3PZOA

Structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 in complex with three maltose molecules
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila rku-1
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
total genus 159
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzoA00
3F5JA 3BCFA 3WQWA 1DP0A 2NT1A 4AZIA 1V02A 2QF8A 2OYLA 4JL2A 4ZEPA 5E6YA 3FXYA 1KFWA 1C91A 4GZIA 4X0NA 2ZE0A 3OBAA 1GHSA 2JE8A 3WDHA 2IXVA 3OGVA 3N1AA 4AD5A 1ZU8A 1PZ2A 3DYMA 2WVVB 3RM9A 2CKSA 1DHKA 1OGSA 3CUIA 4MDPA 3SCSA 2PI6A 1BYAA 1WDQA 3I3EA 3WQ4A 4GZEA 2ZUUA 4PMOA 3VD5A 3EDKA 1EDGA 3AIQA 3BAIA 3RJYA 1V3KA 2F61A 2GDUA 2ZWZA 5ECUA 5ABEA 3VGGA 2V3FA 2XIIA 1PIGA 4D1JA 4ZXLA 3UR7A 1E6ZA 1VB9A 2GK1B 1BTCA 3CUJA 3KL3A 2UY3A 1RH9A 3WFZA 4HOWA 3VILA 4W7WA 2ZXAA 1K6AA 4NF7A 2YBTA 4J7RA 1W9DM 3MUAA 1WZKA 5A6KA 1N82A 1WZAA 2DT3A 3MUZ1 1CLXA 2WMJA 3EBVA 5HDRA 5A8MA 3AXXA 2E40A 4K68A 1KBKA 3ARUA 1E6QM 2J7EA 2WC7A 1W9UA 3N04A 2X05A 1X6NA 3MSGA 4PUEA 1GW1A 2CBJA 4HOZA 3GXIA 4KGJA 4OBSA 1TE1A 3SEPA 4TUFA 3WMBA 5DT7A 1UR9A 1LWHA 2D1ZA 4JFSA 1CWYA 3L4UA 4JKMA 1OB0A 2BY3A 3RPMA 3L2LA 4PTMA 1ZBVA 1TA3A 2WZEA 3OGSA 1H0GA 5FL0A 1CXHA 4AISA 2XG9A 2D22A 3L4YA 1QHZA 1QI3A 4DM1A 1HX0A 4P7OA 1NOUA 1V0LA 1E43A 1G01A 4GO9A 2AAAA 2CYGA 4Y7EA 3WENA 3B8SA 3IANA 3NYDA 2WHJA 4HA1A 3ARYA 2VZSA 2JALA 2VRQA 4W86A 5A94A 1XSJA 2UY5A 2QHAA 2NT0A 1GQLA 3SUTA 3BCDA 1FOBA 1WDSA 4EKJA 3GBDA 1B3VA 1UD6A 4M56A 1NWTA 2PBGA 1I1WA 1UWRA 1EGZA 2F8QA 4P7LA 1QOXA 3BMWA 4KMQA 1DWIM 5A69A 2VURA 4AW7A 4FF5A 1ISYA 1DWJM 2B31A 4FK9A 3N13A 4BQ2A 5JBFA 1XD0A 1MXGA 4D72A 1GOWA 3AISA 3A47A 3T0DA 3WH5A 2BVDA 2W4XA 3WH8A 4V27A 5CLTA 4J3XA 2WNWA 4ZENA 1Q6CA 2CXGA 4D6JA 3PZVA 4R27A 2CKRA 4WF7A 5KZ6A 5FCZA 3AYSA 1BHGA 1CGTA 5IHSA 3T2QA 2VX5A 3WL0A 3NDYA 1OT1A 1R8LA 2IUZA 2PC8A 1ISZA 3LPPA 3AQUA 2BY0A 4MJ4A 3VKKA 3SCWA 1XH0A 5A6MA 4GI8A 2J62A 1ISVA 1MW0A 1E1EA 2ZUMA 1LL6A 1O6IA 5HOSA 5C70A 3WUFA 4UFKA 4PMRA 1UQZA 4UZSA 4AZ5A 5BROA 2XWEA 3ZO9A 3KL5A 1G9HA 3JUGA 4PUDA 5GNZA 3UG5A 1QI5A 1EHAA 5GPRA 3U7BA 2VR4A 3FNDA 4MB3A 4M82A 1MW1A 3OLIA 5CXPA 3DC0A 1JYNA 2XPKA 1H11A 2D2OA 1KGUA 4GIAA 1JNDA 2OWXA 2ZOXA 1V6YA 4CN1A 5DO8A 5IXEA 2DSWA 3AZSA 1EXPA 2DIEA 4HMEA 1AQ0A 2ZX8A 1GQKA 2J47A 3T2PA 4EAMA 2FGZA 2HVMA 2QMJA 4HU0A 2WVSA 1W3HA 3W26A 4CKQA 4PMYA 3WH7A 2VCBA 2ZX5A 3WF1A 1PJ9A 1Q6FA 5BYWA 3ZT5A 3VX0A 1VEMA 5GNYA 3CZEA 1G1YA 1C90A 3ZJ7A 3GZAA 1RD6A 3TTQA 3D5HA 1UD3A 4JAWA 3CLWA 1HT6A 5EMYA 3VNYA 4AIUA 2D0HA 1AVAA 2VI0A 3K8LA 3CZGA 2EQDA 1LQ0A 1HN1A 1CBGA 3KE0A 1PX8A 2J79A 4JHOA 1DTUA 2VL4A 2XYLA 4AZBA 2D24A 2VUYA 2WB5A 4BZYA 3K8MA 3GNRA 4TVUA 1CXIA 3PZUA 2XFRA 4LPCA 2BFGA 1E6RA 2YL9A 3VIOA 2QPSA 3ECQA 3MU7A 2CETA 2WLZA 3AMLA 4P8UA 2XVNA 3CO4A 3VMOA 1CENA 1CZ1A 4JCLA 4CU7A 1FP9A 4DWSA 4ATWA 4LQ1A 5BXTA 1WB0A 3ZMRA 1J0ZA 4H2CA 1PBGA 3MUY1 4CCDA 1QNOA 2BHZA 1YHTA 4A4AA 2ZUNA 1MQPA 1HP4A 1JFXA 3W82A 3EDJA 1XH1A 4DUXA 1V0KA 5IFPA 3T0BA 4IM4A 2V5CA 3OZPA 2CIPA 2UY4A 1MQRA 3RCNA 2WHMA 3VNZA 2JIWA 1U30A 4UOQA 4AEEA 1W9BM 4M80A 2D3NA 5D9PA 2V5DA 1NWUA 4GZJA 4KRTA 3ALGA 4XX6A 3SURA 1WZLA 2ZX9A 3WQ8A 1KXTA 3WNKA 4X0VA 2DH2A 1Q6EA 4GQQA 4AZGA 4AD2A 3QHMA 3QOMA 3UERA 4CCEA 3FHQA 3D3AA 3BC9A 2BY2A 1O7AA 3UCQA 3RILA 4ZE4A 1K9FA 3A4XA 3DHUA 3AS0A 1UKPA 2XWDA 3HU7A 1C8XA 1BYCA 3AHZA 1CTNA 4U5KA 1GVYA 3AJ7A 4JFVA 5M5DA 5A95A 4B3KA 3WD2A 1X6LA 1XD1A 3WNLA 2JEPA 1JYXA 4LXFA 2V3GA 2J8GA 3WDIA 2E9MA 1JIBA 3DYOA 5A2CA 1MW2A 3W27A 4JCMA 1V3HA 5HBFA 2EPKX 5HPOA 2JF7A 2VZTA 3SCQA 3T09A 4A3HA 2ZXDA 4HMCA 3SUWA 1SMDA 2XGIA 3AXIA 1TFVA 4W89A 1UD5A 2ZICA 3HJEA 3O9NA 4NZCA 3WD3A 3ZJ6A 1JZ6A 2QLYA 1JF6A 1UWTA 2WCSA 3WN6A 2PWEA 2DT1A 1VFMA 1TUXA 1H41A 1W1TA 4MTVA 3GXFA 4N0RA 5A6JA 2WVVA 3T2OA 3ARPA 4EE9A 1GOMA 1F4HA 3MKKA 4OJYA 2ZXBA 4QDMA 2YL5A 3FAWA 3WL1A 4PTXA 2E8ZA 1NOWA 3OLGA 5BXRA 4CCCA 1V6VA 3WF4A 1KGWA 4RL3A 1J9YA 5D4YA 2J7FA 4WKFA 3IK2A 1U33A 1C8YA 3AICA 3W4RA 4F9DA 4RE4A 1ITCA 5CSUA 3W38A 3K4AA 3CH9A 2G41A 1KBBA 1DWGM 3W0KA 2CEQA 3PZQA 1UR0A 3WKZA 1BG4A 4HPHA 3AHTA 4JFTA 4BCEA 3UG3A 4GXPA 1KXHA 1QPKA 1Z32X 1NH6A 2YA1A 1E5NA 1OD0A 3T08A 1A47A 2D3LA 3LPOA 2J4GA 3N17A 4FLOA 4UOZA 1GJWA 1US2A 1NQ6A 5LYRA 1JZ5A 4U2ZA 4F79A 3VDCA 3CTTA 1ESWA 1UUQA 4WKHA 3UESA 1GCYA 4P8WA 2VNCA 5CPQA 6CGTA 3HMCA 5KEZA 1XRVA 4D6FA 1HJSA 3CHDA 1UKOA 3AIVA 1W91A 2VX4A 3W6MA 2WBGA 5HXMA 4PBGA 1ZJAA 1JZ7A 4J28A 4H41A 4U33A 2Y5EA 4PMZA 5EFDA 4DWSD 3VMNA 4U2YA 4B15A 2OSWA 3FN9A 4HZ7A 5BCAA 5CPSA 3BGAA 1CGXA 1OWQA 1W9VA 1UZ4A 2UY2A 3VD7A 3VGDA 3GH5A 3G6LA 3AI0A 4HOXA 4AZHA 1UG6A 2PF0A 3WEMA 3GXDA 4M29A 2EPMX 4EK7A 4AMCA 1TCMA 2DPEA 3AMGA 1NOFA 3GH4A 4OZOA 4URIA 5C8BB 4MB5A 5E0CA 3ZR5A 3WDPP 5FD0A 2WM0A 1E4MM 3CIVA 4CD8A 1CGYA 1D7FA 1BVNP 1EO5A 2WWCA 3W28A 1PAMA 4AEFA 2VT0A 3ZJKA 2WVTA 4M1RA 3PBGA 1UH4A 3W25A 1CXFA 2PWFA 1G5AA 2W61A 3ZT6A 4JL1A 2WMIB 3WF2A 4AC1X 4BQ4A 1SR0A 2EPNA 2VRJA 4OIFA 3ZQ9A 1VAHA 4JHZA 1J01A 5DMYA 3MMDA 4TOQA 3B9DA 3MSDA 4UCFA 5D9NA 1E15A 1XCWA 2BNJA 4IPLA 1C7TA 1CXLA 1MYRA 1QW8A 4PMXA 1CGVA 4OOUA 1FA2A 3SUUA 