4IFRA

2.40 angstroms x-ray crystal structure of r239a 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase from pseudomonas fluorescens
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
330
structure length
330
Chain Sequence
PRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGAVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title The power of two: arginine 51 and arginine 239* from a neighboring subunit are essential for catalysis in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 116
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4ifrA00
2O4MA 1WXZA 4GX9A 4RDYA 3KM8A 3IARA 1QXLA 3E74A 4HK5A 2AQVA 1J5SA 3ORWA 2A3LA 1POKA 2R1NA 4INFA 2ANUA 4R88A 4LEFA 4AC7C 2G3FA 3K4WA 2IMRA 4GZ7A 1IE7C 4H9YA 4F0RA 5AKQA 4C6IA 2PGRA 2D2GA 4LH8A 4M51A 1R9ZA 2EG6A 3PANA 2OGJA 4GY7A 4KF1A 4PBFA 1FWBC 4QRNA 3CAKA 4DO7A 2PGFA 1P6BA 3B0XA 4KETA 4RDVA 4XAZA 3RCMA 2GWNA 2PLMA 4G7EB 1RK6A 1V4YA 4QSFA 1S3TC 2Z2AA 4KEZA 2ZC1A 3URAA 3K5XA 3TN4A 1FWEC 4ERGA 4L9XA 2E1WA 2YB1A 3GU1A 4GY0A 3GU9A 3IV8A 4B90A 3TNBA 4H9ZA 1EJSC 4G2DA 1EYWA 4LFYA 1FWCC 1A5LC 3A4JA 3T8LA 3LSCA 3LU2A 3A3WA 4Z42C 1O5RA 1W1IE 1J6PA 4BJHA 5A6TC 3CJPA 2D2JA 5E5CA 4HA0A 4CEXC 3GUWA 3MDUA 3DUGA 3HPAA 4LAKA 3QY8A 1RA0A 3MPGA 3TN3A 3B40A 1PB0A 2Z25A 1J79A 4EP8C 1FWDC 4XD6A 3BE7A 2CZVA 1UBPC 4LAMA 3R0DA 4EPEC 1FWGC 3PBMA 2KAUC 2WJFA 3QGKC 4CEUC 3JZEA 1FWIC 4QROA 2XIOA 3SFWA 1NFGA 4XD4A 4C6KA 4XD3A 2Q09A 2QVNA 4DLMA 4IH3A 4WHBA 4XD5A 3UPMA 3AUOA 1EJTC 4EPDC 1KRMA 3A3XA 1ONWA 4RE0A 4DLFA 3GIQA 2Z24A 3FDGA 3QY6A 4C65A 1GKPA 4KERA 2I9UA 1RAKA 4IGMA 4PCNA 3PAOA 3ISIX 1EJRC 4C6PA 4DYKA 2F6KA 3HTWA 4GX8A 4LAOA 4GXWA 3IACA 4P5UA 1FWAC 3GU2A 3O0FA 4IFRA 4EPBC 4C5YA 2YB4A 3SO7A 2ADAA 2PUZA 2FTYA 4R85A 1P1MA 2O4QA 3LA4A 2P50A 4UBPC 4NI8A 1YMYA 4F0LA 1ITQA 4PE8A 4XAGA 3IPWA 4V1XA 2HQAA 1FKXA 1FKWA 5G4HC 4H01A 4CNSA 4IG2B 4R7WA 1FWHC 4ZSUA 2FVMA 2I5GA 4C6EA 4PCPA 4WGXA 3LS9A 4QS6A 3QGAC 4OFCA 3WZ0E 3WMLA 4D8LA 4LCQA 1PTAA 2FTWA 2WJDA 3TN5A 2GOKA 4UB9A 2R1KA 3F2DA 3GTHA 3DCPA 4LALA 1KRAC 2PAJA 3S4TA 4DI8A 2WM1A 5CH9A 2WJEA 2HBXA 3ICJA 2AQOA 4H9VA 2ICSA 4E3TA 4ERIA 4DZHA 1XRTA 1VFLA 4CNUA 4LCSA 3URBA 3E3HA 4LANA 1YRRA 1V7AA 2Z28A 3AU6A 1EF2A 4CQDA 4IGNA 4CQCA 1M68A 3PNUA 1PSCA 4KEUA 4HK6A 4GY1A 4LCRA 1JGMA 3S2LA 4C6BA 4H9UA 4KEVA 3WYZA 3UBPC 5FSDC 3C86A 1I0BA 3G77A 1ONXA 4B91A 2VC5A 2QPXA 4IF2A 3MVIA 2Z7GA 4H9TA 4C6DA 3FEQA 2Z29A 3E38A 1BF6A 2Z2BA 4B3ZA 3F4CA 2UZ9A 4AQLA 4I6KA 3GRIA 4C6MA 4B92A 3GTFA 1EJUC 1R9YA 4JOMA 1DPMA 1YIXA 3TN6A 2VC7A 2W9MA 3MDWA 3O7UA 3S2MA 3MTWA 1GKRA 3AU2A 2YZ5A 3NQBA 4C6NA 4C6JA 1R9XA 3S2NA 1K70A 4H9MA 2R1MA 4GBDA 1NDVA 4KIRA 3ID7A 4NG3A 1KCXA 4CQBA 4WVXA 3NEHA 4DIAA 1WXYA 1PO9A 3B0YA 1RJQA 4BKNA 1A5OC 2OB3A 1EJXC 2EG8A 2RAGA 3E2VA 4KQNA 4DZIA 4IQJA 4XAYA 3MKVA 3EGJA 4G7EA 1FWJC 1XRFA 1A5KC 4TQTA 1K6WA 1XWYA 4C6OA 2Z26A 4DI9A 2GZXA 3V7PA 5FSEC 3K2GA 1P6CA 2Q01A 3RN6A 4PBEA 5LXXA 1QW7A 1GKQA 1RA5A 2QT3A 1ITUA 3URQA 2E25A 3MJMA 2DVTA 1FWFC 2Z00A 1EJVC 2GSEA 2AMXA 3LSBA 3IJ6A 1A4LA 3MSRA 2FFIA 2OQLA 1E9ZB 4NP7A 1I0DA 4RDZA 3S2JA 4H00A 1POJA 3OOQA 3NURA 1V77A 3UR5A 5HMDA 1NDZA 4C6FA 1UMLA 2VM8A 3RHGA 4RZBA 4IFOA 1NDWA 4HK7A 3E0FA 2VUNA 2R1LA 2Y1HA 4J35A 4L6DA 2GWGA 1RK5A 1J6OA 4ZSTA 1UIOA 2UBPC 3URNA 3LY0A 4EPKA 2BB0A 1M65A 4C6LA 4J2MA 4C6QA 3IRSA 1XGEA 1RJPA 4MUPA 1M7JA 1EZ2A 2DVUA 3F2BA 1V79A 3PNZA 1UIPA 3F4DA 1EJWC 3IGHX 3T81A 5HMFA 2HNHA 4GOAA 4QS5A 3OU8A 1KRBC 4CNTA 3GG7A 1E9YB 4RDWA 2R1PA 3ITCA 3DC8A 2D2HA 3OJGA 2HBVA 4DNMA 4BY3A 4ERAA 1YBQA 1V51A 2OOFA 2OODA 3UR2A 2HPMA 1A5MC 1A4MA 1RJRA 5HMEA 2EG7A 4XAFA 2Z27A 4IFKA 3CS2A 4YIWA 3QY7A 2DVXA 3EWDA 4GK8A 1HZYA 2VHLA 2P53A 1A5NC 4I6VA 2BGNE 4GYFA 1KRCC 4H9XA 4C6CA 3GIPA 2Z4GA 1O12A 4J5NA 3GTIA 4HJWA 4F0SA 3LGDA 2QS8A 3UF9A 2VR2A 3LGGA 3GTXA 1YNYA 1NDYA 3LNPA 2HPIA 4IG2A 3T1GA 3E0LA 3N2CA 3OVGA 3RYSA 3EWCA 4GC3A 4V1YA 3D6NA 3MVTA 4C5ZA 3F2CA 3OQEA 3HM7A 1YBQB 1ZZMA 3FDKA 4QTGA 2FVKA 2YXOA 4ICMA 3OODA 4C60A 4IFKB 4KESA 1ADDA 1K1DA
chains in the Genus database with same CATH superfamily
3GXPA 3AIQA 5DCEA 1UP2A 1PX8A 1F9CA 1R7AA 2ZVRA 6REQA 3ORWA 1UWUA 1H61A 1E6ZA 3KCLA 2G8ZA 1ZAIA 4NT0A 3SQSA 3IK2A 2ZX7A 5DY3A 1V3HA 5DT7A 2FPVA 2J7BA 4JS3A 3ZZ1A 1W1ZA 1DXEA 1YE6A 3GH4A 2GVGA 1GTEA 3NL6A 2R91A 4A8RA 1QCWA 3ITGA 4HNOA 4DO7A 3UCDA 1BQCA 3MSYA 2XVNA 3KL0A 3KE0A 2ZC1A 1O6IA 3VO0A 1JGIA 3SZ8A 4RPQA 1EHNA 3L7RA 2GK1A 4JEQA 4X9YA 2VVNA 1EJSC 1CGVA 2VRKA 3E0VA 3KTSA 1NWSA 2JBMA 4RK8A 5I00A 4Z42C 3GS6A 1BEUA 4GMEA 3TV8A 4X60A 4BJHA 3VZXA 3VKKA 6REQB 3UJRA 3VGBA 3DFPA 4K7YA 3V0SA 3PPGA 4M80A 1BG9A 5HINA 3MDUA 3L5MA 3CH9A 3CPRA 5G4WA 3TXZA 1Q6GA 1FWDC 2PF0A 4LBRA 3WF0A 4Y9PA 3V0UA 4H1ZA 3MI6A 2DIJA 1FWIC 1X39A 5AHFA 2V5LA 4GVGA 3QMTA 2A7NA 1BYDA 2GK1B 3EZ4A 4XD5A 2BY1A 3ZJ7A 1I1XA 4DBUA 2A79A 5J5RA 1DJIA 1BF2A 3M64A 3WCZA 5B7YA 4TUFA 3B9OA 3N17A 4PUWA 4YVPA 2RDTA 3LYEA 2FB2A 3M16A 4GBUA 2WKLA 2ISDA 3UYCA 5ABEA 3AHTA 2P8BA 3Q58A 3IANA 1IT7A 2A85A 1G94A 3LLXA 2VZSA 2OWWA 1KA9F 3GH7A 3MHGA 1MWOA 3L2MA 3G2GA 2XVKA 1F05A 