2Q3RA

Ensemble refinement of the protein crystal structure of at1g76680 from arabidopsis thaliana
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
361
structure length
351
Chain Sequence
SVPLLTPYKMGRFNLSHRVVLAPLTRQRSYGNVPQPHAAIYYSQRTTPGGFLITEATGVSDTAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYMAESLNKYGILYCHVIEARMHTLMPMRKAFKGTFISAGGFTREDGNEAVSKGRTDLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-oxophytodienoate reductase 1
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 117
structure length 351
sequence length 361
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2q3rA00
3T7VA 2E09A 4UTUA 1LTDA 5D09A 1L9WA 5F1VA 2QR6A 2Z0IA 3TFXA 4FEZA 3OEXA 4PH6A 3M16A 3O6CA 3GDKA 3FFSA 3TK7A 2QDGA 4N4PA 4LV9A 4FIRA 5E1QA 4O50A 5F4XA 3W1MA 1JCLA 1YDVA 2BWGA 3G22A 4KFOA 2PRHA 1GG1A 4B5NA 5FEWA 1TPEA 4MKNA 2ISVA 4R34A 3UPBA 1XDMA 3W73A 3AJXA 3KRUA 1MEHA 5MHBA 3PM6A 3GKAA 1O95A 3LBMA 4FX8A 4AAJA 1KFJA 3NQVA 3P61A 3MBFA 3DU0A 4CQAA 3ZFHA 5LZLA 2A5HA 3NEVA 3DFTA 1Z48A 3IIXA 3G18A 3W9ZA 4HSOA 1SW3A 3L0KA 1OFDA 4XTDA 1OHLA 1OF6A 2ABAA 2Q8LA 4TX9A 3TSBA 3I7QA 1RR2A 5DN1A 4FXSA 1PL9A 3UWZA 3EEGA 4M7TA 3TCEA 3UWUA 4K8HA 4BWLC 4YCOA 2FIQA 4JIQA 3W1NA 4K37A 3G1DA 3STEA 3Q37A 4CLMA 2I1OA 4TIMA 3MP5A 5D05A 3P8IA 4PL1A 4JX4A 3O1NA 3QMTA 3EXSA 3HGJA 4YMZA 3P80A 3THAA 3QPYA 1M5WA 1IIHA 1ME8A 1GWJA 1H7NA 3L66A 1M7PA 1OX4A 3L21A 5HR6A 3B0VC 2ZZ3A 1WAUA 1X8FA 1I2OA 2H3DA 4Z0JA 3M43A 5F2LA 1GYLA 1XI3A 3NPXA 5KTLA 1J4EA 3S9YA 2RDTA 5F4WA 1LDCA 1KFBA 4AHOA 4PA8A 5C54A 5DCDA 4UXDA 3RU6A 3WJYA 4OHQA 1KV5A 4IPIA 1XBXA 2R14A 2X30A 1TMHA 5CPOA 2NX3A 2YDAA 2E5BA 4JY9A 4A29A 5AHIA 1XUZA 2DZTA 4W9TA 4LVGA 3W70A 1FCBA 2H8ZA 4IMGA 3GXNA 2ZA1A 1D3HA 3RMJA 3W7QA 4CQ8A 5HUPA 5BMXA 3INPA 3EWXA 3M44A 2OJPA 5FF3A 2RDUA 3ZS4A 1VH7A 5HWMA 3A22A 2GQ9A 1TIMA 4WOQA 3R5EA 1FDJA 2TYSA 2NUXA 8TIMA 2ZRXA 1D9EA 4GBUA 4RZ5A 1I45A 1K3UA 3M5XA 5FF7A 2XFWA 4JX5A 4O18A 1SUXA 2JBMA 4DXVA 1ZY9A 3LCWA 1XFBA 4MYXA 1JVNA 4JDYA 1VRDA 4AVFA 2B7QA 2V81A 3NQDA 1JUBA 1OABA 4NVTA 1ZENA 3I6RA 1GOXA 3MHFA 2XN1A 1QAPA 1CX9A 1XUUA 2EF9A 1KTBA 3UXDA 3BVJA 3NQMA 4UMCA 1S5TA 4M7SA 1JRCA 2ATMA 3NXFA 1O94A 5AC6A 1ALDA 1EA0A 3DH7A 2Y7DA 2TRSA 3GR7A 1OK4A 4S1FA 1R46A 1D3GA 2ZZ6A 3CU2A 1X6UA 2CZDA 3SZ8A 3DFNA 3N34A 3B0UX 3LTYA 1JCJA 1SZNA 2TSYA 4EWND 1VC4A 1PV8A 2AGKA 3ZWTA 4FHAA 4N2YA 5A5WA 1KTCA 3TAKA 3THQA 2EGZA 4CQ9A 1Q6QA 3SSJA 1SZEA 4LRSA 2J9ZA 3CHVA 4ZQCA 2OZ0A 3HB9A 3UWWA 3F03K 3A5FA 4JTIA 2VENA 3QMRA 5AOUA 2CLFA 1B4KA 1Q6LA 2A7RA 4K6AA 1LBMA 1KFCA 2YCEA 4JTSA 3LHTA 2A6NA 4HNVA 4UNLA 1YDOA 3PY2A 3W7EA 4EIVA 4IGHA 4UCGA 3OA3A 5HMSA 1UJPA 3RLVA 1QPRA 1FWTA 3W2LA 4UTKA 2C6QA 4DELA 2YSWA 2ZZ5A 2VELA 3PBVA 1VCFA 2YYUA 2ZDRA 1LOSA 4UFKA 3UD6A 3G1VA 1A53A 4UMAA 1YTKA 3CWOX 3EWYA 2QCMA 1VPXA 1W0MA 1SZFA 2QDHA 2ZRWA 4MY1A 1OG0A 3O63A 3GVGA 3UWQA 3TW7A 3W1XA 2DJLA 3S5OA 1RPXA 3WK0A 2LLEA 3IGSA 5KSWA 3ABSA 3M5ZA 5AYXA 3QZEA 3OIXA 1R2SA 1RQHA 4JICA 2CLEA 1BTMA 4R53A 2V30A 1EP3A 4N9BA 2BSLA 1A5SA 3W2UA 2VC6A 4Z1DA 1F74A 1EP1A 3PUDA 2HTMA 1O5XA 4IX2A 3TSMA 1XC4A 4AEOA 1H7PA 3LCHA 1X1OA 1AW5A 4RV8A 5DCBA 2QUUA 1FQ0A 3QMSA 5F2MA 1EWDA 3P81A 4UR7A 4ADSA 1OFRA 5I3KA 3PB0A 1K03A 3W83A 1UCWA 4MZ8A 1MEWA 3CTLA 3KVMA 1G4PA 3W71A 3ZR4A 2QCDB 3C8FA 3NQ2A 3R2GA 2A21A 1NF0A 4U28A 4O1AA 2J27A 4QAIA 1R30A 4NJHA 3S42A 4TR9A 3GK0A 3GAKA 5D2TA 1Q3NA 3NZRA 1QPOA 4DF2A 2NUWA 3NDOA 1OVDA 2PURA 5AHLA 3W1AA 3P67A 4LS1A 1PE1A 1JRBA 2GUUA 2CZFA 3FYOA 2JGQA 4UMBA 3W22A 3NQ6A 3STGA 3BLIA 3MP3A 4MZ1A 5DY3A 1Q6OA 4EVZA 4EOUA 3HGRA 5EL1A 3LRKA 3LHYA 1DJNA 5LHEA 4C1KA 5KZEA 1FX6A 5AHFA 4BF9A 3LV5A 5E0KA 4JD4A 5F2IA 3KVKA 1PCKA 4POCA 4MJZA 2ATSA 3FYPA 4YL2A 4JN6A 3PG8A 2ABBA 3G1SA 4RJEA 1QO5A 4AMAA 2Y63A 5G2IA 1YPFA 2E6DA 1LZOA 3LDVA 3TU9A 4FIQA 5AB3A 2ALDA 4O0KA 1W56A 4RCXA 3C2RA 2C1HA 4Q33A 1LLWA 3W75A 1UB3A 1VYRA 4O17A 3N14A 3IV3A 3PBWA 5F1UA 1SZGA 3NL6A 1YADA 1PVNA 3W86A 1OK6A 4CNNA 2ZQ0A 4O8RA 3QW3A 1EB3A 1VLWA 1IGSA 3TE9A 4E2BA 1SSGA 1TV8A 3KOFA 1H7WA 1JCXA 4E2DA 1FWRA 3W84A 2E1DA 1DOSA 2QAPA 3EX3A 2C0AA 2QKFA 4GUHA 3LHWA 5FF4A 5D2WA 3CEUA 1FY6A 3FEMA 4QITA 4AH7A 1VJIA 3GB6A 1KLYA 2PCQA 3I7SA 1ZHAA 4R7JA 3I65A 4TMCA 3CIXA 3LI0A 4N4QA 1QOPA 1W8SA 3STCA 5CGQA 2FDSA 3PG9A 2A1YA 3TUUA 1B57A 3L65A 4I7VA 1P0KA 2DZWA 4YWIA 1Q45A 4CNPA 5KZMA 4MFDA 1WQ5A 5TIMA 5K4ZA 1GG0A 2J9XA 5FF0A 5CZTA 1QR7A 1R2RA 3M1ZA 4IMDA 1UUOA 1S5VA 2CFFA 1QPNA 4UFHA 5FF2A 3PS7A 1OYBA 3YPIA 1JCNA 1CW2A 3NG3A 3WFAA 4GE8A 1LBLA 2HMCA 1YXCA 1K7XA 3R12A 2XN2A 4JTEA 1ADOA 2Y89A 4UUIA 2Z6IA 5EBUA 4KWWA 4Z08A 3U8GA 3DKJA 1A5CA 3RF9A 1Z42A 1G4TA 5H91A 3S5NA 5G5IA 4UIOA 4WD0A 3TFCA 1H60A 1UASA 1G67A 1ZCOA 3W2MA 1ICSA 3M6YA 4XBSA 2E6FA 4E38A 3PBUA 3T55A 3GDTA 4O0ZA 1H62A 4DPQA 4AB4A 3VKJA 1I2RA 5CZJA 1LROA 3KXQA 3KAOA 3PB2A 5HQEA 1DKWA 1H1ZA 2GOUA 1GTEA 1M7OA 2PRLA 3B0PA 4OT7A 2H6RA 1LLZA 1FCQA 2ZRVA 1GYNA 1AL8A 1TSIA 4G1KA 1NVMA 3OG3A 1GZGA 3BO9A 3MWAA 3DGRA 2B7PA 2V2DA 1QCWA 5KITA 1H61A 4AWUA 1NF7A 4XKYB 1XXXA 3LHUA 4GFSA 3UQNA 3O6YX 4DF0A 5H2ZA 2QCFA 3G24A 2X1SA 3BW4A 