2Q3RA

Ensemble refinement of the protein crystal structure of at1g76680 from arabidopsis thaliana
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
361
structure length
351
Chain Sequence
SVPLLTPYKMGRFNLSHRVVLAPLTRQRSYGNVPQPHAAIYYSQRTTPGGFLITEATGVSDTAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYMAESLNKYGILYCHVIEARMHTLMPMRKAFKGTFISAGGFTREDGNEAVSKGRTDLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords 12-oxophytodienoate reductase 1
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 117
structure length 351
sequence length 361
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2q3rA00
1I2RA 1KM6A 2C18A 1XKYA 3GDLA 3TV8A 1I4NA 3RF9A 1QOQA 1LBMA 3QF0A 1DVJA 1D3GA 3R13A 5LZLA 4NU7A 4LRTA 4CLMA 4DXVA 3M5XA 1K7FA 2X1UA 5AHNA 2PRHA 4K36A 1TYGA 2ISVA 3A23A 2CLKA 2ABBA 2AQWA 4GFSA 4MUZA 3MBDA 2XN1A 4IMGA 1KBIA 5KINA 2C13A 1PV8A 4UXDA 2Q3RA 1PL9A 2FB3A 4O4WA 2DZVA 4DBEA 3LHUA 3C2FA 4YMZA 2JGQA 2VFIA 3LCXA 4JTIA 1QWGA 4IXHA 4IXXA 1SO4A 4CQAA 3LLDA 3ABQA 3FS2A 4UMBA 1DQWA 1M6JA 3DKJA 2FB2A 1H1YA 3QQ0A 4G1KA 4NVTA 3HIJA 3V1PA 5K9XA 1R46A 1NAL1 2WKJA 1NFBA 2PC4A 4C1KA 3P8JA 5DELA 3PG9A 3QJAA 1PCWA 4U4MA 1QPNA 1IIGA 5FEPA 5C55A 1GOXA 3Q94A 3NM1A 1JQXA 3W7EA 3W86A 4UC5A 2A4AA 4JYEA 2E09A 1F74A 3NQEA 1IIHA 3IGSA 4UTMA 1RPXA 1HTIA 4HHPA 3L68A 3PM6A 3QC3A 3S6DA 2NV2A 5BOOA 3LHYA 1W5NA 3W70A 3MWAA 4WOQA 1VCVA 4JD4A 4UMCA 1JCMP 4NZFA 1TPB1 4LVBA 2J9XA 4W9TA 3C2OA 3W1QA 2ZRUA 3TFCA 3SFKA 3LCWA 1W54A 5DCEA 4O15A 3NL6A 4YLWA 1X6UA 3TDFA 3W1PA 3O16A 3AO0A 2V2DA 3B05A 3FEMA 4LS1A 3G1DA 1XM3A 1IGSA 2CLFA 3ZFHA 3O05A 3OA3A 3NAVA 3PUEA 2VELA 2E77A 3EKZA 1T96A 1TPDA 2VFDA 2Y89A 5CZJA 3WK0A 5T26A 2E5DA 3KFTA 4Z1AA 2W79A 1O5XA 3ELFA 3NXFA 2WNZA 4H4IA 2H3DA 4K8EA 2C1HA 1PHQA 2Q8ZA 4CCCA 1EWEA 4MIMA 4UTKA 2WOQA 4TX9A 2Q8LA 3GNNA 1FDYA 3W88A 2WPBA 4JN6A 4FNPA 5D2TA 1MEIA 3A24A 5J5RA 4MY9A 3QW3A 4FX8A 1K03A 3DXIA 2ZZ3A 3M7WA 4WOZA 4DEFA 1Z48A 1OFRA 2JKAA 2FDSA 1BTMA 1QO2A 5HR6A 3GB6A 3BK0A 3G0SA 1OF8A 4BWLA 1VCFA 1O5KA 4ALDA 3A5FA 3P62A 1AL7A 4LWWA 4IWWA 2R8WA 5E93A 1XL9A 5KZEA 2WQPA 1SU5A 1KFLA 2Z0IA 4K39A 4JTEA 1NF0A 1DQXA 4RKAA 1S3HA 3DI1A 3MW7A 5ABTA 2V9DA 3LCFA 3T40A 1DHPA 4IPJA 3NNTA 2YR1A 1M7OA 2QJHA 2H90A 1R47A 5FF0A 3O8AA 4UTTC 2YW3A 3SGUA 4M6QA 5G4WA 1FCQA 2QCLA 1ADOA 3L66A 2GVLA 4FNRA 4AWUA 4O10A 5DY3A 3HPSA 1OFAA 1SFLA 2BX7A 1DJNA 1KFCA 1LOLA 2LLEA 3IIOA 3NQAA 1YADA 4QNWA 2CU0A 1TPWA 4N6FA 4H6KA 5EL1A 2H6RA 3PBUA 3NR0A 3LDVA 3VE7A 4FF7A 4RX0A 4O28A 2RDUA 1SZEA 3NQGA 4DPPA 1YXYA 1B9BA 5CPMA 3GXNA 5FF7A 3W7PA 4I9AA 4RR4A 1WYIA 3N73A 3I65A 3IGXA 1I8JA 3DU0A 3TQ0A 4N9DA 1GEQA 1GJPA 1KTBA 5D03A 4AVFA 3N34A 3SGZA 1SZNA 1VYPX 4IMDA 5KMYA 1GG0A 2NLIA 3P5ZA 4UTTA 1A53A 5AC6A 1OF6A 3TSDA 5CSRA 3NQ8A 3UXAA 2VOMA 3GVGA 2Y7DA 4JX4A 2HS8A 1FCBA 1FXPA 3PG8A 3NM3A 2YYTA 3LHWA 1D9EA 2V8ZA 2IQTA 4K7VA 5LNVA 1X7FA 1M7PA 3HF3A 3GXPA 2P1FA 3TCEA 1NEYA 3WJXA 2E6FA 1EP3A 5HMSA 5DBTA 4AEOA 1ZAJA 2QCEA 5HULA 3T78A 1H5YA 3OG3A 3EKLA 4KFPA 4OGZA 2R91A 5FEWA 1TJPA 3NOEA 4GJ1A 5G2IA 4WX2A 1S5VA 3W2LA 2QCDB 4Q4KA 2ZZ1A 3NL2A 2E68A 2FFCA 3W76A 4LVFA 1HUVA 5I3GA 2X1SA 2ZZ4A 2QCDA 1KFBA 1KLZA 2FTPA 1VCGA 3S1WA 1AK5A 4UFIA 3W7HA 1OFBA 3QH2A 3B0PA 4HSNA 2E6YA 5DCDA 2J9YA 4HSOA 4MZ8A 4O11A 3CT7A 1KFKA 1SO5A 4H3DA 1VJIA 4Q33A 2E5CA 3KRUA 3A21A 4JGDA 1TV5A 3HO8A 4LV9A 3N2MA 5L6UA 4LUJA 2A2IA 4MY8A 1UB3A 4NUWA 3PBWA 1XCFA 4UR7A 3TQKA 3L65A 1YYAA 2A85A 3HG4A 3QYQA 1ZY9A 8TIMA 3G0XA 1OABA 2TYSA 5TIMA 4MFEA 1VQTA 2CLIA 1JCXA 1KM3A 2RDTA 5AHEA 3NO5A 3I68A 3JR2A 1JUEA 4QISA 4NXSA 1N7KA 4E2BA 4IOTA 2H8ZA 1ICSA 3JRKA 2VFEA 4Z08A 1P1XA 3DZ1A 3P61A 4ML9A 4P2VA 2Z2UA 1ME8A 3W6YA 1H1ZA 2JKPA 3UWQA 4O18A 1C29A 1A5BA 1YTDA 1KFEA 1A5AA 3WK2A 3C4UA 3S1UA 3W83A 3GYEA 5AYZA 5EA9A 2ZRVA 1EEPA 1OFEA 2FPYA 4KKXA 5D09A 1Q45A 3F1QA 3P8IA 3RK8A 4FNQA 1JRBA 3W75A 2R14A 1ZFJA 1W5MA 4TR9A 1VHCA 4RXGA 3MP4A 2RDWA 1TTIA 3O15A 1H7PA 1WBHA 3R5EA 1EB3A 3NPWA 1VLWA 2DZUA 3LERA 1OG0A 5FEXA 1F05A 3G22A 4JDBA 5C6MA 2GJNA 1F6KA 5I3KA 3QPZA 4N2YA 1YTEA 3KHJA 1QNVA 1JUBA 3DFNA 3EX1A 2PRLA 1V7YA 5D2XA 4OHQA 1I2NA 1OHLA 4JTHA 1EUNA 4I7WA 4UTJA 3RLUA 4FXRA 2CLEA 5CKSA 3C8FA 4UFLA 4EIVA 4FX7A 2Y85A 4UNLA 3DHFA 3GXTA 1GYNA 3MHFA 3LB0A 1FWTA 4IMCA 1GVFA 1WA3A 2TSYA 1F73A 1OYBA 4OE7A 4N4PA 3B04A 1HO4A 3IIVA 2VKZG 4BI6A 4YCPA 1O4UA 4X22A 4ADTA 3ABRA 2QF7A 3UWVA 3VNDA 1QFEA 2GJLA 2UV8G 4LS2A 2X2GA 2GVGA 4TU1A 3SY5A 3IIZA 1L6YA 3MI3A 3PR2A 4MFDA 1MZHA 5A8GA 3FYPA 2OT0A 3NL3A 4OBTA 1GWJA 2Y7GA 4EWND 4JR5A 2FIQA 3P5YA 2XN0A 2WJZA 1N55A 3LTPA 5D32A 5AHLA 1EIXA 3TUUA 5CG7A 4Z1CA 3HGSA 2GQ9A 1GG1A 3FFSA 3M41A 4LOCA 5E0KA 3VKJA 2DZTA 3LCHA 3MMTA 4YXGA 1J2WA 2A1YA 1F76A 3HG2A 4WY0F 3BGGA 4MYXA 3TFXA 4CQ9A 2RH9A 4PEKA 3HG3A 3HB9A 1ME9A 4LRSA 3UYCA 2EAWA 1YPFA 4OV9A 2YSWA 3WJSA 3R2GA 3STFA 5H91A 1YTKA 1L2UA 1W5PA 5D2YA 1TQJA 2QUVA 5D30A 2ZZ7A 3MYPA 2JBMA 2XFWA 1P0KA 4N02A 5AYYA 5LSMA 1PIIA 1X8FA 3SW6A 5BNKA 4XWUA 5AHIA 3GDRA 3BPWA 1G69A 1KFJA 3G1XA 4Q32A 4DO5A 1OX6A 4GNJA 3W1TA 3TAOA 3W1LA 3LTYA 3P84A 4X2RA 5D37A 2KZHA 2Z1BA 3GK0A 