1P6WA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with the substrate analogue, methyl 4i,4ii,4iii-tri-thiomaltotetraoside (thio-dp4)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of barley alpha-amylase isozyme 1 reveals a novel role of domain C in substrate recognition and binding: a pair of sugar tongs
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords PROTEIN (Alpha-amylase type A isozyme)
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1p6wA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1p6wA01
1EH9A 3AIBA 3HJEA 2BHUA 4W88A 1V3LA 4HZ7A 1E43A 4GPNA 3AZSA 1S46A 3B8SA 4H8VA 3IAPA 3PN8A 1CGWA 3KZSA 2J7HA 1H5VA 2W92A 4S3JA 3GXNA 1QI4A 1TVPA 2E3ZA 4HMCA 2V3EA 3EJSA 2V3FA 3A24A 1V3KA 3LXBA 1R46A 1C90A 1WDQA 3EDJA 3WQ6A 1CGXA 3IAQA 1HKMA 3ZIZA 2OWXA 1JGIA 5C8BB 2X8RA 4U5KA 2YFOA 3WNOA 5IHSA 1E6RA 1TFVA 5JIPA 4FMVA 3PZ9A 4L4PA 2DGAA 2GK1B 1ESWA 3VIKA 4MPKA 4DUVA 3K8LA 3SUVA 2YFNA 1VEPA 2JEQA 3VILA 1JFXA 2EPOA 2WBKA 2ZXAA 4C7DA 4KWUA 5BXRA 2OLHA 3ARXA 1FHLA 1LL6A 4UCFA 4PYSA 1BYBA 3GBEA 3II1A 3ARWA 1C91A 3LPOA 2CPUA 5A69A 1EOMA 4BQ4A 5LA0A 2DSZA 1R75A 1XYZA 4UFKA 5CSYA 3DDFA 4BQ2A 2TAAA 2W67A 2PWFA 3RILA 3D51A 4E4PA 1TMQA 2XWEA 2XYLA 1QHOA 3WNMA 2W61A 4NRSA 4UFJA 5FIPA 3CZEA 3VIJA 4DWSB 1KQZA 1QVBA 1V6YA 1W3LA 2X1IA 3VMPA 4K68A 4FF5A 2VRJA 3SUWA 5I3DA 1WNOA 3AZRA 4PMXA 1K9DA 3HG5A 4J3XA 1B1YA 2J47A 1QNOA 1E6SM 3IJ7A 3WUGA 3AFBA 2ZXQA 1E0XA 1JZ5A 3SCRA 4Z2KA 3W27A 1D3CA 1ZB5A 2JF6A 2WMGA 1QNSA 2RGLA 3MV01 3OB8A 3VDAA 3NSXA 3PZNA 2A3EA 4CUCA 5DO8A 1OGSA 1HJVA 3VMOA 3K8MA 4AZCA 3EJPA 3CZKA 3L4YA 1B3WA 1UASA 3W81A 4PMDA 1QBAA 1WB0A 4TX6A 5EBAA 4J3TA 5ABHA 1XH2A 3KEHA 4TTUA 3VGFA 1KTBA 2VI0A 4MAZA 3VM7A 3AHVA 1HJXA 4FLQA 5D9MA 2WHKA 2AOSA 5IFTA 4LX4A 1V6WA 1TQSA 1UH3A 4PTXA 1G5AA 4J28A 1NP2A 4J27A 4OOUA 2WHJA 2WMJA 3ZM8A 1KXQA 3CIVA 1UD5A 2QPUA 5M03A 2PWGA 1MW2A 3WMBA 4MTVA 3N18A 4UQ9A 1QOXA 4GZEA 3RDKA 1J18A 1R7AA 1G1YA 1XSKA 2WK2A 5E6YA 2XIIA 4H7VA 1BVNP 1MQRA 1HJSA 4JKLA 1IT0A 2GUYA 2BVYA 3WDQA 1JXKA 1XD1A 4AXNA 5HDRA 1HT6A 3O9NA 3S6TA 5CSUA 1I1XA 3N11A 1KBBA 4AD1A 2QV4A 4RE3A 1KWKA 1NH6A 5A8PA 2X05A 4DWSA 5CGTA 4BQ3A 1UH2A 4UFIA 3WD0A 1UOKA 3W0KA 2O9TA 4UQBA 3BUDA 1MW1A 1UWQA 5I5RA 4ZXOA 1KGUA 4CU6A 1XHGA 1V0NA 5HXMA 4PSRA 4ACZA 3ZR6A 4W8BA 4P8XA 3UESA 3VKKA 1J0ZA 1C93A 3ZT7A 2VUYA 3TP4A 3WNPA 2D1ZA 3J7HA 4JFVA 1LG1A 3TA9A 1PIGA 2BHYA 2W62A 5CPTA 3IJ9A 1DWFM 3VDBA 1HWWA 3WQVA 2OSXA 1BVZA 2ZUSA 4UQDA 4GZIA 3L4XA 3SEPA 1F4AA 6CGTA 3HG3A 2WPGA 1HXKA 3HMCA 3B9EA 1UKQA 3THCA 2WVUA 2YKKA 3KL5A 2CYGA 4XV0A 2D73A 2J7DA 1B30A 1WZMA 2BVTA 3WENA 2CBUA 1UR2A 5D9NA 3VNZA 1Q6GA 3CTTA 1WDRA 1GOWA 4U3AA 5IDIA 2IXVA 4N42A 3SCPA 4CGTA 2F1BA 4URIA 1KR1A 5JBDA 2XHYA 3W26A 3K1DA 3BXWA 3ZMRA 4CVWA 1WDSA 3PZTA 1H09A 4NI3A 3A23A 3WD4A 5EFDA 2YLAA 4OKDA 3HG4A 2Y2WA 2XFYA 3DYMA 5A8MA 1CENA 2VZSA 3MS8A 2VCAA 1VRXA 3LPFA 1E3XA 3ARQA 1BHGA 4WKAA 4Q22A 4UOJA 3FAWA 3B9DA 3ALGA 5GNZA 2EPLX 3FXYA 1PBGA 1MFUA 3L4UA 4JFUA 3NYDA 5KEZA 1KXTA 4MDPA 1O7DC 5JIWA 4FNRA 4D1IA 5JBFA 1E1FA 5C70A 2ZIDA 1R86A 3VMNA 1B3ZA 6A3HA 1BG4A 1D7FA 2E4TA 3CUJA 2WHMA 3L2LA 4W7VA 1E6PA 3CPUA 3H54A 3U5YA 5GNYA 2HVMA 1HF6A 3RM9A 4QDMA 5LA2A 3O2LA 3POCA 2AAAA 2W5FA 1W91A 2NT0A 3AMKA 3CC1A 5LYRA 3WDHA 1UUQA 2WANA 2J7EA 1NWTA 2CHNA 2YA2A 3DX3A 4TVDA 4F79A 1BTCA 2O9OA 5A2BA 1SZNA 2BNJA 1TA3A 5A95A 3H55A 3A3HA 4W85A 1OSEA 3BAXA 4A3YA 3O6AA 2ZWYA 3PTKA 4AZGA 3EJTA 1TG7A 4J7RA 3VIHA 5FL0A 1C8QA 2DEPA 5IXEA 3FAXA 1E4LA 3AROA 1VENA 1GOOA 3BVWA 4CN6A 4R27A 3WQ8A 1KGWA 1Y7VA 1ISXA 2D20A 4ACYA 5HOSA 3UG5A 4M8UA 3CGTA 4FNPA 3A6OA 2VNCA 1UQYA 3EDEA 1E72M 2X2IA 3NDYA 3ECQA 1XRVA 3VD3A 1BYCA 1FH8A 1JZ2A 2ZUNA 1N82A 1PX4A 2ZX7A 1FP9A 3GXDA 4KMQA 3WIJA 4CD7A 1QWNA 5A6AA 1W1YA 3OGRA 3AIQA 3LX9A 4PEEA 1JDDA 2VZOA 3OLIA 3GNOA 4NRRA 1CYGA 3DX2A 3WUFA 4GO8A 1OGBA 2XG9A 1EGZA 3WQ4A 4ZE5A 3I3BA 5AYBA 3BCDA 2PC8A 1ISZA 3WSUA 1LG2A 2DSUA 1BQCA 1TCMA 1UZ1A 2CBVA 1UR8A 3VX1A 3OZPA 2X2YA 4QP0A 4M80A 1UD8A 3MUZ1 1GJWA 3VM5A 1VEMA 3T2PA 4BF7A 1QW8A 4W89A 5TD4A 1XV8A 2FGZA 5BROA 3VIPA 2EAEA 5I23A 1GHSA 4DO6A 4OBSA 3VO0A 1HP4A 3GZAA 5ABFA 1GQKA 5ABEA 2F18A 4NX0A 3HG2A 4LPCA 1MXDA 1DTUA 1FFQA 5DF0A 5I79A 4AW7A 2F2HA 4EK7A 2NT1A 1GUVA 4CU7A 4CCDA 3LMYA 1CGVA 4AMWA 4LQ1A 4AMXA 2DPEA 3MSGA 3VSTA 1DWGM 1UA3A 1US2A 2Y8KA 4QCEA 1E40A 1CXFA 3WFZA 3RM8A 4JFSA 3WFLA 3H53A 4CD4A 4H8HA 3VUPA 3ZT6A 4X0VA 1B0IA 2J7FA 3W28A 2VX5A 3AIUA 2WVVA 3UCQA 3OLDA 1DWIM 4AZBA 5DFAA 3L2MA 5IHRA 1BYDA 1H41A 4CN4A 1W9BM 3K46A 1OINA 2XSBA 4P7QA 3SURA 4AISA 3GTNA 1BGGA 1JDCA 2DT2A 2YL5A 1EXPA 1UKOA 1JZ3A 1JYWA 1GVYA 2EPMX 1JZ4A 2G4FA 4PMUA 4AD0A 1ZBCA 3RM4A 1HIZA 3ZSSA 1EOKA 1G01A 2WAGA 2VVSA 3ARSA 9CGTA 1UQZA 4JHOA 4GI9A 3BLKA 4RE2A 4TX8A 3L4VA 1L8NA 1MYRA 1EDGA 1W9UA 3LXCA 3W37A 4NZCA 4LYQA 4JL1A 1CGYA 3RMEA 1NARA 4W84A 2ZX5A 3RJXA 1XSJA 3QOKA 3SUUA 2IGTA 1JG9A 1CLXA 1SYTA 5D8WA 4ATWA 2GJPA 4XX6A 4DWSD 1U2YA 1R34A 3L4WA 2BY2A 1NWSA 3BAWA 3ZOAA 5FKYA 1KBKA 1RH9A 3VD5A 2O9PA 2J25A 2C8NA 1HVQA 4JHZA 4D6EA 4W93A 1PZ3A 2WB5A 