3DI1A 4WY0A 1BKSA 2VFFA 4JTTA 1H1YA 2EHHA 3GXTA 3T44A 2VEIA 1K02A 3SW6A 1DBTA 1LRNA 4LUIA 4QISA 4Y6GA 1H7XA 1TTPA 3ANYA 3C2OA 4IOTA 3JR2A 4KKXA 4O11A 4JTJA 2JKEA 4O1CA 4NX5A 4RXFA 2ZFAA 1KLZA 1SO3A 2NZLA 3EWZA 3HO8A 4JNMA 3GDRA 3O06A 4LC6A 3EX2A 3ABRA 2GJNA 5FEPA 1FBAA 3C2EA 3NQ8A 4BFAA 3K30A 1GEQA 2JGYA 1TPWA 3DKLA 1KM1A 1JQVA 4O13A 4TMBA 4WY0F 3SJ3A 3OHIA 3NAVA 2OX1A 2DORA 3TJXA 4O15A 3SGZA 3W7JA 2C19A 3WK3A 3EKZA 5LNSA 5C6MA 2ZBTA 1YXDA 5G2WA 4NUWA 1SFJA 1B4EA 2Y7GA 4LC8A 5HUOA 3CWNA 3JS3A 4Y9AA 1IXQA 4HT3A 5K7JA 1F76A 4LS0A 3M9YA 2VXNA 4PTNA 1E51A 5D02A 3WK1A 1XDLA 1TTIA 3IGXA 3W6YA 1F7BA 5A8GA 1QNVA 4GUGA 5C2XA 4CCDA 2A6LA 1Z41A 3V75A 3G0XA 4FNRA 1B3OA 5D2VA 2FPVA 4DPPA 4WUIA 1TO3A 1X7FA 1KFLA 2DU2A 2FJKA 3LXCA 3Q2DA 4UTMA 1VS1A 3DHDA 1NEYA 3NZ1A 1EIXA 1S5WA 5D04C 4PODA 1PS9A 1WBHA 3LOTA 1DL3A 4HNNA 3O05A 4UFMA 1OX4B 3TXVA 2I9EA 2WSYA 1UBSA 2VEKA 2W6RA 1GVSA 2QUTA 3A23A 3IRDA 4BR1A 1L2UA 2OMAA 3M7WA 3L5MA 3S0CA 3G1YA 4PL2A 3MYOA 4JTLA 4LVDA 5AHNA 1K8ZA 4RZ6A 4LWWA 3STFA 3G3MA 5LGZA 1Y0EA 1MO0A 3TSDA 3W1TA 2FPYA 3EXTA 1MXSA 3TIMA 2NX9A 2F7FA 4TO8A 1H5YA 1G4SA 1L6SA 4HNUA 2PRMA 3PC0A 2GPTA 3TH6A 3GAYA 4JYFA 2VEPA 3O6DA 3BK0A 3G1XA 3BARA 2P10A 3L0NA 2ZA3A 4XUGA 4ZQOA 5KINA 5AYZA 2CLKA 4AWTA 3E12A 2PC4A 4ORMA 3P74A 3LTSA 4MY8A 3VE7A 2A7PA 3QRHA 4AHPA 3OVQA 3OBKA 1QPQA 1F05A 1QDSA 5L9FA 2WNNA 4Q4KA 3HPSA 1GVOA 2V5LA 4ZQNA 3S1XA 1EWEA 5GVJA 1P5BA 5U4NA 1SW7A 3MW7A 4X2RA 3LHVA 1GVFA 1W5MA 3NQFA 1H51A 3DHFA 2E5CA 4WQ6A 4MLJA 4BI5A 2P0OA 3P5ZA 2YW4A 5K9XA 5FEZA 1DORA 4LOCA 4K39A 1LORA 4DBEA 3C2VA 1O5KA 3N9RA 3W3OA 3T40A 3SGUA 4ALDA 3KRSA 5BMWA 3MHUA 3OVRA 3A9IA 1XKYA 2FB2A 3MYPA 3HIJA 4XWUA 3N2XA 3NO5A 4IJBA 2HSAA 1I2NA 3TR2A 2Y7FA 1WA3A 4UNKA 5AC8A 1G7UA 2V8ZA 3W7OA 4ZQPA 3MHGA 4P2VA 4EF8A 3CIWA 2A0NA 1VZWA 2Y6ZA 4N9DA 1SO5A 3DI0A 5LGXA 2JKPA 2QAFA 4FXRA 3BG9A 3CEPA 1IIGA 4S2CA 3NL3A 5EPDA 1JUEA 4A2SA 1M6JA 3TQVA 5J5RA 1FWWA 2D73A 1GVRA 5CG7A 3IVSA 4Y90A 3EWBX 4RR4A 3PSVA 5G4WA 2CZ5A 4FX7A 4FNPA 4HNTA 2FLIA 2YX0A 5DY2A 3BW2A 2ZRUA 1DV7A 2E68A 3DBPA 2WKJA 2WQPA 3L0GA 3EB2A 3G0UA 5D30A 2QF7A 2AQWA 4HN4A 1B9BA 2QCHA 4KFNA 3MO7A 4JTHA 2A4AA 3HJZA 4C1LA 2VFGA 5FESA 3P84A 1OX6A 4LVFA 4JXCA 3R13A 1LCOA 4JTKA 1JQXA 2X1RA 1KFKA 4LTSA 3RNDA 3E9AA 2NXHA 4JTFA 2G96A 2C15A 3W72A 3N73A 3G8RA 1QOQA 1H7RA 2QJGA 2X1TA 4OE7A 1HL2A 2B7OA 5EY5A 3O16A 3ZWSA 1TREA 3WJWA 3FLUA 2QCEA 5G2HA 4O4VA 5DELA 4ZL1A 2J24A 2QCLA 5LKYA 2QCNA 3L2IA 3CQ0A 3PVFA 1P4CA 4D2JA 4O1DA 3IIZA 1I2QA 4LRTA 1RQEA 4X22A 4H6KA 3LLFA 5D37A 1G6CA 3FJ6A 4Z1CA 3QSTA 1EPXA 1QO2A 1TRDA 1KW1A 1XBZA 4OV9A 4DQWA 3GXPA 3S5ZA 3G1FA 5K2ZA 4DEFA 1TPDA 3NM3A 2HS6A 2GVLA 4NNBA 3E96A 4UTJA 2Z6JA 3NQCA 3IVUA 4QQ3A 2ZA2A 2Q8ZA 5BOOA 3CB8A 4ZMGA 3DZ1A 3F4NA 2NWSA 3SFKA 4UFJA 1EX5A 1OFAA 1TPC1 2CZEA 4MLRA 1C9DA 5ABTA 5CPLA 5K4XA 3TDFA 4UC5A 3HF3A 4HKPA 4IMEA 1WDWA 1K8YA 5CPMA 1F6KA 3BG5A 4UTTA 2H90A 5HJLA 2DZVA 2VKZG 4O19A 3S1WA 3PSWA 4A2RA 3EWWA 1TV7A 3MMTA 4WJEA 1U83A 2VEMA 4X9SA 3U2OA 1ZFJA 1I8JA 2VFHA 3NL5A 1DJQA 3UPWA 1TYGA 3NQ7A 5DCEA 1AMKA 1TTQA 2E6AA 4RXGA 3LLDA 1G4EA 2TMDA 1FCUA 5CKSA 1LRTA 5EA9A 5CSSA 3W23A 1TPH1 5AFDA 3RK8A 3TJLA 3H53A 5I3FA 4M19A 1FXPA 3MI3A 3SIZA 2Q3RA 4HHPA 2Y62A 1Q6RA 4O10A 1SO4A 3P82A 2ISWA 1VLIA 2ZTJA 4MVAA 4O54A 2CLMA 4JR5A 2WJZA 3E02A 3MP4A 4RKAA 2NXIA 4LVAA 1W3IA 2RH9A 3TNOA 3HG4A 3H55A 3B04A 1ONRA 4XQ6A 5BW6A 3PUOA 4PCFA 1LOQA 1AG1O 3Q94A 4QNEA 1HTIA 2E77A 1SW0A 1TCDA 4ICNA 4GNJA 3PAJA 2DZUA 4GUJA 3C56A 3P7YA 3MBDA 1I4NA 3HMJG 2BZNA 5D2XA 1TQXA 3VI2A 1VYPX 2FFCA 3S6DA 1MZHA 2DP3A 2R91A 5FI8A 1L6YA 2CLIA 1Z44A 2WNQA 3MI6A 4NXSA 4HSNA 4JTGA 3KRZA 4MJMA 4WXZA 2ZTKA 2GQAA 3ATYA 1JR1A 2ZZ7A 5CSRA 5HNRA 2HS8A 4IQLA 3U6WA 1NAL1 1FWNA 4OWGA 4ADUA 1OFBA 4N6EA 2NLIA 3B05A 2B0MA 4O57A 3KVLA 4RX0A 3HQ1A 4BWLA 3GDMA 1V5XA 3BV4A 1BWKA 2AAMA 4DO5A 4A22A 4RZ4A 1TJRA 4FF7A 3M5YA 2G5WA 3BW3A 1WBJA 5CZSA 1WV2A 4YLWA 4FNQA 2IQTA 1OFOA 4MY9A 4QNWA 3UZ5A 3BGJA 1BWLA 1PCWA 1S3HA 4LUJA 3M41A 4K38A 3TMQA 5DXXA 1IF2A 1LOLA 1ZAIA 1HG3A 1LM1A 3RFAA 2Z2UA 2C3ZA 3W7HA 3S8HA 3CPRA 1FUYA 1FDYA 5AYYA 1F5ZA 5I3IA 1N55A 4K7VA 1TPVA 2FPTA 4M6VA 5I3GA 4Z0SA 1TRIA 4UTHA 4KWVA 2JKAA 1KM5A 4UFIA 3W74A 4I7UA 4DBDA 1TPFA 2X16A 1W5NA 3WJXA 1GPWA 3QJAA 1QWGA 4NJKA 4LY8A 3TKFA 3W1RA 3PR2A 3GLCA 3IEBA 2CLHA 2JK2A 2NV2A 4ORIA 4JYDA 3BLEA 2CWNA 3B4UA 4M6PA 1LYXA 5E93A 3GIYA 3T4CA 1RVGA 1THFD 4QSHA 5KZDA 1EEPA 4CCEA 4LNYA 1EUNA 4LT9A 3VFLA 3IIPA 1AK5A 1WOBA 1XCFA 4WY0B 3FKRA 4JS3A 4WX2A 3NPWA 3C3NA 5DBUA 2WV8A 3LCXA 2RDWA 2OT1A 3PBYA 4NXKA 3GKFA 4J9JA 4FNTA 1DQXA 4N9CA 1G69A 1OYAA 1J5TA 2H8XA 4Z1AA 3BLFA 3DFPA 3NR0A 1GT8A 3HG5A 4QM1A 3N19B 3W1PA 3UZJA 3ABOA 3LB0A 4OQVA 3BGGA 1JCYA 2DZPA 2BXVA 3NQGA 1LP6A 3G3DA 5EKYA 4MUZA 4XTIA 3AO0A 3ELFA 2X1UA 3DFSA 1KM2A 1ZALA 3LM7A 4OU1A 4QJ1A 4IXXA 4Z1BA 1AW1A 5LNUA 3A24A 3NM1A 3FKKA 5I3JA 2R94A 2EAWA 2ZYFA 1RD5A 2DJXA 2Y70A 5CZ0A 1YYAA 3W7LA 3JRKA 3W7DA 1JCMP 4AF0A 4IMCA 3MI2A 3TQKA 3W85A 5L6UA 3Q58A 5D33A 3F4WA 1ME7A 4JX6A 2C14A 1H63A 4AF0B 3W1UA 6ALDA 3I7RA 2WPBA 3QF0A 4IMFA 