1P6WA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with the substrate analogue, methyl 4i,4ii,4iii-tri-thiomaltotetraoside (thio-dp4)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
b'HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (Alpha-amylase type A isozyme)
molecule tags Hydrolase
source organism Hordeum vulgare
publication title The structure of barley alpha-amylase isozyme 1 reveals a novel role of domain C in substrate recognition and binding: a pair of sugar tongs
pubmed doi rcsb
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1p6wA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1p6wA01
1OIMA 4CU6A 3H54A 4PEEA 1JD9A 2XYLA 3ARSA 3IJ9A 3OLGA 3OBAA 2WMJA 1IZKA 1OSEA 1LG2A 1NOWA 1GQLA 3PZ9A 5JBFA 2D3LA 2WWCA 3K8KA 1CXEA 4NZJA 1SR0A 2VCCA 3K46A 1KB3A 3LXBA 1ZJAA 1E0XA 2DIJA 3AXIA 2FYVA 1W9DM 3M46A 4RE3A 1KXVA 1TG7A 5KEZA 3W37A 3GZAA 1W1YA 3SCQA 2D22A 3ZT7A 3VPLA 1BYAA 4AD4A 4W8AA 2VMFA 3ZJ6A 5I2UA 3D4YA 3JUGA 2XGIA 2ZXAA 1W1VA 3MUAA 3SUWA 3PN8A 4OBRA 1UR8A 1SMAA 1BLIA 3ARQA 3SUVA 2VC9A 5JIWA 1HL8A 1MW1A 4IUGA 1NWSA 4W8BA 1TQUA 2G4FA 1UR9A 5I79A 1E73M 2V5DA 5IXEA 3MMWA 2Y24A 2X2HA 5E6ZA 3TV8A 2E3ZA 2J74A 3BVVA 4BS0A 2DEPA 1W1TA 2PWEA 4JHOA 1E6NA 3AIRA 3EYPA 2GJXB 1QI0A 2FHFA 4UQDA 4PTMA 3VSVA 3WNPA 1DHKA 2VQUA 4ZENA 4QLJA 1W2VA 4ZXOA 4U2YA 4M80A 4IPLA 3FXYA 4YN5A 5I5RA 3RM8A 3VX1A 1K9DA 1YHTA 4DUVA 3FY1A 2YA0A 1H0GA 1C92A 2J7BA 3DYPA 2X2IA 1ODZA 4NXSA 3ARPA 3D5HA 1H0IA 5EFDA 2BVTA 3UCQA 1WZKA 4ACYA 4ATDA 5IDIA 4BQ3A 1NARA 3O9NA 2DT3A 2J8GA 2IXUA 4N0RA 4AMWA 1CDGA 3VDHA 5C70A 3WQ4A 1J01A 3ZT5A 1FH8A 3W26A 3WL1A 2WBKA 1V0LA 3EDJA 2WC4A 1V3IA 1K6AA 3OZOA 1XHGA 1GOWA 4W85A 2BY1A 3GH7A 1R75A 3EDDA 4GPNA 1R46A 1H09A 3BVUA 1XD1A 3D3AA 6TAAA 1V6YA 4CCCA 1JIBA 5FIPA 3OGSA 2TAAA 2E4TA 1XD0A 3G6LA 1F4AA 4PYSA 3PZQA 1PIFA 3AIWA 3B9DA 2DSKA 3BCFA 1B2YA 3MKKA 4F8XA 5I77A 3G6MA 3GM8A 1E6SM 1XYFA 1IZJA 2BHUA 2E9BA 3BUPA 1UD3A 4BZYA 3WF3A 3BGAA 1UH2A 2J79A 2WZEA 4PMOA 5ABHA 1Y7VA 4J3TA 3CMJA 3THCA 1E4LA 1GORA 4X9YA 1EDGA 1R34A 4RL3A 2F7QA 1HJVA 4CUCA 3TTOA 1KWKA 1DWJM 1HKKA 4U3CA 2ZWZA 2UWFA 4W7VA 4BQ2A 2VVNA 1WE5A 8A3HA 2RGMA 4UOJA 1WO2A 4CU8A 2EPLX 3NUKA 6CGTA 1I1WA 1KXTA 2D3NA 3M07A 4LPCA 1CGXA 4UQEA 2OSXA 1BVNP 5D9NA 3J7HA 5GNXA 3S5YA 5C71A 3HN3A 3ZJ7A 1LJYA 3PTQA 3IJ7A 5DFAA 3W38A 4HTYA 3CC1A 2PI6A 1UA3A 1XCXA 3FN9A 1KBBA 4ATWA 1FHDA 2DH2A 4NSBA 2PBGA 2CKRA 1JZ7A 4UFMA 2EAEA 1W91A 3L4XA 2WMIB 4B15A 1EHAA 3A4WA 2XFRA 1PX4A 2YKKA 1CNVA 3DX3A 4W88A 4PMZA 4MDPA 3VDCA 4TVUA 1V02E 1E55A 1JXKA 2WZIA 3VIMA 5BWFA 3K8MA 5A8QA 5CPSA 2XJ7A 2W62A 4AMCA 2UY4A 3PHAA 2Q8XA 2J8FA 1E6ZA 4D6IA 1CWYA 4DUXA 4MPKA 3GXIA 2ZXBA 3E1F1 4PUEA 1J0KA 2C8NA 3SEPA 3VIJA 1E0VA 1C8QA 3AHZA 1JYXA 5CZKA 4JFUA 4F66A 2XSBA 3VM7A 1UD8A 3SIMA 1E4NA 3EJTA 5BROA 4W5ZA 3PZIA 2VQTA 3HG3A 1MXDA 1WAWA 4WKHA 1PIGA 2XVKA 3O6AA 1E3XA 2WCGA 4H8HA 3VUPA 3CHEA 2WM0A 4HMCA 5D8ZA 1ISYA 3K4AA 1ODUA 4P7NA 4NXKA 1VEMA 1J0ZA 4AIOA 2J75A 3SCUA 4B9ZA 3WMSA 4B16A 1B3XA 2ZXQA 1TQWA 3WD2A 2W66A 1CXHA 2CETA 3A4XA 4ML4A 4TVCA 1F4HA 4W86A 3CIVA 3RCNA 2VZTA 3CZLA 1JZ3A 2OW6A 1HP4A 2BY0A 1CXLA 5JBDA 1OCQA 3RMEA 1W3KA 3WUGA 3VNYA 2JFEX 1G01A 4E8DA 3PZMA 3BVWA 1B3YA 4AZCB 3LPPA 1NQ6A 1QI2A 3F5LA 1TA3A 3WEOA 3AQUA 3WN6A 4XV0A 5HXMA 2XVGA 3ZJ8A 4EAMA 4PN2A 2QF8A 1W3JA 1IV8A 2PWHA 1EQPA 2OYKA 1BTCA 1BG9A 3VILA 3WQ6A 2J7HA 2EPNA 1CGWA 1E3ZA 2G3IA 2CPUA 1E6PA 3PZNA 4PTVA 1NP2A 2ZE0A 1VEPA 1HNYA 4X0NA 4P7LA 2XWDA 3MUZ1 1X6NA 2WXDM 3SCSA 1UKOA 5LA1A 1VENA 3BLPX 4WF7A 4P7RA 2QLYA 1OGSA 2EABA 3W6MA 4HA3A 3AS3A 5LYRA 1W9XA 2OWXA 3T0AA 3KZSA 5FD0A 3NYDA 1B0IA 2F8QA 3NDYA 1V6WA 1UR0A 1KTCA 1JG9A 2WNWA 4ZE5A 3ZR6A 3L4TA 4PSRA 1BGGA 2JEQA 3KLKA 3WD0A 4FLSA 1E72M 1GCYA 4UFIA 4UOZA 1PZ3A 4CGTA 1PX8A 3WSUA 4KWUA 1GZJA 2YL5A 2BHYA 2D0FA 3WDHA 1M03A 2CYGA 5LA0A 4FNTA 3EMZA 4HMEA 3W28A 1UD2A 1ECEA 4UZSA 1TUXA 4OGZA 1WNOA 4IPNB 1GOQA 2V5CA 2IUZA 2D23A 1O7DC 2F7RA 1E5NA 5LA2A 4AZ6A 4AZ7A 2XSAA 3WQWA 2WSPA 1TCMA 2WANA 4M56A 1RH9A 1JDDA 4Y7EA 2DSWA 4MDOA 1JL8A 4GZEA 3FAXA 2WLZA 1FH9A 1HWWA 4HA1A 1W32A 4GQRA 3RO8A 3QOMA 3BAXA 3N1AA 1GW1A 2DSZA 1G94A 2VVSA 3W81A 5CJ5A 2WAGA 2XPKA 2DGAA 3KL5A 3VKKA 4BF7A 3WQ5A 4FNPA 4LYQA 4ATLA 5IHRA 3EJSA 2J7EA 4H8UA 1UR1A 1UOKA 1R8LA 1XH0A 4UTFA 3H53A 3WF4A 1CXIA 4CD7A 2W4XA 4NRRA 4OBSA 4CKQA 4D6JA 2C7FA 3UR7A 3AFBA 4Z2GA 1DWGM 5FL0A 1XSKA 4NX0A 3WBAA 4E4PA 5D9PA 1QHOA 4KMQA 3VIGA 1ITXA 3WMBA 1MQQA 1M53A 3L4WA 1VJZA 4P8WA 2JALA 2G41A 4UQCA 4ZFMA 4JFSA 3N04A 1VF8A 3L2LA 1GQJA 3VSTA 4HPHA 2XIBA 4EK7A 2F1AA 1DWAM 3W6LA 3WL0A 3HJEA 5BRQA 2IGTA 1QNRA 1HVXA 4YHEA 4JZ5A 3ARRA 1XCWA 2VCBA 1E9LA 4PTWA 4AY1A 3RJXA 3DX1A 3AJ7A 2DPEA 4M29A 2D1ZA 4DWSB 2WSKA 3VIFA 3RDKA 2GFTA 3ZJKA 4YPJA 2YA2A 1UZ1A 4OUEA 1HKJA 4B3LA 2E0PA 1E56A 3CTTA 2Z1KA 4PMRA 1JDAA 2XVNA 2RGLA 2D20A 5I0DA 1QWNA 5M17A 4FNUA 2CXGA 1OD8A 4D6EA 3WNMA 3MU7A 3N13A 3WNLA 3BAKA 1ZU8A 3T0DA 8CGTA 4OOZA 2F7OA 3BMWA 4DWSA 3ALFA 3A21A 4HZ7A 5FL1A 2DQXA 2J7GA 2EEXA 2AOSA 2E9LA 3AZRA 4DO4A 4V27A 4UQ9A 1UHVA 3S2CA 3VTRA 3LPOA 5A8NA 