1P6WA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with the substrate analogue, methyl 4i,4ii,4iii-tri-thiomaltotetraoside (thio-dp4)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (Alpha-amylase type A isozyme)
publication title The structure of barley alpha-amylase isozyme 1 reveals a novel role of domain C in substrate recognition and binding: a pair of sugar tongs
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1p6wA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1p6wA01
1HTYA 2VCCA 4B16A 1BVZA 1CDGA 4QCEA 3T09A 1J0KA 4DUWA 1OD8A 2BS9A 1NQ6A 4Q7NA 2PB1A 2Z1SA 5A69A 4ATDA 3WDIA 4TVDA 2YJQA 1CGXA 1RD6A 1CXLA 4HPHA 3CMJA 3GDBA 3WH9A 4UR9A 3EDKA 2BY2A 1JAKA 4AZGA 5CSYA 4EK7A 3TV8A 4F66A 1BSIA 3VGBA 4BZYA 1CNVA 4AD3A 1V02A 2WWDA 1FP9A 3LXCA 1R47A 4AZCA 3SCTA 3MKKA 4U2YA 3WF2A 3MANA 3VVGA 1IT0A 2CBJA 5A6SA 3IAQA 5D8ZA 3AS1A 5C71A 2JALA 1E3ZA 3H53A 3VGDA 1UWSA 1VFFA 3LRLA 2PWFA 1QVBA 4J3TA 1C8XA 1WB0A 3VX0A 1EGZA 1O7DC 1W3LA 2W4XA 4FNPA 4UFHA 4NF7A 4MADA 1MXGA 2WVSA 4UQ9A 4FF5A 1CZ1A 3PZQA 1VIWA 4ATWA 1O6IA 5HBFA 3EJRA 4UQAA 3WEZA 5D9PA 1UASA 3VGHA 1U33A 5LA2A 4LYRA 3WQ4A 4A4AA 1PEZA 4UQEA 3IANA 1VEMA 2VZUA 3VILA 3FAWA 4S3KA 2F7QA 4MNKA 2MANA 5FCZA 2AAAA 4PCTA 3F5JA 3CO4A 2D23A 1GQLA 1J10A 3BAKA 3VIFA 3D4ZA 4OGZA 4TX8A 3AIUA 2F1BA 2WZIA 2IGTA 3MUAA 3VU2A 4PMXA 4KWUA 1WKYA 4N42A 3SUWA 4ZFMA 2WXDM 4U31A 3AHYA 3TONA 1R87A 3J7HA 4MB3A 3GXDA 4CCDA 3AXHA 1BYDA 1NOUA 1ZU8A 3W81A 3SCSA 4V27A 1M03A 3A47A 2GSJA 3MUY1 1R33A 3WDPP 4NXSA 1ISWA 1UWUA 4DWSB 4E8CA 3WD3A 1F4AA 1H2JA 1HN1A 3B9DA 1UUQA 2YDSA 3TA9A 3T2PA 3QR3A 4PCSA 3ZJ7A 3BXWA 1W3HA 1QPKA 3PTQA 1WZAA 2WB5A 5EFDA 1PZ2A 3K4AA 3A4XA 1W2PA 3VGGA 3CLWA 1MQPA 3AROA 4D6CA 3ARPA 2YL6A 3GH7A 1KR1A 4N0RA 3BCDA 3WBAA 5A6BD 1XH2A 2OSYA 2G3IA 1B3WA 3N15A 4PMDA 3RJYA 1BG4A 4ZXOA 1AVAA 2DH2A 4EAMA 1NOWA 3UG5A 3DYOA 1AQHA 1R34A 3WUGA 1R85A 1UG6A 1UWIA 5LYRA 3PZNA 3W4RA 4D6HA 3BSHA 3W38A 2OYMA 1ZB5A 5GPRA 1E15A 2EJ1A 1ZL1A 3QGVA 3WMCA 1OB0A 4JAWA 3DX4A 5E6YA 2GJRA 2HISA 3MV01 3EJQA 2NSXA 4CN6A 4MNJA 1S46A 2X8RA 4LGXA 2JF6A 4HU0A 4XX6A 3WQ8A 4DWSC 3WUBA 2BFGA 2DDXA 1H3GA 4KH2A 3EMQA 4P8UA 2XSBA 3WD2A 1CGYA 3AHXA 2XFRA 3ARYA 4DM2A 1HXJA 4CKQA 2ZUTA 4UQDA 2CBVA 3IJ9A 1G0CA 4B3KA 1W91A 2Y2WA 4GZJA 2E8YA 1JZ7A 4JIEA 2EACA 1E43A 3UR7A 2BY0A 3WNKA 4M24A 3RM9A 2WHMA 1QBAA 5AY7A 3AOFA 2XVKA 2XWEA 2NT1A 3HG4A 1H5VA 2J7EA 3OLGA 1W1TA 3L2MA 2O9RA 4AIOA 1ITXA 3CZ8A 3QOMA 2CKRA 1JZ4A 1JIBA 1UKTA 1VJSA 4UFKA 1QI0A 4HZ6A 5BXSA 1HVXA 2FGZA 3VD4A 1GORA 1HL9A 4HOWA 3IK2A 4P8XA 4UQCA 1EDQA 4P7NA 3N04A 1E6NA 1C93A 4HA1A 1LL4A 1HKMA 2PWEA 2UY3A 2VR4A 3FAXA 5FL1A 2YOCA 3W6MA 5ABEA 2E9MA 2VMFA 2Q8XA 2DEPA 3TTOA 5DFAA 4QCFA 1ESWA 2E3ZA 2J77A 5FD0A 1WE5A 1XSIA 2D24A 8CGTA 2CNCA 1QWUA 4PN2A 3CIVA 4NZFA 1HP4A 4UOZA 2BVTA 3L4YA 1I1WA 1DP0A 1I1XA 4PUDA 3LPOA 1QW8A 3ARWA 1ISVA 1E71M 4OOZA 4DO6A 1RP9A 4B3LA 4LYQA 1QX1A 5DMYA 1W9XA 1UR9A 3AS2A 2RGMA 4M81A 2C0HA 1E9LA 3DX2A 3PHAA 1Q6GA 3WH5A 3GXFA 1E4LA 4UNIA 2YA2A 4J3WA 1W1VA 1E72M 3SCWA 3CUFA 5D8WA 4W7UA 4JHZA 4KRUA 4GO9A 2YL8A 3SUTA 4PUEA 3WQWA 3ARTA 3EJTA 3AMLA 4W85A 5BWFA 2BHUA 1NM9A 2CIPA 4H2CA 4L4PA 1V6UA 1WZLA 3AZRA 1R7AA 2J7FA 4M1RA 1CECA 2AOSA 1WDPA 5DT5A 1ODUA 5I5RA 3WFZA 5CJ5A 3CHEA 2YKKA 1LQ0A 2YLAA 1OGSA 3CC1A 2V3FA 3AIEA 1JZ2A 2J7GA 3IAPA 4PEEA 4TUFA 3VO0A 3RIKA 3AS0A 3HG5A 2YA0A 3SCOA 5CGTA 3WUFA 2DQXA 2GFTA 2ZUNA 5I23A 3GXPA 4AD0A 3WY4A 4UFMA 3K8LA 1UWTA 1TA3A 4HZ8A 4GZEA 1OD0A 4TXEA 1V3IA 5TD4A 2V3EA 1KXQA 1K9TA 1PS3A 4GKLA 3CZGA 2ZXBA 3M07A 1JXJA 2VT0A 3W28A 2WHJA 1W9BM 1GHSA 1V0MA 2BVYA 3CHDA 2VR5A 1FH7A 5CQ1A 1HNYA 4UQBA 3BUQA 1E73M 2BV9A 1QNSA 1FH9A 3WF1A 2PBGA 3AHZA 5M17A 4P7LA 2VRQA 1J9YA 1KQZA 3IJ7A 3SCPA 1CYGA 1E0XA 4JCMA 1QBBA 4JKLA 1QNOA 3ZT7A 1GOWA 1OIFA 1H09A 4WSJA 1XCXA 2CHNA 3AIWA 3NDYA 2EBNA 3WD1A 1L8NA 3B9AA 1JZ5A 1GQIA 3D52A 1BPLB 3SCQA 4IISA 1UQZA 3AYRA 2UWFA 1HWWA 3VM7A 1FFQA 4PBGA 1EOKA 2QF8A 5DT7A 5I79A 2BHZA 3A4WA 4Z2HA 1OT1A 4NZCA 4Z2IA 2XPKA 2XVLA 4JCLA 4FNUA 3AS3A 1H1NA 3FHQA 4JFVA 5A6KA 2JIEA 5A6JA 5A8MA 1R75A 5E70A 2UY2A 1BFNA 3ZR5A 1E6RA 4D1JA 1PPIA 4CD6A 4CVUA 1OIMA 3AISA 1D2KA 4GZIA 1UD5A 4FNRA 2A3HA 4S3JA 3SURA 1AQ0A 1KTCA 1WDSA 1UR4A 1K6AA 1WAWA 3DHPA 2J79A 1GOOA 2VUYA 2J75A 1UR1A 5BXRA 1C3FA 4JFWA 5AYIA 3VD3A 4WKAA 4WSKA 4M8UA 2EPLX 3WQVA 1GJWA 3L4TA 3MMWA 1OGBA 3MS8A 1KFWA 1EHAA 1E6XM 5E9AA 3VUPA 2ZX6A 3ECQA 3CZSA 1GW1A 4PMUA 3PZOA 3PBGA 2J47A 1DWAM 2WMIA 1W9VA 1JDCA 5BROA 1CLVA 2VX6A 3PZMA 3ZJ8A 3AIQA 1UKPA 3N11A 4BF7A 2FDMA 4AEEA 2J4GA 3L4UA 4MB5A 2BY3A 4U5IA 1C8QA 5D9OA 3WD0A 5M5DA 2PF0A 3HJEA 2WVUA 1ODZA 3RCNA 1HF6A 1DWGM 4AIEA 1JGIA 2QPUA 2QMKA 2XIBA 5I77A 5CLWA 5A8QA 2ZXAA 3BVWA 1TG7A 4R27A 3CUIA 3ARUA 3L4VA 1JG9A 2YBUA 3WMBA 2W5FA 1GJUA 3ARVA 1BLIA 2WK2A 1UD6A 1E70M 1Q6CA 4U33A 4BS0A 3EJSA 3LPFA 4QLJA 1C92A 5E6ZA 3O2LA 1W9DM 1CGWA 3UCQA 1UD3A 1X6LA 3GYCA 4NRSA 3WL1A 4W5UA 3OG2A 3K1DA 4UFIA 4B9YA 3WF4A 2ZX8A 5HPOA 3UETA 2GJXB 1OBAA 4XUYA 1KR0A 5HXMA 4C7FA 1KXHA 4HTYA 3VIOA 2VJXA 2GK1A 3RILA 3DDFA 