1P6WA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with the substrate analogue, methyl 4i,4ii,4iii-tri-thiomaltotetraoside (thio-dp4)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
b'HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (Alpha-amylase type A isozyme)
publication title The structure of barley alpha-amylase isozyme 1 reveals a novel role of domain C in substrate recognition and binding: a pair of sugar tongs
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1p6wA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1p6wA01
2WZIA 3WBEA 2YA2A 1JAKA 3T0BA 4CGTA 1CXEA 3RIKA 3GXIA 3VMOA 1A47A 3CZKA 2VZSA 4UQCA 5ABHA 3BAIA 4OZOA 1UG6A 3M46A 1KTBA 2DIEA 4PMYA 1CTNA 4PMOA 1G94A 1KR0A 5I2UA 4P7LA 4LX4A 1H1NA 3MUAA 1E6NA 2V5CA 3VPLA 1JYXA 1EHAA 2F61A 4MJ4A 4W89A 1BYDA 3MI6A 3VU2A 4ZE4A 3GH4A 2XN0A 4TTUA 1V3KA 2VURA 5BRQA 2YL8A 2VC9A 1UWSA 1ODZA 1QBAA 3MO4A 1UWUA 1LWJA 1E4NA 1S46A 2Z1KA 1MVYA 2FYVA 1ZU8A 2DH2A 5D8ZA 2V3FA 4J7RA 3NSXA 4UFJA 1V0NA 3U5UA 5HXMA 4Z2JA 3OLIA 2YKKA 4MNJA 4MAZA 4WJXA 4CCEA 3AIUA 1NOWA 2D1ZA 1B0IA 2ZXDA 1K9FA 1V03A 1H0GA 1NOUA 5IHSA 4J3TA 3OLGA 4X0NA 2JFEX 1V6UA 5A2CA 2W5FA 4PRWA 3CZJA 1NM9A 3VDAA 3PHAA 3GBDA 1LL7A 1V02E 4AZBA 3KL3A 3HJEA 1ZBCA 4JKMA 3I3BA 3AFBA 4LQ1A 2E40A 1J0ZA 1E3XA 5BXSA 1CLVA 4E2OA 3BUIA 5IHRA 4FNPA 1M01A 1J18A 3AYRA 3MS8A 4BZYA 2Y8KA 3MUY1 4UOZA 3BXWA 5HDRA 1CENA 1I75A 2VCBA 2DSWA 3U5YA 2XFFA 5D9PA 3GH5A 1TQSA 2GJPA 5ABEA 3WEMA 2FGLA 4ZENA 4PN2A 4U5KA 1UD8A 1PEZA 2YDRA 1B30A 5I5RA 1XV8A 3VNZA 3SCNA 2D3NA 1G1YA 3ZSTA 3LPGA 6CGTA 2W92A 4AZCA 1UR4A 2WANA 3W53A 1R46A 3CHFA 2XIIA 4GO8A 1CXLA 4H7VA 3WL0A 1OWQA 1JD9A 2WC7A 1UHVA 3G6MA 3VIKA 1C7SA 3T2QA 4URIA 2GJXA 2W91A 2DT0A 2WK2A 3UR8A 3I3EA 2X2IA 1CGUA 2FH8A 4V27A 5I24A 4ACYA 3D51A 3NDZA 3SUSA 1CXIA 3EDKA 1Z32X 4Z2GA 1ISYA 4DO6A 2DPEA 3WMCA 3TTOA 5JBFA 3HMCA 3BH4A 1OGGA 5DF0A 2VX4A 4Z2LA 1EGZA 3VGBA 4HPHA 4UTFA 3VIHA 2F2HA 2ZIDA 4FLRA 4OOUA 7TAAA 4PMXA 1CZ1A 3L4VA 1HT6A 5D9NA 1VFFA 4PEEA 1CGYA 1BHGA 4XZWA 1H5VA 5CGTA 1W2PA 1OBAA 2HISA 1Q6FA 5C8BB 4TTGA 3T09A 2ALWA 3U57A 1GCYA 1KQYA 5DO8A 3H55A 5A6MA 3SUTA 4QCEA 2F8QA 3WDIA 3WNLA 1U2YA 4TVCA 3BLKA 2WMGA 5A1AA 3I3DA 3DX1A 3MANA 3S5ZA 1WAWA 1XH0A 1DTUA 1E4MM 1US2A 3CHDA 4F66A 3FNDA 2Y4SA 4MNKA 3WD3A 1JYWA 1C7TA 4AIOA 3UERA 3WBAA 1QI0A 4HMEA 1V02A 5A6BD 1CGTA 3WL1A 2XGBA 4PSPA 4U3CA 3D3AA 1FFQA 4E8CA 3SCWA 4PTXA 1P6WA 4DWSA 4NZCA 4H2CA 1OSEA 2X05A 3LXBA 1JYVA 3BUDA 1BFNA 3TV8A 4OIFA 1J01A 1EDTA 4NX0A 2AAAA 3BAKA 1TMQA 2HVMA 2J77A 4JKKA 4B9ZA 3QR3A 4ZXOA 2UY3A 1QI5A 1BPLB 3WELA 3N9KA 2QV4A 3T0DA 3H54A 3HU7A 1NP0A 1CXFA 5CZKA 1OINA 3MV01 1UKOA 4U5IA 1O7AA 2WMJA 3EDDA 2VRKA 4OGZA 2D24A 4EANA 3VOCA 4FNQA 3CGTA 5DT5A 3CZ8A 1UKTA 5CPTA 2NW0A 4GI6A 1GQJA 4CN4A 1Y7VA 1G5AA 4B16A 1PS3A 1UOKA 1UH3A 3ARYA 1HTYA 5EBAA 1BF2A 3VX0A 2BVDA 3AHXA 4OOZA 5A2BA 2X8RA 4PTVA 1OIMA 1UD2A 4PMQA 4GINA 2JEQA 3PZTA 4EE9A 3VGDA 5HOSA 5JIPA 1QW8A 1QI3A 3ZMRA 1GHRA 3AMKA 3AXXA 4JFSA 3BAJA 2VTFA 4CD8A 1WZMA 2VR4A 1QNPA 3CV5A 1C93A 2WBKA 4HTYA 3OZPA 2YA0A 2AMGA 2QPUA 5CSUA 3CIVA 1W9DM 4PTWA 1R34A 4U3AA 1D3CA 5I79A 1I1XA 3WQ8A 2VX7A 2CBJA 2PI6A 4H41A 1KXVA 1NP2A 4AYGA 2FGZA 1GQLA 4TXEA 2YL5A 3B9AA 1C8YA 4PMUA 3ZJ7A 3QOKA 3ECQA 2ZWZA 1VF8A 4QLKA 3WDPP 3ARPA 2G3MA 3VILA 2J62A 4W5UA 1J0HA 2XM2A 3N12A 3WDQA 1TVNA 5HBFA 5BXTA 4DUVA 1HJVA 2A3BA 2CYGA 1HXJA 5A8OA 5CSYA 2WXDM 5LA1A 3KLKA 1GORA 3POCA 4D72A 2J7GA 1FHLA 2YLAA 1X6NA 3A3HA 5D9OA 3FN9A 4PSRA 4PCTA 1OD8A 3O2LA 4AD2A 4QCFA 1E4IA 1K9DA 4D6EA 3AQUA 3ZOAA 1GHSA 2Y5EA 3W81A 1UD5A 1DWGM 3AMLA 2F7RA 3NSMA 1E6PA 3OGRA 1TUXA 2W61A 3VD5A 3WN6A 4F9DA 2YFOA 2ZUVA 1QI2A 3WUFA 3UETA 2VO5A 1PX8A 4BQ4A 1E6QM 1JNEA 1KGXA 1AQHA 3IK2A 1RP8A 3N13A 3WENA 1QOXA 1BLIA 2WHJA 1H09A 2BY2A 3BC9A 3BSHA 1GUVA 5DT7A 3W24A 4AZ7A 1GOQA 3AS0A 1V3JA 1GQIA 4IISA 4MJ2A 3DYPA 5E9AA 2CESA 2XVNA 3CZNA 1XH1A 1V0LA 3D5HA 2YBUA 4W87A 3AOFA 4AWEA 3TA9A 2VZVA 1TA3B 1XGZA 2WMIA 3WEZA 3IJ9A 4AC1X 1KXTA 1Q6GA 4M24A 1GJUA 3SCOA 1A3HA 2WKLA 3W0KA 1GOIA 1FFRA 3VIGA 1VEOA 1Q6CA 2PWFA 1JZ5A 3N15A 3F5JA 3PTMA 4PMZA 5C71A 3AISA 2IUZA 1X1NA 4D6GA 1XC6A 3FY1A 3N17A 1VBRA 5M03A 3II1A 4HZ6A 4X0VA 1R8LA 4C7DA 4KRTA 3GXMA 2EEXA 3LX9A 1C3FA 3BAWA 1UYQA 1WB0A 3CLWA 3L2LA 2A3EA 1WO2A 1E56A 2ZXQA 1JFXA 1G0CA 2D20A 2WB5A 3VD4A 2BVTA 2VVSA 4AEEA 1L8NA 3WNNA 3ALFA 1V0MA 4GZJA 2YDSA 4CCCA 3T2OA 5E09A 4J3WA 2B31A 4TUFA 1UQZA 1FP8A 3W82A 1K6AA 1HJUA 1LL6A 4HZ8A 5BRPA 3EDFA 3VIJA 3WKZA 2CHOA 2J78A 5A94A 3VDBA 3BAXA 2PWHA 4PMDA 2OYKA 2V38A 4CU8A 3EJQA 2D3LA 1WZLA 3HN3A 1E6SM 1Q6DA 1SZNA 2EPNA 2F7PA 3HG3A 1E4LA 3MMUA 3ARZA 5JBDA 1ECEA 4GPNA 4UQAA 5JUVA 2YA1A 1R33A 2YJQA 1MFUA 4BA0A 1ZBVA 2WNWA 1R47A 2WYSA 2BS9A 3JUGA 4FK9A 5ECUA 3VINA 4NF7A 3WMBA 2XFRA 3T08A 3AS2A 2CXGA 3WF0A 3WH8A 1SMDA 3DDFA 4PMNA 4JL1A 2DSUA 3AS1A 3BVTA 4W85A 4PUEA 4AZ5A 2WCSA 3AHZA 3AXHA 1PJ9A 3CUHA 2F1AA 4KMQA 2YIHA 1CGVA 2GDVA 1W9XA 1AMYA 1K9EA 3EMQA 2YLLA 1JDDA 3WY1A 1JZ8A 4NRSA 2JIWA 2EACA 3EDEA 1BGGA 4U33A 2X0YA 4OUEA 4CU7A 4PBGA 4UQDA 4WKHA 