1G4PA 4JX5A 4MPQA 4JS3A 4S2CA 4O53A 1O95A 1WOAA 5CPNA 3R8RA 2P10A 5K4ZA 3UWWA 1KTNA 4KFNA 1ZAIA 1JUKA 3BV4A 5IBXC 3M5YA 1QDSA 3T44A 1D3HA 1I2OA 3OVQA 4WXZA 1VS1A 2NV1A 3LRMA 1DOSA 4ADUA 1XUUA 2QR6A 2CZEA 3B8DA 1UCWA 3STGA 3E96A 2X16A 4LY8A 4EF9A 3BW4A 2YW4A 3N3MA 3CLMA 2Y7FA 4YWIA 2QCMA 2F84A 1RQEA 2ISSA 3FIGA 4NX5A 4BF9A 1T99A 1VYSX 3E12A 3WJWA 2OT1A 1U83A 3UPWA 2QJGA 3NQVA 4NJHA 1AG1O 1RQHA 4DBDA 1TCDA 4O52A 4GRSA 4RK8A 1GVSA 2VEKA 1WOBA 3O63A 4NXKA 1EP1A 3W9ZA 3S0CA 2OX1A 4KWVA 4ZQRA 4DO6A 2DJLA 1RD5A 4Z0SA 1QMLA 5IBXA 1ZCOA 5C5YA 2CFFA 5K9CA 1L6WA 3KRSA 3ATYA 2X30A 4ZZ9A 3BW3A 4O57A 5K4XA 3ABOA 3T55A 1IXNA 3TSBA 5HWNA 2A5HA 3SIZA 3ZWTA 1OX4B 2EF9A 1EPXA 1NSJA 4RJEA 3TE9A 4HNTA 1G7VA 3T4CA 4LC6A 5HWJA 1PE1A 1OX4A 2C6QA 3GKAA 5EYWA 5I3IA 3W7GA 1KV5A 3DH7A 3G1HA 1CI1A 5EPDA 3ATZA 5G1TA 3EXTA 1GVQA 3RLVA 3W7CA 3VI2A 1FQ0A 3P7YA 1SPQA 3KVMA 1GZGA 3R12A 1UUMA 5KZDA 4QM1A 1AW2A 1KBJA 4UFHA 2HMCA 1XUZA 4TMBA 2ZRZA 1EX5A 4BWLC 4E38A 3S5NA 1B57A 1TPC1 3PS7A 1I2PA 2ZRWA 4R53A 4EOUA 2NUYA 5F2LA 1P5BA 3FLUA 1VH7A 1TPUA 2F7FA 2V5BA 2QUTA 3RU6A 2WO5A 1G4EA 1WV2A 1Q6QA 3KAOA 3S5OA 5AC8A 3NQCA 4AH7A 2QCCA 4IX2A 4POCA 2Z6IA 5CZSA 4DO4A 1JQVA 2PRMA 1OVDA 4JTUA 3EWBX 3FKKA 4NNAA 3S8HA 5FF4A 3GAKA 4PCFA 4GBUA 3VE9A 2FPTA 1LBFA 4MOZA 4O4VA 4O12A 1LROA 3A9IA 3TW6A 1RVGA 4AWSA 4UTWC 1XI3A 1VZWA 4IGHA 4LVAA 1ICPA 2Y63A 1MSSA 3B06A 2YGYA 3N9RA 3QMTA 3W1AA 3WK3A 2QCHA 1Y0EA 2A7NA 3IIXA 4NJJA 5K2ZA 4JXCA 5LNRA 2A7PA 3MBFA 1FDJA 1K02A 2NX1A 4XTDA 2Z6JA 3FA5A 3L21A 3SSJA 4AMAA 2BXVA 2QKFA 3H55A 1YDVA 1EA0A 4NX0A 2HTMA 4UTLA 4YCOA 1VHNA 1SZGA 4MZ1A 5CGQA 1TTQA 1QCWA 3P82A 2RFGA 4UIOA 2X1TA 1W1ZA 1SO3A 3HGJA 2B7QA 4IMEA 1JCNA 2DORA 5D2VA 5AC7A 3H54A 4LC8A 3KX6A 1AL8A 2D73A 1RZMA 4UTHA 4UTWA 3MI6A 2TRSA 4A2RA 1H60A 3EB2A 4O0ZA 4UMAA 4GWEA 2QCGA 3ANYA 3F4WA 2CW6A 1YDNA 4ORIA 3LHVA 1L6SA 1VYRA 2Y6ZA 1IXPA 4TIMA 3GR8A 3HPXA 3W74A 3DKLA 4O16A 2OZ0A 4UNKA 1YPIA 4HNVA 5LGZA 3LHTA 4FHAA 1FWNA 1F7BA 3IEBA 2CZ5A 4PL1A 1TTPA 3GDKA 4ZMGA 4AXKA 3G8RA 3CWOX 2R94A 1LORA 3VCRA 3EWXA 3F03K 3M1ZA 4JTGA 1G4TA 4FEZA 3FYOA 4RLIA 1G67A 1T0OA 3KVLA 3TSMA 4NT0A 2DJXA 3W7DA 3OBKA 4MVAA 4LNYA 3ZR4A 2JGYA 4QQ3A 5CPOA 1LOQA 2NZLA 1QAPA 3PBVA 3E49A 1UJPA 3PVFA 2BLEA 1ML1A 2C14A 3M9YA 4JYFA 3W7RA 1Q6LA 4M19A 3TAKA 3TW7A 1I2QA 2DZSA 4OV4A 1TPH1 2OJPA 4CNPA 3NG3A 1Q3NA 4JTFA 1GQNA 3BVJA 2ZRYA 4O13A 4QNEA 5D33A 3DBPA 3YPIA 3V75A 3TQVA 1KA9F 4ONVA 3EXSA 4QSHA 3L5AA 3GZ3A 3CIWA 3Q2DA 4X9SA 1Z41A 1YDOA 2YFOA 1OFOA 3WFAA 3BLIA 3C61A 2JK2A 4WXYA 2ZZ6A 1ZALA 1VPXA 1LM1A 1L9WA 3NZRA 3QRHA 2V0TA 3UQNA 5DN1A 2FLIA 1OYAA 2P0OA 4UTIA 5FF2A 3TXVA 4UFJA 3FOKA 4A2SA 3K30A 5I3HA 3QW4B 4KWWA 2E1DA 4Y6GA 1G6CA 4ADSA 1DBTA 4XKYB 1TV7A 3L2IA 1SUXA 1R30A 1W3NA 2O7SA 4QIUA 4AWTA 1TREA 4BFAA 1UUOA 1FUYA 2ZA3A 4NZJA 3W7NA 3UY7A 3PAJA 3MYOA 4BR1A 1ME7A 2NUWA 3TKFA 3NVTA 1W31A 2BTMA 3LOTA 2VFFA 1PVNA 1BEUA 5C54A 1LRNA 3PC0A 4XZ9A 1FDZA 2JKEA 2GOUA 2ZQ0A 1P0NA 1O60A 4S2BA 3G1VA 1H7WA 4Y96A 2X1RA 5AFDA 2VXNA 3NZ1A 1X1ZA 2FQIA 2Y7EA 1H62A 4PA8A 2TPSA 3LCLA 3MP5A 2DZXA 3UWYA 1DJQA 3W7QA 4RZ4A 2ATSA 1B4EA 3N2XA 4O1CA 3PB2A 4R33A 5E1QA 2RHGA 4UTUA 4JY8A 5U7SA 2E6AA 3W2KA 4MLJA 3P67A 5EY5A 5F4XA 5DXYA 4JYDA 1XBVA 3TMLA 3W7IA 5F1VA 5I3JA 3W7JA 3BW2A 5A5WA 3W73A 1THFD 2PURA 5KTLA 1R2SA 1K7EA 2YFNA 4MKNA 2H8XA 1ONRA 1QOPA 3BARA 3PB0A 3S1XA 5F4WA 1LRQA 2PCQA 2C3ZA 3W07A 5F2IA 2NX9A 3LRKA 1EUAA 5D2WA 3S5YA 2B7OA 5F2GA 2J27A 3M43A 1VGAA 4WZHA 4ORMA 1HO1A 4XBKA 3P74A 1S5TA 1W5OA 4MJZA 3TMQA 3LI0A 4GUGA 2J88A 3BGJA 1ALDA 5TQLA 3NEVA 3EX6A 3W1MA 3LV6A 1W8SA 1W3IA 3BG9A 4L4LA 3NPVA 1GPWA 5D05A 4BI5A 4C1LA 3CIXA 2QAPA 4PL2A 1G7UA 2ZA2A 4RCXA 1E51A 3W1NA 3MJYA 1G4SA 4Y9AA 3EX4A 1P4CA 2NX3A 1GTEA 3NGJA 3ZWSA 1XDLA 5KITA 2V2HA 1R2TA 5AYXA 1WX0A 3THAA 1JCLA 3EWUA 1B3OA 1LLZA 3L0NA 1TQXA 4O1DA 2ZZ2A 2J6XA 3G3DA 5SWUA 1IXOA 3QSRA 3CQ0A 1VRDA 2A21A 2V30A 2WNQA 3I7RA 4HN4A 1KV8A 1KW1A 5LNUA 4O19A 3KOFA 3QPYA 4XQ6A 3SI9A 1RQBA 5IM51 1T8XA 1ZAHA 3E02A 2ZZ5A 4M7SA 1TB3A 4UR8A 4ZQOA 1OX5A 1EWDA 1W0MA 3SR7A 3FJLA 5HUOA 3C3NA 3DGRA 4IQLA 4QITA 1SR9A 3L9CA 1TPFA 2ZBTA 2YDAA 3HG5A 1K8YA 1LYXA 3IIPA 2RKXA 3TC6A 1LTDA 2J9ZA 4AHQA 4A22A 5I3FA 1HG3A 4JTKA 3STCA 2I14A 1SQ7A 4K37A 3EWZA 4LU0A 3B03A 1WXJA 1W56A 3OVRA 5GVJA 3ZS4A 3W1XA 1K8ZA 3TA6A 1JCJA 5J5DA 1A5CA 4L4MA 1BWKA 3UWZA 3KRZA 1OYCA 2DZPA 4UFMA 3LXAA 3DFTA 4JICA 4I7UA 2AGKA 1OFQA 2G96A 4RXFA 4FIRA 4N6EA 3B0UX 3CC1A 3TC7A 1MXSA 4ZQCA 3NQMA 1GTHA 4O1BA 3U8GA 1GYLA 4EF8A 2ZTKA 1M5WA 2QDHA 3BG5A 4MLRA 5G5IA 5LGXA 2C16A 3HGRA 4WUIA 3TX9A 5CPLA 1H7OA 1JR1A 1DORA 2O7QA 1LZOA 2YX0A 4JTLA 4GUHA 3LXBA 2B0MA 4DQWA 5FI8A 1KLYA 2QEZA 4EVZA 2W0UA 4GXMA 1JCYA 1XBZA 2CLMA 4P61A 3IV3A 1ZJIA 4WD0A 2XN2A 5U4NA 1H7XA 3HGOA 3CTLA 3IVTA 3O1NA 2QCFA 1H7RA 3IRDA 5LKYA 3WJYA 4AAJA 3LTSA 3CPRA 1MEWA 1OK4A 1XBYA 4GE8A 3OEXA 1FCUA 2DU2A 1F2JA 1IF2A 1WQ5A 3EXRA 2I9EA 3QMRA 3P81A 1JULA 2TMDA 1FY6A 1O94A 3PUOA 1UASA 2YYUA 1FWRA 5FEZA 1OJXA 3GNDA 3W7KA 3C52A 3EEGA 3PUDA 5AB3A 4CQ8A 3O6DA 2CLOA 1AW1A 1RR2A 4LT9A 3NQFA 4M5PA 3S5ZA 