3PZOA

Structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 in complex with three maltose molecules
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila rku-1
total genus 159
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzoA00
4YN5A 3WEMA 2VZTA 1J0JA 2J7HA 3K4AA 1UKSA 4BS0A 2Z1KA 5BXPA 3GDBA 1V02A 1KBKA 2XVPA 3CHDA 5DT7A 5AC4A 2EPKX 5A8NA 2WC3A 4PTWA 2BVYA 2ZUSA 1LJYA 2FGZA 3BSHA 3CMGA 4QAWA 4H8VA 4WK9A 4V2XA 4AXNA 1NWRA 3UR7A 1BPLB 1E3XA 1CYGA 2FHBA 3IJ7A 1JXKA 3ZM8A 1W3LA 4J7RA 1R86A 1OT1A 1H09A 2XHYA 3SUTA 3AXXA 4YHEA 4XB3A 2X0YA 3CZGA 1W9BM 1J0HA 3CUJA 2E8YA 3AFBA 1E5NA 4ATLA 3MUZ1 2GDVA 1W3KA 2JF7A 4OZOA 4PBGA 1G01A 3IJ8A 5GPRA 1QNPA 2DT2A 4FF5A 1J11A 2YL5A 1KQYA 2GJXA 1CLVA 5FCZA 3LPGA 2W63A 3UG4A 4PMZA 1CTNA 3AMDA 3OZPA 4CU8A 2WKLA 3VPLA 2FHCA 4YPJA 1ZS2A 3CZ8A 3WQ5A 1VFMA 4CKQA 1US3A 3AHZA 4JFUA 1ODZA 4D6EA 3AICA 5HNNA 1R7AA 4QDMA 1C7TA 1NP2A 4JKMA 2BVTA 2XSBA 5M3WA 3VIKA 3L4VA 2CBIA 1XYZA 3B9AA 4U5KA 1V6XA 3ARVA 4U31A 1UZ4A 1C93A 3TOPA 4D71A 1W1TA 2J8FA 4WIWA 3BAWA 2AAAA 1ZBCA 4AD5A 4E8CA 5A6BD 1ISYA 3CMJA 1C8QA 3NSXA 3CUHA 1MW3A 4WLCA 2Y2WA 1V0LA 4AZCA 1LF1A 4OBRA 3AXIA 1DEDA 4ATDA 1GHSA 3GBDA 8A3HA 4XZBA 3VIJA 4TX8A 3WY1A 3EBVA 2BY0A 2PI6A 1ZL1A 4TXEA 3II1A 4MJ4A 4N0RA 4UOZA 4C7FA 1OSEA 2O9PA 2Q8XA 1J18A 1MVYA 1UWSA 3EDFA 1V3LA 2J77A 1UUQA 2MANA 1PBGA 1IV8A 1O6IA 2EJ1A 2WSPA 4M29A 3U57A 2WWDA 5EB8A 4AISA 1CXHA 3KL5A 4MPKA 1VFOA 1CGYA 1E1FA 3GH7A 3VGHA 1HKKA 3WQWA 4U33A 3VDBA 1HJUA 5CPSA 2Y8KA 4W5UA 2OYMA 3BAKA 5A6LA 4TVCA 3CHFA 1KR0A 2ZUMA 3BLKA 3LPFA 2XG9A 3JUGA 1QBBA 1EA9C 3FN9A 4PUDA 5FL1A 4B15A 2XVNA 5KZ6A 4JHZA 2O9RA 4UFJA 1QI5A 3CBWA 2BY3A 1WP6A 2V3DA 1ZJBA 1QNRA 1B0IA 5ABHA 4HOZA 4IM4A 1PPIA 3VMNA 6CGTA 3U5UA 4DUWA 3WQ6A 4JL1A 3QHMA 5FIPA 4PMUA 2CHNA 3RO8A 2EQDA 3VTRA 4JFVA 2A3CA 2A3EA 4ACYA 4HMEA 3AS0A 5ABFA 2VCBA 1V3HA 3PZTA 1W9XA 3NUKA 4MB1A 4FLRA 5A8PA 2FH6A 3VD7A 4W88A 3VILA 2A3AA 1J0YA 3DYPA 3POCA 2VVNA 2BHZA 4B3LA 2PWEA 5I6SA 1J12A 1J9YA 1WPCA 4OKDA 4CCDA 1JXJA 4DWSB 1FHDA 4P8WA 3LMYA 4KMQA 1KWGA 1M04A 2YOCA 4A3YA 3MMWA 2WYSA 2RGLA 3OLIA 1OIFA 1M7XA 4PUEA 3BLPX 1CGWA 2JFEX 1CGUA 1VEMA 5A95A 4Z2LA 2CETA 1CECA 2AMGA 3WH8A 2WVSA 4GIAA 3GNRA 1TFVA 3AIVA 1JGIA 5A94A 1JZ2A 3UERA 1QHOA 5I24A 4AZBA 1TA3A 3CHEA 1V0KA 1TZ7A 3F5JA 4HZ6A 1E4IA 3VM7A 3WFLA 5DT5A 4N42A 2VZVA 3N13A 3CUFA 1UHVA 3M7SA 3A4WA 2B31A 2NSXA 4KRUA 3RJXA 3OGRA 3LPPA 1DWIM 4UZSA 2YKKA 5DEZA 1JNEA 4HP5A 1VJZA 2EPOA 5DMYA 1UWQA 5D9PA 1SYTA 3W29A 5A6MA 3KL0A 1XD0A 4F9JA 2EPLX 3THDA 3F5KA 4QFUA 4AD1A 1KFWA 3L4TA 1B31A 4E2OA 4WSJA 1Q4NX 1C3FA 5D8WA 1HJVA 4CD6A 3A47A 4D6DA 1UR2A 1V0NA 3F4VA 1E0XA 2WZHA 4UQDA 2BXYA 5I5RA 4MAZA 2X1IA 3GYCA 2EO7A 1YHTA 2J62A 1UD4A 2CEQA 1CGTA 1LL7A 1E70M 2DH2A 5LYRA 2ZUVA 4HA1A 4PN2A 3WD3A 3AZTA 4GXPA 3S2CA 2OLHA 1TE1A 1CZ1A 1WDQA 4F66A 1OT2A 4LX4A 3QHOA 5A8QA 3AMGA 4MTVA 1XHGA 1ODUA 5GNXA 1E9LA 4D6HA 5I78A 4PMVA 3W6LA 2XYLA 3N04A 1IZKA 4RE2A 2TAAA 2QPSA 3WH5A 3UESA 3PTQA 1ZB5A 3FHAA 1B3WA 1QNQA 2WBKA 1FH8A 3VGGA 2J7EA 2D0FA 1U33A 2VCAA 4LYRA 2OSYA 1EOMA 1CNVA 2J25A 3L4YA 1RPKA 5ABEA 4HTYA 1C8XA 2F8QA 1V3JA 3SCVA 3G6MA 4LYQA 4BQ5A 1FHLA 1E6PA 3GM8A 5IDIA 2JIWA 3RMEA 2BXZA 2YDSA 3WNKA 2BV9A 4TVUA 4UCFA 4AYSA 1OD0A 1PEZA 1PX4A 3AMKA 1NP0A 3QR3A 2ZICA 1ISXA 2NT1A 2V5DA 1GOIA 3MUIA 4OJYA 4OBSA 1K9FA 2WMKA 1HJWA 3VGFA 3VD9A 4EE9A 4NF7A 5EBAA 4FLSA 5D4YA 1L8NA 3LPOA 2VX6A 1BG9A 3OGSA 1JYNA 3BH4A 1YQ2A 3L4WA 3N11A 1GONA 1K9EA 1PIFA 4PMOA 1EDQA 3IAQA 3VIHA 1XCWA 3A3HA 3EYPA 3OIHA 3VNYA 4P8UA 1TA3B 5KEZA 3BMWA 1ZU8A 3ZJ8A 1UH3A 2WVVB 5A8OA 2V3GA 5E09A 1ZJAA 2WW5A 1CEOA 1M03A 2PWFA 2PWGA 1VEOA 1XH2A 2DEPA 1AQ0A 1IZJA 4EANA 1JAKA 3VDAA 1E6ZA 3W25A 1NOFA 3W82A 3SCNA 5A8MA 1HX0A 3PBGA 3KE0A 4PCTA 3QOMA 4M80A 4JAWA 4X0VA 4HA3A 1E6NA 3L2LA 3WF2A 3SUUA 2GK1A 1XRVA 1MXDA 1V0MA 2W61A 1C7SA 4W7UA 4UNIA 3T0BA 1E5JA 3TONA 2E9LA 3WSUA 2CITA 2HVMA 3W26A 1NARA 3ZR5A 2VZSA 4F79A 3SCOA 2CESA 3EMZA 1SR0A 3WNOA 2J74A 3AYRA 4GI6A 1XCXA 2D1ZA 4GI8A 3AS1A 3CLWA 3DHUA 2D2OA 3PN8A 3BSGA 4PMNA 1JZ5A 2VNCA 3AIWA 2C7FA 1GJUA 1AQHA 4J3TA 2WHLA 5LA1A 3RDKA 4UZUA 3VU2A 1UD6A 3CZJA 1XC6A 2DT0A 2DT3A 3AXHA 4MJ2A 2GUYA 4W85A 1H0IA 3WL1A 1E0WA 1GUVA 2CYGA 1W1VA 3A4XA 1Q6GA 2VRJA 1UOKA 1MWOA 3VIOA 3ZJ7A 1E6RA 4CN6A 2ZX5A 4D6CA 1WZKA 3WF1A 2W67A 4W84A 4P8VA 3WF4A 1RH9A 4MADA 3UG5A 2CHOA 4AIEA 4J3XA 2CBJA 3CIVA 5A6SA 4OOUA 2X0HA 4Q7NA 1E43A 4GZIA 3OBAA 2VTFA 3T2OA 3VX1A 5JUVA 1CXLA 2BVDA 1UH2A 2ZXAA 2E4TA 1VRXA 5EMYA 2YJQA 4W8AA 1BYCA 5CGTA 1V02E 1GHRA 4QLKA 1B2YA 3I3EA 3SUSA 3AI0A 1BQCA 4JFSA 4UQAA 5CPQA 3ARQA 1PX3A 2O9TA 