3PZOA

Structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 in complex with three maltose molecules
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila rku-1
molecule tags Hydrolase
total genus 159
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzoA00
3EDKA 4L4PA 1WNOA 3CUFA 3AXXA 2WHJA 1TVNA 1PX3A 2AAAA 4EE9A 5GNYA 2YIHA 3LPOA 4P8WA 1VFOA 5AC5A 1VF8A 5LA1A 2VR4A 2D0FA 1W91A 1RPKA 4P8XA 5FD0A 3SUTA 1XD1A 5EB8A 4PMRA 2C8NA 4GO8A 4RL3A 4Z2HA 3UEQA 3WNPA 1Q6FA 2DSZA 2PWGA 1E1EA 5BWFA 2ZUUA 1HL9A 1CXKA 3AIVA 5ABHA 3SIMA 4H04A 5JBEA 3ZJ8A 1H09A 2D2OA 3QOMA 5FL1A 3K8LA 1CXFA 1UA3A 2IXVA 2OYKA 2WKLA 7A3HA 3CBWA 4D6FA 5BYWA 4URIA 3IJ8A 5D9NA 1IT0A 1VENA 1DWGM 3A6OA 2DSWA 1UOKA 3NSNA 4W8AA 2CYGA 1B3YA 1E3ZA 2JIEA 5ABFA 1U2YA 3WUBA 5ABEA 2ZUNA 1NH6A 4KMQA 3KEHA 3N13A 2PBOA 1TMQA 3ALFA 1E5JA 2QF8A 3CMJA 2VOTA 2D1ZA 1LL6A 1NWRA 3FAXA 4GIAA 5AYIA 4WSKA 1Y7VA 1GQLA 1BPLB 1JXKA 4MNKA 4AEEA 1VEMA 4GINA 2WVVB 1DWIM 3AS2A 4CGTA 4HA4A 1MVYA 2J7BA 2WZHA 3AMKA 1PAMA 3AYRA 4GO9A 2X1IA 3WD1A 3VDCA 2DIJA 3WNMA 1CXHA 4M8UA 3VDBA 4X0NA 3VU2A 1GOWA 2VX6A 2NSXA 4U31A 4A4AA 4P8UA 1UWIA 4DUXA 1W9BM 1E40A 4CN6A 5IXEA 2X0YA 4MJ2A 2Y2WA 1GOMA 2XUCA 1HVXA 2XSBA 1GVYA 5M5DA 4HP5A 3ARPA 4UQ9A 2Y5EA 3A3HA 1OBAA 4AXNA 4XV0A 3UG3A 4E4PA 1XC6A 2XHYA 4D72A 2DDXA 1C91A 2WMFA 2UY3A 4V2XA 4F66A 1VRXA 5CPQA 3WQ8A 4OJYA 3AZTA 3GXIA 3PZNA 1BG9A 2CESA 3PZUA 4WLCA 3WH5A 1R7AA 2W4XA 1TR1A 3PTMA 3OLIA 1XH0A 5EBAA 1FH8A 2GDVA 1V6UA 5IFTA 4XX6A 2XFYA 3AMDA 1UR4A 5E9AA 1X6LA 1QW9A 3ZMRA 3ZSTA 1UKTA 4B9ZA 5BXSA 1J9YA 4QCFA 1W3HA 4D6DA 1E6PA 4GXPA 1HJQA 3A4XA 4AWEA 1OT1A 5CSUA 4DWSA 1V6VA 1WZMA 3L4XA 3PN8A 3WEMA 4P7LA 3AIEA 1PZ3A 3CZKA 2C0HA 1CBGA 1H1NA 2DT0A 1OIFA 3GNRA 3OGRA 1L0PA 2WVSA 1G0CA 4YHEA 1EXPA 5BCAA 4J27A 1JG9A 1Q6CA 2D3NA 1E6ZA 4UFKA 1XYZA 5FOOA 2CHOA 3VGEA 3WENA 1QNPA 3N18A 4ATDA 4HMEA 1JGIA 4W89A 2W63A 1E4NA 3GM8A 4D71A 2V38A 3U5YA 5CG0A 2W5FA 1CGUA 4L4OA 2NT0A 5AYBA 2XYLA 2J62A 5CJ5A 4GPNA 2YJQA 2A3BA 4PMQA 1BAGA 1CLVA 1GUVA 3OLGA 4Q7NA 4CCCA 2G4FA 4ATLA 1W9DM 5HDRA 5BROA 1C92A 1EOKA 1Q6DA 3AISA 3THDA 4ATWA 3A4WA 3WNOA 5D9OA 1V0LA 3ARUA 5A6MA 1UD2A 2O92A 2E9MA 1NQ6A 3D3AA 4Y7EA 3OB8A 3ARRA 2G3JA 4FLRA 4ZEPA 3WF2A 1E6NA 5F7UA 4C7FA 5IHSA 3WL0A 2FHFA 2CHNA 1UQZA 4PMXA 4LYQA 1ITCA 5I5RA 1MW0A 3VIFA 5TD4A 4MDPA 4MDOA 1B31A 1UR2A 4TXEA 3KL0A 1UWQA 3RJXA 2CKRA 2PWEA 3BSHA 1JZ4A 4QLKA 3F5JA 2WC3A 1WB0A 4XZWA 3VMOA 3KE0A 2EPKX 2VZUA 3ZM8A 1DWJM 1UH3A 2W92A 3AIQA 1UD8A 1X1NA 3J7HA 1MW3A 3AHTA 3TOPA 1QBBA 2UY4A 3CHCA 2YBTA 5A2AA 1NP2A 1E6RA 4BQ3A 2J79A 1V02A 1BHGA 1CTNA 1OD0A 2CETA 1JI2A 3ZQ9A 2DQXA 1TA3A 1EO5A 1UQYA 4PTVA 5IDIA 4HZ6A 1WZAA 1HN1A 3BAWA 4GZIA 4JHZA 3O6AA 3PZQA 4W7VA 2WK2A 3K4AA 3T2QA 1XSJA 3IANA 1E4MM 3BAXA 1E5NA 7TAAA 4W5ZA 1KCKA 4TVUA 2Y4SA 1E15A 3ARSA 3W53A 1DWAM 5DMYA 1XHGA 3GDBA 1GPFA 2X09A 1GORA 4LQ1A 3N11A 4H41A 1Z32X 3WDPP 5A6BA 3VNYA 1RH9A 5DT5A 5IHRA 4HU0A 2V5DA 3VM7A 3QOKA 3AHYA 3AIUA 3ZSSA 1F4AA 3BMWA 4UCFA 2JF6A 1ISZA 4AZCA 2WNWA 1AQ0A 2MANA 4YN5A 1PBGA 2PI6A 2ZWYA 3LPPA 4R5EA 1TG7A 2J47A 1BGGA 2QV4A 1XCXA 2RGLA 3VVGA 1JZ2A 5CLTA 2Z1KA 2WYSA 3PTKA 1CXLA 3ARTA 4MNJA 5IFPA 1HJXA 3GXMA 3AIBA 3SCPA 2X2YA 4PMOA 3IAQA 3SCSA 4CD4A 2VQTA 4Z2GA 2WMIA 1C7TA 3PZIA 1M01A 3AHVA 4AZGA 2YKKA 3MU7A 4MNLA 1KXTA 2WVTA 1B1YA 3ARQA 3CZEA 3D5HA 4NI3A 4DUVA 1A3HA 1XH2A 1ZJBA 4CUCA 4W8LA 4MNMA 1FHLA 3RDKA 4JHOA 4X0VA 4BCEA 2ZUSA 1H41A 5A95A 5I6SA 2WAGA 1GOQA 2FGZA 1NWUA 4JKMA 2G41A 2ZXBA 1DTUA 4M56A 3PHAA 4PMZA 3VM5A 1OD8A 2GUYA 4F8XA 2ZICA 2Z1SA 3AIRA 3WQVA 2J7DA 2YL6A 1E4LA 1WCGA 1JF6A 2WM0A 1KWGA 1ZBVA 5A8MA 3PZGA 2BV9A 4JCMA 2E9LA 2UY5A 2CIPA 6CGTA 5M03A 4V27A 2HISA 3BCFA 1HJUA 3VIJA 4U5KA 3E1F1 4MTVA 1QHZA 4QLLA 4AZ5A 3VGFA 3CH9A 1CYGA 4AYSA 4AIEA 3AXIA 2X0HA 1BTCA 1J0JA 2VCBA 1NM9A 3BXWA 2WWDA 1HXJA 1PPIA 1QPKA 1C3FA 1E1FA 4AD5A 2YBUA 5M17A 1ZU8A 4UFMA 3VNZA 1E0VA 1RP8A 4UFIA 1W2PA 4UQCA 4H7VA 4FK9A 3VDAA 3WDIA 5I77A 2GJRA 2JALA 4YPJA 1JFXA 1VBUA 2CBVA 4N0RA 1CWYA 1HJWA 1DEDA 4PUDA 1HKMA 1OINA 1ISYA 1TUXA 1W1VA 4HMCA 3VGBA 5ECUA 5CGMA 3OIHA 3WMBA 4E8CA 5A6AA 3WF0A 4JFTA 4P7OA 3HU7A 1B3XA 1ITXA 4DM2A 2DT2A 2E9BA 4FF5A 3AXHA 3UG5A 2Q8XA 1N82A 3BLPX 3N17A 2V3FA 4ACZA 5EFDA 3W27A 2WB5A 2E8YA 2XVKA 1NWSA 2C7FA 1JYXA 1KXVA 3KL3A 4HOWA 1GJUA 2BFGA 4U3AA 4CD8A 2XWEA 1PEZA 4DUWA 2D22A 4BS0A 4IUGA 3WH7A 1JAKA 4W7WA 3QHMA 1UR0A 3VUPA 5HPCA 1UKSA 5JIPA 5GPRA 2XIIA 4NZCA 2WPGA 1W1YA 4JFUA 3WNNA 1QNSA 2WBGA 1IV8A 3CZ8A 4U3CA 2BXYA 3WNLA 1QOXA 1KGXA 3ZT5A 2VC9A 4WKAA 1QI3A 4M29A 1UD6A 1GOKA 2J25A 4TOQA 3LPFA 4HMDA 3SCUA 1B3ZA 1OGBA 5A2CA 3KWXA 2XVGA 1GONA 2BVYA 3CZJA 1E6SM 1KBBA 1H5VA 2VT0A 4E2OA 4AZ7A 1JZ8A 1NOWA 4MJ4A 2XM1A 5ABFB 2ZX9A 2QLYA 1CECA 1UD4A 3DYPA 1UR8A 3DC0A 2OYMA 2NW0A 3DYMA 2QMKA 4Z2KA 2JEPA 4QAWA 3L4WA 3CHDA 3GNPA 3UR8A 1GOIA 3OA5A 3U7BA 1JXJA 3TTSA 4UOQA 2GSJA 3IK2A 5LA2A 2ZUWA 3CZGA 3UR7A 5A8PA 3DYOA 1OIMA 3PZOA 3UG4A 1ZBWA 4HZ7A 2QPUA 4F9DA 2CXGA 2O9RA 1KFWA 2JE8A 4S3KA 4CKQA 4D6EA 1MFUA 1E55A 2ZXAA 4HA3A 4W7UA 