4LYQA 4DM1A 2XUCA 3DX0A 3CZEA 4LYPA 1NWTA 5A3HA 4KGLA 2O9RA 2WLYA 5A6JA 3OZOA 2WCGA 2W62A 1MXGA 2VNCA 4AMXA 1V3IA 2ZX9A 2JALA 1UA7A 2X0HA 3WF3A 4AZIA 1QNRA 3VD9A 1HKIA 2F7QA 1TG7A 3VMNA 1XSJA 2PC8A 4NXKA 2EPMX 1ESWA 5EB8A 2C7FA 1B1YA 4DO5A 1TQWA 3K4DA 2DQXA 1XD1A 2DIJA 5A2AA 3PZGA 1H0IA 1W1PA 5AC5A 5HPCA 2CETA 1JGIA 3BAYA 3MKKA 3KLLA 2J7HA 1YQ2A 3BVWA 4Z2KA 5I6SA 6TAAA 2A3CA 4XUYA 1PX4A 3WQ6A 4GI9A 1DWJM 5A6KA 2BY1A 1WNOA 1CBGA 3PBGA 3ZO9A 3FAXA 3DHUA 1V6YA 1JAEA 2J7BA 4MB3A 1XH2A 2XWDA 1QWNA 1B90A 3LXAA 3ZR6A 3VSTA 5KEZA 1CECA 2CBUA 1C8XA 2VCAA 3VIPA 4UQ9A 2Z1SA 1F4HA 1B9ZA 5HNNA 4GXPA 1ZB5A 4EAMA 2DGAA 3D52A 2V3GA 4E4PA 3AYSA 1E6ZA 4FNRA 3CBWA 4AZHA 1CXHA 4W93A 2OYLA 4HA4A 1E43A 1V6XA 4D71A 4JHZA 4JFWA 3ZM8A 2G8ZA 3AHYA 5CQ1A 4X9YA 3WFZA 5DEZA 2E8YA 1IT0A 4JIEA 4H8HA 4W8BA 4M56A 4W86A 5JBEA 2DH3A 3GM8A 1WDQA 1E15A 4ATDA 1PZ3A 3VM5A 3PZVA 3ARRA 1H49A 3BGAA 4CVUA 1WP6A 3VNYA 2CITA 3S5YA 1E5JA 8CGTA 1NARA 3OGSA 2DSKA 2GK1A 1JDAA 2G3IA 3THCA 4AXNA 2FH6A 4AD3A 3TTYA 1XCWA 3S6TA 3BUBA 3RM9A 4DM2A 2E4TA 4WIWA 4OBRA 3CO4A 4AZCB 2YBTA 3GNPA 1JF6A 5AYIA 4AD5A 2JE8A 4JAWA 4BF7A 3K46A 5LA0A 1UWIA 3THDA 4QLJA 3KL5A 5GQBA 2UY4A 2GJXB 3WFLA 1KCLA 3CHCA 5E6YA 2VJXA 2VZTA 3K4AA 3U7BA 3U7VA 3WD1A 4AZ6A 2VRQA 3QGVA 4DUWA 4B3LA 1ISVA 3SCTA 3WD4A 2WVUA 3IAQA 2QMJA 4TVUA 1KB3A 2WC3A 2D22A 1ZBKA 3UCQA 4LXFA 4C7FA 4P8XA 1XHGA 3OG2A 5GPRA 1LLOA 2FDMA 4R5EA 4WSJA 2BFGA 1BYCA 4JFVA 3TONA 4OJYA 5A8PA 3EJSA 3OBAA 4J28A 4GQQA 3AROA 5JIWA 1CPUA 3MSDA 2Y24A 4ML4A 3KWXA 2WVTA 4H8UA 3AIBA 3OGVA 4UFKA 4CD6A 2VVNA 2BY0A 5CJ5A 3CC1A 2J25A 3CZSA 3RM4A 2G4FA 3RPMA 3NDYA 2XWEA 1NWUA 5ABFA 3SCQA 1JZ6A 4W84A 4BQ2A 3BUPA 1PZ2A 3N1AA 1BGAA 4IUGA 4BQ3A 4Y7EA 2WCAA 3VVGA 3AI0A 2PF0A 5A6LA 1TR1A 3BCFA 3GNRA 5EFDA 4CD4A 5A8NA 2CBIA 2WWDA 4NZJA 3BUQA 1JD7A 2W67A 1VB9A 3APGA 2WVVB 3N11A 3DX3A 2VZUA 1PX3A 2VMFA 4QDMA 3WQ5A 3CMGA 1EXPA 1HNYA 3L4XA 2WZHA 3IANA 1DHKA 4P8WA 3K1DA 4JHOA 1GOKA 4S3JA 1E6XM 4MB4A 2OWWA 4AIUA 1H11A 1R75A 2VOTA 4W8LA 1JXJA 4J3SA 1EOMA 4FNTA 4MAVA 4M82A 2PWDA 4N0RA 5GNZA 3DECA 3BMWA 2CKSA 3LPPA 4JCMA 3QHNA 5BXRA 4QAWA 1TFVA 3WNOA 1HKJA 3EJPA 1WDPA 3AICA 3IAPA 1J0YA 3AMCA 1B31A 1BG9A 3UG5A 2RGLA 4XV0A 1OGSA 1V3HA 3GXFA 4JFTA 4HMDA 5E0FA 4W5ZA 5DFAA 1O6IA 4MNLA 4AISA 1GZJA 3LMYA 2NT1A 2XVLA 1C92A 1OIFA 1KQZA 4P7QA 4HOZA 2G41A 1JI2A 3F5LA 3NYDA 4S3KA 3A4XA 3AIWA 2WW5A 3NCOA 5A69A 1V6VA 1D7FA 4FMVA 3QOMA 3W38A 1US3A 4DWSD 3RO8A 2GFTA 3AIRA 5EMYA 1WZKA 1UR1A 2XYLA 5D4YA 4MADA 1W3LA 4FLSA 1OT2A 1NOFA 4UCFA 4M80A 1QX1A 4HA1A 1HVXA 1M03A 5CG0A 2CHNA 2GUYA 2XSBA 2EO7A 1LF1A 3SIMA 2FE0A 3W26A 5BROA 4ZXLA 5E0CA 1CXKA 1WKYA 1DWAM 3A21A 1R86A 3WIJA 1V6WA 3ZJKA 2ZXAA 2YL9A 1MWOA 4PUDA 2WM0A 4BQ5A 3W6MA 1WPCA 3CUJA 1F4AA 1JG9A 2DEPA 1HP5A 2XM1A 4CCDA 5A95A 3DYOA 3ARXA 1W1VA 5E1QA 4H04A 1NH6A 3WNPA 3KE0A 4AYSA 2V5DA 3WQVA 2VT0A 4A3HA 1KBKA 4FLOA 4PCSA 3RJYA 2TAAA 5IFTA 4PTMA 2VI0A 2BHZA 2E9BA 3MUZ1 4NRRA 4GI8A 2YDQA 3DDGA 4HZ7A 2EAEA 1YHTA 1B3XA 2E8ZA 5M5DA 5I3DA 3AMDA 3AZRA 3TP4A 3BCDA 4XB3A 3WNMA 5A8MA 4HPGA 3EMCA 3UG4A 4AW7A 1LQ0A 4W7WA 4GKLA 4V28A 4B3KA 1E72M 1VFMA 2XPKA 4L4PA 3ARUA 4HU8A 1G01A 4U31A 2FHFA 1WCGA 1UH4A 3D4ZA 4A4AA 4UOJA 1LG1A 2A3HA 2J75A 2XN2A 1XSKA 4UR9A 1WDSA 3GDBA 1GVIA 1R87A 2W4XA 3SUVA 1W9BM 2ZICA 5FCZA 1HJXA 3W28A 4MDOA 3IJ8A 1PAMA 4D1IA 4P7RA 3VGFA 3W4RA 1QPKA 3RILA 3WD0A 4KGJA 1JYNA 3CUIA 1EH9A 2WMIB 3SUWA 3ZQ9A 3A47A 1VRXA 1J9YA 4N42A 3PN8A 1HX0A 3L4ZA 1E0XA 2VL4A 3QHOA 4D1JA 2FHCA 4H8VA 1ODUA 4UZSA 4F8XA 2ZX8A 5I0DA 2O9PA 2XSAA 3ZJ8A 1KFWA 1XCXA 2WAGA 1QHOA 4Z2HA 1D2KA 3LRLA 5BWFA 3LRMA 2C0HA 5AYBA 2XHYA 3FHQA 4UFIA 2UY5A 4ACZA 1Q4NX 3OB8A 4P7NA 4WKFA 3CHEA 1QHZA 4D6FA 1GW1A 5A8QA 1TA3A 2GJRA 2VRJA 4RL3A 4UFMA 2WMKA 3CMJA 3WEOA 2Q8XA 1AVAA 2OSWA 1JNDA 1UWTA 3VM7A 3L2MA 1BVZA 5F7UA 3PZ9A 2ZX7A 4GO9A 3WF4A 3CTTA 3OIHA 1W9UA 1MW0A 4HOXA 2EPKX 3WH6A 2D0FA 1QNQA 1JF5A 2XGIA 5CPQA 5M17A 2F1BA 3TTQA 1UWQA 3RMEA 4EKJA 1VFUA 1PIGA 2V3EA 2XN1A 1BTCA 1J11A 4PYSA 3S2CA 5FKYA 2VQUA 1MW1A 4D6JA 4GQRA 4WF7A 1PBGA 3NJ3A 1V3MA 3AHTA 3GNOA 3WF1A 5BCAA 1HL9A 3E1F1 1KBBA 2CEQA 3RM8A 3VUPA 1QVBA 2JF7A 3AJ7A 1UUQA 2OW6A 1M53A 4M81A 4UQEA 3D4YA 4W8AA 1GPFA 2G3JA 2J7CA 3ZSSA 4IPLA 4DWSC 3DYMA 4EK7A 1DWFM 4BS0A 2A3AA 3POHA 1DWIM 2IXUA 4MTVA 4YPJA 2J4GA 1RD6A 5FL0A 4NXSA 1TE1A 4CN6A 2D0GA 4BCEA 1J10A 4UZUA 3CH9A 2ZUUA 3O9NA 3J7HA 2GSJA 4D6IA 3CZGA 3VGHA 3AIVA 4AMCA 4LPCA 4ATWA 1SFSA 1ZBWA 1EA9C 3FHAA 3AIEA 3WY3A 2WSKA 4MNMA 2J7EA 1BYBA 3WMSA 3GBEA 2E9MA 4MDPA 1E0VA 3A4WA 3ARSA 1UKQA 4CN1A 1J0JA 1O7DC 2UY2A 4TVDA 3UEQA 1TQUA 1M04A 3MMWA 4JCLA 7A3HA 2J7FA 2CIPA 5ABGA 1QW9A 1W1YA 3VDCA 4IPNB 4P7OA 3PZMA 2BNJA 2WKGA 4W88A 2WVSA 1V0KA 4D6CA 2IXVA 1HKMA 3BLBA 1TCMA 3EMZA 3CPUA 3T0AA 1MW3A 4KH2A 3N04A 3TTSA 3ARTA 4HOWA 3A4AA 4MB5A 2VR5A 3NSNA 5DMYA 1E0WA 1WDRA 1UR8A 5LYRA 2IGTA 3TOPA 3FW6A 1FH7A 3AZSA 3IGUA 2UWFA 3WDJA 2ZUMA 2X2JA 3A5VA 5E6ZA 1HJWA 2DSZA 2QPSA 3VD7A 2CNCA 3BVXA 2E9LA 4AY1A 2GVYA 1TQVA 2NT0A 4TX8A 5AC4A 1E55A 1VENA 3VKKA 1HVQA 4WKAA 1XD0A 1WZAA 3BVVA 6A3HA 