4C1NB

Corrinoid protein reactivation complex with activator
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
309
structure length
309
Chain Sequence
AVEVLKEKWNSKVVEVTLGTGDKTVTLGGDSTLPFLTFEGEMPNPPRFALEVFDTPPTDWPDILVEPFKDVINDPVAWAKKCVEYGADIVALRLVSAHPDGQNRSGAELAEVCKAVADAIDVPLMIIGCGVEEKDAEIFPVIGEALSGRNCLLSSATKDNYKPIVATCMVHGHSVVASAPLDINLSKQLNIMIMEMNLAPNRIIMDPLIGALGYGIEYSYSIIERMRLGALTGDKILAMPVVCFIGQEAWKAKEAKDPEVAEWGDYALRAIHWETVTTVALIQAGGHLFVMRHPKSLAEVKEHLKRILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBON MONOXIDE DEHYDROGENASE CORRINOID/IRON-SULFUR PROTEIN,
publication title ATP-Induced Electron Transfer by Redox-Selective Partner Recognition
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Oxidoreductase/metal binding protein
total genus 98
structure length 309
sequence length 309
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03599 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4c1nB01
4MWAC 4MWAB 2DQWA 4C1NA 2E7FA 4S3EA 4D8ZA 2H9AA 4MWAE 3TYAA 1Q8JA 4NL1A 1Q7MA 1Q8AA 1Q85A 4C1NB 2Y5JA 4DJFA 3MCMA 2H9AB 4HB7A 4O1EA 1TWSA 3H2AA 3V5OA 4NIRA 4DJDC 5JQ9A 4DJFC 1Q7QA 4O1FA 1TX0A 1Q7ZA 2DZBA 3TR9A 2DZAA 4S3BA 4O0QA 4NILA 4S39A 4PZVA 1EYEA 4S3CA 4DB7A 1TWZA 3H22A 3H2MA 4G9PA 4DJED 4DAIA 2OGYA 3BOFA 3H2FA 3BOLA 3K13A 2VEFA 3TYEA 4DAFA 3H21A 1AJZA 2Y5SA 3MCNA 3TYZA 2YCIX 1TX2A 4NHVA 4S3FA 3TZNA 4CCZA 4S3AA 4MWAD 4S3DA 1AJ2A 4D8AA 4D9PA 3H26A 1F6YA 3H2EA 3TYBA 4DJEA 1AD4A 2BMBA 4S23A 3H23A 1AJ0A 2VP8A 4S38A 3NOYA 4DJEC 2Y0FA 1AD1A 2YCJA 2YCLA 4DJDA 1TWWA 4DJDD 3H2CA 4MWAA 3TZFA 4DJFD 3H24A 3H2OA 3TYUA 3MCOA 2YCKX 2VEGA 2YCLB 3TYCA 3H2NA 3TYDA
chains in the Genus database with same CATH superfamily
1OWQA 4FHAA 3KHDA 3R8RA 1T41A 3PZIA 1XIGA 5AN7A 2RDWA 2VVNA 4GLEA 4MWAE 1XC6A 4JTAA 4NZ4A 2F6UA 5D4YA 5AZ1A 2QUUA 5FIPA 2VX4A 3GVWA 3CASA 3IJ7A 3AYVA 1B3XA 1FWFC 1KV8A 2V3EA 3UJFA 5DO8A 4LVFA 4FNSA 4G7EA 5IBXC 1RY8A 4XSMA 4LNCA 3M5YA 1XLEA 3WJZA 2OSYA 3GDRA 4G1KA 5REQA 3S0CA 1M9HA 1H7RA 3BSGA 3HG2A 3VNLA 1LBFA 2QGHA 1XIDA 1GVQA 4R27A 4LF1A 2F84A 2OT0A 3VOFA 2PP0A 3ATYA 3LPGA 4N6FA 1U33A 4O50A 4MGGA 4UTWC 5I2UA 1WOAA 1OM0A 4MHBA 5KTLA 5HNNA 3MS8A 4C5ZA 3TN5A 1FUYA 3HPFA 4S3AA 4HHLA 4O52A 3IJLA 4NXSA 1QWGA 3W1AA 3HBLA 5HJXA 2CIPA 5FJUA 4CGTA 4C7FA 3AXMA 3BAIA 4R88A 1WKEA 2P3ZA 4MKNA 2BTMA 5JBDA 1DJGA 3GX9A 4AX6A 4MJ2A 2QPSA 3B9EA 2QCMA 2WMGA 3PB2A 3BE7A 3Q4DA 4IFOA 4QJ4B 4W85A 5HPCA 3KXQA 2IQDA 3NXFA 3EAUA 2VGBA 4GG9A 2GPTA 3WQCA 2GGHA 5CZSA 5XINA 4YMZA 4GFIA 1V7AA 3W76A 2V5KA 4ZCWA 2QIIA 2EPHA 1SFSA 1XYBA 2BXVA 2VRJA 4PFMA 1UD6A 3RPDA 3VIGA 5FF4A 2WVVB 4JQ3A 3H2AA 3LX9A 4FIQA 4RDZA 4LOCA 3WUFA 4KEMA 1D9EA 4CNNA 4GXWA 1D8CA 3AISA 3G1YA 5HPOA 2XZ7A 4XIAA 4JEJA 2HE5A 1QHZA 4PZVA 4EIVA 4GQQA 1EYEA 1CDGA 3L2LA 2PDXA 2ACQA 2VFDA 1JDEA 4NJGA 3MWCA 1BTCA 3CHCA 1EJ7L 1EHNA 5IM51 3E38A 1SJDA 1GPWA 1QNRA 3VNMA 4DWSD 3M6DA 1XJBA 3KBNA 2ISFA 3KHJA 1A47A 1TA3A 3W2LA 2A7NA 2VX6A 4C6CA 3H8AA 2EBNA 3PP7A 4LCQA 3PPCA 1K8CA 1LOLA 4NAFA 2RFGA 1NOWA 1K9DA 3II1A 4BS0A 3ERPA 3R6IA 1XIFA 1VHCA 2V5LA 1UUOA 3K8LA 1F05A 2A6NA 1SFLA 1XYMA 4P61A 3B8SA 5HMSA 1UR9A 3SI9A 2F61A 3RCNA 2HXTA 5CQ1A 5I3KA 2B0MA 4ECLA 3IUDA 3LCHA 1JIBA 4BK9A 4P8UA 1Y5VA 3P80A 2QCDB 1V6XA 2EGZA 5EBAA 4A8NA 3S4TA 1A4MA 1YEYA 1V93A 2H3BA 4QM1A 1XM3A 3UA3A 1SFJA 1WUEA 3R1ZA 3E5PA 4UUIA 2CWXA 3SSJA 5C2GA 3F4DA 3IAQA 3WNNA 3L5AA 3GC5A 3WK1A 4B5WA 3W83A 2J62A 2D3NA 2Y6ZA 2DZPA 1DBTA 3SCPA 4M3PA 3TXZA 4LRSA 4EX4A 2OQHA 1HG3A 4LH8A 3WKZA 1W8GA 2CC0A 4YVVA 4UTLA 1F6PA 3M5ZA 3S3GA 3G24A 4MLJA 4XKYB 4C6FA 1VKFA 3CPUA 4QXIA 3VXGA 4DY1A 2DT0A 3B97A 4WOZA 3SRHA 1GEHA 1AH4A 1JCJA 3UCQA 2KZHA 3HGOA 4NJHA 3MC5A 2D20A 1ZU8A 3IACA 3QPEA 2JGQA 1BRLB 3V0TA 5FACA 1RQHA 3BK0A 4XD6A 2PLCA 1UHVA 1S1PA 1J5SA 4UTMA 3W82A 1S2AA 1Q85A 4GK8A 1E40A 2DW6A 4LYRA 1PV8A 3MCMA 5CPQA 1U22A 5EU9A 5HR7A 4TXEA 4MJZA 4YYFA 4Z2GA 5FAJA 1TCDA 1JCXA 1C29A 3DXIA 1L8PA 2EEXA 2WNNA 3WJWA 1UJQA 1E0TA 3OZOA 1V3JA 1YE4A 1VLWA 2EPNA 3ID7A 2I9UA 5DCEA 4QEHA 3IK4A 4DJED 4GACA 2PBOA 1OFAA 4TQTA 2QZRA 2WZTA 4IZGA 1EDQA 1UA3A 1CECA 2X7WA 4M8UA 3FN9A 3A13A 1YBQA 4I5UA 2YZRA 2Y7EA 1RCXB 4KBXA 3LMYA 3W1TA 1EPVA 1HGWA 2GVJA 4H9TA 5LSMA 4L4MA 1FXPA 4NP7A 1GWJA 5CLTA 1W3KA 3A9IA 2WWDA 3ABXA 3VZYA 6PTDA 7TIMA 3T40A 3P8JA 4JTQA 3FKRA 3THDA 5IRPA 1CGVA 4IFRA 4TOQA 4DWSA 3GDKA 4JYDA 3CWNA 3SEPA 2UY2A 3GDTA 3AS0A 2XH2A 1OC5A 3QSRA 3MI3A 3KWXA 1OEPA 4KCUA 2PZ0A 2BVTA 2V6AA 4ZBCA 3SRKA 3ZSSA 1DIEA 3TYAA 1EJXC 4HSHA 3ALFA 2NUWA 2PZNA 4U33A 3MA8A 2YB4A 4GZ7A 3NL2A 3BV7A 4CD8A 3HA1A 1I2QA 1W6TA 4LS2A 1NQ6A 4JDYA 2VELA 3VM7A 1DYSA 2DSVA 3VPLA 3VOHA 4HYRA 1G0CA 3R8HA 4M5PA 1ICQA 3MPGA 4PULA 1WZAA 4PRWA 4QISA 5JUVA 1IT7A 2UBPC 1UIPA 2ZUVA 3AC0A 2CZEA 2XUCA 1TWDA 3N9RA 4QS6A 3UZ5A 2Y61A 2OPJA 2QUNA 1FVPA 3F1QA 1OGGA 1EWEA 3B0UX 3O6CA 3H23A 1MMFA 3TC7A 4ADSA 3N4FA 1HKMA 1XS2A 3TQVA 5FJRA 1DWJM 3A6OA 3OGSA 1Z89A 3NDYA 3RM8A 1SZRA 4I3GA 4RV8A 3RLVA 5K3VA 1A5CA 1V77A 3S5NA 2YXXA 1UZ4A 2VWTA 4PMXA 2ZXDA 2NUYA 1E4NA 5AC7A 4RZ6A 1NFGA 1CYGA 5HQLA 4TO8A 2ZA3A 3MDUA 1ZUAX 3V1HA 5AVHA 4TX8A 1F74A 4TMCA 