1P6WA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with the substrate analogue, methyl 4i,4ii,4iii-tri-thiomaltotetraoside (thio-dp4)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of barley alpha-amylase isozyme 1 reveals a novel role of domain C in substrate recognition and binding: a pair of sugar tongs
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords PROTEIN (Alpha-amylase type A isozyme)
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1p6wA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1p6wA01
1QNRA 1ITCA 2WKGA 3BLPX 2XGBA 3ZIZA 1O6IA 4AWEA 3ZR5A 1XH0A 2JFEX 3T0AA 3GH7A 3ARZA 3VM5A 3EJSA 3F4VA 2XIIA 1BPLB 1X1NA 3WF1A 2EABA 3WNKA 3AICA 3HN3A 3QGVA 2BNJA 2DIEA 4PYSA 1PIFA 1U2YA 3ALGA 5DF0A 2E8ZA 1O7AA 3OGSA 3AZSA 1R7OA 1HVQA 3KL5A 4HTYA 4BQ4A 5BYWA 3NUKA 4GI9A 4Z2HA 4QCEA 1PX3A 1HN1A 1OB0A 1QI5A 3HG5A 4QFUA 1EQPA 2QF8A 1JIBA 3N1AA 2XHYA 3N11A 4UQDA 5GPRA 4CVWA 1QNPA 2QMKA 5KEZA 3WH8A 1V3HA 2V3DA 3AIWA 4DO4A 5TD4A 1YQ2A 2GK1A 3EJQA 1D2KA 2XVLA 1V03A 3SCWA 1ZL1A 2WPGA 3D52A 3VMOA 3GZAA 1J9YA 1UH4A 3ARYA 4D72A 4UZUA 5BWFA 5JUVA 4XUYA 4GO9A 1EDQA 1C8QA 2UY5A 2Y4SA 1CECA 5D8WA 3DX1A 1G1YA 5C8BB 1FH9A 1J0HA 4B9ZA 2OYKA 2BHUA 2WLYA 1AQ0A 2GFTA 4WSJA 2YL9A 3LPGA 1E6QM 1R8LA 4FK9A 4P7QA 3DYPA 2WWDA 3AZRA 4UFMA 4P7RA 3OB8A 4MNLA 5GNZA 3NJ3A 4V2XA 4AD2A 1MQQA 3WFLA 4WF7A 1FFRA 3SUVA 4ATLA 1JZ5A 2JEPA 1DEDA 1KXTA 1ZBWA 3WNOA 1WZAA 1W9PA 2CEQA 3U7BA 1MWOA 4L4PA 1UKTA 7A3HA 5D8ZA 4AD4A 1E4LA 4W8BA 3WDQA 3VGGA 2YIHA 7CGTA 1GONA 1H09A 5E0FA 2E9LA 3N15A 3W25A 3VGEA 3WENA 2VQUA 4AMCA 4H8HA 4S3KA 2WHJA 3A47A 5FIPA 3GBDA 3D4ZA 5IDIA 4AC1X 3VO0A 3GDBA 4DM2A 3FW6A 1KXQA 1HJWA 3S2CA 3SEPA 1QX1A 3BVVA 4PMOA 3BAWA 3U5YA 2BXYA 3BC9A 1WDSA 4W88A 1Q6GA 2WANA 2WC3A 1B9ZA 2VRJA 1M53A 3SCRA 1BAGA 1OM0A 3WNLA 3O2LA 3BAYA 2WMFA 4AMXA 1CGTA 4AZBA 1BVZA 4KWUA 3BVUA 1HL9A 1LG1A 1W3KA 1LL6A 1UR0A 5CLTA 4ZFMA 1M04A 2QV4A 4PSRA 1TVPA 1FHLA 2VJXA 4PTXA 4W7VA 4PMQA 1HJUA 5KZ6A 3JUGA 1E1FA 5HOSA 3IAQA 2VCBA 4KGLA 4AISA 4JFUA 1TA3B 2VCCA 3EDKA 4BQ3A 3CZLA 4U2YA 1WAWA 2XFYA 5LYRA 1QHZA 1E6ZA 3BSHA 3VDHA 4UNIA 5ECUA 3S6TA 2J7DA 1XSJA 1QPKA 1GHRA 4FLSA 4R27A 1TQWA 3MSGA 2BY2A 1UWRA 3DYMA 1BTCA 1UD6A 5BRQA 6CGTA 4ZE5A 5C71A 3MSDA 4Q7NA 1GOWA 2VX6A 3VNYA 4WKFA 3BSGA 3QR3A 1MQPA 2F7QA 3VPLA 2VZSA 3RPMA 3WMBA 4H8UA 1HJQA 3WFZA 1H11A 2VVNA 5IHRA 4B3KA 1JXJA 1LQ0A 3GNOA 5HNNA 3CZJA 1JZ6A 3H55A 4WJXA 4MDPA 2WMIA 2FHCA 1HNYA 2WNWA 3AJ7A 2D20A 1JAEA 1MW3A 4EKJA 2CHNA 1XCXA 2DSKA 3DYOA 1QHOA 3WUBA 1KTCA 1QVBA 1PIGA 5A2BA 1M03A 2PWEA 1A3HA 3CHEA 3KZSA 1RP9A 4WLCA 4Y7EA 1E5NA 4PMDA 1LJYA 4H41A 1FOBA 3NSXA 1DWAM 3LPPA 1MYRA 5JBEA 1CGVA 3K46A 4MTVA 3WQVA 1QW8A 4J3TA 1V3JA 4ZEPA 2ZUNA 3WNMA 4D1IA 3ZMRA 4UFKA 1SMAA 3B9DA 4PUEA 1FP8A 1Q6FA 4Z2LA 3SCTA 1CDGA 4OUEA 1GNXA 3VSTA 2ZUUA 1UH3A 2VRQA 5BXTA 1BG4A 2VZUA 1CPUA 4PEEA 4AIOA 1FHDA 4X9YA 3D50A 1C90A 2PC8A 1GOMA 4EE9A 4W8AA 1E6RA 3W82A 1EHNA 5GNXA 4H04A 3K4DA 1VB9A 3WH7A 1H4PA 1FH8A 4Q22A 3VDBA 4UQCA 5FL0A 1W1YA 4C7GA 5CSYA 2W63A 2YBTA 1UD8A 1EH9A 4FF5A 1RP8A 1FA2A 3DX0A 5CJ5A 1ZU8A 3DECA 5AYIA 1G5AA 1J0JA 5FOOA 2WAGA 4S3JA 3RM9A 3AHTA 5E6ZA 3PN8A 1GOQA 1Y7VA 4BQ2A 1GQJA 2GDUA 1NM9A 3PZTA 4ZXOA 3CZSA 4DUWA 2F18A 1GPFA 1R75A 3RILA 5JIPA 3ZJ8A 1E43A 4F66A 2F2HA 2EBNA 1E0WA 2CITA 1QOXA 7TAAA 3IANA 2QHAA 1PX4A 1E70M 1OD0A 2AOSA 3WDHA 3PZOA 2YDQA 4P8UA 3F5KA 4J3UA 4NZCA 3VSUA 2CKRA 2QLYA 1JD9A 4CD8A 3LXAA 3EMZA 3MV11 2XFFA 1S46A 4MNMA 5JBFA 1TZ7A 3FHQA 3MV01 3VIPA 2XN0A 4GZIA 2OWWA 3LRKA 3WQ6A 1V3LA 1V0LA 1ECEA 1NQ6A 1ODUA 3GH5A 5A6LA 1R85A 5A8PA 4P7LA 1JD7A 1I75A 3AHXA 5A1AA 5AYBA 2D24A 3AHYA 3VVGA 1MFUA 3WL1A 3GM8A 5IXEA 4C7DA 4D6JA 1QBAA 3N18A 1C93A 1VEMA 3I3DA 1ZJAA 5IHSA 3AIQA 2IXVA 4OOZA 2VURA 1BYAA 4CN1A 1WO2A 4MAVA 3PTMA 4QP0A 3HZ3A 4TTGA 4AW7A 2OLHA 1MXGA 3FXYA 1W3JA 2EPOA 3VKKA 2J62A 4BS0A 3AISA 4CU6A 2ZICA 2A3AA 1G0CA 4JFSA 1XD0A 5HXMA 3W37A 4PMUA 1ISZA 2DT1A 3M07A 2F7PA 1NP0A 3SCPA 3EJUA 1UD3A 1W9XA 2UWFA 3BLBA 1JZ8A 4DWSD 3PTKA 1UG6A 1VFOA 1FFQA 4LX4A 4ACZA 3D51A 2FH6A 3K8KA 3VX1A 1QNSA 3N04A 4XZWA 1E9LA 2V3EA 1WZKA 5A8OA 3FAWA 3BVXA 3AI0A 2G4FA 1R47A 3ARWA 2X2HA 4PCTA 1CTNA 3I3EA 3D3AA 4MDOA 2OYMA 3KE0A 4PSPA 2EJ1A 1R34A 5DEZA 2RGLA 2WCAA 3WQ8A 4OBRA 1WPCA 4A4AA 1SYTA 2F1AA 4UOJA 3RMEA 4MADA 4D6GA 3MKKA 5CSUA 2WMJA 9CGTA 1WDQA 1TQUA 1GUVA 5LA2A 1B3ZA 1E56A 1UR2A 4HOWA 3LXBA 2G41A 5IFPA 3SCNA 2D0HA 4F9JA 3PZVA 2D23A 1JL8A 4HZ8A 3CZNA 1TQVA 3TTQA 3CMJA 3CUHA 4MJ4A 4AIEA 1WNOA 1BYDA 3WH9A 2YA2A 3VIOA 2PWFA 2E40A 2WYSA 1W3HA 5ABFA 1J0KA 3L4WA 3CC1A 4TTUA 4AD1A 1JI2A 3L4ZA 2AAAA 4IM4A 3VSVA 1GOOA 3POHA 4LXFA 2CCRA 3B9AA 2GSJA 1NWUA 3SUSA 3AFBA 5F7UA 1CGWA 3FNDA 3MANA 4JKLA 1GW1A 3OGVA 4CN4A 3VD9A 1K6AA 1E6SM 3RDKA 3RO8A 4HMCA 4W87A 1CXIA 5FL1A 3WBAA 4BF7A 1A47A 5I3DA 4HA3A 3F5LA 4J3WA 3CO4A 2D22A 3K1DA 4JAWA 3BAIA 2GJRA 1H1NA 3T2PA 3PHAA 4XZBA 3W53A 2FDMA 3GNRA 3G6MA 3G6LA 2BHYA 3FY1A 3VGHA 3UCQA 1VJZA 2GUYA 2ZXQA 3KWXA 3CBWA 1WKYA 2J7CA 3WSUA 3WF2A 1ESWA 3EDDA 3AHZA 4JZ5A 3WMCA 4JHOA 4J28A 1E4NA 