3VD4A 2DIEA 5M5DA 1ZS2A 1CZ1A 2FH8A 1UR4A 3IAPA 2ZX5A 1KFWA 1HT6A 3TOPA 3AIVA 3AYSA 4IISA 3VU2A 1UG6A 4D6FA 3W53A 3RJYA 3U5YA 3VIKA 5I6SA 1UD4A 3CO4A 4Z2KA 3GXFA 1TQTA 1O7AA 2J7FA 1JF6A 1J9YA 1W9PA 3CZEA 1EXPA 2YL6A 1JXJA 4J28A 1E1EA 3QHNA 1HF6A 4NZFA 5BCAA 4WK9A 2XHYA 1BYCA 1CENA 2QMKA 3NDZA 1GUVA 1V08A 3ZM8A 3AMGA 3WDQA 1JI1A 1HVQA 1PBGA 1FFRA 3PZGA 3VMOA 5BXSA 1E0WA 1V3HA 1U30A 2WPGA 3GNRA 2D73A 1FOBA 1KWGA 4QCEA 3MO4A 4E8CA 1OM0A 1KR1A 4GIAA 4AIUA 4U5KA 2FH6A 5I78A 3TA9A 2EJ1A 1JZ8A 4AC1X 3RPMA 4HOXA 1OT1A 2ZXDA 2WMIA 4ZE4A 3ZT6A 3OB8A 3FAWA 3AHXA 3T2PA 2V38A 5A1AA 1HN1A 4WSKA 3N12A 5A6BD 1W1PA 3RILA 3WNOA 3EJUA 3WDJA 1HJXA 1TMQA 3CZGA 1GHSA 3AS1A 3W29A 2ZUUA 3VGHA 1GPFA 2VX7A 3PZTA 2YLLA 5F7UA 1OINA 2YDQA 4IM4A 3BVXA 5CPTA 2YIHA 1JFHA 3TTQA 4GZIA 1D3CA 3WUFA 1Q6CA 2AMGA 2CIPA 2OLHA 4HA4A 5EB8A 2EADA 4PMNA 4AYSA 2YA1A 2BVDA 4GXPA 3L4VA 1C8XA 4H04A 3T08A 2QMJA 3DC0A 1V0KA 3MANA 2NT0A 1VEOA 1NOUA 4L4PA 3AOFA 3WUEA 4J7RA 1RPKA 5A6SA 3CUJA 4AD1A 3WNKA 1UR2A 3D51A 5CG0A 1CGTA 3A47A 3UESA 5CLTA 1OWQA 3MS8A 1E43A 1N82A 2YOCA 4C7FA 2CKSA 2PB1A 1J0YA 3K1DA 2J78A 3M7SA 1LG1A 2CERA 2XVLA 4J27A 1GNXA 4KRTA 4L4OA 1NWTA 2YL8A 5BXRA 4R5EA 1GJWA 3I3DA 4UFKA 1VBRA 3W4RA 1ISWA 2YFNA 4M81A 4FLOA 3DDGA 2GJXA 3WDRA 4JFVA 1HKMA 4M8UA 2DH3A 1ZL1A 2YFOA 2UY2A 2EPMX 4DM1A 1QI3A 4MAZA 4AD3A 1J12A 1NWRA 3SCPA 3VX0A 4PRWA 3EDEA 5E9AA 3CGTA 3VD5A 1VBUA 3WDIA 5AC5A 1XYZA 3N15A 1CGYA 1FP8A 1D7FA 3BMVA 3LXCA 1H5VA 1XSIA 1CEOA 1R86A 1BYDA 2D24A 1V6XA 3KE0A 2EBNA 5FOOA 2GUYA 1TVPA 3FHAA 1W9VA 3S6TA 4TX6A 2Y2WA 1QBBA 1WZLA 2F61A 4PCSA 4AIEA 1HX0A 4AMXA 2ZWYA 3L2MA 1U33A 2OW7A 1KXHA 4AZGA 3LRKA 5I23A 4FNRA 2G3MA 3APGA 4QFUA 2ZUNA 3CUFA 5FCZA 4TTGA 3AMLA 4JIEA 1X6LA 3VDBA 4Q22A 1HJUA 5AYIA 3VD7A 3SUUA 5A2CA 2EPOA 3WKZA 4D1IA 4TTUA 1CLVA 3CMGA 3NJ3A 3NSXA 1BYBA 1W3HA 1QI4A 3MSDA 3UG3A 1LWJA 1BF2A 1GQIA 3WEZA 4CCDA 1HXJA 1OGGA 3FNDA 5HOSA 3UERA 2CBIA 1UD6A 1TZ7A 1UQZA 1J0JA 2WC7A 3BLKA 2V3EA 1L0PA 1PAMA 3HG5A 2GDUA 2J25A 1JF5A 2Y4SA 2OYLA 4A3YA 2WKLA 4GI8A 3OZPA 2VR4A 3EJQA 4XB3A 3GBEA 3OLIA 2GSJA 1SMDA 2XFYA 2UY3A 3AMKA 3AIBA 1WDPA 4J3SA 4WJXA 1UD5A 1W2PA 1JZ2A 2WWDA 5AYBA 3WH9A 4F9JA 4P8UA 5A2AA 2XFFA 1UWRA 1OT2A 3CBWA 4AEFA 1MW0A 2W5FA 4U3AA 4OJYA 1JZ6A 4CN4A 1YQ2A 3W25A 4MB1A 1MQPA 2PWDA 1L8NA 3ARWA 1CECA 1KGWA 3BSGA 3GH4A 2XTKA 3AHYA 3N11A 2ZUVA 1UASA 4S3JA 3WH7A 4NF7A 1MWOA 3LPFA 2MANA 1EA9C 3BVTA 4HMDA 4UFHA 1QVBA 1NH6A 3LXAA 4AW7A 2ZUSA 3VGGA 2WZHA 4FF5A 4PMVA 2BV9A 3LX9A 1UWTA 4QCFA 1Q6GA 4H8VA 3AS0A 4B9YA 4OZOA 1KGUA 3OIHA 1KTBA 1OB0A 3HZ3A 1LL7A 3WF0A 2BFGA 2W63A 4RE2A 2WHKA 3SCRA 1Q6EA 5CPQA 4OIFA 2X8RA 1ESWA 4MJ2A 4QLLA 2VRKA 4HOWA 4AD0A 4AZHA 1AQMA 4AYGA 1DWIM 1CGVA 1OGBA 4QP0A 2ZX6A 3NSNA 4W8LA 5A6BA 1VJSA 2FDMA 1OIFA 2XM2A 3CHDA 3LRLA 3VNZA 4R27A 4MB4A 4WIWA 2WMHA 4AXNA 4MADA 5DT5A 3KEHA 5TD4A 4AD5A 4JHZA 2VUYA 3WH6A 3A3HA 2ZIDA 2BY3A 1CLXA 3AROA 5A6MA 4EKJA 5JUVA 2XGBA 3DHPA 4C7DA 4WSJA 1FH7A 6A3HA 4XZWA 4X0VA 2VRJA 4MJ4A 1MVYA 4ACZB 1GOMA 2FGZA 1QX1A 3BXWA 1ZJBA 1ITCA 1DWFM 3CZJA 2JIWA 2BVYA 1OBAA 2Y8VA 1QWUA 1R33A 2BY2A 2A3BA 4XZBA 3VOCA 4CN6A 2V3FA 2VRQA 3F5JA 3UR8A 1KBKA 2EQDA 3WY1A 1T0OA 4UOQA 2YDRA 1ZBCA 3ZMRA 1VFMA 1R47A 4GQQA 3AMDA 3T09A 5A94A 1RD6A 1LL4A 1JYNA 4ZEPA 4BA0A 2YLAA 5DO8A 5CXPA 3MSGA 3SCVA 4HZ6A 3MI6A 3OLDA 3QGVA 2J47A 1E5JA 3WELA 2WHJA 1BPLB 1QW9A 1VB9A 3FW6A 2Y5EA 2FHCA 1E40A 2OSWA 1G0CA 3IJ8A 4WKAA 3D4ZA 5IFPA 3ZO9A 2YBTA 3IANA 2GJRA 1WDSA 1NM9A 3AMCA 3L4ZA 5BXPA 1JYVA 3B9EA 2WK2A 4FLRA 1C93A 4C7GA 4KRUA 2W92A 2WVSA 3DX0A 3L4UA 1FP9A 1NWUA 7TAAA 3KWXA 2VJXA 3NIYA 5GNYA 1VFOA 4AEEA 1JGIA 3ZQ9A 1DEDA 2W67A 1X1NA 4KGLA 3MMUA 4XUYA 3PTKA 3PBGA 4JL1A 3EMQA 1LQ0A 4FK9A 5A8PA 3WD4A 3GXTA 1DWHM 2A3EA 1WP6A 1HJSA 1ISZA 3RM4A 2VR5A 2ZUWA 2JF7A 4PBGA 5DMYA 1B30A 3AXHA 1E6QM 1H49A 2EACA 2XN0A 3SURA 3MV01 3WNNA 1FFQA 1LWHA 1E1FA 3WY4A 1E4MM 3VGFA 1C90A 4KGJA 1KCKA 2V3DA 3CH9A 2ZUMA 2QPSA 2WVVB 4GZJA 4EE9A 3EDFA 5E6YA 1QNOA 2BS9A 3SCTA 3IAQA 4AZBA 2X0YA 2JE8A 1V0MA 4CU7A 1E4IA 1EIBA 2WYSA 1EDTA 3N9KA 3OGRA 3DYOA 3WH5A 4URIA 3AHVA 1PEZA 1TQSA 1J10A 2WHLA 4MNLA 1E15A 3W24A 1QHPA 1NOFA 2WVTA 3BAIA 3VMPA 3VGBA 3ARXA 1WZMA 4MNKA 2VZOA 4NRSA 4P7OA 3WY3A 5A6AA 2DSUA 2GDVA 1LLOA 7CGTA 3WEMA 3K8LA 2CHOA 4AD2A 3ALGA 1G5AA 2VL4A 3T2OA 2CEQA 5A6JA 2VX6A 3WMCA 3VO0A 2Y8KA 3BSHA 2E40A 4W7UA 2JF6A 5CQ1A 1UKSA 5E0CA 1BFNA 4CD6A 1ISVA 3VD3A 4EANA 2YL9A 3A6OA 2VZVA 1EGZA 1H2JA 3SUTA 5HBFA 2F2HA 1B3ZA 1CTNA 1EHNA 1PX3A 4PMYA 3QHMA 2NW0A 3OA5A 2O92A 5ABGA 1LL6A 3AHTA 4D6HA 4MTVA 5CGMA 1Q6DA 3RIKA 1HJQA 2DSVA 1BHGA 2WC3A 3TONA 4PUDA 1WDQA 3HG4A 1QW8A 4NZCA 3VM5A 3CLWA 2DT1A 5CGTA 1GOIA 2WMFA 1UWQA 2F1BA 3BUBA 3U7BA 2J7DA 1XC6A 5E09A 3FHQA 3GDBA 3BUDA 4TXEA 3ZOAA 3DX4A 2WBGA 3GXMA 3AXXA 1KGXA 2CHNA 2WMGA 5EMYA 4MNJA 2GJPA 5DF0A 3OGVA 1RP9A 1J0IA 3D50A 5D8WA 1LF1A 1TFVA 1SFSA 3ARYA 3CZ8A 1G1YA 1WKYA 1QHZA 4TUFA 3SCNA 3A22A 4J3UA 4D1JA 5I24A 4LYPA 2VX4A 4XX6A 4QDMA 4J3XA 2VZUA 4JFWA 4Q7NA 4JFTA 3IK2A 4U2ZA 3ZSSA 1GVYA 4PCTA 1UZ4A 2XM1A 4U33A 2VZSA 3SCWA 4UQAA 1QNSA 