1P6WA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with the substrate analogue, methyl 4i,4ii,4iii-tri-thiomaltotetraoside (thio-dp4)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of barley alpha-amylase isozyme 1 reveals a novel role of domain C in substrate recognition and binding: a pair of sugar tongs
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords PROTEIN (Alpha-amylase type A isozyme)
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1p6wA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1p6wA01
2ZX5A 4WF7A 4IUGA 3MU7A 4PYSA 3FY1A 4S3JA 2UY2A 4H04A 2WVVA 3WNOA 3FHAA 3HN3A 3LX9A 4L4PA 3LXBA 1BPLB 1XGZA 4UQDA 2G3IA 2F18A 4PEEA 3DDFA 4RL3A 1B3ZA 1I1WA 3ARRA 1O7AA 9CGTA 5FCZA 1XH1A 3PZQA 1WZMA 3WBEA 5DT5A 1HF6A 4K68A 5I78A 3KLKA 4TXEA 3E1F1 4OKDA 1LL6A 4DUVA 3SURA 2EBNA 4ZE4A 2J7CA 2XM2A 3VO0A 3WNKA 3CUHA 2JEQA 2YA2A 3ZMRA 3ZJ7A 1UR4A 2FHBA 3DYOA 4QLLA 2DSVA 4P7LA 3ZJ8A 4P8WA 5D9PA 5E6ZA 2XSAA 4W7VA 1R7AA 3CHCA 1Q4NX 1EDQA 2WC7A 3GM8A 3ZOAA 3UR7A 3T09A 4S3KA 2ZXBA 4FNTA 2A3CA 3CZNA 1ZL1A 2G3JA 4E4PA 2FGLA 3W24A 2VX5A 3VMOA 3WUFA 3WD3A 5I23A 2CPUA 4CD5A 3SUWA 3WY4A 3PBGA 3IJ8A 4PTXA 1US2A 3WD4A 4J3VA 2X1IA 4ZXOA 2EQDA 2OW6A 1CDGA 4H7VA 2GFTA 1K6AA 3DHPA 2DQXA 1UD4A 4F9JA 4GZJA 3CPUA 3MS8A 5BYWA 4X0NA 2YL6A 1Q6CA 1GOWA 3CUIA 2A3EA 5AYBA 1GOKA 2WMJA 3WH9A 4TOQA 3VGFA 1OIFA 3W6LA 3BUIA 7A3HA 1D2KA 4WIWA 3D50A 1GONA 3SIMA 5TD4A 1R7OA 1J11A 2C0HA 1BG4A 1BQCA 2BHUA 2Y2WA 5A69A 1KBBA 1V3JA 2WANA 4C7DA 3MMDA 5A2BA 4WK9A 1G0CA 1RPKA 4M8UA 4WKAA 4Z2JA 2PC8A 3VNYA 1B30A 3H55A 2WC4A 4W8BA 2PBOA 4PMXA 3T2QA 2AMGA 2CKRA 1WPCA 3IK2A 3K8KA 3PZNA 3WEOA 1HP5A 2J79A 1SYTA 1KXTA 2Y8KA 2F8QA 4M82A 1R87A 1J0JA 4MADA 1KXHA 2XVPA 8A3HA 5CXPA 1K9EA 3GBEA 1M01A 3NSMA 3AS3A 1KXVA 4J3TA 5GQBA 1VFOA 3NSNA 2CXGA 5ABFB 3PZMA 1J0KA 2XIIA 2GDVA 3EJRA 1V6XA 1GVYA 1F4HA 2VO5A 4UCFA 2D0HA 2WC3A 1BGGA 4HOZA 4PMDA 3AXXA 3EJSA 1Q6DA 2C8NA 2WYSA 3AOFA 1EIBA 3ZR5A 3MKKA 4AD3A 1V3LA 4GZEA 4OOZA 1E40A 3ARXA 5BCAA 4GXPA 3WIJA 3CHFA 3VIJA 3AQUA 3N18A 3VGDA 4LGXA 4UFHA 3BVXA 4F79A 2XPKA 3ARVA 1VFFA 1IV8A 1HXKA 1N82A 1MWOA 1UD2A 1UD5A 1ODUA 1IZKA 1HKIA 4DO4A 1DP0A 2J25A 2QV4A 3SCUA 3G6MA 1MXGA 3BVVA 5A8OA 3PTMA 1PIGA 4P7RA 4GIAA 1OT2A 4AZHA 2HVMA 1OGSA 3SCOA 3WQ4A 1CBGA 1C91A 5BXRA 2EAEA 4J27A 4BQ5A 1KFWA 3EBVA 1KGWA 1VFMA 2AOSA 4W8AA 4DWSA 1C8XA 1US3A 4TTGA 1YQ2A 3F5KA 1QX1A 3F4VA 3PTKA 1OD0A 1EDGA 1E1EA 4UFMA 3THDA 5A94A 1B3WA 2D22A 3FAWA 2GJRA 3VIOA 4KWUA 1HWWA 2BY2A 5A6LA 2WCAA 4P7OA 1O7DC 1W1TA 3AHZA 4PMYA 1XD1A 3WDHA 3GNPA 1MYRA 3K8LA 3M7SA 1EOKA 3VDHA 1JI2A 2PB1A 3WQ5A 5E09A 3IAQA 5A95A 5FL1A 3PZVA 1R47A 2VC9A 3PZUA 2EPMX 3WD0A 1AVAA 2PF0A 4PMUA 4M24A 1TA3B 3B9EA 3B8SA 3VGBA 1WO2A 4FNSA 3GYCA 3WF4A 4ZFMA 4Z2HA 5CQ1A 3B9AA 2YA0A 4E8DA 1X1NA 1GHRA 2WVUA 3WDIA 2VUYA 3OLDA 3CZSA 3SCTA 4KGJA 1XYFA 1IZJA 1WE5A 3CZGA 3H53A 5IFPA 2VI0A 4MB4A 4JFSA 2BFGA 4DO6A 1PJ9A 3EMQA 3HG2A 2X09A 4P7QA 3W4RA 3VDCA 3CUFA 4MB3A 2RGMA 1JNDA 1R46A 1ISYA 1CEOA 1KCLA 5HDRA 3PZGA 4A3HA 1WDPA 1GVIA 1YHTA 3TTOA 5KEZA 1XSJA 3WFZA 3W53A 1XCWA 1KBKA 3A21A 3QOMA 4AMXA 2YDSA 2XN2A 1E5NA 3AS1A 1TQSA 3MV01 3BMWA 1MQQA 2PI6A 5JBDA 1E3XA 2NSXA 3N15A 4E8CA 3DX4A 2XIBA 5AYIA 4W85A 3VOCA 1BAGA 3ZQ9A 3ZO9A 1UA3A 4AEFA 2FH8A 4DWSB 3CTTA 3QHMA 1E1FA 3SUVA 5HPOA 2X05A 3I3DA 4MAZA 1VJZA 1E5JA 4V28A 3A5VA 1V3IA 1QHPA 4JHOA 3L4ZA 1VBUA 4HOWA 1CZ1A 1VF8A 2X0YA 3EJPA 3PN8A 4MNKA 2OLHA 3OGRA 1CNVA 1NWRA 4ATWA 4BS0A 2WNWA 2E3ZA 3WNNA 2DPEA 2J75A 1X6NA 1IT0A 4FNRA 2O9TA 2J7FA 3VKKA 3WELA 3BAXA 1R86A 3D4ZA 1CENA 5GNYA 4H8UA 3SUUA 4U5KA 2W4XA 3POHA 4D6FA 5A6BD 3DX3A 3D51A 4PCTA 3AMDA 4LQ1A 4PMOA 4CN6A 1HL9A 1DTUA 3BVTA 3WNPA 1E6RA 4UFJA 1CTNA 1JFXA 3LMYA 2XVGA 4DUWA 1CXEA 3KEHA 3VIHA 2VL4A 2WAGA 3HG3A 1K9FA 5DEZA 1GOIA 1W9UA 4D6HA 1SFSA 5ABFA 4AZGA 1EOMA 1W91A 3A24A 3PTQA 2IUZA 1BYAA 4P7NA 2YFNA 1GOMA 5BROA 1JI1A 4NZCA 2F7RA 1TG7A 3BH4A 1W3KA 4AWEA 1UD6A 2ZUNA 3BVUA 1V0MA 4FLOA 4KH2A 3VD5A 1JZ6A 1GHSA 1SZNA 4J7RA 3DECA 3PZTA 4HU8A 5M03A 1HJVA 2XFFA 4EKJA 4NSBA 4WSKA 1MW0A 2WK2A 3KE0A 4EANA 4J3WA 3VNZA 2O9PA 3MMUA 3RO8A 4IPLA 4QLKA 4XZWA 4AD5A 2TAAA 3WENA 1TVNA 2BVDA 1UWSA 2W91A 1R8LA 1KR1A 2E9BA 4JKMA 1U30A 1JNEA 2DT0A 4AZCA 2DSWA 1RH9A 3RM4A 1TA3A 1K9DA 1QWNA 2WZHA 2NW0A 4D6EA 1J10A 1DWAM 2V3GA 2X2HA 3RCNA 1UH2A 1PX8A 1UH3A 1V08A 3N13A 1HN1A 4MNMA 3L4VA 4IISA 5CPSA 2V3FA 4CKQA 4KGLA 3CBWA 1M03A 2VCBA 5HOSA 3EDKA 2OSWA 1MVYA 3AMGA 4ZEPA 4P8UA 4N42A 3GH5A 2XVKA 4AXNA 1B1YA 3UETA 4C7FA 3THCA 1E43A 2DT2A 1JFHA 3NJ3A 2ZWYA 2QPSA 2E40A 1QI4A 1BYCA 3GXTA 1PPIA 1CGVA 3WY2A 3BUPA 2OSYA 3L4WA 1B2YA 5BWFA 3APGA 1BVZA 1E15A 3UR8A 2YOCA 1E6XM 1HKMA 2VCCA 3GBDA 4AD2A 2CNCA 2DIJA 1CGTA 2BY1A 1GUVA 1XV8A 2QPUA 3VMNA 2O92A 2W61A 3EJQA 5EFDA 4CVUA 1XSKA 3U5YA 3ARTA 4HPGA 2DSZA 1WZLA 2W62A 2XSBA 1GQKA 1DWFM 1TCMA 3AZRA 4NXSA 1ESWA 3RMEA 4FLQA 3LPGA 3WD1A 4BQ4A 1CGWA 5BRPA 5CGTA 3WMCA 1TE1A 2D3LA 1XCXA 1QBAA 4B3LA 1M7XA 1HX0A 4MDOA 4ML4A 4HMCA 4OBSA 1KWKA 4F66A 3A6OA 4DWSC 2C7FA 3VIGA 2FE0A 1H09A 4CN1A 4UZSA 