4IFRA

2.40 angstroms x-ray crystal structure of r239a 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase from pseudomonas fluorescens
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
330
structure length
330
Chain Sequence
b'PRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGAVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title The power of two: arginine 51 and arginine 239* from a neighboring subunit are essential for catalysis in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 116
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4ifrA00
4C6CA 3K5XA 5HMEA 3F4CA 3S2MA 2HBVA 1PTAA 4LCSA 1J5SA 1FWCC 3B0XA 5A6TC 1HZYA 4H9MA 3QY6A 4DIAA 4F0RA 4QSFA 4TQTA 3PNZA 1R9ZA 1K1DA 1FWGC 2W9MA 4C6QA 4C6KA 4IQJA 4IG2B 2VR2A 3CS2A 4C5ZA 3GTHA 4DNMA 2Z2BA 4L6DA 4H00A 1NDVA 2R1NA 3QY8A 3IACA 3UBPC 1PB0A 2Z24A 4LEFA 1NDYA 1NDZA 4PCNA 4EPDC 3B40A 2ZC1A 2VM8A 4QROA 3F2DA 4XD6A 2PGFA 2VUNA 4KQNA 1R9XA 1JGMA 4C6NA 2A3LA 4EP8C 3GU1A 1W1IE 2HBXA 2R1MA 2Z29A 4DYKA 1UBPC 3QGAC 1UIPA 1M65A 4WHBA 2Y1HA 3URBA 2Z27A 3LSBA 1EZ2A 2XIOA 4CEXC 2O4MA 4RDZA 1ZZMA 3A3WA 3LGDA 4AC7C 4H9ZA 1I0BA 1FWIC 3UF9A 2FFIA 1NDWA 4RZBA 4P5UA 2R1LA 3PNUA 1RJQA 3BE7A 4QS5A 1WXZA 4RE0A 2VHLA 4C6EA 1FWEC 4I6VA 3OU8A 1XWYA 1I0DA 4V1YA 4XD4A 1QXLA 4BY3A 5HMFA 3S2NA 2ICSA 4CNSA 2GSEA 3ORWA 2BGNE 4HA0A 1XRFA 2WM1A 2GZXA 3GRIA 3HPAA 3MVTA 2Q09A 3LSCA 4B3ZA 4XD5A 1IE7C 2P53A 4HK7A 4GYFA 3K4WA 3K2GA 4DZIA 2PAJA 1K6WA 3GTFA 3OVGA 1VFLA 3LA4A 4YIWA 3E2VA 2RAGA 2OB3A 2PLMA 2Z00A 3WZ0E 4KF1A 4C60A 3NEHA 4GC3A 1GKRA 1KRMA 4XAYA 3OJGA 5HMDA 1YIXA 1UMLA 2EG6A 2VC7A 4M51A 2D2HA 3URNA 4XAZA 4LANA 3MSRA 3LU2A 2E25A 1A5LC 1YNYA 2OGJA 4JOMA 3E0FA 1BF6A 2D2JA 4LAMA 1FWHC 4LAOA 3IJ6A 4UBPC 2VC5A 4CQDA 1E9YB 3FEQA 1S3TC 4IFOA 3O0FA 3G77A 4PBEA 1FKXA 3T1GA 3T81A 4IGMA 4C6IA 4CNTA 4J2MA 1RJPA 4C6DA 1XRTA 5AKQA 3NQBA 3DC8A 2G3FA 3D6NA 4G7EA 4LALA 4G7EB 3GTIA 2ADAA 4CEUC 4RDVA 3IPWA 4DZHA 2YZ5A 2OOFA 3AU2A 2WJDA 4ERIA 4PBFA 3DCPA 4H9XA 2Z26A 3E3HA 1P6CA 2QPXA 1A5MC 3B0YA 3LS9A 3AU6A 4C6BA 4BJHA 2Q01A 1O5RA 4ZSTA 3UPMA 2R1KA 4E3TA 4EPBC 4GXWA 4BKNA 3RN6A 1QW7A 3TN3A 2Z7GA 2WJFA 4IFKA 4IFKB 1ONXA 3MPGA 1GKPA 4IGNA 2Z2AA 4QS6A 5E5CA 3F4DA 3FDGA 4F0LA 2KAUC 3WYZA 3EGJA 2D2GA 4LCQA 2GWGA 4F0SA 2UBPC 1P1MA 3OQEA 1RAKA 2Z4GA 2QT3A 3HTWA 4INFA 3LNPA 4CQCA 3T8LA 2OQLA 2DVTA 3WMLA 3O7UA 4EPEC 1E9ZB 2F6KA 2Z25A 1M7JA 3DUGA 1M68A 4KESA 1WXYA 1P6BA 1EF2A 3IRSA 4RDYA 2AQVA 4H9YA 4XAFA 3A3XA 2IMRA 1RJRA 3GG7A 4Z42C 3C86A 5FSDC 1GKQA 1RA5A 2PUZA 1RK5A 4LAKA 1FWAC 4PCPA 2P50A 2GWNA 4EPKA 3ID7A 2WJEA 4CNUA 2PGRA 1YRRA 4MUPA 2YXOA 3MVIA 4HK6A 3ISIX 3A4JA 3S4TA 2I5GA 2HPIA 4C6OA 4WGXA 4B91A 2E1WA 4H9UA 4IFRA 3OOQA 3E74A 4GOAA 4DI9A 3ICJA 1NFGA 3PANA 1FWDC 4OFCA 4KEUA 3QGKC 4ERAA 4B92A 4LFYA 1KRCC 4DI8A 3RHGA 1R9YA 3S2LA 1PSCA 4GY1A 3EWDA 1ADDA 3QY7A 1KCXA 3URAA 2GOKA 2O4QA 4ICMA 1A5KC 4KIRA 4KERA 4NP7A 3E38A 4RDWA 3TN4A 4B90A 2YB1A 1DPMA 2EG8A 2UZ9A 4R88A 1V7AA 3V7PA 1K70A 3GUWA 3UR5A 3E0LA 4QTGA 4V1XA 1FWFC 4D8LA 3MJMA 1V79A 3MTWA 4IH3A 4XAGA 2FVKA 3OODA 1PO9A 3GIQA 5CH9A 4C65A 2DVXA 4GY7A 2FTYA 4IG2A 3TN5A 4GY0A 3NURA 3GU2A 4I6KA 4C6FA 4LH8A 4GBDA 4CQBA 4H9TA 3UR2A 5G4HC 4GK8A 4IF2A 1EJRC 3KM8A 3HM7A 4R85A 2YB4A 3TN6A 4GZ7A 5FSEC 1EJSC 4GX9A 2EG7A 1YMYA 1RA0A 1EJVC 4ZSUA 4DO7A 3RYSA 3EWCA 3ITCA 4HK5A 4GX8A 1A4LA 2FVMA 4R7WA 4G2DA 4J5NA 1POJA 1J6PA 1FKWA 1EJXC 3N2CA 1V77A 5LXXA 4DLMA 3CAKA 1ONWA 2QS8A 1EJUC 2BB0A 2Z28A 1V4YA 4QRNA 2R1PA 2ANUA 4XD3A 4J35A 4L9XA 4KEZA 1EJTC 1FWJC 4AQLA 3TNBA 3GU9A 3FDKA 1RK6A 3JZEA 4NI8A 2HNHA 3GIPA 1EYWA 1ITQA 4C6LA 2DVUA 4ERGA 1A4MA 4UB9A 3F2CA 4KEVA 3IV8A 1XGEA 1YBQA 2CZVA 3GTXA 1YBQB 1FWBC 1EJWC 3RCMA 2HPMA 1KRBC 3S2JA 4HJWA 3PBMA 2FTWA 1J6OA 1ITUA 4C6MA 1J79A 2HQAA 4H01A 4NG3A 2I9UA 1V51A 3F2BA 4LCRA 1POKA 3MKVA 2AMXA 2QVNA 1A5OC 4H9VA 2AQOA 3URQA 3LY0A 4C6JA 3IARA 4WVXA 3PAOA 3CJPA 4C6PA 2OODA 3SO7A 3MDUA 3AUOA 4DLFA 1UIOA 3SFWA 4PE8A 3IGHX 1A5NC 3MDWA 3R0DA 4C5YA 4KETA 1KRAC 1O12A 3LGGA
chains in the Genus database with same CATH superfamily
3AISA 4K36A 1JRCA 3U5UA 2VUYA 1JG9A 2O56A 3CPGA 1EPVA 4LCSA 3F5KA 4ZXOA 1EEXA 1YE6A 1TQJA 5CSSA 3V5CA 5TF0A 4DIAA 3IJ7A 4XV0A 4PMQA 2QUUA 8CGTA 4AEOA 1K9TA 1EIXA 4ZMGA 3FA5A 4GFIA 1TV5A 3CZLA 2QJGA 4OUEA 1BFNA 3T9PA 4UQBA 3ZWSA 5A6SA 1HUVA 4AMAA 4LBRA 1PB0A 2Z24A 1N8IA 2ZIDA 3QV6A 3QPZA 4LEFA 1Z41A 3FYOA 4O18A 4OJYA 1BD0A 4GINA 1RBOB 3GH5A 3OW1A 3PBWA 4EF8A 2BY1A 2QDHA 3PTQA 3RX4A 4GH1A 4PRTA 2B7OA 1MW3A 3G1FA 5CGQA 3TQVA 3ANVA 3U9IA 1JULA 3AZTA 4NYYA 5M5DA 4IQDA 4EXBA 3GBEA 1QASA 3GB6A 4H83A 3KVLA 4C1NB 1PZ1A 2Y7EA 3QW4B 3WH9A 1FFQA 4W7VA 1QHZA 5I07A 1YLVA 3VIOA 3VMOA 1QRQA 2VRJA 3QW3A 5KZDA 4H6KA 1NP0A 4AWTA 3P0XA 4JYDA 2EPKX 1OGBA 1XJBA 4IJBA 1E0TA 3GTFA 4LNCA 3SRFA 4JNZA 4A22A 1HQTA 3N11A 1ME8A 4OQVA 1DJQA 4PGLA 2VWSA 3KX6A 1TZZA 3B8DA 1VRDA 1B54A 2NV2A 4MAVA 4O15A 3KTXA 4UR7A 4ILSA 5A8OA 4K8EA 3E0FA 3P62A 4O50A 2WSYA 3B06A 4XIAA 1VLIA 3SCVA 4JL1A 4EKJA 3H2EA 2CLLA 3FXGA 1JCXA 1T8QA 3ZXWA 2I7GA 4GIEA 3WJWA 4F0MA 3T81A 