2G8ZA 3K4AA 1S5VA 4K1GA 1XYLA 1JFHA 4F0SA 1DQXA 1MEWA 1E70M 5CEWA 4QE1A 4JS3A 2G96A 4IPPA 4FNPA 2PP1A 2YL6A 1J0IA 3CZGA 4L9ZA 4HTYA 4IPLA 3STPA 4WR3A 1TPDA 4GIAA 2H8XA 1VCFA 2FZDA 2BP1A 4AZ5A 5FL1A 3MANA 3BSMA 2C7FA 2Y7GA 4B5UA 3REQB 3U3HA 3F4VA 3PZMA 4TTUA 4UTIA 5KZMA 2WPBA 4NZCA 3KVKA 3TJLA 4XK2A 1AZ1A 4MMWA 4YPJA 4NNCA 2IKIA 1VZWA 3P84A 4N9DA 3B04A 4DJEA 4HOXA 1XCFA 3URBA 1AJ0A 4DZIA 1W5PA 4PTDA 1VYPX 1TV7A 4Y6GA 3NQMA 3L66A 4TV6A 1VRXA 3PG8A 2DZWA 1EBHA 3LGGA 4W7VA 2I5GA 2G3FA 3WJYA 3LXCA 4O54A 1GTEA 3B4YA 4GWEA 3CB8A 1FH9A 1EP1A 3M0KA 3MYPA 1F07A 5FF2A 1FP9A 1SUXA 4HCLA 4NI3A 4JIHA 3S5ZA 1TTIA 5I24A 3KDOA 2X0SA 1F4AA 1VAHA 2X42A 4LUTB 1S2TA 4OV4A 4JN6A 1TV5A 2VUYA 5KSWA 4ZO8A 2VTFA 2OQLA 1ICPA 1PE1A 1JG9A 4XBKA 1QPKA 3OLEA 4PH6A 1M7XA 1OGBA 5HNTA 5XIMA 2QCFA 5LYRA 4CVWA 4PB4A 3AXXA 3QF0A 2PD9A 1K03A 4BKNA 5C2CA 3EWXA 4JZ5A 2R8WA 2ZX7A 1RBAA 4GKTA 2ZUWA 1XYCA 1T8XA 5HBFA 2BHUA 4GBUA 1CXHA 2EXOA 1DP0A 3M0LA 2Y63A 2INEA 3DC8A 3M0JA 5M5DA 5LA2A 1UC4A 3C86A 2XVLA 2FZMA 3P5YA 4QDPA 3KCLA 1I2NA 3GTNA 3C8FA 1QNQA 1V3LA 4ATLA 4CN4A 4UFMA 1Q65A 1AD1A 3BQ5A 2AGKA 1B4EA 1P7TA 3PR2A 4AZHA 3S2JA 3WELA 4WXYA 1MSSA 1E1EA 2O7QA 4G5DA 1BQCA 4Q8TA 1KKOA 1J0KA 2FB3A 4AAJA 1LLOA 2XIMA 3NIYA 4D8ZA 2OQYA 4HHHA 3FS2A 3KS5A 4IH3A 2QDGA 3AHXA 4CNSA 3BARA 1Q6DA 2XN0A 3AROA 3WL0A 3M0IA 1BWVA 4HB7A 1X7FA 2ZXQA 1M7OA 3QQ0A 2IXVA 4H7VA 1FWSA 1OIFA 2GJLA 4O11A 3PFRA 5H8MA 2QUTA 4AZCA 4C1LA 2I5IA 1AH3A 1X8CA 3AWNA 1WOBA 2QJJA 2RAGA 1TQXA 1BVWA 1W2VA 2J6XA 1LUCB 1UP2A 4W7UA 3EMZA 3E1F1 4GQBA 4UC5A 3ZQ9A 5IDZA 1S5MA 4F4RA 4B5TA 4CUCA 3TW9A 1PYFA 4XQ6A 1EZWA 1G67A 2R91A 1AODA 4KESA 3VDGA 2J4GA 1VPQA 3H7UA 4GH1A 1G7VA 1X38A 2X0YA 1KRBC 3P6LA 4FSAA 1F3TA 3DFQA 1CI1A 1E4LA 2RUSA 2YL5A 4S23A 5F4WA 4PUJA 2J13A 3TOPA 5T9CE 4XZNX 1K3UA 4PR4A 2O55A 2ZZ3A 3AIRA 1CZ1A 4LY4A 2NVDA 2J6VA 3SIZA 2NVAA 1Y7VA 4RNJA 3HGJA 2YCKX 1DV7A 2RDTA 1XSIA 2J9YA 4GHRA 3B3DA 3R58A 3RIKA 3L12A 2QV4A 5ABFB 1S2WA 3A3XA 4W9TA 2J27A 5LIWX 4LAUA 1R0MA 1X6LA 3MB9A 2XFFA 3P5ZA 5HDRA 3URNA 3E5BA 1F3XA 2YBUA 3DFTA 1RBLA 3SN1A 3LB0A 1NSJA 2PWDA 3RMJA 1RHCA 1H09A 3EA2A 3WQ6A 2PTWA 2WC3A 3CH0A 4QIUA 1XLLA 4E4FA 1UR1A 1RPXA 3R0KA 2D24A 1K4HA 4GGBA 3HO8A 1XXXA 1XQLA 4GUGA 4ZR8A 1K9FA 3WLRA 4D6CA 1ONXA 2CZVA 3RUBL 4C6LA 2OKOA 3STCA 1WDWA 3OYXA 2BY1A 3W1QA 4ILSA 3R79A 3U4AA 3FJNA 2WMKA 4ML4A 3GRIA 1KFBA 1E9ZB 1FP8A 2DZTA 1WBJA 4NHVA 1TE6A 2W61A 3OBKA 1GKRA 3GXPA 2GVYA 1RH9A 4PRTA 1XBXA 2QVHA 3ZWSA 3C2VA 1LBLA 1YTEA 2O4MA 3GVQA 1VEPA 4JIIX 2GDVA 4JAWA 4PTWA 1H0IA 2BXYA 5D2VA 2E3ZA 5DT7A 5JH1A 3TQPA 1A53A 1UJPA 4JHOA 4IX0A 1XUZA 1ODUA 4JFWA 1BKHA 5I7GA 2H9AA 1HXJA 3DHUA 1EHAA 4GYKA 1XIMA 1J5TA 1TRDA 4ORMA 3B8UA 1BAGA 5FOOA 1XRTA 1W31A 4QJ3B 4E38A 5U7SA 2CCRA 6ALDA 4PGLA 3DG6A 2WC7A 2GVGA 4M80A 3UPMA 1DIOA 3PY2A 2X7VA 1GOWA 2EKCA 3LS9A 4OUEA 4P5UA 4QLLA 5CH9A 3UA4A 3EX4A 4K8HA 4CNPA 2X1TA 3DERA 4W5UA 3PBYA 1VBGA 3VM5A 2PDBA 4XV0A 4X2PA 2FTYA 2AAMA 4XIMA 1V51A 3AAMA 4NNBA 3DI1A 4LX4A 1GVYA 2REQB 1JXJA 1QPQA 1L0PA 3BAJA 3CTLA 1NVMA 2QDEA 3SUWA 4NG3A 4H4IA 5LIYX 1GVOA 3PBWA 3P14A 3N1AA 2Q09A 4HJFA 5D04C 1WXZA 4JNZA 2A3HA 3TTYA 3E96A 1D3GA 5FJJA 3VIMA 2CLIA 3T0AA 2NVCA 1WZKA 5D2XA 2P10A 1HW6A 1IIGA 1N55A 4JIEA 3TTQA 4ONVA 3C2EA 1GVSA 2NWRA 3UJEA 1M41A 1RP8A 4EWND 2XDFA 1FWGC 3M44A 3EWYA 3IIVA 3PK7A 4UMAA 5HUOA 3HPZA 3D3AA 3I10A 3SY1A 1W1PA 3KOZA 3GTIA 4X3ZA 2OEKA 3KTXA 4JNYA 3CIWA 1BQGA 3IRSA 4QS5A 4DBEA 2PF0A 4IHCA 2PDLA 5C9ZA 4JICA 2ZRVA 4Q7BA 1UBSA 4E4UA 2QW5A 3G1FA 4E2OA 1SJBA 4PN2A 3NXLA 1NEYA 1KWKA 1TJ1A 1E72M 2VURA 3QV8A 2BFGA 3L4UA 3BW4A 4NSBA 5REQB 3VOIA 1KRAC 4AY8A 4BWLA 1RQBA 3UWZA 3L67A 1HKVA 3S1GA 3V7PA 4M6QA 4J3XA 1ZENA 1PTDA 5CSSA 4PODA 3WH9A 3CV7A 3O63A 2OELA 4HMCA 1GW1A 5LNUA 6ENLA 2XIOA 3UZXA 3IIZA 3OG2A 1F6YA 4J27A 4O10A 5BMWA 5HA7A 3N4EA 3W9ZA 4PMQA 5AYZA 5F4XA 5HR6A 3G18A 3CB3A 1U83A 4HA0A 3SN4A 2C1IA 2YCJA 1HJUA 3TQKA 2DH2A 3RLHA 3W3OA 4DQWA 5B7YA 1JDDA 1OCQA 3AHTA 1XLBA 4I5RA 2HS8A 2YDQA 3PNUA 1JGIA 3KFTA 4C5YA 1XLIA 2WMIB 2PWFA 3T44A 4GZIA 3T55A 1M04A 1ZB5A 4IPIA 1YE6A 3MUZ1 3OYZA 4WSHA 4QNEA 1IXPA 1ZBVA 1EQPA 1RV8A 4FOKA 2XVPA 3AJ7A 4WY0F 3EWZA 4AMAA 2QJMA 3IJ9A 2PDIA 1REQA 4RE2A 4Y8FA 4P7OA 3TK7A 2GUYA 5E09A 2YA2A 1ZP3A 1DVJA 5JXQA 5DCDA 2PDNA 1V7YA 4HHMA 1JZ2A 4Z2IA 3RGTA 2PLJA 3F4NA 4LBUA 2DJLA 5H8UA 3BOLA 4P8WA 3CUZA 3DFYA 2OOFA 4E2DA 5T8GA 3AZTA 3VOJA 1TTQA 4QE5A 1RLDA 4JN8A 4Z1CA 4UR7A 1G4EA 3CJPA 4GIRA 2Z1WA 5KZEA 2FIQA 2PA6A 5C7VA 1NDVA 1O5QA 1I9CB 1TA3B 2Y7FA 2XGBA 3GTFA 2WSYA 4BY3A 5E70A 1MO0A 1KV5A 5BU9A 1W3IA 5JMUA 2NW0A 3UXKA 1R2RA 2BS9A 2W67A 4RKAA 4U5IA 4UBPC 4K39A 4DJDD 3PSWA 2D2OA 4FLRA 3SCTA 3VI2A 4BFAA 2QXWA 1KKRA 4J3WA 2PUZA 1C8VA 4D6FA 4DI9A 1YNYA 5I79A 3QMSA 3OQ8A 2GLKA 1P0NA 3M1ZA 2A3AA 3NFUA 2ISDA 3WD0A 3T05A 3W7GA 5FEZA 5IFPA 4J5NA 3WCZA 1VJIA 4G7FA 1OT1A 2J7GA 1QAPA 1KTNA 1M65A 3BJTA 2XM1A 2C91A 2VC7A 3K8MA 1C8QA 3PBMA 1Q7ZA 4EE9A 2ACSA 5I00A 2OLAA 4ZTYA 1GG1A 4A4AA 2XSAA 1LL6A 5CPTA 1PDYA 3URAA 4UNKA 4LAOA 1G4SA 1DJQA 2WHJA 3EPMA 4GQRA 2VWSA 2WVTA 4ZTXA 3W1RA 2QUVA 1US0A 2XFRA 1H62A 3W1MA 1BVZA 3E6EA 1VBHA 