4PFMA 4AB4A 3DFPA 1AW5A 5K3VA 1AMKA 3LCGA 4RZ5A 1KM2A 1J4EA 1JJKA 5AN7A 2CZFA 1TRIA 3W85A 2HSAA 4FNUA 5EKYA 2VEMA 4RZ6A 1TO3A 3DAQA 2G95A 3IVUA 5DCBA 3PF3A 4XBSA 1J5TA 3W72A 3KXQA 1LBLA 1H61A 3TIMA 3M5VA 1BKSA 1PS9A 3U6WA 4FNTA 1TPEA 4LVDA 4JEQA 6ALDA 2E6DA 3WK1A 2WSQA 5CSSA 3HJZA 3QQ1A 4D2JA 4K6AA 3QM3A 1YXDA 1VC4A 4GUJA 4ZVJA 4FB7A 2DZWA 1TSIA 3INPA 4LTSA 1KM4A 3MO7A 4CNNA 5TBOA 1FBAA 1QR7A 4KFOA 1DV7A 3LHZA 5BW6A 4HPXA 4E0CA 3L5LA 3MI2A 3O6YX 4IUOA 3TJXA 4O50A 4FXSA 2WSYA 2QAFA 1SO6A 1W37A 1SZFA 3DENA 3PULA 3BLFA 3HQ1A 3QSTA 3DI0A 3Q37A 1ZENA 3LLFA 3FKRA 4BI7A 3N14A 3GKFA 1TPVA 4DF1A 5F2MA 3C6CA 1LOSA 4MYAA 3NDOA 1KM0A 4IX0A 2ZA1A 4PODA 3EWWA 4GC4A 3QMSA 1QPQA 4PH6A 1ZHAA 2NUXA 4CNOA 1Z44A 3Q58A 4ZL1A 3LCIA 4Y8FA 4Z0JA 5HINA 5D02A 2QCNA 5DLCA 5L9FA 5D04C 3TU9A 4K8HA 1H50A 3PSVA 4JX6A 1K3UA 2Y88A 3HMJG 4J9JA 4MJMA 1KM5A 1Q6RA 3DHDA 3C0JA 3NYZA 3UY8A 4JY9A 1N8FA 4X3ZA 4ICNA 3W2JA 1YLVA 2GVJA 4QJ1A 2NXHA 4OU1A 5HJLA 2PE4A 1FX6A 4RV8A 1Z42A 4WJEA 1IXQA 1DKWA 2EHHA 4R34A 5LHFA 4GUFA 3HBLA 4LS0A 4NNBA 1W3TA 2QJIA 3CB8A 2BZNA 4QAIA 2ATMA 3CEUA 1FWWA 2G97A 4S1FA 3QFEA 3G1SA 3UD6A 3S1VA 1WDWA 3A5VA 4JDYA 4R7JA 3TNOA 4YL2A 5G2HA 2VENA 4IPIA 3OIXA 2OMAA 4FNSA 1GVRA 5BMWA 4JIQA 3E9AA 3RNDA 4M6PA 3USBA 3G0UA 3TH6A 3C56A 3UWUA 4HKPA 1V5XA 1R2RA 4NJKA 1LCOA 3UZJA 2CLHA 2QDGA 2VEIA 2Y70A 3BG3A 3GIYA 3KVJA 3MUXA 4LVGA 2EGZA 1S5WA 3P80A 2E5BA 3I6RA 3SZ8A 1ZNNA 3CWNA 1QPOA 3RFAA 1OK6A 3BO9A 3S42A 2ZDRA 1LDCA 3KVKA 3N19B 4HIBA 1SW7A 4CCDA 3NQ2A 4ZQNA 5DBUA 1ICQA 4NJIA 4NNCA 3GR7A 1WAUA 3W7OA 3NL5A 3WJZA 3E0IA 2ZCGA 3UZ5A 3L0KA 1K8XA 4UCGA 3UXDA 1SW3A 4O54A 1OFPA 3W2UA 3W7LA 1XBXA 3P60A 2CZDA 2ZYFA 4JNMA 3G1AA 3NQDA 4IJBA 5G4EA 1TV8A 1C8VA 4LV4A 5H2ZA 3W1UA 1YXCA 4N9EA 2NXIA 1W5QA 1XFBA 4A21A 2C19A 2YCEA 3W87A 3O07A 3PWAA 3LI1A 1F5ZA 1UBSA 3LV5A 2C0AA 1KTCA 5CZTA 2Q3OA 3UNDA 2VFHA 1K7XA 5KSWA 3LM7A 2EPHA 1NVMA 3W2MA 1FWSA 2W6RA 1RV8A 4I7VA 2VEPA 3SJ3A 4PTNA 4AHOA 3GDMA 3NA8A 2HS6A 1TIMA 1TRDA 3W2NA 4FIQA 2GQ8A 4XKYA 4HNUA 2WV8A 3S9YA 2VC6A 2DP3A 3M5ZA 2A6LA 2VFGA 3UPBA 3TK7A 3C2VA 3C2RA 2ALDA 2CLLA 4XUGA 1BWLA 4UFKA 1A5SA 4Z1BA 4E2DA 4NJGA 5EBUA 4MZYA 2H3BA 3L0GA 1U5JA 2YXGA 1QPRA 4O8RA 5HWMA 3CU2A 2FPVA 3EWYA 3MHGA 1FXQA 3THQA 5C2XA 3W23A 2B4GA 3RMJA 3OHIA 2B7PA 2A7RA 2ABAA 2GPTA 1TJRA 3LX9A 3TXZA 1JRCA 4O17A 5HUPA 4WY0B 5HR7A 3EX3A 5LHEA 4AHPA 4HPJA 1C9DA 4BK9A 1LP6A 4HT3A 3NPXA 3W7MA 3TJLA 4WY0A 3TROA 4OQVA 2CWNA 2Y62A 6TIMA 4M6VA 1GVOA 1LLWA 2ZRXA 4DELA 2NWRA 3CM4A 2V82A 3G3MA 3LRLA 4LUIA 3L67A 1SFJA 1F6PA 4WQ6A 3EX2A 2YPIA 3STEA 3PBYA 1SSDA 3IGUA 2BSLA 4TMCA 3M6YA 3G1YA 3QZEA 4A29A 1PHWA 1H7NA 3NQ7A 3FJ6A 2ZTJA 2FJKA 2A0NA 3I7QA 2G5WA 5G1YA 3M0ZA 2ISWA 3GAYA 3T7VA 3DFSA 2B7NA 4FX6M 3A22A 1FCVA 4DF0A 3PSWA 3C2EA 5F1UA 3DFQA 1TMHA 1A50A 3JS3A 5AHMA 1MO0A 2WNNA 2GQAA 2YZRA 1OFDA 2WSRA 2NXGA 3OVPA 5K9DA 1WBJA 4N9BA 2OCZA 4ZQMA 1XXXA 3F4NA 1XDMA 3MP3A 4HNNA 4Y90A 3LBMA 5K7JA 5FF3A 1VLIA 3LBCA 2V5LA 3GX9A 4GUIA 4B5NA 2C15A 1CX9A 5DY2A 3D0CA 2J24A 3TR2A 1Q6OA 1TTJA 5AOUA 3W22A 4DF2A 4OT7A 5EMUA 3G1FA 1MEHA 5BRBA 4AF0B 1B4KA 3I7SA 3AJXA 1PCKA 4AF0A 1H51A 3N9SA 5D38A 5LNSA 4FO4A 1I45A 2BWGA 1HL2A 4OWGA 5HQEA 2I1OA 3NQ6A 3CEPA 1LRTA 4ZQPA 4XTIA 3G8EA 3VFLA 3BLEA 3W3OA 2ZFAA 3NPUA 2QUUA 1X1OA 4K7YA 3HPZA 1NF7A 3G18A 5FESA 3B0VC 3MHUA 4CCEA 3M47A 3IVSA 2V81A 1JVNA 4UUIA 5CZ0A 5LNWA 3LGEA 3GLCA 3QEZA 5DXXA 1HFBA 3HOJA 4IMFA 3LXCA 4TO8A 1KM1A 1DL3A 4JTJA 4K38A 3W1RA 4JIPA 4A3UA 2A6NA 5F4SA 5AHFA 5MHBA 3L5MA 3U2OA 2AAMA 3SECA 4U28A 3G24A 1SW0A 4N4QA 4O14A 1H63A 3DFOA 4LW7A 3PY2A 5BMXA 4O0KA 1CW2A 3ABSA 3O6CA 2GUUA 5KZMA 4NQ1A 1VR6A 1GT8A 1SSGA 1XC4A 3O06A 3W71A 1EP2A 2EKCA 4Z1DA 5HNRA 4M7TA 3GDTA 4DPQA 4N9CA 1QO5A 3B4UA 2NWSA 4JTTA 5G2WA 7TIMA 3M16A 4MY1A 4PC8A 3W84A 3CHVA 3M44A 4O1AA 2V2CA 3R89A 2Y61A 4JTSA 3H53A
chains in the Genus database with same CATH superfamily
3AOFA 1KM6A 2C18A 3GDLA 3H2OA 3BAYA 3V16A 4AD0A 5A94A 1XYFA 3RF9A 3B8WA 3M0IA 1P0BA 1QNOA 1E56A 3RYSA 1AJZA 4ICCX 4NU7A 1GHRA 1A0CA 4CLMA 2BV9A 2DEPA 2WCAA 3GY1A 4ZGYA 2J25A 5AHNA 3PWIA 3WMSA 4OOUA 3KRBA 1TYGA 1AFSA 3A23A 2CLKA 2AQWA 3MBDA 1CBGA 2Y5JA 2C13A 1E4LA 2FB3A 4PCPA 4LCSA 3LHUA 4C6MA 2JGQA 3LCXA 1S3TC 4GFIA 4GXPA 1DIEA 3HURA 2PDXA 3H22A 2G3JA 4PULA 1UOKA 2PWGA 4GA8A 1SO4A 3KS6A 1JZ6A 3F7JA 3FS2A 4JN7A 3QQ0A 1UA7A 1R46A 3U9IA 4IG2B 1NFBA 2WSKA 5DELA 1FKWA 3QJAA 2INZA 4KQNA 5FJOA 4U4MA 4IG2A 1R5YA 3VNZA 4E4PA 4DLMA 4X2PA 2Q6ZA 4MF4A 4UC5A 2E09A 1F74A 1UD5A 3IGSA 1JI2A 4NF7A 3VZXA 2R1LA 4GG9A 1E40A 1XLHA 2Y4SA 3LHYA 1V93A 4UMCA 3T81A 1JCMP 1TPB1 3VIJA 4W9TA 3SB0A 3CWHA 4D9PA 4J7RA 5I5RA 1W54A 5DCEA 4LQ1A 4BA0A 1BTCA 4NSBA 1FH8A 4YLWA 5KETA 2A3EA 2V5DA 3WG6A 2BOGX 2V2DA 4ENLA 1XM3A 3RDKA 3EKZA 2EEXA 4Q8WA 4QS5A 1HZYA 1JAEA 4L6HA 5T26A 1XIFA 4Z1AA 4DX3A 3ELFA 4KIRA 1QATA 2DZBA 4JFUA 3I4EA 4C6OA 2WOQA 4ZODA 3GNNA 3SCPA 1FDYA 3TYAA 4LX4A 1TWDA 1MEIA 5J5RA 3LM3A 4MY9A 1K03A 2DSKA 1Q63A 3QV9A 3QYSA 1Z48A 2V5KA 3APGA 4L1WA 4D6IA 4K1GA 2ZUTA 5HR6A 3GB6A 1XKJA 4GI6A 1MW3A 4ACYA 3G0SA 4MAVA 4GD0A 2RJHA 