3ZJ7A 2PBGA 1LG2A 4B9YA 2VT0A 2ZOXA 2OW7A 5EFFA 1GZJA 4X0NA 4AZ5A 3WF0A 2ZWZA 2VO5A 1B2YA 4NZJA 1U33A 3NDYA 1IV8A 2D2OA 2WKLA 3DHPA 4ATDA 3N12A 4CN6A 3I3BA 3UR7A 2FGZA 3U57A 3WD3A 3WUFA 4H7VA 2VUYA 4ZE4A 2ZUTA 2GDVA 3BLKA 2UY3A 2YFNA 3EDEA 5ABEA 1C8XA 2BVYA 2BVTA 2CERA 2YFOA 4NXSA 4PCSA 1EA9C 3VGFA 4GQQA 4CD5A 3LPOA 2ZXDA 4BZYA 4MB4A 2W4XA 2O9PA 1CWYA 2ZUSA 1KBBA 3VMPA 1JNDA 1J18A 5A69A 1Z32X 1AMYA 3N17A 3HG4A 1UWSA 3RM4A 1QNOA 1B31A 3SCUA 4HU8A 2XVNA 1NP2A 3WBEA 4MPKA 2EADA 3AIRA 4N0RA 3BVWA 1XHGA 1ZBCA 3NSNA 1XYFA 2XGIA 1HL8A 1UYQA 4HZ6A 1SMDA 3AIBA 1CYGA 1JYNA 2WM0A 1TMQA 4HMDA 3WD2A 3WQWA 1W2VA 3A23A 4CCDA 4GZEA 4AY1A 3WD4A 4LYQA 3EDFA 2D3LA 3AMDA 1XYZA 1KQYA 1BHGA 4J3SA 4FLQA 5M03A 3NIYA 5CZKA 4OKDA 3PZNA 3TTYA 2X0HA 1V02E 2FGLA 2Y5EA 1W3LA 1E6NA 4AYGA 3ZSTA 3BGAA 1V6UA 5HPOA 2WK2A 4OZOA 5I24A 4JCLA 2IXUA 4AD0A 2WC7A 4HA4A 1CXEA 3DX3A 1LWHA 2W66A 3AMGA 4JFWA 2XSAA 3WEZA 4AYSA 1J0YA 4M81A 3DC0A 4OGZA 3BUPA 4ZXLA 1O7DC 3K8MA 3EDJA 2CIPA 2ZE0A 3FAXA 1XV8A 1MQRA 2ZX8A 2BS9A 5A2CA 3K4AA 2DSUA 4D1JA 3SCVA 1EQCA 4D6HA 3KLLA 2D3NA 1WP6A 4UFIA 4UQAA 2XIBA 2DSZA 2DDXA 4QAWA 1HKIA 4GIAA 1E71M 3W28A 2F7RA 3UESA 4MB3A 2W91A 8A3HA 3CH9A 3AS0A 3CLWA 2ZX5A 2W61A 5LA0A 2ZX6A 4MNJA 1E4MM 2G3JA 5A8MA 1Q6CA 3WKZA 2G3MA 2BY1A 4M56A 1V0KA 3AMLA 3UR8A 3CTTA 4PMZA 1CXKA 3AIEA 2WBKA 4GO8A 3AS3A 1NWSA 1OWQA 2DEPA 3ZT5A 2DSWA 3S5ZA 1XRVA 1CIUA 3VDCA 4B15A 1UA3A 2A3HA 4URIA 3VD4A 1TR1A 3LMYA 4U5IA 4FNUA 2VR5A 2OW6A 2FYVA 1UR9A 4PMNA 3CUIA 1UA7A 3RJYA 3CZKA 4MAZA 2XUCA 4NF7A 4OIFA 3RM8A 3GTNA 4AZ6A 5A94A 1HIZA 1OIMA 5DFAA 3L2MA 2CNCA 2E4TA 3PZ9A 4XV0A 1CGXA 4DM1A 1TCMA 3VIGA 1RPKA 2UY2A 1NOFA 6A3HA 3W26A 2HVMA 1J0IA 3WEMA 2E9MA 1JXKA 1JZ3A 5A6JA 2OYLA 3VU2A 1DWHM 3THCA 3L2LA 2Z1SA 4AZGA 3GXFA 4AD5A 1KQZA 4YPJA 3WF3A 2B31A 1WZLA 3OA5A 4M1RA 4CU8A 3B9EA 5GQBA 1AQHA 4CGTA 3GXDA 3ARTA 1UD2A 4M8UA 2VMFA 3AS2A 1EXPA 3CHCA 3L4UA 3OIHA 4V27A 3II1A 4M29A 3KL3A 1ZBKA 3U7VA 1CXLA 2CBIA 1JF5A 4NZFA 3HJEA 1XD1A 4NRSA 4E2OA 4ATWA 4CD6A 1BYBA 4HOXA 4E4PA 1MFVA 3WMSA 2C0HA 4IPNB 4ACYA 4GZJA 2VZOA 1HP5A 2EXOA 3OZPA 3EMCA 1T0OA 3TA9A 4P8XA 3D4YA 1E55A 2DT0A 2DIJA 4E8CA 1HKKA 2VR4A 2YLLA 1SFSA 4GQRA 3M7SA 1KB3A 3VINA 1OSEA 2QMJA 1SZNA 2ZXBA 1E5JA 1CEOA 2CBUA 4EAMA 5CLWA 1CNVA 2XYLA 1UWQA 2WHLA 3PZGA 3T2QA 5CG0A 1UHVA 1UOKA 2YL8A 4UR9A 1J11A 1W1TA 2GJXB 1WDPA 4UFJA 2J47A 5CPTA 1QI2A 4M24A 2NT0A 2A3EA 3WD1A 4PMVA 1BF2A 2X8RA 4U3AA 1GQLA 1KFWA 3W0KA 3MS8A 1CBGA 2G3NA 3CV5A 1C8YA 1E72M 1UR8A 5CPSA 4DWSB 2J25A 2XN2A 1KGXA 3O9NA 3THDA 1L0PA 4NI3A 2Z1KA 2Y8KA 4YN5A 1HXKA 4PMXA 1W9DM 1CXHA 1C3FA 2E9BA 2WVVA 4GINA 1J01A 2X2JA 1UD5A 3WUEA 3VD5A 1KWKA 1NWRA 1OD8A 3GXNA 4CVUA 2W67A 1NOWA 4DUXA 3QOMA 3WH5A 1BYCA 2GVYA 2D0GA 2BFGA 1H41A 2IUZA 3ZT6A 3WY3A 3DDFA 3W24A 1E40A 3QOKA 2W92A 4ZENA 2YA0A 3QHOA 2XG9A 1UQZA 1MVYA 1W91A 4Z2KA 2JF6A 3BUIA 3ARVA 3L4YA 1K9EA 4CCEA 3MU7A 3TP4A 4DO6A 1KGUA 5A8NA 2WBGA 5I5RA 3T09A 5A3HA 1JFHA 4W5UA 3ZR6A 3VD7A 1H3GA 1ITXA 5BROA 1JNEA 4TVCA 3BAXA 5D9OA 3D5HA 4WKHA 2VRKA 3EBVA 4RE4A 1KXHA 1B90A 1WE5A 1R7AA 1V08A 3OBAA 3CIVA 3OG2A 3L4VA 5BXPA 4GXPA 3VTRA 1JDCA 4JKKA 1BVNP 5A6BA 3GXPA 2YDSA 2WHMA 4W86A 3A4XA 4LYPA 1E15A 4MNKA 3NSMA 2Y24A 4AD3A 4HMEA 3LXCA 4KGJA 3T0BA 1V3IA 1KR1A 1VFMA 3UG3A 1DWIM 2YA1A 4JL1A 1EDTA 2VQTA 4U31A 4LQ1A 1UZ1A 5BRPA 1ODZA 2J8GA 5JIWA 3BCFA 1JDDA 4HOZA 4DO5A 1K9FA 3ARRA 3KLKA 1V3MA 2FHBA 4M82A 4YHGA 5ABGA 4W93A 5FD0A 4HPGA 3LX9A 1XH1A 5M5DA 1J12A 4FNQA 2Y2WA 1UWIA 1HWWA 4UCFA 3W4RA 2W5FA 1US2A 2XPKA 3WH6A 1B30A 3VGDA 3POCA 3J7HA 4QLJA 2WMIB 5AC4A 1W9UA 1E1EA 1HKJA 2YL5A 1BG9A 5A95A 1EHAA 4D6EA 2QPUA 2VC9A 4M80A 1JYWA 1LF1A 2CESA 2J7GA 1V6WA 1JDAA 1NWTA 1QW9A 3M6DA 3FN9A 4LYRA 1KCLA 3VOCA 5DT5A 1V02A 3VGBA 3PZQA 1OGGA 4UFLA 2UY4A 5LA1A 2WSPA 4FLOA 1V6VA 3AS1A 3W81A 1QWUA 1EGZA 2E3ZA 5DT7A 3VIMA 1E73M 3UG5A 1P6WA 6TAAA 3AMCA 2F61A 1HXJA 4P8WA 1JGIA 1JYVA 3CUJA 1E6XM 1K9DA 1TG7A 2VX7A 3CHDA 1B3VA 2A3BA 2VTFA 1FH7A 1V6XA 3MUAA 2CYGA 4CUCA 2MANA 3HMCA 1WB0A 2YL6A 3VILA 3BVTA 5DO8A 4AMWA 3SCOA 2O9OA 1UWTA 1VRXA 1R46A 1MW1A 5ABHA 3IAPA 3FHAA 1JZ2A 3BUQA 4DUVA 2PWHA 4AEEA 4K68A 3NCOA 3AIVA 1UR1A 2WC4A 2D1ZA 1IT0A 3BMWA 3IGUA 1MW0A 1E0XA 2EPLX 1TVNA 2V3FA 2X2IA 2EQDA 1HF6A 4KRTA 3BMVA 1ISVA 1E4IA 3TTOA 3WD0A 5A6AA 1V0NA 1C92A 1L8NA 1VEOA 2YKKA 4UZSA 3KL0A 3VIKA 4U5KA 3ECQA 4KRUA 2J78A 1W9BM 3WDIA 2DQXA 3HG2A 3VIFA 1JAKA 1V0MA 4JIEA 1NH6A 1VENA 2PBOA 4TX8A 5FCZA 1ISWA 2AMGA 3W38A 1VEPA 1BQCA 3OLDA 1GVIA 2J8FA 1UKSA 5HPCA 4BA0A 3EYPA 3AZTA 3DDGA 1H49A 3ALFA 4AZ7A 2XVPA 2DPEA 4AIUA 1OT2A 2VNCA 2PB1A 1EDGA 4Z2JA 3A5VA 4PMRA 3A6OA 4UOZA 3NDZA 1F4AA 3CGTA 4P7NA 1HT6A 4KMQA 1MW2A 4JKMA 1VFFA 1B3WA 1LWJA 1R33A 5E0CA 3WEOA 4D6DA 4A3HA 2PWGA 3BCDA 3TONA 3DHUA 1UKOA 5HBFA 3ARSA 1B0IA 2G8ZA 1KCKA 3ZQ9A 4QLKA 4AXNA 5A8QA 1OBAA 3WY1A 3OLGA 2XVKA 1OGBA 2GJXA 4KH2A 4TUFA 2W62A 1G9HA 4J3XA 1FP9A 3GNPA 2WZEA 3WQ4A 1TFVA 2WB5A 2VVSA 1W9VA 3W6LA 4AZHA 4P7OA 1DP0A 2ESCA 2WMKA 2QPSA 3WIJA 2DH2A 3WY4A 1HTYA 1G01A 3RIKA 5I2UA 5CGMA 5I6SA 2DT2A 4PTVA 2WCGA 