3WLNA 3VD9A 3E74A 3B8IA 2ZE0A 1VJSA 2HXUA 3HGRA 4ZVJA 3NZRA 3U0HA 3CH9A 3W7IA 2ZUUA 1HF6A 3B06A 1ZZMA 4E8GA 5A6LA 4L4PA 4EPBC 3FYYA 1UD5A 3FK4A 1UIOA 8XIAA 1CX9A 2BOFX 2XIBA 3UPWA 2C71A 4PEKA 1K9TA 3VOGA 3T1GA 5FJTA 3ZJ7A 1UZDA 1BWKA 4MPKA 3VTRA 1DJWA 5DEZA 5CBJA 1E1FA 1R3QA 1C3FA 5HJLA 3HU7A 1TX0A 3FJ4A 2XM2A 3VGHA 3O07A 1IYXA 1KXQA 1K1DA 3NQGA 2DFAA 4L9YA 3MUCA 3PUOA 5D05A 3W85A 4Q7IA 1LWJA 1GVRA 3SQMA 3N6QA 1HJWA 4FXRA 3UR2A 1XD0A 5CPMA 3W6YA 3V16A 1K7XA 1KBIA 4NKCA 1E0WA 4L1GA 3VFCA 3L4ZA 1OK4A 3MBDA 2PTYA 2HBXA 4WKFA 3DENA 1YBQB 1NDZA 2V82A 1B3VA 2EJ1A 1N2VA 2WSKA 3PF3A 4ERGA 3TP4A 1DWFM 3ZFHA 3P93A 4R9OA 3VKCA 3UR5A 3LUTA 1A0DA 4BQ2A 2QJIA 2ZICA 1MXDA 2PLMA 4DWSB 2JF6A 2ZQ0A 7REQB 2D69A 2I17A 4GUFA 2HBVA 3WMCA 3FOKA 4HNUA 4FX8A 2AL1A 2R24A 1TG7A 4CQDA 2OODA 1UKOA 3DUGA 2HE8A 1ITCA 1M3UA 4HA4A 3O05A 2HWGA 3D5HA 3FSTA 3QKEA 4DZ5A 3GIYA 3W2NA 1MEIA 5AYYA 4HPXA 4HD5A 1RVKA 1XC4A 1R3WA 2P0OA 2BHYA 4OBSA 2ALRA 1GHSA 4EF9A 4HPNA 2E68A 4XG1A 3ZLGA 4WSKA 5LGXA 4S2BA 3OW1A 4NF7A 1O6IA 3QSTA 5CSYA 2Z6JA 1W9BM 3M0XA 1QBBA 4PC8A 1Q6LA 3TZNA 2CBIA 1TSIA 3TCSA 3U8GA 5KMYA 4DIAA 4J40A 4DBWA 2WAGA 4TTGA 3STGA 1B2YA 4CVUA 1UD4A 1W3TA 3TSBA 1EJTC 3H2CA 5LHEA 4DJFD 4LQ1A 2BODX 3GNNA 1VFOA 2VJXA 1LF1A 1QVBA 2F7FA 1FDYA 4WGXA 1J12A 3HPAA 1S2UA 2D22A 3BAKA 3GVGA 2UV8G 1W3NA 3KBSA 1H7OA 3WFAA 4ACZA 4C6KA 4B4FA 1E3ZA 3VX1A 4C6PA 3LV5A 1JI1A 4U28A 5A2AA 3UERA 3IUHA 3K4DA 1KBBA 5D32A 4O53A 1LDCA 2XG9A 1EDGA 5CGMA 2OSWA 3MKVA 1UPMB 5I02A 2OX1A 3C2YA 4LAZA 4AD2A 3GNRA 1ZJIA 3C0JA 2ZC8A 3QV7A 4WD0A 2DZUA 2Y70A 3HZ3A 4C7DA 3RJYA 3IAPA 3DC0A 3LPOA 1QT1A 5I3DA 4XTIA 1U5VA 1WZLA 4UOQA 4GISA 3DZ1A 5CC5A 3LA4A 4Z08A 3UG3A 3LCWA 1DEDA 5T9BG 4QNWA 2E67A 1BHGA 1DWHM 4CKQA 3D46A 2Z26A 2VP8A 1ADDA 3S1VA 3MU7A 5TNVA 4DBUA 3SRDA 1PBGA 1LRNA 1DIKA 1GZJA 2DVTA 3QC0A 1J10A 2BX7A 4H01A 1TMHA 5E93A 5A8OA 2NXHA 1ML1A 2QNEA 2YBTA 5DY3A 4AWTA 3OA5A 1Y8BA 5EA9A 5D9NA 2RDUA 4GI4A 3OGVA 4GPNA 3MHUA 1T0OA 2QIWA 1ITUA 3VAVA 3O6YX 3WQFA 2ZCGA 1MDRA 1WQ5A 1BYCA 3SSZA 4PUEA 4JYFA 3CK5A 3WUEA 2X2YA 5G1TA 3K1GA 4RK8A 3WNLA 4K36A 5I07A 4GY1A 3H54A 3NZGA 4B5SA 1NWTA 5PTDA 1JNDA 1H1ZA 1LORA 2AMGA 5HMFA 4UTTA 1OF6A 4IF2A 1XLJA 3M0ZA 4XZ9A 1GYLA 3HIJA 3UZYA 3IJQA 1T40A 5D9OA 4JFVA 3T0CA 1S46A 1CIUA 3W22A 3BO9A 4JL2A 4KCWA 4YYCA 3EB4A 5ECVA 4R34A 3ATZA 4GI6A 4WJXA 3EOLA 3CMGA 2XIJA 1SZFA 4MNMA 4N02A 3MDWA 3WK3A 3WK2A 2CPUA 1B0IA 1ZJBA 3W7QA 4BI6A 3P0XA 4M6UA 1OFPA 1RSCA 2FHFA 4D6GA 5C54A 1AQ0A 2QF8A 3LCXA 4Q4RA 2WYSA 2PDYA 1SGJA 3P61A 4DZHA 3N29A 5CKSA 4CEUC 1D7FA 2ZZ5A 3CZ8A 3K1DA 3SB0A 2WKGA 3FIGA 3NJ3A 3C0LA 3TYUA 3BPWA 3VD5A 3W71A 1HNYA 4XTDA 2QMJA 1P7TB 4GINA 4IJRA 1A5UA 5FSDC 3M4HA 1VBUA 1XLDA 3CQHA 3DX5A 4QITA 3CEUA 3CQ0A 4A3YA 1OINA 3WQ4A 3EDFA 1VLIA 1TTPA 4DJFA 3ARXA 5I03A 2E09A 4TVCA 1Z6KA 3UZWA 1J96A 2BNJA 3RU8X 5BRQA 4RNIA 3TAOA 1ME7A 2BZNA 3EPOA 4HCHA 3SY5A 3ABZA 3W7MA 2NV1A 4TX9A 2YSWA 3DN5A 3SCSA 4M0XA 4AZCB 2CZDA 3WQOA 4J2MA 1OGSA 1QR7A 4IQDA 1QW9A 4IP4A 1PWMA 3T7VA 1OX4A 4IJBA 4QFUA 3QOMA 3AIVA 4ALDA 2QCGA 3QOKA 3ZOAA 1OCNA 3M7WA 1R5YA 1XIHA 1I8JA 4OKDA 4ZQCA 4MLRA 1SZNA 1F61A 3A4JA 4C6BA 1D3CA 1LOSA 1H4PA 1KR0A 3U2ZA 2PBGA 4BWLC 5I3HA 3LLFA 3CT2A 5I6SA 1JQXA 2VDHA 1ITXA 4MB5A 2PAJA 4DO6A 1S3HA 2YYTA 1M53A 1V6VA 1VFUA 4AC1X 4XZWA 3L4WA 2YGYA 4MZYA 4Z0SA 3DFSA 2GZXA 2PCQA 1JYXA 4NZ3A 4F0KA 4CNOA 1NTHA 3O0FA 1KRMA 2ZRXA 2G3IA 2J8GA 1DE5A 1EA0A 4ZMGA 1J01A 1EF2A 4UTKA 4IGHA 2CERA 2EJAA 3W87A 4KF1A 2WVSA 4HNVA 2DZSA 4EPDC 1YTDA 1XICA 4NY2A 1FCVA 4O1BA 2VVSA 1TMLA 5DMNA 1UBPC 2IMRA 1QK2A 3ZT7A 3S6DA 3U57A 2YXOA 3B9OA 2PDJA 3R10A 4F9DA 1JYWA 1UWIA 3EWDA 2MUCA 4LB3A 4ZOAA 1H1NA 1UR4A 1PZ3A 3DFOA 3BV4A 4AEFA 4ZFCA 4H00A 1HJXA 2J47A 4PYSA 4JGDA 2R1MA 3WEMA 3G6LA 1E56A 3U2EA 1KGWA 4ZODA 4DNHA 4LTSA 3FAWA 4V1YA 2PP3A 2PTXA 2BXZA 1T7LA 4IIBA 4R3UA 3G77A 1WKDA 2PDKA 1RVGA 3WF3A 4M1BA 2HV5A 2G4JA 1XFCA 5CPNA 3QZAA 4J9JA 4XVEA 1EP2A 4JTFA 1ZL1A 4NZ5A 3DKJA 3T4WA 1IR2A 3CAVA 1DL3A 1UCWA 5LNRA 1LLZA 5G2IA 4FOUA 3LYEA 1M7JA 5HANA 2VD8A 4HK6A 3S46A 4FZIA 3GG8A 1SJCA 3IVUA 2VGIA 3AICA 4B3KA 2YCEA 1BG9A 2GSJA 3S1UA 3SQLA 3QR3A 2H9AB 3OJGA 3VE9A 2VENA 1YDNA 1PWLA 3W2MA 2O56A 4EP8C 2CFFA 4WCJA 3GUWA 3WSUA 2Z28A 2CLKA 4AVOA 4HNNA 3P7YA 1JCNA 4EAMA 1W3HA 4H3DA 3E12A 4KFPA 1H7NA 1UYQA 1PX3A 4OV9A 1H61A 2FVMA 2OYMA 5BXPA 2VYOA 2QJNA 4LPCA 3K30A 1W91A 3JVAA 4OHQA 3VCCA 4FALA 1CB7B 3MV01 3OZMA 2Z25A 2WM1A 5A6BD 1KNWA 1AJZA 2DZXA 4PBEA 3IV3A 1KBJA 1UWAA 4GD0A 1V0NA 3GBDA 3CIXA 1IEVA 1K02A 4MADA 3FDGA 3TFCA 2PDPA 4JIPA 1X6NA 2Q3RA 5A3HA 1WBHA 4YVXA 1AH0A 3T09A 1QI5A 3L21A 4YU1A 3TTOA 3M41A 1UWUA 4AZ7A 4GGHA 3GSMA 4GMEA 4YTUA 1BGAA 4LF2A 5T26A 2E6AA 4J3TA 2ZUTA 3TQ0A 1XR2A 5L9FA 4KEZA 5EMYA 3HTWA 5E0FA 5AVNA 1P5BA 4B5NA 2G5WA 3LHTA 2MANA 4TVDA 2WNZA 3KM8A 2CLFA 5IHRA 1TREA 4NT0A 5AHEA 3W6MA 4JFUA 2PGWA 3T9PA 3RG6A 4FB7A 1W32A 1UPPA 1IZJA 2TMDA 4AMCA 5G1YA 1GVEA 4UCGA 1YMYA 3AZRA 2G41A 4YWSA 4YVPA 3VKBA 3GHRA 4OBRA 4AIUA 5FKYA 2V63A 5CZ0A 3UXIA 4WDUA 1V03A 3NURA 4PMRA 1E4MM 4DO4A 3VIIA 1QI0A 3WNKA 5ABEA 2ZA2A 3XIMA 2OGYA 2PGFA 1ISWA 1A4LA 1F73A 2GQAA 