2Q3RA

Ensemble refinement of the protein crystal structure of at1g76680 from arabidopsis thaliana
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
361
structure length
351
Chain Sequence
SVPLLTPYKMGRFNLSHRVVLAPLTRQRSYGNVPQPHAAIYYSQRTTPGGFLITEATGVSDTAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYMAESLNKYGILYCHVIEARMHTLMPMRKAFKGTFISAGGFTREDGNEAVSKGRTDLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
molecule keywords 12-oxophytodienoate reductase 1
total genus 117
structure length 351
sequence length 361
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2q3rA00
1QO5A 3TV8A 1GTHA 2EKCA 4JS3A 4QJ1A 2A7RA 3FYPA 4X3ZA 1WOBA 5G5IA 1KFBA 4O13A 2CLIA 1OK4A 4FIQA 1M7PA 3I7QA 4MY1A 4OU1A 2YSWA 3DH7A 3TFXA 4M19A 4TIMA 3NL2A 4ONVA 3BW4A 3EX1A 3DFPA 3P8JA 4Z1CA 3BG9A 3TQKA 1QPOA 2WKJA 1H50A 1ML1A 3W1UA 3TUUA 2VFHA 3HG3A 3NAVA 2DZTA 5C2XA 1V5XA 4FNPA 3LV5A 1WBJA 1QWGA 3W23A 1O5KA 1TJRA 2A1YA 2EGZA 2PCQA 4FIRA 4BF9A 2H8ZA 3UWZA 3IIVA 3O16A 1SSDA 2C1HA 3TMQA 2R14A 1XUZA 4HSNA 1LP6A 3BW3A 3M5YA 3FEMA 1SO4A 2QDHA 4IGHA 3ZWTA 5LSMA 4IOTA 3NZRA 4K8EA 4A22A 4ADUA 2FPVA 5F1VA 5IBXA 1PCWA 3Q2DA 1GYNA 3PG8A 2ZA1A 3F1QA 4FXSA 4XBKA 1SW0A 2Z6JA 3QSRA 1W56A 4CNPA 5LNRA 1TMHA 3L68A 1U5JA 1AK5A 4EVZA 1OG0A 2PRLA 3L66A 3P67A 1J5TA 2DZSA 3NQMA 3C56A 5DY3A 1X6UA 3SR7A 4KKXA 4MJMA 3EKLA 1Y0EA 3PF3A 1EX5A 5TIMA 1AW5A 4HNVA 4PL1A 4RZ6A 5AC8A 2ZZ4A 3N3MA 1I2NA 3PUOA 4XKYB 3EWBX 4GNJA 2V2DA 3MYOA 2NWRA 2RFGA 4FNSA 5HMSA 2G97A 4RXFA 4C1KA 1A5SA 1P1XA 3M7WA 3OBKA 1XCFA 3DFTA 4GUHA 8TIMA 1YPFA 1XBVA 1ZY9A 3R89A 2YDAA 3BG5A 1EWEA 4JEQA 1H5YA 3MMTA 5EKYA 2AAMA 2C3ZA 1KBIA 4UMBA 4YCPA 1R2SA 1IIHA 4LS2A 1ICPA 2J9XA 3PBUA 5AB3A 3W1AA 4LVDA 4RXGA 4JTFA 4ZQNA 4AXKA 3TCEA 2QF7A 3CM4A 5K9CA 4NZFA 1SZFA 1DKWA 5DCDA 2ZRVA 3ELFA 1UJPA 3QMRA 2VFDA 3WJZA 4NU7A 3STCA 1NEYA 3S1WA 4Y96A 1MZHA 1TPVA 4JIPA 3W1QA 1M5WA 3UZ5A 3C61A 3KVMA 1KTNA 2GQAA 1G7UA 3G1VA 3GIYA 3GXPA 2ZZ1A 3K30A 2NZLA 3IIPA 1XBYA 4R7JA 1O4UA 3BLIA 4Z0SA 1DJNA 4U4MA 5AYXA 3LCHA 4UTWC 2ZZ7A 4GRSA 3GR8A 5AHLA 1O94A 3EXRA 1TTJA 5F2LA 1A5CA 1SFLA 1OX6A 3W70A 5IBXC 2CLLA 3ABQA 5U7SA 3BLEA 4DPQA 4JX4A 1QAPA 4MOZA 1G7VA 4PH6A 1AL8A 1THFD 2A7NA 2X1RA 3BLFA 4UMAA 1K02A 3STEA 1EWDA 2CLMA 1TB3A 3NR0A 3KVLA 4HSOA 3CQ0A 3G3DA 1H61A 5K7JA 5K3VA 3TQ0A 3BVJA 5DCBA 5D05A 1FX6A 1FWTA 2QJHA 2H8XA 4UTLA 2V9DA 1RVGA 2YFOA 3UWVA 3TQVA 3NNTA 1G4PA 1I45A 5HR7A 2GVLA 3UQNA 1L9WA 3QC3A 3QFEA 3GAKA 5C5YA 4PEKA 1EPXA 2EAWA 5CZ0A 4DO4A 4IX0A 2WPBA 3TA6A 2J88A 1L6WA 3G1DA 2CLEA 1LOQA 3M9YA 1OHLA 3L21A 3LTPA 4NJIA 1PS9A 3ABSA 5HUPA 4YXGA 1H60A 4NUWA 4NXKA 1KFCA 2VFIA 3EKZA 3LRMA 3M6YA 1S3HA 2ZBTA 5E93A 2Y70A 3FLUA 3BGJA 1H1ZA 2XN2A 5D2TA 4L4LA 3SGZA 4K7YA 3NQVA 3W87A 2Q8LA 6TIMA 3RU6A 1GQNA 1KBJA 3NYZA 1GWJA 4GBUA 3HOJA 1GG0A 1FCVA 4KFOA 5G1TA 5D2YA 2VKZG 2P10A 1JCJA 3W2NA 1Q6LA 2V2HA 4K36A 3RMJA 2XN0A 1K7EA 1R46A 1F6KA 1Z42A 2P1FA 4K6AA 4CLMA 4Y90A 4RKAA 1XBZA 4ZQPA 5EL1A 3HF3A 2QCLA 2WSQA 1K8YA 2Q3OA 3DI0A 4B5NA 4UTTA 1ME9A 3S5YA 1CI1A 2E6FA 2E5DA 2DORA 2FB2A 1X8FA 3NO5A 1X7FA 3M44A 1GYLA 5I3IA 3QW3A 2W0UA 1TPDA 5D2WA 2E77A 3WK0A 4PL2A 5EPDA 3TROA 1K8XA 1EIXA 3S9YA 1JRBA 2A6NA 3NGJA 2C19A 4DF1A 1D9EA 2IQTA 1J2WA 2B0MA 3E9AA 4DBEA 1H1YA 3LCWA 1B9BA 1VZWA 3BK0A 5G4WA 2V81A 4I7UA 1T99A 1SQ7A 1ZJIA 4JTHA 3G22A 3OEXA 4O1AA 4X22A 1FCBA 2A85A 1SZGA 4O57A 5BNKA 4UMCA 2GPTA 3O6YX 3WJWA 3HGRA 5C6MA 3W2LA 3W7EA 3LXCA 3SFKA 2V2CA 3PM6A 4U28A 1H7XA 3LCXA 4OBTA 1HO4A 5BRBA 3FJ6A 3LERA 2VENA 1QPRA 4GFSA 5FEXA 3IEBA 3EB2A 3W88A 1H7PA 2ZDRA 3LRLA 1XM3A 1FUYA 1WBHA 2GJLA 4QNEA 4MPQA 2QUUA 3W1RA 4JYDA 3MI6A 3CIWA 1GZGA 3UXAA 1VYRA 4QIUA 3M43A 3NQCA 3TAOA 1EUAA 2B7NA 4QM1A 4WY0B 1JQXA 2QUTA 4KWVA 3G8RA 3MBDA 1OF6A 1NFBA 2DZWA 4KWWA 5CZTA 4GJ1A 5G1YA 4WX2A 1WAUA 2V82A 3LHZA 3LRKA 3NZ1A 4DF0A 1F05A 3LLDA 4ZVJA 4AHQA 4RLIA 4UXDA 4TU1A 3GDRA 1R30A 1W3TA 3PS7A 1F73A 3PG9A 4GUFA 1V7YA 2FPTA 2H3BA 3NQ6A 5F2GA 3UWUA 4WJEA 2WV8A 4Z1BA 1YTKA 4N9EA 2NXIA 1I2OA 4E2DA 1KV8A 4WXYA 1FXPA 1FCUA 2CLFA 4JXCA 1O5XA 1M7OA 1I2RA 4S2BA 3ZWSA 1B4KA 3H53A 4X9SA 1QFEA 5HR6A 2YPIA 3M0ZA 5K2ZA 3TC6A 2V30A 4P2VA 4EIVA 4YWIA 1GVSA 5G2WA 4JR5A 4CNOA 1JCNA 5I3HA 4HHPA 4D2JA 5G2HA 3AJXA 4AHPA 2VEIA 3A22A 3NG3A 4DXVA 2E1DA 1G6CA 5CPLA 3P61A 3OVPA 2RDWA 1WYIA 3UXDA 3VE9A 3O05A 2YR1A 4LVFA 3B06A 5LZLA 1DL3A 3W7HA 1NSJA 1VGAA 5EA9A 1GVQA 1XDLA 2DZUA 2Y7GA 3TK7A 5D38A 3LGEA 3QJAA 4IXHA 3W7RA 1JJKA 3TSMA 1YYAA 4UC5A 2OJPA 1VR6A 2X30A 2DZPA 3UY7A 5EY5A 2WJZA 5I3GA 3GLCA 1K8ZA 2ZCGA 4AHOA 5FEPA 2HMCA 5KMYA 4BWLA 3GDMA 4BI6A 2QCGA 4UUIA 3P60A 4JD4A 1I8JA 3NQDA 5F4XA 1YADA 3B0UX 1DQXA 1XUUA 1W1ZA 1UB3A 1WX0A 4RZ5A 3VE7A 5FF7A 3TIMA 5LNSA 1QOPA 1Q45A 2H90A 1Q3NA 2C0AA 2NUXA 4XTIA 3S42A 1MEHA 3C3NA 4H6KA 1KV5A 1YXCA 1GOXA 2YYUA 3NQGA 3HG5A 3QMSA 1AMKA 1KM6A 5AHMA 2B7PA 4LRSA 1PIIA 4J9JA 5CG7A 4OV9A 3IVTA 4MKNA 4HPJA 4UTMA 3IIOA 1S5TA 2JGQA 3C2VA 2YGYA 1HUVA 1LDCA 2Y88A 4OV4A 3W1PA 4JYEA 3G1AA 3MYPA 3M41A 3N73A 1OX5A 1VLWA 4RCXA 4WXZA 5D2XA 3QMTA 4FB7A 4N9CA 1K3UA 2ZRXA 3DXIA 2QDGA 3W1MA 5J5RA 