1P6WA

Crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with the substrate analogue, methyl 4i,4ii,4iii-tri-thiomaltotetraoside (thio-dp4)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (Alpha-amylase type A isozyme)
publication title The structure of barley alpha-amylase isozyme 1 reveals a novel role of domain C in substrate recognition and binding: a pair of sugar tongs
pubmed doi rcsb
source organism Hordeum vulgare
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1p6wA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1p6wA01
1O7DC 4N0RA 3ARUA 3DECA 1MQPA 3BCDA 1OWQA 2F7QA 2ZX6A 4PCSA 3W29A 3GM8A 1OD0A 2J8FA 4M56A 1QWUA 3OZOA 3PZIA 1J0ZA 3TONA 2BY1A 1BSIA 1R87A 3UR8A 5A95A 3CMJA 2X1IA 4OOZA 2XVGA 1HJVA 1TMQA 1BQCA 4GO8A 1GW1A 1JXJA 4AD4A 5I3DA 2HISA 3M46A 2FH8A 4F9DA 3ZIZA 2J4GA 2JALA 1DEDA 1E1EA 2W5FA 3IGUA 5HXMA 2F18A 2WCSA 4LXFA 1EH9A 4S3KA 4BS0A 4M8UA 4GI9A 3DX2A 1W9UA 2XYLA 2QHAA 1G94A 3L4WA 1E73M 5CJ5A 4U2YA 2VZSA 2V38A 4H8UA 4PMRA 5A3HA 1O7AA 2IGTA 4M81A 1KGWA 4Y7EA 4FLSA 1EA9C 4MNMA 3LRMA 3BVXA 3VNYA 3KL0A 1KXVA 1QBBA 3ARVA 3CV5A 3VIIA 1BVNP 1QI4A 3AYRA 4KH2A 3WDRA 2EO7A 2WKGA 3WMSA 1V6VA 3W28A 4OOUA 3RM4A 2X2HA 1WDPA 2GK1B 3HG4A 3WL1A 3WN6A 4Z2LA 1A47A 1J0JA 1TG7A 1EOMA 1FHLA 4P8WA 1HF6A 3TV8A 5CPQA 3GXPA 4F79A 4HMEA 5A94A 1VB9A 1KWKA 3AICA 5M3WA 4CU8A 5D8WA 1UYQA 2DT1A 1UWSA 3PTKA 1Y7VA 4CD8A 3WQ6A 4YPJA 2XWDA 1LWHA 5ECUA 1TZ7A 1E43A 2ALWA 3ZSSA 4CCCA 1KQZA 1JGIA 3KL3A 3CZJA 2V3FA 3AHYA 2WMIB 1UH2A 1VENA 5I6SA 4XV0A 5A8NA 5FKYA 4V2XA 3AROA 1G9HA 1F4AA 5ABGA 3TTYA 1QNPA 3VSVA 2WHLA 1ZBVA 1ODUA 1FP9A 1B31A 2GK1A 1XYFA 2PWGA 4W87A 1C8YA 2NSXA 3A4WA 1HVQA 1Q6EA 2D3NA 1EO7A 1W2VA 3NDYA 2WCAA 4UQDA 3VGBA 2FHCA 3VD3A 2CEQA 1PIFA 5KEZA 2EACA 4NXSA 1XH2A 1FFQA 3RM9A 3CGTA 4JCLA 1QI0A 1TR1A 4N42A 4UFHA 2G3MA 1BG9A 1RP9A 3BSHA 1GONA 2WZEA 3UG3A 1WP6A 1WO2A 1UA7A 3CHFA 1B9ZA 1I1WA 3HU7A 1TQVA 2WSPA 2QF8A 2BXYA 4NRSA 3AS3A 4DM2A 2WMIA 4J3XA 4UOQA 1Q6FA 1LL7A 3T2PA 4AZBA 2D0GA 3RO8A 3IJ8A 5FIPA 2VJXA 4L4OA 1J9YA 4WK9A 2WC4A 4CUCA 4L4PA 1RPKA 1OD8A 3AS2A 1CTNA 2CERA 3GH4A 2FE0A 3EJUA 2PWFA 2AMGA 5D4YA 5A2BA 1KTCA 3L4XA 1JYWA 4DO4A 3VDBA 1E9LA 2EAEA 3WNNA 3SCTA 1XH0A 2BY3A 1GOKA 2GSJA 2ZIDA 1E71M 1W91A 1HJXA 4OIFA 2X8RA 1ZBKA 3T2OA 1J0KA 3W6MA 5A6BD 2D73A 1VBRA 4AD5A 3WH8A 4HZ7A 1HTYA 2VRQA 1NQ6A 4D6CA 3A21A 2Y5EA 3T0AA 3PTMA 4AY1A 1CGVA 4QLJA 3CZLA 3T2QA 3EMCA 5GNZA 4HA3A 3WUGA 3CMGA 4W88A 4BQ3A 5ABHA 3NCOA 3PZGA 3NIYA 4HP5A 2WVVB 1W32A 4AEFA 4Z2JA 3PN8A 3VIJA 5ABEA 3GH7A 3MSDA 4NXKA 2EJ1A 1J18A 3VDAA 4PUEA 7A3HA 1QHPA 4W7WA 4DWSC 4ZFMA 4HOZA 3AFBA 4AZIA 1QW8A 4PYSA 3VDCA 1JD9A 3ZR5A 5JIWA 1JNEA 4AD1A 3WNKA 2WHMA 4D6FA 3AOFA 3W53A 2V3EA 1ISYA 2XM2A 3L4VA 5EFFA 3POHA 1MQRA 1UR1A 1QNSA 2DT0A 1CPUA 3VMPA 5E6YA 2OW6A 4OJYA 5A6LA 1E4MM 1NP2A 1MW1A 4EE9A 4FNSA 1J01A 3KZSA 5AYBA 3KL5A 3VGFA 1AVAA 4OZOA 4ACYA 1E0XA 3WNMA 3CC1A 4QCFA 1H1NA 4WKFA 1W3KA 4PTVA 2F61A 4NZJA 3VSUA 1O6IA 2YDRA 5IXEA 3EJRA 2UY5A 4FLOA 2JF7A 2VQUA 2ZX9A 4PRWA 1KBKA 3FAXA 1LG1A 2VR5A 1HWWA 2D20A 3K8MA 1QNOA 1JZ4A 3KE0A 4PMYA 2DT2A 1UWRA 3THDA 2YBTA 1W9XA 6A3HA 1UD5A 1GHSA 3VX1A 3VKKA 2BVYA 2Z1KA 5I0DA 3UG4A 5TD4A 3MV11 5AY7A 2E4TA 5A8QA 1UD8A 1M01A 4AW7A 2QMJA 1CXLA 4D6EA 3A47A 2VZVA 1W1TA 3ZT5A 3SCOA 1W1VA 4JL2A 4RE4A 1XSKA 1XHGA 1JZ6A 1US3A 1E4LA 3ARZA 3AJ7A 3DX4A 3WNOA 1C8XA 2ZUMA 4PMDA 1SZNA 2QPUA 3A6OA 3WD4A 2FGZA 1MXDA 3OB8A 1KR0A 3RJXA 2OSXA 1RD6A 3CZKA 2VX5A 3AZSA 4LX4A 4FMVA 1C7SA 3IAQA 4MTVA 1HXKA 2JIWA 2O92A 4UQ9A 2WB5A 1UZ1A 1XRVA 3LX9A 1UKTA 4LYPA 1CECA 4BA0A 1B30A 3WQ5A 3HG2A 5DEZA 3VD9A 1G5AA 2V3GA 4W86A 3ZO9A 1GJUA 3DX1A 4AZHA 2XN2A 3BC9A 3EJSA 1JL8A 2OLHA 3J7HA 3W6LA 4DWSA 3S5YA 2VCCA 4J3VA 4LYQA 1K9TA 1EQPA 2XVKA 4KGJA 5JBEA 3FNDA 1ISWA 4BQ5A 1ITCA 3RMEA 4B3LA 5CGTA 3ALFA 4C7GA 4P8XA 3SUVA 1GQLA 1CNVA 1NH6A 1IT0A 3BAJA 2C0HA 1HL9A 5FOOA 1MWOA 1XSJA 1UQYA 2VX4A 1CXEA 1UKSA 4MAZA 4ZXLA 5GNYA 4UFKA 3SCVA 2VX6A 1DWHM 4DO6A 2JIEA 3ARQA 1QHOA 3OIHA 2BHZA 3AXHA 4MB5A 5IHRA 1HX0A 4JKKA 3EJQA 2G4FA 5D9MA 2CBIA 3ZMRA 1CGWA 1NWSA 1GHRA 4B15A 2EPOA 2J62A 1W3LA 3N04A 2Z1SA 4TXEA 2UY4A 5BXSA 4AC1X 2VVNA 5IDIA 5AC5A 3D4YA 5A2CA 3BUQA 1D7FA 3MSGA 1OT1A 2G3NA 4MB1A 1TE1A 2ZXQA 1BYDA 3N1AA 5A8PA 2WCGA 3VDHA 3ZQ9A 3TA9A 5I2UA 2J7FA 2CXGA 3ARPA 1N82A 4HTYA 3AZTA 3K4AA 1JYVA 3WKZA 4PEEA 1UR2A 2J75A 5A6MA 2Y8VA 3G6MA 4M24A 2OWCA 1XC6A 1HKMA 4EANA 3TP4A 3AXXA 1H2JA 1CGXA 5ABFB 1QNRA 3F5LA 3HJEA 1XV8A 4UZUA 1V08A 4U2ZA 4GZIA 2BVDA 2O9RA 4MB3A 2E3ZA 2XIIA 3U7VA 4UFLA 1R8LA 3AMDA 1C90A 2CHOA 5BYWA 3W37A 1X6NA 1EGZA 1Q6DA 1K9DA 3A22A 3VD5A 2PBOA 3WEMA 4LPCA 3SURA 2ZUUA 3I3EA 2JEPA 3DX0A 4QFUA 4ACZA 3F5JA 4LGXA 1JI1A 1LJYA 3OLDA 4KMQA 3NDZA 2ZUWA 1KXTA 4UFMA 4FF5A 1XGZA 3MANA 3VIKA 4A3YA 3CZEA 3BMWA 2RGMA 5ABFA 5DT7A 1EO5A 2UY2A 5DO8A 1W9BM 4UFJA 4D6DA 3LPFA 4MNJA 3RPMA 4D72A 4TVUA 4IISA 3UERA 4JFWA 4PMQA 5FD0A 1QHZA 3MUIA 2VZTA 3OLGA 1GOOA 3B9AA 1WPCA 3M7SA 4PMVA 1H09A 1P6WA 3BXWA 3ZSTA 2Y4SA 2WMJA 3N15A 1KXQA 4W93A 1DWJM 5CPSA 2WW5A 2WZIA 5LA1A 2OWXA 