4C1NB

Corrinoid protein reactivation complex with activator
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
309
structure length
309
Chain Sequence
AVEVLKEKWNSKVVEVTLGTGDKTVTLGGDSTLPFLTFEGEMPNPPRFALEVFDTPPTDWPDILVEPFKDVINDPVAWAKKCVEYGADIVALRLVSAHPDGQNRSGAELAEVCKAVADAIDVPLMIIGCGVEEKDAEIFPVIGEALSGRNCLLSSATKDNYKPIVATCMVHGHSVVASAPLDINLSKQLNIMIMEMNLAPNRIIMDPLIGALGYGIEYSYSIIERMRLGALTGDKILAMPVVCFIGQEAWKAKEAKDPEVAEWGDYALRAIHWETVTTVALIQAGGHLFVMRHPKSLAEVKEHLKRILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBON MONOXIDE DEHYDROGENASE CORRINOID/IRON-SULFUR PROTEIN,
publication title ATP-Induced Electron Transfer by Redox-Selective Partner Recognition
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Oxidoreductase/metal binding protein
total genus 98
structure length 309
sequence length 309
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03599 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4c1nB01
4DAFA 1AJZA 2DZAA 2YCKX 3H2FA 4S3EA 1TX2A 3H21A 1AJ2A 4DJDC 4DJEA 2DQWA 4S23A 2H9AB 4C1NB 5JQ9A 3H2MA 4O1EA 3MCOA 2H9AA 4C1NA 4HB7A 1TWWA 1EYEA 4G9PA 3NOYA 1Q7QA 3H24A 4DJFC 4MWAD 4S3CA 1TWZA 1AD1A 3TYDA 2YCIX 3V5OA 3TYEA 1Q7ZA 4S3FA 4PZVA 3TYZA 1Q8AA 3H2AA 2BMBA 4DB7A 3H22A 3MCMA 4S3DA 4DJEC 2E7FA 3TYCA 4MWAB 3H2EA 3K13A 1Q7MA 3MCNA 3TZNA 2VEFA 2YCLB 4CCZA 3H23A 4O1FA 1TX0A 4NILA 4NHVA 2Y0FA 2Y5JA 4DJDD 3BOFA 3TYUA 3TR9A 3TYBA 4DJFD 3H2OA 4MWAE 2VP8A 4O0QA 3H2NA 4NL1A 4NIRA 3H2CA 1AD4A 2OGYA 4D8AA 4MWAA 4DAIA 4S3AA 3TYAA 2YCJA 2Y5SA 4S3BA 4MWAC 2YCLA 4S39A 4DJDA 1F6YA 2VEGA 1Q85A 3TZFA 4DJED 1AJ0A 4S38A 1Q8JA 1TWSA 4D8ZA 3BOLA 4DJFA 3H26A 4D9PA 2DZBA
chains in the Genus database with same CATH superfamily
1JCYA 3A9IA 2RDUA 1GYLA 1RR2A 1IT7A 1WBHA 3VZZA 2DP3A 3THAA 3FS2A 4X9SA 1CXKA 3WO8A 4UOJA 1A5BA 2HDJA 3SGZA 1XKYA 2YFNA 3QQWA 4WXYA 1NY1A 4R5EA 4HPNA 3PZMA 5CPQA 2OEKA 3T0TA 3QXBA 1NFBA 3DIPA 1TVNA 1ZP3A 1ME7A 1EGMA 3L4VA 4QIUA 4WGXA 2YLAA 1KM5A 3J7HA 1W5NA 4JYDA 3HB9A 1OD0A 3GTNA 1T8QA 3F2DA 3LCIA 1J93A 2QEZA 3HPXA 3VX0A 2A85A 3LXBA 1FWNA 3WQFA 1DQUA 3DFPA 1GW1A 4IHCA 1UBPC 5FF4A 1UOZA 4KMQA 5SWUA 1R3SA 1SZFA 3QR3A 3T6CA 3N11A 4DBUA 2QJIA 3VMOA 3OP2A 7REQB 1LTDA 4IIHA 3N29A 1OSEA 3A23A 1V02E 2OX1A 5FD0A 3H2CA 2HEJA 2Q8LA 1XSIA 1PKMA 3RR1A 5A8PA 1TJ0A 2PEVA 2VEGA 3KOXA 4UQCA 4NI8A 1XLBA 2EAWA 3WMSA 1J96A 3VDHA 4BS0A 2F6UA 1XYFA 1GPFA 1ZENA 1CGUA 4PUDA 1EA9C 1TV2A 2E25A 3QYQA 2PDHA 1PV8A 2XFYA 3ZWTA 4C1LA 1YEYA 1A49A 2IS7A 1C3FA 4LS0A 4ZA0A 4E2VA 1LRTA 1V77A 4E2DA 1WNOA 1BRLB 4XKYB 3OOQA 2YOCA 5KZMA 2EBNA 1W5MA 2A4AA 1POKA 4TVUA 1RCXB 2XN0A 3AAMA 2VUYA 3KTCA 4I3GA 3BV7A 3BAJA 2XIOA 2Q8ZA 1UD3A 3SRHA 2WC3A 4IICA 2CBUA 4J35A 5CZ0A 5T8GA 1ECQA 4C7DA 1YX1A 4JTRA 4LF2A 3GC4A 4MB4A 4ADSA 4MAVA 4IPPA 3T09A 4Y9AA 2JGQA 1TQJA 3MHGA 4M7SA 3DC0A 4Q4KA 3DG7A 4RNJA 4O13A 2QZRA 3TOPA 2XIQA 3M6YA 1B54A 3TYBA 1BWLA 3JRKA 2XINA 4ORMA 2ZICA 2PDFA 2EPNA 1UQZA 2ZRUA 1F7BA 3GB6A 1W9XA 3R43A 3P8IA 1ZAJA 2A79A 3LLDA 3T78A 4BF5A 1G5AA 3UJEA 4RNFA 3MYPA 1K9TA 3ZXWA 4R85A 3O6DA 3AXKA 3OZMA 1B3ZA 1FCVA 4CNTA 1AMKA 2I9UA 3LHZA 2Z29A 3CS2A 3KOFA 3BGAA 2I16A 4X61A 4KBXA 3SDOA 3PZQA 3W85A 4C6IA 1HKVA 3VO0A 1JZ5A 3WDRA 3RX4A 2QLYA 4E2OA 1MO0A 4KESA 5EL1A 1KC7A 4YWIA 1TCDA 4MF4A 4G5DA 3NSMA 1M7JA 3DHFA 3URBA 2Z2AA 1UMLA 1Q13A 4V2XA 3KWXA 3W07A 2VRQA 2R1NA 4NF7A 1Q8AA 1RQEA 2VWTA 1V4YA 3ZJ8A 3ITYA 5DN1A 4PGLA 3THDA 1FOBA 3IS4A 2DVXA 3H2EA 2BY2A 3XINA 6ALDA 3EWYA 1TTIA 3EX1A 4XQ6A 4MADA 2XH2A 3EPNA 2X8RA 3GDRA 2OR2A 3QYSA 1RHCA 1EKOA 5E6YA 3OLIA 4JNYA 2ACQA 3CUZA 2DSUA 3Q45A 2BBFA 3M0ZA 3W73A 1WXYA 3LZ3A 4FNUA 3R7MA 4PH6A 2Z1KA 3BAIA 4LNCA 3OZYA 4X2PA 1VCVA 1GORA 1UIPA 2OSWA 1E6PA 4WD0A 3A5VA 2OZ0A 2Y5SA 5JBFA 1TIWA 4S3GA 1LP6A 1J2WA 1JUKA 2INEA 1JCXA 3UGVA 2WZHA 1W9BM 2C8NA 1YE6A 4MTVA 4GCXA 1TPVA 2AL2B 3ITVA 3ABZA 1UR1A 3G77A 1XLCA 1CGYA 3QGAC 4H2HA 4HJFA 1B4KA 1P0BA 4GUJA 4WIWA 2A3HA 2GJNA 4MNJA 3OLEA 3GIPA 1WA3A 3QN3A 2HPIA 3SRFA 3WLKX 1E72M 2CBIA 4REQA 3W1MA 2BY3A 2VEIA 3IRSA 4MPKA 3WLQA 3UY8A 3WQ8A 3EMZA 2HRWA 4LV9A 3N15A 3NDZA 2CNCA 2FZMA 1PS9A 3UG5A 1HKMA 3GKAA 3AROA 3ZQ9A 2BNJA 1EC7A 1O4UA 1XIBA 4TTUA 4FPSA 2VZUA 4M1BA 3A13A 5KEZA 1XISA 2DH3A 1KFWA 4RZ4A 5E5CA 5FJOA 4HHMA 4S1FA 4KERA 3P62A 1NSJA 4B9YA 3RF9A 2R9RA 5D37A 3QKZA 3PTQA 1ZHAA 1QMLA 4S3AA 3UJSA 1DTUA 3R6IA 2BP1A 3EX6A 3OA3A 4NJIA 4YYFA 3OVQA 1ZTVA 2Z24A 4INFA 4HPHA 1LG1A 2VMFA 1S2WA 5TNVA 4HA4A 3TC7A 3BXWA 1D8CA 5FF2A 4DX3A 4HTBA 4JN8A 4F66A 2HXUA 2VX6A 3U2ZA 4AZ6A 4F0HA 2WMFA 3TTYA 2ZC8A 1KGUA 2TYSA 3O3RA 1BWVA 1NH6A 4O1EA 4CU7A 4UR8A 4CD6A 3IPWA 2X41A 1TPWA 3RILA 3L0GA 3O15A 3TW6A 3MP3A 3U2CA 3GG8A 1G7UA 1DJQA 1LUCA 3WF2A 4I6VA 4TMBA 3VAVA 1B3XA 1LQAA 4LRTA 2HQAA 3WLJA 4HSOA 1TSIA 1J6OA 4FAMA 3UG4A 1X7IA 4MFEA 2E67A 1KR1A 2J9YA 5LNWA 4OBSA 1E1CB 5D9NA 3OHMB 1WUFA 2CHRA 4F2TA 1W9PA 2GJXA 3QJAA 3P74A 4XO6A 4I7UA 2PDKA 4KFOA 2OQHA 1QHZA 3FV9A 3U7VA 4B92A 3T0AA 1XSKA 4PMQA 3C0LA 1A5LC 1S2AA 2PLKA 2Z2UA 4WSKA 1UKQA 1V6YA 5C7HA 4P8WA 2Q02A 5E0KA 4JXCA 3RHGA 3EGJA 4D8ZA 1XV8A 4HYVA 2WNQA 4GYJA 1LRQA 3WBYA 4AZIA 1XH0A 5AYXA 5HR6A 3MHFA 