2GK1B 3A4AA 4GI8A 1EO5A 2XM1A 5A2AA 5EFDA 3AYSA 3UG4A 1C7SA 1CLVA 2F8QA 4CU7A 2BXZA 3MUZ1 2TAAA 1JG9A 5E9AA 4R5EA 1HVXA 3BH4A 3ARUA 5D9NA 1QBBA 2BY3A 2HISA 1CLXA 2ZUVA 1VBUA 2OWCA 1MXDA 1V6YA 1XCWA 1UASA 2WZHA 2J74A 4N42A 1I1XA 4FMVA 3WNNA 4C7FA 4FLRA 4D6IA 4D6CA 3ARXA 4NX0A 4RE3A 1DHKA 4Z2GA 2WVSA 3BUDA 1PEZA 2XM2A 1X6LA 4W7UA 1DTUA 1VFUA 3TV8A 1ZBVA 2V38A 1HP4A 2WW5A 4IISA 3H54A 3UERA 3SIMA 4FNRA 3WUGA 1D3CA 2VI0A 1EOMA 4W89A 3O6AA 1R86A 1ZS2A 3AQUA 1GQIA 3RCNA 2VX4A 3W27A 4GPNA 2X0YA 5A6SA 1GORA 4W84A 3WF4A 2WCSA 4AZCB 5C70A 3VM7A 3ZOAA 2YBUA 3EJPA 1KGWA 5A6MA 3OLIA 2DSVA 3VIHA 2WMHA 1PPIA 2JALA 5E09A 2XFRA 5CXPA 2X1IA 1XSIA 4J27A 2EPKX 4W5ZA 1W2PA 2EPNA 2O9TA 1EO7A 2WMGA 1Q6DA 1PZ2A 3CZ8A 4WSKA 1XH2A 4W85A 3HG3A 1OT1A 4H8VA 2ZUMA 2D0FA 5AY7A 2DH3A 3A4WA 5GNYA 4HA1A 3N13A 5I78A 1TQSA 1VBRA 1QWNA 1PJ9A 2NW0A 1UD4A 2FH8A 4H2CA 1XC6A 1Q4NX 4HPHA 4JFTA 1N82A 1WCGA 2XVGA 4F9DA 4WIWA 4F79A 4IPLA 3MUIA 5I0DA 1B3XA 3E1F1 2PI6A 1SR0A 1H0GA 4TOQA 3VIIA 2GJPA 5E70A 4DWSA 5AC5A 2DT3A 5M17A 4NXKA 1TA3A 1BLIA 3NYDA 5M3WA 3A21A 1C7TA 3CPUA 2EACA 2FE0A 2O92A 4IUGA 1CGYA 4JCMA 3WQ5A 1JFXA 4OBSA 2VZVA 4RL3A 3GYCA 4CCCA 1HJVA 3MUY1 1JZ7A 2J79A 3QHMA 3WN6A 5CGTA 1M7XA 1CENA 2VOTA 4MB5A 3DX2A 1U30A 2J75A 1NOUA 4GKLA 1VAHA 4RE2A 1LLOA 4TX6A 1PBGA 1TUXA 2XSBA 3N9KA 2ALWA 2F1BA 1X6NA 3GXIA 3WY2A 4W7WA 1PS3A 5E1QA 2PF0A 3AROA 3H53A 1BGAA 1BFNA 4UTFA 3WELA 1I1WA 1QI3A 2V5CA 3PZIA 4LPCA 2X2YA 4F8XA 1QHPA 2CETA 2D73A 1RH9A 8CGTA 3T2OA 1KXVA 4BCEA 1AQMA 1E6PA 5BXRA 1G94A 1OGSA 2JF7A 2WHKA 1E3XA 4V28A 5HDRA 4TVUA 3BUBA 3SUUA 2VX5A 5I79A 4MB1A 1E3ZA 3LRMA 1HJSA 2WVTA 5D4YA 1J10A 4HZ7A 3WDPP 3K8LA 2Y8VA 3SUWA 4FNTA 4CD4A 1UKPA 5JBDA 1LL7A 2JIWA 3QHNA 4QLLA 5IFTA 2CKSA 2E8YA 4AEFA 1E0VA 2DGAA 3S5YA 1DWGM 4J7RA 4QDMA 4X0VA 1UWUA 1RD6A 1AVAA 4D6FA 1UQYA 3VUPA 4QCFA 5BXSA 4UOQA 4Z2IA 4YHEA 3SCQA 4UQ9A 4J3VA 2WLZA 3CMGA 2YOCA 4FNSA 1GJWA 5EBAA 1VIWA 2OSWA 1TQTA 3A22A 2YLAA 3OZOA 4CKQA 2J7EA 2CHOA 2V5DA 1V3KA 3AXIA 2BHZA 4PTWA 3BAJA 3GXTA 3IJ8A 3F5JA 1JYXA 1GHSA 3VX0A 1BGGA 5E6YA 1US3A 1JF6A 1CXFA 2X05A 3SUTA 1GQKA 4D71A 1UUQA 5CQ1A 2FHFA 2OSXA 1QI0A 3ZJKA 2XWDA 3MMUA 1C91A 2J77A 1HX0A 2ZWYA 2CPUA 4P8VA 3L4TA 1B3YA 3ARPA 4A3YA 4PUDA 2RGMA 5FKYA 2JIEA 3AYRA 5I23A 1B1YA 2OSYA 4OOUA 1PX8A 3KEHA 3MI6A 3PBGA 1GCYA 2EAEA 2G3IA 4NRRA 1VJSA 3MMWA 3U5UA 3OGRA 3AOFA 2PWDA 4B16A 2XWEA 3RJXA 3A3HA 1ZB5A 2XTKA 2ZUWA 5D9MA 1KTBA 2O9RA 3TTSA 2WVUA 2C7FA 3SCSA 1IZKA 1KBKA 3EMQA 2ZX7A 2WXDM 1W1VA 4HP5A 2EO7A 1KWGA 3BAKA 1ISXA 1Q6EA 1HJXA 3UEQA 2ZX9A 1F4HA 1XSKA 2E0PA 1GVYA 3CUFA 1DWJM 1K9TA 2WWCA 2XJ7A 4PBGA 1GJUA 1BSIA 4U2ZA 1JI1A 4EANA 3DX4A 4JL2A 3CUGA 3GXMA 5D9PA 3VMNA 2BV9A 3IK2A 5EB8A 2VL4A 2J7FA 3CZGA 4AZIA 3AXXA 3PZUA 1QI4A 1R87A 3PTQA 2BY0A 5BCAA 4B3LA 3OLEA 1OINA 1UR4A 1YHTA 5I77A 3M46A 1EIBA 4W8LA 2VZTA 3W6MA 2WVVB 1H0IA 5DMYA 4EK7A 5EMYA 3MO4A 2JE8A 1TE1A 1WZMA 3ZO9A 2V3GA 2F7OA 4PMYA 3AMKA 4AZCA 2XN1A 2IGTA 3SURA 1EOKA 2NT1A 3AXHA 4GI6A 3GBEA 4ML4A 2BVDA 1UZ4A 3ZSSA 3EJRA 4BQ5A 2NSXA 2CBVA 3APGA 2CXGA 1JZ4A 3PZMA 5CPQA 4UQEA 4WK9A 1NARA 1J0ZA 1ISYA 3UETA 4JFVA 3MMDA 1W1PA 3CZEA 1WDRA 4PN2A 1GOKA 4TVDA 4U33A 2ZIDA 1H2JA 1CGUA 1OCQA 3AHVA 4OJYA 3HU7A 4PRWA 1H5VA 3WDJA 3IJ9A 1CZ1A 3B8SA 4DWSC 3AIUA 2X09A 1UH2A 3BXWA 4XX6A 2YJQA 1IZJA 1HKMA 3VD3A 1PZ3A 3LPFA 4MJ2A 4HU0A 1PAMA 2EEXA 1VF8A 1GOIA 3LRLA 3GH4A 3L4XA 5A6KA 2C8NA 4LGXA 3ZJ6A 3ZM8A 5ABFB 3ZT7A 2YDRA 3WL0A 2ZXAA 3TOPA 2A3CA 2EPMX 3T0DA 2J7BA 3VIJA 4UFHA 2VCAA 3WDRA 3W29A 3A24A 1OIFA 2J4GA 2JEQA 1LL4A 1XGZA 2WZIA 2Q8XA 1QNQA 2WSKA 2OWXA 4PTMA 3VDAA 4CD7A 4L4OA 1W32A 4ACZB 3WNPA 3IJ7A 1KR0A 1DWFM 5A6BD 2CBJA 3ARQA 3CHFA 4TXEA 1ZJBA 4JHZA 4NSBA 4WKAA 1UKQA 4XB3A 3EJTA 3VNZA 2J7HA 1D7FA 4E8DA 1M01A 4UQBA 4U3CA 3T08A 4FNPA
chains in the Genus database with same CATH superfamily
2Z4QB 3NSFA 4ELMF 1KTDB 4HS3A 4B91A 1IBYA 1AZBA 3ALPA 4NQEE 2DV0A 3R13A 2XGBA 4H26A 4XNMA 1RIHH 3EOBA 1OPGL 3FU7B 3PGCB 5DURB 5HHQB 1T1YA 5LGJB 4IBWA 1XW8A 3C5ZD 4J6RL 4P4RA 3ZR5A 5H4ZA 3ARZA 1I7UA 5CZXD 3HR6A 2VP8A 1U8OB 3EJSA 3FU0A 5DFVC 1BPLB 2EXYC 2J8UB 2AL1A 1BZ7B 3WNKA 4F24A 4M1GL 2LAAA 1A4CA 1MQ8A 4X5PA 3PJWA 1I8KA 2O6FA 5CR8A 3QGVA 2FPTA 1RY0A 4US5A 4NQUA 3VW3H 1MSPA 3K13A 3PR2A 4IW4C 4P5TA 1FYTE 2VR8A 2HLFD 2X4TB 1KJVA 4MAYB 5HTSA 4BSJA 3ALGA 3FQ2A 3CUPA 4U3SA 1XAUA 4Q6IB 3IU4L 3FQXA 3DXIA 4Z8FL 3MKGA 1F3EA 3AZSA 3SOBL 3M1BB 3RWJB 4XCYA 1G9MH 5BYWA 3FUMA 2UZYB 1PY4A 4UTBA 5KITA 4IHBA 4I7UA 4U7MA 4ODUB 3WS6C 4ZUUA 1RUQH 4U10A 3BP5A 1F3DH 4J39A 3MRMA 3DHJA 5M7QA 2NY5L 4TL4A 1S9KC 1O5XA 1QW7A 2IH9A 5AOIA 1ZHLB 1JRHI 1VPQA 1A3WA 4PB3A 5AHLA 3FYEB 3DFSA 2XHYA 1MI5D 1CFQA 5E1HB 3WH8A 2BSTB 3SDAD 4EVZA 3BZEB 1ETZA 2V3DA 4FO4A 1MJJA 3AIWA 2ICWI 2VN3A 4DO4A 1FA4A 2O30A 1HSAB 1YQ2A 25C8L 3I2CH 3TZVB 3C6LC 3QIBC 4G8FB 5DUJA 5C2GA 5C2UB 2VE6A 5E5UB 3TBSA 1V03A 4PWIA 2VWTA 2Y6SD 5I3GA 2WPGA 4LSRH 1HL2A 2AF2A 3D52A 4LPXA 4MGXA 3VMOA 3SYPA 1RZGB 3M0MA 4JGDA 2H0PA 4JN1H 5D72H 4H7ZA 1J05B 3HB3B 1ADQA 2HVKB 2AI0H 5F0PB 5CSSA 4E5XA 3EWCA 1XFPA 