1J11A 4C7DA 4TVCA 1JGIA 3UG4A 2CPUA 4OUEA 4CGTA 2V38A 3N11A 1ZS2A 1J12A 4PMDA 4GKLA 3PHAA 5TD4A 2VX6A 2O9RA 4MAZA 6A3HA 3RM4A 3M6DA 3QR3A 4D6GA 7CGTA 4HPGA 1UQYA 1M7XA 3IJ9A 1FH9A 2OYMA 5A8QA 4OKDA 1E56A 2E8YA 4AD1A 1BSIA 3WNPA 3VDAA 3TTSA 3VU2A 1VIWA 3U5YA 5ABFA 3AOFA 1E55A 3AIRA 3VGBA 2A3EA 3GDBA 3GNPA 1EHNA 1DWAM 4E8DA 1WAWA 2WKGA 3AS1A 3AROA 1JDDA 4S3KA 3WH9A 1VJZA 1X1NA 3CPUA 4P7RA 4AYSA 4AZ6A 1GQIA 3M07A 4H8VA 3VM7A 4ATLA 2BVTA 1IZJA 3CZKA 3LMYA 3ZSSA 2FHBA 4P7NA 2DIJA 3PTMA 4MB1A 2VRKA 4UTFA 5AC4A 3WUEA 2XVPA 2JEQA 3A4WA 2D23A 2JF6A 2E3ZA 1KB3A 5HPCA 1WZMA 5ABHA 3BAWA 3GYCA 1K9DA 5JIPA 1HVXA 3N9KA 3APGA 3A4AA 2EJ1A 1VFUA 3L4WA 2Y8VA 3VIMA 2ZUVA 3AHXA 3K8KA 1MFVA 1KR0A 2EEXA 1OGBA 1EIBA 3CHEA 5DF0A 2WC3A 1W9PA 1HKIA 2XSBA 3NUKA 5E9AA 4YPJA 1GUVA 1XYFA 4E8CA 3EMZA 3FAXA 1M53A 1KQZA 1B31A 4B9ZA 1HJUA 1P6WA 2FHFA 5A8OA 4MNKA 1JYWA 2G3IA 2OSXA 3VIHA 1K9TA 1B3WA 1H1NA 3WUGA 2DSVA 1K9EA 4WIWA 3U57A 2WHKA 1UR4A 1V6UA 2WXDM 3F5KA 2J78A 4PSPA 2VC9A 1FFRA 3WQVA 5CJ5A 2VR5A 4UFHA 2C0HA 2WW5A 1R86A 3NSNA 2DGAA 2J25A 3QOKA 3N12A 4TTUA 4AY1A 4WSJA 1GVIA 1GOKA 1WNOA 5E6ZA 4E4PA 1HKMA 1KQYA 1JD9A 4KWUA 1HP5A 2XM2A 4YHEA 2J7BA 3KWXA 2QV4A 1UKTA 4QLKA 2GFTA 2W62A 1QHOA 4HA4A 3BH4A 2PWDA 1E4LA 4PYSA 2CHOA 1ZBWA 4HMDA 1KWGA 1EH9A 2E4TA 3VIJA 4W5UA 4QP0A 1M03A 3L2MA 1JXJA 4A3YA 3DECA 5GQBA 5A6AA 5IHRA 3HN3A 1L8NA 4CD7A 4D71A 5DT5A 1UWQA 1UKQA 3NIYA 4XB3A 2D20A 3AMCA 3WIJA 4W8AA 2TAAA 1KCLA 4Q22A 1QHPA 1J0HA 5IDIA 4U3CA 4TXEA 4H8HA 1GZJA 1E6XM 2A3CA 3II1A 3ARQA 1D3CA 1LWJA 4U31A 1V6XA 2EBNA 1E6PA 1HXJA 5M3WA 3MMUA 1R7OA 5E0FA 4PTVA 1V03A 1BPLB 1KGXA 8A3HA 5M17A 1W3KA 4LYPA 2J7DA 1QNQA 4D6DA 3KZSA 2FH6A 2UWFA 1J0JA 2PB1A 3WNNA 2WC4A 4HZ6A 4Q7NA 4MADA 2GJXB 3BLPX 1DWFM 3NDZA 2J7HA 4TVDA 4FLRA 2Y4SA 2VVNA 3ARWA 2BXYA 3OG2A 4CD5A 1RP8A 4YHGA 2J7GA 1GPFA 1V6WA 2JFEX 2BY1A 1JFHA 5A2AA 3S2CA 1CXEA 4GI9A 4J3VA 5FKYA 4V28A 3PZIA 1US3A 2WCAA 3FW6A 5A6BD 1MW3A 3WF3A 2OWCA 4H7VA 1HJQA 4PEEA 4PCSA 1E6NA 1EOKA 3L4TA 1VF8A 3K1DA 5I5RA 1EA9C 1B3ZA 2PWGA 5BXPA 3A3HA 1BGGA 2RGLA 1B3YA 5A6SA 2YIHA 3PZ9A 8CGTA 2WAGA 4AZCA 3DYPA 1UH2A 2DH3A 1XV8A 3NSMA 2YDQA 4LYRA 1Q6DA 1W32A 1DEDA 4UQCA 3LPGA 3BAKA 1PZ3A 4EANA 4HZ8A 3WD0A 1V3MA 3BAJA 4KH2A 4UOJA 5F7UA 3N18A 1S46A 2FDMA 2YLAA 1HJWA 5JBDA 2EPOA 5CGMA 1QNRA 4NSBA 1PEZA 5A2BA 3KEHA 1E72M 3ZR6A 4AD3A 1BQCA 4PMVA 3S6TA 1UA3A 3NSXA 4D6EA 3K4DA 2DT0A 3O6AA 1JI1A 1ECEA 1B1YA 1LLOA 4Z2HA 2V3EA 2WVUA 1JXKA 4ACYA 4FMVA 1J10A 1UA7A 3MANA 2WZIA 4PN2A 3AS3A 4CU6A 1RPKA 3W29A 1UYQA 2XJ7A 3L4VA 2WWDA 2QPUA 1V0MA 1QI0A 2YL6A 2OSYA 2FH8A 4CUCA 3WF0A 4AIEA 2G3MA 3GBEA 4MNLA 1C8QA 2WMKA 4B3LA 4W8LA 3WD4A 3AIWA 1E3XA 1HL8A 3CZ8A 1L0PA 1ZL1A 2C7FA 2DSZA 3GTNA 1B2YA 4UNIA 4NRRA 1M01A 3OLEA 1KXVA 3SCTA 1I1XA 5BWFA 3EYPA 4TX6A 1VENA 2BXZA 3CUHA 1E71M 1CYGA 2OYKA 1EQPA 4BF7A 3BAXA 1CPUA 2ZIDA 4ZE5A 1LG1A 1UD2A 2VZOA 4XUYA 3MS8A 4IPNB 1MQQA 1UZ1A 4WSKA 3BSHA 5I2UA 2F2HA 4QFUA 2CERA 4UFMA 1JF5A 3VGHA 2WMFA 3ARVA 2X8RA 5A6BA 5E70A 1JZ8A 4PTWA 4ATDA 1WO2A 1QI2A 2GSJA 2E9LA 3CZLA 3MV01 1NP0A 1HNYA 4JIEA 4MNJA 3THDA 1G0CA 2G3JA 1ITXA 4CVWA 2PBOA 2CITA 2W63A 2XVKA 3ZM8A 3VUPA 4WKAA 1ISXA 1W9XA 4PMQA 4F66A 4WLCA 1E0WA 5IFTA 2W66A 4CVUA 2CNCA 9CGTA 2BHYA 4GINA 2WK2A 5LA1A 4GPNA 2W91A 5A8PA 5CSYA 1H5VA 4MB4A 3GNOA 4GI6A 5C71A 1E5JA 4AIOA 2DEPA 1B9ZA 2WMGA 1E0VA 1E6SM 1PPIA 2XHYA 1EDQA 3WY1A 1JYVA 1W3LA 1WPCA 3ARSA 2YJQA 5CQ1A 2IXUA 1QVBA 1W2VA 1JZ2A 1HIZA 2AOSA 1HJXA 1LL7A 7A3HA 1F4AA 2YBUA 1I75A 1V3JA 3EMQA 3ZOAA 1V0NA 2DQXA 2WSPA 3BAYA 4AZ7A 1WKYA 1MXDA 1W1VA 4J3TA 4D6CA 2DSKA 3L4ZA 4L4OA 4PMUA 4W88A 3PTQA 3VGEA 4MAVA 4XV0A 1FHLA 2W67A 1KCKA 2DT2A 4XZWA 3PZOA 3WDQA 2J75A 5D8WA 2VOTA 5CLWA 3GXMA 1WDPA 4Z2JA 2O92A 1HF6A 2QMKA 1E9LA 2VQTA 2ZX7A 5D8ZA 1H4PA 1LG2A 1UD4A 4QLLA 3ARXA 4W5ZA 2ZUTA 1XHGA 1H2JA 3AIUA 4P8VA 3PZTA 4UQBA 4W87A 5JBEA 4S3JA 3VIKA 1QW9A 2A3BA 3MO4A 2EPLX 2Z1SA 3AXHA 2A3AA 1C7SA 2XSAA 2C8NA 1GHRA 1B90A 4M8UA 5I79A 4BS0A 1ZJBA 1OM0A 4H04A 3VX1A 3L4XA 3ZIZA 3WEZA 3AIBA 2Y8KA 3POCA 4UFLA 1MVYA 3BMVA 3OGRA 2ZXQA 3RO8A 2VTFA 3QHNA 1E73M 4ML4A 3O2LA 3RMEA 3SUSA 2XVLA 4QCFA 1GOOA 4F9JA 1JZ4A 1H0IA 2G8ZA 1WE5A 5EBAA 3IJ8A 1OIFA 4FLQA 4DUWA 4Z2LA 3RM8A 3W6LA 3NCOA 4JFWA 1H09A 1W1PA 4W8BA 4WK9A 1OT2A 2VMFA 2WHLA 3AMDA 4PCTA 1LF1A 3FY1A 4DM2A 4OOZA 3ARTA 1FHDA 3VIFA 2Y2WA 3PZGA 3UR8A 5I78A 3VPLA 1UH3A 1NM9A 3NJ3A 3AFBA 3I3BA 3MV11 5CGTA 3KL0A 2XVGA 5CG0A 4CD6A 4J3UA 1XSIA 1UR8A 4BQ3A 1AQHA 1J0KA 1SFSA 1WCGA 1E40A 3SCUA 2NSXA 1CIUA 1JDCA 3W24A 3VM5A 1HJVA 4AXNA 6TAAA 1BVZA 2VZVA 3WD1A 1J0IA 1GOQA 1QNSA 1JAEA 3WDRA 1UWIA 2W92A 4DWSB 1CDGA 1QI4A 5DFAA 2FGLA 1XC6A 2V3DA 1Q6GA 4RE2A 1CNVA 2EO7A 4Z2KA 4CN4A 4JKKA 2ZUWA 1TMQA 5AY7A 1VEOA 2WLYA 4J3WA 4J3SA 3BXWA 1EOMA 2BS9A 4MDOA 3M7SA 1UOKA 2CHNA 3SCPA 2J77A 3CBWA 1GJUA 3WQ5A 1CEOA 1OSEA 1E4IA 1JNEA 1U2YA 2OLHA 3PZMA 4U5IA 2YDRA 4D6IA 2X0YA 2YA2A 4GO8A 1E70M 3VDHA 2WYSA 2O9OA 1SYTA 4UQAA 1ODZA 2ESCA 4UQDA 3ZSTA 3QHOA 1CXKA 1NARA 2VQUA 3J7HA 3OLDA 4W93A 1XGZA 2GJPA 5FL1A 4D1IA 