8CGTA 2XIOA 1W3KA 3SUTA 1AL7A 3UZYA 1XL9A 2IKGA 2WHJA 2D24A 4RKAA 5ABTA 5C9UA 3AHYA 2CITA 2OFJA 4RPPA 3VILA 2WK2A 4Z1YA 4DHGA 4QLKA 3GNRA 2H90A 5FF0A 3O8AA 4UTTC 4M6QA 5G4WA 2QCLA 1X97A 4OJYA 2WJEA 1OFAA 2XIBA 2VP8A 1XSIA 4CGTA 5E0CA 2J7BA 2LLEA 1ODUA 4QE4A 2EQDA 2QJJA 2H6RA 3CIVA 2A79A 1Z3NA 2G4FA 5M03A 1MI3A 2D0HA 3GXNA 5FF7A 4I9AA 5A6TC 3SCRA 3R0DA 5REQA 3WLNA 3ZLFA 3DU0A 3PP7A 1GEQA 4V33A 5D03A 4LAOA 3B3DA 2WMGA 3N34A 4GJJA 3VGEA 3WBXA 1SZNA 1HX0A 1V0NA 3GO2A 1U2YA 1JPKA 1OF6A 5CSRA 2EJ1A 1BAGA 3W25A 2VOMA 3R43A 1K9DA 3PPCA 2Z00A 1RK6A 4XUYA 2XFFA 1VBHA 3PG8A 4JQ2A 4W85A 1D9EA 3GYCA 3WF4A 5LNVA 3HF3A 2P1FA 3DG7A 3WJXA 2E6FA 4P7QA 1EP3A 4AEOA 3W6MA 4NAEB 3U2ZA 4NAEA 1HKVA 1VFHA 1ZPTA 3T05A 1XYZA 2OB3A 4F48A 3W2LA 3SGGA 2QCDB 4Q4KA 4LAZA 4PB4A 3IJ6A 2VQUA 1HUVA 4UOZA 6PTDA 2QCDA 3BWWA 1XYAA 1KLZA 3S1WA 1ITUA 3MQTA 1VFSA 3K4WA 3ZOAA 4PCNA 4HSNA 5DCDA 3WMLA 1EOMA 4HSOA 4MZ8A 5I03A 3WNNA 1DWJM 1KFKA 1SO5A 1VJIA 1ZBKA 4MWAC 3FVMA 3KRUA 3N2MA 5L6UA 2GSHA 3TOYA 3BSMA 5ABEA 1LQ0A 1FHLA 4K68A 1TE6A 1BGAA 3HG4A 3WNMA 3TA9A 8TIMA 5EGRA 4GI9A 2GQ3A 2TYSA 5AC4A 2E8YA 4XIMA 5DANA 1JCXA 3MV11 3VM5A 4A8RA 3NO5A 1FHVA 2PWUA 3I3DA 1JUEA 4NXSA 4E2BA 1UKOA 5A6KA 3RILA 2H8ZA 4TQTA 1EJRC 2PB1A 1P1XA 1J93A 1A5KC 2Z2UA 1XLBA 4I9MA 7TAAA 3ERPA 3E0WA 1C29A 1A0EA 3G6MA 2FVLA 3VC5A 2FGLA 1A5AA 3AYTA 4EAYA 4Z42C 5CZKA 3W83A 3GYEA 5AYZA 1T7LA 1OFEA 3B8TA 3BOXA 1C3FA 3P8IA 4FNQA 5ENLA 3DG3A 2R14A 1KRMA 1VFFA 4TR9A 4RXGA 4GYKA 4AYSA 3CB3A 4AZ5A 1WBHA 4M6UA 4DB7A 1OG0A 1F05A 5C6MA 2GJNA 5I3KA 3VC6A 3M46A 2BBFA 4N2YA 2XVKA 4CU6A 3KHJA 4GC3A 1JUBA 1ONWA 1U22A 2XM2A 4OTKA 1V7YA 1W32A 1E4MM 1W1YA 1EUNA 4UTJA 1MQRA 2CLEA 5CKSA 3C8FA 4LUTB 2J7GA 1QI2A 2Y85A 3DHFA 5CLWA 3GXTA 3D6NA 2YCLB 4IMCA 4LUTA 3SRFA 3IIVA 4Q8VA 2YCLA 2VKZG 1O4UA 2QF7A 3QY8A 3I6TA 4H04A 2HPMA 2E67A 4GY0A 2UY2A 1BHGA 1UWTA 1QUMA 2PD9A 1L6YA 1M3UA 4N0RA 1Y7VA 3UR2A 4NAFB 3JW7A 2OT0A 3NL3A 2VZSA 4NAFA 3WF2A 2Y7GA 3SBFA 1UD6A 2WSPA 1KQYA 4PR4A 3TW9A 2XN0A 3CQKA 4MADA 1N55A 4WVXA 3LTPA 3IK4A 5CG7A 4Z1CA 1GKRA 1VBRA 3VDAA 4MG4A 5E0KA 3VKJA 2DZTA 4H1ZA 1J2WA 1UZ1A 1F76A 4WY0F 4MYXA 1WUFA 3CAWA 1SJBA 3CQJA 3HB9A 2EAWA 1YPFA 4OV9A 2X8RA 3WYZA 1YTKA 2NVCA 1L2UA 2QUVA 3ARPA 3DBNA 4PSPA 5LSMA 2XFWA 1P0KA 4ZA0A 3SW6A 4XWUA 2Y0FA 3SM0A 5AHIA 2PLMA 1KGXA 3BPWA 3AS1A 3L23A 4HPHA 1G69A 3R8HA 2NQJA 3G1XA 3MU7A 4DO5A 2MNRA 4HVXA 3P84A 5D37A 2PP3A 3QGKC 2Z1BA 1G4PA 4YS1A 4S2CA 1JF5A 1FHDA 1J5SA 4FALA 2P10A 1KTNA 4KFNA 4ATWA 5I23A 1QDSA 4DBSA 1D3HA 3OVQA 4ADUA 2QR6A 3B8DA 3ZZ1A 4EF9A 3N3MA 4IP5A 1YNYA 4NYYA 1XG3A 3CLMA 3UG5A 3DCPA 2NQHA 1J01A 4JKLA 4Y7EA 3RN6A 1NH6A 2QQ6A 1T99A 1R3SA 2OT1A 1ELSA 1NELA 1LT8A 3UPWA 3P14A 3UG8A 4Z17A 1AG1O 4GACA 4HHHA 2J6VA 2VEKA 1WOBA 1RJQA 1EP1A 4IFOA 3S0CA 2Y24A 3QTPA 1TJ0A 3D5HA 3VOCA 3FHQA 1RD5A 5IBXA 3FA3A 3RR1A 2YA2A 5ABGA 1O7AA 3BW3A 4DO7A 4O57A 1QI0A 5K4XA 3ABOA 5HWNA 3PNUA 1ZUAX 2EF9A 1SR0A 4Q8NA 3TE9A 4HNTA 4EPDC 4JCLA 1H4PA 1NQ6A 4C6DA 2C6QA 5I3IA 2DSWA 3W7GA 2XJ7A 5G1TA 2D3NA 5DEZA 4JTAA 1GVQA 3RLVA 3TP4A 3XINA 6ENLA 3ME3A 2D2OA 4C60A 1JDEA 3KVMA 3R12A 1UUMA 1EDQA 1KBJA 3H2NA 3IANA 1IWBA 2ZRZA 4OFCA 3WELA 5JU6A 5A8QA 1PX4A 3VIHA 3DGBA 3IAPA 3H7UA 1TPUA 2F7FA 2VGFA 3S5OA 1D7KA 4IX2A 1UYQA 2ZIDA 5CZSA 3WNLA 4U2ZA 1NWTA 4JTUA 3EWBX 3FJ4A 2ACUA 1CEOA 4PCFA 4GBUA 3VE9A 1L8PA 4MOZA 4O4VA 2VJXA 3A9IA 3SY1A 3TW6A 4AWSA 4EPEC 1XI3A 1ECQA 1ICPA 4M8UA 3WQDA 1W2PA 1OC6A 2EKGA 3B06A 1KCKA 3M0JA 3QMTA 3WK3A 1Y0EA 4AEFA 2A7PA 1IYXA 3GXDA 4FPSA 3SO7A 4V28A 1RBOB 1RJPA 2QGYA 3KM8A 3H55A 1YDVA 1A3HA 4Q22A 4O0QA 1VHNA 1WNOA 1SZGA 4S3FA 4P8UA 5CGQA 4V1YA 1TTQA 3LZ3A 2Z25A 3HPAA 1YIXA 1MW0A 4UIOA 3OG2A 4P7NA 3H2MA 4IMEA 4ERIA 2DORA 2GWGA 4FP1A 5AC7A 3W53A 1AL8A 2OOGA 3VGGA 4G6CA 2D73A 1B3XA 1EL3A 1W17A 3MI6A 3VMOA 4R3UA 4ERGA 1H60A 2XYLA 4O0ZA 4DXXA 4GWEA 5AZ0A 2WMHA 4D6DA 4D6HA 3LA4A 4IJCA 4PRRA 4PUNA 1L6SA 1Q4WA 1NQKA 4TIMA 4HYRA 2X42A 3GR8A 1H3GA 3SCOA 4O16A 4Z2KA 3WDIA 4HNVA 5LGZA 3LHTA 4C1NB 2NQLA 3PJWA 1F8IA 4B91A 4ZMGA 1A3WA 3EKGA 4C1NA 3RO6A 3GXFA 3F03K 4JTGA 4R5EA 1V0KA 2G3FA 1T0OA 3QOMA 3E74A 1V6XA 3OBKA 4LNYA 1AVAA 1LOQA 4GKTA 3S2NA 1UJPA 1GVEA 3PVFA 1M03A 1B90A 1ML1A 2C14A 4G8TA 4H19A 3TJIA 2WHMA 4JYFA 3GC5A 3C0SA 3EOLA 1JEZA 4NP7A 4IF2A 3SQLA 1W8GA 3NG3A 1GQNA 3BVJA 1UOZA 4QNEA 4I6KA 3AMLA 3EXSA 4QSHA 4H9UA 1BPLB 4H8NA 4PFHA 4PSRA 3Q2DA 4AWEA 1GW1A 3CL7A 3CK5A 2IUZA 5M2FX 2YDSA 3C61A 3S9ZA 4JQ1A 3MKCA 2ZZ6A 4QEEA 3MTWA 4HA4A 3WF1A 1J0YA 1L9WA 4XZBA 2P0OA 4S23A 3D46A 4FLQA 4UFJA 3CAQA 3FOKA 4MUPA 6REQA 1W1A1 2VNCA 4KWWA 1G6CA 4AY1A 4B15A 3COTA 3L2IA 4O1FA 1SUXA 1Z6KA 3T4WA 1DHKA 1VENA 1OG6A 4FR6A 1UR9A 4NI3A 1DQUA 4H01A 4B4HA 4BFAA 1XD1A 4RE4A 3FA4A 1W31A 1POJA 3LENA 1BEUA 2J8FA 3KDNA 5C54A 1LRNA 1FDZA 2JKEA 2GOUA 2ZQ0A 1ESWA 4ZO6A 1O60A 3W82A 2BXYA 1Q4NX 3G1VA 3G6LA 2ZE0A 3OA5A 2JF7A 1R3YA 4MHBA 1REQA 5AFDA 4L1GA 3LCLA 1ENUA 2ODOA 3QV7A 2ZC8A 3E0FA 1DJQA 2WMFA 3TC3A 2VRJA 1KCXA 2DUZA 2F9RA 5HNNA 2AMXA 3U2CA 3W2KA 1BQCA 3N2BA 4JYDA 1XBVA 3W7IA 3QLLA 2NVDA 2WC4A 1XIDA 5I09A 2YFNA 1ONRA 1ISWA 