5A1AA 2IXUA 3EDJA 2G4FA 4AZCB 3SCRA 5E0CA 1U2YA 3PZ9A 2X2IA 4AIOA 5A6MA 3KL3A 1GQIA 3WD2A 3L4TA 4ATDA 5A6KA 3SCSA 3VGHA 4WSJA 8CGTA 1VB9A 4BQ2A 1ISXA 1ZBVA 1CXHA 4XUYA 5E70A 4UFKA 4QFUA 4AD0A 2VTFA 2VVNA 1JXJA 4UNIA 5A6JA 3OLIA 4C7GA 3QHOA 2X8RA 2BY3A 1E70M 1PEZA 1JZ8A 3WF1A 4JFUA 5C8BB 3LXCA 1MQRA 5EFFA 3U57A 3ZIZA 3WSUA 3ZM8A 1W2VA 4H41A 1CGXA 4OIFA 2PWDA 5AC5A 1J12A 3WDRA 1VIWA 4DWSD 2X2JA 1ODZA 5A8QA 2JALA 7CGTA 3GNOA 3VD7A 1XHGA 4JZ5A 1OSEA 4UOQA 2JEPA 2F61A 4B16A 2D0GA 1SMAA 3O2LA 1ECEA 3AS2A 5I6SA 1BFNA 2GJXA 3KLLA 1E6ZA 2XFYA 3ZJ6A 2RGLA 3UG4A 2NT1A 4GINA 1ZB5A 4BCEA 1W9VA 1UWQA 4OGZA 4FLRA 1DWGM 3W29A 1E56A 2EACA 2O9OA 3FW6A 4J3SA 5EBAA 1LG1A 4CVWA 3BLPX 1E6SM 2WKLA 1R34A 2YL9A 2GDUA 2D23A 3OB8A 3N11A 4U31A 1L0PA 3M6DA 4H8HA 2J7BA 2WHLA 1VAHA 4TVUA 4UZUA 2D2OA 2Y8VA 2G8ZA 1MFUA 3CO4A 2DH3A 2GVYA 3AZSA 1UHVA 3MANA 5A8MA 2WMIB 1E55A 3W38A 1MFVA 3RDKA 4URIA 5ABEA 3A22A 2FDMA 1WDRA 6CGTA 4AZBA 4CU6A 3DC0A 1FHLA 2WBGA 1C90A 3MSDA 3CHEA 3IGUA 1UR9A 2OWXA 2ZX9A 1UKTA 4JHZA 2WLYA 3AXHA 3ARPA 2F7QA 3EMCA 5I0DA 1W32A 2JFEX 3BC9A 3WMSA 3WMBA 1U33A 2DIEA 5HBFA 5D4YA 5A2AA 4UFIA 2DT3A 4P8VA 1GQJA 3IANA 1CLXA 2J7EA 5C71A 4CD7A 1OT1A 2Z1KA 1QBBA 3CZ8A 4HTYA 1QI2A 3T0DA 1WKYA 2FHFA 1JZ7A 4ACYA 1XH0A 1EHAA 1NWSA 4U33A 4GI8A 3NCOA 4AD1A 4MB1A 3BAIA 3VDAA 1W2PA 3VM7A 3SUTA 3VDBA 2VX6A 1OINA 3GXIA 2VR4A 2E0PA 2XGIA 3WNMA 1EH9A 4U2YA 5CSUA 4RE3A 5AC4A 1JZ5A 4A4AA 4Z2IA 3AZTA 2D3NA 1E6NA 2FYVA 1RP9A 3BAJA 1EO5A 1J0IA 1JXKA 3RJYA 1NOWA 2WKGA 1AMYA 4GI9A 5DFAA 1J9YA 2CESA 3VINA 3JUGA 2EABA 1C8QA 1E0XA 1UWRA 3WH8A 5CZKA 3QGVA 3M07A 3CUJA 2CHOA 5D9NA 1J01A 1H41A 2W66A 3O6AA 1B31A 1UR8A 3IJ7A 3W25A 4FNQA 2FGZA 3VSTA 1TR1A 5I79A 3T0AA 4LYRA 3AHTA 1UKQA 1UWTA 1FH8A 1OGGA 2BVYA 3PZIA 3TP4A 2VR5A 3ALFA 1CIUA 1TMQA 5LA0A 3T2PA 3WQWA 3LRKA 1HL8A 3DX0A 1KB3A 2J7GA 4CU7A 5E1QA 3AIUA 3CZLA 2WHKA 4OOUA 4GQQA 4YHEA 4M29A 3MUAA 3EDDA 4J3UA 1KXQA 1ISVA 4PUDA 5FOOA 1UWIA 1D3CA 4JCMA 4W93A 1ISWA 5A8NA 1BLIA 1DEDA 4LYQA 4U5IA 3BSGA 4B9ZA 4QP0A 3MV11 4NX0A 1R33A 2VCAA 4R5EA 2PWGA 1G5AA 4MNLA 1EGZA 4BZYA 2XJ7A 2G41A 1J18A 1GZJA 3RJXA 2XHYA 4OUEA 2BHYA 4GO8A 3WN6A 2YLAA 4FK9A 2QHAA 4PTMA 1OIMA 4XV0A 4CN4A 3GXPA 6TAAA 1X6LA 3AROA 1JZ4A 1XSIA 4U2ZA 1S46A 4PN2A 3ZT5A 1E6PA 1JAEA 3CLWA 3EDEA 3U7BA 3BUDA 3TONA 1NQ6A 3OGSA 3QHNA 3A4XA 2Y24A 2WXDM 4AZ7A 7TAAA 3AIVA 1E4NA 1WCGA 1ZU8A 5F7UA 3CZKA 2D24A 3VD3A 1ZBKA 4QCEA 2MANA 1WDSA 3ZJKA 1QNQA 1CXKA 1C7TA 4JIEA 2ZICA 3WF2A 1LWJA 2OWWA 1C93A 2UY3A 1C8YA 3ARYA 2OWCA 1BSIA 3KZSA 1W1VA 1HP4A 4FNPA 3SCNA 4ATLA 3BSHA 3W0KA 3IAPA 4RE2A 2JE8A 2G3NA 1ITXA 4FMVA 1BHGA 3S5ZA 2ZUMA 3VVGA 1ZBCA 1NP0A 3BCDA 3L4XA 1NOUA 3WKZA 3WH5A 3AJ7A 2DGAA 3IJ9A 1K9TA 3FN9A 4PUEA 1FFQA 3W37A 1HTYA 1E71M 4D1IA 2XFRA 2CCRA 3DDGA 4MDPA 3TTSA 3LRLA 4XX6A 1QW8A 4W7UA 4EK7A 2WW5A 1A47A 2XUCA 1CLVA 4TTUA 1JL8A 1DWJM 3OA5A 3SEPA 2OW7A 1KGUA 1EA9C 1BYBA 5EB8A 5M5DA 1NP2A 1UD3A 1ISZA 2WZEA 4AW7A 2BHZA 2E9MA 2J7DA 2O9RA 2WMHA 3II1A 1LLOA 5JIPA 3HJEA 2YA1A 4BF7A 3ZT7A 4HP5A 4JKKA 1W9PA 3PZOA 1W9DM 2XGBA 4XZBA 1TFVA 1R75A 4UR9A 1TQWA 1C92A 4M1RA 4PTWA 1I75A 1LQ0A 1M04A 4AYGA 3KL0A 5HNNA 2JIEA 3RPMA 1NH6A 1V02E 3FNDA 1GJUA 5D9MA 4FLSA 3G6LA 1QHZA 1OD8A 2J4GA 3WQ8A 1EO7A 3WUEA 5IDIA 2Q8XA 4AYSA 2WMKA 2VQUA 5D9OA 2GK1B 3W81A 1P6WA 1H49A 2CBVA 1TVPA 4CCDA 1FP9A 4NXKA 1VEMA 2WHMA 2EPKX 4WKHA 3OGVA 1D7FA 3A4WA 2E8ZA 1EHNA 5JUVA 2ESCA 3CIVA 4NRRA 2V3EA 4M56A 2Y4SA 4YPJA 5IHSA 2XYLA 1VBRA 3GZAA 3EYPA 1VJSA 3DX1A 1GQLA 5C70A 5CPTA 1UD8A 6A3HA 2YL5A 2Z1SA 3T08A 1J0HA 1HJXA 4MNJA 1FFRA 5A6BA 3WFLA 4X0VA 2YBUA 1T0OA 5DMYA 3L2LA 1QNPA 4NF7A 1SR0A 3MMWA 3AIBA 4AY1A 2EPOA 2ZUTA 4H8VA 3VSVA 3W6MA 1V0LA 2YJQA 3VU2A 4CD4A 2WLZA 1BTCA 1NARA 5CGMA 1UA7A 1JYVA 5DF0A 1JIBA 3WH6A 3TTYA 1PX3A 1ITCA 1Y7VA 1UZ4A 4TUFA 2CBIA 1JF6A 4HOXA 4PMQA 3WY3A 4B3KA 3L2MA 3VSUA 4DO5A 2WB5A 3VPLA 1CGYA 2QF8A 4B15A 4PSRA 3N17A 1G94A 1NWTA 4A3YA 3VIPA 3S6TA 4DM2A 3WEZA 4UQAA 1PZ3A 3LXAA 2IGTA 2G3MA 3ARZA 2WSPA 4D6JA 5A8PA 4W88A 3CV5A 3H54A 1GOOA 1TZ7A 2OSXA 3EJUA 2VRJA 2UY4A 3HZ3A 4P8XA 2YKKA 2WHJA 1ZJBA 3S5YA 4RE4A 1XD0A 1AQHA 1QI0A 4E2OA 3B9DA 2EPNA 4YN5A 5AY7A 4ZXLA 2QMKA 4HZ6A 1HVXA 1KTBA 4UOZA 3NIYA 4Y7EA 1JDCA 3OIHA 2ZXAA 4F9DA 4JFWA 3WQVA 1G01A 1WZAA 1HJWA 1UASA 4AD4A 3QOKA 2A3HA 3AIEA 2VJXA 3A23A 4QLJA 4J3XA 3GTNA 4QAWA 1W3HA 3UEQA 5BRQA 1WZKA 4DM1A 3GNRA 2YBTA 4JAWA 4Z2GA 2D20A 3CZEA 4OBRA 1JYXA 4L4OA 2W92A 2OYMA 2J77A 3L4YA 2BV9A 3UCQA 2ZUVA 2XM1A 1KR0A 1V6YA 1E4MM 4ACZB 4MJ2A 2E9LA 1H2JA 2CERA 1H3GA 3AI0A 2CEQA 3SCVA 2EXOA 1XH2A 1XYZA 2GUYA 2DSUA 3WL0A 3ALGA 5JBFA 1KTCA 4Z2KA 1GNXA 5ABGA 5DT7A 3SCPA 4D6DA 1FHDA 2YLLA 3CC1A 3O9NA 4D1JA 4W8LA 3F5JA 3RIKA 3AYRA 1Q6EA 1E6QM 1I1XA 4WLCA 3S2CA 4CD8A 3HMCA 3W26A 4M80A 3BLKA 3D4YA 2ZXDA 1H0IA 1HKJA 1HJQA 3GXFA 1PS3A 3DHUA 2XWDA 3WY1A 1G1YA 2CITA 2CYGA 2X0HA 5FL0A 1W9BM 3DYPA 4ZENA 4LXFA 1E9LA 5IFTA 3HG4A 1QWUA 1KQYA 2W67A 3N1AA 2JIWA 2CIPA 4GPNA 3CH9A 2EJ1A 4GI6A 1EQCA 1BVNP 2ZUUA 2DT1A 3DX2A 3GH4A 1JD7A 5A6AA 1VEOA 1W1YA 4UQBA 5A3HA 2OYKA 3F5LA 