2YL6A 4HK6A 1ONWA 2GLKA 2VHLA 1PCWA 4FX8A 3TQPA 3T2PA 4OHQA 1TWWA 1E6RA 1W37A 1BQCA 3S1VA 3LA4A 4EPKA 2WJEA 4FF7A 1R3TA 1YLVA 4H04A 2QDEA 2BVDA 2HVMA 2Y7EA 1B1YA 1RK6A 3KBJA 3ZSTA 1WZKA 2C19A 3VNKA 1I0DA 4K6AA 3TJIA 2E7FA 2YXXA 4E8DA 4D6FA 2D22A 1MQRA 5FJTA 1VHCA 2FYMA 5HQEA 3WF1A 1TQXA 1F3XA 2XH7A 4NASA 1CNVA 2VELA 3I3DA 3U4AA 1OYCA 1W9VA 4JTFA 1MDRA 3BDKA 3V16A 3O7UA 3P67A 1ZL1A 4Q4QA 1JD7A 1XIDA 4X63A 4L65A 4KS0A 1B5TA 2QCNA 1ELSA 1JQVA 1UPMB 2QGYA 5AYZA 2FTWA 1PPIA 4AZCA 1P4CA 1M1BA 4XG1A 1L2UA 3OLDA 1JPHA 5HNUA 1O94A 1XIFA 1EBHA 2PI6A 2ZRXA 4OECA 2POZA 4GZ7A 4AWUA 3UJRA 2PSNA 3ISIX 2BG5A 5C7VA 1PWLA 2YDQA 5HNNA 1KM1A 4MDPA 2GVEA 4AEFA 3V0SA 2VX7A 4XAGA 4LYPA 3LUTA 3HGRA 3EAUA 3EB3A 1T99A 3WDHA 4LBRA 4LVFA 3LQGA 3RPTA 5D38A 4MNMA 2X0SA 3W6YA 1KFJA 5FEZA 3W1LA 1XF0A 2H6RA 1IEIA 2PLMA 4LYRA 3WL0A 4PMZA 4QQ3A 3VGHA 4DB7A 1SO3A 2W92A 1WOBA 2DVTA 4U28A 1CZ1A 4MHBA 1E0UA 5AY7A 1P6CA 2V6AA 3G1DA 3T55A 1EZWA 5KINA 4AC1X 1QW7A 2XM1A 1CYGA 2VD8A 5CG0A 3UXIA 2FFIA 2HTMA 3HMCA 5HWJA 3BQ6A 4L6HA 3ABSA 6TIMA 3WQGA 5MKGB 1W31A 1EDQA 1OG0A 1XGZA 2YYTA 2R1KA 3OTRA 3BJFA 4IUOA 1MNSA 1S3HA 3M07A 2WQDA 5EMMA 1RBLA 2V5CA 3G6LA 1SPQA 2F38A 3AXIA 3LZ5A 1J0ZA 4H4IA 4E4PA 3GHUA 4Z1CA 2HZGA 2NXGA 2XN1A 2H8ZA 4ZB5A 1DJIA 1W1IE 3DHDA 5HMFA 4IIGA 1EWDA 3AHVA 3TCEA 4L4PA 5BOFA 4UQDA 2RKXA 1PKLA 1FUYA 5D09A 3W1PA 1CGTA 5C2CA 4FR1A 2VFIA 3TU9A 2F2KA 4FZIA 3B9NA 1GOKA 3ANUA 3DFYA 2ZWYA 3BPWA 3AIQA 4QEHA 5IRPA 1EOKA 1IWBA 2FZNA 1QTWA 2WVTA 4Z2HA 1K4GA 4DPQA 4EOUA 3VD4A 1SO5A 1VFUA 1W1B1 3CUHA 5D9MA 3FNDA 1VFSA 3MVIA 2VXNA 2J7FA 4NJGA 2C91A 5I3FA 4OOZA 2P8CA 1ADOA 3LG3A 3TN6A 1U33A 3C6CA 2J13A 2W66A 1XGDA 1GPWA 3LCHA 4Y9NA 4IP7A 4LX4A 2ZZ1A 1F76A 3GIQA 2PWHA 2YYUA 2Z00A 3NWRA 4HSNA 1K8YA 1KFKA 4GIRA 3CLMA 2PGEA 3ERPA 2G4JA 2G3IA 4M6QA 4IMFA 1QOXA 5G2WA 1UH3A 3H4XA 3EWCA 4B5TA 1MEIA 3PSVA 3P5YA 5EBAA 1WDRA 1RQHA 4AZHA 3BG9A 1LOLA 3QFWA 2C1GA 3GO2A 1QK0A 4AIEA 4IMAA 1KBKA 4O1AA 3AUOA 3LQLA 2XFRA 1FFRA 2ZE0A 4WDTA 3QZEA 3LU2A 4GQBA 3H54A 5A6BD 3GYCA 4GH1A 1K7XA 4AHPA 4XWUA 4JNZA 4EACA 1UWRA 4R88A 5AHMA 2O9RA 4FXSA 3AHTA 2ABAA 2VX4A 3A24A 3CV2A 5IBXC 2PCQA 3LHUA 4ZB2A 3W87A 1E1EA 4GXWA 4MIMA 3EXSA 1A0DA 3SCVA 2WV8A 3HJZA 3E38A 3SADA 1RH9A 2YJQA 4QQUA 3WN6A 3R13A 5CZSA 3F4CA 5LIWX 3G24A 1FBAA 2G3MA 4D1JA 5C0QA 2A3CA 2ZYFA 4NQ1A 3NPWA 1CLXA 4O18A 4PCTA 1Q45A 2BWGA 2V2HA 2F7FA 4JS3A 1D3HA 4PA8A 1E40A 4KCVA 4PODA 2DZAA 2QW5A 3AHYA 2D24A 3GHSA 1EDTA 3UZZA 5BXRA 1Q6RA 3U5UA 3NGFA 2NXHA 4Z2LA 3NTYA 4C91A 4HK5A 1W1ZA 3WENA 4DN1A 3G3MA 1TVLA 3GC5A 2ZTKA 3QLLA 1J0JA 2HBVA 1HNYA 4R9XA 3GFXA 1IV8A 5EB8A 1CPUA 4FR6A 3SO7A 2WC7A 3P14A 5HWMA 4B2DA 4J3WA 3T7VA 1OCQA 2VD9A 3TQKA 1OM0A 1FWTA 1X39A 2INZA 4G6CA 3IGSA 1XHGA 4LQ1A 2V3GA 3W70A 4IP4A 1JRCA 3QRHA 2QMJA 3UYIA 5BOEA 1A4LA 1E3XA 4IFKB 3P80A 3TAOA 4AF0B 3UR7A 4UFMA 1XIMA 3KM8A 1OABA 3MUZ1 3V4BA 2HVOA 1JD9A 1OIFA 2P50A 4ENLA 4RKAA 4DLFA 1QFEA 3EWWA 3UCDA 1EJ7L 3U0HA 1TPEA 3WBEA 2YCLA 3WD0A 5GQBA 5K9CA 5AVNA 4AISA 1EJWC 2CLIA 1RP9A 1U5HA 3QMSA 3W6MA 1DJNA 2DZBA 5T91A 4UTFA 1CXFA 4UMAA 4WQ6A 3RLUA 3VABA 3EOLA 4A6GA 1HG3A 1TTPA 5H6HA 1V3MA 4DWDA 2WOQA 1ADDA 4O0ZA 3NSXA 5DF0A 2OFJA 2UV8G 2GGGA 2YGYA 4DJFC 4JQ1A 2BOEX 2J74A 4DYJA 4H6EA 2VUNA 2R1PA 2Y89A 1Z7AA 4JN6A 3HO8A 4HZ8A 3BSGA 4W8LA 3I7SA 2J88A 1MXDA 2HS8A 1XIJA 4CKQA 1EXPA 4XZNX 3SSJA 4CCCA 5BZAA 3NOEA 4E6MA 3W7IA 1FCBA 1DJGA 2GVLA 4GVIA 1Z3NA 3WNLA 3M0JA 3AI0A 1R87A 1TV4A 3W7DA 2IXVA 1VEOA 2C18A 5AC5A 2WJFA 4DAIA 1VYPX 3B8UA 3NQBA 1MQQA 4J3TA 4MWAC 2WC4A 4LVDA 3HF3A 3UNDA 3MA8A 5EYWA 3QHMA 3NQAA 1VPXA 1V6XA 2VC7A 3QV8A 5ABEA 1P6WA 2OYLA 2ANUA 1OY0A 4DAFA 2X7WA 5E9AA 5HOSA 2NZLA 3ICJA 3WLMA 4UNLA 5CC6A 1S5VA 2QJGA 3UJ2A 4JTAA 4P61A 4GC3A 4PCSA 1CB2A 3M0IA 4B3LA 3RNDA 3TKFA 3ARQA 2W9MA 5I7GA 3I65A 1SFTA 3URNA 4W87A 2G0WA 3ABQA 1XPGA 4PMJA 2ZZ4A 3GDTA 2YB1A 3OG2A 4PULA 5I77A 1UR2A 1GZJA 1VB9A 4L6DA 1V03A 3WSUA 4FOKA 1HZYA 3BE7A 1FDJA 1OT1A 1KV5A 3W88A 3POHA 5A8MA 4P2VA 1QW9A 2QT3A 1B57A 4A8IA 3DG6A 3P84A 4FLQA 2WSPA 1D3GA 2D20A 4JHOA 4AD5A 3GKFA 2X2GA 1VBRA 3C2FA 3P61A 3TLQA 2FMOA 3ABOA 3QV6A 4V1YA 3FAXA 4IL0A 4NAEB 4J7RA 4P8VA 3VE7A 3CO8A 5F4SA 1JDCA 4HD5A 4AVNA 4LCQA 1QO5A 3FXGA 2TAAA 3L68A 3SGGA 1U83A 2DVUA 2HJPA 1FA2A 1ZRQA 5D9OA 5G2IA 2ZUSA 4YMZA 1US2A 1OC7A 3P82A 1I4NA 4X0NA 2DSVA 1W0MA 5HPOA 2UBPC 3VE9A 1ZJBA 3PPFA 3VX1A 4O28A 4LFYA 1EHAA 4GGBA 3CUGA 1REQA 1GVSA 3ANVA 4ORIA 7TIMA 3SUVA 4WHBA 1N7KA 4PMXA 4HNLA 1AQMA 2HS6A 1YBQA 4O50A 3S2CA 3GBDA 5H1WA 3G1SA 4J3UA 1GTHA 2GL5A 2ZUNA 3LD5A 3P93A 1HP4A 1EIXA 3AZRA 3NQFA 3U8GA 4EX4A 1IHIA 1QATA 1UR4A 3GTXA 2Z4GA 2QJNA 3R8HA 5LNUA 3TQ0A 1FH8A 4LY8A 4Q22A 3R25A 4KEMA 4ADUA 4P5UA 1DBTA 4UTLA 1E0VA 2PDMA 4CCZA 3W00A 1LQ2A 1BG9A 4HNVA 3WNKA 4PL1A 2OKTA 2ZRVA 3CAQA 1DXIA 4GBUA 3EDDA 5BU6A 1F3EA 2VEMA 1FTXA 2Y4SA 1LBFA 5TF0A 3GY1A 1JR1A 3NQ2A 1OCJA 4DHGA 4ES4A 4HOXA 1WDDA 3LOTA 4IIDA 1VP5A 5AHLA 4AVOA 3MJMA 2V5DA 1VAHA 1QVBA 1UR8A 5BU9A 3PAOA 3ALFA 1PX4A 1XW8A 4J3ZA 1EGVA 3RX2A 4DNHA 2JFEX 2GOUA 3CZKA 5IFPA 3ZYZA 3C0JA 3TJ4A 1UPPA 4RX0A 1SUXA 1O6IA 3LRLA 2NQHA 1QCWA 4UUIA 3IANA 