5LGZA 1UR2A 2X05A 1X38A 3SR7A 3ZT7A 4C6DA 5BYWA 2Y6ZA 3LB0A 2PP3A 3L5LA 3SQLA 4G7EB 4S23A 5F1UA 4QJ5B 3F1QA 2G96A 4LYRA 1L8PA 1UZ1A 2DZUA 3AS3A 5LIKX 3PF3A 5K4ZA 4DYEA 3DCPA 4H2HA 4RNHA 3WL1A 3M5VA 4ZO6A 3UPMA 4O53A 2YX0A 5ABTA 1G0CA 2CLFA 2YR1A 4P2VA 5BOEA 4PCFA 2IPGA 2WMFA 3NM3A 3U57A 3ANYA 4ADUA 4LPCA 2VEMA 1JYNA 4MWAA 2GJPA 5DXYA 4M24A 5E0KA 4MF4A 4AEFA 4OZOA 3T55A 7REQA 4YCOA 3VOGA 1XX1A 1J10A 2PFHA 2CHOA 2OQLA 2DIEA 2VDIA 4H7VA 3AZRA 1RR2A 4MSSA 4WJ8A 3EMQA 3VA8A 3LRKA 4AF0A 1VEMA 4IIBA 3DOPA 2IMRA 1JPHA 1PKLA 4F2TA 1W5OA 3C2VA 5A8QA 2QGYA 4YLWA 2F8QA 2VFHA 4DO6A 2ZZ7A 2O9OA 2PDYA 2V2DA 3MHGA 3WEZA 5M1TA 3LRLA 5LIWX 4HA3A 1U1HA 1HW6A 2PC4A 5JH1A 4GOAA 3QMTA 1LYXA 1FWDC 3WLMA 4B92A 2VZSA 1TX0A 3A23A 4DI8A 3QBUA 5AYXA 5I03A 4NUWA 4A3YA 2PLKA 1ADDA 2YCKX 4UR9A 3BLOA 1AH0A 2HCVA 4M3PA 3QQ1A 1BQCA 1PYFA 3FV9A 1DWFM 5LNUA 2WLZA 3ABSA 1U33A 2ZDSA 4US6A 4N7QA 1NEYA 3UG8A 3CMJA 1CTNA 2O55A 4IMDA 3W81A 3LQGA 3V7PA 5HWNA 3U2EA 3FN9A 3MW7A 1YXCA 4ECLA 1ZFJA 4W8AA 1I45A 3IWPA 1TSIA 4PH6A 4GY0A 3BANA 1SJBA 3HJZA 2QUVA 4CD4A 5HWJA 3RU6A 3TYCA 4GK8A 3CK5A 1TPB1 1QOQA 1MW0A 3TROA 4CLMA 4JDYA 2V2HA 2WHMA 1E9IA 1NWUA 1HKWA 1VFHA 2WC3A 2PCEA 3EX1A 2IQTA 1WV2A 4J5NA 1POJA 1Q8JA 5C2CA 3JUGA 2WM0A 1V0NA 2OEJA 5D02A 3W01A 3UG5A 2PDXA 4HHLA 1LLWA 4RNJA 4XWUA 4GUGA 5BRBA 3CL7A 3PZ9A 2D23A 3L2LA 4XD3A 2GGGA 3W86A 1N7KA 2OOGA 4P8VA 4D6DA 1Q6DA 3KXQA 4UB9A 3EWZA 3NVDA 3IV8A 4V27A 3I7RA 3TC7A 3WG6A 3WY1A 3UCQA 2V69A 2H3BA 3N04A 1UKSA 1VENA 1G4PA 2HQAA 1FH8A 5HUOA 5A1AA 1FHLA 4ROQA 3SCUA 1MEWA 4X60A 3PTDA 4W5UA 5DBTA 5CPTA 4B5SA 3CUXA 1TPWA 1OBAA 3SO7A 5E6ZA 4XBSA 1Q6QA 3N3TA 3WQ8A 3TYEA 2REQA 2GJNA 1RCXB 3LK6A 4UFIA 2DT3A 2BNJA 4GYPC 4HHMA 2XGBA 5CBIA 1QNQA 4JY9A 3R58A 3AIBA 3WLHA 1VYSX 4I8DA 1E0VA 4H9MA 3MZNA 1L0PA 4LRTA 4I9JA 3SBFA 1MRAA 1ZUAX 3CS2A 1DOSA 3PM6A 3W73A 2OZTA 2GDQA 2ZICA 1CT5A 3KS5A 1O1HA 2P10A 4QROA 2PD9A 1FH7A 1EGZA 4QDWA 4MNKA 1A47A 3HJEA 1TV7A 4XZHA 1XH0A 5HQMA 2OLHA 1VIZA 1NWRA 3TCEA 2G3IA 1UJPA 4BF5A 4CEXC 4HU8A 2O4MA 4RDZA 1XH1A 3UF9A 4S3BA 3K1GA 2R1LA 3PUEA 4AIEA 3WFZA 4DM2A 3W71A 2DZVA 3P6LA 4M80A 3I3EA 5HMFA 4F48A 1XC4A 3VCRA 3Q45A 1LUCA 1XBVA 3SURA 4R9OA 3A6OA 3LZ3A 2TAAA 3I4KA 4MJZA 3LSCA 4XD5A 3WF3A 1IE7C 1FWWA 3N13A 4L5ZA 2PRHA 2VD9A 4MNJA 3S5OA 1EL3A 4JKKA 3ZO9A 4YIWA 4O28A 2CLIA 3RMEA 4UTHA 4X0NA 4JQ1A 4GC3A 4QAIA 2VI0A 2IPWA 3VAVA 1N55A 1YIXA 2EG6A 5FJPA 4C7FA 3LPFA 1MEIA 1XGZA 1OCBA 4NVTA 4ZGYA 4IQLA 5IDIA 1LBFA 1K7FA 4JKLA 3W07A 1V93A 2IXVA 3IJ6A 5F1VA 4B9ZA 3AYSA 2YXXA 1PZ2A 1RXOB 1XIEA 3VDHA 4RE4A 3QTGA 1O4UA 1AD4A 4A8NA 3P5YA 4U10A 1KA9F 5F4WA 5G2IA 3NQ7A 4Q4MA 4ICCX 3VM5A 4JFSA 1QO2A 3HGSA 4AY1A 1GWJA 1JDEA 1JQXA 3OYZA 2YOCA 2BS9A 3W0KA 3UYCA 1A5MC 3LX9A 1QOXA 3EEZA 5AN7A 4QFUA 2Y62A 3S2CA 4BKNA 3GIYA 3M0ZA 3NQFA 4HA4A 4PR4A 4W86A 5CC5A 3TTOA 1RY8A 4PL1A 1UD5A 2C14A 3MWCA 4PEKA 4HPGA 3SGUA 5DQPA 2KAUC 4AX6A 5C55A 3BLLA 1KR0A 1VIWA 4G7FA 1P1MA 4XISA 4UZUA 2G5WA 3PVFA 3QYQA 1KKRA 2NUXA 5D04C 1QHOA 2VXNA 3O7UA 3APTA 2XVGA 2JBMA 3QFEA 5LA0A 1SFSA 5D2WA 4HCHA 4L9YA 4ZVJA 3CQHA 4RDYA 4RX0A 3SZ8A 3WD0A 1PX3A 3WH6A 4IICA 3C86A 3R0UA 1GKQA 4G56A 1RHCA 4IMEA 2P50A 3M6DA 5C7VA 3AHZA 1OEPA 4LF1A 4OT7A 2EHHA 8RUCA 2GJXB 2ZX7A 1QT1A 4GNKB 1P0KA 5HNRA 3CZ8A 1YXDA 5H91A 3OOQA 3FW6A 5K9DA 3CL6A 2Y4SA 3REQA 1RSCA 1IGSA 2QULA 1QATA 3CWOX 4E4UA 2BSLA 4X3ZA 3NCOA 1M9HA 4A35A 3QY7A 1IT0A 2YBUA 1U2YA 4W4QA 4FNQA 4RDWA 3WN6A 2GK1B 3CAVA 1OYAA 1H41A 4Z17A 1GVQA 3C52A 1KBBA 1RY0A 4V1XA 3MJMA 1K9EA 3IAQA 2XH2A 4I7UA 4DUXA 3EX4A 3MI3A 4BWLA 4IP4A 3LNMA 1EYEA 1IXNA 4YHGA 1G4SA 1BVWA 3TN5A 3AJ7A 3AS2A 4C6FA 3DERA 3HF3A 3WD4A 1DWGM 3CPUA 1J2WA 4FOUA 3GX9A 4TXEA 4GZ7A 4HZ6A 1L2UA 1XD0A 3S9ZA 3TTYA 4XG1A 3QHOA 3PK7A 3HMJG 1MZHA 1HNYA 3NPUA 5H6HA 4W85A 5C9WA 4GNVA 5LXXA 8A3HA 1SQ7A 1JD7A 3V0TA 3BG3A 4GQQA 2Z28A 4MKVA 1KCZA 3WDHA 4ZL1A 3N6JA 2GL5A 1EO7A 3R7MA 1EJTC 3R12A 1BKHA 3L65A 1EA0A 2Z6IA 3UGRA 4KIEA 2HNHA 5DY3A 1BXBA 3NZRA 3VFCA 2P5NA 4TV6A 5M03A 2H8ZA 2AAMA 5K9CA 5GVJA 1W56A 3H2FA 1F3WA 4L1XA 3S5SA 1PWLA 4RL3A 4H01A 2J88A 4BS0A 3QV9A 1RCQA 1HJSA 1QPRA 2YSWA 4XVEA 4J3SA 4DF1A 2QUNA 3WD2A 3GHTA 1E5NA 1GQIA 4H9VA 3FS2A 2E6FA 2E3ZA 2FZDA 3AZSA 3P82A 2NT0A 2PF8A 2OKTA 3AMGA 2XIMA 3RLUA 4N6FA 3UP8A 4ZOCA 4R53A 1MNZA 4GI4A 3OA3A 4PTMA 1WP6A 3BAIA 3ABRA 5A6JA 4CGTA 4K3ZA 3G0SA 3MJYA 4UIOA 4D6JA 2FPVA 1WB0A 5REQA 4AWUA 4Q8WA 5HMEA 1XIDA 1OJXA 5FEZA 3F4CA 4R5EA 2Y89A 1ADSA 1RH9A 2HS6A 4ZOBA 1UD2A 4N9CA 5E9AA 1TV4A 1M03A 5MKGB 1LBLA 2W61A 4IQJA 3L7RA 3AI0A 5JXQA 2Z2BA 3M46A 5E9XA 4W89A 4H00A 2QCNA 1K4HA 3O15A 2VFEA 2Y7FA 4S1FA 5TBOA 4EWND 3WNPA 3APYA 3T0TA 3BCJA 2UY3A 4FK9A 2V5DA 1MQRA 3SCRA 1VJIA 1VFTA 2ACQA 2G4FA 3MBFA 2Y0FA 3V0SA 3NGFA 3C2FA 2OU4A 2PCQA 3G1SA 2A3LA 3RPDA 3OG2A 1P0BA 4ZODA 1PX4A 5K3VA 2W3ZA 5FEPA 3URBA 1ZS2A 2YYUA 3W6LA 3D47A 4DWDA 3TR2A 1CXFA 2WW5A 1MXSA 1CPUA 2BXYA 2D24A 4UFLA 4W8LA 4MJMA 3T08A 4I6VA 4ACZA 3VFLA 3VGHA 1QNSA 1AJZA 5HUPA 1J4EA 4KW2A 2AL2B 1ISXA 4HHPA 5BU9A 4HK7A 1TO3A 1WZAA 2XUCA 3H53A 3THAA 3GDLA 3SFKA 2WAGA 3N9KA 