3ELFA 3N6JA 1FKXA 1N2VA 3FN9A 5K9DA 2OXNA 1FWHC 1B5TA 3A4WA 1E6NA 3U2OA 2BP1A 3W1RA 4HMDA 1UD4A 3WL1A 1TWWA 1JDDA 4HYVA 3MZNA 4BQ2A 2IPWA 1KRAC 3I6TA 1OIMA 1XKJA 1ZRQA 3GFXA 4IGNA 2PLCA 1GVFA 1PX3A 3C2VA 2FFCA 1XBVA 3MO4A 1PTDA 2Y85A 4H9UA 3AO0A 3C86A 2YFOA 3BAJA 1HP4A 1TSIA 1TX2A 3M0KA 3P5YA 1AL7A 1UG6A 1JDCA 4HA4A 1DJQA 2CLEA 2P5NA 4NZFA 3LHTA 3ZLFA 4LS2A 1V3KA 3GXTA 3DDMA 4K1GA 3OBKA 1XYFA 5AZ1A 1SJDA 5F1UA 4BCEA 1AQMA 4YPJA 3IIOA 4FX8A 4XZNX 4G7FA 4ZQOA 3NQBA 1QO5A 4DEFA 2HTMA 4BWLC 4B15A 5CSYA 1NDVA 4B5NA 1PKNA 2XH4A 2G50A 4TVUA 3UWQA 1GQLA 3W2JA 4BHYA 2IQDA 1A3HA 4K6AA 4JIPA 3E2VA 3DZ1A 4A4AA 3CMJA 1XLDA 3EPMA 4DXKA 3D47A 2CLMA 4C91A 3WEZA 5A6KA 3H8AA 3QC0A 4IMFA 4D6FA 1K6WA 3NM3A 1T8QA 4QDWA 2VDGA 4JTQA 1ME7A 4Y6GA 3W83A 2RKXA 1RA5A 2BV9A 3LBCA 3N4EA 3M0YA 2PODA 1EJVC 3A3HA 1NP0A 4HZMA 1G0CA 3WJXA 3PBGA 3EMQA 2J7HA 3IGXA 2X16A 2WZIA 1EIXA 1VLWA 2ISVA 1POJA 4NAEB 5FEWA 5FAJA 2J9YA 1JCJA 4S38A 3GUGA 2OEMA 3L23A 3W1AA 3M47A 1RY8A 2YBVA 4JIIX 3QZAA 3WJZA 2X1TA 4RNFA 3F7JA 4A8NA 1JRBA 2IKIA 2J77A 1FWSA 2OJPA 3IRDA 3VD3A 2WHKA 1WDPA 4GQ0A 4WDTA 1JL8A 1JQXA 4DXVA 2O56A 2F8QA 1GZ1A 2J75A 1M65A 1DQUA 4QR6A 1TPFA 2D0GA 5TAOA 1AH0A 3AXMA 5CZTA 4J27A 1OD8A 3CZGA 4QS5A 4AX7A 4KGLA 3VIFA 4R9XA 3THCA 3AISA 1F3WA 4UTLA 1CXIA 1PKMA 1VPQA 1C7SA 2WMIA 3PSVA 1VIZA 1HFBA 1E15A 4MDOA 3EA3A 3A22A 3CQIA 4E2VA 4FXJA 4QHRA 1XLIA 1IV8A 4I9AA 3UNDA 2R6OA 2ZXAA 1OC7A 1LT8A 3QLLA 3WF3A 4S1FA 3CZJA 1OG0A 2QEZA 1XI3A 1F3TA 1WKEA 2Q6ZA 3GTIA 3KOZA 3H2OA 3RR1A 3WMCA 2GJXA 2ZKMX 2ZRVA 4OQVA 4PMZA 5A6LA 4PMJA 3HPSA 4L64A 3LGGA 4RNJA 1QMLA 3UZ5A 3SFKA 4PL2A 1NDYA 2WJZA 3S5ZA 2CW6A 4XSLA 4H6QA 1N55A 1CGTA 3BJFA 1G7UA 2TYSA 5A69A 2WMIB 2EPOA 3EWXA 4K39A 4O4VA 3GTNA 1ODZA 4JQ4A 3OODA 3SN1A 3BH4A 3ITTA 5D9MA 3DKLA 4NHVA 5I3FA 1CXEA 2ZZ6A 1Q13A 2QDDA 4LJ3A 4GHRA 3NQAA 1E3ZA 3IGUA 3W6YA 1CGXA 2ANUA 4U4MA 2ZXDA 5CPQA 4KT2A 2GJXB 3WBYA 3PZNA 3BLPX 2D2GA 4XZHA 4YJ5A 3S9YA 1RCQA 1PYFA 3TYZA 4JQAA 3CT7A 1HO1A 2FMNA 1S3TC 1L0PA 3TN4A 4Z17A 3TA6A 8XIAA 3EX1A 1YDVA 1FH9A 2PTYA 1E1CA 4X2RA 5EMJA 3NZGA 2VFEA 5FI8A 3VCRA 3VVGA 4DYEA 3IJ9A 4D72A 4QE5A 1A0EA 4LUYA 5E5CA 2XN0A 2OTDA 3MCMA 3CV1A 1ZB5A 2E0PA 5CJMA 3CZ8A 4XIMA 4JTCA 4WXZA 1C7TA 1OK6A 1XYAA 3W76A 1VJIA 5FAGA 4U10A 4JQ2A 4OJYA 3KL3A 4DELA 1B4KA 1SZEA 4TX9A 3CIVA 1EJTC 2YDSA 1HQTA 1E1CB 4N4QA 3ABZA 4GUFA 1QPQA 1KRMA 1AD1A 2RJHA 4L80A 4DLFA 4K36A 3KRBA 3LCFA 4JDBA 3QY6A 1GKPA 4H04A 4G8TA 1YXCA 2I1OA 3I6EA 1Q5MA 4YCOA 2YLAA 2YZRA 2VD8A 2PCQA 2FZNA 1GZJA 4OWGA 2AMGA 1VFFA 3A5VA 1OC6A 3IJIA 3TWBA 5H1WA 3IJQA 1QNSA 4BA0A 1YPXA 5JVLA 2PBOA 4O19A 3N34A 4ZO6A 4LVFA 2JFEX 1BKHA 1W3HA 4WOZA 1EDQA 2FHBA 6CGTA 4PE8A 5BWAA 3WQOA 4CNSA 4FZIA 5A6AA 1OFPA 2P76A 4C6EA 2VEGA 3LCGA 4E2BA 4P8VA 3RJYA 3WZ0E 4U28A 2Z1SA 2FTWA 3PWAA 3TN5A 2WVVB 5DF0A 4U2ZA 1OY0A 1HTIA 4GACA 5LNRA 3URBA 1A50A 1TUFA 3B03A 4L1WA 1BD0A 4JN7A 3MI2A 1UH2A 3KTXA 3CL8A 2CXEA 3HPZA 1JCYA 1MXGA 4C6BA 4ZE5A 4C1NA 3TLLA 4FHAA 2RH9A 8XIMA 1VCGA 2F2HA 3PP7A 3GG0A 4YXGA 4C6DA 2J74A 1B3ZA 1XD1A 2VOMA 2E9BA 1K8CA 3H21A 2EEXA 1ZHAA 4B92A 5HDRA 1UWRA 2Y6ZA 3EA2A 1B31A 1CYGA 1F73A 2WQDA 1XRSA 1G7VA 1TQXA 1A5BA 1RQHA 2UY5A 3AU2A 1XQLA 3UETA 3O1NA 3Q2DA 2VX6A 3CPGA 1U2YA 2OPJA 3UZXA 1VJZA 4GBDA 2OEKA 5C71A 3EDEA 3V18A 4CQBA 2XFRA 3O9NA 3PZQA 2ACQA 2OU4A 4JTEA 3GBEA 1PO9A 1OFOA 2NWRA 3B0YA 5K3VA 4E8GA 4S2CA 3S6OA 3ALFA 5DX7A 4BI6A 4UMCA 2PWUA 2QCCA 3IEBA 4MB4A 4XAYA 5KZ6A 4DM1A 4H8NA 4CD8A 1PZ1A 4TQTA 4IQDA 1FCVA 1J0YA 2VEKA 2OELA 3PPHA 4O1EA 2VO5A 4E4PA 2ISWA 3AWNA 4XTDA 3BG9A 2BVYA 2YIHA 1UD8A 4QQ3A 5CXPA 3C5QA 3K13A 1F6PA 3DH7A 2YCKX 1X8FA 2DVTA 1HKKA 3Q45A 1QVBA 5LNVA 1GCYA 1RP9A 2IXUA 1KXHA 4NP7A 4WGHA 1FHDA 2GOUA 1IXOA 2GQ3A 4O1CA 5FJOA 4NRRA 2AGTA 1K4GA 1KQYA 3CMGA 8CGTA 2D0HA 3W25A 1CXFA 3V1HA 3RU6A 5M3WA 2I14A 3K1GA 3NWRA 3PN8A 1E1FA 4YTSA 2O0TA 3FHQA 4FF7A 4FK9A 1LDCA 4CVUA 3STCA 2GWGA 1V0NA 3Q67A 1BYAA 2UBPC 3WLHA 2DV0A 3CUXA 5T8GA 2E6AA 1X96A 3QHOA 2Y24A 2O7SA 3B06A 3N9SA 1EJWC 3RM8A 4D8ZA 1XH0A 4YTTA 2JF6A 3KX6A 4PTMA 5FKYA 1DQWA 1L6WA 4DNMA 1ZCCA 4EAYA 2FZ9A 3MUY1 1G5AA 1TMQA 3PZUA 1WPCA 5DBUA 1NF0A 5FF3A 3EWDA 2NQ9A 1UQYA 1WBHA 5H8UA 1HZYA 1P4CA 4GZIA 4AYSA 1NOFA 4LUIA 3P60A 2CWNA 4WY0A 3WJSA 5LNWA 2Z4GA 1O12A 4J5NA 4S3JA 2WNWA 3UW6A 5FL1A 5M5DA 3MYPA 4YL2A 3W1TA 7REQA 3L12A 1W5NA 4QLJA 2YFNA 3PBWA 3NQ7A 1EEXA 2QYGA 5D09A 1W1TA 4U5KA 4GC3A 1CB2A 3EAUA 4KEMA 4NZJA 3RAOA 4JTGA 3VA8A 2V8ZA 2DPEA 1WX0A 3LB0A 4IPPA 4GNKB 6XIAA 7XIMA 3GIYA 2HVNA 2PTWA 2YXOA 2BGQA 4ICMA 2V5CA 3CB8A 4QCFA 1DWIM 4HN4A 5L6UA 2OZ3A 2C6QA 4Q7NA 3IJ7A 1WXZA 5AHLA 2G97A 1XFCA 2WB5A 1MEHA 4EANA 1PHQA 2PGWA 5HMSA 3W88A 4BI7A 4AY8A 1FFRA 1R2TA 3EDKA 4N42A 4A8IA 5DO8A 4DX3A 3GW3A 3VOHA 3LDVA 2GL5A 3APTA 4BS0A 3QLDA 4KCUA 1JAKA 3EB4A 2GWNA 4D6HA 3KWSA 3JVAA 1J93A 1TA3A 4O10A 3BW2A 3H22A 1AQHA 1FWNA 1WO2A 4QNWA 3MA8A 4J3WA 3KFTA 1G67A 3FKKA 5K4ZA 2QJGA 2Z1VA 4K68A 1XGDA 1V3MA 3GSMA 1QDSA 1S1RA 3W00A 2QUMA 2G0WA 3ARUA 3UNTA 5EMUA 5M1TA 4HPGA 4MG4A 1ISWA 3FXYA 2C14A 3ES7A 1GVOA 3BV7A 4K37A 4HPXA 1J12A 