2GJRA 1V3KA 1LWHA 4DWSC 3EDEA 2XWDA 3TTOA 1V03A 1H2JA 1OIMA 2WM0A 1PZ3A 3ZSSA 4LGXA 2DH3A 4JHOA 4EAMA 1GORA 4ATWA 3NIYA 2W92A 3J7HA 1EH9A 2WLYA 2E8ZA 1GOOA 1I1XA 3HU7A 2XPKA 1GCYA 5LA2A 2YL6A 2WPGA 3WMCA 1V6VA 2A3HA 3WNLA 4ML4A 2QLYA 1UKQA 3ALFA 1KCLA 3L4XA 2QMKA 1H11A 4S3JA 2YIHA 1HN1A 1JZ3A 2D20A 2WCGA 4URIA 3NDYA 1L0PA 3OLGA 4LXFA 5C71A 4ACZB 2WZIA 3M07A 1GW1A 1W2PA 1CXFA 4BQ2A 1DWAM 3W6MA 5EFDA 2J8GA 1D7FA 1OB0A 3WUGA 1ITCA 1D2KA 1JDAA 2WANA 1LWJA 2WZEA 5CPTA 1M01A 4U3CA 2YL8A 1HXJA 1KXQA 1WCGA 1EHAA 3VGEA 4QCFA 3SCPA 1KXTA 4J3VA 1FP9A 1UR8A 2WWCA 1EGZA 2ZWYA 4Z2HA 5HPOA 1GZJA 3EDJA 3ZQ9A 4P7RA 2WB5A 3UG3A 4AIOA 2IXVA 3GTNA 1NOWA 4RL3A 3G6LA 1TVNA 3CHCA 2CPUA 4PSRA 3U5YA 1GNXA 1WDSA 4X9YA 4P8XA 4Z2GA 1CXIA 3AHXA 3VIPA 2WSKA 4AD2A 2J78A 5I2UA 2FH8A 4M1RA 2ZUWA 5GNZA 4CCCA 5BXRA 4QP0A 4UOQA 3N12A 2G3JA 3VX0A 1E0VA 1HJSA 1KXVA 2FHFA 3EDDA 2G3MA 3PZQA 2YDQA 2D3NA 5I3DA 1J0ZA 5I23A 4V27A 5IHSA 1BYBA 3A4AA 1PIGA 1X6NA 2DT1A 4E4PA 2VOTA 3ZT7A 3N1AA 3VIIA 5A69A 3WD0A 4AEFA 3MUY1 4A4AA 5C70A 4AZGA 1GOWA 5AYBA 3ZJKA 3ZSTA 3PHAA 4CVWA 1WAWA 4R5EA 2VRQA 4H8HA 2PBGA 3W24A 5CGMA 2WVUA 4NI3A 2J7DA 2WMIA 3VIMA 4Y7EA 5A6BA 3T08A 1R87A 3PZOA 2E0PA 4AC1X 3WBEA 4DUXA 1H0GA 1G9HA 1AVAA 7TAAA 1WE5A 4JFTA 1E6SM 1KGUA 1UWTA 3SCTA 4XUYA 2Y5EA 5DF0A 2VUYA 3PZUA 1UWRA 1F4AA 1W2VA 3OLEA 1WO2A 5EFFA 2WHKA 2ZX7A 1SFSA 1GVYA 4MAVA 5A3HA 1E72M 2XIIA 1XYFA 3AIQA 1RP9A 1CBGA 1PX8A 3GNOA 4OOZA 3WF0A 4KRTA 1OGSA 4AZIA 1EO5A 1NWUA 4FMVA 1V6WA 3DYOA 3SCUA 1W91A 3WELA 5AC5A 8CGTA 3POHA 1XSJA 2J47A 1C91A 1BTCA 2C8NA 2GJXB 1E1EA 3VKKA 3SCWA 2GSJA 2G3IA 3VIFA 4K68A 3WKZA 4B3KA 4CU6A 5E9AA 1BAGA 1VBRA 1J0IA 4KWUA 4X0NA 5LA0A 1HKJA 1QI2A 4KH2A 3W81A 4S3KA 3K1DA 2DDXA 1E55A 2X05A 1BHGA 3WDQA 4UR9A 4CCEA 3HJEA 3WDPP 3U7VA 2VQTA 5TD4A 2DQXA 3PZIA 1HKMA 3BMVA 1HIZA 1N82A 3AS3A 3QOKA 2X2YA 2G3NA 3BAIA 4D6IA 2ZXBA 1HVXA 4CUCA 4HZ7A 1JG9A 3WH6A 3WDHA 3WQ4A 3BAYA 3AIBA 4ZXLA 1RD6A 1WZLA 1A47A 3SCQA 4AZCB 4EKJA 3RJYA 1WDRA 5IXEA 1B3VA 3MV11 4AZ7A 4IPNB 1EIBA 3OGVA 4XV0A 1W1YA 1KB3A 2XGBA 4PTVA 3AJ7A 3TTQA 1KCKA 1H5VA 5HPCA 3VUPA 3BCFA 3NDZA 1QI3A 4B16A 3W0KA 4CD4A 4V28A 1UYQA 3QGVA 3WD1A 2YL9A 1BSIA 1K9TA 3NJ3A 2CCRA 3ARSA 2XJ7A 2XGIA 3RIKA 3BXWA 1KGXA 3WUBA 2OYLA 1OGBA 2VQUA 2WAGA 4CN1A 3TP4A 2QPUA 5CSYA 3SCRA 1W3JA 2JEQA 3T2PA 3ZO9A 4HA4A 4Z2IA 2A3BA 2J7CA 3KWXA 3ZMRA 5A2CA 4ZENA 5CG0A 1MW2A 1OM0A 3GBEA 3GXIA 2J7BA 5D9NA 5BWFA 5A2BA 4OUEA 1GJWA 3W4RA 2W62A 4W7VA 5CJ5A 4TTGA 4IISA 1QW9A 3WNNA 1V3IA 4W89A 1GQKA 3N18A 1BG4A 7CGTA 2UY2A 5CLWA 1QBAA 5D8ZA 5ABFB 3ARPA 3CZKA 2VMFA 2Y4SA 1UQZA 5IFTA 1PZ2A 1DWJM 1UZ1A 1Q6FA 3DHPA 1UR4A 2CIPA 4KGLA 1WB0A 3K46A 5I79A 3WFZA 1JD9A 1G1YA 1K9DA 1DHKA 1EDTA 1QOXA 2XM2A 5A6AA 1X1NA 1MFUA 3DECA 4H04A 1ESWA 1H41A 2Y24A 4UTFA 4JIEA 1JF5A 1B9ZA 4UFLA 5A6KA 4U3AA 4AZ5A 3ZR6A 2GFTA 2XSAA 2F2HA 1XV8A 3VD3A 3WNMA 4BZYA 1WKYA 3VNZA 3NCOA 4UQ9A 2QHAA 3MSGA 4GINA 3RM8A 3W38A 2YLLA 1C90A 2BY2A 4JKKA 4XX6A 4CGTA 4RE3A 1Q6DA 5GNYA 1LG1A 4AW7A 1B1YA 1K6AA 1LL6A 4D72A 3SEPA 4U2YA 5E6YA 4UOJA 1CPUA 1E6XM 3WF3A 2VZUA 4GQRA 1R7OA 2XFYA 1BYAA 4HPHA 3AS2A 1QVBA 3F5LA 4E8DA 5BXSA 1CXEA 5M03A 3OG2A 4AWEA 4U5IA 3WEZA 5ABGA 2ESCA 1JYWA 4WF7A 3VD4A 1FP8A 3KL3A 4PMYA 5JIWA 2WMJA 1JZ6A 4GKLA 5CSUA 2CKSA 4PMXA 1WNOA 4UFIA 2XWEA 1SMAA 3SCSA 3VGBA 4MNJA 2VURA 4F9DA 3N9KA 3PZGA 3A6OA 3WN6A 1CLXA 3CTTA 3KZSA 4M82A 4U2ZA 2DPEA 4AD3A 1J0KA 2WMHA 1BLIA 3B8SA 4CD8A 4Q22A 1FFQA 1S46A 4KGJA 1UD3A 1JI2A 3RPMA 1QNSA 1JDDA 1JF6A 2ZXDA 2JIEA 4B9ZA 3AMLA 4JCMA 2XVLA 4D1JA 1MQQA 4P7QA 4CN4A 1JYXA 4J3UA 5CXPA 1GQLA 2V5CA 3ARZA 5CQ1A 3WIJA 5BRPA 2BHUA 1C8YA 3RM9A 3EMQA 5IHRA 1U30A 3E1F1 1B3YA 1D3CA 2JALA 2VI0A 3ECQA 3WBAA 3NSNA 1EOKA 1UG6A 5I77A 3MU7A 4W5ZA 1Z32X 3T0AA 4IUGA 4HOXA 2XVKA 3BAJA 1E73M 2FDMA 3AIRA 4C7DA 1JZ7A 3EMCA 1W9PA 3MV01 2NW0A 2HISA 1W9UA 1JYVA 2BS9A 3N15A 2VL4A 1B3ZA 1UKPA 1UR1A 2AOSA 4H7VA 4PRWA 2XM1A 2WC7A 5A6JA 3SIMA 5A2AA 4DWSD 2VX5A 2G4FA 1B90A 2PWDA 4P7OA 4TOQA 2ZUUA 3AYSA 3L2MA 4NRRA 1KGWA 1OINA 2VC9A 1VEPA 4D6FA 4A3HA 1JFXA 3FHQA 4QLJA 5I0DA 3RM4A 3VO0A 5BCAA 3THCA 1JZ8A 5BROA 4AD0A 1TG7A 2DSKA 2OWWA 3SURA 3MANA 3AQUA 1JI1A 4TUFA 9CGTA 1NWTA 4WJXA 1W9DM 2OWXA 4H8UA 4LQ1A 1VFUA 1KXHA 3ARRA 4AY1A 3BCDA 1JIBA 1CGVA 2W66A 3VIGA 4GO9A 1UWIA 1VBUA 2W4XA 4P7LA 3WQVA 4CVUA 1FH7A 1DWGM 3GZAA 2J7GA 3AOFA 5A1AA 1MYRA 4ZEPA 1AQMA 3VMOA 1XGZA 2CERA 2QF8A 3AHYA 4WSKA 2QMJA 5E6ZA 2G41A 1GOQA 4HU8A 1NQ6A 1A3HA 2CXGA 2WKGA 2D24A 2CBVA 2YA0A 5ECUA 5E0CA 1B30A 1UR0A 5HOSA 2EPMX 3D3AA 4JFWA 3FW6A 3PTKA 4DWSA 2UY3A 1E4MM 4TX6A 1V3MA 4L4PA 4YHGA 1HL9A 2JF6A 4MNLA 