3GH5A 4DO5A 3NIYA 3CHFA 4X0NA 1PX3A 3U7BA 1GVIA 2CESA 2VURA 3VIMA 1UWRA 4X0VA 2BNJA 1B3ZA 2WM0A 3VOCA 2ZUUA 3SCRA 3ZM8A 5GQBA 2JIWA 5ABFA 4BQ5A 4PTWA 1TZ7A 1UOKA 4LXFA 3QHOA 1FFRA 1CIUA 1XC6A 3K4DA 1H0GA 2VX7A 2V5CA 4XZBA 5IHSA 1CGUA 4J3VA 1V6YA 1FP8A 4AY1A 5BYWA 1EQCA 1VFUA 2OW6A 3NDZA 4FNQA 3VSUA 4WIWA 3AJ7A 4E8DA 1SR0A 3BAIA 4PTMA 3ZIZA 4TOQA 3HZ3A 1E55A 1V0NA 3WF0A 2Y24A 1FA2A 2YFOA 3M6DA 4MTVA 5A94A 1E1FA 4RL3A 3ZT5A 3L4WA 1QW9A 4A3YA 3BAWA 2YL5A 1SYTA 2VX5A 1JFHA 1ZJBA 1UQYA 3ZJKA 1HXKA 4W8AA 3OLIA 1D7FA 1GNXA 1W3KA 1OT2A 1TQVA 3AI0A 4TX6A 4BA0A 3WUEA 5A6BA 3G6MA 2WAGA 1X6NA 3WN6A 2FHCA 3K46A 1PX8A 4AD4A 3KL5A 2DPEA 3DECA 3WF3A 2F1AA 3VM5A 5EMYA 4JL1A 2IXUA 1WCGA 3N1AA 1J0IA 4X9YA 2X0YA 4KRTA 3BC9A 3ZJ6A 1K9EA 3FN9A 2G41A 3FHAA 4PTVA 1BQCA 4ZXLA 4OIFA 1E6QM 2ALWA 4W93A 3VGFA 1TFVA 4ZEPA 2YDQA 5D9MA 4PMZA 4PYSA 3LXAA 2IUZA 3LRMA 1JI2A 5A2BA 1B1YA 3AICA 3AXIA 4JZ5A 1US3A 4CU7A 2J8FA 3MMUA 3WQ5A 1JI1A 2V5DA 1C90A 3WY3A 4AZIA 4AZ5A 3RJXA 1VBRA 4W87A 1G5AA 5AC5A 2OSWA 5FOOA 5A6LA 4DUXA 5CPSA 1HL8A 7A3HA 3PTKA 2X2JA 3DHUA 1MXDA 1JF5A 2G8ZA 3ARRA 4PMRA 2QV4A 1UH4A 2VVSA 2E8ZA 4AZ7A 3MUZ1 4C7DA 3EYPA 3ZQ9A 1QNRA 5BRQA 2WMGA 1LJYA 2DT1A 3RPMA 3WDRA 3WNNA 4PRWA 4ZENA 1JDAA 2VZOA 4MPKA 1ITCA 4HA3A 1UD2A 2FH6A 2CERA 3WNPA 3AIRA 1GVYA 4MAVA 3BLPX 4ML4A 2JEPA 2OSXA 4D1IA 2YL9A 3VIIA 7TAAA 1MVYA 3NJ3A 1E1EA 4H04A 2X0HA 4DWSA 2E4TA 3GH4A 4J7RA 1CXFA 1BGGA 2ZUMA 5KEZA 2XGBA 4CGTA 4PTXA 1M7XA 3KLLA 1J12A 1SMDA 1JNEA 1VJZA 5A3HA 3W53A 4V28A 1V6XA 1MW2A 3FNDA 3POHA 1LLOA 3EMZA 3VD9A 1HT6A 4P7OA 2NW0A 1GONA 3M46A 3OZOA 1BYAA 1BHGA 4QLLA 3CHCA 4JKKA 3AMKA 2GDVA 5I2UA 1B3YA 2WHLA 2D1ZA 3NSXA 5ABHA 1ZS2A 1EXPA 1EIBA 3BLBA 1FHLA 5HPCA 2EO7A 1QWNA 4BQ3A 3GM8A 2VZTA 1VFOA 4ATLA 2E9BA 5F7UA 2XYLA 2WCAA 1KGWA 2WC7A 4HOZA 1QI2A 2J74A 2J8GA 1MW3A 1NARA 1W32A 3BUDA 1HJQA 2VCBA 1PX4A 1H0IA 4ACZB 1M01A 2CYGA 3VIJA 1O7AA 1CXKA 4LQ1A 1ZBKA 1VRXA 2WWCA 4D6FA 1TQUA 2ZX5A 5CG0A 1EHNA 3D4YA 2FH8A 1Q6FA 1VBUA 8A3HA 2YFNA 1GUVA 3KLKA 1KQYA 1A47A 3SCVA 1A3HA 2WVVB 3TOPA 4D6IA 3AIVA 4W7VA 1KTBA 1PJ9A 4IPLA 3VSTA 3AHVA 2BXYA 4A3HA 2JF7A 3NUKA 2DSUA 4MNLA 1C8YA 1H4PA 4M56A 4TTGA 1Y7VA 3GBDA 2WMFA 1BVNP 2VI0A 5DEZA 3S6TA 4DUVA 3GZAA 3MI6A 2OWWA 1B2YA 2W61A 4JHOA 5LA1A 5EFFA 2DIEA 2E9LA 1IZKA 3TP4A 3VNYA 1BAGA 5A2AA 2W66A 5A1AA 3VD5A 1ZBVA 3CUHA 1JNDA 2Y4SA 3A23A 3WKZA 4L4OA 4NSBA 1K9DA 5I78A 1VEPA 3S5ZA 5A8NA 3WEOA 2YDRA 1F4HA 1OGGA 1XRVA 4XV0A 3SUUA 3A22A 2WNWA 2A3EA 1JYNA 1HKKA 1KXVA 2OYKA 3WDQA 4PMYA 1LG1A 3T08A 3WL0A 2XVPA 3WQ6A 1P6WA 3FW6A 3ARSA 2E0PA 2ZE0A 4WK9A 2F7OA 4PSRA 9CGTA 1R46A 4MB1A 1E3XA 1BYBA 4W86A 5JBDA 5CGMA 1YQ2A 3BMWA 4CU6A 2X05A 3W25A 2BY1A 2CKSA 3PTMA 1YHTA 1EOMA 4OJYA 4Z2LA 1GQJA 4GI9A 1VENA 3TTYA 2CEQA 4AMCA 3A5VA 2O9OA 4W7WA 4AZ6A 3DYPA 3BVUA 4LPCA 1DWHM 3GNPA 2CITA 1DWJM 1WZKA 3B9EA 1JXKA 4GINA 3T0DA 3WD4A 4JKMA 2XIIA 2WLYA 3CZNA 2J62A 3WNMA 1CXEA 4AIUA 2ZOXA 1V02E 1XCWA 1V6VA 5A2CA 1J18A 5GNYA 5E0FA 3DYMA 3N17A 3WFLA 3I3BA 1SFSA 3VDAA 4MAZA 4AWEA 3OZPA 2VX4A 1B3VA 2EPMX 2WKLA 4J3XA 4CD4A 2A3BA 1XSKA 2A3CA 5FL0A 1KCLA 1GHRA 3VINA 1CWYA 4NXKA 2VVNA 1IV8A 4P8VA 4GQRA 4OKDA 1HKJA 5A6MA 1TE1A 4BCEA 1R86A 2XGIA 1BG9A 2UY4A 4M80A 3AXXA 4NRRA 2QLYA 1UR8A 4PMNA 4DM1A 1HIZA 1E6ZA 1QOXA 4MDPA 3L4XA 4OOUA 5D4YA 3MO4A 1EDTA 1VAHA 3BH4A 3AYSA 4CVWA 5JUVA 3SCUA 4J3UA 4AD1A 3ALFA 4WF7A 1NWRA 3KEHA 3SEPA 3QOKA 1UA7A 2O9TA 2D3LA 1J0JA 1X1NA 4OUEA 1W1YA 1B30A 4AMXA 5DF0A 1XV8A 3W24A 3PZTA 1DWFM 1SZNA 1CGVA 2F18A 4U3CA 4M29A 2DSWA 4B9ZA 3SIMA 4AYGA 5JBFA 3U57A 2F2HA 3BVVA 1FHDA 5JIWA 1U2YA 1TVNA 3PZIA 3VKKA 2F8QA 3T0AA 3EDJA 1DEDA 5CPTA 1UH2A 1CLXA 4Q22A 2AMGA 2WCGA 4FLSA 2W62A 2V38A 3LXBA 5I0DA 5CSUA 3W0KA 1E6PA 3O9NA 3L4ZA 2D73A 3VX1A 1GOKA 4GXPA 3THCA 4FLRA 2WW5A 4AISA 4W5ZA 4EKJA 3EBVA 4NX0A 4XZWA 4OBRA 2YLLA 1WDRA 2WBGA 4F9DA 1B9ZA 1KGUA 2GUYA 2ZX9A 4HZ7A 3KZSA 1JFXA 3SUVA 3K8KA 2VCAA 3NSMA 4RE2A 1PIFA 1NWUA 2G3MA 2F7RA 3VDCA 2ZUVA 5GNZA 3T0BA 3WY2A 2Y5EA 1PIGA 2CXGA 2XUCA 1KWKA 5JIPA 2CCRA 3VIGA 1TCMA 2DSKA 1H11A 1WO2A 2XFYA 4KGLA 3GTNA 1JZ8A 1V3JA 3SCNA 2PWGA 2VQTA 2CHOA 2X09A 1XH0A 3WY1A 2DSVA 4F8XA 2PWDA 4AZCB 2D2OA 2Z1KA 1I75A 4E2OA 4H8HA 1LL6A 2Y8VA 1VFMA 2OWXA 2A3AA 1UA3A 1V03A 3CUGA 2X2HA 1VB9A 3ZSSA 4PMQA 4HMCA 1LWHA 1E5JA 2VZVA 3L2LA 1B3XA 3VSVA 2PBOA 3VMOA 3EMCA 4D6JA 4YHEA 2WMJA 1ZBCA 5BCAA 4GI8A 2W63A 4QLKA 3FY1A 4DO4A 3HU7A 3OA5A 1J01A 2ZWZA 4B15A 3GNRA 1IZJA 2EEXA 3BUIA 1NP2A 1UD8A 1GCYA 2WMHA 1KWGA 3I3EA 4U3AA 4H41A 1WDQA 2J7DA 2QHAA 3EDEA 3N9KA 1B0IA 4TTUA 1XYFA 1GZJA 4WKFA 4YHGA 4ZE5A 1H49A 2ZICA 4MJ4A 3D3AA 2DT3A 4GQQA 1V3KA 1QHZA 4H8UA 2QMJA 2YBTA 1KB3A 3BVTA 3WENA 3MSDA 3VMPA 3BAYA 4GI6A 5IHRA 5DO8A 2PI6A 2EPNA 3BCFA 2FHBA 3WNOA 3QHNA 3E1F1 2DT2A 1L0PA 2GDUA 3ZO9A 1OWQA 2VRJA 5CPQA 4IM4A 1TMQA 1QI3A 2WBKA 1MQRA 2ZUSA 1RPKA 2ZWYA 2XHYA 2F7PA 3WH6A 4AD2A 5I24A 1EQPA 2DIJA 3PZ9A 2V3DA 3IJ8A 1E4MM 4FLQA 4W88A 4P8WA 5A6AA 1CGTA 1ISZA 3T2QA 4BQ4A 3N13A 1V3MA 3ARZA 5IFTA 3RDKA 5GNXA 1PAMA 3UESA 1UKQA 1EO5A 1SMAA 1GOQA 5M03A 5ABGA 