1R47A 2R8WA 1YTDA 2TPSA 1F73A 1ICPA 1FWSA 4N6FA 2QJIA 4UTWA 1JULA 3G1HA 1KM3A 3GNDA 2VFDA 1HUVA 1MEIA 1TQJA 1FDZA 5CPNA 5LNVA 3LERA 1ME9A 3L5LA 4UTIA 3KFTA 4H3DA 2YYTA 2ZCGA 3UXAA 3H54A 1K7EA 2J9YA 1YTEA 4Q32A 4K7YA 5AHEA 3R89A 2Z1BA 1PIIA 3A5VA 4KFPA 1EP2A 5AHMA 3N3MA 4O4WA 3SY5A 3NL2A 3W1QA 4A3UA 4GUIA 2GVJA 3O8AA 1LBFA 1VR6A 2VFEA 1W5QA 2Q3OA 3EKLA 3HPZA 3P5YA 3PUEA 4M6QA 3WJZA 3PULA 1T99A 1XM3A 4NZJA 3TAOA 4GJ1A 4HPJA 3HPXA 4ZZ9A 4IUOA 1XBVA 4OGZA 1NSJA 3O15A 3EX4A 4LU0A 3KHJA 3OVPA 4U4MA 2V9DA 3W76A 4YXGA 3LTPA 1V7YA 3TA6A 4XBKA 1PHWA 1RZMA 3NPVA 4JTUA 3W2NA 1T0OA 5HINA 4IWWA 1W5OA 4R33A 3RLUA 4H4IA 1VCVA 3HG3A 4OV4A 1SPQA 3VNDA 1W3TA 2VFIA 3W88A 3C4UA 3SR7A 2YR1A 3TXZA 1YDNA 2V2HA 4PFMA 4L4MA 3TMLA 1ML1A 3O07A 3M0ZA 2ISSA 5TBOA 3G0SA 1K7FA 5SWUA 1ZAHA 1F2JA 3UWVA 3KX6A 3WJSA 2DZXA 5G1YA 3HG2A 4N9EA 1VCGA 4FX6M 5DXYA 5AC7A 3TC6A 2YZRA 3VCRA 1GJPA 1W54A 3L68A 3QEZA 4JEQA 3MUXA 1VGAA 2ZZ2A 4GXMA 1O4UA 1AL7A 4K36A 1QMLA 4IPJA 1HO4A 2BTMA 2QCGA 4I9AA 1G7VA 2GQ8A 3SI9A 3LRMA 3VE9A 5LNRA 1W37A 4OBTA 3B03A 2UV8G 2B7NA 4FNUA 3NQEA 3LV6A 3TW6A 3GYEA 1WXJA 3UYCA 1DVJA 2A85A 2OCZA 1SQ7A 4LW7A 3FA5A 4NJJA 3PF3A 5K3VA 4FO4A 5LNWA 2E5DA 5BNKA 3LX9A 3EX1A 3LXAA 1U5JA 3V1PA 3G8EA 2YGYA 4WXYA 3KVJA 3LXBA 1JUKA 1SO6A 4AXKA 1YLVA 2C13A 3W7CA 1TTJA 4PC8A 4JYEA 5C5YA 1T96A 4QIUA 1A5BA 4Y96A 4E0CA 1ICQA 4NNCA 5T26A 3TC7A 3UWYA 3QH2A 2QCCA 3B8DA 3DFOA 5BRBA 2I14A 4FB7A 2VOMA 4HPXA 4UTWC 3FOKA 1R2TA 3L9CA 5D38A 3GR8A 5D03A 5IBXA 2ZRZA 5K9DA 5HR7A 5EYWA 2RFGA 3GDLA 3D0CA 3MJYA 4BK9A 1A50A 1TPB1 3IIOA 1BEUA 5FEXA 3UY7A 1RQBA 3FIGA 2EPHA 1N8FA 2YXGA 1OYCA 2GVGA 3IGUA 3QSRA 3C61A 1GQNA 4A21A 4O28A 3W7MA 1C29A 2O7QA 2WSQA 2YFNA 1TJPA 3G1AA 4BI6A 2Y88A 1XBYA 5I3HA 3TROA 2FQIA 1SR9A 3W1LA 2FB3A 1KTNA 5KMYA 3LI1A 1KM4A 2WSRA 2BX7A 4ML9A 1KFEA 2P1FA 4DF1A 3ATZA 3LCGA 3QPZA 3FS2A 2QJHA 3NVTA 4NQ1A 5HWJA 4O16A 3E49A 4FNSA 3LCLA 1VHCA 3P62A 2CLOA 3CLMA 2QEZA 1AW2A 3C0JA 2ZZ1A 1IXNA 2GJLA 3TX9A 3N9SA 1TV5A 3T78A 3W07A 4Y8FA 3HBLA 1SFLA 3BG3A 5HWNA 2A7NA 3GNNA 3NOEA 2NX1A 4RK8A 2QCDA 2BLEA 3NPUA 4AHQA 1TPUA 1OJXA 4MOZA 3HGOA 1WYIA 3W7PA 2Y85A 1T8XA 3S1UA 1P1XA 4RLIA 5AN7A 4DO6A 1OFEA 3DAQA 4GC4A 2F84A 2W79A 3NNTA 2C16A 2ZZ4A 4NJIA 1OFPA 7TIMA 3SECA 3FJLA 1K8XA 4IX0A 2RKXA 2CU0A 1KA9F 4ONVA 5DLCA 5C55A 4UFLA 2QUVA 4LVBA 5K9CA 1KM6A 1I2PA 3NA8A 1F6PA 2B4GA 2PE4A 2YW3A 1RV8A 3LBCA 3LGEA 3W2JA 3L67A 3E0IA 4UR8A 3M5VA 4UTLA 4O52A 5LSMA 5F4SA 1MSSA 5DBTA 1TB3A 1DHPA 2WOQA 5J5DA 3P8JA 1EUAA 4N02A 4O1BA 2XN0A 3M47A 3QFEA 3F1QA 3C52A 1CI1A 2CW6A 5TQLA 3QQ1A 5D32A 3S1VA 3LHZA 3W7RA 1W3NA 4CNOA 1ZAJA 1QFEA 4I7WA 1J2WA 1HO1A 4HIBA 1C8VA 4PEKA 2J6XA 4NNAA 4P61A 2V82A 2A2IA 3W7KA 1ZNNA 2V5BA 1KV8A 1OX5A 1P0NA 4MZYA 1FXQA 3WK2A 2CLLA 4LS2A 1ZJIA 1YXYA 2RHGA 2H3BA 3W87A 3DFQA 5G1TA 1GVQA 3NQAA 2X2GA 4WZHA 4MYAA 1KBIA 3QQ0A 3CT7A 1L6WA 1VQTA 1O60A 5IBXC 1HFBA 4XZ9A 1YPIA 5LHFA 1OF8A 1WX0A 3IIVA 4X3ZA 4BI7A 2KZHA 2V0TA 1FCVA 3HOJA 4NZFA 5U7SA 3DXIA 3QYQA 2G95A 3LCIA 4GRSA 4NT0A 2ZRYA 4NU7A 3NGJA 2NUYA 1LRQA 4JGDA 4ZQRA 3QM3A 4DO4A 3CM4A 3IVTA 3QW4B 3EXRA 2G97A 4S2BA 1W5PA 1VYSX 4IXHA 1H50A 6TIMA 3C2FA 1W1ZA 1UUMA 2J88A 1IXPA 1H7OA 4MFEA 4O12A 4EF9A 2C18A 1KM0A 2E6YA 2NXGA 1PHQA 4K8EA 3C6CA 5HULA 3ABQA 4JDBA 3W7NA 3W7IA 3UY8A 4WOZA 2V2CA 2YPIA 3EWUA 5G4EA 3N2MA 4TU1A 3I68A 1N7KA 5EMUA 4ZQMA 1DQWA 2WNZA 3TQ0A 2WO5A 1SU5A 2NV1A 2OT0A 3QC3A 4GUFA 4L4LA 4NX0A 2NWRA 3W2KA 4CCCA 3PWAA 4AWSA 3GZ3A 4LV4A 2Y7EA 1IXOA 2DZSA 3W7GA 3A21A 4O14A 4MPQA 3CC1A 4MIMA 4GWEA 3LRLA 1XL9A 1KBJA 4YCPA 2FTPA 1SSDA 1GTHA 3L5AA 4NJGA 3S5YA 4ADTA 4UTTC 3NYZA 3EX6A 3R8RA 4M5PA 4ZVJA 2O7SA 1OFQA 4O53A 1W31A 3TV8A 3HGSA 4JY8A 1X1ZA 1WOAA 5D2YA 3UNDA 1JJKA 3BPWA 3DENA 3GX9A 1A5AA 1NFBA 3B06A 3USBA 3LCFA 2W0UA 5F2GA 3P60A 1VHNA 2EKCA 4XKYA 5IM51 2YFOA 2Y61A 4JIPA
chains in the Genus database with same CATH superfamily
1LTDA 3DDMA 4Q4OA 5HK4A 2QR6A 4PH6A 2AL2B 3E38A 1F4HA 2GGJA 2AMGA 3O6CA 3ZJ6A 3FFSA 3TK7A 2QDGA 4DM1A 5CG0A 4DWSA 3IUHA 4RPPA 4LCRA 4KFOA 2PRHA 4GHRA 4H00A 1GG1A 4B5NA 4GH3A 5B80A 5IFTA 4R34A 1CLKA 3UPBA 3Q67A 1Q63A 3G2GA 3PJTA 3GKAA 1O95A 3LBMA 4K3ZA 1GK8A 2XG9A 2OZTA 5JIPA 4JFVA 1F61A 2A5HA 1J6PA 1LT8A 1KKOA 4ZOAA 2V63A 2O9TA 5H1WA 1N8WA 4J35A 1XLLA 4HSOA 1OHLA 3CQIA 2J7HA 1FHUA 1HIZA 1OWQA 4IH3A 1PL9A 4IP7A 2PWGA 5EB8A 3TCEA 4BWLC 3LGGA 4CEXC 4JIQA 3G1DA 4IQEA 2I1OA 3RM8A 4OZOA 3GU9A 1A0DA 4ERAA 1EGMA 3EXSA 4YMZA 3CUZA 4Q7BA 2HROA 4QLLA 1ME8A 1GWJA 3GG8A 3B0VC 1WAUA 1X8FA 1I2OA 1KR0A 3AIEA 2I7GA 3RX3A 3M43A 4OIFA 1OC5A 1TWIA 2FVLA 1J11A 1RD6A 1O1HA 1UWTA 2AKZA 1SMDA 3MDUA 2QNEA 7ODCA 4LYPA 3WJYA 4OHQA 1KV5A 4IPIA 2ZVIA 5M2FX 3QY8A 5CPOA 2NX3A 2VI0A 3KBWA 4JY9A 4AFYA 2PDUA 5A1AA 4PFHA 4HNCA 4QE4A 1E9LA 2GSHA 3W29A 1FCBA 9RUBA 2WAGA 4W4QA 1D3HA 2QV4A 4DYKA 1H5VA 3EWXA 2OJPA 1TZ9A 2RDUA 3GG1A 3ZS4A 1VH7A 1XH1A 5A8QA 4QROA 2Z1WA 2GQ9A 3R5EA 4K68A 4HZMA 2ZRXA 3NZGA 1D9EA 4HQVA 4GBUA 5CBJA 3M5XA 2XFWA 5CLWA 1IEQA 4QRNA 4JX5A 1GZ1A 3MUZ1 4PCNA 4DXVA 4R88A 1KC7A 4ATLA 3LCWA 4Z42C 1XFBA 4TX8A 1C8QA 4AVFA 2B7QA 