1TCMA 3AOFA 2D23A 1HIZA 4A3HA 4NRSA 3QHNA 4U2ZA 5HXMA 2BHZA 1E70M 4U2YA 4UQDA 2YL5A 4Q22A 8CGTA 1VEPA 1JIBA 3RILA 3T08A 4W5UA 3WF1A 5A8NA 1R8LA 4W84A 4Z2LA 2VCCA 3L4UA 2PBGA 3ZT6A 1CGVA 5BRPA 2CCRA 2WXDM 3CUIA 4HA1A 1QI2A 3DHPA 5BXTA 2ZX7A 1BYBA 1OWQA 1ISVA 1TVPA 2WMHA 1G01A 1C7SA 3B9AA 1UH2A 4JCLA 3WMSA 1US2A 3L4VA 4PTWA 2EJ1A 3WMCA 1M53A 2JFEX 3N15A 3UESA 1BGAA 1V6WA 4JFVA 3T09A 4DWSC 1WDRA 2YA2A 3AYSA 5CPSA 5BXRA 1R85A 3TTQA 3THCA 1JNDA 1G1YA 1Q6EA 2D0GA 3MANA 4HZ8A 2E40A 1BFNA 1V0MA 2PWDA 2WVVA 2BY2A 2EEXA 3F5KA 3SCNA 3WFZA 4DWSB 3EYPA 2ZX8A 3EDJA 4J28A 3ECQA 2YA1A 1OM0A 2W91A 1W9VA 1W1PA 1UR1A 2GK1A 5I79A 1HP5A 5A6SA 4IPLA 3W26A 3NCOA 2JEQA 1MQPA 2XM2A 1VFFA 1BLIA 4LYRA 3RM4A 3WD4A 1FH9A 3W37A 5CPTA 1QNRA 3VIPA 3WD2A 3WELA 4X9YA 1VEOA 1NARA 1EGZA 3CLWA 3G6LA 1K9EA 2WLZA 4AD4A 2BS9A 3FHQA 2YDRA 3WH9A 7CGTA 3RCNA 1SFSA 4GI8A 3QGVA 5LA0A 2D24A 3VINA 1H2JA 1GJWA 3AMLA 1HKIA 4PN2A 2IXUA 1CGXA 1US3A 3W4RA 1R7OA 2VVSA 3PTQA 3EDFA 2EPMX 3B9DA 1U33A 3CZLA 1EHAA 4EANA 2BY3A 3TP4A 4PSPA 5BRQA 1JD7A 2A3HA 2YLLA 4WF7A 1CZ1A 1CGTA 3VIMA 3WQWA 4BF7A 2DEPA 3VOCA 2EXOA 3SEPA 2F8QA 3VMNA 1HJSA 3UCQA 3QHOA 2F2HA 1O6IA 3PZTA 2IUZA 2WWCA 1WDSA 1XSIA 2GJPA 4JFWA 4CCDA 3WUGA 1GQJA 4UFLA 1CXEA 4UFJA 1J11A 1C8YA 4BZYA 2BVDA 1MXGA 4GQRA 4EKJA 2VNCA 4CD5A 1GQIA 3IJ7A 1WDPA 2DGAA 3FAWA 2GJXA 2D20A 3T0DA 2W62A 1ZBKA 3GH4A 3BMVA 3AZSA 2G3NA 3AMGA 3FN9A 3MKKA 1V3IA 4UR9A 5CQ1A 2XSAA 1KCLA 1PX8A 1TA3B 2ZUVA 2XG9A 4W8BA 2J78A 4OOZA 3NSMA 3ZIZA 1KGWA 4IM4A 1E56A 5HBFA 1HJVA 5D9MA 3PZVA 2EQDA 2VZTA 1B3WA 1BVZA 1KBKA 1QW8A 1QHOA 5M3WA 1A47A 4B15A 1PIGA 2VVNA 4ZFMA 3GZAA 4XB3A 3RM8A 1CLXA 1UA7A 3KL5A 2QPSA 3W29A 2FHCA 1NOFA 4AZHA 2WW5A 2X8RA 3AJ7A 2VRQA 1W32A 2CBIA 2PWFA 1J10A 4GQQA 4AZCB 4AEFA 1AMYA 4AZIA 3POHA 1LG2A 3W24A 1FHDA 1QI5A 4ZE5A 4MB1A 1W3KA 3ZR6A 2A3CA 4OUEA 4EAMA 4U33A 2QHAA 1IZJA 1E0XA 4FLSA 1QBAA 1W3JA 1BYCA 1TFVA 1MQQA 1AQHA 1JAEA 3WDHA 1JNEA 3MMUA 3SCTA 2J7HA 4ZXOA 3GXDA 1LQ0A 3BCDA 1UWTA 2ZXDA 3ZJ7A 2Y8VA 2WMIB 5FIPA 4C7GA 1CDGA 1FP8A 3ARXA 1ODUA 2GFTA 3O2LA 1I1XA 3WIJA 1LLOA 3VGHA 4PMUA 3WF3A 2VI0A 1SR0A 2CITA 4D6HA 3AZRA 1ZS2A 2WSKA 1UZ4A 1V3MA 2PWHA 3B9EA 2XJ7A 2XGIA 2VUYA 2VZSA 2XFFA 3QR3A 1QNQA 3VPLA 3EMCA 9CGTA 3FY1A 4CN1A 1XH1A 3WH8A 3WEOA 4DWSD 1HX0A 3NUKA 3UERA 2FH8A 1J12A 3W82A 1WZLA 1JFHA 3PZMA 4ZXLA 5A6KA 5E09A 1EHNA 3BAJA 3CO4A 4P7RA 4H8HA 4UOZA 4KWUA 1S46A 4MAZA 2V3GA 3MMWA 4UQEA 3MV01 4AW7A 1B9ZA 3TTOA 4IPNB 4C7DA 1QVBA 4AD2A 2PF0A 2VO5A 5A94A 4MADA 3WDQA 1J0KA 4OBRA 4KH2A 3EDDA 3BAIA 4ZENA 1HT6A 4AZBA 1BF2A 1Q6GA 3BC9A 4UZUA 4CCEA 3MUY1 3A47A 4YHGA 3SUWA 1M04A 3CHFA 3HMCA 1GQKA 1L8NA 3W6LA 2A3EA 4AZ6A 1W9PA 2J75A 5JIWA 2G3MA 2XTKA 1KB3A 3K8MA 4FLQA 1UR9A 4TUFA 2RGMA 3CIVA 1E73M 1V3JA 5DF0A 4Z2IA 5KEZA 3WY1A 4NRRA 3IAPA 2AMGA 3SUVA 3AROA 4QCEA 4HU8A 4GI6A 2JIWA 1D3CA 3HN3A 1WKYA 2ZXQA 2BY0A 1YHTA 4ACZB 2WZIA 1XV8A 3WD3A 1JYNA 3NYDA 3NDZA 1OSEA 4M82A 3GYCA 3WBEA 4M80A 3II1A 4N42A 1M03A 2F61A 4WSJA 4UNIA 4LGXA 2VX4A 1Q4NX 1EDQA 2DH2A 2XGBA 2WC7A 1YQ2A 3EMZA 1ZL1A 2D0HA 1WE5A 3CUJA 5DEZA 1JZ6A 2YDSA 3W6MA 3POCA 5A3HA 2W67A 4DM1A 2CBUA 4CU7A 1JDAA 5E0CA 3VD4A 2EO7A 2WMJA 4TVDA 1KR0A 1CENA 3FW6A 2XIBA 3RO8A 3VD7A 2W61A 1K9FA 2ZX5A 3W28A 5C71A 3VMPA 5A69A 3EMQA 2O9TA 1J0HA 1EQCA 1I1WA 1VAHA 1ECEA 2VCAA 3ARVA 1HF6A 1LG1A 3GBDA 4J3WA 3L4TA 4LXFA 2TAAA 3NIYA 1E4IA 1ZBCA 5AY7A 1V0KA 1UWRA 4ACYA 4AISA 3A4AA 3IJ9A 1E6QM 1OGSA 1E72M 3WQ5A 1GOOA 1JZ5A 4NF7A 4PBGA 5A6BD 3VD9A 3GH7A 1V0NA 4CU6A 3MV11 4PRWA 1W9XA 2OLHA 1WO2A 4PMDA 1VJSA 3AS0A 3BAYA 5DFAA 4RE3A 4KGLA 4PMNA 3SCRA 1EDTA 3GNOA 3ARWA 3OLEA 1E3XA 4D1JA 3CTTA 1CEOA 4HPHA 1I75A 3MUZ1 2CKSA 3AHXA 1MQRA 3ALGA 2VRJA 2ZE0A 1JF5A 3AFBA 4MB4A 1MXDA 1B2YA 1W3LA 3FHAA 2UY2A 4FMVA 2WHLA 5EMYA 3PBGA 3KZSA 3JUGA 3RIKA 4GKLA 4FLOA 4UTFA 2D3LA 4D6JA 1ZB5A 4U5IA 4P7QA 2J74A 2E8ZA 3AQUA 5E70A 2VZOA 4AY1A 4M1RA 1CPUA 1SYTA 1AVAA 1OGGA 1UHVA 1XD0A 3W38A 1V3LA 1X6NA 4AD3A 4J3SA 1XSKA 3APGA 2BHYA 1M7XA 3GH5A 1E6XM 3CPUA 2OWCA 1G5AA 4RE4A 3K4DA 1LL7A 4OIFA 1UKOA 2VX7A 4QP0A 2OSWA 5DO8A 1HKKA 3U5UA 3OG2A 1NWTA 1OT2A 3VX1A 1LWHA 5HNNA 4WJXA 2J8FA 3AI0A 5I23A 5GNXA 5DT7A 3VTRA 4AC1X 2VRKA 1D2KA 3ARYA 3WUFA 2UWFA 1FA2A 3SCWA 2XVPA 4W87A 3M7SA 4KRUA 5C8BB 1FH7A 1TZ7A 3S6TA 4HPGA 3N1AA 2OSXA 4EK7A 5CXPA 2FH6A 1PX4A 4ZE4A 2G3IA 5CGTA 1H11A 1B0IA 3VIOA 3NSXA 2VURA 4PSRA 1XYFA 1C93A 4JZ5A 1KR1A 1MYRA 2GK1B 4GI9A 1SMDA 1K9DA 3AHZA 1BQCA 1WPCA 1HP4A 3RJYA 4Z2JA 4QDMA 2WCGA 2WANA 4NSBA 1B90A 5CLWA 4J3UA 2OWXA 4D1IA 6TAAA 4BQ4A 1H4PA 1PIFA 1F4HA 4PYSA 5CZKA 3GTNA 3CMGA 2W66A 1VB9A 1KWKA 1J0YA 1C8QA 1GCYA 3AMCA 5BXPA 1KGUA 5CSYA 1EDGA 3HJEA 4QLJA 1GHSA 2X05A 5D8WA 4CD6A 2VR5A 1AQMA 3ZR5A 2E4TA 2VMFA 3VD5A 1B30A 4KRTA 2DH3A 4WKHA 4JL2A 1UG6A 3L4YA 2OYLA 3VKKA 4HTYA 3VIGA 2CPUA 1FOBA 5C70A 2V5CA 1BSIA 1DP0A 4JFSA 1JD9A 1V3KA 3ARZA 4WKFA 4WIWA 1EQPA 5E6YA 3RPMA 1VIWA 4MB5A 3LMYA 5A6JA 3T2OA 1BVNP 4PCTA 3K8KA 3DECA 2GDUA 5D4YA 3M46A 3WUEA 4J3VA 2CEQA 1GVIA 5I78A 2ZUTA 3M6DA 1LF1A 3MUAA 1QNOA 