3PB0A 3A21A 4LU0A 2UV8G 2DZVA 5DBUA 2OX1A 1FQ0A 3LM7A 1NF0A 2JGYA 3HGJA 4AAJA 4OQVA 1JCYA 2J9YA 4DBDA 4N6EA 4EWND 4LVBA 5G4EA 5KZDA 1VRDA 3FJLA 3IVSA 1E51A 4M6VA 4QQ3A 3BPWA 2QEZA 5BW6A 3KFTA 2HSAA 3S0CA 2AQWA 4A2SA 3HG4A 4JTUA 4FNUA 1IGSA 3SJ3A 4NJHA 1GTEA 1TCDA 2C13A 3GB6A 4CCCA 1S5WA 4IXXA 3ZS4A 3G0XA 3UWYA 4TMCA 4XTDA 1GPWA 1FWNA 4KFPA 1SW3A 4NJKA 1OYBA 3NL5A 4LUIA 3EWWA 2R8WA 1N55A 5HINA 5LNUA 3S1XA 2XN1A 3ABRA 3NOEA 4O1CA 2QCHA 2ZZ6A 3IIXA 1W31A 4LS1A 1ALDA 1SZNA 2E5BA 1W5NA 4K38A 4DELA 4E2BA 4N9BA 2DP3A 4WD0A 3P8IA 2VELA 4CCEA 2PE4A 4NZJA 2CWNA 1DOSA 2HS6A 4YMZA 3U2OA 2FB3A 2Z6IA 2CZ5A 5HWJA 3EWXA 3CPRA 2EHHA 4TMBA 4EOUA 3JR2A 1VYSX 4MUZA 4O4VA 4UNLA 2A2IA 2FIQA 1K7XA 2J24A 1F5ZA 4NNAA 4PC8A 3NPWA 5H2ZA 5FF4A 4JTGA 5K9XA 4XBSA 1QNVA 1ZAJA 3NQ8A 5A8GA 3NQAA 2YFNA 3TXZA 1AL7A 1KTBA 4R34A 3ATZA 3P82A 2QCNA 2D73A 1FWSA 1QMLA 2VEMA 3GDKA 1SPQA 3M1ZA 2ISWA 4JIQA 3P62A 3W7JA 1JCMP 3CWOX 3TJXA 3PB2A 2V5LA 1HFBA 4LC8A 3T44A 3BG3A 4LOCA 1HL2A 3OHIA 5K4XA 3W74A 3EX4A 4QSHA 4ZQCA 3S1UA 1T8XA 2QCFA 5DBTA 3PAJA 3S6DA 4FX8A 2JK2A 5J5DA 5FEWA 4ZMGA 4MIMA 3H54A 5DN1A 2JKEA 3BGGA 2BLEA 2G95A 1TV7A 1W3IA 2VC6A 1A50A 3T4CA 4N4PA 3PY2A 3W86A 4IPIA 5CZSA 2VEPA 3R13A 1NAL1 5LNVA 3OIXA 1SSGA 2E5CA 3DKJA 1RQEA 1H7NA 3EEGA 4MFDA 4IMFA 4NVTA 4Y8FA 4E38A 3W1TA 1ME8A 4WZHA 4UFLA 3HO8A 5AC7A 3HQ1A 1JUBA 3LI0A 4MYAA 3TE9A 1GEQA 2FPYA 1CW2A 1KA9F 5AOUA 4M5PA 1H7WA 3NDOA 3LHTA 4JNMA 1OABA 1WDWA 4IX2A 3TW7A 3W22A 3QRHA 4LVAA 5HQEA 3CHVA 3SZ8A 1F7BA 1TPEA 3NEVA 2Z1BA 3P5ZA 1JUKA 2YW4A 4O1BA 1VCVA 3VCRA 3HMJG 2RKXA 4I9AA 4NX5A 3QM3A 5D02A 1LTDA 2CZFA 3KXQA 2A6LA 1OFOA 1OX4A 3HJZA 3MI3A 4HT3A 2O7SA 3SSJA 1M6JA 4ICNA 1SW7A 2BTMA 2YXGA 5GVJA 5FI8A 3G3MA 3TFCA 4LV4A 1G4EA 2QCEA 1C29A 2V5BA 4ADTA 4DO5A 1PV8A 5E1QA 4A29A 2NLIA 2Q3RA 4JTKA 5LGZA 5CPNA 3LTSA 3FKRA 3R12A 2VEKA 4WUIA 1VS1A 2PRMA 3BO9A 3GYEA 3W72A 5K4ZA 3STGA 3L5MA 4RZ4A 3IVUA 2QAPA 3DHDA 2NXGA 1F74A 3IRDA 3FS2A 1XDMA 3W3OA 3PC0A 1XXXA 2A21A 4MZ8A 3L0NA 1ZAHA 3LHUA 4O52A 4FXRA 1C9DA 1LROA 3O8AA 3G24A 1KFKA 2WNNA 4UCGA 4PFMA 4Y6GA 3TR2A 4ZL1A 1OX4B 1W5MA 2OZ0A 4L4MA 5TBOA 1AW1A 4FNQA 4WQ6A 5HWMA 4HNNA 3NPUA 4DPPA 3TXVA 2Y62A 3UD6A 1SUXA 4EF8A 4N6FA 3PBVA 2RDTA 4IQLA 4WY0A 4ML9A 1O60A 4ZQMA 5ABTA 3WJXA 4TR9A 4ORMA 1P0NA 1DORA 1VCGA 1EEPA 4YLWA 5D03A 2PRHA 4XZ9A 1TRIA 3PUDA 1FWRA 3PBWA 1TREA 2C14A 1F6PA 3LB0A 2QKFA 5SWUA 3M5ZA 4JY8A 1HTIA 2J9ZA 1RPXA 3KHJA 4C1LA 1FXQA 3LCGA 2V8ZA 2WSRA 1VJIA 1YDNA 1LLZA 3ATYA 4FNTA 2QUVA 3G1XA 4O1DA 4AF0A 4MVAA 4TX9A 2PC4A 5CPMA 3QZEA 3S5ZA 3NQEA 3FFSA 4GXMA 4BK9A 4Q33A 1JR1A 1N7KA 3HPZA 2GVGA 3W7GA 3W85A 2YW3A 1PHQA 2WSYA 4MY9A 1LOLA 2FLIA 1VPXA 5D04C 3T40A 2ISVA 3SECA 1QOQA 4MFEA 1VHCA 1ZNNA 1HG3A 3NQ7A 4OT7A 4O0ZA 1YDOA 4M7SA 3DFNA 2Q8ZA 1EUNA 1H51A 3W1LA 4BI5A 4RX0A 3FOKA 1VQTA 5I3KA 1LRQA 3N9RA 1JVNA 1KLZA 1DV7A 1MSSA 3JRKA 2CZDA 3OA3A 3G0SA 3G18A 3Q94A 4PA8A 2Y63A 3HGSA 4I7WA 2Y7FA 3UYCA 2X1SA 3ZFHA 3L65A 2ZZ2A 5FF2A 3NXFA 2ZTJA 3CU2A 4I7VA 4Z0JA 3O1NA 3B0VC 3T78A 3A24A 1RV8A 2X2GA 4LTSA 4GUIA 1NVMA 3KAOA 3OVRA 4LC6A 2ZZ3A 3N14A 4XUGA 3S5OA 3WK1A 3B0PA 1YPIA 1B57A 1KM0A 3MP3A 2NUWA 4AF0B 2QJIA 1OFPA 4O15A 3O63A 5A5WA 5FEZA 4X2RA 3E02A 3OVQA 3QEZA 5H91A 3TJLA 1XL9A 2B4GA 2E6AA 4AEOA 4MLRA 1TPC1 3NPXA 1KM4A 3C8FA 3M5XA 1KFLA 3O6CA 3SW6A 1QDSA 2ZYFA 1YDVA 4OWGA 4Y9AA 1VH7A 5DXYA 3EWZA 3P80A 2H3DA 1ZENA 5D37A 3LI1A 5HULA 3EXTA 1KTCA 3W84A 3IV3A 1I2PA 2ABBA 3B04A 4ZQRA 1W5QA 3LHVA 3CB8A 1TYGA 4JY9A 2BZNA 3P81A 3GNDA 2O7QA 5DLCA 3S8HA 4IPJA 1MO0A 1W5PA 4O19A 4POCA 2E09A 3LHYA 4AWSA 1TIMA 5LKYA 2C6QA 3N9SA 2A7PA 5I3JA 2OT1A 4IMDA 2QAFA 3F4WA 2CLKA 2LLEA 1WQ5A 2DJLA 1TPUA 1P4CA 2Y6ZA 3P84A 3MUXA 2QCDA 3CC1A 2Y85A 1KFJA 4FX7A 1HO1A 2P0OA 4O28A 4GUJA 3UZJA 3NPVA 4S1FA 4LV9A 1WA3A 3BV4A 3N34A 3L5LA 1R47A 3W07A 3NQ2A 4JX6A 2ZRWA 4CQ9A 3GKFA 2JBMA 3UY8A 3A5VA 2GOUA 1OF8A 2F84A 1A53A 2GUUA 4O0KA 4GWEA 3L0GA 2A0NA 2AGKA 3ABOA 3HPXA 1FBAA 3NL6A 5C55A 2CLHA 3MHFA 3DFOA 3O06A 4LNYA 2I14A 2J27A 1KFEA 1KM1A 1UBSA 4HNTA 1OFQA 1G4SA 3A23A 1TPFA 3HGOA 4NJJA 2EF9A 1SR9A 1IXOA 1OFBA 3DAQA 1IXPA 3CLMA 4MZ1A 4S2CA 1D3HA 2FTPA 4XWUA 3RNDA 4WOZA 3T55A 3GZ3A 3PSWA 2A5HA 3HBLA 1DBTA 3W6YA 2GQ8A 4DF2A 3PBYA 2ABAA 1GG1A 1TTIA 2JKPA 4JDYA 4A3UA 1BKSA 1LORA 3IGXA 4BR1A 3I7SA 4FF7A 3VNDA 1OFAA 1L6YA 4N4QA 1Q6RA 4JDBA 2F7FA 1TQJA 3C0JA 3IGUA 1EP3A 3RK8A 3DBPA 1VHNA 3GNNA 4UFMA 3FKKA 1KM2A 1OVDA 4Z1AA 1Z48A 2TRSA 1Q6QA 4RK8A 4JTIA 1LRTA 3E12A 3IIZA 3V1PA 2JKAA 2CZEA 3LTYA 3GAYA 5FF3A 4RV8A 3TSDA 3UPBA 4HIBA 4WOQA 3RLUA 1H7OA 4PCFA 2ZZ5A 3SY5A 3UWQA 4FEZA 1RQHA 3THAA 4IMGA 2E6YA 4IMCA 3DFSA 4LVGA 2OMAA 1WOAA 1FY6A 4EF9A 5F4SA 3UWWA 3QPYA 3DGRA 5C54A 2Y7DA 1VCFA 5AYYA 1YTEA 1O95A 2WOQA 3MP5A 2YYTA 5K9DA 3W7CA 3OG3A 1VC4A 3QPZA 5AYZA 3I68A 4MLJA 4N9DA 5LHFA 4IWWA 4JTTA 3HG2A 4O10A 2ATMA 3W7KA 3V75A 4HNUA 1DHPA 2A4AA 1GVFA 3LCFA 1YXDA 3WK3A 3ANYA 3CWNA 4O11A 3L2IA 5I3FA 1FDZA 3G1FA 3W2MA 1T96A 3FYOA 6ALDA 3RLVA 3N2XA 3N19B 1L6SA 3M47A 4BFAA 3M5VA 3SI9A 2BXVA 3EWYA 3LDVA 3KX6A 3QF0A 1K7FA 2BSLA 2W6RA 2DJXA 1ZHAA 