1NJJA 2TAAA 3TQPA 1ZENA 3FK4A 1J9YA 3KS6A 3FAWA 1MVYA 3ARQA 3MHFA 2GK1A 2VHLA 4W5ZA 4KT2A 3NQMA 1RALA 2REQB 1S5TA 4GG9A 1JRCA 3NXFA 1O94A 1ALDA 3DH7A 1NDZA 3GR7A 1OK4A 1D3GA 4LAUA 1CXLA 4B2DD 3B0UX 3TWAA 1SZNA 1Z89A 2TSYA 1VC4A 2G3IA 4FI4A 2FH8A 3VAVA 3ZWTA 4QEHA 1BYAA 1KTCA 2WNWA 3PTMA 4CQDA 1UOKA 2CC0A 4LRSA 1UR8A 4ML4A 3HB9A 1E4LA 3UWWA 4JFUA 1BQCA 2VENA 2CLFA 1B3YA 1SMAA 5HPCA 4JTSA 4H19A 4UNLA 4EIVA 4DJDC 1UJPA 2OFJA 3KTXA 4PSPA 3RLVA 4IIHA 4JQ4A 2OELA 3W2LA 4DELA 4A3QA 2VOTA 3PZIA 4HNOA 5G1MA 1PZ1A 2DY3A 2QF8A 3N3TA 1DWJM 3A6OA 1N2VA 3QOKA 4TV6A 3MMUA 4ZCWA 3MO4A 1JXJA 4MADA 3GRIA 1SZFA 3SBFA 3RO8A 1EEXA 2ZRWA 2Y0FA 2WCGA 5EMJA 2XIMA 4H2HA 3S6OA 3H2EA 3S5OA 1H11A 2F6UA 2AL1A 3M5ZA 1XLCA 3MUIA 3GTXA 2OYKA 5C71A 3U4FA 4W88A 4ZGYA 4YYCA 3N29A 1BTMA 3DFYA 1BF6A 3WQGA 1A5SA 3WDJA 4FOJA 3MB9A 1F74A 1XYLA 3PUDA 1UZDA 4GQ0A 3WLPA 3HA1A 1XIIA 3WEMA 3GD6A 3WD1A 3B9EA 1D3CA 1QNQA 4UR7A 3D6NA 2V5CA 4ADSA 1OFRA 4MWAC 5I3KA 1ENUA 1K03A 4CN6A 4D1JA 4O1FA 3MSGA 3KVMA 2QCDB 2MANA 3NQ2A 5D9NA 2BHYA 4D71A 1CXFA 3R2GA 3VZYA 1QHOA 2V68A 1OGGA 1EJXC 2E8YA 4O1AA 3S1GA 2IW0A 5CJ5A 3LM3A 4GIYA 3UGVA 3GK0A 2W67A 3NZRA 1E5JA 3UZYA 2WMHA 3PZVA 1A47A 1W8GA 2JGQA 3HFYA 5I24A 2OLAA 2BNJA 1HJXA 5EL1A 2Y5SA 5LHEA 5FJOA 1BGAA 4A4AA 5KZEA 4GKLA 4AIEA 5E0KA 2UY2A 1Y5VA 3KVKA 3ARSA 2G50A 4JN6A 3PG8A 4B91A 1VBJA 1YPFA 2E6DA 1LZOA 1IQ8A 2WSPA 1R9YA 3LDVA 4FIQA 4G7EB 3OJGA 1RBLA 4LBUA 2C1HA 3VCCA 3WNNA 1OGBA 4Q33A 3ZT6A 3VX1A 3UXKA 1HT6A 5AKQA 3N14A 1CGVA 4KEVA 3PPHA 1OK6A 1XLHA 5C2GA 5FIPA 3U5UA 3P6LA 1EB3A 3WSUA 4E2BA 3KOFA 4HB7A 1FVPA 3R79A 2QVNA 4E2DA 3REQB 2D2OA 2JF7A 3CJPA 2QKFA 3VU2A 5GNZA 2J77A 3H2FA 2J7FA 2ON3A 1FY6A 4QITA 1T7LA 4AH7A 1VJIA 1KLYA 3I7SA 2C91A 2OEKA 4TMCA 4N4QA 1QOPA 4IT1A 1W8SA 3STCA 4KPLA 5CGQA 3PG9A 3CUGA 3TUUA 3OQEA 4I7VA 2DZWA 3KZSA 1Q45A 1EGZA 3WLKX 4MFDA 3WENA 5TIMA 1EXBA 5A8OA 2J9XA 4RZBA 1UUOA 1S5VA 5CJMA 4B90A 4U5KA 5FF2A 1OYBA 4PUEA 3QV9A 1J8VA 4UR9A 5CPTA 1GVYA 4MNLA 3EOUA 2Z6IA 2GL5A 3U8GA 5H91A 2NQZA 5G5IA 3VM5A 1H60A 4NZ1A 1ZCOA 3W2MA 1ICSA 3TLQA 2E6FA 1R87A 3SAZA 1DPMA 3VKJA 2BY2A 3B0PA 1YE4A 3WUBA 2EKGA 5F7UA 4GINA 1J0YA 4NHVA 1QHPA 3RPTA 2CZVA 1UR0A 1NVMA 3OG3A 3DGRA 3P0XA 3V18A 1QCWA 3AMLA 5H8PA 4AWUA 5IHSA 2GWGA 3O6YX 4YVVA 1H41A 4DBSA 3ITVA 4M6UA 1ZSXA 3SCSA 2EHHA 5EU9A 3T44A 3MMWA 2O4QA 1MQPA 1LRNA 4AZBA 4LUIA 3SCOA 4Y6GA 2ADAA 5FJUA 4DWSB 4O11A 4NX5A 1A3WA 1KLZA 1V3LA 4UQAA 1I0BA 4FLRA 3EWZA 3HO8A 4JNMA 3WQ4A 3J7HA 1GGOA 2D0GA 3O06A 3EX2A 3ABRA 1FBAA 3C2EA 4P8WA 1GEQA 4WY0F 1JQVA 1HP4A 3H6OA 3W7JA 3EKZA 5C6MA 1XIBA 3AXHA 4DHGA 1YXDA 2Z7GA 4LC8A 3F2CA 4XAYA 3OU8A 4Y9AA 1F76A 3LPFA 4HPNA 4PTNA 4A3YA 3UFYA 5D02A 1D8WA 1XDLA 3IGXA 3CH0A 2E9LA 3KE0A 1QNVA 5C2XA 2A6LA 1Z41A 3VKBA 3G0XA 1B3OA 5D2VA 1KFLA 2FJKA 1JGIA 1VS1A 3DHDA 3B8UA 3AWOA 4KMQA 1R38A 1JIBA 1EIXA 1S5WA 3CGTA 2CHNA 3N9KA 3SURA 3AYSA 2D22A 3O05A 2BV9A 1W9UA 3JUGA 1GVSA 4BR1A 2ALRA 5CSUA 3M7WA 3S0CA 3G6MA 1O66A 4PL2A 2J47A 1WNOA 4JTLA 2G37A 4AZ6A 1UZ1A 2OOFA 1GQKA 1JFXA 3TIMA 2NX9A 4WKAA 4TO8A 3ARRA 2VGFA 4HNUA 3BLOA 5GJPA 2XWEA 4DJFD 1PUDA 1MYRA 3DFHA 4ZQOA 2V3FA 2CLKA 4J4KA 5XIMA 2P50A 1UG6A 3QYSA 4AZGA 4IMAA 5L9FA 2WNNA 4Q4KA 4J2MA 2PDCA 1EWEA 4RL3A 5U4NA 1SW7A 3TOPA 1GVFA 1W5MA 3WLOA 1QNPA 3IRSA 4MLJA 1EDTA 4GVFA 2BY3A 3KRBA 1DORA 4LOCA 3MVTA 4GO8A 4AZ5A 3KW3A 5BMWA 4RDVA 3MHUA 4RDYA 4XWUA 1JYXA 2O55A 3WDQA 3WUEA 2HSAA 1WA3A 4UNKA 4MB1A 5AC8A 1G7UA 2GK1B 3MHGA 4P2VA 3OZPA 1K9TA 5A6MA 5AYBA 2A0NA 4Y2WA 1J5SA 3ZO9A 1WCGA 3AIWA 3NL3A 5EPDA 2OO0A 1VEPA 2E4TA 3CO4A 3A4XA 3O2LA 5J5RA 5M03A 2DIEA 1PSCA 1MZRA 3V3WA 1GORA 4J2PA 3PSVA 4I8DA 3R43A 4FX7A 3ZYZA 3SCNA 3VKCA 3QQWA 3DBPA 5I5RA 1F3TA 4I8YA 1QT1A 1Z7AA 2DFAA 4PB5A 1TZZA 2QF7A 2OO6A 2CEQA 1IT8A 4HN4A 2QCHA 4C90A 2DVTA 1RY8A 4E8CA 3ABXA 2A4AA 2EQDA 4MAVA 2BOGX 4C1LA 3OLDA 3KP0A 3EA3A 4L9YA 2Z2BA 1M04A 4IP4A 4J27A 2FVKA 4JXCA 1V0LA 1LCOA 1EQPA 3BTNA 4IQDA 1JQXA 4KW2A 3E9AA 1E43A 1K4HA 2NXHA 2Z28A 5ABHA 1MMFA 4JHMA 4JIEA 1RCQA 5EY5A 4GQQA 3ZWSA 1GJUA 3TJIA 1WDPA 1W9XA 4C6QA 4US5D 3B8WA 3PVFA 1P4CA 4D2JA 4O1DA 1NDVA 1A5OC 3BLPX 1ZP3A 3IIZA 1XYBA 3GG7A 1EXPA 4HSHA 3E74A 3QSTA 1TRDA 3QTGA 1YMYA 4OV9A 4DQWA 3S5ZA 5K2ZA 4KS0A 8XIAA 1E6SM 1XHGA 1VFOA 3ARWA 2G41A 5JMUA 5DMLA 3UCCA 1TWWA 4QJ5B 4HZ8A 2J25A 4QQ3A 2Q8ZA 2BGNE 5BOOA 4HA4A 3TCSA 1VFMA 4HOXA 3BGAA 5LA2A 4GQGA 3S2CA 4UFJA 1TPC1 2XYLA 4PEEA 2CZEA 5ABTA 4CVUA 4YVPA 1F8IA 4H01A 3EOEA 1BRLA 1ZCCA 2BXZA 3HF3A 3L4VA 1XF0A 2YXXA 4GYPC 1DWFM 1E6RA 3SRDA 2H90A 5HJLA 1TVPA 4FALA 1OGSA 2VTFA 1XP3A 4MUPA 1UHVA 1WB0A 2GQ3A 1CGWA 3PZOA 5GNYA 2QJMA 4WLCA 2BGQA 3K1DA 1I8JA 2FDMA 3NL5A 3VZXA 4URIA 4PMDA 1REQA 1VPYA 2YJQA 3VDAA 2Q02A 4DUVA 1G4EA 1RY0A 5CKSA 3QKEA 1LRTA 2ZC8A 4W93A 2BP1A 3H53A 3TA9A 3WQ8A 3ZJKA 3SIZA 3KBSA 1R6WA 1SO4A 3TTSA 1UZ4A 4XD5A 4O54A 2CLMA 1BD0A 3MP4A 3UEQA 1BXCA 3BOLA 2HPIA 4R9XA 3K8LA 2OPJA 4M56A 2HK1A 1M53A 3H55A 3B04A 4IG2A 1LOQA 9XIAA 3DHPA 3Q94A 4QNEA 2DH3A 3AICA 2E77A 3EDDA 3S9IA 1TCDA 3HPFA 4GNJA 1TCMA 3M7SA 4GUJA 3GNRA 4IIFA 5D2XA 4I5XA 1GOWA 1TQXA 