2PWHA 5C8BB 1QHOA 3CV5A 3HG2A 2XN1A 3M7SA 2F61A 2UY5A 3WELA 4GO8A 3WNLA 3W6LA 1KBBA 1UZ4A 3ALGA 3RM8A 2PC8A 3VPLA 2GJXA 1UKSA 3EDFA 1XGZA 1EDGA 3CBWA 3N18A 1JDDA 4FK9A 1JF6A 2VO5A 2XFFA 2EXOA 1MYRA 1VEOA 2WZEA 1B90A 1W3JA 1MWOA 3PZUA 3O6AA 2B31A 2WKGA 1AMYA 4W84A 3F5LA 3WMSA 2CPUA 2YIHA 3W82A 3U5UA 3K8MA 5BRPA 5HDRA 2OWCA 4D6GA 4FMVA 1KGXA 4J3SA 4MJ2A 4GPNA 2BXZA 4HP5A 1XYZA 3OB8A 3EDDA 4HOXA 1V3LA 3RMEA 3OGVA 3W27A 4P7QA 1MW1A 4JFUA 4HPGA 4W8LA 2WANA 2JEQA 3GXIA 1V6WA 1B31A 2JE8A 2X1IA 1ISYA 2BVDA 2XM1A 4CN1A 1G1YA 2FE0A 1K9FA 3S5YA 2O92A 1QI4A 2IXVA 1HJUA 1QHPA 1DHKA 1WNOA 2QPSA 4UTFA 2J7CA 1E4IA 1JL8A 3AZSA 3VIPA 2WZHA 4NZJA 1C7TA 1C91A 2FGLA 3AIBA 1EH9A 2VRKA 1OSEA 3OGSA 4MB4A 4HMEA 3UG4A 1E4NA 1E0WA 1KBKA 1BYCA 3II1A 5I6SA 6A3HA 1UWQA 1CEOA 3DX3A 3WDJA 2D3NA 2CBIA 5HNNA 4UOJA 4EE9A 2NT0A 7CGTA 3I3DA 3UR8A 2XVGA 1XHGA 3LPGA 4HMDA 3WSUA 1JYXA 2XWDA 3A24A 3H55A 5JBEA 4W89A 1Z32X 5AYBA 3ARQA 2W92A 3T2OA 2JFEX 1CBGA 1R8LA 5KZ6A 3BMVA 4WJXA 2RGLA 3CZJA 5IDIA 4QDMA 2D0GA 4U2ZA 3UERA 2WC4A 4UCFA 1XD0A 1JZ3A 1TQTA 3D5HA 1JD7A 1W9UA 3AFBA 1V08A 5LA0A 1JYVA 1BF2A 3LX9A 1T0OA 1TQSA 2J25A 3EJPA 3A3HA 3AMGA 1UR2A 1OCQA 4IPNB 1N82A 1V3HA 4LX4A 1HJVA 4FNTA 2XJ7A 1MQQA 1UYQA 4JFTA 3H54A 1BTCA 2VOTA 3KE0A 4NI3A 4H8VA 1PBGA 3WEMA 1GQKA 4JFSA 3HG3A 1E0VA 3GNOA 3A4AA 5A95A 4QFUA 3WBEA 3HMCA 2ZXQA 1H41A 1LF1A 4CU8A 1J0YA 1FH8A 1NOFA 3PZGA 4CCCA 2WMKA 4UFJA 4WKHA 4E4PA 2EABA 1EO7A 5FIPA 3F4VA 2VZSA 4D72A 1J0HA 3VMNA 3CH9A 5A8PA 1LL7A 2D0HA 2EADA 5A8OA 2WYSA 4DWSD 3BSGA 3DDGA 4H7VA 5E1QA 4CD5A 4GIAA 4PMOA 1CTNA 2W67A 1WZMA 4ZE4A 3F5KA 3WDHA 4OZOA 1UHVA 3VIKA 3GXNA 4C7GA 2D0FA 3ZOAA 3DC0A 3G6LA 3ZR6A 2XM2A 4V2XA 1HKIA 2ZUWA 1NWTA 2J78A 1KCKA 1XD1A 1GOIA 2BHYA 2TAAA 3BVXA 3A21A 1M04A 4PSPA 1HJWA 1E56A 1CPUA 1OM0A 5ECUA 1V0KA 1JZ6A 4HA4A 2D20A 3GXMA 2X2YA 1UKOA 1GOMA 4CD7A 3BAXA 4AEFA 4AYSA 1E5NA 1Q6EA 2DSZA 4UOQA 4W8BA 1LG2A 3CZEA 1TA3B 4Z2GA 1MW0A 3OLDA 4ACZA 2WCSA 1XSJA 3VNZA 3MV11 3ARXA 5E0CA 1NH6A 4UZSA 3MUIA 3MMDA 2V3GA 1C7SA 1TR1A 2WVVA 3BGAA 1RP8A 3HN3A 2VC9A 3CGTA 1D3CA 1ECEA 1DWIM 3D50A 2O9PA 4TVUA 5BXTA 4F9JA 2YA1A 2J7HA 1ZJAA 1CENA 1UR0A 5E09A 3IGUA 2FHFA 4Z2JA 2XN2A 4J27A 3APGA 4K68A 4AXNA 3JUGA 6CGTA 2D22A 1PZ3A 5FKYA 3CTTA 1OINA 2EQDA 4URIA 4YPJA 3AZTA 1G94A 1V0LA 2EPOA 4UZUA 3OIHA 3W26A 4RE3A 3PN8A 4ACYA 4D6EA 3QHMA 1W2VA 5C70A 3POCA 3FXYA 4CCEA 1R7OA 3AMDA 5EB8A 4D6DA 1J11A 1EA9C 2G4FA 3SUSA 1ISXA 4EANA 5EBAA 5CZKA 3A6OA 4KGJA 5I3DA 3ZSTA 3BLKA 1VF8A 2OW7A 3DX1A 2DT0A 3MU7A 4MDOA 3KL3A 3VGEA 4YN5A 1M53A 6TAAA 1JD9A 4F79A 3VTRA 3THDA 2ZIDA 3KWXA 2WHKA 3GXTA 2GVYA 3CUJA 4OBSA 4D71A 4Z2KA 2C8NA 2ZXDA 3AMCA 4AC1X 2WVTA 2CBUA 3NSNA 3ZMRA 3RO8A 1HX0A 1TQWA 2OYLA 1FOBA 1JYWA 1QNQA 4XB3A 1KXTA 1HP5A 3AQUA 2VNCA 3N12A 3BAJA 1QI5A 1GPFA 1W9PA 3BUBA 3LPPA 1US2A 1CXIA 3W29A 4AD5A 1DTUA 2XVNA 4J28A 3EJUA 3DX0A 4CD8A 4PMVA 4AW7A 2WMIB 4CN4A 3NYDA 4AZHA 5IFPA 4RE4A 5IXEA 2XSAA 1LWJA 2XTKA 3KL0A 2G3JA 2XN0A 2FYVA 3GBEA 4M82A 1QNPA 2OLHA 5AC4A 3OLEA 4Y7EA 4KMQA 4LYPA 3U5YA 4CUCA 1HJXA 1TVPA 3PZVA 5CXPA 4BQ2A 1HJSA 4AMWA 4HU8A 1UH3A 4QP0A 3U7VA 2DGAA 5D9NA 1U30A 4FNSA 2WC3A 2WPGA 3RM4A 3OGRA 4FLOA 3VDHA 3AHTA 1NWSA 4JL2A 5HOSA 3VDBA 2VL4A 4MNMA 1HVQA 2WLZA 1CXHA 3TTQA 2DH3A 3LRKA 1UZ1A 2VTFA 1Q6DA 1RH9A 4QAWA 4U5KA 2CETA 1E40A 2WSPA 3UEQA 3CMGA 1W1PA 4UFLA 1J0ZA 2X2IA 3NCOA 1XH1A 5CLTA 2J7BA 3MSGA 3VD7A 4WLCA 3WH7A 3D51A 3B8SA 1BGAA 1JAEA 2ESCA 1G9HA 3W37A 3S2CA 3LMYA 2E40A 2VQUA 2Y8KA 4IUGA 3WIJA 2C7FA 1MFVA 1WP6A 5BXPA 2GK1B 1MFUA 1UD4A 4R5EA 3CZKA 3CZLA 1TUXA 5M3WA 1WPCA 3UG3A 2EPKX 3BUPA 2ZX7A 4AZBA 3WH8A 2W91A 2G3NA 3ZT6A 4P7RA 1G01A 4TVCA 1E6SM 3VIHA 1Q4NX 5ABFB 3TTSA 1AQMA 2XG9A 2WSKA 2EAEA 1NP0A 2GJPA 3CPUA 3OBAA 2HVMA 1ZBWA
chains in the Genus database with same CATH superfamily
4RX4A 4B16A 1CDGA 2J6VA 4GY7A 1YAIA 4DUWA 2WXHA 4ZTOH 1OD8A 1RD6A 2ZYIA 3LQZB 1CLCA 1C29A 4Q32A 3W7MA 2BY2A 3TV8A 4BZYA 1M9SA 1E50A 2BP8A 1R5IB 3KXFE 2W3ZA 3R94A 1HEJC 1RY7B 3PP3K 4P2VA 1YBQA 3QJFA 3QQXA 2XISA 1QSEB 4N87A 2DEWX 3PWJA 5AG9A 5F1IB 1BVOA 4M02A 3RPTA 4YYCA 3QQ9D 4IHOA 2YAOA 1VLXA 3PZQA 2GIYA 4CQ9A 4ATWA 4MJID 1UM6L 5F9AC 3QARA 1UASA 4K38A 2WBWB 3IANA 1LO0L 3F58H 3JVAA 5AWNL 1YNPA 5KJ7E 4G56A 5JHDD 2UV3A 5IV2A 2ATKB 4Y8AA 3ZS4A 1CS6A 2OTPA 1TQBC 1TT6A 3KEDA 4M8VA 2YMXL 3QDJB 2WZIA 4QRSB 4TNEA 5IBTH 4DP0X 4ICCX 1BOGA 5HJYA 4PP2A 4HW6A 4FG6C 4L9XA 2BNQB 2OXHB 1QOQA 3WDPP 4ZOEA 1NQKA 3CVHA 4QKXB 1W5OA 1OWRM 3W9EA 1ADQL 3B9DA 2FAUA 1ASPA 1JR1A 1XPYA 2WKOA 2DW5A 2IAND 1YVLA 1JNHA 2PCQA 3UXDA 5JA9A 1HH9B 4TX9A 2A9MH 2LU5A 1RMFL 1DN0B 1KPRA 3LHWA 3RX4A 4DP8X 5DGRA 4GAAA 2BWDA 3W4RA 2R4SL 1IXPA 4N3UA 2OJ1A 1HIMH 1ZB5A 3BIAX 2QUUA 2OEMA 1E15A 2EJ1A 2R23A 2VXVL 1OAKH 3ZHNA 1OB0A 5DVKA 3VTAA 3U1SH 2PGEA 3IE9A 4F27A 4K36A 1L6SA 1H0DB 3KGUA 3CNYA 4HU0A 1BAFL 4DWSC 3SO3C 2ZZ5A 2XSBA 1K4CB 1R3LB 5HHPB 3H6OA 1UP2A 4P46C 1F8IA 3QWQB 2EDTA 5DJDA 2E8YA 2CXEA 1OSZA 4K9EH 3RM9A 2FNWA 1PY0A 1GGBH 4ICXA 2PS2A 4EWND 1C5BH 5CCKH 4ZBCA 5F1NB 1D5RA 4R5TA 5GGUA 1ZHAA 3C75A 