2J7GA 1J12A 1PX8A 5CQ1A 2DSZA 3CZ8A 1CEOA 3WH5A 3VTRA 1XCXA 4LQ1A 3VNZA 5CSUA 3T0DA 3MI6A 1B3ZA 1FH8A 1G01A 1BPLB 3AIUA 4W5UA 4LYRA 3PZMA 4EKJA 1VJSA 2CNCA 1OIFA 4RE3A 3EJPA 1JYNA 4MPKA 2WHJA 2A3BA 1UWUA 1ISZA 3AS0A 4GO9A 1E15A 1V3JA 3DC0A 3DDFA 1HT6A 3LXBA 3TTOA 3CUJA 3VGEA 4PTMA 3VILA 2W61A 4J3UA 1FP8A 3QOKA 4KRUA 3OLIA 3VMOA 1JYXA 2WLZA 2DIEA 1K9FA 1FH7A 2VCAA 1V6UA 2O9PA 3WF0A 3WMCA 1D2KA 4U3AA 3WF4A 1UOKA 1Q4NX 4GQRA 3FHAA 1QI5A 1VJZA 2C8NA 3RIKA 1KTBA 1XSIA 2WNWA 5EMYA 2F7RA 4CN6A 1CLXA 1C92A 2W91A 5DF0A 3BAKA 1PX3A 2WC3A 1XH1A 3VGDA 3WENA 4XZWA 1W9VA 5IFPA 1JF6A 2G8ZA 4KRTA 2OW7A 2YJQA 3CHDA 1F4HA 2XVPA 1E40A 1GQKA 5CPTA 2QPSA 2ZUSA 1JFXA 2WWDA 3AQUA 4M82A 1XD1A 4QP0A 4OBRA 2FHBA 1E56A 1HKIA 2XSBA 2ZWYA 5E1QA 2J77A 4CN4A 2JF6A 3VPLA 3BLBA 2D24A 2XG9A 4CU7A 3QGVA 4R27A 3U5UA 1PX4A 5GQBA 4U5IA 4ZEPA 2JFEX 4E4PA 1UR9A 4GIAA 1D3CA 1SFSA 1MYRA 1JDAA 3N18A 3VGGA 3BLKA 4DUVA 4AMCA 4UQCA 1DHKA 1M53A 3GNPA 3K8LA 3GYCA 1GQIA 1V3LA 4PCTA 4W5ZA 3WEZA 2VT0A 1R47A 4YHEA 3RJYA 2G41A 4TVCA 3BAWA 2DDXA 3HMCA 3OGSA 4WSJA 2YL8A 3OG2A 2VX7A 4P8UA 3VD7A 1KB3A 1UQZA 1VFOA 2PB1A 1UR8A 3GZAA 2ZX7A 2ZUVA 2W63A 3ARWA 4J3TA 1VRXA 1MW3A 2XN1A 2BNJA 1AMYA 1W2PA 3EDKA 3LMYA 4CKQA 4AIOA 1V02A 2YLLA 4EK7A 4V27A 3U7BA 5BXPA 2PC8A 1BG4A 3RM8A 5CGMA 2D22A 1T0OA 1XD0A 2PBGA 4GI6A 4B9ZA 4WKAA 1J0IA 3MUAA 4H7VA 5A8OA 1E3XA 2FHFA 4AMWA 3A4AA 1QOXA 1UHVA 1QBAA 3SUUA 3VIMA 3WL0A 5C8BB 2EEXA 2B31A 2BFGA 3EDJA 1ECEA 3CUFA 2NT1A 2EPKX 1V0NA 1TFVA 1HP4A 4D6HA 4AWEA 4TOQA 1KGXA 3WNLA 3MU7A 3AI0A 4WIWA 2XIBA 5BRQA 4UCFA 2GVYA 2BS9A 2EPLX 5I79A 3KLLA 3W25A 3H55A 1J0HA 1NWTA 4MB4A 1TA3B 3WQ8A 8A3HA 2Q8XA 5BRPA 3DYPA 4BQ2A 2DT3A 4GZJA 4GQQA 3SIMA 3WF1A 1PAMA 1MW0A 3ARRA 2WVUA 2J7DA 1NM9A 1HJSA 1M04A 3OZPA 3PZ9A 3HG5A 1UWTA 2WPGA 4R5EA 1ZJAA 2GDUA 3CUHA 5BROA 3ZJ8A 3L4TA 2G3IA 1EDTA 2J7EA 2WAGA 2CKRA 1JZ8A 1UWQA 3AIVA 2WMHA 4ML4A 3SEPA 3PZVA 4U33A 3N13A 1WCGA 3DHPA 2Y2WA 3L4ZA 1PBGA 3U57A 2WVVA 2AAAA 3BVUA 3NYDA 2WC7A 2ZWZA 3WUFA 3NJ3A 4TX6A 3WH9A 3LPOA 4E2OA 1CENA 1GCYA 1KFWA 1TA3A 3ZJ6A 2ZE0A 3MKKA 3T0BA 1Z32X 4J28A 3VGHA 2CHNA 1BGGA 1CBGA 1AQHA 3KLKA 2CBJA 4Z2KA 4WKHA 1J0YA 2MANA 2VRKA 1BYAA 3N12A 3MMDA 3BUIA 3AIEA 5CSYA 1VEOA 2J7CA 3VD4A 2WVSA 4CD4A 1V0KA 1IV8A 2IXUA 2HVMA 2VL4A 3ECQA 4C7FA 3MMWA 4D71A 1C91A 5HDRA 2PWDA 1QI3A 3AIRA 3TTSA 4AXNA 3BAYA 5FL0A 4AYSA 3SCSA 2FYVA 5HBFA 3CZGA 4MADA 1IZKA 2CITA 3AIBA 2FH6A 3UETA 3SCPA 1CIUA 4S3JA 2CBUA 4UFIA 3D50A 1W9DM 4PMZA 4U5KA 3WDHA 1JDDA 4UOZA 3VIPA 2E9MA 2GFTA 4MAVA 1DTUA 3UR7A 3VOCA 1TQUA 1VFUA 3WH6A 2VQTA 4XUYA 2XM1A 5E9AA 4GZEA 1GOMA 2XFYA 2F7PA 3VM7A 4JAWA 4OBSA 4PSRA 1G1YA 1GOWA 9CGTA 4EAMA 4E8CA 3IJ7A 2ZXAA 3ZM8A 1HJUA 3GXIA 2F7OA 4HOWA 2VCBA 2WK2A 3CIVA 1TQWA 1YHTA 4OUEA 1UKPA 1JNDA 5I5RA 3II1A 3TOPA 1E6RA 2DSKA 5D9OA 1R46A 1L8NA 4W89A 1CGYA 4GI8A 1TVPA 1LL6A 2XGIA 1GVIA 2Y8KA 2W67A 2X2YA 4A4AA 3QOMA 3PHAA 4X0NA 1HVXA 3CZNA 1JFHA 1NP0A 3T08A 3ZJ7A 2BY2A 1H0GA 1DWGM 3PZQA 4JL1A 4TTUA 3T09A 2YIHA 5DMYA 1S46A 3FXYA 4QLKA 4H8VA 4U31A 3CHCA 4F8XA 3CH9A 4CD7A 7CGTA 4PMUA 1MW2A 1B3XA 2GJRA 3QHOA 3BVTA 3OLEA 3AHZA 2UWFA 1E3ZA 3AYSA 4AZCB 4DM1A 1E70M 4WLCA 4P7LA 2J25A 3WFLA 2VOTA 1XCWA 3IANA 3BUDA 1E1FA 1E6PA 3AS1A 4NX0A 1R85A 2W4XA 1GQJA 4CD5A 3WDQA 3QHNA 3VM5A 3K4DA 4A3HA 1H3GA 3VIHA 2ZUNA 1CYGA 2ZX5A 1KQYA 3CZSA 3WY4A 1SYTA 4URIA 3LXAA 2DQXA 4C7DA 1PZ3A 3VINA 4HPHA 1ZJBA 2F1AA 3LRKA 1I75A 4DWSD 1CXIA 3BSGA 2D0FA 3KEHA 1BTCA 3RILA 4PUDA 4J27A 5LYRA 1CXFA 3HG3A 1H11A 2EADA 2CPUA 1X6LA 3W26A 2WMKA 1ZB5A 1JAKA 3BGAA 2A3HA 3CHEA 1U2YA 4X9YA 2D1ZA 2YFNA 4WF7A 1JZ2A 4F66A 2PF0A 4UTFA 3WBEA 4HU0A 4FNQA 5C71A 4J3WA 5AYIA 2PWHA 3POCA 5A6JA 3WSUA 3O2LA 4FNUA 2YBUA 3D5HA 4P7RA 5E0CA 5DFAA 2DSWA 3H54A 3PZUA 1JD7A 1TVNA 3A24A 2DGAA 1QI2A 2C7FA 3LXCA 4FLRA 4XB3A 1BF2A 1UWIA 4NF7A 3WD1A 2CKSA 1G0CA 2O9OA 3E1F1 3GXMA 3WD2A 4H8HA 2FDMA 1UG6A 1M7XA 2GUYA 4ATDA 2E40A 4HA1A 2E9BA 3VSTA 3VMNA 1GUVA 3UEQA 2VVSA 1UH4A 1HJWA 2X09A 1QWNA 4W7VA 3WFZA 1QVBA 1WNOA 4XZBA 4PTWA 2YL6A 1R75A 4D1IA 1W1YA 1PZ2A 3AIQA 3U5YA 4D6GA 3KWXA 1OINA 3BUPA 1WZAA 2J78A 1OB0A 3A23A 3WELA 4W8AA 1HN1A 4KWUA 2ESCA 3IAPA 3PTQA 1NOFA 4JZ5A 3WEOA 1QPKA 2E0PA 1FH9A 1HL8A 1H41A 2TAAA 1ZBCA 4W7UA 1NWRA 1ZU8A 3ARTA 2WKLA 1TUXA 4ZENA 3CLWA 3D52A 3M6DA 2XGBA 1MFVA 1Q6GA 5JBDA 4U3CA 1I1XA 3WQWA 3FY1A 2VZUA 1VEPA 3IK2A 1VAHA 1K9EA 2V3DA 1GOIA 3DYMA 1W1PA 4ATLA 1JDCA 4AEEA 1PEZA 3NUKA 1SR0A 1VFMA 1EOKA 1UD4A 4PSPA 1WKYA 3ARSA 5CG0A 1EIBA 4AZ6A 2DSVA 3OA5A 2VR4A 3AMCA 5BWFA 1BFNA 2VNCA 2YFOA 4AIUA 1VF8A 3N9KA 6TAAA 3D3AA 4AZGA 5D9NA 4WSKA 5CLTA 5GNXA 2E8YA 4CCDA 4HU8A 2DEPA 4IM4A 2Y24A 1H0IA 4UOJA 2JEQA 1WDQA 4WJXA 1E0VA 1B0IA 1E4IA 1KCLA 4CVUA 2DIJA 2X0YA 2ZOXA 1AQ0A 3BAXA 3ARXA 3N11A 4IPLA 4B9YA 2CESA 3W27A 3ZR6A 1GPFA 1MXGA 1W3JA 1M03A 2XSAA 3A5VA 2CIPA 2D3LA 1QNQA 1EXPA 3D4ZA 1UD3A 3DDGA 3VIFA 4UQEA 1VBUA 1ODZA 2XHYA 2OYLA 2CYGA 2GJPA 2VI0A 1SMDA 4BQ4A 2IUZA 3MUZ1 2NT0A 3WF3A 4JFUA 4GKLA 3THCA 5D8ZA 1X1NA 1W3HA 3MO4A 1ITXA 1OBAA 3WH7A 1DWIM 4W8LA 3OGVA 5E70A 3EDEA 3FN9A 