3KEHA 4M8UA 1M7XA 3W25A 1QI4A 4GIAA 1BYAA 1CYGA 1HWWA 2O9TA 2BY3A 4KWUA 4L4OA 4CVWA 1R7AA 1UQYA 5CPSA 3AZTA 1UR9A 2WHMA 2EBNA 4NI3A 2XVGA 4FNSA 1LWHA 1FOBA 4J3XA 3M07A 3CUFA 1U30A 4WK9A 3ALGA 3ZJ6A 5I77A 4ATLA 1CGWA 2BHYA 2WHLA 2OW7A 1GOWA 4AIEA 1E1EA 1GNXA 7CGTA 1EIBA 5EFFA 1H3GA 1U33A 1B3YA 1TZ7A 3MUIA 3G6LA 1W91A 3IJ7A 2VX5A 1W3KA 2XG9A 3EBVA 1QWUA 1OGBA 1FH9A 2GK1B 1UWRA 1KXHA 1EO5A 3ZR5A 2EPLX 3LXCA 5IXEA 1VEMA 4YN5A 4Q7NA 1ZJBA 1KGWA 1EO7A 3EDJA 1QHPA 5BXPA 3VD3A 3BMVA 2QMKA 1NWRA 2VZOA 1WE5A 3CUGA 4JKLA 1Q6EA 1B3ZA 3WDRA 1W9PA 2VUYA 1HJQA 2BHUA 4UFHA 1OT1A 1FP9A 2ZUTA 1EOKA 1OB0A 2BXYA 1W32A 3RJXA 4DUXA 3GXTA 3W27A 4MB1A 1XRVA 3HG5A 3GYCA 5HPOA 1ISWA 3FAWA 1JIBA 2J47A 4B9YA 5FIPA 1HXKA 4JFUA 2ESCA 4PMRA 4J3UA 4UFLA 4P8VA 1GJWA 1HF6A 1VFOA 3WF2A 1TQTA 1EHNA 1E6RA 1JZ2A 3GXNA 1EQCA 4UOQA 1BAGA 4XX6A 2XIBA 1UZ1A 2XVPA 3A22A 3OLDA 1DWHM 1C90A 5IDIA 4XZBA 3HZ3A 4AEFA 3SEPA 2BXZA 3WH5A 4UQBA 3L4TA 3PZOA 5C70A 3VMPA 2ZE0A 1EDQA 1KTCA 4CKQA 1MXDA 1E71M 1CDGA 3LPOA 3AS3A 5ABFB 2V3DA 3GH7A 2ZXBA 2EADA 1LJYA 2DT2A 4K68A 1JFHA 4YHGA 1QNSA 3VGGA 3MMDA 1BQCA 2J74A 2G3NA 1OM0A 3MV11 3GZAA 3ARQA 2WC4A 5A6BA 2O9OA 1HIZA 1BVNP 5FL1A 4AD4A 4A3YA 4HU0A 1GOOA 2EPOA 1MW2A 2XFYA 3ZT5A 3DX2A 1IZKA 3ZT6A 1IV8A 1C91A 1GVYA 1ZL1A 3VSUA 4IM4A 1UD6A 3ZIZA 3M7SA 4KRUA 2WWCA 3K8KA 3UR7A 1ZJAA 3K8MA 1MFVA 3WD2A 5I78A 3A24A 2QF8A 1UR0A 5FD0A 1E3ZA 3WQ4A 4DWSB 4FF5A 2X09A 2WBGA 3PZNA 2NSXA 5E70A 4F9JA 1B3WA 1VJZA 1SR0A 3VO0A 1T0OA 2J8FA 1W9VA 3PTQA 3VDHA 3VGEA 2W66A 2WVVA 3AIQA 2C8NA 4LYRA 1FHDA 5LA2A 1KCKA 3VIFA 3SCVA 1FH8A 3H53A 3SCRA 5I23A 4FLQA 5CGMA 1B3VA 1H41A 3PZIA 4AZGA 2D0HA 1E1FA 1QNOA 1VIWA 4M29A 1IZJA 4NZFA 3OA5A 4JL2A 2CBVA 3GXPA 5KZ6A 1CLXA 4M1RA 1JZ4A 1SYTA 1I1WA 3WUGA 1RH9A 1LL4A 2VCCA 4DO4A 3WNKA 1XSIA 1H2JA 3RCNA 1PPIA 1CGXA 2XJ7A 4V2XA 2E3ZA 3KL0A 1GOMA 2F7OA 2F18A 3HG4A 2D23A 1RPKA 1VAHA 3PZUA 2EJ1A 4RE3A 1KR1A 3NIYA 1MQQA 2WMFA 3BSGA 5CLWA 1VEPA 4HMCA 4E8DA 2W63A 4UNIA 3L4YA 1EQPA 3AXIA 2J8GA 4B15A 3N18A 3NUKA 4HA3A 1W1TA 2VX6A 2CCRA 2X1IA 3D50A 4F79A 5IFPA 1MQPA 3WH7A 3WSUA 4D6HA 2D73A 3BVUA 1UR2A 3EYPA 2OSYA 4W7VA 1C8QA 4GZEA 3DX4A 2X2HA 1J0IA 1R7OA 9CGTA 1LG2A 1TVPA 2OSXA 4CUCA 1J0KA 1GQKA 1FA2A 3WY2A 1OD0A 1MQRA 2BVYA 2DDXA 4C7GA 1HKKA 3CZLA 5TD4A 4AMWA 3O6AA 3HG2A 3WUBA 3MU7A 1R85A 1RP9A 1HP4A 4JZ5A 3AHVA 4YHEA 1CEOA 2Y8VA 4J27A 1JZ3A 2GDUA 1L0PA 3PTKA 2WMHA 2ZUWA 1XYZA 4CU6A 5M3WA 3L4WA 1EDGA 1ISXA 2AOSA 1SMAA 2CPUA 3F5KA 1UKSA 1K9TA 3BLPX 1G9HA 3WQWA 3OLEA 3VSVA 3F4VA 3GTNA 3EJUA 1E70M 4J3VA 1N82A 4CD7A 1W3JA 2J7DA 1ISZA 3WH9A 2YOCA 1KWGA 1AQMA 3EJTA 3VIMA 3WDHA 4QFUA 2EXOA 2MANA 2YFNA 2WSPA 1DEDA 1JI1A 2JF6A 2XTKA 3DC0A 1ITCA 2DT3A 3GXDA 2EABA 3EJRA 3B9DA 1VJSA 2PB1A 1H4PA 3PZQA 2D2OA 1HN1A 4PMVA 2ZX6A 2X2YA 4AD0A 3LRKA 2BV9A 4R27A 4HP5A 4GZIA 2OWXA 5D8WA 1E5NA 1E40A 1AQ0A 1NWSA 3SCSA 5FOOA 3W29A 3LPFA 4U2YA 5BYWA 4ACZB 3DHPA 1E73M 5CXPA 2QHAA 1HJSA 2FHBA 2PWEA 4ZEPA 5A6SA 2WLZA 2J79A 3QHMA 5GNXA 1NQ6A 1QBBA 2JEPA 3ARVA 2OYMA 2ZUNA 5AY7A 1E9LA 3M6DA 1KXQA 1ITXA 2E0PA 1V08A 2CERA 1W3HA 1XYFA 4ZFMA 4P8UA 1UH2A 4WLCA 3ZT7A 1JZ7A 1CNVA 1JDCA 2OLHA 4TOQA 1GONA 3A6OA 2EQDA 3WY4A 4Q22A 1UD4A 4LGXA 1W2VA 4ZE5A 3FXYA 3UG3A 3RDKA 2RGMA 4U2ZA 3KZSA 1PIFA 3K8LA 3ARWA 1BSIA 1UZ4A 5GNYA 2OWCA 1BG4A 2JIEA 4OKDA 5D9MA 1J12A 2ZUSA 3VIOA 3W37A 4CD5A 4Z2IA 2YL6A 4QLLA 8A3HA 1UA3A 1X6LA 4AD1A 2ZWYA 1CWYA 3VX1A 2PWGA 2WZEA 2PBGA 2VQTA 3UESA 1HL8A 1DP0A 3B8SA 4MPKA 4OBSA 3VTRA 3SUUA 5A6AA 5CLTA 1KGUA 2DSVA 4WSKA 3MSGA 4RE2A 1V3LA 2CKRA 3L4UA 3B9EA 4TX6A 1VBUA 4NSBA 2XVKA 2QLYA 3VIIA 1OCQA 1KWKA 2PBOA 3A23A 3WUEA 1MYRA 1UD3A 4D6DA 4RE4A 3SCPA 2ZOXA 1B2YA 1JXKA 1UASA 1ZS2A 2Y2WA 3SURA 2DT1A 2ZX5A 1UKPA 2WHKA 1JL8A 3SCUA 2WPGA 3T2PA 4QP0A 4FNUA 1CIUA 3AMGA 3W6LA 4W7UA 2O92A
chains in the Genus database with same CATH superfamily
5GJTL 4R4FH 1U92A 4FXGC 4F0KA 1JGVH 2BVOA 3ILPB 4U6VH 3MLZH 1KBJA 2Q8ZA 4O4VA 3BAIA 2ZA3A 3M6YA 5DUJA 4MA3B 5CG7A 1U3JA 4E42B 2V63A 4RSYA 2WTRA 4KTGA 1E6NA 5DS1A 3TW6A 4BBWA 2YDAA 3LMJL 3G24A 3GH4A 2QKIC 2KHAA 5EC2B 3VNLA 4TTUA 1H6FA 2VC2L 2N01B 3QCTH 5IJVB 5ACZB 1M56B 2VC9A 3NQ7A 1ZANH 1RPUA 2AJZB 2JGYA 2PDBA 1I1YA 2GL5A 5SWZB 1OCBA 3LM7A 4GRSA 3KW8A 1WRFA 4N28A 1BGXL 5IGXL 4WEBL 1MCCA 3U5UA 3BE1H 1XIMA 2PP7A 4QM1A 5AVQB 3MR9A 4GKNA 1S4IA 1R3TA 4XPTL 2W94A 1EEZA 4US5D 4BZ1A 1BZ7B 1IBFA 3LAFA 2ATMA 4E4FA 4OZIF 4DKFH 1AKJB 2IANE 4POZD 4CLMA 3QARA 1G7QB 4NNAA 3KLDA 1TT6A 2CUHA 2I7GA 2I1OA 4XX5A 4NQ1A 1JWUA 3OEXA 2YQBA 3WIIH 2AJSH 1I31A 3FT0A 1OYAA 5XIMA 1CLYH 1ORQA 1B6DA 1M01A 3G5XB 3W1QA 1Y1UA 2JIXD 4MWFB 1P0NA 1QZNA 1I75A 1JXGA 2A3TA 3B34A 1SLWA 2GAZB 1CCWB 9XIAA 4U5KA 3QFJE 3OODA 4DUOA 1PLCA 3VNZA 3H9YA 1ETZB 4UTUA 3M44A 2W0KA 4AZUA 3SQMA 1MN4A 1RFDH 5GS1B 1AMXA 1TIMA 2DMBA 1C7SA 3QG6A 3KBMA 2VDQH 2DQGL 3L3DA 4ZB2A 2AK4B 3SOBH 1X38A 1DLFH 3QULB 2C3ZA 2WLIA 5KSBF 5FLUA 3II2A 1G4EA 4OZGF 1X5JA 4LQFH 4KRPB 4FQIL 4GKOA 2MOGA 5BO0D 3GRWL 7REQA 1H5VA 3I6KB 2ADIB 5TGBA 3RFRA 4A21A 3UPRB 4A3QA 3H9SD 3QPXL 1KRMA 3SE3A 4C1NB 1G9MH 