1T40A 4DO7A 1LLZA 1ZBWA 1DE5A 3ITCA 4XUGA 2DZWA 3BARA 5KZDA 4XAZA 1EC9A 4RE3A 2ZZ7A 3CPGA 1D3CA 3N6QA 4WZHA 2A0NA 5AECA 3AOFA 2NXIA 1A5CA 4IJBA 3UZJA 1R2RA 3C4UA 1T5AA 2A21A 5E1QA 4NHVA 5JU6A 4JDYA 3UF9A 4M6UA 1YDOA 2YDRA 1FWIC 2R94A 2J47A 2QKFA 4IZGA 2CZEA 4XK2A 2GDUA 3WUBA 2BZNA 2J78A 1F9CA 4AXNA 4NYYA 1QWGA 3W4RA 1YE4A 3TQVA 2QAPA 4Z0SA 2YXOA 4RXGA 3I3BA 4MWAA 1ITQA 1CXEA 1DWJM 1GJPA 1QPOA 4Q4MA 5HMSA 1OINA 2OLSA 1M04A 3F4WA 1D7FA 3UU0A 3W3OA 4Y9MA 1CXLA 1FCQA 1G4SA 2RFGA 4R53A 3H26A 1O68A 1P7TA 3MJYA 3PB0A 5GPRA 4UTUA 2OJPA 9RUBA 3S6DA 1FHVA 4L6OA 2ISSA 3DFNA 5M2FX 3S3GA 3S46A 1LYXA 2WLYA 4KT2A 3Q37A 3BGGA 3CL8A 3EWBX 1JPMA 4IQEA 1YHTA 1KQZA 4R27A 1XKJA 3HG4A 2DU2A 1R7AA 3TSDA 1TWZA 3PJXA 5K4ZA 3FDGA 4NY2A 3HJEA 1WAWA 3CWNA 3TCSA 3W1XA 1AQ0A 2OWCA 3S83A 2RAGA 4J2PA 3D46A 1JCNA 5AHEA 1ZBCA 1TX0A 5C70A 1GUVA 3MZ2A 1HVQA 1I9CB 1JZ2A 2W5FA 2G37A 2WQPA 5FI8A 3GG1A 1B30A 3B8SA 5DBUA 2SFPA 5BRQA 4H19A 2ZUUA 4LVAA 1R3VA 1WE5A 4JL2A 2RGMA 3BMXA 2C0HA 1MFUA 1MEHA 2CWNA 2ISVA 1NF7A 2TRSA 4GK8A 4JN7A 4DJDA 2GZXA 3ORWA 1A5OC 3P2VA 4PMYA 1E4IA 1P1XA 1W3TA 3LEPA 3OODA 3ARYA 4B5WA 4GUIA 2ABBA 1F4HA 1SJAA 5C5YA 4OWGA 4BWLC 3UZYA 3CO4A 1Y5VA 5IHRA 3H2FA 3S0CA 1IE7C 3USBA 2NLIA 5F4WA 3ALGA 2QCHA 1GG0A 1ENUA 4B5VA 1E55A 4BK9A 1V3KA 4UTWA 4XB3A 1QOPA 3G1VA 1W54A 4RDYA 5A6JA 4LYQA 4GWEA 3SW6A 1XSJA 3OBAA 4WXZA 4QJ3B 1MW3A 3EXRA 1LWIA 1LLOA 1Z6KA 3PFMA 3QR1A 1NARA 3L12A 2FPTA 3QW4B 2W4XA 4Y90A 1R7OA 5I00A 3B9OA 5DCDA 3PUOA 1R38A 2H90A 4XTDA 2J4GA 2AGTA 3THUA 3TA6A 1GZ1A 4LPCA 3B06A 4ZENA 1QPQA 1XH2A 3DU0A 3MT1A 3APYA 4GI8A 3OBEA 4XBJA 2CCRA 5C8BB 3UWUA 1Z44A 1M03A 2DZVA 3W24A 1WDPA 4MDOA 2R14A 3GXMA 1YRRA 1JZ8A 3BLFA 2PGFA 5DEZA 4BA0A 1ZSXA 3MSRA 1WXZA 2ICSA 1CXIA 1K9EA 1XUZA 5DX7A 1BGGA 1X1ZA 2G97A 3IGHX 5K2ZA 3GNOA 3R12A 1ZFJA 3O2LA 2G8ZA 2YCEA 3CWHA 3SCUA 1H7RA 1G6CA 1QJWA 2QJHA 1OG6A 3BLOA 5LHFA 2PRMA 3CASA 3F5KA 4XZIA 3CPRA 4TUFA 2ADAA 4FB7A 2FMNA 5LIUX 4UB9A 3SGUA 3C8FA 5LHEA 2W3ZA 1BRLA 4XKYA 2V30A 4TU1A 1SM9A 1IZJA 3HG5A 3LCLA 4UTTC 1BQGA 3FKKA 1VBGA 4D72A 3QMRA 1W9DM 5AC4A 2GJXB 1NP2A 4IXHA 2ZDSA 3KAOA 3VIOA 3HURA 3DN5A 1JF6A 1LDCA 4N42A 3W84A 3QZAA 5CSSA 2PDPA 2DIKA 5CLWA 3ARXA 3LM7A 3VM5A 3MDUA 3TC3A 4PRTA 2PS2A 5AYYA 3KVKA 4W86A 4BF7A 3VI2A 1WCGA 4QCFA 2PRLA 1YIXA 4H9ZA 1DWAM 2HMCA 5I0DA 3TLLA 1BGAA 3L2MA 1VJIA 1SSDA 1WKDA 5FJRA 3LSBA 3SFKA 3TONA 5HINA 4S39A 3BTNA 2I57A 2DT3A 1EX1A 1GOMA 5FJJA 4EXAA 2CEQA 2W27A 3L67A 1PWMA 2FH6A 1K02A 4NZ4A 4GCAA 3WQEA 1KKOA 3GU2A 1X6NA 2GSHA 3NUKA 5TAOA 3KBWA 2HK1A 3LENA 4IFRA 4H9YA 4KPLA 1IXQA 3PPCA 4HU0A 2C6QA 2OLHA 3HV9A 2ZUMA 2B7NA 4XAPA 3E0FA 2MNRA 1UZ4A 3B8DA 1TZ9A 2X05A 4KGLA 5BCAA 4D6HA 4E3VA 4A05A 3HM7A 4WOZA 2QULA 3E0VA 3PUGA 1IQ8A 1MRAA 3PZVA 1UOKA 1EPVA 3SEPA 3ARZA 3T4CA 5FF3A 2ZZ6A 3BLPX 1CLVA 2FGZA 4WUIA 1MUCA 3STGA 1QHPA 1L2QA 1DE6A 3PR2A 3MWCA 4W5ZA 3LI1A 1JDFA 3BW2A 1SO6A 1G69A 1HJVA 3TDFA 2E0PA 3WH8A 4HU4A 3BUVA 1J0YA 4IGSA 4JD4A 4NI3A 1AW2A 4RK8A 2FB2A 3CUJA 3NM3A 1BVWA 3KLLA 4I8YA 1ISZA 4D8AA 3WEOA 1TZ7A 3E2VA 1NFGA 4WKAA 4IGHA 4JYEA 2DY3A 3CT2A 4AC7C 4ATLA 4L56A 1TMLA 3RM8A 3WY1A 1R3QA 4H3DA 1M6JA 2VOMA 3GQYA 5HWNA 3T05A 4AX7A 4H7VA 4KFPA 2AMXA 2QJJA 4U4MA 2VJXA 4FOJA 2AL2A 3LCWA 4HN8A 3U2EA 5AB3A 4D6DA 1PIFA 4H6QA 3AZSA 3I3EA 3M0MA 1E0XA 2VVSA 1QAPA 4ZXOA 2J7CA 3GLCA 1CDGA 5HXMA 3I6EA 5G1YA 4WDUA 2E77A 3W7GA 1OK6A 5AZ0A 3I68A 3QTPA 3KE0A 3WBAA 3MCMA 1POJA 1PYMA 3IJDA 4NSBA 1BVZA 4JBRA 1OF8A 5AVHA 2WMKA 1XYZA 1JXKA 3BOFA 1ZS2A 3W75A 1MUWA 3EX3A 5FEPA 2WMHA 4Z17A 2PC8A 4XVDA 1GQJA 4UQBA 3UR2A 5H2ZA 2GJRA 2Q71A 4KEUA 2NX1A 2PDGA 6PTDA 2OO0A 8RUCA 4BI6A 2GFTA 3CJPA 3SQLA 3EOUA 3G1YA 4CN1A 4YL2A 1BG4A 4A2SA 4BFAA 4C6MA 2DDXA 3F1QA 1Y8BA 4ZVJA 3APTA 3MSGA 5HBFA 3W23A 3K30A 3UESA 3S42A 1MFVA 4YS1A 4WEVX 4S23A 4UFLA 1I2OA 4UTTA 3CU2A 3ZS4A 4L9ZA 4XD6A 3UVIA 3GH4A 1QBAA 3PTKA 3R79A 1X1NA 4MY9A 4WRHA 2GGEA 3ES8A 4Y6GA 4XSLA 4A22A 5DFAA 3CM4A 3PJWA 5JBDA 1MEWA 1U1HA 3STFA 2AQOA 4B91A 1ONEA 4QDMA 4F3HA 4O1CA 5G1TA 3WJZA 5KSWA 3MP4A 3ITGA 1TFVA 1NDZA 3H7UA 4H8HA 4GFIA 1NU5A 5E93A 4XIMA 1TE6A 2YW3A 4UWMA 4GIEA 4C6LA 3OU8A 3SN0A 3SCNA 1UWAA 2I5GA 3IVUA 5BROA 1E1CA 3TR9A 1UA3A 4DJFD 5HQLA 2UY3A 3LPOA 5T9BG 1H1NA 4JCLA 5IXEA 4C90A 1SU5A 5BXPA 3S1GA 3U48A 3E12A 3VKDA 1Z8AA 1WKFA 2OU4A 2QDGA 2Y70A 4G7FA 3IUHA 5JIPA 4MZ1A 4ROQA 3WNPA 4RW5A 4D9PA 1KM0A 3S8HA 4V27A 3DC8A 4GACA 4UZSA 1E6XM 4S3EA 4QROA 4LBSA 2XZ9A 4CU6A 4YLWA 3NM1A 2A3EA 4ICNA 5KZEA 1RJQA 4FXFA 4Q8TA 1PX8A 1AL7A 1RVGA 1KM2A 4MWAD 4NG3A 3HPZA 2QQ6A 1DORA 4UNKA 4AUBA 3K1DA 3GXNA 1GJUA 3TYZA 3E1F1 3B0XA 2BMBA 3NDYA 4NNAA 3L5MA 4DJEC 1TA3A 3D6NA 4OQVA 3AJXA 3AYVA 4TX6A 2Z1BA 2F84A 4IX2A 1XBYA 1ZU8A 2OGJA 3R0UA 3N6JA 2EPKX 1PTDA 1QNRA 4AG0A 1K8CA 8A3HA 3G6MA 4Q32A 5HATA 2XHYA 1RZMA 5CCZA 1KGXA 4WSJA 3UETA 2G50A 4HJWA 4U3AA 1NJJA 4HBKA 1UCWA 4CQ8A 3QOKA 4XZBA 1C7TA 5XIMA 1OGBA 4F8XA 4FNSA 2CKSA 3R89A 3GYEA 3CZLA 4GMEA 3CYJA 3BJTA 1QI4A 3CEPA 5BXSA 2X1RA 3SUSA 3NIYA 3PK7A 4JIPA 2H8XA 3N14A 1MW2A 4TIMA 2WHJA 3RCNA 5E09A 4AZ5A 4CLMA 1K6WA 4XX6A 2X1SA 1GHRA 1LWHA 3GE7A 4L7ZA 3C3UA 3ZVIA 1B4EA 