1W5PA 1CXIA 2PWDA 4PCSA 4FNUA 1KBLA 2ZZ1A 4NNAA 3WK3A 1XIGA 2GUUA 4JL2A 5HPOA 3OJGA 2FPTA 2VC7A 2D22A 6TAAA 3P80A 1BHGA 1JCJA 1SO3A 4QG9A 3V18A 4NRSA 1S3TC 3M07A 4GCXA 3O0FA 4IFOA 2J78A 1XIJA 2YJQA 3VILA 2XZ9A 2F61A 4C6IA 4K38A 4QCEA 2PZ0A 2BODX 3ZLGA 2W0UA 1AW5A 7PTDA 1SGJA 3BLEA 1DJXA 2Z2UA 4E5TA 4PSRA 3VZZA 4X2RA 3I7SA 5I3HA 3AROA 4HOZA 2YLLA 1XUZA 4N9EA 3UQNA 2WCGA 4WKAA 3A4AA 4YL2A 2WJFA 3KTCA 5AYYA 4ZQMA 4LVDA 3SQMA 1KQZA 4LB4A 1V0MA 3DHUA 2QMKA 3UCCA 3ENLA 3M0JA 2GDUA 4QJ4B 4MIMA 1B4EA 1E56A 3SUSA 3NDZA 4WDUA 4Q4PA 1LG2A 1KFBA 4INFA 1BYBA 1F07A 4L9ZA 4PFMA 5CJNA 1JL8A 2AKMA 4R3UA 3VO0A 3C3NA 3SAZA 4U31A 2Q02A 3GBDA 4XTDA 3SIMA 1XCXA 3TLLA 4Y9PA 1CB7B 4K37A 4H7ZA 1RQEA 3HURA 4NKCA 2E4TA 4JHMA 3KVKA 4AZGA 1UWRA 2WJEA 2VX4A 2OR2A 1LQ0A 4DNHA 1XIHA 3EDJA 1OK6A 4GI6A 3ZIZA 2OEKA 1HKVA 5AZ1A 3QM3A 3TJIA 2E9MA 3I65A 3NEVA 1JPMA 2J9YA 4HNUA 4JZ5A 1FQ0A 1W1ZA 4DI9A 3MUIA 3LPPA 4LFYA 2OGYA 5H8PA 1R9YA 3ELFA 3WDRA 4LUSA 4JCMA 3APGA 3SCPA 1US2A 1XLAA 3ALGA 3A47A 3URAA 2NV9A 2DEPA 1LCOA 2VEGA 3T05A 4DJDD 2YPIA 3R8GA 2YB1A 1U5HA 2EG8A 4H19A 4Q6XA 4TIMA 1HKIA 3M0MA 1HT6A 1DVJA 3GIQA 4P7NA 1NIUA 1N8WA 4NNCA 3PZGA 1XKJA 2CFFA 1TIWA 1YKWA 3UR2A 3PB2A 5T9BG 5HULA 3CWHA 4QLKA 2IQDA 1K9DA 1ISYA 4KT2A 2EG7A 3TZFA 4ZSUA 4DY1A 3AC0A 3RYSA 2WXDM 2GVYA 2PB1A 5K9XA 3ITCA 4CD8A 2FB2A 2DY3A 1Z48A 2X16A 4PTNA 4LVAA 3JU2A 1FKWA 3FHQA 1C8QA 3M6YA 4RKAA 1Q6RA 4DLMA 5I3DA 4Q22A 5ECUA 4KFPA 1YDOA 4RPQA 3ABXA 1EJUC 3K13A 2I14A 4J3ZA 2QDDA 3E0IA 4M19A 5CKSA 4GQ0A 3GIPA 4RNFA 4EACA 3EDKA 1Q6CA 4LUTA 4JR5A 3RUBL 1V3MA 1KRBC 2AMGA 4XAPA 3DG3A 2X2YA 1J79A 1JF5A 1PKMA 2TSYA 1PJ9A 1H0IA 1S2CA 4HQVA 1EDGA 5H8UA 2ZUWA 2AL1A 4JIEA 1UR1A 3T2PA 1B4KA 1XSIA 1FUYA 3O07A 3T0DA 2I5QA 2P8CA 3AQUA 2A3AA 2NZLA 3USBA 2ACRA 1AL8A 4HVXA 5CC7A 1QI5A 1DE5A 2VTFA 4ZB5A 3NXFA 2WZTA 1F3TA 1JDDA 4JTFA 3UESA 1WX0A 3GDTA 4C5YA 1KNWA 1UQZA 3STCA 3SCOA 1B30A 3VNZA 1W37A 3T0CA 5LZLA 1JF6A 5A6TC 2BGSA 2P0IA 5AYZA 1LOSA 1SR0A 1KM4A 3MQTA 3TCSA 2WMJA 3SN0A 3FJLA 1K1DA 2X7WA 3P8IA 3A9BA 3EOEA 1T0OA 4XK2A 4KFNA 3B04A 2YW4A 2PDGA 5CPLA 4Q8TA 4H04A 1R3VA 3OBAA 4MOZA 2DP3A 3GG8A 3NOYA 2NQLA 3UFYA 4M7SA 5CSRA 4EPDC 1EH9A 1U1JA 4O10A 1D2KA 4IP7A 1M7PA 4MB4A 9XIAA 1R7OA 4GUJA 2G8ZA 1TV3A 4HN8A 4WRHA 4GIAA 1QPNA 3GLCA 3DHPA 4UQDA 4EP8C 1P7TA 1QHPA 2DORA 5JH2A 2ZX6A 2Z29A 5CLTA 1UBPC 1GHSA 3WLNA 3DH7A 1Z44A 1W2PA 4DJDC 3QJAA 3B8SA 3QPEA 2Z0IA 2PDWA 1ZBVA 1TJRA 3L21A 2XFRA 3MI6A 2X8RA 1SJDA 4V1YA 3VDCA 2BGNE 2OXNA 1K8CA 4P7QA 1CGXA 2FHCA 2P53A 2XVNA 2ZE0A 1M5WA 2OO0A 1MRQA 3T6CA 3VNYA 2VFGA 1KC7A 4UCGA 1LT7A 3LA4A 4FXSA 2CESA 4TVUA 3OZOA 4QDPA 5C8BB 3FOKA 4LS2A 1V02E 4Z1CA 3URNA 3CV1A 4X2PA 3TIMA 4OIFA 2E25A 1DJGA 3MKCA 2PGEA 1LOQA 3SGGA 1FWHC 1JYXA 4CQDA 1VFUA 4XX6A 3MI2A 3G77A 3POHA 5D03A 4IGMA 2QCDB 1OFOA 3ABZA 3K4DA 4WSKA 4EVZA 3KCOA 5ENLA 4Y7EA 3KBWA 2B7NA 2G3FA 3D6NA 2R9RA 1HJUA 1E3ZA 4FPSA 3DAQA 4M6PA 4XSLA 4AAJA 1OG6A 3HG5A 4UNKA 1HGWA 2QPSA 2FGLA 1SJAA 3HGOA 3C0LA 2H9AA 5E70A 2R82A 4C6BA 1JPDX 2WVVB 4RR4A 3M4HA 1I2RA 3M0KA 2VENA 4QGCA 3UERA 2JALA 3C5QA 3VUPA 3D5HA 4PMJA 1ONXA 5AHEA 2YL9A 2VOMA 1XI3A 4I5RA 3N4EA 4F0LA 4LSBA 3E5BA 2DV0A 4K1WA 3BW2A 2EAWA 2WVTA 2OZ8A 3IAPA 3ZSSA 3INPA 4UMCA 4IM4A 1V02A 1KXVA 4Z2HA 2WVSA 4G1NA 4BQ5A 4DJEC 1BEUA 3UJRA 3RCYA 3IRSA 4H9YA 1AW2A 4LYPA 4GVFA 4IPJA 6REQB 5CSUA 3VINA 2CBIA 4US5D 1R5YA 4FOKA 3HQOA 1ZBWA 2QW5A 3B9EA 4A6GA 5KZMA 1ZP3A 1YRRA 1B31A 1RLCL 4WXZA 1SFJA 5AVNA 4BI7A 4IISA 4TO8A 5CPNA 5G1TA 1JR1A 3W1RA 1CB2A 1G7VA 2VZTA 4JTTA 2P3ZA 2Y8KA 1TX2A 1KRCC 3G8RA 3RHGA 2CERA 3ZVHA 1REQA 3T7VA 1VKFA 4NSBA 2XINA 3B0VC 1DTUA 3L4TA 3ITYA 2WKGA 1LZOA 3WK1A 1TWIA 3VVGA 3I3BA 3B4YA 3OHMB 2YA1A 4NZ3A 2VEKA 1NQ6A 4TUFA 1CGWA 3TOYA 3E0LA 4AFYA 4QLJA 5FD0A 1CI1A 3PZUA 4XAGA 4ZBCA 1E3XA 4UTTA 4R27A 3RO8A 1JZ4A 3PPHA 4GIYA 5CLWA 1C29A 1ICPA 5TNVA 4NNBA 1K03A 2ACUA 3B8VA 3A4XA 2CU0A 3NQCA 5XIAA 2V5KA 5FJJA 3NURA 2WMGA 1Y0EA 1NQKA 4R85A 3UWZA 3WH5A 3CUJA 3GNDA 4HD5A 1XPYA 4Q7IA 3AHYA 1WZLA 8XIMA 2HE8A 3UYIA 2QCCA 1W3JA 3FJ4A 4HK5A 3S1UA 5A2BA 2A7PA 4AWSA 2NXGA 2LLEA 5KINA 1G5AA 2J6XA 1GVEA 2O9PA 3THCA 4D1IA 1GNXA 1SFLA 4WGHA 3WQVA 4NY2A 2Z7KA 3BAKA 3STFA 2OO6A 1LROA 1S1PA 4DELA 2WSRA 2CW6A 1E51A 1JCTA 4NL1A 1OWQA 4XZWA 1TUXA 1FCBA 5A6LA 3JW7A 3HQPA 7CGTA 1XYMA 4BHYA 3C4UA 2WYSA 4IIGA 1FWNA 3PBMA 4I5UA 3GNPA 1OINA 3L9CA 1JAKA 1ITUA 1ZCOA 4Q8VA 4HMEA 3LPGA 4GO8A 4F2BA 5J04A 2TRSA 1H50A 1TPEA 2NXHA 3LY0A 1R3WA 3KWSA 5D8ZA 1JZ6A 1TR9A 2GGJA 3QR3A 3KHDA 4CN1A 1CBGA 2WKLA 4AD2A 2MANA 1SO6A 4W88A 3R0DA 2NT1A 3EX2A 1YHTA 1OFEA 4CNOA 2Z1BA 1TJ2A 1KRAC 4GBUA 1PZ0A 3KUMA 4CQ8A 3KVMA 1W32A 2WC7A 3WFAA 1WYIA 1BRLA 2HBVA 1FWCC 2RUSA 5I06A 3LXAA 3MB9A 1VPQA 4J3XA 3B97A 3SIZA 1YTDA 1KQYA 1GT8A 3PPGA 1MUMA 2E5BA 3BSHA 4NF7A 3TFXA 7TAAA 1ZP4A 1F6YA 5E09A 1BSLA 3VDAA 1OFAA 1V6UA 1PCWA 2C19A 3UY8A 3FYPA 1R2SA 1YDYA 5CZJA 1V3HA 4ORMA 2OSXA 3KL3A 4XKYA 3TYAA 3IRDA 1R46A 1Y5WA 2ZUVA 3M64A 1LG1A 1UIPA 3QGAC 2PDFA 4A29A 1EZ2A 4NAEB 1HJQA 1GVYA 4H8VA 3WLSA 3IEBA 4D6GA 3HG3A 4P5UA 1AMKA 1RJQA 2V68A 3BE7A 