2PF8A 5EFDA 3NGFA 3VIPA 3U48A 1MZHA 2R91A 1ITXA 4Y9PA 2WNQA 2BMBA 4MKSA 1GOKA 1J01A 6TAAA 4WXZA 3ATYA 4BQ4A 2ZZ7A 5CSRA 5HNRA 1NAL1 3FA4A 4GLEA 1M41A 3H8AA 2NLIA 4O57A 1JZ4A 4RX0A 2R6OA 1FWDC 4J3SA 3VIGA 4B92A 1FWGC 2AAMA 4DO5A 4A22A 2VDIA 4PUMA 1BVWA 4FF7A 3I6EA 3VZZA 5BU9A 3CZLA 4YLWA 2IQTA 5KEZA 2ZE3A 2EJ1A 1OFOA 4MY9A 1K9DA 1QI5A 3GHRA 1BWLA 2Q01A 1S3HA 3A3WA 1XFCA 3TMQA 3WH9A 1IF2A 1HG3A 2O9OA 4IP5A 5EBAA 4QS5A 2Z2UA 2Z27A 1JZ6A 5AYYA 3BC9A 2YCLA 2C1GA 1TPVA 4US6A 3HV8A 1Q6FA 1TRIA 2PFHA 2W92A 3UWEA 1K9EA 4KWVA 2JKAA 1VIWA 1WDSA 2F6KA 3KBJA 1W5NA 1GPWA 4LY8A 3S47A 3TKFA 3W1RA 4AD4A 4D6HA 3PR2A 3AS1A 3GLCA 5E0FA 2DW7A 1DE6A 1DIEA 4PRRA 4S23A 1LYXA 3T1GA 3QPEA 1RVGA 1THFD 2JIEA 5KZDA 2PTYA 4CCEA 1RHCA 1RA0A 2RJGA 3HQNA 1WOBA 1WDQA 3FKRA 2WVTA 4I5UA 2BVTA 2J62A 3V5OA 3G6LA 3PBYA 1ITUA 4OBSA 4FNTA 1DQXA 2OKOA 1OYAA 1XLAA 2H8XA 4HN8A 2QLYA 3O3RA 2UY4A 3BLFA 1GT8A 3HG5A 4QM1A 3AU2A 2W62A 5A6TC 2BGSA 1OB0A 2P53A 4OQVA 3BGGA 5GQBA 1NFPA 3H4GA 3TYCA 4HZ7A 1ZRQA 4EKJA 1JZ3A 5A6LA 3DCPA 1UOZA 3S46A 1QW9A 4WVXA 1GVEA 2X1UA 1ZALA 4QJ1A 2HRWA 4CD7A 3RRAA 4Z1BA 3FKKA 3NM1A 3OZMA 1DWHM 1RD5A 3R8GA 1JCMP 3M0XA 3EDKA 3ARYA 1X96A 3BAWA 4PUWA 1JYWA 3TQKA 5D33A 3E2QA 2IKGA 4QE5A 2VCCA 3LPOA 3I6TA 4F0SA 3MQTA 3NSNA 4IMFA 4NYYA 1R47A 2TPSA 1SJBA 4L1GA 1ICPA 3ID7A 2DPEA 3KP1A 3STPA 3MSYA 2D0FA 1JULA 1KM3A 1F4AA 3GNDA 3BSHA 2VFDA 1HUVA 1ADSA 1TQJA 4AX7A 3T2OA 2WB5A 2XFFA 3IUDA 2XHYA 4H3DA 1JNDA 3AUOA 3H54A 4ZOBA 2J9YA 1N82A 3R25A 1XYAA 2CETA 3LA4A 3FXYA 4O4WA 3SY5A 3M0HA 2ZX9A 4A3UA 4QP0A 2VFEA 2WC3A 3URNA 3EKLA 3P5YA 3AHXA 2ZADA 4M6QA 2FZ9A 3ZM8A 1XM3A 1W3LA 2QW5A 1WKDA 1POKA 4IUOA 4OGZA 1B31A 3EX4A 3C3UA 3KHJA 3OVPA 1XSJA 1GHSA 3WF4A 2F2HA 4XBKA 4W7WA 2KAUC 3UR5A 3MSRA 4GJJA 4H2CA 4RE3A 4B5TA 4R33A 2Q6ZA 4KESA 4DN1A 4Y8EA 1VCVA 4OV4A 1SPQA 3VNDA 1I1WA 2VFIA 3VFCA 3AOFA 3WDPP 4HU4A 1YDNA 5FSEC 1X97A 3SQMA 1Q85A 3TMLA 5I00A 3POCA 1V08A 1ML1A 3O07A 3RDKA 1F07A 5TBOA 3IJLA 3WJSA 3VD4A 4N9EA 2PGWA 5AC7A 3GZAA 2YZRA 1W54A 2WBKA 3QEZA 3KZPA 3MUXA 2JEQA 2ZZ2A 3SCTA 1SM9A 5HAOA 1BFNA 2OODA 5I06A 3UU0A 2CYGA 1HJWA 2WKLA 4C7GA 3E5PA 4XAGA 1G7VA 2GQ8A 4IUGA 2FTYA 4Q8OA 3B03A 2UV8G 5LIUX 1U5HA 3WQWA 3UYCA 3C8NA 5D4YA 3FA5A 2VMFA 1UR9A 1M1BA 2Y8UA 5H6HA 3WUFA 3WQPA 3G8EA 3ITTA 4JPGA 3LXBA 4WKFA 3F4VA 1P0BA 1CEOA 3PNZA 5C5YA 1T96A 3BXWA 4Y96A 5T26A 3TC7A 1AFSA 2QCCA 3RG6A 2YBUA 3N17A 2I17A 3DFOA 1DTNA 4FB7A 4HPXA 2VVNA 1EJUC 5FL0A 3VK5A 2D69A 4MF4A 4KCTA 5D38A 4CD4A 5FACA 5IBXA 2ZRZA 5FJIA 2RFGA 4B9YA 4BK9A 5FEXA 4BCEA 3KL3A 2VNCA 3UY7A 3W01A 1RQBA 2P8CA 1N8FA 1OYCA 2GVGA 2PWUA 3C61A 1GQNA 5FJPA 1IHIA 4A21A 4O28A 2PDQA 3ARTA 4GY1A 2WSQA 1UBPC 2YFNA 3RAOA 2VP8A 5BXTA 5BRQA 4E8DA 5JBDA 4BA0A 1XBYA 5I3HA 3L12A 4PBFA 3TROA 3L23A 3W1LA 1KTNA 9XIMA 3LI1A 5E6YA 3KUMA 3LZ3A 4X9YA 2RUSA 3LCGA 1ODZA 4F9JA 1GQJA 4HA3A 3R8HA 4Q4RA 2TODA 2YL6A 2PP0A 2CLOA 3GM8A 3RHGA 4DM2A 3N9SA 1S2AA 2D2HA 2R24A 1SFLA 4QFUA 1OD0A 3GNNA 5TD4A 4OOZA 1MFUA 1BRLB 2I5GA 3VXGA 1WP6A 4Z2IA 2EXOA 4XB3A 1OBAA 4QSFA 4DO6A 4A8LA 2F84A 3NNTA 3WN6A 3BV7A 2RKXA 3T9PA 1CWYA 1KM6A 1CZ1A 3AUJA 4L4OA 1XD0A 1F6PA 2PE4A 1RV8A 1IV8A 3DYMA 1EJ7L 3TN3A 4UR8A 3GO2A 4O52A 1IT7A 3KWSA 5DBTA 1REQB 1R7OA 2WOQA 3WX7A 3BJFA 3RIKA 3S4TA 2XVNA 3VNMA 4N02A 3SEPA 1MNZA 3QFEA 1CI1A 2VWTA 2HISA 4ZO7A 3I3DA 2GJXA 1W3NA 3CNYA 1XPGA 4I7WA 4HIBA 3TZFA 1C8VA 2J6XA 4NNAA 4P61A 3UR8A 2V82A 2WMJA 3W7KA 2BOFX 1FP9A 3THCA 4IG2B 1EPVA 1YXYA 2H3BA 2P3ZA 3DFQA 3H2MA 1E9ZB 5DMMA 1US0A 5JVLA 4C6OA 1ISYA 3L2MA 1MDRA 1L6WA 4ZBCA 1JDDA 1X39A 2GJPA 3N4EA 1PZ0A 3FCPA 1UWUA 1HFBA 1HN1A 1YPIA 4QDWA 3QBUA 3IIVA 3LU2A 4BI7A 2V0TA 3URQA 4NZFA 1JF5A 1DJYA 3DXIA 3WEZA 4G5DA 1LG2A 2G95A 3LCIA 4Q8TA 1E5NA 4NZCA 3CHDA 3NGJA 3ORWA 4DO7A 4KRTA 3TVAA 3VD7A 2NVDA 3CM4A 3IVTA 4DO4A 1BPLB 1V79A 4DZAA 3EXRA 4LSBA 2AOSA 3EDEA 1VYSX 6TIMA 1H50A 3C2FA 2J88A 2CCRA 4K8EA 4AWEA 1NELA 1J93A 3NDYA 3UZXA 3VDHA 4QR6A 4MB4A 1AJ2A 3OYZA 1MUWA 2WCSA 2NQLA 4JL2A 5T8GA 3EWUA 3EBVA 5G4EA 4DX3A 3N12A 1F3WA 1KB3A 1DQWA 5ABEA 3TQ0A 3PJUA 2WO5A 1DJZA 2OT0A 2NV1A 1UPMB 2I16A 4GUFA 3IPWA 1BG4A 4CCCA 3PWAA 4G6CA 4LV4A 4L6HA 3BJTA 4MPQA 5T9CE 4CNSA 3GHUA 3U2EA 2YCLB 3LRLA 1KBJA 4YCPA 2V67A 4NJGA 4UTTC 3L4WA 3NYZA 4M5PA 1UQYA 3ONCA 2HEJA 4WKHA 3HGSA 1TR1A 4EXBA 3QGVA 1TUFA 2R1NA 3UNDA 3USBA 4B3KA 1U5VA 3SCQA 2W0UA 3AJ7A 1GUVA 2VRKA 2EKCA 5FJTA 2PA6A 3OB8A 4JIPA 3T7VA 2E09A 4UTUA 5D09A 1L9WA 4F40A 1KXQA 5F1VA 2Z0IA 4DVOA 3TFXA 4PSRA 4N4PA 4FIRA 4O50A 3WLLA 3CS2A 3W1MA 1QWKA 5PTDA 4ZTYA 1TJ2A 4AD3A 3WD0A 1TPEA 3L4ZA 2G3JA 4H8VA 4FF5A 4C60A 1MEHA 2HVNA 1R3WA 2Y1HA 4ZB5A 3GUWA 1KFJA 3NQVA 3BZJA 3P61A 3MBFA 4CQAA 3RM9A 3KHDA 5C9RA 5LZLA 2CLPA 4L56A 1Z32X 3DFTA 1XLDA 1IYXA 3W9ZA 3CPGA 1V03A 1IR2A 1ZUAX 2G3FA 3PPCA 2Q8LA 3L4TA 1RR2A 1HKKA 3UWZA 3B0YA 1ECEA 3UWUA 4K37A 3STEA 3U9IA 5KETA 4RV3A 3RX4A 3VOCA 2FZNA 4PL1A 4JX4A 4H6EA 3O1NA 3AISA 3W38A 1E4MM 3P80A 4Z1YA 1PTGA 4GO9A 3QPYA 4DJDA 1KNWA 6ENLA 3L66A 1MW1A 1M7PA 3L21A 1OM0A 2J79A 5A6AA 3LG3A 3IJ9A 2Z1KA 3KDOA 5LIKX 2PI6A 4GH1A 4G2DA 4X60A 4C6CA 1XI3A 