3UCQA 4GZJA 3CZLA 4EK7A 4XZWA 5HDRA 1GQJA 2CBUA 4JCLA 4BF7A 2DSZA 2DSWA 1R85A 4DUVA 2VO5A 4L4OA 2GK1B 5JIPA 1NM9A 4J28A 2D3LA 1GQIA 1TCMA 3CGTA 2BHYA 1VB9A 1ISWA 3AISA 2CKRA 3U7BA 4W8LA 1EQPA 5AYIA 3I3DA 1MW0A 6A3HA 1XSIA 2ZX9A 5FOOA 2WCAA 4W8BA 3CUIA 2ZX6A 2EXOA 1VF8A 2VJXA 3WMBA 4BQ4A 3VMPA 3AHVA 2NT0A 5E0FA 3HN3A 2J7FA 1LLOA 5FKYA 1UD2A 2W91A 1E6QM 3PZMA 3VDHA 3D5HA 1VFFA 1JZ4A 1CIUA 1HF6A 3BGAA 4IPLA 4D1IA 1E71M 1W9VA 1XD1A 4W87A 1DWFM 4TTUA 2OWCA 1G0CA 4NZCA 1B3XA 1HKIA 4J3WA 1BGGA 1JFHA 3ZIZA 1CXKA 4RE4A 1CENA 2WVTA 3ARWA 2D23A 2IUZA 2UY4A 3FAWA 3PZ9A 5JBEA 1E15A 3SUWA 4GQQA 1AMYA 5FL0A 4MDOA 3WQ8A 3BC9A 2Z1SA 2WMFA 3UEQA 3ARTA 2WBGA 4UFHA 6TAAA 2DSVA 2UWFA 2OSWA 3ARYA 3WENA 1ZBVA 1WDPA 1OWQA 2VX4A 2YA1A 3AMCA 2E40A 2J75A 4GZEA 1HNYA 1HP4A 4M24A 3PZVA 4MB5A 5GQBA 3K8LA 4NSBA 2GVYA 3NYDA 4P7NA 4UQBA 2PBOA 4AD4A 2E9MA 1NOUA 3GH5A 1W3HA 2ZIDA 3WEOA 3T0DA 3ZJ6A 1MW1A 1HJXA 2ZXQA 3TTSA 1KWKA 4MDPA 4UQEA 4PYSA 3O9NA 2WMGA 5JBDA 3DC0A 1BVNP 2Y8VA 4FLOA 4H41A 3VVGA 2DIEA 1TVPA 4M81A 1G5AA 3VD5A 1MFVA 4HMDA 5CLTA 2XIBA 3MMUA 4TVDA 3AIUA 2C0HA 4HPGA 1CDGA 1PJ9A 2E3ZA 2E9BA 4C7GA 1BGAA 3FNDA 3WL0A 1WZAA 1ITXA 1UR9A 1QHPA 2VR4A 5D9MA 1JL8A 3MMDA 4J27A 4BQ3A 4H2CA 3M6DA 2D22A 2DIJA 3ZT6A 5BYWA 2PB1A 1JDCA 3T09A 1UD8A 3VDCA 1E3ZA 4CD7A 4AEEA 1ECEA 1EXPA 3ARXA 2YBTA 4GPNA 3CO4A 3FAXA 1LG2A 1TMQA 1H1NA 3VOCA 1GVIA 1UD5A 3ARUA 5JBFA 1JNDA 3OLDA 1OCQA 2JEPA 3AZRA 2WVVA 2BNJA 1ISZA 2WNWA 2V3EA 1I1WA 3PTMA 2VR5A 4WKAA 2WHJA 3PZNA 3W27A 3CH9A 2QV4A 3RILA 3L4ZA 1F4HA 2PC8A 3MSDA 4Z2KA 2RGMA 4ZFMA 1HJQA 1JD7A 1ISVA 3O2LA 3WD2A 1EO7A 4FLQA 2FGLA 4QCEA 2D0GA 3ZOAA 2GJPA 2V3FA 4W7WA 1WZMA 2XVGA 1TR1A 3N17A 2BY1A 4ZE4A 3QHNA 4LYPA 2O9OA 1OGGA 1DP0A 5C8BB 4PSPA 3K8KA 4GI9A 4B9YA 1UA7A 2W5FA 2DGAA 1QI4A 3MS8A 2YLAA 1C92A 1BFNA 4HOWA 1P6WA 1UA3A 4UFKA 1GOKA 3IK2A 2ZWZA 1MXGA 3M46A 2X09A 3MUAA 3VGDA 4HMCA 1BF2A 3T2QA 1O7AA 3CPUA 2WMIB 1LL4A 5M17A 3ALGA 4PEEA 3UR8A 5HBFA 4JZ5A 2XTKA 4J3SA 1UQYA 3AROA 2J4GA 2J79A 4PMDA 4PCSA 3AHTA 1E56A 3RCNA 4OIFA 4AIUA 1QPKA 1V08A 3CUGA 3L4UA 2OSXA 1FFRA 1TUXA 3CZEA 1JAEA 3GXFA 3SUVA 2ZX8A 4ZXOA 2UY5A 5M5DA 3WNPA 3TTYA 1HT6A 1V6YA 5CZKA 1FOBA 1J01A 2EPNA 1H49A 1UKTA 1XH1A 2WLZA 3WDJA 1KBBA 1MQPA 1NH6A 2V38A 4DM1A 4UQCA 2XFFA 3HMCA 3B9EA 3GNPA 4R27A 2YBUA 1VAHA 1UWUA 1US2A 2VT0A 3OZOA 4QLLA 4D6GA 1ZBWA 2XUCA 1J10A 1W1PA 3MO4A 1KR1A 1CWYA 2WCSA 3AIEA 3NSMA 1DWHM 3WMSA 4JKLA 1ZBKA 5HXMA 4AZHA 1DTUA 3EDKA 4MNKA 1VIWA 2D0HA 3K8MA 3S6TA 2ZE0A 1FA2A 1QNOA 1GOMA 2YA2A 1H4PA 3W28A 1MQRA 4W86A 2IXUA 3B9DA 1OBAA 2ZOXA 4WKHA 2F61A 1IT0A 5IFPA 5DFAA 1E4LA 3WUEA 2OYKA 4CD5A 1RP8A 3GXMA 1EDGA 3GXDA 1Q6EA 4JL2A 1BVZA 1G94A 1R8LA 7A3HA 4UFMA 4BA0A 3OB8A 1HL8A 2GDUA 3MKKA 2O92A 3WH9A 2EBNA 3I3BA 4ACZA 4DM2A 4GO8A 4BCEA 1NWSA 5DO8A 3OA5A 1VENA 2DSUA 4MB4A 1SMDA 4PMRA 4MNMA 5F7UA 4NRSA 2CNCA 1EHNA 3WDRA 4PTMA 1W32A 3FY1A 1HVQA 3APGA 4AZ6A 2XFRA 1E4NA 1H3GA 4HZ8A 2PWHA 3UETA 4MB3A 3IANA 1QW8A 4WKFA 2WK2A 3DYMA 1Y7VA 1X6LA 4W93A 2YDRA 2VCCA 4F8XA 5FD0A 3IAPA 3WUFA 5BXTA 2VX7A 3W53A 3VM5A 2VZOA 5BRQA 3KEHA 1HP5A 1XSKA 1Q6CA 1VJSA 1I75A 1EQCA 1LQ0A 1BYDA 1QI0A 4Z2JA 4ZE5A 3WH7A 3TA9A 2ZUTA 3AZSA 1V6UA 2EEXA 3O6AA 1U2YA 4M56A 3WDIA 1FH9A 3VINA 1E40A 3GH4A 3FXYA 3IJ9A 2X8RA 2WHMA 4PTXA 1M53A 2ZUNA 5D9OA 4PMQA 3BAXA 3ZT5A 3W37A 3K4DA 4FK9A 2BFGA 1OD8A 1GPFA 2G8ZA 1KQZA 1UH4A 4AMCA 3WD4A 1UKOA 4CU7A 1CGXA 4D6JA 2JE8A 5AY7A 2PF0A 1QHZA 1PAMA 2VVSA 1XH0A 4LPCA 2WXDM 4M8UA 5E70A 2VRKA 4HU0A 2WC4A
chains in the Genus database with same CATH superfamily
1M9HA 2VZTA 3D0CA 3BSMA 2VFDA 2Z1KA 3GDBA 4O19A 3CHDA 5DT7A 5AC4A 1VZWA 2WC3A 3BSHA 3CMGA 4LJ3A 4H8VA 4V1XA 2FDSA 3G1VA 1BPLB 1KM3A 4QBXA 3R4IA 9XIAA 4G7EB 1H09A 2XIJA 3RAOA 3AXXA 1W8SA 1I2OA 2X0YA 3EWYA 1W9BM 1J0HA 3OIXA 1OQFA 3V5OA 3M0VA 1E5NA 4Z1YA 2GDVA 3G24A 4PBGA 1G01A 3H21A 4LCRA 2FJKA 3IJ8A 3KVLA 3AU6A 3H54A 2OODA 1F3WA 1NTHA 3R12A 5EKYA 1KQYA 4XIMA 1R9ZA 1CLVA 3R25A 3GC4A 4MYXA 3UG4A 4PMZA 5AECA 3AMDA 3LXBA 2PCEA 1XS2A 4CU8A 4X2PA 4NY2A 3NOEA 3C0LA 2ISVA 3GFYA 1XIHA 3AHZA 4D6EA 4MGGA 4PUWA 3AICA 3LTYA 4PBEA 4QDMA 2DUZA 2XSBA 3SJNA 3L4VA 1V6XA 4IX2A 3CMFA 3TXVA 3OO2A 3QM3A 3TOPA 4YTTA 4D71A 3P6LA 2J8FA 4KWWA 4WR3A 3HQPA 1ME7A 1O68A 1ISYA 4WLCA 2H8ZA 1HUVA 1LF1A 2WOQA 4JIRA 3AXIA 5EMJA 1G67A 3UXKA 4H8NA 1A5CA 4A22A 2OEJA 1EFZA 3TNOA 2PI6A 3WBXA 3ITGA 4MJ4A 4UOZA 2ATSA 3LG3A 2HEJA 1J18A 4QXIA 3ITXA 1UWSA 3IJQA 4OE7A 1HG3A 3T4CA 3G2GA 2J77A 4QEHA 3HZ3A 4G8TA 5E5CA 2UZ9A 4ILSA 2QXWA 2EJ1A 2E5CA 4GYJA 4K39A 3U57A 2Z1XA 3M0HA 1L6GA 1H50A 4WY0B 5G2IA 1CXHA 1MZHA 1F3XA 2NLIA 1RAKA 