3NFUA 3RLVA 2XVPA 1R85A 1WKYA 2XN0A 4HMCA 4Q33A 3JS3A 4QHRA 3FA3A 1QXLA 5IBXA 2DUAA 4CNSA 2DSWA 3N12A 3VE9A 3BUVA 3HPAA 2D2OA 1ZBKA 3PTMA 3L0KA 3GSMA 1RP8A 3WLQA 3LCXA 2DW7A 2WCSA 2PDMA 1E71M 4M81A 1B2YA 1OCQA 4KF1A 5C70A 2ABAA 1WNOA 4TMBA 1GKRA 2QJJA 2V5BA 3HG2A 3W74A 1KV8A 4GD0A 4DYJA 3LU2A 2PPGA 4FR1A 2V82A 4MYXA 3V3WA 5EBAA 3KZSA 4IUGA 4UBPC 1E9YB 1F2JA 1EF3A 1WO2A 3QSTA 2CZDA 2J8GA 3VMNA 1T40A 3GFYA 3WFLA 3UXAA 4JIHA 1JZ3A 3KRUA 1Z3NA 1ZJIA 4L4MA 2UY2A 3VIFA 4CEUC 3VU2A 3ZT6A 3RRAA 2X0HA 1ME9A 1SO4A 2WJDA 4PTXA 2Z26A 3LS9A 3VNMA 3VUSA 1IT7A 1W1VA 3KRBA 3QF0A 1XQLA 2OPJA 2Z7GA 4IFKA 1ELSA 5AY7A 1J2BA 1GKPA 4IGNA 2Z2AA 3EDEA 3ARVA 4JTHA 1H1ZA 2DFAA 3OGRA 3RGTA 2AKZA 3CLMA 2YA2A 1W1TA 2E77A 4ATLA 3MCOA 1RVKA 1SZRA 4LQ1A 4NAFA 1OYBA 3MYPA 1LOLA 5HK4A 3BAWA 2ZTKA 1WDWA 2VX6A 3B8IA 2XVLA 2JKAA 3S5NA 4OE7A 2CKSA 3CO4A 1SW7A 1UH4A 1C92A 1I6NA 5I3FA 2J75A 3AXXA 2CBVA 1Q7MA 3PJXA 3DEQA 3QC0A 4Q4SA 2Q8ZA 5JU6A 3B05A 2XGIA 3HQNA 3EB2A 1B3YA 7TIMA 1EP3A 4IJRA 5EPDA 1BG4A 1FCUA 2WNNA 2PDIA 3ZR5A 2I5GA 5T8GA 2HPIA 4WGXA 4B91A 4FSAA 4YNGA 3TH6A 1LRNA 1A49A 3RM8A 1CW2A 3BSGA 1MXGA 4FB7A 2DPEA 1NAL1 3FYYA 2V3EA 4OVXA 1D3CA 1GOMA 1H7RA 4A8IA 2J13A 3AMDA 1FWTA 6ALDA 3E38A 1UUQA 1THFD 3ZWTA 5CSYA 2BGQA 2ZUMA 3TWAA 1TWSA 2OSWA 3EWYA 3BK0A 1V7AA 2Y70A 1J0ZA 1FXQA 1V3LA 2DGAA 3UR5A 1GTHA 1I2OA 2IKHA 3RJYA 4AD0A 2WHKA 2BOGX 1QOPA 1X98A 3IJLA 3KBJA 4M82A 4CN4A 1KB3A 4OOUA 3LHZA 1DE6A 5FJUA 2FTYA 4P8UA 2X1UA 4WKHA 3VNIA 2EKCA 4PYSA 1ICSA 1X97A 3WENA 2OYKA 1IXQA 4O1CA 3S42A 3VOJA 1GOKA 4GZIA 2HROA 3RMJA 2PP1A 4XUGA 1JVNA 4O0QA 3W7HA 1LT8A 1Q4WA 3KP0A 3VE7A 2BXVA 1VEOA 2O9RA 3SCNA 4MTVA 1QUMA 3ITLA 3DBNA 1J0HA 2V3DA 3H2MA 5I3GA 3M0HA 2VZVA 2B7PA 4NAEA 1QI3A 2XSBA 3O6YX 4RZ5A 1KGXA 2J66A 3F4NA 4GGHA 3GU9A 4E2DA 5BRPA 2EGZA 2IKJA 1GYMA 3DKLA 3OPSA 2FB3A 3COTA 2GLKA 3WDQA 4HTYA 4K1GA 2XIBA 3WEMA 4DM1A 5CG0A 2A1YA 2ZOXA 1KFJA 3L4YA 4HYRA 1QWKA 4HJWA 3EOLA 1J6OA 1LRQA 1TTPA 2IUZA 2D1ZA 3GK0A 4LCRA 2YDSA 3GXNA 3EB3A 2WMHA 4AZCA 3C0JA 4L4PA 1AD1A 4H41A 3H4XA 3A13A 1PZ3A 4NIRA 4PSPA 4CKQA 3CH9A 1T99A 3AUOA 1UZ4A 1V6TA 1UIOA 4PE8A 1JUEA 2Y24A 3WO8A 1RBLA 3MDWA 3BDKA 5T26A 1DEDA 3RR1A 3BMVA 4LTSA 4W7WA 3L2MA 1R3QA 1YX1A 2HRWA 4X9SA 4CD7A 3KTSA 4L61A 2A6NA 3GR8A 4ZR8A 3SGZA 3WLLA 2I1OA 2IKGA 5D30A 1NOUA 4QNEA 3W82A 2W62A 2CLHA 4F0RA 4V15A 4CCDA 4XTIA 3S5ZA 4HCLA 1FWGC 2W9MA 4C6QA 1WKEA 3LLXA 1LWIA 1V08A 3GTHA 4DNMA 3N6QA 3T8QA 2R1NA 3CBWA 1TJ1A 3EWUA 1KBKA 1XLBA 3WSUA 3I10A 1VBHA 2ZC1A 2ZQ0A 4JQ4A 3V0UA 1HFBA 1BG9A 1CGVA 1W9DM 1H1NA 4GXMA 4XO7A 2G0WA 5D2YA 3MANA 3THQA 4K7YA 1BSIA 4KRUA 4JCLA 4PUWA 4MPQA 2QQ6A 2CZEA 3XISA 4PL2A 3ABQA 1Q7ZA 1J0IA 1J11A 5HAOA 3BW4A 3KW3A 4P7LA 4Y96A 2FFIA 2WSPA 2BOFX 5D38A 1G1YA 1XHGA 2AAAA 3O16A 1FWEC 4BCEA 5A6AA 2D3NA 3LUTA 3ALFA 1I0DA 5ECVA 2W66A 4NZCA 4HOWA 3CHFA 1A80A 5BOFA 3BOLA 4FX7A 2FKPA 1KFEA 3LRMA 4QCFA 3ZT5A 3N2OA 4DXKA 2OQYA 2PDHA 2P0OA 1U22A 4PUKA 4IIEA 1QJWA 1E6QM 5GNYA 5KSWA 4HJFA 4JBRA 2VEIA 2YBVA 2EBNA 2O9TA 1UKOA 2F2HA 2NX3A 4B2DA 5DELA 1KCLA 4YXGA 4LAOA 2VC5A 3M16A 2OLAA 2ISDA 3IUHA 3FEQA 2E0PA 4OECA 5H1WA 3VD7A 5A8NA 2F6XA 2Y7DA 3PFRA 4HYVA 4AB4A 1GJPA 5B80A 1F3XA 3Q58A 2FPYA 1KFKA 3TDFA 4BQ4A 3H70A 1SPQA 3DENA 4U5KA 5KITA 4L1GA 2BVWA 5I77A 3NO5A 4O54A 3U8GA 2QYGA 2QPXA 1IEIA 4I9AA 3UJ2A 3MY9A 3C56A 5DO8A 2G50A 2VT0A 3DX5A 1OG0A 4KCWA 3MUXA 3G0XA 3PAJA 3RN6A 1F8MA 1QW7A 3TN3A 4OTKA 4HPHA 5DMYA 3DC0A 4QS6A 5E5CA 5LNSA 5C6MA 3LGEA 1VRXA 4UTWC 4DUWA 3WYZA 3GXFA 3UNDA 1EWDA 1T96A 2JGQA 2PBGA 3AIUA 4F0SA 3K1DA 2HV5A 3CV2A 1E6SM 3UPBA 3LNPA 1UP0A 3GXPA 5HMSA 2RJHA 3PPCA 2INZA 1CIUA 4Q3MA 3V16A 2DQXA 1WXYA 2POZA 4FA3A 3U2CA 2AQVA 2PDBA 1RJRA 3GG7A 4LVGA 4MZ8A 1VHCA 3CHEA 3ARUA 4CD6A 1LQ2A 2WBGA 4UNIA 1KM0A 2J79A 1W3IA 3L2IA 1U5JA 1F8IA 3PJWA 3FJ6A 3S4TA 3S6OA 4UTMA 3N4FA 2A4AA 1IEWA 3VYLA 1IZCA 2YFOA 2XWDA 3GWQA 1ZENA 4FNSA 3RRXA 4F9JA 4UTJA 3NSXA 2ZRUA 3W72A 1V6YA 2OX1A 1VBGA 2NQHA 3EWDA 4Z2JA 3OLEA 1BAGA 3I6TA 3VNJA 3CTTA 1JCYA 3HV8A 2PDQA 3P2VA 5BXSA 4AYSA 3BSMA 2UZ9A 1X8CA 4MWAD 3TTSA 3N3MA 2VRQA 1L8NA 4FXJA 3A3HA 3LMYA 1DWAM 1FWFC 3GXMA 5I00A 4IH3A 4NZ5A 1DJHA 4CU8A 2JKEA 2GUYA 5CH9A 2DVXA 1P0NA 3CUZA 1XYLA 2WZIA 4QLLA 3UU0A 3U0HA 2XH7A 4GBDA 3H21A 3IGUA 4CQBA 3KP1A 2BY2A 2G41A 1OK4A 4UC5A 1BGGA 1PE1A 3AIVA 1W1YA 1GONA 1J01A 3RR4A 2ZXQA 1MZRA 3AIRA 1WKDA 3LHUA 3BICA 4DBEA 3EPOA 1I2NA 3LZ5A 1MSSA 3CIWA 3RDKA 1YYAA 3OHIA 3W1UA 3OA5A 5DT7A 3GC4A 2J9XA 1V77A 1J12A 1C93A 3WMCA 3SADA 4Y8FA 1TA3A 1HL2A 1RQHA 2Y5EA 4QRNA 3UXDA 3S0CA 1EQPA 4J35A 1FWJC 1W5QA 1XIMA 2Y61A 1VJZA 3WQCA 3AWOA 3L5MA 5DMLA 4PODA 1F61A 3MA8A 1XLFA 2C6QA 1DORA 2FTWA 2FTPA 1TIMA 3GVVA 2XVKA 4MZYA 3LQLA 4RLIA 2GVLA 3OBEA 2VZUA 1DJZA 2VYOA 3QQWA 1POKA 3VCNA 3MKVA 3U4FA 4UTFA 1WXJA 2WMKA 1P5BA 2PWEA 3VIGA 5LNWA 1TJPA 3CB3A 3DHDA 4REQB 3HOJA 4CUCA 3MDUA 3SFWA 1OD8A 1VFMA 4B5TA 4DX3A 3ZYZA 1NSJA 4FNPA 2VDGA 3FKKA 4TMCA 3QZ6A 3K5XA 1PHWA 3UNTA 3CIVA 4ZEPA 4FIRA 2KX9A 3W29A 1O68A 2TMDA 2J7BA 2Q71A 1MFUA 1EIBA 1QDSA 3ATYA 3R4IA 1GW1A 3U6WA 2RJGA 3DG7A 1IEXA 