3GTNA 3W28A 4YTQA 5H8UA 3S9YA 5F4WA 4A8RA 1IE7C 4AHOA 2NT0A 4O8AA 5C54A 5DCDA 1XBXA 1LLOA 2R14A 2X30A 1TMHA 2YDAA 4EPDC 5I79A 4A29A 1B30A 3TTYA 4XD4A 5AHIA 1M68A 4LVGA 3DN5A 3B9NA 1QK2A 1ITQA 1G5AA 3VOGA 2ZA1A 2P3EA 3OGVA 1EDQA 5BMXA 3WMCA 1JAEA 5FF3A 2UY5A 5T91A 3QN3A 4Y9MA 3RLGA 3G77A 7A3HA 4PMRA 4WOQA 4JIHA 1A3XA 1ESWA 5LYRA 1I45A 4XZIA 1K3UA 5FF7A 4CN1A 3DEQA 3PPGA 3IJDA 6REQA 4O18A 3ZR5A 1SUXA 2JBMA 4IQJA 3PNUA 4MYXA 1JVNA 4WHBA 1EC9A 2V81A 2ACSA 4IIGA 1XLIA 4GXWA 4HCLA 1I6NA 1GOXA 3WD3A 2XN1A 2OQLA 5C0QA 1XUUA 5HA7A 1S38A 3U3HA 1UQZA 4ACZA 3BVJA 3QVQA 4UMCA 3TN4A 4GVGA 1EF2A 3TYAA 1JYNA 1NWSA 4DNMA 4M7SA 1EA0A 3ARUA 3BWWA 5I09A 3H2AA 1TMLA 3DOPA 1J0HA 4S1FA 1X6UA 2CZDA 3DFNA 3A3HA 1WDDA 2P88A 3N13A 3T08A 2OG9A 3RCYA 4QX4A 3VNKA 1RCOB 1CIUA 1MQQA 1WAWA 5C9ZA 4DUOA 4TUFA 5ENLA 2O0TA 3CHVA 1BTCA 4C6IA 4ICMA 2PODA 4JIRA 4XAPA 1Q6LA 4C7FA 2A6NA 4HNVA 4DWDA 1YDOA 4XZNX 3TNBA 2VGGA 4GY7A 2YCJA 3W7EA 1ONWA 1QPRA 4N42A 1QUMA 2PDYA 2YBVA 2X7VA 2C6QA 2VGBA 2ZZ5A 2VQTA 1OZQA 2VELA 3PBVA 1VCFA 3BLKA 3SCRA 2YYUA 2ZDRA 4GMEA 4UFKA 4IPPA 3V0SA 4UMAA 3CQHA 3DYPA 1TVNA 2HE8A 5DEZA 4L9ZA 3EWYA 5CXPA 2QCMA 5A6BA 1Q8JA 2I56A 3MKVA 4MY1A 2Z25A 1VKFA 2VC7A 3C0LA 1UWSA 2WVSA 4QXIA 2NLYA 2DJLA 1RPXA 3WK0A 2LLEA 4AVOA 2G0WA 3IGSA 5KSWA 3M6DA 4I9TA 3OIXA 2ZOXA 1JNEA 3MV01 2CLEA 2A3AA 3U2ZA 1BG9A 4Z1DA 4JTDA 4IX2A 1XC4A 1PB0A 1H7PA 3LCHA 3XIMA 3VVGA 1UR1A 2OX4A 3OODA 1C3FA 4QQUA 3ARVA 3QMSA 4U10A 1EWDA 3WNKA 2VRQA 1XLBA 2D24A 3SIMA 2DH2A 5HQMA 1ZGDA 2PF0A 4MNKA 3W83A 1TV2A 1E3XA 3CTLA 4PMXA 2VZVA 3W71A 3UA4A 4LUYA 1W1YA 3GC5A 3FHAA 4LPCA 4U28A 3H7RA 3GC2A 1V51A 2J27A 4QAIA 4IPNB 1R30A 4S3KA 4MTVA 2VR2A 2Q09A 1Q3NA 4EPBC 2A3EA 4DF2A 3P67A 1PE1A 2GUUA 4NRRA 3WLMA 2CZFA 4UMBA 1UWIA 3NQ6A 4MZ1A 1D7FA 4I3GA 5J8LA 4EVZA 4EOUA 1YW1A 1W17A 3LRKA 1FX6A 3ITLA 4BF9A 3DG7A 2I9UA 5CPSA 5F2IA 4JQ3A 1CNVA 3QLDA 2GJXB 5DT7A 4D9PA 4F3HA 2C1IA 3ZOAA 2Y8VA 3EZ4A 4EAYA 1NFGA 3QC0A 2NQHA 2INEA 1ECQA 8CGTA 3C2RA 5A2BA 1UB3A 4W8AA 3T0CA 1VYRA 4O17A 3WH6A 2UZ9A 3VIMA 1S5MA 5F1UA 3NL6A 4CNNA 1M03A 4PUUA 3APTA 3QW3A 2XFRA 4O1EA 3EMCA 3U7BA 1VLWA 1IGSA 2G4FA 2E1WA 2O92A 2C0HA 1JCXA 1UC5A 3K5XA 1NDYA 1FWRA 1UPPA 2QDEA 4J3XA 3W84A 4HCDA 1CXHA 4GUHA 4DJEC 5FF4A 2R1LA 3PZUA 4W8LA 3KOWA 1UKSA 2WZMA 1YQ2A 4K1WA 1ZHAA 3I65A 1VBGA 2FDSA 4JQAA 3SB0A 3OO2A 1J6OA 4V27A 2XIBA 1P0KA 1KRAC 3S2NA 3SO7A 4C5YA 3BOFA 5KZMA 2ODOA 3ES8A 5FF0A 2NQ5A 4IMDA 1QR7A 2W63A 1BVNP 3PTKA 5XINA 3ABZA 2C79A 4KWSA 3YPIA 3VIIA 1UYQA 2HMCA 3VKDA 3BMWA 2WK2A 3ALGA 5EBUA 4KWWA 1CECA 3RF9A 2RDXA 3NZPA 3T8LA 4F8XA 1XD1A 3S5NA 4J3VA 4UIOA 2CBUA 3TFCA 1Y65A 1ZBVA 1UASA 3BQ6A 3GNPA 3BDKA 2FZDA 2XUCA 4XBSA 1P0DA 3M6YA 2ISDA 2PD9A 4ZXOA 3PBUA 4GGBA 1L8PA 1H62A 4DPQA 1TVLA 3OTRA 1V02E 3GH5A 3AHTA 1DKWA 1H1ZA 1ZTVA 1M7OA 7TAAA 1GYNA 1AL8A 4G1KA 3VD3A 3NWRA 3BO9A 1EJVC 3N4FA 4PULA 4D6FA 4C91A 1JPDX 3PP7A 1RVKA 3LHUA 1D8CA 4DF0A 2QCFA 2X0HA 3CASA 3DI1A 3G24A 1BKSA 2PLKA 1X6NA 4JTTA 3IK2A 4XAFA 4W8BA 2VEIA 3W00A 2BDQA 3SW6A 1DBTA 4E8GA 2J78A 4PTVA 4IFRA 2VX5A 5E70A 4C6KA 1R85A 3UJEA 2PWDA 2NZLA 2I5IA 4LC6A 2IUZA 2WM0A 1KXHA 4C6BA 3PTDA 4F9DA 2WVUA 4FP1A 3AXIA 3TOYA 4LALA 1H0IA 1KM1A 1L2QA 3GUGA 5EGRA 3OHIA 3NAVA 4IICA 3WK3A 3DUGA 4Q6XA 4DJDD 4OUEA 3ISIX 2ZBTA 4V1XA 2VT0A 5HUOA 3CWNA 3LMYA 2QMJA 3URBA 3WLHA 4EWJA 4HT3A 3SCWA 3B9AA 4Q4PA 3M9YA 1P43A 1TTIA 5DANA 3UGRA 4LGXA 3O0FA 4FNRA 4ATWA 3LZ5A 4DPPA 5JH2A 1UA7A 4UTMA 3AALA 2GGIA 1NEYA 3E2RA 4PODA 1B3XA 1WBHA 4AD1A 2OLHA 3UT0A 1M65A 3GS6A 3ES7A 3WLNA 4UFMA 1TE6A 1ZJAA 3TXVA 2VEKA 5CPQA 3A23A 4NY2A 2OMAA 4EK7A 4EACA 4W86A 3LPGA 3VNLA 3G1YA 1EJSC 4OJYA 4RZ6A 2E25A 3STFA 1Y0EA 4DAIA 1MO0A 1L6GA 2FPYA 4L6DA 3EXTA 1O6IA 1V0KA 1J10A 3TZNA 1L6SA 2ONEA 1QI0A 3FN9A 4MWAD 1XS2A 1VBUA 2OWXA 4JYFA 2VEPA 3BK0A 3BARA 2P10A 4TTGA 1E4IA 5AYZA 1AQHA 4AWTA 5I07A 3E12A 2PC4A 2ZUSA 2EBNA 3FAXA 3UA3A 3LTSA 3VE7A 3QRHA 3OVQA 1QPQA 4W87A 3HPSA 1GVOA 4C5ZA 2V5LA 3S1XA 5GVJA 2FKPA 3MW7A 4X2RA 3LHVA 2CITA 3BQ5A 3BAYA 1XGZA 4JKLA 2X40A 5CC3A 1UZHA 3M0LA 4KH2A 4X0VA 4F2TA 3VNZA 2W66A 4C7DA 1IZCA 6REQB 4DWSC 1O5KA 3V16A 3VC5A 3M0IA 4ALDA 2IQDA 3VOJA 4KWOA 1XKYA 1XLMA 3CL7A 4GYPA 3N2XA 1R3VA 1POJA 4NSBA 3II1A 3JZEA 3TR2A 1DHKA 3ZLHA 2V8ZA 3W7OA 4ZQPA 2I5QA 5C7HA 8XIMA 4ATDA 1OZMA 4ACZB 3CIWA 4PUNA 4D8ZA 1VZWA 2Y6ZA 1SO5A 2BG5A 1UMYA 3CYVA 1JUEA 6CGTA 2QHAA 4AD5A 1H2JA 4GFIA 3EWBX 5G4WA 3RCMA 1KR1A 4FNPA 3AXKA 5DY2A 2ZRUA 1DV7A 2E68A 3FDKA 3IJIA 2WQPA 3L0GA 1E0XA 1XYCA 2XTKA 5A6BD 3DERA 5DX7A 3G0UA 4KEUA 1B9BA 1UKQA 2G3MA 3HJZA 1XIJA 1VD6A 2VFGA 5FESA 3WG6A 2GDVA 1V02A 2XZ9A 1OX6A 4B2DA 1JZ8A 3E2SA 4YS1A 4LEFA 5BWAA 2XH0A 1I60A 3NJ3A 3QZ6A 3N6HA 3T05A 3RNDA 1B0IA 1IEVA 1WKEA 2X2YA 4JTFA 2EPOA 2QJGA 4OE7A 2B7OA 3O16A 3VD5A 3TYEA 1HQTA 4S3AA 5A3HA 5LIWX 2HBXA 2DQWA 3O9NA 4ZL1A 2J24A 3RO6A 2QCNA 1FH8A 2HXTA 1FWFC 1YRRA 2NQ9A 3AIQA 1I2QA 3WQ5A 1YIXA 4X22A 4JAWA 4EX4A 4WR3A 4KCWA 4IPLA 1G6CA 4Z1CA 1YX1A 1XG3A 2FHFA 2XDFA 5HJXA 3Q65A 3UR2A 1AH0A 3NM3A 3H24A 4NNBA 2JFEX 1XRFA 1V0MA 3N18A 3EB3A 3IVUA 4FZIA 1PPIA 2VQUA 