4NI3A 4UQBA 5CLWA 3H55A 1XV8A 3OG2A 1V6VA 4HPGA 4CD4A 5A8MA 2E8YA 4HU8A 4E2OA 4DUWA 1HIZA 2O9RA 9CGTA 5M03A 1PS3A 2F18A 1FHLA 3LRMA 3WUBA 3CZSA 4WLCA 1GHRA 5BXTA 1H3GA 3CZNA 4FLQA 3II1A 2XVPA 4PMUA 2X2JA 1AQHA 1TE1A 3WFZA 5A95A 1JI2A 4J3WA 1B31A 1MW2A 1W9UA 1V3LA 1V03A 3WFLA 2ALWA 3CUIA 2GVYA 3BH4A 4M82A 1CXFA 3VIHA 4H41A 3ARVA 2VT0A 3W0KA 2WMKA 4JKLA 1KR0A 3F4VA 4LQ1A 3POHA 4PSPA 5AY7A 2BXZA 5E0FA 2UY5A 3B9AA 1UKQA 3VIPA 2CESA 3QOKA 1JNDA 1UWIA 4FMVA 1HJWA 1WZAA 2ZOXA 2FE0A 1QNQA 5JIPA 3WF2A 2X0HA 4ZXLA 2XN1A 2WVVA 3AIEA 3GXDA 3WENA 1QI5A 3UEQA 4PMQA 3AISA 2NT1A 3VGDA 4HOZA 4CVWA 2HVMA 1V02A 1AQ0A 1E6RA 2Z1SA 4D71A 5HPOA 1XH1A 1XSJA 1UYQA 4RE4A 2VX5A 2EPKX 3BUIA 2X2YA 2WCSA 2YJQA 1C7TA 1R7AA 3L4YA 1OD0A 1B9ZA 2BHZA 1PZ2A 3RM9A 5IHSA 2FGLA 4CD8A 3VINA 2OSYA 4FNSA 3AS2A 2VOTA 4D6CA 3QR3A 5M3WA 1HP5A 1QBAA 3F5KA 1EOKA 2QV4A 1V0NA 3DX2A 3SCOA 4F79A 3A4AA 5CSUA 1RP8A 2BNJA 2A3CA 2DDXA 1KCLA 5EFFA 1ZB5A 1JNEA 4AWEA 2J62A 4JCMA 3WQ8A 3QHOA 1AVAA 4PMDA 4W87A 4GI9A 3M6DA 4CVUA 2D0GA 3D52A 3MUY1 1UKPA 5BYWA 1GOKA 1QPKA 3ARTA 2CCRA 1P6WA 1FA2A 3PTMA 3S5ZA 4FNQA 1G9HA 1UQYA 2ZUTA 1V3KA 1UH4A 3HU7A 2E8ZA 4W93A 1EO5A 5A8OA 5EBAA 5FKYA 1O6IA 4UZUA 1XH2A 4AISA 4J3VA 3N17A 4DM2A 5DT7A 4U31A 1E70M 4F9DA 2XG9A 1EO7A 1B3VA 3UETA 1JZ4A 2PF0A 3EJRA 3GTNA 3KL0A 4TX8A 1JAEA 3KLLA 1MYRA 1C3FA 2PC8A 2V3GA 1EOMA 1KQYA 1VIWA 3AZTA 7A3HA 2W91A 2DT2A 3NSMA 4UFLA 1KQZA 2PWGA 3ARZA 5D9OA 2OWCA 4DO5A 3AI0A 1B1YA 3BCDA 2J7CA 3GBDA 1U2YA 2G3JA 1EH9A 3GNOA 5JBEA 2CBVA 4AZ5A 1KXQA 4S3KA 3AZSA 3AYRA 3DECA 1MW3A 4AZCA 4A3HA 1ZBWA 1XRVA 2XIIA 1K9FA 1GOOA 3IGUA 4UR9A 4KH2A 3VVGA 5DEZA 3VD9A 3WH8A 3T2QA 1WCGA 1GVIA 3TTSA 3POCA 3PZOA 1M7XA 1BVZA 4K68A 3CPUA 4JKMA 1A3HA 3MMDA 1BG4A 4P7QA 1R7OA 4LYRA 3TP4A 1H11A 4QAWA 2E9MA 2HISA 3ZIZA 3WIJA 3ZSTA 4W84A 3UG4A 4V2XA 1IT0A 5HNNA 1TVNA 3DYMA 5C8BB 1Q6FA 3WD3A 2G3NA 1K9EA 1ZBKA 1B90A 2G8ZA 3VMNA 3DDFA 4Z2IA 1VFUA 3TTYA 1C7SA 4MAVA 2VO5A 3CHCA 4Z2LA 3CHFA 3BAWA 4W5UA 3EMCA 5A6LA 2X09A 1HXKA 1J11A 3PZVA 1ISXA 2JIEA 1UA7A 2J4GA 2O9TA 2WW5A 1HTYA 2D0HA 3WY2A 2AAAA 4DWSC 1Q4NX 4PTXA 5ABEA 3THDA 4B3KA 3CUGA 2WHMA 5GNZA 2C0HA 4JKKA 2A3AA 4UCFA 5A2BA 3WD1A 4D6DA 1K9TA 2X1IA 5D4YA 1BAGA 4TOQA 1H1NA 1VAHA 5E70A 2W61A 1DP0A 2ZX8A 4N42A 1ZBVA 4QLKA 2YBUA 1JFXA 2GK1B 2ZICA 1UWSA 1VFFA 2OWWA 4GI6A 3VGEA 3HG2A 4M1RA 3U57A 3WQVA 4GINA 1JD7A 4DO6A 1M01A 5A69A 3A5VA 2ESCA 3O2LA 1E6XM 5ABFB 1UH3A 4YHGA 1JZ5A 2NSXA 3K4DA 2QPUA 4CCEA 1J18A 1R87A 2YDSA 4MNMA 4W7WA 4GKLA 1D2KA 3VSUA 2PWFA 3MV11 1JDCA 4H7VA 2IXVA 3W27A 1I75A 2CITA 3AIUA 2O9PA 1MQRA 1EDQA 2VI0A 4JL2A 1PJ9A 2VTFA 1C8YA 4ACZA 5IFTA 4A4AA 4LX4A 3WF1A 3GXPA 1JAKA 4JCLA 1DTUA 1BSIA 1JYWA 3MUIA 3GYCA 3LMYA 5A3HA 1QOXA 3BUQA 2D2OA 3W82A 4MB5A 1UUQA 1I1XA 2JEPA 2WVUA 4LXFA 3LPGA 4HZ8A 5I3DA 4GO8A 1CBGA 3UG5A 2OYMA 1H4PA 3PZUA 1B3WA 3A24A 5BRPA 1AMYA 3VDAA 3BAYA 1GQKA 2O9OA 2QHAA 3WDPP 1W9BM 2CNCA 4HP5A 1XGZA 1NP0A 3VIIA 3U5UA 4WKFA 3GXNA 2ZX9A 5CSYA 4P8XA 2ZX7A 1US2A 2XWEA 1CXKA 4H2CA 5KZ6A 1E71M 3AIQA 2FHBA 4M24A 1CYGA 2GK1A 1H41A 4TVDA 2EO7A 1UKTA 5E1QA 4D6GA 4OKDA 1GONA 3HMCA 2PBOA 2VNCA 3BLBA 1WB0A 2WKGA 3ECQA 4CD5A 1TR1A 5GQBA 3BC9A 5GPRA 1QNPA 1V6UA 1A47A 1HKIA 1VRXA 3WBEA 3SUSA 1GJUA 3GNPA 4UFJA 1SZNA 1UWUA 5AC4A 1W3LA 4Z2HA 3NCOA 1V3JA 1V3MA 2F7PA 1BGAA 1J0HA 2XUCA 1CIUA 4Z2JA 2X05A 4BCEA 1MFVA 1US3A 3ZR5A 3BAJA 4UNIA 2VCAA 1WDRA 2VURA 3VIOA 4AZIA 4GO9A 4P8VA 4JAWA 1HL9A 2DT0A 1CGUA 3EBVA 2XN2A 1PPIA 5HPCA 2BXYA 4BQ5A 2CBUA 4BQ4A 5ECUA 1EQCA 4LGXA 3GH5A 3KL3A 4HU0A 1CPUA 1R85A 2J77A 5HDRA 4PMXA 3A23A 5D9MA 2B31A 1SYTA 4V28A 2A3HA 3EJPA 4W89A 3DHUA 2WB5A 3I3EA 3ARUA 1M04A 2EXOA 3N18A 4DWSD 3CZKA 3OLEA 4D72A 3I3BA 1C91A 1WPCA 5ABFA 3U7VA 3CUHA 1MXGA 4CN1A 4MB3A 1MFUA 1BQCA 3AICA 2WLYA 1TA3B 1S46A 5A6KA 3CV5A 3EDKA 2WCAA 3B8SA 2CBJA 4OOUA 1TQVA 4U5IA 1Z32X 3T0BA
chains in the Genus database with same CATH superfamily
1LL1A 2Y85A 1KENH 4PJ8D 3RVWD 4KO9A 5IGXL 2IPWA 3OVUB 1F4XH 4PEEA 5AG8A 2CBOA 3ZMEA 1W5NA 2TSYA 1NL0L 1L9TA 3AQZA 3HE6C 1L3NA 4JKPL 1H7OA 1IZKA 1LG2A 1KO0A 2BO0A 2ZT9C 4U1IB 5TBOA 3GVQA 1AE6L 3G5YB 3GBNH 2NXYD 3Q43A 4M9OA 3RX7A 4AYFA 5A2KH 3ZTDC 3FB8A 3UP6A 3FBQA 4ZFOB 3KBMA 2VCCA 3OKEB 3ETBJ 3ZW3A 3PJXA 1FWDC 4Y4FD 5IVXA 2H8XA 5IVNA 1W9DM 3E0LA 3NFNB 4TV3A 3QHZL 3F3HA 2XZAL 3N29A 5C9JB 2LLNA 3QPXL 5FEXA 2D22A 3GO1L 4NP9A 1NCJA 1BQRA 2UVFA 1DSFH 3F7QA 3SJVE 4E41D 4S10A 2X4NB 1W6LA 4PJXE 1E4WL 1XIHA 2Q3OA 3TKFA 4ZK8A 5I2UA 3G5XB 4PRPA 4Y16A 3CHVA 3NZHL 4LL1A 3IJEA 3MCKA 1XGUA 1FFOB 2XGIA 3JUGA 1W1VA 1SR9A 5D2LB 1A6WL 5K59F 1A80A 4IOSD 2SEBB 3ZDWA 2R69L 4HWBH 4Z7NF 2E9WA 1BLIA 5ICZA 1QRNB 2ZAIA 4P3DB 3IUIA 2EH8L 1Q4WA 3UGRA 4BHYA 1K8DB 5IT2H 4LS2A 3SUVA 5JIWA 1AL8A 1N8ZA 1E90A 4G6ML 4PI2A 4ZD3L 4B97A 1BEXA 5ADPH 2N56A 1A0QL 4FJZA 2YMTA 3LRSA 1AXSA 3S34L 1UR9A 4OFVA 4FS9A 3LUTA 4K3DH 3QA3A 2Y24A 5CSGA 2NXZD 4YBLB 1KLZA 3RGBA 1W72H 4ZMOA 4P99A 2E9GA 5LGHH 2ISFA 4M51A 5AHEA 1VP5A 2C9AA 1A4JB 4KO7A 3GSWB 1NANI 3URBA 2IJ0C 4ZFGH 4P46C 1TV4A 2J74A 1MI5E 3WTWA 4Z7QB 4Q4KA 5T91A 1IGIL 