4GKLA 1UZ1A 3B40A 2D0FA 1EH9A 2WMKA 4X22A 4LAMA 2CZVA 2QJIA 3E2RA 3G5EA 3GR8A 5TIMA 4EPEC 2D20A 1PIFA 2ZRWA 3NYDA 4GYJA 5CJNA 3W23A 1P48A 3P93A 1VZWA 4ICCX 3EX2A 1E71M 4GYPA 4AG0A 2X05A 2FDSA 2FMOA 3ANUA 1EP3A 4IXHA 4C65A 3W29A 3RDKA 4F2UA 5AB3A 1M41A 4L9ZA 3L5LA 3LGEA 3HIJA 3PAOA 1R8LA 4E4UA 3NG3A 3HTWA 1EYEA 1XYCA 3CASA 1JCNA 3H70A 6A3HA 3WQFA 4OE7A 3NSMA 3LMZA 3SY8A 5EBAA 2FTYA 3GHUA 1P1MA 1SW0A 2A3AA 3KOFA 1W3JA 2XM2A 2XGIA 1ITQA 2FZ8A 4O54A 4E8DA 1DWGM 4AAJA 4I9TA 3HG4A 1WOBA 3DFNA 1L6YA 1V7YA 4ZQMA 2E40A 3FFSA 4XSMA 3ZR4A 2QUVA 1Q6OA 2E28A 1BQGA 2WKJA 2HBXA 4E3TA 4YWIA 4ERIA 2DFAA 4MVAA 1JR1A 1KCKA 1GG1A 2I7GA 3E3HA 1B3OA 1V7AA 2LLEA 3EPNA 2BVWA 3PWGA 4CQDA 5F2GA 1J11A 2QGYA 4LRTA 1E3XA 2GDUA 2OLAA 4HK6A 5EY5A 5CZJA 4BF7A 4LCRA 2ALDA 1SGJA 4Q33A 2XVGA 1ISYA 3N9KA 1EUNA 5J04A 1KXQA 1EA0A 2E8YA 3WDJA 3OW1A 4Q3MA 2WNZA 3E38A 1BF6A 2WAGA 2XFWA 3C2OA 5A8GA 4NF7A 3EXTA 4AQLA 1W9PA 5GPRA 2YYTA 3KOWA 4JOMA 1Z3NA 4KWVA 4XBJA 3PS7A 1JCMP 4G56A 4M81A 4PB3A 4ZCWA 1OEPA 5BRBA 4HCDA 3A47A 2QZRA 4C6NA 3RITA 3HPXA 3S2NA 1VH7A 3WF2A 2CBVA 3ZR5A 1R3VA 2G37A 4PUEA 1HUVA 3OGVA 1EFZA 5HAOA 4REQB 2Y63A 3U2ZA 3EMCA 1B90A 4M82A 3N12A 3M44A 1NWTA 3EX4A 1NWRA 4US5D 3LEPA 3KWXA 2ISSA 2EQDA 4DZIA 4IQJA 1JDAA 2VUYA 1YX1A 2QMKA 1CIUA 1R6WA 3OLGA 3G8EA 1Z6KA 5C54A 4Q32A 3WBXA 3S1WA 3MWAA 2Z26A 1HKIA 1JCTA 4J3SA 3G1SA 2DJXA 3ERPA 3UU0A 4Z08A 4S3FA 1GKQA 1P5BA 1QNVA 1QBBA 3TC7A 4WDUA 5FL0A 3VILA 3V5FA 3L68A 4O1FA 3NO5A 5A94A 1TREA 4GO8A 1SJBA 2QCLA 3N18A 2PDUA 3LD5A 1KTNA 3UERA 3FA4A 5ABTA 4EKJA 1JXJA 1DEDA 5CQ1A 3W1NA 4JIHA 3SUTA 3W87A 3VIMA 4NZ5A 1VYRA 1E9LA 2FHFA 2I9EA 5AECA 1M7JA 1JJKA 4OBRA 3WEMA 3CHFA 1DXFA 4IL0A 2REQB 4FALA 3W38A 2EGZA 5AC7A 2PDNA 3CLWA 1LLOA 2J8FA 4QGCA 1H7OA 4GQQA 1H49A 1XLBA 4S23A 1LRNA 3CYJA 4Y8FA 1OJXA 1DKWA 4WEVX 4YIWA 2Y62A 1DJHA 3DIPA 1YW1A 4I6VA 3UG5A 3SUSA 1MXSA 5D2YA 3I7SA 4PN2A 4DF1A 4UTIA 1CLVA 5D2WA 1OFDA 4ZQPA 3H7VA 2QF8A 4S3DA 4F9DA 5IXEA 1RHCA 2P3EA 3CWNA 2VD9A 4WUIA 3BJTA 4QP0A 1TJ0A 1XINA 1GPFA 3G18A 4H19A 1T7LA 4OUIA 4JPGA 4HOZA 5A5WA 4JFTA 3RPDA 2DZPA 5DQPA 3TWAA 3ZWSA 1LF1A 1BTMA 2FZBA 5D2VA 1Z69A 1LWHA 4E4FA 3GHTA 4TV5A 3W7NA 2J7DA 3P74A 3FW6A 1OX5A 5F2IA 4UQEA 1KWKA 3MKCA 3L2LA 1NFPA 3WMSA 3TTSA 3PSWA 3KM8A 2QUUA 4F9JA 1GJWA 1ALDA 2TAAA 1F4HA 3G22A 1GQKA 4ROQA 1XLHA 3EDDA 1BSIA 1B3WA 2V2HA 4KIEA 4UCGA 5JBFA 2E68A 2YGYA 5AKQA 1ZBKA 3DHUA 2OGJA 3O16A 4AD1A 1J96A 2PLMA 3TTQA 3EEZA 3C2YA 4D9PA 4M8UA 4RE3A 1T96A 1C8QA 2VR4A 4AEEA 4IUGA 1OD0A 6TIMA 3LPFA 4DZ5A 3RO6A 2NV2A 5BROA 2DSZA 5HULA 3A24A 1B3XA 1A80A 4F48A 4B9ZA 1Q6CA 3MT1A 4MPKA 3O6DA 4E6MA 3OVQA 4IMAA 4HQVA 1AH4A 1V02E 2HVMA 4PMVA 2FHCA 3MPGA 4AZ6A 1TVLA 3R0KA 2A21A 3L67A 4AW7A 1NQKA 1AD4A 4OVXA 2VWTA 3F5KA 3MW7A 2VEMA 3HGJA 5LIUX 3KHJA 2Q09A 4I5UA 1W54A 1B1YA 1IGWA 3KP1A 4HGXA 2CPUA 4J7RA 2HMCA 1CGUA 2IQTA 2P0IA 3VDHA 2PLJA 1XF0A 4FR1A 4DB7A 3S9IA 3POCA 4DBDA 3UY8A 1XSIA 2Q8XA 3VYLA 5I3HA 3BTNA 3G6LA 1J18A 3I68A 4N02A 2D3NA 1R5YA 1FWAC 3ATZA 1VBGA 2FKPA 4QISA 4TR9A 2Y2WA 3CIXA 3ZT5A 2E4TA 3RCYA 1LBMA 3DENA 1UB3A 4UBPC 3SBFA 1LLWA 3W53A 4DAIA 5BOOA 1ME9A 3M6DA 1EIBA 5IM51 5E6YA 1K03A 1Z44A 4LUSA 2H8ZA 3MMDA 2OLHA 3VDCA 4OFCA 4MWAB 1HVXA 3TYBA 1WA3A 3BLKA 2VEFA 3W71A 1EDTA 3SJ3A 3RUBL 1M04A 4RE2A 3U6WA 1G1YA 2HK1A 1XRTA 1XPYA 3LRLA 4S3EA 3M0IA 3GNRA 1PSCA 1I2RA 3PAJA 3GDTA 3EYPA 1UPMB 4PULA 5J8LA 4AC1X 4UCFA 3B8VA 2NT0A 4IF2A 1QBAA 3AC0A 3ITLA 4Q4RA 4A3HA 4U33A 1AMKA 3CO4A 5DN1A 4CD5A 3SN4A 1DJZA 2ZOXA 3PJTA 1MEWA 3GHSA 4IX0A 1TV8A 3CV2A 3FA3A 3P0WA 3U0HA 3KDNA 4IMCA 4K8HA 3AYVA 9RUBA 2CU0A 1W2VA 4WY0F 2ZC8A 3UA3A 4ZE4A 4HPNA 3KBMA 2CEQA 1F6YA 4J3TA 3THUA 4AF0B 5JIWA 1XIEA 3PUOA 4UIOA 3WSUA 3WUEA 1EC7A 4Y9NA 2ZZ1A 3M07A 2CCRA 4HOWA 3K46A 3GNNA 4IIHA 2A2IA 3HMJG 1W8SA 2YDQA 3QM3A 2GUUA 3GC5A 3WQDA 3V35A 3R6IA 1BYCA 2GVLA 1BRLA 3OLEA 4X2PA 5I77A 3URQA 2B7OA 1TCMA 3KOXA 2G5WA 2GSEA 3LQGA 3IJ6A 3N19B 5C9WA 3B9AA 1U30A 3NQEA 1GWJA 4AYGA 4LRSA 4ALDA 2J25A 2HJPA 2X40A 3NIYA 1GOWA 4AZ7A 1KGXA 2QCMA 4AZCA 4MNMA 3WH6A 5I02A 1Y7VA 4MF4A 3RILA 4IZGA 2H90A 3E49A 3TC6A 2ZIDA 1US2A 3WD1A 2VZUA 4LBUA 1ITXA 2D1ZA 4LSBA 2IXVA 3TA9A 3NQCA 1T40A 1GOIA 4O17A 4TOQA 3T81A 3GNOA 5LGZA 3H2MA 4NNAA 2Y89A 3OJGA 1GONA 1OVDA 3BQ6A 3G3DA 1YBQA 1V51A 4IMDA 4W7UA 3ZSSA 4W93A 3LRKA 3WUFA 4A8LA 1VFSA 1NELA 2H3BA 3QF0A 5AHIA 3W7MA 3RPTA 3ZJKA 5HA7A 4LC8A 3N11A 3QY7A 2DVXA 1ZPTA 3M0ZA 4AZCB 2VHLA 3CWOX 2NVCA 3EXRA 3SQLA 2BGNE 2Z1XA 4HIBA 3ZM8A 4D1IA 1J10A 1LG1A 3VZZA 4WR3A 3AMGA 2FDMA 3GIPA 3CYVA 3SCWA 3L66A 4AHQA 4LS1A 3LGDA 1SW7A 3KTCA 2V67A 1Q3NA 4GJ1A 3DFSA 1TKKA 3LHWA 5D9PA 2XJ7A 3RYSA 1REQB 2YL8A 3S3GA 1DBTA 2BFGA 2VJXA 3DBNA 3OYZA 4RXGA 3AIVA 1G4EA 3G1HA 4F0KA 1XL9A 1YBQB 3UFYA 5GVJA 1WCGA 5I3KA 1ISVA 1ZP4A 2VP8A 1Q6FA 4Z0SA 1JYNA 1JNDA 5M2FX 3HB9A 1J5SA 4FEZA 3HV8A 1UJPA 1RH9A 3GB6A 2G3FA 3S42A 1J8VA 3HJEA 1XLMA 1TB3A 3TJXA 5A8NA 2QULA 5C6MA 5BYWA 3DOPA 3NQGA 1TPC1 4M6UA 2E3ZA 4RDVA 1I75A 3GYEA 1H41A 1SMAA 5AHNA 2DT1A 4KEZA 4F2BA 1SR9A 2XIMA 4R7OA 1WKYA 4U5IA 3K8MA 2QPSA 1BWKA 4OOZA 2PTZA 