1WXZA 3PV6A 3QQ3B 3RA7L 3S9YA 1RZ7H 4O52A 3MDJA 2ZXGA 5HYJA 2GQ3A 4TF4A 5T3XD 4DY1A 1CECA 4CADB 3DX1A 3HUJB 4UILL 2F6XA 2P4AB 4O2CA 1PCKA 4LVFA 3L8QA 3PE9A 2HBVA 3ZLQC 3T4AC 3EB4A 4LANA 3L1EA 1XLKA 4QTGA 1NQKA 4AK1A 2JK5A 2L0DA 3MYJB 3D25A 2BHUA 2WLYA 4GG8B 1PW3A 4F15B 2CAKA 3LPGA 4V15A 4Q33A 1E6QM 4OV4A 5DJZA 4JFEB 2Z35A 2YGNA 4FFWD 4BFEA 3PWNB 1NMBH 4UFMA 4JZOB 4MNLA 4ODSL 3WEXB 4YVNA 4P7RA 1RZJH 3G5VA 3HAEA 4QRUA 1KLFB 1EK3A 3ARBB 3FT4A 4JZJB 3ZJAA 5GS2H 3LQLA 1MQQA 2PUZA 2E5DA 4LSQL 2GHZA 1AZRA 5CS7A 3MGTB 3XIMA 2OMTB 2FVLA 5EEWA 4AIXA 4IBVA 5E6UB 3WLSA 1X6UA 4ATLA 2E6JA 4LLYB 5BS0A 1ZA3A 4R5TA 3P4NA 2CO7B 2V7NB 4LSDA 4N5ED 1E0UA 2FQIA 2JEPA 3FN0H 4BDVB 4ORGA 1KXTA 1F11B 4YSRA 4YZFF 1ZBWA 2X1WL 3GG0A 3W02A 1X5LA 1DQDL 3FSWA 4IMLB 4NUQA 3U7BA 3NOEA 1MWOA 2H0JA 4X2RA 3DTUB 1ZHKB 7A3HA 1OZQA 1Q66A 2WOQA 3SQOH 3ZS4A 2IANB 1E4LA 5EIIB 2DAVA 4M51A 1N8WA 4E9QA 1A5UA 4QTHA 5I6XC 1H09A 1Z69A 4W9HC 3N15A 3MMEA 3W25A 1J1PH 4YSDA 3ZTEA 4UAHA 1W0WA 5AD0A 4OQ1A 2FBOJ 2Q7NA 1DBAL 2ZG3A 4MJIA 5D8JH 4NYLA 3KVPA 1RQBA 4JBRA 1XX9C 5AVVB 2C4FU 1DLFH 2HNEA 3FQRA 3KOXA 2ZKYA 3ABKB 2FIRT 2WHJA 2FZBA 5IJBC 3MLZH 1I1AA 4M62L 1KM0A 3C5SB 3D4ZA 4ONFL 4HS6B 4BBWA 2R27A 2AXFA 5FB8A 4JO1H 3E2QA 3ROOB 1BOYA 4M8QB 3D39B 3EXTA 1YYLH 5EWIH 2F58L 5IQMA 1P0DA 3S2CA 2ZKHL 2G75B 1T1XA 3VFUA 1JCMP 4TSCL 2PCYA 1NDGA 2ADGB 2XZAL 2Y25A 2V5BA 1CG9B 3BAWA 4O0ZA 3ZRCC 4PY8I 3QQ4B 4DVRL 4E41E 1C9SA 2YMXH 3TQPA 4EPSA 1WDSA 5JH1A 2WV8A 4NO0D 4P2OA 1LJMA 4YXLH 3KH4A 3DX7A 3LOTA 2RQ8A 5ANHA 1B9ZA 1MFAH 5D4IA 1WTLA 1G7VA 1BAGA 2VN7A 3O2LA 5IJKC 1TJPA 5JMRA 3ORJA 2EJAA 1MCCA 4RX4D 4AZBA 4YSAA 2APSA 5D1QC 2A4AA 4GRWH 2UZPA 1UXSA 5LNUA 4K71C 4NT0A 5DT1L 2EVGA 4NHCL 3WJJC 4AK2A 3WGUB 3PVFA 3G1FA 2J6EH 2PETA 4MA8L 4EI5A 3O11A 1M04A 1LDSA 4M43H 4MHBA 2HT4D 1MFNA 2BVQB 2Y1AA 2OTUA 2R0WL 3OKKA 5AAWC 3SODB 4YHZH 1SOSA 3BE7A 4B2DD 2VJXA 5E8OB 1MFCL 1PY0A 3G7TA 4PMQA 1HJUA 2KBGA 3LHUA 3A67H 3V16A 5KZ6A 4HS3B 1FZMB 2OXNA 5DJYA 5HOSA 4XPGH 2YAMA 5B39G 4HD5A 3ARGD 3IAQA 2BOFX 4KGLA 3H2OA 4YS1A 4ENZA 1ORQA 4WFFE 2VFDA 3SJVE 1AGFA 2DQJH 4MX7A 1EXGA 2NSMA 4G9DA 4QDMA 4RRPG 4AUBA 3I9AA 4XGZA 2R4RH 3CZLA 2ONEA 1P5VA 1IGTB 2E9IA 2N56A 3FOMA 3BSHA 4NQXA 1GQNA 4JTDA 4YGVA 2PW1B 2B1AH 5FO8B 1ED3A 2C14A 4FLSA 1V7NH 2J2ZA 5DWPA 4PV1C 3U0PB 1TDQA 3BZGA 4FFZA 3MSGA 4JEGB 1M05A 1JNJA 5HI3D 1D3GA 1BTCA 3MV8D 4U1KB 3BP4B 3Q2VA 3GRGA 3Q45A 1Q63A 4ZE5A 2X7LA 4MSWB 5C71A 1GOWA 1E8WA 4NN7B 3MUGA 3S7GA 3WJLA 1RIVH 2VX6A 5RUBA 3EHBB 1MUJA 3QR3A 3LLFA 4NT6B 1MQPA 5H8PA 3WIIH 3BKYH 5DJ0A 3VPLA 1DVFA 3UTTB 1LK3H 4JO5A 1N8ZB 4IQEA 2W0PA 2VM4A 3T77A 4KERA 3AUOA 2EDEA 4PI2A 2ADFH 1WCQA 4H8UA 2A73A 3H56A 4YNGA 5CC3A 4AC1X 1BM3H 5CP3A 4AM0B 1PD1A 3UZXA 4MKNA 3RMJA 4DF1A 5HNNA 2E7LA 5GJSH 1XLMA 2KMWA 1CFQB 4LCCC 1HILB 3IBEA 3P81A 4HOMA 5DD1H 3BKYL 5CZ0A 2BINA 3VFPA 4WJXA 4B6ZA 3MRRB 1UEMA 4UILH 5BXFA 4C59B 4OVXA 2AK4E 1BYOA 1AMKA 4LSPH 2CIKA 3MACH 3GVWA 1MW3A 2N3JA 3DYOA 2B08A 1JQVA 1XT5A 2FR4B 2ZE3A 1QHOA 4D0BB 2NLYA 2O5NA 3LQZA 4NQDA 5GRYA 1A14L 4ZOEA 5EF1A 3HG1A 2PWEA 4JZNB 1S7XA 2MKLC 5FOJA 3DOSB 2IDQA 2WKOA 2ZNWA 1UUMA 3JWNE 3L9CA 1FHNA 1WAAF 2H8PB 4RAVB 2FGBA 1EZUA 1DWAM 1MYRA 1VPXA 1QAPA 3X14B 4QNPE 2VSCA 4C6FA 2R4SL 1DSFL 3ZE0B 4NKQB 9XIAA 1JPGB 5DQJB 1SEBA 1BBJA 3THMH 1MHPH 1A66A 4M7LT 3OAYK 3B6SA 5DGQA 2ZUNA 1TYEB 3WNMA 3ML8A 1EZLA 5JW4M 1D6VH 4XO8A 1UJ3C 2XKUA 4ABWA 4OUUB 4AUYA 4Z76B 1KO0A 1P7BA 1X1OA 1UIPA 3C6EA 3C2OA 4KK5C 5JOFB 3UPBA 1FNSL 3HBGA 3IXTA 4M7LH 4OGAC 1QOKA 4JO2H 3OZLA 2R0ZL 3DTXB 1IEHA 2AQQA 4IYKA 1PZ1A 2OVLA 1FN4A 4QRSB 1GNXA 3KPSE 1QVOB 1A1OB 1E6OL 4F8LA 3WKYA 1J8KA 2YCEA 3BO9A 4Y9EA 5LGZA 5F7EL 1UH3A 5L0QC 5BXTA 5I1LB 2WZAA 1BG4A 3WLNA 3ZKXC 1CPUA 4XTRC 4PEEA 2EVFA 3DGGB 1S9XB 5E9DA 4O1CA 2OKOA 1S2VA 4LF2A 5D7IB 1QFHA 1K6QH 4XVSL 2PTWA 3IIZA 1ZDSA 3D50A 3FOKA 2OQJB 1UZ8B 1G6RB 4QUOA 4LUTB 4X9SA 4TMCA 2MCPL 1BAFH 1HH9A 3CCHB 4RNRA 1TZ8A 5E08H 1I2PA 3MBWA 1XXDC 1EHNA 2AK4D 4H04A 3KXFD 3FO0H 3VAEA 5TH2B 3K4DA 3B2UC 3NQMA 1VB9A 4Q22A 3H9YA 4K3DL 5E2JA 5E1IA 5CEZH 1RIHL 4MF4A 1WIPA 5FL0A 5IW6A 4IWWA 4X80H 4PM1A 5DO2C 2EDWA 4XX1G 4QEEA 3EKGA 1JTTA 3B56A 3JZEA 5B1AB 3F4DA 2WD0A 4NC2B 4Y2OB 4MQXC 4FQIL 1S7RA 3ZE0E 5C0IA 3EPMA 1XCTA 1IFHH 2KUTA 3T65A 4LAZA 3CYJA 1MEWA 1BIIA 1G5AA 4H26B 4QJ5B 2TSYA 1TO4A 3UBGA 3AADB 2O4EA 3D2UB 2N1KA 3IRCA 4WTZA 3GYRA 2C1OA 3CN2A 4P2QA 3RVUD 2YPKA 3V0JA 2XTJD 3ZL1A 4AHOA 1GSKA 3LDBB 1X4ZA 4OD3L 3FQYA 3MV8E 3PZTA 5EUOA 5CGYD 4IOFD 4XO4A 2VEIA 4HQVA 1BVKA 4B96A 5D1ZD 3V0GA 1GPFA 4BI7A 1CDHA 2B1HL 3EGXA 3H2QA 4I88A 5IVXF 5CGBA 5IFJB 3IGSA 4Q6KA 5JIPA 3OJVC 3E0FA 2QDHA 1KACB 4GD0A 4ZFOA 3ZRSA 1E0WA 3QN3A 5E8NA 4KHXL 1QOXA 7TAAA 5J12C 2X70B 1T96A 4PTDA 3DX7B 2QHAA 2L8AA 3CUPB 3F64A 3WDHA 4GAGH 4XAZA 1BIHA 4E9RA 1IKOP 3U7YH 4NZCA 5F2GA 3VSUA 3FF8A 2QLYA 2V2WB 4ZS7L 4QJ4B 3CMOH 4KEVA 2FJFA 3RL1A 3TVMA 1TVBB 1Z8AA 4LLUB 2YR1A 4CD8A 2AQPA 3LXAA 2XFFA 1EDHA 1S46A 5TGBB 5KZCB 1PZ0A 1NMBL 5DTFA 3ML9A 5G4MA 3LNFA 3T3PB 5KBDA 2EDFA 1F3JA 3LB6C 4E9LA 1UC5A 1PJWA 3DK2A 5I1CH 