5A6LA 3DHPA 4P8XA 4KRUA 3CMGA 1PX4A 3TA9A 3VO0A 1OD8A 4UFJA 5BXSA 1FH8A 4YN5A 4NI3A 4TTGA 4HP5A 4R5EA 4B9YA 4QAWA 2E0PA 1OINA 3PN8A 1B3XA 5DEZA 5JUVA 2X09A 3F5LA 4H8UA 5I24A 1XCXA 4CU8A 3E1F1 3UETA 1C3FA 1VJSA 3EMCA 4ACZA 1V3LA 1HVQA 5CPTA 1QBAA 5A1AA 3LPFA 1B30A 2CCRA 3WBAA 3AHYA 1R87A 4PRWA 1KWKA 2J74A 3BLKA 1QNPA 5I0DA 3VVGA 1VRXA 1GONA 2VZUA 3TOPA 4W84A 3WNOA 1NP2A 3CMJA 4ZXOA 5I6SA 1VBRA 1JG9A 4QLJA 4E2OA 1D2KA 1J18A 3VD4A 3WUBA 4D6HA 2Z1KA 4JZ5A 3MUIA 3AS2A 3AHVA 2A3HA 1VFFA 3RDKA 5BRPA 1JDAA 1BLIA 4XZBA 5FIPA 4C7FA 2G4FA 4C7GA 1MFUA 1IT0A 2YLLA 4JKLA 4P7QA 3ZJ8A 1GNXA 4LX4A 3SCNA 2X1IA 1CGWA 2D0FA 4JFUA 4BA0A 2CESA 1NWSA 2WKLA 3MMWA 2YDSA 1RP9A 1GOIA 2WBKA 1JAKA 3BSGA 1E3ZA 1CECA 2BHUA 4LGXA 4UFIA 4M81A 1ZBKA 2WANA 1C93A 1SMAA 4GQRA 1XYZA 1Q4NX 2RGMA 2ZX6A 4U3AA 4UQEA 3UEQA 3VTRA 2XM1A 4UZUA 1V02E 4NRSA 5A8NA 3N15A 2JIEA 1TR1A 5EFFA 3OIHA 1E1FA 1UKSA 5D9OA 1EO7A 1CGUA 2YA0A 1CLVA 3K46A 3U5UA 3VINA 1XSKA 5D9MA 3WH6A 4DUVA 2HISA 5FOOA 5LA2A 1ISWA 1E0XA 1LJYA 3WQ6A 3RJXA 2ZWYA 3TTOA 2CBUA 3B9EA 2X0HA 3PZNA 2WMHA 2VCCA 4WJXA 1UWUA 2XFYA 5JIWA 5LA0A 3ALFA 1WDRA 1OGGA 1BYBA 3VDBA 1BAGA 3IAQA 3AMKA 1BF2A 5AYIA 4AD4A 3AYRA 5E09A 1TVPA 4Z2IA 1W3JA 4BQ5A 4HTYA 4Z2GA 3CUGA 2CBVA 1G94A 3M46A 1WP6A 3CHCA 1Y7VA 4J27A 1JD7A 2J7CA 5AYBA 2WPGA 3CZJA 1UHVA 1TZ7A 3IJ7A 2XUCA 5ABGA 1W1YA 3AZRA 4M24A 3VIIA 1HKJA 4PSRA 1W2PA 4N42A 4F8XA 1PIFA 4AD0A 3WELA 2W5FA 3W37A 1KR1A 2GUYA 3I3DA 2GDVA 1PX3A 1FP8A 4MNMA 5HNNA 2WMIA 2ZUSA 2VCAA 2OWWA 3T0AA 4FLSA 5GNXA 3GM8A 3B9AA 1OCQA 1VFOA 4ACZB 1H3GA 2Q8XA 3VMPA 2FHCA 5ABFB 2MANA 3U7VA 4AWEA 1OBAA 1HL9A 3RIKA 1IV8A 3WFLA 2VX7A 3EDFA 4QCEA 5I3DA 3WEOA 1UWSA 2YL8A 3CUFA 3SIMA 4IUGA 3IAPA 3TONA 2YKKA 4LYQA 3VGFA 2BV9A 3THCA 3SUVA 1VEPA 4KGLA 3CHFA 4AZCB 2YOCA 5A3HA 3FHAA 5I77A 2D0GA 7TAAA 3EDEA 3AIEA 3CGTA 3PTKA 4W7VA 1J0YA 2GJXA 1ZB5A 4V2XA 3WSUA 3VIGA 2J8FA 3OZOA 4HU8A 4W85A 1TVNA 2AMGA 2VVSA 1ZBCA 1A3HA 3EDDA 4W7UA 5I23A 5AC5A 3ZT7A 1V3IA 2O9TA 2XGBA 4HA3A 1BG9A 3W81A 1TG7A 3SCOA 3ARZA 4TX8A 2WCGA 1GQJA 3OA5A 1FH7A 2PWHA 2X2YA 1AMYA 3AZTA 1AQMA 2EXOA 3VOCA 1MWOA 1M04A 3POHA 1BYDA 1JI2A 4CN6A 4MPKA 4RE3A 2GVYA 2CBIA 1E4NA 2VO5A 1DWHM 1QBBA 1OIMA 3VD9A 3VD3A 3SCRA 2GK1A 1HKKA 3F4VA 1NWRA 2DDXA 3TTYA 1BFNA 3SCVA 2GJRA 3A6OA 4DWSC 1V08A 2G3NA 1ODUA 3ARRA 4B16A 4L4PA 1EQCA 4PMNA 1UD8A 1IZKA 1TA3B 1B0IA 3VIPA 2E9BA 3WBEA 1GORA 3WMSA 1H49A 5EB8A 3QGVA 3G6MA 4OBRA 2Y24A 3TP4A 2XIBA 2DSUA 2BVYA 4IISA 1VBUA 3GH7A 4X9YA 3WMCA 1KXQA 2NW0A 1JZ3A 1FFQA 1JL8A 3WNMA 1YQ2A 1UR1A 3OB8A 4UQ9A 1LL4A 2XTKA 5BRQA 3W53A 1BGAA 4ZFMA 1R7AA 2VJXA 2WSKA 1EDTA 3WDJA 5CZKA 2WZHA 2XFFA 1UR2A 5M03A 4MJ2A 2O9PA 1C92A 1XH2A 4CD4A 1R85A 4UR9A
chains in the Genus database with same CATH superfamily
1T41A 2POTA 2KX9A 4DX3A 4AZIA 1V02A 1VFTA 2OYLA 1NF0A 4JL2A 4JNMA 1M3UA 3RR1A 2UBPC 4ZEPA 4X60A 3QGKC 4LCQA 3OBAA 2QEZA 1WUFA 1ZU8A 4QNWA 1OEPA 3LX9A 1AL8A 3H4GA 1FWIC 3FGCA 3GQYA 3CPRA 2ZVRA 2ZUUA 4I9AA 4PMOA 3GFYA 1EDGA 5E93A 4QEEA 3AIQA 3FVMA 3R0UA 1V3KA 2F61A 2AGTA 4S3CA 1EBGA 2ZWZA 1VPXA 2BOGX 2PP1A 1TX0A 2V3FA 2XIIA 3NWRA 3VNMA 4D1JA 1YADA 1XYLA 1DHPA 1QT1A 1X8CA 3M1ZA 1VB9A 2GK1B 3RYSA 1BTCA 3CUJA 3MMTA 3KL3A 5G4HC 1TPFA 5K4ZA 3C0JA 1MZRA 4W7WA 6REQA 3HPXA 1LBLA 2PC4A 4KFNA 3MJMA 3PSWA 3LRLA 4NF7A 5I3IA 3CB3A 3VOHA 2PDLA 1N82A 5FA5A 4INFA 4XVEA 5REQA 4MJZA 2AAMA 3C2EA 3SQMA 3JRKA 4K68A 1E6QM 2RDWA 1X6NA 3MSGA 2NQJA 3CT2A 4O1CA 1FCQA 4MWAD 1SO3A 1BEUA 3ATZA 3GXIA 3BO9A 2Q6ZA 3GS6A 1E1CA 4IIBA 3BURA 4KGJA 2HNHA 4TUFA 3WMBA 5DT7A 4H6KA 5XIMA 2RH9A 2D1ZA 3KHDA 3L4UA 4JKMA 4GVHA 2BY3A 3DI1A 5C0QA 1TA3A 2IKJA 1AZ2A 1AODA 2Q8ZA 3GAKA 2OJPA 2BGQA 4XZHA 3KP0A 3FLUA 3GE7A 4NAEA 3MHFA 1QHZA 1QI3A 2P5NA 2TRSA 1V0LA 3LBCA 4WY0F 3QV7A 1G01A 2VGBA 1FWDC 2CYGA 2F38A 4Y7EA 1TPWA 4QXIA 3ARYA 1PKYA 3LLXA 1ZAHA 3B4UA 1Q45A 1M7PA 2VRQA 2Y63A 2PLKA 1S2CA 5F2GA 3P67A 4WHBA 1A5AA 4EKJA 3THAA 1NWTA 2PBGA 2QUUA 1EGZA 3TFXA 3B8WA 4CQ8A 5A69A 2VURA 4AW7A 4FF5A 3Q58A 3N13A 1XD0A 1SO6A 1GOWA 3F4WA 4HCHA 1OFQA 1BXBA 5G2HA 5E1QA 1FCVA 3GG1A 5DMMA 2CKRA 5KZ6A 5FSDC 4YS1A 3KTXA 3T05A 4FIQA 2A0NA 3QTGA 2C13A 1JULA 1O5QA 5IHSA 3B0XA 3NDYA 2VEIA 1OT1A 3KLLA 3UY8A 1KCZA 2RDUA 1DE6A 3SCWA 1GVOA 4C6IA 3QF0A 3T4WA 5A6MA 2J62A 3KBSA 1E1EA 5EBUA 1LL6A 3W1TA 5H8PA 4PMRA 4UZSA 4IQDA 2QUMA 5BROA 4B2DA 3W7NA 1XLIA 3SRHA 5XIAA 2DQWA 4GIRA 1QI5A 5GPRA 3U7BA 4PRTA 3HGJA 4UR7A 1KBIA 4ZSUA 2VHLA 1HW6A 1MW1A 4H9XA 1JYNA 1IWBA 3XISA 4B91A 3MP5A 4LC8A 2OWXA 3VAVA 1NFPA 4CN1A 5IXEA 2DSWA 4IZGA 1DOSA 3NQ2A 2F9RA 5F1VA 1GQKA 3PUOA 3T2PA 4EAMA 2FGZA 1G67A 4BJHA 3QLLA 4L6HA 4TQTA 4YVPA 3W1QA 2OOFA 2VEPA 1Q6FA 4FP1A 2WV8A 2TMDA 3L12A 4QISA 1V79A 3AC0A 4YVVA 4KEZA 1TWDA 3SJ3A 1W5NA 3BLDA 5C7VA 3ZJ7A 1QASA 3D5HA 4LCSA 3VNYA 4PUKA 1AVAA 1ZHAA 2GJNA 3XINA 1LQ0A 3KE0A 5C9ZA 2QIIA 7PTDA 2J79A 1DTUA 1XS2A 2WB5A 4MG4A 3GNRA 3C2RA 2XFRA 4LPCA 1LT8A 3WLIA 2YL9A 1JPDX 3W2UA 3ECQA 3R89A 2WLZA 3CO4A 4O18A 4RR4A 5EYWA 3VMOA 4JTKA 1KM5A 4DJEA 5BXTA 3ZMRA 4JTTA 1XLKA 2HRWA 3TMQA 1QNOA 