1KNWA 1KW1A 1P1XA 1H0IA 5D4YA 3CAQA 1VR6A 3A4JA 3PZIA 4DJFD 3WJWA 1O5RA 4XB3A 2RFGA 1Q6LA 1LWJA 1X1NA 3N3MA 5E0FA 3EWYA 1OINA 4W85A 4NU7A 4JX4A 1VFHA 3AYTA 2JEQA 4ROPA 1RA0A 1UR3M 1EBGA 1XH1A 4A22A 1JZ7A 3UESA 1K9DA 2WCSA 5CLWA 4LNYA 3BOFA 2WHMA 3BJSA 3R0DA 2WZTA 2QV4A 1JPIA 1EXPA 4AD2A 2QVNA 3F4WA 3U5YA 4RNIA 1IXPA 1X98A 3SN0A 2WCGA 1RUSA 1R3QA 4UR7A 1N82A 2CLOA 4QITA 5A6JA 1HX0A 3UQNA 4NVTA 3WNKA 4YN5A 2XPKA 2OZ8A 3H53A 1ZJIA 2PDWA 4UTWA 2XIBA 1U1JA 2D24A 1QI4A 1IZJA 4H7CA 3MU7A 4LX4A 3W2LA 1M6JA 4EWND 3ENLA 4IIDA 1LP6A 4ZB0A 1L2QA 3WUBA 2PEVA 6TAAA 2YB4A 3CHCA 1FRBA 2ADAA 3W4RA 5F2MA 5C2CA 3ZSTA 3EOOA 1SFJA 2VGGA 3WNNA 4Z2LA 2ACRA 4H6RA 3AIRA 4O50A 1UKOA 2CYGA 5HWMA 2JKPA 3SCQA 3W72A 1S1PA 1D3CA 4XUYA 4BQ3A 1IHIA 1PPIA 4PMUA 2CESA 2XUCA 1GOMA 1ICPA 1WP6A 2R1KA 4Z1DA 5CH9A 3WFLA 1KFWA 4AMCA 3DFQA 3P81A 2B31A 3GVQA 1A3WA 2Z28A 4L6HA 3MUXA 3N6HA 4GZJA 1JQVA 1DTUA 4NQ1A 5FEPA 3IIVA 4I7VA 1UD3A 1XV8A 4KRUA 4J28A 4MJMA 1QOXA 3DHFA 5CAHA 4WIWA 4ZB2A 3G77A 1TJPA 3WH8A 4B91A 2DP3A 3LRMA 3K4AA 1BGAA 5FJRA 3M6YA 3HPFA 4GI4A 4B3ZA 2YL6A 4L6OA 3N13A 1V3IA 3AFBA 3LZ5A 3RLUA 1PL9A 1L6GA 1L8PA 3BXWA 1NP2A 1EX5A 4H6EA 4QE1A 1J0HA 2NQ5A 1NTHA 1SW3A 4K8EA 1JUEA 1MI3A 3V5CA 3RFAA 3L2IA 2PDKA 1UW9A 1WB0A 4B4FA 3G6MA 4NG3A 4BQ4A 4HNVA 2BXVA 1OM0A 3GKFA 4UNLA 1WXYA 3ARTA 4UTMA 1EXBA 2WBGA 3FA5A 4BKNA 1MW2A 5DBTA 4YU1A 1DWAM 3TOPA 4R27A 2QCFA 4B5SA 3OLIA 1JZ4A 2VDIA 2VENA 1W3NA 4JAWA 4NXKA 4E5TA 1RBLA 1XWYA 1W5PA 3MMUA 4ORIA 1P6CA 3BZGA 4Q8PA 5A95A 4W88A 3S46A 5B80A 2QCGA 3GK0A 4XZLX 4FX7A 1TR1A 4Q22A 4RNHA 5D2XA 5TBOA 4U2YA 5BNKA 1VBRA 1A4LA 5D8WA 4TVCA 3OA3A 1UP3A 4Q8NA 3UR5A 1LL4A 3TTOA 4O1AA 3EOUA 3NO3A 4DZAA 1IF2A 4X61A 4DWSC 1ZAHA 4FXFA 1EKOA 4R33A 3D0CA 3TW7A 3GG8A 3VD5A 1J2WA 1JI2A 2VT0A 3C3UA 4B2DD 1EZ2A 3PNZA 4KFOA 1F61A 2FLIA 1X38A 4C90A 1KRBC 2L5HA 3GG7A 3OLDA 4MZ1A 5GQBA 1G6CA 3SRDA 2WSYA 1VP5A 4KW2A 2BY2A 3CUFA 1SVDA 4EACA 4V33A 4TVDA 4LYRA 3KUMA 4GJIA 4XAFA 2Z27A 4IFKA 4DRSA 4XO7A 2XFYA 3UJEA 3M0HA 2A1YA 2NZLA 4IPLA 2ZUNA 5JQ9A 3OG2A 2X1IA 1OHLA 4BEQA 4NJHA 4HHLA 3ZT7A 2EPNA 3B9DA 4DQWA 2F38A 1XIBA 4DWSD 1CW2A 2BDQA 3WEOA 2VR2A 4FNSA 1I2PA 2RDUA 4UQAA 3LNPA 3WD3A 4WJ8A 4XVEA 1XSKA 1UBSA 3VMPA 3CZLA 3EWCA 4Q8UA 3TH6A 3WLQA 3SRHA 1PVNA 1UWTA 4L5ZA 4D6JA 3DX5A 4PUJA 4UXDA 3G3MA 3QSTA 3RK8A 3KBWA 1OCJA 3BLDA 1OYBA 2TRSA 4UTHA 1NWUA 2VGIA 1RXOB 1GOKA 1E4LA 4IFKB 3W22A 2O4MA 3P14A 3W1PA 4RDYA 1XFBA 4NZ3A 4CKQA 1TTJA 5IBXA 3VCCA 3T8QA 2R1NA 3W7LA 1I9CB 5I06A 1QW8A 5D32A 5AVHA 2X2YA 2V6AA 1ICSA 2J78A 3QPEA 1UH4A 2QHAA 3ATYA 3VIPA 3TJ4A 2FVLA 3LV5A 2PWEA 4PH6A 4CNPA 1KO0A 2BVTA 3XIMA 4M51A 1D7KA 3UPWA 3CU2A 1B4EA 4PBFA 4QRNA 3CPUA 5HNTA 2PGFA 4XAZA 1Q7MA 1V4YA 2HZGA 3RM4A 1RPKA 3BURA 1UKTA 3KW3A 2E1WA 2YB1A 2V3EA 3GU9A 5A8PA 1H11A 3KVMA 1ADSA 3CL7A 3MZ2A 3A6OA 1QHOA 2OEJA 2X8RA 5LIKX 5LNSA 4TTUA 4LF1A 4TTGA 2D2JA 1JUKA 3MCNA 3HPAA 5I09A 4LAKA 3RX3A 4HNTA 3E12A 1EPVA 5C2GA 4ENLA 1Q6RA 4WXYA 3L0NA 4PTXA 1NQ6A 1PWMA 5C9UA 4CD6A 3G1AA 4OOUA 4O8RA 4ZOEA 3AXIA 3DFHA 2XIQA 1RV8A 3H2EA 3SFWA 3SEPA 2W4XA 3FS2A 4IX2A 4Y90A 2NLYA 4KWWA 3REQA 1K3UA 4EPDC 4DUOA 4FLOA 4IJRA 4HVXA 2J4GA 1UQZA 2VNCA 3N4AA 1AODA 1SO3A 3SADA 4OGZA 1Q66A 1KV8A 4ASTA 5LXEA 4KERA 3BL3A 3IWPA 4H6KA 4Q7IA 1I2OA 4C6PA 1XHGA 3W7KA 2ZADA 3HQ1A 2EBNA 5I2UA 2QCEA 4LYPA 3I65A 3WFAA 1EWEA 3ZLGA 3KDOA 1ME8A 4MYXA 2D2OA 3W75A 3B97A 4CCCA 2ATMA 3UR7A 1VYPX 2J79A 3AS2A 1KXTA 3NCOA 3ZFHA 1MW1A 4UQDA 1XIMA 2QJHA 4AVNA 1GYMA 2FB3A 4IG2B 1AQ0A 2I5GA 4OV9A 1P0EA 2WKGA 3QGAC 1CLKA 1UH3A 4DUWA 2FIQA 4D8LA 3CQKA 3WD0A 2W0UA 1H1ZA 3VZYA 1I2NA 2YSWA 2WZMA 3VFCA 3AU6A 3WMBA 1L6FA 4CQCA 3PNUA 3GAYA 2KX9A 3V16A 1OGSA 4PSRA 1A5UA 3OG3A 4WX2A 1QOPA 4HNNA 2PWGA 1OGBA 2Z7GA 4A35A 4H9TA 4UQ9A 3IJDA 3VMNA 4A2RA 3TU9A 1E51A 4EIVA 4NNCA 2XH0A 2CNCA 3PVFA 5H6HA 1NAL1 3QZ6A 4JN8A 4MPQA 1WZMA 2CFFA 4W87A 2ZRZA 3GX9A 5IHSA 3LI1A 3A13A 4P7QA 4QG6A 3S2MA 3RF9A 2RGMA 1BLIA 3KVLA 1GKRA 1NFBA 4RR4A 5TNVA 5LA0A 3KCOA 4CD4A 2JALA 3U9IA 4HHHA 4AVFA 4WVXA 2IPFA 2NXGA 1VPYA 3NZ1A 4US5A 2WLZA 3FGCA 4LGXA 4CN1A 3OA5A 3GVWA 1HKWA 3KZPA 1XLEA 1PZ2A 1OF6A 1C92A 1ZNNA 3CIWA 4UTKA 3TQKA 1VEMA 3GDKA 2AGKA 4C1KA 1D2KA 4Q6JA 5IFPA 1FWJC 1QNPA 1AG1O 4P7RA 4DO5A 1KFLA 2WSKA 3LHUA 2XDFA 2NXIA 5AYXA 5JIPA 1R3TA 1GHRA 5FSEC 1RVKA 2Y8VA 5A2CA 4ZENA 3C2FA 2AKMA 3U4AA 4JL2A 5FCZA 3EPOA 1DWHM 2WM0A 1GQNA 1Z48A 5AZ0A 5FF2A 5FIPA 3I7QA 5BW6A 2JIEA 2X1SA 1V08A 2NUYA 3ARQA 1XQKA 5BXSA 2DW6A 2V68A 3GKAA 3GNDA 3FGCB 4DJDA 4NAFA 2Z1BA 3L4WA 4XKMA 3DHDA 1AZ2A 4G5DA 3ZO9A 2NT1A 4B5WA 3S1VA 3E1F1 2TODA 2ALRA 5DRIA 5DY2A 1H7XA 3UYIA 4J4KA 4NZCA 3LHYA 3UWUA 1O7AA 5GJNA 1J0KA 4G1NA 2ZRUA 1U5VA 4HYWA 4QG8A 1E4IA 4C6LA 5K9CA 3IRSA 1XGEA 5AVNA 3O06A 3SY5A 1UIPA 1UR8A 3MKKA 2HNHA 3UA4A 4Q8OA 4DHGA 1UUMA 4X3ZA 4PMYA 5IHRA 2R1PA 1EUAA 2PGEA 2QIWA 3OGRA 1ZFJA 3VKCA 4BY3A 1VFOA 4CU6A 2OOGA 1BVZA 1ZS2A 5FACA 3UR2A 1D8CA 4WSHA 1KM0A 2A3CA 2ZTKA 2GSHA 4HZ6A 3AS1A 4MB5A 4QG9A 3NL3A 3GZ3A 4XBKA 4GPNA 2XN2A 2X0YA 4O57A 3W1QA 4K1WA 3TOYA 2VFGA 4X63A 3CQ0A 4XWUA 3PHAA 1LUCA 