1S1PA 1G0DA 2DEPA 3PBUA 4J1OA 3U25A 3NFSL 4U6VH 1DVXA 4JHOA 2EC8A 3MJWA 4DPAX 3SDDD 5JOPD 1ONQA 2RFXA 3ZDXB 3PREA 2CA4A 5D1QA 1I3UA 4NAQA 2XWJB 4UQDA 3DFOA 4XN7A 5D38A 5CC5A 2HFFA 1G9NL 3QNFA 4IJTA 4QXUH 5FK9A 4F9PC 3OO2A 3IDIB 3FOMA 4KZEH 1T20B 2LVEA 5E4EC 1FUYA 2E6FA 4WK2B 2NLYA 2VLRB 5HDBF 5T5NF 3S2AA 3RU6A 1AI1H 1Z6JT 3F5WA 3D30A 4RWHA 5TK4A 3CSGA 5H8UA 4U2YA 5D2NB 4HJFA 4M80A 2Y7GA 4B2DA 2Y5SA 3UGXA 4DKFH 3GKZA 1RCXB 4JQ3A 3CQQA 4O14A 2UY6A 1IL1A 3TIDA 3KXFE 1XG3A 2GAZA 4PJDB 3RM8A 3O63A 3VCCA 3W7OA 4Y19A 1K9DA 3WN5C 3GHSA 3UMNA 5D8JL 3CN3A 4V1DD 5AW3B 5A43C 1DQMH 1H0GA 4KS0A 1W17A 3P4MB 4ZAKB 5LN4A 3MWCA 4D9PA 4AAJA 2W9EL 3MV8D 2XZAH 2BXVA 2V2CA 3F2BA 4NXSA 5T1DL 3LEYH 3CCHA 3TX9A 5DFVC 5F21B 3WEBA 5TGBB 4ZQOA 4NQDE 1P53A 2X5PA 3ARBB 4XI5D 3V4PB 2O6DA 2R8SH 5EEUA 4IJ3C 4JR9H 3BZ4A 4PLJC 2J8OA 1XVSA 5D2LF 2ITEA 4F3HA 3O9NA 4AWSA 3KPOA 4IMCA 2H5UA 2E46A 2X6MA 4OZFB 4F0RA 1EP1A 5G4WA 1M65A 4PJCB 3TEUA 3SDCD 1CDGA 3VDHA 3TA3D 5CCKH 2PXYC 4I0PA 2FIKA 4ZSOA 3ZUCA 2OMVA 3WIAA 3LN4A 3TQPA 3RL1A 3G5WA 2CU9A 5JOEA 1V3IA 2R2CA 1KJ3L 2JI1A 3ZKNC 1OAUH 1KYAA 1I1RA 1K6AA 2VGGA 1YMME 2CLVA 4HWBA 5DJZA 5FJJA 4CCZA 3CH1A 1AAJA 1MFEL 3FTSA 4N5UA 4AQLA 3ERXA 1R75A 4KKAC 4RISH 1OLLA 1ZIBA 3L5IA 3DCPA 4DYKA 3P9LA 1R46A 2WBJC 1T83C 1RLCL 3AGVA 4O15A 1BVOA 1FG2A 2NX9A 1SN2A 1CD1A 2MQ0A 4GAGL 3IIVA 3S5OA 2C7UA 4AXWB 5FR3A 2GGHA 1XYAA 2QQKH 1J8HE 3DO4A 1V6YA 5G4OA 4FFWD 1E28A 3CVBA 2I17A 1ZSXA 2Y1AA 2QW5A 3L9BA 1LWRA 1DJHA 4PE8A 1JIBA 1CW2A 1XF2A 4NCC1 5DC2A 1PSKH 1SHSA 4YHLL 1RZIB 5K9QI 1AD0A 3W00A 2Z31C 5ESVA 1JZFA 5T1DH 3D9AH 3VFPA 1J93A 4LLMA 2DSKA 1PKNA 4N90D 4OD1L 2VXQL 3U2CA 4NHCL 4F8XA 3SYPA 3S36X 5J57B 2KAUC 3ABXA 4LS1A 4H9MA 1NCDH 4W4OC 3ARDC 1MXSA 3GSOA 1TZHB 3GS4A 3H9SA 4ZMAT 1XINA 3HMWH 4GY1A 3STFA 2E9BA 2GUOB 5D7SL 3BUPA 1UD3A 3O11A 1EEZA 2OKMA 5CJMA 3PDDA 4LHUB 3PHQB 5DRZA 3W7NA 2MNWA 3BGAA 2P80A 2VABB 4YS4A 5HPMB 2J79A 1EJ8A 2HPMA 1FG9C 1KT2A 3QIUD 4NFCA 3TBYB 4XPTL 4UTAL 1DQUA 3K4ZA 1U93B 3NZRA 3FO0H 4OFQA 1T4KA 3S36H 4IIEA 2W0KA 4I9TA 4PMOA 1J2BA 3P0VH 1YDOA 2CNYA 2NNAB 4DTGH 4E2BA 1E4LA 4WJKB 3N2XA 1AD9B 1WICA 1WV2A 4ZFOA 3IMBA 4K7YA 3FS9A 5HA7A 3RBGA 2X2UA 3IMSA 3LZPA 5GZOD 1HJVA 4KRPD 1I2OA 2N01B 4W4NA 2ISWA 1B4JH 3QZEA 5L8JB 1UM4L 1W8SA 1EX0A 1UJ3A 5FECB 1DWJM 12E8L 3G6AB 2AMUA 2ZWZA 3QHTC 4GXUN 4LLAA 5IBLC 2UWFA 4JLRA 4JFEE 3MV8E 3AXMA 4YXGA 2RGMA 4NIKB 4UOJA 3BQUD 1R2TA 4GG6F 3SY0B 1S7RA 1BQ5A 1JZGA 3TZVD 5KVFL 2EPLX 4ZW3A 3BGGA 4J3OC 5C9UA 3QUXA 3V0WH 2AJSH 1I1WA 5TTRA 1A5AA 2QR6A 4EAEA 3O6LL 2E67A 1YYAA 2Z1WA 3TFKC 3UG8A 3BD4A 4GQ9H 3G6JF 4OJFL 5GGSY 1EBGA 1H1ZA 3H9SD 3CMOL 4L9YA 1CD0A 1G4MA 2BDNH 35C8L 3F7VB 5D9NA 3J7HA 4ZMZA 4EDXB 1F4YL 3GU9A 4XMUA 2QPDB 4Q4PA 2VWEC 4F58L 1N8ZB 5FI8A 5CEYB 4Z3FA 4OFKA 1SVCP 1R3HB 4DPCX 1BXXA 3IJ7A 3SYAA 2DLEA 3RCYA 1X5ZA 4UAHA 2XJLA 1VSCA 3GBMH 3B43A 3S35X 2PI6A 4HCLA 3K7UA 4TULL 3DGGA 3FN9A 1INQB 1KBBA 1GHFH 3M8OL 4M6NL 3HV9A 1N67A 2DH2A 2DQEH 3DO3A 1XUZA 3MYJB 5CHNA 1QO3B 3N1MC 3E6EA 4ICCX 5AAWA 5I6LA 5DJ0B 2CKRA 2H9GB 1QFWM 4D8AA 2ESVD 4FAAB 3G1XA 4BE5A 5G1TA 1C1EL 1P7QB 1BOGA 4FI4A 3S35L 1M5WA 3PB0A 5GZNC 1C9DA 3II3A 2VDOH 4OF7A 2Q7YB 4UFMA 5LN8A 1B4LA 1BZDA 2K8MA 1IHIA 1NFGA 1N7MH 3Q9QA 2WMIB 3GG7A 3G9AB 4B15A 4G1KA 4RFNB 2C1IA 2VDLB 3DERA 3S5LG 2V81A 3GMQA 2KLTA 1KKRA 1NWPA 4QDMA 5HHOE 1R3LB 2E9JA 5IJBC 2X1TA 1PHWA 3QDGD 1WTLA 1CNVA 3TA3A 2GJ6A 3HPZA 1P6FA 3IV3A 4JQVA 1IEAB 5F7BA 5KSBE 4EP8C 1SJHA 3DMMD 1JRHH 1OD9A 3G08A 3EOOA 3TVMD 5CJ8A 2CO6B 4P4KA 4LSPL 3X3FL 2FR4B 3OJGA 5FHAH 1EBAA 4JM2A 3VXTB 1PZSA 4YHNB 5KBNC 4OH2A 2AS5M 2XJ7A 5EMUA 1FNEB 3GB7B 4IU2A 3RLSA 4WSHA 3MVIA 2XI9A 5IJKA 3TC7A 4WEBH 4KI5D 2MEJB 4AQ1A 5CN2A 3KS6A 1GIGH 5DSCA 1QSZA 1RVFL 2KKQA 4GS7B 1E6ZA 4B5TA 1WFOA 4D6IA 1AP2A 3QWNA 4I5UA 4IMGA 1ED3A 4QR7A 4DVRH 5AVQB 1ZZMA 2ZXBA 5CMAA 5D93B 1H60A 1Z5YD 2BGNE 4GSXA 1XQKA 4PVMA 4PUEA 1ES0A 2UZYA 3ZE1B 4KI5C 4Y19D 1F45A 5D1XE 4S2BA 3O3BA 3NPWA 1AZUA 3ZK0A 4Z0SA 1MQKH 5C0IB 1AH3A 1YTDA 1JWUB 3ULUL 1MRFH 4AEIL 1C8QA 5F70A 4QRFA 4ZBJA 3CNYA 3DOHA 2AP2A 1XIFA 4X8JB 3KLHD 2BNUA 4HK7A 5I6XC 1NCAH 4LUSB 3HC0B 3O4LB 4O02L 4L61A 2DL2A 4L1GA 1BWWA 4KC3B 4RFEB 2DTML 1NSJA 4ISVA 4EDWH 2VQTA 2Z92B 2XHNA 3L3KA 4EUPG 1V7YA 3BARA 3C2VA 2R1XB 4H8WL 5KVDH 4QDWA 4WKHA 5G5IA 1PIGA 1UENA 2ZG1A 3GUGA 1WGVA 4H8HA 1FSKC 2R2HB 4JPSA 4WEMB 4HMCA 2WM0A 5D6CB 3CHEA 1ISYA 4KUCD 3VUPA 1SBBA 3K4AA 5GGVH 5FACA 1QO5A 5CG7A 1DQTA 1SJMA 1N70A 4P7NA 1VEMA 4YDZA 4ZO8A 3TU6A 4IRZA 5BRZB 1ADQH 3PABB 1J0ZA 4LUSA 4B5VA 2FO1A 1OK8A 1VZWA 3BVNA 1Q7QA 4HKBB 3KM8A 3TYBA 2M1KA 1PNCA 3T77A 1CXHA 1B9BA 1N19A 4TVCA 4GEIA 4QNPE 1F4HA 4GUCA 2HQAA 4OCRH 3BEVB 1PWMA 4O8RA 3DTXA 3GFXA 1RUMH 3ZE2F 2VZTA 3BXNB 3NEOA 1GOFA 1E4JA 2WWMC 4J6RH 1JZ3A 2GL5A 2TRSA 1Z2KA 1A66A 3A9IA 5DN1A 2C3GA 4PCKA 5EN2A 2KQMA 3NQBA 4XVDA 2X3CA 3V5CA 4AQ8C 4G9PA 4PJ7E 3O8XB 4B5EA 3NGJA 1YYCA 3LZQA 4ELME 1GW6A 1G01A 2DKMA 4GKSA 2AQRA 3KTSA 2J8UE 5ENLA 3SB3A 4XVSH 4E41A 4TOYH 3UTOA 2OJPA 3EKZA 4XV0A 3AQUA 4J3OD 3WN6A 2V5BA 5XINA 2X7WA 3H6OA 1KB9K 3ZJ8A 