 4I7WA 3VGDA 4G6CA 3NXFA 3FSTA 1UPMB 3MI3A 4UXDA 2OKTA 3MYOA 4XUGA 7ENLA 1N7KA 1F05A 4PCSA 1GK8A 3ZLFA 3B9DA 4GI6A 3SUSA 4MWAA 1Y0EA 1C9WA 1UUQA 1TG7A 2FPYA 1R9ZA 3ARSA 2G4FA 1P7TB 1E40A 3KCJA 4A4AA 4UFIA 5FCZA 1GKQA 3CZJA 4UB9A 4JN6A 5I79A 1P0EA 1X97A 2ZOXA 3ITVA 2OKOA 3K2GA 4H9VA 1BXNA 4IXHA 1NDZA 3EYPA 1LQ0A 5FEPA 5KZEA 2TMDA 3UJ2A 4L9XA 2H3BA 4MHBA 2E8ZA 4W85A 4QFUA 1IEWA 3XIMA 2PTWA 1N55A 3LHZA 3EDDA 4A8NA 1KM6A 3PNZA 3MKVA 4HCDA 2YR1A 3QH2A 1RSCA 4BR1A 4OZOA 4DBSA 3GXFA 3UJRA 4A2RA 2WB5A 1J6PA 3QQ0A 2INEA 3VMPA 4KS0A 1DJWA 3S46A 4GJJA 1S2TA 3FK4A 3Q37A 4ONVA 3ZLHA 1TCMA 1UR8A 2X42A 2X41A 1ZQ5A 4NL1A 3V1PA 2YW4A 1UW9A 4YPJA 2BWGA 4KKXA 4Y9AA 3VDAA 5AN7A 4AUBA 4CCEA 3HIJA 1WNOA 2DSKA 4ICNA 2CITA 4BWLC 5HPCA 4UC5A 5FF4A 4IPNB 4H7VA 1F3EA 3W7EA 4UOZA 1E6NA 1FDZA 4NAEA 3BJSA 2XZ9A 3CGTA 4S3CA 2VEMA 2BODX 1AD4A 3GU2A 3VDCA 3W82A 3IRDA 3QMRA 2IXUA 2WZTA 3PTKA 3L4WA 2Y70A 1W1TA 2PGRA 5FOOA 1ZALA 4YXGA 1JAEA 3T05A 1XRFA 2F9RA 1BWLA 1TCDA 4GKTA 1TX0A 1A5OC 4N6FA 5GNZA 1W9VA 1A5UA 1UH3A 4XZLX 2J9YA 4I8YA 4AHPA 4Q4MA 1QW7A 1GW9A 4HMDA 3AAMA 3ISIX 4P8VA 3ZSTA 1UZ1A 4IJCA 5EMUA 4V28A 1UKOA 3BO9A 4AVNA 2A85A 2Q3RA 4IG2B 3E74A 1MW2A 4A29A 3TV8A 3P8JA 2JF6A 3AS1A 4H8NA 3H70A 1TJRA 1E0XA 1KBBA 1SU5A 1R2RA 3NPWA 3A3WA 3ANYA 3C3NA 3VDGA 4B5NA 2QYGA 1L9WA 4QQUA 1A4LA 3PBYA 4WJXA 3CUJA 2YYUA 4UCGA 4O0QA 3TYCA 3BANA 3BLEA 4WF7A 3VZXA 4A6GA 1F5ZA 5FL0A 1B57A 2RHGA 1J12A 3PN8A 2R1PA 2ZBTA 4M7TA 4D6EA 3KWXA 2I1OA 2Z7GA 4IL2A 5G2IA 3WMSA 1FWIC 3NJ3A 3POCA 3Q94A 3AICA 1UJPA 3DFOA 3ARRA 8A3HA 4JTDA 3NA8A 5MKGB 2OVLA 3UY7A 4QNEA 1P6BA 1Z9AA 2QNEA 2E1DA 4U2ZA 1BWKA 2FZDA 1OCNA 3CIVA 5BRPA 2D22A 2XUCA 3VI2A 2IPWA 3Q58A 2KX9A 3MBDA 2CLEA 4KERA 1HN1A 2QV4A 3W23A 4DNHA 3NL3A 4UUIA 2CYGA 2YL9A 1OCBA 1VD6A 1R9YA 1IEXA 1TJ1A 5CBIA 1EX1A 5CLWA 2A3AA 4DXKA 1GVFA 1D8WA 4QSHA 3LA4A 3U4FA 2P5NA 2J88A 4E2DA 2DT2A 2GOKA 3GIYA 1RY0A 2B7OA 2ATSA 4JS3A 4L80A 2QJHA 2WVVB 1O95A 1XL9A 2TSYA 5I23A 4HU4A 3GZAA 3O2LA 2V3FA 2JK2A 1V3KA 5CAKA 2VGGA 3S1GA 3PZTA 2PTXA 3NIYA 4MB3A 4NSBA 1U30A 3TW6A 3ZM8A 4UTJA 2HPMA 3M0VA 