3BARA 3PB0A 5F4WA 1LRQA 2C3ZA 4AEEA 3IAQA 2PPGA 4HK6A 5F2GA 2J27A 1VJZA 1VGAA 1VAHA 3D3AA 4ORMA 1DJWA 1S5TA 4L9YA 5GNZA 6TAAA 2J88A 5TQLA 1D7FA 3W1MA 7PTDA 1F3TA 4C6LA 1AQHA 5FAGA 1GNXA 5IDIA 5D05A 2QAPA 1MQQA 4RCXA 3MJYA 2BXZA 1FH7A 4Y9AA 3WQCA 3VOJA 3NGJA 2R1PA 1NARA 3THAA 3L2LA 1JCLA 3AZSA 2ZZ2A 3ES8A 4QRNA 4A3RA 5BU9A 3VTRA 2ZUSA 2AOSA 4XAGA 3CQ0A 1ZSXA 2P3ZA 4EACA 3H2FA 1JDDA 4JL1A 4PMNA 1KV8A 3WBYA 1NDVA 4ZE5A 5LNUA 4WLCA 3KOFA 4IPLA 4XQ6A 5A95A 3E2QA 2VC9A 3SADA 5HNUA 1T8XA 3OP2A 3RX2A 2PWHA 3FSTA 4M7SA 4Q4MA 3GD6A 5IXEA 1FWHC 1BG9A 1EO5A 4LPCA 4IQLA 4QITA 1SR9A 3L9CA 3GSMA 3L4YA 2NW0A 5FSEC 1TPFA 2P5NA 1MDLA 3HG5A 1K8YA 1LYXA 5BRPA 3IIPA 2B81A 2RKXA 2J9ZA 4Q4PA 2I5IA 4JTKA 3R58A 1YE4A 2CIPA 4LU0A 4BHYA 1WXJA 1W56A 1K8ZA 3TA6A 5EB8A 3GH5A 1A5CA 4HU0A 2C71A 3UWZA 2GJPA 1OYCA 3DFTA 1XS2A 2IQ0A 4YVXA 4I7UA 4MTVA 2G96A 3ARXA 4N6EA 1MXSA 4ZQCA 1GTHA 1GYLA 2ZTKA 1LG2A 1M5WA 2CBVA 5G5IA 5LGXA 3EPNA 3HGRA 3TX9A 1DWGM 3OYXA 3KBJA 3LZ5A 1HJXA 4JTLA 3GU1A 3H24A 3EOSA 5ECVA 1UH4A 1U5HA 2QHAA 5FI8A 3UCDA 1JYVA 2W0UA 2C7FA 2VD9A 3I10A 4ZCWA 4H41A 3VIFA 4WD0A 2FFIA 1QNSA 4HCLA 1MMFA 5JBEA 3IRDA 4UZSA 3WJYA 3LTSA 3PFRA 4RDYA 1U30A 3OEXA 4EPKA 1WQ5A 2FVKA 3F2CA 4KPLA 3EWDA 4NRRA 4KH2A 3P3BA 4DJDC 1LWHA 3VNJA 3PUOA 4FMVA 1UASA 4MB1A 4PCTA 2OOFA 2XU2A 4RDVA 2F2HA 3O6DA 3QR1A 3DHUA 1RR2A 1X6LA 3S5ZA 3CH0A 5FD0A 1SFSA 3KS5A 2ZWZA 1AQFA 1Q2SA 1AW5A 5FSDC 3CPGA 2OWXA 4MJ4A 1S1PA 2JE8A 1RHCA 3PTMA 4YNGA 3PTQA 3PZNA 2BVWA 5DCBA 3PZOA 4FSAA 1J5TA 4Q6JA 1ISXA 1LBLA 1HIZA 1CXEA 3CO4A 3RHGA 4KWUA 5TAOA 2VT0A 4LVDA 3A47A 3QQ1A 4D2JA 4K6AA 3B40A 3AISA 3D47A 1YXDA 3SRKA 3A9BA 3OLEA 3QY7A 1M04A 5BW6A 4GVGA 3FSUA 4OVXA 4E0CA 3VNMA 1PKYA 1W37A 2D2HA 2PFHA 4LSBA 4F0MA 1SZFA 3DENA 4I9JA 4Y9OA 3I3BA 3BLFA 2DPEA 1QW8A 2FYMA 4BI7A 4G1NA 4CCZA 4S38A 5IDZA 4Q8UA 1E4IA 1LOSA 4M3PA 3PPHA 4MYAA 5CC3A 3BJSA 2Z2AA 2ZA1A 3LPOA 3EWWA 3GG8A 4GC4A 1QPQA 4CNOA 2NUXA 5JXQA 1HKJA 1Z44A 3WH9A 3LCIA 4Z0JA 5D02A 5L9FA 5D04C 4K8HA 1K3UA 2Y88A 3DHPA 2FZ9A 3UY8A 1EXPA 1XYCA 1V6WA 4X3ZA 3EB4A 3N6HA 4ICNA 3W2JA 1JZ2A 3ARRA 3QLDA 4GBDA 4AX6A 4RV8A 1Q13A 4F0HA 1DKWA 3GU9A 2VGGA 4LS0A 3L7RA 3NXLA 3A5VA 1IEXA 2BOFX 1JPIA 1Q66A 3GR4A 3E9AA 1V3HA 4M6PA 2WVSA 1MW2A 1W9BM 1CB7B 2EPMX 2R1NA 1V5XA 4J28A 1AODA 2CLHA 2QDGA 1Z7AA 4GVFA 3TWBA 2VEIA 3GIYA 3KVJA 3LYEA 3L4XA 2EGZA 1S5WA 1AD4A 1XX1A 2E5BA 4CVWA 2V3DA 1XGZA 1HL8A 3R0UA 1JFHA 2QVHA 1OK6A 1VFTA 4LBUA 3BO9A 2XGZA 3T8LA 5CPSA 3CMGA 3NQ2A 1NP2A 1XSJA 1OD8A 3GR7A 4M1BA 1WAUA 4AY8A 2CHOA 3BC9A 2ZCGA 3E0IA 3UZ5A 2GDVA 1TR9A 1OFPA 2QGHA 3FJNA 4LXFA 1XFCA 1Y5XA 2CZDA 1PX3A 3G1AA 5HQMA 3NQDA 4LV4A 5AYIA 4DM2A 2PGWA 4GIEA 2C19A 5EMLA 4PEEA 5JMUA 1KTCA 1GEHA 1E1EA 2XG9A 4ATDA 3THCA 2EPHA 1RV8A 4PB3A 2DSVA 3WCZA 1PWLA 4JOMA 5E70A 3A6OA 3PBGA 1TIMA 4H6RA 3W2NA 3NSXA 3TLQA 2VC6A 2A6LA 2YLAA 3OVGA 4EK7A 2CLLA 4XUGA 5DMMA 3UJSA 1A5SA 1EPVA 4DJEC 1U5JA 2DSZA 4NZ1A 2FPVA 4M80A 4B9YA 3MHGA 5C2XA 1XC6A 1DWHM 2FMOA 1XIJA 2ABAA 2GPTA 3OLGA 3FAXA 3GFXA 5D9NA 3WDHA 3TXZA 5HUPA 1R3TA 4WY0B 2F2KA 5LHEA 4BK9A 5A1AA 3VNKA 3NPXA 4WY0A 3TROA 2HVMA 1V79A 2YB4A 1W1TA 1LWJA 3OHMB 2BGSA 3LRLA 3QV6A 4MSSA 1CLVA 3MO4A 1F6PA 4DUOA 2YPIA 1U5VA 4TMCA 3QZEA 1PHWA 2P88A 3MJMA 2A0NA 5G1YA 3M4HA 5IFTA 2ISWA 3T7VA 1GONA 2YLLA 4NIRA 1B5TA 4J2PA 4D1IA 1TMHA 4W8AA 1F4HA 1MO0A 2WNNA 3KOWA 1Q6EA 2YZRA 1Z69A 2G3IA 4U10A 3MUAA 5KZ6A 2E9MA 3A3XA 3IJ9A 3BUVA 3OVPA 5C71A 5K9DA 4P8XA 1XXXA 1XDMA 4JBRA 3VMNA 5M3WA 2OEJA 2W67A 4HPGA 2XPKA 2HVNA 1K4GA 5FF3A 1VLIA 3LBCA 1WXZA 4QROA 4GUIA 3P6LA 4Q3MA 2C15A 4HB7A 5DY2A 2Q8XA 1Q6OA 4WCJA 1TTJA 1YW1A 1O68A 5BRBA 4AD3A 4IFRA 4AF0B 4P8VA 1FWFC 1GKPA 3AJXA 4PUWA 4AF0A 4U33A 3N9SA 5D38A 4FO4A 3BLDA 1I45A 3L4WA 1HL2A 4OWGA 2OSXA 3NQ6A 3NGFA 1UKSA 3VFLA 1UPPA 1TX2A 1GVIA 4BKNA 2W9MA 1YHTA 4B3LA 1SGJA 2ZX5A 3LMYA 3IVSA 3ZM8A 2V81A 1JVNA 3FAWA 1JGIA 3N13A 1XYMA 4UUIA 5CZ0A 2OZ8A 5A8NA 2P53A 3GLCA 3LGEA 3QEZA 4IMFA 2V67A 1JPMA 1LG1A 4TO8A 4ZTXA 3W1RA 4JIPA 4A3UA 3CHFA 5MHBA 1S2AA 4U28A 1AQ0A 4N4QA 4O14A 5AY7A 1UP3A 3DFOA 2G37A 1R7OA 4LCRA 4UQDA 3PWGA 1CW2A 5KZMA 1GGOA 5CSYA 4Z1DA 5HNRA 4N9CA 4JTTA 3NEHA 2VDGA 4MY1A 2BHUA 1IEVA 2DVTA 3M44A 1F07A 2V2CA 3R89A 5DFAA 3S2LA 4KGLA 3WD0A 3TV8A 1I4NA 3W6LA 1E72M 4C6JA 5FACA 3W38A 5A2CA 3U7BA 1OGBA 2PU0A 3QR3A 2X1UA 5CC7A 1PB0A 3V0SA 2ABBA 1Q6FA 3R11A 1UQYA 2GGEA 4GFSA 1IT0A 4IMGA 4FZIA 4DZAA 4PBEA 4J3ZA 2C1IA 1PV8A 4XZIA 4ES4A 1P0EA 3CH9A 4Y9PA 2AAAA 3S2CA 4NL1A 4DBEA 2CESA 1Q85A 4DN1A 4MWAD 2X05A 4PMQA 2VFIA 1WZMA 2ZADA 4IIFA 2JFEX 3VD3A 1K77A 4DWSB 1OBAA 3T0TA 1OD0A 4UMBA 1QHOA 2OSWA 1NFGA 4YTTA 3DKJA 1H1YA 3AJ7A 4G1KA 3AZRA 3WL0A 1DEDA 3SJNA 3KLKA 1EIBA 1U1JA 3SN1A 4L80A 3AWOA 2E28A 1S1RA 4AMCA 5FEPA 1GOXA 3H70A 1XRVA 1JQXA 3W86A 3R0KA 1IR1A 3ZQ9A 1BXBA 1IIHA 1AQMA 5CPQA 4UTMA 3VUPA 1RPXA 4QDWA 4LALA 4HK5A 4IHCA 1E6SM 1FWAC 4KETA 2WHLA 5I7GA 3L68A 3PM6A 4KT2A 2NV2A 4H9XA 1W5NA 3OPSA 1GQLA 4TX6A 4LVBA 2UY3A 3TCSA 4C90A 2ZRUA 3LCWA 1VEOA 4WJXA 4O15A 3NL6A 4PTDA 5DT5A 1KB3A 1X6UA 3TDFA 3W1PA 1E5NA 3C8NA 3M0MA 2WYSA 4PMJA 