2VFGA 4N7QA 4RW3A 1X8CA 5HNRA 2P53A 3NZPA 2P76A 1QU4A 1EF2A 1OFQA 2XN0A 4RDYA 1G4SA 4DBWA 4N2YA 5A6LA 4MZ8A 4TVCA 3CHFA 1QBBA 5FL1A 3KDOA 4YLWA 5KZ6A 4H1ZA 3WJYA 2ZC8A 4AF0A 4EPBC 1QNRA 4G2DA 1WA3A 1B0IA 3CASA 4IGHA 4IM4A 2L5HA 4Z42C 6CGTA 2DW6A 4JS3A 4DUWA 3EOOA 4JL1A 2NVCA 3WQ6A 2FTWA 3B8UA 2C14A 3QHMA 1FDYA 4PMUA 2CHNA 3VTRA 4JFVA 2I7GA 2A3EA 1UPPA 2A6NA 2ISDA 2FZDA 2VCBA 1V3HA 2Q71A 3PZTA 1AW5A 4M7SA 1XIDA 4FLRA 4EXQA 1VBGA 4S2CA 4W88A 3Q45A 4S1FA 4XD3A 1A5KC 5DX7A 4A6GA 1Y8BA 4PL1A 2DW7A 2ZVIA 3I10A 3IJIA 4IQEA 3LV5A 4IG2A 1FKXA 2VVNA 3DKLA 2PWEA 5HR6A 1S3HA 1OK6A 4UIOA 1R5YA 4QJ5B 2Z26A 3PPGA 2XH7A 3ITVA 2E28A 3MMWA 4K38A 4NJHA 4KEVA 1NEYA 2RGLA 3OLIA 5KITA 5FA5A 4JQ1A 1KM0A 3V3WA 2BGSA 1XLHA 2CETA 2HJPA 2WVSA 3K2GA 3GNRA 1I4NA 1W37A 2PE4A 1JGIA 1JZ2A 4FNPA 1SZEA 5I3GA 1QPRA 4ZQNA 1ITQA 5FJUA 1UR3M 3M7WA 2FB2A 4JY9A 2E77A 4PTDA 3QMRA 5DANA 3I6EA 3MVTA 3W84A 4DJEA 4U10A 3VM7A 3CYJA 1UHVA 3M7SA 3A4WA 2ZRZA 1LLWA 5AHEA 1O4UA 4KRUA 3MKVA 2QUNA 2A5HA 2YKKA 5DEZA 1JNEA 4HP5A 4XTDA 2EPOA 5BNKA 4LAMA 1ZQ5A 5D9PA 1SYTA 5A6MA 3C2OA 3S6OA 1XD0A 4F9JA 3THDA 4FOUA 4QFUA 3GIPA 4XD6A 1HKVA 2AKZA 2J9YA 3CS2A 1TUFA 2XU2A 3UXIA 4P5UA 3T0CA 1Q13A 4FNTA 2FKPA 1V0NA 2FTYA 3TA6A 2FPTA 4J2MA 3LQGA 2X7WA 3TQPA 2CEQA 1WKEA 4QSHA 1BQGA 3VKJA 3LHZA 1LL7A 4LVAA 3AZTA 1IXQA 3RUBL 1W3NA 3CAKA 1CZ1A 1OT2A 4QROA 2XN1A 4QR6A 3KWSA 5CG7A 4MTVA 3GG8A 2GVGA 2REQA 3QC3A 3W6LA 3CV6A 1IYXA 1REQA 1BD0A 3W2LA 3TAOA 3LOTA 3FHAA 1B3WA 4X3ZA 1QNQA 1FH8A 4LYKA 1KM4A 4HK6A 3NQ7A 4NU7A 5GJNA 1RPKA 4BWLA 4HHHA 3VOHA 1FHLA 4YWSA 1F07A 3UR2A 2Z27A 3APTA 4S3AA 3U48A 1FRBA 4XD5A 3W7DA 2JIWA 3OQ8A 3SY1A 3M43A 1KV8A 1K77A 3T4WA 2QCMA 3MUXA 3AMKA 3N4FA 2ZICA 1ISXA 3MUIA 1GOIA 3L0NA 1GG1A 2PDUA 2AQVA 4OBSA 2XH2A 3MJYA 5C2XA 1HJWA 3VGFA 3WJXA 1A49A 4EE9A 2VOMA 4LS2A 4FLSA 4HSHA 4HHMA 3LPOA 2VX6A 4B5VA 3M6YA 3CB8A 1GONA 1PIFA 3VOGA 3W7QA 4PMOA 1FWHC 1XCWA 3A3HA 1JPIA 4MJZA 3OIHA 3SQLA 3NAVA 5KEZA 2ZDSA 3BMWA 4L4MA 1UH3A 4RNHA 2ZVRA 5AOUA 3GIYA 4PB5A 3CTLA 3NQDA 3BLDA 4LTSA 1XH2A 1IZJA 1XRSA 1AFSA 1F3EA 1JAKA 3VZXA 3VFCA 5HWMA 2HWGA 5C9ZA 4GISA 1HX0A 3PBGA 4DF1A 4M80A 2XINA 2QPXA 4X0VA 4RKAA 2PDCA 2YSWA 3DG3A 1YDVA 5C0QA 4C5ZA 2X1UA 2OKOA 4X60A 4DNHA 3W02A 1C7SA 4UNIA 3T0BA 5FAJA 1UIOA 1S5VA 2CITA 4MLRA 4DQWA 3KVMA 2HVMA 3GR4A 1NARA 2VZSA 3SCOA 3SRDA 3VYLA 1QDSA 1SR0A 1SJBA 4RNJA 1XCXA 2D1ZA 5BZAA 3DHUA 2D2OA 1YPXA 4MFDA 1XLMA 3R89A 3AIWA 1ONRA 2ZKMX 3E02A 3VU2A 5FEXA 1XC6A 2R82A 2DT3A 3AXHA 4MJ2A 2Z2BA 1RPXA 4LT9A 1E0WA 1GUVA 4B92A 4C6KA 1UMLA 4Y9OA 5FJPA 4FEZA 5AC6A 1SU5A 4GYKA 4M7TA 1E6RA 2PDPA 2ZX5A 4QQ3A 4CN6A 4D6CA 1W8GA 3WF1A 3PAJA 4LAOA 3V4BA 1RH9A 2VFEA 3UG5A 4AIEA 3KZPA 1WXYA 3CIVA 4H00A 3SY8A 1SO6A 5EGRA 1KFCA 1RXOB 4H19A 2FGBA 4DXVA 1AH4A 3QYQA 4NJJA 4NHVA 3GDKA 4F0RA 4W8AA 3BVJA 1GTEA 1NFBA 1W3IA 2E1DA 5CGTA 1DIEA 3A9IA 3EX1A 3I3EA 4RV8A 2E09A 3ARQA 2Z00A 5A8GA 3LCFA 3JR2A 3D46A 1LWHA 2FVLA 3MC5A 2PRHA 4ONVA 1NJJA 4H7ZA 4E2DA 3TTOA 3GXTA 3S2MA 3AYVA 4O28A 3D6NA 4LGXA 2ZRVA 3J7HA 1Q66A 3LI1A 4I3GA 1EH9A 4NAFB 2E8ZA 1I1XA 2X30A 5I07A 1T99A 2NQ5A 1A0EA 4RW5A 3WMCA 1I2QA 2HXTA 4HZMA 2ZRXA 3STEA 1POJA 2QLYA 1QR7A 5CSRA 3W1QA 1L0PA 5C71A 2HK1A 5U4NA 1DWAM 3W6MA 3NPUA 1OZQA 1ZNNA 1OB0A 1NF7A 2PDMA 4JQ4A 1VYSX 4FF7A 5CPTA 5BU6A 3TSMA 1M01A 1PWMA 3DERA 3QGKC 1WCGA 2GGJA 4O1BA 1EHAA 3VGEA 4QCFA 3V0UA 3B0PA 3WQDA 3VABA 5HPOA 2HNEA 1SFLA 3C2EA 4U4MA 5C9UA 2IXVA 3N19B 3GTNA 2AQOA 3EWDA 3G6LA 4C60A 4PSRA 3CEPA 3EGJA 2WSKA 2HDJA 3NGJA 2J78A 4ZO9A 5G1TA 2ZUWA 4JIHA 2FZ8A 4WD0A 4DI9A 3N12A 2G3JA 4R85A 2VFHA 1HJSA 3E0LA 5D2TA 2NLYA 1OF6A 2YDQA 4YIWA 2D3NA 3O7UA 5HA7A 1J0ZA 5I3DA 2DZSA 1KFJA 1KW1A 4LUYA 5I23A 3ABSA 3ZYZA 3GK0A 4E4PA 1OX6A 3GW0A 3MY9A 4LBRA 3N1AA 3CPRA 3N14A 2BVWA 4JGDA 4L9YA 4A4AA 5AHMA 5AYBA 3BOXA 1K8CA 2WV8A 3PBMA 2HE5A 3DENA 2I1OA 5CPOA 4KESA 4QNEA 4LSBA 4YYCA 1G7VA 1LBLA 2HVNA 3MHGA 1DXIA 2VDHA 4IQLA 1XLJA 3NDOA 2E0PA 4O15A 1XIBA 4ZCWA 4DUXA 1AVAA 4NX0A 3PSWA 2A3LA 3INPA 7TAAA 5DF0A 2E25A 1W2VA 3OLEA 2WHKA 2FFIA 4RZBA 4OECA 3QGAC 3PJUA 1L9WA 1XYFA 4JX5A 3M64A 3NQBA 3OBEA 3AIQA 3OEXA 1A0CA 3E0WA 4IPIA 3GNOA 4KRTA 1TO3A 4R9XA 4C6DA 4FMVA 2OT1A 5AC5A 3G1DA 3POHA 1XSJA 4DAIA 3WQEA 1BTCA 2BGQA 1C9WA 4RR4A 2POZA 1PV8A 3UCDA 5E9AA 2W27A 3WLNA 1BAGA 1VBRA 3QW4B 3H6OA 1VS1A 1HKJA 1RQHA 5L6UA 5CAKA 3S0CA 3K1DA 4RLIA 1KBIA 1E55A 2YYTA 3MVIA 6ALDA 3HJEA 3WDPP 2VQTA 5TD4A 1HKMA 2CZEA 1TV5A 3QOKA 4GQBA 2G3NA 3BAIA 4XUGA 2Y85A 3W1LA 4O14A 4AMAA 3GY1A 3Q94A 3UG8A 3WH6A 3WDHA 4PFMA 2BX7A 4S23A 5CC6A 4ZOBA 2G50A 1YPIA 5G1MA 4JOMA 4LUTA 4IQDA 4L61A 1J2WA 5LIWX 