1UKSA 2XN2A 1BSIA 1Q6FA 4CD5A 2QMJA 3WY2A 4D6JA 3NCOA 2FGLA 5DMYA 4HPGA 3SCVA 3WF2A 1ITCA 4KGLA 4LYRA 1QWUA 2RGMA 4OBRA 4KH2A 1UD3A 1JI2A 2YA1A 1V0MA 1TQTA 2J4GA 1GOMA 4X0NA 4W5UA 2B31A 2WVVB 2XGIA 5HBFA 4AIUA 1V02A 1GZJA 4D6GA 3FW6A 4PMOA 5M5DA 4CVUA 3WD2A 4E8CA 1UD6A 3TTOA 2WCAA 2WZEA 3BSHA 1GQIA 3N9KA 3LRKA 5CZKA 2WYSA 2D3NA 4GI6A 3CZLA 4LYPA 2PWHA 2XVGA 4HA1A 4GINA 2ZX8A 4HP5A 4LXFA 3VGBA 3RPMA 1W3JA 5F7UA 3DHPA 2QF8A 3ZO9A 4AZ7A 3MV11 2Z1KA 1E73M 4LGXA 5IFPA 3VINA 4JAWA 2WKGA 4BQ5A 3PZGA 3GNRA 1X1NA 1W32A 1QPKA 3GXTA 2DDXA 2WCSA 4HOZA 3WH7A 2IXUA 4HU8A 1BYAA 5M17A 1G9HA 2W66A 4PMRA 3RCNA 3U7BA 3G6LA 4WF7A 1FH7A 1M53A 3BLBA 2Y8VA 1LF1A 3CBWA 3T2OA 5ABFB 2DIJA 1FH9A 2DH2A 5A8QA 2WMHA 3FHQA 2JIWA 3PZIA 5BXSA 3AHXA 2UY2A 5I24A 2G3IA 4J3UA 4L4OA 4J3SA 1CBGA 3CUHA 8A3HA 2UY5A 4UTFA 4M24A 2XVLA 1E9LA 5A6KA 2ZUMA 1B31A 5E0CA 2V38A 5A6MA 3WQ5A 1B3XA 2Q8XA 2BV9A 4X9YA 3AMGA 3AXIA 4DO4A 2DIEA 1FOBA 3A4AA 3I3DA 5GPRA 4GKLA 1BGAA 1CNVA 4UFMA 3FN9A 2G8ZA 2O92A 3UETA 2VX4A 3N13A 4P8WA 4Z2GA 2EPNA 1ZL1A 3WNKA 2J8FA 4AD5A 3TTQA 3POHA 4PUEA 4JKKA 3UR8A 2BY3A 2D23A 2QMKA 2E40A 3UG4A 2X2JA 4IPNB 4PTMA 3WNLA 1E3ZA 5CJ5A 4FNSA 1GQLA 1XCWA 1E6XM 1CXEA 1E6QM 4N0RA 3EMZA 4IISA 3D50A 3VOCA 1J0JA 1R87A 3G6MA 1UR1A 2G3NA 4DUXA 3EJRA 1UKTA 4OIFA 1W9DM 4V2XA 4Z2JA 4D6FA 1W2PA 2YLLA 5D9OA 3BVVA 2G3JA 2Z1SA 2VURA 4XUYA 4DM1A 3CZSA 1ODUA 4WJXA 1CXLA 3AIEA 4NSBA 2EJ1A 3HN3A 3DC0A 4FLSA 3B9AA 1TZ7A 1H49A 2F7PA 2XVPA 3AMCA 4F9DA 3OIHA 3WY4A 5A94A 4ZENA 1LLOA 5A2AA 2XN1A 2VR5A 1OIMA 3VNYA 3HZ3A 4UQEA 2XVNA 3D5HA 3VSVA 2WSKA 3WF3A 4PTVA 1GOKA 3GDBA 5GQBA 4W7UA 3AIVA 1WZLA 2G41A 2CBIA 2FH8A 4U2YA 2OYKA 3WDPP 4CCEA 2V3DA 4AC1X 3VIGA 5A6BA 3F5KA 1VBUA 3L4ZA 4U33A 4AYSA 2MANA 1Z32X 5I2UA 3D4YA 1PX8A 4XB3A 3CV5A 5EB8A 5A6BD 1LWHA 3W25A 3W38A 1QHZA 4OOZA 4MNMA 3FY1A 4MNKA 3AYRA 3UERA 3IGUA 1TVNA 4D71A 3SUTA 2ZUVA 2F7RA 1VFMA 3APGA 2WKLA 1ZU8A 2WC7A 1ISWA 1GONA 1XC6A 4AIEA 3BUBA 1I75A 3AIRA 1H3GA 4JZ5A 4YHGA 1V3JA 1NQ6A 2Y24A 4UZUA 4BCEA 4U3CA 2JIEA 4MB4A 3BMWA 3LRLA 1UH4A 4W86A 3SIMA 3DX4A 4WSKA 3VGDA 3NDZA 2OSYA 1B3VA 2XIBA 4IPLA 4UOQA 2WBGA 3MMWA 3VIOA 4D72A 3AS2A 4AD2A 1VIWA 2UWFA 3BGAA 3WH8A 1UR9A 5BWFA 1MW0A 3F5JA 4PCTA 1XGZA 5CLWA 4ATDA 1J11A 4BZYA 4P7NA 2O9RA 3ZR5A 2BHZA 1IZJA 3LPPA 4V27A 1WP6A 1LWJA 5FL1A 3MKKA 2A3HA 2VX6A 3E1F1 3UR7A 1YQ2A 2GK1A 3W53A 1PAMA 1PZ2A 5CPQA 3VGGA 3N15A 1FA2A 4HOXA 4WLCA 2Y5EA 1IV8A 2ZX6A 3DDGA 1KGXA 1ISYA 1ZBKA 1LL7A 1V6VA 3UG3A 3OGSA 4B9ZA 2J7CA 2ZUTA 2YIHA 4PN2A 4W5ZA 4AZ6A 2XWDA 1EIBA 3AS3A 3WEOA 3ARUA 3EMQA 4NXKA 4AWEA 4HZ6A 2WMIA 4PCSA 2YL6A 1YHTA 4ZE4A 3QGVA 1DHKA 1WE5A 1H4PA 3BAKA 4Q7NA 4TXEA 3EYPA 2UY4A 4QFUA 2WZHA 3QHMA 3RJYA 7TAAA 5LA1A 4WSJA 3NSNA 3CHDA 4HZ8A 1FHDA 1ISVA 1EDQA 1CZ1A 2WVTA 1EQPA 2XFRA 1RD6A 1CXIA 2X2HA 2D0FA 4WIWA 4AMCA 3TONA 3FNDA 3GXIA 3IK2A 1HX0A 2ALWA 2XUCA 3WDRA 2BY0A 2WM0A 2VCBA 1WZAA 3W6LA 2E8ZA 3S5YA 2XM1A 2BVDA 4PBGA 4JCLA 1OCQA 1JZ6A 4PMNA 3QHOA 2C0HA 2VRQA 2GDUA 1QNRA 5I6SA 1V3IA 4C7FA 5D8ZA 1MQPA 1W3KA 1VFUA 2XTKA 2DT0A 3PTQA 4D6HA 5CG0A 5CXPA 3K4DA 1UWRA 4PMYA 1WZKA 2J78A 1M7XA 1MFVA 1VAHA 1PS3A 2HISA 1W1PA 1DWAM 2WNWA 2F7QA 3A4WA 4W87A 3AMLA 1H2JA 4OUEA 2OWCA 1R85A 2VR4A 2XJ7A 3AS1A 3CHFA 1E5JA 4R5EA 1QW9A 3VGEA 3WY3A 2CKSA 4V28A 2J79A 1MW3A 2CIPA 1J0HA 3CMJA 4YPJA 3K8KA 1WO2A 5BXPA 4Z2IA 5A6JA 4MB3A 4W7WA 3WBAA 2ZUWA 1W9VA 2WWDA 3CZ8A 4AZCB 4GO9A 1SMDA 4BS0A 2VMFA 3GH7A 1JZ7A 1FP8A 3VSUA 3RIKA 3VDCA 1VEOA 4PSPA 5ABGA 5FOOA 1MVYA 1QNQA 4GQRA 7A3HA 1MQQA 3DYPA 3DX0A 2VCCA 2WMFA 2BY1A 3K4AA 3N1AA 2X09A 2WMKA 1JXJA 1OWQA 2DT1A 3CMGA 2QLYA 1AMYA 3BUQA 3U5UA 3MU7A 1E55A 2NSXA 1C92A 4UQAA 1OIFA 1AVAA 1GNXA 5CLTA 1KQYA 4PRWA 3VD7A 3TTSA 4XZBA 2GSJA 1K9EA 4PUDA 3GNPA 3QOMA 3BUPA 4MAVA 3GXPA 5E09A 1JI1A 5CGMA 2ESCA 3ALFA 3N17A 1QHPA 3CUGA 1CWYA 4CU8A 4MJ4A 3M46A 2BS9A 1K9TA 4MJ2A 5HPCA 5A2CA 3W4RA 2J7BA 1O7AA 7CGTA 5BRQA 2VTFA 2WC4A 4YN5A 3AHTA 2XM2A 1V08A 1K9FA 1TQWA 2FYVA 1E70M 2JALA 3WF1A 3AHYA 3BAJA 5GNXA 2YJQA 3QR3A 1PIFA 1UR0A 1BAGA 3MUIA 1KWGA 2AMGA 4HA4A 4ACZB 3TOPA 4AY1A 1H11A 4QAWA 4KRUA 1CTNA 2GFTA 2D22A 1EA9C 3TV8A 1QI0A 5BCAA 1OT1A 3SCWA 3WF4A 3AMDA 3W82A 1V0LA 4NXSA 1ZBVA 1OB0A 1AQMA 2EACA 4JCMA 4XZWA 4U2ZA 1UZ4A 2YL9A 1X6NA 1KTCA 1VBRA 3GYCA 3M7SA 4PMZA 3AOFA 5D9PA 3VDHA 1V0KA 4JFTA 3VIIA 1V6UA 2OYMA 4M1RA 1HP5A 3WEZA 3OLEA 3CH9A 3DX1A 2J8GA 2VRKA 3OZOA 3OG2A 3ZSTA 3M6DA 5JUVA 4HPHA 1M01A 2J74A 2DH3A 4B16A 2E0PA 1Q4NX 3A22A 3AJ7A 2CBJA 1J0YA 5BRPA 3AISA 3BC9A 1ODZA 2CEQA 4DM2A 4ATLA 4F66A 4UQCA 3WBEA 5HNNA 1QBBA 2NW0A 3MO4A 1GPFA 1KCLA 4CKQA 3EDDA 1B3YA 2VOTA 3MANA 3VU2A 4MNLA 3THDA 1BG9A 2ZOXA 3T0BA 5KZ6A 4JFWA 3PTMA 2W91A 1TA3B 2DSKA 1WDPA 4WK9A 5A1AA 2CESA 3EMCA 4MDOA 4UFHA 1CECA 1UG6A 1RPKA 2PWEA 2EXOA 3LPGA 3CO4A 1HJQA 1HKIA 1TQUA 3N04A 2IUZA 4TOQA 3ZJ8A 3N12A 4J3WA 2CETA 5EFFA 2WZIA 4QLJA 4JIEA 3KL3A 2WSPA 5HPOA 1HN1A 3WD3A 1J12A 1G94A 4D6CA 3A47A 1UWTA 3VD4A 2XN0A 1EQCA 2CNCA 1ZBWA 1JYNA 1JD7A 2YA0A 2JFEX 4ZEPA 4ZFMA 2ZXDA 1E0VA 5ECUA 5JBEA 2ZE0A 2J75A 2X0HA 2D3LA 1VFOA 