5IM51 1QPQA 5L9FA 3TSBA 1IXQA 3VFLA 3MJYA 1DJQA 1MXSA 2ISSA 3PWAA 4DEFA 1UASA 4Z08A 4LRTA 2NX1A 1F76A 3DKLA 1QR7A 3W7NA 1D3GA 4FHAA 5CSSA 3P7YA 3G0UA 1LLWA 1K03A 4O54A 3TW6A 4UIOA 1S5VA 1KLYA 4UTIA 3INPA 1B4EA 3TU9A 3PR2A 2YZRA 3W2KA 3W7IA 3W7LA 4JICA 1UCWA 1OK6A 1DVJA 3DENA 2J6XA 5AHEA 4HPXA 3UPWA 1XFBA 5TQLA 4ALDA 5HWNA 2GJNA 1IXNA 2WNQA 4K8HA 1NF7A 3UNDA 5EBUA 3TAKA 2Y61A 3MHGA 4P61A 3P5YA 2GVJA 4OHQA 3L0KA 2TYSA 4MZYA 3IGSA 1TTQA 2X1UA 1OFRA 2R91A 4AVFA 2DZXA 4QISA 2Y7EA 2C15A 1EA0A 1BWKA 1H62A 3E49A 1LBLA 3WJYA 4MJZA 3I7RA 3LV6A 4HKPA 4CCDA 1KM5A 2C16A 5DXXA 1RZMA 1SZEA 5HJLA 4FO4A 5D33A 3QW4B 5HNRA 4OGZA 3VI2A 1JCLA 2VXNA 2NV1A 2OCZA 1JUEA 3CTLA 5L6UA 3C52A 5HUOA 3W83A 2C18A 4MY8A 4JYFA 3D0CA 1TPWA 3MP4A 1R2TA 2B7QA 3N2MA 3LXBA 3M16A 4Z1DA 2R94A 2FDSA 1KM3A 3T7VA 4A2RA 4GC4A 2YCEA 2WO5A 3O15A 3GVGA 3MHUA 1OYAA 3EX6A 4N02A 4ZZ9A 4CQAA 1FDJA 4JTLA 2CLOA 3TNOA 1ONRA 1MEWA 1MEIA 3LBCA 3TH6A 4RJEA 4GE8A 3B8DA 3SIZA 3RF9A 3QH2A 2QR6A 2ZRUA 1SO5A 2ZFAA 2VOMA 2Z2UA 2ZTKA 4AMAA 3LBMA 5CZJA 3TC7A 5G2IA 3JS3A 1TQXA 4IUOA 3DHFA 3PULA 4UTKA 3W73A 3G8EA 1GT8A 1RQBA 3KOFA 4JTJA 5AC6A 4R53A 1AW2A 3ZR4A 5DCEA 4PODA 4MYXA 4IJBA 1TSIA 2WNZA 3MW7A 5CSRA 2VFEA 3G1HA 3DFQA 1YTDA 5FESA 3U8GA 3W75A 3CEUA 2NV2A 4NQ1A 3P74A 3MBFA 4FX6M 3A9IA 1U83A 1IIGA 1VLIA 1SFJA 1XBXA 4O16A 4O18A 1PHWA 4UR7A 1H63A 3F03K 1UUOA 4KFNA 5D2VA 1WV2A 1TPH1 5KZEA 3KVJA 2E6DA 4UR8A 1B3OA 3QYQA 1EB3A 2RDUA 4QNWA 4NNBA 1UUMA 3USBA 3W7DA 3VKJA 1BTMA 3C2RA 2NX3A 5DY2A 2TPSA 2X16A 1I2QA 2H6RA 3GXNA 4K39A 4O14A 5LHEA 1LCOA 3GR7A 4UTJA 5F1UA 3O07A 3C2EA 2WQPA 3LHWA 3NL3A 3W9ZA 3LOTA 2ALDA 1QPNA 3LLFA 3MO7A 2NWSA 4AB4A 2Y89A 4H4IA 1ME7A 3W71A 1I4NA 4H3DA 4LS0A 3QQ0A 1OFDA 1J4EA 3W1NA 1ZAIA 3QSTA 3EX2A 1Z44A 1ICQA 3NQFA 4UFIA 1TV5A 3TDFA 3Q58A 3BARA 1W37A 4NJGA 2I9EA 2QJGA 4OE7A 1A5AA 3DZ1A 1FCQA 4YCOA 2X1TA 5KTLA 2V0TA 5KSWA 1X1OA 1OJXA 2G5WA 3STFA 1TRDA 1Q6OA 2B7OA 4WY0F 1ICSA 2ZRZA 3W1XA 4ORIA 3SGUA 3THQA 5E0KA 4E0CA 2VFFA 3E96A 4UTUA 3C2FA 1ADOA 4RR4A 1VYPX 3YPIA 1AG1O 1RD5A 1JCXA 3F4NA 1TO3A 2BWGA 2ZQ0A 1N8FA 3MI2A 2EPHA 4XKYA 5KINA 1LBFA 4PTNA 4ADSA 1XI3A 5U4NA 3NM3A 1GVRA 4CQ8A 1WXJA 1G67A 4O4WA 2Z0IA 3KRSA 4CNNA 3W7MA 2E68A 4JTEA 1JRCA 3I65A 4G1KA 3NM1A 1C8VA 3DU0A 1P5BA 2QCCA 3WFAA 1SU5A 3Q37A 3TKFA 2I1OA 3L9CA 2ATSA 3RFAA 2NUYA 1LRNA 1EP2A 3LCIA 1LM1A 3W76A 2NXHA 1L2UA 2G96A 3KRZA 3U6WA 1W3NA 4O50A 3TMLA 3AO0A 4DO6A 1YLVA 3GDLA 3R8RA 4LY8A 4UFJA 4BI7A 3QQ1A 3R2GA 3GDTA 5F2IA 5LGXA 1R2RA 2RHGA 1PE1A 1T0OA 4LT9A 3CIXA 3DI1A 5LNWA 1LOSA 5F2MA 5CGQA 1TTPA 2KZHA 4UTHA 3WK2A 3G1YA 3I6RA 1EP1A 3W7QA 5BMWA 2TSYA 5AN7A 4O17A 2XFWA 3C2OA 1GVOA 1JQVA 1X1ZA 2ZA3A 1F2JA 4W9TA 1FWWA 3G1SA 4GUGA 4AWTA 7TIMA 1DQWA 1SO6A 5CKSA 3MWAA 3B4UA 4UTWA 3C4UA 3HPSA 3H55A 4M6QA 2NX9A 3GXTA 1LZOA 5DELA 3L67A 1LBMA 1W54A 3A5FA 4K37A 5F4WA 4M7TA 3KVKA 4N2YA 1G69A 1FDYA 4NNCA 5EYWA 3TX9A 1OYCA 4UNKA 4JN6A 4JX5A 3S5NA 3FIGA 1JULA 1Z41A 1CX9A 1W5OA 3EWUA 3W7OA 3HIJA 3GKAA 1W8SA 4UFHA 4LW7A 3B05A 5D09A 1ZFJA 2CW6A 3L5AA 5AHFA 2FJKA 2ZRYA 3W7PA 3W2UA 2CU0A 1KW1A 4DQWA 4LWWA 1A5BA 2W79A 3LCLA 3NVTA 4XQ6A 1TPB1 2DU2A 4K7VA 5AHIA 1QO2A 4IMEA 5BMXA 4TO8A 1YXYA 5KZMA 1BWLA 3FA5A 3R5EA 1W0MA 4O53A 1ZCOA 3WJSA 2OT0A 4UTTC 4ZQOA 2BX7A 3B03A 4Q32A 2ZA2A 5EMUA 1TJPA 4NXSA 4HN4A 5AFDA 4JTSA 5AHNA 4YL2A 3PVFA 1PCKA 4BWLC 4Q4KA 1BEUA 5D30A 2VFGA 2HTMA 2FFCA 4JGDA 1G4TA 5CPOA 3S1VA 5T26A 2YX0A 3O6DA 2QCDB 3W2JA 2GQ9A 4A21A 1GJPA 1ZALA 1PVNA 4QAIA 3CT7A 3HB9A 4O12A 5BOOA 4LUJA 4M6PA 5KITA 4AH7A 1RR2A 1PL9A 5MHBA 2CFFA 4O8RA 1SO3A 1LYXA 3C6CA 3EXSA 1P0KA 3EX3A 4UFKA 3CEPA 3PUEA 2FQIA 4FNRA 3BW2A 5D32A 3GX9A 2PURA 4QITA 2TMDA 3GK0A 4NX0A 2RH9A 1XKYA 1TV8A 1XC4A 1OFEA 4NT0A 4R33A 1QCWA 5FF0A 3LX9A 4AWUA 3KRUA 1H7RA 1IF2A 3E0IA 2QCMA 3NA8A 3LXAA 3PSVA 2HS8A
chains in the Genus database with same CATH superfamily
1QO5A 3GC2A 4RDZA 4X3ZA 1WOBA 1JFHA 4BA0A 4O13A 3UR2A 4M81A 1G5AA 1QOXA 3I7QA 1E15A 2YSWA 4GH1A 3VNIA 2WKGA 3MO4A 3TFXA 2VEFA 3W26A 1E4MM 4M19A 3C5QA 4DZ5A 4C6FA 3W6MA 4D72A 1ML1A 3S83A 3S2MA 4K2SA 1V5XA 1FA2A 2D3LA 1QWGA 1O5KA 4I3GA 1ISZA 4GA8A 3OB8A 4FIRA 5KETA 2NT1A 5ABGA 1SSDA 1JYWA 3CUFA 2OOGA 4JTCA 1VBRA 3ARZA 4NYYA 1YDYA 4ML4A 5LSMA 5E70A 4AYSA 1EBGA 4M29A 2AOSA 5IBXA 1GYNA 7ENLA 2ZA1A 1UR0A 4XBKA 1W56A 5LNRA 3L68A 3POHA 4EVZA 1OG0A 5HQMA 1BD0A 1FKWA 1J5TA 3C56A 1XD1A 3SR7A 4KKXA 4MJMA 1S2CA 3VNKA 2IKHA 3EKLA 4JIIX 5IDIA 3PF3A 1IGWA 3W37A 5TIMA 5E6ZA 3B8IA 4G7EA 4WRHA 6XIAA 1W3KA 3DHPA 5AC8A 3HPFA 1B9ZA 1XLFA 5FJIA 1I2NA 2Y8UA 3ITLA 4XKYB 1J0ZA 3EWBX 1TZ9A 1EFZA 4HTBA 1DJGA 1DJHA 4MWAA 1EGMA 1Z69A 4GUHA 4Q4QA 1E6SM 1ZY9A 3BG5A 2GYIA 3MMTA 4JEQA 4NILA 5BYWA 1D8WA 2HQAA 2C3ZA 4GJIA 4MKSA 1VPQA 1IIHA 4LS2A 5DMNA 1ICPA 5C0QA 1E9LA 2DV0A 3L4WA 3BICA 2J8FA 3KBMA 4AXKA 3TCEA 1LQ0A 1ZQ5A 1ZCCA 2IQ0A 1CGWA 1R85A 2ZRVA 1UJPA 2VFDA 4NU7A 1D7KA 1E6ZA 1NEYA 4Y96A 1OC5A 3W1QA 3CQKA 1ESWA 3C61A 1A5KC 2PWGA 1R3QA 2VZOA 4IP5A 3G1VA 1J2BA 4US5A 3JZUA 4H6QA 1XIIA 4GY7A 1VENA 2G37A 2VM8A 3MSRA 1A47A 1O4UA 3LPOA 2XVLA 4GKLA 3LCHA 