2OLSA 3OGVA 4TMBA 1W1YA 2XGBA 3NXLA 4C5YA 3BMXA 4BI5A 4UR7A 3VNIA 1VIZA 1OF8A 3BCFA 3U4AA 3NDZA 1RBLA 2Q01A 4JTAA 3MB9A 1QI3A 4B16A 2ZE3A 3TZFA 3NR0A 3WD1A 3EA3A 2HPIA 4UTIA 1BTMA 6ENLA 3C2VA 3UW6A 1YXCA 3E74A 3ARSA 2XGIA 1ZJIA 3E2VA 2OX1A 3NQAA 3WUBA 1WXJA 3LBOA 1SJAA 1OGBA 2WAGA 3TP4A 3BLLA 3UGRA 1W3JA 3PPFA 3S5NA 4HA4A 4TMCA 1MEWA 2DVTA 2A3BA 3C0SA 4QE1A 3KWXA 1JPDX 1OM0A 3GO2A 2ACQA 1LQ2A 5CC5A 2TODA 4OUEA 1GYLA 1TMHA 5CJ5A 4TTGA 1GQKA 3N18A 4RNIA 3W88A 1BG4A 4N9EA 1PCWA 3AO0A 7CGTA 5CLWA 4OGZA 4Z0SA 4H9MA 3ARPA 1TIMA 4QSFA 3AC0A 7REQA 3DHPA 1WB0A 1RBOB 1G1YA 1QK2A 2XM2A 1MFUA 2PDHA 4WXYA 6PTDA 4JTLA 1ESWA 1RR2A 5C9RA 4ZQMA 2WJDA 2Y24A 3B9OA 5KSWA 1RK5A 1OVDA 4EP8C 1DQXA 3WNMA 1WKYA 3ABQA 1TRDA 3RM8A 2YLLA 2HSAA 1M7JA 1Q6DA 1R3RA 1LG1A 4KEMA 2G0WA 3G8EA 2V30A 3GVGA 4DPPA 5HWNA 4U2YA 4KQNA 2DU2A 1RALA 3WK1A 2OGJA 2EKCA 4EX4A 2XFYA 1AJ0A 3WLSA 5ABGA 4BF5A 3N4EA 1FWJC 3KL3A 1L2QA 2WMJA 2OU4A 1IR1A 4GKLA 1WNOA 3GX9A 1SMAA 4Q7BA 3VGBA 1H60A 2VURA 3PZGA 3A6OA 1DXFA 1Y5WA 1YXDA 3CPGA 1LRNA 5BU9A 3KZSA 1J4EA 2NUWA 4AD3A 1TPFA 3B8SA 4Z0JA 1FFQA 3DH7A 1GT8A 1UD3A 1JI2A 3RPMA 5K3VA 1JF6A 1U22A 4M6PA 3UWQA 2HTMA 4B9ZA 1YDNA 4UNLA 4WX2A 3CL6A 1GGOA 3RR1A 4HA0A 2GUUA 3Q37A 3JVAA 1PKLA 3WLHA 1GQLA 3DC8A 4GWEA 2V5CA 4A21A 2D69A 1Z3NA 1FHUA 2Y1HA 5BRPA 5KETA 7ODCA 2H3BA 3GR8A 5IHRA 1K02A 1U30A 1B3YA 1D3CA 3EWWA 4LV9A 5TNVA 2PDGA 3ECQA 4QJ4B 1D9EA 1VYPX 3DFOA 3NSNA 1YX1A 5K9CA 5I77A 1ADDA 3OYXA 3G8RA 5G5IA 3DIPA 4C7DA 4JTJA 3P82A 2PAJA 2OR2A 1JYVA 5RUBA 1UR1A 2OXNA 4H7VA 1Q7ZA 1FKWA 3RO6A 5A6JA 2REQB 3SIMA 3VUSA 2ZTJA 1J6PA 4HK7A 5TQLA 1REQB 4DWSD 3ABRA 3VOIA 1B90A 3UT0A 1U5HA 3AYSA 3A22A 4DWDA 1KV5A 3I65A 5I0DA 4PR4A 4PRTA 5JH2A 5BROA 3KCJA 1YE6A 3PAOA 1B4EA 2VDGA 3QTGA 1EIXA 1KXHA 4O11A 3UJRA 1TQXA 2ACRA 3KOFA 3KTSA 1JIBA 3UF9A 4XAPA 1EYEA 2VENA 4GO9A 2W4XA 4CVUA 1FH7A 3UNTA 3LSBA 3S46A 1DTNA 5LXXA 4EIVA 5A1AA 1XRTA 4ZEPA 2QIIA 3AHYA 5E6ZA 1TMLA 2G41A 4HU8A 2CXGA 2X0SA 1W5QA 1I2NA 2I16A 4Q6XA 3UJEA 1W1A1 1PTGA 2D24A 1XF0A 1EJTC 2YA0A 4HCDA 5CC7A 3PWAA 3W7IA 4HPJA 3DI0A 1GYMA 2UY3A 3GXPA 1E4MM 3NO1A 1V3MA 1EC8A 4AU0A 3OJGA 1XG3A 3E5PA 4J35A 1HTIA 2GVLA 2CBUA 2OQLA 1JDFA 2DSZA 3WK0A 4J28A 3MP5A 1GQIA 3SECA 3O6YX 3CGTA 4DHGA 2BHYA 1H5YA 2RAGA 4YMZA 3BPWA 5G4HC 4KPLA 2ABAA 2RFGA 1MW0A 1PVNA 3L0GA 4W8BA 2EXOA 3RLUA 2CLEA 4P2VA 1TRIA 6XIAA 3VMPA 2B7OA 2NT0A 2J7FA 3GNDA 4B5UA 1E6QM 4DBSA 3D5HA 1JZ4A 1CIUA 4IPLA 3FLUA 2NVAA 2BG5A 4GI4A 1G0CA 4MUZA 5I3IA 1B3XA 1JFHA 3ENLA 1XQLA 4RE4A 4PMJA 2UY4A 3URQA 3R5EA 3SN4A 1H51A 3FAWA 1K7EA 4K8EA 1E15A 2C79A 1SJDA 2ZZ7A 4GQQA 1TZ9A 1K7XA 1X8FA 3D47A 1FWRA 3BC9A 4H9UA 1XDMA 3GVWA 4HT3A 3ARTA 1DQUA 3BANA 1Q8JA 4K2SA 1AK5A 1K03A 2PP3A 5J5RA 3W7NA 1ZLPA 6TAAA 1EXBA 4FI4A 3EX2A 3BOLA 1WXZA 2Z2UA 4LVFA 2VX4A 2YA1A 4DPQA 2NV1A 2E40A 2J75A 5CSSA 1HNYA 5D38A 3PZVA 2QUMA 3JZEA 3TFCA 3W86A 1R3WA 4A2SA 3NYDA 4P7NA 4UQBA 2PCQA 3M16A 2HQAA 3PM6A 1LORA 3OZMA 1P6CA 4AD4A 2TPSA 2E9MA 3W74A 1NOUA 3GH5A 4I9TA 3WEOA 1RCXB 1MW1A 3FJNA 3TTSA 2Z7GA 2ZRYA 4MDPA 4PYSA 1JCLA 2TMDA 5JBDA 1S2AA 2Y8VA 4FLOA 3W1XA 1K7FA 3LCWA 2PTDA 4HTBA 4M51A 5DBTA 2ODOA 5HJXA 1HZYA 1MFVA 5KZDA 4YYFA 2C0HA 4HPGA 1CDGA 4EF8A 3KAOA 3FNDA 3WL0A 1ITXA 4ADUA 3R0KA 3SSZA 1UR9A 5D04C 4ASTA 4O1EA 3TYCA 2CW6A 5D9MA 1JL8A 3CUZA 1TPH1 3REQA 2DQWA 4QM1A 3W7MA 3ZWSA 4UTLA 4D8LA 3MKCA 4GPNA 2F38A 3SO7A 5LSMA 3FAXA 1LG2A 3G1SA 1H1NA 4IIEA 3DUGA 3VOCA 4E4UA 2PLKA 3C2YA 4Q8UA 3OLDA 2OZ3A 2WVVA 4YU1A 2GGGA 2BNJA 5CGQA 1YTEA 4WDTA 4I8YA 3PZNA 1A5AA 2PC8A 4QITA 5REQA 3UD6A 3GU2A 1JD7A 3DKJA 1EO7A 1ZAHA 2P50A 1SVDA 3EXRA 4QCEA 2O7QA 4DO6A 3PNZA 2XVGA 2ALRA 4ZQRA 3RRXA 1DE6A 1DL3A 5AZ1A 2PLMA 1UA7A 2ZQ0A 1L6SA 4I9AA 5D2WA 1XIFA 3QPZA 1P6WA 4QHRA 3O16A 4UFKA 1DXEA 4HYWA 1GOKA 1P7TA 5I06A 3NNTA 3M46A 3MUAA 4DJFC 5C6MA 4HMCA 1BF2A 4LEQA 3WJWA 3TE9A 5XIMA 5BOFA 4JZ5A 1S5NA 5AB3A 2AAMA 4O4VA 3U0HA 3M0XA 1EGVA 2J79A 4NZ1A 1ZCCA 1PDZA 1V08A 3WJSA 1FFRA 2V2CA 3SUVA 4JYDA 2QUTA 2ZX8A 5AFDA 2INEA 3NXFA 1QOQA 5CZKA 1FOBA 2YFNA 1K8YA 1H49A 1B3OA 2QV5A 2WLZA 4LWWA 4DM1A 3FJ6A 3VAVA 1QMLA 3VZYA 3F2BA 5HMEA 1RJRA 2DZPA 3GNPA 3I4KA 2YBUA 3BDKA 1VAHA 1UWUA 4UNKA 4EPKA 3OZOA 1ZSXA 3KTXA 1J10A 1YIXA 3MO4A 4V1YA 1P1MA 1CWYA 2F6KA 4GG9A 3AIEA 4JTEA 3NSMA 3ANUA 4NJGA 4JKLA 3STGA 4IH3A 3T6CA 1XDLA 5EU9A 4MNKA 3K8MA 4GVGA 2ZE0A 3CYVA 2FQIA 3FGCA 2V0TA 4YXGA 1MQRA 3GVQA 2IXUA 2PRLA 4V15A 4ERAA 1YDYA 4LBSA 2OYKA 3F2DA 1RP8A 1W54A 2HBXA 4YL2A 4PB4A 3TX9A 1Q6EA 5AYXA 1WX0A 7A3HA 1UJPA 2NWSA 3MKKA 4LUTB 3F03K 2DZTA 4BCEA 5DN1A 1H1ZA 1VENA 2XH4A 3WBWA 2VGIA 1AG1O 4AWTA 3WDRA 1XWYA 