3T09A 1HKJA 1TE1A 1EO5A 3OA5A 1VJZA 1CLVA 1W3HA 1JFHA 1KB3A 3SCTA 3U57A 2V5DA 5AY7A 1NP0A 3T08A 2EADA 4WKFA 3S5ZA 4AD3A 4UOZA 4P8UA 4D6IA 2WHLA 3CUIA 1HL8A 3MUAA 2VC9A 4HU0A 1H0IA 1ECEA 3OBAA 3WH9A 4MB1A 2FH6A 2A3AA 4M29A 3M07A 2CHOA 3AQUA 2D0HA 4TVCA 4UFLA 1HVXA 1J0KA 1OGGA 4GQQA 1OT2A 1AQ0A 1OBAA 1E0WA 2G3MA 3NJ3A 2W63A 3VTRA 3AYSA 1H1NA 1VF8A 1GJUA 2XFFA 1L0PA 2ZXBA 3GM8A 4M81A 5A6LA 4ML4A 1BPLB 1C8YA 2EABA 2EBNA 5E70A 5A8NA 4GI8A 4JKMA 5C71A 2ZICA 1CIUA 1GVIA 1J10A 3LXAA 1FFRA 3IJ8A 1JD9A 4DUWA 1NOUA 1UR4A 4AZHA 3BVTA 1UKPA 4P7LA 1CXKA 2GDVA 2QHAA 4HMDA 2J7GA 3PBGA 1US3A 3F4VA 1QI5A 1XH1A 2YDRA 3WDIA 4KRTA 1UWSA 2E8YA 1T0OA 4J3VA 3BSGA 4NZFA 4C7GA 4E2OA 4A4AA 3D4ZA 1OD8A 4H04A 1HL9A 3WL0A 4FLRA 4E8DA 1E71M 5AC5A 1B9ZA 1W1VA 1E6NA 4B9YA 1XSIA 3PZOA 1UD2A 1CPUA 4H41A 2DSWA 4QLKA 3KWXA 4DWSC 1LJYA 1AQHA 1M03A 3PHAA 2OSWA 1V03A 3A5VA 3S2CA 1J9YA 2E9LA 4IUGA 3EJUA 2WLZA 5E0FA 1E56A 4Z2LA 1SFSA 3IANA 3WN6A 3KLLA 3AI0A 4P7RA 3OGVA 1ZJAA 2FDMA 1QI2A 2FE0A 3WL1A 4AZ5A 1HXJA 3DHUA 2XPKA 1R8LA 4FK9A 1E4MM 2CERA 1EHNA 1V3HA 1R47A 3ARPA 1QNPA 2PWDA 1W2VA 4OZOA 5E6ZA 3F5LA 3D3AA 1W9XA 3WMCA 2J62A 2GJXB 3CZJA 3MMDA 3ZJ6A 2C7FA 3MI6A 3OLGA 1UA7A 1GQJA 1EO7A 1BF2A 4RL3A 3T0AA 4KGJA 3WUBA 3QHNA 3PZQA 4OJYA 2ZUUA 5I78A 2WWCA 2PB1A 3PZMA 3DYOA 1A3HA 5D4YA 1UYQA 2WXDM 1C3FA 1HTYA 4FNQA 2QPSA 4IM4A 3BAIA 4FLOA 4MNJA 4B3LA 1LQ0A 3VIFA 4PMQA 3MSDA 1JL8A 5EMYA 4F8XA 3RO8A 3VIMA 1A47A 1CGUA 4U5IA 2PF0A 2WC3A 5A6SA 1JNDA 4HA3A 3AZTA 4EKJA 1J01A 1E4NA 2VO5A 3WH5A 4GIAA 2CITA 3NSMA 2F7OA 2DSVA 3MUY1 2CKRA 3WMSA 4WKHA 1I1WA 2F8QA 1TUXA 3JUGA 2BXZA 3KLKA 3ARYA 5DEZA 2VT0A 4AIOA 1KR0A 2FHFA 1E6ZA 1Q6DA 3MMUA 1WKYA 3WUEA 3ARVA 1F4HA 1PPIA 3DECA 3GH4A 1RP9A 1P6WA 4DO5A 1GOIA 4EANA 3ZT5A 2GJRA 2DT3A 4A3HA 1CXHA 1E15A 2VZUA 1W1TA 2WW5A 1CGTA 1HJWA 2CXGA 4AYGA 4P7OA 4MB5A 2WMIB 1MWOA 1ZJBA 4P8VA 4TUFA 1OD0A 2PI6A 3W24A 2VZVA 1JIBA 3GXMA 1D2KA 2YDQA 1UHVA 4W8AA 1KFWA 2JF7A 1K6AA 3NIYA 3ARZA 2ZWZA 1JYXA 1H0GA 2V5CA 4PMVA 2F1AA 1LL4A 1HJUA 3SCNA 2A3BA 1U30A 1KCKA 1ITXA 2D24A 2VL4A 5A8OA 5AC4A 2J77A 1GHRA 2WVSA 2EO7A 4FNTA 4AEFA 4RE4A 3WKZA 1NM9A 2F61A 1PJ9A 1MXGA 3UEQA 3SCUA 4HMEA 3CLWA 2YBUA 1PEZA 4TTGA 1JNEA 2PBOA 2VJXA 1DWHM 3BCFA 3ARTA 1E4IA 1VJSA 1KXVA 1NWRA 3SCOA 4UR9A 4Y7EA 1UWIA 4JL2A 3BLPX 4D1JA 2BFGA 3AHZA 5FCZA 2VQUA 1TQVA 1HNYA 3ZQ9A 1SMAA 5FD0A 2YDSA 2W4XA 3CUFA 1V6XA 2FHCA 3I3EA 4UZSA 2VZTA 5A3HA 3KE0A 3EBVA 4CD6A 2OWWA 3T2QA 1JZ8A 1QI3A 3EDFA 1QX1A 3EJQA 4S3KA 2YL8A 4TVUA 4UNIA 2A3CA 2VX7A 5CQ1A 2E9MA 3PZVA 2OW7A 2BXYA 1C7TA 4FNUA 4GZJA 3SCQA 3TTYA 4F9JA 3GBDA 2JEPA 3VPLA 8CGTA 2VVNA 2ZX9A 1KXHA 3CHEA 2EEXA 1VFFA 4AZIA 1E1EA 1Q6EA 1JAEA 1XH0A 2DQXA 3CZNA 3AXXA 1R7OA 1EDTA 1O6IA 1V3MA 3A4XA 3D52A 3W29A 4QCFA 1NWUA 4OGZA 1W9PA 5CPSA 1BLIA 4CD8A 2GJXA 3WF0A 3VD9A 3SUSA 2FHBA 1XD0A 3WQWA 3VX0A 1JF6A 4PTWA 4BA0A 4YHEA 3ARRA 4ZXLA 3HU7A 2UY3A 1GW1A 2EPKX 1ZS2A 1GOQA 3WELA 3LRMA 2YBTA 3BMVA 3BAYA 1CEOA 1JDAA 1GCYA 1M04A 4Z2HA 2Y4SA 1G0CA 4HTYA 1JAKA 1JF5A 4M56A 3NUKA 4HOWA 2CCRA 2WLYA 1B2YA 1NOWA 2YOCA 1C8XA 1WCGA 5I0DA 3AICA 4EAMA 1SR0A 1RP8A 3KL0A 3PZUA 3VGHA 4NZJA 3ZJKA 5I77A 4AEEA 4NF7A 1DEDA 1DWJM 4CN1A 1B90A 1EHAA 4H8UA 3WEMA 1Q6CA 4AD4A 2EQDA 1XYFA 2VQTA 4H2CA 2PBGA 1U33A 1DP0A 3BH4A 4GXPA 3GXFA 1OM0A 3FHAA 5DT5A 2X0YA 5M3WA 1CDGA 3U7VA 1TR1A 1IZKA 1NOFA 1JYVA 3BVXA 4B15A 1C7SA 3A21A 3AS0A 4MADA 1WAWA 4M82A 3WY1A 4B3KA 4EE9A 2D0GA 4U31A 3SCSA 1V02E 2GVYA 3CHCA 1GORA 5BYWA 1J0IA 3BUIA 3L4TA 4CCCA 4D6DA 3WDJA 1UD4A 3ZJ7A 1HKKA 3WD1A 2OW6A 1E5NA 2OYLA 1BFNA 5E9AA 3WNNA 5DT7A 3WH6A 3EDKA 1UWUA 2D2OA 3BVUA 4W8LA 3CZGA 5E1QA 3GH5A 2XGBA 2XSAA 3AXHA 2E9BA 1R33A 1VB9A 3T0DA 5AYIA 2JE8A 1XCXA 4QLLA 1WPCA 6TAAA 2WCGA 1PX3A 1X6LA 3VVGA 3W6MA 5BXTA 2XVKA 3AIWA 2V3GA
chains in the Genus database with same CATH superfamily
4Y4HD 1SZGA 1AANA 1JV2A 1MCPL 3QUZD 3KM2A 4ODWB 3S3BB 4HZ7A 3G5YA 2HLFD 1DQDL 3EJJX 1NAKL 2HA1A 3MJGX 3H2AA 5KAQG 1S46A 1YEJL 3B8SA 2R1WB 3R1GL 2QJMA 1P5UB 1CGWA 4P2OA 5D7KE 4FI8A 4LLYA 1MREL 4MSWB 4MKVA 1M3JA 5BS0B 3GSUB 4XN7A 5EBMA 3GF8A 4NWUL 4POUB 2G50A 4H7CA 4ZSOB 2J55A 1F6YA 3D34A 2MPAH 4J6RH 4HMCA 3HPJB 4P2OD 4J39A 4C65A 4ZUVA 3AWNA 1GKRA 3KZPA 3FUNA 2C4FT 2V3FA 1WD8A 3K91A 4OLWH 2ZRYA 3H3KA 1V5XA 4E9TA 1CBVL 1R2SA 3RWHA 4PRHD 4ANWA 4KKBC 5LGJB 4HK6A 4UOW0 4RJEA 1GGCL 1LM1A 2FTAA 3NQIA 5AOIA 3ZZQA 5FO8A 4H26B 4P9HC 5IJCC 4WNSA 3WQ6A 4YBQD 3HPZA 3KRUA 4OOUA 1G1OA 1TENA 1UZ8B 4MCMA 5GZOA 3CK5A 1FL6A 2VIRB 5DRXB 3SJVD 4QAIA 5F7FA 3OJGA 1PCSA 3B2DC 1UATA 1YDOA 3IEBA 3IKCA 2XZQL 5DLML 3U2CA 4U5KA 2Q10A 2YFOA 1T6VN 2R51A 2WLMA 4L1LA 3WNOA 3N25A 3NOEA 3W1QA 5DD3L 3A67H 3EYSH 4Y8FA 4OUIA 1FNHA 3VIKA 2H45A 2QGDA 3HI5H 1QVOA 4I77H 2F19L 5GGQH 4DUVA 3BW2A 3SUVA 1VEPA 2JEQA 4JRYE 3GHBL 1YCSA 4UTWA 1JFXA 2OKMA 2WWKT 1FWBC 4LW7A 2WY3B 2W0UA 2YZ5A 3D3VA 4OLXL 5J56B 1A9EA 2A85A 1HZLA 4KWUA 2XA8H 1AZZC 2OLHA 1P7TB 1KNOA 1ZA6B 4UTTC 3QIUA 4JHWH 3GLDA 1WXYA 4DWHA 1VHPA 3O6LL 1LL6A 2QCDB 3WJXA 1W9PA 1KZQA 4IIHA 1UJ3C 4GRSA 4PYSA 1J9SA 1FNAA 2NNRA 