2YL8A 4RE2A 1FP9A 2WMKA 1E71M 1HVQA 3RMEA 4MAVA 4B9YA 1UWSA 4AD1A 4S3JA 1VFUA 4B16A 4PUEA 3S2CA 3BLKA 3WBAA 2GJXB 2DT3A 2J8GA 1D7FA 3F4VA 1GNXA 5JBFA 4F9JA 2BXZA 1U30A 1H0IA 4F79A 3W25A 4TX8A 4JAWA 3SUSA 2ZX6A 2PC8A 2YLAA 1R87A 5JBDA 8A3HA 3MUIA 1C90A 3TA9A 2DT1A 3WEZA 2XVLA 4HOZA 3K46A 1PZ2A 1P6WA 2VZVA 2JF7A 4BQ2A 2J4GA 1QI0A 2XWDA 1OB0A 4CU8A 4K68A 2CNCA 2EPOA 4XZBA 1NP0A 3LPGA 4TTUA 1QHPA 4CD7A 1DHKA 1JDCA 2VJXA 3OBAA 1WAWA 3SCOA 1HKJA 4PCSA 4GZJA 4J7RA 1ODZA 1RP9A 2XVNA 4JL1A 1H49A 3M07A 1MWOA 1VBRA 3UETA 1RD6A 1CXIA 1V03A 1SMAA 4R27A 1UD5A 4M81A 2WHKA 1K6AA 1W1TA 5E0FA 1VFMA 5I3DA 4UZSA 1UYQA 5D9PA 5A8OA 1K9TA 1E43A 5A2BA 2ZWZA 4OZOA 3ZOAA 4WK9A 4ML4A 3BH4A 2YDQA 2E0PA 3DHUA 3WN6A 3MS8A 3F5LA 2WMGA 1HNYA 2VX5A 3K1DA 5FL0A 4UFHA 1CGYA 3FNDA 5LYRA 2B31A 1JYWA 2XPKA 4CN4A 3O9NA 1XRVA 4JKLA 3T2PA 2EBNA 3OZOA 3G6MA 2OWWA 3T0BA 1KXQA 3OLDA 4TX6A 2ESCA 1PJ9A 5I2UA 3SCVA 1UUQA 3L4ZA 2WBKA 1J01A 1JI1A 1H0GA 3MSDA 3WD0A 4D6CA 1VJZA 2WKGA 2WC4A 1H3GA 4TTGA 2J7CA 5KZ6A 3WSUA 1BG4A 3I3DA 3VGGA 1UH4A 1R86A 3PZ9A 2DPEA 2Y8KA 4BA0A 2FGLA 3BGAA 3U57A 2O9OA 4MB3A 3SURA 2WVUA 2ZIDA 1J0ZA 3N9KA 5A6LA 1JYVA 4B3KA 2ZUMA 2WCSA 3WDJA 3EDEA 3WF4A 1V3HA 2EPLX 3VGDA 1KQZA 4AMCA 1DWFM 1XGZA 1B3VA 2WCAA 6A3HA 1LJYA 1TE1A 1J0IA 3WNKA 1J18A 4A3YA 2DSKA 2AOSA 4LPCA 4M24A 1ISXA 1GW1A 3WL1A 2WSPA 3CGTA 2BY1A 2DSUA 5E6ZA 1UKPA 2CERA 1LL4A 1WZKA 1JZ3A 2O9PA 1W2VA 4UQAA 4W85A 1EA9C 3WDRA 1CNVA 1EIBA 1WP6A 1C8XA 2ZOXA 2DIEA 2VTFA 4PTXA 2CBJA 3NJ3A 5FKYA 1JDDA 4J3XA 3NDYA 2FHBA 3BSGA 3WH6A 3ZO9A 1KXHA 1CIUA 3WQ4A 1EH9A 4MPKA 4H2CA 4PMVA 4UOJA 4H8VA 2GVYA 1UD3A 4PEEA 1V6XA 4LX4A 1G94A 4J3TA 2J7GA 2YL9A 1NOUA 4W86A 3VILA 2VL4A 4OOUA 1GZJA 3W0KA 4QFUA 4JIEA 1W9UA 5EFFA 3VIIA 4P8VA 2HVMA 4KGJA 1E0WA 3WKZA 5FCZA 2NT1A 3U7VA 3VD3A 2V3DA 4PMYA 2DSVA 3CUGA 4E8DA 5HPOA 1UKQA 2Y24A 3VO0A 4BQ5A 3GXFA 2V3EA 1FFQA 2BVTA 4D6GA 1ISWA 2J7EA 2XFRA 4W93A 2A3AA 4GZEA 1GHRA 4IISA 1UZ1A 3L2MA 5GQBA 1MFVA 2E3ZA 2BNJA 3MMDA 3AS1A 3GBEA 2YOCA 3I3BA 1EOMA 4AD0A 2OSYA 3L2LA 2YA0A 1EO7A 3OZPA 4XUYA 2VQUA 3VIHA 3I3EA 3BAKA 3MSGA 3MO4A 1BYDA 1OCQA 5A1AA 1BYAA 2WLYA 1KQYA 3RM9A 1ZJAA 2G8ZA 3N12A 3WQ6A 2EPNA 4LYPA 3TTYA 4P7NA 2WZEA 1LWJA 3B8SA 4OKDA 5AC4A 3W81A 5I0DA 3CUHA 1UWUA 2PB1A 1O7AA 3VIKA 5I24A 2J7FA 3ZJKA 4W88A 4H8UA 5JUVA 3WFLA 4HOXA 1E9LA 4AIUA 1WDQA 4TVCA 1FFRA 3ZJ6A 2QMJA 1QI4A 4CVUA 1V02E 4OBSA 3ZT7A 1ESWA 1IZKA 3SCQA 5ABGA 4PTMA 3VX0A 3T0AA 2BHUA 3TONA 1CGWA 1JZ7A 1HL8A 3VDHA 5A8QA 1DWHM 1G9HA 2WHMA 3CHEA 3EBVA 3AICA 5GNZA 4UQBA 2FDMA 3AS3A 1XCWA 3N04A 4B3LA 4CVWA 3AIWA 4AIOA 4V28A 1V08A 3OGSA 3OGVA 5D8ZA 3SUUA 1V6YA 4JKKA 1JL8A 1MW1A 1MW2A 2J77A 4D6IA 3FXYA 5HOSA
chains in the Genus database with same CATH superfamily
1FDZA 3ITGA 4QEEA 4JEQA 4YTUA 5LA1A 2VR4A 4L9YA 4J4KA 2P0OA 2C8NA 3WNPA 2IPWA 1Q6FA 2DSZA 3TJLA 2PWGA 1OFAA 3SIMA 4H04A 5JBEA 4JTQA 2QCEA 2QZRA 2DZBA 3MVTA 4FEZA 3T6CA 2F38A 2OKOA 2QCLA 1TMHA 1H7XA 2DZXA 3U9IA 7TIMA 5D9NA 3RF9A 2DSWA 3NSNA 3W75A 3S3GA 2C3ZA 2CYGA 1NELA 3E74A 2PU1A 5ABFA 3COTA 3WUBA 4C90A 1NH6A 3FGCA 3GS6A 2C0AA 5LIKX 4EX4A 2WO5A 3WQCA 5CEWA 1PKYA 3ALFA 1E5JA 5KITA 3CMJA 1OK6A 2QNEA 1LL6A 7ENLA 4FXRA 4GUGA 5E0KA 3O07A 1QTWA 4PR4A 1GQLA 4K6AA 1BPLB 1QPRA 2R9RA 2HS8A 2YCEA 3PSVA 1C9DA 3SQSA 3GU2A 1EFZA 1DQUA 4GINA 1P48A 1XLJA 4IP7A 4IP4A 3W76A 3AMKA 3BLFA 1LBLA 4OUIA 1D7KA 2AKMA 2PRLA 2EG7A 3MUCA 2GVJA 1OADA 3VU2A 2NSXA 4BI5A 4U31A 2JKAA 1NVMA 4A4AA 4P8UA 3W74A 4DUXA 1E40A 2ISFA 1VR6A 2X0YA 3C2FA 1HVXA 2CC0A 2XSBA 3GVGA 4LJ3A 3IACA 5HJYA 2H6RA 3GO2A 3ARPA 4UQ9A 3SRFA 5FF7A 3K4WA 3UZXA 4FOJA 4CQCA 1K7FA 2XHYA 2ZZ2A 2E6YA 1C91A 1QJWA 3WJXA 5CPQA 3GXIA 1TV8A 4WLCA 3MHUA 3OLIA 3F1QA 1AJZA 2PDHA 5KSWA 4HZMA 3PF3A 4DB7A 4C5YA 4GJJA 2XFYA 1F6PA 1UR4A 4C6NA 6REQB 1X6LA 3ZSTA 1M41A 5BXSA 1J9YA 3M0JA 1G4TA 4MSSA 3STGA 1HJQA 3A4XA 1OT1A 1Q2SA 1VLIA 4DWSA 3R8RA 1WZMA 2OG9A 2WJEA 4TO8A 4P7LA 3AIEA 4HYVA 3CV7A 3TC3A 2PURA 1CBGA 2WNQA 2DT0A 1KBIA 3GX9A 3GNRA 3OGRA 4YWSA 3LZ5A 2OEKA 4IMFA 3CWHA 1O5QA 2PP1A 3H2OA 4AFYA 2P3EA 1JG9A 3E5PA 3NPXA 2D3NA 5JU6A 1LLZA 1O66A 1XYZA 2CHOA 3WENA 3N18A 1JGIA 4FP1A 3ZR4A 1E4NA 1K02A 4QIUA 1RCXB 1T96A 2V38A 3P5ZA 2W5FA 1CGUA 5AYBA 1ELSA 2XYLA 4C1NA 4NZ3A 5CJ5A 1IR1A 1LOQA 3H24A 4FZIA 3SBFA 4JTRA 4PMQA 3W87A 1BAGA 1JCJA 4IMAA 1ZJIA 1ZZMA 4C5ZA 4LW7A 1JUBA 4Q7NA 4HN4A 2F6KA 2JBMA 3DN5A 4CCCA 4QQUA 1AW5A 1W9DM 4LAZA 4MY1A 4BI7A 1KD0A 3THDA 1LP6A 3A4WA 3Q67A 4AHPA 3WLNA 1V0LA 3ARUA 3S1UA 2O92A 2EF9A 2YDAA 2V2DA 1E6NA 1EC9A 4DQWA 3ITXA 1EF3A 3KXQA 3WL0A 2XGZA 2FHFA 2E7FA 1N8FA 2QIIA 4LYQA 1DE5A 5TD4A 4MDPA 1UR2A 4RNHA 4GBUA 2NUYA 2CKRA 3QGAC 3TW7A 4AY7A 4DX3A 4Z17A 3F4NA 3P14A 1WB0A 3UBPC 4XZWA 3V7PA 3NQFA 4GNJA 4A8IA 2E25A 2GWGA 2EPKX 2VZUA 4GUIA 2W92A 3QLLA 4DPQA 3LGDA 1XQKA 5G2WA 1XLDA 1VFLA 3AHTA 3TOPA 3EX6A 2AL1A 3CHCA 3EOOA 5AYZA 1L6GA 3H2NA 4MZ8A 4G7EB 1XF0A 1BHGA 1CTNA 1N2VA 2CETA 3RYSA 3CB3A 1TA3A 3P8JA 3BAWA 4MVAA 1DTNA 4JHZA 3W7JA 3PZQA 4E8GA 3A13A 4IJRA 4C6LA 2WK2A 1PTDA 7TAAA 1TJRA 1R3TA 1Q7ZA 