3FHQA 1TIMA 3H12A 1J2BA 3SJ3A 2A5HA 4ERIA 3JZUA 5DANA 1NQKA 3WUGA 2VC5A 4JQ1A 4UFJA 2VRKA 1ZFJA 3V36A 3W88A 2E5BA 3ORWA 4H1ZA 4MYXA 5A8GA 3K4WA 2I16A 5FA5A 3WQEA 1IXOA 2Q02A 1SSDA 5AHNA 2J7CA 1JRCA 3QHNA 3AIQA 3W75A 1W56A 3F2BA 4ORIA 3QYQA 3VIFA 4W89A 2BV9A 4Q4OA 2OG9A 3NEHA 4AHOA 2HSAA 1HTIA 3APTA 1KCZA 1EJVC 2ZADA 2DQWA 1J6PA 3W2UA 3GDMA 1TVPA 3CNYA 5HATA 4ML9A 1CGTA 3B05A 1DOSA 1KQYA 4A35A 3T07A 3CYVA 2FDMA 3AHYA 4MAVA 2I57A 3HG4A 1ME9A 1QHPA 4GUHA 4JTRA 5HAOA 2PEVA 4L6DA 4KWUA 1WE5A 4RE4A 1N7KA 4WOQA 5TF0A 4GIYA 3WL1A 1PXGA 4FO4A 3CHVA 1QWKA 1PTGA 2WJEA 3N2BA 4F48A 2VEIA 4J3VA 1RP9A 1REQB 2GYIA 2X16A 1MQRA 4C6IA 2YDRA 3K2GA 5E0CA 1JNEA 4O17A 1J9YA 3NYZA 1QO5A 3NZQA 1W54A 1XFBA 4GYFA 1MWOA 3SCNA 3WH5A 4YIWA 1VCGA 1BYBA 1S5TA 3G0UA 1JZ5A 1SZGA 3L5MA 3VMPA 3QFWA 4FK9A 4PCPA 3P81A 4LXFA 4S38A 5FJPA 2O92A 1GG0A 4CQBA 1OIMA 3GHTA 1VBRA 2ISSA 3PWIA 3HV9A 3RHGA 1BF2A 1EIBA 4IFKA 4JFSA 1GQLA 2FZBA 3WLMA 3GVRA 1CENA 2O0TA 1V02A 3UVAA 3VNJA 4Q4SA 3T42A 4H41A 3W7CA 1XBZA 3U5UA 1HIZA 3VD3A 3LI1A 3NZPA 3ICJA 3YPIA 4IIDA 4HU8A 4QX4A 3VYLA 1E5NA 2PLKA 5C9WA 3TR9A 3CAWA 2QVNA 5C55A 2E5CA 2ZX5A 4A8RA 1MW3A 3P60A 5CPLA 2HTMA 4KGLA 1JCMP 3RCMA 5CSUA 4AXKA 4KCVA 4UOZA 3KX6A 4HN8A 3NCOA 4MZ1A 3QJAA 1UR8A 3HG5A 4NVTA 1G6CA 3CAKA 1OVDA 2O4QA 4X63A 3QM3A 2GSEA 1GW9A 1XGZA 1KM2A 4DYKA 1DXFA 3IEBA 2ZIDA 3BG5A 3VIJA 1NU5A 4MWAD 2NX9A 4E4PA 3NQ7A 3FJ6A 3F7JA 3S2NA 4PBFA 2PRLA 2VR4A 3QQ1A 3SURA 1EGMA 2DPEA 4ZOBA 4AY1A 2XU2A 5HWNA 5J04A 3EOEA 2DY3A 1NF7A 3WLTA 3CQJA 2XH7A 4ZEPA 2Y24A 2X1IA 4H8HA 3F2DA 4EVZA 4MOZA 3F2CA 5JBFA 4OVXA 1SFTA 1ITQA 2Q3OA 4AZGA 3RITA 3QZ6A 3TAKA 4PA8A 1UWRA 3GR4A 1U1HA 3PAJA 4XISA 2QEZA 4AVNA 3BGJA 4YTQA 1TPC1 4GBDA 5I3JA 1ISZA 3VIOA 5GNZA 4RXGA 3V5FA 2X30A 1LG1A 4XWUA 3NL6A 2A7RA 4AYSA 4REQA 1OG6A 1CW2A 3APGA 1XDMA 3Q94A 1W0MA 5LA1A 2PC4A 3WF2A 1P0EA 3CZJA 1Z8AA 3ARYA 5M17A 1VFLA 1R3VA 4C6EA 1AK5A 5EGRA 4LB4A 3IV8A 1SR0A 3RRXA 4FOJA 4Q6JA 4TX6A 2RGMA 2DZVA 1YADA 2WB5A 4WVXA 1ZGDA 3USZA 4UTHA 3C52A 4X2RA 3QLDA 1NWSA 2OWXA 2Z1KA 3SUTA 3KRZA 1AZ2A 3STEA 5FAGA 3I68A 1GOIA 1TUXA 4O15A 3GH5A 2C8NA 1G9HA 4LVDA 5CPOA 4V33A 3H24A 4IPNB 1XG3A 1SPQA 2DSKA 4AZ6A 3S6OA 1A5NC 1B30A 2B7NA 5G4EA 4M7SA 1N82A 3M0MA 3W23A 3UWQA 3SRFA 3V0UA 3O15A 5F4SA 3E49A 3PBGA 2VX5A 1KXTA 1H0GA 2W91A 4FEZA 2WSPA 3MP4A 1GZGA 2NQJA 1JCTA 1JVNA 3LCFA 3B0XA 1JZ4A 3BUVA 3G1AA 2QKFA 5HJYA 1U1UA 3TSDA 5C70A 2E9BA 2YFOA 1TTJA 3HMJG 3TN4A 4AHPA 2HS6A 1JPIA 3FHAA 1WXYA 3AS2A 1S5NA 2QCEA 1DWGM 1KM0A 2BY0A 5E6ZA 4RZ5A 3RMEA 4C1KA 4MY9A 1L2QA 4I6KA 1ZP4A 5CG0A 3SFWA 1VR6A 3NVTA 1V3MA 1DKWA 1K8YA 4AWEA 3KCJA 4IIEA 3G1RA 3EXTA 1H51A 5G5IA 3I65A 4JTLA 4RE3A 3UP8A 2E6FA 2Y89A 1FWEC 2HNHA 2W63A 1W9UA 2GJXA 4MWAA 1CGWA 2OYLA 4WHBA 3B8WA 2GJNA 2VOTA 1OFOA 3MMDA 4LALA 2C1GA 3TJIA 3CBWA 2ZZ7A 4E5TA 2PC8A 3SAZA 4I6VA 1E6NA 1J0YA 1Q8JA 2NLIA 1TR9A 3PJUA 3QRHA 4RDYA 3EA3A 7ENLA 3GR7A 4LC6A 1GKPA 2ABAA 1TWSA 2W62A 4HIBA 5BCAA 1YXYA 4A2SA 1VFSA 3AXIA 4ACZB 4HP5A 1AQMA 3E0LA 1XDLA 3PC0A 1FXQA 1SM9A 3VKJA 4O8AA 2C3ZA 1BFNA 4UQAA 3VABA 3O3RA 1I60A 3ARTA 4EXAA 3A4WA 1KXVA 3QR1A 4Z0JA 3WLSA 4FR6A 2QJGA 1C8YA 4W8BA 4M19A 4PMOA 4HZ7A 4W84A 4J3UA 2X1RA 3W28A 1QRQA 1KFKA 3MSGA 4H2HA 3AXKA 1NFBA 2TPSA 1C90A 1KR1A 3Q65A 1W5OA 1F9CA 2Y8KA 4LJ3A 1MXGA 3IK2A 3G22A 1I1WA 3EBVA 3HJZA 3EKGA 2ONEA 4E2VA 1TZZA 3LTSA 4LW7A 3POHA 1ADOA 3MUAA 4Q8PA 1A80A 5HQMA 2VI0A 3VGDA 3W1UA 1CTNA 1GHRA 3N15A 1O1ZA 3PPFA 8A3HA 3R0UA 1LQ0A 1MW1A 1ZLPA 5LZLA 3A3WA 2BWGA 2HNEA 3BAXA 4UQEA 1JZ8A 7PTDA 4K7VA 1FCBA 2IPWA 4YXGA 2CLEA 5CXPA 2JIEA 4A2RA 5CCZA 2VZTA 1EO7A 3EB3A 2OWCA 3WDJA 5FESA 4CQ8A 5EL1A 1KFEA 1B31A 3AI0A 4K38A 4IQEA 1TPEA 1YHTA 4MUPA 1PKLA 4ZZ9A 1GVFA 1UB3A 3W7RA 3GM8A 1JJKA 4MY8A 4CLMA 1A50A 2FMNA 3QTPA 4JOMA 1CXEA 1DWIM 1YTKA 1FFQA 4LYPA 3WH8A 4CD4A 4S39A 1QW7A 2VNCA 4B90A 4O0ZA 4A3UA 1G4PA 4LC8A 3M5VA 2J24A 4IJCA 1U2YA 3UW6A 3RX4A 3NQFA 2ZVRA 2IPJA 3K13A 1Y65A 4LUSA 4MIMA 5I0DA 1IGSA 1UD8A 3W6LA 3WEOA 2NXGA 2V69A 1OFEA 3UJ2A 5B80A 1B90A 4Z2JA 3GXNA 4F0MA 4UFKA 3W26A 3WD1A 3TA9A 1FWAC 3TYBA 3M46A 4AIOA 4IG2A 3SGUA 5J8LA 2G0WA 4JDBA 1VRDA 4MNJA 1Q3NA 3VC5A 3C0SA 4L65A 4H9VA 4GRSA 3TC6A 4QJ1A 3IJIA 3DGRA 3CGTA 2PGRA 1XF0A 3ABQA 3W2JA 3KW3A 1Q6FA 4XAYA 3OBAA 5F1VA 4CNUA 3MKKA 2WM0A 1YW1A 3SCUA 3TH6A 1HJSA 3W1PA 1OYBA 3GG7A 4IXXA 3UR7A 1QNSA 1US3A 4GJ1A 5D9MA 2V3GA 2VD9A 1IIHA 4FNUA 2ZX6A 3PTDA 5G4WA 4EPKA 3AHVA 4F66A 2Z29A 4M81A 4OZOA 3PZVA 4AG0A 1ADSA 5JVLA 4AX7A 4P2VA 4ZENA 3WLHA 1UKPA 1PX4A 3GTXA 3LBMA 1GUVA 3LHYA 1G69A 3WLIA 1W3LA 1JDFA 2W3ZA 3EKZA 1RXOB 1B3OA 4EWJA 2OO0A 5AECA 1EH9A 1W8SA 3TMQA 1NM9A 4UCFA 4MG4A 1JPMA 3UCDA 1G1YA 1J8VA 3KP1A 2WMIA 3VZZA 1QU4A 2VT0A 3CUHA 3E2SA 1XLMA 3I6TA 2X1SA 1OX4B 5FEPA 2YX0A 2DT1A 3WJXA 2OXNA 2V30A 2C16A 2V2CA 3EGJA 4KT2A 1OADA 3KRUA 3ISIX 5HMDA 4A05A 2GUUA 4O1DA 3GFYA 3VDAA 1TPFA 3GIPA 5D2YA 2D0HA 2VFGA 1SW0A 1V3IA 1E6ZA 2OEJA 1MW0A 4NQ1A 2Z1SA 1LT7A 5F7UA 1FA2A 2VRQA 1YLVA 1OZMA 3NQDA 3MKCA 4XZBA 4WXZA 2WPGA 5I3GA 1ZHAA 3QY6A 3EDEA 2V5DA 5DX7A 4HPGA 2Q71A 1MZHA 3OHMB 4Y9OA 3LHUA 3RPMA 1VFFA 1A5SA 1WDDA 3H7VA 