3LPOA 1ZT4A 2VERN 1TJRA 4GZ7A 1UP2A 2CPUA 1YMYA 3H8AA 2WNKA 3UABA 1EXBA 3HJ0A 3FXIC 4LO9A 5I74B 5D55A 2ZADA 4Z3EA 1XYZA 1PDYA 4P5TD 4L8CA 1NKRA 2VKWA 3NZQA 1I9IL 3PP3H 4KUZL 3VUSA 3H6JA 5AVNA 2OMVB 4PUNA 3P73B 2Z6FA 1UXLA 7REQA 1LRNA 4QY8A 4GUGA 2W67A 2FDBP 4KZDL 3LQAL 3DSNA 1G0YR 1H6TA 4YL4A 3AY4A 3D51A 5HGAB 5IP4A 4DN3L 3CIQA 3VFSA 4H1LH 4HSQA 4LCYB 1QHOA 4NRSA 5FIPA 4ZODA 4ZMWA 4ODHH 2R29H 4XCCH 5EUOB 3MV7E 3VA6A 3RX2A 4AM0B 1W3LA 4DN1A 2YQ3A 3MREB 2X42A 3TH3T 4YHZL 4NQCD 3SCMC 4FF5A 1SJMA 4L4VE 3EO9L 3M9YA 1FTXA 2IBGA 3NJGA 3A64A 4YSTA 2NYKA 1NPNA 1JRCA 4Z7VE 4XAPA 1ZPTA 3QEQE 4PHZA 1K9DA 4PVNA 2VDML 4J3XA 2O56A 3NZRA 4NT0A 1JPFB 2E1WA 4B5NA 3IJ7A 3QP3A 2WBJA 4G9FE 2ZXQA 3IFOB 4GY4A 3AFBA 5DXXA 3GSUA 4A2RA 4PRRA 3NFNA 1Y65A 5LIKX 3JVGA 2QQLH 3GC3A 3DZ1A 3TN3A 1TJXA 5HUOA 1KUMA 3WBYA 4WKZB 1OF0A 3C2AL 4HEMA 4FYQA 1GJIA 5IMOA 3IU4H 3D06A 4JY6A 1E9QB 4H44C 4X7SL 5EO1A 1UGKA 4PS7A 5I6NA 3WLIA 1BVKB 4BGDA 2E6PA 1KCBA 4RUBA 2DLGA 3CSYA 1M9WA 5C97A 1IR2A 1GZPB 4K94L 4O2CA 5MEQB 4FEIA 5HDQH 5DHVB 5F6IC 1N6QL 1T89A 3VRLE 1AGEB 4IKNA 1NLDL 3EJPA 3CZKA 1HQ4B 5KVMC 1ZJIA 2H9GB 3QKEA 5LCVA 2JJVA 3UTTB 2YXWA 4XN1A 4JO1H 3CC5A 2R15A 3QEZA 3XINA 1EEUA 4K7PL 3W81A 3WYZA 1QBAA 1A9BA 4JOMA 1OB1B 4J3TA 2EVIA 2R1KA 4TX6A 5KSBF 2VDHA 1A6UL 2OXHA 5ABHA 2V8MA 1IFGA 3O3DB 1S7VB 2LAAA 3HNSH 2EDXA 1KJMB 2HFFB 4IDJH 3VGFA 5JW4N 1BMGA 4M3PA 3B8WA 2ZYHA 2G3ZA 1XIJA 3CVHB 3MLUL 2HTMA 4HD9A 3SJVA 3HCVB 4FZEH 5E5MA 5EPDA 3FRPB 4NM4H 2RFGA 4BWTA 2DZEA 4F7KA 3GJFB 4LF1A 1IR1A 4LX4A 4A66A 2R27A 2QQKL 1TQSA 4RRPG 1BYOA 3FNKA 4I3RL 4KKXA 1PZ5A 1MFBL 2BLFA 3GLZA 4ORGA 3QULA 3BVNA 4C60A 3KCLA 1G5AA 4L3EB 4J28A 2KX9A 5GGTA 1NP2A 3V18A 2DZUA 1CB2A 5J3HD 2JGYA 1JRHH 1UM4L 3OMNB 4NDMA 2A7RA 2BZDA 1SLVA 4PHXA 2C9UA 1VSCA 3CIVA 4NNAA 3WKYA 4HJGB 1UD5A 4A39A 2OKTA 5LLIC 3ZE0B 4NJKA 3DFYA 2ED8A 1T0MA 1MW2A 2MKWA 2P48B 3T8VA 3N18A 4APQC 4K3ZA 2NW3B 1TPXC 4JO3H 3QE5A 5F6HJ 1S7UB 1L5GB 5ID0A 3RDKA 4NENA 3RVUD 1CR9L 3VXPA 4JDBA 2IMNA 3IPBA 1V8EA 4GMSH 2YPIA 1QNVA 5E6YA 3X1GA 2ADJA 2XIIA 3KBNA 1BJMA 3GZPA 4HPOL 2V9QA 2H1PH 3V0VB 3H2CA 4QE1A 4PIBA 3SQLA 4P9MH 4ALAL 5H94A 1V5JA 4H8QA 2CDGA 3GJFH 3L16A 4ELKB 1XIMA 4TUKH 1DQKA 3WDQA 3S9ZA 4C6CA 1XD1A 3B5TA 3CFUA 3KXFA 4OF7A 5HDRA 7FABH 3RU6A 3O9NA 1BXUA 5DLLA 5CSUA 4H8WL 2Q76B 3QUXA 5GS0L 5H35A 5EOQH 2XC8A 5FW6A 3E2HC 3SOBH 1JCJA 2WQRA 3BARA 1FE8L 4XKMA 1S5VA 1YSOA 1QA9B 1PCWA 2Z2UA 5A8PA 9XIMA 4FQ2L 4NQXB 4I90A 2RJHA 1NCHA 4TUUA 4YE0A 1XXDC 4JVUA 1F4YL 4QYAA 3BKYL 3F4DA 3HBQA 4MJMA 2UZYB 5KZCB 2O9TA 4ZMNA 1EC8A 3SOTA 3TT1L 1MAML 3RTLA 3MJ7A 5MENB 1A0DA 4R53A 2PDXA 4DELA 3WBDA 3B9KB 1IMHC 1V0NA 2QVNA 3P84A 2X4OA 4W8BA 4AH2A 3U2EA 3F84A 1EK3A 2WLJA 4O9HL 3ZT7A 2VUYA 1NJ9B 1Z9NA 3STZB 3TP4A 1P5UC 3WNPA 3ULUD 2HFTA 1ZSDA 3KLHC 3IPWA 3ZWSA 2HTKD 4JYEA 3U25A 2EC9T 1UPMB 5E5UB 2D1ZA 5HJ3A 1OP3K 3PWPB 1XF2A 1S5WA 1PIGA 3LCLA 2BJMH 4XAFA 2OOFA 5FJTA 3F7YB 3HGRA 4MZYA 3JU2A 1DWFM 4QTIL 1HWHB 5E5RB 3GSMA 4UUIA 3KDMB 4HS3A 4HJJH 4LUTB 2C9AA 1HINH 4NAEB 2X4PA 4N2AA 4Q14A 3ME3A 4E2DA 3W7PA 2GQHA 2X3BA 2VE6B 3G5ZA 4A8RA 3HI5L 1KOAA 1T7VA 4EF8A 1D8CA 4PBDA 4L0ZA 3LV6A 4J9JA 3S35L 4BCXA 1RUAH 4MD4A 2FT7A 3P77B 1ECYA 4XI5C 4LQFH 5E5LA 1QR7A 1HXKA 1IBDA 3CK0H 3B9EA 4EO5A 3H6OA 3ILEA 4N85A 1A3WA 1UKQA 1EJUC 1H1ZA 1HNGA 4F9LA 1DQUA 2YKKA 3TN0B 3WJMA 3N50A 2D73A 4KQ0A 4M5TA 5EWIL 2C9QA 5IVXF 1CLOH 5K33A 5REQA 5AECA 1BA9A 1JPGA 3LDBC 4B5EA 1JRHI 2IWGA 2GT9A 2VUOA 3U9WA 3WENA 1WGOA 2DD8H 2Q2EB 2QEJA 3MA7A 1UR2A 2V2HA 1R3SA 2MPVA 3FRPG 1NC4D 1YN7A 1OYBA 2OL3H 1GOWA 3VXOA 4U3AA 2W9EH 5GS2H 2ZSWA 1PLGH 5IDIA 1WVZA 1IEWA 1AH4A 3ZKND 4P3DA 3MHUA 4URIA 4ONFH 4QT5B 3BXWA 1PWMA 1GGBL 3G1AA 4CVWA 1C5DB 1HGWA 2CW6A 4LLDA 4OIIH 1U8LA 4LARH 3HPAA 3YPIA 1MCNA 3ZZLA 3LHUA 4LCUA 1VZHA 4NI3A 4M9PA 5F1NA 4XNBA 2YLAA 5CPOA 3L3KA 5D7JD 4BKSC 3GVRA 3BHBA 1EJVC 3DYMA 3HB9A 1RKRA 3E0WA 3EKZA 4QXGL 1PLGL 4TQIA 1UJ3B 4KRLB 4WFGD 5L9DL 3OF6A 1XCTA 3P54A 5I1IL 1CDBA 1FUYA 1X5MA 3IJ6A 4YWIA 3L5XL 1SVDA 3FAWA 1P4LB 2BX5A 3B9DA 3MLYL 4LVNB 5I1JL 3HMXH 3VGAB 5J6HA 2G97A 4C5ZA 4XO9A 3CSBA 2H32H 4HKBB 4X83A 5BV7C 3T8LA 1UPPA 5H8MA 3GI9H 1CI5A 3W87A 4PW9A 2GUBA 3L4UA 3AU2A 3P5YA 3CWNA 4X50A 3NYDA 1U8KB 5KEZA 1KXTA 5F89A 5F2MA 3TPKA 2ADAA 4FNRA 2IOOA 4XCEA 2RDUA 2XUWA 3UP6A 4XAYA 5C6MA 4GX9A 5JBFA 2AZAA 3ITCA 4XKYA 2MIZA 3UMNA 4K0OA 1W1IE 3HE7B 1JUFB 4BKNA 3P73A 4EN3D 3U36A 1X5LA 1CFNA 1XGYL 5JOFB 1B3ZA 4OV4A 3SQRA 4B3ZA 3ESPA 6A3HA 3MMTA 3VRJA 2MTAA 3OKLA 1S6NA 4K23L 1DZ0A 3TO4B 4HWEL 4OCSL 1T96A 4W7VA 3GDLA 4WWKB 1HQRA 3VW3L 2ATKB 2VMCA 4JQ1A 1RI8A 3CPUA 3H54A 4UIMA 3NQVA 1A6PA 3ZW3A 1SN2A 2EE2A 2OCZA 3PCYA 3U5YA 3M86A 4NO3B 3EJYC 4W1TA 3RM9A 4C6QA 1LQBC 1S2WA 5K4XA 5FAJA 4V15A 5D30A 2AXWA 1H7XA 2R2HA 1Q0XL 5LNEA 1W91A 4L3CA 3JVGC 3QDMB 3MLXL 4R9OA 3WDHA 4N0FB 5FKPB 3PFRA 3WXWH 4O53A 2Q3RA 2PTTA 2CHNA 4PRID 1X1ZA 3DX3A 5JUEH 3WUWG 1Q1JH 2NY5C 1J88A 3L9RB 4L8DB 1I45A 4H2HA 2ZXEB 3KDMA 3O3UN 1GHFH 2EXTA 1ZOXA 4HS3B 1TSIA 5GJNA 5BOJA 4Q4IA 2NY7H 2X40A 3V6FB 1ZXQA 1TA3A 3FDWA 5DLCA 