2ZZ7A 5AHLA 2PDMA 4B92A 4HQVA 3H12A 1LWIA 3N04A 5F2LA 1SFLA 4AZGA 3NGFA 1WKYA 4PB3A 2FGLA 1O5RA 1TR9A 2CLLA 3LBOA 5U7SA 3BLEA 1KBBA 2ZUSA 4BKNA 3EDKA 4IPNB 3CPUA 1UPMB 2GOKA 1THFD 3RR4A 4UMAA 3CUJA 4ENLA 4UOJA 2Y5EA 1CEOA 2AKMA 1EJRC 3AIRA 1XLIA 3TQ0A 3BVJA 2JF6A 3B4YA 4AX6A 5D05A 1YNQA 1J11A 1FX6A 2QJHA 2H8XA 4UTLA 2YFOA 3TQVA 1OB0A 1PKYA 1I45A 4QR6A 5C71A 5HR7A 3RGTA 2C7FA 1K9DA 3R7MA 5C5YA 4DO4A 2FGZA 2R1NA 2GGJA 3TA6A 1L6WA 1QJWA 1LOQA 3LTPA 4NJIA 4QXIA 4AEFA 1XC6A 1KFCA 3LRMA 4LANA 2HK0A 1W6TA 2UWFA 4L4LA 2PDQA 1V0NA 4K7YA 4DJFA 4AY7A 1BYAA 3VCNA 4HN8A 2Q8LA 2FHCA 1KBJA 1EXPA 3HOJA 4KFOA 1MNSA 3SCOA 2VKZG 1XX1A 1TA3A 1NU5A 4K36A 3SN1A 2XN0A 1R46A 1C7SA 4CLMA 1XH2A 4ZQPA 2J4GA 1C9WA 1YBQA 4WDXA 4JN8A 3R1ZA 1K8YA 1TWSA 2BVTA 1R9XA 1TKKA 3EOSA 1KXTA 1JZ4A 2E6FA 3LMZA 4J5NA 1X8FA 3M44A 5LA1A 1VEPA 2W0UA 4V33A 1TPDA 3WK0A 4AIUA 5EPDA 1JZ6A 1JRBA 2PTWA 3BCJA 4GZEA 2IQTA 2VZUA 4IFOA 4QAWA 3KDNA 2W67A 4PB4A 3BLLA 2V81A 4I7UA 3VAVA 4MKVA 1SQ7A 3G22A 2EPNA 4X22A 3ZVIA 4F0SA 2A85A 2X09A 4GCXA 3QC0A 4O57A 1HW6A 5EMLA 1L0PA 3E74A 2YDQA 3O6YX 4GIEA 3WJWA 4EXQA 1FWIC 2ASHA 4NL1A 1OZMA 1HKIA 3R6IA 5HNUA 1X96A 3W7EA 4XZWA 2QULA 4GZIA 3E0VA 1E6PA 2IXUA 3TN3A 1QPRA 2CNCA 2QPXA 1YPXA 5MKGA 2AL1A 4PMDA 3IEBA 3WBWA 4ECLA 2VYOA 5FJJA 1WBHA 2AQOA 1E0WA 3W1RA 3MI6A 1GZGA 2PSNA 3WLQA 4KRZA 2XH4A 2B7NA 1ISVA 1DYSA 1FKXA 4S3EA 1QHOA 4FSAA 1Z7AA 2WC3A 2UBPC 5DF0A 4W8LA 1A5NC 1KKRA 2VJXA 1E70M 3LRKA 1MXDA 1NY1A 4DF0A 4XD3A 4B4FA 4FLQA 1DJWA 4TQTA 4CD4A 3NUKA 3VGBA 1UMLA 3FN9A 3VGGA 3H22A 2XISA 1X39A 2H3BA 5F2GA 3F2CA 3C8NA 1HVXA 1I2OA 2ESCA 1XYCA 1FXPA 1QK2A 1Q8JA 2Y2WA 2EQDA 1O5XA 1I2RA 3PJUA 3RO8A 1EJSC 1QFEA 5CBJA 3GNXA 1MXGA 1JCNA 1G0CA 2HE5A 4HHPA 1J6PA 2PLKA 4D2JA 4ZB0A 5G2HA 1HNYA 2DW6A 2VEIA 4IIFA 2GJPA 3UP8A 3CZ8A 3FDKA 4HU0A 1WYIA 2YB4A 3VE9A 5DANA 5LZLA 5EA9A 4FXJA 2HWGA 3S2LA 3QJAA 4IXHA 3UCQA 4Q3MA 4UC5A 1VR6A 2OLSA 2YBTA 3ID7A 5I78A 1BXNA 1UW9A 3GLCA 5KMYA 4PRWA 3U2CA 2XU2A 3NQDA 2DT1A 1UR9A 5F4XA 2AQVA 1F4HA 1W1ZA 1UB3A 2Z25A 5PTDA 1WX0A 5EFDA 3UU0A 3VE7A 3D3FA 2PFHA 1Q3NA 2NUXA 4XTIA 3C3NA 1SM9A 4H6KA 1F4AA 1KV5A 1YXCA 4AD5A 3QMSA 1AMKA 5AHMA 2XGBA 4HHHA 1PIIA 5HQLA 4OV9A 4RPPA 2FMOA 3IARA 3N2TA 3LPGA 3WEOA 3R10A 3C2VA 5C2CA 2PDBA 4GYKA 2VX4A 2EPMX 3W1PA 3G1AA 4XZHA 1UD5A 3M41A 1OX5A 4DYEA 1GZ1A 4IICA 3GFZA 4FB7A 4LAUA 3WELA 5CJNA 2VUNA 3WDQA 5J5RA 3GG0A 3PNUA 1JZ3A 1SFTA 9XIAA 4S3AA 2ZUVA 2D2GA 2WYSA 4KPLA 1XJBA 3WQ6A 1NF0A 3L2MA 2VX6A 4AD3A 3CT2A 2J9YA 4DBDA 4N6EA 4LVBA 5M17A 1M53A 5KZDA 4AG0A 1ZRQA 3L4ZA 4NZ5A 3NWRA 4HCLA 5BW6A 3GBDA 2HJPA 2HSAA 3HG4A 1QK0A 4JTUA 1H3GA 3TTYA 3GB6A 1EF3A 1YHTA 4JQ3A 1S5WA 3AISA 4IXXA 2XSBA 4RW3A 3WUEA 4C90A 3UWYA 3THUA 4WR3A 4W8AA 3PBGA 4KFPA 4QJ3B 2QF8A 2CXEA 4OFCA 2J25A 4PE8A 4TTUA 5A95A 3N13A 1PUDA 3NOEA 5D8ZA 4LS1A 2F61A 3XINA 4MB3A 2I17A 2PS2A 4NZJA 1DOSA 3N17A 3WQEA 3H4GA 3L7RA 3W38A 3FVMA 3O6AA 3B8VA 4C6CA 4AY1A 2OSYA 3E5BA 4ROPA 5H2ZA 5FF4A 3VMOA 1ZAJA 1F3WA 2O4QA 3TXZA 2GSHA 5B7YA 3WN6A 4UQBA 3P82A 4LXFA 1CBGA 3E0WA 2D73A 2VT0A 1JI1A 2ISWA 4A35A 3N3TA 3TTEA 4AUBA 1B3XA 3P62A 2YL9A 3UR8A 1JCMP 1OT2A 1X98A 3CWOX 3PB2A 2VNCA 1FTXA 2CYGA 5K4XA 1JXJA 2VR4A 4GG9A 1ELSA 3LMYA 3EPMA 2ONEA 1T8XA 4OECA 3UG8A 3S6DA 4FX8A 3UPMA 1V3HA 8A3HA 5ECVA 4DLFA 2ZX8A 4B9YA 5DN1A 3QKEA 4A8RA 2BLEA 4B5VA 1JPHA 2GGGA 2VC6A 3UG3A 3MSGA 1A50A 1PIGA 2ZDSA 3PY2A 4IPIA 2VEPA 4J3TA 2OGJA 4U2ZA 4DVOA 1NAL1 5LNVA 1SSGA 1H7NA 1W1A1 3EEGA 4MFDA 2PLMA 2VGFA 4NVTA 1UWIA 4PUDA 1GQKA 2O9TA 2QQ6A 5FCZA 4PMXA 4B5UA 4FMVA 5A8PA 4QLJA 1HZYA 1JUBA 1BSIA 1KA9F 4M5PA 1AD1A 4JNMA 1M04A 1OABA 1WDWA 2RAGA 2ZE0A 1JUKA 1VCVA 4PBEA 3GHRA 4I9AA 1OX4A 3HJZA 4S3KA 2O7SA 1M6JA 3M0VA 2O55A 3G3MA 4LV4A 1G4EA 1TUFA 2QCEA 1C29A 4DO5A 1YNPA 4A29A 5I24A 2Q3RA 5LGZA 5CPNA 2MANA 3WNKA 1DE5A 2DVTA 3URNA 3MMUA 2PRMA 3CO8A 4U2YA 4HBKA 1IHIA 1UPPA 3IVUA 2D2OA 3DHDA 2NXGA 4MAVA 1O1HA 3VIFA 3PC0A 4H8UA 1VB9A 1XXXA 2A21A 1FWJC 3L0NA 3UETA 4O52A 1PJ9A 1EEXA 2EEXA 4DRSA 3MZNA 4DUWA 4I6VA 3AUJA 1TMQA 4PUUA 2OEMA 2OKTA 4YYCA 4ZFCA 4ZL1A 3OGRA 2C79A 3GFYA 3VUPA 4E8CA 2DH2A 4HNNA 3TXVA 2Y62A 3UD6A 4CN6A 4D8AA 4EF8A 1GKRA 3E2RA 1VFHA 4HU8A 4HZ6A 4GIRA 2XDFA 4JTRA 4ORMA 3W81A 3AHYA 1DORA 1V77A 4A3HA 4XZ9A 3GBEA 1PB0A 5A6JA 4LH8A 1F6PA 3AC0A 3KHJA 1Y65A 2WMIA 2WSRA 4GC3A 1YKWA 1VJIA 1EJWC 4D6IA 1IEIA 1A3HA 1FHUA 3PZMA 2WQDA 2C71A 5BRQA 4O1DA 2CBIA 4F79A 3ONCA 4TX9A 3S5ZA 1Q4NX 3OYZA 5CPMA 4GX9A 4YHGA 3PPGA 1SMAA 4Q33A 1AZ1A 3HPZA 3LZ5A 2NVCA 3W85A 4MY9A 4Z2LA 2ZUWA 2FLIA 1VPXA 4Y7EA 1S46A 3T40A 4AD0A 1VHCA 1ZNNA 1NOWA 1T5AA 1YDOA 1V6WA 3DFNA 2Q8ZA 1Q2RA 1EUNA 2HBVA 4XZLX 3KBNA 1H51A 3W1LA 4RX0A 1P6WA 1JVNA 3DUGA 3WH9A 2ISFA 5EFFA 1QW9A 3AXHA 2XIJA 5JUVA 1HP4A 4Y9PA 4W7VA 1XYAA 3AS2A 3MVIA 4OOZA 4I7WA 5H6HA 4DNMA 4GY1A 1S2AA 3UYCA 5ECUA 3WLKX 4NYUA 3EDFA 2WLZA 3O1NA 3MKCA 3B0VC 2F6UA 5DMYA 1ZU8A 1XLGA 4B2DA 4LC6A 5CPSA 4XUGA 1B57A 2FZMA 1KM0A 1Q63A 2NUWA 4L6DA 2QJIA 4W7UA 4O15A 3RHGA 2VCAA 4X2RA 5FOOA 3QEZA 5CSYA 3UZXA 1XL9A 1FWFC 3HPAA 3RLHA 1HP5A 3H2NA 3L4YA 1RP8A 1YE4A 1H41A 