3DFYA 3SDOA 4A3UA 4WJEA 4ZODA 2V69A 4MZ8A 3SGUA 1FVPA 1OFRA 1TWZA 8A3HA 4NX0A 2AL2B 2QDHA 1DJNA 3KL5A 3DHPA 3G1VA 4WSKA 3P84A 2HE5A 1UWSA 3ZR6A 3ALGA 1V6XA 3CUIA 2V5JA 3TMLA 1TX0A 1EBHA 2Z7KA 4IQLA 4HK5A 2AQVA 4B5XA 3PM6A 2Y7EA 1IR1A 5TD4A 2YCLA 2YLLA 3OHMB 1HJVA 2XHYA 2IMRA 1IE7C 5C9ZA 2EKGA 3P6LA 3IIXA 4UZSA 3TJIA 1Z9AA 1R9ZA 3CQJA 3OZMA 1HW6A 4GY7A 1KGUA 4D6GA 1Q6QA 3TKFA 3TYUA 4HZ8A 3W7IA 4FIRA 5DXXA 4ERGA 1AH3A 1TE6A 1US3A 3SCPA 2B7PA 4N9DA 5LGXA 3E2QA 3VE7A 1IGSA 2WWCA 2XYLA 1TZZA 4LFYA 4W8BA 4M6VA 1QTWA 4CD7A 5CC6A 1KQZA 4DYJA 3U7BA 3MV11 5A6TC 1UMYA 3TSMA 1HNYA 1R3WA 4HA0A 2YCLB 1JD7A 3W1MA 1D7FA 4WDXA 4DXXA 4ZB5A 1SMDA 2Y8KA 1I45A 1LBLA 1CWYA 3TN3A 1KM1A 1J79A 2CLIA 1Z41A 3FJNA 2ZFAA 1SZNA 3PBMA 1X97A 5G5IA 1QPKA 2OQYA 3PG8A 2V2DA 1J0IA 5D30A 1GGOA 4WHBA 1IYXA 4JFWA 2YA2A 1V6TA 4Q4PA 1L9WA 3OBEA 1IXQA 3GIQA 1QATA 2J62A 2O9OA 2XFFA 1YNQA 4FLRA 5H8PA 1XBYA 3PTKA 2YJQA 1UC4A 1JZ3A 1VGAA 2WCAA 1QI0A 3SCNA 2INEA 2FH6A 1FWTA 1E4MM 1TMLA 4L65A 1R30A 2GSJA 3UZZA 2PDLA 3GNPA 2PP3A 1UPPA 1ZBWA 3G1DA 2HVOA 3VIIA 1U83A 3T2PA 4R34A 4EPBC 4KBXA 1MQRA 2I16A 3BARA 3CEUA 2BNJA 1Q2SA 3R94A 4F0LA 1S2CA 4Y9MA 4EE9A 1ECEA 4ZSUA 2RDXA 3WDQA 3T0AA 4PTWA 1CI1A 2WWDA 4RW5A 2Y88A 3WD2A 3F2DA 3DCPA 3P2VA 5F2LA 2ICSA 3L0GA 2C1GA 4CNUA 3SI9A 2W66A 3WBAA 3WJYA 2O55A 2OSXA 1EF2A 5HXMA 2JEPA 1JYVA 1OCQA 1W5QA 1T8XA 4ZXLA 5TQLA 1GW1A 1M68A 2QUTA 3M0LA 4EVZA 4PRTA 3DXIA 4HN8A 4LB4A 4N9CA 1PCKA 1ZQ5A 4CVWA 4GXPA 4JYFA 2QPXA 3GXMA 3MVIA 1F3EA 3AMDA 2E77A 3VOGA 3F4CA 4IGHA 4I6KA 1TWIA 3GTFA 3DECA 3HO8A 4PL1A 4XBSA 5G1YA 4KS0A 2WANA 1CXHA 3MDWA 1M53A 2QCDA 3QW3A 1G9HA 4NZ4A 5D2TA 3ABQA 3VGDA 1R9XA 3ZWTA 1K70A 1HL9A 2OZ0A 1MMFA 2VL4A 4JDYA 2G3IA 4PUDA 2C13A 3BSHA 1IWPA 3NDOA 1R86A 1A5OC 2B0MA 3KVJA 4ZOCA 2EG8A 4OECA 1W8GA 1W9UA 5EMMA 4IT1A 3VTRA 1XRFA 3M5ZA 2PDHA 1ECQA 2WSRA 1KFBA 3GHRA 4C6OA 1W1A1 1WZAA 1JXKA 2DQXA 3K2GA 3BWWA 1PTGA 2Q01A 4GCAA 1XUUA 2QIIA 2G3JA 4FMVA 3PK7A 4EXBA 1RVGA 5U4NA 1AFSA 1FWFC 3G1XA 1WBJA 1QHPA 4B16A 2FFIA 4CUCA 3WN6A 3WDHA 1VLIA 4HYRA 2WHLA 2BOEX 2PC4A 3NAVA 4XZBA 2VCCA 4UFHA 4QJ1A 2PDGA 4AWSA 1K9EA 2XVLA 3JUGA 1H50A 3W24A 5K4XA 5AYBA 4HD5A 2AAMA 4AD3A 4M6PA 2V38A 4HK7A 2QCNA 3SW6A 3PBUA 4J35A 3SURA 5CC5A 1HIZA 3C0JA 3H2AA 3URNA 5HWNA 1OF8A 1AW1A 3EBVA 3LXAA 3R13A 4FLQA 4HSNA 3BMXA 2BB0A 1DE6A 4IPIA 2DVUA 4YTQA 2XTKA 4KCTA 5CSUA 3O05A 6PTDA 1R85A 4MWAC 4OUEA 4PFMA 3LUTA 1XKYA 1H1YA 3DC8A 4YLWA 1DJGA 4IIEA 1XLGA 2OODA 4DY1A 3APYA 3N04A 3W2MA 2POTA 4LV4A 5REQA 3KVKA 2JGYA 3BANA 5RUBA 1R87A 4O1BA 3QRHA 2WYSA 1KRCC 3H7RA 2VCAA 2Z1KA 5CBBA 3GR4A 5ENLA 3AWOA 5KZEA 1HGYA 2WNQA 3PZTA 3KBVA 1WAUA 3BMVA 1UHVA 4PEKA 4XK2A 4LUTB 1K4HA 4CGTA 2B7NA 4JIQA 1YNPA 3N2CA 3VDBA 2VTFA 2JKAA 1AW2A 2AOSA 3R8RA 4UR9A 2BY3A 1XX1A 4EK7A 4Z2GA 3UWEA 3D6NA 4C5ZA 3AS3A 5L9FA 5C0QA 4MWAD 1XCFA 3FDKA 4PMRA 1EPXA 1PWLA 4GZEA 1YTKA 1YYAA 3FYYA 1JI1A 3UJSA 3N3TA 1T99A 2QJMA 5REQB 3B9EA 2OO6A 4MM1A 5ABFA 1TTQA 1R2SA 1EP2A 1QI3A 4AMAA 1QXLA 3ANVA 1GNXA 2ZXQA 4EF8A 1SSGA 1XIHA 2NWSA 3AIBA 3K4WA 1UKPA 1HKVA 3TYCA 4GQRA 2FTPA 2IPJA 5CC7A 4F0RA 2IS7A 4O18A 3A9IA 3NZRA 4DJEC 1EX1A 3PANA 1OGGA 2PWHA 3S1XA 4PB4A 2O9RA 4JKLA 4S3KA 1C8VA 3RCMA 4S3BA 4GWEA 1WDDA 4QSFA 3INPA 3QKEA 3UGVA 1OYAA 5ECVA 3IV8A 1SZGA 5FJPA 1WZKA 4FNPA 2FZDA 4DJFA 3FJLA 3O3RA 4LAZA 1TV4A 2FGZA 3LG3A 4IP5A 3OZOA 5ABFB 1TPVA 4LYQA 2PU0A 5FF0A 3FYOA 4J3UA 4IMEA 2OMAA 2PI6A 3PPFA 1VPXA 2O92A 1V02A 1OADA 5BZAA 2CKSA 3VDGA 1XDLA 1HT6A 1I4NA 4GC4A 3CM4A 3ZVHB 3L65A 7A3HA 1JZ6A 3AZTA 2JE8A 1GTHA 3QZEA 2ZX5A 2BHZA 4H41A 1A5SA 3K30A 4GNVA 3B0UX 4DJED 2ZUMA 4C6KA 1F74A 3KS6A 4NUWA 3A5FA 2RDWA 3LENA 5AOUA 1M7XA 4I8DA 1GQIA 1F76A 4XTIA 5JUVA 4NAEA 3T40A 3U8GA 4YYFA 4S2BA 2D3LA 3N9RA 1GVRA 3EWBX 2F6KA 4LAOA 4BK9A 1VBUA 4TMCA 4ML4A 4HKPA 3FX4A 3W2KA 2AQWA 4V28A 4ZGYA 1JAEA 3B04A 4DWDA 2INFA 2KZHA 2DJLA 1O1HA 3SO7A 3M46A 3WLJA 1HJQA 4HTYA 2VCBA 2MUCA 3OGSA 4WDWA 4HOXA 4LV9A 3SGGA 1KWGA 1K02A 4UTTC 3VOCA 2ZWZA 3WD4A 3DG6A 5C2XA 5C70A 1FH8A 2A4AA 2QV5A 3OPSA 4MSSA 4HSOA 3UZJA 1KFJA 2VZOA 2OVLA 1WDWA 3IVUA 3H7UA 3SY1A 1OYCA 1PZ0A 5HPOA 1EO7A 3EWUA 2PAJA 1R3SA 4YHEA 3AXHA 2BY0A 4K7VA 4MGGA 4LANA 3KBNA 2HDJA 3SUUA 3G0UA 2DW7A 1V6YA 3N2BA 1JGMA 3UWZA 2BLEA 1MW3A 1E6QM 5EGRA 3TYDA 1OZMA 2PDXA 1HL2A 3EB2A 4M6QA 3SCUA 4QJ3B 5HNUA 3EWWA 1C90A 2QMJA 3O2LA 3DERA 1TE1A 1YXDA 2X1UA 5D04C 1MUWA 2UY4A 1U33A 5HUOA 3TN6A 5KETA 4Z1AA 4AIOA 1IR2A 5A6SA 3W1XA 3F5LA 5G2WA 1GVEA 4OU1A 2J7FA 1F6KA 1QI5A 1MUMA 4FR6A 3TW9A 4B9YA 4XZIA 5IDIA 3I3BA 4O8AA 3DFOA 1Z89A 2ZYFA 4UFKA 3TX9A 4Y96A 4NXSA 3LCWA 3UXKA 3WIJA 2RAGA 4KQNA 1Q63A 3WX7A 4JHOA 4HMEA 4GFIA 8RUCA 3QHNA 3RRXA 3UCQA 4N6FA 1SO4A 1A3XA 1UOZA 3TLQA 3DKJA 4Z0JA 2WO5A 4D6CA 3R8HA 1C3FA 3QXBA 2Z6IA 4OTKA 1YTDA 2TPSA 3W2UA 2HK0A 4L61A 5AC4A 3SUWA 3S9ZA 4QBXA 4ADUA 4ATWA 3A9BA 3JR2A 3MCOA 1X6LA 3HN3A 1XPGA 4EOUA 3POHA 1AMYA 1MDLA 1MQPA 2E6DA 1I6NA 4LVAA 3TQPA 4NASA 1KTBA 3DG3A 3R58A 3B8UA 1WUFA 2I5QA 2VUNA 4I5XA 3W85A 1OIFA 1UR9A 2BODX 3BICA 2MANA 4ZSTA 1FWWA 2ZZ7A 4FXRA 4B2DA 4XZMX 4MLRA 5HATA 