5AOUA 3T4CA 4H8HA 2QZRA 4J4KA 1M41A 3GO2A 5HQLA 4O8RA 1FWSA 4DWSD 1CCWB 2ZFAA 4ZFMA 3QC3A 2J6VA 3ES8A 4UTIA 1W3LA 4PUUA 1L6WA 4NZJA 2ZX9A 4JX5A 4GMEA 3S1XA 2HTMA 2JGYA 2FH6A 1XLHA 2DT1A 3SUWA 3NUKA 4ICNA 3NYDA 2XIJA 3VZXA 3GZAA 2ZE3A 1ZPTA 5DANA 2V5LA 3AFBA 4GJIA 5EYWA 1KGUA 1YEYA 4L4LA 3QKEA 4DYKA 3P67A 4WHBA 3W1LA 4QSHA 1G67A 1I0BA 1NDWA 1W3KA 4RZBA 3TOPA 4MWAC 3W85A 4WOQA 4E3VA 1EC9A 3DYOA 1JCNA 1US0A 5C5YA 3CAQA 3H55A 1ZY9A 3S2NA 1HKKA 3T09A 3DFHA 2FJKA 1VYPX 1CNVA 2Q09A 4GYKA 3U3HA 1UA3A 2ISVA 4X63A 1H0GA 3HBLA 3AMLA 3LCGA 4WKFA 1WKFA 4FMVA 3UXIA 2PDPA 2V81A 1MEHA 4RE2A 4XUYA 3EX6A 3BGAA 3WF4A 1OCJA 2DJLA 3K30A 3KAOA 2RAGA 2OB3A 2Z00A 3LV5A 3O05A 4IPLA 3PG8A 2BMBA 4LANA 5DY2A 2XTKA 1VPYA 3AXKA 4WJEA 3GQYA 3B9AA 1R6WA 4H8UA 5FF0A 3KLKA 5FF4A 5AYBA 4AISA 3C2OA 1OZQA 3VKAA 1L2QA 3L4UA 5C2GA 3C8NA 2DSUA 1XIIA 4MUZA 1RUSA 4O0ZA 2JKPA 1C3FA 2QKFA 3FJNA 5LYRA 4G6CA 3SY8A 1W8GA 1A53A 2RGLA 4JIPA 4JD4A 3PZNA 3VTRA 1R38A 1AODA 2R6OA 4PTWA 3G22A 3II1A 1EDTA 4WD0A 1N8FA 4LXFA 2Q01A 4CCCA 3UWVA 1E1EA 1IWBA 3N29A 1CZ1A 1J9YA 4YVVA 1ZU8A 4HU4A 3TJ4A 4O19A 4MWAB 3EGJA 3SRHA 3SSJA 2PWFA 1PPIA 2BVDA 3R13A 4H3DA 4LNYA 4Q8MA 4GA8A 3BLFA 2WSKA 4BF7A 1MWOA 3FXYA 3UZYA 4TVDA 5CGMA 1R7AA 3GG0A 3DUGA 4KESA 3MCNA 4Z1AA 1XIBA 3I4EA 3E0WA 2FQIA 4AF0B 3BURA 1W5MA 3RPTA 3P81A 1PHQA 1RA5A 1K7EA 2DU2A 3H2OA 4WY0A 4YCPA 1S5MA 4RXFA 5FF3A 4CNUA 4JTUA 2XH0A 4WJXA 3XIMA 4H6QA 4MB3A 3LMZA 3CZJA 3U48A 5CQ1A 1NFBA 3WUGA 4JTIA 4AD5A 2QPUA 2WJZA 3IJIA 1NFGA 3NQ2A 1QTWA 3B8WA 4GNJA 3W76A 3QGKC 4ZTYA 2F7FA 7XIMA 2QMJA 3TW6A 4A8LA 1BYDA 4QE4A 1GYNA 3NTYA 1HGYA 3VKJA 2X41A 2VC9A 5GJPA 1BWKA 4M29A 4NX0A 1UH2A 4MVAA 4EOUA 1QBBA 4OBSA 3QPYA 3PBYA 4PN2A 4O57A 3GFZA 1CLXA 3FNDA 3WBXA 1BLIA 3BVJA 3QQ0A 4GYJA 5IM51 4M6VA 2V5JA 3TW7A 1J0KA 3C2EA 1BPLB 2BDQA 3TXZA 2BFGA 4IXXA 3EOSA 4LH8A 4DN1A 4H9TA 4IWWA 2G4JA 3CUIA 3OZMA 4OV9A 3QKZA 1E5JA 2C1GA 2W79A 3NG3A 2XJ7A 1BYCA 1RA0A 1XL9A 4YPJA 1HKMA 1I8JA 1SSGA 1TG7A 2WZHA 1AZ1A 4ASTA 2OTDA 4RV8A 1KM1A 4IHCA 2G3JA 2WMIA 5FAGA 4XZMX 1EJXC 3TSBA 1TJ0A 1GCYA 2NUWA 3P5ZA 1VLWA 2BB0A 4Z1YA 1XYCA 4JKMA 3W28A 3WBWA 3CYVA 3P3BA 4RJEA 3OVPA 4OU1A 1QMLA 5KZ6A 1QNVA 1LJYA 1E6PA 1I1XA 4AQLA 4D6FA 3TNBA 1JYVA 3E96A 5D4YA 3VNDA 4NI8A 3M5XA 1TV2A 3W7RA 3LHYA 2ZWYA 4NJHA 1B90A 1J5TA 2Y8UA 2JF6A 1D9EA 1YBQA 2H90A 1BWLA 1ZRQA 1A0CA 1OSEA 5GQBA 3T42A 3RLGA 5XINA 3C3UA 4WSHA 4GVIA 4MWAE 5EMYA 4CVUA 3ITGA 4AZBA 3BPWA 4KWVA 1SZGA 4RW3A 4AHPA 3SSZA 4JY8A 3KBMA 2VC6A 4C6PA 2J8TA 1H60A 1KD0A 1A5NC 1PBGA 1U83A 2REQB 2V67A 3TWBA 2PDUA 4Z1DA 3UWWA 4KETA 1O12A 1I60A 3KOFA 3H8AA 2NVAA 1IIGA 5D2VA 4NQ1A 4HGXA 3W7OA 2ZA3A 2YCLA 3I3DA 2YLAA 1J5SA 1KXHA 3A5VA 5E6YA 3I6RA 1H5VA 1UZHA 1JGIA 3QY6A 1OF6A 2WC4A 2PU1A 3NIYA 2CLPA 2HWGA 4RZ6A 5A3HA 4KRZA 3VOHA 3T78A 2VR4A 4WY0F 1R2RA 1SM9A 2OCZA 1UP3A 3LHWA 4E8CA 1XSKA 4MG4A 1PYMA 1EEPA 1GQJA 1GVSA 3H12A 4PCNA 2GGHA 4H8NA 2OVLA 2O7SA 1E15A 3M0YA 1FCQA 1JXKA 2PGFA 3BG5A 3FK4A 1KR1A 3GZ3A 2WHJA 1JGMA 1CXKA 4N4PA 1XRVA 3RU8X 4I5XA 1XC6A 5FJRA 1SW0A 2OT1A 1VS1A 3BO9A 4FZIA 5DRIA 3QR0A 3GHRA 2CITA 1JIBA 3M41A 1DWJM 2QV4A 2WPGA 2CHRA 2NQJA 4H9ZA 3DFQA 2WB5A 2XM2A 2B4GA 2B81A 3HV9A 3EWBX 3IGXA 3WQWA 5BROA 2DZWA 3WQEA 5MHBA 2OT0A 1O5KA 3ERPA 4BI6A 1C9WA 4DUOA 2BZNA 3ARXA 1TMQA 2BHUA 1LUCB 3UJFA 3S1WA 1ZGDA 3CUHA 3GDMA 4YTRA 3PULA 4ZB2A 1P4CA 2GVEA 1JZ2A 3O3RA 4HSOA 2P3EA 1FFRA 4CNPA 2PLMA 1KWKA 3WZ0E 3GC2A 3AMCA 3PZIA 3KRSA 5F2MA 5D05A 4XAYA 3NPVA 3QLLA 2OLSA 2Y85A 4JN6A 2PDKA 3KDNA 1ECQA 4MKNA 1N82A 3NQAA 3WELA 1UMYA 5FOOA 3UWEA 2INFA 2G97A 1NJJA 3OLGA 3S6TA 3VOCA 1U1UA 3EKLA 4L56A 3T1GA 3QRHA 5ABFA 1V0KA 1A50A 4JFTA 2WZMA 4GHRA 3EDFA 3RF9A 4UFHA 3WBEA 2W27A 3IGSA 1GTEA 5AKQA 3VGDA 5C9XA 1A5BA 3MP3A 1E4LA 1QCWA 2INEA 3W1MA 2PDJA 3PS7A 4JXCA 3PWGA 1XPGA 3CPRA 1G94A 3E3HA 1EC8A 3UZ5A 1O5RA 2OWXA 3CXOA 3PPFA 2Q8XA 1WDDA 4FI4A 4GQBA 1RZMA 2UY4A 1IQ8A 3QEZA 4BWLC 2GSJA 3JRKA 5A8MA 3PG9A 3DYPA 4OV4A 3VKDA 3TQPA 1IWPA 3EEGA 2I16A 1VF8A 3VCCA 5FKYA 5TQLA 1QW9A 2XN1A 2L5HA 4ALDA 1T7LA 1KBJA 4I3GA 3WLPA 5TD4A 1GPWA 4CQCA 3B9DA 4J7RA 2DVTA 3ZMRA 5LSMA 2F6KA 4DWSA 2W92A 3OZPA 3LOTA 3W4RA 1ZAJA 4LV9A 2GUBA 3WUFA 1AK5A 2RDXA 3NZ1A 3GVWA 4ADSA 2PUZA 2YIHA 3F7JA 4RW5A 1QK2A 1AUSL 5EMJA 3MMDA 5DXXA 5AFDA 2ZUNA 2X0YA 2PURA 5I0DA 2VDHA 1ZAHA 4GJ1A 4K39A 4HK6A 3ISIX 2RGMA 3A4JA 3AALA 2FDMA 1CXEA 1H5YA 3N15A 2QJHA 3H24A 1EA9C 1LL4A 2BHYA 4Z0SA 3FGCA 3ICJA 4V33A 3REQB 4GXPA 1R30A 2UWFA 1PSCA 1V6VA 4JTJA 1RD6A 1TPVA 4QXIA 4KIRA 1IT8A 1BVNP 3TZNA 3BAJA 4LAZA 4B5VA 4LT9A 1E1CA 3W1NA 2V30A 1FBAA 3CIXA 4ZQOA 1JZ7A 2V2CA 3T40A 4HNOA 4YTUA 4QX4A 1O7AA 2DZXA 3USZA 1G9HA 2PLCA 5AVHA 2F2KA 1OX5A 3AIWA 4S39A 3HIJA 3HM7A 7ENLA 1UWUA 2A3HA 2PDCA 3GNOA 4UMBA 1MW1A 1X6NA 1LF1A 1GJWA 4YN5A 2ZZ5A 3BZGA 3A12A 2Z6JA 4E6MA 3QOKA 3TP4A 3CHDA 1XUUA 5DF0A 7A3HA 1Z7AA 1DQWA 5C7HA 4HMDA 1EB3A 3DYMA 5AC8A 4BFAA 4GVGA 1TREA 4F0HA 3NWRA 3K8LA 2XG9A 5A94A 2R1PA 2GFTA 3CGTA 4GACA 3R79A 2OZ0A 3C61A 3UZXA 3CHCA 5BXTA 2JEPA 5BMXA 3ZSTA 3ABOA 4C6LA 2DVUA 2CXEA 1M53A 3GTXA 3WLTA 3OGSA 1E6XM 