3RAOA 1JF5A 4XVDA 1TV4A 1GVIA 2TAAA 1FHUA 4YWIA 2XPKA 3UXAA 1XSJA 1Z7AA 2UZ9A 1H2JA 1MQPA 3TX9A 5KEZA 4DRSA 4FXFA 1GGOA 3CXOA 3E2RA 3KL5A 4OUIA 7ODCA 5HOSA 1XIJA 3T0BA 4FX7A 4H7CA 2WVUA 3G1VA 1EC9A 4LT9A 2QT3A 2GK1A 4S3FA 4Q4KA 1WDPA 1E0XA 3W1LA 1PJ9A 3MQTA 1W1VA 3LHZA 4LYKA 2A21A 5CPSA 1XBVA 3WUBA 1EOMA 3SM0A 2QLYA 5LHFA 4QDWA 2PTDA 1BD0A 3W72A 1IT8A 2VFIA 5BW6A 2VDGA 1KB3A 5D30A 3H4WA 1E6PA 3PS7A 2J78A 1EA9C 1V0KA 3UXLA 1IF2A 4GY7A 1CXFA 3NQ8A 2ZUNA 4XBJA 4B5XA 4NU7A 3B9NA 2DVXA 5EFDA 3E9AA 3NDZA 3L4VA 4ZSUA 5DFAA 3MHFA 4IUGA 4WQ6A 3N2MA 1SO4A 2YLLA 3BWWA 4XX6A 2GVEA 4IISA 4O1CA 1BYDA 4JTIA 4AC7C 3V5CA 1BSLA 3A9BA 5EMJA 4S3JA 3RO8A 1AFSA 4DI8A 1JDCA 3OVPA 3VVGA 3ZJ6A 4XD3A 2ZRWA 5JBEA 3SUVA 4H6EA 3T8QA 4OWGA 2W66A 3JW7A 5M03A 1JUBA 2DSWA 1M6JA 5C5YA 1L2UA 1WYIA 3EX3A 4AWUA 1VBJA 3S5YA 2DJXA 3AZSA 4RE0A 3UZZA 4X9YA 3GDBA 6REQA 3AMDA 3WMLA 2CEQA 1C9DA 4C6NA 3P67A 3ZZ1A 5CBBA 4N2YA 5AC4A 2NUXA 1LZOA 5K4ZA 4XUGA 1UOZA 2FGZA 4WJ8A 1XLFA 3E0FA 3FKKA 4H8UA 3QPZA 1EIXA 5EY5A 5EMKA 4HSOA 5LIXX 2L5HA 3W1NA 3I4KA 2J8FA 1BGGA 2W0UA 3BLFA 3VGEA 2ZFAA 4MM1A 2RGLA 3THUA 2OSXA 3M0VA 3WBWA 3GW3A 1OYCA 3U9IA 1OHLA 3QW4B 5IHSA 1MNZA 2V0TA 1ZAJA 3BLEA 3EEGA 3P3BA 1O68A 1XLAA 3IGHX 3ENLA 2X41A 3WQPA 3C5QA 1T96A 3UWYA 1M5WA 4AWSA 2DSUA 2AQOA 4V28A 1CXKA 2R1NA 4U4MA 2NQZA 3RX2A 4DAFA 2R1KA 3CUXA 3IJDA 3WMBA 3UF9A 2CKRA 1ZAIA 1FTXA 2DIKA 1GJWA 7REQA 1RK5A 1UUQA 4KQNA 5D38A 3LZ5A 5E5CA 2R1LA 1DE6A 2EKGA 4MVAA 3UYCA 1QTWA 3QC3A 2W4XA 2WCAA 1C9WA 1FWRA 3GG0A 4ZO7A 2PDFA 3D47A 1IEWA 1ENUA 2FVLA 3A24A 4QE4A 4X0NA 4Q22A 2OCZA 4PCFA 2WW5A 1KGXA 3JS3A 5BOFA 2V3DA 3WO8A 3H2NA 3UGVA 1FH7A 2Y5EA 1EKOA 4UQDA 9XIMA 3GHUA 1O60A 2Z0IA 3CV2A 3MT1A 1EUAA 1X96A 4B16A 1IHIA 1VEMA 4O28A 5ABGA 4Y2WA 1EC7A 2DU2A 2HVOA 1WDQA 1I0DA 3F4WA 5DMYA 3JUGA 4JY9A 1R3YA 1YPXA 3WQDA 4GE8A 2Z24A 4ZOEA 2OT1A 3DGBA 2A7PA 1R3SA 1Q6OA 3IIXA 5TIMA 3S42A 4PMNA 2OLHA 3BC9A 4H8VA 5KETA 2E1DA 4IOTA 3MI6A 2I5QA 2YYUA 3LHWA 4C7GA 2H6RA 3TC3A 1AA1B 2R1PA 1A5KC 4UOJA 5K9XA 3GNOA 4UXDA 4MNLA 4KETA 4DHGA 3RCYA 3L7RA 2VUNA 4ROQA 3MZ2A 2O9RA 2WMFA 3MVIA 2CHNA 1I2PA 2Z2UA 5AB3A 3WJSA 2QHAA 2W92A 3FXGA 3OO2A 1E6XM 1XH2A 2HZGA 3IVSA 4L7ZA 1VHNA 1I2RA 3WBAA 3QMRA 4LAKA 2BVDA 3IGUA 2J7DA 2J66A 2E4TA 1F2JA 1B57A 3KBJA 1TPB1 4AZBA 4DUWA 1XIIA 1IXQA 4HMEA 4HTBA 4O0KA 1PS9A 1XLGA 2GWNA 1XD1A 3FDKA 2FDSA 2VXNA 1VPYA 4IFKB 3MI2A 3AUOA 1Q6RA 2HROA 2XZ9A 3BCDA 3QLLA 2X09A 5C9UA 4YHGA 2PSNA 1UR0A 3RRAA 3WF0A 2DT2A 4WUIA 3NSMA 4PL2A 1RA0A 1R7OA 3PAOA 4IL0A 3TWAA 3SCVA 3CYJA 3DG7A 1WAUA 2W9MA 3NPWA 3N12A 4S3BA 3S2CA 4JR5A 4F0RA 4O0QA 3LK6A 5A8MA 4MYAA 4XZMX 2B4GA 3ABSA 1LWIA 4RW3A 2J7HA 5D2WA 3PZQA 5DLCA 5F2LA 3UG5A 4Y9AA 5GQBA 1W1TA 1ZALA 1HQTA 4EAYA 3VIHA 3CO4A 1SO6A 3K5XA 1JUEA 3VUPA 3E0VA 1S38A 4YLWA 4K7YA 1B1YA 3G8EA 4JN7A 1A3WA 1M1BA 4UIOA 3W01A 5CC3A 3DH7A 5IXEA 2NXIA 1JPHA 1HKWA 3C2RA 1IV8A 4AEOA 2YLAA 5HNRA 1GOQA 5DY2A 4IQJA 4R7JA 2VKZG 3GDLA 1B4KA 4BI5A 5J5RA 1E9IA 1NWRA 2CXGA 3TN6A 4DPQA 3ITCA 3BSHA 3QW3A 4FF7A 3VZXA 1TQJA 2PDGA 4JPGA 4HOZA 3TMLA 4KRTA 3F5JA 1HO4A 2F2HA 4GO9A 3GBEA 3OQEA 3FA3A 1MRQA 1IEIA 1XX1A 4LFYA 2Y62A 1JXKA 4JCMA 2WZMA 3W02A 3WNPA 4XAGA 3N2OA 4V15A 3ARRA 4LYQA 4FPSA 4C91A 3K46A 2WANA 4IIGA 1SSGA 3MO4A 4JIRA 1VYRA 5T91A 3WDRA 4C90A 4JIQA 3R4IA 3FFSA 3ZSTA 5DQPA 1T8QA 2YW3A 4H83A 4MFDA 4QCFA 1W1A1 4PFHA 3G3DA 4D71A 2FH6A 4REQB 3TE9A 3QKZA 5HNUA 3NWRA 4WK9A 5BWFA 2QDHA 3QPYA 2WMJA 1HKIA 2WHMA 3H53A 3QFEA 4MKSA 3S47A 2WJDA 3A5VA 1Q45A 1T5AA 2ZX8A 4LS0A 1PZ2A 3OGRA 3BMWA 3IJ6A 3GNDA 1W9XA 2GL5A 6CGTA 2VEMA 4GVGA 3P62A 3U2OA 5FF7A 4YS1A 4E8CA 1ECQA 2GQ8A 2H90A 3KP0A 3H4XA 1OB0A 2ALDA 1JRBA 1US2A 1POKA 1I6NA 1T6MA 3L65A 1YNPA 2CESA 1QW8A 4F9JA 3AYRA 1L6GA 1UH3A 3VOCA 3RXZA 2IKJA 1R47A 2VZOA 4JX6A 4RLIA 1H63A 3PTQA 1XRVA 3UEQA 1LQAA 1NIUA 4WDTA 1GNXA 2WKLA 5AC6A 4WF7A 3AUJA 4IP7A 2C6QA 3TNBA 4JKLA 2I9EA 5LXXA 4DWDA 1QDSA 3N3TA 2D23A 3JU2A 3NM1A 2WK2A 5H2ZA 2JQXA 3VMNA 3KBMA 2INFA 2QMKA 5K7JA 3BG9A 3NNTA 4IQLA 1E0UA 4WRHA 3CHFA 4Q4PA 4FP1A 3WF1A 3MYOA 3CQKA 1RCQA 1RAKA 3VNZA 1J4EA 4P7QA 4S3DA 4PUNA 2VFEA 3S1XA 4DLFA 1BKSA 1CBGA 4Q8WA 5LKYA 3WK0A 5C71A 3NUKA 2QR6A 2XYLA 4YTRA 2WCSA 1EB3A 4ZXLA 1FY6A 4R33A 3FSUA 3L2MA 1LROA 4UFHA 5LXEA 3HV8A 2JF7A 2P3EA 2GJXB 4MF4A 4LSBA 3U7BA 1ZCCA 3S1WA 2YL9A 1K6WA 4MWAB 1YRRA 4IGMA 1MDLA 3PZGA 4JYEA 1V6WA 5G2HA 1EJUC 4ZQOA 2WLYA 3NPXA 5E0KA 4R5EA 4GI8A 5EPDA 3ZWTA 2V9DA 3ARQA 2DIEA 3LGEA 1XPGA 5C6MA 2CYGA 3FAXA 3ARSA 4Y90A 3NQBA 1G5AA 4DYEA 4H19A 1ECEA 4M7TA 3LXAA 3PBUA 1PHQA 4QTGA 1GONA 3WFLA 5A8NA 1PKYA 2FPVA 1UWQA 3WMSA 2Z7GA 3VU2A 4J28A 2DEPA 3VCRA 1FDZA 5AZ0A 3QQWA 1ONWA 4LUYA 4KEVA 3CL7A 1EGZA 4TU1A 1QI4A 2YA0A 4HCDA 2CKSA 3UYIA 4MZ8A 5AYIA 3ZT5A 1HL8A 1E9LA 4OOZA 3M7SA 1KCLA 1OJXA 4N9BA 1XGEA 1JZ6A 2VO5A 3PZ9A 1RZMA 4UQ9A 1JI2A 1P1MA 2Z6IA 3GNPA 1P6WA 4DN1A 2CU0A 3D6NA 2E25A 1UZHA 4Y8EA 1VD6A 4KWWA 4J2PA 2C18A 4PB3A 1QOXA 3N2TA 4LY8A 5DXYA 4IXHA 3B8DA 5DBUA 1L6SA 3BJSA 3NEVA 3LTYA 4XBSA 1PKNA 2WZHA 1TFVA 4DYJA 4O19A 3UCCA 3VGFA 4ZE4A 2UY4A 3SGZA 3EOOA 2DGAA 3AJXA 1MRAA 3I7RA 3FXYA 1XLCA 2DORA 3C2FA 