2WXPA 4G3YL 1E6JL 4O02L 3TPKA 1W80A 4WY0B 4UFKA 4PREB 1F18A 4W9JC 4KZEH 1EEUA 2ADAA 4R7DB 3U6WA 2DB8A 1EDQA 1VD6A 5DO2C 4WJG3 2I1OA 3IDGA 5E6ID 2HRLA 1KM6A 3TWYA 4YZFE 2AK4D 4KDTC 4RDYA 4JPWL 4PJCE 5XINA 4Z3FA 3S8FB 1OTUC 3LDBB 6REQB 1A49A 3QA3A 1I31A 4FX6M 5DS8B 3OMNB 2BVTA 1I1XA 1THCA 4PUDA 3RPKA 2NY4B 5C6MA 5CN3A 4K94H 1MI5A 2QSTA 4I1NB 1AFVL 1KM2A 1MHCB 1ZTXL 1A3WA 3IJYA 5EU6D 4AIXA 3WJLC 4OV5A 4HBCH 5C0DA 5D8WA 4LCWD 3SUTA 3HPAA 4HS6A 3SADA 1B0GA 4DGVL 3NQFA 3VA8A 1X44A 4ODTL 3MC0A 1TTUA 5I5RA 1MVUA 2HVJA 3O2VH 3D0LB 3KDMA 3AIEA 3RIKA 4AH2B 2IG2L 2VITB 4HIQA 3VU1A 3TJIA 3SPCA 2V7NB 5CZSA 3GSQA 3V6ZB 3RU8H 1ZA6B 4HFUL 2I5YL 1QSFD 3LGGA 4CQCA 1BP3B 1R3KB 3DFOA 3CUPB 2OLSA 2QR6A 1IRAY 3QQDA 2X0UA 1F8TL 2LR4A 4WSJA 3NDYA 1U8IA 3P3UA 4LUSB 3Q65A 1L8NA 4PJCB 1JZ5A 2LFGA 3ITYA 4HK0B 4IKNA 4NZCA 1RCYA 3BX7C 3Q2CA 5C9KA 3CIAA 4OLWH 1Z5LB 2GABA 3TA3D 4R2GB 3TO2A 1FJ1A 1HQRA 1CD0A 2GCYA 1JPFA 1VPYA 3SGDH 5D38A 4HKXB 1TJXA 3DBSA 4MDIA 1UB5A 3KTSA 2OMZA 3WQVA 3PHOA 2JJVA 3ZRFC 2VEKA 1R3IL 5E9DA 1XLEA 2DMCA 1N8IA 1ZUAX 1O5RA 5KVGE 4HWZA 3QKEA 1MVFA 5I1GL 5M94B 3TFCA 2J2ZA 1JDCA 4LBUA 5IFHH 2GHWB 4QHNA 1BXXA 4MJ6A 5CP3H 5ESVA 3R8QA 4CW1A 1HF6A 2C14A 2JF1A 1PYFA 2D2HA 3OPUA 5GS0L 4DVOA 4QRPE 4U1HA 5B3JF 1WA0X 2XV2A 4GMTL 3ZYIA 2A77L 4FHBD 4HNCA 3W0WA 2DWYA 4YO0B 5E5CA 4LLWA 1MFAH 1JZHA 1N5AB 5EN2A 4Y4KC 2FLIA 5AW2B 5MKGA 3CHFA 2FSDA 1FF5A 3E2QA 5FUCC 2YXOA 4PLJD 1ZP4A 3ZM8A 4YHLL 2DQTH 3QSRA 1QO3B 1HKFA 2NXYB 5C0AD 4GKNA 2Y36L 3FVDA 4KEUA 4OCSH 5KBMA 3DFTA 2IH1A 3KPRA 1IGML 2I9LB 2NY3B 1P7QB 3VSUA 3SGGA 3WNJA 3W7JA 3P54A 1L4IA 1EC9A 5IB5A 3F7PC 3HS0B 1PKQE 3NG5A 2ETWA 2VX5A 4AV5A 4HNVA 1DLHB 1D7FA 3MBEA 5JQ6L 2E28A 4N2HA 2YW3A 3AI0A 2C34A 1GOFA 2DPEA 5HVHB 3QV9A 4WJKB 2ATPA 5HULA 2DQHL 2X40A 2CLVA 1ZLWK 2Z2UA 4QRPB 3IJSA 3EFFA 4A29A 4PL2A 4W93A 3WUWA 3GPEA 4RCAA 1KNWA 1T7XA 5HI4C 1F3DJ 1JCVA 3NIDF 3AADB 3B7YA 3GO1H 2E27L 3RWGB 3CH1A 1NCAL 3WJJC 5I6MA 5EZOH 5DBUA 4NNYA 4K7VA 1QNRA 2BIIA 2QTVA 3FTZA 3QCTH 4MPKA 3C2FA 4BGDA 3PGFH 2G0KA 2QLVB 1MDLA 4LCRA 4Z7NF 5C2GA 1LMIA 5E93A 2DQUL 5I0YA 2D3VA 1CE1H 2YGYA 2DZXA 2GKIA 1CJYA 5EEUA 2J73A 4OGXH 1PKQB 3EOUA 1V6XA 2BSCA 7FABH 4I77L 3WS6A 1YYLL 2FO1A 4YLWA 2A7PA 3AMKA 4P23A 5TK2A 2GDVA 4C4KT 5DVPA 2VXUH 3BLBA 1KLFB 4K7FB 3FDGA 3WLWC 3CQHA 4XMKH 5A6TC 1D6EB 1FDLL 3MRPB 1MF2H 1MEIA 1PX4A 1H0IA 2I7OA 1UVQB 3TJXA 1M01A 4IRZL 4J6RL 3BQUB 5DMLA 5I16A 4D6FA 1ICSA 1Q6FA 2VQ1B 5B7FA 1P9MC 2DD8H 3S37X 3HE6C 4D6IA 1AJ7H 5GRUL 4O53A 5T5FH 5B8CC 3V75A 2UUDK 3FO1B 3UPMA 3DXAA 3MI6A 1FG2A 4AMKL 2DIEA 2QXWA 5I09A 2L04A 3MOAH 3P74A 1F1AA 3CDFA 1ZLPA 4XPTH 4S0SD 4NZRH 3WL0A 4PSRA 3UJFA 1HDMA 1WCBB 4L0PB 4B97A 1YHTA 5FECA 2X7WA 2NW2A 3HB9A 3ETBJ 3LERA 1U42A 4JJOA 2Q5BA 4E5XG 5J11C 1M7DB 4RLDA 2LAGB 2GK2A 2F53A 1NEZB 5KG9A 2HSAA 2B20A 1NC2B 3O05A 3IJDA 3F7JA 3BAEH 1W37A 1TX0A 5CNHA 4JJHA 3FEMA 4I48B 5I1JL 1FL5B 3O6YX 2LTQB 2AKRA 1XSKA 1VRSA 1RCOB 3JWNC 4BCEA 4D8PA 1R1CA 2V5YA 1FVCA 2Q8AH 25C8H 4PJ8D 5IB2B 2X3AA 4G72B 1KN4L 2AXWA 3CNKA 3GW0A 4MDPA 4C65A 4OOUA 3PBVA 3LKSA 3AAZA 2WINA 3FRUA 5GS3A 3W74A 4J2QA 5JUVA 4PY7A 3ALFA 3C8KB 5TAOA 3TZVA 1P1XA 3ZKMC 5C08D 2VDOL 4MSSA 1X1NA 1LE5A 5EHFA 2WQDA 3VXTA 3BH9B 1H7OA 1DWFM 4MPQA 1I2RA 4G83A 2I9TA 1RAMA 5DHVH 2WNGA 3BVVA 5GIRB 1D5ZB 1EJSC 3VKKA 5EH1A 4JM2A 5CPTA 4N8VG 4L8CA 3FXIC 3AXMA 1RPXA 3THCA 3PNWA 1PYWA 1NCWH 2YLLA 5AW8B 5KOVC 3C86A 2GUYA 1PG7X 4ZOBA 3K8KA 4P5RA 4M43H 4RE2A 2FZNA 1NWUA 3RB5A 2H26B 5F6HJ 1CU4H 2P76A 2MIZA 3S3PA 3C08L 4IIDA 2QR0B 2NSQA 2EDLA 3VFWB 3C60D 2V5RA 4C56E 3UR5A 4HUMB 4H8HA 4R3SA 3CIXA 2B15A 4ZB2A 3TH6A 3ZSSA 3ULUC 4S0TD 3PCYA 2VZVA 4O1CA 1OP3K 4P2RD 3RNKB 3UO1L 3SJVE 4JDVA 2X87A 1G4EA 5D2NE 2C1HA 3FY1A 4Y96A 4O14A 5IG7A 4KPHL 2QCMA 1W6TA 4JVUA 1N2RA 5F3BA 1S5HA 4FQLL 3D5OF 4PWHA 4YHIB 1WDQA 1TWIA 3LN4B 4L1LA 4DF2A 2QBWA 4I9MA 3P1VA 3FRPB 4NAJA 2EPNA 1WKFA 1S7TA 5LXVA 1U3JA 1M6UA 2OX1A 4QEHA 4RIRA 1JGLL 1FORL 3RAJH 3X14B 2JCWA 2FZ3A 4W88A 1ES0A 3ARZA 1HXYB 4UIKL 2Z7ZA 4NQED 4L8SA 3GWQA 3DJZA 2YWYA 5F6IC 1QHOA 3ABLB 4L9DA 1S7WA 1KTLB 2QJGA 1DQKA 2BVQB 1VZWA 1N9PA 1P0EA 2GJXA 4UU9B 2QUTA 1HXMB 2H90A 3M6YA 4X9GA 3U4FA 3SI9A 4O5LH 5TDPB 1TTFA 4A6YL 2PMZA 2EF9A 4NFBA 3PUOA 4NKQB 4C56B 5DUJA 3KWWA 4X6BA 2BSLA 1U8MA 5BRPA 1U8QB 5JW5A 2QSCL 1KRMA 1I8IA 4NFCA 1EFZA 3MWAA 4CMMA 2JI2A 3SJVB 3GB6A 2FT7A 5D2NB 2EEBA 4Q33A 4OLYH 3HMXH 5HJ3A 3U2EA 4Y4FD 5B80A 5CJNA 1AD9A 2L4OA 3OHXC 3U82B 4CC4C 4FOKA 3QUGA 1LHZA 5JXQA 2WZAA 4K2UH 1KLGA 3FTSA 4NZJA 2BOFX 4HMEA 1E4NA 1E0WA 1GZQA 4XNZC 4Z42C 5EA0L 3LJ3A 3C2AH 3WDJA 1AXIB 7CGTA 4MAYA 4F48A 2IBZY 1T2QH 3ARQA 2ZSVB 5JXED 2XTLA 4UMAA 5HANA 5G2HA 3VCLA 2DZSA 3HRPA 3PXJA 2GQAA 1U83A 4RDZA 1QUPA 1ZANL 1MJJB 3NA9L 5EEXA 3S36X 5D7LE 4XPHL 1I1CA 3E7JA 2J25A 1XW8A 3FQ1A 5CZRA 5GJTH 3WUWG 1HJVA 3ENEA 2XJ7A 1UYQA 1QEWB 5HR7A 3YPIA 5IVOA 3M8OL 5SWSE 3P84A 1ZVNA 3WEMA 1UOLA 3MREA 3FA4A 1FY6A 3MNVA 1NBCA 1FFPA 2YXXA 4N6RA 2PPAA 1V77A 1J79A 3HM7A 2VEIA 5BZDA 3ZJAA 3EAKA 1J4EA 1U8LB 1J0HA 3VMNA 3N73A 5D04C 5DCCA 1T3FA 