3FEMA 4LYRA 1EKOA 4CNSA 4MM1A 4QLLA 3ZFHA 3O05A 3T07A 2E77A 3JZEA 3P93A 3BV7A 3WK0A 2VFDA 2Y89A 2ALRA 2YBTA 2GGJA 2W79A 4HMNA 1DJGA 1O5XA 1TA3B 3AROA 3VIGA 4H4IA 3U5YA 4K8EA 3QHOA 3CXOA 2Q8ZA 2GUBA 1EWEA 4MIMA 4L56A 1DPMA 4H00A 1S2VA 3W88A 4CU8A 4FNPA 1GORA 4QHRA 3QW3A 1E43A 3DXIA 4WSHA 4HOZA 4WOZA 4R88A 4X0VA 1OFRA 4NKCA 2AL1A 2JKAA 1QO2A 2J77A 1XRSA 1OF8A 2HK0A 2GVYA 1ZBCA 1O5KA 3QFWA 2D2GA 3N4FA 4LWWA 4KRUA 3ITTA 5H1WA 4I5XA 3B0XA 5KZEA 4GO8A 1KFLA 3GXMA 4IJRA 2X0HA 2VTFA 1DQXA 3PFMA 1OY0A 1S3HA 3MW7A 1Y8BA 3LCFA 1DHPA 4IPJA 3NNTA 4Q8MA 4H8VA 1M7OA 3GS6A 5B7YA 2A3CA 1GVYA 1MRAA 2FGZA 3SGUA 1E1FA 1EYWA 3W28A 2Z7GA 4CN4A 4DWDA 3G1RA 4AWUA 5I6SA 4GIRA 5DY3A 2BX7A 4MKVA 4AD1A 1W1VA 1YADA 3NQAA 5A6JA 3GUWA 3TLLA 3JUGA 4H6KA 2GYIA 5C9XA 3PBUA 1T5AA 5ABHA 3BOLA 3H6OA 3LDVA 4GY1A 3UJFA 3EOUA 4RX0A 4O28A 3WQ4A 1B9BA 3W7PA 1WYIA 4YYCA 4PTVA 4YHGA 5JBDA 3ZLHA 4ZENA 3IGXA 3WLHA 3ECQA 5E5CA 1GJPA 3WD1A 3MKVA 3SGZA 3S9IA 9RUBA 1VYPX 4IMDA 2NLIA 4UTTA 1KGWA 1A53A 3GVGA 4AW7A 3CAKA 4HMEA 4TVDA 3T9PA 4WHBA 3NM3A 4UQCA 3SRHA 2FJUB 3KL0A 2YKKA 4K7VA 4GCAA 3UJEA 4LH8A 3TCEA 1NEYA 3CYJA 4RNFA 5HMSA 1UQZA 5DBTA 1LQ2A 2H9AB 4YU1A 3GG7A 1ZAJA 5HULA 3EKLA 4TV5A 1V6YA 3BE7A 2H9AA 2R91A 1A0DA 2DIEA 2VGIA 1XIGA 2E68A 3NL2A 4LVFA 6XIMA 2X1SA 1IEQA 3LUTA 4GZJA 4IISA 1VCGA 2IW0A 4UFIA 3W7HA 4A8LA 1IWAA 1FWBC 2E6YA 2VM8A 1IQ8A 1MW1A 4FA3A 1CZ1A 3CT7A 3B9OA 4GKLA 4E3TA 2Q02A 4JHOA 3K8MA 2Z2BA 4FOKA 4LV9A 4G7EB 1OADA 2WKLA 1CENA 4LUJA 4LYPA 3E2RA 4NUWA 4G7EA 4UR7A 3RAOA 2J7FA 3R6IA 4W5UA 3WUGA 3VIOA 1CXKA 2PDFA 3G0XA 5FIPA 1OABA 1S2UA 1XIIA 3QPEA 3CO8A 5TIMA 4EX4A 1UHVA 1KM3A 3H7RA 5AHEA 2DFAA 1N7KA 1X8CA 1DWFM 2X40A 1MFVA 3EA2A 4JKKA 1ICSA 4MWAB 1D8WA 3DZ1A 2FMNA 3FW6A 2PDJA 2VRKA 1H1ZA 4MWAA 2JKPA 3EDKA 4W8BA 4UR9A 4J3WA 4I5UA 3C4UA 1UWIA 3VOGA 3S1UA 3VZYA 1K70A 4M82A 4ZB2A 1EEPA 4HMCA 4IM4A 3REQB 5D09A 1CDGA 3U7VA 3W75A 3REQA 4RNIA 1VHCA 2BGQA 1EF3A 3G77A 3MP4A 3L4UA 1AZ1A 1TTIA 3O15A 3LERA 3N15A 3QPZA 2XIJA 3R7MA 2P76A 4YIWA 3WLKX 4DJFC 4KGJA 1ZGDA 3TEVA 4OOZA 5D9OA 3GVQA 3RLUA 1A3XA 4FXRA 3CNYA 4UFLA 3P0XA 4IIBA 2BP1A 1FWTA 1GVFA 4O1EA 1HO4A 4GH1A 3ABRA 5FJPA 1OGSA 3UWVA 3VNDA 3SEPA 1RP8A 1QFEA 3AYVA 4LS2A 2GVGA 4TU1A 3SN4A 3T6CA 2CWXA 3SY5A 5EMMA 3IIZA 1KXHA 4B9ZA 3MI3A 5A8GA 3V36A 3ISIX 4GJIA 1RA5A 1E6ZA 1BYCA 4OBTA 4QJ5B 1GWJA 3GHRA 2FZNA 4JR5A 4R9OA 3WUBA 3P5YA 3F4CA 5D32A 2HPIA 5XIAA 5AHLA 2XVLA 1PIFA 2PP1A 3HGSA 4UNIA 4S39A 4L65A 4LOCA 1WPCA 3LCHA 3MMTA 3M7SA 4RPQA 2A1YA 2CKRA 2GSEA 5CC6A 4G56A 4D8AA 3WD4A 3TFXA 4WSJA 4CQ9A 3GE7A 1HJUA 3HG3A 4ZFMA 2IKIA 2ZXAA 3R2GA 3IRSA 1J6OA 1W5PA 5D2YA 5C70A 1RJRA 5D30A 4LY4A 2ZZ7A 3QGAC 4N02A 2Y1HA 1X8FA 4QG6A 1SVDA 3GDRA 4FLOA 3MB9A 3WKZA 2PLCA 2OKOA 1KFJA 4Q32A 3NWRA 3OOQA 3C0LA 1V0MA 4WRHA 1OX6A 3EMZA 4HZ8A 1W9XA 3TAOA 5LIWX 2PDHA 1C91A 4QJ4B 2KZHA 3PAOA 3ARYA 1W1B1 1O95A 5CPNA 3R8RA 1XR2A 3BJFA 3UWWA 5EMKA 4EANA 2IQDA 3T2PA 4TVCA 1TKKA 2G8ZA 3AHZA 3AIBA 3THUA 1C7SA 2E0PA 1Q7MA 1VS1A 2NV1A 1DOSA 3L4TA 2CZEA 1UCWA 1XIEA 3STGA 1L8NA 3FGCA 2X16A 3CZKA 3BW4A 2YW4A 3U3HA 1M1BA 3BAXA 4XZWA 3TVAA 1R7AA 3N6QA 3RJXA 2QCMA 2F84A 5KEZA 3FIGA 4BF9A 2DH2A 2PDIA 1B9ZA 2QJGA 3NQVA 1OCBA 4DBDA 1RPKA 1CXLA 1G94A 4NXKA 4Z2HA 3W9ZA 3AIVA 3TN4A 4KWVA 4E4FA 2DJLA 1QMLA 1ZCOA 2F61A 5C5YA 3ZYZA 3KRSA 4ZZ9A 2WAGA 1U1HA 3KHDA 3WX7A 1UP2A 3T55A 3EMQA 3SIZA 3ZWTA 1OX4B 4AISA 2PUZA 1NSJA 2BFGA 1K1DA 3VCCA 1RD6A 3ZT5A 1PSCA 1WAWA 2WZTA 4GHRA 5RUBA 1OX4A 2IMRA 5EYWA 4LUSB 1H2JA 1KV5A 3DH7A 2OQYA 5BXSA 3DESA 2EG8A 3T0DA 4TOQA 3W7CA 3WDJA 1BF6A 3VI2A 4AVOA 2VWTA 3CQIA 5KZDA 2VCCA 3R4IA 4QM1A 4CD5A 2VZOA 1A5MC 5A8OA 1A80A 1GHSA 4EOUA 4R53A 2NUYA 3B8IA 5IOBA 2ZUUA 3RU6A 1G4EA 3NUKA 3NQCA 2W61A 4BCEA 5MKGB 2QCCA 4POCA 2Z6IA 4DO4A 1DYSA 2PRMA 5MKGA 1JXJA 1XHGA 4C6EA 4NI8A 3ARQA 5FF4A 2PP0A 2FPTA 1LBFA 1RVGA 4H9VA 3II1A 4LVAA 1CGUA 2PZNA 5E9AA 5C8BB 3SURA 1XLDA 1MSSA 1D3CA 2XSBA 3W1AA 1Y5VA 2QCHA 1JDFA 3IIXA 4H9YA 4J4KA 4NJJA 5K2ZA 4JXCA 4AZGA 2QYGA 1K02A 1PJ9A 1TZ9A 4XTDA 2FZ8A 4HA3A 1OGGA 2BXVA 2QKFA 4NX0A 4UTLA 2D1ZA 4YCOA 2QT3A 2PBOA 1QCWA 3PZ9A 3ICJA 2RFGA 5C9ZA 2X1TA 1SO3A 4J3VA 5IFPA 2FHFA 4QJ3B 5HMEA 2B7QA 1JCNA 2EXOA 3H54A 1TZZA 4LC8A 2VWSA 5AZ1A 4BF5A 4UTHA 3VD4A 2E9LA 2TRSA 3VX0A 2PF8A 4ILSA 4UMAA 1XLKA 3K5XA 1Z8AA 3VA8A 1IEWA 1J11A 1YDNA 4B2DD 4GGHA 2IXUA 2Z24A 3W74A 2D69A 4F0KA 4UNKA 1YPIA 3WF0A 2CXEA 2QPUA 1YBQB 1FWNA 2NQ9A 4PL1A 1LT7A 3G8RA 1YBQA 1K8CA 4L6DA 1V0LA 3M1ZA 3CJPA 4XZMX 1G4TA 1G67A 2XWDA 3PTKA 3J7HA 2WMJA 3CV7A 3VOIA 4NT0A 2JGYA 1Y65A 1M41A 1NWRA 2DT0A 4UQ9A 1JXKA 1HJWA 3GWQA 3M9YA 4L9ZA 3W7RA 3NOYA 3WDQA 3GHUA 3VFCA 1I2QA 2DUAA 1AH0A 3DERA 5CBJA 4OV4A 1XLAA 3EPOA 3PBMA 4JTFA 2ZRYA 5CBBA 4QP0A 3KTXA 2ICSA 3V75A 3TQVA 1KA9F 5H8MA 5TF0A 7REQB 1YQ2A 1BRLB 3W00A 3IACA 1JNEA 3WQ5A 4X9SA 1C7TA 7REQA 2WHKA 4J35A 4D8LA 4DJDD 1WZLA 3CZGA 2YIHA 1VPXA 3ARVA 1V51A 2BDQA 3AFBA 3QRHA 2D3LA 3IJQA 3EBVA 4QQUA 5DN1A 1EJUC 2FLIA 4GZEA 3UQNA 1XLFA 3N11A 4A2SA 1H41A 3WQOA 5I3HA 2E1DA 2XVNA 2FKPA 1T40A 2XZ9A 2YBVA 5AECA 2PDBA 4AWTA 4CQBA 5CLTA 3DFHA 