2P0OA 3PBYA 3B0UX 3H12A 3APGA 4AZ6A 2XFRA 1DQWA 1E4NA 3BGJA 3UETA 3CIWA 2J13A 3IANA 3U2EA 2WK2A 3DYMA 1RA0A 1X6LA 1SR9A 2VX7A 3W53A 3VM5A 4ZOCA 3UWEA 2VZOA 1M65A 3ABZA 3IUHA 1R47A 4GJ1A 1XSKA 1Q6CA 3CC1A 4EWJA 1RLDA 3LTPA 1TREA 1KM6A 4GGHA 2IPWA 4UC5A 2EEXA 5CPMA 3WDIA 1FH9A 4GVFA 1VRDA 2Y89A 4H01A 2Y5JA 3LX9A 1WAUA 1XI3A 3T42A 4PMQA 1OY0A 3PG8A 4XSMA 2G8ZA 1KQZA 4QIUA 7REQB 4G9PA 3B8TA 2CLIA 3QR0A 3WBYA 3TUUA 4F40A 1AL7A 4OWGA 4LPCA 4M8UA 2CLLA 4RDVA 4LUSA 4I7VA 2GWNA 3WEMA 2J7HA 3A5FA 1F6YA 1UKSA 4BS0A 5BRBA 3KRUA 1UP2A 2BOFX 3GVRA 1LJYA 4V2XA 4AXNA 3UR7A 5ABTA 3CQ0A 3A24A 4MYAA 1TTJA 4J7RA 2RDUA 2XHYA 2AGTA 4JY8A 2W3ZA 4XB3A 1ENUA 1OFEA 2W6RA 3RPTA 2P88A 3SN0A 1W3KA 4XZ9A 2JF7A 3Q65A 4HPNA 1QNPA 1J11A 3V1HA 4MUPA 4R33A 4J40A 3LCXA 5GVJA 2W63A 3IIPA 3VPLA 2FHCA 4R3UA 3GYEA 3LBCA 3MI3A 1PTDA 4X22A 1ZS2A 3CZ8A 3FSTA 2JQXA 1TPWA 1Q85A 3HG5A 5IBXA 5HNNA 4YTRA 1DJNA 1C7TA 4JKMA 5M3WA 3B9AA 1XYMA 3HQ1A 4U5KA 5G4WA 3VKBA 3ARVA 4RX0A 1I45A 5CH9A 3KLKA 3W7CA 4H9TA 1W1TA 4OHQA 3SDOA 2AAAA 1M6JA 3S5YA 3DG7A 5D02A 1QWKA 3CMJA 3NO3A 4E38A 2GWGA 3CUHA 1V0LA 3TFXA 4U28A 1DEDA 1GHSA 3GBDA 4FXSA 4XZBA 4TX8A 2VHLA 3WY1A 2Y63A 3EBVA 3WLIA 4GFIA 1EUNA 1KTNA 4AG0A 4IGSA 1OSEA 1MVYA 3EPMA 4XZIA 3TSBA 4PUKA 2FZMA 3RX4A 3FIGA 1TV8A 3L67A 4NJKA 3G3DA 4C6CA 3LEPA 4HNOA 1VFOA 1G7UA 5EMKA 4GYPA 3VGHA 2P3ZA 2VD8A 4HIBA 3TLQA 3BGGA 4U33A 3TXZA 4CNNA 4ZOAA 4DN1A 1I8JA 2V67A 4W5UA 3BAKA 3LN3A 2ZUMA 2GQAA 8XIMA 4PUDA 5FF2A 4GNKB 3LYEA 4UFJA 2OZTA 1QI5A 3BW2A 2BY3A 4IMEA 1FUYA 4Q8PA 5E1QA 3UZYA 3VMNA 1W1IE 4MZYA 1C8VA 4HVXA 3EKGA 2MUCA 3RO8A 4AAJA 1FWBC 2OMAA 3LGDA 3ZLHA 2A3CA 1R46A 1W9XA 1EP3A 1TPVA 4IL0A 3MCMA 5EMUA 4QQUA 1ZHAA 1ECQA 5T26A 3WLRA 2A3AA 3MP3A 5AZ0A 3KBNA 4Q4KA 1YPFA 4QGCA 3B03A 2HROA 5I6SA 1EGMA 1CCWB 1WPCA 4OKDA 1OX5A 1HL2A 1THFD 4P8WA 2ANUA 4KMQA 3K1GA 1PSCA 2C1IA 4ICNA 2VGBA 2WYSA 1T0OA 1BWKA 5T91A 1M7XA 2BOGX 3EWZA 2HRWA 4IIDA 4EXAA 1CGWA 2JFEX 1CGUA 3MYOA 1KFEA 1SFJA 1VEMA 1TPUA 5A95A 4Z2LA 3B9NA 4GIAA 3BG5A 1EEXA 2DFAA 1TFVA 2QQ6A 3W85A 1AH3A 3LZ3A 1TZ7A 1D8WA 2Z4GA 3NZGA 3BG9A 3WFLA 1DIKA 3NA8A 3N13A 2RDTA 1V93A 1LROA 1R3SA 4US5D 2B31A 2XFWA 3B97A 2WZTA 3QH2A 1GKRA 4WVXA 1DWIM 1VJZA 5DMYA 2OO6A 3BG3A 4WDXA 2PDXA 5AC8A 3KL0A 4QJ3B 3W7EA 2PS2A 1T8QA 4DZAA 3C8FA 1ZP3A 1GVRA 3USZA 3KBWA 4I8DA 5D03A 1C3FA 3H2NA 4TU1A 5D8WA 1HJVA 2PURA 4CD6A 3S5ZA 3W00A 2YGYA 1FWSA 4NG3A 3V18A 2BXYA 3E0VA 4MAZA 3VC5A 3GYCA 5FESA 1A80A 2J62A 1ICQA 3M5XA 1CGTA 1ZENA 5CBIA 2AKMA 1E70M 2DH2A 2ZUVA 4HA1A 1R3YA 4YVVA 3NQ8A 4RZ4A 3M0YA 4GXPA 4QJ1A 2PZNA 1NFPA 1WDQA 4F66A 3GFZA 3QHOA 3ELFA 3UPBA 1XHGA 1ODUA 3KOXA 1E9LA 4K36A 3W01A 4CNPA 3VKCA 3N04A 2CLPA 1UOZA 2OOGA 3UESA 2I56A 3PTQA 1ZB5A 4ROQA 4DBEA 2A7NA 3IRDA 4CCZA 2VCAA 4PH6A 3U9IA 2OSYA 1EOMA 3H7VA 5J8LA 3L4YA 4F3HA 4Q8QA 5ABEA 3CAVA 3SCVA 2PEVA 4C6BA 2QJGA 1E6PA 3GM8A 5IDIA 1GTHA 3G0XA 2BOEX 3C56A 3RMEA 2BXZA 4L1WA 4NVTA 1K4HA 1PDYA 2BV9A 1HKWA 2RKXA 3I7QA 4AYSA 1OD0A 1PEZA 2PDJA 1PX4A 4PL2A 2YYUA 3REQB 1IT7A 3BCJA 1OHLA 2NT1A 2V5DA 4OJYA 1TX2A 2ZZ5A 3PY2A 2PA6A 3WCZA 3VD9A 3DFNA 4NF7A 2DZVA 5EBAA 3OGSA 1NIUA 1N2VA 2GVJA 3BH4A 2CFFA 1OFOA 2QCDA 3LHUA 2BBFA 1TA3B 1XXXA 1ZU8A 1CLKA 2WVVB 5A8OA 2V3GA 5E09A 1ZJAA 5LHFA 1MUCA 1U1UA 1M03A 3KFTA 4N9DA 1X96A 1VEOA 1XLKA 3K30A 1E6ZA 3W25A 5REQB 1T7LA 5A8MA 4EVZA 3LCGA 2NV9A 3QOMA 4JAWA 1AW2A 2WJZA 4HA3A 1IZCA 1F9CA 2GK1A 1XRVA 2EPHA 1MXDA 2W61A 4W7UA 2YW3A 1E5JA 1B9BA 4CNOA 3CQJA 1TWWA 5B7ZA 2CESA 1SSDA 3EMZA 4GI6A 3LV6A 4GI8A 1NSJA 1P7TB 3BSGA 1W17A 3TQVA 1JZ5A 4ADTA 4XVEA 2C7FA 1GJUA 4LAUA 3VKDA 1UD6A 4QEEA 4LF2A 1OFAA 2ACSA 1XKJA 3C86A 1AW1A 1H0IA 1IWPA 2WO5A 2CYGA 5G2HA 1OYAA 1MWOA 1SZGA 3W2KA 1EWEA 2W67A 2WKJA 4M3PA 1GVSA 2CHOA 3STFA 1HFBA 3RX3A 8TIMA 3LRLA 5A6SA 4OFCA 4Q7NA 3OBAA 4ZMGA 3P0WA 3BQ6A 2BGNE 2VTFA 3VX1A 5U7SA 1QPOA 5EL1A 1SM9A 2VWTA 4MKNA 3D3FA 5EMYA 2YJQA 4YTSA 3CV1A 3TYEA 1GHRA 3TMQA 3SUSA 1EZ2A 1BQCA 3ITLA 1PX3A 1Q5MA 2O9TA 3DX5A 3W23A 1V3KA 2R1NA 3NEVA 3NEHA 3N4AA 3KOYA 3QW3A 1QJWA 2Y8UA 4HSNA 4PB3A 5DCDA 1PZ3A 1C29A 2OELA 5JVLA 1GORA 3FGCB 3GTFA 3H7RA 1EC7A 1PS9A 3DEQA 3QSRA 1A4MA 1GOOA 2XPKA 3BTNA 2YCKX 4Q3MA 3NQCA 5LA2A 2WPGA 1E1CA 3SRKA 4A3UA 2BODX 3WLMA 1V6VA 2YX0A 3COTA 2A3HA 4CQCA 2O55A 3V35A 1UKQA 4YTQA 3SZ8A 3EKZA 1H11A 2ISFA 4S3JA 1DVJA 4UXDA 3RLGA 3H2FA 2D20A 2WCGA 4QDPA 1TCDA 2WZIA 3M07A 1LYXA 4BJHA 1XLEA 4TV6A 5C7HA 3G1YA 5EMLA 4BQ2A 3TN5A 2OLAA 2J8GA 3U6WA 4GC4A 2WQPA 4OT7A 1XKYA 1D2KA 2WANA 3UP8A 3CEUA 2D73A 2HNHA 2ZA1A 1QWGA 3R7MA 2CLKA 1TTIA 3C2FA 4KEUA 4F2UA 1D8CA 2Y7EA 1YTKA 2ZWYA 1KM1A 4A8LA 4Z2HA 4KS0A 