1DTNA 3P74A 4GYPA 2OJPA 1OG0A 2ABBA 5IFTA 3W27A 3USBA 3EDJA 5CZTA 1H50A 4HNOA 4PSPA 5HXMA 5TBOA 4BQ3A 2JFEX 1FHLA 4GVHA 4NYUA 3QGKC 5JIWA 5MKGA 2PE4A 3WH6A 5FF0A 2PU0A 4HZ6A 1CT5A 1ODZA 1YKWA 2WNQA 4HBKA 4YCPA 2Y5SA 4L6OA 1I1XA 4HHPA 2I1OA 4N4PA 3V35A 4LUSB 3ELFA 1MVYA 3I3EA 1IXNA 2PDMA 2J75A 1ELSA 3BMXA 2J8TA 5ABHA 1UC5A 2B7QA 4BQ5A 1LLWA 1JCYA 3LHVA 1V3HA 3A4AA 1F3EA 4PE8A 4GC4A 3T81A 4Y9MA 4IG2B 4ASTA 4DXKA 1A0CA 4O14A 3VDCA 2GWGA 2E6YA 1L6FA 3CM4A 2VQUA 3GTHA 1PCWA 1QFEA 2ZZ4A 2NWSA 5IOBA 5HQEA 4CCCA 1B9ZA 3D3FA 1K9EA 1VFHA 4NNAA 2Y7DA 2ZBTA 3LRLA 2HRWA 5CBIA 3UQNA 4Z2KA 3CQIA 1IR1A 3HF3A 3QVQA 2OO6A 2YDAA 2FQIA 3S9YA 3UBPC 2VEPA 3EZ4A 1N8FA 4GQ0A 2WKJA 1KM1A 4IIFA 4B9ZA 4NZ1A 3CTTA 2QS8A 4TVUA 1EJSC 1VYSX 3RM4A 4PTMA 4PUDA 5TD4A 3E0IA 3E02A 5DRIA 3KDNA 2VFFA 3EMCA 3LQGA 1JAEA 2EPOA 3AMGA 3VIPA 3NQCA 3PNZA 2OZ0A 4ERAA 3WDHA 3DG3A 1MYRA 3EMQA 3CLWA 4GCAA 1Q4NX 1E6SM 1KM5A 3IVTA 5G2WA 1FOBA 5GVJA 4ZSTA 4KEUA 1YIXA 3FCPA 3W81A 1M68A 5D8WA 3QGAC 1QOQA 1W1YA 3RYSA 2V2HA 3AIBA 4P7NA 3VFLA 3UD6A 4CCEA 4HPJA 1Z3NA 2J9XA 3OU8A 1GQNA 1UD2A 2PTZA 1BPLB 4DWSC 3M0YA 3NL3A 4HGXA 4S3EA 1XIBA 3N2CA 3A5FA 3A12A 1X98A 2TYSA 3MMWA 5AC8A 1UKSA 3KAOA 1S5WA 2YJQA 4D8LA 4DNMA 4G56A 2BASA 1R9YA 2G3MA 4WJEA 4NIRA 2OFJA 2PWHA 3NL5A 2ZYFA 4MSSA 3RILA 3ECQA 3GLCA 1KFWA 4IGNA 4WKHA 1F3WA 4NI8A 1V6YA 2CBUA 3G8RA 1C92A 1W37A 2VFHA 4M6VA 1KQZA 1DJZA 3WLKX 1WZMA 5BMXA 5BU6A 2XVKA 3KVMA 3EKLA 3T8LA 4YTSA 1F4HA 1PUDA 3M16A 2JEQA 3TYZA 3W73A 2V2DA 5A6MA 1E5JA 5D37A 3TV8A 1O7AA 1XQKA 3L9CA 3VNIA 3GQYA 3MUY1 3E0WA 1PSCA 3R11A 4JTUA 4UR8A 4D8AA 4PMVA 5CJ5A 4J1OA 3FA5A 1W9PA 3LI0A 5E9AA 5DN1A 2GK1B 3ABOA 3I6RA 3G5EA 5CC6A 1FHVA 3PZOA 1OK6A 5DMLA 1ZJHA 2NV2A 5F2MA 1K7EA 7A3HA 3KBWA 2YCLA 3OOQA 1WV2A 3TXVA 3V4BA 1TWWA 4U5KA 1EX5A 4BJHA 4PMYA 4UFIA 1XI3A 3EA1A 1AL8A 3LOTA 3OZYA 4PTXA 3ES8A 3IWPA 5HK4A 3CL6A 1MQQA 2PODA 3GG1A 3SADA 3NDOA 4QEEA 2BDQA 2XWEA 4F2BA 4PL1A 1EBGA 3N04A 4D72A 4Q3MA 4XZHA 2Y5JA 2PURA 2XTKA 4FLSA 3UNDA 1AW2A 2VOMA 4O12A 1VFMA 4D1JA 1NDWA 4D6JA 1OC6A 4Q32A 3DDMA 4S2CA 4QQUA 4CQ9A 3HB9A 5CG7A 1J0HA 1R30A 3FGCA 3V18A 4QROA 4HNLA 5LIKX 2EG7A 1Z48A 4PUKA 3LSBA 1E6QM 4A6GA 1ZTVA 2XINA 1TPVA 2QQ6A 1M01A 1NWUA 1FKWA 2ZC1A 3OIHA 3OEXA 1S3TC 3C8NA 4EK7A 1VIZA 1KTBA 3BOFA 2VR2A 3KRSA 2WBGA 2OU4A 3DBPA 3QV9A 2WWCA 4RV3A 2PRHA 3MZNA 1TZ9A 2RJGA 1DWAM 1GKQA 2LLEA 1KD0A 1EYWA 3H26A 2D0FA 4BHYA 1TO3A 1WX0A 1NFPA 3A21A 2Q8LA 1KXHA 4JTKA 4ACYA 5BWAA 3BH4A 4NASA 4DJEC 2Y0FA 6REQB 2RJHA 3ZJ8A 1HJQA 1TUFA 4U3CA 1R38A 3IS4A 2FTWA 3G3MA 5A1AA 4R7WA 2ZXBA 3OBEA 3TEVA 1TV2A 4HZMA 1FKXA 5FCZA 3ZJKA 3LBCA 1NY1A 1HX0A 4US5D 4JX5A 1HUVA 1FWBC 2FGLA 1K7FA 1DJIA 4IMFA 3DEQA 4LEFA 2V67A 3KVJA 1JFXA 1J2WA 5H1WA 3T2OA 3M0HA 4O1EA 1NP0A 2WSQA 2PWVA 5AOUA 5CAKA 3W29A 3GR8A 3NQ6A 1SO5A 4IX2A 3QZEA 3VKDA 2PI6A 4A8LA 3WF4A 5CZJA 3ARVA 2AQVA 1QNVA 4N9CA 2VCBA 3CV6A 1AVAA 1TWZA 5C9XA 1MI3A 2QUMA 1E1CA 1Q6QA 4GVFA 3WNOA 2OZ3A 4HSNA 1FBAA 4ENLA 1JZ3A 2P88A 1OFBA 1FWJC 2DUXA 5DCBA 2ICSA 4ICCX 2C15A 4IUOA 3EXRA 3ZM8A 3WY1A 2FHBA 4QLJA 3KOWA 1Q6CA 4DF2A 1K77A 2VX7A 1LJYA 3HN3A 2WZIA 3UY7A 3PZNA 1KM6A 3OP2A 4FIRA 1L6YA 3L4XA 3O6DA 3R12A 1J0JA 3M64A 2YFNA 1MUCA 2E28A 4MTVA 4FMVA 4DJDA 1JQVA 2Q8XA 1MUWA 4B15A 4C6QA 1ZJAA 1BEUA 4ZQRA 3TOYA 3CUGA 4K2SA 3WX7A 4L4LA 1ZQ5A 2E6DA 1KBKA 1JPKA 1Q8AA 1C7SA 4GH3A 4Q8NA 4IMEA 3HURA 2NQ5A 1TV8A 3WLOA 1MNSA 4LUJA 5CJNA 4LGXA 2Y8UA 3LSCA 4URIA 1W9DM 3M43A 1NH6A 4I7UA 1SW3A 3TW7A 3VCNA 3ANUA 1VB9A 2NSXA 2KX9A 2CW6A 1RJQA 4N6EA 4FA3A 2FTPA 1GEQA 3TJ4A 4NXKA 1JR1A 1FHDA 1ISVA 3QHOA 5FI8A 2DVUA 3GY1A 3LRMA 3H2MA 3THQA 2DSZA 1PZ0A 3AMKA 3WENA 1DPMA 5HINA 3BAWA 5BXTA 4AIEA 4CD7A 4F3HA 3EYPA 4X22A 3RFAA 4JHMA 4L80A 3LENA 3LPFA 1R3RA 1ISYA 2CXEA 5H8PA 4JXCA 3GXFA 1GK8A 8CGTA 1J6OA 1R6WA 1LRTA 1AUSL 1G94A 4GNKB 2B31A 2X0HA 3OHIA 1CB2A 4V27A 1KM3A 2D1ZA 5C0QA 3W4RA 4UMCA 3LV6A 2NT1A 2DUAA 2Z7KA 4NUWA 2GOUA 3ZYZA 4C1NA 2E7FA 2Z1VA 1O95A 3AU2A 1T99A 2NT0A 4CD5A 3B0YA 3BOXA 2HCVA 5K2ZA 1V79A 2IUZA 2W5FA 3FVDA 1XINA 3AFBA 3VGGA 1N8WA 5MHBA 2ZKMX 3SCWA 3TTEA 4E3VA 1UG6A 2DQXA 4US5A 1KLZA 1BG4A 4LCSA 4TR9A 5HWJA 1UKQA 3VD4A 2PDCA 4EPEC 3FY1A 2BHZA 2VCCA 4XSLA 2IPFA 3CUJA 5A2BA 3SECA 1WXJA 4X9SA 3VNDA 1Z32X 3B8VA 3KCOA 2NQ9A 3LGDA 1IEXA 1EP3A 1G7UA 4DAIA 2E9LA 2ZRZA 4Q6XA 2EPKX 4R7OA 3BG3A 3CC1A 4V2XA 3LQLA 2JGYA 4GZJA 5I5RA 2IKHA 3KOFA 4JTGA 4DXVA 1XLHA 3PB0A 5D9PA 3H2EA 1YX1A 1XKJA 2POZA 1IE7C 1HVQA 4O16A 3P2VA 2F38A 3J7HA 5LNSA 3ZLHA 2P50A 1QJWA 1VGAA 5EYWA 4I7WA 3S5OA 4MJ4A 5CZKA 3QEZA 3EEZA 1VC4A 2CLHA 4LANA 4GZEA 1VQTA 3NZ1A 4HZ8A 2FPTA 2ZTKA 3DHPA 4C65A 3W38A 3EPNA 4AH7A 1WKFA 3VNKA 3PUEA 1PAMA 4OGZA 3WD4A 4JCLA 3NSXA 3UJRA 2R6OA 3BANA 3DOPA 4L4OA 1VPXA 3WLLA 1TPUA 3I6EA 4RPQA 3VKAA 3P82A 4PB5A 1F8IA 1UH4A 2F9RA 1LL4A 3GKAA 4ICNA 1EPXA 5K9CA 4KH2A 1V3KA 3PPGA 2OYKA 2VHLA 2WQPA 1CGYA 2VQTA 4K37A 3N6JA 5DELA 4PMJA 2AMXA 3EXSA 2J7EA 2TRSA 2XJ7A 1XGDA 3NPUA 1OT2A 3D0CA 4JTTA 4UTFA 2QCNA 3U2CA 1DJNA 1HT6A 1DQUA 1OBAA 3GKFA 5A8QA 5M3WA 1FWIC 3TYEA 4Z17A 4NAEA 2EF9A 5MF5A 4DF0A 3KOYA 4AU0A 3LLDA 4GYJA 3ITLA 1TKKA 3PZUA 