2Q09A 5D4YA 5J8LA 3STPA 5GNYA 3PAJA 2DT2A 3QC0A 3H12A 3MYOA 4BR1A 1TV4A 5HDRA 2VFFA 1FHUA 1BYDA 1PVNA 3EWCA 3QTGA 4PBGA 1ECEA 3DYPA 4XZ9A 3NO3A 4HMDA 1UWAA 1P0NA 2VVSA 5I3DA 2ESCA 3BTNA 5HOSA 4S3BA 5BOEA 2X1RA 2E25A 3NZ1A 4HP5A 5E9XA 1KRBC 3NO1A 2W92A 4GINA 2DZXA 4EP8C 4RZ4A 3UPMA 1B4EA 3QZ6A 1QK0A 4R33A 5E1QA 2RHGA 2NT1A 4JY8A 1MWOA 4MLJA 1NM9A 1QHZA 5EY5A 4IPPA 5DXYA 3HQPA 5I3JA 2CNCA 2FH8A 1E70M 3UWEA 1K7EA 4MKNA 3MZ2A 4W8LA 4YTRA 2VDIA 3W07A 5F2IA 4JTDA 2Z1XA 5D2WA 3CL8A 3E38A 3Q65A 4KRZA 4CNUA 4AY7A 2XIQA 4HTYA 4WZHA 4MJZA 4KCTA 4PBFA 2DDXA 4GUGA 3MUY1 3NEVA 3S83A 3VKKA 4TVUA 5DMLA 4M0XA 1XINA 2F38A 4L4LA 1PO9A 3CIXA 4PL2A 1DWIM 1MNZA 1N2VA 1P4CA 3CUHA 3BCJA 3GC4A 1XDLA 5KITA 1R2TA 3N29A 3L0NA 1B3OA 5CJMA 3MDUA 3CMJA 2O0TA 4L5ZA 2J6XA 1UD4A 1KGUA 4AC1X 4ZEPA 3GNXA 1IXOA 1KO0A 2C0HA 5HAOA 4HN4A 3SCSA 1MYRA 2Z26A 2XH0A 2PGEA 4MGGA 1DIOA 2HWGA 1OIMA 1QNRA 1KKRA 1ZAHA 4C6QA 1TB3A 1S2TA 5IHSA 4C6FA 3UG4A 2E7FA 1ISVA 3N2TA 3CAVA 2DIJA 5HUOA 2UY5A 3C3NA 4UB9A 3UR5A 4IL0A 3UCQA 4F66A 3CUGA 1HGYA 4A22A 1FP8A 1SQ7A 3UG3A 1VBGA 1PZ3A 1DP0A 4L6OA 5GVJA 3ZS4A 3W1XA 4EXQA 1W1PA 1JCJA 3T0BA 2J7DA 5J5DA 3ZXWA 3R94A 1BWKA 2F6KA 1C90A 1E0UA 3ENLA 2DZPA 4UFMA 4JICA 4UCFA 1OFQA 4RXFA 3CV2A 1TG7A 4GIYA 3B0UX 2WXDM 3TC7A 3U8GA 3BG5A 3LD5A 5H6HA 3HQNA 4AU0A 4C7GA 2O7QA 1LZOA 4DAIA 4X60A 4AIEA 1KR0A 1IHIA 4DQWA 4S3JA 4DZIA 3HFTA 1FFQA 3WDPP 2Z7KA 2PWFA 3T0CA 4LJ3A 4IIDA 2CLMA 4B2DA 2W63A 3HGOA 4BS0A 1DTNA 3CTLA 3EOOA 3QY6A 2QCFA 2OYMA 5LKYA 5C7HA 1UR1A 2Z1VA 1UBPC 2R82A 4J27A 4PYSA 2DU2A 1F2JA 3QMRA 4EPBC 1RALA 4CD6A 4GYFA 5HJXA 4H7VA 4DJED 2TMDA 2QULA 1V3KA 3E0VA 2TAAA 4P7RA 4XX6A 1OC7A 5FEZA 1OJXA 3GNDA 1UKQA 3EEGA 2PDMA 1HN1A 3PUDA 1PXGA 3D3FA 3AI0A 4LT9A 3NQFA 1FRBA 2QDEA 3ID7A 3DFPA 3W01A 3LCGA 3B0YA 1SFTA 2OLHA 4RZ5A 5CQ1A 2XH7A 1KM2A 7ENLA 1JJKA 1NWUA 2CZFA 1TRIA 2D0GA 3B9EA 1UKPA 5E6YA 3W85A 5M5DA 4FNUA 3POHA 1ZP3A 4D6FA 1EA9C 3IVUA 1XISA 4XIAA 2E40A 1AA1B 3W72A 4DJDA 1J0ZA 3M5VA 1S46A 1EBHA 2ZXBA 3WFZA 4FNTA 1TCMA 2WSQA 3OIHA 5CSSA 4NZ5A 2QPSA 3QM3A 2DZWA 3EA1A 3INPA 1XLEA 1P0DA 1KM4A 1CGTA 4CNNA 1GPFA 1A5LC 1QR7A 1QBAA 2JEPA 2PDLA 2CBUA 4MNKA 3LHZA 4DI8A 4HPXA 3O6AA 3MI2A 3TJXA 3V4BA 4O50A 1VFMA 3QSTA 3DI0A 3OLIA 2R6OA 5I77A 3MVIA 4DXKA 3N14A 3OBAA 1TPVA 4DF1A 3ONBA 5C2GA 1KM0A 1QNQA 4IX0A 2CLPA 3VYLA 3OGSA 3QMSA 1ZHAA 1ITXA 3CUIA 4HNCA 5DLCA 1MNSA 5DQPA 2PDGA 4EWJA 1H50A 3GXIA 4KEZA 1DIDA 3IGHX 1KM5A 3NYZA 3MMDA 1N8FA 4NG3A 1ADDA 3BJTA 4JIHA 2NXHA 4OU1A 4YTUA 2PE4A 1Z42A 2PU1A 3V0UA 1VBUA 2EHHA 5LHFA 3T2QA 4E6MA 4ZO7A 2ATMA 1TWZA 2AKZA 1NDZA 1ITCA 2W91A 1EDGA 1WDWA 2XFYA 4JDYA 4R7JA 4YL2A 3OIXA 2OMAA 4FNSA 2VRQA 5BMWA 2J8GA 5CGTA 3OLDA 4HKPA 2HV5A 1R2RA 4NJKA 3UA4A 3OGRA 3AMGA 1J18A 1PTAA 4LUYA 4Y8EA 2X7VA 1NDYA 3RM4A 2RDXA 1HVXA 3I6RA 2J79A 3SZ8A 1ZNNA 5REQB 4KCUA 1MVYA 1LDCA 3KVKA 3VOFA 3N19B 5G1MA 3TYBA 5CGMA 1B30A 3DECA 3AALA 3WFLA 1JAKA 4JCMA 4CCDA 3ZT7A 3ZSTA 1K9FA 4NNCA 1QI4A 5GQBA 3WQFA 3NL5A 3WJZA 3MSYA 4UQEA 1K8XA 3UXDA 1SW3A 5GPRA 4O54A 2YBUA 3KBVA 4JIIX 3W7LA 1V77A 1XBXA 3P60A 4IPNB 4H6EA 2ZYFA 3ANVA 2FTYA 1TV8A 3W1UA 3HPFA 3ITXA 4L1XA 1FTXA 2YCEA 1HJSA 4Y2WA 3O07A 1R9XA 2QW5A 1WE5A 3PZUA 3PN8A 1UBSA 1KXTA 2HJPA 5CZTA 2YL8A 1EX1A 1HL9A 5KSWA 1NVMA 3AICA 3W2MA 2HRWA 4W86A 5JVLA 4F4RA 4QLJA 4RL3A 1W9VA 4GOAA 2I17A 3RUBL 1J6PA 4AFYA 1BYBA 3LPPA 2QJNA 3NA8A 3WLOA 4JTRA 4ZXOA 2PTDA 2R9RA 4XKYA 2QF8A 2DP3A 5GJMA 2PMQA 5HATA 3C2RA 3UA3A 1TV2A 5HPCA 4UFKA 1Q7QA 4Z1BA 4E2DA 5EBUA 4MZYA 4MB5A 2ZOXA 2YXGA 1QPRA 4O8RA 5HWMA 1N8IA 1RUSA 1PEZA 5I00A 4XAPA 3VOHA 5LIXX 2Z29A 2BHZA 3VKCA 4M1RA 3BLPX 4QAWA 4A4AA 2B7PA 4O17A 3EX3A 1C9DA 1LP6A 2DUXA 5HPOA 1TFVA 2WMIB 4HJFA 3W7MA 3TJLA 4OQVA 3GVVA 2XSXA 5CCZA 2WMIA 1GVOA 1HKWA 3MV01 3CM4A 3L67A 1SFJA 2Z4GA 3H2AA 3KBSA 3STEA 3PBYA 4DJEA 3E5PA 4OUIA 2A3AA 2ZTJA 1ADSA 2FJKA 3LS9A 3PZTA 4PUDA 2GDUA 2ZX8A 2NQZA 3VABA 3TYZA 2WB5A 3WH8A 4XZNX 4FX6M 1UR8A 1W3JA 3PSWA 3C2EA 3MMUA 4J3TA 4WJ8A 5F1UA 3CL6A 3JS3A 1OB0A 5AHMA 4KIEA 1PYFA 2QVNA 2GQAA 2QUNA 4DM1A 2YL5A 2WSRA 4XISA 3G5EA 3W24A 3A3HA 1RY0A 2OCZA 3K4AA 4N9BA 3HV8A 3GQYA 3F4NA 3APTA 3MP3A 4NYUA 5BXTA 4Y90A 3LBMA 4B90A 5K7JA 3BAWA 4DI9A 3DDMA 2TODA 3B8SA 4HN8A 2J24A 3NZQA 3QR0A 3N25A 2MUCA 2HVOA 1A5OC 3P0WA 2ISDA 1V3IA 2J4GA 4LF1A 1B1YA 1V02A 4K8GA 1V4YA 2ZUVA 2INEA 2AL2A 2RUSA 2WLZA 2I1OA 4ZQPA 4XTIA 3FX4A 3BQ6A 2Y2WA 1I9CB 2GK1B 4QSFA 3NPUA 2YXXA 1X1OA 1XH0A 1NF7A 3B0VC 2GK1A 4FXJA 2VR4A 1V03A 4W93A 4CCEA 4GXWA 4GLEA 1J0KA 3HOJA 1R9ZA 4JTJA 4K38A 4LAKA 4YYFA 4XB3A 4W88A 2VVNA 1H49A 1XH2A 2A6NA 1S5NA 1C8XA 5F4SA 5T8GA 1F9CA 5AHFA 4F0LA 3L5MA 3PHAA 3G24A 4LF2A 3R8GA 4UQBA 1NWSA 4LW7A 3VD7A 4W5ZA 3UXIA 3ABSA 3WBWA 3O6CA 3VNIA 4NQ1A 2PBGA 1CLXA 4HZ6A 1SSGA 2XTKA 3O06A 3W71A 1AJ0A 3NSMA 3A4JA 2EKCA 3LQGA 4HHLA 3F5LA 1HKKA 3GDTA 4DNMA 1GQKA 1UC4A 5G2WA 2VDHA 3U4FA 7TIMA 3M16A 1R86A 4PC8A 2YDQA 4LBSA 3ITCA 3V1HA 1GOQA 2Y61A 3VK5A 1E0TA 1JYXA 1R6WA 1XKYA 2AKMA 2W62A 2E4TA 1CB2A 1IZJA 4QE1A 3ZLGA 1LBMA 3CGTA 1US2A 3QF0A 4JN8A 3RM8A 3R13A 1XYBA 3VVGA 4DXVA 1K7FA 