2GT9B 1IT9L 5G4WA 3DFHA 3LBCA 1EBHA 1FYHB 4OH2A 2Y1ZA 1POKA 2Y7NA 4A3RA 1EP2A 2VGLM 3SPGA 4XXDA 2NZ9D 2DVUA 3SN1A 1G7LB 3ZLHA 1N8ZA 3KPSB 4TIMA 2VDKL 4APQB 4HUWA 5D32A 2J77A 2LU3A 3QR3A 4KEMA 3E0IA 4PIRF 1CXFA 3B9KD 4U5IA 1F41A 2WMJA 3EDDA 3HC4L 2D24A 4H5SB 3VYPA 2NYYC 4BK9A 3CFKB 2RB8A 1HTYA 1D5XA 1REIA 5A2BA 4HKZA 4CRPA 2CR3A 2AEQH 4PMQA 4GINA 2J7LA 5HD8D 1F58L 2BP3A 5KSVB 1EAPB 1Q5MA 1T6BX 2AMGA 3O41A 4MD4B 2WLNA 1ZLWH 2CLEA 3GDLA 2OR9H 1XTMA 4XP5L 2YSSA 2Q9OA 4G8IB 3QRGH 4XKYB 1ID2A 5HDQH 5G2NA 3HPAA 2QFPA 2G3MA 1CX9A 3UCCA 3WDQA 1SW0A 3BICA 3UGVA 4G2AA 3LHYA 3O9WD 1EEYA 1JNNH 4NKIH 4DKEL 2J7GA 2F19L 1FHLA 1AZZC 4GRWF 1X6NA 2XACC 2PWVA 4AD2A 1QBLL 5MHBA 2A6JB 2F7RA 1Y5WA 1X7SA 1TUXA 1HC1A 4WNJA 2G0LA 4R90L 4Q2ZA 4F9DA 2RACA 1JNEA 3R5EA 4ROPA 4AXKA 5JUEL 4PB5A 3WENA 5LUMA 1A4LA 1DEEA 2WSQA 5TE4H 3QWOB 4UNVA 2NDFA 4U1HB 2YBUA 3FKUS 3QIBA 1N0XL 3IJ9A 2HRPH 4XCCH 4M24A 4QNPF 5ITFA 3U7YL 1MELA 2DM2A 4EDWH 2H9AA 1KCUH 1CLKA 5I8OL 1NBVH 2DYRB 1BRLA 5TAOA 3HN8A 3LB0A 1PO9A 3HLKA 1OARH 1A1MA 3KCPA 1AQDA 2C5DC 1JWSA 1C3FA 5D7EA 1DQKA 1NC2B 3K2GA 2ZXQA 1IU1A 3BN9C 2JKLA 2NW3A 3L3JB 3MO1A 2AGJL 1G7PB 1YG9A 4GYJA 3SE3C 4KVCH 1PLGH 2HLAB 1A50A 5EF2A 3ABZA 2CM6A 1FDLH 4ERGA 5C7HA 1CT8B 1T1YB 2PCXA 4EO5A 1U91B 2CO1A 5DHEA 4L7ZA 1Q6DA 4X7CC 4KNQA 1ORSB 4WWID 1KYOJ 3FT4A 3T2NH 2FQEA 2E59A 4RNRB 3XINA 5AD0B 1SMDA 3NSCA 3DO4A 3HV8A 3T6CA 5F1SA 4A39A 3LKNB 2K9UA 3IRSA 4B9PA 1BQHB 3E12A 1WA3A 1S3KH 2HYMA 4J9JA 4PBWD 3ECVA 4TN9A 3HS8A 5HQMA 1MCPH 3AABA 4U33A 2XSXA 2J2ZA 3UBXA 1WV7T 4IOSD 2XWTA 3DFYA 1QD0A 2DQFA 2VNCA 4C4BA 5K1NA 3OR7A 3Q1SH 3ZRCC 5EB8A 5D7KD 3UBXG 4EUPH 1W1PA 2O5XH 4MQXC 3FQXB 3KLLA 2Y8UA 3JTTB 1OCZB 4XMKL 1Q0YL 5A6KA 1N6QH 4IBTA 3PBGA 3LYRA 3SYCA 1V6YA 1NANH 2YK1H 5DJ8A 4UIOA 2Z93B 5BZDB 2YD1A 4C56D 3RZCA 1A2YB 1OX5A 2CKBB 1IEVA 3P30L 1CXHA 4PRNA 1T1ZA 1MSSA 4DSYA 3E96A 3WFZA 3QW9A 1BEYH 1UYWH 1KLFA 4N68A 4PUUA 3P69A 2WBJD 2DSKA 1JDAA 2QADC 4PU2A 4Q4SA 2H0EA 2ZZ5A 3CLEL 2D31A 2JK2A 3LLFA 2YW3A 4JQXA 1Q2RA 1RLBA 3DIFB 3CO4A 3Q5YA 5K3VA 5LSMA 5LA0A 1BJMA 3WLKX 3U7BA 2E25A 3QZOA 3WD1A 2W9DH 5I1JL 5IJBC 3IAQA 3E8VA 1PV8A 4LEQA 1SJEB 1OK4A 3A4DA 5E1AA 1VFSA 4R5EA 1A5LC 5A8PA 1YYML 1LO0H 1TZ8A 3F4DA 3GMNB 3V4BA 5GRYA 3PLYA 2PLTA 3F2LA 2VVNA 4ZFZA 5D2LB 3HS0B 4IRSB 2G4FA 1I2PA 3C9NB 5D2NA 3CXFA 1BGAA 1FAIL 2WCPA 3SGZA 3IEBA 4E5XA 3GNRA 3OZMA 4XN8A 4L3CB 2Z1XA 4N5EC 2NXGA 4AW4A 3CMGA 1RZGA 1RUKH 5DZOA 5E2WH 1MH5B 4UDUB 5FJTA 1U8NB 5DC2A 1BBJA 4REQB 4E5XG 2P43B 1T83A 5TDOB 4A2SA 4FR6A 1W0MA 4OCYL 1BXXA 5MENB 4HWNA 3H22A 1FTXA 1YC8A 4XNBA 2CHWA 4ODUA 4NM8H 2N1KA 1NL0H 3QY6A 3MUGA 1CFTB 1P4LA 2PYEA 2E6JA 2VLKE 1V8EA 4BE6A 1HI6B 4FXSA 2P44B 3QRFM 3TCTA 5ERWB 1W8SA 5DJDA 2QR0A 4MNLA 4U6YA 1OALA 1MEWA 1R9FA 3OBEA 3UTTB 5A69A 1J1OH 1NWOA 3W38A 1QASA 4HAFA 1P0EA 1S5TA 1ZS8B 4XN5A 1TTFA 3D06A 3UYOD 2MHAB 1CT5A 2EO7A 4RAUA 1GTNA 4DI9A 3QE5A 5DMIL 1DWAM 1V6WA 2ZXAA 1A0EA 4UCGA 2OMAA 1YEFL 3MBXH 4C58B 3OKDB 5EOQH 3UADA 2DD8L 4MWAB 1JG9A 2DEPA 1BXBA 3QNFA 1VPXA 2O5YH 2WINB 2NR6A 4MXVE 1NAMH 5F70A 2IQ9L 3WK0A 2H1PH 2RKXA 6PAZA 5ANMB 3T2LA 4XCFH 1EUAA 4UM8B 4IBLT 3DA0A 3B3BA 4O15A 4AC2A 3W2JA 1DBKL 4HPGA 2EEDA 3ICJA 2HWZL 4JO3H 2X4TB 1T89C 3BQUC 4JQXC 1G01A 1N2RB 3W7IA 2A3HA 4HH8A 1EUNA 1GVIA 1W9BM 4G5ZL 4WFEE 4FHKA 4LGRB 3WD0A 4AB4A 1JYNA 3CUIA 4M19A 4XSMA 4CQDA 2ZVIA 1YNTA 3GLAA 5TDPA 3ARDA 5BOZG 3TLLA 4PJ5D 3EOUA 2CCVA 3IJHB 3V6OE 3OC5A 1I8MB 4HSQA 2D7NA 1JV5A 4ANUA 4IOIB 4NKDB 3G6DL 4G7SB 2ARJQ 5T26A 3CJJA 4PJBF 1QHZA 1J5SA 3RVWC 5D2NC 4I77L 3GTXA 1RHCA 3T1FB 5FYLH 1JF5A 3FEQA 5KMYA 3P11H 3WD5L 1NU5A 3V4VL 2IPFA 3VABA 5C8JA 3LEYH 3OJMB 3DXAE 1QR7A 2VYRE 4X9FA 3SCMA 3X14B 5IT2H 1T83C 1UUQA 2Q86B 5E00A 3DYMA 3ARGD 3WLTA 3ARFA 1UROA 1EJ6A 1VD6A 2ABAA 3ULVD 1QK2A 1EF2A 1IKFH 2F74A 4WO4A 4L4TE 4ZUSB 4WK4B 3V0WH 1KB9J 3FHAA 1NAL1 4MD0A 4WQ6A 2FO4A 1ZJIA 4PVNA 2QCLA 3UFYA 3MV8E 2Y9RT 3V1PA 2I25N 3QLLA 4U4BA 2JI2A 2DLTA 4FQ1L 3MMWA 1XAKA 2VELA 1K03A 4GAYB 1W1YA 4XVUD 2R24A 3LRSB 4KFPA 4XBKA 3WLSA 3FQWA 3KBVA 4Y16B 3CPUA 9XIMA 3WHE0 2Y7QB 3BE7A 5IB2B 2MSPA 4HGWB 3ILPA 2ZCLH 4MA3A 3IGUA 3WIHL 4M7ZB 3W5MA 3A5VA 3H21A 1ROCA 2BRQA 3IDYC 4A37A 2AJYH 2GVYA 1VENA 4DK6A 2ZZ2A 1P4BL 1F74A 5EC2A 1GZGA 1ZLVH 3H3BC 5IJVA 5ACZA 2OZ8A 1P7HL 1NFDF 5SWZA 1HHJB 1UQYA 1N0LB 1MI5D 1A6VL 2QQNH 4Z3IA 4Z7QF 4EWJA 1BMZA 1QSEB 1JV2B 1IEIA 3IJ7A 1W3KA 2C9AA 5BRZA 3CFBB 4M6QA 4C4KT 2WN2A 2CRIA 4N9GB 1BZ7A 1FG2B 1KXHA 4KOBA 5D1XD 4MLJA 3WLHA 3TYDA 4HS8L 3LTVA 2IGFL 4HSOA 2B4GA 1G7QA 4DQAA 3EEGA 1RIVH 2JJVA 5FOBA 1I3UA 4M5YL 5GJNA 1HCYA 4LARH 4LEFA 1P4IL 4YDVB 3GAYA 2CD0A 3NZUA 3NFSL 1HKLH 1LK3H 5HJLA 5DX7A 3G5XA 3NIDB 5HPOA 4X9BA 4BFFA 4LNRA 2DMGA 2PUQT 4MWFA 1KLUB 1LM1A 3NJMA 4C6PA 2VW7A 4JN1H 4YYFA 4OCSL 1YHPA 3TBSB 3W1XA 1V10A 5D7LB 3HIZA 1SU5A 1ETZA 2BGSA 2DZEA 1EDQA 2YEVB 3K81A 4CKQA 5H8DA 4H2HA 5GS1A 5IBTL 1X9LA 3S3CB 3X11B 2DQJH 4N24A 3EG9B 1RZ8B 3SCMC 4PJAE 1FWEC 3EJZC 2GK0A 2J74A 2W8CA 3OVUB 4NUJB 4O58H 5LIWX 4LVHB 2O9OA 1HIZA 4JPWH 4JRXA 4R5TA 3BT0A 4ZOCA 2E6PA 2DQHH 