1P5VB 2PWHA 1XO8A 2VRAA 4ZFFA 1EQPA 1NCIA 1SY6A 3ZRSA 4H0HB 3I9GH 1QNZL 4NI6A 3E2QA 3UCDA 4LK4A 1H15A 1ZD6A 3BIKB 2ED7A 3SE3C 5CM1A 2VSDA 2JK2A 1T6VN 4J3OH 3BH8A 3WQ6A 5SWSD 1CGWA 3DFYA 2G3IA 2P9RA 1E6PA 2HLFC 1LK3L 4PTVA 3U9UA 3UJRA 4GRSA 3TROA 2HKAA 2FZBA 4I7WA 1CDJA 3D39B 2XWDA 4C6OA 1IKNA 1SQ2N 1L9OA 3L17A 4DKEH 3F4CA 5LA1A 5I30L 1M6OB 1ZLSL 5HHPA 1FYTB 4H00A 5E2WL 4WF7A 1VLWA 2F38A 3BKJL 4LBUA 1OGSA 2AEOA 2AV7A 3W6MA 1VH7A 5CJBA 2ZG2A 4ZGYA 3AS3A 4TVPE 3SDOA 1DJXA 4QGTA 5ITFB 2OWXA 2ADYA 3KZSA 1EF3A 4Y7OC 4PP2A 4F80A 3OAUH 3DGGB 3IGHX 3NYDA 2VZ1A 5LCVH 3NDYA 1V6WA 3P0XA 1XMEB 4BD4A 3ZR6A 3L4TA 3CCHB 2HG5A 5TF1L 3BZDA 1BGGA 1Z5LA 5CP7B 5IBXC 2Z31A 4Y1SA 3MPCA 4XWGH 5FM8A 3E0WA 3O0KA 1OLZA 4GH3A 1E72M 2NNXA 3UU0A 4DPBX 3WD0A 5I1JH 5H35A 2X9YA 2ARJB 1YW1A 5D7KE 2FATH 3NACL 5J5RA 3PL6D 4U1HB 4PUMA 4HFWB 1E4XL 3A4FA 2D0FA 2E56A 1GZJA 1O95A 1F4YH 3NZGA 2ZRYA 2HXUA 2WBJD 1HE7A 2WXQA 4IQHA 1AR1B 1M03A 2JJUA 3U7AA 4ZCWA 4P9HC 4BK5A 2CZ5A 3BGFC 1UD2A 3OMIB 1NCTA 2DZPA 2LTQC 1JVNA 1W1ZA 4NI8A 4U6XA 4DBSA 1RK5A 1CE1H 2D4FA 1YLVA 3QB7C 5KN5B 4OF5A 1WNOA 3PL6C 2VSKB 4B5UA 1Z0NA 2DLFH 3GR7A 3T65B 3UP1A 4X4YB 2HDJA 4IBLT 2IUZA 4DKEL 4QNEA 2CO6A 3G8RA 3FBKA 1FFNB 1UM4H 4R4FL 5KVGE 4N2EA 3ZHDA 1LROA 1ML0A 1ZIAA 1O7DC 3KFTA 1T7XA 5ANMA 5ECGA 4JQ4A 3A12A 3SQBA 5BU9A 4AZ6A 2MHAB 3FKKA 2XPGB 1MQKL 5FO8B 4M7ZC 1Z9SB 3ZHNA 1KGCD 3KEDA 3QORA 5F7EH 3UYPA 3NJIA 5JR1H 4J2PA 4XTRC 4ZNEE 1K4GA 4YAQA 2OTDA 5KINA 3EJJX 1A1MA 2NW2A 1Y6NR 1LTDA 2WSPA 3VXUE 1TCMA 2XA8H 4LAQH 1A7NH 1DEEB 3OMNB 4LHUA 1U8JB 4HBCL 4HH9B 5DVLA 2FJSA 2E1DA 3E5BA 4MDOA 3IUDA 4WJ8A 4Y7EA 3WE6B 2LAGB 4IMKA 4XVSL 4R7OA 1WFTA 3D0LB 2NTSP 3TC3A 2XYCA 4WW1A 4MKNA 4X4MA 4FOMA 1U5VA 2I57A 3RO8A 3TT3H 5J1AB 4UB0H 3GMOB 2QJJA 3SKMA 3V52L 1ZPUA 4TUUA 3N1AA 4R9OA 1CWVA 1GW1A 5BMWA 1PCSA 3IT8D 5F7HA 3W81A 4XMTA 3XISA 1TJPA 5GS0H 4AVNA 3ABMB 3SKNA 1EZVX 1AY1H 3L68A 2AQSA 4KFNA 2JQZA 3HTLX 3MNWA 4K6AA 4HMNA 3UJ2A 4N3UA 1WA3A 3VKKA 3DX6B 3KVDD 3MMEA 3W83A 3WQ5A 4HALA 5SX4H 1MIEL 4L3EE 4ZX6A 5AECA 4PJEA 4O4YL 1CS6A 1AYOA 4AKQA 3T0WA 4WFGE 2O5YH 1TU2B 1XH0A 2N7BA 5IIEB 1INEL 3H53A 1T1YB 3MV8A 4PS3A 1EZUA 3V0EA 4S3AA 5HI3D 4ZQKA 1RJRA 3GWQA 2BRRH 1ND0B 4FMFA 5JYMA 3QAQA 5T33L 1H3VA 2YAFA 3D3VA 3IFLH 4JFHE 3AFBA 3HMXH 2PGEA 1RLWA 4KQ3L 4FIQA 4P2OB 1DWGM 4Z2GA 1AIFB 1F6AA 2DQEL 2DKUA 3VJ6A 5EU6B 1OP3H 5MENE 1UZHA 2DQJL 1RZPA 1MIML 1G6RL 3PR2A 2OMBA 1FUNA 1QHOA 4OGXH 1Q90A 4X4XA 1YEIH 1AH1A 3TPUA 1FWWA 1MQQA 1M53A 2YSSA 3O9WC 4J2XA 2FIQA 4KVCH 5AW1B 1U83A 2ZA2A 3NO5A 4HYVA 4PJ8B 5B1BB 3L6FB 1QTWA 2HFEB 2G41A 3KYAA 4F8LA 1SYSA 4X6DF 3BK0A 4UQCA 4EI5A 2Z1XA 3GFUA 1OCWH 4XVJH 2O61A 4RSVA 3FT2B 3L1FA 3UZQA 3ORJA 4R5XA 4LVDA 2OXNA 1BXBA 5DR5L 3S5LB 1OF6A 1GQJA 4POYA 2JIXD 2XIBA 4EK7A 2VDKB 3B5HA 2ZDRA 5H37G 2DIBA 3O2VL 4NUMA 2FPTA 3QDMA 1JRBA 5I6PA 1DVYA 4P2OC 3NSYA 1JCKA 3RTQB 1OK0A 4BWLA 3FONB 2KBGA 5AB3A 4XGZA 1HYSC 4UTUA 1F3JA 4DRSA 3UXFA 2ODIA 2PE4A 2OB3A 1XWVA 3TMQA 4Y1AD 3ZVHB 1MQ8A 5CCJA 2FPVA 4PTWA 1NA8A 1XBDA 3NPVA 5CBIA 3NJNA 5F9JB 2OBGA 4FFZH 3CFNA 3W7CA 2TPSA 4YNYA 3AJ7A 4N6RB 1MN4A 1KFEA 3Q1SH 5LO7A 1T2XA 2NNAA 1FYTA 2CK2A 1E65A 4UM8B 3VIFA 5B39G 3HE6D 4HJWA 3TZFA 3QH3A 3T0EE 4IRSC 4ACTA 1PKMA 3Q8EA 5DYOB 1LEKA 1XIBA 2YA2A 3VK5A 7PAZA 1OOWA 1VQTA 1UXSA 4MNQA 3TM6A 3PG8A 5C9KA 4WW2A 3UZEA 4QRUA 5AAMA 2HZHA 4WI3A 4LO9A 5BNXD 1U8HA 3T8MA 1Y1DA 4LSDA 1QG3A 2YD0A 3O3AB 1JDAA 5EU7C 3OYZA 3HHSB 2WO2B 4FE9A 4ZTPH 1W15A 2KS0A 3HR5B 3ZDZB 4A6YH 2OL3B 4XNAA 1TVDA 3L5LA 2C14A 4XXDB 4NHUA 5I0DA 3SGEH 1CLZL 5E99H 4K3DL 5F7KC 3V4UH 5M17A 5L6YL 2CXGA 4GAYB 3R06B 3OAYH 4RX4D 3VWJA 3BZEB 4FP8L 3R0MA 4TO8A 4ZUVA 3WNMA 4HKJB 1YECL 5DJ6B 4CMHC 1PLGH 1RUQH 1S2AA 2JH2A 3MU7A 3ESPA 4OGAC 1RUKH 5FCUL 2AITA 2G60H 4R96A 3BAKA 1N5YL 3BLEA 8CGTA 4QRUB 4AYID 4PJFA 4PREB 4TNWF 4UAOC 1X9LA 3E7JA 5KUMA 1ETZA 1PZAA 4HJJH 3MLZL 5IFHH 5EZOL 2OR2A 4PC8A 2QTEA 1MCIA 3BMWA 1SM3H 2WJFA 5HHOA 4DWSA 5TJWK 2R83A 3DRTB 2PPDA 5C0CD 4CJ1A 2DQXA 1ORSA 1P4LB 2R1NA 1J5HA 3PTDA 3EAKA 1FFNA 4HB7A 5C0FB 1Z9OA 4PJEE 3ARFD 3ZL2A 5LWYL 3LH2H 4UQ9A 1FO0H 5EOTA 4MVBD 1BXVA 3NK3A 1UHVA 3CT7A 2PPCA 3BLDA 3VZZA 4RZKA 1U2HA 4AQZA 1I6NA 2ZYIA 3V0JA 4ORMA 2DIEA 3W1PA 1GKQA 3KWWA 1YYMH 1E2WA 5F0JB 4DETA 3QQ1A 4Z3TA 3CVHH 1IGYB 3QR1A 4YYCA 1UR4A 2R1LA 1OQXA 4PY7B 1A2YB 1O5KA 4GUFA 1DBBL 4XP1H 3RVUC 2DUAA 4P05A 4IISA 5DWUL 3WLRA 4G5ZL 5GJSH 4D6FA 4Q14A 1W2KT 4HKJA 5DJ6A 3W53A 4JKPH 4FQQA 1UD4A 1IB5A 3DXAD 3TJHC 3GHTA 4FPSA 4Y6GA 3CO4A 2AVFA 3KGSA 3GXFA 4PLKC 5AVWB 1CU4L 1DANU 4NNPL 5F7FA 3V5DB 3AU2A 3M5VA 4XP9H 4KKAD 2YQ3A 1O7AA 3PU7A 1HCFX 2EDKA 3DOSA 5D9SB 4IZGA 3MLYL 5CKSA 1M6OA 2JIXA 4JDTH 3DUHA 1J9YA 3CZEA 2YL6A 2QPXA 3MI3A 4IT1A 1IGYA 5J11C 2VGBA 1KIRB 1S9KC 1VCAA 3EWDA 4IP4A 1JGDB 2XWZA 4LSSH 4NZFA 4PUBL 3WLMA 3VE7A 4M8QB 1P5BA 3O16A 3UAEA 4TS6A 5CMAB 1CENA 2QMKA 4DH2A 2CBMA 1S8DA 3UADA 1HVQA 3IFPA 3CFMA 1KCSH 1FFRA 1JZJA 3EUDA 4JFYA 5IMLA 3KBSA 3BHBB 4C4BA 4LSQL 4NQXA 3B2VL 2X4PA 4YL9A 5KYUB 4IQLA 2I27N 2C9SA 3NFSH 3RUGE 4K1GA 3BIAX 1AKPA 2BZDA 5FWRA 3LZ5A 