2BHFA 3RL2A 3P11H 5KSVB 4L9LB 2UZIH 4P3CH 2VUNA 1RJQA 1T1WB 1FZJB 5SV4A 4XD3A 3K4WA 2DD8L 4G9FD 4M5ZL 1EJVC 1NU5A 4OLEA 1DIKA 5D1XA 5D71L 5D02A 1ETZB 5GS1C 1V0LA 3W2DH 4TN9A 2OJPA 3FEMA 3L5WB 4ADUA 5A6LA 1S8DB 3WK2A 1PYMA 1TCRA 5A8PA 1EQWA 4QHRA 1R2TA 4XP5H 2CLOA 3PHOB 1D5ZB 2J12B 4KI5C 4LSSH 5JXEC 2P10A 2OMYA 4NO0B 5A1AA 4AENB 3IBOA 2D24A 3SBRA 4X5QA 1MFUA 2QADC 1KCSH 4A2FA 1LD9B 3QFJA 3UBXA 5L2KA 4G8TA 3QXBA 3R58A 5IXEA 4BCZA 3ZDZB 5B39A 1HL4A 1X7TA 3FU5A 2CZDA 2QQQA 4E5XB 3MV8B 1NL0H 4OZ4B 4POZD 4MJIE 4LSTH 3RIAF 1CD1A 4LSRL 1QLFA 5IHSA 4NM8H 4I18A 2I5YH 5DVLA 1FWDC 3ZQXA 2IVFC 1FE8H 3QWRD 1VDGA 5IVZB 1BYAA 1Q6LA 2GQ9A 3WFEH 4OOZA 4U1NA 3RFAA 5D1ZC 1WSST 3N85H 4UOW1 3T9PA 2RFXB 3MRQA 3V8OA 1S2CA 3DOPA 2Y6TE 3QJXA 1FC2D 4QP0A 3NEEA 3HZ3A 2ID5A 3BVNA 2DYPD 3EFFA 3IN0A 1ONWA 1W3JA 4YBLC 3BANA 2JELL 2FQDA 2V5TA 4IRJA 5K33A 2OB3A 4X9IA 4IBQA 4UNLA 2VHLA 2J62A 3GPSA 4AF0B 1TZOA 3CL7A 2E75C 2ATKA 4L1SA 2RDUA 1JGMA 1OSYA 4O54A 4UUIA 3C09B 5FO2A 1KLFA 3ARBA 4A3QA 4UUJA 3R06A 1IAKA 3P0WA 3VI3E 5AFAA 1LTDA 3CLEL 4MAUH 4YYFA 4LKXB 4H83A 3SSJA 4IGHA 5REQA 1ULVA 3FZUD 4CNIA 2QZRA 4TNEA 3RHWK 4NO2B 5K1JA 1A53A 2F8IA 4ODWB 3SDYL 1FWIC 1JZ8A 3LNMA 4DWSD 3N06B 2D7NA 3LQZB 2EG7A 4G7FA 2H0EA 2W9DL 4XAPA 4MUPA 2GJ6B 3RGTA 3WLLA 5GGVH 4IG2B 4WAFA 2DVXA 4JTUA 3QSRA 3UVIA 1BJ1J 4LHUB 1A2YB 2R0LH 4RAVA 4W9JC 1Z3RA 4HIIB 2A83A 4FNLH 4N68A 2XETA 4U7SA 4DZ8B 5BVPL 5EF2A 2VB5A 1FRBA 1OCCB 4CAGA 3S5LA 1D7BA 1N3NB 2EYSA 1P6AB 4N2HA 3CQ0A 1E4KC 4TXVB 4PRRA 1YC8A 3QXDA 1HIML 3QPYA 4PJIB 4NYLB 4JRYB 2HSIA 1R47A 1QSFE 4K7VA 4N9EA 1BLNB 2J1XA 5E00B 1U8PB 4D2JA 3KM1A 4PCTA 1AYOA 5HGBB 4AYEC 5K9JH 1CTNA 4MMXC 3MLTB 4LHUG 4UINH 2ATPA 3LTVA 3KE0A 5CAYB 4PSPA 4MVBD 5T33L 2X53A 4PJXE 1R34A 4U6XB 1AR1B 1M65A 2PDLA 2R9RA 4YMZA 2FLRT 5ISZA 4BWLA 4U1SB 4N0UA 1DLFL 4R84A 3O2DH 2NUXA 5IMMB 4OBRA 3Q1SH 4G8GE 5AHIA 3ICJA 1NJJA 2I60L 4N4QA 3TESA 5BVJB 3DIVA 1SYTA 1QBMH 4FFYA 4HWZB 2D2JA 3VYLA 3FFCD 3HJ0A 1JNHB 2KPWA 1K4HA 1FZOB 3BGFB 5I1LA 2HVJB 4DAGL 3E6FB 2NV1A 4LP4A 4LPUA 2WQAA 4Q4IA 5E7BA 1G9EA 1XLLA 1WOBA 2YD8A 5CSUA 9CGTA 4DRSA 1WDQA 1TQUA 4ECNA 5LA2A 5GZND 2WWKT 2VD8A 3II3A 4H4NA 3OHMB 2ZF8A 4WGKA 4M19A 3PCYA 3UJEA 3SCNA 1G7IB 5DMGC 3QAQA 3GI8L 3UJIL 1E6JH 3PG8A 3PZVA 1XXFC 1G0YR 3A4FA 1KBGL 4MG4A 1JWMA 2K0RA 5TH2A 2JJUA 4IUOA 4NPJA 5HHXL 3C5ZC 4QEHA 2H45A 43C9B 2C7UB 1ICTA 1TO5A 3IK4A 1EFXA 2ISVA 3QY6A 3WTUA 4WJEA 3B3DA 3TZNA 1XG4A 3SE8L 4DZAA 4ZUSB 3WFHA 4FFVC 1HUVA 3WH9A 5I0YA 4I7VA 3VIOA 3L1GA 4PB9H 3EH5B 2Q8LA 3LIUA 4FYTA 2PWFA 4X7CC 5FYKD 2ZP9A 5JIIA 3TS8A 4LDCA 4AH2A 3HC0B 4PJIE 3ENLA 4K7PH 4I18C 3L4WA 4AD1A 3OZ9H 3L4ZA 1YECH 2C1OB 2WSRA 1JPST 2H3XC 2WO4A 3QRBA 2YHGA 1FVCA 1NBQA 2D9QB 3O45A 2W07A 4NKMB 5C09A 3VSVA 3NPSC 3G6DL 4XBEH 1F4WH 4ABQA 1GOOA 3GU9A 4G7EA 4D8ZA 1P5BA 3WNIA 4D3CH 3V5DA 3Q94A 1D5BB 3N42F 3GK8L 3SDOA 2EIBA 4L48A 4JQIA 1IQWH 3FTVA 4PAZA 2V6AA 4UM9B 2JTDA 4PCNA 2HTKD 2PYEB 1U8JA 4Y4HA 4YHMH 1T21B 4CMMB 1AHMA 3MV7D 3DGRA 4PY7B 3VXPA 2DQEH 4R7JA 3T6VA 3UPRA 1W0VA 3AFBA 5AAMA 4R7OA 5CM1A 1ZOXA 3RR1A 1XR9B 2YSWA 3L6FB 3IDGB 1H61A 3QEGL 1CGWA 1OFQA 3FNDA 1SOXA 3OQEA 2X1XR 3IFPB 1W72A 4N2AA 1LQAA 4RW5A 4ZB0A 1QFWH 2EXSA 2VDOL 3MZNA 1LILA 2CCWA 4LCWA 4JEJA 3DZ1A 2IDFA 2ARWA 4JTSA 4YHNA 1KY6A 2BZNA 4QS5A 2IAMC 3P0VH 4KTEH 1E9QA 1H7NA 1L6ZA 1CXIA 2V2CA 2YUWA 3L67A 2N0MA 4B9KC 4M5PA 3RUBL 5FL1A 1YDVA 1SM9A 1INEL 3DUSB 4EN3C 3T0EB 4A6YL 4TNWK 2EKJA 4HA3A 4BH8A 1T7YA 1OW0C 1U4FA 2BNRE 4JFDB 3RFZC 1UCWA 3F5LA 5LXXA 3MRRA 1R9ZA 3SBQA 3BAIA 1S8DA 3RIFK 1H1NA 2EZ0D 3PHAA 5FACA 1JK9B 4OT1H 1GPOH 3RVTD 1G7QA 4YLCA 1MNSA 2JWYA 4F7EA 1KZYA 3G6MA 3G6LA 3B04A 3ECWA 3FTWA 1AS7A 3RVWD 3MC5A 2IANE 4O8RA 2HJPA 4I89A 1BFVH 1NTDA 1MWAB 2GUYA 3KWXA 2FPVA 4WTQA 5A5WA 5A43C 5CP3H 1AYRA 1OP3K 1ID2A 2FO4A 4KY2A 1ESWA 1SJDA 3M0ZA 3EDDA 1DSYA 2PS2A 3MTRA 2W9LA 4IIQC 3WMCA 4RNJA 2BC4A 3R18A 1FWXA 1KXVC 2QEJA 3SE3C 2ED9A 2DOCA 1A6TB 4YK4B 3H42L 4OF7A 3ZLGA 5FEZA 2OKTA 1SPDA 2VWSA 1N70A 4NP4H 4Z7QF 5D96B 4JM4H 2WO3B 4B9YA 1LOLA 4ODSH 5IMOA 1TPFA 2A77H 1XLDA 1FX6A 2H1LM 3QZOA 2ZOXA 4JIIX 5CAHA 1Z7JA 4L05A 4S3DA 1WCBA 4X0NA 1SXZA 1VFAB 5I5JA 4AT6A 1D5XB 1YUHA 2XV3A 4TQEH 4AZ5A 2KZHA 3OVQA 2HRGA 3NQCA 3NDYA 4XTDA 1WFIA 1RJYB 3WLHA 1A7RH 4AGQA 2AQOA 4GQ9L 1RZ8B 4UM8B 1WBZA 1DIEA 5BMWA 4ATDA 1TTBA 5ID0B 4FL4B 4O4YL 2P9RA 3EFDH 3BUVA 3HLKA 2B4CL 2K6ZA 5AW6B 3JW7A 1RZFH 1DQQA 2ZDRA 4H8PA 4XMKH 4DEPB 1FL3B 4PREB 3VOHA 5EH1A 2G5RA 3LZNA 4L6OA 4H7VA 4KC3B 1FNEB 2VUYA 4HALA 1R3TA 3FA5A 1EJWC 1IUZA 3F85A 5K9KA 4NUWA 4AYFA 1CGSL 1KELH 4O5LL 2AI0L 3B37A 2UY3A 1AD0B 1MDAA 3HFMH 1IL1A 2G5WA 3KRZA 3B9KB 4G3YL 1EEUA 5HI5D 4Z77B 3UZEC 5DX7A 5H1WA 4KCWA 4YHNB 3NK4A 4JDYA 3G3LA 2ILLA 4G5DA 3DMMB 4NXSA 5TPWL 3O9WC 4UT6H 4XIMA 4FEMA 1GTEA 4XSLA 1GMIA 5TTRA 4OZFB 4UV7H 4EVNA 2FGWL 4HIIA 4XNUH 3LPOA 1NFDB 5E2WH 1L2QA 3BCJA 3GNMH 4E38A 2FJHA 35C8L 1OFAA 4HUWB 1KGYE 1UOLA 1WFNA 3IMRA 1OWRM 5G4WA 5LDUA 1I60A 2QKIA 3K5XA 4WUUE 3QORD 2IBGA 5AALA 2X3AA 1SW7A 4HZ1A 3NJJA 3HG4A 3V79C 3RY6A 2ACUA 1QNOA 3B03A 