2W9LA 4H9MA 4ICMA 4M48H 5F6IB 4EOWH 5GRJH 3QEZA 4KKPA 3ABGA 1RU9H 4MCMA 4RMRA 3I6KA 1ZNNA 4DWSB 4FF5A 3Q9QA 1EZSA 3KJ6H 4FI8A 1E8YA 5M95B 2K6WA 1FCCA 3VFUB 2J8FA 4C1NA 4MXWL 4FX6M 2WVVA 2GT9A 4YHYC 2C8NA 1QHQA 3HI6H 1OGTB 2B81A 5CGBA 1Z42A 1HWHB 1P5BA 5FUCC 4ZG1A 2YGYA 1IZJA 5F7HA 3P54A 1UOZA 5AZ2H 4MAUL 2NX5B 1G7LA 4QRUB 2O4EA 1QSZA 3KPSA 4APQA 4N4QA 3L5XL 2QQLL 5T1KA 3MMEA 1W8EA 3HZMB 1OEZW 5FHAH 4KFNA 4JHMA 3G1YA 4DESA 4P2YA 4JFZL 4BRJA 1XDJA 2E46A 3B2DC 4LNVA 3CFKA 2P5WB 3RUGB 3FOMB 3GX9A 4MTMA 4HA3A 4KKBD 4C4UA 4PJEF 3BEWB 1NGZB 5IFPA 1UR2A 2J6XA 3LQGA 4LIQH 5I26A 5KSVA 1EAPA 5EU6E 2XJKA 3WUWA 1GQKA 3BJSA 2HVOA 3KOFA 2VXVH 3FTSA 4MD4A 3UBGA 1M2VB 4QRSB 4DJFC 2X40A 1VPQA 1CEOA 4MZ3A 1UURA 4G8IA 3WUWG 3H7VA 3WCZA 2DJMA 3GJFK 3OZ9H 1NGPL 4EF9A 4HD5A 3OLEA 4OW6A 1GOFA 3GZ3A 1K5WA 3LKSA 4ES4A 2A6JA 5HPMB 1A5MC 2YB1A 2PW2A 1KXTB 2DY2A 35C8L 3SN4A 3QQNA 2FQIA 3TSDA 1FDJA 4R9XA 3TBVB 3BZEB 4IT1A 4Y19A 4AD0A 5AZEH 4X7EC 3ME0B 2OWXA 2VIRB 3PWUA 4Y4HA 3KYAA 1T7VA 5GS1C 3EZ4A 1J8HE 2KERA 2Y69B 3QWOA 3FSZA 1PTZA 2NMSA 1AANA 1DCLA 4U1HA 4AQAB 4I3RH 4M1GH 1FNLA 1U3HA 4D0DB 2HK0A 2FGBA 1F9CA 2C13A 4QROA 4M5SA 3Q1EA 5JDSB 5HYJE 2OJZH 1CNVA 4S3FA 4KRPC 3AY4A 3NIGF 3QDGE 3TH6A 4IBZA 5I00A 1CL7L 1RLCL 3WHE1 1W37A 2ZUSA 4CD5A 1NC2A 1XB8A 1U0QA 2DQTH 3FQ4A 3UXDA 1G7PA 5CJQL 5TBOA 4TSCL 1X98A 2NY1D 3BQ5A 4BFIB 3CH8A 2HLAA 4JDVA 4UB0H 4ANKA 2VW6A 5L2JB 1T1YA 2GQAA 1ZAJA 3Q65A 3S7GA 4FXFA 1N6VA 1ORSA 3GNNA 3QM3A 4AY8A 1VPOL 4JM4H 4RNRA 4APQC 3I02B 2ZOXA 3CVHH 5FYKD 5I6LA 4HHAB 5DWPA 5AD0A 1F4XL 4GXFA 3QBUA 2IH8A 1T1XB 4O11A 3X3GL 3TCXA 1BQHA 4GACA 1PDKB 1FH5L 4B0MB 1NCGA 4JRYD 3WO4B 1KTBA 5I15H 1CTNA 4PMOA 1G94A 2JJUA 2JB6A 4LPYA 1UT2A 1M7UA 5FYJD 3S1WA 2ZWLT 4G9PA 2XRAL 3PRZA 3RB7A 4WI4A 1BQHG 2RQ8A 3D25B 1DANT 2VAJA 3VXGA 4B9CA 3S5LB 1MVYA 1R9ZA 3IMBA 2IPGA 1JCKA 2I85A 4K39A 3L2IA 3FQXA 4Q8OA 4WJXA 3T8MA 4HUCA 2D1ZA 1JCXA 4DEPB 4NRYB 1CN4A 3C09B 4IMEA 2WWKO 1NLDH 5C0FA 3F7KA 4TV3A 2JFEX 5A2CA 4QRRA 3VFSB 1LP9A 4K9JA 2OFJA 3GSOB 2Z93A 5BZDA 5JHBA 5F2LA 2OO6A 2CKBA 3S4SB 1IMHC 1IBHA 3MLVL 2E40A 3SDXE 3SO5A 1WVZA 3KRSA 3MS8A 2QVHA 3PUOA 4BZYA 3TAKA 4FP8L 3PGCB 2OTUA 3HW7A 3SDYH 1Z9MA 3U5YA 3VZXA 1EANA 5D9PA 1GGIH 4FX5A 3NCXA 1AUSL 4ZO9A 1MXSA 4IIZA 1X4XA 1G1YA 4Z3TA 3ZSTA 1ET8A 3DIFA 4UR7A 1JHLH 2QHLA 4PRIA 1JHKH 1JN6B 1R46A 4XH2B 3PP3H 3X1GA 3VACA 1JXDA 4J3OF 3F6IA 5IG7B 2X2IA 3O3UN 4QGYA 4V27A 2SFPA 3BLIA 3D51A 3AT0A 1RZPA 3EDKA 5MEPB 1SJEA 4OV9A 3LS4H 1JRBA 3MNDA 2Y6SC 4JUSA 2PZ0A 4LU5H 1X9UA 2V5RA 3NOEA 4ONFL 3GIQA 2PDLA 3QQXA 3KZPA 1XIHA 5D2LA 3T3PF 3HS0A 4IRSA 1RZKL 3V52H 4D9LL 3C9NA 3LCYA 4GO6B 1RL1A 4LAZA 4H4NA 2FZBA 3D39D 2HFEB 5HHPB 3C6LB 2JKJA 3RTQD 3QI9D 4L3CA 5CSSA 3V3WA 2PW1B 3LD5A 3MRNB 3NL6A 1KB5H 3TMLA 4DRSA 3FO1B 4UDUA 4AXWB 2V67A 4REQA 3TV8A 1J01A 1O5KA 4NKMB 3DKJA 4B60A 3S36H 5MENA 1K5NA 3HR5B 5E8PB 3MTXA 3CYJA 2H3DA 1GG1A 4MNQD 3CGTA 1CFTA 5F0LB 5ANHA 1UKTA 1OSPL 4A6YH 4CN4A 3SZ8A 2E5BA 1HI6A 2UZ9A 3TM6A 3Q45A 1T40A 2GIMA 2NLJB 5ERWA 3L3KB 3KWUA 5JA8B 1THCA 5C08A 1U8KB 5DBTA 3BGJA 3UTTA 1D7DA 3PWPD 2F08A 1TIWA 3T0VA 4MA8L 2QV2A 2DVTA 4P4KB 3GYRA 2ZXCA 1ZS8A 1CFNA 3NTCH 2EUWA 1RULH 2MHAA 2Z34A 4JJ5B 1KXVA 2W0PA 15C8L 4AYGA 4A66A 4FG0A 3RPKA 1C8YA 3JTSB 4PMUA 3RLGA 3P4OA 1KKRA 1KTLA 2FVNA 4NDMB 4FZEL 1MVUB 3NZHL 3EPNA 1B4LA 1P1ZA 1U36A 4MWAA 2NUXA 1PKNA 5LA1A 3KLKA 3MRDB 3CSPA 1AO7B 2WINA 3L13A 4CMHB 3RKPA 4D3CL 1KT2B 1RI8A 3DTUB 4IXXA 2PPFA 1E6PA 4UM8A 3MUCA 3PDGA 1O7VA 2X4TA 3QUMH 3NESA 4WI9A 2BRRL 1MJ7H 3N13A 5DHXB 1N2RA 1H09A 1AIZA 2IKJA 2QADB 4DWDA 2P8LB 5DC9B 1WA1X 2JCCE 1XH1A 1V0LA 4GFIA 3TA9A 2QTVA 1UUNA 1GJUA 1IBDA 1CLOL 3OF6D 3W0KA 5SWSE 4KK8D 4YDIL 1RK0B 3IJHA 4U4MA 4QXTB 4K5OA 4ZFOL 1OAQH 3WJXA 4QHKI 1VERA 1TKKA 3KYNB 4IOIA 4QG9A 5TE7L 4NKDA 3GXMA 3HS0C 4IRSC 3N9SA 8XIMA 1JULA 1KGJA 4PB4A 1JE6A 5JW4R 1AH1A 2XV6B 4HUVB 3NCBB 4PJHE 4P8QA 2H90A 3KTCA 3ABMB 3GVWA 1LL6A 4GRLA 5EV7A 5DGQA 3FT9A 2YKLH 3VIJA 3UIZA 2Z8RA 2J71A 5FO7B 3SPHA 5AYQA 4WDTA 4QR6A 1J1PL 2B77A 3X14A 5JBDA 5HHVL 3X13A 2Q86A 5JOPD 5F0MB 1NA8A 1T03H 3WMBA 3D0LA 1JPHA 4R3SB 3S9DB 1A4KB 4F58H 1L6YA 3IBOA 2HP4A 1UBSA 4ZUSA 2YGNA 4XNZB 2PE4A 1YECL 4K71B 4NKCA 1G67A 4NRSA 1BGGA 2MPAL 4OUEA 3B97A 2MUCA 2XUCA 5EDSA 2CZVA 3D85D 4XUGA 4UT7L 2QVFB 4RA3A 2O9RA 2ZRVA 3OZOA 1YEGH 1AJZA 5FV1L 2X0HA 3LRSA 1KXVC 4UTBL 4HZ1A 2EPMX 4H00A 4FOMA 4Y16A 1D6VL 5KSAB 4MKMA 2IMNA 1BFTA 5IB2A 3FSAA 4HGWA 4XD5A 3MV9D 3PTDA 2J7HA 3PJLA 1PX4A 4GI9A 1FP5A 3VD1A 3QYSA 2HAZA 2OMZB 3RX7A 1PZDA 3LYEA 1OF8A 3TZVD 2VLLB 4XMZA 4MDJA 3ISWA 5SV4A 3NO3A 4LCCB 5FUOL 3GMMA 5C97A 4ZQCA 5JHDA 1HHJA 4I3SH 4GY4A 8RUCA 4JO1L 4W9DC 4FQXD 1P84K 3UTSB 1EZUA 4M56A 1NSNH 1QSEA 1JV2A 4ORGA 1HGWA 3QORB 1MCNA 3S5YA 4N9GA 6PCYA 3K7UA 4JO2L 3T78A 3GMQB 1SMOA 3WJSA 4AH7A 2NUYA 4FD0A 1NCDL 4Z3HA 3N2BA 1CCZA 2IF7A 4XN7A 4Y0GA 3VFGL 1RVKA 2EKSB 1LO3L 1UWIA 3KL5A 2GJXB 4IJ3B 4K73A 4HIEA 3CHCA 4GGBA 2VZTA 2WYIA 2DDQL 3GDTA 1MFAL 5FJUA 1A7NL 4Y9PA 3GFZA 4TVUA 2OU4A 1KLUA 1CB4A 2DQCL 1LLOA 1N3NB 2BFGA 3QTGA 5I16B 3TBSA 