4DWSD 4GKZA 1E5YA 4S1DD 1GJPA 2CLEA 4MOZA 3WO4B 2W67A 4P46D 3UXKA 2XCMC 3VIKA 3W7KA 4J3OH 2VGGA 4OZFB 4N90D 1WBJA 4JANB 3G1YA 1NWTA 3UGEA 2GAZA 3MRQA 4IIFA 5I75B 3M43A 1ONXA 3U30C 1JZ6A 4PCNA 3ZW3A 3MRDA 5E2WL 5FM5M 4WGXA 1YJDC 3PS6A 3MRRA 3LKNA 4ANKA 3OLDA 4YHZH 4ACZA 2VISA 3FJLA 2NPLX 3B0YA 3TC3A 4EUPG 2Q01A 2V3GA 3F01A 1RP8A 4X4ME 3STPA 3CMFA 5D7LB 1Q9OA 3GIZH 4CA4A 3I6SA 2QDDA 2Q87A 3FXGA 1AACA 4YBHA 3UZXA 2EG7A 2RD0A 2Z31D 1V7ML 4AQ1C 1NIAA 5SWSB 3NSCA 3OR6A 4XBPA 5HYSA 2EQDA 1UWFA 5EORH 5HHOD 4RE3A 4XWOC 3GUTA 2YPVH 4NYLA 3WK3A 2IQDA 2AJUH 1EEYA 5L6YL 1NBQA 5REQB 1KRAC 1IIIA 1YEKL 1VBHA 3A6OA 3MU7A 1EHLL 2P44B 3P30L 3F85A 2B7OA 3GXTA 2GVYA 2NX1A 3NSNA 3QV7A 3PU7A 1HX0A 1TQWA 3ASOB 3ZUCA 5JORB 4PR5A 3MBWB 1QNQA 5FWQA 1WK0A 5FOBA 3A4JA 2PPFA 2DYSB 4FFWC 4M48H 1ZLUK 4Y16C 4PUUA 2I57A 4DZ8A 4MXQD 2E77A 2O56A 1P0SE 2K4WA 1TYRA 2P8MA 4PJ9C 2G3JA 5EUKA 3LPWA 1RIHL 1MRCH 3GBEA 3KPQB 2W0FB 1I4FB 2C3ZA 1GYCA 4QP0A 1P7KA 4MD0A 2WPGA 5I0WA 2DORA 5F71A 4UDUA 4ZUUB 1JNLL 1O94A 1HVQA 3K2GA 3SDXF 4HJ1A 4JQIA 6FABL 1IL1B 1RH9A 3FX4A 1U8CA 4X8JB 2BMKA 4N0FB 4ADUA 2B0SL 1RZGB 1RCQA 1XDTT 3LSOA 3GR7A 4C1LA 3TC9A 4WDTA 4MD4A 5FOJA 3DOPA 4XTRD 5C7XH 1IT9H 1YDVA 5EO9A 3WHXB 1X5JA 5D8JL 1H3PH 1FNAA 1OY0A 4D0BB 1LILA 4S11A 3GU2A 3X3FL 3LKRA 2TRHA 3HEIB 4BWWA 3MI3A 1D2PA 1BEYL 5TDOA 4JTJA 4MSWA 3GR8A 2VCCA 4AZ8A 3T09A 4BK4A 4F80A 5FO7B 1J8VA 2CLIA 3U9PL 4LAUA 3SDDA 3S42A 2VMEA 3CLEL 3B9KB 2Z35A 3RBSA 5DHDA 1A6WL 4P0DA 1BJ8A 3QQ9C 5CC7A 3TXVA 1SZFA 1I7UB 4U2YA 1YSOA 3UJTH 1EX0A 5A6SA 3IAQA 4Z3JA 3ARBB 3N9RA 2FIRT 2ZXCA 3TQ0A 3V52H 1E4WH 3DTXA 4ZUSB 2ROYA 1F3WA 1WFJA 3EYOB 3O41A 3GD1C 2JJTA 5FIEA 2XA8H 4WI3A 2W9DH 1MEWA 1PEZA 5ITFA 3N1QC 4JO3L 1X5MA 4X4XA 1FCUA 1NANH 3LLFA 4XAZA 2Q7YB 4LEBA 5TJWK 3SE9H 5INDB 3VFVA 4KVNH 1OD9A 4NKOB 3QRFM 2CJUH 1I9RH 2OVLA 3UBXI 4CNSA 3RU8X 1URZA 1ZE3C 4NM8L 1J9QA 1HKLL 2AGTA 3ABXA 3CVBA 4BA8A 4KMLB 1KIUA 3ZLGA 5A40E 3GVRA 1R3SA 3RX3A 4DKFL 3LHPH 4ZTEA 2N7AA 3NABH 3ABZA 4NXSA 1MH5A 2VR3A 3GMPB 4LVOC 2HX9A 1XIHA 2HVOA 1PZ2A 2CMRL 1W0VB 2CBQA 4LGPB 3OGOE 1QSED 2NUXA 4PBEA 4HCFA 3MA9L 4NJAH 5E03A 1L9MA 3AUOA 3CN1A 3WUGA 1R85A 1AQKH 3EYUL 1N10A 1S6NA 5AZ2H 5EZIH 3S3JA 2IGFH 4H25A 4IQDA 2IH3B 1A7QH 3NJVA 3DX4A 4DUOA 2HISA 3GMQB 2JKRM 4QXIA 2YAFA 4I90A 2J4WH 2ZF8A 1NMAL 4KH2A 1HZKA 3QDJD 4C6QA 3GYEA 4HUVB 3EH3B 5ENLA 2ZG3A 1G0CA 1S2VA 1GK8A 2JMRA 4GBDA 1LEKB 3FO9B 4H8PA 4OTXH 5KVFH 5E6SB 3RVVD 3FU3A 4NVTA 2FJHB 3AOFA 4G8TA 3NOYA 4OZGF 5AFAA 2BNQD 1HINL 5E6IC 5ITBL 1F3DH 4WO4B 3IKCA 3WE6A 2VIRB 1C16B 1FCQA 1JZ4A 3PWLB 1H5BB 4HZ6A 1DBKH 1GORA 2P3ZA 2F1EA 4ZX4A 1Q6OA 2Y0FA 2L7EA 2GBTA 3KXFD 4YUEL 2ZC8A 3H4GA 1TJRA 1IC4H 4IP4A 5HUPA 4LCUB 3LPOA 2OAAA 4A63A 5L4FA 1KCBA 5IBXA 3DFYA 4XPFL 5CN2A 5IW3A 3MLZH 1PMYA 1MCKA 5AAWA 4BHUI 4J3WA 1EXBA 3O0FA 1Q63A 1CC3A 4FJ6A 2Q2EB 3UTSA 2XOTA 1WZLA 4R97B 3TSMA 1R7AA 1FGVL 5AOIA 2FTYA 3M4HA 2PR4H 1SDAB 2VENA 3O45A 1B2WH 3FYEB 3N25A 3VO0A 3LRGA 1HNFA 3SCOA 1NJ9A 3LNHA 3JTTB 5E6RB 4XMVA 4REQB 4GZEA 1OP4A 2AGKA 2WO4A 4XWGL 4XBMA 1GHSA 2BVYA 4DK3A 3H7UA 5CJ8A 5AB2A 3MYPA 1JHKL 4LAQL 1FH9A 1TVHB 2LOEA 3L3OA 4S1QL 5HUOA 4ODUB 3JVFC 1P7BA 5D7HA 4MMZB 3GJFH 4FZ8L 3CU1A 3M88A 1EJ7L 3TA3C 1OIFA 4XPAL 3H7LA 3MV9E 4YVVA 5GGTA 3CWNA 2NY4D 2H4EA 1UZ6F 1FFQA 2E47A 4JPSA 1EUTA 2AEQL 2JI1A 2CLKA 4QT5A 4PA8A 3GTHA 1AHKA 2EDQA 1C8PA 4A35A 4R26H 4Q0XL 4JZOA 3G8RA 4DYJA 3OD3A 1O1ZA 1YEJL 2AXGA 1OZMA 5EOTA 3MLWH 3FUJA 3VXSB 5I17A 2CIIB 1POKA 3WAKA 4QDPA 4IU2A 2HFGH 3ECBA 1HK6A 3S4SA 3LTVA 1DQXA 1PZSA 4IGBB 1CL7L 5EN3A 4TQ8A 4P9HL 4OJCA 1NFDE 2BSDA 3ARGA 2GYIA 4BQBA 1T03H 3EH1A 5KYYA 1CLVA 1JCNA 3PZMA 4TQEH 1AQ8A 3C5QA 1CDIA 1DJZA 1U0QA 3L4UA 4AAJA 3URBA 2QAFA 3OZKA 1SBSH 5ERWA 2WVUA 1NSJA 1FPTH 2XIBA 1UEYA 5FYLH 1UB6A 1JUEA 4PJGE 4QXUL 1X7SA 5AYZA 1DQLL 4W9DC 3E3HA 2O5YL 4JJ5B 2WXJA 5EC2B 3EJSA 4KCWA 3OJGA 5BJTA 5CKSA 4TR9A 12E8H 4TQPA 2ZZ6A 3KJ6H 5AVSB 2DM4A 3LQAL 3H3PH 3HAEH 1XG4A 4PLKC 1RAKA 4LEXL 2EKCA 4E4FA 3L0NA 4PS7A 5BW7A 3RILA 4Y1AE 2R6OA 3H9SE 4ZS7H 3U7BA 3RY6C 1SOXA 1W5PA 3BP5A 3F84A 3FFDB 4US5A 4L37A 4ETQB 3W1NA 3N91A 5E8EB 2AJSH 1HILB 4TNVK 4PTWA 4Y2OB 1MHHB 3MFFA 3K4DA 5JUEL 4PRTA 1LQ2A 1EC7A 4A2LA 5FUOL 1IZCA 5J6GB 2FWSA 4WIWA 4J6IA 2YEZA 5SV3A 5LKYA 1SYSA 1E55A 1OARH 1NFDB 4M19A 2ASHA 1K2DB 1G6RB 4F3HA 2P3EA 4PI2A 2RAGA 4Z0JA 3QXVA 1DE6A 1PU0A 1GNXA 1WV7T 2R0LH 1JCMP 3EJZD 1DJSA 4AT6A 5A6BA 1I8AA 4DGWC 3N5AA 5FDYA 2XPGA 2CO7B 3IE4A 1SY6H 2ATSA 4LSRH 2X0YA 3CQKA 1K9EA 1IAKA 1BZ9A 1FE8L 4XCNB 3IPWA 1BXAA 3B03A 2ALWA 5D2LA 1V27A 1I3GL 3QORA 5K9QI 2MPAL 4XCFL 5F3HA 3LRMA 1US3A 1XL6A 5H6HA 3MMUA 1I8JA 4BQCA 1LL1A 4TPRL 3RWEB 1S9XB 3T2NH 1FWJC 4Y1AB 1TPWA 4DUXA 3H9SB 2G8ZA 5D7EA 1DQMH 4AZ7A 3MUZ1 2NXYD 2CLHA 4W4OA 4HG4J 4HPNA 1GSKA 2CERA 4OLXL 2Y88A 1NCDL 1NICA 1P7QD 4D1IA 5AOMA 3UT0A 3FVMA 3R4RA 1E1EA 4H04A 2ZC1A 3SKNA 3UAFA 4AC4A 4HXBH 3R12A 3TT1H 1FHUA 5A3HA 1CG9A 4H88L 2ZRVA 1LO5A 1ZGLA 2OT0A 2GQ9A 4EMZA 3RWJB 4L64A 4JKKA 1G7JA 5ADPH 3UIZA 3BW2A 3RU6A 3CDGB 5LG1A 1EXPA 1LO4L 3H70A 4JBRA 