3VXSE 1GH7A 3IGHX 2Z34A 1NCBH 1TZIA 3PP3H 1QPOA 2MUCA 3SCUA 4A7TA 1SSDA 1M68A 4XBJA 1FLRL 4PCFA 4QSHA 1F0LA 5CAKA 3DJTA 4N0CD 3WMPA 2YXFA 4KCVA 4OUOA 1IAOA 5AAMC 2YXVA 4MQ7A 1XHGA 4K37A 1A5MC 3TAOA 4BF5A 1D8WA 1XYFA 1MHCA 2PDYA 1KCRH 2OZTA 3M64A 2JQZA 2UY6B 2ERJB 3QORC 3WJLC 1UYQA 3IGXA 1SMDA 1GW6A 1NDWA 2F53E 3KD4A 3FTZA 5DUML 1QEWA 5J6SA 1B2WL 4A68A 3PULA 3WYZA 4LLVB 4Y9OA 1YEEL 2X0UA 4FX5A 4EZKA 5G4EA 4K7PL 2XWTB 3AHTA 3WQWA 1F02I 1PL3A 4TPRL 4Y5VB 2ZOKA 3HLAA 4KKAD 3D18B 4E42A 3TWAA 4TTUA 2DZXA 3RGVD 4B3ZA 4G6JL 4ZFGH 3BJTA 1A9EA 1T1ZA 1LWIA 3EF4A 3WLQA 3EDFA 3TDFA 4IQDA 3CQIA 4LLUA 3EX6A 1RULL 1XYZA 3LGDA 1MDTA 1UM4L 3CFBB 4NRZA 1M3IA 1KQYA 3FKKA 1OPOA 2NPLX 5ESQA 3SN6N 5C0FA 5JW4Q 5M03A 3ZL4L 5HDOA 4OLUH 2P5WA 4XE5B 2E7MA 3BD3A 3GVGA 1CR9H 1WIUA 4KQ3L 4L9LA 2LFEA 5A16B 1LEKA 1NDTA 3S35H 2PDGA 4C6QA 1TF4A 1U92A 4OKDA 5GJMA 1VBGA 3WQCA 4XAGA 1ZLWK 3BURA 3PUCA 1PVHA 2AQTA 4P5MB 4HK3N 3K72A 4FG4A 4NQTA 1AQDA 5DLLA 4E9VA 2KC0A 5IW3A 1R9YA 4XNMB 5H37G 4BFAA 1ZSHA 1W3LA 2GSEA 2XFGB 4HN8A 4B50A 3EYVA 2Z65C 4XN9A 4FAAB 3BN9D 2ESVD 3ZSTA 1H3UA 3P7YA 4JOMA 3HAEH 5HPOA 2H32H 1P6BA 3L3HA 5IROD 2Z27A 2GI0A 4OZOA 4DXVA 3AYVA 3NCBB 5EZOH 1CXEA 4LLDB 5LQBL 2HWGA 3V4PB 1J79A 1X8FA 2W66A 3AMGA 4WCYL 2XSAA 1AIZA 4IIEA 4V1XA 3I6LE 1JHTA 2XV2A 5CBAA 1IC4H 1LLAA 2V7HB 1B0RB 2CLVB 4E9WA 3F4WA 1NGZA 1IXPA 4M81A 3DC0A 4N8VG 2YMOA 3LCIA 2R0KH 3N3EA 3PB2A 1SF5A 3U2IA 1VACA 4Q6IA 1NPJA 1MAJA 3VFMA 3LCHA 5C0AA 4YX2L 1Q6QA 3BVDB 5EOQL 1XR8A 2CIPA 1DOSA 3CX5K 3GSNB 3LI0A 3QHZL 3QC3A 1IEVA 1KCSL 1URZA 4Y5VC 1GGIL 1H15B 1HJCA 1LL1A 2B8OT 2ZX8A 4LSPL 4XMUA 3OZKA 1X7SA 1SRDA 2IDCA 2VL5B 1B6UA 2HPTA 2KLRA 1PSKH 3WFBL 4HFWA 3K4AA 2DSUA 1XF3B 3RLSA 3OOQA 2I9TB 1GW9A 2RIKA 3ORWA 4JTJA 4Q9RL 4D6HA 4ZFQA 2HPMA 1N59B 1OAKL 5H35A 2EDDA 1DJYA 2Q8BL 4X60A 3D69A 4XAYA 3OMAB 3R06B 1CFVL 2TODA 1BFOB 2X30A 3S46A 3D6NA 3HHSB 1HKIA 1UZ6F 1W8OA 4I9TA 3ZO0A 1M9WA 3MRBA 1QPQA 3DX8B 2Z92A 4WEVX 4YHML 3W28A 4TIMA 2UZXA 1IC5H 2W91A 4KO6A 5I1CL 2X9ZA 3BPOB 1FLTX 4JLRA 4DK5A 3FO9B 1F6LL 1TEGA 4PRHE 3GTHA 1KJMB 3P1VA 5LA0A 2CXEA 2ZX6A 1QFWM 2WXIA 4CQBA 4IG2A 4WW1A 3OIXA 2J57A 5I73B 2NWRA 4UT9H 1FG9C 1PLBA 1IZCA 1SO4A 5KS9F 1XGDA 3NO3A 3OYZA 5K9CA 4S1FA 2W9EL 5C1MB 5E93A 3F6LA 4YFLF 1S7VB 4M56A 1V0KA 3DWTA 3NO1A 3UTSB 3QGAC 5JUEH 3R25A 5FA3B 3GIPA 4UAOB 1U8HB 3AIEA 2XX0A 4NNXA 4ENED 2DZUA 1J9QA 1I9IL 1QRNA 2JI3A 3OMZA 1XLEA 3WLKX 4DB7A 2V6HA 3CH9A 1NCJA 3QBTB 5LGHH 4C6KA 3QS3A 1AC0A 3MJ7A 2DEPA 4PUKA 4N5UA 2AHIA 4YDVB 1TJIH 3KXFE 1TVHB 2RBLA 4ONGH 4S1QL 2ZWKA 1T0MB 43CAB 4AIZB 2PDIA 1CIUA 1GC1L 2HKFL 2WQXA 4PP1C 3RWHA 5BQ7B 1UA3A 2FYYA 5DJ8A 4PWEA 4QOKB 5E6ID 3F84A 5MERA 4AJWA 3QUZC 2CMRL 1IKFH 2G4GA 1OX6A 4DKEL 3LMYA 4RH4A 2J8HA 3S3GA 1OY3B 4TSBL 2VR3A 4K8HA 2FYVA 3VKDA 4QRUB 1E6JL 5BU6A 3L16A 4H25A 1S9YA 3FDKA 3H22A 3L23A 4DFIA 4NF7A 2ICES 5CJXA 4RQQA 3GTNA 1SXNA 3UPWA 4C5YA 1F3TA 1CGXA 2IGLA 5BS0B 1I8IA 4DF9A 3QYMA 3DEQA 3EGSB 3KW3A 1PQZA 3QEGH 4PUUA 2UY2A 1AR1C 1A4KA 1NOFA 4NOBA 3W26A 2W38A 1BD2A 1YRKA 4BZ1H 3QRHA 3WEMA 5ICUA 3DKHA 3SJVA 3KPRE 5HWMA 1MREL 5DMGD 4PY8J 1U83A 3THCA 1DWHM 4LBSA 4XWGH 2YB4A 1S7WA 3HHRB 4JM2C 1HEHC 1QO5A 2E47A 2HXAA 4JFOA 4JRXE 5IVXA 1RV8A 2QCDA 2FNBA 3Q2DA 1U4EA 2OCCB 2ZSVB 1G7HA 4GJJA 4KRZA 4PR5B 5EUOF 3WF3A 4FQQA 2PLTA 1WZLA 3GIZL 2PLKA 2GB2A 1GGTA 1L9MA 1ILSA 3G6DH 4H0LC 3Q0HA 4JFHE 1NCWH 4ADGA 3FLUA 3B9EA 5I3IA 4B7LA 1UMYA 1AG0A 3P2BA 2CRIA 4JFYB 1W31A 2FO8A 1BXCA 3MODL 3PL6A 4YVUA 5AVHA 1T1YB 3SQLA 2HE8A 4P4RB 4KZDH 3FSUA 2F68X 1QBLL 3UADA 4N2KA 1P7QA 4EKXA 5C09B 4OTKA 1DR9A 2AVFA 3U6RB 2JKSA 4XI5D 4OU1A 4U49A 3VQLA 3E3QE 3Q5TA 4RMBA 1ZBKA 2AGJL 1Z6JT 3MZTA 3QZMA 2FX7H 5J3HC 4L64A 2P5WD 2QQNL 2A6DA 5FFOA 4JTFA 1CXLA 1LO2L 3DVGB 3ATYA 5EBMA 1ME7A 1YXDA 2HVOA 2LLEA 4N6RB 3RYSA 4Q4SA 3N25A 4D7PA 1XF1A 4A2HA 2WXPA 3RFZA 1RFDH 1KDIA 2J88L 3L54A 3B9KC 4KPLA 3UAFA 1HZHL 2VIRA 2G96A 2A9NH 4YR6A 3H2MA 3W1AA 3IFPA 3MFGB 3MSPA 3O6FC 3QG7L 5KVDH 4IPNB 5E2VH 2PD5A 1N5AB 3BXNB 3IDXH 4N22A 4N25A 5GS0H 2QFPA 4XCNA 1GKQA 3PDGA 2QHRL 3UFYA 3NAAL 4P06A 1K85A 3UXKA 5FM8A 4PGBA 1T0OA 4PW9A 2GPTA 3KM2A 3HE6D 4Z3IA 3NQBA 2DT0A 3IVUA 4MNQE 2V8MA 2A5HA 1HKKA 3S88H 3JXAA 3P3SA 2OZ8A 2VR4A 1O9VA 3U6WA 4ADJA 2WXOA 2APVA 3TT1L 1SFSA 4L56A 3TPKA 1XRFA 3W9DB 4IP4A 3EYVB 1UB5A 2ZCLL 1GGCL 2QMJA 4R7DB 3O8XA 2XPGA 4I1RA 1DANT 3MXVH 4R8WL 4X98B 5T1LD 1E5JA 3UWYA 3H2PA 1KJ2A 3O3UN 3TT3H 2CBUA 2ASHA 2Y63A 2QVFB 4JVPA 2VXQL 3DJSA 4M1DH 4EAMA 3GMNA 5H37A 4XBPA 4EXKA 1HESA 2WHVA 1DVTA 3QXUA 1UWQA 2EG8A 3VXNA 4DBDA 1FUYA 2WKOF 3V9FA 1JGDA 3ZU8A 4MFEA 4TQ8A 2LU3A 5BV7L 2A6NA 3G1SA 1IF2A 4ZXBD 1UOKA 5KYNA 3ZYJA 1CN4A 2PU1A 2Y7GA 1W1TA 2GJXB 1YYMH 5C7VA 3BH9B 1FVEA 2FWSA 5CPTA 3ZDXB 3QRGL 2OAAA 1QI2A 2WJDA 5CINH 3KBNA 3GC4A 1OAXH 2G2RB 3FUEA 4NPYB 4AXKA 1G0XA 3D25B 2NT0A 3W6MA 4KNQA 1BA9A 5EOCJ 1A22B 4X4KA 2A3EA 4GGHA 4MXQD 4JDBA 1WDAA 4S1DC 4PP2B 1HEZA 2AQ3A 1A7PH 4KJYA 3TJPA 4HXBL 5TDOB 3UX9B 1X44A 3USZA 1A0QL 4LCIH 4N3TA 4WNJA 1WS7A 1T2JA 2Z31A 3BLFA 4F7TA 1D6EB 1I9IH 1KF9B 3R1GH 