1LG2A 3H53A 3GXTA 2ZICA 4GINA 2RGLA 3EMQA 1JZ3A 2WSKA 1VIWA 2YA1A 3QHMA 1KR1A 1B90A 3VVGA 1MVYA 3VIGA 1R7OA 4NZFA 2EABA 1FHDA 3VU2A 1ZL1A 8CGTA 5HOSA 1UKOA 4Q7NA 1KCKA 3GXFA 1W9PA 5F7UA 3AHTA 4CVWA 4W8BA 4GPNA 3BLPX 3VUPA 4FK9A 4RL3A 2AOSA 3L2MA 1A3HA 1NOWA 4H04A 1JG9A 1UD6A 5JUVA 1ISVA 1MFUA 2NW0A 3VX0A 4MDOA 3L2LA 1FFRA 1GJWA 1BGAA 2A3EA 4P8VA 5M5DA 4X0VA 4OGZA 3GH5A 1EQCA 1DP0A 3APGA 1J11A 3OBAA 5A6BA 2YDSA 1V3KA 1EDQA 4KGLA 1CXHA 3ARYA 1OCQA 4AISA 1V6WA 4FNRA 1OSEA 3CPUA 1TCMA 1US2A 3AHXA 1H49A 3ZT6A 4IUGA 1DWAM 3WQVA 3VO0A 1BVZA 3EBVA 5A6SA 1RP8A 3GBDA 1R7AA 3ZOAA 2WLYA 1UKQA 2G3JA 2J79A 1E55A 2CCRA 3WNPA 1UASA 1E72M 5A6KA 3G6LA 4NRRA 1E0WA 3AXIA 2BY0A 5E6ZA 3EDFA 2XUCA 2XPKA 4J7RA 2E8ZA 3WDIA 1DWFM 1NWUA 5I78A 1JXKA 1V6YA 5FL1A 2IXVA 5FCZA 1BLIA 3S2CA 3QR3A 2WANA 1EHAA 2OSYA 2OWWA 2YLAA 2F1BA 1GORA 1QW9A 2X2JA 4AZ5A 1PPIA 1C7TA 1V0LA 1E5NA 2VZOA 4JKMA 1UR0A 2XN0A 3FW6A 4TX8A 3SUSA 3WD0A 1JI2A 4IPNB 1PIGA 1FA2A 4PBGA 4Q22A 1OGSA 5A1AA 1CDGA 1ISXA 5A2AA 2CBVA 2W92A 4HMCA 5EFDA 1ESWA 3LRLA 3FHQA 4MDPA 3CTTA 3WDJA 4QDMA 5M03A 5BXRA 3LPPA 3O6AA 4JHOA 4TTGA 1E6QM 2VRJA 4JKLA 1VFFA 4P7OA 4HZ8A 3HZ3A 1L0PA 2XFFA 2ZUTA 1TQTA 3N17A 1V02E 1J10A 2DH3A 2WYSA 3NSNA 1E6NA 4ZE4A 1WB0A 4M80A 3CUIA 4BF7A 2XVNA 4BZYA 1GZJA 3PBGA 3AHVA 2X05A 4FNPA 2WMFA 2BHUA 4W84A 2D2OA 4H2CA 3IJ9A 4UQAA 1BYBA 2FGLA 2JE8A 1HNYA 2ZX8A 4NI3A 4QAWA 2WZHA 1OIMA 4RE2A 3A3HA 3GNRA 2BHYA 2XFRA 3HN3A 3EJTA 1HJQA 3UESA 4Z2IA 1HP5A 1MQQA 4JFTA 4QCEA 4NSBA 1OT2A 2EPNA 2YOCA 1KXHA 4FNTA 1ZBWA 1KBBA 3WDPP 4DUXA 3GDBA 4B3KA 5I24A 4F9JA 2YKKA 1Q6CA 3EDDA 5HPOA 4AD3A 1JIBA 1H5VA 2WWCA 3BAIA 2YDQA 2W66A 1QX1A 1NOUA 1RH9A 2WM0A 3SUTA 1ZS2A 6CGTA 1KWGA 4UR9A 1B1YA 5KZ6A 2WMGA 1HKKA 3NSMA 2X2IA 3DX3A 3AMKA 3GXDA 1V3HA 3PZTA 4P7NA 3SCUA 2XVLA 3W38A 1E4NA 1AQMA 3AMLA 3JUGA 1UD2A 2QLYA 1EHNA 5E09A 1CLVA 4M29A 3PZOA 5E0FA 1UUQA 2EBNA 4TVDA 3F4VA 1V03A 2VUYA 1WZLA 3CUGA 2F2HA 1GNXA 1U33A 4JFSA 1LQ0A 1WDSA 4YN5A 3DYOA 3TTQA 3AIWA 4HPGA 4HA4A 4ZXOA 3D51A 4QLLA 2YA2A 5LA2A 3OGRA 2EPMX 3K46A 3UG5A 1V6XA 2CETA 2J47A 4Z2GA 4MJ4A 1SMAA 4BCEA 4Z2HA 1HXJA 1WZKA 3UCQA 3L4UA 1YQ2A 2WHKA 2VTFA 3GTNA 1UA3A 1PS3A 1PJ9A 2DPEA 5EBAA 2EQDA 4XX6A 2V5CA 5CZKA 4GXPA 3S6TA 2A3AA 3BMVA 1H4PA 3I3DA 4J3SA 2ZXDA 2J74A 3AISA 5DT5A 3WMBA 1OGBA 3ZT7A 4AD2A 1GVYA 4DWSB 3ZJKA 3BCFA 1K6AA 1B3VA 1R86A 2VMFA 4PN2A 3K8KA 3SCRA 5CLWA 3RCNA 2ZXBA 3SUWA 2BV9A 4JHZA 2OYKA 2DSUA 1JZ5A 1HKJA 3WY2A 1BHGA 1JZ7A 1CGUA 2D0HA 1VEMA 4B16A 5AC4A 3SCQA 1WAWA 2GJXB 5GPRA 3S5ZA 3CO4A 3F5KA 4AIEA 1C93A 5CXPA 1KGUA 1BYCA 4HMDA 4PMXA 2DH2A 1UR4A 4K68A 2V5DA 3I3BA 2QMKA 1E6SM 1BAGA 1U30A 3AMGA 2YL9A 2PWEA 3GNOA 1OM0A 4DO5A 3EMZA 3WBAA 1C3FA 4PMNA 3WQ4A 1LLOA 3WF2A 1E5JA 3NSXA 3AZRA 3W81A 2D23A 1OGGA 4MNKA 2OSWA 3SCNA 3WIJA 2A3CA 3VIOA 4FLQA 7TAAA 4W85A 3ALGA 4D1JA 3BVVA 3GXNA 5LA0A 1UH3A 4NZCA 4PMOA 4CGTA 4V28A 4HZ6A 5A6AA 4JCMA 5A8MA 1HIZA 2QV4A 4AD0A 3MV01 2VO5A 3SCWA 3W0KA 1IZJA 4UQBA 2GJXA 2F8QA 1LF1A 3CBWA 5IHSA 1E6XM 5BCAA 3B8SA 5I77A 3FAWA 5D9PA 4AYGA 4DUWA 3WUEA 1JAEA 2J7HA 4JFVA 3W4RA 5HPCA 4CU6A 2XJ7A 2J8GA 3BVWA 4TUFA 5A69A 3WY3A 1B2YA 2BXZA 3WUBA 1UZ4A 2XTKA 1XYZA 3WY1A 1R33A 4AMXA 4MNLA 4AZCA 4OKDA 3BUBA 1WDRA 5C70A 1LL4A 4UZSA 3B9DA 2VC9A 4D6IA 1C8QA 3L4YA 3BH4A 4M1RA 4CCEA 2EXOA 2WXDM 3PZNA 4D6JA 2WBGA 4PTXA 1E6ZA 3MMUA 1GOQA 2YA0A 3O9NA 3RDKA 1JF5A 5HNNA 2BVTA 4ACZB 3W24A 1V0MA 4CN1A 2E9LA 2VURA 4JIEA 5M17A 1CXKA 3GBEA 2PI6A 1CGTA 2OYMA 5BXTA 3MS8A 1WZMA 1TQSA 2XWEA 5IFTA 1R34A 4H41A 3MUY1 4HOXA 2UY3A 1WE5A 1NARA 4YHGA 3DHUA 2YL5A 1FOBA 2GDVA 4P7QA 4ZE5A 4MJ2A 5I23A 3M07A 3K1DA 4ATWA 1LWJA 2WBKA 1CZ1A 1B3WA 2W62A 4CD6A 1CWYA 2J7BA 3W82A 1B3YA 1EDGA 4E8DA 3LPGA 5JBFA 2X0HA 5JIPA 1V3MA 3A4XA 4AZ7A 3EYPA 3WD3A 5EB8A 4UNIA 3B9EA 2WVTA 1V3IA 2O9TA
chains in the Genus database with same CATH superfamily
4P3DA 1ZWIA 1AHWC 3P0WA 3QHZH 3BCDA 4OV6F 4KROD 4GBXB 1R87A 1IHIA 2CKBB 1IGJA 1VPYA 3RWDA 2X6BA 1MUCA 2ZKMX 1OAZH 1YVLA 2FTAA 3M46A 4F9DA 3ZXWA 3QCVH 5KVEH 1R5YA 4AVKA 4D3CH 1E1EA 2W5FA 3EOOA 3SGKA 4ZAKC 1FJ1A 2ON3A 1SM3H 1IVLA 3O3RA 3ETTA 2AJVH 3VWKA 2YAQA 1W15A 2HKFH 3KL0A 4QG9A 4PJ6A 3B2XA 2RQ8A 3O3DA 4PJXF 2HKHH 1MRDL 3AJXA 1FVCA 3TA3B 3UWUA 1CDYA 3VDGA 1KM0A 1ZIAA 1EOMA 4HEPA 4MAUH 3IIVA 4FP1A 3MACH 4XNUL 1E4XH 3HPXA 2QJJA 1H3WM 1S5IH 4MHHG 3IU4L 1XIMA 5D8JL 4LSTH 1E43A 4MWAD 3ZSSA 2GIXA 2BIMA 1P0BA 4Q4PA 2ZT9C 3PGCB 5IOKA 3HGSA 1MDRA 1VENA 4V2XA 1F4AA 2VXSH 3PWIA 5DCCA 5G1YA 1NLDL 1ZEAL 3CT2A 3W7GA 4KTYA 2IEPA 3FQUB 3PPGA 3AXLA 4GQPH 4F7TA 2L8AA 5GS0D 1KRAC 3IRDA 4NXSA 1DO5A 4JFEB 1XH2A 1G6CA 1IQWL 1XWYA 3LIZA 3R43A 3GBLA 2C9SA 5DC4B 5E4EC 3V8CA 5ALBL 2QR6A 4AKPA 3VFUB 3X17A 5DMKB 4UILL 4X7CC 3UJFA 4NHUA 3CU2A 5FIPA 2JV6A 4MA8H 4Y19D 5ACLA 1VFSA 1I1AD 3M43A 1EDHA 4TOYL 3ZQWA 1ZHNB 1H1ZA 3F4WA 3OKLA 4KS0A 2PDQA 2ZADA 3MBEB 3SYPA 1ALDA 5CJ8A 1TZGL 4XBSA 2ZIDA 1ZBKA 3EO1B 3T2OA 4LVDA 4IMLA 4JVWA 4OLVL 4MNGB 5A6BD 3KXFD 4HZ7A 3HUJF 1J87A 4RGOL 5GRZA 3CZLA 3T2QA 4MD0A 3WUGA 3P6LA 3FIGA 5EU4A 2P5PA 3S3JA 3FO9B 5C0EA 4M7LL 