3P60A 4Q8PA 3BGGA 3T2QA 3G1AA 1MXDA 2G3NA 4HN4A 2DUZA 2AMXA 1UR9A 3QVQA 1NM9A 2FMNA 1NF0A 2FH8A 5BCAA 3STPA 4CU7A 1DWIM 4C6JA 3DESA 3IARA 3N73A 3VX1A 3WD1A 3GAKA 4LC8A 5DRCA 1X8FA 2E7FA 1BKSA 3GVGA 3B3DA 4NJIA 5ABGA 3PJUA 3SUVA 1H7XA 3G6MA 1UROA 4PTVA 3O06A 1GQKA 2AQWA 1HKJA 4OHQA 3GU2A 1K02A 3EB4A 3HPZA 5REQB 1EC7A 3CT2A 1PX8A 1W1PA 3CM4A 3NDOA 4TV5A 1TQXA 3A5FA 3N34A 4P61A 1DJYA 4XKMA 3UT0A 4HSNA 3N18A 4JNMA 1D7KA 2J9ZA 3PC0A 3V1HA 6XIMA 1XQKA 3WQOA 1P1XA 1XICA 3T0AA 5EBUA 2BY3A 5F4SA 3AUJA 1C8XA 3KEHA 4DPPA 3LTYA 1FHUA 2CLMA 3GY1A 3L23A 8TIMA 4LVFA 1Q5MA 4RCXA 3MHFA 4TX9A 2ZDRA 4O16A 1HO4A 1OY0A 3GU1A 1ZLPA 4A3UA 3BLIA 5FIPA 4EIVA 1DXFA 2VO5A 1X1ZA 2Y1HA 3HFTA 3TKFA 2QIIA 5BWFA 2ZRWA 3A3WA 3G5EA 2HNEA 3KBNA 4DPQA 1WE5A 4FLSA 1XG3A 1S3HA 4HNTA 4WUIA 1D8CA 4GWEA 3KBSA 1EWEA 2FZNA 4QS5A 3IIXA 2VJXA 4EX4A 4DXVA 1OZMA 1IHIA 4ACZB 3AYTA 1HL9A 3SRKA 3H2CA 3LERA 1XLDA 1XRFA 4PCTA 1UD8A 3MVTA 4JN8A 1UPMB 3TU9A 1H62A 2FDSA 3IJQA 1MMFA 2PAJA 4IIFA 2XDFA 4CNNA 3PWAA 3ONBA 2YGYA 4FNRA 3SJ3A 4C60A 1FHVA 9CGTA 2RDWA 4B9YA 1Q2SA 4S3GA 4AZ6A 2DH2A 4M51A 4MPKA 4E38A 3S47A 3MSRA 4A3RA 1TYGA 2P76A 4QG8A 4TR9A 1UW9A 5D2XA 1TRDA 3AHVA 4PUNA 3TVAA 3NR0A 3HPXA 1XISA 1DIKA 2HDJA 1XDJA 2VEFA 1W8SA 5D2TA 1RJPA 5F2LA 5KMYA 3DC8A 2Y88A 3U2ZA 1O66A 2J7FA 1TVLA 2GSHA 2NWSA 4DZHA 1QVBA 3IPWA 4HA1A 3BARA 3AXIA 1L6FA 3VDGA 3CNYA 1B3XA 4YU1A 3W2LA 3WNKA 3UEQA 2XU2A 1Z9AA 5E0FA 1HJWA 4GXWA 1QI2A 1C91A 1PDYA 2B7QA 1Q8AA 3HMCA 2DT2A 4WX2A 3QV8A 5DN1A 1JZ8A 1PKYA 6XIAA 3O8AA 4Y2WA 2UBPC 5SWUA 3ZFHA 2QT3A 1M1BA 5HJYA 5CEWA 3T8LA 2R94A 4V2XA 1UA7A 3W7EA 2GVGA 2V5CA 3IVSA 1KFCA 5D8WA 1JZ5A 3H7RA 5FL0A 4GCAA 1KFLA 3HFYA 5AHLA 3W9ZA 3MUY1 3TJLA 4MLRA 2XISA 3EAUA 1LL7A 4YJ5A 3QTPA 4HP5A 3BXWA 4IXHA 3KOZA 2VQTA 1VGAA 2E6YA 3T4WA 4JTDA 1EHAA 3DG6A 3KZPA 3SCQA 1OX4A 5AC5A 3H26A 2E6DA 2XSXA 2FZ8A 1LWJA 3M0XA 1NOFA 1TE1A 1YXYA 4HNVA 2GDVA 3W24A 1TCDA 4LUSB 4S3DA 2DSVA 3FHAA 1F74A 3LN3A 1SZEA 1E40A 1G4TA 3QMRA 1OIMA 4KERA 3GTNA 3W83A 5RUBA 2NVDA 1X6UA 3H2AA 2PE4A 1VFSA 3PSVA 3BLKA 1BGAA 1ZAIA 4D8LA 4YMZA 2NLIA 1UWQA 3OVRA 1MUCA 2C7FA 5LHFA 1UC5A 4A4AA 4PMZA 3M0VA 2G37A 3U2OA 4NILA 2JIWA 4GISA 1CENA 3MV11 3M9YA 3CQIA 3EX3A 3W02A 1EJRC 1JPKA 1SMAA 1O6IA 5LA1A 4K8GA 1BVZA 2NW0A 2QNEA 1LLZA 5IDZA 4BF9A 1XBXA 3LYEA 3S83A 1GOWA 4HHHA 3EWCA 1HJXA 1UOKA 2VR5A 1A4LA 2BHZA 2I57A 3L0GA 2A2IA 1TPUA 4DXXA 3EKGA 4N4QA 4F9DA 5C2XA 4K6AA 1GQLA 4F3HA 1R3TA 4JGDA 4C1LA 4IGHA 1H11A 3POCA 4S3KA 2HXTA 3BTNA 4AHOA 4XBJA 4Y8EA 1LBMA 2QCFA 1PVNA 2BY0A 5FAJA 4URIA 3SN4A 1EYWA 4D6EA 1A4MA 4HZ7A 1W5NA 1H7PA 4G9PA 1A3XA 4IZGA 4LUTB 3VIMA 2J7EA 1OHLA 1UC4A 4AXNA 1GYLA 4YVPA 4PB5A 3TTEA 3MP4A 5G1YA 1VBRA 4IP5A 5A8PA 1RP9A 1IXOA 1AW1A 3T2OA 2X0SA 2HJPA 1JUBA 7ODCA 3QMSA 3PAOA 3B0UX 3E9AA 4NYUA 1B9ZA 2OELA 3H7UA 4WDTA 2XYLA 1ZBCA 3LV6A 1Q65A 3N14A 3B8TA 2IQ0A 1DYSA 2QJIA 5TAOA 5B7ZA 1RQBA 2VVNA 3FLUA 3NZGA 3DGRA 5M2FX 5C54A 3DGBA 3MUAA 3R8HA 4NI3A 3EXRA 5CPQA 5HBFA 1ODZA 1YTEA 1R87A 1B3ZA 4DJFA 4KFOA 3SY5A 4JTSA 3TV8A 3LENA 2YXGA 2Z1KA 1NDYA 5H8MA 3WLJA 4D6CA 1SVDA 4YTTA 9RUBA 2Q8LA 1FRBA 4UZSA 3BOXA 1E4IA 3TUUA 2VUNA 4YTQA 3CU2A 5LKYA 4PMVA 3HQ1A 3UR8A 3VOIA 3M7SA 3EOUA 3PUOA 2NSXA 1P7TB 1KTCA 1TVPA 1CLVA 5LIYX 3Q4DA 4FLQA 2XSAA 3LCWA 4AMCA 3G1RA 3W38A 4AC7C 1AZ2A 3W1PA 4JICA 2WNWA 1CDGA 4KCUA 1FWRA 1EX5A 2ZZ2A 3UZWA 2I9EA 2VWTA 4JQ2A 2D20A 2FZMA 5B7YA 1TPH1 1UKPA 1Z42A 1ISWA 2ZRYA 4XD4A 3O6CA 4BY3A 2WM1A 4JIRA 1W1A1 4LY8A 4JTCA 2F9RA 1QBAA 1L9WA 1GEQA 1ZJAA 2ZZ4A 3FFSA 2XWEA 1FTXA 4ZOAA 4ZZ9A 4RE3A 4GZJA 4UQCA 3UETA 2RKXA 4KBXA 2H3DA 4S3FA 2Y63A 4AHQA 3R5EA 3IIPA 5G2HA 2E68A 4PULA 2QJNA 2ZZ3A 4UOJA 3B03A 3S9IA 5FJOA 5CCZA 1YADA 2C91A 3TC3A 2VD8A 1W31A 2EEXA 5DBUA 1ZCCA 1XRTA 4NRRA 1SZNA 1VC4A 3LCFA 4Q6JA 5AC4A 1JEZA 1EGMA 3O1NA 4GUIA 4RDVA 1FHDA 1QNRA 2Y7GA 4KPLA 1S1RA 1DIOA 3QGVA 3L0NA 2H9AB 3GNRA 3IV3A 5CXPA 1YDNA 4J1OA 4LW7A 1DQUA 2VP8A 1KM5A 4GJJA 4NJGA 1GEHA 5CZTA 4UTTC 3LLDA 4F79A 1LWHA 4PC8A 3G24A 1BYAA 1I9CB 2VGGA 4J28A 4PMNA 1I2PA 5EL1A 2X09A 2XHYA 1IZJA 2J7HA 3VIKA 5A6BD 1J93A 3EPNA 3WF1A 4XVDA 1O5XA 4LCQA 1JI1A 1R3YA 1TMLA 1AA1B 3W7KA 5I02A 3UZJA 5EB8A 1W3NA 5HR6A 4MJ2A 1OFBA 3WDPP 2A79A 3NPWA 4AD4A 3O6AA 3CL8A 4NJJA 5JIPA 2ZC8A 4JIIX 5A2CA 3PHAA 1PDZA 3FCPA 1E9ZB 5JBFA 5E0CA 2A85A 3WQGA 2HE5A 1M68A 4HKPA 4NZ4A 3B9OA 2ATMA 2ATSA 1GPFA 2X1IA 5HDRA 3N19B 3MUZ1 1JDCA 1RK5A 2GWNA 5JUVA 3VXGA 1DKWA 3G3MA 4KWOA 4E2OA 1FH9A 3QHNA 3WNOA 1CGUA 2WQPA 4U33A 4HPXA 4MUPA 3BL3A 1CYGA 4RNIA 4OBRA 1UASA 5D9PA 4C6OA 1AH4A 3ZLHA 3BLDA 1XW8A 2DIKA 4IFRA 3OP2A 2E9BA 1TFVA 2OSYA 1G4EA 3H4GA 2CXGA 1AQ0A 3ZVHB 1O60A 1REQB 4J9JA 1ME7A 3NQMA 4RV3A 3UD6A 4ICMA 4PMRA 4NJKA 3M5ZA 4GKTA 1ONRA 3BV4A 2PC8A 3GW3A 4CQAA 1KBIA 3KOYA 2V6AA 4UR8A 3NQ6A 1VJSA 3G0UA 5LGXA 2BTMA 1NH6A 4PA8A 4H7CA 1CLKA 1VQTA 2C71A 2PTXA 2WWCA 5LHEA 2AGTA 2Q6ZA 5HXMA 3ECQA 3M0IA 4IX2A 4C91A 1I75A 3IVTA 4BEUA 2RH9A 1PIGA 4MMWA 1H49A 3RK8A 2QR6A 3AS0A 1ZSXA 5G4HC 3LHVA 4FO4A 4M1RA 3TN6A 5DMMA 4XZIA 1TMHA 1EJSC 4GX9A 4LUJA 4R7JA 3DFYA 3HPFA 4D2JA 2ZXBA 