5D7LA 4C6QA 2NVCA 5LXVA 1U9KA 2EE6A 2EO1A 3NJXA 2VLRD 3QBTB 5DRXB 4JM2D 1OYBA 3EG9A 1RZ8A 1A9VA 4Y7EA 3DVFA 5FGCB 3IMSA 4IX0A 3KDMA 2ZG1A 1TR1A 4NUJA 1HUVA 4CD4A 4LLWB 2Z35B 4OGXH 2YD8A 5MKGB 1TE6A 3W1UA 4IBWA 4F33B 4WHTB 5LXXA 4RZKA 5KBLA 1TV8A 5LKNA 4GG6F 3X3FL 2IKIA 4XAWL 1UIOA 3BMWA 1KNOB 5JZ7D 3HB9A 5T3XE 3NZ8A 5LHEA 3VFUA 5I75B 4JPSA 3EOAB 1MHPL 3GKWH 3P61A 4Y1AE 1OZUA 3EKGA 4EVNA 1OGTA 3QWQB 3L9EA 4MASA 3MXWH 2GBAA 3LXUX 1JRHL 2F53E 4M6AA 2EDOA 4NQDE 4Y16C 1OFOA 2ADFH 3I7RA 2PCFB 3O05A 4DN4H 3B8DA 1KQZA 5I0XA 2J3SA 2NX5A 1JI2A 1P48A 3EYUL 3QOMA 3MRHB 1CF1A 4FJ6A 2FTAA 3AIRA 5EMYA 2NQ3A 1AC6A 1VBJA 3CMFA 4M7ZC 1EMTL 2ZKMX 2V5MA 2X7WA 2C4FT 4M80A 4IIQB 2BNQE 3O3EA 4PAZA 1RA5A 3HHMA 1CO1A 4MKNA 4HIBA 4QRNA 3DI1A 2EF9A 2GJ6D 4JR5A 5T1JA 5B1BB 3G9AB 2P5WA 3RUGA 1UWGH 5I02A 1ZE3H 1NAKH 2FEDD 4XPGH 1DFXA 4QRPA 3BEWA 1NGZA 1OWWA 3I6TA 4DP5X 4PFMA 4L5FH 4ZSOB 3BKYL 4CBZA 2VI0A 4NRRA 2C1GA 4J4PA 1RZQA 1M2VA 1H7NA 2BWGA 4QRSA 4AW7A 3GBLA 3LPWA 1ETJA 2CBMA 3WFDL 3W7MA 5G1YA 1IJ9A 3US1A 3W3BA 5AYXA 2HKHH 3VQMA 5D8JH 1LG1A 2F8IA 5LNWA 2ZICA 5FCZA 2VKWA 1PAMA 3BFOA 2X9WA 3OKKB 1RA0A 3ULVH 4YVNA 5KSBB 1C1EL 1MREH 5HVFB 3NSJA 1SJHB 4NC1E 4OZGB 3CQKA 5HPMA 4IMGA 4NBYB 2OX1A 4HTBA 3F7LA 3W11D 3KHOA 4UZSA 2NZIA 3ALWA 4W4OA 2O9PA 4WJ8A 4RGNB 5A7EA 2V9DA 3ME0A 4YHML 2VIRA 5IFHH 1D2KA 4WI5A 2C0HA 1EWDA 2GYSA 2WNQA 5DJXA 1F90H 3MRMB 4OF3A 1IBYA 4MUPA 2VDGA 3MRQA 4PFEA 4PJIB 3WEOA 2FLIA 3O8XD 2NV1A 3WF4A 4LVHC 4D0DA 3L16A 5U4NA 5C0CE 4TULH 2Z2BA 5HGBA 3RG6A 4XPAL 5M2FX 1MF2L 1TZZA 1Z9SA 1KBBA 5F6IC 1A0DA 2OYPA 1QVBA 2ICEB 2J7CA 4DWSC 1FVPA 3CQFA 3CWHA 4PY8I 4RCAA 5GGQL 4MTVA 3IDUA 1IGIH 2XKUA 4ICCX 1WBJA 1WKEA 3CH9A 3PK7A 4BFIA 1FWDC 1IGCL 3VGHA 4ATWA 3ZTJH 5L2JA 3WMSA 3Q8FA 4N85A 1HCVA 4NBZB 5ENWA 2JFCA 1E5CA 4YHYB 2J57A 4KKZA 4XPHL 1EGJH 1NIAA 4LSQH 5ABGA 3I02A 2R1XA 5GJSL 1AW2A 3DK2A 3VXRE 5T9CE 1T1XA 1ALDA 3CQJA 4PV8B 4S23A 4XNDA 3BLEA 2BLEA 1NFBA 3N29A 3FZUC 4O0KA 3T9PA 4HS3B 2JKNA 3LSOB 1TTCA 1PDKA 3NSNA 3L9YA 3RHWF 1DSFH 4UNTA 3MQTA 4O5LH 4WFGD 4FYQA 5T5NG 5F7DB 3MNWB 5E6ZA 4P5TB 2CNCA 1I9EA 3H2FA 4LL4A 1K8DA 1GS8A 2O61B 2DKMA 4ILSA 4J4PC 2F15A 4W68A 2GBTA 1FWJC 5DVOA 3S5LA 3WYRA 4P5KA 1IAKB 4FLHA 4JPGA 5I77A 4G8GD 2WHLA 3IN0A 4POUB 5LBSL 1H8LA 3K0YA 3IGLA 5FFGA 3S5LG 4NRYA 4BF9A 4Z3JA 1DQXA 2CGZA 1KCSH 4YX2H 3HN5A 1JSYA 3VFSA 3HZYB 1GA2A 4FSAA 4KZDH 2FSDA 1IGML 3AG4B 4W4OC 2HFTA 4MF4A 2VUYA 3S4SA 3W1NA 4LSTH 4ONVA 2ZUTA 4ERSL 5C3IA 2ZPKH 1S5WA 4LCRA 3KGTA 4YXLH 1PNCA 5FHBL 3BVDB 1IWPA 2GJNA 2VOMA 3X1NA 2J47A 1I1RA 5DVNA 5C0BA 3LHPH 3URBA 1SBSL 1HF6A 3S4SG 1RIUL 1A9EB 2CU0A 3OKOA 5I1AB 1XLAA 2NQCA 1C90A 4YIQB 3SEPA 1UGKA 2FBRA 5GZNC 1JN6A 4LHUD 4XH2A 3HI1B 3AQXA 3WLPA 5IQLA 5IB3B 3P3YA 1LUCB 4YH6A 5ECVA 4XNMB 4DPRA 3H7UA 3NQMA 2HT3D 3FUFA 5A3IC 1OM0A 4HAKA 3WBXA 5FL1A 4KWOA 3VUAA 1MW2A 1ZV5A 4A7VA 2P28B 4X5XB 3N2XA 3JYBA 3H12A 3A24A 2ZKXA 2QUNA 2P80A 4XP9L 4LESA 1FAKT 1RY8A 4JCWA 4MKSA 5EB9A 4V15A 1GVEA 3PHQA 2HFEA 1QEXA 4YK4B 3C6LA 4MXVF 4AYDC 1NFIA 4QHKJ 2C9SA 2A6LA 4FXLA 1VP5A 3VXME 3H53A 3SBFA 3VRLE 3MRNA 1H5YA 1WITA 2D0HA 1TCRB 3O6LL 3OA5A 2DJLA 2HJKB 4J4KA 3FO1A 4AXWA 1YQVH 1CD8A 1I1WA 3WUGA 4NKMA 2B1AH 1U8PB 3DMMB 4NN5B 3WO4C 1QNZH 1J9SA 4GAJL 4U1SA 3DBPA 4Y7MA 5TFSL 1BQLL 3UZVB 3T8LA 5B8CB 2ZTKA 5E8PA 4OIAA 4G6FB 5CP3A 5TQ2H 4HMCA 5KVGL 3O3DB 2JQZA 5AG9A 3GNMH 3CQHA 3L3KA 4TPRH 3H3PL 1SVBA 1U8KA 4UBPC 2VSCA 2Y70A 4Z3FA 4YXHH 1I4FA 3VXUE 1R7OA 4P4KA 1BOGB 2FKPA 1GOXA 2ORBL 4ORMA 4DEPC 4HCHA 1Y65A 3C09C 3FH7A 2XH7A 4AMWA 1ZD6A 5I2IA 1KFCA 4JJ5A 2FMNA 3ECWA 4ADGA 1R85A 5JVLA 5IQOA 2G95A 3L08A 5AHNA 1VBGA 1YPZE 5FLVA 4MYWB 3JTSA 1QLEH 4Q7IA 4O54A 2GDUA 2R69L 4P2QE 1WUNT 4CU6A 2V9RA 4RGOH 1YNPA 2OJPA 4JHWH 4BXSV 3MRDA 2EDQA 4LH8A 1AO7A 5D96B 3ZHKA 4Q7DA 2NNXA 4DFIA 1KT2A 3CVIH 4WI7A 1ISZA 4S1SH 2ADGB 4ENEC 4CSTA 4OGAD 2DT3A 3EJRA 1IAOA 5AVVB 2OKOA 4PMVA 4HP5A 5KUKA 1RZ7H 4KXZH 3NVQA 3QEGH 3V35A 2R0ZH 1EJSC 1SHXA 1AIFA 1L0QA 3W7KA 1WG3A 2P8LA 2WLZA 2XFGB 2EIDA 4BI6A 3OR6B 3LB6C 4LOCA 3MWAA 3JWDL 3M6DA 2YRPA 5BUPA 2DTML 2FFCA 4JFED 1G7MB 5H37H 1WF5A 3SRKA 3A6OA 4QXTA 1IC4H 4Q22A 1KJ2H 5I74B 4W9IC 5HVGB 3BRDA 5FYJH 3TS8A 3P82A 2ZCHL 3KYNA 3VKDA 5DCDA 4JN2A 2CA4A 4KY1L 4WW2C 3NFUA 3VIOA 3W37A 2YL6A 3TN3A 1NCCH 2IIJA 4PGZA 2QVTA 5DVLA 3GHPA 2LAGB 3C6LC 4HUVA 4ZPVB 3S8HA 4WSKA 4OFVA 1KZYA 5FO7A 1J5TA 1NMBL 4F8OA 3HA1A 4W9LC 1OCQA 4LKXB 3TCSA 4JVPA 3V8CA 5BS0E 3QIUB 3UPWA 2Q7YB 3SCPA 5IROD 4NM4H 3FA4A 5K4XA 2P5PA 2ZX5A 1YKWA 4ACPA 3WFAA 3MBWB 4R3SA 1A4KA 2OL3L 3OMNB 4DLMA 1G5GA 3T0EB 3RDTD 1DXFA 5DQDL 3KCJA 4CGTA 4ZUUA 2BSBA 4JYFA 2DIEA 4F5CA 2FX8L 4P7LA 3U2JA 2UV8G 4OF0A 4WHYG 2PTVA 3Q48A 5E8NB 3HO8A 1PG7X 3ITVA 4P4KC 3BMXA 2YR3A 3L7RA 3ATFA 4X2PA 1BF8A 3MO4A 3WHXA 4HULB 1JGUL 1ZU8A 2LFGA 2O4QA 2XXFA 3FO9B 4LKCA 3OLIA 5HHMB 2ABBA 3AIUA 2PLKA 1NBZB 2DMCA 2OMZA 1H0GA 3FB7B 3S35H 4WKZB 4X0NA 1K7XA 4CMHC 4HXBH 1AGEA 3CXHJ 5AVWB 5IHZA 4PJAF 1YEWA 2VLLA 4ZBJA 2EDYA 2HS6A 3B5GA 1SOQA 2AXGB 2OS7A 3G1FA 2ONEA 2X70B 3I3BA 5EU7C 5BXSA 4KWVA 1L7IL 