1HHIB 4RDBA 2B0SL 5EC2A 4QCEA 4JPIA 4QHKI 4PJXF 2PF6A 3TC9A 1RALA 1GG1A 3D69B 4WI9A 4AIUA 2OODA 3GTVA 1EZVY 5DO2D 2FH6A 2ICEB 4B9IA 5D5MF 4AM0A 3BO9A 5I78A 1M1SA 3P30L 3JT2A 4K8RD 4DPRA 1TLMA 3RIFF 3ABKB 1KLGB 2H1PL 4KI5E 5D1XC 3SBWA 3NH7H 4H9VA 4KWOA 4K5NA 3CXHJ 1NC4B 5C2UB 1KTDB 1S7QB 4E8GA 1CK0H 2GEEA 5LUMA 3ITCA 3T42A 3AHXA 5FF6B 2G4GA 2VWEE 3T2PA 2HS6A 4H9YA 5A1AA 4U1HA 4JY5H 1P84J 3IE9A 3P4NB 1W0VA 3LZNA 4W9KC 3RWHB 2KX9A 3DARA 4A6YL 1E4WH 3N12A 2MQ3A 4GRWE 2OTUB 4U0RB 3ZE0F 3WNOA 5CBAB 2WB7A 1CLOL 4TQ8A 3Q37A 4LPYA 3MUUA 5B1CA 3F6LA 3QDHA 5EOCJ 3QXAB 3UPMA 3TJIA 2XFXA 1NKOA 2ZUUA 2KDYA 3C6LC 2DZTA 1WSST 1Z3NA 1TFPA 3VB9A 1P48A 2GI0A 4MGGA 1T6WA 3NCYS 2D2CC 1A6ZB 5GRUL 5TE6L 1ZT4A 1EFZA 2VX7A 4P3CH 3PZTA 4HK3J 4QEHA 1IGCL 3TCSA 3VE9A 4C1NA 4F40A 1U6AL 5ANMB 5EZJB 3O6FA 3CK0L 3QY7A 3ZTNH 3BDYH 1JFHA 5F3BA 3MRMB 2Z35B 2MMXA 4H0GA 3IAGC 1QTYT 3CTLA 1CD1B 3SKMB 4I48A 4Y5XC 3O0FA 2HJKA 1TYRA 3FT4B 2VMJA 2C1GA 1C5CH 2WP3T 3IIXA 4AIXA 3UO8B 4ALDA 4Z0XB 3E96A 4PMNA 3GVWA 4BZ1L 5DQJA 1OAJA 2X4RA 2K6WA 3QI9B 3O2DA 3IGAA 5J6GB 5C9XA 1NJ9B 1D5ZA 4B7IA 2I16A 4AGNA 1VFHA 3BO8A 2QELA 2C91A 4I7UA 3DV6A 3C6LB 2BOEX 1E9QA 1NAKL 5FLVA 3U30C 3IVTA 5FUOL 1A21A 5KSBB 3VXUA 5IR1A 3H23A 3Q94A 3OG4B 4H8NA 1V0KA 3T4CA 5I3HA 1F2XK 4PPTA 4ZMPA 3P74A 4ABVA 2NT0A 5IK3B 4F8NA 5IHUH 4Q8WA 3D4GA 4QI3A 3C9NB 5I8OL 4ZZ9A 3WQOA 1JCMP 4HT3A 3D18A 1JK8A 3WNKA 3X1EA 3OR7B 4IBUA 1GTEA 4MMXA 4DZAA 2RDUA 1EPVA 3BDXA 4WWKA 3CZFB 1WX0A 3D0VA 3PWIA 4S3FA 1OWQA 3KPPB 3MS8A 4JE4B 3RWGA 1N82A 1BD0A 1SJEB 1JFQH 2AQNA 5FO9A 1LLZA 1DZBA 2H32B 3RVTC 2CKSA 3OR6A 4GEJA 3IVKB 2J78A 3ANYA 4AY8A 1YPIA 1HCZA 1OQOA 1RIVL 1CFVL 3IMWA 5L8LB 4J27A 3ET9F 4L3EA 2R0KL 3CBRA 4XCCH 4YXKL 1HOCA 3PC0A 4F8PA 2ITCA 3PXLA 1FQ9C 1NWTA 3BZ5A 4O1AA 4NPYB 4G7SB 2NVAA 3TEZA 3H9HA 3RUGB 5L7XH 2OR9H 3BQUA 1BFTA 3QDJE 3KYMA 4ODVL 4NDMB 2YXWA 1A25A 1XGTB 1UWGH 3UX9B 2J1YA 1A3XA 5E9DD 1U5JA 1XW8A 1YPFA 1ZP4A 5B39B 1BGXL 5AZUA 2NY3B 3IJHB 2CLIA 4XTIA 1KLUA 3DDGA 2GJXA 1G7PB 2R82A 2MSPA 4JFVA 3OC8A 1QLRA 2DH3A 4M8UA 4UTAA 3RI5F 1ZUAX 1FCBA 4MAZA 4X5WB 3NOEA 3X1NA 1HZHH 3MODH 4KTDL 1ZT1B 2EDOA 5EPDA 2YARA 2FIKB 2DQUH 4KJQC 5F3FA 5B22A 3RLVA 4K3JH 3TH2T 2YGQA 3VX0A 3EDEA 3U1SL 3TT1L 4YLCA 1TZ9A 5HMEA 4G5DA 1DZ0A 3UBPC 1QFWI 1ZSDB 3EF7A 1L2UA 2EZ0C 4YH6A 1M9WA 4BQCA 1MHHB 2NVCA 4NRYB 4RNHA 4Z1DA 2Y7OA 2D24A 1ZTXE 4QAMB 2CW6A 4NZ3A 1SM3L 2PGRA 1A8ZA 1WA1X 2EBNA 2GUYA 5FOOA 1U8OB 1W9VA 4JG1L 2OX5A 4I9AA 3S6TA 3O3AA 1FFPB 1OSZB 4ZOEA 2D9CA 1QBBA 2Y2WA 3M4HA 3BKMH 3I85A 4ZNEA 4NO2B 3KYMB 3RPKA 1TUFA 4J2MA 1OC6A 3KR3L 4N2FA 4AMXA 3P5ZA 3UY8A 5BRZA 2ZWYA 3L2MA 3BAEH 1RUML 2WBXA 4TF4A 4Z1PA 2VZ3A 1Z9NA 2Z1BA 3DFNA 1JCYA 4YPGA 4JO4H 2DQIL 2J6EL 1I0BA 3U9PH 3T6ZA 3MRQB 5HHMD 2FR4A 3QV9A 5AC6A 2NNFA 4IFOA 5DHEA 1S7UB 2EEDA 3LAFA 1EEZB 2AXJA 3U0HA 1CJYA 2DQMA 4N0YH 3T0EA 4Q8UA 2GQHA 4PWGA 3E2VA 3KOYA 1YEFL 2BJMH 4AQEB 4TTGA 1OE2A 1JVOA 4XO8A 3DGBA 5FJIA 1EC9A 5ADOL 4M3KB 4QYOB 1QRNE 1SEQL 4JIEA 1XF5A 3TLRA 3GC2A 3ZYIA 4GBXB 4B95C 5GS2H 2VP8A 1NDMB 3OKLA 4KX8A 1FHGA 4WU7B 1HGYA 2FZ3B 1S9VA 1WS7A 1VS1A 5D55A 5L0QB 3ATYA 4APQC 1F8TL 1SHXA 1WHOA 4HHGA 5F6IC 3PGCA 4N9OB 3UPWA 3ZWSA 5EUOA 3O3BB 1UQSB 1OAZL 4I1RA 1CLVA 3C2AH 3CMGA 3MOBL 3NSXA 3SJVB 5FDWA 1HK6A 1S7UA 2I60H 3UJIH 4XNXL 2FYYB 5D4HA 3SOBL 4EVNB 3TCXA 5BUGA 4HW6A 3NZUA 5MI0B 4PY7A 1RHHB 5DEGA 1TTGA 4Z7QF 4UWMA 4HSCX 3QQDB 5IF0B 1HXJA 4CCDA 4CL7A 4MIMA 4KX9A 2FQFA 4QOKD 1K8DA 2R27A 4ERSH 2PSNA 3ZDXF 5JLZA 4ZA0A 2IAND 5CIPB 3MV9D 3WLWD 1UQZA 4UANA 1J0JA 4C58B 2NY1B 2VDRB 3Q58A 5AVTB 3JU2A 5FSEC 5HGDA 1MZZA 2ZADA 4Q8NA 3D2TA 3K6FA 3RAJL 3RWIB 4OGYH 3P3YA 2GDUA 4WHDA 3GFZA 5H4YA 2JB5L 4JTAA 3S2LA 4LNCA 2D03H 4LDOB 4DVBA 3BKYH 2I9TB 1F8IA 3FT3B 3TAKA 3K0WA 2Y4SA 3ML8A 2XZ7A 3MRBB 4A3YA 5HHXH 3E0VA 3H2QA 3OZPA 1S5HA 2VR4A 1TZAA 1XTMA 3EJQA 5J6HA 3RGTA 2WSYA 4ZPVB 1W3IA 1UJ3C 2HNEA 4HULB 2I69A 1LOQA 4LRIA 4OHQA 3C8FA 4JZNA 1MJJA 5JXAH 2OK0L 4D9LL 2A9ML 5LGJB 1DL7L 1EBHA 5C09B 5IB3A 1R19A 2E6YA 2XFYA 2OI9B 3V6OA 1EF2A 3EOAA 3AIBA 1WDPA 4BA8A 4XKMA 2EP6A 4ZAKA 1H7NA 5DEJA 5D93C 4AU0A 4G11A 2BC4B 4ES8A 5C0RH 4I0CC 3LENA 3BW3A 1G43A 2DLTA 3F03K 4MZ1A 3SE4C 1AZ2A 1MFAH 4IBZA 1IL1B 3T0VA 2ZC1A 4PRIA 3QH2A 5BZDA 1LP9A 4P8UA 5DQ9B 5I1KL 1MFDL 4PS7A 3UO1L 5J06A 1O6TA 2WAQA 5A2AA 2AABL 2XFFA 2EUZA 1KYDA 5D9SA 1M7JA 3FA5A 3CBWA 1U8KA 2WNGA 2X4TB 1VESA 4X6BA 4JY5L 4MUZA 3HFYA 1N26A 3IFNL 4K2UH 4AJYV 5L88H 3QXUA 1GVSA 5GGUB 2L7QA 2NZ1A 4G42B 3COTA 3C86A 2R14A 2VJ0A 1AZ1A 4PJBA 3VXTA 4N2CA 4UIKL 1YQ2A 1OQFA 2EYRB 4O13A 2LU3A 3QKEA 2UVEA 1G7QA 3RGVD 1NFBA 1ZTMA 3C8NA 3MJGX 2X4UA 3B5TA 1MQPA 3WKYA 1Z42A 3GSNA 3S98A 4LARL 5IVXF 3WFHA 5HNUA 1CECA 3WMLA 2OR9L 4HUWA 4K8RC 1XYLA 3RY5A 4GGHA 4NQXB 4MY9A 3DETD 4O51A 3VRJA 1U8LB 3BQVA 3VKDA 2IGFH 5HGAA 5C09E 3T8LA 3TPKA 1OAYL 2C3WA 2ZYRA 3V5KB 1HNFA 2ZUVA 3BN3B 3CHSA 3NPZB 5I75C 3LMZA 4S3JA 4NF7A 4XPFH 3T40A 4G6FD 3TCLB 3PBVA 3CB8A 2BODX 4HMDA 4D0DB 1NH6A 1RK1A 2VE6B 4Q52A 4PMVA 4WJG3 5KAQF 1GOHA 3QFJE 2BVQA 1AZRA 1HL4A 1UWTA 4YCPA 4R2GB 2JNZA 5KS9A 