3KLKA 4DYEA 3NZQA 4ZTXA 1XICA 4GIYA 3FFSA 4L1WA 2Y62A 1EO5A 4C1KA 3KRBA 2Q01A 1DPMA 3AYSA 3OIXA 2W63A 1VFOA 4YYCA 4DWSC 1W1VA 1E1FA 2Y8UA 4HA1A 4G9PA 1OFDA 1O60A 7ENLA 4M29A 3MQTA 4QLKA 1IEVA 2DW6A 4GBDA 4AHOA 2YXGA 3VOGA 1E6QM 5A8QA 2OG9A 3IK4A 2PDIA 3LLFA 2VFDA 1KCXA 4GPNA 2YCLB 2D2GA 2FFCA 3VUPA 1V3LA 2Z1WA 3RITA 3KX6A 3LPPA 4JOMA 2F8QA 4GY1A 1IT8A 1EP1A 4PMUA 2XVGA 2GSEA 3WF4A 4F79A 1NDWA 2X0YA 3PS7A 3IJIA 2PLJA 2VFFA 3UXDA 3UA4A 3VKJA 3T40A 3E2QA 4B90A 2GYIA 4A21A 4Z1BA 1XIIA 2OVLA 5MKGA 3ZLGA 1YXDA 4KIEA 3OVRA 3S4TA 5H8UA 4GG9A 2IPGA 1EC8A 1IGSA 1V0MA 2JQXA 3UPMA 1VRDA 4LANA 1RK5A 3O8AA 6A3HA 1ZCCA 3ZR4A 1V3IA 1XDJA 3A12A 2F6XA 4QG9A 2NVCA 1K8XA 3IGXA 4QR6A 1FH7A 2J8TA 4BCEA 1EDGA 1FFQA 1UD6A 4K8HA 1ALDA 4FO4A 4O15A 2D2JA 4TO8A 1K6AA 2CBJA 3ARRA 4OVXA 3NOYA 1Q7QA 5AC7A 2OYKA 1TV3A 3TYDA 3PG8A 1DIEA 4URIA 4B4HA 4PUJA 2ZUVA 3OGSA 1ZGDA 3WELA 2E68A 1XIEA 3O06A 2VZSA 1I6NA 3GG7A 5IDIA 5I09A 3D3AA 3CL6A 4PBEA 3V18A 4PUWA 3GR7A 3W29A 3W1QA 3WG6A 4GFSA 5ABHA 4CQBA 3U2OA 1V0KA 1NDYA 4WDWA 3H55A 1M01A 1NFPA 2YZ5A 3HV8A 3SCSA 2OODA 3FJNA 3PSWA 1HJUA 4RE4A 5D4YA 2IKIA 3VNMA 4ZQNA 4XZLX 2DSKA 2HWGA 2PDNA 3R94A 5E0CA 9CGTA 3VK5A 1ONXA 4ZGYA 4JX4A 4IUGA 1EF2A 5CJMA 1G0CA 4R34A 4XZMX 1H60A 3I6RA 3VGGA 1W5PA 2WLZA 3B9AA 6XIMA 3PY2A 2VRJA 5A2AA 1SW3A 1E51A 3W71A 3TP4A 4PTXA 3AXHA 4P7OA 3WUFA 4O57A 1Q6FA 3T1GA 3H53A 4C1NB 2Y2WA 2F2HA 3WF0A 3TUUA 3DFTA 3SY8A 1NWRA 5EMJA 3GXPA 5MF5A 1HN1A 2VFHA 4L1XA 3GHTA 4JTQA 3HQOA 1X8FA 1K3UA 3TN5A 3SI9A 3WLTA 1VEPA 5A6MA 2OPJA 1GVIA 4GI9A 4UC5A 4ACZA 1AODA 3N4EA 1M41A 3QPZA 2RDTA 3I7QA 4KWVA 4UCGA 1UKTA 3AQUA 4O4VA 1YXYA 2CW6A 1UWSA 1ZJIA 4BJHA 3WFLA 3BCJA 3BLKA 3HOJA 2BGSA 1US0A 2VNCA 1R86A 3RXZA 3D47A 1NWSA 4AY8A 3VNLA 3WLPA 1HQTA 3LDVA 4L80A 1GQNA 1JFHA 3VGBA 5K4XA 2A7RA 4DI9A 3I4EA 3T0BA 5GNZA 4F2BA 1ADSA 1S2CA 1SZGA 1JYNA 3QPYA 3VDBA 1FWGC 2DV0A 2AAAA 3EYPA 2HE5A 3GU1A 3M4HA 3FX4A 3MO4A 4IFOA 3P81A 4FIRA 3GW3A 3NA8A 1YPFA 2Z26A 1CTNA 1FCUA 1W56A 1TR9A 4GXMA 4J1OA 4GVFA 1YNPA 2ZX8A 4C6BA 1W1PA 2YDSA 4YJ5A 1RBOB 2WPBA 2XIMA 3GU9A 2W91A 4Q8UA 3U5YA 4ZE5A 4GO9A 1MSSA 3QGKC 2OXNA 1GGOA 1QW8A 5C9WA 5M3WA 3S5ZA 4LYKA 4LWWA 1H7WA 3CHVA 4QRNA 5KETA 1VHNA 2NQLA 2J27A 1V0NA 3O05A 3O9NA 2C1IA 2XVPA 3UT0A 1H4PA 4IMCA 2ZZ3A 3IVTA 2QV5A 3AUJA 2NSXA 2A3LA 3UPBA 3MSDA 3P8JA 4OUIA 1F6PA 4LB4A 4UFJA 4I6KA 2VP8A 3V1HA 4AF0A 3WMBA 4LT9A 1N8FA 2EXOA 4BQ4A 3LGDA 3QH2A 1OJXA 4N7QA 2PMQA 4I9JA 3HG3A 4OKDA 4IT1A 4DF0A 3NJ3A 1ISVA 2XZ7A 4Z08A 2V68A 3DXIA 3MMTA 7TAAA 4MYXA 3L4ZA 1Q4WA 2PDWA 4AIBA 3WX7A 5M03A 4FNRA 1HJXA 2DZTA 1AJZA 3GD6A 3GDBA 2YCKX 4UMBA 3SB0A 4Y9OA 1SQ7A 3T8LA 4M1RA 2VFEA 3N73A 3M5YA 3CQIA 2HROA 5DLCA 1HGYA 3C2RA 5MHBA 1TRIA 1KFEA 3DFHA 3NG3A 2I1OA 1D7KA 3N34A 4CCDA 5BMXA 2QHAA 2QPUA 3NZRA 3HFYA 3ZR6A 1TPH1 1XIGA 3BICA 3W2LA 4MWAB 3VXGA 3LS9A 3E0WA 2Y6ZA 1TMQA 2BODX 4H9UA 1JPKA 5D30A 4RUBA 3CWOX 3V0TA 3VDGA 2JALA 4WY0B 3UGRA 3E02A 4WDXA 3KL3A 3L4TA 1X98A 3CAWA 1P7TB 3W25A 1OF6A 1RCQA 1TKKA 1FDYA 3R8RA 3UZWA 2ZUTA 2NWSA 3LTYA 3E9AA 4UQ9A 4AD1A 1FWJC 1GT8A 4MYAA 4S3BA 1FKXA 2CERA 3WDQA 3ABRA 1VLWA 4KEZA 3KFTA 2WHLA 3SN1A 2J8GA 1A0EA 3E2SA 5CPNA 1P0NA 1JIBA 3FLUA 3LY0A 5I02A 4W7WA 4PMNA 2CXGA 3WD4A 3S5SA 1JFXA 1DP0A 3IACA 2WSQA 1H5VA 4LAOA 1YTDA 1H49A 2G3JA 1HVXA 3LN3A 2ALDA 1T8XA 3K5XA 1GVRA 4NZ5A 4EVZA 4CNPA 4QISA 2D3NA 2CLMA 1DYSA 2ACSA 1JG9A 1V5XA 3W7NA 2R82A 4Q6JA 4ZOAA 3A4JA 4DQWA 3GVVA 1L6SA 3DFSA 1L9WA 4LS2A 4X22A 1JCTA 4Q33A 4J2MA 3QC0A 1QNSA 3SZ8A 3MBDA 2WM0A 2EG8A 1KRCC 3L66A 3BJSA 2X2YA 2GK1B 3MSYA 1PYFA 4O14A 5LIYX 4NAEA 4HCDA 3VIJA 1KWGA 2Q3OA 5A94A 2QPXA 1LORA 5K9DA 3W2NA 4QM1A 2J6XA 4MUZA 4C6QA 2PDCA 2PDUA 2NUXA 4Q8QA 3WLOA 1AG1O 5CBIA 4V28A 4FX7A 3GTIA 1LZOA 4ZSUA 1ICQA 5I3IA 4G7EB 1MXGA 4IIBA 4S38A 1NWUA 1ISYA 4NRSA 3H7VA 1XS2A 3LRMA 2BV9A 3C2VA 5HDRA 4CQ9A 4PE8A 1M7PA 4IPNB 4IIFA 1ZY9A 1EH9A 1A5MC 5HA7A 3UERA 2X40A 5EFDA 4PMRA 5E9XA 2FHFA 2GDVA 1XYCA 3PG9A 3ONCA 4NJJA 3PJUA 4DI8A 1BLIA 2QCEA 5H91A 2VR4A 2Q3RA 1AA1B 4DM2A 4AU0A 5F7UA 1XBZA 2FH8A 3DHUA 2WWCA 3OVGA 3S5OA 2WHMA 3ABXA 1FWFC 2QMKA 5DBTA 5DCBA 4PTMA 4O0KA 2X1IA 1J0IA 1EBGA 1AH3A 3H2AA 4CNSA 4AQLA 3F2CA 4IX0A 1RBAA 1J18A 3LBCA 4JTDA 2A2IA 4JIIX 4FLRA 2W61A 3TV8A 4BQ2A 2PP3A 1XP3A 2BHZA 4K7YA 3VA8A 1PJ9A 2FVKA 5GJNA 2XH0A 3M0XA 1ISXA 1B3YA 1I60A 3G1AA 4AWEA 3LXAA 2WMJA 1JZ7A 2J6VA 4U33A 3CQ0A 3GVQA 5D2WA 1XD1A 3WH5A 3ID7A 4ASTA 1X6UA 3WNMA 2O7SA 3N2XA 1EWEA 3H6OA 5L6UA 2DSWA 4M6VA 3B3DA 2J9XA 2QDDA 4EF9A 1XXXA 2TPSA 2VR5A 1DIDA 1O5XA 2WMIB 3AZTA 3WQWA 5F2IA 2H9AB 5DY3A 3NL3A 4TOQA 2GQ3A 1Q6LA 1DL3A 5EMYA 1OADA 4EP8C 4US6A 4YTRA 3CEUA 5T9CE 3QY8A 1KWKA 2EJ1A 2ALRA 3SIMA 3FK4A 2CPUA 1DOSA 2E4TA 5CPLA 3TN4A 5FOOA 3NQGA 1ODUA 2C71A 1F07A 1XCFA 4HU3A 2P5NA 1Q6CA 7ODCA 3SCWA 3RG6A 2EJAA 3BC9A 2W67A 1OX5A 2CLHA 1LM1A 4GH3A 3FGCA 3KP1A 2ZZ5A 3A5FA 1J79A 2Y0FA 3QKEA 1RP8A 2YBVA 5A6BA 4JX5A 1PXGA 2FLIA 3OZPA 4QX4A 1Q6EA 4FIQA 1CW2A 5IOBA 1JZ3A 2XG9A 4HN4A 4F2UA 3KL5A 1TO3A 3S1WA 5I3KA 3UWQA 3N25A 4UOQA 1WZLA 4QG6A 4KFNA 2GUYA 1P0DA 2HPMA 4TXEA 5CZTA 2BOFX 2C13A 3WDIA 1UD5A 2C16A 1B9ZA 