4LOFA 3STPA 3N2JA 3Q8EA 2R8WA 4PWGA 3O6FA 3NJVA 4IMAA 3O8XD 3BAEL 3R1GH 1F02I 3PTKA 2GIXA 5MEQA 4AZGA 4JVWA 3MI3A 1TG7A 3DV4A 5IM7B 3VIHA 3QIUD 3RFRA 1V4YA 4PLNC 3WXVH 25C8L 4F7EA 3K6DA 4NKDA 3X11A 4OZGB 2V2TB 3AROA 1E4LA 1BBJB 1U2HA 3VFNA 1KFCA 3MTWA 2HLAA 1NMCC 3BVWA 4GXFA 5BRZE 3BWSA 4CN6A 1JHLL 3S2AA 5CBIA 3PGDB 1U8JA 3QF0A 3WQ8A 1KGWA 1Y7VA 4ISVA 2LU7A 5DHVH 1TNMA 1S5TA 2INEA 4QHMB 5FI8A 1F1GA 2Y6SC 1XKJA 4ACYA 2FZDA 1J05A 3CLEL 2E5EA 2OQHA 5E5CA 4R9XA 3UY8A 1SFHA 2E9GA 3LGEA 1NCUA 4G1MA 4YSCA 3UG5A 4M8UA 3K2UH 5DUPL 3V6BR 1RQHA 2ALRA 3EFDH 4E9WA 1UQYA 4PJGE 1T1YA 2BCMA 2C1GA 2CXKA 3IVSA 4GFSA 1WV2A 2B1HH 3LCHA 3CN1A 4LCUB 5F1NB 1GGCH 4OT1H 1MNNA 2PDWA 3KXQA 4QISA 2F53A 5IMMB 3WKPA 3ZZ1A 4NNCA 4PRIA 5SWZE 3VD3A 5DEFB 2XH0A 4XAGA 5EOTB 1Q0YH 3BKML 2NYYD 1JZ2A 3U6XA 2AK1H 5T9BG 3JTTB 1TPXB 1PX4A 4X99A 2Z3FA 2JLPA 2ZCZA 1LNUA 1YYML 5IFHH 1TTAA 2FJHA 3MSRA 3IJYB 4BE5A 1FP9A 5KVDE 2PLCA 4LSRL 4JFEE 5IDZA 4MWFB 2J6WA 4LPVA 4KMQA 5MERB 1QLEB 4AENA 5ID0B 1OCRB 4O58L 4YLQT 1IM9D 5IIEA 1EO8L 4GAAA 1SXCA 1BQ5A 1E7VA 1J9RA 2AF2A 2KC0A 5C6WH 1LWIA 4FQIL 2VUKA 3OGRA 2DTML 1W6WA 3LX9A 4PJAE 5JOPD 4ZDHA 3SE6A 3RUGB 2OM5A 3FA3A 1R5VA 4WU5A 2P8PB 5GZOC 3FJNA 2L0DA 2CPCA 5HHOE 5IR1B 3GNOA 5JOFA 5EF3A 4AMKH 1XTLA 2CIIB 4OLYL 1RSFA 4KJQD 2ZOKA 1OGBA 4G43A 1BF8A 1EGZA 4GFIA 3WQ4A 5MKGB 1GZ1A 5HQEA 3TF4A 1OZMA 4KERA 4WWKA 3Q5YA 1AIZA 3O2VL 4JE4B 4QIRA 4HK3J 3R8QA 1ISZA 5CGYC 1PZ0A 1BXXA 1UMYA 2DSUA 1DJYA 3VXTB 4EP8C 5ITBL 3EWYA 2E25A 4GFXA 3CT2A 5BS0E 5IHZA 1O12A 3CDZB 1UR8A 4NP9A 6REQB 2H6OA 4M5YH 3HE6A 1UD8A 5D7SL 1TPC1 2ISFA 4M80A 1GJWA 3SDDD 3VM5A 3U7YH 3SGDH 4DW2H 1QW8A 5DDHB 3MLSL 1TV2A 2H2PC 3B9KD 3BOVA 4W89A 1NZRA 2EKGA 4D8AA 4OR1A 4Z5RA 3GR8A 2IOMA 4NBYB 1HEJC 2XIQA 1X96A 1QEXA 3VIPA 4YDIL 5I23A 5HUPA 3HUJE 5DY2A 1EEPA 2UVFA 4B3VA 5EF0A 2X3AA 4PJFE 3KBVA 4PS4H 1D5XA 1UM6H 2O61A 3VO0A 1L9SA 4QJ3B 3TW6A 5DFWH 3OB0K 2OZ0A 3QSKB 5AD0A 1A7QL 5IROC 3B04A 1AO7D 2VE6A 5DFVC 2Y62A 2GJ6B 1GQKA 2DRUA 1BG1A 1WD9A 4RPQA 35C8L 4DH2A 2FYYB 1BBJA 4KHTL 4YDIH 1NGQL 1IB5A 2SEBB 4NQSA 3QWOA 2NT1A 2NX5E 5ICZB 1MUJA 3LMYA 1OOWA 4XE0A 4GIYA 1CGVA 1WS8A 1BXVA 3I50L 4CC4A 2X4QB 1KN4H 3DX8B 2W9DH 4EI5D 5KYUB 2H8XA 5EBUA 4AVNA 4OJFL 1OL0A 5DJAB 2UXTA 1ICQA 3GR7A 1KDIA 2WXOA 1JCNA 3THMH 3OWEA 4AMXA 4JS7A 3IK4A 4A68A 2DPEA 3IMUA 3QJAA 3IJHA 4B95C 2NY6D 3MJ8A 1DWGM 1US2A 3G6JE 5KSUA 3DRTA 2HBXA 3GSRA 1AODA 3VI2A 3TA3C 2EKSA 2F54E 3CFCL 3OSKA 5CPNA 5JXAH 1XINA 3LEYH 1NFDB 3D8MA 4H8HA 4PR5A 3QG7H 1X4ZA 3S37X 4WCYH 4ZUSB 1DL3A 3PBMA 4O52A 4RNRB 5HA7A 3WCZA 3VFWB 1CZ8H 1AO7E 5F9OH 3BP7A 5IWLC 1ILSA 5LXVA 4GUIA 5BVPL 1NDYA 4UBDD 4M1DH 3AIUA 4LLQA 3F6LA 1EJFA 4M6AA 4Z7WF 4BWLA 1LDSA 2KZ1B 4JDZB 3U46B 2ZNWA 1IT7A 5J11C 1ELSA 4EXAA 4Q3MA 5LAXA 4P2RE 2BWGA 3N29A 5GRUH 3CFKA 4ZO9A 4F7PA 1DWIM 3JZUA 5DFAA 32C2B 3L2MA 2HVNA 5IHRA 1H41A 4PUBL 1A4MA 1E5YA 3T9WA 5HYQA 3GLCA 3NIGB 1JCLA 3O6CA 2YD9A 1AQDB 1HEZA 1NCCH 3IDIB 3S8FB 1E8ZA 3SURA 2P44B 4PJ6A 1JDCA 4LLWA 3LKQA 1H51A 3HURA 4U7MA 5BVPH 1L6WA 4PJDA 1UKOA 4X9SA 3R7MA 4KXBA 1TR9A 4HKBA 1WV7T 1JZ4A 1YYLH 2ENYA 3QCUL 1NFDF 2G4FA 3VD1A 1X5HA 4PMUA 3RM4A 2ZKXA 4FFZA 4HKPA 4CNSA 4ODTL 1HIZA 3AAMA 3W56A 5CJMA 5JUEL 2VZ1A 2X4SA 4XCEB 5FA4B 2GPTA 2WAGA 4LGRB 1XHHA 2QGCA 4FYRA 1QSFA 4PUBH 1PL9A 2FEDD 4XVTL 3EGJA 5AVHA 5CCKH 5C0JA 9CGTA 2CGZA 1G7VA 3BLKA 3FTYA 4RE2A 2EEFA 1MYRA 2B9AA 4YBLC 5E0QA 3LXCA 3W37A 3OGCB 5E95B 2DJUA 4OSUL 2I14A 4ZOBA 4A7UA 4FQQB 3BKJH 4EIUA 5I1KL 4GG6F 2FGBA 4NZCA 1XM3A 1I9JH 1CGYA 2ARJQ 1UM5L 4QRAA 2NNAB 1UOLA 3FT2B 5HD8D 2YQBA 4I5XA 2OJPA 4A3QA 4ENED 4F2UA 3NPWA 4W84A 2ZX5A 1VCAA 5CCGE 4LEFA 3CDCA 4BFBD 1NGWB 2ICEC 3D2UB 2DQFB 1RUKH 2EDQA 1KTLA 2WP3T 3D0CA 3L23A 1NCTA 3N2OA 1CDIA 2NXIA 3FSTA 4R7OA 3DX7B 3PG2A 5FF7A 2XXCB 2FJGA 4Y89A 3IBOA 1LEIA 1SYTA 1FWNA 4IRJA 4X6DE 4IEFA 1DJIA 1QJWA 1EX0A 1NQBA 5AZUA 4IUOA 1NWSA 3L3GB 1QACA 5I6OA 2P8MA 3BAWA 3TJHD 1ZK5A 1WWCA 2PF8A 2GJ6A 3FN0L 4FHKA 5LJYH 2RJGA 3BPNC 4IGHA 4FFYA 1GYVA 5JO5A 2B2XL 2O9PA 4LZKA 3LNDA 5CUSL 5AYQA 3RYMA 4MFHA 4HBCH 5IESL 1WLHA 2AK4A 5CU9A 1CB7B 1ZA3A 5CPMA 5AVYB 3K30A 3GIZH 3MODH 4W93A 1PZ3A 4JGDA 4JTDA 3ESUF 3K81A 3NQBA 1VRSA 4Q8OA 4KAQL 5MENE 3H3PL 3QC6X 2NX5B 5TQ0L 2GTZA 2XQYG 4OZGA 1UKSA 2XN2A 4N8UA 2V2TA 3EYQC 3QAQA 4NKCA 5CGQA 2PTXA 4H5SA 4PJ5E 2QMJA 4U1LB 2DLFH 4C6JA 4D6JA 4JN6A 2HPTA 1JXGA 4AQ1C 4D8PA 3NCOA 4R4NC 4AUBA 1ZAGA 2UWEB 3NCXA 4F1SA 5DMYA 2NY4C 1PYFA 5HP5A 2P5WD 4RV8A 3VCLA 1DIOA 3STLA 2BW5A 2OMYA 3FB7A 3IN2A 4HH9B 4RNRA 4X0KB 3HM7A 1QWUA 4QNPF 1RCXB 1LO5B 3DGDA 2I5YH 2AKRA 1KGJA 4D2NA 4JQAA 2WO2B 1Q66A 1NDMA 4AU0A 3QFJD 1TZHB 1TQTA 4S1QL 5HYEA 4Z8FL 1Q6LA 4LUIA 1F6AA 4S0HA 2WVVB 1N5YL 1FFNA 1AGCB 5H37A 1PZ1A 3N0AA 1MDRA 1K8YA 2GVGA 2GTWB 2XGIA 4JPVH 5EO0A 5HI3D 4MFDA 1KGYE 1GZJA 2XQBL 3FOLA 4IJ3C 3FW6A 1M9SA 2VLRE 2AJUH 2VO8A 4JKPH 4G1EA 1TFHA 4M7ZC 4ZOEA 5FUZL 4FADA 4Z0BL 3UZEC 2FTWA 2XZCL 3TTOA 5DMNA 3OAYH 4I5BB 2WZEA 1D5ZB 2H7WA 3WEXA 5HVWA 4BQCA 2O26U 1R0AL 3VYLA 2YMXH 4M6OH 5CZKA 3TYUA 3VG0H 4ZQMA 3MACH 1QTPA 2PWHA 