2EADA 1V3KA 4JL1A 3POCA 3VM5A 1KQZA 3VMPA 3WF3A 1W3LA 4WKFA 1HJUA 2V38A 4ACZA 2J8GA 2VZTA 4UTFA 2GJPA 2VQTA 3WUBA 3D52A 1R85A 2BXZA 1ZJAA 1KCKA 1CXIA 1CGUA 2F2HA 1LWHA 3VUPA 2EO7A 5D8WA 2HISA 3WH7A 2ZXQA 2EEXA 3GXDA 5HPCA 1V3HA 2EPLX 1XRVA 1DWHM 3HU7A 4CCCA 3ZSSA 3UERA 3ARWA 2X2YA 3EDFA 2CKSA 4PSPA 2ZWZA 4QCFA 3BXWA 1JF5A 1MW3A 4W7WA 1GJWA 3QR3A 1GOQA 4EAMA 1Z32X 3VGGA 1QNOA 3BAWA 1UOKA 4BA0A 1H1NA 3GXNA 5IXEA 3DYMA 2ZOXA 1E3ZA 5EMYA 1QNRA 3CHDA 2XG9A 1L8NA 3CMJA 3ARUA 3UESA 4IM4A 4M81A 4GZIA 3K4AA 4H2CA 3GDBA 2CBUA 2A3BA 3AHYA 4R27A 4W89A 5FD0A 2WZIA 1HJSA 4XB3A 1V0NA 1O6IA 1SMDA 4AZIA 1HT6A 2VMFA 3VIKA 1CECA 1CWYA 1JDDA 1E0WA 1WB0A 1H5VA 2WWDA 4Q7NA 1PZ2A 2AAAA 1H0GA 2DH2A 2GSJA 1RD6A 1OCQA 3VD4A 1V6WA 5M17A 1QI3A 3FAXA 2W5FA 5ECUA 3W28A 1M53A 1V02A 5A6SA 1WAWA 1FP8A 3OG2A 4CUCA 4HA3A 3OLGA 4W86A 4GKLA 4WJXA 2VX4A 3D5HA 2BY0A 4UQEA 4UQCA 5CLTA 2YDRA 1V3MA 4AIEA 1JZ2A 1B90A 1E73M 1UZ1A 2ZX8A 4F8XA 1QPKA 4QDMA 3WDQA 5FIPA 3CUGA 4MTVA 5D8ZA 1F4AA 1PIFA 5CSYA 4V27A 1OWQA 4PCSA 1E72M 3MO4A 2F1AA 4NRSA 1FOBA 3AS0A 4FNUA 3OZPA 3T2OA 1CXFA 2WMGA 4CGTA 1XC6A 3BUQA 4HZ7A 2XTKA 4UFLA 4JFVA 1HIZA 4D6IA 2BXYA 3N04A 3MUIA 2OYLA 1JAKA 1NWUA 2JF7A 1Q6GA 4NZFA 2FH6A 1JZ3A 1C7SA 2A3AA 3W82A 4J28A 4CCEA 3WQ6A 1GCYA 1JYWA 1HNYA 1H11A 1VEPA 2XVNA 4TVCA 1EQPA 3AXIA 2BS9A 3AMLA 3U7VA 4JKLA 4D71A 1CYGA 4U3AA 4KRTA 2D0FA 3CGTA 2GK1A 2VRKA 1OM0A 4NZJA 2ZUWA 1UG6A 1WDQA 4AMCA 2J62A 1TUXA 2J78A 1QNSA 3VX1A 3OLEA 1BG9A 4ZE5A 4PMVA 3UG3A 4FF5A 4GO9A 4HA1A 1UKPA 1MQPA 4HMEA 1VFUA 3WBAA 3EJTA 3FHQA 3NUKA 2PWFA 2ZIDA 3LPFA 2VZVA 3M46A 2PWHA 1VRXA 1LG2A 2VX7A 1VENA 1UUQA 1UKSA 2E8YA 2B31A 3OZOA 2GJXB 1E4LA 4MJ4A 1UR2A 3WDPP 3AYSA 1UKOA 2WVVB 3KL5A 3L4UA 3ZR6A 5CPQA 1NOFA 1BF2A 3VX0A 2UY5A 1KWGA 3MSGA 4KRUA 3BVWA 1QI5A 2XN1A 5LA2A 4N0RA 2WBKA 3AIWA 3NDZA 1UQYA 3NSXA 2IXVA 1EXPA 4TX8A 1B3XA 1E4IA 1PAMA 5KZ6A 1B9ZA 1GORA 1EDTA 1V6VA 3D3AA 5CG0A 4TX6A 2PBGA 2WCSA 1WP6A 2NT0A 1HVQA 3AICA 1NM9A 2F7OA 4MAVA 5FKYA 2DEPA 2YL8A 3K4DA 4EE9A 4W84A 2YIHA 4LPCA 1FA2A 4OZOA 2WMFA 4JCLA 1W3JA 2J74A 4LYPA 3AHVA 2WPGA 4JL2A 1ZBWA 3OBAA 4AZ5A 1E0VA 4AMWA 4PMRA 3T0BA 1V03A 1JD9A 5GNZA 3AIQA 4W5ZA 2UWFA 1GW1A 2QMJA 2V3DA 3GXMA 2WMIA 2QLYA 1UR0A 4W87A 3J7HA 1HXJA 2VZOA 3I3BA 3VIIA 1WNOA 4W5UA 1TQTA 3K1DA 1A3HA 3ZSTA 1UWUA 1AQMA 3ARSA 5IHRA 1Q6FA 5I77A 1QHOA 1H4PA 1OGBA 2WWCA 4AISA 5E9AA 1UR1A 3AHXA 2D1ZA 5BXSA 1JYNA 3CMGA 4PMZA 3PHAA 3LPPA 2WVSA 2DSKA 4X9YA 3A3HA 3I3EA 4AIUA 2ZUSA 3VGEA 5ABHA 4YHGA 4PTVA 3AMKA 1B3YA 5LYRA 4D72A 1LJYA 3WDJA 1PX4A 1V0KA 3MI6A 2YDQA 3MUZ1 2ZE0A 1OBAA 3FXYA 3AISA 2VZSA 2W63A 4HA4A 4KMQA 2VZUA 5I5RA 2CETA 2XWEA 1UH4A 4Z2LA 3WEMA 5CLWA 4TVDA 3NYDA 1LF1A 5I2UA 3EMZA 3TA9A 4GQRA 1BYDA 1G9HA 1ZS2A 2V5CA 2PWEA 2J8FA 3UG5A 1B3VA 4CU8A 1DWIM 2WSKA 1DHKA 4OJYA 1PBGA 4MB5A 3WUGA 2WCGA 3ECQA 2BVTA 4V2XA 3A47A 3LPOA 1FH7A 2CBJA 3KWXA 1MW2A 1LL7A 3W27A 1MW1A 3WL1A 2VNCA 3ARQA 1JGIA 1TQUA 3BGAA 2WM0A 1HKKA 5BXPA 1AQ0A 3TTQA 5BXTA 1B0IA 3TOPA 3A4AA 2VURA 4CD6A 1OB0A 4HPHA 4Q22A 3RILA 2VRQA 1W9XA 2E4TA 2F7PA 2Y5EA 3K46A 4HZ8A 2VOTA 3BCFA 1CPUA 2XVLA 3ZT6A 3BAYA 2ZX7A 1TQVA 1QOXA 1UYQA 2J7HA 4HMDA 2DDXA 2ALWA 1V6UA 3N9KA 3LRMA 3VTRA 2BNJA 3SUSA 1QVBA 3SCWA 1RP8A 3GH7A 3VD9A 1FH9A 2F1BA 2VT0A 2J47A 5JBEA 1LL4A 1KGXA 5I24A 1C3FA 5M3WA 1UQZA 4DUXA 4PBGA 1MXDA 5CJ5A 3VILA 4JFTA 2JF6A 5A2CA 5E0FA 4AZ6A 5GPRA 4D6GA 3RM9A 4D6CA 4LX4A 5DO8A 1J0ZA 4U3CA 4B9YA 2YFOA 4UQ9A 1W1PA 3U5UA 4AC1X 3WF0A 4UOJA 1J0YA 2CHNA 4PMNA 3AMCA 5I3DA 1JG9A 3VIMA 1JDAA 3N12A 4MPKA 3BLBA 3BAKA 1CXLA 3NDYA 4AEEA 3AFBA 3AIRA 4PRWA 4NI3A 2V5DA 3MUY1 3RM8A 2WVTA 3WNLA 5HXMA 5GNXA 3BUBA 5E6YA 2ZX6A 1BGAA 3CZJA 3K8MA 1GPFA 4IPNB 2D73A 3BMVA 3TV8A 3HG5A 1QW9A 2XN0A 5LA1A 4HU0A 2FHCA 4BQ3A 2VVSA 3SCQA 3VIFA 5JIWA
chains in the Genus database with same CATH superfamily
5E5MA 4NUJB 5BUAA 5IESH 3T78A 1KJ2A 2X0UA 4WF7A 4X6DF 2AQVA 3MU7A 4PYSA 1O9WA 4WWKB 5BVPH 3FY1A 4LLVB 1M7IA 3W22A 3UTSB 2UY2A 4YHYB 1DZ0A 2YMTA 1YVLA 4GKNB 5DI8A 4WWNA 1IR2A 3GINA 3FHAA 2W9EH 5HHOB 2X1PA 1Z7JA 3LX9A 1HCVA 2ZT9C 4ZAKB 4AJWA 2Y62A 3S96B 2E67A 2J5LC 4UOW0 1K7EA 4OFQA 2IBZX 3QDGE 2DQTH 4LOUD 3ES7A 4XP9L 2F18A 3EA1A 3EXTA 4WI2A 4GQZA 4PEEA 3DDFA 3LV5A 1X8FA 1HL5A 1TRIA 3H7RA 2EILB 5JPNA 4IPPA 1HINH 3GHPA 3LN4A 5E5RB 3SDXE 3SYQA 1JJUA 5B3SB 1GGIL 2ZKHH 5IROD 2L7JA 5JMOC 3GZ3A 1A1OA 4ICCX 4HGWB 1XGUB 2DZEA 4HBCL 4JFZL 2Q6WA 3M8OH 1FFPB 4N3TA 1OVZA 1M7DB 3HRZC 4LKCA 4FABL 2I7OA 3IJLA 2ZQ0A 1KGCE 5F6IC 5HDWA 4Z7IA 1XH1A 1CYXA 4R7OA 1ZOXA 4ZUUA 1WZMA 3W7EA 1JV2B 3WFBL 3MLRH 3JV0A 4K68A 2IGFH 3UJRA 4NQCD 5JIHA 4TXEA 3EHBB 4CMMB 1MQKL 4FP1A 5FJOA 4DF0A 2DORA 4M6MH 5T5FL 3FCGA 4BELD 2CBQA 1NF0A 1HQRA 5TFSH 4W1TA 1F58L 2GGGA 3MPGA 4HIPA 5K1JA 3TBBA 3SDDD 4Z7QB 2XDFA 4DERA 1RJPA 4WK2B 2XSXA 4HIEB 3HGJA 3IGKA 4WHYG 1JFQL 2DWTA 4N0YH 3NAAH 3S48A 3GNDA 4GY7A 2JEQA 2J72A 4LT7A 4MJMA 4PP1D 2QCDA 3BEVB 1RU9L 5B1JA 1NBVH 3SE8H 1BEYL 2P8PB 2A6JA 1BF5A 2HS6A 3ZZSA 1UT1A 1CGSL 4MD5B 3S3GA 4BDVB 3I6TA 4WHBA 2FHBA 2OMVA 4QLLA 2NTSP 4LMQE 2Y69B 