1F2JA 3RU8X 2B7PA 2QR6A 3ZQ9A 2WB5A 3UG3A 3S1VA 4B5WA 4FO4A 1PHWA 4RL3A 1TVNA 1GNXA 3AHXA 3FEMA 3SN1A 2P8CA 2QCFA 4B4FA 5BXRA 4UOQA 4E5TA 3KLLA 1KC7A 1UP0A 1E0VA 3RX2A 3FXGA 2D2JA 2FHFA 4IP7A 3EDDA 1YYAA 3PZQA 1PZ0A 3BWWA 5IHSA 1EJUC 1ONXA 1BYBA 2DT1A 2R1KA 3M0JA 5E9XA 4JIIX 3CB3A 4AEFA 3UFYA 4JICA 1YNPA 2C1HA 3MQTA 3PHAA 4K7YA 1XBZA 5C5YA 5K9DA 3SFKA 3M47A 1RY8A 3VIMA 4Y7EA 5A6BA 4GLEA 4G5DA 4ADSA 4HN8A 4LUSB 3PZOA 3DFSA 1KKRA 2OVLA 1H0GA 1ME8A 5CCZA 1PL9A 1WE5A 2BSLA 4JFTA 1E6SM 4XZHA 1UWTA 1E9ZB 2OZ0A 2VUYA 1UWRA 1MMFA 3KS6A 1SO5A 2IW0A 1SFSA 3S8HA 3CQHA 3F4CA 1MZRA 3ZVHA 4LF1A 1J8VA 3O0KA 1RP9A 2WZMA 1CBGA 1PX8A 3WF0A 2XIMA 1EO5A 5I3FA 4UMBA 1NWUA 1V6WA 4HCHA 1GK8A 2B81A 3WG6A 4EOUA 1C91A 4E8GA 2C8NA 1FTXA 1V4YA 3M0LA 2GSJA 4K68A 1J2BA 1T40A 4KWUA 1AZ2A 4ZSUA 4YCOA 1A5LC 4OQVA 4A8IA 1P0DA 4ZQCA 5FJJA 3KRSA 4UR9A 4CCEA 3R8HA 2DQXA 3PZIA 1ALDA 5H6HA 4L5ZA 3AS3A 3PTDA 3I7RA 2HZGA 4D6IA 2ATMA 4KWOA 2ZXBA 1HVXA 4Q8VA 1KO0A 4JN6A 2ZZ6A 4HZ7A 1FDZA 1ELSA 2ZRWA 3WQ4A 3LGGA 3BAYA 3AIBA 1MI3A 5E0KA 1WZLA 1QCWA 3RJYA 3S2LA 3IGSA 5CBJA 4Y8FA 5IXEA 4IJBA 3SW6A 5CZ0A 5MF5A 3WQOA 3VE9A 4UMAA 2R24A 4OUIA 1KB3A 3PJTA 3TTQA 3P93A 5HPCA 3QLDA 4NXSA 3U4FA 2INZA 3SSJA 4GQGA 4CD4A 2I57A 1UYQA 3G1XA 2J8TA 2X1SA 2ZTKA 2IQDA 1R3TA 2RJGA 2NWRA 1LDCA 3GVVA 1JR1A 4R7WA 3QY6A 4RZ5A 3R8GA 3DFQA 1PKMA 3MZ2A 4EACA 2VQUA 4CN1A 1RV8A 1EC9A 4O54A 4Z2IA 3P60A 3DHFA 4KBXA 4GUJA 2WSRA 2J7CA 5IM51 1BKHA 1MW2A 3P61A 4O12A 2H8XA 4LU0A 5KTLA 3UGVA 5BWFA 2Y88A 4AC7C 1GJWA 1RJQA 2W62A 3WNNA 1XYCA 2G3FA 4W89A 3GHSA 5LNVA 1YMYA 3WX7A 4DJFA 3CU2A 1Z48A 2VMFA 3C6CA 4W4QA 2VGFA 4GQ0A 1DWJM 3IVTA 1Q6FA 3THAA 1UR4A 2CIPA 1GG0A 3K46A 4HNLA 1JD9A 4Z17A 3KTCA 1DHKA 1EDTA 3IUDA 1X1NA 4LB3A 4S3DA 3DECA 3QVQA 2OG9A 1H41A 4O17A 4UTFA 1JCNA 3UA4A 3GIQA 2FPYA 2GQ3A 1B9ZA 4U3AA 3XIMA 1WKDA 2XSAA 3ZR6A 3H4XA 4GD0A 3W07A 3HIJA 3W83A 4AYGA 2QHAA 3MSGA 3ITYA 1FWWA 2I9EA 2J24A 3PJXA 2BY2A 4XVDA 1EBGA 4AW7A 1B1YA 4HYRA 2NQ9A 4AHPA 4L6HA 1Z8AA 3SEPA 5E6YA 2V2DA 1CPUA 3WF3A 4DBDA 4HCLA 3R10A 4MVAA 3S9ZA 1R7OA 3PSVA 1UMYA 4HPHA 3F5LA 2QDGA 3W7JA 4XZMX 1CXEA 3WK2A 5BXSA 1IGSA 2W0UA 3QLLA 4JYFA 2ESCA 3WEZA 4B3ZA 1JYWA 3VD4A 3NOYA 3I4EA 4PMYA 2B7QA 1BEUA 3LQLA 2CKSA 1PB0A 4UFIA 1XG4A 3EWUA 4F9DA 4DLMA 1G4EA 1DBTA 1H7OA 1J0KA 2UBPC 3GU1A 1QNSA 3L21A 1JDDA 2RH9A 2XVLA 3MPGA 4ORMA 3IARA 1V6TA 1JYXA 4J3UA 4DXXA 3LSCA 1PXGA 5CQ1A 3RF9A 1SSGA 2BHUA 4HNNA 3RM9A 3EMQA 4KCTA 4IJCA 3EWBX 1RVKA 4GIEA 4Z1DA 1OZMA 1RY0A 1OFPA 3MU7A 4W5ZA 1Z32X 3T0AA 4IUGA 4ZB2A 3BAJA 2FDMA 3U2ZA 3E6EA 3HJZA 4LUIA 3IGXA 4MG4A 3N15A 3XISA 2VL4A 1B3ZA 4XBSA 1UKPA 2P3EA 2CWXA 5DMMA 3EWXA 2XM1A 4GJJA 5HUOA 5B80A 5MKGB 5LNRA 3L2IA 5HMDA 4YTUA 2G4FA 1PWLA 5EA9A 1EJXC 4P7OA 3I6TA 4D8ZA 4L4LA 3L2MA 1OINA 4IGNA 3P62A 3TJXA 3RM4A 3VO0A 3LMZA 4WY0F 3E12A 1XLGA 4NL1A 3THCA 4HJFA 4AD0A 1TG7A 2VDIA 2YFOA 1Q2SA 4BFAA 1JUEA 9CGTA 1NWTA 3ARRA 2DZUA 3C0QA 3KXQA 2G96A 3UY8A 1HW6A 4FOKA 1SQ7A 4DY1A 4FNRA 2E1WA 3DXIA 2W66A 1YADA 2Z1WA 3LM7A 1UWIA 2YB1A 4UMCA 7PTDA 4WGXA 2PDBA 3NTYA 1X7IA 1DJXA 3MDWA 1MYRA 1O5QA 3WLPA 4M6VA 3A13A 3DFHA 4CQ8A 2GSHA 2PPGA 4WSKA 2QF8A 2RDXA 1YKWA 4IP5A 1E0TA 3SR7A 2QCDB 3OPSA 2QW5A 2C0AA 5TAOA 1T6MA 3P81A 2CBVA 3G0SA 3KP0A 1B30A 4FAMA 1EA0A 3H22A 3FW6A 3PTKA 4DWSA 1W5OA 4TX6A 3LERA 4HNCA 4GVIA 1XPYA 1HL9A 2JF6A 3N2OA 4XZWA 1LM1A 5HDRA 5K9XA 4OV9A 3P5ZA 4ERIA 2WNQA 2WM1A 2JKEA 5HNUA 4BF7A 4O10A 4DUVA 4L4OA 5G2WA 2GK1B 5JIPA 1NM9A 4DJDC 2D3LA 4IIBA 3TWBA 2Z6IA 1AA1B 3S1UA 1WBHA 2QJMA 1K6WA 4PRRA 2WNNA 3U7BA 4W8LA 1EQPA 3MHUA 4GZ7A 6A3HA 3EPNA 1XSIA 1OG6A 3PUEA 5FOOA 4IMGA 4NZFA 3NL3A 3W1MA 3CUIA 1VCFA 2V63A 4CNSA 1PYFA 4BQ4A 2VJXA 3WMBA 4A2RA 3T8QA 3TQ0A 1H7XA 3PZMA 3VDHA 4UTWA 3IV8A 3CLMA 4RXFA 2R94A 4D1IA 4LBUA 1HF6A 1E71M 1FWEC 4GGBA 1XD1A 3FJ4A 4W87A 2GGHA 3HV8A 4NZCA 3IV3A 2JBMA 5XIAA 3QKZA 3R43A 4PEKA 1VLWA 2IUZA 3N3MA 5CPLA 4C6JA 3OBKA 1VKFA 2WJFA 1RUSA 2PD9A 4JTQA 3SUWA 1DJIA 4C6NA 4Y9MA 1AMYA 3GDTA 1H7WA 2W79A 2C15A 2WMFA 3EOUA 2G97A 1PYMA 3OVPA 1BVWA 3E0FA 3UCCA 4G6CA 1TYGA 4G1KA 1ONWA 2DSVA 4G56A 2UWFA 2OSWA 5LZLA 1IEXA 1EEPA 3OOQA 3WENA 5AYZA 1ZBVA 1WDPA 9XIMA 3N9SA 4JQAA 3AMCA 4M24A 4MB5A 1S2TA 4TX9A 2PP1A 2GYIA 3N6QA 2GLKA 1QFEA 1RJPA 4Y9PA 3FYPA 1TJPA 2LLEA 1W3HA 1NDZA 1P0KA 3T0DA 1JCTA 4MJMA 3N2MA 3W22A 4AVNA 2ZXQA 3PWGA 3UPWA 3E2RA 4UQEA 4ZQPA 2WMGA 1ZCOA 4Q6JA 4NZ3A 4WCJA 3DC0A 4A8NA 5EBUA 1FWAC 4RPQA 1NAL1 2P5NA 1TVPA 3G5EA 1KRAC 3VD5A 3R79A 3VA8A 4HMDA 2F2KA 1E1CB 2PGEA 2E3ZA 2E9BA 4C7GA 5LXEA 3HM7A 1BGAA 1WZAA 3O15A 4F0SA 1FCVA 4HNTA 3USBA 4MM1A 2B4GA 1V8EA 5E93A 2BWGA 4J27A 