4P2VA 2JKTM 5F70A 7PAZA 1XUZA 4U6HB 1IGIH 4GINA 4HP5A 5BRBA 1DQQA 3QEHB 1Z9LA 2X6AA 2Y6SD 4PRHB 4BK5C 4LARL 3BEWB 3QZ6A 4MMXB 3P02A 2CUMA 2VR8A 1KNOB 1ZA6A 2IDUA 3MUCA 4NL1A 3EJZD 3L65A 3SPGA 1QSED 3O9WD 4L1TA 1JV5A 3U3HA 4RNFA 1LQSR 4KY1H 5D1QA 1W8EA 1ZVSB 5CINL 3VQ2C 5IFPA 2K8QA 2IAND 3TC9A 5DCDA 1H7WA 4HJTA 3BRFA 3MJ9H 3IUIA 1YY9D 2J5LB 2YK1H 4W4OC 1SY6L 4KESA 3OZ9L 4ABVA 4BQ5A 4YR6B 2F9RA 3EXTA 1XICA 2X3CA 3D2UA 5SWSE 5ECVA 3ZHDA 4GVGA 5FM4A 2HRPL 3GXTA 4C83A 4N4QA 3FDKA 3O2WL 4HOZA 3L1FA 3WH7A 1INQB 2IXUA 4HHMA 4KPHH 1CS6A 4FKKA 3H9HA 5MI0B 3VFSB 5LXXA 4ML9A 1E4WL 1YJDC 4HU8A 5FB8A 3QG6A 3VFMA 1QNIA 2A6JA 3I02A 3L1OH 5TH2B 5KVFL 3U7BA 4ZXBB 1HIML 2P26A 1ORSA 1PD1A 3MNWA 1ZD6A 4ALDA 1BPVA 4CNOA 5EH1A 5IMKB 1M53A 4I9JA 2CHZA 1UACH 2QGYA 4N68A 2WZMA 3WV0A 5JO5B 1YADA 1YDYA 4DF2A 3R7QA 3WFHA 2V7NA 3QJUB 3H4HA 2GSIA 3KAAA 4KZEL 1J6OA 2DH2A 4X8CA 1G43A 3TNMA 2YD7A 1EPXA 4F8QA 1FP5A 1Q0XH 2BS71 3FHQA 4PY8J 1AO7B 2NX5A 1EAOA 3LRHA 3C0SA 1AG0A 2IFGA 3FB8A 5I24A 1AQ8A 1E30A 2Z1PA 2YCJA 4YC2B 1LT8A 1RZ8B 3ZDXF 3G1VA 3STFA 3W73A 5CP7A 1DJWA 1IC1A 2PNDA 2G3IA 3RR4A 3O3EA 3IJQA 4P46A 1Q1JL 3ITGA 3MV7B 2I7GA 2GUUA 4CJ1A 8A3HA 3V6OA 2Q8ZA 3UMTA 4UTFA 5T3ZL 5FHBH 4TTUA 1BVLA 5SV4A 1U83A 1JTPA 1B31A 1RY8A 2WOQA 2E47A 5A6MA 4LSUH 1BVNT 5IFAH 4EN2A 5JHDD 2BV9A 5DT1H 3HGSA 1FRGH 4DO4A 2DIEA 1ZLUH 4AJ0A 5ALBH 5JPMB 1MHPL 4HYWA 1YQVH 1FFNB 1MJ7H 4AY7A 1I8IB 1BGAA 3TXVA 1Z8AA 2QPFA 5D8JL 4CEXC 4FMKA 5IBLC 3MRRA 1JEZA 3UYOD 4RFNB 1MCCA 3DUUB 5FGSA 1TYEB 4AM0A 2QAFA 1SGKA 4Y9MA 4QHUB 4XB8A 5J89A 5KS9F 4P2QD 3L5JA 1MLCB 4IICA 3F4VA 4KJPC 5EU7C 5E5MB 1E4KC 2NY4D 3F7PC 5FV1L 3G22A 3ML8A 4GRMB 3WNKA 1R5IA 4ZW6A 1M57B 4F5CA 4OV5B 4ERAA 4YVUA 5TF0A 1SQ2N 4JDVB 1WHPA 3T5WA 3BZEA 2DQGH 4WGXA 3L81A 3ZK0A 1J8SA 3TCSA 3TTQA 5LHEA 1DBTA 1E28B 3KPRA 3MRQB 4LLWB 2FO8A 3VWJC 4JNMA 5DUPH 4XCFL 5F2GA 1EHKB 4YE4L 1LEGB 1DQQB 1G9NL 6REQA 4ERIA 3KPOA 5D5MF 1UWAA 4P48A 1GOGA 2QMKA 3LV5A 2Y1AA 4HK0A 1T5XB 1URIA 2ZOWA 2ERJB 1JQXA 4X42A 3W70A 2BJML 1EGJH 3UPWA 4ZFCA 1MNUH 1RERA 2EO1A 2IH3B 5E4EC 2MNRA 3DDMA 3ETSA 4XNQA 3LB6C 5DQ9A 1CTOA 4N0RA 3MRGB 3LA4A 2R2EB 3PUDA 4NO0D 3D50A 1F56A 4QOKA 4MFEA 1LORA 4OVVA 1JZEA 4E41B 3O9WA 2LGNA 5FC9A 3UTZA 3MCNA 5EORH 4NBZB 1RJLA 1G0XA 2ADJB 3EJRA 4GSUA 4CSZA 4MD0B 5F9JA 5JHDA 3VD0A 2P42B 4V2XA 2RUSA 3URBA 4TULL 3AZUA 3PDOB 3L7RA 4IJRA 3UTQB 3R79A 2P5EA 3SYPA 4RH4A 2YLLA 4XX1G 2R94A 3WNMA 2G3JA 4O1AA 4NQDA 1XYMA 4OFYD 4PJAB 4CILA 1H5BA 3CZSA 4JQXC 2WIIA 4MTMA 1KYAA 4QLWA 3PNUA 1X5FA 1JNJA 1AMXA 1QLEH 1ODUA 5CCHE 4WGHA 4WJXA 4OU1A 5ABTA 3K6SB 2IH1A 4ZXBA 4NSBA 2XBZA 1HZHL 1P69B 4LEXL 5JIDA 3NN8B 5I6PA 3D69B 3MLVH 3T6XA 3R4IA 2EDYA 5DVPA 4ZB2A 4ZQPA 1FLTX 4GA8A 2BGNE 3HN5A 5AZ2H 5FLVA 2I32A 1JHKH 5DI8B 1FA4A 1HILA 4M8VA 4NIRA 3TNMB 3NA4A 3DGCR 2VDQH 4ZENA 2F08A 5A2AA 3SGEH 4ZD3H 2DM4A 2NR6D 2FB3A 1ZSDB 1FGNH 1LO3L 2CCLA 2F38A 5T33L 4FX7A 1BZ7A 4OCWL 1YNPA 2HG5A 1JCVA 2B7DT 2H3NB 4K3DL 1U3HC 2NYZA 2ON3A 4MX7A 4PJGB 3KCWA 1LO4L 3QIWD 4KKLC 4UQEA 3R6IA 3WF3A 3KVDD 1IQWL 3KPNB 5L9DH 5I16B 3GDBA 3SQOH 3OB0H 2H4EA 2F84A 3AIVA 4WHYH 3FU8A 4DZ8A 5DZLA 5KSBE 3SUSA 3D0LA 5J04A 2BW4A 1WFIA 3C9NA 1TJIL 4MJHA 1V6TA 3PHSA 4TSCL 1AI1H 1XR9B 4R4FL 1XR2A 1MDAA 2MOGA 1A02N 1NAML 5EZOH 2WYHA 3JBG7 3F5KA 1M65A 5HNTA 5BVJB 1YNYA 2Z25A 1YNKH 3IGXA 4WI9A 4TTDD 2Q8BL 4F48A 4IIQB 1PX8A 1ZLSH 1OAYH 4AQLA 1HKLH 4ZFZB 1BRLA 4AQOA 1DJHA 4XB3A 2ICWA 4OGYL 2XVBA 4QGTA 4JFFD 3WTXA 1I1CA 3LCFA 5AOZA 1FGVL 3EX6A 3QO0A 3FT0A 1ACXA 4TYUA 1F76A 4AZ8B 4Z7QB 1XP3A 5DJ2B 3TCEA 2VX7A 1A1OA 2X1OA 1WXZA 3MT1A 3V9EA 4IKIA 3AM8A 2BVOB 3UJFA 3QEQA 3UERA 2CHDA 4HFWB 4G8GA 1AD1A 1IM3A 1L6XA 1NL0L 2NQHA 4KVCL 1I1FA 4N90D 4UXDA 1NEPA 3O3BB 3W01A 1EA0A 1BF5A 4ZX4A 4GIEA 1R30A 1E28A 1FZJB 2WKLA 3BT2L 3KPRB 4MA7H 4ADIA 2WNZA 2V5JA 5KTEH 1XC6A 3EGDB 3DUSA 3QEQD 5ABAA 1FVEA 3VD2A 2ETWA 3W02A 5PTDA 2VDNH 1N3NA 1H3GA 5FO7A 4F27A 4KJWC 4YHGA 2A99A 4Y9FA 7A3HA 3H7VA 1O6VA 4LEOB 5HGHA 3H2FA 2C9RA 4XH2B 1V55B 3II3A 1K02A 1SM3L 1LYQA 4KROC 3CVHH 4TNVK 2Q8AH 1OVZA 1ONWA 4Z42C 1U92B 3LNFA 1NL0H 1Y6KR 5IQ9B 2HWZH 2PP3A 1W6LA 3U7WH 5CFAA 1AR2A 3HC2A 3OWRA 5IQLA 3SIMA 4PRPA 2VQ1B 1ONXA 1VLXA 3I75B 4E41A 4FOUA 2D4DA 1IWBA 3U4EA 3NSJA 2OSYA 1B3VA 5D9SB 4YTRA 1WKEA 2PDGA 4MHHG 2VSCA 3K80A 3LQLA 1KLYA 4GKZA 2YQ2A 2CALA 3DHMA 2Y5SA 1I7ZA 3NZ8B 1RJYA 2L3BA 2LVCA 1EJTC 1DR9A 4FS0A 4NZUL 4OM1L 5AZ0A 4DPAX 1I8KA 1G7IA 3BN9D 5BWFA 1MW0A 1JGVH 1G1KA 2OMWA 1TVHB 2BK8A 1ULVA 4PCTA 1JR1A 2E3VA 2K8MA 1E4KA 2Y06H 3ZUNC 1J11A 2GC7C 4BZYA 4P7NA 1I60A 3N9GH 1WFNA 3DJ9A 1IZJA 3LPPA 3O6KL 5LO7A 1S3TC 4JTFA 4E42A 4P59L 4GP5B 3RBSA 1XKYA 1LWJA 2HJKA 3VFOB 5FL1A 2YBRB 3P0YL 1YMME 4JBSA 2ITFA 1PKQA 1R3QA 1S9YB 2VX6A 3BDKA 4FERA 4AEIH 2MSPA 2SODB 4UU9B 5IZ7A 2OBGA 1DXEA 5CHNA 3PU7A 3QUGA 3DCPA 4RW3A 3W6YA 2BIHA 3ITTA 1O75A 4L3CB 4MDRA 5CU5A 1K03A 5CPQA 3TVMD 3VGGA 5JH1A 2H3NA 2PETA 1PU0A 2QCGA 4XMPH 1ADOA 4HOXA 1Z44A 4NWUH 2L7QA 4IRZH 4WLCA 2GQ8A 5JIKA 1US0A 1IV8A 4KZ0A 3E8UH 3LHWA 3D48R 4L8DA 4R5XA 5JW3L 3M0JA 3DDGA 1P5VB 