4NILA 1S5MA 1D2KA 1HT6A 5MF5A 2P8CA 1PX8A 3T2OA 3VIKA 1E4NA 3GTNA 3GIPA 3CHEA 2XN1A 4B3KA 2DY3A 1EOKA 1KBIA 1UZ4A 4GYJA 5KINA 4XG1A 4UXDA 1KXQA 3EA3A 3LG3A 5JH2A 2DZVA 1LJYA 4C5YA 2Y5SA 3C2FA 3S47A 4W7VA 4JTIA 1QWGA 3KOXA 2VOTA 3PJUA 4IXHA 3BOFA 2XIIA 4CU7A 3TTOA 3NZGA 4IXXA 3VM7A 3LLDA 2UWFA 3OGVA 2FB2A 4C6NA 4NVTA 3HIJA 3V1PA 1NAL1 1EHAA 2PA6A 2PC4A 4LAUA 3P8JA 1US0A 1X6NA 2J13A 1QPNA 3KP1A 1IIGA 2HNHA 1XIHA 3NM1A 3W7EA 1HJQA 3ZJ8A 6A3HA 4JYEA 1GCYA 1UW9A 3NQEA 8A3HA 5JQ9A 4HSHA 4QS6A 4RDWA 4XVDA 3VIMA 1WKEA 5BXRA 3QC3A 3C0QA 3S6DA 4WOQA 4C65A 3W1QA 5CH9A 3V7PA 2PWDA 2HNEA 1F3XA 2IPWA 3K46A 3MUCA 4IGNA 4IGMA 2O9OA 3L2MA 3AO0A 2BVTA 4LS1A 1VRXA 3G1DA 5HJYA 4GQGA 4GYPC 1IGSA 1R3RA 2CLFA 5A69A 2I7GA 3NAVA 2DQXA 5LA2A 3QVQA 3VXGA 7XIMA 1TPDA 3M0KA 3VDHA 4C7DA 5DT7A 3KFTA 4FF5A 4DJFD 1ZTVA 4OKDA 1XG4A 3KOYA 4V2XA 4HJWA 2H3DA 1PHQA 4CCCA 3WIJA 4DYEA 4WGHA 1PTDA 5BWAA 4TX9A 4RNHA 5DMYA 1E6RA 3E5BA 1V6VA 3A24A 4KW2A 1JD9A 4FX8A 1YPXA 1OCQA 4PUUA 4DEFA 1BWVA 1A5NC 3GDBA 1BSIA 1E15A 2FDSA 3LY0A 1TVLA 1CECA 4B16A 1TUFA 4BWLA 3QHMA 3N2CA 3OJGA 4IWWA 5E93A 1OCJA 2WQPA 1SU5A 5I78A 4K39A 4ZE4A 3C5QA 4WIWA 4QTGA 3TZFA 2D2JA 1GOOA 4C6CA 4ZFCA 2V9DA 2ZDSA 1Q7ZA 3BXWA 2ANUA 1WP6A 1R87A 2YR1A 2QJHA 2JIEA 2XINA 1FCQA 1HVQA 4OUEA 4DAFA 5ECUA 1M01A 2IS7A 1X1NA 1ADOA 4JPGA 3L66A 3SCWA 3HZ3A 2GOKA 2PTXA 1LOLA 4R85A 4JFSA 3BLOA 1TPWA 1I1XA 4N6FA 2OQLA 5EL1A 2O4QA 3VE7A 3QXBA 4FF7A 4XAZA 2RDUA 1WDDA 3TR9A 1SZEA 2XGBA 4DPPA 2FHCA 1Q6GA 4RR4A 3MPGA 3I65A 4H9MA 3KL3A 5G4HC 2W4XA 4BZYA 1I8JA 1GOMA 5A2AA 4N9DA 3VIPA 5KMYA 3P5ZA 5GNXA 5JBFA 4XSLA 5AC6A 3NQ8A 3UXAA 2Y7DA 3AWNA 1MUMA 1WUEA 5IHRA 1FCBA 3UCCA 2PDKA 2YYTA 3LHWA 2V8ZA 1W3HA 1AH3A 1BF2A 4EAMA 1M7PA 3GXPA 4UTFA 1H5VA 3BL3A 2W27A 2UY4A 4UQAA 3BCDA 2VZUA 4ZSTA 1H5YA 3OG3A 4KFPA 3CUZA 4B5VA 5FEWA 1TJPA 2RAGA 5G2IA 4WX2A 3BAIA 1B31A 3KBNA 2VX7A 3RMEA 2OLSA 5DRCA 4US5D 2QIWA 3DC0A 6REQB 2DW7A 2FTPA 1FWIC 2VX4A 3BZGA 1BFNA 4P7OA 4MDPA 2J9YA 3MUZ1 4O11A 4E8DA 2W3ZA 4H3DA 1UWUA 1QK2A 4QDMA 4JGDA 3RR4A 1NIUA 2A2IA 1YNQA 4HYWA 3PANA 1UB3A 4OIFA 3UJ2A 1XCFA 3TQKA 1TJ1A 1EC8A 3BH4A 3DUGA 1JPDX 3WBAA 4YWSA 3H23A 2HXUA 2WC3A 4DUXA 4MFEA 1VQTA 2CLIA 2RDTA 1REQB 1K6AA 3GIQA 3GTIA 1DTUA 3I68A 3JR2A 4QISA 5CAHA 2J7EA 4CD7A 4GY7A 4C91A 4IOTA 1V08A 3F5KA 5FJJA 1JD7A 3TN3A 3P61A 4J40A 4ML9A 4P2VA 1ME8A 3W6YA 1PKLA 5CEWA 3FHAA 3AIQA 2OGJA 3IUHA 1UR0A 3H4XA 4D6GA 1OC5A 2HE5A 2ZRVA 1ONXA 3MDWA 4KKXA 3F1QA 3BICA 3RK8A 1RCQA 3WENA 5FJUA 3BMXA 1TMLA 3WF3A 3V18A 3URQA 3PZVA 1GKQA 1W5MA 5DX7A 4Q7IA 4MKSA 2RDWA 2GJRA 4KCVA 3WNOA 1H7PA 3R5EA 1VLWA 4LB3A 5FEXA 3G22A 1M7XA 1EO7A 3T42A 3MS8A 4U3AA 4GMEA 1CGXA 3EX1A 3UFYA 3GTFA 4S3DA 1FOBA 2PRLA 2OEMA 5HNTA 1I2NA 2XWEA 1OHLA 4JTHA 3U57A 1KC7A 1MZRA 4I7WA 3ALGA 3E2SA 3PPGA 4GI8A 5A8MA 1W3LA 1P43A 4UNLA 1GYNA 3LB0A 3UGRA 1F73A 1OYBA 1HKMA 4OE7A 4N4PA 4RUBA 4BI6A 4YCPA 3URAA 2INFA 3BURA 2GJLA 1M53A 2X2GA 3ZVIA 3ZJ7A 3SUSA 2F6UA 1QRQA 2VHLA 3PR2A 4MFDA 1MZHA 3LQLA 3NVDA 4DJFA 4WDUA 4EWND 2WPGA 2FIQA 2OVLA 5XIMA 4BEUA 1BGGA 1BD0A 2A3BA 3TYUA 1EIXA 1GZ1A 1O12A 2FZMA 3FFSA 2GGHA 3M41A 1R3QA 4L4PA 1VBJA 3Q67A 1E3ZA 3WDRA 3VNYA 4BJHA 3BGGA 2RH9A 3UYCA 1S39A 2HZGA 1CXIA 1QI3A 2YSWA 1EQPA 4CVUA 1TQJA 3GM8A 3MYPA 5D8ZA 2JBMA 5AYYA 2DSUA 1PIIA 3HV9A 3WQ8A 1E6QM 4WDTA 3WD2A 2NT0A 4IH3A 4ACZB 4J3UA 1O5RA 4ACZA 3W1TA 2DIKA 4DWSC 1BYAA 3W1LA 3LTYA 1VEPA 4X9YA 4A3YA 3GK0A 2PD5A 4JS3A 1XLLA 4O53A 4GIAA 4WGXA 5K4ZA 1ZAIA 1JUKA 3BV4A 4D6JA 5CSUA 3V5OA 5EMYA 3M5YA 4QX4A 3WEZA 1IR2A 1I2OA 4AYGA 2OO0A 4WXZA 3LRMA 3CQHA 1P48A 1XV8A 4Q4SA 2BS9A 3E96A 3I4KA 3PPFA 1N82A 3DEQA 3AIWA 1ZP4A 4YWIA 3VNLA 3FXGA 4C6IA 1QT1A 1HP4A 1RQEA 2ISSA 4NX5A 4GO9A 1C8YA 2CETA 3H8AA 4S3GA 4RV3A 1U83A 3ZJKA 1QASA 3T8QA 2Y8KA 1TCDA 4RK8A 1GVSA 2WZIA 4US6A 4PMRA 4J1OA 4B3ZA 1Q6DA 4ZQRA 2OTDA 1K9EA 1VFLA 5CPTA 2BHYA 4R7OA 2CFFA 4ZR8A 5EFDA 5BCAA 2X30A 2PODA 5JH1A 1OCNA 3S2MA 1IXNA 2A5HA 1M9HA 2FZBA 3BAJA 4LC6A 3K2GA 1PE1A 4CD8A 4ZBCA 3SIMA 3WLIA 3F4VA 3A13A 2O9PA 3G1HA 1CI1A 1X7IA 5EPDA 3ATZA 3EXTA 4FI4A 3VGBA 1C92A 2GUYA 4US5A 3AU2A 3AXKA 1GZGA 3SRDA 4R9XA 1UJQA 5A8PA 1AW2A 4DVOA 1XDJA 1CNVA 1XUZA 1JCTA 4TMBA 3IJIA 1EX5A 4E38A 1TPC1 3PS7A 5HMDA 2PLKA 5F2LA 2FTWA 4HHMA 1P5BA 4JFWA 1VH7A 2V5BA 2QUTA 1R38A 2WO5A 1WV2A 1Q6QA 1FKXA 2IKJA 1RBLA 2O56A 3OTRA 1TWSA 4IP4A 4ECLA 4LCQA 1OVDA 1EDTA 4O12A 1RVKA 1CTNA 4UTWC 1VZWA 4IGHA 2ZUNA 1BVWA 2HEJA 3P2VA 3KW3A 2WVTA 2Y63A 3OZPA 2YGYA 4GGBA 3N9RA 2A7NA 3N6JA 2EG7A 4X0NA 5LNRA 2Z6JA 3CASA 1UUQA 3FA5A 2HXTA 1EA0A 3GC2A 3LK6A 4AIOA 4DIAA 2HTMA 4HYVA 5HXMA 4BF7A 2PDNA 4S3KA 1WKYA 2YL9A 3F4DA 1R3VA 1EEXA 1P6BA 2NQ5A 3HGJA 3H4GA 5D2VA 1HP5A 4C6KA 4GQRA 1OM0A 1EGVA 3AS2A 2HQAA 1RZMA 4PUJA 3WLPA 4QCEA 1XIBA 1Y5WA 2QCGA 3ANYA 3EZ4A 2QPXA 2WM1A 1VYRA 2Y6ZA 3HPXA 1NY1A 2OZ0A 1R85A 3IEBA 2Z1WA 2CZ5A 1SM9A 3GDKA 4KEVA 4J3SA 3UNTA 3HU7A 3ZR5A 1MFUA 1LORA 3VCRA 1PPIA 2Z1KA 4I90A 3PTDA 3W27A 4RLIA 2E8ZA 4XZLX 3AUOA 2VEGA 3KVLA 3NURA 3TSMA 4N42A 2DJXA 4DUWA 4MVAA 4QQ3A 3OQ8A 5CPOA 2NZLA 1QAPA 3E49A 4XV0A 3ZJ6A 5I02A 1Q6LA