1Z3RA 1N70A 3JWNH 3IARA 2AABH 4EEEA 3RWDA 4QRPD 1ETZB 2YJLA 4N22A 4PRBA 4JRWA 1D9KA 3BUDA 1OYAA 3EKGA 1AJ2A 3HS9A 2OZTA 1CXKA 4LRTA 1THAA 2BRQA 4NI6A 2FH8A 1KN2L 1FH5H 4AGMA 3CFKB 5C0GA 2DSUA 4HH8A 3MUJA 4APXA 1BVNP 1TJ1A 4LEEA 5J1TC 3RLHA 2OWWA 5EFFA 3W73A 1IZKA 2W66A 4DJFA 3LMJH 3FFCE 4R96A 3UIYA 1TZGH 1GYUA 5EC1B 3NP3A 3FCSB 4AKPA 4E2DA 2X7LB 1HKKA 4PMYA 3NPSC 3FUNA 4PJCF 4M7KH 3WQ6A 4I85A 3GNMH 3BD4A 4LHJB 2W79A 4W86A 1JEZA 2OMTB 3MHZA 2A6NA 4QTIH 1ENUA 5DRIA 1T5WA 2OCZA 5ANME 3ULUF 1MHPH 2CEQA 4Q8MA 4PZVA 5I07A 4ZPTA 3LOWA 3QH2A 4KTYA 3VFSA 4CSSA 3BVUA 2WBXA 3RWFA 1OG0A 2YSTA 3ROOB 4PJ8C 3RKDD 5AW5B 2WLYA 3BQUD 3S35L 3VFCA 3F2DA 4JN2A 5T3ZE 4KQ4L 2CJ3A 3S5LA 5A2CA 4QTHB 2XRAH 3PIQA 4XKMA 3OC8A 1HHJA 5J0BA 2B7NA 5DS1A 5FL0A 3FZUD 4E41A 2VVNA 2AZUA 2DOCA 4GQRA 4DLFA 2R1XB 2IDQA 5J4MA 2HX8A 5GRJL 1TTCA 4NO5B 4X5WA 3QKZA 3UWZA 4DM1A 1QOXA 4DB7A 2N7SA 2HK0A 3T42A 1WAUA 3LHAA 4UNKA 1GRWA 3V9FA 4WF7A 3FFCB 4X0KB 3ETSA 4M8QA 1UBPC 5DMGD 4NNPL 5HMEA 4Z6AT 2OODA 4I7VA 2F2HA 4G7YH 3LKOA 5SWUA 1ROWA 3ZL2A 3RUBL 3WTUA 4FFWD 1E51A 4Z1AA 3Q05A 2V38A 5LGHH 3R79A 4Y16D 3W5MA 3SO7A 4C54A 5EMJA 3C60C 3EBVA 2WXMA 5FEPA 5TE7H 5ANMB 3A5FA 4X7EC 4G7VL 4HZ7A 1TPH1 3GFXA 3JV6A 2G3MA 5KW9H 3BHBA 3DHDA 1PQZB 1R3HB 4OV6F 4H6QA 2MHAB 1A3QA 1KV8A 2X4UA 1XH0A 1SGJA 1A4KA 4O11A 4I0PA 1I75A 4E2OA 4QXWA 1AD1A 4H00A 1ZS8A 3G24A 1SYVA 3TNNB 3WNIA 3QUMA 4OLVL 5B38A 9PCYA 4YHEA 4G7FA 5CAKA 4R4FL 1T4KA 3OA5A 2YB4A 1N64L 3V0WH 2EH8H 2FB2A 4OKVB 1FV1A 1UCBL 4AXWB 2Z8RA 1AFSA 4CC0A 3BEWB 4UMGA 2D31B 3UTQA 3S4SG 1KCSL 1SF5A 1R4XA 3PUUA 1QHZA 2NY1C 2EEDA 3DVIA 5DD0H 2M26A 4WHDA 5EOCJ 1ITBB 1TV3A 3KYOB 3TH4T 4EJ1C 3UEZA 4Q4OA 4ZOCA 1LNUB 3NFSL 2AAVA 3FT2A 2CR6A 5JOFA 3UESA 4YNGA 4NRYA 1F76A 5M03A 4BDVA 1G7HA 5IM7B 2F61A 1QLEB 3A67H 4A7TA 5JPMC 4HGWB 3VPLA 1EDGA 1JMZA 4TV3A 4KO5A 1A7PL 3TV3H 3O6AA 3N4EA 1CL7I 3DX8B 4Y4FC 4X4YA 2UY6A 3BGMA 1O6TA 2D03H 5L2JA 5HDRA 1A50A 3MBXH 2Z29A 4EF3A 5TE4H 4AK2A 2AQ2A 4NZDA 2W9EL 4HNUA 4AQLA 2PFHA 1NFIB 2VL5B 2VMJA 1Z8AA 3LCHA 1H7WA 3LAFA 1FVDA 1A7BA 1I9EA 1KFEA 3FTGB 4N2OA 2AEIT 2O92A 4V1DA 2DZEA 5MI0C 1MCBA 3QY7A 5JXEC 5TIMA 5KN5A 2PRLA 4X9BA 2FGLA 1LROA 1SZRA 3UG4A 5CSSA 4JX6A 2GHZA 4K73A 3ATEA 1UXSB 1YTDA 3UQNA 1XHGA 4Z1PA 3W83A 5T1MB 4DN4L 2W92A 1P1ZB 1PLCA 3I9IA 3BXNB 2A7BA 5JPNA 4HJJH 2AXHA 3GI8L 3E2SA 1BKSA 3L17A 2UX7A 2YD4A 3T78A 3D5HA 2WLLB 1D5MA 3OXSB 5C0FB 2J57A 5LA0A 1JYVA 4HKBB 5KBPA 2Q3OA 3QEHB 1VCGA 1TR7A 3KFTA 4C56D 3M0MA 3OB0H 3GKWL 1GYMA 4S1DC 4BR1A 4JFTA 4M0XA 2DVUA 2W0KA 5D72H 3ABMB 3ZVHA 1W8SA 4RMRA 4JVWA 3SJVD 5MHBA 3CBKB 4UFJA 1ZLSL 1EJOL 1A1NB 2EABA 4E42A 3VXGA 3VKCA 4JG1L 3CH9A 4Y5VC 2OZ8A 4HS3B 3G5XA 4GIAA 1SHWA 5B1BB 3FYYA 3G8EA 3RR4A 3T0EE 2XH7A 4WW2B 4U49A 1SJAA 1OGAA 4EI5B 3DBNA 1O1HA 1AG0A 3GHPA 3ZOAA 5HGDB 2HNEA 4KXZH 3ZR6A 5T1DL 5C2BH 5DJ2A 1T89A 4MZIA 1YRKA 1L9OA 3IDJB 4X9SA 2CUAA 4KTDL 1KJ2B 5EUOF 4G80A 4KJYA 2CM5A 4L65A 1N8FA 3JTSB 3MRCA 1LG2A 1J86A 4MY1A 1GYAA 2Z31C 3VNZA 1A5SA 4WUUE 4JTLA 4NKIL 4NQSB 1PDZA 4AQEB 1TR1A 2WVVA 5CEZD 2EVHA 3AU2A 3TXZA 1USZA 3N9SA 4A2FA 1H8OA 4TVUA 1F8MA 2IALA 5BXTA 2F9BT 3AU1B 5DA4A 2XWJB 4AJWA 2JB5L 1AY1H 2AJYH 2IPUG 4DN3L 4UILH 2XIDA 1AGCB 4XCYB 1BVLB 3TJEL 2KUTA 3ESUF 4LKXB 3KGTA 3LH9A 5C70A 5T26A 4K3ZA 4H40A 5F88B 4CNPA 5FA3A 4R7JA 1BQ5A 1SHXA 3SUSA 2YW4A 1OOWA 4LCIH 1FYTB 3T0EB 2DT0A 1K77A 4MXQC 3P3SA 1NIUA 1RSYA 3OAWA 1E28B 1C08A 2FZMA 3I02A 1B6DA 3W7PA 3G1AA 1S3TC 1HP5A 3N12A 4G6JL 2G2RB 3BAJA 1WDWA 1P4BH 1R2TA 4AD5A 3U0PB 4X7TB 5D9SB 4Z8FL 3SN1A 2Y5TB 2IPJA 5IWLA 4WUUB 5D7LD 3IVTA 3QEQA 3VOHA 4JRFA 2QVIA 3ORJA 1DL3A 3R10A 3P3TA 3ANVA 1XVSA 3MNMA 4DWDA 5SWSD 2GTZA 4XTRC 2GK0B 3V9CA 2ZCLH 4Q6IA 3IXTB 2CDEA 3FF8A 4NO3A 1F6YA 3KNBA 5AVZB 4PJIA 1KY6A 1MCWW 1WDDA 2PDCA 3V10A 4NUJB 5HQLA 3QWRD 1MAMH 4CVZB 4AZBA 3WYZA 3SB3A 2VDQH 3HVNA 2Z4QA 3FH7A 4R9XA 3F2LA 4XC3L 1Q4NX 2XG9A 4E0CA 1FXPA 4LQFH 1PAZA 4GLRI 3M44A 1WD8A 4ZZKA 5MF5A 4LGSB 2PURA 3ZN6A 1UWGH 2VC7A 3QRGL 1CGXA 3NCCB 5CPMA 1XF2B 4PGCB 4HZAA 5FCUH 4ADJA 2PTVA 3KPOB 1JGVL 4UR9A 1U36A 5DHYB 4X6DA 1OAUL 4CL7A 4O1DA 4PJDB 1G1CA 1RA0A 4AOFA 3KOWA 3GDTA 4G70B 3HHSA 5DEJA 5CZXC 3BICA 3MANA 3BLOA 1BFOB 1IGWA 5LHEA 2YGVA 4ZFOA 2YQGA 5MERA 3O6FA 2CDGB 4HX1A 1WB0A 1D5IL 1BDYA 4M62L 4QXTA 3WN5A 5I1DA 4PUNA 4KK8C 1RHHB 2QPDB 2E74C 3E2HC 1WS8A 4PLKD 2X53A 4AIBA 5KJ4A 1ZMYA 1E4XL 5C2CA 5AOZA 4BEQA 5CC6A 2KMWA 2UZIH 1NAML 3C2VA 1HTIA 2G0LA 3WQFA 2ZD0A 3QAQA 5LA2A 1XRTA 5ESAB 2EXSA 3WKYA 2IADB 2VZUA 4W9GC 4M3KB 1FAIL 2P0OA 3C5ZA 5I3JA 4BH7B 2D23A 4XMTA 7REQB 1RJLA 3QJXA 4BI7A 3BAKA 3PBMA 1FLRH 3C9NA 5I8CA 1VA9A 2XLLA 2X0SA 1Q72H 2IOOA 4EXPX 5KVMC 3QIBA 5JIHA 3UYOD 2WXDM 2FSEB 3ZBMA 1OY3B 3NPZB 4MB3A 3LENA 3SCSA 1S39A 3FT0A 4LP5A 1JHLH 1E42A 2KAUC 4HGXA 4BJHA 4WHCA 4CC1A 4XN1A 3AROA 5GZOD 3MTXA 3D39A 4UTBA 3A3YB 2CKBB 2GQHA 3VFPB 1B3WA 2VC2L 3ARBD 5AB0A 3SQLA 2VYOA 2G0WA 1JVLA 4I3SH 4TRPH 3PXHA 2DQCL 2WUBL 5CIPA 4MFDA 2EYRB 3HPJB 3L1FA 1SQ7A 1OV8A 2WW8A 1P84J 1OGTB 1YEGH 3QXTA 1AMXA 3CSYB 4K8RL 3ZTNL 3HNVL 1BXCA 