2IBZX 3PQYB 5E8OB 4O28A 4HHAA 1ZBKA 4PH8A 2J24A 3RCYA 3UG3A 4IBUA 5AHNA 1KDJA 3OGSA 1E51A 4B9ZA 2J7CA 3UTTE 1O5QA 2OMUB 1YHPA 1MIML 2IS7A 4HIIB 5GJTL 3MV7A 1AQFA 3HZYB 4PN2A 4A29A 4LAUA 4PJEB 2PURA 4O14A 2XWDA 1EIBA 3FB6A 2WBWB 1QTWA 4LUSA 3KPQA 2RJMA 4GUFA 3WLSA 3OPZL 4NN7B 4LLVA 3QH3B 4IIQA 3ARUA 1CFSB 4ZAKA 1A7OL 4ZMLA 4AWEA 3UXLA 5HDQL 4HZ6A 4GIOA 2ICWB 5HGGS 4KEUA 3BGFC 2VABA 2IQAA 1PTGA 3W7MA 1DHKA 2O5YH 3MAWA 1KFEA 4PRBA 2J21A 2ADIB 3OQEA 1J1XH 1ET5A 1H4PA 4FQPA 1DO5A 4K9EH 3BAKA 5DJ8A 3IMRA 1TB3A 5LUMA 2OI9B 4YPGA 1IM3B 1PKNA 1B88A 4UILL 3ZQWA 4M93B 3WQCA 3OXRB 4AOFA 2WZHA 3RJYA 3TBYA 5DCEA 3PBUA 4HUCA 1OF6A 7TAAA 5LA1A 2Y1VA 2Z0BA 4CEUC 1WWBX 1EXGA 4U6XB 2DLIA 3L48A 3OMIB 4P23A 3F2LA 1QYGH 4ES9A 1FHDA 2FZMA 4HZ8A 4WUIA 1CU4H 2XFRA 1RD6A 2C9VA 4WIWA 2JWYA 1AA1B 1GVRA 2LTQB 4JPVL 4P4KC 2OR2A 4KMLB 3TLRA 5GGUB 4XHJC 3O2DA 3FYOA 3S8WA 2BVPA 3CHPA 4L1SA 3PAJA 2Q7YB 5BOPA 4NJAL 5EG6C 4ZS6C 4US6A 5DJ0B 2ALAA 5EMKA 3QIUB 1WZAA 2VQ1A 4HK7A 4MWAC 4KNQA 1DQDH 2OB3A 2QSCL 3RFZC 3GRWH 4BKLB 2J13A 3VXRD 5CD3A 1FXPA 2X6BA 3WX7A 5HHXL 4WKZA 3DA0A 3QHOA 4GRLD 1BQHB 2QTEA 3LHYA 1C16A 2OZTA 4HNVA 2YC1A 5E6UB 2GDUA 1UUOA 4HUVA 2NWRA 1V3IA 2E6YA 3A9IA 4GY7A 2CKBB 4K5OA 4GUJA 5D8ZA 2EKCA 1EMTL 2W9LA 1AKJB 4OQVA 4HXBH 3N2TA 3AY2A 2DT0A 4P9ML 1XBXA 4D6HA 1RY0A 3TEVA 3K4DA 1JGDB 4LPTA 1WZKA 5DQDH 1M7XA 4LVBA 2DL9A 1X9QA 3FU7B 4G6JH 4H4IA 1VAHA 1BWWA 4LB3A 1PS3A 3NCEB 4KVNH 3NK3A 1BM3L 2I7OA 2QBWA 3O3DA 2WNWA 4ZMXA 1W1PA 3M16A 1F07A 2KLSA 3DWTA 1PKQB 4JIHA 4AXWB 4FALA 4GXUN 2POZA 3KBPA 4Y8AA 4HUXA 5CHNB 2OWCA 1M1XA 4KWWA 1R85A 4MG4A 1DFBL 2VFHA 2BO0A 4QO1B 3V5HB 2XJ7A 4IGMA 5G1MA 5AW6B 1XFCA 3AS1A 4WTXA 4NU7A 3CHFA 3ZXWA 1B9KA 4GT7A 4LPYA 1QO3B 1E5JA 1EJWC 4N3UA 3EYSL 3SDXF 2GABA 3D7PA 4R5EA 3WLKX 3ULUF 1QW9A 1W1A1 1N68A 1ZLDA 5C0CD 1A5NC 4BGLA 1NTHA 1ZENA 3FSVA 3R06A 2ACQA 2CLKA 3DO4A 2DIKA 1ZTXE 4L3EE 5LBSA 3DVGB 4G9DA 4KPHL 3W9DA 4WJ5A 1KULA 1BWMA 3CMJA 3BUTA 2NTFB 4YHOL 1YUKB 4EX4A 3MVIA 3Q1SH 4MLSA 5BXPA 2FO4A 1NUGA 5DZVA 1Q0EA 3M8OH 4JZOB 1Q9OB 1X5GA 5FLUA 4H88H 2WXRA 4KITB 4W7WA 1RZKH 3WBAA 4AC7C 4F0MA 4FZ8L 2OODA 4LF3B 1OHZA 2WWDA 3RGVC 1OVDA 1S2EA 3IGKA 3BLFA 4RMVA 5KYYA 3B3IB 2XPYA 2AERT 2BP0B 3H7RA 4ZZFA 3QFWA 4OJEH 5G55A 5CWSB 4AVFA 1TQBC 4OD2B 1EUUA 2VMFA 4BS0A 4TNEA 3CV2A 1A6UH 2W0PA 1H6UA 2ADIA 1NWOA 3G3LA 4CSPA 1WT5A 2A6KA 2PGRA 3GDCA 4PSPA 1W1ZA 3SPIA 3ATYA 1MSSA 1A1MA 3G3DA 5CC3A 4K5PA 4XVTH 1QNQA 1IEVA 1L6ZA 4V1YA 1RZKL 2BY1A 3QUXB 1VACA 4JFEB 5FR3A 5ICXA 3UWUA 1OK6A 1AOHA 5G1YA 1REIA 4YUEL 4IS6B 4WUUD 4ONGL 5CFHA 4POZC 2BDQA 4MNQD 1R9YA 1JXJA 1TOXA 2XV3A 1OWQA 2DT1A 5DUJA 5ILTH 3CMGA 4HT1L 2XPZA 4PM1A 4PJCF 1UM5H 3AUVA 5D71H 3GMNB 1AYRA 1E55A 1T5KA 4BK4A 3M1CA 5CEZD 5CJQH 3NO3A 2IV9A 1C92A 2NOYA 4FQLL 1OIFA 3LH8A 5CLTA 1KQYA 1DVFC 2AK4E 1Z0NA 4PRWA 2CDFA 4TUJA 3VD7A 1TPH1 4N2OA 4N0UA 3RVTD 3AWGA 3T3ME 3QEGL 1N5AA 4QQ3A 4QRFA 3R8GA 2Y7QB 1X7FA 3QOMA 1WZ1L 1AE6H 1S7XA 1Z0MA 4MXWL 3HFMH 1OGAE 3A0OA 7ODCA 1YNTB 3S4TA 4M00A 5EU9A 4JM2C 1XEDA 3FCTB 3E6EA 3H3BC 4P2QA 2XFXB 5TF1H 4JHAL 4A55A 1QHPA 3NZPA 4PJIB 4JR5A 1BQHA 1AZVA 3SW6A 1CWYA 4M5ZH 2IDTA 4Y5XB 4ONVA 2ISWA 1DIKA 2LV4A 2WQDA 1WAAA 5GHWH 2BIIA 3B8VA 3G3MA 1F90L 1DN2A 4MJ2A 5HPCA 2XWJB 2UV3A 3CVDA 4QGYA 2ZOLB 3TWBA 2RDXA 2I60H 4DGUA 3QBUA 3QUMA 3MXWH 5J06A 3EXRA 3QZWG 2GY7B 3NMEA 4NYLB 2WC4A 4TO8A 3T71A 4HJSA 4RX0A 3AHTA 3QYQA 1JVNA 3BP6A 1TQWA 2C1HA 1SBSL 1TF4A 2A79A 4HWNA 5SX5H 4J3OC 2ROXA 4C6KA 3NO1A 3VFVA 2XX0A 3LYRA 3HQPA 2ADFL 1HKVA 1YEDA 4PFHA 1DQXA 5DS1A 3A5FA 3AM8C 1WKFA 1WCQA 3DTDA 4OQTA 4LKXB 3NQKA 3MA7B 3IYLW 3Q5OA 3IAGC 1JPDX 1BAGA 3MOBH 3AT9A 3MUIA 1VDGA 4X4XB 3BZFA 5KAQF 1A9VA 2YDAA 2P28B 3VXMD 1A7OH 5HI3C 2X4OB 3UJRA 1FORH 2ZSWB 4MYXA 4AY1A 3ISIX 3MOQA 5AC8A 2YPLA 1GA2A 3KPSA 4M7LH 4QAWA 1FWIC 4QHLB 2KYIA 3H42L 3O15A 1H8LA 1L0YA 1MCPH 1DBKL 2EICA 1YNQA 1YG9A 4FG0A 1IQDB 3G6DL 1C5DA 1LTDA 2R4RL 3DV6A 4EUPH 3C8HA 5ANHA 5BCAA 5C1MB 4BQ4A 1UT2A 3EYFA 3D85A 1KNWA 2NTFA 4O00A 5T26A 5I73B 3SCWA 3EWCA 1UJTA 1WTGT 2WW8A 4AVJA 4HG4K 1AQMA 3HRZB 3NP4A 3OHXA 3PUCA 3PJNA 4KCUA 4S0TD 3VI3A 1WRFA 1GHFL 5F96H 5FEBA 4XZWA 4WV1C 2OMUA 2YL9A 1X6NA 2XTJB 4JQXA 1TDQA 4M7LL 1LP9F 4OU3A 5K9OB 1CCZA 2BP0A 4D0BB 3BW9A 1BD2E 3RQ3A 2J2ZA 2WJFA 2NQJA 2CZVA 2E77A 2ICCA 4WSHA 1ZA3B 3G6JF 2XN9E 1OTUD 3VC6A 3GYCA 4PMZA 4Y19B 1H0DB 4ELME 1CL7L 1DVQA 3ATAA 1X4XA 4IMKC 4PRPD 1OP3H 2WOBA 1OP5H 2QJGA 1D5IL 6ALDA 1ZV2A 2VW4A 1SO5A 2E6AA 2OYMA 4DJFC 2FD6L 5E8DL 1DUYB 3EBAA 3SD2A 1HP5A 4KK9C 3WEZA 3LCYA 3F01A 5BZWA 4RXFA 1KB5A 1JXFA 1BD0A 2QVHA 2F5AH 1JN6B 1PYMA 3DX1A 1TU2B 4NRXA 2VRKA 3U36B 1DJXA 4RISH 5HHXH 3DKHA 1X8CA 5KZMA 4YDZA 1YY8A 4NQCA 2QKIA 3ZSTA 2XZZA 3AQYA 1ZPUA 1NC2D 3GMNA 3PIQA 4BEQA 1P1ZA 4W6WB 4X0KA 4B27A 4JTIA 2DS4A 4B16A 1K4DA 2VLJE 2E0PA 3REWB 5BU9A 3UTSB 1IWAA 4WFHE 3EGSA 3B2MA 3AJ7A 1Z5HA 4OZFA 4WDXA 3V0TA 2IKGA 1DVFA 1UQSB 3AISA 3BC9A 3BO8A 2CEQA 2Y7QA 4DM2A 1OAYL 3WBEA 2LU4A 1F97A 1NEUA 1KBJA 1YVLA 2BVEA 4UYQA 1U1JA 2CH8A 1VBJA 2BP1A 2DFAA 2NW0A 4FG6D 1A6ZB 4NPYB 4R97B 