1SMDA 4FXFA 2KZHA 3HN3A 1QPOA 2VEPA 5BZAA 2VFIA 2AGKA 1DV7A 3MUCA 5EMMA 1XIFA 5ABHA 2MNRA 1JDAA 1Q45A 1QI4A 2PP0A 2QCHA 4G8TA 4LS1A 1OC5A 3PSWA 1X1NA 2E5DA 3SECA 4Z08A 4FP1A 1D7FA 3BAXA 3IJ9A 3R10A 5A95A 1RPXA 2E8YA 1VZWA 3RCMA 1XYZA 2QDEA 4NT0A 2J7CA 4TTGA 2EPMX 2VGFA 3NL3A 4LJ3A 4N6EA 4C6MA 4QJ3B 3MO4A 3WL0A 3THUA 5IBXC 4WDXA 1ML1A 3CZEA 3RILA 1UR0A 4JTEA 1VB9A 2YDAA 4Y9MA 1VBJA 4QIUA 2E40A 1W91A 1KW1A 5FEXA 2DJXA 3SW6A 4HOXA 2VQUA 3O6DA 4UQEA 4DLFA 3IGHX 1GVOA 1M6JA 1AL7A 1Q6LA 3WUEA 3S5YA 4JEJA 1MQPA 1A5SA 2QEZA 3CMGA 1SSDA 2DZTA 2HISA 2BASA 4LU0A 4POCA 1BRLB 1Q3NA 2RDUA 2Z1VA 1XLLA 2DZAA 4WSJA 3H23A 2J7GA 4EE9A 1HX0A 3VDBA 4M7TA 5D09A 3RIKA 5I78A 1NVMA 3RO6A 1Q6OA 3VGFA 5ABEA 2AOSA 3P93A 1VCGA 3SCWA 1K8YA 4W84A 1G7UA 1SUXA 2IW0A 2CIPA 1OFDA 1EJ7L 1E55A 5J5RA 3O9NA 1GUVA 4ONVA 3B40A 3EXSA 3AXHA 3WK2A 2VM8A 4HIBA 4HPJA 3Q67A 4H1ZA 4XD6A 2PRMA 5I3IA 3VC6A 4K68A 4Z2KA 4AG0A 4Q4OA 3V75A 4XKYB 3ITVA 4DBUA 3E49A 2R1MA 4B3LA 3RM4A 2A3BA 5FL1A 3WQ5A 4C1NA 4WR3A 3ITXA 5BNKA 3LGDA 4MFEA 1FWIC 3EA2A 3NQVA 2VNCA 3HZ3A 2F38A 2WBKA 4RE0A 4B5NA 4C6EA 1YW1A 4XIMA 1IF2A 2O0TA 4EAYA 4AIBA 3R0KA 3CHVA 5AHIA 3CEUA 1ZB5A 5HNUA 4IUOA 3CAWA 3TTQA 2GQ8A 4C90A 3GR7A 2OKOA 2ODOA 4NXKA 4GGBA 3QZAA 2RFGA 2WO5A 1GG1A 6ENLA 3NQEA 1GK8A 1UPPA 2E6AA 2JQXA 3M5YA 2WANA 3E2VA 2OG9A 3DFTA 1AVAA 5IHRA 4B5WA 4GG9A 3E0VA 1KRMA 5CJMA 5HMDA 4A3HA 1UMLA 3WLOA 1ZALA 1RPKA 1H63A 3BGJA 3P8JA 4MDOA 4LAMA 2QHAA 3M44A 3W2KA 3AS1A 2YL8A 1PKNA 1YNQA 4JYEA 5HANA 1WAUA 3VIHA 2V9DA 4HNLA 3W7MA 3LDVA 2PTDA 3TQ0A 3W3OA 4G7EA 4P8WA 1SU5A 1SW3A 3TAOA 2QDGA 3NGJA 2YZ5A 2OOFA 3CASA 1EFZA 5L9FA 3KOXA 3RM9A 3TC6A 1BXNA 4A2RA 3B0YA 2CETA 2ABBA 4EPBC 2PGWA 3NXLA 2WWDA 2PEVA 1WOAA 2YL5A 3C8FA 4CVWA 1WZMA 1E72M 4IFKB 2QIWA 5D37A 5A5WA 1AMYA 4M5PA 1A3HA 3TX9A 4D8ZA 3V4BA 1OCNA 2BXZA 3DI0A 4PMYA 1V3IA 2VCAA 2A0NA 1JYWA 4I9MA 4PZVA 4NAFB 2FJUB 3VMPA 3HTWA 2ZADA 5BU6A 1GJUA 3WMLA 2X40A 3CT7A 4E2BA 3QV7A 1M7JA 3CO8A 2VELA 3PTKA 3SQSA 1EBHA 4S3AA 1XCWA 4B2DD 5PTDA 3JZUA 3SN1A 3F03K 2CBJA 2DH3A 1OIFA 4MADA 5FSDC 4E8DA 4BQ2A 2C8NA 3WBYA 1ICQA 4MM1A 5CPOA 4X61A 1OC6A 3MV01 1OQFA 1VP5A 4AUBA 3H6OA 2Y5SA 5AB3A 1QAPA 1VBUA 3UWYA 1ENUA 4M0XA 2JK2A 3KRZA 4YTSA 1S5NA 4JHZA 1A5UA 3EXTA 1B3VA 4JTLA 5DCDA 2F84A 2PWUA 2BBFA 3W88A 1YPFA 3M43A 4IGSA 4UFMA 4I7WA 4I90A 1NARA 4F8XA 3WEOA 2O4QA 1A5KC 1ISZA 5HJXA 6CGTA 1ALDA 4MNMA 3E6EA 5LIXX 1OC7A 1GHRA 2YZRA 4R88A 2HSAA 1TKKA 4ZE4A 4IT1A 8XIAA 4GIRA 1JRBA 2RDTA 3R25A 1XYAA 2HS8A 2X30A 2VGIA 2XN2A 2V3GA 2CEQA 2OX4A 5EU9A 2ZVRA 2YKKA 4EXQA 1XV8A 1UG6A 3V1PA 3DFSA 5FSEC 3GXTA 4XSMA 1EJVC 1TPC1 1RCOB 1VEPA 4UTKA 3WKZA 3BG9A 2ACSA 3RPMA 4AWEA 4KCTA 2NXIA 3DZ1A 3AO0A 2JEQA 4EK7A 2YYTA 4D72A 3FSTA 3VX0A 1AFSA 4R34A 3GM8A 3R89A 3VD9A 4BEQA 1RK6A 4BI5A 1TPFA 3JZEA 2PS2A 4AY8A 1D3HA 4ENLA 3WD3A 3F2CA 1T41A 5AZ0A 3EMCA 1XGEA 1TCMA 3AOFA 4W93A 5CZSA 4UTLA 3TEVA 1J0YA 1UWIA 3AAMA 3AWNA 4D1JA 1JNEA 4ZFCA 5A6BA 3PWIA 2QGHA 2TYSA 4AZCB 4ZQCA 3A4WA 4ATDA 2FMOA 3UCDA 1K77A 3QH2A 5I2UA 1A3WA 2QXWA 4LYQA 1UUOA 4MLJA 3WDJA 3W22A 2TODA 3MO7A 1EXPA 3GE7A 1W9BM 4FXRA 2ONEA 3C0SA 3STGA 1ECEA 2QAFA 3ITTA 1R0MA 4HMNA 3FAWA 2CBUA 5JQ9A 1MYRA 3QZEA 1PTAA 4P7RA 3UGVA 3GDKA 4O1DA 4UCFA 4AW7A 3ARSA 2HK1A 4JHOA 4N0RA 3PNZA 5F4XA 5HQEA 2NWRA 2ZXAA 4EF9A 4C6KA 1UWAA 5EMKA 3NOEA 4BA0A 2VR2A 4E2VA 4O0KA 3G18A 4CQ9A 1XR2A 3W53A 1NDVA 4KWUA 1MNSA 4KGJA 4R9XA 3FEMA 4QEEA 3A9IA 4JTKA 1UBSA 1CGTA 3PBUA 2EPNA 4KQNA 3TONA 1HTIA 3S8HA 2C13A 2WVUA 1UWTA 4O1AA 3P7YA 1CEOA 4MY1A 4X22A 2XZ7A 1AJ2A 1O95A 3NNTA 1S2TA 3G2GA 3PUDA 1GG0A 1W2VA 4DEFA 1EX1A 2Z27A 3LSBA 2XIOA 2EJAA 4XO6A 3WF0A 1KM2A 1NFPA 1Z8AA 1TELA 3CZGA 1UR4A 2EJ1A 3VGGA 1YE4A 1WXZA 2HXUA 4JS3A 3QSRA 4F0KA 3W7DA 5I23A 4ZO8A 4XB3A 4L6OA 3QOMA 3WLKX 1IGWA 2UY5A 1KM6A 4UOZA 2E67A 2NUYA 5EKYA 5GPRA 1US3A 3DIPA 4F4RA 3P0WA 4QNWA 3W7NA 4MZ1A 1EOMA 3TR9A 4ZB0A 2CCRA 1TUFA 1TZ9A 3IUDA 2A21A 3T07A 4LF2A 3NEHA 3MMTA 4GYPA 4N2YA 2HVOA 5IFTA 2D2HA 3KWXA 3G1DA 3XINA 2ZRXA 5F7UA 1A5LC 1YNPA 2XH4A 3W7QA 2HVNA 3VM7A 3VNLA 3R43A 2OMAA 3R11A 4AIUA 1F6KA 3Q94A 2ALDA 3NA8A 1Y7VA 5I7GA 3UXLA 2Y5JA 4D9PA 3P61A 3QLDA 1EPXA 1WAWA 4HU0A 1V5XA 4L1WA 3R6IA 3WLRA 1S2UA 1FVPA 3A64A 2C0AA 4JTGA 3CUGA 4RXGA 5I79A 4DF0A 1W9VA 4AVNA 4DRSA 2J77A 3W7LA 4BJHA 2OFJA 4Z0JA 1C90A 5D9MA 5AHNA 3I6EA 1HL8A 3C6CA 1XBZA 1L6YA 1C7SA 4NASA 3K8MA 3N1AA 1MDRA 1WBJA 3VKBA 3N17A 3GVRA 4EANA 4RUBA 5H2ZA 4GUHA 3OQEA 4QR6A 4V28A 1J0JA 1HN1A 3AMKA 4KWWA 4P7OA 5CZ0A 2NQZA 3SDOA 3AJXA 3DBPA 1GZJA 3GHSA 3M1ZA 1GGOA 3VIPA 1JD9A 1E9LA 4B3KA 1XYBA 3W23A 1NTHA 2E09A 1P6BA 3E2QA 1K3UA 1MI3A 3BOFA 4Y6GA 4Y9NA 3R8RA 1U30A 4Q8UA 3TMQA 3PZTA 3ZLFA 3E5PA 4PB4A 2WHLA 3UVIA 4U2YA 1BTCA 2VKZG 3BCDA 4NZFA 1H1YA 3VKKA 1OT1A 2CKRA 1UHVA 3IJ8A 4WQ6A 5I09A 5FF2A 5CGTA 1E73M 4DHGA 1SZFA 3IS4A 1QO5A 4ZENA 1NOWA 2GJXA 4A05A 2YXOA 1JCLA 2B0MA 5BOOA 5LA2A 3NYZA 3GAYA 3WDIA 4I9TA 1OGGA 3CB8A 4AEEA 2ZTJA 4AYGA 2Q3OA 4PEEA 2Z1XA 2G95A 2QCGA 1E0WA 3IIVA 3NL6A 1KTBA 1VFFA 4PBGA 2VFDA 2GK1A 1CGYA 1F9CA 2J27A 4BZYA 1OVDA 3VABA 1QI0A 