4N4QA 3KLAA 3RVVC 5JO5B 2JQZA 5GSVB 5ID0B 1ID5I 2QQNL 4YHOL 2X8RA 4N2CA 4BZ1A 2GPTA 2C1PA 1NEPA 2H6PB 1H3GA 4ZFCA 4OZHA 1WA1X 4DM2A 3ETTA 1Q66A 4UQDA 4HGKC 3IJEB 4O2FB 1H50A 3R2GA 4M24A 4L6OA 4K7PX 4ELKA 2NT1A 3RTQB 5B3NA 1IMHC 1A6VL 1YG9A 3E9AA 1PCKA 1G7MB 2B4CL 1Y1DA 4FHAA 3NQVA 3IK2A 4OU3A 2DBLL 2R29L 1ZV2A 4PW9A 2DBJA 1YRRA 1DR9A 5TPWH 3GEFA 4MZ2A 1B9BA 3T2LA 4UR7A 5C0JB 1IC1A 1RZ8A 1IKNA 1WICA 3NCYS 3L4YA 1QO5A 3CCHB 1OZQA 5ENWB 2WWMD 1CFTB 3THML 2Y5JA 5HAOA 5AOKA 2RGMA 5IVZB 4UINL 1Q6GA 3WH5A 2FBOJ 1YMHB 1TPEA 4MWFA 2DLGA 1EYEA 2FLBT 4XP5H 3MUCA 1UP0A 4MA7L 4JKPL 4W7UA 1T7LA 4QPEA 5BZZA 1LDCA 1MI3A 4DPBX 3MRIA 3OTRA 3RFZB 2FJSA 4IMKA 2GB2A 2HWZH 2BC4A 2PDNA 2K9UA 3BEVB 3AWNA 3SAZA 1GOGA 5HTSA 1BV8A 3P2BA 4WO4D 1J8HE 5GS1B 3HG5A 3RWCA 2YA0A 4S3FA 1PZ5B 3HZKB 4HNOA 5CGTA 3GXPA 3B3BA 5B1CA 2J3SA 1EUNA 1ZXKA 5IKCB 1TA3A 3LDBC 4TXEA 2XPYA 3CZGA 2INZA 1BGXH 4YL9A 2NY4C 3PPFA 2CBMA 2UZPA 3IFNH 2VR5A 2OX5A 1M2OA 2VXTL 4AQAB 3VUAA 3QNXA 1N2VA 2UY7A 2B1OA 4FD0A 1Q8AA 2ZZ7A 2BNRA 4B5NA 1GC1C 3MCG1 1XYMA 5EBMB 5C09E 2Y3NA 4OCWH 1OB1A 2KKQA 1VR6A 1KCRH 4KRPB 3SCMB 5J89A 2V8LA 1CICA 4B2DA 3PWVA 3QNYB 5K4ZA 4I6KA 5I79A 1XGTB 5B7ZA 1OT1A 4ZMTA 1MRFH 1INDH 5A8MA 4R9HA 2UY2A 1XIIA 3O9WB 1IGCL 4CVUA 2J6WA 4YEEA 1MCOL 1S3KL 3K71B 5E8NB 3DHPA 4GC4A 2XKNA 2NX5A 3RFAA 2VUYA 3MJGX 3L5AA 4JGJA 2MSPA 4WSKA 2FT8A 2FJFA 4L4VE 2P50A 3FJTA 2IPTH 4OBTA 3VRJB 3N6QA 1J8HB 4Y4HB 3OGCA 5HYQB 4L5ZA 3CZSA 3K72B 2J8OA 3N29A 1FIGH 2CO6B 2CLPA 2C4XA 1W9VA 1UKPA 5CGBA 4DEWA 1DQDH 2Y22A 2PDHA 4M5ZH 2BASA 1N12A 3JT0A 1U3HB 3D33A 3NRQA 2FCBA 2QMKA 3EADA 2H0FA 2UYLA 3D2TA 4R2GC 2B1AH 2OQJB 4NIKB 3T71A 2I5IA 3ORWA 1F7BA 5C09B 4HKPA 4FQQA 1GJUA 4CRPA 1KCUL 5K9JH 2YC1B 4BS0A 3O3RA 1CD8A 3W1AA 1L9TA 4GEIA 5CJOL 1BYOA 4BSVB 4RNFA 3LEXB 5DJYB 3M5YA 2O72A 3B0UX 3AYTA 3GSNH 1KYOK 3UETA 5FO9A 4OH2A 1NMBL 4DZAA 4XN9A 5GGRB 4XOAA 4DO5A 5M95B 3CB8A 1KV5A 4GW5B 2GJ6E 1S7RB 4O4YH 3KPNB 4BINA 2YAEA 2EXTA 3WIHH 3L0GA 1BFVH 1JUKA 2V0TA 1XC6A 1JXGA 4HJGA 1X9UA 4XZ9A 4IGBD 1K03A 5J6HB 2XBDA 4J8RA 1FP8A 3EJZC 4L4VB 4MZRA 2NY1D 1H8LA 5IQMA 3ZIZA 2WYHA 4UT6L 3BE1H 4I4WB 4ODVH 1M1XB 1GW6A 3ZT5A 3A9BA 4WRHA 3JWDL 5INCB 1EA0A 2YD9A 5CZVH 3QC0A 1E5AA 1DVXA 5DVLA 3WN6A 5ICYB 4MUZA 3TE9A 3WF3A 2ZUYA 2E7FA 5HHVH 2CIKA 4NO2A 2EVJA 3V0TA 1FNSL 1WCGA 4AGPA 1CF8H 2R27A 3BC9A 1QWKA 3OKDA 4S38A 3MV9D 5I1EL 4G5AA 3FN9A 3FHAA 1O12A 3NQ8A 5AD0B 1MWAA 3WFEL 3ZWSA 5HVWA 4LSVH 3SW6A 5LNUA 2NXYC 4TSAH 1Y5WA 5FA4A 2OR8A 1XF5B 2XACC 2JKXA 3F4NA 4L1SA 3S3DB 3ZDYF 5EOCH 1JI1A 2GFBA 3BQ5A 2NY3C 3WY3A 4POZD 4W9CC 1XRSA 2UWEB 3LZQA 3LNDA 1UUMA 3HS0C 3OKYA 4EN2A 4A8RA 3ARRA 5HHXL 4JDBA 2GJ6B 3M1CA 3HJ0A 1E9ZB 3ZQ9A 2VLRD 2WAQA 3TWCL 5F96L 2VN7A 3JQOB 3RA7L 3BLPX 5AN7A 2KC0A 4BZ2H 5HVHC 3SE4A 5CWSA 5I8KL 4XNQB 1NM4A 4JFXA 4DY1A 4R90L 1JTTA 3NFUA 5LZLA 4GFXA 1J05A 3S6CA 4D2NA 2B39A 1A5FH 4PJEA 1SMDA 3IUDA 2PNDA 1MFMA 3MOBL 3A6BL 2QZRA 2NW0A 5DJ0A 3SBWC 1OCZB 3USBA 4S1SL 2FZ8A 2EZ0D 1E4XI 4DEUA 3LQLA 1T1WB 3IU4L 4BQ3A 4S1RH 3GM8A 3S2MA 1K8CA 2QFPA 3D6GA 4J5NA 1NARA 5FGBC 5AVNA 1TF4A 4PN6A 3W3OA 4AY8A 2OTDA 2XV6B 3S34L 4CSPA 3FCPA 5DLML 2QAPA 2EECA 3EH5B 4NN7B 3GG1A 3WBDA 3A3XA 1TQUA 3GBMH 5AENA 4AYFA 1LJMA 3SCVA 3Q6FA 5ICXB 2Q3RA 1T8QA 1SVZA 4Y1AD 2X0WA 5H37H 3C6LB 3H9SD 4B0MM 3DHFA 4EZKA 4PRRA 2I5GA 3GI9H 2JELL 4F91B 3HMJG 4MY8A 7PCYA 1B2YA 2W60B 3UROR 1BD2B 1SM3H 5LA1A 3FHEA 4UM9D 5A1AA 5SX5K 1DBTA 1O75A 4PJBB 4ZAKA 1C9DA 1F4HA 2GPZA 5GRWA 1TTRA 3U9UB 1QFPA 1AQDA 3FCTB 4AEHH 3T08A 2O61A 5IF0A 2F7OA 4QRAA 1TPUA 1T22A 3QCUH 1E3XA 3N4FA 4CJ1A 1UACL 3U1QA 1N0LB 2V2XB 4GW1B 3RKDC 3BQUC 2RH0A 2CKSA 2PTYA 4KI1A 1WV2A 3VYOA 3NQKA 2WZ5A 4U6YB 5D7IB 4PV9B 1RQ5A 5JDSA 3V6FA 3P0VH 4ONFL 3W2LA 1BIIB 1BQKA 1JV2B 3FZUC 4RMWA 2GGGA 2CITA 2DLTA 1GR7A 3OAUH 4GINA 3GMMB 3IF1B 3T0DA 3O4LA 2J62A 3WFCH 1IKFL 1V02E 1H1YA 1EO8H 4DO7A 1KTDB 3H42H 4HJEA 5G4NA 3OAYK 2X89D 5DMGC 3O07A 1EZUA 4HJFA 2N3JA 3QEGL 1M1SA 2NDFA 1CVSC 1FL6A 1NVMA 2Y7DA 1RUPL 3BH4A 1EPXA 4AD1A 2QQLH 5DUBB 5HDBB 1NWRA 4C90A 4Y88A 3KEHA 3HLAB 4G6MH 3SEPA 3VA6A 1QQDB 4ELMA 1XV8A 2PYFB 5IFJB 3N2CA 4M29A 1S5MA 2DIKA 3H2PA 3MROB 3EYSL 5J6SA 5EMUA 2WOBA 3UZEC 1WBYB 1DBBH 4ABWA 2OJEB 2LTQC 1LD9B 5T5NG 4NX0A 3PJXA 3PSWA 1YKWA 5JDJA 1JFXA 3O16A 3E0IA 5T3XL 2R0WL 2I24N 4C6OA 4YXLL 5JIPA 1KJMA 1R3WA 4FQJL 3NRFA 2GT9B 5DCBA 3EOLA 2X09A 3GFYA 3KYKH 1A7NL 4LVBA 1IM3A 4X83A 1LL6A 3FUIA 3UACA 4N8CL 3V5KA 3US9A 3V4BA 3W1RA 3S0PA 3RVWD 1KB5B 1AGEA 4WJ5A 2Q71A 1XAKA 5I30L 2W63A 2J8TA 4QLKA 4MAUH 1RK1A 4JEQA 1NL0H 4TTDD 2OEJA 5KSUB 4U3AA 2YMOA 2OZ4H 4PJGF 3QJVB 3L9RB 1JJUA 1Z42A 4TTUA 2AQTA 1C5CL 2WYTA 2DAVA 2DT3A 5I9QB 1E2WA 4PWIA 4GQQA 4HC1A 3A0OA 3QPEA 2QMJA 4LFHG 4DYKA 4YNYA 1VYSX 3EW3B 3L67A 4LRNH 2FHBA 3QUKB 3ROLA 3ISWA 2HZGA 4KKZA 2I7SA 1OYBA 2DT2A 5FYKE 2WBKA 4JO1L 1F6LL 2WTRA 4J4PA 4KX7A 4GYBA 4XHQA 3D85D 3C2SA 3GSRA 2APXA 4DGIH 5KBKA 5C0CA 5AC8A 4XP6L 1P0DA 3WELA 5CZXD 2F5AH 1E9YB 1TNMA 5T3ZD 1DE5A 3GVVA 3KH3A 4KUZL 3NZPA 2Q8BL 4O58H 1DVFB 4JDTL 4KK8D 2CLZA 1MCJA 3HI6L 1JS4A 