4UMBA 3WF1A 3EOSA 4PA8A 1KBBA 3S5NA 3L4ZA 1H7WA 4FIQA 2RJGA 1DE5A 5HMFA 1OX4B 2ZXBA 4CNTA 1BG4A 4FI4A 1IT0A 4RDWA 2OYKA 2D2HA 1H09A 3UWVA 3UXLA 5K9XA 3TAKA 3B0VC 2OOFA 1GOXA 2PWDA 1WAWA 4GD0A 1EHAA 4ORMA 4Z1CA 1PKYA 3U5UA 3CHEA 1Z7AA 2DT3A 5G2HA 3QQ1A 3VNLA 1BWLA 4QIUA 3QPYA 4NKCA 1SQ7A 4LC6A 3ONBA 3GVGA 3EX3A 3Q94A 1E5JA 3R0UA 4ZO8A 3ABXA 4F0SA 1TV2A 2B81A 3GTXA 4GGBA 1XDJA 2B7QA 3MHFA 1S2TA 4UQCA 4I5RA 4LNCA 1MEIA 1QASA 2ZZ5A 3E9AA 5A8MA 2XGBA 4HNLA 3ZQ9A 1IWAA 2WVVA 3R11A 5FF4A 3GBDA 4DPQA 1ELSA 3CEPA 1PJ9A 3CNYA 2FQIA 1KBIA 2DZTA 5IFTA 3D3AA 4M7SA 4C60A 2C7FA 1S5VA 4JL1A 5T9CE 3W1LA 5GNZA 3AHVA 5FA5A 3QV8A 4DWSB 2W79A 2ISFA 2YX0A 2GQ9A 4JTDA 5CCZA 5I24A 2BHYA 3OIXA 4LEFA 3ITVA 4MFEA 5KSWA 3ES8A 2X1RA 1YE4A 3BV4A 3BOXA 3WUGA 3IVTA 2OYLA 3NVDA 5HNRA 9CGTA 2F84A 3LX9A 4LS0A 1C9WA 5KZDA 3LERA 3GU1A 5DEZA 5KTLA 1WDSA 2CC0A 1K7FA 1EYWA 2GGHA 4KWUA 1RALA 3T8LA 4ACZB 4K2SA 3NDYA 1W1IE 2V9DA 1XC6A 5I03A 1J6PA 3NYZA 4UNKA 4K8GA 4O13A 2VELA 2ONEA 3DG7A 4JY9A 2CLKA 1O5XA 1HF6A 3NL2A 3QY8A 5CZKA 3WQGA 3STEA 1KCLA 2ON3A 5BXPA 3UVIA 4H8VA 4YVXA 3KZSA 2J7GA 4AHPA 4GUIA 1KKOA 1S39A 1HJXA 5KITA 1E0WA 3MMWA 4UOQA 1GVYA 3OZYA 4LU0A 4AD5A 1H7RA 1Z8AA 2JK2A 3EDJA 4JTRA 1BSLA 4JICA 3B8TA 1Y5XA 3PBVA 2ZA2A 4AZHA 1OFBA 4F79A 5CZ0A 4WSJA 3NQMA 1S5NA 3AI0A 1P0NA 4I7WA 2HISA 4IGMA 2WOQA 3VNJA 4H8UA 3CAVA 3V75A 1UA3A 2I17A 2NX1A 5M03A 3BAIA 4BF9A 4WCJA 4G6CA 2YR1A 3IV3A 1OABA 3I3DA 1TIMA 3BMWA 3EMZA 3H55A 2GQAA 4ADTA 2HEJA 1QO2A 4IICA 1HKMA 1W5MA 3MV01 2NQHA 5MKGB 3EXSA 4CU7A 1FDJA 3ZJ6A 2HQAA 4QX4A 1T0OA 3J7HA 4WJXA 2JKEA 3WLNA 3P61A 2RHGA 1W1B1 1UUOA 2ZRXA 4AH7A 2AQOA 4MADA 4W7WA 4DZHA 5JBDA 4GYPC 3TROA 3YPIA 3V36A 1IEQA 3C8FA 1KKRA 2GGEA 1XSJA 3DEQA 1VRXA 4AHOA 1XLCA 2J47A 1DIEA 1U5HA 2J6XA 3QN3A 3WNPA 3LLFA 3WQ5A 4MLJA 2FPYA 1EL3A 1THFD 1R7OA 1CDGA 4LW7A 1BWVA 3M41A 4HP5A 3U48A 1TRIA 3D3FA 5EA9A 4US6A 1Q6DA 2XIJA 3VX0A 2VC7A 2EPHA 2OQHA 2DORA 1XG4A 3RLGA 3SSJA 1S2AA 3UG8A 5F4SA 3A4AA 4H9MA 4UWMA 3UJ2A 4UOJA 2H3DA 4KIRA 3PPCA 4HZ7A 2ZBTA 3LHZA 5I0DA 3BAXA 2XVPA 2C3ZA 3C0QA 1W1VA 4ATLA 1NJJA 1C91A 4RW3A 2EPLX 4A6GA 3NA8A 5BXRA 1OB0A 1PUDA 3E96A 1C8YA 4UTUA 3B8WA 3P7YA 5C9RA 4UOZA 4PR4A 1QNOA 2X30A 1XLAA 2QDEA 1KBJA 4YHGA 4MNLA 2FJUB 3AJ7A 1UASA 1N8IA 6XIMA 3LPPA 2XU2A 1E1EA 4IISA 2DZSA 5FD0A 3NJ3A 2YA1A 1ENUA 3T4CA 4M56A 1CECA 5LHEA 2OLSA 3CV7A 1OFQA 2YPIA 3LSBA 1HL8A 4E2OA 4DF0A 3E2SA 1ZGDA 2Y0FA 4RDZA 4H00A 2E1DA 3ABOA 3U2CA 5T26A 3ARYA 3QPZA 5HMDA 4AY1A 1NDZA 4NX5A 2OFJA 1FFQA 1G4SA 4O28A 4L6DA 3CK5A 4JTHA 3LTPA 3P82A 4AWEA 3SAZA 3AYRA 1MSSA 3HG2A 1J9YA 2TSYA 3F4NA 1ZALA 3W07A 1K6AA 1DL3A 1OSEA 4O15A 2R9RA 5GJPA 4O4WA 3S2CA 4D6DA 1E9YB 1VIWA 4YWSA 1B0IA 5JU6A 4GI6A 1UJQA 1WOAA 3DGBA 4HA3A 3N14A 2J7EA 3M5VA 3R5EA 5HMEA 1V3JA 1PDZA 5AYYA 3E0IA 1WUEA 3CT2A 2J9ZA 4MNKA 1WKFA 4GYFA 1LM1A 3AAMA 3B8IA 3NPWA 1IZCA 3TUUA 2PMQA 2PBGA 3UF9A 1XYLA 4FXSA 2OX1A 4UNIA 1R0MA 2QJNA 1CXLA 3HJZA 3E0LA 3MUIA 1JFXA 1LOQA 1QNQA 3VAVA 2WLYA 3FJ4A 3AROA 1K8ZA 1JPHA 2PURA 3C4UA 5EB8A 1U1UA 2WHJA 3WF4A 4BF5A 2WMGA 3LN3A 9XIMA 2HRWA 4PRWA 1BFNA 3HGRA 3IARA 1P7TB 1F3XA 2Y5SA 4IOTA 3VOJA 5D9NA 1MZRA 3VGFA 1EF3A 4P8WA 3FK4A 2H8XA 4XG1A 2P0OA 2YBUA 4HJFA 1UZHA 3VFLA 3WQPA 3ARPA 3WQ6A 2DIEA 4L4MA 2Y4SA 1JCXA 1S5TA 1FWBC 3DYMA 3CAKA 4GH1A 4ZR8A 4EXAA 3BAWA 4KETA 2PRMA 3SCOA 4G7EB 1OFAA 2WPGA 4RZ4A 3JRKA 2WBKA 3BLOA 1FWEC 4UQBA 5J5DA 3C6CA 2OT0A 4G1KA 3TNBA 3O63A 3L21A 3APGA 3W28A 3UJFA 4REQA 2I5IA 3IAQA 3B4YA 4ZBCA 1W31A 4ZTYA 2C71A 2AKZA 3M9YA 3MI3A 3O15A 5GNYA 1HG3A 2WPBA 4XZ9A 3AS0A 4N7QA 3ZVIA 4DAFA 2YW3A 3N73A 1S5WA 2OCZA 4JTFA 4L4PA 3V1PA 1W9BM 5KMYA 3ONCA 1PB0A 2Z25A 4XV0A 2X09A 3MQTA 3H2NA 1Q6EA 3ABSA 2Q71A 3JZUA 1XCWA 4GNJA 2HWGA 1X7IA 3B4UA 2ZE3A 3BAYA 3K8KA 1XG3A 5K7JA 2G4JA 4B5VA 1QWGA 2EO7A 4HB7A 1UYQA 4F0MA 1R3YA 4RE4A 5HQMA 3QSRA 4RE0A 3USZA 5JH2A 2WXDM 2Z24A 2VOTA 3RX4A 4QJ5B 1U22A 1XRVA 3C2RA 2W91A 2VDHA 3FHAA 3SGZA 4DF2A 1DXIA 1OBAA 2DY3A 1J5TA 3AICA 3O0FA 1FY6A 1LOLA 2H6RA 3O07A 2VGFA 2NVAA 4ZO7A 1OC5A 3QV9A 4Z1YA 1CCWB 2EPKX 1AJ2A 1XLLA 2REQA 4GO9A 4XAGA 4V1XA 5HJLA 4JN6A 1FKWA 4TMBA 4WZHA 4KCVA 4X9SA 5D38A 1I1WA 3RNDA 1UKQA 3TW6A 3WL0A 4HNCA 4RPPA 4F2TA 1PTAA 3UCCA 1TJ1A 5LIYX 1K7XA 3Q65A 2P3ZA 4XQ6A 3R43A 3CO8A 4LVBA 5I79A 1QI2A 1XYBA 1W3KA 1XIIA 3H4XA 4ONVA 4CCDA 2CERA 3FCPA 3PC0A 1GT8A 4EF9A 1JUBA 2CBUA 4WOQA 2ASHA 3WK1A 3NXLA 3TDFA 1GK8A 1XH2A 3QFEA 3M0VA 1YTEA 3W7EA 3VIHA 4C6MA 3LZ3A 3GFZA 3BOLA 3G0XA 4LUJA 7ENLA 2QAFA 5EMYA 3CHDA 3O7UA 3TSBA 4PB5A 1D9EA 5EMLA 5D9OA 3VIJA 3VM5A 3ZLHA 4NRSA 4YTRA 1BXCA 2V63A 3II1A 4NY2A 2FYMA 1EGMA 3ID7A 3PFMA 3W73A 1JF5A 3T07A 4MJ4A 5E9AA 4WF7A 5AYZA 4IP4A 2P10A 3UWYA 3E5BA 4LQ1A 2PWVA 4GUGA 1G4PA 2YDRA 5CG0A 3FY1A 1M9HA 3W81A 4RZ5A 1FHLA 1QPRA 4WKAA 3PFRA 8TIMA 1S2UA 1IZKA 2WQPA 3GY1A 1VKFA 9XIAA 1A5KC 4AZBA 1AJZA 7PTDA 1W56A 1V93A 4JFUA 4GIAA 3A64A 4PYSA 4IHCA 4ZZ9A 3HGSA 5DANA 3KXQA 4KH2A 2PP0A 4L7ZA 3P62A 3MS8A 2V5DA 3PY2A 5A2BA 1VEOA 2UWFA 4FP1A 4JNYA 4IM4A 4XIAA 2IQ0A 1I0DA 3WNOA 2OKOA 3RHGA 1H4PA 4QE4A 4AZ5A 4BFAA 