4LT9A 3TW9A 4K36A 4AB4A 1GORA 2X7WA 4WY0F 4KEUA 1VCGA 4H41A 1PO9A 4CEXC 1LQ2A 5IHRA 1BXBA 4HU0A 4KFPA 3UY7A 3QQ1A 3ZSSA 1F4AA 5C9ZA 3M7WA 1BSLA 1ISZA 4M6UA 4FI4A 1I2PA 2WNWA 1U22A 4D8ZA 2MANA 1RR2A 4YN5A 3IVUA 3LPPA 3GIPA 2BODX 3NQ2A 5C5YA 4ZFCA 4AF0B 1XJBA 1YE4A 4GGBA 4LBSA 2VGGA 3BSMA 4AAJA 3HOJA 3VVGA 1O5KA 4NJKA 3ARTA 2P53A 4ZMGA 1VGAA 1XLMA 3SCPA 2X2YA 4PMOA 1VC4A 3TXVA 4EWND 3DFNA 2OOGA 4JDBA 2P8BA 2WMIA 3IJIA 5K4ZA 3PZIA 3AHVA 5KETA 3DZ1A 3QQ0A 4AZGA 4JN6A 2ONEA 4Y9OA 1OHLA 3G1VA 3RNDA 5D2YA 1OC6A 1B1YA 3D5HA 5D38A 3VFLA 4DUVA 4CUCA 4W8LA 4MNMA 1CB2A 3RDKA 6ENLA 1UP3A 2ZUSA 5A95A 1AL7A 2WAGA 2PRHA 1NWUA 3L2IA 2G41A 5DBTA 3VYLA 4M56A 1A0DA 1LUCB 4NT0A 4F48A 3LRLA 3V18A 3HV8A 1XUUA 2ZICA 4C6DA 4BWLC 2OZ3A 1E4LA 1OFPA 4XKMA 3Q2DA 5A8MA 3EXTA 3PZGA 3T7VA 2OQHA 1Q4WA 4MTVA 4IX0A 1FX6A 3IIOA 2QULA 4E2VA 1QR7A 4AZ5A 2OZ8A 1Y5XA 4UNKA 2O56A 3ABZA 4AIEA 1O68A 1Y0EA 1JPDX 1SW0A 3Q4DA 1GZGA 3N6JA 1YLVA 2QJJA 1C3FA 1YDYA 2YBUA 5M17A 3HFTA 5IRPA 1ZAHA 1ZU8A 4ZOBA 1RP8A 4UFIA 5KMYA 1D8WA 1V5XA 4FK9A 4RE0A 2GJRA 4W9TA 2BXVA 2VFDA 4YPJA 1YNQA 1XQLA 3M1ZA 4NNAA 4GYKA 1OINA 4JTKA 3TYBA 3UWVA 1TUXA 3OOQA 3OIHA 4GBDA 1S2VA 1E9ZB 4P7OA 3FCPA 3HU7A 1ITXA 4LSBA 5CCZA 4FF5A 3WLPA 4GUHA 4MUZA 4G1NA 1WQ5A 4PULA 4RK8A 4ACZA 3KWSA 3KTXA 4CNOA 3W27A 4K2SA 1NWSA 3UXDA 4Y9MA 4M0XA 3BL3A 4EXQA 3VNKA 2O4MA 1F74A 3MVIA 3QMTA 3GKAA 4QR6A 2FDSA 5GJPA 1F7BA 4IUGA 3WH7A 2Q09A 2NVDA 3PTDA 1FWIC 3TROA 4W7WA 3QHMA 5G5IA 1UR0A 3VUPA 2ZA1A 1W1B1 5GPRA 3LDVA 1V6TA 2WPGA 4GY7A 1IXOA 1IV8A 3W23A 1ZP3A 1UOZA 3ZT5A 3B04A 1LROA 1OX4A 2RKXA 1KRAC 1TPB1 2Z4GA 3SCUA 2XU2A 4DJFD 3ZYZA 3AALA 3VABA 2YB1A 1JQVA 3CZJA 1KBBA 1H5VA 4AZ7A 1NOWA 3P84A 4BHYA 2XM1A 2W79A 2PU0A 4LANA 2ZX9A 2QLYA 3DI1A 1CECA 3CAQA 4E6MA 4AHOA 1UD4A 1A5UA 4GCAA 2I9UA 2J9XA 2E1WA 3GK0A 1G4SA 3DYMA 1MO0A 2Y1HA 4Q6XA 4QAWA 2V5BA 3KHJA 3L4WA 2QUUA 3UR8A 4YYCA 3CLMA 3U7BA 4UOQA 4NQ1A 3KM8A 1S5TA 4DYKA 3UG4A 4HZ7A 4F9DA 2BOGX 3B9NA 2CXGA 1KFWA 1RQEA 2C1IA 2JE8A 1AJ2A 2X1SA 2ZXAA 4H8NA 2YXXA 2IPFA 2YB4A 3UJFA 3MUXA 4A3QA 4A3HA 4OV9A 2GQ3A 1W1ZA 4UQDA 2PA6A 2YL5A 3QFEA 3W1AA 1PCKA 3THUA 3UCCA 8CGTA 3OYZA 3T08A 1DIDA 2FJKA 3P0XA 3DX5A 4W84A 3EWYA 2YSWA 5G4HC 2WXDM 3CUIA 3TU9A 1L6YA 4LUTA 5BXTA 3FKKA 1J2WA 3W2KA 2ZX7A 3IGUA 1OWQA 4XZNX 1TVPA 3V3WA 4HYWA 1WA3A 3ELFA 2X30A 4JCLA 1US2A 1DJGA 7ODCA 3W7RA 3N4FA 1BD0A 3ANUA 1GTEA 3UWQA 2PDJA 4XZHA 4LOCA 3RLHA 3N15A 3F4WA 5HUPA 2Y5JA 3OHMB 2DVUA 4G8TA 3T09A 3AYSA 5H8PA 4IWWA 1G1YA 1Q6EA 3NNTA 3DI0A 3PUDA 2E40A 2I17A 1XRSA 2WVVA 2BY2A 2EEXA 3LU2A 3MI2A 3IUDA 2NSOA 3WFZA 2DVXA 1DXEA 3ENLA 1GVQA 3EYPA 4HCLA 3V4BA 3VKAA 1GW9A 1RPXA 3C61A 2FZ9A 1W1PA 3S8HA 1UR1A 2CWXA 1S39A 2GK1A 5I79A 3WJYA 1HFBA 2NQLA 4JBRA 3NCOA 4M7TA 2QUNA 4K38A 2XM2A 3VOHA 3PM6A 2D73A 3WD4A 3E5BA 2JGYA 4KKXA 5CPTA 1QO5A 2WJDA 3CLWA 2HZGA 2WLZA 4AD4A 3FHQA 4FF7A 2YDRA 4LVBA 5LNSA 1JEZA 1R3WA 2RHGA 3ME3A 4HNLA 1TPFA 3FSTA 3QPYA 3RCNA 2PTYA 1KBJA 1NF0A 4DBEA 4KCVA 5BNKA 3VNDA 2C16A 1R5YA 1PE1A 3LLFA 3H7VA 3W4RA 2ZDRA 3B9DA 3BLEA 1OC7A 2BY3A 1DE6A 1JD7A 2A3HA 1W54A 4WF7A 1CGTA 4XKYB 3GVWA 2DEPA 3N2CA 2IQTA 1P0EA 2O4QA 4A8NA 1O12A 4DY1A 2F8QA 3H8AA 4ZSUA 4HGXA 4FNTA 4DVOA 1O6IA 3NGFA 3CQKA 4UFJA 3CMFA 1J11A 1I2OA 3B0YA 2VNCA 3HJZA 3IPWA 2HE8A 4R7JA 1PUDA 3CWOX 2GJXA 3W7EA 3EB2A 3OVGA 1XS2A 2W62A 4EXAA 1B57A 3W07A 2AGTA 1S3HA 3E3HA 2AL2A 2J66A 2Y5SA 3QEZA 1D9EA 5CQ1A 1TB3A 4UTMA 3AWNA 1PX8A 3V5OA 1VH7A 2Y63A 3CT2A 1AUSL 1HJVA 1OFOA 1MDLA 3PZVA 4H6EA 3B0VC 1BVZA 2WPBA 4B15A 4ZFMA 3NVTA 4Q4KA 3WFAA 1CLXA 2HPIA 3STCA 2FKPA 2FHCA 2OQLA 4N02A 4RNFA 1NOFA 1ZP4A 4WY0B 2GUBA 1QK0A 3W86A 2YFOA 5FI8A 4AZCB 3QXBA 1SVDA 5CAKA 4IPIA 4X60A 4AZIA 2DU2A 1W3KA 3N4EA 3ISIX 2OLAA 1PCWA 1IZJA 1BKHA 3G1XA 1TFVA 1MQQA 4GC3A 1JNEA 1V93A 2J7HA 3GXDA 4IIHA 4NZ5A 2J27A 1UWTA 3C6CA 4B5SA 1E51A 5FIPA 2DQWA 1FP8A 4L4MA 3WF3A 3GY1A 3M0MA 3AZRA 1RBOB 2WSKA 4Y9NA 1AD4A 3P6LA 1TIWA 3WJSA 2XJ7A 2XGIA 1NU5A 2XFFA 3BJSA 3FVDA 1QNQA 3VOJA 4LNYA 3M0KA 4XO7A 3EMCA 3UXLA 1XH1A 2NXHA 2CLKA 3WH8A 4XSMA 3NUKA 4HJFA 4XTDA 1K77A 1LT8A 3BPWA 1LCOA 4KW2A 5E09A 4LS0A 1SFTA 2PWUA 1OABA 4FX8A 2BTMA 4C7DA 2OQYA 2R14A 2Y85A 1QVBA 1ONEA 3NL3A 4AD2A 2PF0A 2FVKA 4H3DA 5XINA 3WDQA 4UIOA 5FEXA 1J0KA 2POZA 4O13A 3BAIA 1R3RA 4YVXA 3UNTA 4CCEA 1H51A 2J13A 1ZALA 2HMCA 3R1ZA 4YHGA 1M04A 1UC4A 2Z6JA 3HMCA 1GQKA 3ES7A 2A3EA 3OU8A 1Q3NA 2G3MA 3K8MA 4FLQA 4TUFA 4QNWA 4XISA 5DF0A 4O14A 4Z2IA 5KEZA 1P0BA 1QPOA 3CAKA 4O1FA 1A4MA 3LGEA 4M6PA 3RLVA 4QCEA 4HU8A 2JIWA 1W3TA 1D3CA 3W72A 1HUVA 4NAEA 2XIJA 4BJHA 1VQTA 1FUYA 1YHTA 2WZIA 1XV8A 3WD3A 3PJTA 4US6A 4Y2WA 4FALA 1M03A 2GGHA 3L7RA 2F6XA 4WSJA 3UXIA 4DELA 1EDQA 3ITLA 1M7JA 3I7SA 1NFPA 1TPH1 1NTHA 1WE5A 4DJEA 3VNIA 2QQ6A 3V0SA 1UIOA 4DM1A 4CU7A 3VD4A 2DZWA 3KOFA 2C91A 3G2GA 2XIBA 1IWBA 3W28A 5C71A 5A69A 3DFOA 1I1WA 1OX5A 3UYIA 1NDVA 1Z6KA 1LG1A 2FLIA 5EGRA 4KERA 4C1KA 3EB4A 3L4TA 4NX0A 1E4IA 2QCHA 2PGFA 2Q3RA 1V0KA 3IJ9A 1UR3M 3QBUA 1E6QM 3STFA 3WZ0E 1OGSA 2NLYA 4LB4A 1E1CA 3IUHA 3ATYA 3ZS4A 4LEFA 