1ZJHA 3CB8A 1O1ZA 4BF5A 2VR5A 3F4NA 3WCZA 2NWSA 3F2BA 1OFAA 3TP4A 1EDGA 4MLRA 4H9TA 4PMVA 1YKWA 1QOXA 3N11A 1ZPTA 4UC5A 4HKPA 4AG0A 5AY7A 1K8YA 1S2WA 3AYRA 1F6KA 3BG5A 2POTA 5TNVA 1HZYA 2DZVA 4O19A 1ISWA 1HGWA 3E0LA 2EPMX 1TV7A 4JL1A 4X9SA 1ZFJA 4OVXA 4FA3A 1M3UA 2GFTA 3LUTA 4FS9A 4IIBA 1R3QA 3TYZA 4JEJA 1TYGA 3AS0A 5DCEA 4S3EA 4YTRA 4HK5A 1EGVA 1FCUA 2YDSA 1HGYA 5BXPA 4F66A 5DO8A 2VC5A 3PZGA 3F7JA 4P8UA 4O10A 2FHBA 3P82A 2ISWA 4JNZA 2WJZA 4FR6A 4UOZA 4RKAA 4LVAA 2WHKA 4GACA 2RH9A 1ONRA 1F9CA 1PYMA 3A47A 1S5NA 4F4RA 4ZA0A 1JI2A 1F6YA 4ICNA 5E09A 5BRPA 2DZUA 2EEXA 4R7OA 4PTXA 3EPNA 1I4NA 2V3GA 2BZNA 4A05A 4DI9A 3M0YA 2PDNA 2DW6A 1VYPX 1EBHA 1FA2A 2NVCA 3S6DA 2DP3A 3L4UA 4GD0A 4XV0A 1L6YA 2CLIA 3UR7A 1Z44A 4PB4A 4HU3A 3RPMA 3QV8A 1BVZA 4MJMA 3EEZA 1MFVA 3FA3A 1N8IA 1JCTA 5HOSA 1NP2A 4ADUA 4N6EA 3B05A 3IARA 3HN3A 3KVLA 1W9VA 3AYTA 3HQ1A 3CV7A 3GDMA 3H4XA 1BWKA 1BLIA 4YIWA 2PDWA 1TJRA 2BODX 2G5WA 2VVSA 2ACQA 1E9IA 3BAJA 1WV2A 1NWRA 3BSGA 3B0XA 5CC7A 1PXGA 1EC7A 4QNWA 1OY0A 3A3XA 3VOHA 5I78A 1PCWA 2Y5EA 1UWAA 1JDFA 1FRBA 1W1A1 3EB4A 2XH2A 1W1VA 3VUPA 2C3ZA 4AUBA 4WCJA 1FDYA 2HJPA 4HHHA 4K7VA 4M6VA 4ZE4A 5I3GA 4Z0SA 2J7DA 3NO1A 1VJZA 4GVHA 1KM5A 5M17A 3W74A 2WCAA 2ZUUA 1TPFA 3ZQ9A 5IXEA 3QJAA 3OA5A 3MC5A 2X09A 1XLJA 1PYFA 1MXGA 5I3DA 2JK2A 4IGSA 3B4UA 3CAKA 1GNXA 1VFFA 5E93A 4HHLA 4TTUA 5C2CA 1EEPA 1UKOA 1PX4A 1T5AA 2WBGA 3VFLA 3H22A 1IWPA 2C7FA 4MNJA 3SM0A 3AFBA 1O7AA 1CXKA 1OADA 5DBUA 3LCXA 4M81A 2RDWA 2XIIA 3PBMA 3PZQA 3GKFA 5B7YA 1FWBC 1J5TA 3DFPA 1W9BM 3ABOA 1JZ7A 1XINA 2Z7KA 2OSWA 2DQXA 4J3TA 1JCYA 4RE4A 3PK7A 2DZPA 2BXVA 3TEVA 1LP6A 4G9PA 4JKMA 3CZKA 3ELFA 3T07A 2E40A 3DFSA 1J0IA 2OZ3A 1V3IA 4AXNA 4IXXA 5DMNA 4LCSA 5LNUA 1J0KA 1TX0A 3R11A 2EAWA 3DECA 4H9MA 2Y70A 5CZ0A 1YYAA 3UYIA 4YU1A 4AF0A 3BANA 1K1DA 3PWIA 2ZUTA 4W84A 4DZIA 3PWGA 1X7IA 2X0YA 1DIDA 3HFTA 1H63A 5IDZA 2E67A 6ALDA 3QOMA 3I7RA 3QF0A 3AQUA 4H7CA 4NZ4A 2R8WA 1FWSA 1XRTA 2QDDA 3CT2A 2QJIA 3KS5A 3FHQA 3G1HA 1W3KA 1KGXA 1NM9A 1MEIA 5D9OA 3LERA 3L5LA 4UTIA 5JUVA 2YYTA 2ZCGA 1K7EA 5I03A 4Q32A 5M1TA 2E0PA 4X0NA 4GKTA 1W32A 2PDFA 3NL2A 3TONA 2JQXA 2NQJA 3AIUA 3GU1A 2GVJA 1XKJA 2PMQA 2PBGA 1P0EA 1YBQA 1UWQA 2Q3OA 3PUEA 5XIAA 3PULA 4NZJA 1S39A 4Y7EA 4ZSTA 4D6CA 4HPJA 3PZMA 1NSJA 5BOFA 3MKCA 4QHRA 1ISXA 3W53A 4J3UA 1VFTA 3WBXA 4AYSA 1PHWA 2OSYA 5IDIA 5CCZA 3PZ9A 1GQLA 1Q2RA 5CLTA 2DIKA 1B54A 5I02A 3AXMA 1FWIC 3C4UA 3G1RA 1OCQA 3B9OA 3FYYA 4AIBA 4DJFA 1W3HA 2ISSA 1K7FA 2AQOA 1F2JA 1O5QA 3CLWA 3UWVA 3KX6A 3E1F1 5G1YA 3HG2A 1GJPA 1FKXA 3L68A 1CB7B 3CAWA 1EJTC 1VGAA 2D20A 2WANA 1AL7A 4UQ9A 4P7NA 4JHOA 3O7UA 1JFHA 1YNQA 4GYFA 2BTMA 2HV5A 2ZVRA 4Q6JA 3LRMA 3SI9A 3WELA 4M82A 4FNUA 4ZO6A 3LV6A 4WIWA 3UVAA 4BEUA 2GGHA 1WXJA 3GNOA 4LANA 5A6SA 3CMGA 3U5YA 1ELSA 5K3VA 4FO4A 2E5DA 3NVDA 4MAZA 2PZ0A 2ZXDA 1HX0A 4AIUA 3LX9A 3LXAA 4WJ8A 1U5JA 3V1PA 3UXLA 3AAMA 4D6GA 3KVJA 4AXKA 1QI3A 2C13A 4Z2GA 2PDHA 4PC8A 4QIUA 3H4WA 2BFGA 4HCHA 4E0CA 1ICQA 4NNCA 3BOXA 1HXJA 3QH2A 1XR2A 3B8DA 1GOMA 1V3HA 1ZLPA 1DXIA 1R9ZA 2I14A 2VOMA 2YOCA 2DT3A 2FZMA 4JZ5A 3WO8A 2W4XA 1R2TA 3GR8A 1EYEA 1G01A 3E0FA 3UNTA 5REQA 3MJYA 1RJQA 1TPB1 2QPUA 4GXPA 3B97A 4WK9A 4ZEPA 3VA8A 4GNVA 2BOEX 2YXGA 3T42A 1LWHA 3IGUA 4QG6A 4LH8A 2WJEA 1C29A 1CGYA 3CL6A 4IIEA 1XV8A 3G1AA 2UY3A 4BI6A 1P48A 3A9BA 2IKIA 4LY4A 3V4BA 3TYUA 3UG5A 3C5QA 2UBPC 5HJYA 3WLTA 4C1NA 3WLSA 3HZ3A 1X38A 4OECA 3C2YA 2WSRA 4HBKA 1PKYA 2P1FA 4DF1A 4AVNA 1BYBA 4DNHA 3FS2A 3WF0A 4IGMA 4RNFA 4FNSA 1VHCA 3CLMA 2ZUWA 2ZZ1A 1RAKA 1IXNA 4MG4A 3T78A 4US5A 4Y8FA 3CAVA 4NP7A 2A7NA 4HVXA 1V6YA 4PRWA 2IPFA 4AHQA 1TPUA 3FSUA 3K1GA 3LSCA 1WYIA 2WC7A 2Y85A 2ZC1A 4K2SA 2XISA 1P1XA 4RLIA 5AN7A 2PDJA 1OFEA 3DAQA 4GC4A 3VILA 3FJLA 1K6WA 1F8MA 5DLCA 5C55A 1RH9A 2QUVA 2GWNA 1PDYA 4V15A 3LN3A 1R5YA 1PTAA 1GPFA 3E0IA 1S2CA 2Z1XA 2ZWZA 1BXNA 1DWGM 1P6BA 1P6CA 2OWWA 5J5DA 2QIIA 1DWIM 2D1ZA 1VP5A 2XN0A 3M47A 3F1QA 4DYEA 1JXKA 2CW6A 1PBGA 2PDMA 3QQ1A 5D32A 3S1VA 3LHZA 4C65A 3W7RA 1G9HA 1QFEA 3WY1A 1J2WA 1IEWA 1FWAC 4OOUA 3T09A 4EP8C 5BXSA 3T0TA 2A2IA 3CYJA 2V5BA 1HW6A 3PAOA 1KKRA 4DXKA 3WK2A 3WF3A 4WEVX 4JCMA 1XRVA 4ZO9A 4H8HA 3W87A 1BF2A 5G1TA 3MUY1 2AKMA 2X2GA 4XX6A 2RJHA 3UVIA 4LX4A 1KBIA 3QQ0A 3RYSA 1PWLA 3CUHA 2XZ7A 3LQGA 1HL9A 1V7AA 1JF6A 4CVWA 4XZ9A 1FCVA 2J7BA 3VMNA 2ZUMA 4DIAA 3W02A 1JG9A 4G56A 3W37A 4GRSA 3VABA 4LAOA 1LRQA 4I5RA 1K6AA 1TFVA 2XGBA 5LA1A 4QG8A 3VGFA 4S2BA 2HE5A 4O12A 4EF9A 4KCVA 2NXGA 1KM0A 1PHQA 1QI4A 3KTSA 3F5JA 3MU7A 1KQYA 2ZKMX 3ZVHA 3UP8A 3B8SA 2WNZA 4QCFA 3WQ6A 3QC3A 3MMDA 2NWRA 3W2KA 3AWNA 4AWSA 3GZ3A 4M1RA 3AXXA 1IXOA 1DQUA 3A21A 4O14A 4M1BA 3POHA 3CC1A 2QVHA 1E15A 2XSBA 4GWEA 1OC6A 1SFTA 3TN6A 3VMOA 1GTHA 1EQCA 2QMKA 2HVOA 4Q8UA 4U3AA 3OW1A 1UD8A 2ZUNA 1MWOA 4IL0A 3HURA 1OFQA 2QYGA 2W5FA 4RE0A 3KBMA 2FMOA 1QU4A 2VDHA 1X1ZA 1WOAA 2CWXA 5D2YA 1JJKA 4MJ2A 3GX9A 1FH7A 2XIQA 1A4MA 3KLLA 1RJPA 3QR0A 5EMYA 1VHNA 3SRHA 4GC3A 4DB7A 1TR9A 1TE1A 5IM51 1XSKA 4PTMA 5AZ1A 1F3EA 2WC4A 3OEXA 1Z9AA 3CO8A 3GDKA 1J0JA 2PDXA 4LV9A 5E1QA 5EFFA 1XDJA 2YL9A 2G8ZA 5F4XA 1JCLA 4PMZA 