3OAYK 3OXRB 3E02A 1AGCA 1JCVA 3T4WA 3RM8A 3ZJ8A 3PBUA 1CT5A 3UP1A 3SI9A 1LILA 1NBCA 2P8LB 4LNCA 3SDCA 5KSBE 1XB8A 3DRTB 5AW4B 2HSAA 3PF3A 3LS4L 4Q4RA 1RKRA 2D7NA 4W7VA 1I8IB 1QAWA 4LPVA 3CHCA 1K8CA 1U8HB 4BH7B 3OX8A 2ZFAA 5DVLA 1R6VA 3WLSA 2H5UA 3UJTL 3MJ7A 4L7ZA 3UR7A 2BWQA 1ADWA 3LGDA 3VOJA 1HGYA 4A8IA 3PGDA 4KWVA 2A3CA 3WHXA 4NZ4A 1ZL1A 2G3JA 3N9SA 3W24A 2HTLD 4OQVA 4JRWA 3SQRA 3QKEA 4U6YA 2D3VA 3WD3A 5BO1L 3NCCB 4OCLC 4XMPL 4CD5A 1CC3A 4X4YB 3NJJA 5E1AB 3WY4A 3PBGA 5C0CA 1D5MB 2H47C 5HGHB 2FZ9A 1E3FA 2P5WA 5TE6H 1S1PA 4YLWA 3UPAA 1SVDA 3QA3B 3PJSB 4ZSOB 2AVGA 4UTLA 4Y2WA 2RH0A 3EUDA 3S5LG 4QDGA 3QHFL 2GFTA 4XMUA 3EYFB 5F1IA 3NL6A 3QCVH 1IZCA 4B2DD 4FDWA 2JI2A 3JWDC 4IBYA 4Q58C 4I7UA 2AZUA 1K6AA 5AECA 2J43A 1I82A 3DHPA 4AGQA 1T5WB 1K8YA 1TZGL 1H1ZA 2DQXA 3MRPA 1EGJA 4OZFA 3Q6GL 3OC5A 1UD4A 4J1UB 4NWTL 4GZJA 3MJGX 3UGEA 3UQNA 1A7RL 1G7QA 2HKAA 1F11A 4Z5RB 3FO0H 2FDBP 4Y0GA 1W1B1 5SWSB 4FXGB 3TBSA 1AXIB 4JTJA 1OE1A 1RIVH 3MI3A 3CUIA 4UTTC 2WMJA 2EDNA 5DUPL 2YPLB 3DVFA 4OQTL 3BYTA 4TOQA 1M56B 3WH9A 3L1EA 3QC6X 2DF3A 4WHDA 3FCTA 1PY0A 5CEXB 4BGDA 3ESNA 5I76B 3BUIA 5I0VA 4B5ZA 1D2KA 3QXBA 1N10A 1BVLB 1UWGL 3RE0A 1G9NC 2AKZA 2IKHA 1A7BA 3DX8B 5L6YL 3FLUA 4R53A 4EIBA 3QISA 1P4LB 3BXNB 3SIMA 5EC2A 3G5YA 4IU2A 1G1CA 5XINA 4JO2L 5DUML 1NC2D 1EFXA 4BHUA 3TFXA 1NCGA 4NKOB 4UMSA 1YA5A 1IX2A 3GVGA 1XIBA 5LAXB 1JSYA 1RHCA 4YSPA 3HIJA 2CO2A 1WBHA 3RGBA 4XCYB 3AU6A 2YZ1A 4BFFA 2AAMA 1CT8B 1XCQA 1MPAH 2A9MH 2YGPA 4FXKA 2DZXA 4PRIB 4NQCA 1DXIA 1KIRA 3R06A 5C08A 2B0SH 3V7AE 5C6PB 1AANA 4C7DA 4ZPTA 3S3PA 3SKOB 4JO1L 4WK9A 5A3IC 4LH8A 4S1FA 5F7KC 4KT2A 4YTTA 4S10A 4PBEA 4Z2JA 5IHWA 5L2JA 3O2DH 3KRUA 3CQPA 1WK0A 3MZTA 1B30A 1K77A 1LBLA 1WAEA 4HKPA 5FAJA 2WC4A 3ITXA 4DI8A 1SOSA 1T80A 1PKMA 3V4PH 2ICWJ 2O72A 2IH3A 3EX4A 1FFOB 5IEKA 1Z3NA 4PCKA 4YIQB 5CEYB 3PZNA 4TMCA 4LL4A 3BLOA 2IV8A 4HSNA 2QUTA 4L4TB 1X7QA 1WXZA 1GZGA 1MEIA 2J79A 3AUJA 4FX6M 1CZ8L 3O2WH 1VKXB 5LIKX 2HJPA 1AFSA 2LAAA 2OTWB 2YCEA 3JS3A 3KOXA 1XBDA 4NGHH 4P46C 3VCLB 5EPMB 1J0JA 2D7TH 1DUZB 3G08B 2XVPA 3DBNA 1TVDA 2PYFB 1HZLA 4QOKE 5HJLA 1F6AB 3MRQA 4X4XB 1G7PB 2JVUA 5T3XL 4OZIE 1YXYA 1FG2A 2C79A 5F7BA 1FIEA 1B6UA 1I9IL 1LWIA 3NSMA 3ML9A 4WGHA 3SQSA 1DBAL 2JJTA 4A2LA 4BA8A 2CBOA 3MRGB 3QZOA 5F9JB 4Q6JA 5MHBA 2C1PA 2VN3A 5DZNA 3NSNA 3QSTA 3MTRA 3TLQA 3PG9A 2XIIA 4U1SA 4IX0A 1CDYA 4Y9NA 3WO4B 5K9JH 1GVYA 4K7PH 4LLWA 5IJCC 3GVVA 1F4HA 2VO5A 4KOBA 3UPBA 1TJXA 1ROCA 1QFWH 1J5OH 1SW7A 4LSBA 1BOGB 1BXUA 1H15A 3PQYE 3N85L 4F3HA 3RWHB 3C2YA 2HDJA 5CC6A 1NBYA 2VFGA 2ROXA 3EJSA 3P82A 3KLSA 3FVMA 5I30L 1IEIA 2BSBA 1EJOH 1FFNA 4WKZA 3UTTB 2QSQA 4WW2F 3HI5H 3ZR5A 4JTCA 1EJSC 4GZEA 4BI5A 2KPWA 3EFDH 1H0DA 4WOZA 4OOZA 1E40A 2EICA 1GQNA 5F7EL 2YX0A 1XL4A 4GXPA 2AP2A 2XN9A 2VC2B 3OGOE 3IDYC 3JRKA 4GG8B 5J5EA 4GNKB 2AABH 1EHLH 3HUJE 4RMVA 3W9EB 2IBGA 4LP4A 3FHEA 4Z78A 2Y1VA 3M17A 1ZMYA 4ZX5A 2FWUA 5GS0D 1F8IA 3UROR 3H0TB 4U7MA 4OLYH 4KQ0A 4TM9A 1LEGA 3NIFB 4A67A 3P9MB 2B1HL 4XXDA 1NCAL 4H9YA 3ARVA 4D0CB 1W56A 1VFFA 1ZCCA 3S9ZA 1B0RB 4AYID 1C5CL 1MRDH 4ZO6A 3O15A 3PNZA 1M9WA 4EVZA 5DO2C 2OFQA 1N82A 4A22A 4HHAA 3R0NA 1ODUA 1NLDL 1QYGL 1H8NA 1ZANL 3HHRB 3PQYA 1LL1A 4WWKA 1NMBH 5IMKA 5DJAB 1E5YA 2YSTA 1XYBA 2LLEA 3CUZA 4NO0A 3G8RA 1Z9PA 4DO4A 3ULUC 1DP0A 2JJTC 1B4JH 2WLNA 4Z77A 2VQ4A 3ZBMA 2OL3B 1GYWA 4DZ8A 5B39G 3UPCA 3MLPA 2CWNA 1J9TA 1F58H 1MXGA 3CUPA 1NPJA 4GJ1A 3PTMA 1GGBH 3EYSH 4UTJA 1PIGA 1QA9B 1OE3A 1OT2A 3IGAB 4AZHA 3UZ5A 1DFBH 2XY2A 5HI3C 3VXQA 3CXFA 3IJEB 1I0DA 1OGSA 3ARBB 1E4XL 1NBVL 5DT1L 3SE8L 1O0VA 1F56A 3QJHB 3INPA 1CBGA 3WQ4A 3TR2A 1YY8A 5BXRA 1VFHA 4OCYH 1U92A 5CJXC 1AZCA 3GSUA 4P2OD 1ZWIB 3HRZA 1M42A 3L16A 5HAOA 4Z7VB 1KEGH 1C8PA 1GY1A 1KGWA 1FYTD 1VFMA 2FEEI 3MV7A 5KVEE 3EBVA 4YDNA 3MCMA 1AH4A 1ZT4B 3N5AA 4PLKC 5DRZB 3QUXD 4W8AA 3D18A 1C8XA 1US3A 4LDLB 2ARWA 3GPSA 3QSKB 1TVLA 3F5KA 1XIWC 1EDGA 2YAOA 3DOIA 3FTUA 1E1EA 4UFMA 2X4OB 5C0AA 4PBFA 4N22A 3THDA 1KC5L 3CPLB 3MXVL 4HW6A 15C8L 3FAWA 2BJML 4X6DE 4EAEA 5DD3H 3T3ME 2D22A 2ZYFA 3CEPA 3FU6A 5EPDA 3QDJB 3NIGE 3VKBA 2A85A 4YDKH 4F7PA 3QJQB 2BY2A 4NYYA 2BWIA 4Y2OB 1F8TL 3LOWA 1RHHB 2VSMB 4N9OB 3WKNA 4D9QD 1T6MA 4KRNA 4NQDA 3NO3A 3BEVA 2ABBA 1MF2L 4LCVA 3FDGA 3R10A 4N4QA 3FULA 3PV7A 2CRYA 1IAOB 4K8RD 2WTPA 4FJZA 4FIQA 3SW6A 2UZIL 1G7VA 1FNSL 3OHMB 1U8JA 5E2VH 5EIIG 2IF7A 3VDHA 5ILTL 1JI2A 4FFYH 5AZ1A 5KSUA 3S1GA 1TZGH 2O55A 1S5HA 4PJIB 3GM0A 1ZHNB 2DYPA 1N3NA 3QULB 3BQUC 4AK1A 4Q8OA 1R47A 2MOVA 1MDLA 2A6IA 3PNWA 2EPMX 3WD0A 4HK3N 5CG7A 2I5YH 2XFXB 2PF0A 3S96A 4PMUA 3UACA 1RURL 4X7CC 3WXVH 3B9EA 3TYUA 4DBWA 1JPTL 4JKNA 3RHWK 4N85A 2I26N 4CMHC 2VN4A 4GBXA 4JJOA 2QHRL 3NTCH 3GYCA 1VYRA 2WO4A 4E8DA 3LHTA 1NF7A 1HOCA 3DOHA 1GHRA 2WBXA 2PTVA 3FH5A 1OM3L 5HP5A 3MOAL 4JG0L 1HJBC 4LDCA 1KRAC 3WDIA 1VGKA 1U6AL 2VUYA 3VIFA 2H1LM 2R23A 3PF2A 3OLDA 3RITA 3SCTA 4P2YA 2LABA 3PQYD 4D8LA 3VNLA 3H53A 3BPWA 5CZSA 2VI0A 3SN6N 1S9WB 1W0WA 2BFGA 4BM7A 4DO6A 2I24N 4IHBA 1EHXA 3W4RA 1ZALA 4OLUH 1J79A 4HUKB 4J1UA 4I88A 1JNDA 5CD5C 4X2UA 3KHQA 3LZRA 1ISYA 2RFGA 