3NA9L 3CV5A 1TJ2A 3SGDI 3HQOA 1C8YA 3DETC 1E72M 1FZKB 1W5QA 3FCTA 1I3GH 2J25A 3DPBB 2XZQL 4L0PB 2XN2A 2Z92B 2HKHL 5K9KB 2J9YA 4QWWC 3O9NA 3MB9A 3S2LA 3WBWA 3QFWA 3THDA 2ABAA 5JHMA 2DYPA 3SAZA 4TQEL 2XACC 2KKQA 2YBRA 4QXUH 3MXWH 4WW2A 2GFBA 4NX5A 2VXVH 4W9CC 5HULA 1EAPA 1GZQB 2ALAA 3MR9B 1KIUB 3NA8A 3SM0A 1J01A 3WFEL 1ICSA 2X2JA 1DQTA 4CC1A 1DJQA 3VD5A 1N26A 1JWSA 4B41A 5EIIA 1NWRA 4U1LB 4P4KC 2QVMA 3PWVA 4CVZA 1RR2A 1H3PH 1VFLA 2SODB 3F65A 3BV7A 3ULVE 2BNRA 4Y8EA 2J73A 5BWFA 2GGGA 1JPFA 4YYCA 3N3TA 1U8HA 1KNOB 2WJZA 4QSFA 2JK2A 5REQB 1QRNB 3NPSB 5CIPH 4JAMB 1U3NA 5KS9A 4WZHA 3MLWH 3BQUA 5LAXB 4XN8A 3QSKB 2Y5TA 3NGJA 1G7JA 2V17L 2W92A 4RFEA 1H7PA 4ZENA 4R90L 2YRPA 1PSCA 4LGSB 1TTQA 3CIQA 4J1OA 4K5PA 1EPXA 4UTIA 1V7ML 4I4WA 1RK0A 4D8LA 1FFPB 3BUIA 4CW1B 4RAUB 3KPSD 3AM8C 4PTUA 4XB8A 1T4KA 5I0WA 3TWCH 4E2DA 2OPCA 4W4OA 4YO0B 1CB2A 4JGNA 2YAQA 4BQCA 2VRAA 5DVMA 5HJ3B 3FTXA 1SJXA 1KEGL 2Z1WA 1UQSA 2BSCA 3BMXA 5A8NA 3IV8A 2MHAA 4I77L 5HD8C 5JORB 5A3HA 5CKAA 4ABVA 1OSZA 4NDMA 4LLWA 5D8JL 1KCXA 2E67A 4JFPB 3CM4A 2QPFA 3O6FB 4WKZA 5DK2B 2PTXA 4TU1A 5EA0L 5D09A 3LEXA 3TVMD 5BROA 2CNYA 2DLGA 2B20A 3N14A 3GLDA 3N6YA 1QYGH 2DBLL 3C3UA 1F74A 4Z7WF 2ZXWB 3UA4A 3CN1A 5DSCA 2IPTH 4CSZA 2QAFA 1SEQH 2Z8SA 1HQRA 4WKHA 1MFCH 3EBVA 2MQ3A 3N2CA 5SX5K 2A9NL 1KXHA 1UXMA 3UC2A 3EX3A 4F9LC 1UJ3B 4GKNB 3CFBA 1LO4L 3HNSH 4NRZB 3WFDH 4GIOA 2IWFA 3QXWA 2XV0A 5CR1A 3IS0X 4MA1C 1JDCA 2OJZL 4GMSH 4JKKA 3FTUA 4Q0XH 5EU4B 4AMKL 3VTRA 2G95A 1BVNP 3STZA 2FX7L 3IMSA 1A6ZB 4AGNA 1OP3H 5D1QA 1LCOA 4W86A 4DZIA 3WJZA 2VN5A 2ICWA 2OZ4H 2QADB 3L3JA 4OLUL 1E15A 1LT7A 3NSMA 4JHMA 2IQ0A 2DICA 4AD3A 4HMEA 1Y18A 5I0XA 3LXCA 1NIBA 4HGMA 2CBMA 3T0BA 3EOEA 4LRNL 3OJGA 3W0WA 1WBXB 2P3YA 3HI5H 1NGWA 1KJ2H 4S11A 5CP7B 2N7SA 4ZRGA 3UG3A 3K71A 3WSQH 2Y61A 2BDNH 5EUOB 2VQTA 3GMLB 2CJUL 5FUZL 1WBYB 1ECYA 1D9KB 2JXMA 5BRPA 4FHBD 1A3XA 2J8GA 4WUUA 3FYOA 5TE4L 4F5CA 32C2B 4HOZA 3SN4A 1K9FA 4JNYA 4HBKA 1SUJA 4ZL1A 5KVDL 1N12A 5CBEB 5JA9A 4OIIL 3S34L 1ME9A 2WIIB 2Z91B 2YKLL 4QJ3B 4MMWA 4YHGA 1LEGA 3QIWB 3NRQA 4HJTA 1J1XH 1HXMB 1OCWH 2YAPA 1QDSA 1OFDA 1MUJB 3K81A 3P4MB 4HPGA 1XH1A 5M5DA 4JHBA 2CU0A 2QTEA 1ROCA 2WXGA 4IH3A 3L3GB 1W0YT 5IK3A 1CJYA 2VDRB 2J6VA 1GY1A 4NN7C 5FV2A 2A73B 4OJDH 2HX7A 3V18A 3EOUA 1S5HB 3CVHA 3EEZA 4J8RA 3RL2B 1ORSA 2R2EA 2DM4A 2DQTH 3GRWL 4N85A 4ZFFA 3PC0A 2XPKA 3PNUA 2PWUA 3QPXL 3OXSB 1OX4B 2HMIC 3VGDA 2I60H 3NQFA 3POCA 4X3ZA 1JGEA 3J7HA 4H2HA 3VKAA 2ZQ0A 3L5IA 1DVUA 4L1HA 4L3EA 3KOZA 4YU1A 5CSZB 3C2RA 3O9WA 3OKEB 3MOAL 3X17A 5FLVA 1W9UA 2OMWB 2RA1A 3VFTB 2UZXB 2R59A 1RY7B 4P57A 1E1EA 1HKJA 3UJFA 4ECLA 4JLRB 4AENA 5AAWA 2BASA 4LO9A 4R5VA 2VDLL 4FQJL 3PP4H 2A6JA 4YBQD 2EDOA 4JZNA 1RJLA 4Z7UB 4M3KB 4M80A 2XNAA 3HI6H 3O4LD 4POYA 1TJIL 2BSSA 1KN4L 3MCKA 1UADC 1CZ8L 1BZQK 4PS7A 1MCKA 3GHBH 2Q7YB 3SOBH 5I66B 2CESA 1V6WA 1JDAA 3GS4A 1S7VA 2X3BA 1C5DA 1LLWA 4XVEA 1I0DA 4O1BA 3AY4C 3SDDB 1I1YB 2A85A 5DT5A 3VWKD 1WAUA 4G6AD 3SD5A 4DO7A 3I7SA 3F58L 4NKDA 1OGGA 4O4YH 3UAEA 1XQKA 3NZQA 1OAQH 2WSPA 1KC5L 3BWZA 3CXDL 2JKAA 4UNKA 4IMDA 5KVGE 4XHJD 2OI9B 4WWID 2HX9A 1YC7A 4YXKL 3MNZB 4QF1B 3VJ6B 5CBJA 3LZQA 1XRTA 3TNBA 6TAAA 5F93C 2F61A 4NUJA 3MQIA 5CCKH 5ITBL 1JGIA 4PS4L 3CUJA 2PRHA 1N7ML 1M7IA 2AERT 4WFEE 4QRRD 3P73A 2RDXA 4B5NA 3HBPA 1ACCA 3QHTC 4G9FB 1JCTA 3U1SH 3PQYB 3LZFL 2H26B 1OYBA 5T8IA 1FVDA 3H42H 2BNUA 2ZSWA 4DHLA 4TOYH 5F2MA 3KBVA 1QSEB 5ACZB 3FFDB 3Q2WA 4PA8A 2NX1A 2CYGA 4LY4A 4LVDA 2BODX 4C1NA 2RALA 5J13C 2NNXA 1R3YA 2H47C 1RZ7L 1XIWC 2E7LC 1Y1UA 4WEBL 3EYSL 1I8LC 2ZT9C 5GZOD 3KW8A 1Q8AA 2INEA 3BVTA 4NP9A 3ITOA 3OZYA 3TNMA 2CDGB 1XS2A 5L2JB 5DO8A 4EXBA 3KEDA 1UFUA 4HN4A 2O9OA 4RIRB 4V2BA 1JWSB 4G1NA 3W2UA 1NGXA 4FG6D 4ROPA 3IAPA 3Q13A 5ABHA 2Y7QB 3BUQA 2PWHA 4IK7A 1KB9J 3DV6B 4GP8B 4AEEA 1NCOA 1N0XL 4LALA 4MVBC 5DMKB 3MNVB 1E9ZB 3M88A 4GXVL 4X63A 2V63A 1UM6L 3RCMA 1KC7A 4QQUA 1MCWW 1EJ6A 2IQ9L 2HWZH 4I13B 4XO7A 3IGUA 2DB8A 2A6KA 3GJFH 4WQOA 4P9ML 1T66D 4KMTH 2ATPB 3VI4B 1FXQA 1WBHA 2V3FA 3BFQG 2NOYA 2R1WA 2X2IA 2VDML 4IBTA 1AQFA 5CN2A 2DLFL 2V5JA 2CKBA 3BMVA 4LF3A 3GSQB 1ISVA 2P45B 1E4IA 3TTOA 4QY8A 2C3XA 3WD0A 5A6AA 4PTUB 3MDWA 3ABLB 1AKJB 3VW3L 1LMKA 1VEOA 2XZCH 4HSCX 4V2CB 3L3IA 4Y4FA 4AM0Q 3ULUF 4F7CA 1DPMA 1WKDA 5HNRA 2FTAA 3UYRL 1YSOA 5BVJA 1WQVT 4XXCA 3ECQA 2JKIS 1QQDA 3ANYA 3GGWA 2DWDB 1OAUH 5ABAA 2P5EA 2NVAA 3DO4A 3GSVA 3TIEA 5KN5A 5SX5H 2VLJE 4NJGA 2BNQD 2YGOA 1HDMA 2P8LA 3HG2A 3IJSA 4GRLC 4WHTA 2VGIA 1J5DA 3VIFA 4GA8A 4E4UA 1V0MA 3T3MF 5CD3B 1PE1A 2I25N 3KFTA 4WWKC 1IVTA 4JIEA 1NH6A 3NJHA 1T3FB 2F5BH 4KKLC 1TQBB 1JS4A 2J4WH 3CDZB 1ISWA 1TSHA 1ZLEA 3IDMB 2AMGA 3W38A 2Q7AA 3OLDA 2ENYA 3BO8A 4L4VE 4Z7QE 3IAGC 4E2BA 2VW4A 4F80A 2J8FA 3E80A 3WSQL 3QZ6A 3W71A 4JB9H 4HIJA 4BA0A 4A3UA 1IBHA 1UGKA 2ERJC 3EYPA 1MRDH 4PGZA 1NOAA 4J6RH 5K4XA 1BSLA 3ALFA 2AC0A 2XVPA 4H9MA 1DE4B 2DPEA 2DJUA 5D04C 1IQDA 2BW4A 4TULH 5DUMH 4E41B 1OT2A 5FPIA 3Q2LA 1RUPH 1GEQA 2WQDA 2PB1A 1X5IA 3IVKB 4Z2JA 4G5AA 3UBXG 3QJQB 3LOWA 3MCLL 3QEHB 1PWLA 1QFEA 3IT8D 4GKTA 1WISA 4LVOB 3HC0A 3OC5A 