2ZUNA 3NQGA 1HP4A 3NL3A 2GVJA 3W82A 1R2RA 3VNJA 2DY3A 5IFPA 4IM4A 2V5CA 3VNZA 2JIWA 4UOQA 4AEEA 4M7TA 1ITQA 2GVLA 2WSQA 2D3NA 5D9PA 2YXOA 4OBTA 1P0EA 4HNOA 3PY2A 4PUWA 3WQ8A 3QMRA 1KXTA 3UJRA 3M0XA 2J6VA 4AIBA 4GQQA 4Q8VA 5AC7A 5LIUX 4WY0B 3D3AA 3BC9A 4A29A 3S47A 1PE1A 3P6LA 3GRIA 3GDLA 4HNVA 3A4XA 4UWMA 2FFCA 3DHUA 2OO0A 2BGSA 3NEHA 3TJLA 1DJZA 3CV6A 4DJFC 1BYCA 2VEGA 4A22A 5M5DA 1XD1A 3WNLA 2JEPA 2NZLA 4K3ZA 2E9MA 3NTYA 2A85A 1L6WA 2VZTA 1J96A 5TQLA 4CEXC 2Z29A 5TNVA 3N3MA 3AXIA 1UD5A 2ZICA 3HJEA 3WO8A 4JTUA 4EPEC 4RZ5A 2GVGA 1D8CA 4JTDA 1BWLA 5C2XA 1H41A 1TSIA 4JNZA 4MTVA 5A6JA 1TX2A 3P0WA 3ARPA 2GWNA 1GOMA 2ZXBA 3ZVHB 1TWSA 3UZYA 2PUZA 3NA8A 4H9VA 3GG0A 1OFPA 2XISA 2E8ZA 3LSBA 4WJEA 1ONXA 1KGWA 2JBMA 5DBUA 3OP2A 4RL3A 4XO7A 4KT2A 1FWJC 3E49A 1R9XA 1F74A 2JKPA 4Q8TA 2IKGA 2P0IA 3SFWA 2FPVA 3W38A 2B7OA 5TBOA 2PGEA 2OOGA 2BOEX 3RLGA 3LNMA 3CL7A 3PZQA 1KXHA 1OD0A 1IT8A 1U1HA 3UZ5A 4B3ZA 3TCEA 5LYRA 2VGGA 3C61A 2PDXA 4U2ZA 1ESWA 5K7JA 1UUQA 3DKJA 4AFYA 1GCYA 3HMCA 1XRVA 3R2GA 1HJSA 4ZZ9A 3CHDA 5CZJA 2VX4A 2ZRWA 3NQVA 4PBGA 1TPEA 1ZJAA 1JZ7A 4J28A 2FDSA 4CQBA 3EX3A 1FWFC 1S5VA 4U2YA 5H2ZA 3QV6A 3TUUA 2PDNA 2AKMA 4FS9A 4PE8A 1CGXA 3RHGA 1ADSA 1OWQA 4WY0A 4H6EA 1KFLA 4XBSA 3GH5A 2V67A 2Z28A 3GXDA 3TKFA 1XG4A 2Y1HA 4EAYA 4DBSA 2DPEA 5I03A 2J13A 3CJPA 3A22A 4JTGA 2EPHA 2J8TA 4G8TA 1ZPTA 1P0DA 1GQNA 1ZQ5A 1F7BA 2QPXA 3AYVA 5EMJA 1R3VA 3EKZA 3E3HA 1OFRA 2D2GA 3ZJKA 3IRDA 2PDPA 3LCIA 3PUGA 1Z41A 4J1OA 4M1RA 1YXYA 4FOKA 2ICSA 1G5AA 5XINA 3LMZA 1JCTA 4BQ4A 1H7PA 2VRJA 1VAHA 2ZA3A 3ITLA 2NXHA 1V77A 2NLYA 1B57A 3XIMA 1S3HA 1J01A 5DMYA 3MMDA 4TOQA 3GXPA 3OQEA 1L2QA 2A1YA 1VPYA 4IPLA 3C8NA 1QW8A 1FA2A 3UA4A 1R38A 2PE4A 2FIQA 1TCDA 2VR2A 4MAZA 4O1EA 2CZVA 3GHRA 1MRQA 4JQ2A 4IP7A 4UXDA 2QGHA 3GTHA 3E2RA 5E9XA 1WA3A 3N4EA 3AIRA 3VGBA 3GNPA 2GQAA 3AROA 4S3KA 3WH9A 2PTXA 1XISA 4P7RA 4N9BA 2DZPA 4DJED 2CLPA 3LDVA 4I5RA 3W7JA 3M07A 3N14A 3W88A 4OQVA 3G3DA 5EMLA 1ZALA 1OVDA 2VRKA 4MY9A 4DF1A 5AC4A 3A4WA 2D23A 3BANA 3STEA 5G2WA 1G7UA 4V1XA 5JIPA 2QULA 1HVXA 3N9KA 3APGA 3ES7A 2Y8VA 5JVLA 3I4KA 1VH7A 3K8KA 1MFVA 3MDUA 4NT0A 2O7SA 1OGBA 1EIBA 1W9PA 1HKIA 4GLEA 3UCCA 2P53A 3KBJA 4E8CA 3EMZA 3FAXA 5KETA 1M53A 1TO3A 2FHFA 2OU4A 3H2EA 2EHHA 1JYWA 3UWQA 1B3WA 4AEOA 4K8EA 3WUGA 1S2AA 1K9EA 3UWEA 1E9YB 5FSEC 4GJ1A 3TA6A 1FFRA 3V36A 2C0HA 3TC3A 1PUDA 2PZ0A 2C1GA 4M0XA 3KFTA 4LBSA 2J25A 2Z1XA 3RG6A 4K8GA 4WSJA 3E74A 1DIOA 4KWUA 1H1YA 4GKTA 3GVVA 3KWXA 1Y5XA 3TR2A 4QLKA 4Z17A 2W62A 1KFEA 4PYSA 1BD0A 3GO2A 2CHOA 3O06A 1QW7A 1EP1A 4EF8A 3DERA 3CL6A 1FDYA 3M0VA 1O5XA 4QP0A 1F5ZA 3U2CA 3L2MA 1JXJA 4DYKA 5A6AA 1TKKA 5FF0A 1EP2A 2RUSA 3A64A 3KOXA 1AA1B 2P8BA 4N02A 3LGDA 3VI2A 3WIJA 2TAAA 3T55A 4DJDD 4K7YA 5CPMA 3GTFA 2EKCA 1E6XM 1JRCA 2PDJA 1LWJA 4U31A 4C1KA 1FWBC 5E0FA 2OEKA 2NQHA 3WLMA 2J7DA 2PODA 4UTUA 3S83A 3PG8A 3FJLA 2GJXB 2X1TA 3W83A 4IQLA 2VVNA 3HV8A 4AHOA 4GC3A 4CD5A 1RUSA 3CAKA 1YTKA 1RP8A 4YHGA 3WJYA 1SJBA 2BASA 4BWLC 1FY6A 5HINA 4L1XA 4V28A 3OPSA 2WCAA 1F07A 3R11A 4L5ZA 4PEEA 4K37A 1EOKA 4B4FA 1DYSA 4AVNA 1GT8A 5ECVA 1EA9C 4V15A 3PBYA 3T9PA 3UP8A 4IX2A 1BGGA 1IEVA 3UZWA 5A6SA 2YIHA 3NVTA 2E6DA 3PBWA 2PTWA 4LF1A 3DYPA 3NXLA 4IQEA 1XV8A 1S5WA 3NSMA 1Q6DA 4UQCA 4LSBA 4XBJA 1PZ3A 4CQAA 3ABQA 4HZ8A 4REQA 1V3MA 3BUVA 1OFAA 1OYAA 2XIQA 4WDXA 2DZXA 3LXBA 2YLAA 1JUBA 4IPPA 2EPOA 3GY1A 3PWGA 4NSBA 3W3OA 1PEZA 3KEHA 1E72M 1OX6A 1HUVA 3ZR6A 4AD3A 4HN4A 5CGQA 3IRSA 3VDGA 3S6TA 1UA3A 3CUZA 3NGJA 2DT0A 2DZSA 2WVUA 2IW0A 3WLRA 4FMVA 4J4KA 1EJ7L 3MANA 3FK4A 4HBKA 3RCMA 2WZIA 4OU1A 1M1BA 3B03A 3LQLA 3CYJA 4XAGA 4CU6A 4OGZA 1UJQA 1MEHA 3P81A 4AAJA 3B8VA 2YL6A 3WLJA 2FH8A 4CUCA 2OTDA 1KV5A 4FR1A 4K7VA 1FCUA 1VGAA 3LI1A 5HQLA 2O4MA 1IEWA 3WD4A 2XH4A 1SZNA 2H3DA 3R0DA 1OX4B 3WBWA 1HL8A 2GQ3A 3CZ8A 4YCPA 5LIWX 1ZL1A 3TK7A 1I45A 2REQA 2ZADA 4M6PA 1EIXA 1M01A 1R5YA 1XIBA 3WMLA 1P48A 1VENA 3SBFA 1Z42A 2WO5A 2NQ5A 2BXVA 3CUHA 5DY2A 7REQB 2ZRVA 3LY0A 1CPUA 2E67A 3F4CA 1LG1A 2VZOA 3KCJA 1SJDA 5HATA 4IPNB 2QDDA 1MQQA 1UZ1A 5K3VA 1UWAA 5I2UA 3WLHA 4NYUA 1CX9A 2F6KA 3AO0A 1X7IA 3I6TA 2WMFA 3ARVA 1VRDA 4UCGA 3IV8A 5A6BA 5E70A 1XGEA 4ATDA 1KC7A 2XN1A 1O12A 4IMEA 1UP0A 1PXGA 2PWUA 2PBOA 4OECA 2Q09A 2XVKA 4GWEA 3G1DA 3URBA 5GJPA 1WDDA 1IXNA 3WLTA 4I3GA 5IFTA 3C8FA 1TJRA 3HZ3A 1ZP4A 1O1ZA 1IR1A 2IKHA 3L5LA 4AF0A 5JH1A 4N7QA 4PUNA 1PDYA 2V5LA 5A8PA 5AN7A 4IGMA 5CSYA 2ON3A 3GNOA 1RY0A 4DNHA 1XINA 1I60A 3G1AA 2DEPA 3PAOA 2OVLA 1VCGA 3QKEA 3EKLA 4Q4PA 4XQ6A 4GJJA 1A5NC 3RX3A 1JYVA 1WPCA 2YJQA 5CQ1A 1UPPA 3H7VA 3CQHA 3UU0A 1JZ2A 1HIZA 4RDWA 3CQIA 1HJXA 2HVNA 1K70A 1LL7A 3L0GA 2Y7GA 7A3HA 1F4AA 4G6CA 2VFGA 2XH0A 1CT5A 4LV4A 3NQMA 1WKYA 1MXDA 1ZJIA 3CC1A 2OB3A 2A3LA 4LAUA 3W75A 1ALDA 5AHEA 4PMUA 2E5DA 1OCBA 3TV8A 3PTQA 4X61A 1FDZA 3RGTA 2OXNA 3M16A 3KS5A 3CV2A 4X63A 4XZWA 1KLYA 2QGYA 3PC0A 3U0HA 2J75A 5J04A 3O8AA 3GXMA 4IICA 1YMYA 1R9ZA 2ZFAA 3NM1A 3UY7A 1E9LA 2VQTA 1ME9A 4AX6A 2VFHA 3CQKA 2XFWA 3G1YA 1EJWC 1XRSA 1K8CA 5T9CE 1DQUA 2R1PA 1XRFA 2H90A 4HHPA 4L6DA 4C1NB 1QW9A 2A3BA 