3WLRA 4DF1A 5A6BD 3VD9A 3GH7A 1I9CB 3MV11 4Q4PA 2OLHA 1WO2A 3BGGA 5DFAA 2E28A 3L65A 1EDTA 2IW0A 3ARWA 3ITYA 2QCDB 3SI9A 3GC5A 3PPFA 4I9JA 1EJRC 1A50A 4HPHA 1QUMA 3MUZ1 2A85A 1MQRA 1TTQA 3VZZA 4LU0A 1EF2A 1H1YA 1ADOA 1MXDA 3HB9A 2XIMA 1TJPA 4YTRA 1BTMA 4FMVA 3PBGA 2NX9A 3JUGA 3RIKA 4FLOA 4B91A 1OG6A 2EAWA 3E9AA 4U5IA 5E70A 2CLLA 4LAKA 4M1RA 1CPUA 1L6FA 3TSBA 3GSMA 3G18A 3S42A 3GH5A 4I9AA 4ONVA 3CPUA 4Q4QA 2V9DA 1FDYA 1MUWA 1XC4A 3OQEA 3VI2A 3U5UA 1T7LA 4L6HA 2PFHA 4IMDA 1K8ZA 4LVFA 3A5VA 2J8FA 2XH4A 2VRKA 3ARYA 2I5IA 2JQXA 5H91A 3CNYA 3SCWA 2XVPA 3O6DA 4B5NA 1A3WA 4QXIA 5C8BB 3S6TA 4HPGA 1XM3A 3G0SA 3LHVA 5CXPA 1DJYA 1H11A 4MKNA 2VURA 3MYOA 3DFSA 4DHGA 4GI9A 2B7QA 2VFFA 5HANA 2I16A 3ABQA 1WPCA 1R2TA 3UJEA 4Z2JA 4LCRA 3Q37A 2WCGA 3MJMA 3KX6A 4Q7BA 1JUEA 4NILA 2QDEA 3CMGA 3D0CA 4FXJA 3LXAA 1C8QA 1MSSA 2RDXA 3AMCA 3ITOA 3EWWA 2O0TA 3UU0A 3F7JA 4J5NA 2X05A 4RDWA 1YNPA 3LXCA 4CD6A 1NQKA 2OELA 3ZR5A 2VMFA 3VD5A 1B30A 4KRTA 1K8XA 5JXQA 4JS3A 2OYLA 1ALDA 3LTPA 4HTYA 4TU1A 3UA4A 1BRLA 3GNXA 1DP0A 4H9YA 1MNZA 1OJXA 2BBFA 1OY0A 3G1SA 5HNUA 1UJQA 3LQGA 1T8XA 3R6IA 3RR1A 2GVLA 3A9IA 3M46A 5FSDC 1GVIA 5I78A 5LXEA 4C65A 2NQJA 2BOFX 1J5SA 3NQAA 4B16A 3LG3A 3BJTA 4PTNA 3S2CA 4PCPA 1D7FA 3F4VA 1DV7A 4TX8A 1FWRA 4N6EA 2V69A 4D2JA 4EPKA 1R87A 1C90A 1ZTVA 3TA9A 2DT1A 3WEZA 2PTZA 3GDRA 2OZ0A 2HXTA 4AVFA 1I4NA 1RQBA 2OB3A 1TPDA 3B4YA 3G3DA 3TAOA 1IIHA 2PLKA 2EPOA 1XIGA 2A6NA 2PGEA 3I68A 3LM3A 2VDIA 4CD7A 1JDCA 2VJXA 1BWVA 5LZLA 4PCSA 3IJ6A 4A05A 4GZJA 1X6UA 4MYAA 1H49A 2R94A 3B40A 3HM7A 5TIMA 4B5TA 5EYWA 3VKJA 1V03A 1OCJA 3BZGA 4JX4A 4YCOA 1W1TA 3FOKA 3P3BA 3I7QA 4JPGA 3ZWSA 3GNNA 5I3DA 4K1WA 3BUVA 2CLEA 3V16A 5D9PA 1K9TA 2ZWZA 4OZOA 4RZBA 3W1XA 1UBPC 3XIMA 4IT1A 4WUIA 1VYSX 4QROA 3MDWA 5JH1A 4AYGA 2VX5A 5I3KA 1CGYA 3N2XA 1VBJA 2B31A 1JYWA 3MCOA 4CN4A 5ENLA 4JKLA 2ZQ0A 3G0XA 4REQA 3GTXA 3G6MA 2J6XA 3S1GA 3PPHA 1KXQA 3OLDA 3BQ6A 1UUQA 3L4ZA 1J01A 3MSDA 2WC4A 2ISVA 2V82A 3I3DA 3C52A 4F4RA 2J9YA 4E4UA 3VGGA 3H4XA 4JTCA 2DPEA 4BA0A 1I2RA 3U57A 4MB3A 2ZIDA 3BTNA 1JYVA 4B3KA 2CZEA 2WCSA 3WDJA 3WF4A 1V3HA 2F84A 1XPGA 2WNNA 2VEPA 3VGDA 1JPIA 4AMCA 3BE7A 3H70A 4OU1A 2VWSA 1J0IA 4JQ4A 1J18A 2ZFAA 3EAUA 4DI8A 4LPCA 1DORA 1GW1A 3HTWA 2WSPA 3NURA 1XX1A 5DY3A 2P50A 1UKPA 3QR0A 3WLTA 1JZ3A 3WYZA 5HQLA 1TWIA 3HPSA 1E0UA 1KNWA 1PZ0A 1OQFA 1EIBA 1KTNA 1WP6A 3WLKX 4IMEA 1RJQA 3SIZA 3SY5A 1UW9A 4CEUC 2WQDA 4JEJA 1KXHA 5DCBA 2X7VA 3UGRA 4HKPA 4MPKA 3L0NA 5K9DA 3W1QA 1R0MA 4NIRA 2J7GA 1AL8A 1NOUA 3GXPA 2B81A 2VL4A 1XYMA 4JIEA 1MDRA 2PEVA 4P8VA 3T0CA 1EP3A 2NT1A 3U7VA 4PMYA 3SGGA 3T4CA 1J4EA 1I8JA 5FF4A 1FKXA 7PTDA 3UWZA 3VO0A 1X8FA 3GXFA 4D6GA 1ISWA 2YCJA 3H2CA 2HBXA 1CCWB 4IISA 4NY2A 3L2MA 3EPNA 5DMLA 2PLCA 3PG8A 4YLWA 2W9MA 3SN0A 1T40A 1PL9A 2D2HA 4HNTA 3VIHA 4DXVA 3L9CA 3TNOA 2Z2AA 1BYDA 4JN7A 3RM9A 4JICA 1DQXA 4WOQA 1K6WA 4GH3A 1FCVA 1YTDA 3CPRA 3DU0A 4OHQA 1SFJA 4ZTYA 3I10A 3PB0A 4Q8WA 2ZA2A 1O7AA 2J7FA 2OOFA 1H7PA 4RV3A 4HOXA 1I0BA 3NR0A 4AIUA 1WDQA 1CI1A 4WVXA 3DAQA 2WV8A 6ALDA 3HIJA 4XAPA 4HHMA 4CQ9A 1KW1A 4DO7A 1XYAA 4PTMA 2ISSA 2ZVRA 1TELA 1O5XA 4O8RA 1RCQA 3CYVA 3V0UA 3QGKC 3VDHA 3EKLA 2ZRZA 3OBEA 2WHMA 2XN2A 3IIZA 1XICA 4ZOAA 4WDWA 3MKVA 2CZFA 4HSHA 3CWNA 4AIOA 1A53A 4LH8A 4WDTA 1V08A 2OVLA 5CZ0A 3OGSA 5D8ZA 5LNVA 3CYJA 3N25A 5I09A 3RX2A 5CPLA 1MW1A 1MW2A 1P7TB 2J77A 3H2EA 4D6IA 3PWGA 1OK4A 2CZDA 4XUGA 4BKNA 3CUFA 3BQ5A 3GHRA 3AXXA 2WHJA 3CV1A 5GNYA 2YIHA 5G1YA 2BGQA 1VFOA 3TQPA 1VF8A 2PDUA 3PR2A 1W91A 1RPKA 4IXHA 5FD0A 2WJZA 3SUTA 3U0HA 3M41A 2V68A 4RL3A 2TODA 3LQLA 3AIVA 4QG6A 3ZJ8A 4WCJA 3QOMA 5FL1A 3MT1A 4UB9A 1GKQA 4ORIA 4L6OA 2OYKA 3TFXA 1K4HA 2WKLA 3BLLA 4C6FA 1RV8A 3CBWA 5CJNA 3N14A 3IGHX 3OP2A 3W73A 2OO6A 4D6FA 5C2CA 1S5WA 4H9UA 4GFIA 1K3UA 3WMLA 2XIQA 3E2VA 3GXNA 1HL2A 4F0HA 4UC5A 5A6TC 1IWPA 4YJ5A 1U2YA 5ABEA 3DG7A 2PBOA 1TMQA 4QM1A 5TNVA 2QF8A 2ODOA 4ES4A 2D1ZA 2INEA 1VCFA 1UPPA 1MZHA 1J5TA 3FAXA 4ICNA 4S3BA 3U6WA 3C4UA 2FVMA 1JXKA 5F4WA 2OPJA 4MNKA 5FACA 4A6GA 3USBA 1M65A 4S3EA 4RZ6A 1VEMA 2OMAA 2WVVB 4HA4A 1MVYA 3KW3A 2NQZA 1PAMA 3SB0A 4GO9A 4NAFB 1R2RA 4PUKA 3WCZA 4M8UA 4H00A 3AXMA 4O53A 1ADSA 1W9BM 3EA1A 5LIUX 1FCUA 2Y2WA 3XINA 5I02A 1GOMA 2XUCA 3S4TA 4DNMA 1IE7C 3VKDA 3S2MA 4F40A 1DJZA 1TPC1 4XV0A 2ZDSA 1R3SA 5BMWA 3WQ8A 4OJYA 3RCMA 2CESA 1VHCA 3PZUA 3EPMA 3PTMA 3OEXA 1M9HA 1LRTA 4GUJA 4IFKA 5EBAA 1F61A 1V6UA 2OKTA 2OR2A 4HN8A 4X2PA 5IFTA 3RX3A 3NM3A 4H9ZA 3AMDA 3IEBA 1QW9A 3BO9A 3FEMA 1UKTA 4C6CA 4QCFA 2V2HA 1W3HA 4D6DA 4O17A 1E6PA 3UJRA 2Z2UA 4QS5A 4M7SA 4KBXA 4UTKA 3L12A 3WEMA 3NXLA 2C0HA 1X98A 3M0ZA 5B7ZA 1OIFA 2EHHA 3ZVHB 1KO0A 2WVSA 4YXGA 4QBXA 1EXPA 5TQLA 4J27A 5I3HA 4O1AA 4GQBA 3ID7A 1S5MA 4O57A 1F3XA 1ZAJA 5D32A 4GYJA 2KAUC 5CC3A 5HATA 3U5YA 5CG0A 2V2CA 2ZA3A 4L4OA 2NT0A 1OZMA 2YXOA 4EP8C 1GUVA 3VC5A 3RLGA 1K4GA 3OLGA 3IRSA 3TNBA 1X97A 1YPIA 3M64A 3AYVA 4ATLA 2HVNA 4ATWA 1EOKA 4YMZA 5D9OA 3E0VA 2HV5A 3KVMA 1UD2A 4FA3A 1J96A 2E9MA 1NQ6A 4Y7EA 3OB8A 5G2HA 3C2VA 2G3JA 2FTPA 1ICSA 4OE7A 5F7UA 3UGVA 4F2UA 3MI3A 