4LOCA 3VD2A 3KPLA 2FZ8A 1HT6A 2BBFA 3PGCA 4KMQA 4IEFA 4QKXB 2YCLA 4C6NA 1TMLA 5CU5A 3SYAA 3UP6A 3UYIA 3DUUA 3I75B 4U3HA 2BWIA 5F4XA 2P1FA 2W07B 4U1MA 2AJUL 3MOBL 4A66A 5J89A 3T3MB 2F74A 5KBNC 2PDKA 2F7FA 2XV6B 1BZ9A 3BCDA 1P1MA 4MCYA 2OPJA 4IXXA 1CR9L 4KQ3H 3NIFF 1J8RA 1HHJB 2F6AA 2X6BA 2DQTL 4UF7C 2ISDA 4XO6A 3UW6A 4TUKL 2XH7A 1B0IA 2G8ZA 3TASA 3FQWB 1LVEA 4QLKA 3RK8A 1PD0A 4PY7A 3VXPB 5A8QA 35C8H 2KZKA 1QACA 1F1GA 1XGQB 3ETTA 4FHKA 4UB0H 3MRNB 4X5XB 1LEGB 3QIWA 3TBVA 2Z6IA 4LIQE 5FYKU 4XCYB 2QFRA 3DIFA 1KZQA 3N9GH 1FP9A 1AJ2A 2WZEA 3VFNB 4F57H 3L1FA 4NPYA 4PJFB 4WV1B 4GSXA 4F8NA 2UBPC 3MKVA 4F33A 5AVNA 1KGJA 2LGNA 5IK3B 4H88L 5C0RL 5I18L 2AKRA 3HQNA 2Z93A 3W6LA 4NZTL 4AZHA 3RKPA 3KOFA 4L4VB 2ESCA 4L29A 2WSYA 2FECI 2WMKA 5H94A 3V0VB 2QPSA 2MNRA 2DH2A 1T6VN 3BZ4A 3WY4A 5IQ7L 2OX5B 3PAVA 2Z25A 1G01A 4E3VA 3RIKA 1HHHB 3G5XA 4K07A 4MLSA 4BH8B 1EJUC 3NSJA 1CTMA 4CJ1A 5CU9A 3V0FA 2PURA 3NTCH 5F9AC 2R0ZH 4YQXH 1ZCRA 1AD1A 4US6A 2WQUA 4PTVA 1X96A 2GUOA 4JDZA 1ECZA 4TLUA 3SZ6A 1HS6A 2NVCA 4WNQA 4WI0A 3EWYA 3WS3B 4JTLA 1RK1B 2I9UA 3BSMA 2I7GA 1ADDA 1CI5A 2BVOB 3TSMA 3GJEA 2HTLD 4CU7A 5HNUA 3VOIA 4FXTA 2A6JB 1H19A 3VRIA 4HULB 5ETUB 2J21A 5E9AA 5FDWA 3ULUC 4LYKA 2UWEB 2JKEA 3P60A 2TYSA 5SWSD 1A2YA 1XWVA 3BH4A 4ZZFA 1A0QH 4LCIL 1A4JA 3ILEA 2A83B 1QBBA 4GMSL 2DW5A 3I6TA 4J5NA 2LV4A 4FFYL 3GNML 4LCWD 1CFSA 5EPMA 2R4SH 1JWUB 2LTQC 2BNRB 2ZUVA 4JFDE 1MXDA 1U8IB 4OJFL 1PMYA 3RZCA 2Q0ZX 4Y5XB 1SZGA 4K3JH 2D31B 1UASA 4U6TA 4YHIB 5C0GA 1PB0A 5ADPH 3H4GA 2GK0B 3WNNA 2CRMA 2DKMA 2NX5D 5JHAA 3O3AB 4UTMA 1ET8A 5JXAL 4D6IA 1EHLH 4HIQA 3JV5A 1NCDL 4UV4H 3WBDA 2IC2A 1IGYA 1EL3A 7ENLA 1A3LL 4P46A 1PYWA 4G2AA 4X6DF 4GG8A 4YHOL 4JQAA 4QISA 4JX0A 1B9BA 1QFOA 1PEZA 3AXLB 3SPIA 2WYIA 1M7JA 3ESUF 5EEXA 1W37A 4JNZA 4YTUA 1A7OL 3IS4A 2D7QA 4U1SA 2BGNE 4UDUA 5D2VA 4DP0X 3P73B 1RD5A 3MBEC 3ZHLA 1FYTA 2Z6JA 3OQ3B 3QHFL 5EOTA 1HP4A 1ML0A 2PDCA 5C09D 2BNUB 2ZSWB 1WD8A 1KG0A 1FZOA 4KRPB 1H3XA 1CIDA 2H41A 3MGTA 4KX8A 4ZDHA 2GK2A 1RUSA 1X1ZA 3N6QA 4OV5A 4W9TA 1Q90A 4P49A 3S36H 5DLML 4R4FL 4PJBB 4QCIA 1SUXA 4BH7B 3MJYA 5D1ZI 5AOKA 1R86A 3O6AA 2MPAL 1E4KA 4RETB 5E6IC 1KXTB 2GQAA 1RBOB 1MCNA 1LE5A 1EEZA 2P24B 5C0JB 5L88H 3E6HA 5IMLA 2OK0H 1ONEA 2QCLA 3T2LA 2VX4A 5HSFA 1RIVL 1E4WH 4Y2NA 3W27A 4HUCA 2QJGA 4JY4B 3P4OB 3ALXA 2ITFA 2JCCF 1O68A 2C15A 3TN5A 5DBUA 3IM1A 3A4DA 5GGQL 1GVSA 3QRLA 2PMQA 3KPRD 1XTLA 1BW8A 2A6IA 3OJDA 5AENA 3HGRA 3WJXA 4BUHA 4DGVL 5G2HA 2GCYA 1W0WB 4C6IA 4L3EE 3STZB 1I9JH 5ELIA 1OY0A 3FQXB 5J5RA 3ARFD 2VLRD 4OB5H 4UT7H 2BDQA 3V0HA 5A6MA 3OLIA 2PCFB 2DQUL 3FQRB 2WMHA 5E1GA 3W2LA 5XIAA 2XKNB 2D69A 4HT3A 2X4NA 5EL1A 5AZ1A 4Q7IA 5AUMB 1DORA 4QRPB 4GFIA 1YJDH 2CO6A 1QSFD 1XSIA 1XIWA 4J27A 2EPKX 4XPTH 1WGVA 1CE6A 2D03L 3NOIA 3ARGA 2F2KA 3LBCA 3OB0H 3MAWA 3RRXA 2MCAA 4C91A 1U8OA 1HSBA 2WMGA 5CBIA 3UBXI 1MDRA 4Y1AE 2YYTA 4M7ZC 1XINA 4QYOB 1J7VR 3DI3B 5I1GH 3MO1A 1PDYA 3OYXA 2BX7A 4MFDA 4D6CA 2D0FA 1AD4A 5XINA 3H12A 5AY7A 3N1QC 1P43A 4UMCA 2D4FA 4JUTA 4L4TE 1GSMA 1BJ1H 2K4AA 4HA1A 4RBPK 5GZNC 3EX4A 4J40A 2EDQA 4ZQKA 1TV5A 4P59L 2GYSA 4XHQA 4ALAH 3MBED 1VBRA 1QWNA 2OCZA 1PJ9A 1SW3A 2FH8A 2VE6B 3IKCA 3MCLH 3QDGB 3H21A 3MP5A 4S1SL 5C0EB 4PG2A 4E6MA 3GJFB 4X4YB 1RCQA 4ZO9A 1W8NA 2I9LA 4HKBB 4M1CD 2VQ4A 4K7FB 1NUGA 2UVFA 2P7TB 4U4BA 4GAFB 3WQPA 4X8GA 4N2OA 2ZP8A 3BPOC 5GRUL 3RAJL 1KFJA 3NDOA 3QDMD 2R69L 4IPLA 4JFFD 1HG3A 1NBYB 3JS3A 3QIUA 5GS2D 3ME0A 4A2EA 2I1OA 4K94L 3UO8B 3WHXB 3C87A 3WEBA 5E4EC 4DVRH 3BQVA 4YE4H 3FMGL 4S3AA 4W9ZA 4OCSH 1H0GA 2HPIA 3EWWA 5E8DH 3ILPA 4KWVA 4IFKA 2B5IC 1OC5A 3NOYA 3CXHK 3MYJA 3B2MA 4L3EB 2PPDA 4G80B 1VFTA 5M17A 3KPLB 4EAYA 3MJ9A 5DHVB 1BLIA 4Q52A 4GRWE 2FB3A 2QTVA 3A21A 5AWNL 2FTWA 2YRBA 1MCWM 1MWAA 1P5VB 2HT3D 4S10A 3TBYB 1DXIA 3KHJA 3NN8A 4LOUD 1OAZH 3GI9H 5D6CA 2IMMA 2FO1A 2HBXA 1F90H 3H9ZA 3CHOA 3DSFH 3QNZB 5T3ZH 3GYCA 2EDJA 2W88A 6TIMA 5SWSE 4I9XA 4IRZA 4O1EA 4GQBA 3GR7A 3BHBA 2FZ3B 4LLYA 3P3YA 3TJEL 1NIDA 2OL3H 1PHWA 4P5KA 3P4NB 3TMLA 1AR2A 3N4EA 1TU2B 3I02A 1PZAA 3VC5A 4OIBA 3MRGA 2VOTA 2AABL 3CSPA 1WHOA 5BVPH 4FNLL 4NC0B 1U30A 5LXGH 5HHPB 4ALAC 1UBSA 5LGHL 2DZBA 5HD8D 4GHRA 2APXA 2WNKA 1M71B 3O16A 4RE2A 1KUMA 3P9MB 3MBEB 1WEJH 1FNSH 3L95A 2YEVB 4OAWA 1V6TA 3C6LB 2DM7A 1PBGA 1SQ7A 1TYGA 3CWOX 1BZ8A 3MRCB 3BQ5A 1I3GL 1Q1PA 2F1BA 3MRPB 3DJ9A 4IBUA 1KPUB 4W7WA 1PS3A 1IKFL 4JFEA 2YZ5A 3ITCA 3QH3A 1I3RA 2NY2D 4XC3H 5MP6H 3PF3A 3IRDA 3QDMB 4UTFA 1KIPB 1FFOA 3O0LA 2R23A 1E30A 3V4BA 3N40P 4I8YA 1IAII 3KGSA 3BZFA 4JQIH 4QRBA 2REQA 4MMZA 5TE7H 3Q06A 3WKNA 4F8XA 1QHPA 4HFUL 2CETA 2I5QA 2X4OA 5DD6A 4H00A 8CGTA 4F20A 1MJUL 5LGXA 1JUFA 1KXVA 3DOHA 3SE3A 2AXFB 1QK2A 4GY4A 4BCEA 1IL1B 1E90A 1IJ9A 5TDNA 2WJEA 2OG9A 3LN5B 1FQ0A 5HDQL 1AI1L 4XPFL 5DVNA 2WXLA 4GXMA 1RCYA 3FSOA 4OZHF 4FQHA 1Z44A 5EIIG 4H8NA 2EUXA 4Y8AA 5DS2A 3NXLA 3OJMB 3U0TB 3WFBH 1QR4A 3BUBA 4NN6C 3T9WA 4F1SA 3DV6A 3IRSA 1YEHL 3B5HA 3P77B 4JM0A 4RVBA 5IQNA 3UTSA 1R3WA 5I79A 2OKMA 2ODIA 4V1DE 3GMOA 2ZOLB 3MLRL 4LIQH 1W8GA 4HHHA 3V4VL 3L7FB 3V0EA 4IHOB 1BGXL 3ETBF 4LU5H 1QO2A