4OLUH 4AEFA 3G1DA 4PJ8C 4PJXB 3D39A 3J27A 2VDKL 4LALA 2OMYA 1WAUA 1QP1A 1JPMA 3FJNA 3FH5A 5J3HC 4GYFA 4HOZA 1QW8A 3IDYB 1Z9AA 3BXNB 5EN2B 5F8RC 5I73B 3WNKA 5FKPA 1PTGA 2R69L 2IPFA 4WW2C 1KIPB 1A5OC 3POHA 1YMMA 1XCQB 2H3BA 1LO4H 2CU9A 3BQUA 4EI6B 3DI0A 2W07A 4XTDA 1I9RH 1E9ZB 1UP2A 1XLGA 3L3IB 4HNNA 4LEOB 5T1KD 2X4OA 1L6XA 2X1RA 4KKBD 2EDWA 1T2JA 2BIOA 1H19A 3Q1SH 4MMZC 1VHCA 1O6IA 2GAZA 2DTSA 3MO1B 3E0FA 4H00A 3B6SB 4FI6A 4PRWA 1VPQA 3TZVB 5DZOA 5M94B 1XCTB 3DFOA 4L1WA 3K8MA 1HSAB 5TQ0H 3H9SA 4U1SA 4O58L 3VX1A 2IANB 5HWJA 4LSDA 3VOHA 1TPWA 3BICA 3ROLA 3QUZD 4YE0A 2XY1A 2EAWA 3E0VA 4ZO6A 4GRWE 1DJGA 4DN1A 4LAJH 3APNA 1KV5A 3GSVA 4NPKA 2QPUA 3ATZA 4IRJB 2FGZA 1A1MA 1KR0A 5TGBB 1PS9A 3JV5A 3GDRA 2EYRA 1GYUA 2EDBA 2VWTA 3MVIA 5SV4A 1T5XA 4JANA 1JGMA 3U4KA 3B9VA 4KW2A 1CFQB 3SSJA 1IM9D 2IW0A 3HUJB 2FIKB 4JK0D 3B8DA 3I4KA 2MH4A 3U7YH 4FO4A 3S5YA 3HFYA 2P1YA 1XT5A 2DQGL 4GUPB 2VDNB 3EGSA 4GY0A 3W39B 2AZAA 1GEQA 5D4HA 2OKMA 1CNVA 4JG1L 4JZJB 3VWJD 1O95A 3LQMA 4AYBA 1VLXA 2ZJSL 3EAUA 4KZDH 4FTVA 2WV8A 3D3VA 3RDTA 3LQZB 1GHFL 1ZPLA 4L29B 4K5NA 2PKDA 2WXLA 3B8YA 3AQYA 1AAJA 1X8CA 1PLBA 2GQHA 4W9TA 2E9GA 3CL8A 2OMVB 1CB2A 3PXHA 3BRFA 3BUQA 3EHBD 3CC5A 4YCPA 1IEIA 1XB6A 2BVEA 3K4AA 4KFNA 1WT5A 4G1MB 5MENA 4KCVA 4KMTL 4BFKA 3QVQA 2X4PA 2VDMB 2R9HC 1QEXA 2X4TB 1TOXA 3SDXA 3UJEA 5D1ZB 3PG9A 4XXWA 1A9EA 3W11C 4U2ZA 2O9RA 5LXGL 2OPJA 2XIIA 4UFLA 4AVFA 1OGAA 2OT0A 4XHJD 3WLTA 1MF2H 1E6JH 1M3UA 1WFNA 1ZTXL 5SWQB 4EOWL 1L6WA 1P6FA 2PBOA 4QRSB 2R51A 4ZFCA 1SGKA 1WD9A 4WI6A 5CEYB 2YD2A 4TPRL 3N2JA 4QFUA 3MHGA 2DQTL 4KEMA 5MERA 3WJXA 1QRND 3QWQB 3OXSB 4LYKA 4A3YA 1J8HD 5DT7A 2GEQA 3OJDB 1SVCP 5C07E 4TUUA 4MNJA 2QDVA 3P84A 2VLKE 2VZTA 4JTSA 1H09A 1DPMA 3P0VH 2EICA 3QN3A 5E51A 1LD9A 1KM6A 4W6XB 1XLBA 2ICWB 2Z3FA 3DSNB 3LHPL 1J7VR 4P61A 1BPLB 3AIUA 2O6DA 1AOZA 1A5FH 4ELMB 3IJQA 3ULSB 3S48A 2FX9L 2Y70A 3ULUL 4GO9A 1E15A 1FWCC 3PFMA 5KSVA 3NTYA 1HT6A 2HTKC 2NYKA 3M5XA 4JTHA 1UWXK 4I6KA 4AH2B 3VILA 4OCWH 1RZIB 1AKJB 1HKLH 5DD1L 2WXRA 4HIXH 2CJUH 1ZA6B 2C7UB 2VCAA 4JY4B 3RRXA 5ECGA 5K1JA 4OIIL 4PIBA 4LS0A 3BH9A 1BJ1J 2QQLL 3GZOA 3O4LA 4PJCF 1KTBA 1AI1L 3LZNA 4I2XA 4HCRA 5DJ0B 2FX8H 1FPTL 2UZXB 4P5UA 2DZTA 1TNMA 1FLTX 4WO4C 1MHHB 3V36A 4ZQKB 3E0IA 4XZWA 3KYOA 3GWJA 4PTNA 2XVPA 1AXSB 5I1EH 3CFEA 25C8L 1Q9OB 4OBRA 5B3JF 2QKIC 2PDKA 2ZTKA 1V7YA 5BS0A 3VXNA 3O8XD 2AQQA 3NQBA 4Y1AE 4E4PA 1JDAA 4HJ0D 4GFSA 5KW9L 4YHKH 3ZDXB 3T0WA 4OU1A 5HI3C 4PCTA 4K9EH 1R47A 4FYSA 3EG9A 3IRZA 2R4SH 1FWAC 2ZSVA 3F03K 2WBJC 3U36A 1GVRA 4CNTA 5LG1A 1DL7L 1VRXA 4D8AA 1TYJA 3T6QC 5AC6A 2WPBA 3UH8A 4I89A 4HHHA 3MAWA 3M5ZA 2OGJA 4OI9A 5F1OB 1ZT4B 5FFOA 1KCRH 3WL0A 1UGKA 5HHOA 3CUFA 3QAZB 1LORA 1V0NA 3V4UL 4UB0L 3WNLA 4GIRA 3HI1A 4LB8A 3UGUA 4AZ8A 2UXGA 4UCFA 2XZ9A 4YHNB 2AJUH 3W25A 1G9MC 5HDWA 3VG9C 4DXKA 4YXHH 1N2VA 1USQA 1JR1A 2FQIA 1SJVA 1HJSA 3HG5A 3ZTEA 3VCNA 4I48B 5B1JC 1ZJAA 5BROA 4DKTA 3MJ7B 5LSMA 1GYWA 3TV3L 1LM8V 2GEEA 4PJCB 5E03A 3SEPA 3TYEA 2ZTJA 4YDZA 3U57A 3FDGA 3BVUA 4WU5A 4AENB 3P4NA 1FFNA 4A6YA 5AW6B 3WH9A 1PWLA 2BP0A 1KFWA 4NQSA 2HDJA 1T66C 2E77A 4GKZA 5HJYA 1E65A 1CLZH 2E27L 3ZVIA 4XT1C 4CD4A 5BWAA 2VJ0A 1IV8A 4C7FA 3MMWA 2XXMB 4D71A 1NLBL 5EU3B 2PWDA 5I71C 3VCCA 1YPZF 1EERB 2BLEA 3CXOA 2B4CH 2JKJA 3NIFF 2BGQA 3D50A 4HD5A 5D7EA 3VIPA 4YSUA 4PRDB 2GFTA 3F2CA 3MJ9A 2XH4A 5IB1A 3F7QA 1DBMH 2F7IA 1YC8A 5F71A 4HZLA 4Z8FL 2PWVA 2KDYA 3MXWL 3DKJA 5F8QC 5E2JA 5K9OA 2RHEA 1DQTA 1KCVH 4ESKA 4F7KA 1GR7A 1ZXQA 1DSFH 5K9XA 1PD6A 3OHXA 1J9SA 4MXQC 1XGYL 4FS0A 4U0RC 3T8XA 3P11H 3U6XS 4MASA 4JO2L 2Q02A 3TCXA 4KMLB 4KJYA 2EDEA 2WZ5A 5ESVA 5HGBB 2ORBL 4HNVA 3OLEA 1PY0A 3ZDZB 4E3TA 3H6OA 2O30A 4P7LA 1F4XH 2J25A 1KG0A 5KJ7E 5CGBA 4AMAA 2BVOA 5JTWA 3BZ4B 4JQXC 1OFOA 3QW3A 1A7PL 3NP4A 2XTSA 3FO2A 1FNSH 1SJBA 4Q6XA 2BWDA 1WITA 3U30B 4W4OA 1Q1JH 2F1AA 3S8GB 3RILA 3TH2T 5EWIH 3HMWH 1JULA 3IV3A 1X6LA 1TUFA 3VFPA 4S3DA 3S1WA 1M7IB 1AS7A 4H4IA 2A9BA 4QBXA 2OMNA 5D03A 2YWYA 3G1SA 4QHUB 1QOKA 5E8NA 4DEFA 3MFFA 2YPLD 2HVKB 1YPZB 3ZRCC 2DGAA 5ADOL 2CWXA 3INUH 3TO2B 3RNKB 4F7PA 1GZGA 3FULA 3LZRA 5DFTA 4L4VB 3E1F1 4WFFD 1VCVA 5FF6A 4ALAL 4P57A 4B4HA 2XPGA 1DBKL 2VM9A 2MOVA 3UZZA 4HA1A 5KN5B 3WGVB 4DJMA 2VVSA 1YW1A 4TYUA 2K4WA 3FU6A 4C56D 3P9LA 1L5GA 4GAYB 4X6CF 4LLDB 1BXUA 2J78A 2H9GA 1GMIA 5HVWA 4XPBH 1CD1B 2VC2B 2ZZUT 4N2YA 2YD0A 5JPMC 3K13A 4U1LB 2X6UA 2WLIB 1WKDA 4IBZA 4US6A 3P2TA 1MNZA 1T1WA 2C9AA 2ALDA 4ATLA 3VI3B 3CVHH 4BQ6A 3D2UD 1SJHB 3AT0A 1NTDA 1E5BA 3UOAB 4DF0A 5JOPE 3FRPG 1XPYA 4L3ED 6TAAA 3KWWB 2NNAB 4ZUSB 3HV9A 2R1YA 4JRYD 2HLAA 3C2YA 3H2EA 1JTOA 1KCLA 2Y36H 3MDUA 4IPLA 3MHZA 4K94C 3E6EA 1I2OA 4A2SA 4AIXA 1XTMA 5FB8B 3BV7A 4N9CA 4OV4A 1EO8H 1BD2D 3SKNB 3LQGA 4DJEA 4PJ7F 3LNMA 2DQEH 3MUZ1 1EC9A 3PPFA 5KSUA 2Z4GA 3THCA 1AHWB 1ITXA 3FCSB 1IILE 3SGJA 3OMIB 5TBOA 1W5QA 5EEYA 4Q6JA 4BINA 1O1ZA 1GGBL 2P80D 5FM8A 4QHKJ 4RLDA 4JGNA 1R7OA 1FHDA 1VH7A 3U9UB 2Y3NA 3GTTA 3S4SG 2XYBA 3BLPX 4YVPA 4RFEB 2GW5A 1JG9A 1ANUA 4ZAKB 5C0AA 1ISVA 3SY6A 3VX0A 3T4YB 1IX2A 5C6MA 3KRUA 1HH6B 4O4YL 4AV5A 4RV8A 3VYLA 