1KFLA 3O6CA 2QJJA 3ARPA 3H23A 2NSXA 4B5TA 3T6CA 3LI1A 3EXTA 3W84A 1KCZA 1I2PA 3T8QA 3B04A 4YIWA 1E0TA 1MI3A 1K6AA 3LGGA 4C65A 1WXZA 3P81A 3GNDA 3RPMA 2O7QA 4O19A 1W5PA 1PZ2A 4H9TA 5FD0A 2E09A 3LHYA 1GVYA 5LKYA 3PTMA 2VWTA 4CU8A 1EOMA 2WZHA 3FSUA 2A7PA 4PCNA 1JZ5A 4IMDA 2V3GA 2GQ3A 3PZ9A 5AC5A 1TPUA 1P4CA 4JFSA 1W9BM 3MUXA 5KEZA 4DJFC 2QCDA 3HQPA 3BMXA 1TELA 1HO1A 2YDSA 3UZJA 3NPVA 3WKZA 2VR5A 3BV4A 4CD5A 2BOGX 4WDTA 2PPGA 2OX4A 4GNKB 3VD4A 4JX6A 1JIBA 2VGGA 5CC5A 1C90A 4CQ9A 5IOBA 2DT0A 4KGJA 1OZQA 3A5VA 2GOUA 2PDNA 2F84A 1A53A 1SR0A 3ZVHB 3H26A 3URQA 1FBAA 4YU1A 3NL6A 3MHFA 3UF9A 1JCTA 4L64A 4EP8C 3O06A 1Z9AA 1KFEA 2JIEA 4F40A 1G4SA 2YOCA 3T08A 1CXHA 2OLAA 2Q02A 3IJIA 2WAGA 1D3HA 1XYFA 3GZ3A 1T8QA 1DBTA 2INEA 1BG4A 3SRKA 4QG6A 1GG1A 1G9HA 4KIRA 4XKMA 4A3UA 3G5EA 2PDCA 1SYTA 1OFAA 1JDAA 2BVWA 2NV9A 1RSCA 3TJ4A 3DBPA 2ACSA 1A5MC 2JEQA 3GNNA 4UFMA 2BGNE 1VFUA 4JTDA 4Z1AA 2PGRA 1JYXA 1PWMA 2BBFA 4RK8A 4LAOA 4JTIA 1QUMA 1I0DA 1AJ2A 4L4OA 1OGBA 3IJ9A 1EJTC 1ZLPA 4AVOA 2OO0A 3R94A 3CL7A 3TSDA 1H0IA 1QRQA 3ALFA 4FR1A 5RUBA 4WOQA 4B3KA 1P6BA 3B40A 3SCVA 3SY5A 3UWQA 1U30A 3UNTA 4F0RA 2CKRA 5EGRA 3KW3A 1RQHA 4IMGA 2E6YA 2WVSA 1TWDA 3DFSA 5XINA 4W84A 4EF9A 5F4SA 1V03A 1VCFA 3L4VA 1YTEA 1O95A 4DUXA 4GVIA 1UQZA 2HISA 3CL6A 3HM7A 4U3CA 3TYAA 3K2GA 3SFWA 4YVVA 1JEZA 4RDYA 3RR1A 1UP3A 3W7KA 2DUZA 3I10A 1DHPA 3QHOA 3CIVA 3ZO9A 2A4AA 1GONA 1YNYA 2WC7A 4AZCB 1E4LA 1YXDA 2PP3A 3TN4A 2RJHA 1KQYA 3S4TA 1E40A 1JPIA 2C1IA 4M24A 1L6SA 4TVDA 5GJNA 3T9PA 2YXOA 4XUYA 5DT5A 4CUCA 4BJHA 3QGAC 2BSLA 4S39A 1ZHAA 4ZENA 4Q7NA 3MCOA 4JQAA 3VFLA 2YLLA 3MJYA 3WH5A 3AHXA 1N2VA 4AC1X 1HN1A 3PWAA 4G7FA 3WNNA 4DEFA 4Z08A 3ES8A 2GJXA 2ACUA 3L12A 3E0LA 3VD9A 3P7YA 1K03A 4O54A 4UTIA 3AMDA 3PR2A 3UT0A 4R9XA 3W2KA 3ARVA 4QFUA 5BXSA 4NRSA 4PUMA 2J75A 2J6XA 2HXTA 3QZ6A 4HPXA 3UPWA 3WH8A 3GY1A 5H1WA 4ALDA 2WNQA 3R0UA 2GFTA 3OZMA 4TOQA 4MNKA 1BRLB 3V35A 4Y9OA 3MHGA 3P5YA 2TYSA 3IGSA 4LBSA 3TZFA 1OFRA 3M7SA 3WDIA 3UGRA 1W1TA 3L23A 4O1EA 3WCZA 2Y7EA 4NAEA 5DO8A 4LB4A 4A8NA 4HMEA 3A4XA 3GYCA 2BOEX 3E49A 2R1PA 2Z7KA 3AI0A 4MJZA 3I7RA 3RIKA 4OIFA 3VVGA 5DXXA 1PDYA 1RZMA 3VI2A 2VXNA 3CTLA 1ONWA 1JUEA 3WNMA 4TX8A 2C18A 3LZ3A 2W27A 3RM4A 4QS6A 1EC8A 3KOZA 3ITXA 3KTXA 3M16A 4Z1DA 2R94A 1V0LA 2FDSA 3ITYA 1TWIA 4A2RA 2YCEA 2WO5A 1WB0A 4KRUA 3GVGA 3MHUA 1OYAA 5C9UA 1QHZA 1S2VA 1W1IE 3B0YA 3K4AA 6CGTA 3B9EA 5G1MA 3LQGA 4PULA 3A3XA 2E4TA 3VDAA 4GE8A 1BYCA 3M0IA 3SIZA 4L6HA 2ADAA 2ZFAA 4AMAA 2AKZA 3QV9A 5G2IA 3FXGA 2GGEA 3PULA 1LG2A 3D6NA 1VJZA 3KOFA 4JTJA 3GTNA 1NJJA 4R53A 1LF1A 4XZNX 4F2TA 4MYXA 3B3DA 4IJBA 1RJRA 3GWQA 3U9IA 2VFEA 2WM1A 1UHVA 3DFQA 1XKJA 2W9MA 2HEJA 5IFTA 3CEUA 4NQ1A 3IAPA 1M65A 5I0DA 3L4UA 1WKEA 2WMIB 4O16A 1UUOA 3SM0A 1TPH1 2WK2A 2DZBA 2E6DA 2YCKX 4NNBA 2EG6A 3LY0A 2NX3A 3VZYA 2TPSA 3GM8A 3GXNA 1UC4A 4V1XA 4UTJA 5M1TA 5REQB 4U10A 3KE0A 5E09A 1VD6A 4KGLA 2Y89A 4DXXA 2ZXBA 1ME7A 3R0DA 3TWAA 3W1NA 1E3ZA 1V6VA 1ZAIA 3FJNA 4EPBC 4TX6A 3QSTA 3EX2A 1QW7A 1XYMA 1TV5A 2PDGA 1W37A 3T0BA 2X2YA 4GYPC 1A5AA 1FCQA 4LEFA 1IZJA 3FEQA 4QE4A 3DFHA 1W1PA 5KTLA 3T8LA 3HU7A 2GJXB 2DSKA 1P0BA 5KSWA 1OCNA 4HB7A 2AMGA 4GXWA 3W25A 4PUEA 3SURA 3BANA 4MTVA 3UJRA 5I7GA 2G3NA 1W3HA 3W1XA 3GUGA 3HA1A 3VZXA 4Q4OA 2A3BA 3E96A 1W1B1 3C2FA 3N12A 3GS6A 4TV6A 3PZTA 1XV8A 3A47A 2EPHA 4IP4A 3S6TA 4PTNA 3SQLA 2VMFA 1XI3A 3KHDA 3NM3A 1S1PA 3N9KA 2E68A 4JTEA 4D6FA 1C8VA 3DU0A 3WFAA 4QX4A 1DTUA 3CH0A 1UWSA 2O9OA 4XISA 3KZSA 6XIMA 1E6NA 3MV01 2EBNA 1LM1A 3W76A 3QFWA 4PMNA 3WG6A 5DT7A 1W3NA 1YLVA 3GDLA 1A5OC 3QQ1A 2CPUA 5F2IA 1X97A 1E43A 2PWFA 2V5DA 3CIXA 3ANUA 3WIJA 5LNWA 1LOSA 5F2MA 3E6EA 2WHKA 2OEKA 3E0FA 5AN7A 1GVOA 1X1ZA 2ZA3A 1TJ0A 1F2JA 5HDRA 1DJIA 7TIMA 1XLCA 5CKSA 5DMLA 3B4UA 1XYZA 3H55A 4Q6XA 3H4WA 3GHUA 1LBMA 3EA3A 1M7XA 2GL5A 4KS0A 3PBMA 5CCZA 5GPRA 4N2YA 4V1YA 2DVXA 5EYWA 1C91A 3BMWA 3TX9A 4X2PA 1SJCA 4JN6A 3THDA 3FIGA 2YL8A 4Q8NA 5FJRA 3HIJA 3M0JA 2XHYA 4IH3A 2VX5A 4DBUA 4C5YA 4PSRA 1RCOB 1ZFJA 4EAMA 4PMVA 2FJKA 2ZRYA 4DQWA 1A5BA 2W79A 3R4IA 3BLKA 1K8CA 4DJFD 1I60A 2FKPA 5BMXA 4IMEA 3QR1A 1PYMA 5KZMA 1P0EA 3N2BA 3AYVA 2PDWA 4QDWA 4YNGA 3TVAA 2XG9A 4O53A 1ZCOA 2OT0A 4UTTC 2BX7A 1IWAA 3BCFA 3WLMA 1JXKA 4HOWA 1E9YB 2CETA 4AYGA 4NXSA 1GKPA 4JTSA 2V69A 3WQOA 1PCKA 1BEUA 2HPIA 2WLYA 1NFPA 2ZKMX 1UR4A 4HTYA 5CPOA 3O6DA 5TNVA 3W2JA 2QDEA 3OHMB 4A21A 5FAGA 1GJPA 4J40A 3OOQA 1ECQA 5IDZA 1NWTA 1Q6DA 3IK2A 4GLEA 3C6CA 3PPHA 1QI3A 1WPCA 2OQLA 4ZTYA 3PUEA 1RCXB 4W7WA 2VR2A 3EYPA 2PURA 2SFPA 4QITA 3TYUA 1IEVA 2WSKA 5A2BA 1WZKA 3VD7A 1V6UA 3AAMA 1TV8A 2E9MA 3GR4A 2X1IA 3H7VA 3DG7A 3SQSA 2DVUA 3IACA 4LAZA 1IF2A 5FJTA 3E0IA 2QCMA 3H2AA 1UZDA 3TV8A 1GTHA 4B2DD 1TZ7A 3GXDA 4QJ1A 4EXAA 3IJDA 3GNRA 2CLIA 2VOTA 1HJQA 4ATWA 3DH7A 3I3EA 3UESA 4TIMA 5BXTA 3EX1A 3LK6A 3DFPA 3P8JA 4Z1CA 4IFRA 5BU6A 2WKJA 3WNOA 3V16A 4D1IA 2VFHA 3BCDA 3Q65A 3HG3A 1V0MA 3IJ8A 3SCNA 3L4TA 1FWGC 2NVAA 3W23A 1TJRA 2A1YA 2EGZA 1M41A 1RVKA 1IE7C 4BF9A 4PCPA 2NQZA 3IIVA 3SUUA 3TMQA 1RD6A 2R14A 4GABA 1PBGA 1XUZA 3KOYA 3LUTA 4FZIA 9RUBA 1OCJA 3M5YA 1Q2SA 1SO4A 