5HDRA 4GSQA 3VI3B 1BFVL 4Q4SA 4A3HA 3RX8A 2PYED 1F07A 1JZFA 4JRYA 2J1YA 5TPWH 2Y36H 2O93L 2AZAA 1X39A 4XP5H 2ZDRA 1JGLH 1I1AB 1ETJA 4PJAB 4GK8A 3TAOA 1KCRH 1M1XA 3W7RA 4NRXB 3FB8A 2D2CC 1XSJA 3GXUB 5I66B 1I53A 3HFYA 2L7EA 3GSRA 4H40A 1OSZA 2BWDA 1P7KB 2CZDA 1AFVH 2IDUA 3GSVA 4XCFL 2V6AA 5FUCE 2F19H 2BLFA 3AS1A 2E1WA 1TQSA 1Z3RA 2P43B 2VSDA 1YBQA 4FF9A 4OIIH 1QRQA 1GYLA 2C9XA 1LDPH 4L8BB 4PS3A 3TYFA 4IIHA 1QT1A 3U6XA 3N15A 3VNMA 4E8CA 1NMAL 2ROYA 3ZYIA 4OLZL 3TPKA 3FFCA 4BH7A 3ZQ9A 1BIHA 4L8SB 2OMAA 1LP6A 1U5HA 2AJYH 4JTLA 4NQCB 1PWMA 4C1LA 4XTIA 4W9ZA 4JW3A 4G6CA 4DWSB 4C6QA 2V5RA 4P2VA 3D85A 3JUYA 4MMXB 5HPOA 3QQNA 2J8UB 3BGFB 2G60L 3I3DA 4I0CC 1FWRA 3W0WE 4YHZL 1K3UA 1A7NH 1IL1A 4N2MA 1QHPA 5J6HB 1FH5H 1V3IA 5T1KA 2Z29A 4JHOA 3I65A 2KZHA 4IBVA 4F7MA 5T1LB 1VBUA 2G4JA 4IHCA 4Q9RH 2CKNA 1CZ1A 1VPYA 5TDNB 3SGZA 1PTGA 3NQ2A 4JPKL 4IRSC 5HGBB 5DWUH 4QRSA 4ERSH 1YJDH 1RJLB 1OW0C 2ZUQB 4ATWA 4BS0A 4NDMB 2WNWA 3BW2A 5B38B 1QFUH 3W2MA 2AITA 2WTRB 1ANUA 2KERA 2Q2LA 1HDMA 1EJOL 4LGPB 4TNEA 2DPEA 1D5IH 2AXGA 3DXAE 3FA4A 4PV8B 4L9DA 4QHMB 1CENA 1AD9B 3BPLB 4EUPB 1XLJA 3BPLC 3K2MC 2HLFC 4HLZG 5CMAB 1OO2A 1FNFA 4FR6A 3CQQA 3U79A 4K5LA 3U9UA 3DMMD 1Q38A 3MRHB 1TPH1 5G1YA 1S5NA 3FSOA 4QD2E 3POHA 4XO4A 3STZA 3VB9A 3WSQH 1LRQA 1Y5WA 5D1QE 3S46A 4D6FA 5CU9A 5D9SB 1INEH 4OD3L 5H8PA 3D51A 2Z4GA 3AMDA 4FOKA 4QRQB 3SBRA 4MQSB 1FWJC 1HI6A 4ILSA 3QFDA 1CI1A 4L4VE 4H88H 4RAVB 3RNQB 3S35H 3WNPA 3FFDB 1HO4A 5DEFB 1Q13A 1LO4H 4LHUG 1EEQA 3MRKB 4PB5A 4DEFA 5B7MA 3D09A 1B4LA 4DUWA 3DUUB 4K73A 3ZKXC 3RRXA 3SY0A 3DI1A 3ZTNH 2OZ3A 3KEHA 5IVXE 2Q5BA 1M7JA 4FYTA 2A6KA 4XZ4A 3TMLA 3L5HA 1BQLH 5JHDB 3MNZA 4H0GA 3EH2A 5CBEA 1C08A 1BQRA 1ZLWH 4AZGA 4QRBA 1W91A 4E38A 4TUJA 2GVJA 3PTQA 2XQYK 3BKYL 3U7WH 1E9IA 4TF4A 5AW2B 4G7RB 1B0WA 3C6LC 4NZCA 2F7RA 1Q6RA 2X7VA 2VD9A 3IKKA 4RZCB 5DQDL 4AWEA 3O41B 4JLRB 5CCKH 3IU3A 3B9KB 3MJ8B 5M7QA 1SFJA 2Z0IA 3NIFF 2GL5A 2PA6A 5FHAL 4NX5A 2H2PC 5I02A 1S4IA 4KH2A 4XXDB 3UTOA 5BRZB 2ED9A 5KSAB 1FFOA 5IEKB 1JZ6A 3IJQA 1CF1A 4HU8A 2ASHA 3QXTA 5IQ7L 4F92B 4G70B 5BS0B 4PRHE 5CIPA 5C7XL 3GMPA 2NX3A 4O54A 4RV8A 4Q8BA 4KX8A 1DVFB 3FH8A 4WSKA 1MW0A 4ENZA 4MVBC 1BQ5A 5CR8A 4DQAA 1BPVA 4MWAB 2IQAB 2XFFA 5B7EA 2DDQH 2GIMA 4AYBA 3J2PA 4L4LA 4XHJC 3S4SB 3MBEA 4AIZA 1UCBH 4XZWA 1R5VA 2VE6A 4L3FA 3DROB 1FZJA 4N2YA 2VB5A 1NFDF 1UWSA 3EF7A 3HW7A 4B90A 2DKUA 2NQ5A 4C1NB 4RZ5A 2W91A 2QCLA 3FA3A 2YGYA 3B43A 2KC0A 3DJRA 2MHAA 4JKMA 1BOYA 1U30A 1A0QL 4MHBA 2JCCF 5JW3H 3NCMA 4AXWA 1RH9A 3U2ZA 4US5A 3RM4A 1ZAGA 3UA4A 1K9DA 4ZB0A 3ALXA 4D6EA 1GGCH 1OGAD 4LWWA 1J10A 3DJZA 3HG1B 3IF1A 5ADOH 2PCEA 1WFOA 2MNJB 4NAEB 3LKOA 3RLGA 2QKIA 3CXHJ 3EADA 1KGCD 1WA0X 5IB5B 4O17A 3CAFA 5BUPA 3CCHB 4ZUUB 4JFOA 1UJ3A 2CM6A 2P42B 3CXHK 4S0HA 1HN1A 2SFPA 4NUQA 2EDDA 5E56A 3N13A 2APWA 2KMWA 3S0CA 2PSNA 3L4VA 1FYHB 5CPSA 2V3FA 2Y7OA 2ZKYA 4G71B 4TLUA 4U3HA 3SE9L 1QTWA 4GKTA 4BI6A 1GAFH 3QC0A 4Z76B 3TWCH 4DLMA 4NKOA 1P5UA 1YTEA 1WZ1L 3EDKA 3WXVL 3AMGA 3TESA 4PRID 1IQDB 2WQXA 3MREA 4LBAA 3TJEH 2FNBA 5DK0A 4AJ0A 2ACRA 4P8UA 4AVOA 5HI5D 3UGVA 2Y7DA 2V2TA 3RGVD 3ZDXE 4XGZB 3HF3A 3L3IA 5T5NG 1IRAY 2DZTA 4HU3A 3JWNC 2YD9A 4NSKA 1V10A 3MHUA 3PGDB 1SU5A 5EU4B 5G2WA 3THCA 5HJYA 4KITB 5IMLB 4S1DC 5JHAA 2R1MA 3NCXA 5GGRB 1JPGB 4JFDE 2G97A 4C6IA 6PTDA 3XINA 3NGBB 5AWNL 3ZKXB 4YHOH 3ZQXA 4D7PA 4Z7VE 1BYCA 4IIDA 2VLKD 4BH8B 4F0RA 2EDMA 1CE6B 2P5WB 1MRAA 5FYJE 1MCKA 2FX7H 2WWMD 4XVOA 1Q1JH 1Z5YD 3L4WA 9PCYA 1A6WH 3K2IA 4QJ5B 5CSBA 1AAJA 1IGFH 2V2WA 3BWUC 3EYFA 1BVZA 3UAJA 2F54D 5C1MB 2PLMA 2WM1A 1X5ZA 3GU2A 1DQDL 5CZJA 5FJJA 3WHXB 1HJCA 3R6IA 3OPUA 1I1AC 1UACL 3ARDD 1UXWB 1HKMA 5L2KA 3GBDA 5T5FA 2VCCA 1ZVNA 4BJHA 3MBWA 1DXFA 4RPPA 2Y5TB 3SCMD 3U0HA 1CGTA 4XVUD 1L7TH 5H4YA 1XV8A 2A9NH 3DPBA 1YPXA 2YZ8A 5C0BE 2XV6B 1FZMA 2B9BA 3JWOL 3TNNA 4HU2A 1PEWA 4WI0B 1X97A 1R9XA 2DSZA 1WZLA 1EMTL 3ASWA 2VYOA 4PJ9B 1G7IB 4R5TA 1MCWM 1E27A 1OB1B 1TCMA 3SKMB 3TO2B 3S88L 3TYDA 4NXSA 4XRCB 3PAUA 3CFQA 4M6PA 3RMEA 3LPGA 2DN7A 3WAJA 4O02L 4JRLA 1ZLUK 1RAMA 2YD1A 1XBZA 3ASOB 1FAIL 1KT2B 3LIZL 5FYLL 5BRPA 3GHTA 3OVGA 3CN1A 3INUH 4KRLB 1W1IE 1YTDA 5SX4H 2PTTA 1NANH 2ITDB 3ELFA 2D3LA 1AG1O 3HLKA 2UXGA 3QUZB 4AKOA 3QUZC 2AJ3B 1EGVA 4ML4A 2NY3D 3QXDB 4HMCA 3RDTA 3O4LD 3P3UA 2DLGA 4OIBA 4F66A 3A6OA 2C7FA 4KIRA 1BAWA 4CCZA 3FSWA 5DGQA 2V5BA 1H09A 1NDGA 3B56A 3QO0A 1R24B 3SO5A 5DWUL 5EC1B 2A79A 5KVDL 2ZCKH 3QVAA 4Z7OB 4LTSA 3UNTA 5CCHE 4QX4A 4AEOA 4FXSA 4YWGH 4PRTA 4AAJA 5KTEL 3ELQA 2TRHA 3GHEL 3RAOA 7PAZA 3QWRA 4TLTA 4EZMA 3VGHA 4P4KD 4PGCB 8CGTA 4BQ2A 4F37F 1TTGA 2CCVA 3I9AA 3SDXA 2Z7GA 3NN8B 4UFKA 1M05A 3ETTA 4C4KT 2EYTA 2X1XR 3QNZB 5A6JA 1CF8L 2CCWA 4UQ3A 5F88A 1INEL 1CFTB 4OD3H 4XOAA 4ANUA 1XP3A 3ONCA 3QHOA 5C2CA 1T5XB 5IMMB 1AOZA 3WF1A 1AO7B 5C8BB 1CDJA 1A4KB 3SR7A 3PJXA 3GC3A 3KLAA 1QTSA 5GJPA 1MQRA 3ZIZA 4B91A 4A7QA 4A37A 4S1SH 1QO2A 3ZM8A 5JXAL 4OUOA 5J1AB 5MP6H 3KTCA 3CUXA 4QJ1A 3SY5A 3WTYA 1A9EA 2UYLA 3ZVHB 4AIBA 1OY3B 3ATAA 2ED8A 3HC3L 2WO5A 3IV8A 4JG1L 1HCYA 1QVOB 1GY2A 2OBGA 3ZRCC 4ML9A 4S3GA 4GVGA 3PJNA 