3N04A 4BI7A 3DG3A 4QG8A 3MV11 5FSDC 3A3WA 4QLJA 3CC1A 4Y9PA 1H2JA 2ZRZA 1KGWA 1FWEC 3JVAA 4EPBC 4YWSA 1UH4A 4EXBA 1TX2A 2OYMA 1UR3M 3CQHA 5DCEA 3CHFA 1E9ZB 5GNXA 5I2UA 3LBOA 5HJYA 1EZ2A 3AMKA 2QCCA 3UG8A 2XIJA 3BAXA 2V0TA 1X8CA 3RRXA 1CGVA 3TA9A 2VFGA 1P0EA 4R9OA 3AJ7A 3FYOA 3DGBA 3UWVA 3GNPA 5FA5A 1W3LA 2D2HA 1OC6A 3WLLA 4OT7A 3MKKA 2IPJA 4ZXLA 1YKWA 1XLKA 3W1UA 1RD6A 3KP0A 1G01A 5I3HA 4GABA 3N2CA 1P43A 5BXTA 4GGHA 2PCEA 1UD2A 3A4XA 1W3HA 2BDQA 3VFCA 3NQEA 2D2OA 3B4UA 2GVGA 1HW6A 2FGBA 1DV7A 3NL2A 1PZ0A 3EEGA 2DUAA 2YZRA 5CLTA 5C2GA 2ZXDA 2EG6A 1S1RA 3VYLA 3E74A 3AHZA 3CNYA 1NM9A 1V6TA 3URQA 1EJRC 3N2TA 1EUNA 4GVHA 3E6EA 1RY8A 1I1WA 3WD1A 4GD0A 1WUEA 1UZDA 4RDZA 4Z1DA 3L7RA 1CCWB 4ZEPA 3CV1A 3UEQA 4DJED 4RV3A 1GOWA 3UWEA 1T96A 3ZLHA 1B2YA 2VX5A 3TW7A 3HTWA 4UQAA 3ZT6A 1OBAA 4GYFA 3N18A 3LMZA 3DOPA 4FXJA 3THQA 1RJRA 5LNRA 3F4DA 3S1XA 4ATWA 3EX2A 4YXGA 3CIWA 4PUKA 3ELFA 2PWVA 1XLEA 2BXVA 5JVLA 3T9PA 5AFDA 3H24A 1EHNA 1K9FA 1QNOA 1XYMA 5DRIA 3LLXA 3II1A 1EIBA 3RJXA 4Q4RA 1I1XA 3IRDA 3K8MA 1KTCA 2PTYA 4LVGA 9XIMA 1J01A 2X16A 5CC3A 4C60A 2PZ0A 3FVDA 1BYBA 1X96A 2E6AA 2CLOA 1OFEA 3FHQA 5LNVA 3UPWA 3IUIA 4HP5A 4KWUA 2XIIA 4W7VA 1IR1A 4DWSD 1IR2A 1XBXA 2F61A 3JUGA 3H2NA 8CGTA 3DENA 1UQYA 2GUUA 2PRHA 5F2LA 1NIUA 5FL1A 4AH7A 3NO1A 3CB3A 4HCHA 4WKHA 4IJRA 1YDYA 3AWNA 2EKGA 1R30A 2AQWA 1KCZA 4LVBA 4LU0A 4M51A 3U9IA 4GYKA 4AWTA 5FL0A 1CBGA 3MKCA 4K38A 2ASHA 4JCMA 2OOGA 1OGGA 4W89A 3VD3A 1OK4A 3T08A 1PDZA 3C56A 2P76A 3GIYA 4PTVA 5IM51 3T81A 3QZ6A 1QPKA 3WQ6A 3R4IA 4A2RA 1A3WA 1JULA 1DKWA 1LJYA 1WXJA 4RPQA 3GNRA 3AU6A 5C54A 3ONBA 1MUMA 3GDMA 4O8AA 4UZUA 2MUCA 2E8ZA 3NPXA 5DT5A 2Y61A 1CT5A 3WNOA 4OOUA 5EPDA 1HUVA 3UR8A 1HTIA 4WOQA 4N4QA 1QOQA 2FTYA 3TZNA 1C90A 3TJXA 1DJWA 3B8TA 2DIJA 4C6OA 3OLGA 8XIMA 4GQGA 4UIOA 2RDWA 3TWAA 4CEUC 1PB0A 4O12A 2WVVB 2IW0A 3O6AA 5A95A 1F61A 3V0UA 5F1UA 3GUGA 1P0KA 1WAUA 4J9JA 3BSMA 3REQB 1QU4A 1UWTA 1W17A 3E5BA 3SUUA 4JTHA 4A8RA 3W7KA 4GNJA 2FKPA 2Y24A 4ZTYA 2BB0A 2PTDA 4K1WA 5HPCA 5JH2A 1VLIA 1LBLA 2WB5A 4JKLA 3KVMA 1YDNA 3EB4A 1S5NA 2QIWA 5ABFB 2DIEA 4Q8PA 3N2BA 3NVTA 3THCA 4MNLA 4XAYA 1TA3B 3EDEA 3PVFA 4QHRA 4YU1A 4DEFA 2XUCA 4S3KA 4A3YA 3W83A 2C79A 2J62A 3GTFA 3GRIA 3MV01 4QJ1A 3ATZA 1G4PA 2LLEA 2REQB 3B97A 3WJSA 1EOMA 4AZGA 3G1HA 2P10A 4LALA 1J10A 1BTCA 1HXJA 1UH2A 3VC6A 3WLIA 1W1A1 4AD2A 2R6OA 2BLEA 3B4YA 3AS2A 3JU2A 3SQSA 1UC4A 2QCLA 3GVWA 3CLWA 1OIMA 1JCJA 5A8GA 3UFYA 1V6VA 1BAGA 3FEQA 3R0KA 2CLLA 1JZ4A 4KQNA 1ESWA 2YA0A 3K46A 2DW7A 5DMYA 1O7AA 2VYOA 1AK5A 3DZ1A 4U2ZA 5FSEC 1MXSA 2Y7DA 1TRDA 2J7EA 1UP0A 3O0KA 4EK7A 4EWND 4C5ZA 2V5BA 2Y8VA 3BO9A 4HOZA 1H0GA 4XBKA 1RJPA 2YR1A 4DPPA 5H8MA 4MMWA 4H6KA 2YL8A 3STPA 4DBWA 1FVPA 2DSZA 3ARPA 4GO8A 4GY7A 5KTLA 3KTXA 5CGQA 4TVCA 5KMYA 4A29A 1DWIM 3FHAA 2EPHA 5G4WA 2EHHA 3ZJ6A 3WUEA 5CZJA 2E5BA 2QXWA 1LOSA 4H9TA 2FZDA 4HPXA 1OHLA 1Z48A 4P7NA 1SR9A 3QMTA 4I5XA 3SCOA 4UFHA 1RCOB 1UHVA 4IXXA 3NO3A 3NZGA 2RJGA 2IQTA 3R0DA 2WCGA 1MYRA 3UD6A 6XIAA 1BKSA 1V93A 4B5XA 1WZMA 2Z0IA 3GVRA 1UROA 4OIFA 2ZWZA 1EJUC 1OCBA 2ZX7A 1BSLA 1F8MA 3RDKA 3TN3A 3R5EA 2JEPA 3GHRA 3PBMA 3TXVA 3ITTA 4GX8A 5D8ZA 3LTSA 2ODOA 3STCA 1XDLA 2YFOA 2ZBTA 2ZX9A 3GK0A 3HA1A 4ERIA 2KZHA 4N9CA 1WDWA 1JAEA 4AWSA 4FSAA 4MUPA 6TAAA 1WOAA 2E6YA 2EKCA 3GVGA 1QI2A 2H3BA 4LC6A 4C7GA 1IXOA 4GIAA 3WFAA 4HZ7A 4QSHA 3UXKA 3N1AA 1ZJAA 1ZLPA 3UBPC 2JIEA 1S3TC 5D8WA 3UNTA 1I8JA 4M6PA 3CGTA 3VGFA 4X60A 1CB7B 3DERA 1A5NC 2Z27A 4CUCA 6REQB 1XBVA 4O52A 3IGUA 3LGEA 3N17A 3RJYA 1T6MA 3NCOA 4W4QA 3UCCA 2OZ3A 4HSHA 3UW6A 3RMEA 1PZ3A 4AB4A 1XQKA 2QIIA 1YDVA 1VYSX 5C9RA 1PHWA 2WO5A 1S2VA 3KOWA 1VFLA 5AHIA 3S1UA 3VKCA 3QLDA 4LGXA 1SFJA 3GDKA 1R9XA 2DZXA 1G4EA 3I4KA 4Q8NA 3M46A 4PL2A 5EKYA 1DWHM 1V3JA 1BF2A 4HNOA 4W84A 2NLYA 4GINA 4QGCA 1BF6A 2PWFA 4XZ9A 1CXHA 3BURA 5HUPA 3IIOA 3MMWA 1Z9AA 1WO2A 1KCLA 1D2KA 2B7PA 1JCLA 4UR7A 1E9IA 2ZC1A 4AXKA 1NDVA 3SBFA 1MRQA 3EOEA 1H63A 4I9TA 4U3CA 4JTKA 3SY5A 3TR2A 1X6LA 3S9YA 4A3UA 4KETA 5CSRA 1DIOA 4BKNA 1O1ZA 4OTKA 2D73A 4XBSA 1C7SA 1H09A 2P0OA 3ZVHB 2PDQA 1R47A 5DRCA 1Q8JA 4O16A 4ZB0A 2RDXA 4ILSA 3W01A 5AKQA 1MW0A 2ZE3A 1XG3A 3S2LA 1BWKA 1OEPA 1VBJA 2AKZA 1YTKA 2FPYA 4WJ8A 1Z42A 4MJZA 5A6TC 2VC6A 2AL1A 2YKKA 4PFHA 4LEFA 3VOHA 4ACZB 3FJLA 1OFQA 2PWUA 4CQAA 4JKMA 5GVJA 4DY1A 3WNNA 4GZEA 2NQJA 3DBNA 3WQCA 3LCFA 4NNBA 5CQ1A 3MWAA 3LTPA 1OX4B 2WZIA 1YYAA 4IWWA 2P3ZA 3AIRA 3P3BA 1LQ0A 3FOKA 1PEZA 2DT0A 3C2OA 4B3ZA 4CVUA 3B03A 3FYPA 2DPEA 1V3HA 5TD4A 4LEQA 3OVPA 2J7HA 5G1MA 3SUTA 3JW7A 3L4YA 1YMYA 7A3HA 3VKKA 1PVNA 3VCNA 3PBUA 2BY1A 2DZSA 4I5RA 4KIRA 1KBJA 2ZKMX 3SJ3A 1JGIA 3VVGA 1S5WA 1E4NA 4LRSA 4B16A 1S39A 1UB3A 4CVWA 2VTFA 3A47A 1NAL1 3HQ1A 1VD6A 4BEUA 1TR1A 4BZYA 4RZBA 5B80A 3RR4A 4DWSB 5A5WA 5K9XA 3RGTA 2ZOXA 3BAWA 2YW4A 4TV5A 4DUOA 1F73A 1NVMA 4MJMA 3FIGA 3K2GA 1EUAA 2RJHA 1ME8A 3B8IA 2V3EA 2WKLA 1EYWA 4LBUA 2CZDA 3PF3A 3RAOA 2DUXA 2DFAA 5FACA 3FY1A 4JTJA 3DHPA 4J28A 2DQWA 4MM1A 2PWDA 3TJLA 4GKLA 1E5NA 1C92A 2XVNA 4F0LA 3H70A 5EU9A 3VCRA 1UZHA 4S3CA 3AU2A 3ZFHA 4CQCA 3HPAA 4D71A 1SW0A 4HQVA 4HKPA 3ZT5A 2PPGA 1MNZA 2PU1A 2EF9A 2BGQA 1QDSA 