4IGHA 3ZWTA 3BSMA 4JHZA 3TNBA 2FZ9A 2OB3A 3PG8A 4AC7C 1O6IA 1X6LA 1HQTA 4J7RA 1SW0A 1R87A 2PBGA 1TMHA 1AK5A 1ECEA 3CZLA 5I00A 5DY3A 1CXKA 2WSPA 4KF1A 1ONXA 1E3XA 3VX0A 1Y0EA 4D1JA 4CKQA 1TE1A 3I4EA 4HNVA 4IHCA 4RZ6A 2MUCA 3TTSA 5A6LA 2VTFA 3N3MA 2OWXA 3T2OA 3PUOA 1HIZA 2WC4A 2V2DA 1L6GA 4XO6A 4PYSA 2VX7A 2RFGA 2W61A 5HMSA 2G97A 2ANUA 3W24A 5GJMA 1A3WA 3OIHA 5CBIA 1TX2A 3CUGA 1XBVA 3R89A 4QJ5B 1EWEA 2E9BA 3ZLHA 2AAMA 2O56A 4I5UA 2IMRA 2J13A 4D71A 4RXGA 4GHRA 4ZQNA 1A4LA 5K9CA 1F3EA 1W9DM 4P5UA 4TUFA 1SZFA 1DKWA 1I1XA 3QYSA 4RNJA 2PA6A 4MDPA 4JIPA 1ISYA 1EKOA 1O66A 3KVMA 1KTNA 2VRJA 2YL5A 4Q8UA 1O12A 2ZZ1A 1VEOA 3IIPA 3RILA 3I6TA 4LGXA 2VI0A 3BLIA 4JIRA 1DJNA 4U4MA 4UTWC 3GTFA 4YTQA 4V28A 3WLTA 4J2MA 2E8YA 2YCIX 1E56A 1O94A 2Z2AA 1O1ZA 3W27A 1OX6A 3BJTA 1BGGA 3W70A 5GJPA 1RBAA 4I8YA 3REQB 1UH3A 3PN8A 3ABQA 2OWWA 3T81A 2XH7A 3PPFA 4H6EA 1DWHM 1EC9A 1F3TA 4F9JA 2QT3A 1LQAA 1K02A 3STEA 1ODUA 1FHDA 3TWBA 1ISWA 3NR0A 4M56A 3GHTA 1XGEA 2DGAA 3UWVA 2D20A 1GW1A 3RN6A 3TQPA 2GVLA 3UQNA 1L9WA 4JN7A 4KRTA 2J74A 2EAWA 1S5MA 1OHLA 1PS9A 3FA4A 4O8AA 4YXGA 2DZAA 4ILSA 2ZUTA 1KO0A 1AUSL 1UKQA 1E0XA 1S3HA 2QV5A 5E93A 3FLUA 8XIMA 2RGLA 4GH3A 1EF2A 4HZMA 3SGZA 1J6OA 5CXPA 3W87A 1NDWA 2Z1WA 1YQ2A 2PC8A 1VRXA 3QTGA 1GWJA 3RG6A 2BASA 5IRPA 3VIMA 1FCVA 5G1TA 5D2YA 4NZ4A 2PGFA 4KERA 4TVUA 1AJZA 4D6HA 1YX1A 3DC0A 3AIEA 4K6AA 1Z42A 2F9RA 4RKAA 2Y5SA 3SY8A 3FK4A 2GLKA 3HF3A 2POZA 2Q3OA 3ZR6A 1NDYA 4B5NA 1EDQA 2PWDA 3FA3A 3S5YA 3VUSA 2BVDA 2FB2A 3KP1A 3NO5A 1X7FA 2XM1A 1R3VA 2E77A 2HBXA 3ZT6A 3ZT7A 2VUYA 3JW7A 3S9YA 2A6NA 3CQIA 3BC9A 3NGJA 2C19A 2OZ8A 1J2WA 2B0MA 3VC6A 4DBEA 5ABFA 3U4AA 3FY1A 1H1YA 1HJXA 1RK6A 3WUFA 1T99A 5A2AA 2AGTA 1VBHA 4PMUA 1VAHA 2CERA 1UC5A 3I4KA 1FCBA 3THCA 3N25A 1SZGA 3KBVA 4IT1A 4UMCA 5BNKA 2GPTA 2O4MA 3HGRA 1Q6EA 3PHAA 3S6OA 4KQNA 3VILA 5C6MA 1E1FA 3W2LA 3AMKA 1US0A 3LXCA 4PRTA 3VMPA 3UEQA 1H7XA 1WKFA 3LCXA 3RX3A 1QBBA 1PX4A 5BRBA 1MQPA 2VENA 2BHUA 3DECA 2ZXQA 3WQ5A 5FEXA 1OIFA 4QQUA 5TAOA 3W88A 2ZDRA 2GJLA 4H6RA 2QUUA 3RX4A 3CIWA 4WJXA 3KEHA 1RY0A 4QIUA 3NQCA 3TAOA 4GIYA 3K4WA 2QUTA 1HL8A 4KWVA 1JAEA 1OF6A 1EO7A 1B3VA 2G3FA 2FVKA 5G1YA 3HFTA 2V82A 5A8MA 4ZVJA 3WMCA 4AHQA 4F2UA 4I5RA 4UXDA 3GDRA 3QR0A 3LA4A 2J78A 1R30A 1W3TA 3PS7A 3E3HA 4DWSA 1F73A 4GVGA 3PG9A 3H7RA 3UWUA 3M0HA 1AH3A 4XG1A 2BODX 3QV6A 1REQB 4E2DA 1KV8A 2PF8A 4Y2WA 2J7EA 4M1RA 2CLFA 4LAKA 4S2BA 1M7OA 3ZWSA 3H53A 4IF2A 2PWVA 3TC3A 2PTYA 3EAUA 1YE6A 5HR6A 3NXLA 5K2ZA 4EIVA 1DIDA 3URAA 2PDKA 4Q6JA 5I3HA 4NZ3A 2DPEA 3AJXA 4F0KA 3GD6A 1UUQA 4AFYA 1IT0A 2RDWA 3MSDA 4XSLA 5I03A 2YBVA 1ZJHA 3CXOA 4QG8A 1NSJA 1ADSA 3WMSA 1A5UA 6PTDA 2DZUA 3BXWA 1XF0A 2VRKA 2Y7GA 1CNVA 5D38A 1QPKA 1K9FA 1UH2A 4HJWA 4LYKA 5D9NA 2DZPA 4M82A 2P5NA 3UY7A 1K8ZA 4GYPA 4UBPC 4CD6A 5FEPA 5AECA 4LCRA 4CNTA 2BVYA 4A8LA 3GDMA 4BI6A 2QCGA 4UUIA 3ZQ9A 1F3XA 3B0UX 4V27A 3EDDA 4JIEA 1QWKA 4HOZA 2IPGA 3AYTA 3TIMA 3VNZA 1Q45A 3GO2A 2V5JA 5FA5A 4ZXOA 2NSOA 1KM6A 2OQHA 4LRSA 3GZAA 4DJDC 3O0FA 3VGEA 4UTMA 1S5TA 2YGYA 2Y88A 4OV4A 4JYEA 2GZXA 3CAQA 2GK1A 3N73A 5EMKA 1Q4WA 1VLWA 5D2XA 3QMTA 1DIOA 1G01A 1KGWA 1WZLA 4H8HA 4DAIA 4N9CA 1K3UA 1EYEA 3WLLA 1HJVA 2QDGA 3U7BA 3PB0A 2FH8A 3SCUA 1GKQA 3A21A 2UV8G 3K46A 3SSZA 1FQ0A 3SQMA 3LM7A 3NZGA 1CECA 1WZMA 4AAJA 3FHQA 1UD3A 2DW7A 1W2PA 2BHYA 2JF7A 1AD4A 1FP8A 3FJLA 5XIMA 4FA3A 1HX0A 1NELA 4HNOA 2GDVA 3BPWA 1BLIA 1X38A 1QVBA 1OY0A 3K8LA 3CAVA 3KFTA 3S0CA 2OSXA 1GTEA 2C13A 1TVLA 1PTAA 5MKGB 4CCCA 2W92A 3F4CA 4E8GA 5AZ1A 1FWNA 2FDMA 4NJKA 2PDJA 3HV8A 1OYBA 1J0HA 4UQ9A 1CGTA 4LUIA 5LNUA 4I6KA 3S1XA 2CC0A 1EL3A 1JFXA 4K8GA 1POKA 5HMFA 3ABRA 2UY2A 4O1CA 1YW1A 3T0TA 2E5BA 1W5NA 1M3UA 4DELA 4WD0A 5C9WA 4KWSA 4CCEA 1KCXA 2CWNA 2NW0A 2HS6A 3A9BA 2FB3A 4Y9MA 2CZ5A 1SJBA 4LB3A 3CPRA 1K77A 1W2VA 4CQBA 4EOUA 4LSBA 1MUWA 4MUZA 4O4VA 4UNLA 4PTVA 3P6LA 2A2IA 2FIQA 1K7XA 3S1GA 1J0JA 4JQ1A 5CLWA 2HK1A 4PC8A 3NPWA 1R7AA 4PZVA 3VKKA 2O9RA 3SUTA 4EKJA 5I79A 2VQTA 1Q7MA 3WDJA 2HE8A 2QCNA 1FWSA 4PR4A 2VEMA 3GDKA 1SPQA 2UZ9A 4JIQA 1VFOA 4C1NB 3H2FA 4IM4A 2XJ7A 2BY1A 3J7HA 4R9OA 3PZVA 1EQCA 3W74A 4XD6A 1TE6A 2VC7A 2QCFA 5DBTA 3VINA 2JK2A 3SCTA 4YVXA 4ZMGA 3LLXA 4MIMA 3H54A 4GJJA 1R3WA 5BWFA 2G95A 2V63A 4UNIA 3T4CA 3OP2A 2X05A 4IMAA 3G6MA 4IMFA 9XIMA 1IQ8A 2OEJA 1OC6A 4E38A 3AIQA 2OELA 3ARUA 4QCEA 4E6MA 1LT8A 1QBAA 2I9UA 3VK5A 3AZRA 3HQ1A 3LI0A 2Q6ZA 1BPLB 4UZSA 3TE9A 1GEQA 4HK7A 1CW2A 2OG9A 3VX1A 1OG6A 1H7WA 1DP0A 3W22A 4IX2A 4C1NA 2BFGA 3TW7A 3QRHA 5HQEA 1F7BA 2YKKA 2Z1BA 1RY8A 3VCRA 5BZAA 4WVXA 3MS8A 1R5YA 4I9JA 2XIOA 3RX2A 3BGAA 3KXQA 2GVYA 3AU6A 2P88A 4ICNA 2BTMA 2XH2A 5JIPA 1XLKA 1I6NA 2YXGA 4RNIA 1HKKA 3TFCA 1EZWA 1PV8A 5E1QA 4PMYA 3LTSA 3FKRA 7TAAA 4WUIA 1CGXA 2XGZA 3W72A 3P2VA 3STGA 3L5MA 2QMKA 1R3RA 2UY5A 4L1GA 4R7WA 4OUEA 4MZ8A 4A3RA 4HCDA 3LHUA 4B90A 2IKIA 1KCKA 4FXRA 1QNQA 4EACA 1FFRA 1UR8A 4UCGA 4PFMA 4Y6GA 1OX4B 2E1WA 2OZ0A 5TBOA 4WQ6A 1KB3A 4DPPA 2QNEA 1KRBC 1SUXA 2ZUNA 4KETA 4LUYA 1VF8A 3PBVA 2RDTA 3OVGA 2VURA 2OU4A 4Q4PA 2CKSA 4LUSA 1LL6A 4ML9A 4UOQA 4U33A 4ZQMA 3BOFA 5E0FA 3QTPA 3WNLA 