1LL7A 4N6EA 1CGWA 3WDRA 3RXZA 3GXDA 2PDCA 3QMRA 1PIGA 2F9RA 4WD0A 1DHKA 2VFHA 4L4LA 3FIGA 1WXJA 3T09A 3WH9A 2SFPA 1EWDA 1KLYA 4JEJA 4YNGA 5EFFA 3UXAA 3K4DA 1E0TA 3H2CA 3IGHX 3LPOA 3MC5A 3HBLA 1JYXA 3TTYA 1EJ7L 2EF9A 1T41A 3BAKA 3WDIA 4JKMA 1LYXA 4ERAA 4QAIA 5G4EA 1V6UA 3KAOA 3IK4A 1KV5A 1FDZA 1RLCL 4JIEA 3DYPA 1KM3A 2CLFA 3LCIA 1Y5VA 3F03K 1A5NC 3N2OA 1VYSX 3WELA 4CNOA 4M3PA 3ZS4A 3AMLA 2Y5JA 1R47A 4MY8A 2XSBA 2DT2A 3MYOA 2V3GA 3I10A 1A53A 4E38A 1BVNP 3ITOA 3WO8A 1Q7ZA 3P5ZA 7ODCA 3GAKA 4MWAA 1WNOA 3IJ8A 4XAPA 1MVYA 2XSAA 1V3LA 5A1AA 2QVHA 1HGWA 1DWFM 3HM7A 4S3AA 2A7RA 2FVKA 3IAPA 3TMQA 1IXNA 3PUDA 1CB7B 3O0KA 1Q4NX 1GUVA 1XICA 4U3CA 1SO5A 2PD5A 4ZOAA 4PMOA 1K9TA 2Y61A 3RU8X 1C8XA 3WH5A 2AAAA 3W1UA 1FTXA 5E93A 2R14A 4P2VA 2GVEA 2F6XA 3NO1A 5A6BD 1PS9A 4N9BA 2ZX9A 2PGRA 3QC3A 2A7PA 3C61A 1YDOA 3MUZ1 3WNLA 4Q6XA 3URAA 3TQVA 4NJJA 1I60A 3I4EA 3NZPA 5CC3A 1Q85A 5H91A 4Q4QA 3KLLA 4N4PA 1E6XM 4L4OA 5C55A 5HNNA 3BQ5A 4QAWA 4B3LA 5JXQA 4JTJA 3A3WA 4AF0A 4FB7A 3LXBA 2DEPA 4V15A 4ZFMA 2BS9A 2A3EA 3CTTA 2V30A 1V0KA 5C5YA 3GDBA 3BZJA 4BEUA 1UA7A 4Y9OA 4E8CA 4YVVA 1JZ8A 2ZICA 5CKSA 3IUIA 1F5ZA 1B30A 1F07A 1LORA 2PZ0A 1CGYA 1V03A 5ABGA 4FAMA 1XW8A 3AJXA 1OFEA 1VJSA 4DJEA 3SQMA 1TYGA 4ZXOA 4CEUC 3JZEA 2CBIA 2GJNA 1LWIA 3MHUA 3R4IA 3RMEA 4Q8VA 2Z6JA 3UPMA 1JD9A 1ZJAA 3S5YA 2DZUA 2ZRYA 2VMFA 2FZMA 3LK6A 4QEEA 4E0CA 4Q4KA 2I9UA 4PCNA 4PODA 1EJRC 3VXGA 4RL3A 2YOCA 5HQEA 3VINA 4A29A 3QHMA 4IXXA 5DMMA 1P6WA 3IACA 2B4GA 1Y65A 4IWWA 2ZUVA 2A3BA 3T08A 2F2KA 1RQEA 4C5YA 4WK9A 1ISZA 1ZJHA 4NJIA 3G24A 2A0NA 4NILA 2O4QA 3LA4A 4UTFA 2DZXA 4CNNA 4IGSA 4JFSA 1E73M 2QKFA 4W86A 3GR7A 2IPGA 2E5CA 4GCXA 1ISXA 2Y7DA 1DIOA 4BWLA 1HO4A 1UC5A 4W7VA 1XR2A 3L4UA 4MHBA 3VNDA 4HSHA 2GOKA 3TFXA 3S4TA 3TXVA 2WJEA 1GZGA 1KC7A 4LCSA 1RP8A 4JGDA 1L6SA 3NGJA 2QJJA 5BU9A 2BMBA 4NSBA 2WSPA 5DELA 3QQWA 4J1OA 2A3HA 3FYPA 4R5EA 4GY1A 4UTWC 3S2LA 1ZAJA 2C18A 1IEVA 3NSXA 3S5SA 3PZGA 1JDFA 3SM0A 3ABRA 4LVGA 1REQA 2PDMA 2UZ9A 1SJCA 4UTTA 4JYDA 4FSAA 1MRAA 2UV8G 1Y8BA 1S3HA 3C2EA 4GIEA 4QFUA 3AMCA 1Q45A 4HBKA 3SSZA 4UC5A 3FJ6A 3O6CA 4MAVA 5XINA 1TPUA 2VQUA 4KPLA 1W32A 3RIKA 2ABBA 2WSQA 3LQLA 4DIAA 3TC3A 1H62A 2V5BA 5DMNA 3GC2A 5IRPA 2CITA 3GH5A 3RRAA 4MKSA 1MZHA 3VD9A 3GD6A 1H5VA 4JFVA 3W26A 3MKVA 4XUGA 5LSMA 2E5BA 2I57A 4GQBA 2XM1A 1KLZA 5CPNA 3W82A 3DAQA 3N1AA 4GJJA 4Y9AA 4DI9A 1VB9A 2GZXA 4Q8MA 4F4RA 3V7PA 3W2NA 1S46A 4I3GA 1W0MA 4NNBA 5LXXA 4R7JA 4FOJA 4B5TA 2DH2A 3N2MA 2INZA 3MJMA 4HPJA 1UWIA 1F2JA 4PMQA 1JPMA 3AOFA 2CBJA 1H3GA 2GVJA 5BWFA 1E9ZB 1KR0A 1NF7A 2W62A 1LJYA 1W9XA 3FLUA 1Y5WA 3NURA 2QNEA 4IP7A 3W7OA 4IFOA 3TJLA 4GI9A 2OYMA 2Y1HA 3QV6A 1TVNA 4U31A 3WQWA 5A8QA 3CL6A 1LQ2A 4J2MA 3CMFA 4F40A 1SFTA 2O7QA 3LPGA 4WKHA 4P8XA 2BOGX 3F4DA 3RCNA 2DZVA 3ZT6A 3BDKA 1BKSA 2HBVA 1H51A 3W7JA 4MMWA 1IIGA 4XZWA 3RPMA 2DZAA 5DCDA 3SCTA 2CWXA 2HPMA 2VVSA 1A4MA 3CH0A 3S5OA 1O66A 4KFNA 2EG7A 2ZUTA 3WQ4A 3WLRA 4R53A 1X8CA 2FPTA 2PDIA 6ALDA 4DBEA 1EC9A 1YDYA 2E09A 4E3VA 4H9XA 1YLVA 3S83A 3K1DA 1O5KA 1AQFA 2ZUWA 1FCUA 1AA1B 3UXIA 3WLKX 4C1NB 3OO2A 2Y7GA 2ZZ2A 1UD2A 3NNTA 2EPMX 1ADOA 1MNZA 5D02A 2BG5A 3PJUA 1LTDA 3RM9A 5HUPA 3FOKA 4A3QA 5LYRA 1QK0A 1QK2A 1W1PA 5E70A 3OQEA 1TV3A 4C1LA 4QTGA 3CWHA 3TVAA 1GEHA 3ARZA 4I90A 1AW5A 1FA2A 1UOKA 3WLPA 2WVUA 2QLYA 5AYIA 1ZJBA 2PTXA 5AN7A 2XH2A 2MNRA 1F7BA 2FJKA 3IIPA 1KFKA 3U4FA 3VKJA 4JYEA 2BHUA 4PTDA 4Q4OA 3MSGA 4H9YA 1M01A 1SYTA 5K2ZA 3VU2A 1V0MA 3HQNA 1CPUA 5D33A 1SJAA 1QPOA 4ZMGA 2XZ7A 4Q8QA 5E0KA 5FEZA 3K5XA 4AUBA 1KFEA 4B5UA 4L9XA 3VD7A 4AIEA 5CBIA 2FGLA 4GA8A 1LLZA 4GINA 4CQ9A 1GYLA 1FWCC 1W37A 4GG9A 2VC6A 2C8NA 4KRTA 1VFMA 1KGWA 4IPJA 2J8GA 3VOFA 4GABA 1ZL1A 5XIAA 3GQYA 1X7FA 5KZMA 3E6EA 4MB3A 4MNJA 4RXFA 3NQVA 2ATSA 3KBSA 4HT3A 2OSWA 3BLFA 2YDAA 4JQ3A 5IBXC 2XGZA 2DQWA 2DSUA 2Z2UA 1H5YA 3QR0A 5EBUA 1FX6A 2EKCA 2XIOA 4XD4A 3STGA 3VKAA 4DLMA 2BSLA 1LBFA 2PD9A 5TF0A 3B8DA 2Z1WA 2ZX6A 1FBAA 3PZVA 1V6WA 3F5JA 4D6EA 4MIMA 2ZA1A 1D8WA 3NQ6A 1XP3A 4Q8WA 2ZA3A 3Q4DA 1RAKA 1SO6A 2J8TA 4PUUA 3SCVA 3MP4A 5C8BB 3P67A 5FEXA 4W8LA 4MTVA 1MUCA 3N4FA 7TAAA 2E8ZA 2DZBA 2PC8A 5F4WA 4OV4A 1ZTVA 1CEOA 3QOMA 1WE5A 5BOEA 2UY2A 4P8UA 3BVJA 1IIHA 4WY0B 2GDVA 2HNEA 4Y7EA 3TFCA 1JEZA 5CPOA 3NXFA 4TX8A 1JFHA 4LEQA 4PUKA 4RV8A 1TWDA 2EJAA 7REQB 2NLIA 3I7RA 4R7WA 1V8EA 2FVMA 5BCAA 4EWJA 1QPNA 4C7FA 1E0VA 3ARRA 4MUZA 1GJPA 4WGXA 4PGLA 4QS6A 3T9PA 3GLCA 2YXXA 3ARSA 4UB9A 3G1FA 5CGTA 2CIPA 1WKDA 4AWUA 2WM1A 4JCLA 4R3UA 5E0CA 1QHZA 4UFMA 1GYNA 3ZIZA 1KTCA 3GFYA 3AIUA 1D3HA 2X2GA 3W84A 2PP1A 3BW3A 1PXGA 3CUGA 4W4QA 3ARVA 3EA1A 3WYZA 5I7GA 5AY7A 5FSDC 1I0BA 4UFJA 5F1VA 4MKNA 2VC5A 4ZEPA 3RGTA 3V5OA 4N0RA 4DBWA 3FNDA 2F7FA 4ZL1A 2W6RA 1W3LA 4W84A 1DPMA 4GE8A 1YIXA 2VX5A 3S0CA 2G3NA 1TA3B 1PZ3A 3BLLA 3KP0A 2PFHA 1YPFA 2J9XA 4JTKA 2Q3OA 3I3EA 2WW5A 2VXNA 5PTDA 5A6MA 3PUEA 4MOZA 3WQEA 2ZTJA 2PTDA 1K77A 3BCFA 3VABA 1XIDA 1G01A 3WLTA 1JDEA 1U5JA 4AIBA 3W3OA 2BXZA 1O5QA 2OB3A 4M5PA 5U7SA 2X0SA 3WNMA 3IVSA 4PBGA 3EGJA 1PCWA 3VUPA 2J13A 1AVAA 3QYSA 3CV6A 3RN6A 1GVIA 3DI1A 5HJYA 1QW7A 2OT1A 