1KRBC 8TIMA 1XH1A 4FALA 2XVLA 2VEFA 3GW0A 3LBMA 2VRKA 1TPDA 4FNPA 3W2KA 4KKXA 3PTDA 1RV8A 2QCDB 2PGWA 1FWBC 4I90A 1KXHA 4JTUA 3BW3A 5AOUA 1Q63A 1EF3A 2NWRA 2VO5A 3BG5A 2J8FA 1PE1A 2PFHA 3NXFA 4WJEA 2VCBA 2NV1A 3M7SA 4QJ4B 3W6LA 1J4EA 2OEJA 2Y1HA 4IMGA 3EOOA 4R7OA 4XAFA 1I75A 1UJQA 4DZIA 3W7CA 2Z25A 5BRBA 4G1NA 1XL9A 3LHYA 1PAMA 4CD4A 1JXJA 1TVPA 1GTEA 2OELA 1FWRA 4KW2A 3B0VC 2ON3A 3QGVA 1U5VA 3NYDA 1JNDA 1UWUA 2YB4A 2QS8A 3EOSA 4Q4OA 4C6NA 5CPMA 4MB3A 2QR6A 4LUYA 5E70A 1FWSA 4WJXA 3UWYA 3WZ0E 3GDLA 4S2BA 3LPGA 5BWFA 4GA8A 4IISA 3ZOAA 3WYZA 4IJCA 1HT6A 4TQTA 4HNCA 5DANA 2X1UA 4NXKA 1M68A 2GJPA 3KCJA 2BHUA 4UTHA 1FP8A 4CNNA 2JBMA 3PN8A 3DYOA 3BSHA 1C8YA 4QNEA 3WEZA 3POCA 5LA2A 1W32A 4UBPC 4PTWA 1VJZA 4PBFA 2VCAA 2RUSA 1TWIA 2OO6A 1XRVA 3ZJKA 1KKRA 4WR3A 1FQ0A 2ISFA 1S5TA 3UG3A 3WLRA 1IEQA 3NGJA 3LM3A 1PIIA 1FWAC 1IZKA 3O0FA 1Y5WA 4XD5A 2DJLA 2OSYA 1W2PA 4PMVA 1J5SA 3H8AA 1IZCA 4GJIA 1W5QA 1VJSA 4G1KA 4KRUA 3K8KA 3BZGA 1E15A 1OFRA 4RV8A 2HBXA 3WKZA 2GGHA 5I3DA 2OCZA 3PPHA 3VUSA 1TUFA 1O95A 3A3HA 3NQVA 2QDHA 3W7EA 1R0MA 1LRNA 4MSSA 4A3QA 5CJNA 1Q2SA 1K9DA 4OBRA 5HMEA 3UP8A 2QAFA 4H8UA 1QWKA 3GUWA 6ENLA 4PSRA 2MANA 2OEMA 3STEA 5D2XA 3WLSA 3CHDA 3MUY1 4U10A 1SR0A 4XSMA 2CZVA 4XD4A 2WHKA 5CG7A 4C1NA 4QE1A 4J27A 1AZ2A 5IBXA 1ZNNA 5J8LA 2XGZA 3AIVA 5XINA 1SGJA 2YA1A 2QF7A 1P5BA 1J5TA 3HG2A 3KHDA 4UR9A 1FDZA 1GWJA 2PWGA 3G1XA 4F40A 2NUWA 3L9CA 3KZPA 4PN2A 4JTTA 4YTQA 4I9AA 1J8VA 1OYBA 2D23A 3C2YA 4CNOA 3WD2A 4X2RA 1PKYA 1GKQA 3DYMA 3WBWA 1E9LA 2WSRA 3TMQA 3VCCA 4GJJA 5C55A 1R2SA 5F1VA 3TOYA 4D1IA 5D04C 2OSXA 1RALA 2Z28A 1GHSA 4S2CA 2A3BA 2PDYA 1VS1A 1VZWA 3NQ8A 3QC3A 2BVTA 1W2VA 4O8RA 4V15A 1TMHA 4S3JA 2OZ8A 3GS6A 4LY4A 1SMDA 1XINA 1YPXA 3WDJA 1F6KA 4LUJA 3KHJA 4TTGA 3TWBA 2Z7KA 3COTA 4ICCX 1F5ZA 5D2YA 4GNVA 1TWDA 2KX9A 3AICA 4B5UA 1QASA 3GAKA 3K4WA 4AZ7A 3LGGA 4LW7A 3VINA 3CZ8A 4PCPA 1HF6A 3KBVA 3E96A 1D9EA 1DJHA 1UUQA 2VDHA 2XSBA 1E6SM 1XLJA 2B7OA 2CHOA 4NZFA 1P6BA 3BVJA 2VI0A 1R9YA 3PZNA 1W3NA 1LROA 4HMCA 1XD0A 3TYEA 4ZSTA 4HMNA 5BRPA 2CFFA 4EPEC 3H22A 4HHLA 3LNMA 3VM7A 4JGDA 4KF1A 2OKOA 3FVMA 3BCFA 3OG3A 2QCMA 4JFSA 2QF8A 4JQ3A 1L6YA 3MYOA 2VM8A 4EE9A 2EPLX 3UCQA 3P60A 3CH0A 4GZJA 5JUVA 4AY1A 1YW1A 4GX9A 4D6JA 4MLRA 3QW3A 1GVYA 3NL6A 1H11A 5DO8A 3USZA 1J11A 1LG2A 4PMDA 3WJWA 4D6EA 5G4EA 2UY4A 4JQ4A 5DY2A 5A6LA 1ICPA 1PZ1A 1VGAA 3R58A 3C0QA 3V75A 3AIWA 1KXVA 4FK9A 2PU0A 3W9ZA 5JIWA 1VH7A 3EBVA 2GVJA 4MZYA 1WQ5A 3M9YA 4DJFA 2J77A 3ZT7A 2V3FA 4N0RA 4IM4A 5HUOA 2RHGA 4IGMA 5HK4A 1W6TA 3WH7A 1HGWA 4CCEA 2D0FA 1EJVC 5ABTA 2E9MA 2HXTA 5JH1A 4JR5A 5CZKA 2EGZA 3CTTA 5DXYA 1FHLA 1SO4A 1TJ1A 3RUBL 4FHAA 4BHYA 3EWZA 1H0IA 1W9UA 3FGCB 3UQNA 4UTMA 1THFD 4W8AA 3MUXA 4P8UA 3KBSA 3IIPA 3CL7A 3QY7A 2W6RA 1SYTA 3WJXA 3AYRA 3BL3A 2DJXA 2FDMA 2GWNA 2A6NA 1KNWA 2ZVIA 4YPJA 1Q3NA 3PBYA 3HPSA 4OUEA 3QQ1A 1PIGA 3MHUA 3MCNA 4F0KA 4HYRA 4M0XA 3DUGA 3WK2A 2OQYA 2P3EA 4N4PA 4MOZA 4I5UA 4ATDA 2Y88A 3V1PA 4GNKB 4WY0A 4OZOA 3BOXA 1QI5A 3CZGA 3EA2A 4W8BA 3RLHA 1RD5A 1OT2A 1Q65A 3MW7A 3U6WA 1H1ZA 2WKGA 2G3FA 1NOFA 1A47A 3U4FA 4HGXA 4LUTB 3HPFA 3HGSA 2GVYA 1GEQA 4MLJA 1E43A 2BGNE 1AH4A 1TWSA 3QOMA 2PUZA 4UTIA 1M7XA 2ACUA 3M5ZA 3ARUA 1GYMA 4AZBA 1S38A 1IIHA 3VFLA 3RO8A 4OBTA 5FJIA 2F9RA 5FIPA 5REQB 1EQCA 3PBGA 1UJPA 2JF6A 2IPFA 3UXLA 2A3AA 4PTNA 3W26A 3B0YA 4HYWA 1JQXA 2PD5A 5DELA 1I2QA 3F4VA 7PTDA 3TFCA 3H12A 4XISA 4P7LA 5J5RA 3VZXA 1EJSC 4A4AA 5DXXA 3VNIA 2NX9A 2QUMA 1X7FA 4YIWA 5ECUA 4PEEA 4I9MA 3N4FA 4O11A 1L8NA 3Q65A 2V3DA 2ZADA 1ZJHA 3AALA 1EPXA 1AH0A 2ZA3A 4XV0A 3IV8A 3VDAA 2GK1A 2A1YA 2PE4A 5U7SA 5CEWA 4DBDA 4RNHA 1OVDA 3B0PA 2FJKA 3Q94A 1TB3A 3W74A 4JPGA 4PB4A 1CECA 2A7PA 2E6DA 4G7EA 3MI6A 4C6JA 1KQYA 4GI4A 2YPIA 4MGGA 3V35A 3TH6A 2GQ9A 2O9OA 4O1BA 1XLHA 3RLGA 3PZUA 4K39A 1PTGA 4DIAA 2G41A 3URAA 4TMCA 2V63A 4XKMA 1DVJA 3HMJG 1JI1A 4CD8A 4P8XA 4RR4A 4C6KA 2V69A 4EWJA 5AYIA 2GPTA 1DEDA 4GJ1A 4UFIA 1EP3A 3V7PA 4JY9A 3DBPA 3MO7A 2IKJA 3VPLA 4GOAA 2E28A 4YCPA 1RQBA 1KBBA 1EQPA 1HL8A 5CXPA 1A5KC 4A3HA 2X0HA 1GOXA 3VZYA 5LNSA 3AMLA 1PX3A 2O9PA 1Q7MA 1HP5A 3TTQA 1SMAA 3W2MA 4R7JA 1K7FA 3TE9A 1D8WA 1EEXA 4JFVA 3CQJA 4U5KA 1V02A 2XIBA 3DAQA 3HBLA 1KTBA 5B7ZA 1I2PA 3VIIA 3WFZA 1KD0A 3SN4A 2WNWA 1JUBA 4UTJA 5D9PA 1CGWA 2IXUA 1KW1A 1N82A 4PC8A 3SAZA 1ISWA 4W5UA 4JFTA 3FCPA 4MVAA 2V5JA 4BI5A 2O4QA 2C15A 3TNOA 3ES7A 5IDZA 3L0NA 2BASA 3WQ4A 3SJNA 3GTHA 3WEMA 2OLAA 4UMCA 1ZPTA 3EB2A 1MZRA 3GWQA 3S5YA 3OPSA 3W0KA 3HN3A 3KEHA 4Y8EA 4QS5A 2WPGA 2XSAA 2CLFA 2PBGA 2O0TA 1X1OA 1IF2A 1JYWA 2WVSA 3RCYA 5I3JA 2FPVA 3TTOA 3L5AA 1F8IA 3EXTA 3LX9A 4CGTA 2PWEA 3NDOA 3UJFA 5D02A 3PZIA 4IF2A 2E40A 3L2IA 2WMIA 5AHNA 4NJHA 5AC6A 5FJUA 4DO5A 3IAQA 1MI3A 2H9AA 4LUSB 5I5RA 4L5ZA 1EL3A 5I24A 4N2YA 4PCNA 1H7PA 4IG2A 5TQLA 3IIZA 4S3FA 4K37A 4NRRA 1UASA 4GXPA 4Q6XA 3SFWA 5U4NA 1TG7A 2ZVRA 2VZVA 2IMRA 2FZ8A 4U2YA 2JF7A 3G1FA 1GOIA 1TTQA 3RMJA 4K8EA 1IEWA 5AZ1A 3AS1A 3GXFA 2HE8A 3OGVA 4RPPA 2PDLA 4NZCA 4O1DA 3A64A 1IXNA 4C6EA 3SCTA 1Q6QA 3BK0A 3K4DA 4OV4A 4QLLA 3T4WA 1VFHA 4M80A 2WZEA 3EMQA 3AS0A 5FAJA 3U57A 2JK2A 5CAKA 5EGRA 2JKEA 1LL7A 1RAKA 4NZ1A 