4WW1B 4X6CB 3VO0A 4PRNA 1DVFA 1ORQA 3MBXH 1NSNL 1KELL 4EIZC 3ZOAA 3MU3A 2WBWB 3HIJA 3TA3D 1ZANL 4Z7VF 3RR4A 4IQJA 3P02A 3AXIA 3H7RA 4YDMA 2CU0A 1REQA 3NABL 4DP6X 2HJKA 2C4XA 1W2KT 3SRDA 5K3VA 4KXCA 1TVBB 1U9KA 3QEGL 3S35H 1X97A 4Q9QH 1G69A 4QRRE 4AQ8A 3TC6A 2R0KL 3FB6A 4CQ9A 4ZPVA 4GKOA 5A6TC 3UACA 1OQFA 2GSHA 5ERWA 1BA9A 4QTFA 1SUJA 2XUWA 4HZ8A 1L0PA 2UUDK 1V02E 4OZFH 3ESPA 3M7OA 5IQ7L 4PBWD 1WB0A 1L6SA 1N5AA 1XXXA 5BVPL 2VLRA 5JUEH 3N06B 3PWPA 4AYFA 2X0WA 1OVZA 3KPOA 2X88A 3RY6C 1NAML 3KRZA 3FVDA 2H0EA 2NQDA 4XVJH 4OV9A 2QUTA 5E4EB 3OV6A 3NFSL 4MKNA 4PJ7B 5TK4A 4B9IA 4QCEA 3MLSH 2ICWJ 2WLMA 4M8QA 1JCYA 4PY7A 4ELKA 3U4BH 2WWCA 3MNWA 1NPUA 5LLIC 3UGRA 2RA1A 5F96L 3GFUA 1TJMA 3P0XA 5F88A 3W1RA 2WMGA 3MBED 3AMKA 2ANUA 4MWFB 1OFRA 3UL4A 1A5BA 3MLZL 5DJ2A 2WXHA 4Z7WB 2WQWA 1QQDB 3BW9B 1NQBA 3PQYA 4DAIA 1HHIB 3M0VA 2AEQL 4Y9GA 1U0QA 3MFGB 4ZR8A 1YBQA 4NO5A 1QPRA 4LLMB 1RPQA 4PJ8B 5CZKA 4APQA 4OD3H 5D72H 4Z7VB 3F65A 3D47A 2Z93B 5C0CB 4JO8A 3MRFB 2BV9A 2A3LA 4WW2B 4S2SA 3FDKA 3RLUA 1H50A 4XH2B 3MWCA 4WWPA 4PMXA 2QHLA 1ONEA 3QJXA 1RQBA 4BFEA 3QJRB 1EHLH 5F89B 3L3JA 3NSXA 2PTTB 4MMZB 1OGGA 5GHWL 4KBXA 4QJ5B 3RPDA 2AEPL 3T8LA 3VIOA 2DLHA 4PB9L 5FHAL 2YXXA 2E6JA 4FFVD 4RZKA 2QV4A 3NJVA 2VO5A 3INPA 5FYLL 4UQBA 2WXMA 2QQNH 5A2JH 1FWTA 1KFCA 3TUUA 4RLIA 1UWGL 4JPKL 3TF4A 1ADOA 4K7PX 3R0UA 4GSRA 1QMLA 4BSWA 1UWXH 1IT9H 5IESH 4IRJD 3B9DA 2E7MA 1C8QA 2VDQL 1DQML 5DMMA 2YPIA 5T5FL 1TEYA 2MNJB 1GZHC 4JQIA 1UOLA 3RHWF 3U46A 4J9JA 2A85A 3UTPD 4FERA 4RISL 4RMSA 4PWFA 3R25A 4XP4H 1JPDX 1PNDA 4GQZA 3WFBH 2FD6L 4O1FA 2F8OA 5J6SA 5F3FA 2AV7B 5BOZG 1O5QA 1PGRB 1XL4A 1U36A 1N5YL 4BWLC 1FTXA 3IEAA 1OEPA 2YC1B 2NNFA 4NT6B 3W29A 3FQ2A 5D7LB 5DJAA 4PRIA 3GMMB 3UMTA 3VXTA 2ZTBA 2X1OA 4AD4A 3IBOA 4LAMA 4BJLA 2R7EA 3QIWC 1UURA 2JALA 4W4QA 1G9ML 4O50A 4HUVA 1JHKH 2NQ9A 1VFBB 2XYLA 3G1YA 5K5YA 3RE0A 5D1XE 1FNEA 4GMSH 4U2YA 1X7QB 4TVPE 5HHXH 1GZPB 1WJ3A 3P93A 2XIMA 1JK8B 5JYLA 1ELSA 1O9WA 2IGTA 4JG0L 2PU0A 3U0WL 5KYXA 4K7YA 3VNJA 4P3CL 1FVEB 1M6OA 2XKNB 3VA2C 3WL1A 1VPOH 2X1XR 4GRWF 4P8WA 3V4LA 5C09D 4YDIH 1D6EB 1NANH 1M2VB 3N1GC 3I9GL 4FABL 3NJXA 4WFGE 1LEKB 2WGXA 4XOEA 1BEYL 4DVRH 3JZ7A 4Z0SA 5AD0A 1Z9LA 3HE6C 4JFZL 2CCVA 1T80A 3G5WA 1G9HA 4OLYH 2NR6C 3MRKA 3EZ8A 4FX6M 3ATFA 3BLEA 4AXWB 3PIQA 5BOOA 5KSBB 3P8JA 4X6BB 3F7YB 1ZK9A 5I8KL 4LKCA 4BCYA 4F5CE 1YECL 3HU7A 5CS7A 4UT9L 4F57H 4B5EA 2DQIH 2LU4A 2FPVA 2BOBB 3IU3B 3QJHA 5C54A 1AKJD 4WK9A 4CUCA 1RPKA 4GXUN 2VDLL 7XIMA 4W9KC 2OS7A 3AS2A 3MV7E 2VSCA 4B9KC 2PR4H 3LI0A 1NDGA 4JZNB 1E9LA 3W85A 4CKVX 2AAVA 3ZW3A 4GG6A 4LLVA 3MP3A 3E2HC 1W72A 3L0NA 5EU9A 2QSQA 4WO4B 1G7MB 1U83A 4IFOA 3UTZA 4F2MA 1QKZL 1AZ2A 3N73A 5JXAH 1NCNA 2FJKA 1GGIH 4JVUA 3PN8A 2V5KA 5J8OA 3NQ8A 5CIPB 1J18A 4YSQA 1A0DA 2CZ5A 1MUMA 3KYMA 4U1MA 4W9FC 1WSST 3SQMA 1CLCA 5TF1L 4CNOA 2C0AA 3VOFA 1JK9B 2XM2A 5FO9A 3K2MC 3DHDA 4QRPA 2WBJB 3EXSA 3VYPA 1NP2A 4F91B 4M3KB 4S0SD 3F00A 1ZIBA 3C61A 5CO1A 5EZPA 4DGVL 3S88L 5EO0A 1SFJA 1T1YB 1XGQB 2ZXCA 4ACYA 3XINA 1TZ9A 3OPSA 3MRBA 2H6PB 4PJBF 2G37A 3AU6A 2YDRA 1OGPA 1G7LA 1FCGA 5AVQB 1UXLA 4DI8A 1TO4A 1JRCA 3W2DH 3HR5A 2VERN 3WJSA 3E38A 3BWAA 2YD1A 4O51A 1GGUA 4J1UB 3MHFA 4NRYB 4HKBA 3OPZH 4O2FB 1SXNA 4XN5A 1UZ6F 2GJNA 3H9YA 2R23B 5I30H 3MV11 3U3HA 3VG9B 3BDKA 4F58H 1E5CA 3ZT5A 5AYQA 1F0LA 1G6RA 1P4UA 3QZLA 4NZ4A 2O93L 2XWJB 3AZSA 3IKKA 5I1GH 1IAII 3VKJA 3B3IA 1Z7AA 2G95A 4JEJA 1FBIH 2AGKA 3P4OA 3BC9A 1HAUA 1BAFL 1BKHA 5HYJE 5EC1A 4HUKB 4PRHE 5AN7A 3UXDA 4W9IC 4K94L 5D1ZC 4WWKC 2J9ZA 2QUVA 4GEIA 3CEUA 4L5FE 4B3LA 5CGTA 5I71B 3BJSA 3C87A 2XV3A 5FOOA 5J4MA 2X6VA 4BI7A 3IFNH 2DLFH 1VBGA 3S97C 1RJZA 5D38A 1EJ8A 4JJ5B 1N6QH 1HZHH 4ZXLA 4O2CB 3K6SB 3LTSA 3ABLB 1MHPL 3BG9A 2G4FA 5D9MA 4HCFA 5CAHA 2CBIA 4Z5RA 1WICA 3KPNA 5HD8D 2J20A 1YPFA 3HKZA 4Z7AA 1DJNA 4GW1B 4AC1X 3K6FA 3ULUD 5AC5A 4RH4A 5ACMA 4MB1A 2H2SC 2EDMA 1N12A 2DQDH 1R3IH 3WFCL 5T3XD 4PODA 3FHEA 2R15A 3NFPB 4J2PA 4AV4A 5JW5B 4JDTH 3HPLA 1JGVL 2BVQB 4U0RB 2GIYA 3BKYH 2M8XA 5HYFA 3ESNA 1J5IA 4MB3A 2INEA 3WEAA 4D8PB 1R3JB 1ITBB 1IEWA 1LTDA 5GGRB 4KNQA 1EGZA 1XUUA 1AFVH 4N5UA 1YYML 3WEMA 3TE9A 3V6ZB 3MUJA 4Y5VC 4BK8A 2VR7A 4PR5A 3M0ZA 3FYIB 4PJDE 5ENWB 1A3QA 1Z41A 3R8HA 4ZCWA 4RRPM 3VI4B 4MLSA 1IAKB 2YK1H 3VIKA 1HYSC 2VEKA 3NQEA 5F6HJ 4D72A 4FKHA 1UACL 2X3CA 4JKWA 1ZXKA 3OLGA 1EQWA 2DU2A 5T1DL 4XKMA 5TNVA 3M8OL 5TFSL 1VADB 3CWOX 3TROA 2W59A 1J8VA 2A77L 1H61A 5B80A 1BM3L 1DJSA 5U4NA 4PRAB 1XF2B 3GFXA 4G3YH 2R8WA 5ANME 4JY5L 4LYRA 1OF2A 1VJSA 4QGCA 3N55A 1WUFA 1EZVX 3STZA 1NFIA 3KW3A 3UJJL 5A43C 3B40A 1RJLA 4PLJC 1FZMA 4M7LT 3L3GA 5G5IA 3H0TB 1KFLA 4LVGA 1PZCA 1LMIA 5JHLH 4XP6L 4E9TA 2PYFB 5I06A 2NX9A 4HLZH 4KTEH 4L9XA 4PRPB 3JTTB 3WBYA 1RZQA 3RIKA 3AU2A 2APXA 4UWQB 3MRCA 3TYFB 1HL2A 5J12C 1HXMA 3W7CA 3S4SB 2WN2A 4GQBA 1RVFH 5DF0A 4YGVA 3I84A 4ZUUB 3RWHB 3R12A 3NRPA 1F00I 1F4HA 5LNSA 2J24A 2ENQA 4JGJA 3NTCH 4E42A 4ZMOA 4XX1E 1LQBC 1BIIA 4O11A 1S7XB 4CNIA 4ZRGA 3ZKNC 4D0BA 3GU1A 4N3UA 3GJFK 2YCLB 4QXGL 5B3SB 3LNDA 5EF2A 3QF0A 1PYWB 5AW7B 5J57B 4OLZL 2X4RB 1Q94B 