4KIEA 4XCYA 1J18A 3MDJA 1MAKA 4QJ1A 5FM4A 2VXQH 3BUYB 1T89A 2NQHA 4BSWB 2NNCA 4FFZA 4J3ZA 3BQUA 1QK0A 4M7JL 3MREB 3GMQA 3B0UX 2VWTA 5IFJA 4RLDA 2BVQB 4X80L 5C55A 5E0KA 3NPVA 6CGTA 3PAUA 5ISZE 3OVRA 3GZKA 5HSFA 4H7VA 2XIQA 4WVXA 2EKSA 1JD9A 4U0QB 4HH9B 5EIVA 2GJXA 2IH9A 4NIKB 3V18A 4XCEB 4ETQA 4QISA 5HYIA 4HCIA 5DZPA 3LHZA 4UBDD 5HYQB 3GG7A 1RUSA 4DO6A 1W72A 1M3IA 1W5NA 5EL1A 4WI3A 1N3NA 2ZYHA 2CXEA 2VX4A 3F03K 4PLJC 2RCSH 4NC0B 5I16A 4YE4H 1ZY9A 3CZUB 4DF1A 3LI0A 1XGPB 4LDEB 3R18A 2WAHA 5LQBH 5E9DE 5CGTA 4X22A 4XMLH 4RMTA 1UM4H 3WG7B 4XHQA 1QUMA 3FCSB 5A6MA 5E5UB 5DRXA 4EI6B 2Y72A 1KTKE 3ZKQD 2VSKB 4BF5A 3DOSA 2HKFH 4JRFA 2ALDA 1DTUA 2OR8A 3D7PA 4XE0A 4XHJC 4FZIA 4JG0L 2Z6IA 4NUWA 3NCJH 2Z35A 1C7TA 4F15B 5MKGA 2XGBA 5KSUB 3QKEA 5E08H 4WHTA 2OCJA 4XNZC 3FO2A 4OIFA 3VKAA 4K71C 1YEKL 5H2ZA 2BBFA 1ACYH 5F9OL 1FY6A 3MJ9L 1LO2H 4BQ6A 2R2BB 1Q72L 4Q6KA 3EOAA 1NP0A 3ITOA 1H62A 2WXKA 4GW1A 4LEEA 1SYVB 4Q8QA 3QDJB 1F8MA 3Q2CA 3WNIA 5IJCC 4G7RB 3BVJA 4Z5RB 4PY8J 3S3DB 3N2TA 2PCFA 5KSAC 2PMQA 3TYBA 3JWOL 2N56A 3Q6FB 5C0RH 3QW3A 2X44D 5KAQF 4NZUH 2HG5A 2EDNA 4HTYA 3OZPA 3W1RA 2GI0A 4DEUA 2HRWA 3RYMA 3SE9H 3LN9A 1RPQA 1KENH 3D5OF 1ADQA 3QC5X 2O7SA 3VFPB 1OPGH 4LCCC 1F4YH 1IXQA 4UTKA 3M0LA 4W5UA 3EYQC 3IJ6A 3MKVA 1HZYA 2A3BA 1GHFH 1HGYA 3LVTA 1YBQB 5CSYA 4ZXBB 3HGRA 1FRGH 4R7JA 4O1EA 3HA0A 3KWWB 4EWND 1UC6A 4B92A 4HPOH 3OBKA 3T0TA 4ZSOA 4D6EA 3ZOAA 3V0TA 1PZ5B 3QORC 3QG7L 3BWAB 3WN6A 4AE1A 1XF5B 3RX8A 2ZUVA 3WQEA 3UETA 4F2EA 2Y61A 2CH8A 1XLCA 2GEEA 1JFQL 4PA8A 1BLIA 2BP0B 3CHRA 3W24A 1AD0B 5FIEA 4IJ3C 3IE9A 4JHAL 3OKKA 4HZMA 1OLLA 3O81A 1SJHA 4E9WA 1UXWB 4JIHA 4RPPA 4AM0B 1VEOA 1Q6CA 3VFLA 4LOUC 3C52A 5L2KE 4MFHA 4DX3A 5G2HA 1SM3L 1HDMA 1VCFA 4ZFCA 3OJDB 5K9KB 4G5DA 2E6FA 3ZTNL 3D3VB 3FFSA 4HKJB 4YDJB 1WB0A 5C0IB 1ZTXH 1A7RH 1JFXA 4CSPA 1YMYA 2D2CC 4PJIA 2JJSA 1L9OA 4N2IA 3TNNB 3TIMA 5B7MA 1KGCE 4R83A 2J78A 4G6KL 2P50A 4S3DA 4M02A 2OYKA 2R0WH 2EJAA 4N9OB 4QTIH 4OM1H 3EJQA 2D3LA 1B5TA 1RBOB 2EPNA 1WJ3A 3AWEA 4MPQA 3Q06A 3EH1A 1A5OC 2ICEA 2FB2A 1Y6NR 3ONCA 5I3HA 3URQA 2Y89A 5I75C 1NBQA 1D8WA 4PUEA 2JKEA 3U46B 4KBXA 1KCVH 2DICA 4OIIH 3DH7A 3EOBA 4DBWA 4PJEB 5DA4A 1JR1A 2A9AA 1GGYA 4NZ1A 1GMEA 1MFEL 5GJTH 2J6WA 4KXAA 2JTDA 3SPJA 3UCDA 1GYVA 4LYPA 3REVB 3SDXF 2Q2LA 1DQQB 3FK3A 4AMXA 4HW6A 2G60L 3EWCA 4YO0B 4M6VA 4IIQC 2XIJA 4PV8A 1ESWA 1Q6LA 1TQWA 2Z31B 3LMJH 3S0CA 1ZUAX 5AC5A 4MDIB 2VC2H 4E42A 4DP6X 3G18A 4FOKA 2JQMA 4F40A 3GI9L 5F7DA 4P5TA 4LRIC 5HVHB 3BV7A 4YZFE 4ANXA 3CUZA 1BGXH 1FWWA 5IGXH 4WEBH 1PVHA 1IF2A 2AJZA 2O61A 4HBKA 1CB2A 4AUYA 2FWSA 1G7IB 4XPTH 4UILH 3QJVB 5ESAB 3NJNA 2GTWB 3FTGB 1IAKA 1E43A 5HI5C 1AD1A 1Q8MA 4ENLA 4BK8A 4MVAA 5JBEA 3OTRA 2EIMB 2R2EB 2OP4L 4DJFA 1OGAE 1AKJA 2J8UB 4N9DA 3TE9A 3HZYA 4K36A 2R83A 2V9QA 4M3KB 4DAGL 2OULB 2YBTA 4AD5A 1AZCA 5ABTA 4H19A 2AJUL 3F7QA 4RGNC 4NHUB 2VN6A 4TSAL 1LRQA 2W3ZA 4APXB 2GAZA 1VDGA 3RI5F 5HUOA 1Z0NA 3SY5A 2VYOA 2JJSC 4FHAA 4YNYB 1A9EA 1M2OA 2DQGH 1HKVA 3BD5A 5BV7B 4X5LA 2FPVA 5I1AA 4H8WC 2L7EA 4YIQA 1V79A 4BGLA 2A83B 4FC3E 3TCEA 4YDKL 3UROR 2AK4A 5JXAL 3CNKA 1C8PA 1LUCA 2FLBT 3QULA 2ICEC 4JPQA 3GRWH 3FU9A 5SX5H 2FDBP 1GK8A 3L1EA 1E27B 3D8MA 2DKUA 4KUCD 3I50L 3U4FA 3LNDA 3RX4A 3WQ5A 5D02A 3L4XA 4X5XA 3BSZL 2ADIA 1HS6A 3FSOA 3MLWL 3MPGA 1EOMA 3UPRA 5GNZA 3HMXA 1G4SA 2QSQA 1L8PA 5C09E 1YN6B 1RXLA 4KK5C 3GNXA 2G2NA 3GDMA 4NIRA 1IO4C 1T80A 4F37F 2VDKH 1Z5LB 3SQOL 4PVMA 1VSCA 3TBWB 1YDNA 2EECA 3FO0L 4ALAL 3TYFB 3EXRA 2O1AA 3HC4H 2HJKA 3R0UA 2YBGA 3SB0A 4AT6B 3FYEB 2DZBA 3A4XA 1J79A 4PB3A 1U8PA 3DMMA 1X5GA 1UA6L 2UWEB 4MADA 3BH8B 2AW2A 4H5SA 3IVKB 4P5TC 3UZVA 5B8CA 1QX1A 2XSBA 4W9TA 2PTWA 1NUFA 1F58H 3RVXD 2P9RA 2YD4A 3OGCB 1OIOA 3O3DA 3TJHD 3EGDB 3RLHA 4F7TB 3M45A 5A95A 1K6QL 4A7TA 3F8UB 4XP5H 4HS6B 1T1WB 3SKOB 1KBKA 2BHZA 1ZLEA 1BOGA 1ZA3B 2VR2A 5M5DA 4ZODA 5CZXC 4WUUE 3CQPA 4DKEH 1U8JB 5I0VA 1K4HA 4XKYA 5IOBA 4KMTL 2RDUA 4MS8C 4US6A 2JVUA 3Q44A 3UDWA 4HU8A 1QBLH 2XPZA 2FHFA 4PJHF 4DI8A 1YEEL 4L37B 2HKAA 4R90H 1DBBH 4LNYA 2ROXA 5JUEH 2PP9A 3LCXA 3O2WL 1UXSB 3STEA 1QFEA 2ADGA 2A6IB 3W1PA 1WAAE 4CNOA 5E7FA 3VE0B 4GXVL 2W0FB 3PF2A 5KJRL 5I0DA 1BX2B 3RE0A 4YTSA 4PMFA 4S10A 1N0XH 4IIGA 2HTMA 4Y89A 3LRMA 1KN4L 2NY4B 1VGAA 3U7YH 2UY5A 4XVDA 4WKFA 5I8OH 1GW1A 1MHEB 2Y36L 2VGBA 2WMKA 4HWBA 3CMJA 3OR6A 3MI2A 2J5WA 1X9QA 2VR6A 3PZ9A 1FVEB 2R91A 2JCWA 3QXWA 5IW3A 2A7NA 4WENB 2G4EA 2AQVA 3EO9L 4D6JA 5AENA 4ABUA 2AGJH 1PBGA 3NJ3A 3E5BA 2Z2UA 1O6TA 1EJ7L 1UM6L 3MYOA 3AJ7A 1QSFD 2OW6A 3L3JA 2XA3A 2PO6D 4EK7A 2PDYA 1FYTE 5F2FA 2E9JA 2J4GA 1GW0A 3KD4A 1K4CB 4YK4C 1IB5A 1CT8A 4LVNB 4NAJA 1A6PA 4GUJA 4ZPVA 1U91A 3HG1D 2P5EE 4IMCA 3WQDA 5HHXL 3ZRSA 3KGUA 1JZEA 1H9DA 2V69A 4LKXA 4G71B 1FO0L 3AREB 2UY2A 1DN0B 2CRMA 2AI0L 3DMMC 4NN5C 2Q7YA 5CIPB 3LKOB 3F4WA 2YPLB 3GR8A 5DJYB 3GO2A 4DJED 3MBWA 5B8CC 3LKNA 5EBMB 3CIWA 3PR2A 4JTFA 1XR8B 1TCMA 2QKSA 2X6UA 3BLDA 1E2ZA 5HHOB 1WDDA 4L4VD 2VR5A 4KTDL 4FFYA 5F7YC 1Z7JA 2UWFA 4N2NA 3RUBL 2XT1B 2X4NB 3BVXA 1E6OL 2OKMA 1TQVA 2DLHA 1W1A1 3O6FD 3SGJA 1TTPA 4X98B 1TZHB 5D30A 