1EPXA 2A3AA 1XLAA 4UTHA 4ADTA 3QV8A 1QOQA 4BF5A 1N55A 3NVDA 3Q67A 4EPKA 3MPGA 3VX1A 4PCPA 3F2DA 4XD3A 3L4XA 5HJLA 1XRTA 3PULA 2Y8KA 3POCA 4UFLA 4F40A 1MVYA 1P7TA 1UROA 2ZXQA 3TH6A 2R82A 1N8WA 5K9XA 3ZLHA 1SVDA 3SUSA 1KM2A 3RLHA 4QE5A 3DBNA 3EA1A 5E0KA 3CV7A 4JD4A 3UW6A 1TPDA 2VC6A 4GNVA 4DUWA 2A6LA 2PD5A 5HWMA 1QXLA 1KTNA 3VK5A 4O0ZA 5IRPA 3QSRA 1LF1A 3FY1A 1VBJA 4S3DA 5D2WA 3NZ1A 5L9FA 1OFBA 3LGEA 3LEPA 2WQDA 1YYAA 3STCA 4CD6A 2EJAA 2FGBA 1BRLA 1K4HA 3C52A 3ICJA 1J0KA 4A05A 4AVOA 2NSXA 3NFUA 3BQ6A 4GGBA 1HJVA 1EXBA 3UGRA 4AXNA 1BVZA 3DG3A 3AJXA 2VZVA 4K39A 3WLPA 2XN0A 1GOQA 1QNSA 1JAEA 3WDRA 4AU0A 2AL2B 3V18A 4L64A 4H8NA 3WJSA 4ZGYA 3W22A 2HS8A 2FTWA 4NZFA 2YGYA 3RU8X 3WJXA 4YTSA 2WNNA 3GU9A 1X1ZA 1ONRA 1TMQA 1VEOA 1Q65A 3U6WA 1EOMA 3LLDA 1BF6A 1UOKA 4XAYA 2GOUA 3CBWA 1W1A1 1QMLA 1E4IA 1JNEA 2OLHA 1NELA 1TRDA 3PZMA 4U5IA 4LUTA 2X0YA 4HHLA 2YA2A 4GO8A 4XKYA 5I7GA 5D30A 1K7EA 1JRBA 3N34A 5GJNA 3GFZA 4UQAA 2ESCA 3RR4A 1LT7A 3BL3A 3BLOA 3TYCA 1EA0A 5EPDA 1GTHA 1YX1A 3WQGA 5FL1A 5IBXC 5A6LA 1XBVA 1OF6A 3AALA 3VO0A 4WRHA 4UFJA 2BMBA 2EG6A 4HP5A 4R5EA 3VUSA 1B3XA 5JUVA 4H8UA 5I24A 1DVJA 1N7KA 3BLIA 4NJGA 4CU8A 3MC5A 1VJSA 2WPBA 4ACZA 3WBYA 4OHQA 2V63A 1YXDA 1B30A 2CCRA 3ELFA 3WBAA 5KMYA 4O52A 4RPPA 4PTDA 1KWKA 1FWEC 3O6YX 5BZAA 3BJSA 5I0DA 2H8XA 1VRXA 1E0UA 4B5VA 2ZRYA 1QJWA 2VZUA 3R4IA 5TIMA 4IGHA 3FS2A 4F2BA 1NP2A 4ZXOA 5I6SA 3IIVA 1A5OC 3L9CA 3JU2A 1VFSA 1XIJA 3DEQA 4KETA 4E4FA 2HE8A 5BRPA 3LD5A 5J5RA 1BLIA 4XZBA 4BKNA 1NAL1 3O63A 3NQCA 3O3RA 2G4FA 1TTQA 2YLLA 4JKLA 1XLGA 1XR2A 4NJJA 3A13A 2X1IA 1TELA 4JFUA 2CESA 4E2DA 1YPFA 2HZGA 3UNTA 3RXZA 3R8RA 2QJIA 5AFDA 2C1IA 1A0CA 3TEVA 2YB1A 2POZA 1Q4NX 4YVXA 1YEYA 4UQEA 1DJGA 1V02E 4KERA 2JIEA 4IG2A 2W3ZA 1XXXA 2OFJA 2Y89A 1BKHA 5D9OA 1EO7A 3K46A 4GA8A 4LY4A 3TYBA 3V5FA 5D9MA 4PUMA 2ZZ7A 5DN1A 2FPTA 5LA2A 3NM3A 2V5BA 4JIPA 2OELA 3IARA 1LORA 2CBUA 2GGIA 2X0HA 2PLCA 3MUCA 4QROA 4KCWA 4JGDA 4WJXA 5LA0A 3C0SA 5EMUA 2B7PA 1WDRA 1CLKA 1OGGA 1BAGA 5F1UA 3IAQA 3P84A 1BWKA 3WJZA 2NVDA 1XG3A 2CWXA 2REQB 4CNPA 4KPLA 2Y6ZA 1WP6A 1S2UA 3C2FA 5AYBA 2YBVA 3KS6A 2DFAA 4LW7A 2OLAA 3NPWA 3C86A 1TZ7A 4JPGA 3IGHX 3SRFA 3M64A 3SFKA 3VKAA 4DXXA 3VIIA 1HKJA 3MBDA 4PSRA 4N42A 4JQ1A 5FJIA 4YLWA 1ZLPA 1MO0A 4FX7A 4PGLA 4AY8A 3BLEA 2YW4A 2ZUSA 4HNLA 2ACSA 4FLSA 5GNXA 4QJ5B 5AVHA 1ADOA 5FJTA 4AWEA 1OBAA 3NO5A 4QCEA 4L65A 3VE7A 3WEOA 1ZCCA 2QDEA 1XLDA 3UYCA 3TONA 5CBBA 2ZZ4A 3SUVA 1G69A 3TYAA 2D0GA 7TAAA 1XYCA 1GWJA 4GG9A 3EX6A 3CGTA 3PTKA 3EA2A 1XIFA 3WSUA 1HO4A 3OZOA 4I7VA 3O6DA 4YL2A 2JKEA 2VVSA 1ZBCA 3SDOA 3EDDA 5I23A 2YYTA 2BBFA 4HA3A 1I2OA 2X2GA 3ARZA 3TZFA 2WCGA 4DELA 4B5UA 3AZTA 4K36A 4NNCA 4TX9A 3POHA 1JI2A 3PPGA 2Z0IA 4M19A 2VO5A 3RK8A 3VD3A 2GK1A 1HKKA 2DDXA 3TTYA 1BFNA 1RK5A 3FIGA 3OQ8A 2W0UA 1V08A 2G3NA 1ODUA 3ARRA 3NURA 1OADA 4ORMA 1UD8A 1IZKA 3VIPA 1GORA 3HBLA 1IEIA 3G6MA 3TP4A 4IISA 3GH7A 2A7RA 3TLLA 1FFQA 1PTGA 1YQ2A 1UR1A 2GVEA 3OB8A 4UTIA 3MZNA 2VJXA 1XX1A 4UTJA 3V16A 4I8YA 4B90A 4L1GA 1W5QA 2G96A 3SQLA 2VD9A 4HKPA 1C92A 2QDGA 4CD4A 4UR9A 1FCBA 2VDIA 1PYFA 3WQWA 2NT1A 2FMNA 4XBKA 4DXKA 3N9RA 2ZE3A 2TODA 1RA0A 1XLEA 5E6YA 5FAJA 2H8ZA 1W5MA 1GHSA 2JE8A 4RK8A 2PDKA 2IXVA 5DRCA 1PZ2A 3RM9A 2WVVB 1PHWA 2CKSA 4H9MA 3MI6A 1OGSA 3BSMA 2PI6A 2PLJA 1WDQA 4Y8EA 1UW9A 4S39A 1YW1A 3VD5A 3EDKA 3G1XA 3BAIA 2RDTA 1A5BA 1ZAJA 3QZ6A 4JY9A 5ABEA 4KCVA 3UR7A 2OZ0A 4IWWA 5JH2A 4MKNA 1LM1A 2BODX 3LCWA 2O0TA 5CJMA 3VILA 1JCLA 5T8GA 1R3QA 2ZXAA 3M5VA 3CEPA 3GIQA 4K1GA 4BR1A 1EKOA 3MUAA 4A21A 3VYLA 5A6KA 4ALDA 1LOLA 2VDHA 4DZ5A 1CLXA 5A8MA 1DIEA 3ARUA 3R0KA 2J7EA 3N04A 3VKBA 5HWJA 4LS1A 4H6RA 1EWDA 2D2JA 4RLIA 2GQ9A 4OBSA 4ML9A 4FA3A 4GYPC 1YBQA 2RJHA 3TC6A 5AVNA 4JFSA 1CWYA 4LAKA 4A3UA 4ADSA 4EP8C 5C54A 4LAMA 4PTMA 1OFOA 1P1MA 2WZEA 3KOYA 1OFEA 3C0QA 3M5ZA 3OGSA 1VP5A 1H0GA 2PTYA 3SN0A 1CXHA 3HQPA 4QGCA 1GYNA 5MKGB 4P7OA 4ENLA 1NOUA 4ZQOA 4QRNA 2ZTJA 2DZWA 4JHMA 1LTDA 3NYDA 2GGHA 2VZSA 2F84A 3FA3A 2JALA 1XSJA 4FNSA 5I3GA 1G4TA 4NXSA 4O8RA 4MWAE 4MSSA 3BCDA 1FOBA 1WDSA 3GBDA 1B3VA 3SQSA 1I1WA 1QOXA 1DWIM 1FWTA 1ISYA 1DWJM 4FK9A 1UOZA 4XWUA 4D72A 3AISA 3UWZA 3T0DA 3WH5A 2BVDA 5CSRA 2W4XA 3GB6A 3SSJA 2PGWA 5FEZA 4V27A 5CLTA 1OCJA 1XP3A 5DANA 1A5KC 4FNRA 2CXGA 4D6JA 1B54A 2PDUA 3AYSA 4PB5A 1BHGA 4HD5A 1XYBA 1RSCA 1CGTA 3ORWA 3BG3A 4CNTA 4R7JA 4AWSA 2IUZA 1ISZA 1QDSA 1QFEA 3LPPA 2ZZ3A 3OJGA 2IQDA 3DCPA 1Q6QA 3P5ZA 3QZEA 1D9EA 4LVDA 4UTWA 3EWBX 5HAOA 1W31A 4FI4A 5HOSA 1EYWA 1REQA 4UFKA 4I6VA 1UQZA 4DBWA 1VJIA 1SM9A 2XWEA 4R9OA 1KFKA 1G9HA 3JUGA 5KSWA 3M0MA 2RJGA 3CAVA 4J3ZA 1FVPA 3C4UA 3UG5A 1EHAA 2QIWA 2CWNA 2VR4A 3FNDA 4C6LA 3WQOA 1XLLA 5D04C 4M82A 3OLIA 4WVXA 4IP4A 4IGNA 1OF8A 4F0MA 3G0XA 4FB7A 3N6HA 4ES4A 2D2OA 3QJAA 4LUSB 2L5HA 2R8WA 3MVIA 1LCOA 3B9NA 5DO8A 4NHVA 3VOFA 2GLKA 3UWVA 1EXPA 4HMEA 6XIMA 1AQ0A 3ITXA 2HVMA 4HU0A 4I5XA 3W26A 4CKQA 3H6OA 4PMYA 3WF1A 1PJ9A 2HNEA 3EGJA 3S1XA 5B7YA 5BYWA 3VX0A 2CLEA 3CU2A 3W87A 1TTIA 2F2KA 4RZ4A 4LANA 5GNYA 4JDYA 3W7OA 4LVFA 1C90A 3GR4A 3MKVA 3V4BA 4ERIA 1UD3A 