3JV4A 4LCCC 3T6CA 3BAWA 4LPWA 2BM3A 2YLKA 4M1BA 2HSAA 4P8UA 4X4XB 4MIMA 4IX0A 3HOGA 5JNYB 4JDZA 3TASA 5EF0A 3D0VA 2Z0IA 1FRGL 2GC4C 2BNJA 4CQAA 1J8KA 3U48A 5TQ2L 2A2IA 3OSVA 4N1HB 1GYNA 4RNRB 3WTUA 5D4IA 1PD0A 3DTXA 4OZ4B 1LO5B 2VM3A 1OAUH 3G5ZA 4HGMA 2CLRA 1YO4A 1B4TA 1UUOA 1IVTA 4AI7A 4LS1A 4ZMYA 1CURA 2DQFA 4OF5A 3TLQA 4HJJL 1Y65A 3V4PL 1XIGA 3D9AH 4XX5A 5DHXB 3U25A 1VZIA 4D6HA 4AGQA 3BFWA 1I45A 1UCTA 2R6OA 3MA8A 2VC5A 3H55A 4YK4C 1OSPH 5T1LA 3NQKA 1E5UI 4ZAKD 2OL3H 4GQQA 2VEIA 2WVUA 1F90L 4R8WH 3N0AA 4S1QH 2DVUA 2CKBL 2EKCA 3EH5B 4DZBB 3T6XA 1RSCA 1EJWC 1V7AA 1PFOA 5FSEC 1FZJA 1G7PB 3E9AA 1NGYA 3EH2A 4OF0A 3LVEA 1PBGA 5CPLA 2X3BA 2AAAA 4ERIA 3MTXA 4F33A 3OVGA 2GSGB 4ZO9A 5CGYC 1G0XA 4XBGB 1Z32X 1DJXA 1L8PA 3EO9H 3QXWA 3EB4A 4P46A 1ACXA 3SJNA 2J88H 2DQWA 3GLDA 3CDZB 3DJ9A 3SE3C 4MDIB 7ODCA 4XCNB 4HS3B 2IXUA 2HVMA 2P5EE 3ZS4A 4ZZKA 2AK1L 1FFOB 3TTSA 4JPVL 3AAZB 1OOWA 1RUML 1IZKA 4OLWL 3RL2B 2C1HA 2A7BA 5FOBA 5HJXA 4HNTA 5GGSY 4LLYB 1Q85A 2K45A 4LFYA 1U3NA 3WH6A 4RV3A 1S7QA 1I9CB 3C3UA 3RFZA 2XM1A 3Q45A 1YNKH 3FQWA 3P0YL 5DC2A 1CFNA 2VMEA 3KR3H 3AZUA 1XZWA 3DGGA 3MRNB 4P5MA 3Q67A 4O1AA 2OX5B 1KNOB 3UD6A 4AQEB 1BECA 2BNQB 5C2BH 6PCYA 2OTWA 4F0RA 4NAEB 3HTWA 3GBML 2NX5E 5DRXB 1IGWA 1RZGB 3C60C 2CIIA 4NPYB 4LCIH 1NY1A 1S7VA 1NM4A 3CHXA 3GSRA 2Y8UA 3M9YA 3TJ4A 1K6WA 2GJRA 3BVTA 2OELA 4C6PA 4AZCB 4LU5H 1FVDA 4LUTB 3DOSB 2APBA 5FYJH 2QADC 4KVNL 4Q4MA 4QIUA 2HVOA 1D5BA 2Y61A 2PLKA 4NX0A 2W4XA 4UI2A 1XBDA 4CD5A 3UF9A 1SEBB 3S6CA 4ADIA 4HCLA 3P4MB 4U1HA 4WDIB 4XOBA 5MEQA 1F8MA 1G7IB 3GYEA 4LEQA 1S9YA 5C0CD 1H11A 1EEUA 4AEHL 2YFNA 4MD5A 3CDGA 2N0KA 4JTFA 1U21A 5FCUH 3WSUA 2VGIA 1XH3A 5E0CA 5HR7A 3UBXI 4S38A 3A24A 3HPJA 2I9LB 2XXCB 5BZDA 2CKSA 4BF9A 4LASH 1UG6A 5KZDA 2X6MA 1OWRM 4JO3L 4UTAH 1GUVA 4RGNE 3SY1A 1IGMH 4N2LA 4AGPA 1WNOA 3NJNA 4PTWA 1OP3K 3TWAA 4JKPH 2P88A 4AIBA 3QDMA 3ZK0A 4MQXC 2A6KA 1INDH 4R4FH 3V9FA 1VYPX 3SGEH 1NOFA 1QPKA 43CAA 1TREA 5ICYB 4KK5C 1UXWB 2TAAA 3G9AB 4XBMA 1JZDC 1TUXA 2XWBB 3ZTCC 4ZENA 1E27A 1R3WA 1YNLL 3UTSA 1EEZB 4ODTH 3FY1A 1K9EA 2L5HA 2PMQA 1I7TA 3HW7A 2AJ3A 4JFFB 3QXBA 1NFDA 2XLLA 2FDBP 4Y8EA 3RPBA 3PWLA 5AKSA 3NCBB 3NDZE 2VR4A 1KLGA 3DX7A 4PJIB 4RDQG 1OHZA 2QCFA 1VCAA 1DJYA 3UC0L 5B38B 3LXUX 2CPCA 1RBAA 1PSKL 2VE6A 4LSRH 3N11A 4RAVA 5JO5A 2MCMA 5IVOA 1G84A 4JYDA 4EVNB 4DZ5A 3NL5A 3QRGL 3GE7A 1O12A 2EUZA 4DO7A 3PWAA 4L6DA 3X13A 1Y8BA 5DYOA 3TZNA 5IMOB 3K2UL 5IUSA 2Y1HA 3NZGA 2WQRA 2VDNL 4FX7A 2Z1PA 3FONA 1JWMB 2PCYA 1SY6H 2J55A 2WAQA 4ZS7L 4RIRB 1SO5A 4HSHA 1B90A 4DETA 3VFOB 4OCRH 2JFCA 4GVGA 3QIWB 1TZIA 4KX9A 4F0SA 5I1AB 4IBTA 4RWHA 3OBKA 4H04A 5J5RA 2A7PA 1KZYA 3P3SA 5BJTA 1BZOA 4FHKA 1EQCA 2YDSA 1EDQA 3VW3L 3B0UX 5FA5A 5F9WC 4O17A 2C6QA 5FACA 1XBYA 3VH8B 2D7TH 4L4TB 4NLAA 1IUZA 2I60H 1UFGA 1TJPA 4IBUA 4XMKH 3D69A 4IRSD 3DUHA 2M2DA 3WSQH 1ZV2A 3TFKC 2HSIA 3KJ6L 2EXTA 2NTFA 2VDML 1LUCA 3RUBL 5FSDC 2C3WA 2HFFB 4P9HC 3WIIL 1ZT7B 4HDIA 1I9IL 5K9QG 1E5NA 4PTDA 2IQDA 2E5BA 3SUSA 4G6MH 4Y8FA 4HMCA 3HE6B 2Y72A 3V75A 4A7GA 2ZNXA 2VRJA 4HBQA 3U2OA 4IFRA 2XFFA 4XWOD 2UX7A 1MI3A 4DWDA 1I9EA 1BKSA 3IF1B 5CJNA 2QV5A 3AHVA 4W84A 2AL1A 1CLKA 1OIMA 3A3HA 1F5ZA 1KPUA 3TQKA 1QDSA 1HJQA 5JQ6H 4NIRA 1MQQA 4ZGYA 3CDFA 1KBBA 5HMSA 3B03A 3VVVA 2NUTB 4OHQA 3G5YA 2GGGA 3T2NL 4XBEL 1G5GA 1KWGA 2W9EL 5FYLD 1KTDB 5E6IA 5KANG 4L2LA 3RJOA 4PP1D 4MLIA 3E2HB 1UMLA 1CT8B 4WO4D 2QDGA 2Q86B 4WEEA 1U92A 4H0GA 1JF1A 3LKRB 2YD8A 4P2QB 2GBUA 3KPMA 1ORSB 4JS3A 1QNVA 2PXYA 4XX6A 5CUSL 1XGPA 2JVUA 5JOFB 2CLKA 1CG9A 1IBHA 3KBHE 4U0QB 3H2AA 5HI3D 2L4OA 2G5BB 5TH2B 2A6IA 1P5VB 1D2PA 3HRZA 3TQPA 1GGCH 1BFVH 1YEKH 1P2CB 5E0KA 1YMHB 5EUKB 2XKUA 4WK4B 3MUHL 2VAJA 3K7UA 2GQ9A 3CO4A 2E7DA 4FI8A 2PABA 1C1EL 3NJLA 3FCPA 1JTTA 3BPNC 1H9DA 4DO5A 3EMZA 4NQ1A 3MLVH 2BGNE 4PMNA 3R1GL 2ZE3A 2FATH 4JHWH 4LCWB 3EX6A 1FX6A 2P24A 2I5YL 2P7TB 5KUKA 1Y6NR 3W0KA 4W9CC 2YEZB 1D8WA 4AW4A 5FLVA 4K3EH 3IMBA 4AEIL 4NKOB 1XF3A 5IB5B 3EYOB 3MOAL 4OQ1A 4GT0A 4QD2E 4YDNA 2H1PH 1VKFA 4YEFA 1NGQH 4BFGA 1L0QA 3BG5A 4Y4KA 2AL2B 1JEZA 1C9WA 1GW6A 2YZ5A 1GC1C 4KHTH 4OQTA 1LL4A 2BVUA 4FHBD 4JMNA 1IIHA 4BHUA 5B1BB 3B2DC 3ZDYE 4YS1A 3BFQG 1OE1A 4M02A 1WDAA 4QRUB 3QBUA 4X4ZA 3TFBA 3OAYH 1MI5A 5EMMA 3LM3A 3MLWH 2PI6A 3N42F 5GSVB 2IAAC 4GFXA 1PSCA 1CFMA 4P4KC 3UZVB 4C6KA 4KRMB 4WWKB 4JPWL 1HINL 2FNWA 1IRAY 2IWGA 2XISA 3NPXA 4BKTC 2CZFA 4FJZA 3QARA 5KUMA 4NNAA 1B3WA 2OXHB 3BN3B 3EX1A 4E8DA 3LPGA 2X0HA 1UJ3C 5F7DB 1V3MA 2WXNA 2X4NB 4FIQA 5EYWA 3D18B 3GJFH 2ZG2A 1JNLL 2ZVRA 4GUIA 4U6HA 3ARUA 3DECA 2IADA 3O2VH 2C3ZA 4DY1A 4LSVH 4M56A 4MMWA 4RMBA 3VFWA 1TXKA 1TMQA 5I66B 4GO8A 5LAPA 2V63A 3SN4A 2FH8A 5AZ0A 5I6LA 2DEXX 4P0DA 4JDVB 4EI5C 3DIFA 4NRXA 2JGYA 3GNDA 3SE9H 2V4LA 3J8F7 4WV1A 2VW6A 3O45A 4H8UA 1YKWA 1KEML 3PDOB 2FJGA 2IXQB 2IC2A 1AIFA 3HFML 4ZMXA 3PWUA 4QO1B 3LSCA 1BVNP 2EILB 3BZDA 4JG5A 1FCVA 3L54A 2WKGA 1MFCH 3W28A 4RAHA 2ESVA 2YXOA 1SR9A 1WCQA 3V0WH 1WDPA 2WLJA 1A47A 5JHMA 5T3XL 3KD4A 4Y5VB 6TIMA 3BCJA 5JQIB 3MXVL 2EGZA 1MHCB 3E3QE 3PF3A 3T40A 4F79A 2IKGA 4RAUA 4L9YA 5TDNB 1DXEA 