3RZCB 3UAFA 4HF5H 4HZLA 4M3JA 4RAUA 4CKQA 4KBPA 1JZHA 2NRDA 1B3YA 1P5UA 1UJ3A 1Z9OA 3PWNA 3QRBA 2PTTB 3QNFA 4G5AA 4P2OB 3VU2A 1N8IA 4JM2A 2XBDA 4MNLA 5CAHA 3T0BA 3ZKSD 3VWJD 4JGJA 4HK5A 2Y88A 3R0KA 2B3IA 4IU2A 5JIQA 1UT1A 4WUKL 3ZYIA 1PSCA 3AG2B 4R26H 2DSKA 4B5SA 3GRWA 2XXGA 4L5FL 4YGVB 3SO3B 1H1YA 1TETH 4QTHB 4WJG3 5A1AA 3S2LA 1EYWA 3AG3B 2BFVH 5DD0H 2I69A 3ARDA 2HX9A 4GH7B 4K3HA 5FDWB 4AK1A 4FA6A 5FO9B 2EAWA 2K6YA 2PWEA 4GY1A 3BEWA 1JWUA 1BD2D 2XA3A 4WFFD 5E6IA 1HJQA 2GBVA 5BV7L 3AW5A 1CFNB 3IWPA 4TOQA 2X9WA 4D2JA 1U8MA 1Z9SB 5LQBH 4CA4A 4LRTA 4WKXA 2J6VA 1A7PH 4PRAB 2EPHA 5G4EA 3T0ED 1KC5H 2R1YB 3V1HA 1CIDA 5HPOA 1FO0A 5I6XB 4HX1A 1M5WA 1HN1A 3TASA 1NDZA 3FKRA 3CFBA 4FQCH 3IKCB 3DXAD 3W5MA 4CNUA 1G94A 3QZLA 1TEGA 4TVPH 1UWTA 3GJEA 2EDLA 5D2VA 2WJDA 3ANYA 3SKJL 3ITVA 2FBOJ 4UDUB 3WMBA 3JWOL 1ZBWA 4C6BA 4N2CA 4MS8C 2YA0A 3VXMA 3R0MA 2G75B 1T1YB 3ARBB 1BFSA 1BLNA 1BQKA 1PNCA 4M4RB 3U7AA 2EVJA 4JTJA 3WQFA 3FFCB 3NZHH 4Z18A 4K94C 3E5PA 4ZMVA 1GKPA 2DZAA 1ZANL 3I6SA 3R06B 1GKOA 3T44A 1WBYB 3V6OC 2VRAA 3AFLA 3KYAA 3VZYA 2DI8A 5C3TA 3SSZA 1DSWA 1T21B 4OVUA 3U4KA 4R2GD 1BIIA 2WO5A 2D3LA 1JNLH 3T09A 2VERA 4KW2A 1ZHLA 1RZ7L 3C08H 1OJXA 3FKUS 2DDQH 2I5IA 3W1ZA 3OA5A 1X4YA 5DEGA 4X5RA 5KVDL 1BWKA 5C0IA 4P5SA 3N44B 3LS4L 3TVAA 2JCCB 4X6BA 1IBHA 1T4WA 1ZCRA 2G3XA 3A3YB 4XAWH 3R7RA 2WN2A 1JFHA 4XI5D 2Z00A 3C56A 3SCTA 2XQYA 2BMKA 2DKSA 5EPMA 2NXZC 5GSRB 1UC4A 1Y0EA 1YEYA 3NA9L 3HA1A 4LH8A 5AY7A 3U57A 5IBUB 4FIRA 4P46B 5C0AA 4Q32A 2JXMB 3T6CA 3S5ZA 3SDCC 1SMOA 5FEPA 3WQGA 1FNGA 3HAEH 2Q0ZX 3HUJA 4Q56A 1OAUH 3VJ6B 4BD4A 4Q8MA 3UAJA 2VC9A 1OGAD 3LVEA 4HC1H 2EE6A 4RWYL 2ZVIA 5AC6A 5C0ND 4EKXA 4HK3N 4HU0A 1MHCA 4N20A 1JWSB 4NUQA 1XISA 2F7FA 4KIEA 3X3GH 3ZL4L 5LKNA 1H0IA 3NL5A 3QDGB 4K23H 4XBJA 2UV8G 1CICD 1L9PA 1DVFB 1UQSA 2VWSA 1U1UA 2VMDA 3MRKA 3VW3H 1XQKA 3MV8E 3CUXA 4JK0D 2XDFA 2VN6A 1EJ7L 2FH6A 4LP5A 4NWTL 2N01B 2WN3A 2YYTA 3TO2A 2CHOA 3BL3A 1M68A 3VI3E 4I9WE 2BGSA 1YBQB 3AG4B 3GHEL 1JJKA 4H7ZA 1ZTXL 5AKTA 4JM2B 5I2IB 2OFQA 2FLIA 1S7SA 1VGKA 2LHAA 4MZ3A 3EO0B 4PMEA 3BZ4A 4Y2DC 1RZGA 4ZMTA 5CEZL 1OBAA 3HR6A 3NJ3A 2W63A 2HT2D 4KQ3H 3M43A 2OZ4A 3G8EA 3V0FA 3QXBA 4WDTA 3VTRA 1H1NA 3FCTA 3N40F 1LO0L 4OD3H 1VF8A 1H60A 3GD1C 3CUZA 5L2JB 4QTHA 4H9MA 43CAB 4B4HA 1JGUL 2ZAHA 4M6MH 3QIBD 3GBLA 1XLMA 4CCZA 4LCWB 3V0EA 4PRNA 1Q8JA 4ICNA 4QXTA 1C8YA 3E6FB 5D7EA 4I13B 5TE7H 4L1GA 5T33H 4NCDA 4HK0B 3NRPA 5E70A 1AGEA 3TBVB 2J57A 3BPOB 4ETYA 3NL6A 4GI8A 4JKMA 2FQEA 2ZICA 4UTHA 1U8MB 2DYPA 4G6KH 2X6VA 3UX9B 3C8KA 3D25B 3IJ8A 3TBCA 5HPMB 4E0RB 1DQVA 3IJLA 3QMSA 4M8RA 4O13A 5DXYA 2OTUB 3ARFD 3U0WL 3WXVL 4O02B 5DZPA 4Y4FB 1JZIA 4LAQL 5I8KH 3DFSA 3GINA 3FB5B 4XMLH 5IJKC 1NEYA 4JTCA 1AZNA 3PJLA 3PWJA 2Q3AA 3QWRD 5DTFA 2KZKA 2CGRH 2DYPD 3F7VA 3L7EB 1F4YH 4GQPH 1BQRA 3KNBA 3D39D 2EVGA 2VDOL 2Z8RA 4Y88A 1U4EA 2I9TB 2QNEA 3BO9A 3PBGA 3VXSD 1IKOP 5KN5B 4LGSB 1BXNA 3L54A 4PJHE 2PEVA 4IFKA 3T8QA 1KPUA 5TK2A 3PXHA 2IWFA 4OGYH 4ZR8A 1IAMA 2W60B 3V36A 3S1VA 3MP4A 2F53D 4RMWA 5F0PB 4NZFA 1B4TA 2ID5A 2HKFL 2K3TA 3QFGA 4FQXD 4LMQI 4RMBA 5EZJA 5D6DC 3SGDI 4E2OA 1IIKA 4K5LA 2OPJA 1O6SB 3D4ZA 2E7CA 1NIBA 4HJGA 4LAKA 4UR8A 3M7OA 3GNXA 3KLSA 1MI5D 1SJEA 3FYEB 4K94H 5HJLA 1Q0YL 3BKMH 1EYEA 5HDOA 3ZDXE 4GS7C 2NW3A 3CL6A 4DNMA 4MIMA 3PF3A 4UCGA 5HVHB 2DSWA 1O7SA 1UXMA 3MJ6A 5AB9A 3R0UA 5E1HB 3B6SA 5H1WA 1EFQA 1I3UA 1XR8A 1A25A 3RNQA 3SQBB 1LBLA 5AW5B 4JEJA 4NQSB 5FIEA 1VGAA 4OF8A 4GMEA 4MLRA 3L0GA 5C0CA 1PTDA 2ZZ5A 4NNYB 5LNDA 3QRFM 3ESVF 2G0LA 3JYCA 3A5VA 3KPNA 1J9YA 2VFFA 1PHWA 3RVXD 1EUNA 1I7UB 3IGAB 2ZKHL 2DPKA 2J9YA 3ZRSA 1MZZA 1A1NB 1GC1L 2OMZB 3LIUA 4GSXA 4LAJH 4L37B 4OGAD 3T2NL 1KELL 4Z76B 2D7MA 2CHRA 4L5FE 4ZI8A 5JPNA 5HVFB 1TU2A 1KCXA 1NDTA 3AI0A 1O5XA 3OGVA 4L5FH 1MFMA 2J8UF 5H8PA 1WEJL 1ZJAA 5KS9E 1RUSA 1WFUA 5AVRB 4J3OF 4XCCL 2FE0A 2Y5TA 5PCYA 3KJ4C 1QU4A 1TJ2A 3DHUA 5DGQA 5T5FA 5C09D 2CC0A 1R8LA 2ZBTA 2CERA 1EHNA 4OM0L 5F1OB 4JBRA 5ALBL 1R47A 4R0LB 4UI2A 1W2VA 2YAPA 2FJFB 5E6ZA 4WI3A 1JDEA 2WINB 1VGKB 4ZS6D 4P2OC 1PO9A 5J1TC 3TBTA 5DRWA 1FC2D 2VXVL 3LZPA 3M44A 3SY5A 1MI5A 3ZJ6A 1WBZA 2C7FA 3DX7A 3EHBD 1M7PA 2JKJA 4HG4J 4UNUA 5HAOA 3I6GA 3RGVA 2BSTA 1X7SA 4IRJB 1MQKL 2KDGA 4J4PD 4OZHF 4LRSA 3C2AH 2J7DA 4L4TA 4EZLA 2YMXL 3MJMA 4HS6B 3TW9A 3VG0L 4WI7A 1AE6L 1H3PL 5I28A 1UCBH 5CZRA 2R2BA 3WUBA 3L1GA 4HPYH 4P5TC 4OJYA 2ZUUA 5IQ9A 3Q9PA 3LXUX 4FQ2H 3DYOA 2PB1A 1JWUB 3BQUD 2BSED 5EA0H 1UYQA 3MVTA 1XGQB 5I75C 3BQVA 3D6GA 5I19L 3CWOX 4MNJA 2NV9A 1FO0L 5I1DB 4B3LA 3Q06A 1VADA 1WICA 3MYJB 3Q8AA 3KP0A 3QORA 4HJIA 3M0ZA 1E6OL 2COQA 4HX1B 2R6OA 3IVTA 1K4HA 1G6RL 3RO8A 3MZTA 1T66C 4A2FA 1KPUB 3IGLA 3LS4H 2YYUA 2C91A 5CBBA 1SY6H 2GHZA 3MRPB 1FLRL 3KYKL 4WWNA 5AOKA 4B50A 4DEWA 2DQFA 3WBWA 1S9XB 4RA0C 4PA8A 1J01A 4PE8A 2IGLA 5ACLA 3AWEA 4HJEA 4XISA 5CZVH 2ZG3A 4ZPTB 3WH5A 3GMMB 5E99H 1EEYA 3B34A 3W7RA 2F7OA 5DHYB 9RUBA 3EBHA 1A6WH 2HJKB 2CKRA 4IEFB 3OHIA 3WMSA 2FJSA 5KVFH 3N06B 4OZGF 1XG3A 2VJ8A 1TUXA 3HQOA 3FOKA 3HTWA 3QY7A 1NLDH 1HH9B 3TKFA 2BXZA 1Z7AA 2WKOA 5D1ZC 3MOBL 2F5BH 3KLKA