1QO2A 4KIEA 3VIFA 3ABRA 5MKGB 4TXEA 1SZRA 3KL0A 3RJXA 3KTCA 3CT7A 3BSHA 3GIQA 4QLKA 3WQOA 3R12A 2VD9A 3HO8A 2QCMA 1XIMA 2Y0FA 2PD9A 1UD8A 3L67A 1X1NA 1QK2A 1TJ0A 5AYXA 5CGQA 1PDZA 4R53A 1HQTA 1E6RA 4BQ3A 1V02A 1G7VA 1Q6LA 4DJFC 3QW4B 3M0HA 1JI2A 3PAJA 5IDZA 1T8QA 1XIEA 3ZQ9A 1BVWA 1EO5A 5IDIA 1WZAA 3WQEA 1G69A 1WOAA 3V75A 4W7VA 4N4PA 1GK8A 3NM1A 1Z8AA 3T2QA 3IANA 2PP3A 3E49A 4S2BA 1KCKA 5M2FX 3E2SA 1EBGA 2A79A 2Y8UA 3ARSA 3D46A 1GPFA 3W83A 4LQ1A 3N11A 3T44A 1Z32X 3WDPP 5FJUA 4KWSA 1OYAA 3VM7A 3AHYA 3AIUA 1VPXA 3BMWA 4UCFA 3QC3A 2JF6A 3EX1A 1MNSA 3M16A 3L5AA 4S38A 3WLQA 4GI4A 2ZWYA 1XDLA 4R5EA 5MHBA 5TF0A 2QPXA 4MFDA 2QJNA 4MWAA 5C7HA 1S2UA 3KOWA 4I9MA 1V8EA 2RGLA 1UCWA 4Z1CA 2FFIA 3B0XA 1JZ2A 3PTKA 1IEVA 1CXLA 2A7RA 4L1XA 1XG3A 3PPCA 3FLUA 4EF9A 4JIIX 1HJXA 2B7NA 3AIBA 3L0KA 4Q8VA 2FMOA 2EG8A 2FVLA 3MP4A 3BLOA 4Z2GA 3TH6A 1C7TA 2HTMA 2INZA 1M01A 5DMNA 3TW6A 2WVTA 3E96A 3GR7A 1XH2A 2EPHA 3LA4A 4XZIA 3QLDA 3IWPA 2BDQA 3TFCA 1DYSA 4POCA 3ES8A 4X0VA 4MJZA 4BCEA 5I6SA 4ZQMA 4IIFA 3AO0A 4GQGA 1C9WA 1FXPA 2GUYA 4F8XA 3AIRA 3WQVA 2A7NA 2YL6A 1WCGA 1JF6A 2WM0A 2QCNA 1KWGA 4I90A 3B9OA 4C6IA 3SW6A 2BV9A 3FKRA 4G6CA 2UY5A 2VGIA 6CGTA 2HVOA 1S1RA 5M03A 4V27A 2AQVA 3FDGA 1HJUA 1TO3A 3TN4A 1UASA 4K8GA 4DXXA 1JULA 3HG3A 3AXIA 2X0HA 1BTCA 3PUOA 3BXWA 4FSAA 4ZR8A 1HXJA 4H4IA 4QS6A 2Y89A 1F8MA 1RAKA 3EOUA 3IGXA 4BEQA 2CZVA 3DKJA 3VNZA 2FGBA 2NX3A 3PSWA 3QC0A 1W2PA 4HJWA 3FIGA 4MUPA 4AWUA 3N4AA 4H7VA 4UQCA 3TCEA 2JALA 5AHIA 2HPMA 3S46A 4GYFA 4N0RA 3UYCA 1CWYA 1HJWA 4PUDA 3URAA 2X1UA 4OECA 5ECUA 3WMBA 2P5NA 1PV8A 3IIVA 3WF0A 1SZNA 3C0JA 5K4XA 3S2JA 1R9ZA 3UG5A 2W0UA 4DJDA 2ANUA 2QDHA 2V3FA 4J35A 3TEVA 1U1UA 2R1KA 2WB5A 1TSIA 1VPQA 2PE4A 3DFQA 3P82A 3KVLA 3KL3A 4HOWA 2BFGA 1F8IA 5KZMA 2XWEA 3NZQA 3DHFA 4Q32A 3WLSA 1IEIA 3YPIA 3ANVA 5HPCA 5LIWX 4MM1A 3KBNA 4JFUA 4RNJA 1QNSA 1AZ2A 1QOXA 5B7YA 4I5UA 4GYPC 3EA3A 4GVHA 4BEUA 1OFEA 4TOQA 4HMDA 4PUUA 1EP1A 3EEGA 4C91A 3QZAA 1B3ZA 5A2CA 3KWXA 2XVGA 1FY6A 5IBXC 2YR1A 4LALA 2BVYA 1KM2A 2VT0A 4E2OA 1JZ8A 4I6VA 3WX7A 5CBIA 4XD6A 1XLIA 5I00A 2QS8A 1GVRA 3ANYA 4NP7A 1DXIA 3DC0A 3JVAA 4OFCA 2WSRA 2NW0A 4Z2KA 3RO6A 2JEPA 3RUBL 3KLLA 4LRTA 1GOIA 3G1HA 4E5TA 2GSJA 4JTAA 5K9CA 2ZRWA 3GFXA 1L8PA 3CZGA 3DYOA 1ZBWA 1RVKA 3TQ0A 3TWBA 4I5RA 3AWOA 4NJGA 1I2NA 4D6EA 2CHRA 1FWBC 4B4FA 1A5CA 4W7UA 3CL7A 3ITCA 2D23A 3GG8A 1UUOA 4NRSA 4U2ZA 3T55A 3UZWA 1E70M 3LCGA 3RITA 1RCOB 1SJCA 4RCXA 1QRQA 2KZHA 2KX9A 4W5UA 3A21A 5A8NA 4Z2LA 2VCCA 3L4UA 2PBGA 4KT2A 5L6UA 1CGVA 4LCSA 4K8HA 4GGHA 1S2CA 3DHPA 4MZ1A 2PS2A 1KM3A 4IP5A 3CIXA 3CV6A 3B9AA 3DH7A 1V4YA 8XIAA 3WK0A 4GVIA 3WMCA 2YYTA 3IK4A 4GIYA 3M0LA 4JFVA 4Q8PA 1RD5A 1YEYA 3THCA 2D0GA 3CUZA 3MANA 4HZ8A 4MY9A 6TIMA 1V0MA 2PWDA 2NQ5A 3SCNA 2E77A 4FNPA 2ZX8A 1BQGA 3ECQA 2YA1A 3BICA 1W9VA 3GTFA 5HJXA 1ZNNA 3PBMA 1HP5A 1Q66A 4IPLA 5EL1A 5HWJA 3W26A 2TYSA 3REQB 3NVDA 3EA2A 3C0SA 1BLIA 4GOAA 1FH9A 2FZDA 4HIBA 5REQA 4O16A 2F2KA 1NARA 1VZWA 3NDOA 4IQEA 5F1UA 1K9EA 5C7VA 3KVKA 3TN5A 3FA3A 4MOZA 1F6KA 1V77A 3NEVA 4QISA 1BWKA 3PBYA 3RU6A 3VINA 1SZGA 1SJAA 1HKIA 1DXFA 4PN2A 2YX0A 3W7CA 4XZ9A 1SU5A 1Y65A 3KBWA 3PS7A 3TZNA 2VVSA 3L21A 2PDBA 3EDFA 5D09A 2V5LA 1EHAA 1AH4A 2YCLB 4EANA 3TP4A 4PSPA 5BRQA 2YLLA 1F07A 4ZL1A 1CZ1A 1KRBC 3RPTA 3VIMA 1TZ9A 4PBFA 3GTIA 4BF7A 3VOCA 4PE8A 4M19A 4JTGA 3SEPA 3FJ4A 3UCQA 4S23A 3QHOA 1Y5VA 1FRBA 3PZTA 2IUZA 3VOIA 1HGYA 1QOPA 1WDSA 1XSIA 2GJPA 4CCDA 3WUGA 1GEQA 2P76A 3BVJA 1S1PA 3V5CA 4BZYA 1MXGA 4X61A 4R85A 3IJ7A 1WDPA 3UA3A 3O15A 3W7MA 2DGAA 3FAWA 1H50A 4MIMA 5DRCA 3R0DA 3GH4A 4IZGA 3AZSA 4NX5A 3AMGA 4RKAA 1IEQA 4Y6GA 3UNDA 1MEIA 2P3ZA 4UR9A 3LBOA 3C2OA 4JQ3A 2ZYFA 3H2FA 3NQBA 1QMLA 3NSMA 1YBQA 2HK1A 1KGWA 4IM4A 3DGBA 1E56A 1H7RA 5HBFA 1I0DA 2EKGA 5CBJA 4MLJA 3FYOA 5D9MA 1OF8A 1Q85A 1JPKA 5M3WA 1A47A 1QXLA 1SW3A 2VVNA 1EL3A 4XZLX 3GZAA 4JD4A 4DWDA 3RM8A 4UTWA 4LVAA 3KL5A 2V0TA 1X38A 1FWFC 3D47A 4DO6A 2X8RA 3W01A 3CXOA 3W7GA 1R9YA 4W4QA 3WBWA 3PANA 4GQQA 2BSLA 4AEFA 1AMYA 3DESA 1Z41A 4F3HA 1LG2A 3B05A 3QVQA 3BURA 1FHDA 3W24A 1YXYA 1WV2A 3MDUA 4GD0A 1EZ2A 4EAMA 4B90A 4L61A 2BWGA 1J2BA 1JRBA 1QBAA 3WLJA 1AQHA 3WDHA 2BGSA 1OCNA 1EJVC 4GZ7A 1LQ0A 4EPEC 1XYBA 5C0QA 3UPBA 2Y8VA 3NO1A 4GACA 2NXGA 3TQVA 4C7GA 2HNHA 3ARXA 4IG2B 3O2LA 4D8AA 2Z1WA 1LRQA 1I1XA 4HPXA 3VGHA 1SR0A 4D6HA 3TX9A 4DZHA 1V3MA 4ZQNA 4Y8EA 2GQAA 2VUYA 1LYXA 3QR3A 1Q8JA 5HA7A 1RY8A 2GQ8A 2E5CA 9CGTA 4CN1A 4P61A 1UB3A 1WAUA 3FEQA 3GUWA 4DWSD 2PDMA 3W82A 1JFHA 4NXSA 3TIMA 5I3GA 4WD0A 3TMLA 1S46A 3LCWA 3NWRA 3MV01 3T4WA 3TTOA 5BWAA 1W56A 4IPNB 3S6OA 1R30A 4K37A 1EPVA 4MADA 4OQVA 3QPZA 1X39A 4ZENA 4AZBA 1OFQA 1Q6GA 2NV9A 3K30A 3MUY1 2PDWA 3A47A 3SUWA 3OODA 1N8IA 4CNSA 4S1FA 3W6LA 3I6RA 3P67A 3W7HA 1GGOA 4FAMA 2XTKA 2DJLA 3MHGA 3CIVA 1V3JA 1DJNA 2BX7A 5FAGA 2WJFA 3SUVA 3CK5A 3AROA 3AJXA 5FAJA 3GW3A 4MF4A 4E2BA 3HN3A 3T8QA 2G4JA 4GIEA 2CXEA 3SECA 2QYGA 3DCPA 4Q4RA 4DAFA 2E5BA 1PZ1A 2E68A 5CJMA 4M80A 5CKSA 5H1WA 4LGXA 3QMRA 1Q4NX 1A80A 2WC7A 1YQ2A 1H1ZA 1WDWA 1ZL1A 1XLLA 1JQXA 3K13A 4LFYA 