2YFNA 3NO1A 2J8FA 2DT0A 2IXUA 4QE5A 2BP1A 4MY9A 4Q7NA 2PD5A 3OODA 3RJXA 4C65A 1XLEA 4LX4A 5FEWA 1TB3A 2WOQA 1HIZA 3I68A 3LTSA 1QU4A 2BVTA 1KCKA 1E1FA 2DZSA 1C8YA 4J3UA 4ZQPA 4F2UA 3OGVA 4PMOA 1RD5A 1F76A 3G1YA 1GOIA 3IJDA 2R91A 1Y65A 4PUDA 3LM3A 4LGXA 5C71A 1BXCA 1IYXA 1YMYA 3LCIA 3SJNA 4DZ5A 3S1GA 1SJCA 3LCHA 1XKYA 4GX8A 1OADA 1IIHA 3KL5A 2POTA 1FY6A 4D6HA 1ONWA 3WH8A 1EP1A 3VD5A 4GUFA 2PRLA 1LORA 4HCDA 3TSMA 2HZGA 4I8YA 4DB7A 3W27A 1TA3B 4FX6M 2ANUA 1TRIA 1R3RA 1E43A 5M17A 4GE8A 3ZJKA 5G4WA 3FKRA 1IR2A 4HU3A 5J8LA 4L80A 4FS9A 1FWBC 5I3JA 1TVNA 1F05A 4JTAA 2P88A 4L64A 3W1QA 4DAFA 3FVMA 2DSZA 2PZNA 3GDBA 1V51A 3LBOA 3LHTA 4KGLA 3EWXA 1OM0A 4EXAA 1BQGA 1H4PA 5G4EA 2YCIX 3LI1A 1HJVA 2PDNA 4DO5A 3GHUA 2ZXDA 3IIOA 4KRTA 3QR1A 4NHVA 4RPPA 1WUEA 3GDRA 3MCMA 4A3QA 3HO8A 4ZA0A 3U5YA 3C0QA 5J5DA 2VZOA 2V0TA 1DHKA 3PP7A 2H6RA 1WDQA 2Z1SA 4C6CA 3MWAA 5AC6A 4PUEA 2HMCA 3UR7A 3B4UA 4H2CA 3Q65A 3DECA 3RX2A 1XFBA 1XH2A 1FCVA 1R9ZA 4O1EA 3M0LA 5MKGA 1UB3A 4U2ZA 1DBTA 4R7OA 2V63A 1PTGA 1DXEA 1RV8A 5T9CE 5DX7A 2BX7A 2CNCA 2A7NA 4C5ZA 3OIHA 4DAIA 4MDPA 3BZJA 3UBPC 1I1WA 1L6GA 3WF2A 3SM0A 3W6YA 4UOQA 3CQKA 1TPDA 1RALA 3WJZA 1PIFA 1Q6FA 3P84A 2R24A 2BOEX 2GGEA 1A5AA 4MKSA 1E4MM 2X1RA 3WQPA 5HR7A 4LRSA 3LLFA 1LTDA 3W37A 3TYZA 1M7XA 5CC3A 4DO4A 1PS9A 3SRDA 1PWMA 4FALA 3GG1A 4HPNA 3NSMA 1XWYA 1CX9A 1T8XA 4Y90A 4MFDA 2ICSA 1DWHM 2GSEA 4HA0A 1WUFA 4ZQNA 4DZAA 2AL2A 2GZXA 3MMUA 2FLIA 3VI2A 3EDDA 3K4WA 4XBKA 3GS6A 2V3FA 3WH7A 4PMUA 4YYCA 4Q4RA 5CG7A 1K6AA 9XIMA 1Z69A 4JFVA 4TU1A 4QE1A 3UJSA 1MUWA 1Y5XA 3IK4A 3TLQA 1LLOA 3F4VA 3GFXA 3IUIA 4YWSA 5A69A 3MU7A 2D2JA 5C9UA 1XDLA 3DKJA 4QG6A 3AHXA 1V3KA 3BV7A 1V8EA 1WZKA 2VRKA 3K8KA 4PBEA 3M7WA 2NQ9A 4DJED 1XRSA 4GLEA 2FGBA 3GNNA 3ZJ6A 4ML4A 3GTIA 2ADAA 1Q2RA 4TOQA 5HPCA 4J2PA 3GVQA 3NQDA 3KOWA 2C3ZA 2D0HA 4JX4A 4NU7A 4O1BA 5HWMA 3AXMA 2XIQA 4PRWA 2YCJA 2FIQA 1D3GA 2E5CA 2WCAA 1P48A 2DQWA 3WJYA 2FGZA 4FAMA 2NV1A 6TIMA 4AXKA 4AZ7A 3K4AA 3OVQA 4XZ9A 3FDGA 1EP2A 4C7GA 2GQ3A 1H51A 4JX6A 2WKJA 3SI9A 3N2XA 4HTBA 3FSUA 1HXJA 5DCBA 4FNTA 5DFAA 5K4XA 3KVJA 4IOTA 3G3DA 1UD6A 4U3AA 3OTRA 2CLOA 4AH7A 1OD0A 1WDPA 4S2CA 3EMZA 4WK9A 4WEVX 1FP9A 4M8UA 3DFOA 4D6IA 3TA6A 3H54A 2NSOA 3L4XA 5BXRA 1EF2A 2C79A 3CMFA 3OIXA 5AC7A 1CECA 5CAHA 2D69A 5KETA 4CCEA 3LM7A 3OO2A 2ZUTA 3W2UA 1W54A 2IS7A 2CC0A 4WY0B 2BV9A 3NJ3A 2I17A 3W2MA 2GJRA 1SO5A 2PSNA 4WIWA 3MVIA 4LUYA 2JIEA 2PTWA 4KH2A 3GYCA 4O1FA 1XYFA 4IMCA 3PY2A 4EAMA 4O12A 3FAXA 1DP0A 1YPIA 1GVFA 3RNDA 1LRTA 2OYMA 3E74A 2D73A 1UP2A 4XZNX 3MSDA 2PTZA 3N9SA 2QF8A 3ARZA 1GOQA 2XM1A 1JI2A 1X39A 3W26A 4NP7A 4WDWA 3L5AA 3LBCA 3ZR4A 4WXYA 1NU5A 3W2NA 1H2JA 4DVOA 1DPMA 1W3HA 3VD3A 2YCEA 4Z2GA 1TE6A 2QJMA 3GUWA 2O92A 4QTGA 5FESA 5G1MA 1V79A 3TE9A 1K8XA 1OX6A 2HEJA 3W1TA 4G5DA 1GVIA 1ZJBA 3PZVA 1ONEA 3UA3A 4I6KA 2ISFA 1KWGA 1XF0A 1K8ZA 1G69A 2VGBA 4AX7A 3F5JA 3BMWA 1J8VA 3TFCA 2D0FA 1M3UA 2EPHA 4IMFA 2VX7A 4ZCWA 3VKCA 3WJSA 1F4AA 3IK2A 1GW9A 2W91A 1B3WA 4Q4QA 2X1TA 3IANA 3T44A 4QBXA 3NL2A 4UWMA 1W6TA 2WMIB 2YW3A 3ES7A 4MJ4A 3FIGA 5M3WA 2NX9A 3S9YA 4OUIA 1QNOA 3T0BA 2WV8A 1TWDA 2ON3A 4CU6A 1OB0A 3G6LA 4B5UA 1EKOA 4K8HA 1JXJA 3NO3A 1BTMA 1E6RA 2SFPA 4KEZA 1EUNA 2ZRZA 1OF8A 4C7DA 2WK2A 4HZ8A 1VHNA 2FHFA 1QPQA 4GI9A 1ITQA 5IOBA 4GFSA 3ARYA 4JTRA 1MQQA 4IIDA 2CZVA 1YBQB 4JFWA 4D71A 3Q37A 1B3OA 3SEPA 3S2JA 1F3EA 4P8XA 1VCFA 5C9ZA 3UPWA 1GOOA 2JE8A 1JNDA 1R3SA 2GVJA 1FDZA 1A5OC 3DDMA 1DIEA 1KXQA 4FX8A 3URQA 2W5FA 4FLRA 3ZR6A 4GZEA 3O0KA 4OWGA 4WVXA 2ESCA 5JBEA 1ISVA 2A7RA 2OZ3A 2W63A 2DW6A 5FA5A 3TAKA 3CWNA 1FOBA 4ADTA 3LGGA 1RLDA 5HOSA 3BWWA 5BMWA 1Q4NX 4O8AA 4ZOEA 3HB9A 4M6QA 2YCLB 3NQ8A 4JPGA 1HZYA 1O94A 2FZBA 2A5HA 3E02A 4JTQA 3BJSA 1MVYA 3ITOA 2X42A 4ORIA 3DI1A 4IG2B 4JQ3A 4WCJA 2R8WA 2E1DA 1SR9A 4Z2LA 3EYPA 2P8BA 2B31A 4AC1X 2CWNA 2PU0A 1PXGA 2PWHA 3W75A 5LNVA 1F73A 3BQ5A 5FI8A 5IFPA 3PZMA 5EMUA 1W1IE 3TQKA 3OLIA 5XIMA 4WLCA 1IWAA 3AYRA 1Q6EA 1ZZMA 4Z1BA 2ZA1A 1W1B1 3NM1A 1H7NA 4GRSA 3OU8A 5G5IA 1NWSA 4JYFA 4QM1A 3SCSA 4L65A 1VYRA 2XPKA 4B3ZA 3ARWA 4DWSC 1QPKA 2VVSA 4RK8A 1I4NA 4DZIA 2GQ9A 4U5IA 1K6WA 1UH3A 1Q85A 1VFLA 1UUMA 1PEZA 4K2SA 1GOXA 3PJTA 2EPLX 3PN8A 2TPSA 1XSJA 3GH4A 4XZBA 2C1IA 5CPSA 3MYOA 1KO0A 3DXIA 4HNNA 2I5IA 3KL0A 1YNYA 4E4FA 3SUTA 3P14A 2YA0A 1DXIA 1XS2A 3E1F1 5U7SA 2C15A 1FDJA 4X9YA 3UG4A 5ABFB 2QCDA 4LB3A 1R2TA 1XD1A 3ZS4A 3KFTA 3G1HA 4QEHA 2GPTA 1UD4A 4LALA 5LNRA 3V35A 3SCTA 4PFHA 4AD3A 2CPUA 3G1VA 4ACYA 2XGZA 3H7VA 2IPJA 3B8UA 1MFVA 4BQ3A 4ERIA 2A3EA 3WNMA 2OJPA 5D9OA 5HNTA 5DCEA 1P6CA 1XCFA 1JAEA 1P43A 2WVVA 3LCLA 1XP3A 4E3TA 3AIEA 3QHMA 1ESWA 2E28A 4UFKA 5I5RA 2W4XA 3MKKA 4Z2IA 1H61A 2QUTA 1EZWA 5IXEA 2F6UA 2OEMA 1XM3A 3HG4A 1TV8A 3F4DA 2X1SA 4DJDA 1X96A 4DBWA 3RAOA 3NSNA 2D2GA 4IX0A 3CC1A 3WBAA 3WQ6A 1LQAA 5DMNA 3WK0A 1H3GA 1TTQA 2PI6A 1X7FA 4S2BA 1EO5A 2VX5A 3EWWA 3UZZA 3VOFA 5U4NA 4YYFA 3NAVA 1XLMA 2NX1A 4H6EA 2Z25A 3TA9A 3V5FA 4NXSA 4DWSB 3UVAA 2PDLA 4WOZA 2EXOA 4LAUA 3FVDA 1HG3A 4Z42C 1X1OA 1X6LA 3MT1A 2WZEA 6REQA 5JMUA 4PCPA 3GXIA 3CYJA 4Q7BA 3ID7A 3AHTA 1OYCA 1B57A 5EMLA