1S9XB 4BFFA 1ZGLB 3MV9E 1INDH 3ARFB 5BV7C 1KGUA 1U58B 3M7FB 3OIHA 3GZ3A 1I8AA 1KTBA 3P77A 1OB0A 4TVSa 4YHYC 3ONBA 1U42A 4HCFA 4C4UA 4Z0XA 3PS7A 3U9IA 2BFGA 3QEHA 5A40E 1S9YA 5DD5H 1N18A 1IO4C 2W63A 4LB3A 4HEPG 2UZIH 4N0FB 4LHUG 1Q6EA 2WUBL 4ZXBC 2W88A 1BZEA 3WHE0 5HHVL 5CPQA 1UB6B 5AD0B 1DQML 1J2WA 1JWSB 3NFNA 5I76B 3ARBA 4AV0A 3EOEA 4JTDA 4KWVA 4MLSA 2XWTB 3QXTA 4GT7A 1ZANL 3A3YB 4IDLA 2FATL 3NACH 3WNJA 4QP0A 1JR1A 2CDFB 1TWIA 3EJZD 1OM9A 1IBFA 1BBDH 3UZ5A 4Y90A 5C08A 5JNYB 3W7QA 4NN5C 5JIDA 3STEA 4N8VG 5A6BA 4XN8A 2PLTA 4MD4A 3MRQA 4MB4A 1D8CA 4WIWA 3FQ2A 2WMHA 1T4KB 2Q8AL 1HKLL 3L3GB 43C9B 4BQ8A 5JW5B 1I8LA 4AD5A 4C6JA 2BNRE 2J7LA 1J8RA 2EE2A 5INDB 4L3AA 5HDQH 4B5XA 3BWWA 2QVFB 1XG4A 3MX0B 2ZIDA 4KO5A 1WOBA 3IVSA 2ZCLL 8FABA 5HINA 4EIVA 3P02A 4JM2F 5C0AD 3LM7A 4IK6A 3AROA 2FX7H 3Q2WA 2XWTA 3WKML 4EKJA 5A6MA 5TE7H 2XGBA 2CDEA 4HH8A 4YTRA 2E09A 1VHCA 3LRHA 4HGKC 4C7DA 1TZIA 2PZ0A 2QJNA 4XZWA 4ZUUB 2VRJA 3UA3A 1EV2E 4KZ0A 4MJ4A 5FGSA 3D18B 4TSBH 3PPEA 4LAMA 4U1MA 2Y2YA 1TPWA 5LXGL 1GOMA 3ES8A 3PBMA 4RZ6A 1XF2B 3TYEA 5F1UA 3BXWA 1ITCA 1GGTA 2X70B 4X9BA 3ZE2E 1JWMA 2L8AA 1OC7A 3HG1D 1Y6MR 4BRJA 1OBAA 2Y8VA 4JRYA 4N0CC 1JMZA 4EEEA 4MQ7B 1FG2B 4S1DC 4O1EA 3FUJA 3NMEA 3V0DA 5CF3A 2BY2A 1SVBA 2YBRA 3FUEA 4Y2OA 3VG9C 3ZHFA 5T1JA 3LHPL 5E2UL 4E68A 1DLHA 3VOCA 4CN6A 3NL5A 2B15A 2VRQA 1F8MA 3CUZA 4LEOA 4C47A 3F5JA 5L8KB 4FXSA 4PJHF 2EQDA 1N68A 3AU0A 2EYSA 1FYHB 1A3LL 4PJ5E 5TPWH 3RX5A 3ZMRA 2M8XA 4WI0A 2GT9B 4Z7VF 1R47A 1HNGA 4NQDB 3WQFA 3TCTA 4GQQA 3VKAA 2HYMA 2H32H 2HTLD 1A1OA 1U92B 4PJIB 2G3FA 4U1JB 3FQUB 4I18C 4PRHA 1OTTC 1LL4A 4YK4C 4V15A 3S5NA 4OZGE 2PR4H 4KOBA 1U8QB 2DPKA 1JYNA 2AJSL 1TPVA 2PC4A 2WJZA 1NC2B 1OHQA 4G80B 5F0PB 4GW5B 4XP4L 3ULVC 3GG1A 1P0KA 4QCIA 4BA0A 4RWYL 1GG0A 3W9EB 4DF9A 4ELKA 1U8MB 1TTUA 3W88A 3R0KA 2YD4A 1DQVA 2OQJB 3KLHC 1I7UB 2VDOB 2PO6A 1X38A 3FSTA 4PJ5B 5ACZA 2YZRA 3MI6A 3M9YA 1S7VA 3OAYK 4KMTH 1E5JA 4FB7A 3CV2A 3U79A 4FZ8L 3D85D 3VFRB 4PB9L 5GSVB 3K5RA 3RHWK 3WELA 1KG0B 1I4FB 1OGAE 2A9DA 4LVHB 5EEXA 1NL0H 4MQXC 3KWSA 1E6OH 4R90H 3OX8B 3LCIA 4XCFL 3ZKXB 3PUGA 3CXHK 3KOWA 2PTTA 3JWNC 1XGYL 2ICWB 5FJPA 2FHCA 4ZL1A 4EMZA 1LP9B 5EU6E 5AZEH 1N5AA 2E5EA 4LL9A 3W85A 3O3EB 1ZSHA 5BOFA 4LZKA 1NTDA 1CX9A 3U0WH 4O1FA 1BJ8A 5GHWH 1I2NA 4FQXC 3IANA 4W9HC 1SJBA 3QUMB 5LNDA 4MZ3A 3AMCA 5HI4D 3WV0A 1I8IA 2OCJA 5D5MA 2Q6ZA 3VFRA 4BUHA 4IFKA 5BXPA 4LLDA 3N19B 4XMKH 3P6LA 1URZA 4ODSH 5J5EA 4OSUH 4NYYA 5IKCA 7PCYA 5K2ZA 2XT1B 4TUOB 1FWTA 2HX8A 4KRUA 1MY5A 2QEJA 4RUBA 3QORB 1LT7A 3MO7A 2V7HA 5GVJA 1FP9A 1NWUA 1NIDA 7TAAA 3DO7A 3NEVA 1YZZA 5BRZE 2DQJH 3T8VA 1JPKA 4JTHA 4D2JA 4MFEA 3KPLB 3QDJA 3SYQA 3V9FA 2XU2A 1C9SA 4QXTB 3UZZA 3ZQ9A 1K2DA 3PG2A 4HIQA 1ZPLA 4KGLA 1E5YA 3Q4DA 1S3HA 4WTXA 4I13B 3NQAA 1UT1A 1YJDC 3PTKA 3CXDH 3DOIA 3PBGA 2VFGA 1R3LA 3CIWA 3VZYA 1UUNA 4Y4FA 4P2QB 5A8PA 3WD4A 1FP5A 4WJ5A 3QFJA 3RLHA 3OKDA 1U1HA 3ZTJH 1Y18B 1QRNA 4NBXB 5CJOH 5D2XA 3V55A 5AW9B 4ZMXA 1HJSA 2P1FA 3VQ1C 1RURL 5DY3A 3WQPA 2EDQA 4A6YA 4ELDA 4J8QA 1QSFD 4ODTH 2VR5A 1IE5A 1O94A 1OARH 2JF7A 5DMYA 4FKHA 4PB4A 5DLLA 5SWSA 3L1GA 5KTEH 2D2JA 4UMCA 1JNNL 4U1SB 1H49A 3D85A 4W4QA 4BEIA 3QFEA 1OFOA 4NJIA 2PYED 1TKWB 2VKZG 1LWHA 1KJ2A 3ULVD 1NDGB 1GJIA 1LD9A 5AAPA 4O57A 1CBJA 1EFQA 2AANA 1F1DA 2ATPB 3Q44A 1RZJH 4ORGB 5B3NA 2J88A 2K6ZA 2K70A 1AFVH 4WGKA 3H12A 1N7ML 4N6FA 3VAVA 3QFJB 3T6XA 4TQHA 2NZ9C 1TVHB 2V3DA 3VI4E 1XHHA 3VVVA 1XIWC 3MA8A 3CH9A 3NQFA 4RRPA 2W5PA 2WVVB 3IDYB 4TUKH 2PD9A 3QDMD 2Q87A 5I1AB 1QNOA 1UVQB 5KZDA 3S2NA 2JK5A 5EDSA 1AQ8A 2UXTA 2A0LD 4NKDB 2X0YA 2WXJA 3MLYH 5HHNA 3MRIA 3HGSA 4CMMA 3REQA 2HXAA 5DXXA 2C6QA 3LCYA 43C9A 2GJLA 3QIWB 3WO8A 4BZ1A 1GT8A 2GQAA 2WYSA 1QR4A 1FZMB 1L0YA 1PZ1A 4S3BA 3BESR 3GK0A 3PG9A 2TRYA 2QADD 5F2FA 2PTZA 4KKQA 3OGRA 3W7DA 5FOJA 1DDTA 4OCSH 5E6IA 3DYOA 4FOUA 4BI5A 3BX7C 3HC3L 1TQSA 3W0WE 4NO2A 1J10A 5G2WA 4MNLA 1XMWA 3OKKB 2QIIA 2CBTA 3F4DA 2RDTA 3W24A 4AG0A 2FEEI 4IEFA 2R9HD 1HILB 4XP4H 3PP3K 1KCXA 2ORBL 3W11C 2WVTA 1BVLB 3BAIA 1YYML 5HUOA 3HN5A 4PJHA 3ARXA 5I1LB 2DBJA 4FHKA 4Y9FA 4D8OA 3AWNA 3BGJA 2FL5A 4XCYB 1JGDA 4UQ3B 4NQCA 3ATAA 3TR2A 5HI3C 4JYEA 4F2BA 3QUZA 2NX5E 1HQTA 1VZHA 1LLOA 2NW3A 3AWEA 3WEMA 5IMOB 4DYJA 3CC5B 2GC4C 5I6KA 3K8LA 4AD2A 3C2FA 1G5AA 4Y16C 2WPBA 5E51A 1KKOA 3DRQB 1LP9E 2C19A 2A6KA 4G56A 5LGKA 9RUBA 2CEQA 4X6DE 1YADA 3LHPH 5E2UH 1AQFA 1RQEA 2HE8A 3NPUA 3ORWA 5BVPH 2EE3A 3O41B 3BFWA 4OM0H 2QPEB 3JZYA 3L2IA 1AGBB 2KI6A 2ZKHH 2CIKA 4M5ZL 2E40A 5IHLB 4W7UA 2X7VA 4AIZB 1RJQA 1S78C 4YDJB 2DKSA 1PLGL 2DQFA 1XFBA 3Q5YA 5J1SC 2I5GA 4S2CA 4R4BA 3VD3A 1ISVA 1IKNC 2F1EA 2WQRA 2WWOA 2Z93A 3FIGA 4R7VA 2W27A 1QYGL 2VZVA 2Z4QB 3WXWL 3UXKA 4MA3B 3TW9A 2PR4L 4IH3A 4UIOA 3V4BA 4BCXA 1CTNA 4AFYA 3QPXH 4F7MA 3QXVA 4K94H 3BG5A 4DCQA 2BX7A 4JTIA 3W01A 3QJFB 4DZHA 5FX3A 5HYJB 3WFHB 1N2VA 3QHMA 2NSOA 2EC9T 3OTTA 4PMEA 1NCDL 3BIKA 4PIBA 1FCVA 2O92A 1HU8A 1AZNA 5CZRA 4D3CL 3QORD 4XO4A 1YIXA 2EG7A 1FLRL 3W0WD 2O6EA 4BFNA 5I3FA 2E5CA 3SN4A 1JPFA 4YEEA 1RZ8B 4D6HA 4OLWH 2JTYA 4PS4L 2RH0A 1L5GA 5I3KA 4AH7A 2QQLH 2OR7A 