3U48A 3OO2A 4NUWA 1TPUA 4O12A 3EZ4A 4JTEA 4YL2A 3POCA 2CBUA 5E0CA 4GHRA 4UTHA 3RO8A 2L5HA 3LCFA 3R11A 2ZX5A 3DG3A 4JY8A 3UZJA 5D37A 1FWHC 2DZUA 2HRWA 4U4MA 3LNMA 2ZCGA 3APYA 2QAPA 2VCAA 3M5XA 3QV9A 3GR4A 3LD5A 4J3WA 5I3IA 5K9XA 4LXFA 1HGWA 3NIYA 3XISA 1OC5A 3P62A 4LCQA 3G1DA 4ACYA 1DBTA 2YBVA 1O60A 3A4AA 2NUXA 5LIYX 1UMLA 4JIPA 3LBMA 3M5ZA 3H22A 2ZTJA 3WQ5A 4PBEA 3LGGA 4PBGA 1TV7A 1V0NA 4PRWA 4RW5A 2PF8A 2QCFA 3I6TA 3LS9A 3BAYA 2BZNA 2A4AA 4KGLA 3IRDA 1TV5A 1I60A 5DELA 4LV9A 5FSEC 4LTSA 3TJXA 3CTTA 3E0LA 2CKSA 4MWAE 4WHBA 1P43A 1JF5A 1SJBA 2ISDA 4M3PA 1B2YA 1W3LA 3FHAA 2UY2A 2WHLA 2V30A 4Q4SA 1JCNA 4I7WA 3RR4A 3OVPA 4L1WA 4UTFA 2D3LA 3VCCA 4ZVJA 4AQLA 2HJPA 2VZOA 3QSTA 3SSJA 1XD0A 3T78A 1XWYA 3RX4A 3R25A 4CQBA 4YTQA 4AD3A 2BHYA 1M7XA 2I1OA 1E6XM 3TZFA 1TIMA 3AYTA 4RE4A 3LNPA 3W2MA 3R58A 4QP0A 2OSWA 2QGHA 4RDZA 5XIAA 5KZDA 3BG5A 1NWTA 4FNUA 1TTJA 1XR2A 1S2AA 4I9TA 3L5MA 1FA2A 1EWEA 4HPJA 1FH7A 1TZ7A 2BOEX 3KRUA 1ITQA 1IXPA 2CLPA 1PX4A 2ZRUA 4LAOA 1XYFA 4HQVA 1LT7A 4IGMA 4KS0A 4PRTA 4IQJA 1MYRA 4DO5A 4UXDA 4ROPA 2YW3A 3W85A 3AHZA 3RJYA 4KEVA 1T99A 4EIVA 4QDMA 3KBSA 4JQ1A 1B90A 5CLWA 5HR6A 4BQ4A 3KUMA 1PIFA 3AU2A 1NJJA 5BW6A 4UTIA 1J0YA 1WBHA 2VEFA 4KWVA 5BXPA 3GNDA 4OTKA 3R94A 3N34A 5D8WA 2I57A 4OVXA 1CB7B 1P4CA 3B8UA 3HURA 2PD5A 1QW7A 3L4YA 3UWEA 4BF5A 2R1NA 1ITUA 4WR3A 2CPUA 2QCCA 2V5CA 3W1TA 1ZQ5A 3P7YA 1BF6A 3MP5A 1W6TA 1JD9A 5DN1A 5HWNA 4GIRA 3ARZA 1GYNA 1KRCC 1RY0A 5BMXA 1YIXA 5FEPA 3RPMA 1VIWA 4MB5A 1EB3A 2HWGA 4JNZA 5A6JA 3T2OA 5FF0A 1BVNP 1JPMA 4PCTA 4GVGA 4WDXA 5C9UA 4J3VA 3HQPA 2CLOA 2ZUTA 3M43A 3ZLGA 9XIMA 5AOUA 4O52A 2YZ5A 5FJRA 2YL8A 2WMKA 1E71M 1HVQA 2WQPA 4MAVA 6REQA 1UWSA 3P5YA 5DANA 4H6RA 1VFUA 3QRHA 2FB2A 3WBAA 3A22A 2QUVA 2FZNA 3GW0A 2J8GA 3G22A 4O15A 1GNXA 4AVOA 5JBFA 4IQLA 1H0IA 1VPYA 4JAWA 4LVGA 3TLQA 3ZWTA 3TXZA 1UJPA 2YLAA 4HT3A 4KCTA 1HO4A 1A5LC 5A5WA 3B0PA 4P5UA 3M6YA 1FCBA 3S1VA 5H6HA 1UZHA 2PDGA 1P6WA 1W17A 2IQ0A 2GPTA 4FXSA 2JF7A 3UCDA 3NZRA 3UJSA 2F7FA 4EACA 2CNCA 1XIBA 1XRTA 4M6VA 4PEKA 3LPGA 3W7DA 1VBHA 4J2PA 1IHIA 1S3TC 1WAWA 1TX2A 4F0MA 4J7RA 3V35A 1RP9A 2XVNA 1UIPA 1QPNA 1HKVA 1L2UA 2OEJA 1VRDA 3UETA 1TQJA 4R27A 1KM1A 3KS5A 3QYQA 4IFOA 1BWLA 1EC8A 1QFEA 1GZ1A 1UPMB 3G1AA 4MLRA 3HQNA 1EUNA 4WK9A 1WXJA 4N9DA 2YDQA 1ZY9A 3MS8A 3WN6A 5G2IA 2DJXA 2WMGA 1HNYA 3SN4A 4PCFA 4UFHA 2R91A 5LYRA 4DI9A 2XPKA 3O9NA 2GZXA 3T2PA 2EBNA 3B8IA 2OWWA 4WJ8A 4XD5A 1QASA 4S39A 3RCYA 2ESCA 3I65A 2WKGA 3VE9A 4ICMA 1XLBA 1EWDA 1FHUA 4WXYA 3NQVA 3TYCA 1DIEA 4JTHA 5CSSA 3IIXA 1R86A 4G7EA 4KFNA 5HMFA 1PKLA 1NFBA 4ERAA 3N9KA 4D9PA 2ZUMA 3EDEA 1CLKA 4LNCA 3TOYA 2PGRA 3NFUA 1TPEA 1XLKA 1XGZA 5LXXA 2IS7A 1LJYA 1B5TA 2X1TA 1DIOA 3WNKA 4A3YA 3NAVA 3PJXA 1SQ7A 2DSKA 2AOSA 1XINA 4M24A 1PHQA 4PB4A 3CUXA 1B9BA 1KM6A 3CGTA 1BEUA 2BY1A 5E1QA 5E6ZA 5G4WA 3U3HA 2CERA 1LL4A 1WZKA 4JTFA 2O9PA 3MBDA 1SO4A 2B4GA 3AAMA 4UQAA 3C2EA 1LBFA 1EA9C 1CNVA 4B3ZA 5IM51 1C8XA 2ZOXA 1J93A 1R3VA 3QY6A 3LTYA 1QWKA 2CBJA 1DJWA 3E02A 1JDDA 2ABAA 2DW7A 3NDYA 3UZYA 3WH6A 2NQHA 2IKJA 1SZFA 4AF0A 3WQ4A 1EH9A 3VNLA 2Z6IA 1RLDA 5K7JA 1QNVA 2QR6A 1V6XA 2FPYA 1SO3A 4K39A 4LX4A 2C71A 1G94A 4RR4A 5HINA 3W7PA 3VILA 3A9BA 3BJFA 3W0KA 5AVHA 5EMLA 3VIIA 4L80A 3GR8A 4LC8A 4OBTA 4V15A 2A21A 3WKZA 5FCZA 1D3HA 4Z1AA 2DSVA 3CUGA 3MSYA 4E8DA 1FWEC 3P81A 1FFQA 2BVTA 2GWNA 3W70A 4GK8A 2XFRA 4W93A 2A3AA 1XL9A 1EBHA 4GZEA 1GHRA 1SO5A 1J79A 1MFVA 2YCIX 2BNJA 3AS1A 4BK9A 3GBEA 2OSYA 2Z27A 4YYFA 3KCLA 2YA0A 1QAPA 3KAOA 1M5WA 1RXOB 4KWWA 3BAKA 3MSGA 1XIIA 5A1AA 3CTLA 3VXGA 4BWLA 1ZJAA 2PTXA 4LYPA 4NASA 2ZKMX 4P7NA 2WZEA 3PVFA 2D2JA 2ZZ3A 1LWJA 3W81A 3WQDA 1UWUA 2PB1A 3A4JA 3NL2A 3KCJA 3W1MA 5H2ZA 2Y88A 5JUVA 3TYEA 2CFFA 3BCJA 2A1YA 3UVIA 3KDNA 3R4IA 4CVUA 3QW3A 2G0WA 2V6AA 3MWCA 1IZKA 2VC5A 3PBWA 5ABGA 4XWUA 2AGKA 2Q3OA 2RJHA 2C6QA 4JIHA 1RHCA 4ZTXA 4UMCA 1JZ7A 3EWBX 5A8QA 1DWHM 1RZMA 3AICA 3K1GA 5HJLA 4QDPA 1XISA 1FCQA 1ONRA 4ASTA 3N04A 3LN3A 4PCNA 3OGVA 1Q7MA 3M0IA 1M3UA 1WKEA 1V6YA 3DIPA 3NOYA 5F2MA 4JKKA 4XVEA 1JL8A 3KRSA 4C6JA 3RLUA 3FXYA 4KESA 1EXBA 2VM8A 4L4PA 1WNOA 4LC6A 3OVRA 1TVNA 1PX3A 2AAAA 1KKRA 4EE9A 3W2NA 1DL3A 2IPJA 4HYRA 2D0FA 4GXWA 1Q13A 1XD1A 3LI1A 3TE9A 4HK5A 3RHGA 3UEQA 3FA4A 2GUUA 1E1EA 2ZUUA 4WGHA 1HL9A 4DUOA 5ABHA 2CW6A 3SDOA 1H09A 2D2OA 3MB9A 4D8LA 3TKFA 1CXFA 1UA3A 2IXVA 4GFSA 4LF2A 1KRMA 2CLHA 5BYWA 1UROA 4NXKA 1QPQA 2PDPA 1IT0A 3DFYA 3A6OA 1UOKA 4W8AA 1LTDA 3PUGA 3PWIA 4GKTA 1B3YA 2JIEA 2Y62A 1W5OA 1P0NA 2PMQA 4HNUA 1GVEA 4KMQA 4PUWA 2ISWA 3DBNA 3AU6A 3S2LA 2IKGA 1XGDA 4BF9A 1Y7VA 1PYFA 4AEEA 4S2CA 3WQFA 4UTTC 1EUAA 2J7BA 4H2HA 3DDMA 3PAOA 4JGDA 4ZSTA 2X1IA 2H9AB 3G77A 2DIJA 3WNMA 1F6YA 4JXCA 3AUOA 1EJUC 3LLDA 2NVAA 1XUZA 1NAL1 1WXYA 3VDBA 3URQA 5BOOA 1UWIA 4FOKA 4CN6A 5U4NA 3LMZA 3ZXWA 4MJ2A 3NA8A 5M5DA 3NZPA 4HCDA 4B5UA 4HP5A 2Y5EA 4AH7A 3KRZA 1OBAA 5C9WA 4DJED 1A5MC 3P0WA 2G50A 3UG3A 4D72A 1AD1A 4UTTA 1ZFJA 2DDXA 2WMFA 2UY3A 1VRXA 3URBA 3W2UA 3AZTA 3TDFA 4UTJA 3TN6A 3WH5A 1R7AA 1XLEA 4NZ1A 4RJEA 5LNUA 1XH0A 2X41A 2HEJA 1FH8A 