3GVVA 3NPVA 3WLMA 2Z00A 4FNTA 3VE9A 1E0UA 2ZCGA 3MSRA 4QEHA 3QR1A 1VF8A 5FJJA 1UR2A 1XLFA 4JTTA 3HZ3A 1HVQA 3T0CA 2IKHA 1TQJA 1VC4A 1K8XA 4GUHA 3SECA 3T2OA 1VS1A 3JS3A 4ML9A 1FXPA 2X42A 4H3DA 3ZMRA 1KB3A 3C3NA 1SPQA 1J6OA 1LT7A 3PR2A 4JX6A 3KRUA 4OHQA 5EPDA 2YBTA 3LY0A 3GXFA 5C7HA 5EKYA 5LA2A 4WRHA 4KMQA 1NH6A 2YL9A 4AIUA 1RY0A 2WV8A 4MUPA 2ODOA 3CC1A 1ZY9A 1GVQA 5AFDA 4E2DA 2NQLA 4GOAA 4RUBA 1NM9A 5H2ZA 3VDAA 4A3YA 1UD6A 4O0QA 3EKLA 2QXWA 1N8FA 4PCFA 1BPLB 3H4WA 3E0WA 1MXDA 3RLVA 3VNYA 4DPPA 3V0TA 3L0KA 3BG5A 3AYSA 1UKSA 1DIKA 5FOOA 2OG9A 2WC4A 1ESWA 2CLPA 4BZYA 1KM2A 2C0AA 5E1QA 2DSKA 4C6CA 3EOLA 4DJDC 1L8NA 1IEIA 4ZOBA 4ZQNA 3NUKA 4CU8A 3LNMA 2XINA 1P0DA 4CLMA 4KFPA 1JPKA 4J3XA 2HPIA 4IG2A 3PTQA 3TCEA 4CQAA 3DN5A 5HBFA 4V1YA 1EOKA 1I2QA 4D8AA 2W63A 4O0ZA 3SIZA 5DMLA 3HGOA 3QGVA 1F8IA 3S6TA 1SZRA 3EB3A 1JRCA 1K1DA 1U1HA 3THAA 1TTIA 3L4VA 2NQJA 2G95A 4GUJA 5DLCA 1B3YA 1POKA 1UCWA 3OYXA 2PDYA 3LBMA 3LTYA 5CPSA 4DO6A 3W0KA 4O16A 3UGRA 1VBHA 3BUVA 4DJDD 3N15A 2E6FA 2EAWA 3P8JA 3TSDA 1PBGA 4EXQA 1P6BA 2OSYA 3B0XA 4FNUA 3MP3A 3OQ8A 3P3BA 3W9ZA 4B90A 3ANYA 1CT5A 3SRFA 4EX4A 2DDXA 3L5AA 2VFIA 2WC3A 3FSUA 4W8AA 5E9XA 4LB3A 2GJLA 3QTPA 4IL2A 3UZYA 2Z0IA 4ZQRA 5JH1A 1E43A 5A8OA 3NQDA 4CN6A 4DN1A 2ZDRA 5MHBA 5CG7A 4FNRA 2PDFA 1TPB1 3AALA 4S39A 3WG6A 3KRZA 4UUIA 3NOEA 2CHNA 3CQHA 3QGKC 2BOFX 1Q2RA 2BTMA 2IKGA 4FOUA 1QNRA 1NFGA 1OK4A 4TIMA 4XD3A 3WBWA 1L2UA 1VHNA 4FF5A 2CZEA 4OT7A 2YKKA 4F8XA 2XN1A 1M1BA 5AHMA 3T0DA 5A2AA 1J0ZA 4H7VA 4RZ6A 2PS2A 3UT0A 1EQPA 1ONWA 4JTIA 4L1GA 4Q4MA 3FDGA 2C19A 3NSNA 3DYOA 5EL1A 1UROA 1A0CA 1IT8A 2NXHA 3KRSA 3UR8A 2WMJA 5I78A 3PZMA 1CXKA 3BC9A 3NM1A 5DFAA 1E0XA 5DRCA 1TG7A 4GQGA 3FAXA 5E6ZA 3N2TA 3QYQA 2NV9A 1QRQA 4P5UA 2FH8A 3GU2A 3PJXA 3R79A 1WDRA 3AXXA 3NQFA 3R25A 4AXNA 4JKKA 3HA1A 2RUSA 1K7EA 3TNOA 4NI3A 4DVOA 3OP2A 1Q7QA 1FH7A 2QQ6A 4M19A 3LCHA 3VC5A 3RX2A 4ZTXA 4GFSA 2V81A 1RD5A 1GEQA 3KEHA 1G4TA 5I6SA 5CZSA 1TJ2A 2V5KA 4KKXA 2BX7A 4H7ZA 1WYIA 3WKZA 4MDPA 2QCHA 2PLKA 4LALA 4AWTA 1PKLA 2HROA 3VCNA 4S3CA 1DV7A 4PTNA 1YRRA 4GH3A 1AZ1A 1YEYA 1WQ5A 4JTUA 1SFLA 3LM7A 1VENA 3VM7A 3SB0A 2FGBA 4N9EA 1GOQA 2JQXA 4OZOA 2RGLA 3TYAA 1VAHA 4KEVA 3OIHA 2HS8A 2DH3A 3SCSA 1ZP3A 2C1IA 4UTJA 3FEQA 2AL2A 3T0BA 1B57A 3ZXWA 1NARA 1H63A 3BW4A 3T05A 5H8MA 4HMCA 4URIA 1XGZA 1FXQA 4NYYA 1FWRA 1TFVA 2ZZ4A 1DQXA 3DBPA 5AC5A 3QQ0A 4H2HA 2Y70A 4U3AA 3GG1A 4YCPA 1JG9A 3W7CA 1MYRA 4KCWA 3NEHA 3PULA 4QM1A 4JD4A 3OB8A 3VGHA 1OZQA 3A21A 3LM3A 3K8LA 3LCXA 1EJXC 3R12A 4ATDA 1FP8A 2W3ZA 2C1HA 2VX4A 4LY4A 4PFHA 1US0A 1H0GA 1MQQA 1EEPA 1OQFA 5D37A 2AL1A 4GXMA 2XG9A 5FF7A 1UR1A 4FO4A 1VRDA 4OIFA 3QEZA 5BXTA 5I3IA 4PMDA 1BVWA 3NR0A 3HFYA 3CLMA 1N8WA 4AZIA 4IJCA 2CZFA 1M3UA 4P7NA 4G9PA 1SU5A 1JVNA 1JULA 4H8HA 2WMHA 2J24A 3T7VA 1HJWA 1RD6A 3O8AA 3UEQA 3LLDA 1NDWA 2R1LA 1TRDA 5JBEA 2W61A 3DI0A 2BZNA 4JXCA 3TR9A 5HANA 3H23A 1W91A 2HXTA 3ARWA 3RLHA 4EPKA 1XXXA 4C6QA 1XCXA 2P88A 1RJPA 5F4XA 2G3MA 4JHZA 1ODUA 2Q8ZA 1MNSA 1J01A 1FHVA 2XIIA 1PE1A 4PC8A 3NZQA 3BCJA 4LUSB 4Q7BA 2Y8UA 1SFSA 3W7DA 1BXBA 1QT1A 2X7VA 4TXEA 1H2JA 5FJTA 7TIMA 4PMXA 1MRQA 4GVIA 4POCA 1TPWA 2CZDA 2P1FA 3IIZA 4P7LA 2PRHA 4RV3A 1RBOB 1XM3A 3WQCA 1LROA 4NYUA 4M0XA 3FKRA 3NDZA 2DSVA 3T55A 1O4UA 4MAZA 3C0SA 1F8MA 3PG9A 2HXUA 1C9DA 3T6CA 3CAWA 1UR0A 3LXCA 5LNUA 1GORA 3D46A 2XSXA 1EGVA 2BBFA 2R82A 3E5PA 1VD6A 2VRQA 2OZTA 3W02A 4W89A 1KBKA 4MJZA 3M1ZA 1IEWA 4QQUA 3WK3A 4K3ZA 2Y5EA 1E6RA 1XBXA 3VNMA 1NY1A 2NUWA 3HF3A 1LZOA 5HQLA 4GX9A 3F1QA 3M7WA 4IUOA 2CKRA 3E74A 4O53A 1S5MA 1FCQA 5A6BA 3B8SA 4R88A 3UWWA 1AL8A 4AC7C 1DIDA 4AZGA 4J2PA 1HJSA 4HCLA 3OHIA 2PA6A 3HU7A 4C6IA 2JGQA 2VWSA 3OTRA 5DT5A 2EG6A 4JX5A 2GVYA 4KF1A 4W5UA 3SR7A 2PDBA 1X6NA 2VRJA 1QW9A 4GKTA 4P7OA 3CZKA 4IPNB 4OBSA 3WBEA 3GM8A 4S3GA 5BOFA 2YL5A 4H9ZA 1BRLB 2QW5A 5C7VA 4XX6A 1A5LC 3LSCA 1DHPA 2W92A 4NL1A 3S8HA 2VI0A 1DVJA 1SUXA 3CJPA 3NL5A 4JHMA 1WDQA 1TCDA 4Y8EA 4FA3A 4CEXC 4RJEA 3TEVA 4DM2A 2DUXA 3LHVA 3RG6A 3DUGA 1AJ0A 3T42A 5XIMA 4UFLA 1OT2A 4JTAA 2J66A 1UBPC 5HK4A 3VGEA 3CZEA 2C91A 4O52A 2A6NA 2KAUC 4A2SA 1H60A 4R9OA 3MP5A 1EQCA 5G1TA 3BGAA 4QROA 2OWCA 1ZLPA 4NZ1A 3V4BA 2GJRA 2ZWYA 2ZX8A 3M5YA 4IIFA 3JU2A 3MB9A 3UP8A 1GJUA 3AUOA 2G4FA 3GNXA 4CCEA 1YPIA 3PZOA 4MB1A 3H6OA 2CETA 1ONRA 1TO3A 2X0HA 3N2XA 4HMNA 2WVTA 1TPEA 2VEPA 1NEYA 4JQ1A 2E6YA 3ME3A 2ESCA 1B9BA 4O0KA 4DJFC 4RX0A 3ISIX 3LTSA 4PUMA 1TTPA 1Q65A 4DYKA 4GGHA 3QFWA 4GXWA 3BSGA 1GW9A 1KM5A 1N7KA 3KS5A 4F0HA 2ZUUA 4CQ8A 2E9MA 3OBAA 1UWAA 2NVDA 3W01A 3IUDA 1XLKA 4M29A 4AFYA 1A0DA 3BG3A 2P50A 3VI2A 3V3WA 3TP4A 4I9JA 1GQJA 1X1OA 1JNEA 3H54A 1DJWA 4YS1A 5E09A 1JIBA 3WK0A 3U3HA 3LS9A 3HQOA 4PCTA 4LCQA 2WJDA 1XS2A 3GTHA 4LF2A 3ICJA 4WQ6A 3NTYA 5HR6A 1BHGA 3PBYA 4LPCA 3TE9A 4AY7A 1MW0A 3NPXA 1RLDA 4KEUA 4HU8A 3GW0A 4LBSA 2A5HA 3C8NA 5BU6A 2J88A 2ZQ0A 3T2QA 4LUTA 3SJNA 3TAOA 2YYUA 1KFCA 1ONXA 1EGZA 1ONEA 3VKBA 2HE8A 1AUSL 3MJYA 2Z29A 5ABHA 3QOKA 1RPXA 1JCLA 3GRIA 3DU0A 3RMJA 3R7MA 3PTMA 2PDJA 2ZZ3A 5IOBA 1FP9A 2V3DA 2R94A 1H7PA 2W9MA 3PB0A 4RKAA 3H12A 1E72M 4C6JA 3WY1A 3T4WA