5AC5A 1J12A 3KVKA 6REQA 1MCJA 4WHCA 3WDRA 2DUZA 5LSMA 3ATDA 4CSSA 5D7KD 5JQ6L 4PGZA 4LCRA 4Y9AA 1UZ6F 4X83A 2X2JA 3DSNA 4PRNB 2D8KA 4QYOA 1IGML 7CGTA 3GNOA 1Z9LA 3SOTA 1XHGA 2F61A 3AT9A 3G1DA 4YCPA 4S1QH 4DKEH 1SMAA 3IFOA 1ECEA 1XEDA 4GRWH 5CBAB 1A25A 4LLMA 2XFYA 4YTUA 3ZWSA 4GG8A 4OFPA 1U8IA 5D55A 3UYOD 3HC0A 3QORD 5ANME 4GINA 3ARGC 2BC4A 3VFWB 3QY6A 4PJ9C 3PDOB 4UYQA 1JK8B 1KLUB 2R0WH 1KCSH 2IPTH 5C07A 4R4FL 2H7WA 4JPIB 3WE6A 2ZKHL 5JO5A 3DFHA 5HY9B 4HNUA 4MNGB 4IEFB 3W29A 3TGXA 3AQYA 1IAOA 2FTYA 2HX9A 1RUAH 3TBWB 4PUNA 1WAPA 1ZA3A 4YH6A 3BCJA 1ASPA 5F44A 3FW6A 2YXGA 4HXBH 3VWKA 5CBJA 4CVWA 3VNDA 3VRIA 1OABA 5FA3A 3UVIA 3KCLA 1M57B 1E6SM 3BKCL 2DIBA 2YL9A 1AG0A 1R34A 2X38A 5DBTA 2W79A 3N2OA 1A3RH 5G2HA 1XGPA 1TJRA 4NO5A 2ZC1A 5GSRB 4A3RA 5I71B 4PM1A 1I4FB 3MJ6A 1Q7ZA 1FDLH 4TVUA 4N6QA 3RWDA 2QVMA 4EEEA 1B2WL 1CFBA 1M71A 3NJFA 4ONGL 2D2OA 1X5YA 4UZUA 4WW1B 4AE1A 3B8YA 1RR2A 2J2ZB 1NEZA 3VB8A 1YEDA 3S1UA 3LUTA 1MFUA 4PE8A 3AT8A 1BEYH 1T1WA 3CO4A 5JOPD 1PQZA 2CLOA 4Z77B 1WKEA 3SE9H 5IHBA 4GIYA 3BVDB 4PCYA 2WB7A 4OF3A 3TWCL 4HT1H 1KTJA 2EXTA 5BU6A 1EV2E 4Q4QA 1FHNA 4PGDA 3TEVA 5A8MA 2G3ZA 4G5AA 1E55A 5ISZE 2WMIB 1TCDA 3S2AA 3W11C 5T9CE 3NPZB 1MFVA 3TA6A 3WJMA 1YEEL 5ESAB 1S9VB 3OZMA 1YYML 2IEPA 4AZBA 3HJ0A 1KDJA 2R2HA 2AF2A 3CLFH 2LFEA 2QZRA 4AUYA 3EXSA 2C3VB 2ZD0A 4QO1B 2NXHA 1VF5C 4OM1H 1LGVA 5KJRH 2YKLH 4G83A 2UXFA 1UR9A 2OWXA 4Y88A 5K4ZA 3AXHA 3ARPA 3TK7A 1HQ4B 5F0JB 1W32A 1LD9B 1GPOL 1VHCA 3BWWA 3D39B 2EUVA 3SDCC 2Z7WA 5D4YA 4KZCA 5HBFA 5ID1A 2RUSA 3WG7B 3WUZA 2ZTKA 3LLDA 1R5WA 3NPVA 2X70B 3ZHFA 2P5EA 3MJ7B 4KTEH 3CSYA 1IGFL 2FR4A 3HFML 1Z7AA 3IANA 4F2MA 2J7EA 4LLQA 3U0PB 3ATEA 2FJGB 5SWSE 4PJIF 4APQC 3CLEH 4QSHA 3W86A 1QBBA 1S5HB 4M6NL 4PJIA 3CZ8A 2R39A 3FFSA 5AVHA 4OCSH 3T0DA 4QE5A 1XF5B 3NVQA 2FHFA 2XOTA 1JZ7A 4K5PA 4HVXA 4LLYA 1JS4A 5F1KC 2OCZA 1NWSA 2CIIB 1OOAA 3EWUA 4ODWA 5KYUB 4KO5A 5D8JL 4JPGA 5M2FX 4XODA 4LDOB 1DBBL 4TRPH 4EE2A 3RO6A 3QUKB 2BSSB 4RRPA 4POUB 5B80A 3VDAA 1T22A 2BOFX 4LEQA 2BFVH 1S2EA 3DTUB 2FSDA 5DMKA 5H94A 3DAQA 3NQMA 4HJWA 2FNWA 4LMQI 4XX1G 1TPUA 3GXIA 4U1HA 4HC1A 4ZZFA 2E0PA 4YAQA 3UZVA 1X3DA 2FWOB 1KZQA 4H0LC 4LSPH 3WNMA 3QUYD 5IFHH 1HEJC 4LLUA 5DRWA 2TMDA 5HHMB 2R69A 3U2SA 4DP7X 5F7YC 2OEMA 4AQAA 3C2VA 3N50A 3GMMA 2QSCH 3Q5TA 4V1XA 4C58B 1CCZA 3EXLA 3C8DA 1JXKA 2BMKA 2DW7A 5GGQH 1GGUA 2CUMA 3Q8CA 1ZV5A 4FG2A 1AMYA 4ELME 1FRBA 2AK4B 3LZLA 4EVNB 2Q3ZA 2IPJA 2Z4TA 1KCVH 3KDMA 5DFAA 2QVTA 5DA0B 2C1OB 3MUXA 3VINA 3STGA 3TNMA 1WX0A 2EABA 1C8QA 1E0XA 3WH8A 1NGQH 2PW1B 4JQVC 1XLEA 2QZQA 3NEXA 4JFZH 4G6FD 3DFYA 4FABH 2I69A 4YVUA 2ODHA 3FU0A 1TTPA 3LZQA 3T4YB 1A9BB 3TCXA 2Y2YA 2OGYA 2CHOA 3FDWA 2VM9A 5H6HA 4L4VA 2I16A 1GTEA 3M0ZA 3P8JA 2ADFL 4ZFGH 5A6IA 3MLRL 1M7IB 3SSGA 2W66A 2A9AA 5L2JB 1AZRA 3QJZA 4ABWA 1A1NA 1B31A 2F15A 4OUIA 5TAOA 4N9GB 1U1JA 1GZQA 3E0LA 1W5OA 3K6OA 3L54A 5IW6A 1O6VA 4FNQA 3OZ9L 4F8TA 4TUJB 3KNBA 3U0TA 1TR1A 4K1WA 3AHTA 5I79A 1OFBA 2MKWA 1M2VA 2DQUL 3C61A 1Q90A 3MP4A 3IJSB 2IV9A 1PV8A 2BVYA 4OLXH 4Z0BH 3ALFA 1CIUA 4KPHL 4RGND 5MP6L 3FN3A 3FUHA 3A6CH 2JK5B 4O5LL 3QH2A 4KWOA 3LRSB 1HL8A 3IVTA 2JNZA 3DX0A 1QJWA 3N2MA 2IWFA 2J7GA 1WFJA 2NLJB 4GFSA 3ORWA 3W2LA 2QFPA 5E1QA 2EC8A 4HX1A 2WHKA 1TQCC 2JIXA 1MDRA 3C2RA 3CN0A 1I7TA 2KLRA 3D25A 4NC1E 2BHFA 4U1GB 1J5OL 4J3UA 1TUFA 4ZTPH 3W2DH 1X1OA 3MUAA 4PUDA 4KBXA 3NP4A 5JQ6H 1XYLA 5BZDB 4W93A 1CLYL 4DBSA 2PDIA 4YXKH 3RFZB 4B9ZA 2FO8A 4XPAL 1ZEAH 4J6IA 3MV11 1FCUA 4QP0A 4P2QD 1OF6A 2D31A 1LK2A 3LNMA 1HHHB 4NRYB 1T7YA 1J8KA 2VCAA 5T1LA 4MZ1A 4UQ2B 3T3PF 3L3DB 1VC4A 3NQBA 3T4CA 2PR4H 3UTSD 2QGCA 1EGZA 2XLLA 2XWZA 2DRUA 4MBRA 1AJ7H 4BZYA 3T6WA 1EIXA 5A16A 4X6CE 1BOGA 1J18A 2C1IA 2DY3A 3VPLA 3WBWA 5A43C 4LS0A 3RJXA 3SYCA 4ORGA 3ZGHA 2WZPD 4OUEA 4JDTH 1KCSL 4NENA 5B38A 2FCBA 3N1GC 1BX2B 4ZFCA 4P9HH 1TJGL 2R6OA 1GZPB 3TO2A 5ESQB 4IL0A 2IAMC 1S3TC 3REQB 2Q3AA 3PM6A 4K5OA 3R7QA 2YGOA 3UTZB 2PCXA 1YNTB 2BIMA 4GS7B 4MDIA 5CIPH 1JDEA 4JK0D 6TAAA 3GXPA 2ZZ7A 4QRRB 3PUUA 2FAUA 5LXGH 1JGMA 5EMLA 4U2ZA 5AC7A 4OIAA 1V55B 2GPZA 1X6UA 1GIGH 2OL3H 4QYOB 4I9MA 4KFZC 5ENWA 2HFEB 1E6PA 4IIQA 5HUPA 4UR8A 3T4AA 4RCAA 3TONA 2PPAA 2X12A 1NQ6A 3CVIL 3A4DA 1VFTA 1Y5VA 5F9AC 3NFNB 3IE4A 1TZIB 1INQA 4U6HB 3QJFB 1XIWB 4DP6X 4O18A 2BWGA 1XWVA 2FUTA 3LY0A 2FTAA 3VG9B 3N2TA 4JFHE 4C5YA 4JLRA 3FYOA 2VDRH 2HRPL 1WCGA 1ZU8A 1F3DH 4H26A 2IQDA 5CSSA 4KK5D 3WTSA 4MLJA 2QPFA 1BEXA 5EFIB 1JHLL 4TULL 2ZG1A 2X16A 4E42B 1AHWC 1C7TA 43CAA 4F8QA 3ETSA 2YPVA 3GMQA 5EEXA 2B39A 3RY4A 5DJ2A 1A80A 3WO4C 1QPNA 1S2AA 4B97A 4A2GA 1C93A 3LSBA 3W7HA 2H9AA 2ADIA 2VDML 5L4IA 2XTJC 2ZP9A 3FS2A 3FUFA 4ATLA 2WBJA 5F3BB 4WRHA 4YJ5A 4A3QA 1Q6LA 2VXUL 1KC5H 3WX7A 4OM1L 2HH0L 3DBXB 1FNEA 3P73B 2G3NA 5DHEA 2NY0D 4Z7NF 4ZUSA 1XLHA 3GPEA 4MHHG 5IIEA 2CBMA 1KN2L 4PRAA 5D7JA 2HRHA 2GIXA 3LH8A 3S5ZA 4UIOA 1YNKH 5F7LB 4S38A 3UY7A 2QR0A 5T33H 4PH8A 5D1QA 3RUGA 4QDPA 1SLXA 1SJVA 3BCDA 3QQ4A 1P4LA 1NOUA 3VFUB 1CD0A 5BVJB 4QROA 1NTDA 1Z66A 1GS6X 4FERA 3IRSA 2NY6B 4LEBA 3W37A 3DG7A 3UR2A 4DXKA 4D1IA 4J40A 1SZFA 4OZ4B 