2PTWA 1O4UA 3WLLA 3GDKA 3LENA 3M4HA 3GFYA 5E9AA 2NXIA 3NQ8A 4GXPA 1TUFA 3GG0A 2ON3A 5CSUA 1QU4A 3L0GA 3VOGA 1V6VA 2PWVA 1L9WA 1OFBA 4QEHA 3N29A 1K1DA 3L4XA 3GDMA 3VZXA 1H1NA 1BKSA 5D2XA 1U5HA 2GGIA 1L0PA 2INFA 3VC6A 4YHEA 3JS3A 1YRRA 4IQDA 1NF7A 3O05A 1POJA 4UR8A 1XYLA 1E6ZA 1OFDA 2LLEA 3BLDA 3VGEA 1QNPA 4R7OA 4ATDA 1MRAA 1M7OA 4HMEA 1LZOA 4W89A 2W63A 3GM8A 2Z00A 4D71A 1KLZA 4CNUA 4GPNA 2YJQA 1XW8A 1FBAA 1PTGA 3W88A 3WBYA 4XAZA 3U2OA 4GE8A 3I4KA 1A5AA 3WJWA 1TKKA 1PWMA 5BROA 1I6NA 4ZGYA 2E5DA 2HDJA 3DHDA 1Z48A 4AVNA 4Q8TA 3TLLA 1SO6A 3CEUA 4H7ZA 4FLRA 4XKYA 2WZMA 4C7FA 1EGMA 5IHSA 2PCEA 4ZB5A 2FZ8A 2CLIA 1ITCA 3PJUA 2CLMA 1LBMA 1S38A 1R9XA 1UWQA 1XLFA 2PWEA 5F2GA 1JZ4A 4S3CA 1W3NA 1GJPA 3LCLA 1LRNA 1NDZA 1PIIA 4FO4A 3NPUA 2REQA 4GX9A 3ZM8A 1DWJM 1UH3A 1GYMA 3W02A 3TC6A 4FIRA 3J7HA 1MW3A 3LBCA 1QBBA 2UY4A 3HF3A 1NP2A 4K8EA 3S1XA 4M51A 2DY3A 2Z25A 1OD0A 4A22A 2HS6A 3LI0A 4ERIA 2DQXA 2ACUA 1UQYA 4PTVA 4HZ6A 1HN1A 3EOEA 4LBRA 1S5VA 3IGSA 4ML9A 4LF1A 1FVPA 3K4AA 4RLIA 3H21A 4B5WA 3GXTA 2OGJA 3HG5A 1E5NA 2OXNA 4W5ZA 3LB0A 2A5HA 3NPWA 4QX4A 2Y4SA 4DLMA 3Q45A 2QEZA 4FS9A 2QT3A 3DFPA 2POTA 3W53A 5J8LA 4MZYA 1YXDA 4XAFA 3GDBA 2HBVA 2X09A 3LCHA 3VNYA 1RH9A 2V5DA 2X1RA 1REQB 3EXRA 2XISA 3HPFA 4AEOA 1VJIA 1GTHA 4AZCA 1HTIA 2GDQA 3T0TA 3LUTA 5AHLA 3SJ3A 1Q2RA 2PUZA 5G1MA 1H63A 1M68A 1BXCA 4YS1A 1BGGA 5AKQA 4GG9A 3NO5A 3ONCA 3OZYA 3E0FA 2Z1KA 3EGJA 1MXSA 1R46A 4MNJA 3LRMA 1N55A 2TRSA 5IFPA 1F5ZA 1Q45A 3O6YX 5EPDA 3DG6A 4CD4A 2VQTA 3UD6A 1LQAA 3GZ3A 2DV0A 1U5JA 1XIJA 4I5XA 3MU7A 1M6JA 3EX3A 1KXTA 4NI3A 1ME7A 1ZJBA 2Q71A 2VP8A 4JTTA 1EP2A 4JHOA 2QJHA 4C6EA 1GOQA 1AODA 2FGZA 4JKMA 4Y9AA 2ZXBA 5HAOA 3N2TA 1GG0A 1DTUA 3BV4A 4DBDA 5HUOA 4FNSA 3VM5A 1W5QA 1OD8A 1C29A 5AECA 4L64A 1Z3NA 1ZBVA 1QWGA 4JCMA 2E9LA 4DBUA 1IEXA 4C60A 3HPXA 4IMCA 2HISA 3VIJA 4X63A 4LUSB 3E1F1 1QHZA 4QLLA 2DVTA 3CH9A 1W0MA 1CYGA 2Z7KA 1YX1A 1NY1A 1ZUAX 3BOFA 1IIGA 1J0JA 2VCBA 3OVQA 3OTRA 1RUSA 2WWDA 3WLIA 3SRDA 1PPIA 2FFCA 4ORMA 1QPKA 3HG2A 3SAZA 5FJPA 1E1FA 3NQDA 4AD5A 1AQFA 1XBZA 3QM3A 4FNQA 4UFMA 3UXAA 1WDDA 4XG1A 1E0VA 1XBXA 4RDYA 4JNYA 3VDAA 5I77A 4CNPA 3LV5A 4MKSA 1JFXA 1VBUA 2CBVA 3N3TA 3CPGA 1HKMA 2VUNA 2J9ZA 3ATZA 1ISYA 4HMCA 1W1VA 5GVJA 1C8VA 5CGMA 1GYLA 2PDXA 4E8CA 5A6AA 3JW7A 3MP3A 1G7UA 4B2DA 1B54A 1T6MA 7REQB 1B3XA 4F2TA 1J6PA 2Z26A 5C9RA 4GC4A 2GOKA 2Q8XA 2VENA 2C79A 3N2MA 1N82A 1OX6A 3BLPX 3N17A 5ABTA 5EFDA 1Z44A 3EOSA 4KIRA 1XIDA 4LS2A 3H54A 2XVKA 3SQLA 3ONBA 2I7GA 4IJCA 4Z1YA 1JCLA 2C7FA 4KPLA 3BLIA 1JYXA 2DZSA 1RALA 3EWXA 4U3AA 1KCXA 4CD8A 4IPPA 1PHWA 4DUWA 4E38A 2C14A 4PRRA 4BS0A 3QJAA 3GWQA 1Z42A 1JAKA 3GLCA 5HNTA 4H9TA 1UKSA 2ADAA 5JIPA 1SFLA 3WNNA 1RJRA 3CZ8A 3GYEA 3WNLA 2PDLA 2NZLA 1ECQA 2IQDA 3IJDA 4M29A 2OODA 4DF0A 1GOKA 2J25A 1RLCL 2OX4A 3TMQA 3H26A 2O7SA 3BW4A 4Q3MA 4O19A 1E6SM 4I6KA 4XAGA 5ABFB 2VEMA 3GG7A 3ITVA 1TV2A 3FGCB 1LOLA 3B97A 3RU8X 1FDJA 5HK4A 3C3UA 3DYPA 1UR8A 4MMWA 5KINA 4KF1A 1OCBA 1TZZA 3MBFA 1ZLPA 3H55A 5C54A 4I7VA 1F3WA 3GNPA 2AKZA 4R7WA 2CZ5A 1NFGA 3TTSA 1IXQA 4IF2A 2QCDA 3MSRA 3IK2A 3T40A 1XIHA 3GHTA 3B3DA 3UR7A 5T8GA 3RAOA 2GVEA 3TSMA 2QPUA 4Z1DA 3M0YA 3UWUA 2O9RA 4S3KA 4XZMX 4CKQA 1MFUA 1E55A 3G0UA 3ZLFA 1TCMA 3AOFA 1HIZA 1RK6A 1UC5A 3QHNA 5HXMA 2BHZA 4U2YA 1Z9AA 3IUIA 2W27A 2C15A 1H7WA 3WF1A 4TIMA 2FJUB 1K8YA 3A23A 2FB3A 4A29A 4L7ZA 5AC6A 3O7UA 5AZ0A 4PUMA 4HA1A 4GMEA 2ABBA 4B5XA 3QZEA 1ISVA 1XDJA 1MUMA 3NQGA 4NYYA 4F2BA 4JTIA 3WMSA 3FYPA 4RXGA 4PTWA 3EX4A 2EJ1A 3E12A 4JOMA 2JFEX 3N3MA 4WX2A 1A0CA 2TSYA 4CNTA 3KBMA 4JHMA 4DWSC 4B5VA 1ZRQA 2YA2A 1PB0A 5BXRA 1R85A 2CLFA 3TTQA 4FPSA 3FXGA 3SN1A 3Q65A 1XIFA 3F5KA 4Q4MA 5EMMA 4DWSB 2E67A 2AMXA 5CAHA 3EDJA 2W91A 2VFIA 1W31A 4I8DA 2SFPA 4A21A 4XD4A 2RAGA 4L65A 5GJMA 1GVFA 4EPDC 3LSCA 2JEQA 3LCIA 1DJQA 1MQPA 2VFGA 1VFFA 4UMAA 4TX9A 3RM4A 2Z1BA 1W5PA 2ZRVA 4GRSA 4XBJA 3WD2A 4X9YA 1VEOA 3WELA 3G6LA 3VCNA 2BS9A 3MI6A 7CGTA 4Z0SA 4C1NB 1A0EA 4GI8A 2D24A 3N19B 4O1CA 3H23A 3NYZA 3BWWA 1P6BA 1XDMA 4GH1A 2IXUA 2B7OA 3BARA 3UXKA 4JQAA 2ZZ5A 3PTQA 1TREA 3CZLA 3KBJA 3H2AA 2BG5A 3TK7A 5I07A 2H3BA 1EPXA 3I4EA 3BW3A 4PB5A 2ZC1A 3UZ5A 1D8CA 4QJ5B 3NZGA 5KZEA 2VGFA 2EXOA 1HJSA 2F2HA 1Q5MA 2FTYA 4JFWA 3OJGA 1VD6A 5CZTA 4V33A 1SPQA 4O4VA 4RNIA 1UZDA 4CD5A 4DBSA 1JDFA 2H90A 3M5VA 3TYZA 1S5NA 2ASHA 4WJEA 3IS4A 2WM1A 1SJDA 2HCVA 4Q8MA 1IT7A 2Z7GA 1IR2A 1V3IA 1LOSA 3B06A 4MG4A 1PKMA 6XIAA 1TA3B 2ZUVA 1VLWA 4W8BA 3PNZA 1WXZA 4XTIA 6PTDA 3ZIZA 4DAIA 1FKWA 3L23A 3QKEA 2JGQA 2PLJA 1H5YA 1B3WA 1QW8A 1QHOA 3QTPA 4LVDA 3NPVA 1ZAIA 3NQ7A 3F2DA 4XB3A 4US5A 2QPSA 1FWSA 3CB8A 1RK5A 1TRDA 3TYAA 3W29A 3FSUA 4AZHA 3AJ7A 2R1MA 3O63A 2VRQA 3LCXA 1EX1A 1OZQA 4JYDA 1J10A 2A0NA 2OGYA 1YADA 3SZ8A 2QJGA 1WBJA 4NJIA 1AG1O 3LX9A 3POHA 4GWEA 2ZVIA 5U7SA 3N6HA 4LUIA 1QI5A 4ZE5A 4MB1A 1JR1A 3ZR6A 2XIOA 2Y7EA 3S9ZA 4U33A 2QHAA 4YNGA 1E0XA 4C6MA 1W3JA 4F0SA 1BYCA 4H9VA 4G7FA 2NUWA 4PL2A 1DIKA 4A35A 3SCTA 5CBBA 2V5KA 3BCDA 4INFA 1Z7AA 2Z24A 2ZXDA 3ZJ7A 3VOFA 3WLMA 4EPBC 1TVLA 2NLIA 3LHTA 3O6CA 4K1GA 2WMIB