4XMKH 1Q0YH 1QI4A 1DQJB 5CPSA 4NQEE 3L17A 3VA2C 3WKNA 3UDWC 3O3BB 3JTTA 3ALGA 2HX9A 3QEQB 3M41A 1RV6X 1B3YA 5AFAA 3P30H 3QYMA 5D96C 3LSBA 4HNCA 3IDXH 5DQPA 4K7PL 4I7WA 4H6EA 1A2YA 1JNJA 2QDVA 4GE8A 5BXPA 3F65A 2AXGA 1KM3A 4G9FE 3QWRA 3N4AA 2X70A 3E2HB 2ZG3A 4OT1L 3T6WA 4L48A 4DUXA 4F7MB 4MB1A 3UVAA 1A4MA 1ZRUA 3IBEA 1UUSA 3MRBB 3RK8A 4ZQOA 4UFLA 1CDCA 3DJSA 3BUYA 3HNSH 4BSWA 1HZLA 5F8RC 3MREA 1FWRA 2XIBA 4KROD 5I1JH 4I6KA 1EJFA 3QQ4B 1NCUA 2O30A 2BVQA 4LSRL 4JQ1A 4Y2DB 2MNRA 3SY1A 3MUXA 4S3GA 2YQ3A 1E71M 1YUHB 4XBSA 4HH9A 1YYMH 1MCFA 5I0YA 2EYTB 5I74C 2POTA 1RIHL 1JPFB 4WY0F 3HC0B 5D2YA 5J1SC 3ARQA 5HYQA 1PKMA 1TTUA 4WO0A 4N4YB 1SJAA 4UTHA 3GMNA 3ATEA 4URTB 5C3TA 1FAIH 5F7NC 3IPBA 1IAIH 4L5ZA 5I1CL 1TB3A 1XGPA 3W1LA 4WW2B 2IANB 2FIKB 2WBGA 4CILA 4BFGA 4F9JA 1NCBL 1S2VA 3FCSA 2BIMA 1F61A 1VJZA 4LIQE 1SR0A 1W9VA 4GH3A 2VWEE 3UY8A 3QIUC 2Q8LA 2R4SL 5LA2A 2J8TA 4OCYH 1WUZA 1MH5A 5I23A 3RFAA 2VDPH 3VWJB 1U8NA 3T0EC 3QFJB 1JPSL 5KSUA 4KUZL 5TDOA 4DYEA 3W0WB 2WUBL 4M4RB 1JZ4A 2XA8L 1XSIA 3RCNA 2R2BA 4Y9CA 3CAVA 3HFFA 2C34A 4PCPA 4MCYB 4YR6B 1SSDA 2EJ1A 3SGJC 4I5XA 3NIYA 4LY4A 3GSWB 3VXOB 1VEPA 2W63A 4LJ3A 1C9SA 3PAYA 3CAQA 1MNNA 4Z5RA 3QVAA 4DZ5A 4FXRA 3CT2A 4N86A 1B3JA 1T6MA 5J3HC 3E2SA 4YXKL 5DMIH 2TSYA 3Q6FA 4LFHG 4W7VA 2OZ4A 4K2UL 4XWGH 3IACA 5LO7A 1WUEA 2JKPA 3SJVB 4Q9RL 2ZNXA 2DD8H 3STCA 2F54E 3WY2A 3M0HA 2BVYA 1I2NA 5AALA 3R12A 3FJ6A 1VFHA 5KW9H 4OTXL 4HCFA 3N1GC 5DRIA 1A4BA 3TZFA 1ZGLB 3ZRFC 4HBCL 3OKDA 1AZUA 2IQ9H 2VFHA 3QZ6A 1QMUA 3H42H 3VFPA 4J27A 4JX6A 3PB2A 1S7QB 3LTYA 1EJRC 1NC4D 2KQMA 1YBQA 1DBKH 2HWZH 5HBBA 1UKSA 3KWWA 2VLJE 1ONXA 5ANMA 2NY5L 4J3VA 3RA7L 3F58L 2KBGA 3MYZA 5EF1A 2J1WA 4EPBC 2DQEL 1PZ5A 1A7QL 4QFUA 4DNMA 3BWAA 2JF6A 1XF5A 4ZFFB 3AUOA 2D2OA 4AGPA 1OQOA 4PUNA 1AQFA 5LLIC 2QEJA 5CJNA 1W15A 3B9OA 4KC3B 1LM8V 5AVSB 2H4EA 4HKXB 1GYWA 1QLRB 1ECQA 3ZE1E 3M17B 4MZ2A 2JEPA 1E9LA 1FH2A 3BPCB 2GY7B 3FFCE 3G6DH 4FFTA 2NY7L 1UXWA 1I8MA 4AM0A 5J0BA 4P8UA 3LZ3A 4JFDD 3ZT7A 2FEEI 1B4JL 4I77H 1I0BA 1KULA 2A0LD 3OJDA 5K9KA 4J6RL 4GG6B 1S2TA 4ZE5A 4ETYA 3D3VA 3WD5H 5C0IA 3V4VH 2E7DA 3T1FA 3S4TA 2H1LM 3IUIA 3WKML 5C9RA 2WXNA 5EUKB 3TNNA 1QRKA 5A6AA 1AYOA 4F15C 2DUZA 4PYHA 4MGXA 4XVOA 3AVEA 3UOAB 3VIIA 1LTXA 1KIPB 1E2WA 2QULA 1P7QB 4RXFA 3V0SA 4O2CB 3S1UA 5JH1A 5T1LB 4NT0A 3TIEB 1T6WA 4IOTA 1UMLA 4ZS7L 4OD1L 3U46A 4FQ1H 3BQVA 4J6IA 3GBML 4PJGE 3PY9A 1S7SB 1II4E 3NOYA 2Q3XA 3FVDA 2PTXA 4WEMB 1IZCA 2R14A 4LX4A 2ZE3A 3UJIL 3E0LA 4GAYA 3ZDXE 2Y7GA 1NIEA 3LNMA 4Y9AA 4HNOA 1DQQA 4NLHA 2BCKB 1DJQA 3WLJA 3WIHH 3JV5A 2OZTA 1D5IL 2Y7QA 3D0AA 1V7YA 4N2KA 3BDKA 2Z31A 1MRFL 1QPNA 1P4BH 4UFJA 4MDIA 2I24N 3WV0A 4ODHL 2PMZA 2I32A 4K8RL 4ZXBC 1R5WB 1QOQA 3LMZA 1NGYB 2ESVB 3JUZA 1J6PA 3W2NA 3K4ZA 3VDAA 4RH4A 4L23A 5LHFA 3SYQA 3OGOE 1N0LA 1G7IA 3VZZA 3FQYA 3P81A 5EOCJ 4IRJB 5ESAA 2W79A 2V81A 1QRNB 2HBVA 2YLHA 3FTGA 5HJYA 4WK0B 4HS8H 1DQML 2OOFA 2IGFH 4JFPB 3CFBA 2ZZ7A 5EWIL 3KP0A 3X12B 3MI3A 3TWCL 5LVEA 1FG2A 2R2EA 4M5YH 1UFUA 4HUNB 3HFTA 3HEIB 1P4IH 4PFHA 2J8UA 3NFSH 3LBOA 2X41A 2PDCA 2YDRA 3E0WA 4H0LC 3LPGA 4PJXB 1X5MA 4YDVA 3CHFA 2QCEA 4OCSH 3VRLF 1CXLA 1LYXA 2QJIA 3EKLA 2OZNA 2OTDA 4YLBA 4RSVA 2FCBA 1CGUA 3WKPA 3C2RA 3S1XA 4JQVC 4APXA 4WGXA 1Z32X 2EPHA 4IS6B 4OZFH 2HJLB 1Q38A 1PZAA 4OOUA 4ES8A 4YWSA 1D2PA 4IPIA 2QR6A 1HG3A 3X11A 4QBXA 1SVZA 2A83A 2VKZG 5JQ9A 3V5HB 2F8QA 1QTYT 4GYBA 4HPNA 3GEWB 3JWNG 2N4IA 1R2TA 4YEEA 1HCFX 4KEVA 5AB9A 3UVIA 4AIOA 1E27A 4HNNA 1NZRA 1DBML 5E4EB 3W23A 1KFJA 5IVNA 4DWSA 4H2CA 3RO6A 1OSEA 3UF9A 4NX0A 3V7PA 1D7BA 1YN6A 3DBNA 5E4OA 4YDZA 4MAUH 5CZKA 2ZADA 4HA0A 1TZAA 1RUQL 3L5XH 2V6HA 1XVSA 2QQLH 4JFOB 5CSZB 5D04C 3BPOB 3G8EA 3TBWA 4YSEA 8FABB 4QRUA 1X5XA 5EBAA 4JFZH 2Z31C 3FQ2A 1K7EA 3ZMRA 4AGLA 5AVZB 1PU0A 3HZMA 5C0EB 2RFXB 3KW3A 1F3XA 2UWEA 4OZIB 3BH8A 3FC8A 1XLJA 2IQAB 5HVHC 4DIXA 4JN6A 1NP2A 2F9BT 3FUIA 3B1UA 3FOMA 3OGCA 3UX9B 1QCWA 1J0HA 1OE2A 1TVDA 4F7TA 2CYGA 2R6OA 5K9JH 1O9WA 1U83A 3POCA 4HS6A 1T1WA 4FE9A 3OAWA 1TEYA 3FSUA 1ZA3A 3UTZB 1M9HA 2XN9B 1NGPH 1U8JA 3N6YA 1FXQA 3N43F 3NPZB 1P6FA 4QITA 1Q9KB 4PVBA 4L37A 1CJYA 3R06B 1A4CA 35C8H 3UYIA 1BVWA 3RWDB 3GS6A 3VW3L 3W85A 1S1PA 3BX7C 1SZRA 2XUWA 1UXSA 1KXTA 2A6IA 3BUTA 3VE0A 3SBRA 3E74A 1BPVA 2WSRA 3TBVA 3BZEA 2W0FA 3QK0A 4Y2NA 4QIUA 5BV7C 1EX5A 1BX2A 2A2IA 3JWNC 3KRZA 1QLFB 5F1NB 5I1KL 2J56A 1F3EA 4K9EC 4AQAA 4PBXA 1MHEA 1PZBA 4FQ2L 3P0XA 5DMNA 3VNMA 1PTAA 4I7ZC 1CL7H 43CAB 5GZNA 4CCCA 4U6HB 4PRHE 5JDSA 1FVEA 1SY6A 4TUFA 1FP8A 1W8NA 3AACA 2CHOA 5CJQH 4QHLB 4TSCH 3P77B 4KCVA 4EN3B 1IXNA 3WFCL 3MMUA 3NJHA 1NINA 3TDFA 4DPQA 1R33A 4WZ9A 2YJQA 2BFVL 1R47A 3MJ7B 3ZBMA 1E50A 4NF7A 5GS0C 3AS2A 3WF0A 3TN0D 3KRUA 2R9HC 4W85A 1I1FB 2P10A 1VPOH 1JGEB 2WZTA 3BZDA 4MAYB 4I7VA 4KMQA 4PUJA 5FUZL 1F4XH 1H3XA 3DJRA 1WSST 3X3GH 2N1TE 4IIEA 4YMPA 1I2OA 4DM1A 4EF8A 3DX0A 4S3EA 4HHAA 4EQ3A 1G7HB 4GVFA 1FH5H 2A9ML 5CIPA 5IBXC 3LKOA 4AVJA 4XE5B 1MXGA 3WF3A 5EBMA 2XRAH 1XR8A 5EUOE 4HYVA 2WIMA 1XD1A 4EXAA 3K3QA 4R4NC 4I1PA 5HHOA 4GRWB 2B20A 1G84A 2H32H 2X4NA 2ZYIA 1XCQB 2PURA 1CBGA