1KFLA 3CWGA 3EYFB 4MA8H 4FHJA 5EU5A 1NFDA 5CD5D 5IMMB 4NP7A 1XFCA 4H2HA 4Q4OA 1NDYA 2DSVA 1IEBA 1CK0L 3TVMA 4MJJA 1BHGA 2XGZA 3C3UA 3D47A 3LS5H 2K9FB 4QSHA 3H4GA 3NZSA 4I0PB 1MUJB 2Q8BL 3HG4A 5T1MA 1T99A 1X7FA 2PRLA 2Y7MA 2VC2L 2DW7A 4NZCA 3V35A 3CLWA 2Q2EB 2P5WE 3QEGH 4M7LH 5CGTA 5CPMA 5ENWA 3RX2A 4GVHA 3BP4B 3FCBA 1ZAJA 1X7SA 1MRDH 2IWEA 3LQZA 3PWNB 1UWQA 3JTSA 4MD0A 1U95B 3WSQL 3NPXA 3ZDYE 3U7BA 4WFHE 5JVLA 2L7JA 5CKAA 3T4YB 3DXAB 3UJEA 1IFRA 3FXGA 4OBTA 3BSZA 1QFWL 1H3UA 4XXWA 2J72A 3VUSA 5I02A 5DURB 3MBFA 2CDEB 4YWGH 3ZFHA 2WLLA 1A7PH 5ETUA 3K2IA 1ECQA 3CB3A 5INCA 4GYFA 3V4VA 1WC7A 2P8CA 5F1IA 4HJTA 3SO3C 5DI8A 2WHVA 1L7TH 2J6EA 1FVPA 4MNJA 5HMFA 2GJPA 1NLDH 1P7BA 4Y9GA 5DF0A 5KSAB 3DLQR 3QJQB 2WN3A 3W87A 1UA6L 3D50A 3OHXB 1X5JA 1OGTA 3CWNA 2HN7A 2YKLL 3CWOX 3M1BB 3A4EA 1SFSA 3S8GB 2ZSWB 2A77H 3T77B 1Q9WA 3QEZA 1PCWA 1WKYA 2AV1B 4H4NA 3TYDA 2OGJA 3BEWA 4KWWA 3A22A 3INUH 5E5LA 2NY3C 2VMDA 2XWBA 4DZBA 2FLBT 2KZHA 4RDYA 4RAHA 1VCFA 4D1JA 3P82A 1U1UA 2QCLA 2V5YA 1HDMA 2VZUA 4IOIA 4WI4A 4JR5A 5C0CB 5CP7A 1DL3A 1Q1JL 1IGTB 3ULVL 4JDEB 2NR6A 2I25N 4JFDE 3NRPA 4PCTA 1UZ4A 4XCEA 1ITBB 1KF9B 3TO4D 4UQAA 4BKSC 3BDKA 3P62A 1D9EA 3D0AA 1LM1A 4RK8A 4UQBA 3U36A 3L81A 4UTBH 4LIQL 5CLWA 3H55A 4WUUA 5KSUB 3BGMB 2FTYA 1A6TB 2E8YA 2BSEA 3TIEA 4GW4A 4U1SA 1IC1A 4JFHD 2YW3A 3LNIA 2FJFB 3DURA 4JN8A 3B2PA 2G37A 5J11B 1K03A 1KIQB 1MCEA 3FO9A 3MREB 4DUWA 5E56A 2O9RA 9CGTA 1JV2B 4UT6A 4GY7A 5EZIH 2ZE3A 3GMMB 1FHLA 5U4NA 5M03A 1HHKB 4OZIF 2NW2B 4CDGC 5DJAA 2WBWB 5L2KD 1P84K 1LORA 3ERPA 3HI1B 1U8CB 1VPOL 3WUBA 2F53B 2WXKA 4OGQC 3ML9A 1AYRA 1TV5A 3LNHA 4FLQA 4DNMA 3HE7B 4MASA 4CSSA 1AQHA 2NY4D 2BMKA 2XPGA 4Z1AA 1BZ9A 1RZ7H 1KPRB 3VXNA 5SWZE 4PRHB 1MW2A 1D5IH 2R8WA 1M7DB 5LGHL 2VEPA 4DF2A 2ADAA 3P9LB 1PFCA 2AEQH 3BH4A 4M82A 1ECYA 3RRXA 2NXHA 3W0KA 1Q7ZA 1ML1A 4WEBL 5CPLA 5A3ID 2AL2B 1EUTA 2XBZA 5H2BA 4H7ZA 1V7NL 1P1VA 9XIAA 1F90L 1RZFL 3WTSA 3TN6A 4ONHB 4DNHA 5FSDC 3GI8H 1B5TA 2PCFA 4R5VA 5E0FA 5FCUH 3SPIA 2GQ8A 1MVFA 4EVZA 3HI1A 1UKQA 4U05A 3GDCA 2A6IA 1EUUA 4RZCB 5TFSL 3FYPA 3QZWA 5DJ8A 4UIKH 4GG6B 3ABQA 5TF1H 2A38A 4MOZA 4C56E 1WZAA 1MWAL 1A6WH 4M9PA 5E7BA 4OJAA 5JIPA 3WF2A 4G70B 2Y23A 3Q6GL 3SDAC 1IQDB 4Z7OF 2LHAA 3IDXL 2HX9A 5FGBC 2HS8A 4Q9QH 3D05A 4I3SH 3NQMA 2XN1A 1U8CA 3QDME 1WD8A 3WLBB 3WMPA 3WENA 3TWBA 1POKA 3MB9A 2IWKA 1FGNH 5EU6A 2OMZA 2V69A 3N0AA 4MJ5B 1D3HA 4OZ4A 1TEGA 1CE1L 4HOZA 2PPAA 2A1WH 3H2PA 4CVWA 4MCYB 5B7EA 2C34A 2DTSA 2PYEE 2JKXA 1G7HA 2NNRA 2HVMA 2BPBA 1V02A 2PURA 1CI5A 1AQ0A 4GUPA 4A2HA 4GCXA 3SOBH 1NPJA 2D69A 4APQA 3D2UA 2Z1SA 3QEQE 3VXSD 1GS7A 5TH2A 3CAKA 2Y5TB 1OF2A 2I9EA 3H2AA 3SECA 1HI6A 3FDWA 1XSJA 4F7PA 5TDPB 3QIUB 1BWVA 2VEMA 2VX5A 2EPKX 1F8TH 1EJUC 1RSCA 3GDMA 2YPVL 1ODAA 3BG3A 1KYUA 4J1UB 2YJQA 1C7TA 4DCQB 2BDNL 4Q7DA 1XGPB 4WNSA 4LAUA 1FTXA 3HC0A 3O4LA 4M1BA 3UR2A 3Q05A 4MKVA 1EAJA 3CVIL 4P04A 4NO0D 1UJ3B 4FFVC 5FECA 5JOPE 1ROCA 3QXDB 1TPB1 3RJQB 1GW0A 3C2SA 4WFGD 2IW0A 2WTRA 2BJML 1E9OB 5BZWA 1F6YA 1XGRA 3GWJA 2R0LL 4GP5B 5IFJA 3B05A 3NAVA 5FYJD 3TT1H 2F8VA 4J2QA 5CJQL 1NIFA 4DOHE 3HOGA 4ERSL 4DK6A 3BW4A 1YVLA 3AW5A 4D6CA 3QR3A 1HP5A 1PKOA 4RRPG 4KJQD 2WO5A 2VDMB 3EOYG 4FCAA 4MNGA 3CQJA 3F5KA 1EOKA 5C2GA 3GNML 1OP5K 4YFDB 1XKYA 2Z2UA 4OLZH 1W5PA 3BURA 5DRWA 3DX2A 3C2AL 3MOBH 3VFNB 5LXEA 3VNMA 7PTDA 3PDOB 5CEWA 2MFNA 2A3CA 1MIMH 3I6EA 1QTPA 1KCLA 3JYBA 3PWUA 3IJQA 2XFGB 2GSHA 5EFFA 5AZ1A 4KEVA 4AWEA 4YVPA 1ZXKA 1AJ7H 1B2WH 5DHVH 5E5UB 5GISH 3OQRA 3GRIA 4JCMA 4ZB5A 3Q7JA 1BQHG 4N1EA 2QV5A 2Z6JA 4Q4MA 4NM4H 4OT1H 3QUZC 2BRRL 2GTWB 2WN2A 4GLRH 1H6UA 5EU6D 3UROR 2OX4A 1VA9A 2ICWA 4KK5C 2VR3A 4BIKA 2PDHA 1M3UA 4ZO9A 2PDXA 4MNQB 3LKSB 5SWZA 5BYWA 1JZDC 5DURD 4ZW7A 1GOKA 5XIMA 4KXZI 1XCTA 3BW2A 3TYZA 4G1MA 4QO1B 1OAKH 4GSUA 5IW6A 3PE9A 1FA2A 4B96A 3ABLB 4HWZA 2AGTA 2BIIA 5G2IA 1TR9A 2J66A 1YG9A 1I1YB 1G9HA 1CFMA 2YKLH 3AITA 3BUTA 1KUMA 3SD2A 2AJUH 2ZUTA 4YJZL 4P9HH 5EORH 4P5KB 5JIHA 1UT9A 5A8OA 2AQ3A 2B5IC 4K2SA 4F0SA 1T5XA 4Y9NA 3TLQA 5L9FA 3C5ZA 5E8PA 3DI0A 3GMLB 4L56A 4BEQA 3PQYA 1XH2A 1PYWA 4Q4EA 1HO4A 1Z9AA 3LBOA 4WR3A 1L6FA 1SUJA 3FCGA 4GG8A 3GSRA 5DO2C 1ZLUK 4PJHE 5HI5C 2RGSA 1ZLDA 4GBXC 5TNVA 2NUTB 3TYFB 8PAZA 4YHYB 1MRDL 3HURA 3M0YA 5IEKA 5SWSE 4F9DA 2P3EA 4JQIL 4AVHA 2OMVB 4LRNL 1B3VA 5E03A 1FWAC 2N1KA 3UETA 1ZHBB 3C09C 4K0OA 3IJSB 5BRBA 3T4AA 5EUOF 2VDPB 3QC0A 4DT2A 4IX0A 1DJSA 1ZVYA 2C9VA 5FHAL 2Y7FA 4XD6A 1RK6A 5H6HA 1TJHH 3VFGL 2PC8A 4FQCL 4M1GH 2CH8A 5G55A 3RZCD 2V17H 4WRHA 5AKVA 1XQLA 2ZZ1A 4NL1A 1CFQA 4ALAH 4MGXA 2OZ4A 2W91A 2EDHA 5AC8A 4UFLA 2B2XH 3IGLA 2AKZA 1T7ZA 3DV4B 5KJRH 5M7QA 2Y61A 4BRVA 1SUXA 3QARA 5AHLA 4Q4IA 5I66B 5IHUL 1DCEA 4DO5A 2I07B 3EYSH 3BCDA 4PG2A 4UM9B 3GBDA 4YHKL 1N3NB 5EBMA 4KHXL 1GGCL 2G3JA 3GNOA 2VDOL 3FQNB 1YE6A 2P80D 2CBVA 1JQXA 1KXQA 2YPLE 3LKNB 5BPPA 4N6EA 1DYZA 3AZSA 1HSAB 1MFCL 3BOVA 4LU5L 5BQ7B 3FMGH 4IG2B 1LZOA 3PNUA 1OXYA 4MAYD 1NGWA 4L4LA 1V27A 2J6WA 3UWEA 5IMLB 3M5YA 1LWIA 4UR9A 2Y25A 3H26A 3V3WA 2JK5B 3M8OH 3LV3A 3VVGA 1BW8A 2YRZA 5DEZA 1E9ZB 2K4AA 5C0GB 1GS6X 1XLCA 3WH8A 3II2A