4JAWA 3T1GA 2OGJA 3U8GA 4H1ZA 4C5ZA 2C91A 1XWYA 4HHMA 3L5AA 4XIAA 2HPIA 3VXGA 4JHOA 2XYLA 3GVGA 4AZBA 4XAPA 3GAYA 3GC5A 4WXYA 1EJXC 4JIQA 5CAKA 4WDWA 1C29A 3A9IA 4JEQA 1E6RA 3LV6A 3R25A 4G1NA 4WXZA 3GWQA 3M5YA 4IPJA 3MSRA 2IPFA 4P8UA 2XVNA 3M9YA 2PWVA 2G3FA 4CU7A 3BJTA 4LQ1A 1GGOA 4KWOA 4NZJA 1J0ZA 1UBSA 1RQEA 4CCDA 1F3XA 2BHZA 1YHTA 4A4AA 4MWAC 3G22A 3OU8A 1NDWA 2OZTA 1JFXA 1OC5A 1VFHA 3KUMA 1XH1A 5I3FA 2WHMA 2CLKA 4LOCA 1CW2A 1W9BM 4FNUA 2HSAA 2V5DA 1NWUA 3ZVIA 3CK5A 4KRTA 3T07A 4MM1A 5CPLA 1Q8AA 4IIHA 2ZX9A 3LXCA 1JDFA 1SJCA 4Q4SA 3WNKA 2QQ6A 5F4SA 3E5PA 4AZGA 2G5WA 4AD2A 3QHMA 1WXZA 3NZPA 1MNZA 1V8EA 3UERA 3HF3A 3FKKA 3GR8A 3UCQA 1RQHA 4R88A 3RN6A 1WKFA 4EXBA 2C18A 2XWDA 1W54A 2R94A 3HU7A 3DN5A 2PP3A 1PTAA 1JPIA 1GVYA 1ZSXA 2VFDA 1TPVA 3AJ7A 1AMKA 2DW6A 4B3KA 1X6LA 1H7OA 1RV8A 1SGJA 3WK3A 3LBOA 3WQDA 3DH7A 3HG4A 2OR2A 4PCFA 4UMBA 5PTDA 8XIAA 1JIBA 3W7HA 5A2CA 4AHQA 1HKWA 4JCMA 3W6YA 3W86A 4A3HA 2YW3A 3SSZA 2EG8A 4RW5A 4KKXA 3S1VA 1TFVA 1PDZA 1S39A 2QJMA 5SWUA 1IEXA 4QQUA 4FOJA 4QM1A 4GISA 4ASTA 1JF6A 1S5NA 1VIZA 3N25A 2DT1A 2VELA 4N0RA 4WEVX 4ZO7A 3T2OA 4EE9A 3G2GA 4ZQRA 4QDMA 4FHAA 4G1KA 1O5KA 3FKRA 3B97A 3SECA 1V7AA 5BXRA 1J5SA 1G4EA 4CCCA 1V6VA 1ONEA 3WF4A 1J9YA 5D4YA 4QSFA 3LRMA 4LC6A 3U2ZA 4WKFA 5BNKA 3IK2A 1U33A 1C8YA 3W4RA 1X1OA 5FJRA 3KOWA 1LQ2A 3K4AA 3W1NA 2WJFA 3M0KA 3R5EA 4WGHA 1IXQA 2PTDA 1LRNA 3REQA 1UR0A 4HPHA 3WZ0E 3C2YA 5AYZA 4JFTA 3UG3A 2Q8LA 4YWIA 2Z26A 4FLOA 1YTEA 2J4GA 4UOZA 1H62A 1NQ6A 4W9TA 9RUBA 1QPNA 2J27A 1EB3A 2BG5A 5CC5A 3HTWA 4H01A 5KEZA 1XKYA 3N9SA 1UKOA 3AIVA 5F2LA 5LIYX 5KITA 1S2VA 3W6MA 1PCWA 3S6DA 4KEMA 4B5TA 5HXMA 2ATSA 1K8XA 1XI3A 4NG3A 3PBUA 3IVSA 1X98A 2OSWA 3HQ1A 3R10A 4HZ7A 2GUUA 3H4WA 4GIYA 3BGAA 1UZ4A 3UNDA 1NU5A 4HVXA 3VGDA 3O7UA 2FZ9A 3G6LA 4FOUA 1UG6A 2PF0A 3WEMA 1I0DA 2EPMX 5DELA 3PK7A 4QE1A 2PCQA 4UTMA 2OLSA 4MB5A 4A8IA 4AWTA 4Q8PA 1BVNP 4REQB 5CC7A 1LOSA 4RW3A 2E1DA 2PA6A 1PAMA 3W28A 1WXJA 3SADA 1YLVA 2WVTA 3PBGA 1CXFA 2W61A 3ZT6A 2KAUC 3SB0A 5CPNA 4WDTA 3N3TA 1SR0A 3A24A 2GGEA 3QM3A 1KRCC 4OIFA 4E8GA 1ZCOA 1EBHA 5D2XA 4PODA 1Q3NA 4YU1A 1K77A 3W7KA 2G97A 3H7RA 2QF7A 2DVUA 4UTKA 2GL5A 4R33A 1XIEA 2HMCA 3SUUA 4LVBA 3GVRA 2PFHA 5K9DA 4TVCA 1JGIA 3LHWA 3UXLA 3GXNA 4BWLA 3CIWA 3VNKA 1IXOA 4PMDA 1OC6A 1GVRA 5DRIA 1QNVA 2C15A 7ENLA 5AZ1A 2VX6A 2O9RA 6A3HA 4C6CA 3SZ8A 4A35A 3RM4A 2VFEA 2PDYA 4Q4QA 3U48A 1L8PA 3IJ9A 1OG0A 4NX5A 1FH9A 4HCLA 2OYMA 3STGA 5A8QA 3U3HA 4CNOA 2QZRA 3WNPA 3VU2A 1VIWA 3PM6A 5DQPA 3AOFA 2OQLA 3M6YA 2P76A 3ZYZA 3S1UA 3E2QA 3CQJA 4JTLA 3AS1A 2OKTA 1QCWA 3V7PA 1VYSX 3E2VA 4EXAA 1Q7ZA 2YSWA 4LY8A 4US5D 3P93A 1TRIA 1UMLA 4H8VA 1KKOA 3VM7A 2BVTA 3Q94A 2FHBA 1F6YA 3PTMA 3N6JA 3V5CA 3O0KA 1PZ0A 4UTFA 1Q63A 2NX9A 4IG2B 4ADUA 4PBFA 2GOKA 3GHTA 1K9DA 3EOEA 1RHCA 1A50A 3L4WA 3VIMA 1WOBA 1RALA 2OMAA 5CKSA 2EEXA 2IKIA 4NX0A 5E9AA 4YPJA 1GUVA 1XYFA 3V0TA 3W7DA 1VYPX 4FXRA 2YPIA 4O4WA 3TE9A 1RK6A 4ZR8A 2MUCA 3EPMA 1EEPA 1TPC1 3VIHA 4F2UA 3W74A 2DSVA 2HQAA 2X40A 4KBXA 2J78A 1SPQA 3R12A 4LFYA 3WX7A 3GFXA 3JZEA 3GSMA 2HBXA 3IIPA 3C3NA 4UMAA 3NSNA 4LAZA 4PZVA 2DGAA 3QOKA 1G4SA 3WQEA 1GOKA 1WNOA 4JNYA 5E6ZA 1A53A 1W0MA 4YHEA 2J7BA 3GC2A 3IJLA 2TYSA 3SRKA 3W2MA 2GFTA 5AHIA 1QHOA 4L1WA 1HZYA 3P82A 1W3TA 1ZRQA 1YRRA 3GXTA 1S1PA 1ZBWA 4LNYA 2E4TA 3VFLA 1EJTC 5BMXA 2PSNA 3DG7A 3DECA 1FBAA 4MLJA 4CD7A 3BTNA 4ICCX 1UWQA 2DORA 3NQ6A 1R9YA 1PHQA 4XB3A 4UR8A 1KD0A 1KCLA 4Q22A 4TXEA 4H8HA 3A23A 3RUBL 1GZJA 4GVFA 4B4HA 2A3CA 3LS9A 2VXNA 5D37A 1D3CA 4N6EA 4C5YA 1HXJA 2HK0A 3IGSA 3MMUA 4PTVA 4GUJA 2V2HA 1BPLB 1KGXA 1Y8BA 2R1NA 5M17A 1VS1A 4TMBA 5C9XA 4LNCA 4WOZA 1FHUA 4D6DA 2UWFA 1J0JA 3KCOA 1D3GA 1O95A 3LZ5A 4MADA 4MUPA 3BLPX 1C8VA 1WV2A 3NDZA 4NIRA 2Y4SA 3ARWA 3RF9A 3MBFA 2BXYA 3EKGA 1UPMB 1XF0A 1NDZA 2ACRA 2J7GA 1V6WA 2G0WA 3NGFA 1JQXA 4K2SA 2BY1A 1JFHA 3S2CA 1CXEA 3DFHA 1XPYA 1GK8A 4HJFA 4YYCA 3HMJG 4WSHA 1XLMA 5LNUA 1F3TA 3FW6A 2ISFA 2VEKA 1MW3A 1Y65A 4QHRA 3N4FA 4RNJA 4Y6GA 3PUEA 3CIXA 3ID7A 3L4TA 4DLMA 3QPYA 4GUGA 4I90A 1YPIA 3OZYA 5BXPA 2RGLA 1B3YA 1TIMA 3V35A 3U2OA 3EWXA 8CGTA 4XZIA 2WAGA 4LUIA 4AZCA 3EA3A 3VE9A 2E77A 3BICA 1UH2A 3H2FA 4WJ8A 4JEJA 3MJYA 2YDQA 1TZZA 4LUSA 3BAKA 4XTIA 1TWIA 3WD0A 4LAOA 3BAJA 3GK0A 5F7UA 3MHGA 3S5SA 3LHTA 4Q3MA 3BZJA 5CGMA 4DF2A 2ONEA 3CWNA 4IX0A 2W6RA 1Q6OA 4EPBC 1BQCA 4PMVA 5EMMA 1S5MA 4D6EA 1JI1A 5C5YA 3A12A 1JXKA 1XLHA 1AW2A 5AHLA 1UA7A 3H70A 2FVLA 1Q4WA 2X7WA 2P88A 2INFA 3DC8A 2NX1A 1TREA 1Q5MA 2XJ7A 2WWDA 2QPUA 1QI0A 3TN4A 2OSYA 4BEUA 3BWWA 4DNMA 3WF0A 3L66A 4AIEA 3VNLA 4I8DA 2I57A 4MNLA 4YNGA 4B3LA 4I5UA 4ERAA 4ICMA 3AIWA 1LROA 3GZ3A 1T7LA 1T40A 2IQ0A 1L0PA 3SY1A 5I00A 3GTNA 5G1YA 3SR7A 4OE7A 2WJDA 3OLEA 3QSTA 4BEQA 1F05A 1I1XA 5BWFA 2BWGA 3EYPA 2BXZA 3UA3A 1IHIA 4GVGA 2C79A 4GGHA 1EQPA 3FEQA 3IUDA 1J4EA 3PR2A 3GNNA 4XUYA 3MS8A 3LK6A 2X41A 4R9XA 4WSKA 2ZQ0A 4FNPA 3O0FA 2X8RA 3LCFA 1WQ5A 3GU2A 3VA8A 1JZ8A 1A4LA 4PTWA 2E9LA 4PFHA 4ILSA 3CZLA 1BRLB 1HNYA 3DFNA 3MHUA 2Y5SA 3D46A 3VABA 1G0CA 4CVWA 2O56A 4PEKA 4MY1A 3VOIA 1PIIA 