2YKKA 3G22A 2GOKA 4GI4A 4DLFA 4FXFA 4MKNA 2ISVA 3W73A 4B3ZA 3OP2A 4I9MA 2VRJA 3WF1A 3CPUA 1QBAA 2A3CA 4ZFMA 3GH7A 3ZR6A 1A0CA 3HU7A 3DU0A 5D9PA 3ZFHA 4Y9NA 4TOQA 5CGMA 3KL0A 3NEVA 4HYRA 1Z48A 3GXFA 1WZAA 3K4AA 3I4EA 1FWJC 3V35A 3B8VA 2P5NA 1MW0A 3L0KA 1OFDA 4XTDA 1LQ2A 3WUGA 1CXEA 2ABAA 4TX9A 3TSBA 5DN1A 4FXSA 1UROA 5JQ9A 3EEGA 4M7TA 2X7WA 2FIQA 4WSJA 3W1NA 4WSKA 5A8MA 3Q37A 4CLMA 3CZ8A 4PYSA 5D05A 2XVGA 4GVIA 3HGJA 3THAA 3QHOA 1M5WA 4DZHA 2BBFA 1H7NA 5LIYX 4HP5A 1E6XM 4AEEA 1OX4A 3ZJ8A 2WZEA 2H3DA 2FGLA 4KGJA 1XC6A 4Z0JA 4Q22A 3SY8A 2Y24A 1GYLA 5A94A 3TTQA 1FH9A 2RDTA 4V2XA 4GI6A 3KL5A 4LXFA 1KBBA 3NDZA 4UXDA 3RU6A 5BU6A 4TX6A 1QPKA 4J3WA 1LG1A 3GSMA 4C6NA 2GUBA 2DZTA 3W70A 3GFZA 3GXNA 4M51A 1YBQB 4CQ8A 5IFPA 3CUFA 5DMYA 3TWBA 5HWMA 1K70A 3A22A 1WE5A 1TIMA 2NUXA 2EPNA 1SFSA 2Y8KA 4P8XA 4RZ5A 3PHAA 3E6EA 4IL2A 1ZY9A 3C0QA 4JDYA 1CGUA 2Z24A 2QULA 3TTOA 3NQDA 3CHFA 1JUBA 1OABA 4NVTA 2REQA 3WEOA 4AY8A 1NH6A 3IAQA 3UESA 4JTAA 1CX9A 2EF9A 4HPGA 3WLQA 4IGNA 5BYWA 2ATMA 1DEDA 1UW9A 2Y7DA 3R4IA 2TRSA 3AMCA 1R46A 4LCQA 2F9RA 2VURA 3UCDA 4M80A 4EWND 2AGKA 3M46A 1U1UA 2QXWA 3GE7A 4FHAA 2GGGA 3GBEA 3VPLA 3THQA 3E0WA 1Q6QA 2F6XA 3EWDA 2J8FA 1ONXA 2PZNA 3KOZA 3NUKA 3SSJA 1HL8A 1DIKA 1SZEA 3ARPA 1WKFA 3TR9A 2OKTA 4PMJA 1DIOA 3A5FA 4JTIA 1I75A 5AOUA 1CDGA 1B4KA 3QZAA 5CBIA 3S3GA 3PY2A 3CQKA 4IGHA 4UCGA 3SUVA 3OA3A 2W27A 4FLQA 4X2PA 3V0TA 5BXRA 1FWTA 2QUMA 2WZIA 1UH4A 3KDNA 4ROQA 4GISA 4GNKB 3TTEA 4V33A 4PMYA 4G8TA 3L4XA 3G1VA 5FKYA 1YTKA 2PC8A 4MMWA 5REQB 1XX1A 1VPXA 1W0MA 4W85A 4DJEA 3TW7A 4X61A 2PLCA 3MA8A 3S9ZA 1RJRA 3QZEA 4GCAA 4KRZA 3W82A 3APYA 1R2SA 1UKPA 1RQHA 4R53A 4C1NB 3W2UA 6XIAA 2VC6A 1XGEA 1IWBA 2HTMA 3TSMA 1E1EA 1MUMA 4AEOA 3SCVA 4UZSA 2O9PA 5DCBA 2QUUA 1FQ0A 4W89A 5F2MA 2PU0A 4M24A 1FHVA 2H9AA 1P6WA 1ISZA 4XD3A 1MQRA 3SADA 2OQHA 3W4RA 1R7AA 4H1ZA 4FXJA 1MEWA 3W27A 1DWAM 3MVIA 3GXIA 1J0ZA 1WXZA 2PS2A 1NF0A 2CHRA 3ANVA 4ACYA 1VBHA 2Z4GA 3E0VA 4TR9A 3A64A 4DUWA 3SGGA 3EKGA 3GAKA 5D2TA 1RA5A 3NDOA 1OVDA 2PURA 1ZBWA 2D0HA 3W1AA 4LS1A 3FYOA 1V3KA 4R85A 2FZ8A 3STGA 1WUEA 1NTHA 3BLIA 3MP3A 5DY3A 4OKDA 4YN5A 1Q6OA 1WKYA 4HK7A 1QATA 3HGRA 3FJ4A 3LHYA 3NO3A 2VCBA 5AHFA 1HF6A 2QPSA 3LV5A 3LNPA 1PCKA 4POCA 4MJZA 3CK5A 4KEMA 4GZJA 3WNOA 4YL2A 1H49A 2ABBA 3G1SA 1OCNA 4RJEA 1QO5A 1XIDA 4NAEA 2XM2A 4YHEA 4HMEA 2W61A 4A8IA 2ALDA 1W56A 4RCXA 4W5UA 5AYIA 1LLWA 3N04A 3U2CA 3VGBA 4LAKA 4QJ3B 3RR1A 5D9MA 5RUBA 3FX4A 1PWMA 1NWUA 4Z2HA 1CGTA 3W86A 1RPKA 4KWUA 3QKZA 3S6TA 3BMVA 1PDZA 3REQA 1C93A 4OUIA 3WD2A 1EJRC 4FLSA 3NZQA 5CAKA 1H7WA 1DOSA 2QAPA 4PGLA 2C0AA 3CAQA 4I90A 4UBPC 4U2YA 3VC6A 1JI1A 2X05A 3N15A 5D2WA 3CEUA 4LAMA 1DXEA 4DI8A 3FEMA 4HPHA 4AW7A 3GB6A 4R7JA 3CIXA 3LI0A 2CESA 1QI2A 3WLJA 2A1YA 4PRTA 4WF7A 1B57A 1Z3NA 4C6DA 1H09A 3WNLA 1U33A 2CHOA 1GG0A 2DIJA 4JBRA 4KRUA 5CZTA 2CBJA 3GY1A 1R2RA 4UFHA 1QPNA 3ZVHB 3PS7A 5CEWA 1CW2A 3AS3A 3WFAA 1LBLA 1K7XA 3R12A 4ZODA 1ADOA 2Y89A 3C86A 3VINA 4UUIA 3ZLGA 3DC0A 4Z08A 3U57A 3DKJA 1A5CA 5CJNA 1G4TA 1Q6GA 2IMRA 4LYKA 3T0BA 3PZNA 4WD0A 5AC5A 4GZEA 3F4CA 4V1YA 4J28A 3OOQA 1XIGA 5H8MA 3WFZA 3MCOA 3T55A 3GDTA 4CEUC 3S2MA 4O0ZA 2P76A 2WZTA 1I2RA 3VOFA 3KXQA 3PB2A 1C8YA 5HQEA 5EMLA 2GOUA 1GTEA 4B9ZA 1KFWA 2H6RA 3H23A 2VUYA 3UW6A 1FCQA 2ZRVA 3EA1A 1TSIA 2PLMA 3FEQA 1GZGA 3MWAA 4G1NA 1RXOB 4GK8A 4F0HA 3CUJA 3RU8X 1XXXA 4GFSA 2X1SA 3SN0A 4EAMA 2PDKA 1UC4A 2V3EA 2XU2A 3RN6A 1H1YA 3B9DA 4ASTA 5KZ6A 2ZUVA 1WO2A 5GNXA 4Y9OA 3CH9A 3RCNA 4QISA 4XO7A 5ABGA 1H7XA 3ANYA 3C2OA 4UQCA 2JKEA 4HU8A 4RXFA 2ZFAA 5AZ0A 1JL8A 4CD6A 3GDRA 2DUZA 4BKNA 4E4FA 1Q7MA 1UP2A 3CIVA 1FTXA 2CKRA 5FEPA 3NQ8A 3VTRA 4WRHA 4BFAA 3RRXA 2JGYA 4TMBA 1TPWA 3DKLA 3JVAA 4O13A 4Z17A 2G4JA 2OX1A 2DORA 3TJXA 4O15A 4XZLX 1R9XA 2C19A 3SGZA 4H8NA 5FJJA 3EOLA 3LK6A 4ENLA 4NUWA 1SFJA 5E6ZA 2Y7GA 1NY1A 1UD5A 3JS3A 1B90A 1IXQA 4KBXA 5K7JA 9CGTA 2UWFA 2VXNA 3WK1A 4GUGA 3SN4A 4CCDA 2AGTA 1W3JA 1BAGA 3F5LA 4JKKA 4JCLA 3V75A 2HNEA 2YDRA 2INFA 1X7FA 2DU2A 3LXCA 3GQYA 1CXIA 3NZ1A 1XICA 3WFLA 5D04C 1EBGA 1PS9A 3VIKA 4ICCX 4ZENA 3K46A 4XISA 5DFAA 1OX4B 1IGWA 2I9EA 4L9XA 3MCMA 2QUTA 2JIWA 4XG1A 4YYFA 3BCDA 4GY0A 3SUUA 1V3MA 3E2VA 4CQBA 1R3TA 4LEQA 4LVDA 5AHNA 4D6EA 1K8ZA 5LGZA 4Q8QA 5BZAA 2F8QA 2XPKA 5A95A 1H5YA 1G4SA 5CBBA 1ITCA 3EGJA 2PRMA 1JDCA 1W1B1 3TH6A 2QGHA 3GAYA 3LENA 3T2QA 3O6DA 1BYCA 3G1XA 2DSUA 3L0NA 2ZA3A 5KINA 3HJEA 2DEPA 1UA3A 4AISA 4ORMA 2DUAA 5E9AA 1U22A 1OC7A 2W3ZA 3OBKA 1F05A 1QDSA 3XISA 4AYGA 1NDWA 3I3EA 4ZQNA 2HQAA 1XYMA 3DHFA 2E5CA 4BI5A 3AIBA 2P0OA 4Q8MA 5FEZA 4K39A 4JN8A 3DIPA 4L1XA 3W3OA 5CZKA 3KRSA 1PKNA 3A9IA 3MYPA 5AVHA 1IEXA 4D6JA 2WW5A 1QRQA 3NO5A 2PDGA 1M7JA 4IJBA 2Y7FA 3FV9A 1S46A 3OGSA 1K4GA 1WZMA 4L65A 2NW0A 1KO0A 2ZX7A 2F61A 4BQ3A 4N9DA 2YXOA 1Q66A 2FTWA 2QAFA 4FXRA 5HATA 3HV9A 3BG9A 2FGBA 2YIHA 4R9OA 1XIHA 2ACRA 2A3HA 3ANUA 3TQVA 4YPJA 1FWWA 2D73A 3VIFA 3GHSA 3I3BA 5CG7A 3IVSA 4Y90A 4GZ7A 4XSMA 3K8KA 5DRCA 3EOSA 4HNTA 2WHJA 1EZWA 3BW2A 2PDBA 3EMZA 3F4DA 3AYVA 3RX2A 4B5SA 1MUCA 3N2OA 4DJED 3DGBA 3MO7A 3LS9A 4JTHA 2IXVA 1QHZA 4REQA 3P84A 1EC8A 7REQA