2NV1A 4IPIA 4AH7A 2QCHA 12E8L 4M7JH 1FG2A 4M3PA 2OLAA 3O6FA 2NY5C 2V5TA 2I7SA 2ALWA 3WKYA 1KQZA 4HC1H 4E41A 3OMAB 1ICSA 3AHYA 2F15A 1KDIA 2YPVA 3N42B 2J1XA 3BKJH 1XYFA 5DRNB 3RA7H 5HQMA 1LM1A 3IGAA 4FA6A 1C8YA 2GJJA 4HHMA 4MSWA 1HVQA 2MHAB 2Q1EA 4BE6A 4UQDA 3VGBA 1KGCE 5K9KA 5KVEE 2AGJH 5T8IA 3KPSA 2EIZB 3PG8A 4TV5A 3RM9A 3CGTA 1DQIA 5DLMH 3BURA 4NQEE 3WLBA 4DPCX 3VXSA 2HVBA 4WKXA 3AACA 1TPEA 3QSKB 3VRJA 1O6SB 2GSIB 2WC4A 5D30A 3DV4A 5D4YA 3VKCA 4PRPD 2R2BB 3BEWA 2IH1A 2FB4H 3DBSA 1YY9D 4Y16A 4LUJA 4K6AA 2RH9A 1SFDA 4OIFA 3U0TB 3W6MA 5J12B 1IXPA 4N3TA 4XIMA 3DKHA 4N2IA 5E56A 2PW1A 1DANU 2HJFA 1T7YA 4DFIA 5D32A 2VFIA 4LFHD 1YN7A 3DOPA 5ABEA 2W65A 2YD4A 1XGDA 1MWAA 2DWEB 4M3JA 2VC2L 4LOUC 4LGRB 1UXSB 5IR1A 2Z91B 4PYSA 4HUUA 3OJVC 3NCFB 4WEVX 4JFQA 2IPUG 4MZRA 4HFWA 1QFWL 4NZTH 2WHMA 4LCCB 4DZAA 4JE0A 2RDXA 1FN4A 5DEFB 4E4FA 1SXZA 5A6LA 1E4MM 5GGUA 9XIAA 1DBJH 3WUZA 4B9CA 2P42B 4OUIA 1V5XA 1M3IA 3MC5A 4WGWB 1NBZA 4L1TA 5HJ3A 1VKXA 4P5SA 3O2WL 4Z7UA 4NZJA 2EINB 2GBTA 3BV4A 3TCLA 2PGWA 2J2ZA 4LAQL 3AU1A 1FYTD 3ILEA 1BF5A 2O26U 1N6UA 4PCYA 1J5TA 4HK5A 1GWJA 4J2QA 1PKQE 3C5JA 4YK4B 4LT7A 4NJAH 5LUMA 4CQBA 2BGSA 1DVTA 3MSRA 4C4BA 3ELFA 5TE6H 1XHGA 1KM2A 2E7BA 3NJHA 3KJ4C 1NIDA 1ZVSA 1H15A 4JDEB 2OQHA 2EYTB 4D8LA 1B3IA 2OSXA 1T22B 4LX4A 4FMVA 5H94B 4FZEL 1JPSH 4G9DA 4BRVA 1NOAA 1N55A 3D06A 2ZCZA 4DEUA 3QIBC 4K36A 2P5WA 4ZW7A 2X7VA 4H0LC 4Q2ZA 1VHPA 2V3GA 1CLOL 3I6LE 4RDQF 4Z77B 3B0YA 3HS0A 2OO0A 1A6AA 2NY1D 3MROB 2XVKA 4DOHE 35C8L 4JFDD 4FZ8H 1Z2KA 3SGDH 4P8XA 2HX9A 1Q45A 5CCGE 1I3UA 1IL1A 2W3ZA 3VE0B 1DBAH 3ARQA 4Q52A 4FX5A 3E8UH 4TU1A 2VQ1A 4FEIA 3N3TA 3W9EB 1Z44A 3UA4A 3THUA 1NWSA 1G1CA 1TU2B 3W0WE 4KCWA 5BXSA 3MRPB 1OPGH 2RDTA 4HYVA 2WCGA 1AGCB 2BNQD 2FGWH 1JHTB 3G6MA 1Q9LB 3AY4A 3C60B 4EACA 3RPIB 5AHMA 4PQXA 5IEHA 5KS9E 2EDXA 2YUVA 4LOVA 3BZGA 3TJXA 2CGRL 3LN4A 1R8LA 3NACL 4H25B 2CHOA 3H42L 3NIFB 1R5WA 1R0AH 1MEIA 2QADB 2JEPA 3P3RA 4DGWC 3OLDA 1QSEE 2P53A 3EOUA 3MVSA 4XODA 1DLFH 4P9HL 1R3LB 2ZP9A 2FX7L 4FF5A 3CAQA 1ZK5A 2RGMA 4I4WA 3HOJA 1JPFB 4BZ1L 3B9AA 1CTMA 3BXWA 3FOKA 5E00A 2Z92A 5FM5O 3KBMA 2PTYA 3GMQA 2J7LA 1CEOA 4JX5A 3C9NB 3HZVB 3TBWA 1THAA 1E0UA 4LOCA 4TQHA 1YYCA 4YN3A 1ML1A 4L4LA 5LAXA 3KLQA 4R7XA 1DDHB 5BPPA 5LCVL 5KJRL 3LGGA 5E9DB 1LNUB 4PS4L 1KCWA 3WIAA 3BZEA 4GSQA 4WRHA 4P5TC 3MDWA 3AT8A 3QUYC 3B8UA 1G7QB 5EORL 2XQYA 1VJZA 4XQ6A 3MCKA 4K5PA 3IPFA 1B0GA 4JFHE 4ZXBC 5I1KL 2X4QB 5I6PA 3LLFA 3VGDA 1MAMH 4IG2A 3GMNB 1ZLVK 4GBXD 4XD5A 3DFQA 5CINL 1P0KA 5CPTA 2NQCA 4JFFD 1RULH 3KP0A 4R27A 3GW3A 5GQBA 4BZ2H 3MN8A 1DQLH 4U5IA 2B8OT 2Y7NA 1F4WL 1NC4A 2F58L 2B14A 5E1AA 3WEZA 4NQXA 3OHMB 3S7GA 2ZOWA 3LYEA 3PNWA 3BP6A 5FW8A 3OG2A 2CLLA 2WV3A 1W0YT 1AD9A 4XNZC 1ADQA 1WAAA 3IKCB 1KBGL 2I1OA 5C2XA 1ZPTA 3LMYA 3UDWA 3FTZA 1XD0A 4JPIB 5FDWA 4WKAA 1ASPA 2VLLA 2YQGA 5EEXA 4HK0B 2I25N 3W7NA 3C0SA 3SPHA 3V2AR 1BJMA 4L4MA 2NY7H 1TEFA 2XIBA 5AAWC 5IMMA 3OHIA 4B91A 1JMXA 3DHJA 3KLLA 3QWNA 4G6JH 3R79A 1U4FA 4GQ9L 5H8MA 4PWGA 4GZJA 4YXKH 1MUWA 3ARRA 3HMXA 3QCUL 4JFED 2J7DA 4PW4A 1UEMA 1FE8H 4ODUB 3IACA 4NJ9H 5F9WB 2D31B 3IDMA 3LV3B 1OARL 2AQSA 3CIAA 4PLNC 4ML4A 3FNKA 1MEXH 3Q13A 3UU0A 3NCEB 4ZUWB 4I3RH 5IV2A 3NJ3A 4TX6A 3EOBB 1CENA 5AHEA 3ZJ6A 4KVPA 5A2IH 3GPEA 3HGOA 4HZMA 3K3QA 1BGGA 1KIRA 2MANA 3SCMC 4ENLA 4OLXH 3MMDA 2DMHA 1OXYA 1VEOA 3MOQA 2EKJA 1J8RA 1CDJA 4EVZA 2B77A 3T77A 2ZRVA 4KCUA 4M6OH 1KJMB 1J48A 3DXAA 2FH6A 2QR0A 4S3JA 2DV6A 1EJTC 1YEEH 2GITA 3WDHA 4L8SA 4XOCA 4MAVA 3VOCA 3PTDA 1U58A 4QSFA 4NKMA 1KW1A 3QEZA 4D0DA 1MRCL 4PJ5B 1I2NA 2VLJB 4TNGA 5F70A 4B5TA 3HC0B 4CRPA 4JAWA 4PYGA 2WUBL 3IJ7A 1HJUA 1KC5H 1Z1WA 4RZ5A 2GGIA 2V82A 1BVKA 3H4XA 3GHSA 3C75A 2DZBA 2LLNA 4FXGA 2BNRB 1N59A 4CADB 4PUBH 3QOMA 1ZD6A 2W0LA 1PAZA 4H44C 3BOLA 3T09A 3VXUB 3L1EA 3Q3GA 1UATA 4Y4FA 3D0LB 1IIKA 2JB6B 1XR9A 4WLCA 3TZVD 5JHDE 3UTOA 3RNQB 3IN2A 4N0YL 4I0CC 4P2QD 4Y1TA 5FGCB 4HXAH 3K4DA 2IAND 3V4BA 1IGTA 2QAFA 4R26L 2QVMA 4Z1AA 1HQ4B 2VITA 4H2AA 5DO2D 1R3KA 4URIA 1ZJBA 2WXOA 3O05A 4Q32A 4FFYL 3KEHA 1YNTF 4JM0A 3BUVA 1I0DA 1DVJA 2KLRA 4NQVB 1SZEA 4XMLH 1NL0L 4L7ZA 4DAGL 5JMOC 1YDPB 4S1DC 4XN4A 3FOMA 1SXCA 3ZJAA 4E2VA 4L8DB 1N3NB 3BPNB 5CJBA 2FYYB 3GHEH 2C7FA 5J56B 3FCTB 1MFEL 3WD1A 2Y5TB 5LGHL 3GXMA 1AL7A 2FFIA 3TH4T 4ATDA 5E2UL 4LCWD 3CX5J 1PTDA 5AB3A 4PZVA 4Y88A 3VMNA 2OBGA 3N40F 1PNCA 3UEQA 1RCQA 1HJWA 2WQVA 4B50A 2DWYA 1F41A 2ZYHA 1TO3A 3BUPA 3WELA 1QVOB 3PTQA 8RUCA 1A4JA 1GW9A 2C1GA 3B7RL 4W7UA 4DLFA 1YEGL 5HYQB 1MFAL 3D52A 3GVGA 3LCYA 2EZ0D 1RZ8B 1I1XA 4HIIA 3DG6A 3OW1A 1SDDA 1AZVA 1W1PA 1WKYA 4AXKA 3VD0A 1LP9E 5BWFA 2VNCA 3W2UA 1F18A 1I1YA 4MWAA 2XRAH 3F62A 4G5ZH 4F37K 5CLTA 2PP0A 2J8UA 1RQHA 4CBPA 5D7SH 3JR2A 2X1QA 4KXAA 4P4KB 4CVUA 2V9QA 3N14A 5D1ZD 4WWKD 3R7MA 4KEZA 4NZUH 4XBPB 2WYHA 4KRLB 1GPFA 1RK0B 2XSAA 3S5OA 3LKNB 4GG9A 1S2CA 2D3LA 3E02A 1F58L 4M43L 4IU3A 1UJ3B 4GI4A 5DR5L 2OYLA 4NYYA 4QLRA 2VMCA 4A7TA 3H23A 1T99A 2ZVIA 4YFLF 4WD0A 4WDUA 2IKHA 3MO4A 1OBAA 1EJ7L 4W8LA 2FWSA 3JZYA 1IKFH 3ZPDA 3OKOB 4AL8C 3G1AA 2PZ0A 2YXVA 4Y19A 4GYBA 1I1AA 4GXVL 