4JIHA 5FS5A 1GKQA 5ABTA 1MO0A 4NNBA 2GHWB 1KRBC 2D7TL 4XVUC 2VCOA 4XX6A 3DGGB 2YQ2A 5G2NA 4Y8DC 2XZAH 1W8EA 3PWPA 3H3BC 4TS6A 3DO7B 4LB4A 1L9MA 4PUKA 3OVPA 5GRUL 3X14B 5T3XE 5HK4A 4Y7OC 1MSSA 3FF7A 4U1NA 4NWUH 1DWJM 3OA5A 3L5LA 2ENSA 3MO1B 3W39A 1EP3A 7PTDA 4HUMB 2VGLM 2OLSA 4W70A 3SQOH 3UJ2A 1KGUA 2R91A 2W0KA 1EA9C 4B4HA 1MLBA 4K94L 3W7GA 1TX0A 3L6FA 1TWWA 3SGEH 4BZ2L 5DC0A 1MHCB 1RL1A 3QPYA 4W9IC 3MRCB 3OAZK 1LEKB 4DTGH 4IL2A 1UD3A 4JO3L 2VISB 1M6OB 3HCVA 3F01A 4HXAH 4PP1C 3KYMB 4D9LL 1M7UA 4XBEH 4IMGA 4N2DA 3BV4A 4GSXA 2O7SA 3VI3E 4ABVA 2BH0A 2HV5A 2MMXA 3V0FA 2WMHA 2FBJH 4AH2A 3MOQA 5JIPA 3PFMA 5KN5A 4HUUB 5IJKA 1JK9B 2YA1A 4EUPH 2PDPA 2PZNA 4HQVA 2XZQL 4BF7A 5AUMA 1H9VA 4JKKA 3C60C 3LYEA 1OAJA 5GGQL 3PZOA 4GSDH 2C26A 3MRQB 4X4XA 2PS2A 5A8GA 4PMFA 4XZBA 2FZ3B 3T0WA 2ITCB 1I4NA 1PCSA 1TFVA 1R75A 3MKCA 3D08A 4AV5A 5FXCH 1JGDA 4RE0A 1NM4A 1UXSA 3MNDA 3RWDB 5IOBA 3CDCA 3QTPA 4RXGA 2EO9A 1W31A 4CVZA 3KOYA 3KL0A 4W4OA 1XQLA 2WXFA 3LOTA 3NRFA 3KRSA 1IM9B 3CDYA 2UVEA 4ZNEA 1J8RA 4FFZL 3HOGA 2X4NB 4MS8C 4WI8A 3MDUA 1V02E 1SZGA 4PL1A 3FNDA 1KFKA 4BK5A 2QCHA 4NP7A 3ZHLA 4OV9A 2CLLA 4NFCA 4F7EB 3MRDA 5D9MA 4NQCE 4WUKH 4FLSA 4ABQA 1YSOA 3LSOA 4YZFF 4LUSA 2GVEA 1EDHA 1QHZA 1AKPA 1KFGA 3SDCD 1B4JL 2HVBA 1OD8A 4QISA 1TJIL 2ABAA 3ZTDC 2AJYL 3RWEB 4L3EE 1QAPA 5IDIA 2GOKA 3O07A 1O68A 2IFGA 2ZSWB 2TYSA 4RMUA 1OG6A 2Q8XA 3F04A 1RK1B 5DO2D 1PZ0A 4DJFD 3EG9A 4N68A 3DURA 1KBWA 1PD6A 3IIZA 1OD7A 3WKPA 4ZMPA 3NA8A 2VAAA 5INDB 2XG4B 2XZCL 4KK9C 2IPUK 3CSTA 2VXQH 3IDUA 4IRJC 3A13A 1AY1H 3NACL 3LCXA 4LLMB 4X4ZA 4S3FA 1FP9A 4NXKA 1QO3A 5DJXB 4YX2H 3GNXA 1AQDA 1R5WB 1VEMA 1ZD6A 1ZTXH 2LW3A 3VXGA 4HCRL 4ZW6A 1TKKA 3LIUA 4LAOA 3JV4A 4J6RH 3LNFA 3SGJC 1UM4H 2ICEA 2R2EA 2UWEE 3G6JB 2PDBA 1HW6A 3L3HA 1G1OA 2VDLL 3QZWA 4XNUL 2ZG2A 5AALA 3CIVA 3MOBL 1GR7A 1G0YR 3R8GA 3M7OA 5HHME 3EYVB 1ZS8B 4DQWA 2V3EA 4M93C 1CQKA 3H4HA 2IPFA 5IHSA 1TVBA 5EBMB 2IQTA 1FNHA 2V0AA 3UBGA 2EXWD 3N3TA 15C8H 4EXQA 2OZ4A 1BBJB 4EJ1C 1LT8A 1LQ2A 3KWSA 1ZPTA 3AQXA 3LD5A 2OJ1A 3QORC 5FCUL 1GKPA 3SSJA 4DKAA 4R90L 4P2OA 2R59A 3IGSA 4EP8C 1VJSA 3GJFK 4G9FE 5EO1B 4YBLB 4EI6B 2DQCL 5BZZA 2R56H 3TBYA 4Q2ZA 4PFHA 3F7YA 3DV6B 5CKAA 2DP3A 4QXUL 4KKBD 5CPTA 3WLWC 3PDGA 4XSMA 4GMTL 1FV1B 3ZE0B 4R9HA 1QFWI 3Q8AA 2YAMA 3TF7C 1SZRA 1XLAA 1FNSH 1C9WA 3P2VA 4N2LA 1NMCC 1E9OB 4MNJA 1FFRA 5I3KA 2NQ9A 1L6YA 4NKDB 5LWYH 3MGTA 1OZUA 2YBUA 3RX2A 4PJBE 1T5AA 4KRPD 3KPMA 1TPDA 3GMRA 1QNIA 1SR0A 1QVOA 3DI2B 1PD0A 2FFCA 2PODA 3NQ6A 2ED7A 4AXKA 2BMKB 1ZSXA 2QUVA 3GMNA 4WHTA 1KY7A 1S8DB 2BVPA 3BWSA 2ZUTA 4F5CE 1YXCA 4G80A 3MWAA 2BGQA 3AW5A 1ZSHA 2ZA3A 3CIXA 4H8VA 4C59B 3W6MA 3LV3A 1ZDQA 4Q9CA 4EVNA 1QASA 2PO6D 3ZMNA 1NBQA 4P5TA 5IFAL 2FVKA 3OR6B 1KELH 3ABQA 4XCNB 3QFJE 5CZRA 4BQ6A 4ZOCA 7FABL 4NNXB 3T0ED 3DUSA 3QUYA 3GUGA 1U8MA 2AJVH 4X9BA 4TULH 8FABA 2WLZA 3BISA 2ORBH 2PF6A 2HTMA 2AXFA 3F58L 3NA9L 4P99A 3GDTA 2DD8L 3TBCA 1BTCA 3V4UH 4AYFB 3JUZA 5JU6A 1WBXB 3BPCA 3WE6B 1JYVA 1JIBA 1UVQA 3JV5A 1A7OL 5AW5B 3BVNB 4IEFA 4R2GD 4CILA 3GLCA 4HKBB 2HUEA 3BZEA 3SO3C 4NIRA 4R8WL 3UCRA 4PJFA 2JXMA 4BF5A 4OTKA 3EO0A 1DQJA 1OLZA 4HOXA 3WY3A 5CBAA 1B4RA 3CC5A 3L2MA 4YU1A 3L48A 2FJGA 2BXVA 2YAPA 3LN5B 5AKSA 4RESB 1MJ7L 1O6TA 1QEWB 4XPHL 2WMPB 4PRPA 4MX7B 4HDIA 2DWEA 1D6VL 2H6OA 5EOTB 5JW3L 4DN1A 1ASOA 2A1YA 1EGJL 3VZZA 3RQ3A 1KFEA 3NEHA 4L3ED 4G7EB 4E4FA 2A7BA 3M1OA 3Q3GB 1KTDB 3TV3H 5KUKA 4Q4OA 3TN0D 3NQIA 2IGTA 1E51A 2RJMA 3SPJA 1RFDL 3ARZA 1THAA 3EX3A 4FXRA 4G8AC 3KGTA 2YJLA 5IF0A 1DBML 1OGAE 4NUJA 4ZMWA 2PDFA 2H3DA 4IOSA 1RCQA 3H54A 4JZOA 1GOOA 4ZT1A 3SADA 4GKZB 1TZ7A 3ARFC 4QTIH 3M64A 2DI8A 4AXWB 3VXRD 4ZJ9A 2DQJH 3HZ3A 2LLGA 4ZAKA 3PXLA 5DEGB 1ZJBA 5D1XC 1YMMB 4RE4A 2W88A 2HKHH 1OK8A 1NFDA 1QI0A 3WJMB 5A6TC 3B9DA 3UBXI 2EPNA 3LQAL 2AQTA 2CK2A 2VQ1A 3OTTA 5E1IA 4YN5A 2G50A 1Z5LB 3JWDL 1XUUA 1XPYA 3EGJA 3P30H 4UOZA 1KTBA 5CKSA 1Y6MR 5GS1B 1JDCA 3WIIH 4YDVA 2XRAL 1MZRA 3U9WA 3FT3B 3OIHA 4M6UA 1DZBA 3I6GB 3DCPA 5ENLA 4IMCA 3ZTEA 4KK6D 4HXAL 4PAZA 3U9IA 3WQVA 2VLRD 1AZ1A 3JT0A 1QXLA 4POCA 4J4PC 1OWWA 3NEVA 1SQMA 4PJDA 4LU0A 1WZAA 2EYRB 1UASA 4I7ZC 3VXNA 5EUOA 3ZE2E 1HJWA 5AL8A 1KKOA 3QI9B 3E5BA 2VJXA 3A23A 1E8YA 1FLRL 2PW1A 4GH3A 3HPLB 4BKLA 4J3XA 3NQKA 3LZOA 1D7BA 4F58L 2Z65C 3O3AB 4WV1A 3O16A 3K2KA 5HDBE 4P5KA 4H9TA 3MNWB 1OFAA 2V17L 5BRQA 1F4YL 2NXIA 1WZKA 3GNRA 5FYKD 4X5LA 5ALCH 2YBTA 2EKSB 4QBXA 1DQDH 2CHRA 1PYWA 1YQVL 3QJFA 4K37A 3W07A 2ZCHH 1J8HA 4Z2GA 5C5YA 3IDMB 4BRJA 5IFJB 3CZEA 2X3CA 1AIZA 5J9PB 1I1CA 1N5YL 2D20A 1VACB 4QHPA 4YNGA 2W92A 3GBMH 4KEMA 3WKQA 5JW4M 2XXCB 4Y5YA 4R34A 5JPMC 2WQPA 3IFLL 1Z9OA 4JVPA 5EA0H 3DFNA 1OF2B 3OKKA 3LHZA 3M0IA 3G9VA 2A7PA 2W0UA 4H9UA 4QSFA 4S3AA 3SDAB 4BDVA 1WUFA 3KVMA 2VERA 2WUBL 4FTVE 4Y19E 1F76A 5CJOH 5IVXB 3NFSL 3CWOX 3TA3A 5FPIA 1MEWA 1V6YA 1OTUD 4GH7B 3G9AB 4I5RA 2Y6SC 3GG7A 2PKDA 2VDGA 3MRFB 5L2KB 2E9LA 3L23A 1H3GA 3V0SA 4MJIA 3BT0A 1REQA 4BYHA 4X99A 1E4WH 3H9SD 2GUYA 5GJSL 3S7GA 4RJEA 2FL5B 4F40A 3EFFB 2CIIA 3EUUA 2PEVA 2X1OA 3MRJA 5JBFA 1KTCA 5BZDA 2WLLA 1C29A 2A6DB 3LBOA 