3VGEA 2Q09A 3IIXA 4LCRA 3U7BA 3K1GA 4Q4SA 4DUXA 1H1YA 3C61A 3BMWA 3BLIA 4W93A 4NU7A 5TIMA 2AQVA 5LKYA 3O07A 1R3WA 3B04A 2DORA 3AMDA 3I7RA 3QPEA 3V3WA 5HJXA 2DUZA 3DKJA 1RSCA 3H4WA 3O63A 5JQ9A 3FN9A 3OIHA 4GY0A 1IYXA 3MUIA 4MY8A 3A3XA 3KVLA 1TPUA 3KVJA 4L4MA 1RLCL 3ANYA 3CMGA 4LTSA 3CIXA 2ISWA 2Q8XA 1UW9A 1QT1A 2NV9A 1JDDA 3TW9A 3BCDA 3GX9A 5HNTA 4IMDA 3LK6A 1E4LA 4ZQPA 4GI6A 4S3DA 2QUTA 1QK2A 4JZ5A 1BPLB 4M56A 3UR5A 5G2HA 1XI3A 2QV4A 3P6LA 4GUHA 2WYSA 4GLEA 3BH4A 3K8LA 5AC8A 1O66A 1TPC1 3D3FA 3UWWA 4ERAA 4KWOA 1VKFA 1XIHA 4BWLA 4DRSA 1B0IA 1JRBA 3H2OA 3PP7A 3IJ8A 3VU2A 2ZRYA 3BAYA 1OZMA 3GXIA 2BY0A 3LYEA 4JFUA 5CGTA 3OZOA 1QI0A 2CKRA 3RK8A 3M0LA 2A7NA 4DXVA 2VGBA 4ZFMA 1Q2RA 3AMGA 2GQAA 1UR9A 2Z6IA 1H62A 3ARVA 3M16A 2IQ0A 3V36A 3UZ5A 5FEXA 4Y8FA 3SSZA 2PA6A 2YBTA 2CWXA 3SURA 2VQUA 4FA3A 1X97A 1S1PA 3NNTA 3SM0A 2J7BA 2GSJA 1MW1A 1IXPA 2ATSA 4KGJA 2ZX5A 4B3KA 5CGMA 3R1ZA 1TPB1 4LUIA 3N6HA 3IJ6A 2J79A 2OB3A 4R7WA 1G7VA 3JZEA 4H7CA 2CC0A 4IOTA 4OGZA 1JI2A 1KXQA 5G4HC 3EPOA 2QYGA 3GZAA 4W9TA 2E8YA 2NQ5A 1SVDA 4RDVA 2E5DA 3WF3A 4UTKA 1L0PA 5DQPA 3RFAA 3HGOA 4GQRA 4QCEA 4P7QA 1B31A 3ZO9A 3NZPA 1N8IA 4PYSA 5LZLA 1A3HA 4NAFA 2F6KA 5IHSA 2AKMA 4ML4A 2FB3A 3EZ4A 2C3ZA 2J9ZA 3R10A 1VPYA 4NL1A 3N9SA 4PUMA 4FX6M 4NYUA 2YCJA 4AD3A 4GRSA 4BEQA 4FNQA 1H7NA 2WJDA 4TR9A 3RX3A 4CN6A 2XU2A 2XFWA 3AFBA 3VNYA 3ZMRA 1DHKA 5K3VA 4X0VA 5HANA 1BXCA 3KL0A 4KWWA 4L64A 2HVNA 4TVDA 1GQKA 1VC4A 3FA3A 3RRAA 1U1UA 5BW6A 1M5WA 3H21A 1AJ2A 1MDLA 1XYAA 3KWSA 1L6WA 3RU6A 3SUWA 4MKNA 3CAVA 3VKAA 5HJLA 1ME9A 1K77A 4FS9A 3N9KA 5KITA 4FP1A 4IPIA 2CBVA 4JTEA 1R8LA 1LL4A 3DFOA 3OO2A 4Q7IA 4OJYA 1Q7ZA 4RXFA 3EKGA 4Z2GA 1VCGA 4NJKA 1VR6A 1N55A 1I45A 4D6CA 1NELA 2XSXA 4ZO8A 3KRUA 3TMLA 2X30A 2Z1SA 4AFYA 1V79A 3W7RA 4H7ZA 2BXZA 1XFCA 1QO2A 3W1RA 3UXAA 4F4RA 1BD0A 1H41A 4UQEA 4UXDA 3NYZA 2WVVA 3VIPA 3QF0A 1JEZA 4F9JA 3O6CA 2Y7FA 1NQKA 4AMAA 3S2JA 4ZZ9A 4US5A 3CUFA 3REQA 2X42A 3Q58A 3MVTA 4AMCA 1VBHA 3W37A 2OMAA 1JF5A 1V7AA 2VZOA 1BEUA 3PBVA 2V5LA 3BLEA 4DXKA 1EGZA 1BXBA 1J12A 5ENLA 3W02A 3M5VA 2ZQ0A 1DJZA 3KOZA 2BX7A 3QR0A 4NT0A 4W85A 1XC4A 3PNUA 3WD3A 5ABFA 1OFPA 3N12A 1M7OA 3W2JA 2XGIA 4AYGA 1OB0A 5EA9A 3B8VA 1VQTA 1SFLA 4WKFA 2XTKA 4DUWA 1OFOA 5J04A 2B0MA 4XZWA 2WVUA 2WZMA 2OTDA 2PTZA 2YCIX 2ZTJA 4FXRA 3WLNA 4ZO7A 3L2LA 4X3ZA 3PM6A 2O7QA 2REQA 2X7VA 4K68A 3MUCA 1A80A 1XLFA 1VFTA 1W8GA 4F0RA 4G2DA 2ACRA 2I17A 2VDGA 4L4OA 2XVKA 2CESA 2I56A 4AIUA 2IPWA 2V5KA 1WV2A 1DWFM 1CGXA 1V6UA 3P5ZA 5A8OA 2IKGA 3MPGA 3T8QA 3KDOA 5A8NA 3XIMA 4U31A 3EDKA 4ML9A 1F4AA 1SSGA 1ZB5A 2I5IA 4GQ0A 4M3PA 1AQHA 1TV8A 3O16A 4ZOCA 4AD0A 5C9ZA 4PBGA 3KS5A 1DIKA 4PB3A 3CHEA 3T07A 1E5JA 1VIZA 3G5EA 1MZHA 3IEBA 4V33A 3SRKA 4DBSA 1E56A 4GHRA 4GUGA 3F2BA 3WK3A 1C29A 3NAVA 4FI4A 4J40A 3PPGA 4ZFCA 3M6DA 5G5IA 2WMGA 1SZEA 2RH9A 4F0MA 1WPCA 4MKSA 2Z6JA 3W38A 3R11A 3RCMA 3BLDA 5A6KA 1SJBA 1JYXA 1OQFA 4D8LA 3Q2DA 4JHZA 4GUFA 4HA3A 3WDPP 2E3ZA 3SR7A 1UWQA 1HIZA 2X1TA 3ZR5A 2AAMA 4Y96A 5JMUA 3VOFA 4AEOA 2XN2A 5HMDA 1JDEA 4DELA 2BOGX 2VCCA 1LWJA 2OT1A 1PZ2A 4BQ5A 5AHFA 1XX1A 3BLLA 1ZAIA 3CMJA 2ZXAA 3M0YA 1BYDA 4YNGA 3W7PA 1PKNA 1Q4NX 4K7VA 4LH8A 3S2NA 1RXOB 1FWCC 1Q6DA 4RZ6A 1I0BA 1MVYA 4FF5A 1W1TA 1W8SA 3DX5A 1J0KA 5B7YA 1DTNA 4EF8A 2GOKA 1V08A 1YQ2A 4PUEA 5CPSA 3LCGA 5HR7A 2QJMA 1C8XA 4RE2A 1G4TA 1VFMA 1A4MA 2VQTA 1PUDA 1J2BA 4EXQA 3GR8A 4R3UA 2RGLA 1Y7VA 2FHCA 3MMUA 1V6WA 2HCVA 3APGA 1C93A 6REQA 3GC2A 3L5LA 2NW0A 4DJDC 1JDAA 4O10A 1UA7A 2P1FA 3W72A 1TCMA 1J6PA 4HB7A 4Q3MA 1K1DA 3INPA 4Z2KA 1UP3A 3WMCA 3TK7A 4A8LA 4RE0A 1YPIA 1V51A 3WQ5A 4K1GA 1GQLA 4HNTA 3IJQA 1L6FA 1VF8A 4E0CA 2XDFA 1OZQA 4XVEA 4LAKA 4UTWC 3I6TA 1RPXA 4WCJA 3DI1A 3G8RA 1JVNA 3F5LA 4HNNA 3MDWA 4E4FA 2PTXA 2E09A 3E3HA 3B40A 3MTWA 3T2QA 5E0FA 4DF1A 3HGJA 2CLKA 1EFZA 1AL8A 3GAYA 3RM4A 4AIOA 1R85A 4E2BA 3FDKA 3NEVA 4CD5A 4PUUA 5FKYA 4GC4A 4WGHA 2QGHA 3QY6A 3BZJA 2ATMA 3QSTA 2VZTA 4QAWA 3VD9A 4Q8VA 4E4UA 3T0DA 3ZVHA 2VOTA 4NZ3A 3HU7A 4FEZA 3VMNA 4ZBCA 4ZQOA 2DQXA 4DO4A 3M47A 3P7YA 4QEEA 1I2NA 3N3TA 1UP2A 3QV9A 2XYLA 4LJ3A 4TX9A 5EFFA 1W3JA 3M1ZA 4HU8A 4HOWA 2G95A 3G1RA 2OQLA 4K3ZA 1Q6GA 1SZNA 4JTCA 4DJEA 3QFEA 3BGJA 3LB0A 1UKSA 3G22A 3SCRA 1XUUA 2FDSA 3DKLA 1GYNA 4F0SA 2D69A 1UC5A 1XC6A 4NUWA 3B0UX 4UOZA 1N8WA 2PDBA 4QE5A 3NQDA 1JNEA 2O92A 2BSLA 2VEPA 1OX4A 5FJPA 4ZO9A 4J3SA 1GOQA 2PAJA 3ARSA 3F4NA 4G56A 1GCYA 4NX0A 2WCSA 3G0SA 3M5XA 3HZ3A 2J7GA 3N4AA 3MBFA 5XIAA 2B81A 3AISA 4KEVA 4IP5A 3I10A 5KZ6A 4AAJA 1DXEA 2HSAA 1OC5A 1ITCA 3OQ8A 1RY0A 3IAPA 4GE8A 4E8CA 2E1WA 4ZO6A 4DXXA 1M65A 4M82A 1U2YA 4DVOA 1KR0A 1UWIA 1G94A 3M44A 5I79A 3VD5A 3DCPA 2I9EA 1EB3A 2A6LA 5CJ5A 1XGEA 3QV7A 1QPNA 1E3ZA 3DEQA 1IWAA 4DF2A 4K8GA 1O12A 3EA3A 5A1AA 2NUYA 2CZ5A 3OJGA 3W81A 1UD8A 2O56A 4J3XA 2ZA1A 4RLIA 4DWSA 4H9VA 4ICMA 3AYTA 4RJEA 3MS8A 1AZ1A 1AW1A 5GJMA 1DJXA 1H7XA 3MI2A 1VENA 3AMCA 3PTMA 3W76A 3LXCA 5I03A 3MI3A 1KFBA 1XCXA 1XPYA 1RUSA 4EAMA 5LSMA 2E5CA 5CPOA 1NOWA 2VC9A 4IPJA 1V8EA 2TSYA 1EYEA 3VOIA 5HNRA 5A6SA 4GISA 4LAUA 1FKWA 1UUMA 1LCOA 4H6RA 1OYAA 4N9BA 5D2TA 1ZUAX 3LERA 2ZIDA 3G0XA 1VRXA 2PB1A 1OGSA 4YN5A 2G4FA 