4R85A 1JDAA 4DM2A 4GYPC 4MDOA 1O12A 3TVAA 4N4QA 1E4IA 3KEHA 4FNRA 4JTSA 4YNGA 5B7ZA 4FF5A 3LCIA 4WZHA 4Q8UA 2YZ5A 4NZFA 5M2FX 1Q2SA 5I78A 1H3GA 3U5YA 3W37A 4RXFA 5AYBA 4OJYA 3KTCA 4D6DA 1E55A 4LU0A 1O66A 4ADTA 2E8ZA 1VF8A 2C0AA 3LD5A 4EF8A 1VCVA 1Q63A 3WBEA 3F5KA 2E8YA 4RW5A 4IMDA 4BF7A 5F2GA 3ONCA 1VFTA 3W7JA 1BTMA 2G3NA 3WLJA 1TVLA 3NTYA 3BCJA 4DVOA 4LWWA 2OTDA 3L4YA 4MB4A 1EGVA 1YXCA 2R94A 4WKAA 2XSBA 3SCOA 2JK2A 1DJXA 3LNPA 5BXRA 3TCEA 2XVGA 1XLKA 4GX9A 1PIGA 2CZ5A 4HVXA 4JNMA 1OZQA 3FJLA 4N0RA 4AD4A 1E51A 4HYWA 1E73M 1AQHA 2AL2B 4EXQA 1KA9F 2VEFA 1VENA 3CZKA 3AYSA 1XW8A 3WBXA 4RPPA 3GHSA 1BSIA 3N73A 3KLKA 3I3DA 1XH0A 4CCZA 4BZYA 3ARPA 4GOAA 5BRPA 2CLOA 2Y8VA 3CEPA 2GGIA 3AHZA 2D2HA 1O5XA 3QH2A 3PJTA 4W4QA 4H6QA 4AF0A 3AIUA 5JIPA 4D2JA 3C3NA 4H9YA 3PVFA 2QAPA 2WHLA 4S3GA 1SZEA 2JKEA 5F2IA 2D2JA 4Z1BA 3MSDA 3JR2A 3NPVA 3NQVA 2PMQA 2OOGA 1A5OC 4W87A 2X1UA 2B81A 1W5MA 3ME3A 3I3BA 3UPBA 1TPH1 3AIWA 1UWSA 3LRKA 3N2XA 3DAQA 3UG4A 4PTVA 1BXNA 1W1B1 3B8TA 2FZ9A 1ONEA 3XISA 1YYAA 2ISVA 4FLQA 1GOKA 2Y4SA 1RD6A 3M6YA 5AYXA 1I4NA 1UH2A 1MFVA 4HYVA 5G1MA 2DZAA 3CAQA 1GT8A 3G1XA 3L4TA 3TONA 4E8DA 3EX6A 4KKXA 1XRFA 3RLUA 1SVDA 2ZZ6A 2UY5A 4ZQPA 2ZA1A 3WDIA 1TJPA 2HMCA 2VZVA 4ZO6A 1PZ1A 3M9YA 1E15A 4BF5A 1SO3A 2XSXA 3WFZA 3R43A 3ITTA 1AW5A 1X1ZA 3CUIA 4A3RA 5GJMA 4RZBA 5E1QA 2OX4A 2V68A 4D9PA 4POCA 2WJFA 1WA3A 1HN1A 4RCXA 2ZVIA 3GO2A 2G37A 4P7LA 4ZOCA 1X8FA 1Z44A 4B91A 2JEPA 1Z9AA 3HGSA 4AW7A 2WZEA 1H1YA 2Q8ZA 1U5HA 1CCWB 2OGJA 3CO8A 1WNOA 4EACA 4PTNA 2FJUB 2ISWA 4I9AA 3GYCA 1I0BA 3AOFA 2CLLA 1D8WA 3KS6A 5BOOA 1SMDA 3SFKA 1A5LC 3UESA 4OU1A 3KRBA 4B2DD 3NGFA 4CU6A 1EF3A 1TE1A 1IZCA 4GI9A 1DTUA 3VE7A 5BZAA 2F2KA 1XWYA 3QBUA 3NAVA 1RR2A 2ZDSA 4KIRA 1JD9A 3GFXA 3U4FA 3ITXA 4B92A 1PB0A 1L8NA 2BGQA 4DO7A 3DKLA 4KFNA 1PHWA 4XUYA 1ZPTA 1EWDA 1ICSA 4O4WA 2OWWA 3FV9A 1AL7A 1E6RA 3FLUA 3UWWA 1UQYA 2ESCA 3K8KA 3FYPA 1RLCL 1ALDA 3DFHA 3AALA 3N13A 5MKGB 4MFEA 5LA0A 1TX2A 2QF7A 3FEMA 2GGGA 3WG6A 2GDUA 1V8EA 3G2GA 3LPPA 2FFCA 4L61A 4QG9A 2W27A 4AD0A 3N3MA 3L0NA 3WEZA 3Q58A 4M6PA 2VZSA 3BURA 1DHKA 1OSEA 3C3UA 3CPGA 4HA1A 3VA8A 2W6RA 1XP3A 3CLMA 2R82A 5EKYA 2FHCA 2HVNA 1QXLA 2A3LA 1LRQA 3UWVA 2PPGA 4KWVA 3N9KA 7XIMA 3BTNA 1FFRA 2QDDA 4A22A 3QGVA 1V6UA 5AHIA 1LP6A 3O06A 5A2CA 3EX1A 5AC5A 1FCQA 1LL7A 2NSOA 4BA0A 1WO2A 1UMLA 2ACRA 4AFYA 1QATA 4WGHA 3SW6A 2ON3A 3L2IA 1R8LA 3MJMA 4JTCA 2QCLA 1E0VA 3CUFA 2C13A 2VC6A 2XGZA 2G4FA 4F8XA 4JY8A 3OPSA 3BVJA 3THCA 1O5RA 3LXBA 3S5SA 3TSMA 3I4EA 9CGTA 1H60A 3H22A 2CITA 5AY7A 3SQSA 1JAKA 3ITOA 5AKQA 4XAPA 4GNJA 4G7EB 3ANVA 2CHOA 3DHFA 3KVLA 3O6AA 2Q6ZA 1X6UA 2XN1A 1EJRC 5CLWA 1ISXA 1AD4A 1EEPA 4IIHA 4DUOA 1DIDA 3V75A 3TJXA 3E2QA 3SIMA 3GE7A 1OX6A 4AIBA 4W8LA 3UZJA 3DECA 3MO7A 3S2LA 3SJNA 4D6HA 1ZCOA 1XG4A 5E9XA 2VGFA 4O1AA 3ZMRA 4AISA 1KW1A 3N17A 4G2DA 3NA8A 1FH8A 2IPGA 1Y5WA 4DBDA 4NJJA 3WN6A 1XDJA 4E2BA 6XIAA 2NLYA 3QMTA 2JKPA 5D09A 3OLIA 1HVXA 3GNXA 1KBLA 4UB9A 4H9XA 3L0KA 4HNTA 3VGBA 2DIJA 1ZS2A 4I7VA 1F7BA 3UR8A 2J7BA 4I8YA 1D3HA 2XHYA 4BR1A 1FWTA 4DJDC 3OZPA 3N34A 2VCAA 3ITVA 3IARA 1HFBA 3RLGA 4ZFMA 8TIMA 1KLYA 4RR4A 1Y5XA 4JTEA 3R94A 1R85A 3DU0A 3EWUA 5IDIA 2WHKA 4B2DA 3N6HA 2ZWZA 3RK8A 3B9DA 2QYGA 4A8IA 3ZVHA 2PRMA 2P8CA 3XINA 5CC7A 3MVTA 2NQLA 2Z1BA 3VK5A 1J93A 3LM7A 3W00A 5A6BA 1VH7A 1EL3A 5TQLA 4GUJA 5K4XA 3G1SA 2QPUA 3OG3A 5C9RA 4J3ZA 3UETA 3IUIA 4F79A 2ZZ1A 4XD5A 1R7AA 3O7UA 3PUDA 3HPXA 1FWCC 4FLOA 3MUIA 3BZJA 3UNTA 4AEEA 5KZDA 1B9BA 3GU9A 3MY9A 1U30A 2QAFA 1K70A 1GYMA 4Z1AA 2ZDRA 4V1XA 1E3XA 1X1NA 1J11A 3UWUA 2ZWYA 3EB2A 3HPSA 1ZAHA 4HK5A 3GS6A 1POJA 2ACUA 6TIMA 2YCLB 1GQJA 2AKMA 3VD7A 2BBFA 4ZGYA 2A2IA 4C6JA 2AKZA 2A1YA 3ZIZA 3HFTA 4IL2A 4A29A 1Q6GA 4PBGA 1Q13A 3N11A 4FI4A 4NAFB 2P53A 4X61A 3AS1A 4OECA 1TVNA 3F03K 4IWWA 1XCXA 5HMEA 4KMQA 4GUIA 5F1UA 2J7FA 2GVLA 1AG1O 1OFQA 4GC3A 1KFCA 3BICA 4YTTA 1PEZA 1IWBA 4KW2A 1CPUA 3RJXA 3T6CA 3WQWA 4INFA 4EKJA 3PSVA 3FGCB 4B9YA 1FWDC 4LS1A 4XAZA 2YDSA 1OYAA 3MHGA 4PUUA 1MW2A 4DZAA 2H8ZA 3ABRA 4PCSA 3ITYA 4H9MA 2IS7A 4IMGA 3A4XA 3BLOA 1F8MA 1L6WA 1GORA 3MCNA 7TAAA 3BLLA 5KITA 1K8XA 4GABA 1WDSA 5DT5A 3O2LA 4QAWA 1BXCA 3PHAA 4Q33A 4HMNA 2NZLA 3A23A 1C8XA 3C61A 3DESA 1P6CA 1YNQA 2BMBA 4JQ4A 3ARZA 2V5JA 4BI7A 1JPDX 3FYOA 2V5BA 1Q66A 4N7QA 1NAL1 3TU9A 1LTDA 4RDVA 1ZBCA 1MUMA 3W7EA 2FJKA 4HQVA 3FVMA 5JU6A 2I7GA 4OE7A 1A5AA 3T08A 3LERA 1H7XA 4RUBA 4OT7A 1KC7A 3LN3A 4H7ZA 3O9NA 1LYXA 4WEVX 1QUMA 3L68A 2QCCA 4N9EA 2HK1A 5D8ZA 1JULA 1W5QA 4LUIA 2JKAA 2CZFA 3RX3A 3GH4A 3E2VA 3BLDA 3W7KA 4K8EA 2RHGA 2EHHA 1RQEA 4RNFA 2G97A 4JX4A 3UG8A 2Z00A 2DZBA 1VP5A 4GJIA 3T4CA 3W7PA 5C7HA 1CLVA 3VILA 1KCXA 1FCUA 3W7NA 1YDYA 3TN3A 1BVNP 5AFDA 4GY0A 4DELA 3VMOA 4WIWA 4W7WA 2FZNA 3H70A 5ABTA 3LCLA 5D02A 1EXPA 4Z2LA 3G0SA 1E1CB 4UTTC 2WMHA 3OLDA 3OODA 1V0MA 4GCXA 5EBUA 3VDBA 4MB3A 1A3XA 1MFUA 1WAWA 4JL1A 1QPNA 2QCHA 4WSJA 3TNOA 4ZB0A 3HM7A 2TSYA 4AZIA 4QP0A 4NX5A 2FMOA 2ANUA 3FNDA 1QO2A 1R3TA 3KUMA 2C19A 2J9ZA 2YPIA 1U1JA 4U2ZA 3MSRA 3IGXA 3A22A 3TW6A 1KGUA 4DO5A 4WY0A 1FQ0A 3HFYA 1X97A 1XV8A 4CQAA 1YDOA 3GC2A 1AMKA 1PVNA 4P8XA 1GYNA 1PCKA 4O18A 