1USZA 2OXGB 2E74C 4UDUA 3RBSA 4B9IA 4LVNC 4ZK8A 4BK4A 3F7PC 1RZJH 2DBLL 1FHDA 2PDWA 1IYXA 2YLLA 2YCIX 3GSRB 2VN6A 4DYJA 1IGWA 5I0YA 2QR0B 3PFUA 2FB3A 3HZKB 2F8VA 4EQ2A 5D2NC 3VXMA 3AYRA 1KM1A 4AW4A 3OF6A 4NB7A 1L0YA 4M8VA 2VUOA 5IOPA 4YDMA 3KCPA 4YS1A 4LO9A 4GB9A 1YNQA 4N8CH 1AP2A 4LBEA 3VRLF 5L7XL 1D5XB 1KA9F 5F7HA 3D3VB 3D4YA 1ND0B 2LOEA 3WI9A 3H2FA 4JTTA 4E9VA 4S11A 3DENA 3GB7B 5GGVL 1DN0A 2C3XA 4U0RC 4HIHB 4J3OG 3WO3B 2LE9A 5ANMA 1A9BA 4PJGF 3N6HA 2XWDA 2VLKB 2PTWA 4B5XA 5JMUA 5BRBA 3C87A 4UIKH 2CITA 4MASA 3CSGA 2J27A 3OW1A 1IE5A 5AL0A 4R90H 3TN0A 1RVFH 4W9GC 1I2OA 4MDRA 2C3GA 7REQA 1ZLVH 1H51A 1A3QA 4C6BA 4ZENA 4W9HC 5EU6D 2XG4A 5IFTA 4CJ0A 2IAMD 4RAUB 4XNXL 2R8SH 3QG6A 3G2GA 3G5XA 5FAAA 5I15L 5J11B 1BZOA 3IDNB 3VXME 2OSLA 4NNYB 4GPNA 5AB3A 2NR6D 4OZGA 3KBEA 4G42A 1XINA 3LKNB 1EQCA 3QAQA 5BZAA 2R2EB 2ZUUA 3PWJA 4ZS6C 2E68A 2JWYA 3HV8A 3P84A 1NEYA 3MKVA 4Z1DA 5K2ZA 1CDIA 1OPOA 2Q7YA 1Q9OA 2BVUA 3QDJD 2G9KA 3VQLA 1T1XA 3Q45A 1I7TB 1VEOA 1MG2C 1QSVA 1N6VA 2BSDA 1LO5B 4IRJA 1S7RB 5G2IA 3L4CA 1JPSL 3ZE2F 3KXFA 1Q0YH 4K1GA 4XN1A 1DDTA 2YSSA 1V3KA 4B95C 1QR4A 3VMPA 4X22A 4O13A 4WKFA 4Y4KD 3E8UL 1PGRB 2W07B 4LHQB 3L0NA 1SM3L 4FI8A 3WV0A 4O2EB 2ETWA 1Z2KA 3OWRA 4N5EC 2J8GA 3S2LA 4UTFA 2GJPA 3TYEA 3WUBA 1AQKL 3VKDA 1YEGH 5B8CC 1R85A 4D94A 1MI3A 2BXZA 4X61A 2AANA 4KI5F 3EA3A 3FQRA 4RUBA 1I45A 5I1CH 3MLVL 2NY2D 2R0WL 4WQOA 4RWYL 2RDWA 4AGMA 2D2GA 4R84A 4ZI8A 3VUPA 3AVEA 3L65A 2F0CA 1NDTA 5FF6B 3K72A 2HISA 1LXMA 3WH7A 3BWUF 2EGZA 4JQXA 2BGSA 4UQ2A 5CN3A 1S8DA 3TMQA 4AEIH 1SHMA 4IH3A 4RDWA 3VNIA 4JFQA 4EN3B 3CVHB 1Q8JA 5IQLA 2DZWA 2BOLA 3E2HB 3VDGA 1RUKL 4QHRA 5HWJA 5HYJA 3DV4A 3LI1A 5E1HB 1TUPA 6TIMA 1JV5B 4Y9EA 4RFNB 5AHLA 3W7MA 3HV9A 4W7WA 5MEOA 1GJWA 2D7QA 1GMEA 5KWYC 3KVJA 4XXWA 3W39B 4IOTA 4MUPA 1G4EA 2X0SA 4MDIB 3HB3C 5E2JA 2A2QT 4KV5F 1KC7A 3LNPA 1A6VL 3ABZA 2YEVB 1NCDL 2BIOA 1P7QD 2PCFB 3NIDF 4HSAC 4R3SB 1OCRB 3VFRB 5KBNC 2V2HA 3SE6A 4QRUA 1H1NA 1T1ZA 2P8MB 3GXNA 2O6EA 4JHBA 4Z7AA 1DORA 1D9KC 2J9YA 4PJBB 3T0XA 3KYOA 2VISA 3HCVB 5LQBL 1KCWA 4GGBA 3CHDA 1IBZA 1NCWL 4HKJB 4WJG3 4F3FA 1ORSA 1P5VB 2HSIA 3QUYC 1L8NA 3ARBD 2X88A 4U1IA 1TCRB 1E28B 2ICWA 2PW2A 5CGYD 1IMHC 3RGVA 4Z0JA 4IM4A 4H2CA 4O53A 3P2BA 2GEEA 3LS5H 5KZEA 1N59A 5KJ7E 1ICSA 2A3BA 1TEFA 3P61A 4X9IA 2V30A 4FZEH 4I85A 3HFTA 4W89A 1H60A 1LRTA 3WJSA 1HJSA 2DQGH 1YEFL 1V0NA 3AJXA 4U0QB 4N8PA 4AZIA 2JJSC 3FK4A 1AR2A 1KY6A 2MQ0A 5EZIL 4BSVA 4BSWB 5AKVA 2YKLL 3Q5OA 4NZ8A 5L8JB 3O3DA 3ZHNA 1TYJA 2VMJA 4PRAB 3GQYA 3CCHA 3GKWL 4HD9A 1H5VA 1E6JH 1JRHH 4AQOA 2FJFA 2GSJA 5DY3A 4KI1A 4WSHA 1XGRA 5I9QB 4B9CA 2EUXA 3FYEB 1DQLL 3RX9A 4Z3GA 4F8PA 3DETD 3OTRA 2PDUA 3F4DA 3O3EA 4XSLA 2J6XA 1EYWA 3RRAA 5DS2A 1V02A 2HWZL 5M95B 1DTNA 3G1SA 1WAWA 4GRWF 4LUSB 1YN7A 1RY0A 1FP8A 4OCSL 4QNWA 1WBZA 1N8FA 2J8TA 3EGXB 3OAZH 4O0ZA 3OLGA 4OLVH 1WWBX 1XT5A 4GKLA 4JKPH 1WV7T 4K71B 4KVNH 3BO8A 2Z00A 4RPQA 3RX3A 1PLBA 3UGUA 4EOUA 3EH3B 1U3YA 4UQCA 3IVKA 1J2BA 4BI7A 1RSFA 1RZ8A 1M9HA 4EBQL 4EZLA 3MV7E 5SWSD 5DRZA 4YWSA 2NYKA 3HG1D 4U1LB 4R9OA 2OMXB 1S3HA 3VXUE 1B90A 5E94A 3J07A 1E73M 2EDWA 1UZ1A 4DGWC 1E4WL 2GQ9A 2FX8L 1BD0A 2YC1B 3RZCD 1XH3B 3CUGA 5D8ZA 1PIFA 2ZVRA 3MBFA 4LAUA 5FGBC 5I1LB 2GY7B 4M7KH 2FX9H 4ALDA 2WLKA 5DYOA 3EH1A 2CKRA 2N1TE 2C4FT 4HUUA 3IDMA 2ZKMX 4CVXA 5ACZA 1A2YB 2FB4L 1E72M 4JHAH 4OGQC 1OWQA 2A3LA 2DZBA 3FYIB 3AM8A 3EXRA 2WLJA 2WYHA 4PJFE 1I8MA 2N0KA 3P3YA 1XLIA 5E9NA 2ACQA 1CXFA 1E5UI 2FQDA 4XAZA 1LEKA 4ZSOA 3MVTA 4CGTA 2Z1XA 1XC6A 1CFSA 3QQ3B 5TGBA 4WEMB 2HBXA 1PB0A 3FQNB 1XISA 3KP0A 2IG2H 4WVXA 1U9KA 3AITA 4R4FH 1YPZA 2O6DA 1FP5A 4CBZA 1V79A 4XNQA 2JF7A 4KOCA 1IWBA 2JCWA 1Q6GA 4DJFC 5ETUA 4NZFA 1ECYA 2V2CA 4KKAD 4PW9A 4W4OC 3TM6A 4OZHA 4NZ3A 2A3AA 5IT2L 3B5GA 4I2XB 1QLFA 1FUYA 3GAYA 3GMRB 4XUGA 2POTA 3KDPB 4MDJA 1E2VA 1GCYA 4GACA 2PC4A 3DFPA 1HNYA 1H11A 5EORH 1CD8A 1WGOA 3DPDA 4K3DL 4ERAA 2IWKA 2OXHA 2AVFA 2VMEA 5HYQA 1YADA 3AMLA 3LZ3A 4D71A 1CYGA 4X0KA 2FJSA 2VL5B 3MRLB 3E0GA 3F6IA 4KO7A 3VTTA 3CGTA 1CBVL 2BODX 3QKZA 4K38A 1IEAB 3UG8A 3IWVA 3LY6A 2Q87A 4I9TA 4YXLH 5C0EA 2GSEA 2PR9A 2W9MA 4JAMB 3OF6D 4N8VG 1ADQA 5FK9A 3GS7A 2C6QA 1JERA 1OTSD 4JRXA 2J62A 4WFED 2Y6SD 2J78A 1GJPA 2OU4A 2CR0A 3K4WA 3OLEA 4MFHA 1KIUA 5FB8B 4MPQA 3GIZL 5LKYA 1KBGH 2EIBA 4P5SA 1NCUA 4GO9A 2OTUB 4OZHE 5GGRY 1UKPA 1IIIA 1YEEH 2Y70A 3PK7A 3TDFA 4F15B 1Z9MA 1ZEAL 1RU9H 4HMEA 5DZVA 5AVQB 5JOEA 5HHQA 1MRQA 3WBAA 2EDXA 4PBWD 1SM3H 4O1AA 2B0MA 4HPYH 2OO6A 1RK5A 5B1AB 1MHHB 1WSST 1DE4A 1U42A 3QUZD 5DJ8B 5DHYA 5IJVA 3JQOB 5BV7L 2Z6IA 2VZVA 2VLJA 1VRXA 1LG2A 4ZMZA 2C19A 4D8OA 4RLIA 2DWDA 3T42A 1Z89A 2E8YA 3B0XA 4PLJD 2GJXB 2QQNL 1E4LA 5HPMB 4ORIA 3WDPP 4AVIA 1SUXA 4BK9A 4ZQNA 3KL5A 4FAAB 5FO8A 1GG0A 3AXLB 4GC4A 5CZ0A 1SUHA 1E7UA 2APXA 4NKDA 3VX0A 3IEAA 4FA8A 4JZJB 3DTDA 3WUWG 1TDQA 1JGUL 4M6NH 1G0DA 2E09A 2FDSA 2W1NA 4G8IB 3BVWA 4KRUA 3D4CA 4JN1L 2CO3A 5LA2A 2FO4A 5IBLC 4C56B 5ICZA 1GVEA 4Q2ZB 1UT9A 2WBKA 1OYAA 3AZUA 1DVZA 1DANT 5JHBA 3NWRA 3OHIA 1YMMA 3AIWA 3CVCA 2NY3C 5C2BL 1DBBH 4Y9FA 1QLEL 3KS0J 4YDIH 1UQYA