1XJBA 5HOSA 1UKOA 4Q7NA 3GXFA 2H2SD 2BMBA 4OQVA 4HIQA 3QNXB 3W2MA 4EI5B 2DBLH 3ZHDA 2R0ZH 5JUVA 3OGOE 3KDNA 3KBWA 2QELA 1FFRA 5HATA 1K2DA 4XBKA 5A6BA 2GSEA 4N2OA 3KXFA 3MRRB 4MYWB 3BDYL 4GY7A 1MLCB 4AG4H 1DWAM 3CLFL 1IC5H 4GRMA 4WDXA 5C0DA 1JCXA 4R7LA 1ZLEA 2FR4A 4HIBA 3GNML 3O11A 3F5WA 2Z4QA 5BZZA 3MSYA 3I6RA 4Y5XA 1AW5A 1JXKA 4PGZA 2GTZA 3QR3A 3ZDYF 2OMTA 3KGUA 3EWUA 4LOEA 2OWWA 1HYSD 3RCYA 3T7VA 4LNVA 3SE4C 3CZFB 1ND0B 1LMKA 1MFNA 1ISXA 1F3DH 3FHQA 4KZCA 3RLVA 4FXKA 1RFDL 4BKLB 2ZUTA 1OE2A 4QEGA 4JNXA 2OSLA 3OG6B 5T1KA 4NM8H 1AHMA 1RUKL 1UADC 4FULA 3ZIYA 1DIDA 4UIKH 1N10A 5GJSL 1HU8A 2EKGA 2WZHA 3CSTA 3IXTB 4GRWB 3R10A 3B9KC 4Z2IA 4PLJD 2A9CA 3GR8A 3IEBA 2CDFB 1YRRA 5AW9B 3QJFA 3EFFB 5I24A 3MUUA 1HDMA 3G08B 1JIBA 3QUZA 3DI3B 2W66A 4R3UA 1DZBA 4UR9A 1B1YA 4KKLC 4HWBA 3GXDA 4LCVA 4R88A 3W87A 2RCSH 3F4VA 2ICCA 4L6HA 3LMJL 3LZPA 1IM9A 1QW7A 1F11B 1V6XA 2BZNA 1BP3B 4R7NB 1ZS8B 3SI9A 2VISA 4TM9A 4N26A 3GSQB 5I6NA 1E4HA 4JY9A 2Y0SA 1E50A 4FFZL 3ZU8A 5DDHA 2G75A 1T21A 3SCRA 3UY7A 4EDWH 4JDYA 3VWJA 2BOCB 3WY2A 3I6EA 1M57B 3LVTA 1UG9A 4WAFA 4N0UE 4H9UA 8PAZA 2D0HA 3LN5B 1GXEA 4YPGA 3VZYA 1KGUA 4HIEA 3WQCA 1XUZA 3RRAA 3RWEB 5A8GA 4OGQC 3IUDA 4LKXB 1U30A 3NQAA 4PV9B 5D1XC 3GNNA 4MJZA 4D9LH 1E5JA 5FUZH 4MNKA 3WXWH 4AQZA 5LNWA 5EFIA 1EL3A 2PLJA 3BP4B 3HPZA 3MNZA 3V4VH 4V33A 2G5UA 2RALA 4K7FA 3UYRH 5C0FB 3G6AA 3P4LA 1DJQA 2QUMA 4DGUA 4BQBA 1Q6OA 3FAWA 1WQ5A 1QBLL 1UC5A 1Q65A 3DH7A 5C6TH 4DUWA 3WUEA 2J7HA 3V0VB 1KB5H 5D37A 4G82A 2BXZA 2X7LA 2R82A 4JZOA 3KJ4B 4MNLA 1MUJA 4OKDA 5C07B 2O1AA 4Q97A 3AALA 4OVXA 2CKNA 2VLKB 5DJCA 3DARA 3TC7A 5DEGA 3UJIH 1JN6A 3N4EA 5GJTL 1AO7E 4PJBB 4PLKC 2KPWA 4QG8A 2ACSA 1QRNA 3QIBB 3LYRA 3RF9A 1RJPA 1PG7L 3GAKA 1J8HA 1L7IL 3LD8C 5DS1A 4XCEA 4P2VA 4G83A 4MQ7A 1XF4A 4R7JA 2BJML 1AHKA 2JCCA 3UAFA 3A12A 4XWUA 1UUMA 3WN5C 1FORL 2XH2A 1X8FA 3ASWA 5C5YA 4FOMA 3FUFA 4P2CG 3C4UA 1WVZA 3WCZA 3T0EE 3IMWA 1UVQB 1LCOA 2FQGA 3QCTL 2YUWA 3G6DL 1UFUA 5IB3A 3EBHA 4CC1A 5B7YA 5INCA 3RIFF 1MZYA 4HCIA 2LFEA 2WTRB 1XRFA 1OD0A 2ZSWB 3OZOA 1A4KB 3IFPA 3PAJA 2W88A 3IDIA 4B5NA 5AZEL 3FRPB 4BFJA 1P43A 5FAGA 1QPNA 4IOSD 4PYHA 1CI1A 2GI0A 2VMJA 4Y1AB 1PQZB 5EL1A 4J3OH 4LARH 5C0RH 4GMEA 1QSFE 3P77B 3UCDA 3SADA 4R90L 1OX6A 3JWOH 1I8KA 2W94A 5EIQA 3TOYA 4L4VD 3BLLA 4P23C 3RM4A 2P0IA 2GK1B 2QFPA 4JQ2A 2ZPKH 3O8XA 4L0YA 2QADD 1FDZA 1Q2RA 2UUDH 3FFCE 2PF8A 4CNSA 4A39A 2W5PA 1WCBA 1S5MA 1UYQA 1UWAA 1MJ8H 4D8ZA 3BANA 4YHYC 2XWDA 1LWHA 2G0KA 1URIA 1IGIH 2ZC1A 1M2OA 5FO8A 4G7VH 4J12A 1LEIB 4O8AA 3KPPB 4PG2A 1NUDA 3OEXA 1AP2A 3MRHA 1B31A 5CD5C 2Z6JA 1UZ8A 4P2OB 1CQYA 2WCAA 2IDQA 2WUCH 2FLMA 2CEQA 1P84K 4TR9A 1NCJA 3SB3A 1ONQB 3QXAA 2NW3A 1RP9A 1IEXA 3WNJA 5FUCE 4G1KA 2N1KA 3K5RA 1MDAA 4QE1A 2R4RH 4Q7IA 4PCKA 1XTLA 3MQTA 2G96A 3T2PA 2X9XA 4NUQA 3I6GB 1UPMB 5E9DD 2ADGB 3T44A 3K1GA 5DQPA 4P5TB 4KEUA 3QUYB 4NQTA 2AMGA 2APWA 4MQXD 4HUWA 5EV7A 1RZFH 4OFDA 2NDGA 3WNNA 3SCTA 1ZAHA 4KK5D 4ZXBB 1IBFA 5KBPA 3HZMB 1DFBH 1RVGA 1YPIA 2J56A 4QLJA 5GNZA 4XP5L 4YHPA 5KS9F 1AQDB 1LILA 1IWPA 4EPBC 5ABHA 4HP5A 1U6AL 4GE8A 4Y7MA 1BOYA 5K1VA 4REQB 4OB5H 3V9EA 5JA9A 1USZA 1M7OA 3VOJA 1EZLA 3AFBA 1I2QA 1T6BX 1JPTH 5HVGB 2DIBA 4D6FA 1ES0A 5DVOA 3VZZA 3OB0K 4OZFG 1UA6L 2CDEB 1F74A 4LB3A 4XNZB 4ONFH 2R2EB 4G6AC 5SX4H 3KZSA 3LKQA 3QDJE 3LBOA 1IBZA 3WJYA 3FT2B 2Z7ZA 2UY5A 3U2SB 4IP4A 1SM9A 1XDTT 3AQXA 1QAWA 1EYEA 2K6WA 1C29A 1X6UA 1IMHC 4XNXL 1RUPH 2BVYA 3AG3B 1TPVA 3PS6A 4WIQA 4UDTB 4LOFA 4HHAB 1INQB 1XGTA 1PY4A 3WKQA 1MHEA 2NSQA 1U8IA 4Z1PA 5KYYA 4X9SA 4KTDL 4EBQH 1IGFH 3WKML 1AACA 3D25A 2R1WB 4X99A 5I8EA 3OXRA 2EYSA 1J1XL 2MOGA 3SQRA 1VGKA 4TRPH 5DCDA 4CSSA 1RD6A 5B39G 1BZ9A 1A7QH 4MTVA 5TPWH 3G5XA 4M48L 1Z0MA 4X0KB 3UXIA 1NCBH 3BESR 3MRDA 5L2KE 4Z9KB 3NH7L 5DEZA 3WMPA 3TFKD 2UY6B 3ECBB 3J7HA 1RLWA 2LLEA 2NXHA 4OVUA 3SCMB 1CUOA 2H3XC 2YXMA 3T04D 2X1SA 2X9WA 1QO3B 3L66A 2JWYA 1RUAL 4RBPK 4PY8J 3B5GA 4YHZL 1HJBC 4G7FA 3LZFH 2V69A 2EIBA 1MWOA 3F4DA 2YPLA 1OSZA 5KVGL 3UWZA 5D2NA 5T26A 4OCXL 2ARJA 3JTBA 4MB5A 4IQDA 2PRMA 4FR6A 4JKKA 5BZWA 2BIIA 1IC7H 4PJ5D 2VLJD 4PJ8D 1LT7A 3B0PA 5HDBE 5E7FA 3GRGA 3CMOL 1KXVC 2EE2A 4NP4L 2DICA 4G8GE 4TXEA 3VE7A 3N3MA 5I1CH 5J3HD 1O7SA 5D5MA 2ZG3A 4C56A 1D7FA 1TE1A 4AB4A 4J23A 3VXOA 1A4LA 3TEWA 2BNRD 1PTAA 5A6MA 1A4AA 1VERA 2DZXA 4WY0A 3CUXA 3AXXA 3CAKA 1YJDC 3KRBA 3VXUD 2UYLA 4K2UH 5CZXC 3GB7B 3D0CA 2KMWA 3DVGA 1K3ZA 3D2UA 5HANA 4LPCA 5DD3H 1KCSL 1Q6LA 2R2HB 4QRFA 2VCOA 1P4LA 3DBXA 3Q01A 2MUCA 3EOAA 1CFTA 5HDLA 3KLSA 4L3EA 4S10A 5JW4R 1TWIA 4JRYA 2FSEA 5FEBA 4Z08A 3EPMA 1MIMH 1I4FA 1S8DA 4UFJA 5F1NB 3UR5A 1Z89A 4TVUA 5GS1A 3NPVA 1GOOA 1WPCA 5FYKL 5IBLC 4PS3A 1BD2A 1KXQA 2VB5A 2ACRA 1EJSC 3I65A 1B9BA 2J7GA 4UU9B 2E7CA 2ICEC 1RZ7L 3CHVA 3VNZA 1CBVH 3URQA 1EFXB 1NUGA 3UAJC 4H8WH 5GRJL 1JCTA 1D5XB 5ADPH 1U3HC 2I85A 2D7NA 2P80A 2OCFD 3GRIA 4AE1A 1V3JA 4X6DA 4XX1G 3TT3L 2G2RB 1RIUH 1BBJB 1VACA 2IGLA 3VGEA 3J2PA 5BMXA 2BRRL 3IE4A 1XRTA 1T5AA 3CPRA 2VXUL 4X42A 4AGMA 1DN0B 3EJZC 2PRLA 2BFVL 3Q5TA 1AZCA 4U3AA 3B04A 1TJHH 4JTEA 1IGSA 4L2YA 3R4DA 2CA3A