4GBUA 2CITA 2W63A 4WKAA 3PUDA 1W9XA 4PMQA 5D2YA 3VCCA 4WLCA 2W66A 4C60A 4OFCA 9CGTA 2WK2A 1XIIA 3NO1A 4GI4A 2AL2A 2H3BA 3KZPA 3W85A 4HK7A 3WG6A 3F1QA 5LA1A 4GPNA 3CAWA 1M6JA 2W91A 4L9ZA 4DN1A 2EAWA 3TMLA 4GI6A 4GXWA 2B4GA 3R58A 4PB4A 5C2CA 3CAQA 2DVTA 1E0VA 1I8JA 1NF7A 1W3LA 4KS0A 2NV1A 3OYZA 1QVBA 5HMFA 2I14A 2AOSA 3COTA 3KRSA 4LWWA 3AYTA 3G5EA 1V3JA 5I07A 3DUGA 1V0NA 3L68A 4AG0A 2CLOA 2ZC1A 3SAZA 3L4ZA 3G1VA 3JS3A 1A49A 3WLSA 3EWZA 3VKDA 5CBIA 1FHLA 4R7OA 3TXVA 1F73A 2QNEA 3WDQA 1IGWA 5D8WA 2VOTA 4H9YA 3MW7A 4G9PA 5D33A 1LG2A 2B81A 2ZUTA 5D05A 2PTZA 3DI0A 1XHGA 2Z25A 1GJPA 2J24A 3AIUA 4EOUA 4W87A 5JBEA 4S3JA 4HA0A 3UZZA 4JTSA 1HTIA 3AXHA 1DBTA 1C7SA 4NZ1A 2XSAA 1VR6A 1GHRA 4BS0A 3HPAA 4FIRA 1OM0A 1M7OA 4H04A 3UG8A 4ZQPA 4EWJA 1RQBA 5D02A 4IFKB 1IYXA 3WEZA 3GUGA 1TV2A 3BMVA 3DENA 3OGRA 1GZ1A 1XUUA 2VTFA 3QHNA 3CASA 3V75A 2XVLA 4QCFA 2E25A 1HO1A 1GOOA 2INZA 4DYJA 1JZ4A 3VC5A 4QJ4B 2G8ZA 2HDJA 2ACUA 1WE5A 1YTDA 5LNSA 4Z2LA 4FLQA 3LZ3A 1W1PA 1EGVA 2J6XA 2GDQA 1PS9A 3AMDA 4H4IA 2OX1A 4PCTA 5HR6A 3AXKA 1VCFA 1HGYA 4KWSA 1YE6A 1VBGA 3UR8A 2XIMA 4ZB0A 4FAMA 5C7HA 3E0VA 3WLKX 4HSHA 4HYWA 4YJ5A 2Y7EA 1R3RA 3L5MA 4GJIA 4J3UA 1XSIA 2NXGA 3MWCA 4BQ3A 2VGIA 2BSLA 3IWPA 3DFTA 4HSNA 1CIUA 1ZZMA 3VM5A 1FX6A 3HOJA 3E0WA 1VHCA 2VWSA 5DCBA 1BXNA 1J0IA 1JEZA 3MA8A 1UWIA 3OVRA 3TU9A 2FGLA 1F8IA 1XC6A 3MI2A 4ZA0A 4MIMA 2V3DA 4UUIA 1CNVA 2EO7A 3R8GA 4CN4A 4J3SA 2BS9A 2W79A 3S42A 3SCPA 5JXQA 2NUWA 1GJUA 2O55A 3MP3A 1CEOA 1U2YA 4IMCA 1I2QA 2FQIA 1VQTA 4Z0SA 1SZFA 2QT3A 2WYSA 5HULA 1XLBA 1ODZA 4UQDA 5H1WA 4K8HA 1NARA 3VOJA 3A5FA 3CHVA 2QCLA 3J7HA 3OLDA 1KRAC 4W93A 2GJPA 1TYGA 4WUIA 4D1IA 1DL3A 1PX4A 3S1GA 3TZNA 3WQFA 3OZMA 1AH0A 2FVMA 4OV4A 4YN5A 3KP1A 2OEJA 5BU9A 2FFIA 4DRSA 4QAWA 2E0PA 3PN8A 1KRMA 4NQ1A 5C6MA 1R46A 1V3LA 1KM0A 2DJXA 2XZ9A 1AD4A 3ITYA 1R87A 4J2MA 4E38A 3G77A 4J40A 2VGFA 2A79A 3GIYA 3S2MA 1SZGA 3CUXA 3TOPA 4W84A 4GE8A 1VBRA 3ZZ1A 5EMKA 5CBJA 4D6HA 3S2JA 3C2OA 3MUIA 3TJIA 3AS2A 3RDKA 3PPCA 3PVFA 1JDAA 2FZDA 3MCNA 3EPOA 1MFUA 1IT0A 3O6CA 3T78A 4ZTYA 3LG3A 1FQ0A 1QK2A 2A6NA 3SCNA 3NQ7A 1WBJA 3QH2A 1NWSA 3GX9A 3LHUA 3MMWA 2HCVA 3U9IA 3ZS4A 1GOIA 1TV7A 2WBKA 4NASA 1YDOA 3I65A 3DHDA 4LGXA 3CQ0A 4UFIA 1W5PA 1ZBKA 1C93A 2WANA 1SMAA 2FZ8A 3LCGA 4L7ZA 4E2BA 4IMGA 3VZXA 3NO3A 2XM1A 2PF8A 5A8NA 4GK8A 3N15A 1TR1A 1U83A 3OIHA 4HNTA 3C6CA 3FSTA 2QCEA 3LB0A 4DI8A 1AJ0A 1CLVA 5AC8A 5BWAA 3FOKA 3U5UA 3WH6A 3O16A 2HISA 4MOZA 4FF7A 3KX6A 5U4NA 3WQ6A 4XSMA 3TTOA 3G1SA 2V68A 4DUOA 3KRZA 4B5NA 3PZNA 2WMHA 3M0LA 2VCCA 4E0CA 4E4UA 2OT0A 2XFYA 1JCJA 3TWBA 3ALFA 1PKMA 2PRHA 3K30A 1EX1A 5F2MA 3RO6A 3VDBA 3T42A 4ZQMA 5HQMA 2H6RA 1K3UA 2A5HA 1U1UA 1UUOA 1DXIA 5E09A 1TVPA 4GNKB 3LBMA 1Z8AA 2C16A 1DJIA 2NLIA 3QY7A 3LN3A 2GPTA 1W1IE 2J7CA 2WPGA 2XH2A 4MPQA 1NFBA 3IS4A 1OY0A 2ALDA 2VD8A 2XUCA 2Z6IA 3W2LA 1AW5A 1J8VA 4O10A 1YXCA 3N73A 1LLWA 4M24A 3L7RA 4F8XA 1PIFA 4LUYA 4AD0A 3WLNA 3W37A 1UC4A 3G8EA 3GC4A 3UJSA 4UTWC 5HNNA 2GSHA 4JTIA 2VCAA 1ICPA 4HJWA 5EY5A 2OWWA 3T0AA 1IZCA 3EX2A 3ITCA 1OCQA 4RKAA 1SQ7A 2FHCA 3NQDA 3OVPA 3LV5A 4KEUA 1IV8A 2V0TA 3WFLA 2J9XA 4RXFA 1AJ2A 4QG9A 5LXXA 1B9BA 3DOPA 4C6KA 2YKKA 4LYQA 2BV9A 4Y9AA 3OYXA 1VEPA 1C9DA 2FPYA 5AZ0A 4AZCB 3FHAA 3OG3A 1SW0A 1PTDA 1Z44A 3AIEA 1LLZA 1J0YA 1T8XA 2GJXA 1ZB5A 1GKRA 1QU4A 3GDRA 4V2XA 3RAOA 3VIGA 2ZYFA 5MHBA 4FEZA 1TVNA 2AMGA 2CFFA 2GGJA 2YCIX 1A3HA 3TW9A 4P5UA 2O9TA 2XGBA 1BG9A 3W81A 1TG7A 3SCOA 3USBA 4LTSA 2W9MA 2PWHA 3LERA 1FWGC 1MWOA 1BYDA 3EOOA 3UWUA 4CN6A 1E4NA 1QBBA 2E1WA 1OIMA 1TVLA 3SCRA 4Q8OA 4ZO8A 3SCVA 2GJRA 1YDVA 4R53A 4DWSC 3NZRA 3IJQA 4L4PA 3DGBA 4PMNA 1WKDA 4GUIA 1O1HA 4EVZA 4A2RA 2E9BA 4NXKA 4JIHA 4IFKA 3GVWA 4DAFA 4WZHA 1J5TA 1S1RA 1VFLA 2IPJA 2V5KA 3WNMA 3E0LA 4UQ9A 2XTKA 3F2BA 3EAUA 3LCLA 3A3WA 1EDTA 5A5WA 3PWIA 3IPWA 4Y8FA 2WZHA 5M03A 1HKVA 3I7SA 4MJ2A 1VPQA 3QN3A 1R85A 3F5JA 1F3EA 3BCFA 3PP7A 4XKMA 4XD6A 3N2XA 3PNZA 3IEBA 4DBUA 4JTAA 3FXYA 4GZIA 1C91A 5CH9A 3S46A 4X0NA 3UXDA 3MY9A 5IOBA 2ACQA 3NPXA 3ITVA 3P7YA 2IQTA 4K6AA 1YNYA 2YCJA 2A21A 3CUIA 3SCSA 1H7WA 3GDKA 3WQ4A 2ISVA 4GZEA 4S3BA 1KM6A 4LJ3A 3ZR4A 1A5SA 1TV8A 1SSDA 3RJYA 2NWRA 1NDVA 2QR6A 5ECUA 2V30A 1RJPA 3VCRA 3KLKA 4GUFA 4ZXLA 4XG1A 1QPRA 1E6ZA 3GR7A 2UY3A 4US6A 1RH9A 3PJTA 3EZ4A 1XCFA 4HOWA 3FJNA 4E3VA 3WBXA 1VZWA 4MKSA 3KWSA 2AKZA 2XU2A 3M0JA 4J7RA 4EX4A 3F03K 4N9EA 4B92A 1TQXA 1V4YA 2DT3A 3FVDA 5HDRA 3AXXA 1RBAA 3EX1A 4LRTA 1W9UA 3T8LA 2X05A 4F4RA 4PUEA 2G50A 1CCWB 2CBJA 4FXJA 4JYDA 3I7QA 1AK5A 1IXPA 2JKAA 4KEVA 3CYVA 2DZVA 3IVUA 4R85A 1LWHA 1POJA 2HTMA 3TQVA 3VZZA 3ZXWA 3L2LA 3EWCA 1ZBVA 7XIMA 2QUNA 2EG7A 1AQFA 2Z1VA 5AB3A 4IMFA 4AISA 2XG9A 1GKPA 4IXHA 3PJWA 1D3HA 4OVXA 3ITOA 3PBVA 4AY7A 8RUCA 1OK4A 1KLZA 3OHIA 4GO9A 3W7RA 3WENA 4KIRA 4PUJA 2QDHA 4IIGA 4KRZA 3IJDA 4FALA 2YXGA 1A4MA 3LHVA 4FX6M 4M6QA 3R7MA 4W86A 5A94A 2UY5A 3TXZA 4QAIA 1GQLA 3SUTA 4IOTA 4I9JA 1UD6A 1Z9AA 4M56A 4DJFD 6PTDA 2F8QA 4P7LA 9XIMA 3DFYA 2YZ5A 4GACA 2B31A 5FJPA 4BQ2A 3EWDA 3AXMA 5FF4A 3A47A 1MEIA 4NP7A 4O1BA 2C71A 3B8IA 1V6TA 