3WJXA 2QDDA 1KBLA 1P0NA 3R25A 1TRIA 3PUDA 3ZJ7A 3PBWA 3BE7A 3U4FA 5SWUA 4PRRA 4JY8A 1LL4A 4QJ4B 1RPXA 3AS3A 4C1LA 1FXQA 3LCGA 3G1XA 5FIPA 3UVIA 1Y7VA 4AF0A 4MVAA 2PC4A 3NQEA 3VYLA 3NYDA 5JH2A 3MTWA 4GXMA 1JR1A 1BXBA 5I2UA 2QLYA 1LOLA 3OZOA 4PBFA 3SN0A 2NLYA 3SECA 4BQ2A 1A80A 1HG3A 3VDGA 1FH8A 1XFCA 3VABA 3UG4A 4EANA 4BI5A 1VQTA 4URIA 1LRQA 3N9RA 1MSSA 1TA3B 3UA3A 3OA3A 3G0SA 1WAWA 1EJUC 1PIFA 3VDCA 3KDOA 3HGSA 1LL7A 4BQ4A 3NSMA 3NXFA 4IQEA 2ZTJA 3QQWA 4I7VA 4Z0JA 1GZJA 3T78A 1JPMA 1V3LA 3A24A 4GUIA 1NVMA 2H9AA 4GFIA 3OZYA 3RPDA 3S5OA 3WK1A 3TOYA 1YPIA 3CPGA 3ZJKA 3KBWA 3MUIA 4RDWA 3WLSA 3CUIA 4YTTA 3R11A 3ZLFA 4D6CA 2FFIA 2B4GA 2E6AA 4CQCA 1Q5MA 4BZYA 3ZOAA 4LPCA 3T2QA 1PO9A 1XIBA 3SW6A 2ZYFA 1YDVA 3ZJ8A 4AWEA 5DXYA 3P80A 4H01A 4JNZA 1ZENA 5HULA 5HK4A 3SUVA 3IV3A 4GISA 4IIGA 1CYGA 4Q7BA 4LYRA 1Q65A 4ZODA 2DQXA 3QGKC 3UGVA 3VGFA 3GVRA 2IUZA 4OBSA 4S3GA 1GVIA 3T05A 4ACYA 1VP5A 5DLCA 3S8HA 4IPJA 1MO0A 4GQBA 3IK4A 4B3ZA 1XCWA 1WNOA 2C6QA 2XVGA 3LD5A 2RUSA 1OCBA 4Z1YA 2CLKA 2Y6ZA 3P84A 1XIJA 5CG0A 2Y85A 3PAOA 1KFJA 1K9EA 2P0OA 3NURA 4O28A 2BB0A 1ISXA 3CYJA 1DXIA 4S23A 1GOIA 2ZRWA 1NP2A 2REQB 3GKFA 2JBMA 3UY8A 3TLLA 7CGTA 1MW2A 1GJUA 1ITCA 1CLKA 4O0KA 3QGVA 3HPXA 2X0YA 3CAWA 3DFOA 3OJGA 2WCAA 1U1JA 3CB3A 3AMGA 1PPIA 4L7ZA 1BG9A 3UA4A 1KM1A 4JZ5A 2J7BA 4L6OA 4HNTA 4KT2A 1TPFA 3HGOA 2EF9A 1KNWA 1IXOA 1XRFA 3JU2A 3DAQA 4WSKA 5LIWX 1IXPA 3F4VA 3Q4DA 4XWUA 1E71M 4HYRA 2A5HA 5CZKA 1W9XA 3VIKA 4DF2A 5BOFA 3PBYA 2ABAA 3WLHA 4TTGA 3VA8A 2V3FA 1JPDX 1ZBKA 1BKSA 3MANA 3I7SA 4BR1A 3VNDA 1K9TA 4WKHA 3SCWA 1Q6RA 4JDBA 2F7FA 3PJXA 1DEDA 2XTKA 4G7EB 1VIZA 4QDMA 4HNLA 1E6QM 2YA2A 4JTAA 4B3LA 4QS5A 4V15A 2TRSA 1Q6QA 4H2HA 3U48A 5BXPA 1XLDA 3TA9A 3IIZA 3V1PA 3PZQA 2BP1A 4HIBA 4JQ2A 4IFKA 4UB9A 3VO0A 1AVAA 4XAYA 2EKGA 3K1GA 3RLUA 5M03A 1RH9A 4JTQA 4LYPA 2OZTA 2J7HA 4AIOA 2PDYA 4MNMA 3VKAA 1WOAA 3QPYA 3DGRA 2Y7DA 2PD5A 5AYYA 2BOFX 2WOQA 2FZBA 4G56A 5GNYA 3W7CA 3OG3A 3QPZA 1K1DA 1RBLA 1UR2A 3WQVA 1CXEA 1DWJM 2GVEA 3EDJA 3OA5A 3VOGA 1QNRA 2OVLA 1M01A 1GVFA 4N42A 5A6BD 3WK3A 3ANYA 3AIBA 3CWNA 4M6UA 1GJWA 4C7GA 4O11A 4IISA 4ACZA 4C6NA 1C3FA 1FDZA 3G1FA 4UWMA 5I5RA 3FYOA 1MZRA 6ALDA 1XIEA 3NZQA 1GQIA 4IUGA 3KX6A 2YXXA 4PMJA 4ASTA 4TXEA 4FALA 5IM51 2CXGA 4TV5A 5L9FA 3TSBA 3VNJA 2O92A 3ITOA 1MXSA 4KMQA 3LYEA 5T91A 3DKLA 1QR7A 3W7NA 4REQA 1L6FA 5A6BA 1LLWA 2E67A 3TW6A 1EDGA 3QXBA 4YHEA 1B4EA 3IAQA 3W7IA 2C8NA 5KZ6A 1I9CB 2Z1KA 1OK6A 1XFBA 4S3JA 2P3EA 3OLGA 4K8HA 2VL4A 4WIWA 5ABFB 2XSAA 1R3YA 2E9LA 3B97A 5CAHA 3FXYA 1PTGA 4P61A 4X9YA 5LXEA 2GVJA 4OHQA 5CPQA 4ZOAA 1H2JA 4BQ3A 1FFQA 1IYXA 2WM0A 3MJMA 4AVFA 2PLJA 4QISA 2C15A 4Y9NA 2OYMA 1H62A 5I09A 3BH4A 1LBLA 3CK5A 4WK9A 3WJYA 4KESA 4CCDA 4BS0A 4DJEC 3GFXA 3W6LA 4FO4A 5AVHA 4A8IA 4PUNA 3TP4A 1JCLA 4IGSA 1KXHA 1OCQA 1C7TA 1KRMA 5L6UA 3VMNA 3C52A 3W83A 4MY8A 4JYFA 3WQWA 4OKDA 4JFWA 1GVEA 1YBQB 3N2MA 3LXBA 5B80A 3S9IA 2AAAA 4DO7A 1US2A 4Q8QA 5E9XA 2DIEA 2ZIDA 1XRTA 4A4AA 5A1AA 3KZPA 2QGHA 3IPWA 1ONRA 3TH6A 2OSWA 1PYFA 5CJMA 3RAOA 4NP7A 3QH2A 2ZRUA 1KXVA 1TVNA 3EA2A 3LBMA 3N2CA 1TQXA 3KLKA 4IUOA 4UTKA 1GORA 3G8EA 2WMGA 1K4HA 5AC6A 7REQB 3ZR4A 2PAJA 1FWHC 3WH7A 4Q4MA 3MW7A 5H8PA 2QUMA 1JG9A 1B1YA 3U8GA 2EJAA 2IXVA 3W75A 4ZR8A 2WHJA 2XIIA 2VGBA 1L8PA 5FL0A 6A3HA 1R86A 3A9IA 4HVXA 1XSKA 4PSPA 4UQCA 1IIGA 4GY0A 3RLGA 4MWAD 4UR7A 1PHWA 3IJ6A 2ODOA 1XWYA 5D2VA 5CC7A 1WDSA 3NZPA 1EB3A 2RDUA 4QNWA 3ZZ1A 3WLNA 3USBA 3W7DA 2ZXDA 5DEZA 1ZBCA 3WSUA 1UIOA 3LSBA 4O14A 1LCOA 1UWRA 3O07A 4MAZA 3W9ZA 3LOTA 3N6HA 1QPNA 3CV2A 1I4NA 3CMJA 4UQEA 2V67A 5G4HC 1HXJA 4CGTA 1FWAC 3ZSSA 4UFIA 1JDEA 1XIFA 5DFAA 1NOFA 4E4FA 4ZA0A 1R0MA 3A3WA 4ZFMA 2XFRA 1OJXA 1GCYA 4HD5A 1KCLA 3R58A 1R9YA 2Z24A 3PFMA 2B7OA 3CAKA 1DWFM 3WBYA 3SGUA 2W63A 5E0KA 4E0CA 2VFFA 1K6WA 4UTUA 4RR4A 1ADOA 2XFFA 4JBRA 4P7OA 1GGOA 1UWQA 3OLDA 1AG1O 4GI9A 3VCCA 1JCXA 3F4NA 2BWGA 3V18A 3LEPA 1LBFA 2P76A 2ICSA 3VIGA 1HT6A 4CQ8A 3C0SA 1G67A 4L65A 4F3HA 3KRSA 2W91A 4CNNA 1J9YA 4G1KA 1P5BA 1KQZA 2OGYA 3Q37A 2ATSA 2NUYA 2PDIA 4J1OA 2G96A 3DESA 4BEUA 4HHLA 3S9ZA 3AO0A 3K5XA 4ZOCA 4XIAA 5T8GA 1XIGA 4LY8A 4WLCA 3R8RA 5EMMA 3GDTA 5LGXA 1JDFA 4WDWA 1SGJA 3T07A 3M0XA 4F48A 2PTDA 4ATLA 3WK2A 3W7QA 5BMWA 4O17A 3C2OA 5HPCA 3G1SA 4IJCA 4DM2A 4UTWA 1QU4A 5BOEA 5C7HA 2WVTA 1KBKA 3AHZA 2NX9A 3GXTA 1LZOA 5DELA 4M7TA 2Z4GA 2ZX9A 1G69A 2NQHA 1FDYA 1XP3A 3VNLA 1EHAA 2P8CA 1H5VA 3SY1A 3A3HA 1CX9A 3GKAA 4UFHA 4PB5A 4LCQA 1E5NA 4EPDC 2FHFA 3B05A 1KD0A 5D09A 1GUVA 3L5AA 5AHFA 3ARRA 1R3SA 4NF7A 3TN5A 2ON3A 4HK6A 2R1KA 3AXKA 3KL5A 4L5ZA 3LCLA 4XQ6A 4B5SA 5AHIA 1QO2A 4OTKA 4EWJA 4F2BA 4XD5A 1IWPA 3WEZA 1W0MA 1Y5XA 3H70A 2XM2A 3M6DA 3D47A 4FP1A 1JZ7A 1HJSA 2EPLX 2ZA2A 4DBWA 2DY3A 3AWOA 1N82A 1TJPA 4ICMA 4IGMA 4C6OA 1EPVA 5AHNA 4BWLC 4Q4KA 1BYBA 5D30A 1WUEA 2VFGA 4DZIA 4PEEA 1G4TA 3S1VA 2F2HA 4IIBA 1E1CB 1XLEA 2QCDB 2GQ9A 2ZVRA 3F5JA 1T40A 3U3HA 1PVNA 4L56A 1KWGA 2DH3A 5MHBA 1SO3A 4LF2A 2OWCA 3P0WA 4FNRA 3QY7A 3H2CA 5CQ1A 5JU6A 1MQRA 3GX9A 1NOUA 3PWGA 3WDPP 3H4XA 4OOUA 3WQ4A 1TWWA 1W3LA 1XC4A 1OFEA 1QCWA 4JCMA 3VNYA 