4U3AA 4Q4QA 4GFSA 2EQDA 1A5BA 2G3JA 4MNKA 4ATDA 3UGRA 5TAOA 5EMLA 1W2PA 3CL8A 1SW7A 2GQ3A 4A3QA 3PBVA 4Q8QA 2YA1A 3HQPA 4JTHA 4L64A 4E3TA 2O9OA 5DRCA 4DJFC 4DXXA 1Z69A 4DPPA 3INPA 3KBVA 4HU3A 3T78A 1DHPA 3T0TA 3DFNA 2NV9A 5EMUA 4ZQNA 2W79A 3R7MA 3Q2DA 2GSHA 4KWSA 4KS0A 1K4GA 1UWTA 3O16A 4LVBA 4C60A 3NM3A 4O8RA 2Z1XA 3CIVA 2AAAA 3V0SA 1B3YA 1LM1A 2KAUC 2EAWA 2QV5A 1S39A 4XO7A 4LCRA 4R9XA 1EXBA 4QR6A 4GQGA 3CHEA 1X1OA 3TWBA 4UQCA 1LCOA 3WQ8A 3UT0A 3ZXWA 3L5LA 5A69A 1P4CA 4AUBA 2BLEA 4GX8A 3GAKA 5HWMA 4TIMA 2BSLA 4OQVA 3NOYA 4MAZA 4UFLA 4XAFA 4MDPA 3QN3A 3UFYA 3ZS4A 3VNYA 3CMJA 1JYNA 3FEQA 3NVDA 3WBYA 3TYDA 1TR1A 2OLSA 4HNCA 2IQTA 3GU1A 3N25A 4Q7NA 4QHRA 2YBVA 4H6KA 1RALA 5A5WA 4IM4A 1KRCC 1H5YA 1P6BA 4W5ZA 4C1NB 4EANA 3DI0A 2BOEX 3VINA 3V5OA 2PWUA 1SR9A 1GJUA 1MZRA 3R2GA 3RU6A 4KPLA 5JH2A 3LU2A 3V1PA 5CSRA 4UQBA 2A85A 3NQAA 3R25A 4DBSA 3NO1A 4CN1A 1RA5A 1F5ZA 2GGEA 3MMUA 3ZO9A 2OZ8A 1XKYA 1GOXA 4LEQA 4OOUA 4AXNA 4QGCA 3EWBX 2CNCA 3F5LA 4A3HA 3LDVA 3ALGA 3WQVA 1YXDA 4I9MA 1BYAA 1OY0A 2A0NA 1XH1A 4ATWA 4W93A 2EPLX 1S2VA 4G6CA 4FXSA 1SQ7A 4U10A 3MP5A 4GXPA 5A6SA 2GOKA 3QY7A 1LOQA 2VL4A 2P76A 1JD7A 1IZKA 3IPWA 3UJSA 1A49A 5ENLA 3GB6A 3TZFA 3THAA 1A3HA 3SCQA 4OIFA 1HL2A 2XGIA 1KWGA 4G1NA 1DJYA 4QG6A 2E0PA 4CQCA 4YN5A 5A6AA 2F8QA 3H7RA 3C56A 3CZEA 3G0XA 3AMCA 4D6EA 3I7SA 2HPMA 4GIEA 4MKVA 4PMDA 3EOUA 2UY3A 1EDTA 3LY0A 2WXDM 1ZBKA 1RBOB 4LAMA 2FB2A 3ZR6A 5KZ6A 4O1FA 3IJ8A 5DF0A 2P8BA 4IT1A 3MTWA 4AD1A 1TV3A 3S2MA 5LNVA 1TPWA 4WDWA 4LBRA 3R8GA 4UTUA 5CAHA 3VDHA 3GC4A 1F6KA 1P0BA 2WBKA 4DB7A 3N4AA 1FWNA 1Q6EA 2J77A 2DP3A 5LNWA 5I3IA 1CLXA 1OABA 3GUGA 4HT3A 3BCFA 2A6LA 3BJFA 1HJVA 1HGYA 4NAEB 4IICA 1HO1A 4QSHA 3AMLA 2YOCA 4C6OA 3SCRA 1IWPA 3TDFA 1E71M 2IXUA 5AHLA 1K8ZA 1RK6A 1DJHA 1F76A 2QPXA 2EO7A 1UZ1A 3WIJA 3BGAA 3H6OA 3QYSA 1GTHA 1NDYA 5BYWA 4QBXA 3F4CA 3H2OA 4LV4A 1K6AA 2BY2A 3EWCA 3GFZA 4L5ZA 2GQ9A 3UU0A 3IIOA 4QDMA 1IQ8A 3BAYA 3NYDA 4H04A 4K1WA 4QCEA 1V0LA 2ATSA 2V38A 5GPRA 5FEWA 1E9YB 5C8BB 2PWEA 4UR9A 3PN8A 1A0EA 1BXBA 3WLPA 2G95A 3NO5A 3TLQA 3I7QA 4J4KA 5JQ9A 3AO0A 1RJPA 4H9UA 1XYZA 5AHFA 3B4UA 5AHMA 4GNVA 4QJ5B 1GZ1A 3EOSA 4Q8MA 1NELA 1AMYA 2C79A 4J7RA 1ZNNA 2PD5A 3M07A 3W7OA 4CCDA 1E43A 3BXWA 3MBFA 4Q8VA 3GD6A 2D2GA 3PWGA 3OTRA 4ZE5A 5BOEA 4C6DA 3GAYA 2EG8A 4CN6A 5LIUX 6A3HA 4DX3A 1O5KA 3ZR4A 2RKXA 5M1TA 3T2QA 1J79A 1R46A 4JKMA 5I23A 2OR2A 1MXSA 2INZA 5FL0A 2BVWA 3TTSA 4HKPA 4AF0B 3AU6A 2ZTJA 5LGZA 2YR1A 1RCOB 3CMFA 4D6IA 2J25A 4RDWA 4ZO9A 3N19B 1SMAA 3PWAA 2V8ZA 1PIIA 4E0CA 5GJPA 4HJWA 1WKYA 1OX5A 8XIMA 1QCWA 2WVVA 2YL8A 3CT7A 4JFTA 1HKKA 3OVGA 1B3ZA 2OB3A 4O13A 1QOPA 5E6YA 4RX0A 4D1IA 2BOGX 1XSKA 1J0ZA 4JQAA 3RNDA 4L9XA 3EX2A 4DF1A 2QGYA 1NJJA 3OVQA 2X05A 5FSEC 4LV9A 2WLZA 4FR1A 2PFHA 3NQ2A 4JTDA 3GXMA 4UTJA 3B0VC 4CEXC 4LVGA 5D2TA 2CBVA 2QULA 5A94A 1TMQA 1Q2RA 4M1RA 3ZT6A 1ONRA 9RUBA 3PTKA 3G1DA 2ASHA 2NQHA 2FLIA 3DYMA 3GH7A 1PKMA 4JBRA 4PUWA 5K9DA 2DUZA 2OVLA 1G4TA 2WNWA 1OC7A 1SYTA 1OD0A 1S1RA 1XISA 1H7PA 3IIPA 2C0HA 1OFDA 3URQA 3LNMA 3RM9A 3C4UA 2XISA 1UP0A 2E40A 1P43A 1SU5A 2NX3A 3WDQA 2Y85A 4L56A 3SUUA 1TWIA 1QHOA 2CHRA 2IKGA 3V3WA 3PJXA 4KCTA 4WX2A 4W8AA 4QAIA 4UWMA 4NYYA 1OCJA 3LLXA 1G01A 3RO6A 3FX4A 4J3SA 3NOEA 2QCDA 2WO5A 3SGGA 4M29A 3MUXA 3WD2A 4LNYA 2B7PA 1P0KA 4BCEA 8RUCA 3OLGA 1PTAA 2VGGA 1OD8A 4XB3A 3S8HA 2F6XA 1YDVA 1ZY9A 2Z4GA 5FF3A 4NRRA 2OMAA 2WQDA 1QNOA 3GYEA 1QI3A 2XFYA 3T0DA 1R86A 4LRTA 3CWHA 3AYTA 3O0KA 4S3CA 3EDDA 5U4NA 1C93A 1EO5A 3PUGA 3ANYA 5D03A 1GQKA 2BVYA 1AQFA 4GXMA 4IGSA 2EPMX 2Z2AA 5GJNA 3VC6A 1QPRA 5DXXA 1EX1A 4Y7EA 2OEMA 4XZLX 4J35A 4Q8OA 4XKYA 1QMLA 3DFPA 3N18A 3WQGA 2WOQA 1N8IA 1V4YA 2ZUSA 1LT8A 4HPHA 2GFTA 4YL2A 4IPJA 3SUSA 3A64A 3P8IA 4PSRA 1WPCA 2VC9A 4H6RA 4BEUA 1QK0A 3QR0A 3N14A 4K8GA 1AW1A 3R89A 3SN0A 2P0IA 1OQFA 4Y96A 4K6AA 1R9XA 5IBXA 2D3LA 1BRLA 1JCLA 1HP4A 4IMCA 4F0LA 1W5NA 2FVKA 3TYCA 1HP5A 1ZBWA 3B40A 5KINA 4TV5A 3W74A 4ZQMA 1GOOA 2OZTA 1Q7MA 1X39A 3IGSA 3CZLA 2BB0A 3DCPA 1XYFA 4P7RA 4QRNA 4UTWA 3C2OA 3R0DA 1VEOA 3KL0A 3U6WA 3W07A 3B0PA 2GJRA 3GZ3A 1OF8A 1SJAA 5CGTA 4RJEA 2EG6A 2PDHA 1GOMA 4JTJA 3GU2A 1FDJA 3T2PA 3RPTA 4M24A 3GWQA 5RUBA 2PDUA 4FNQA 1UR3M 1CNVA 1UW9A 3GVVA 5GNYA 3ONBA 4EXBA 1KFJA 3STFA 3LM3A 5ECUA 2J79A 1R9ZA 3HG3A 2QJHA 4Z1DA 3H2FA 1UR2A 1BLIA 1EFZA 3H21A 4HU0A 3P0WA 5HUPA 1TJRA 2DT3A 3W2KA 1QASA 1AJ2A 3B03A 1J18A 4YCOA 3TUUA 5A8PA 4FX6M 1H7WA 1R2SA 2E9MA 2PDWA 4MY1A 1LBMA 2I14A 4I5XA 1ESWA 4FAMA 3HQNA 4ICMA 4Y9PA 1KM4A 3W7LA 3COTA 2POTA 9XIAA 2OKTA 2V5CA 3KZPA 1ZSXA 5HULA 1I2OA 4WDXA 3OVRA 4PEEA 3WNMA 2V81A 1LQ2A 3PM6A 1LWHA 3UXDA 4S1FA 4F2TA 4NL1A 4M82A 4AHQA 1JF6A 3BLPX 4LVAA 5GNXA 1EC8A 3TLLA 4I8DA 4KERA 2AOSA 3OB8A 5CGQA 4FNTA 1UUMA 3UVIA 1W1IE 3IANA 1TCMA 1JYVA 5BRBA 3PFMA 1TB3A 4JD4A 5A95A 3TKFA 3R5EA 1P48A 2HISA 4AQLA 4YJ5A 1BWLA 3AWOA 3W53A 3GW0A 1KFLA 1NP2A 1NOFA 1D2KA 1EZ2A 1WB0A 3GXTA 5FEXA 3AIEA 3LTPA 4EOUA 4QQ3A 3HMCA 2CWNA 3ZVHB 1V5XA 2O7SA 4E6MA 3BW3A 2G50A 4MJMA 3VX0A 1M03A 4LBSA 1H41A 4ZL1A 3KLLA 3DBNA 2HDJA 3GZAA 4PCNA 4PUMA 2CLMA 1VIWA 1PDZA 1VS1A 2HK0A 3ZVIA 1B3WA 3OIXA 5J5DA 3M47A 2GGJA