3FQ4A 1LM1A 4JNMA 4D7BA 3K8MA 1ZXQA 4M6OL 5TE6L 2YD6A 2C9SA 4G59C 5CEWA 2H0JA 2EO1A 3OB8A 2ZPKH 4XPGL 4N9BA 2MNUA 2Y2YA 2JKPA 3HNTL 4W8LA 3W76A 5E7BA 1JZIA 1T21A 1V6WA 5FF3A 2JE8A 4GCXA 1PY9A 1G1YA 1UFUA 2AEWA 4AZUA 1QHPA 4N9EA 3C5SB 2Z65C 4GRWE 1P6AB 4TVPE 1TV7A 1YYML 1MKFA 1D8WA 1ANUA 2K7PA 3VQMA 1X98A 1UWQA 5D6CA 4UTUA 3LM3A 4EE9A 4ZW3A 4IL2A 1VPQA 3FGCB 2TRYA 4LEFA 3GZOA 3TYZA 1R8LA 5DD3L 4YXKH 3BKJL 1LYXA 4FKEA 3UERA 5DK3A 1Q2RA 4HTBA 4A3QA 1OALA 1M2VA 3Q45A 5D2NC 3MKGA 4R7WA 3LX9A 4QLWA 3GLCA 2IXQB 4C1NA 1ZDQA 4MLRA 2X70B 3MLRH 4LCYA 3E0VA 4NI3A 2HRGA 3QFGA 1E0VA 2NTSP 3W56A 3A4AA 1L6ZA 4P2YA 2FGWL 2BB0A 3HMCA 1LF1A 1MRQA 4CU8A 3VXUE 4GLEA 1OF2A 5FIPA 4D72A 3TBVB 5FF2A 3MXWH 4U6HA 1L6FA 2GWNA 1TV4A 2CZFA 4IBYA 3BJFA 1UQSB 5DD1H 3G0SA 4JO8A 4GAGH 5EBWB 2HN7B 4H2AA 2VC5A 3LNIA 3DC0A 3P9LA 4XO5A 4P59H 4GRWB 2CH8A 3ZDZF 3QFDA 1XD1A 2YR3A 4WGHA 3D69A 4ZOAA 4HHLA 1BVNT 4QGTA 1HJWA 3DURB 4ADIA 5DEFA 5ECUA 5DSCA 4JY5H 4ODHH 3HMWL 4GGBA 1SFHA 2YKLH 1RV6X 3P4OB 2H32H 2AJ3A 4UOQA 5C9RA 5CGYC 3TW6A 3HZMA 2L0DA 2WSRA 1AHWA 1NDTA 1PHWA 3GBNL 4UZSA 3QMTA 2X4QB 1MNUL 3EOYG 4LB3A 4I5XA 2F0CA 2J7HA 3WO4C 2ZAHA 1GVSA 1A5OC 3IU3B 1DDHB 4QDGA 5I2IB 3VXSE 4RQQB 5BMXA 5TQLA 2HG5A 2F8VA 2D22A 5FKYA 1P0NA 5HDLA 1XEDA 3VXQB 3FB5A 4UZUA 2W1NA 3VXUB 3W7CA 5I1KH 5F7FA 5I75C 2B2XH 3DNKA 4NZ8A 4LL9A 3WO3B 2EIJB 1PZ0A 4FXLA 1ISXA 3Q8AA 4EI5D 1ZT4A 2XG5B 5L4MA 2VEFA 1BVKB 1JZGA 4YLQT 4XIAA 2V0AA 2GYSA 4J1OA 1DV7A 4OBSA 1UUOA 3O2DH 2OELA 4Q6JA 1CBVL 3X11B 2Y7SA 4GIPD 1MLBA 1JYWA 4E68A 3G0UA 1A5LC 3HFML 2Z93A 1S78C 1SFJA 5HDQL 2Y8UA 3RL2A 3O6KL 5C9ZA 4P2OB 3QDHA 4XPBH 3TESA 2WMIB 5I1IH 4KAQH 4PTNA 4HF5L 3R4DA 3WEBA 4MCZA 1GJIA 1EDHA 3UO8B 1P7TA 5HYSG 4YR6A 1RQEA 1OFOA 3Q1EA 3NJJA 2YN5A 1PLGH 1V7AA 3U4EB 2QKIB 4PGEB 4ISVB 4YU1A 1NLBL 2MNRA 2VRAA 2QKSA 1GTEA 3NQIA 3GHUA 3UWUA 4WI0B 4Q8OA 3IIOA 1NBYA 2X6CA 5KVEH 4L1GA 4NZ4A 4LY8A 1BW8A 1Z2KA 4M7JL 2OGYA 2H1PL 4W9EC 2JB6B 5I7GA 1NGZB 2FT6A 2PR9A 2NLYA 4ZSUA 3T0ED 5AYUH 5F9OH 4WDIA 3CZKA 3QH3A 3RGVB 1AD0B 4DJMA 5F7DB 3UJIL 1O5DT 3EYQD 1L3WA 2EIZA 1UZ8B 4O9HH 1NP0A 1X7QA 3ABOA 5DZPA 5RUBA 1DANU 2IAAC 4DHGA 3LNGA 1CXLA 1IBFA 3V4UH 4W9TA 3WH9A 1LUCA 4WUUD 4GW4B 2D9CA 1OQFA 1LK3L 3OBKA 4AD3A 1F9CA 4R2GD 4AZCA 4UB0L 1WISA 4KK5D 3VVGA 4M5YH 3RYMA 2GSHA 4G71B 3HPFA 4YGVA 4XZUB 4PG9A 3E1ZA 4S23A 2WQXA 2AF2A 1F58H 1JUFB 2J27A 1TG8A 3FSWA 1H8SA 3WI9A 4LPUA 4G8EA 3WLIA 3QRHA 4UQ9A 1AHMA 4FF5A 3EJRA 5MEPB 5DY2A 4GT0A 5HY9A 3L3JB 5DUPL 3BURA 3U4KA 1KW1A 3BSMA 2Z6JA 5B39B 5ADOL 1TENA 4JZNB 3CO4A 1IC5H 1P69B 4ZUVA 4DESA 5LIKX 1Y18A 2DVTA 5HI3D 3PFRA 3TQKA 3B9KC 4X9HA 2O5NA 2YSSA 4NRXA 1XXXA 5GZOC 3VNLA 5DDHB 3J7HA 1R87A 4YHKH 2VDPH 4CCDA 4DBUA 1F6AB 3NZGA 3HI1A 4V27A 1T66D 2CGYA 3E8UL 4HUUA 3ARBC 3GRWL 4FXFA 1DLFH 4J5VA 1H2JA 5F97E 4PRAB 2DQWA 1MIML 3AWGA 1F4YL 3WBAA 4B5TA 3ITGA 2F5BH 4WW2F 4WY0F 4FQHA 5F7AA 2XFXA 3FU7B 1N6QL 1AQHA 2AJVL 3HVDA 1UWIA 1OP9A 3WLSA 4NZUH 3NYKA 3UVIA 1TJHL 4DXKA 4XXDA 2NY3D 2OU4A 3F65A 1OSYA 3G04A 4X6FA 3LA4A 3EJQA 2CUHA 3D08A 4OJDH 3BZEA 2APVA 2IF7A 1JN6A 3IJHB 1RZKL 1Z3NA 3WUBA 2ZZUT 1LEIA 2JXMA 3QWOB 2YGQA 4KJWD 4E8GA 4PJ6A 1JZ7A 2EACA 3U7YH 1R17A 3V4PB 1WFIA 4IXHA 5IHZA 1WYJA 3QK0A 5FYJE 1QNZL 1ITXA 1RIVH 3AT8A 1UM5L 1PKNA 3V5DB 2ONEA 4IZGA 4R83A 2JKAA 2EDBA 4FRWA 3CT2A 1QEXA 1HL9A 4BFBD 4P8XA 2J13A 3R8BB 4AHOA 3WLJA 3N04A 4CEXC 3CC5B 2WWMC 2PDQA 1X5ZA 4KMTL 4JVPA 3SOBH 4LBEA 2Q8XA 5D03A 3L9EA 4MNGA 3F7RA 4W9FC 3UA4A 1QPOA 3BKML 3GZPA 1DBJH 4WWKB 5FSEC 4G42A 1XH3B 1KMGA 4JB9L 2VDRB 1YPZA 3UMNA 4AG4H 3ARWA 3EWXA 3U8GA 4LV9A 3ZLHA 2HFEA 5MENE 4WW1B 1CB7B 1LBMA 3DX2A 6XIAA 4YZFF 1R3TA 3U46B 1E4LA 4WO4C 1IQWL 4A3UA 2YPLA 5C6TL 4QG9A 3MNWA 4W85A 4LJ3A 2BHUA 4PBXA 1H5BC 3APCA 2YYUA 2OOFA 4TOYL 3PL6B 5EZPA 4K1GA 4MMXA 1HYRC 5ID1B 5C0BA 3RTQD 3VZZA 3DJRA 4PEEA 3AS0A 4JNYA 2E5BA 2Z8VC 2MOVA 5G4MA 3ULUH 3K8LA 2XWTB 2V33A 2NY6B 2P0IA 4RAUA 2V3EA 2VDKB 1S7QB 4MYWB 4P04A 2CG9X 4NLAA 1PLBA 4N6FA 4M6AA 5HGAB 3CT7A 1T0NB 5DJ6B 3BUQA 1E73M 4MZ3A 1J9YA 2QGCA 1AO7E 4JCMA 1BLNB 2OQHA 1WEJL 2HPIA 2HFFB 1MRDH 1DIOA 5DD6B 3L3HB 2JV6A 4R97C 4N3TA 1NIFA 3KG5A 5FUZH 3VM7A 1P6CA 4MCNA 3LVTA 3LQGA 1AK5A 3DMMB 5AL0A 3MGTA 2QGYA 2LGNA 5MENB 1AE6L 1W8OA 1IGTB 5CG7A 1LO2H 4NQVA 4JN1H 3AISA 1IM9B 1G4MA 2NY7H 2C13A 1KLZA 4P4KA 4F7PB 2ATAA 2J79A 1Z9SA 1U8NA 4YH6A 6PCYA 4WKAA 3NCXA 4M8UA 1GJWA 3B43A 4DZBB 2XC8A 5C0RL 2PW2A 3ASNB 4MMZC 4HT3A 1LCOA 1MMFA 2PTZA 1NC2D 1U58B 3DA0A 1YDYA 4FTVA 2X4SA 3IRZA 4MWAA 5E4AA 2G5UA 4AEEA 2DZPA 4PS4L 1OIOA 2BY3A 5HGHB 1AR2A 4AEIH 1ZJIA 2HP4A 4FADA 3IXAA 1IGIH 1QR4A 1DWGM 1OF8A 5BOEA 2ENJA 3IS4A 2Y7OA 3E6FA 3CVIL 4KRPD 3SCMD 3ZL4H 2XKSA 1AO7B 5FEZA 3ARVA 5KVGH 3K0WA 2YD5A 2GTWB 2WHVA 1CGWA 4DHLA 2J9YA 5IB1B 3I2CL 1TPC1 2DQDL 5DI8A 3ITXA 1REQA 1AOZA 4IGBC 3F5WA 3N14A 3O9WD 1WD9A 1KGYE 4N0YL 1QNVA 1MJ8H 3KLDA 3PJUA 3GSOA 4NCC2 4AXKA 2CESA 4C6BA 2BFVH 4BQ5A 3MSYA 3S2LA 4AQ8A 2H9GA 1CIUA 2WXQA 1KYFA 4IQJA 5HA7A 2J55A 2A2IA 4FNLL 2OGJA 1BWVA 3ILPB 1J8HD 2QV2A 4EN3B 5AHMA 1FRGL 1C12B 1PG7W