3H24A 1MFUA 5A2CA 2Y1HA 1BQGA 3NA8A 4B4HA 3PSVA 4NNCA 2HS8A 3GVWA 3AXXA 2KAUC 2GDQA 3BOLA 3PTQA 5G5IA 1FVPA 3V5OA 2RDXA 1KFBA 4XAGA 4FIQA 3MWCA 1M7PA 2QMJA 4QLKA 4MY1A 1EQPA 3QY6A 4X0NA 4OU1A 3EOEA 1GOWA 1C8XA 3IV8A 4G6CA 1R38A 5JMUA 3W1UA 1GYMA 2DZTA 5C2XA 4DJDA 1US3A 1PDZA 3ARQA 1TJ1A 3WZ0E 2H8ZA 3UWZA 1UWAA 3O16A 4Z42C 3BW3A 3RDKA 4ZSTA 3WEMA 3FEMA 2QDHA 4IOTA 1B3ZA 3WLPA 4M8UA 1J12A 3OU8A 4GACA 5F1VA 1PCWA 3Q2DA 5I07A 4Z2GA 3F1QA 4MSSA 3QSRA 4H83A 3OZPA 4Y8EA 2PRLA 1UROA 3L66A 4Q4SA 1EJXC 2DZSA 2XZ7A 3NQMA 1X6UA 1S5NA 2JIWA 4S3FA 3AOFA 3BMVA 3VTRA 3RRAA 3MZ2A 3R8HA 1B31A 4GPNA 5C9XA 1EX5A 3MU7A 3B9NA 3SRHA 4DX3A 2ZZ4A 2F6XA 1XLLA 4FR6A 5FACA 5AC4A 4GNJA 2Z00A 4RNFA 3GTXA 2NWRA 3CUXA 4C1KA 1A5SA 3M7WA 2A79A 3OBKA 1XCFA 1DE6A 4LX4A 8TIMA 1W8GA 2YDAA 5FSDC 5EKYA 4P8VA 1KBIA 4YCPA 1EIBA 4LF1A 1AMYA 1BQCA 2J7FA 2J9XA 1QI4A 4ZBCA 5AB3A 4JTFA 5LXXA 5JVLA 2QF7A 3G2GA 3O0KA 2HVOA 3ELFA 3QMRA 4AD1A 4MNJA 2WWCA 3ZLGA 4DJED 2PP1A 3AWNA 3MKVA 1MZHA 3AJ7A 1NQ6A 1M5WA 3UZ5A 3KCOA 4R3UA 3ITTA 1G7UA 4ZTXA 3GIYA 4M51A 1X8CA 4CN1A 3K30A 3PZIA 4R7JA 2FZDA 1GOKA 5AYXA 1JI2A 4GRSA 4IJRA 3GR8A 1XIHA 4IZGA 3ECQA 5JBFA 1FOBA 1BHGA 4W4QA 3ICJA 5IBXC 1TCMA 1OQFA 3ZJ6A 1UP0A 4FK9A 4J27A 4DPQA 1HKJA 1QAPA 5JBDA 4MOZA 1G7VA 3KL0A 4LALA 5A6KA 2CLMA 1TB3A 4HSOA 3CQ0A 1H61A 5K7JA 2WZEA 2WZIA 2DDXA 4YVPA 3BQ6A 5K3VA 3VDHA 1UG6A 4GINA 3ZSTA 3TOPA 1ZL1A 1WDQA 1QASA 3IUIA 1RVGA 1XLJA 1WDDA 3NNTA 2XGIA 2C1GA 4AZCA 2HVNA 3N4EA 3QC3A 4OVXA 3B9AA 1ITXA 4PEKA 5CZ0A 4MADA 4Q8VA 3LPPA 3MUAA 2J88A 4DN1A 1H0GA 3M9YA 3L21A 3ABSA 2UY4A 3QLLA 1H60A 4PTDA 4DUVA 2VFIA 4R5EA 4NG3A 4EPKA 3KTCA 4OJYA 3BGJA 3O7UA 2XN2A 4HU4A 6TIMA 3RU6A 3BJFA 4JKKA 1GQNA 4MB5A 3NYZA 2VO5A 4GBUA 1GG0A 4X0VA 2P10A 1RLCL 1LQ2A 4GQGA 2Q71A 3BAXA 1Q6LA 2DT2A 3BDKA 2V2HA 2Z1VA 1VIWA 1F6KA 1L8NA 2P1FA 4O0QA 4KCTA 1XBZA 5EL1A 4FOUA 2BXYA 2KX9A 4IPLA 3HV9A 2GJRA 4UTTA 3KUMA 1TV3A 1CI1A 3UFYA 3LPFA 1GYLA 4G8TA 4LYQA 1FHLA 2VCBA 4A6GA 3TROA 1K8XA 3PUGA 3XISA 4J3WA 4DF1A 4GKTA 1D9EA 1MFVA 4ROQA 3FGCB 3LCWA 1B9BA 2QIIA 1JGIA 1ZJIA 3TYBA 3OEXA 5FJOA 1VEMA 3T4WA 3CNYA 2IW0A 1XLMA 3RO6A 1OD8A 4FLRA 3AS0A 3NO1A 3N6QA 4JHMA 2V2CA 1XQKA 4LBRA 1KR0A 3T09A 5M3WA 1V6XA 3PK7A 3FJ6A 3E2SA 3LERA 1ZBWA 2WKLA 4U5KA 3RCYA 1H7PA 1XM3A 1GOQA 5I3DA 4KIEA 7XIMA 3VKBA 3KCLA 3DIPA 4H9YA 2ZX7A 4P8XA 3EWDA 3M43A 1EUAA 4QM1A 3KP0A 4WY0B 3G8RA 3MBDA 5B7ZA 1XG3A 2XYLA 3VM5A 2DZWA 4KWWA 4OUIA 1E72M 4EPEC 3HQOA 1EOKA 1WAUA 2WJEA 2J62A 4X63A 3BAIA 3LHZA 3NZ1A 4HCHA 1H49A 1F05A 3KWXA 1PWLA 4G5DA 4PMZA 1TJ2A 4D6DA 4GUFA 1V7YA 3GIQA 2FPTA 3NQ6A 4Z1BA 4MB1A 4KCVA 3ARWA 2X40A 1EZ2A 2B81A 5A6SA 1B4KA 2VZTA 3WO8A 3GU1A 2EPKX 2AL2B 3F5KA 2YPIA 1VBJA 1HJUA 1JDCA 3TC6A 4YWIA 1GVSA 5G2WA 4JR5A 4CNOA 1NDVA 4QCFA 3OQ8A 1Z3NA 1D8CA 4BF7A 4AHPA 3BQ5A 3B8TA 4GMEA 3NG3A 3OLIA 4DXVA 2E1DA 1G6CA 3LS9A 3P61A 1V02E 4W8BA 3E5PA 3UXDA 1EO5A 4G1NA 2YR1A 1DL3A 2BXZA 1XDLA 3KM8A 3TTOA 3OBAA 1KGXA 1MW0A 3W7RA 1JJKA 3TSMA 4PBGA 4NAFA 3CQHA 2OJPA 2ZXAA 3F2BA 2X30A 4HA1A 3EMQA 2GSJA 2WJZA 3CV7A 1K4GA 1JD9A 2ZCGA 4AHOA 2GWNA 1BFNA 5F7UA 2HMCA 4BWLA 1EDTA 4ZXLA 5H8UA 4DWSB 4AQLA 3WX7A 1QW8A 5FAJA 1YADA 1DQXA 1XUUA 4B15A 1B90A 1L2QA 3N4AA 4RZ5A 5AKQA 3S2JA 5LNSA 1QOPA 2H90A 2C0AA 3DHUA 1TUXA 1AODA 4C6IA 1JL8A 3MA8A 3NQGA 3HG5A 3UW6A 4QEEA 5CC3A 2WMJA 1DPMA 2B7PA 3RITA 4J9JA 1E6RA 5CG7A 1J01A 1V4YA 3IVTA 4MKNA 3RJYA 3AFBA 2CESA 1CXFA 2EPOA 3WQGA 3WF3A 1H09A 3MYPA 3KTSA 4NASA 1MUCA 1LWHA 3BSHA 4RCXA 1ONEA 4WXZA 3FHAA 3DXIA 4GZJA 4AZHA 2V5KA 3W1MA 2P50A 2DZVA 5DBUA 4ZE4A 3M0YA 4IPPA 2JGYA 3HGJA 1ZBVA 3IJ7A 4Z2JA 1JCYA 1IZCA 5G4EA 1R7OA 1ZJAA 4C6KA 1VRDA 1Z89A 4HMDA 5IXEA 3IVSA 1PKLA 5LA0A 4RE2A 1E51A 4M6VA 4QQ3A 2VP8A 2VGIA 3JZEA 1CWYA 1X6NA 2ZC8A 2AQWA 1BSLA 2F2KA 4A2SA 1AQ0A 1IGSA 3SJ3A 1TCDA 3DG6A 4ZOBA 3G0XA 4E2OA 2HROA 2L5HA 2JE8A 4Z2KA 4JL1A 1N55A 1FWCC 1F07A 1S38A 3FX4A 1EBHA 2EO7A 5IFPA 1U1UA 1Q7QA 3IIXA 4CD8A 3WNPA 4XK2A 3A64A 3URBA 4PUJA 2J6VA 4E2BA 4IIHA 3P8IA 3U0HA 2PE4A 3U2OA 4YMZA 5C70A 3MVTA 3EWXA 4FLOA 3NOYA 4GGHA 1N8WA 4H8VA 2CBJA 1BWVA 5GNXA 4JTGA 4P8UA 4XBSA 5K9XA 3VKDA 1TG7A 5REQA 3RRXA 1E1CA 1ZSXA 1I1WA 4J2PA 1AL7A 2DSVA 3ATZA 2I7GA 3M1ZA 3MUCA 3H2OA 4NY2A 1A0DA 2CBUA 4F9DA 2PCEA 3GW0A 4YJ5A 2V3DA 1HFBA 3T44A 4LOCA 3OHIA 2X8RA 4S38A 1DWGM 3AU2A 3EX4A 2V3EA 4AD2A 1WZAA 4QSHA 3KBSA 4ZQCA 3VKCA 1HL9A 5DMMA 3S1UA 4QSFA 1EJ7L 3PWIA 3PAJA 2PDFA 4HYVA 3BJSA 4G9PA 2G3MA 2GWGA 3WD3A 5FEWA 5J5DA 4U31A 2JKEA 3OW1A 1W3IA 5DRIA 4N4PA 4UQAA 1PKMA 2EXOA 2BGQA 4AU0A 5C9ZA 2E5CA 1FHVA 1RQEA 2XIMA 3V4BA 4PTWA 4KWOA 1XPGA 4MNLA 4BF5A 2CHOA 3W1TA 1ME8A 2ZICA 4WZHA 4UFLA 3HO8A 1VJSA 4MB4A 3K1DA 1ITQA 4MYAA 3UR7A 2FPYA 1BF2A 2ACRA 4DYJA 3GG1A 1MRAA 3NDOA 3LHTA 3FSTA 4MPKA 4YPJA 4GZ7A 4LVAA 3G1RA 3VXGA 4HMNA 3P5ZA 1Z32X 4DUOA 2YW4A 3GH4A 3HMJG 4NX5A 3QM3A 2CZFA 1V0KA 5BXRA 4NKCA 3SSJA 3CBWA 1SW7A 2GGIA 4UTFA 4MG4A 4C91A 5GVJA 3UXIA 4C7DA 1OBAA 2Y4SA 3DN5A 3N11A 4M0XA 4ADTA 1BRLA 2NLIA 3R12A 2VEKA 1A0EA 1VS1A 3BO9A 2XWDA 3KS5A 3QV8A 4RZ4A 4FI4A 1F74A 3IRDA 1XDMA 1A5LC 3CH9A 3GTHA