3GNXA 1Q6CA 4LU0A 3AU6A 1LUCB 3BVJA 4PCNA 3A21A 4JIRA 4WF7A 3RPTA 3LGGA 1YDYA 2DZAA 1QAPA 3PPFA 1U5JA 4QS5A 4DPQA 1PV8A 3T2QA 4IJRA 3T4CA 2VX5A 3WL0A 3IGUA 3A5VA 3B0VC 3H23A 2PC8A 3AQUA 3URQA 4MJ4A 2A2IA 2AQVA 4GI8A 1ISVA 2I16A 2ZUMA 2WZMA 1O6IA 1ICSA 3LTPA 3HQNA 4AZ5A 3ZO9A 3QYQA 4FO4A 1D7KA 4CNSA 4IL2A 3N2MA 2CC0A 3P60A 4O54A 4R34A 1RVKA 1F9CA 2PCEA 3T0TA 4GZ7A 3QY8A 3FYOA 2I9EA 1YDNA 5LSMA 4IMAA 3KVMA 5CXPA 2JK2A 2XPKA 3QW4B 3H55A 1XICA 3B9OA 4F48A 2ZOXA 3MZ2A 4QDWA 3AZSA 2DUXA 3D3FA 4RNIA 2WVSA 1W3HA 2AL1A 1L6YA 2R6OA 2GJLA 2J66A 4O0QA 3WH7A 2VCBA 5AC6A 1WX0A 3OVQA 3ZT5A 5D03A 8TIMA 5F4WA 1TMHA 1K02A 4HYVA 1JCMP 2WSYA 4ZMGA 1AL7A 4C6BA 1RD6A 3KVLA 3H2CA 2VKZG 1VD6A 4MYAA 5EMYA 2D0HA 2J9ZA 1HN1A 3GHSA 3R13A 1IIHA 1UCWA 2QVHA 3TLQA 2VL4A 3STPA 3H4XA 3K8MA 1H1ZA 1VBHA 1CXIA 3PZUA 2QYGA 4X2RA 3MKCA 5CC6A 3BE7A 2PPGA 1LRTA 3R79A 3W1AA 2QPSA 1TJ1A 3HG3A 3MU7A 5H91A 1MUWA 2CETA 3AMLA 4FX8A 1CENA 3W1XA 4RDYA 1FP9A 5D2TA 5FF3A 4DWSA 1WB0A 1XDMA 4H2CA 1HL2A 3MUY1 2XSXA 3M0HA 1FTXA 2ZZ6A 4PFMA 3TNOA 1RZMA 3BJFA 3D6NA 1MQPA 4RPQA 4L9XA 4NNBA 4Z1DA 3EDJA 1YIXA 4G56A 4DUXA 3IIZA 1V0KA 5CC3A 3OZPA 2UY4A 3RFAA 2OO6A 4AB4A 2Y61A 4YCOA 4PULA 3QZAA 2OODA 4M80A 4IIEA 3TFCA 2QJNA 2A7NA 1RR2A 4GY7A 1W8GA 3ALGA 4XX6A 3SURA 3RLVA 2Z24A 4CNNA 4Q8WA 3T40A 4CCEA 2EF9A 2BY2A 3OEXA 4DWDA 1O7AA 3RILA 3UYIA 3LU2A 3AS0A 3S4TA 3KTCA 1EL3A 1C8XA 3AHZA 2Q3RA 5DMNA 2HVOA 3DFSA 3FA4A 5A95A 3WD2A 1E9IA 3BGGA 3FFSA 4DLFA 2J8GA 3PG9A 3WDIA 4YMZA 2VFIA 3DYOA 1MW2A 4GCXA 3W27A 3S5NA 2PDMA 3BARA 5HBFA 4MZ1A 5K2ZA 4DIAA 3FV9A 3T09A 2ZXDA 4HN8A 3SUWA 2XGIA 4HK6A 4UNKA 4W89A 2CU0A 4NZCA 4AVFA 1V93A 3WD3A 3HGOA 3ZJ6A 1UWTA 2WCSA 3WN6A 5BRBA 3N2CA 2C6QA 4LBUA 3GXFA 4NVTA 4I9MA 4TR9A 1F4HA 3N2BA 4JTRA 4OJYA 1ONWA 2NV2A 5HK4A 3FAWA 3WL1A 1A5MC 4RNFA 3URAA 3BG9A 2ZA1A 3MDWA 2ADAA 2QW5A 4H83A 1NOWA 1XL9A 1F3WA 2P3ZA 4WOQA 1P0NA 3K1GA 2J7FA 1UR3M 2ATMA 4F9DA 4ZODA 1ITCA 5CSUA 1TV3A 2D73A 4V33A 3CH9A 4ZB2A 2G41A 1KBBA 1DWGM 3DKLA 1PL9A 2QUVA 3Q65A 5FJJA 3AHTA 2O4QA 3OO2A 4EWND 1QPKA 3S2NA 1NH6A 5C9UA 1E5NA 2D3LA 3LPOA 3N17A 4LEFA 1FWHC 1JZ5A 1US2A 4HMNA 4MVAA 4F79A 3VDCA 4ROPA 3CTTA 3QR1A 4ZO6A 3QYSA 4X3ZA 4ZTXA 4MMWA 3UESA 3QLDA 3GVQA 3EB3A 2NQLA 4P8WA 3H12A 3DESA 1XBXA 1OYBA 2XZ7A 3UJFA 3E5BA 1W91A 2ZRZA 3P14A 1NJJA 1R30A 4DY1A 3NZQA 3V0SA 4H41A 1WKEA 3MSYA 3W7CA 2Y5EA 4PMZA 5EFDA 3VMNA 3RX4A 2V6AA 4B15A 3FN9A 4HB7A 3RPDA 4W4QA 3UJEA 5BCAA 5CPSA 1EFZA 4HGXA 1W9VA 4IPIA 2RDXA 2JQXA 3EWUA 1LBMA 4GIEA 4HOXA 4H7CA 4AZHA 2FJUB 3LHZA 4M29A 1TCMA 3TCSA 4OWGA 3GH4A 5C8BB 4URIA 1TV5A 4G7EB 4M51A 2BLEA 3H54A 3ZR5A 1M41A 5FD0A 2WM0A 1Q2RA 1K7XA 1E4MM 4U10A 4CD8A 4O14A 4EXQA 1D7FA 3MVTA 4FZIA 1WAUA 1JVNA 4MHBA 2VT0A 3FYPA 3W73A 1EEXA 4LEQA 2PWFA 4JL1A 4AX7A 2WMIB 3WF2A 2C3ZA 5D32A 2EPNA 1JCYA 2TPSA 1Q66A 4JTQA 5DY3A 4JHZA 3W7GA 3N29A 3U4FA 3MSDA 4YTUA 3I6EA 5D9NA 3ZWTA 2BNJA 3ANUA 1C7TA 5JU6A 1MYRA 4PMXA 4OOUA 3CL8A 1LRQA 3FYYA 1WDWA 1KRBC 3VOGA 3UG4A 2CPUA 4OUEA 3PB0A 3N11A 1ZS2A 3IVTA 3HGSA 3EPNA 4GKLA 4D8LA 1EF2A 4GQGA 1Z3NA 2PP0A 5H6HA 4XVDA 3QR3A 4D6GA 1W56A 4IH3A 4WR3A 1UQYA 5FEPA 1L2UA 2X1SA 4AD1A 1PB0A 1TTJA 1BSIA 4BF9A 1Y0EA 1ECQA 3VDAA 1XJBA 1G7VA 3TTSA 1H7RA 3U5YA 3W7IA 2E7FA 3UFYA 2A3EA 3GDBA 3B0UX 1DWAM 5G4EA 1X7FA 2E68A 4J9JA 2NUXA 1TJ0A 1XYMA 4LB3A 1VJZA 4AYSA 1E51A 1EGMA 1GQIA 5C2GA 3B4YA 1IZJA 3CZKA 4P7NA 2DIJA 1TPH1 4NJHA 5ENLA 1FWWA 3WUEA 4WDUA 5A6TC 2ZVIA 2JF6A 3V1PA 2E3ZA 2WNQA 2X30A 4KFOA 1A80A 1KB3A 1Q7QA 4KCUA 3REQB 1DIDA 3BAWA 4LBRA 4HQVA 4XZMX 4DI9A 2Y8UA 1F6PA 3A4AA 1NVMA 2EJ1A 3B3DA 3AHXA 4POCA 1PZ1A 2OEMA 4ECLA 3TYEA 2QJGA 3FEMA 4FR6A 1KR0A 5DF0A 2WC3A 2XSBA 3BLFA 3KXQA 3MYPA 1KQZA 3L0KA 3NL5A 4B9ZA 2ZZ5A 1R0MA 2G3IA 2OSXA 1K9TA 4AMAA 2V9DA 4Z0JA 3U57A 4UIOA 2WHKA 1QTWA 3S6OA 2WXDM 2VC9A 3WQVA 4UFHA 2ZRXA 1HFBA 3UR2A 3UD6A 2OQHA 1KFBA 3EOSA 3K2GA 3SO7A 4A8LA 3ERPA 4TTUA 2NVAA 1AW1A 4AY1A 4M3PA 3CWOX 4E4PA 4ZFCA 1HKMA 1KQYA 3QVQA 1JD9A 4BI6A 1HP5A 4L4MA 2XM2A 3VNDA 4XAZA 1LQAA 4JTJA 2QV4A 3OODA 4FNTA 1KM3A 4L4LA 4HA4A 3BH4A 1E4LA 3ONCA 1KKRA 1KWGA 3KHJA 1SFLA 2VM8A 2YCKX 4W5UA 2VWTA 3K4WA 1M03A 1X6UA 4A3YA 1ZUAX 5GQBA 2KZHA 2DIKA 4JN7A 3HN3A 3NOYA 4D71A 4HYRA 2H9AB 3OTRA 1U5HA 3AMCA 4Q6XA 1JPKA 1J0HA 5IDIA 4U3CA 4GC4A 2PAJA 3LQGA 5LHEA 1V6XA 4R7WA 1E6PA 4N9CA 5M3WA 2OKOA 1SUXA 5D38A 4U28A 1R7OA 4YTQA 4S3FA 3VFCA 1V03A 3KVKA 4IXXA 3TTEA 8A3HA 2ZC8A 4C1LA 1TMLA 3KZSA 3F7JA 1WUEA 2FH6A 4J35A 3VZYA 3DGRA 2WC4A 4HZ6A 4DJEC 4Q7NA 1A5UA 4M7SA 4D8ZA 1DWFM 1H7XA 2QKFA 4FLRA 3OG2A 4Q4MA 4JTEA 4GQ0A 4HU3A 4NJKA 3M0IA 1GPFA 1RAKA 2QCFA 5BOFA 4O1FA 3PZIA 1US3A 4Q8UA 5FF7A 5A6BD 1V5XA 1JDEA 3WF3A 4JQAA 2OWCA 4H7VA 1KFCA 1HJQA 4PCSA 3SIZA 3K1DA 5LXEA 1B3ZA 4H19A 4KFPA 1TJ2A 3A3HA 3RU6A 3PZ9A 1H5YA 4C6JA 1YNQA 1Z89A 3PPHA 1LDCA 2DH3A 3ABOA 4LYRA 1OABA 3LPGA 4G7EA 4EANA 3W02A 1S46A 1P5BA 5DBTA 3A9BA 3EXRA 3W76A 1HJWA 1PKLA 3S3GA 5HA7A 2NSOA 4F2TA 4IJBA 3W70A 1R3SA 3A4JA 1BKSA 1RA5A 3NSXA 3K4DA 4GNJA 4O28A 3CTLA 2A4AA 2V3EA 2VC7A 4ACYA 1SW3A 1DQWA 6ENLA