1JUEA 1VPQA 2H3DA 1BSIA 1NTHA 2VVNA 1YNYA 2VGFA 2WWDA 3KXQA 3CUXA 2TODA 3B9EA 4WY0F 4EIVA 5EBUA 1E9YB 4JIEA 2QCDA 4Q8WA 3RPDA 1J0HA 4NNCA 5D05A 4ZQMA 4I7WA 3YPIA 4YTTA 1Q6OA 1WZAA 3CB8A 4WVXA 1NQ6A 3L23A 1H5YA 3TYAA 1GK8A 3V5CA 2XPKA 1GVOA 4MY1A 1KA9F 2QPSA 3FA4A 3SRDA 4D2JA 3OGRA 4LS1A 3CZJA 1DWGM 5JXQA 2FZ9A 3KBNA 1A5SA 1C91A 3AO0A 3CPUA 3NZ1A 2JKAA 3EWUA 4QDWA 3WQOA 2HNEA 2TMDA 3PB2A 4PMOA 4R33A 3KCOA 3WH6A 2ISDA 4REQB 2NSOA 1W3IA 3KS6A 1QHOA 1UKPA 3BQ5A 1US3A 4N6EA 1SW7A 3W22A 1UYQA 2YLLA 4N9DA 1G1YA 2C7FA 3W7LA 3E5PA 4YHGA 2PURA 1HJQA 2J66A 1W91A 3DYPA 4D6IA 3NQCA 3SCQA 4JFWA 3OYZA 2JGYA 4Z2JA 3OA5A 3PZOA 2V38A 3IIVA 4KWSA 4CNUA 1Z69A 3VC5A 5C6MA 2X09A 3L4WA 1VBUA 5ECVA 4RCXA 1TV5A 3O6YX 1S2UA 3KCLA 1JPDX 3W2UA 1EO7A 3LV6A 2WK2A 2INFA 4HA0A 3AC0A 5I78A 2JEQA 2AGKA 3RM9A 1T0OA 3EEZA 2ZXQA 1GOOA 4NIRA 4I8DA 1PDYA 1KM3A 3CIVA 1F6YA 3TFXA 1E4MM 2VURA 3M41A 4HPJA 2YBUA 3PWAA 1M53A 1K03A 4UCFA 7REQA 3N9RA 2BXYA 4DZHA 3BV4A 2DT1A 3WBXA 4JYFA 2PGRA 5CKSA 2ZCGA 3G2GA 3DESA 2R91A 4B2DD 1GVEA 1XDMA 3NPVA 2P88A 3M0HA 1A5AA 2QUUA 1JGMA 4ZQCA 2WSYA 4HT3A 3IWPA 3FA5A 1FH9A 4US5D 2UWFA 1NOUA 4YTUA 4FMVA 2VT0A 3GG0A 2UY2A 5A2BA 3N2OA 1LUCB 4BR1A 1R3RA 3NFUA 1FWDC 2WW5A 2Z2BA 1KRAC 3P0XA 1KO0A 1P1MA 4TX8A 3DECA 2NV2A 3A4AA 3EKLA 3RYSA 2BS9A 4LCSA 4QAIA 2V82A 2Y5JA 1EJTC 4HMDA 3R8GA 3VGDA 3WMLA 3EDFA 2WM1A 5K7JA 1WX0A 2OZTA 3CYVA 1BYCA 1LT7A 2CLPA 3CT7A 2WCAA 1E70M 1PCKA 2XGBA 5CAHA 3P0WA 1XLAA 2VDIA 2A5HA 3FW6A 2D1ZA 1KTNA 2P8BA 1LL6A 4IGNA 2I7GA 1E6NA 3GBEA 4JQ2A 2XM2A 3FYYA 5I06A 2G5WA 4CU8A 3OYXA 3Q67A 4PSPA 2WNZA 2OX4A 3KRSA 1G9HA 2PF8A 1AFSA 1TJRA 3WIJA 1KB3A 3GR4A 2G96A 4GZIA 3TSBA 1QBBA 3VIMA 3H7RA 3CUIA 3U3HA 1XFBA 4J3VA 2CYGA 4ADTA 4JTLA 2VKZG 1QI3A 1Q66A 3L4XA 5BOOA 4F48A 1R9ZA 4GQQA 4N02A 1EJXC 3TX9A 3TIMA 1VYRA 5E6ZA 4XD3A 4XUYA 2WBGA 1U30A 3KZSA 2HV5A 1KM4A 3C3NA 1LF1A 3QSRA 1HJSA 4HTYA 1EP2A 2XISA 2GJLA 3LHWA 3VOJA 4PRWA 4RW3A 2ONEA 2DZUA 1PL9A 1TV7A 1MMFA 4IQJA 1M3UA 4JDBA 3VTRA 4NILA 3CQKA 3D5HA 2OT0A 1ZAHA 4MAZA 1UD4A 1BYAA 1C8VA 1EEPA 2WJZA 1FX6A 4HNUA 2BVYA 5D03A 1IIGA 2C0AA 5LYRA 1TJ2A 5FCZA 3UZXA 3KRZA 4WK9A 3VIKA 2Z1VA 3ECQA 3W1TA 2PLCA 3PC0A 1E0WA 1AD4A 1WDQA 5I23A 1TZZA 4HZMA 4ONVA 1O5QA 4AZCB 3A22A 3CV7A 4M7TA 2XJ7A 3MY9A 3IJ9A 5M17A 2HISA 2VL4A 3A6OA 3VDCA 3WCZA 4FNTA 1A53A 4G8TA 3ZM8A 4OV9A 4KRTA 3AIEA 2JKPA 1WKEA 2J7DA 4KH2A 4PEKA 4I7VA 3QEZA 3PFRA 4ALDA 3PZ9A 4IG2B 4LAZA 3GZ3A 2EQDA 3ME3A 5GJPA 2QCGA 4H8NA 1CEOA 1CIUA 3ITOA 2IQDA 2CITA 3R2GA 2PDXA 1KLZA 4GYPC 3RIKA 3BWWA 3PHAA 1F2JA 5HQMA 5LIXX 1NWTA 4M8UA 4MKVA 4KCWA 1T7LA 1NEYA 3NXLA 3AXMA 3OQEA 4JNMA 1DHPA 3KBMA 3LMYA 4H9XA 4E5TA 4ERGA 3KTSA 4JTGA 2D3LA 3VOCA 2BFGA 2EO7A 3OB8A 4LV4A 3LHTA 1EXBA 1VIWA 1YTEA 3TROA 5FF0A 1FWHC 1ZQ5A 9XIAA 1VFFA 1XJBA 2WBKA 5F2MA 1R3YA 3NQ6A 4O1FA 3ZJ7A 3KUMA 1PSCA 5H8PA 1QNVA 3WQDA 1QNQA 2PTWA 4FOUA 2JIWA 4PCFA 1TREA 4LSBA 4E8GA 1EA0A 5LGXA 3DDMA 4CQDA 3G18A 3OW1A 1XWYA 4LAMA 4O0QA 3FEMA 1YXCA 2FVMA 3BANA 5A2CA 1O5KA 1H7OA 1Y0EA 3GSMA 4N6FA 3VIFA 1KRMA 5ABGA 3UA3A 1QPRA 4NXSA 3TZFA 4WF7A 4LUTA 2R24A 2WSKA 1ZBKA 4NX5A 3W1AA 1QNPA 1QR7A 4B15A 1XG4A 3HQPA 5M1TA 4YHEA 2PC4A 3WLHA 1IGWA 4JEJA 1EX5A 2QVHA 5CC7A 3EA1A 3C5QA 4CN4A 3IJ7A 5REQA 4UFKA 2BHYA 3NQ7A 3GXDA 3SY1A 3GM8A 4QNWA 3MCOA 3S6OA 4YCOA 5M5DA 3L0KA 2ZFAA 4LNYA 3A9BA 4IQLA 4M81A 2YX0A 3W7MA 4QBXA 3EX4A 4Q7NA 1SFSA 3VNJA 3M7WA 3QVQA 3WJYA 1AD1A 1KLYA 2Z7GA 2EPOA 2O4MA 3V5OA 2PDJA 3EMCA 1YNQA 3WUGA 4LB3A 1GG1A 2WZTA 3WK1A 4EPDC 2AMGA 4X9YA 1BHGA 3EWDA 1JPIA 3DI0A 3LPFA 1O5RA 3S47A 1ZP4A 2V8ZA 3TEVA 3IARA 3PWGA 5D2VA 1XLLA 3W82A 2PF0A 3N3MA 2XH4A 1RVKA 1JYVA 3B8WA 1KCKA 3L65A 4RNIA 4A8NA 1UBSA 4OFCA 4NVTA 1BVNP 4W88A 5PTDA 1YADA 1GVFA 3W86A 5CBJA 2CETA 2WAGA 4PUNA 3IK2A 1CX9A 3AIUA 3C2EA 3GFZA 3S9ZA 2OGYA 1XLIA 4OE7A 3T0CA 4MG4A 4KCTA 1LOQA 4PR4A 2CZFA 5I3GA 3VNZA 2XWEA 4QDPA 3RU8X 3LHVA 1ODZA 1OFBA 4Y2WA 3T2OA 2FHBA 5BMWA 4M19A 3M64A 1B3OA 1FWWA 2ZXBA 1RPKA 1XRTA 4RZ5A 4ECLA 1HJWA 4L9YA 3C8NA 1M9HA 3CHCA 2CIPA 1UG6A 3UVAA 1WKYA 3G0UA 2C1HA 4IL2A 3IV3A 2ZUWA 4OU1A 4MZ8A 4ZMGA 4H8VA 2GGJA 4C65A 3MC5A 1ZBVA 1KBIA 3F03K 3RO6A 2VGGA 2V9DA 1E0TA 1AW5A 4BQ3A 5LIKX 3MU7A 1FRBA 4QSFA 3L21A 4NAFB 4LF1A 3V5FA 3CTLA 1ECEA 4IH3A 4PRRA 4MNKA 5FESA 1AMYA 1G67A 3M0KA 2E1DA 3A21A 4NKCA 1MQPA 1QXLA 1V7YA 1JZ6A 5EMKA 2NX3A 3GH5A 3C86A 4HHHA 5AN7A 5BWAA 1HL2A 2ZX6A 1SZRA 1GONA 4L61A 3W28A 2NQZA 3WK0A 4A35A 4LC8A 2FTPA 2IUZA 4C6PA 4ZE4A 1ONRA 2AOSA 3MANA 3H4GA 4JIHA 4W7UA 7CGTA 3N13A 1WBJA 2GDQA 4Q8MA 3W7HA 4QITA 3W27A 1LT8A 3C0SA 2QUNA 5EY5A 2Y63A 1C8QA 4JL1A 3GNNA 1FHDA 2R1MA 5C2XA 2NQ9A 1U5JA 3LV5A 4AYSA 3TTEA 4ZOBA 2IKHA 5F2GA 2EPMX 4Y7EA 3CXOA 4NZJA 4E3TA 1JAKA 4P7RA 3NPUA 4ZL1A 3FXYA 1GKPA 4GYPA 4H9MA 1XCWA 3DGRA 3EPMA 5FF7A 1P48A 1R6WA 4D6GA 3PANA 2V67A 2R8WA 4HK7A 4C6FA 1HX0A 2VWSA 3EWXA 4MB5A 1XYBA 3ATYA 4GKTA 2BTMA 1ZALA 4LUSA 1ITXA 3NURA 1MWOA 1PO9A 3B9DA 4PZVA 4IIEA 1CENA 1BKHA 4FLOA 1XRSA 4ZODA 4YTSA 1O1HA 4HZ6A 1GVQA 1IWPA 3WH9A 1OWQA 4JAWA 1TELA 4CD7A 2QNEA 4MJ2A 1AUSL 4AHQA 3N2MA 1K7EA 2PODA 5T26A 2JE8A 3KOYA 4B9ZA 5LXEA 4DJDD