3HGRA 4UR7A 1TWDA 2I7GA 3QY6A 1H60A 4PMOA 1H7NA 1ZTVA 3I6RA 3LLDA 2A3LA 4UTUA 1PX4A 1XX1A 2ZE0A 4QDWA 3MO4A 1CWYA 1TX2A 4YYCA 4B92A 3WY1A 2G3MA 1GJWA 1R85A 2NX3A 4AIOA 3QTGA 1HX0A 2CCRA 3NVDA 2W62A 4A3QA 5BZAA 3VCCA 2XFRA 1XQKA 5CSYA 1S2WA 4XVEA 2NV9A 3W27A 2AKMA 3WH9A 2QULA 2W0UA 4LV4A 3V0TA 1JEZA 4MB5A 1FWNA 3ICJA 4CU7A 3B0YA 4LBUA 2R9RA 2BXVA 5BXPA 3B0XA 5F7UA 1GZ1A 1VFHA 1AH4A 4RZ6A 1EP2A 1IWBA 4XKYB 2OX1A 1JCXA 4GO9A 1GQJA 3ITLA 2P0OA 2ZYFA 3SFWA 1E51A 5BXSA 3QHOA 2OZ3A 3V36A 3QYSA 3MS8A 4JN7A 3STFA 1QNQA 3L0GA 1IGWA 1HTIA 2PA6A 3APGA 1JD7A 3UWYA 3C2EA 3R7MA 3QLDA 3N1AA 1BYDA 2JFEX 1BF6A 1V02E 2BBFA 2QCLA 1BRLA 2PP3A 3GNXA 5CSRA 1A50A 1MXGA 3QHMA 3N2CA 1PKNA 1R3RA 2YZ5A 2WC7A 3KS5A 1WDRA 3CLMA 5DBTA 1FY6A 5B80A 2E6DA 3H7RA 4AZCB 5BROA 3MUAA 1EL3A 1CIUA 1K8YA 2WOQA 1XLBA 4QX4A 4MNLA 1NWSA 1NP2A 4LJ3A 3W3OA 1WA3A 4NKCA 1VIWA 1RK5A 5D9PA 2C16A 1IQ8A 4Z1BA 3OOQA 2XDFA 1B30A 2VGFA 3EB2A 4NP7A 5D04C 3T1GA 3QR0A 2VDHA 2VDGA 3DERA 1W0MA 2XIMA 1OQFA 5LHEA 4J7RA 4RNJA 2QR6A 4QLJA 4HU8A 3H4GA 1ZHAA 4UQBA 4PMJA 2JGYA 4LEFA 3L23A 5J5DA 2DSWA 2DORA 3NR0A 3WDQA 3JS3A 1SW3A 3QKZA 3AYTA 2RDTA 4I5RA 2H90A 4XG1A 3OLGA 2ZWYA 2ZVIA 2ISVA 1ZJBA 4JEQA 4U2YA 1XF0A 3W2NA 1DYSA 3E49A 1DWAM 3AJ7A 3XINA 1OIFA 1OBAA 2R14A 2XTKA 2W91A 2Z1WA 3TJXA 4RCXA 1TB3A 4O57A 3M47A 4M1BA 1MDLA 3VZYA 4HPHA 2J24A 3M5VA 1YXYA 3I3DA 4JX4A 5DY3A 4MDPA 1UIOA 3WBXA 2PCQA 4O8RA 4UTWC 4OOZA 3TTSA 4Q8QA 1ZNNA 4BK9A 3FVMA 1XCFA 1W1ZA 1E3XA 5I78A 1DWFM 4N4PA 2ZKMX 1O66A 4G7EA 4RW3A 5M2FX 3BXWA 1LUCB 2E1WA 1B1YA 2Y88A 4P2VA 5E5CA 5DFAA 1HVQA 3LOTA 1E0VA 3AIRA 4Q4QA 3PJUA 3RU8X 3TP4A 4L4LA 3N25A 1C7SA 2J7BA 2O9OA 1CXHA 2J9XA 3T8QA 4GYPC 1GKPA 4XX6A 1H50A 3RILA 1UH4A 4NX0A 3DG6A 1BAGA 3U8GA 1X39A 1A47A 3FA5A 3VD9A 5CZKA 3LN3A 4IIGA 3VOHA 2ZE3A 4LC6A 2E0PA 1V0LA 1JCLA 2GGJA 5AB3A 1UWIA 4C6MA 5JUVA 1FA2A 3A24A 4JQ3A 5FIPA 5ABEA 3CTTA 2ACSA 1FTXA 2C19A 2PFHA 1P0NA 4EXBA 5DEZA 4RX0A 1JZ6A 3MUXA 1ZUAX 2XVGA 3TQVA 5G4HC 2WO5A 4GFIA 4GISA 3CHDA 1J6OA 3V35A 2WMHA 3S2CA 3VNZA 5CCZA 3HB9A 3E2SA 1SPQA 4AH7A 2PU0A 1XHGA 3PZGA 1UQY