4BQ3A 4DJEC 5CC3A 4C6LA 2NUXA 2D22A 2DIJA 1FWIC 1DHPA 2QDHA 1FCQA 3M5ZA 1W0MA 4C6OA 1UD8A 4NILA 3FOKA 4GABA 4FB7A 3DN5A 2EG8A 1Y0EA 4GNVA 2O56A 4JTSA 4ICMA 5EY5A 4NYYA 2Z0IA 5D2VA 3OHMB 1IR2A 2DZXA 3V5FA 1L8PA 4Q8MA 1OCQA 3TJLA 3RG6A 2J9XA 4MZ1A 2AL2A 3O07A 1ISZA 2V3EA 4F0HA 2BASA 3EOEA 3JS3A 4BI7A 3CH9A 4LNYA 2QV4A 4JYEA 3VE7A 3L4ZA 5FJIA 1O1HA 4IFRA 2RGMA 4IPPA 4KIEA 2AQWA 1Z41A 4H7CA 3WD2A 1XIGA 2RJHA 3TK7A 2FGLA 1S2CA 3IIXA 2PDNA 1B54A 2GJPA 1WZMA 1QT1A 4I6KA 2ON3A 4BK9A 4ZE4A 4OVXA 4LYPA 4S3EA 2O9OA 1OGGA 4ES4A 4B9YA 1AJZA 2DVXA 3HG4A 4N9BA 2DGAA 5HANA 3PR2A 1QPNA 3RPDA 1QI4A 1J6OA 3MS8A 4KCUA 1MSSA 4IXHA 4J4KA 4GA8A 3IK2A 4WJ8A 2CZFA 4PUNA 4ZODA 3TC3A 2ZWZA 1A5OC 1MXGA 2ZA3A 2X09A 3BJFA 3CPUA 1LL4A 1MEHA 4PEEA 2XTKA 4J3SA 4BWLC 2QJHA 4MF4A 1OX4A 4A05A 1KRBC 1EJRC 1QOPA 1ZALA 4JIPA 1E56A 4K37A 5H8MA 4KW2A 3RK8A 3PP7A 4AIUA 1QPKA 1TJRA 3UWYA 3KUMA 2H90A 4A3RA 2GPTA 3IPWA 4JTCA 4C91A 4EF9A 1VBJA 3GXFA 4IJRA 3R2GA 4ZXOA 3M5VA 3U2CA 1KTBA 1EJSC 3E49A 3ZVHB 2DVUA 1ZP4A 5CAHA 4X63A 2EPNA 3FX4A 4I5XA 4R88A 1MQPA 2YCLA 3HG2A 4UQCA 4F2BA 3CV2A 4Z08A 3ATZA 3TCEA 3HGOA 2DUAA 4WQ6A 4AQLA 3LLFA 1W1PA 3R0DA 2C6QA 2PDYA 4P61A 1OJXA 3VNLA 1KR1A 4HN4A 5C2GA 2VGGA 1Z89A 5HXMA 1DTUA 1VIWA 4ZTXA 3F1QA 3IWPA 2YA2A 5I03A 3OP2A 4OTKA 3B9DA 1X39A 3KCLA 4MKSA 3QKEA 3MT1A 4IMAA 3EX3A 1JDEA 2GVEA 4JL2A 4O1CA 1G94A 3MW7A 3QPYA 4BA0A 3WFAA 1I2PA 1HL8A 5DCEA 4IIHA 3I3BA 2QCCA 3W1PA 4H4IA 4DM2A 3TC6A 4NIRA 1BXBA 4KF1A 4PTNA 3OA5A 5JH1A 2A4AA 4E4FA 4MNMA 5M1TA 3GG1A 2CNCA 1L6WA 4B5SA 4K7VA 2CLHA 3PANA 4UWMA 1IE7C 2Q3RA 4LVBA 4HZ8A 3ZR4A 3WZ0E 4FNSA 4XAZA 1QW8A 3HA1A 4WKFA 4E2VA 3IEBA 4WDWA 4ZQOA 4LCSA 4G1NA 1XLDA 4J9JA 3FJLA 4ALDA 5F1UA 1HP5A 2BXVA 1BF6A 1VJSA 2OGYA 1LQ0A 2VC5A 1BYDA 4OBTA 1QI0A 3MTWA 2Y7DA 4LAKA 4A8RA 2IMRA 3TA9A 3V7PA 4C6PA 1U2YA 3VINA 1E40A 3GH4A 3IJ9A 1J5TA 3QC0A 2WSYA 2WHMA 2F84A 4L64A 1IEIA 5J04A 2ZUNA 4FK9A 1P4CA 1GPFA 1VH7A 3M0IA 1WOBA 1UH4A 1XGDA 4RCXA 1OABA 3WD4A 1NDVA 1IEQA 4XG1A 1CGXA 4D6JA 5AY7A 3ID7A 3UQNA 4S3FA 5D33A 3C52A 1R2SA 2VVSA 1XH0A 4JTDA 4C1KA 1QXLA 4HU0A 4GYFA 4XD4A 4YN5A 2NSOA 3DFPA 3K4AA 1V02A 2EPKX 5A8NA 2BVYA 2ZUSA 2FGZA 4Z1AA 4WK9A 1NWRA 4JDYA 2FHBA 1S3TC 1JXKA 4K8GA 1W3LA 4L56A 1PZ1A 2G5WA 1R86A 1F73A 1OT1A 2HVOA 4XKMA 1R0MA 3P67A 3L7RA 4YHEA 3PULA 4NUWA 1JVNA 4ZGYA 2QCLA 5J5DA 3IK4A 2E8YA 4GUHA 3MUZ1 3H2AA 1LP6A 1KA9F 2UV8G 2DT2A 3UVAA 2YL5A 3BLFA 3GR7A 5BOEA 9RUBA 5FCZA 3VI2A 3LPGA 1GVFA 1SFTA 3Q4DA 5G4EA 5B7YA 1CTNA 2R14A 3OVGA 2OFJA 2QF7A 3N6JA 1XLBA 1MDLA 4MY1A 2B7NA 1VFMA 1IWBA 1QPQA 2CZDA 3LM3A 3RLHA 4CKQA 4JN7A 3DOPA 1ODZA 1KFBA 1A53A 3YPIA 3BE7A 5JMUA 2VEIA 3VIKA 1XUZA 1PKYA 1T8XA 4U31A 2E68A 1C93A 4IWWA 1H62A 3BAWA 1ZBCA 3LXCA 4E8CA 5A6BD 3GAKA 2VUNA 1C8QA 4R9OA 3UYCA 1MW3A 1LQAA 2Y2WA 4AZCA 4LANA 1FWTA 1L6FA 4G7FA 4GFSA 4LFYA 3ME3A 5D05A 4CNTA 4XZLX 5AVHA 1RHCA 1ZL1A 4TXEA 4N0RA 4Y6GA 3QR1A 1S38A 4B91A 4C7FA 2XIOA 4IZGA 4MY8A 4C1LA 3FVDA 1V3LA 1V7YA 1IXPA 3AWOA 1IV8A 1O6IA 3R0UA 4M29A 4K3ZA 2GQ9A 4J3ZA 4XAGA 4R7OA 3LGEA 4AISA 3KL5A 1CGYA 3GH7A 4GUGA 1HKKA 4IL2A 1QASA 1A5MC 2R9RA 3VDBA 1HJUA 5CPSA 2O7SA 4PZVA 1BKSA 1X38A 2OYMA 1OCNA 3BLKA 1EA9C 3FN9A 1J5SA 1KBLA 3VKAA 2VD9A 4Q33A 1DORA 3B0VC 2C16A 1TQJA 1WP6A 2V3DA 1S39A 4QDWA 5ABHA 4HOZA 4C1NA 3FK4A 4KT2A 2QCHA 3EB2A 3N34A 3U5UA 4O52A 3VCNA 3TR2A 4AY8A 4XBJA 4A3QA 3SQSA 2EQDA 3ISIX 4KCWA 4XQ6A 1Q4WA 4ACYA 5ABFA 3T1GA 3AS0A 3UBPC 3ITOA 3CIXA 1M1BA 4MB1A 4RE0A 3ZWTA 5JQ9A 3KX6A 1GWJA 1V77A 4NJIA 4NZ5A 4H3DA 1J0YA 2HS6A 3ES7A 1G4TA 4JD4A 3Q58A 1BXNA 1SO3A 3E2QA 5CEWA 4I7UA 4B3LA 2AL1A 1J12A 1J9YA 3TC7A 4CCDA 3QF0A 1JXJA 4DWSB 4AIBA 1FHDA 3GZ3A 1KWGA 1M04A 5C7VA 4A3YA 1TELA 4GX8A 4REQA 1IEWA 1OIFA 1JQXA 5AHIA 4FOJA 3BLPX 3DG6A 2IKHA 4WOZA 2AMGA 1GYNA 1OC6A 1F6PA 2DZAA 2OPJA 3AIVA 5A94A 4WDUA 5I24A 3HFYA 3UWUA 4AZBA 5FACA 3F5JA 1LBFA 3B0XA 1GPWA 1E4IA 2I9UA 5LNWA 1W31A 3W70A 1S5MA 3H23A 2FPVA 1OK4A 3AYTA 4JTTA 4LY8A 3CUFA 5EPDA 5M2FX 5L9FA 1S5TA 4JIQA 1XCFA 2NSXA 3W76A 3OGRA 4UZSA 1JQVA 4DJFD 1P0NA 1UWQA 1WQ5A 1UZDA 4YCPA 1DKWA 3F5KA 1KFWA 3L4TA 1B31A 1TE6A 3LTSA 4E2OA 4WSJA 2QCNA 1A5SA 3GNXA 3IACA 4HMNA 2HV5A 5F4WA 3W1AA 3TZNA 1E0XA 2WZHA 4UTTC 3F7JA 2X1IA 2EO7A 3ZZ1A 1YHTA 2VEKA 1UD4A 2VR2A 3V75A 2PLJA 4QX4A 4PN2A 1TB3A 5EMMA 3S2CA 4NASA 1TE1A 1BWLA 1S5WA 5TIMA 4AF0B 2VXNA 2YW4A 1U5VA 4D6HA 3DHDA 5F2GA 3LHYA 2XYLA 1L2UA 1IZKA 2TAAA 4B2DD 2QPSA 3PS7A 2YCIX 4HYVA 3WH5A 4US5A 1KFLA 3GHTA 3BO9A 4Y9NA 1Q7MA 1T5AA 3VGGA 2J7EA 1IHIA 2D0FA 4LYRA 2V82A 5K7JA 2J27A 4NAEA 1C8XA 3TNBA 1V3JA 4LYQA 5KZEA 1XLCA 4N6FA 3LZ5A 4N02A 3T7VA 1H61A 4IG2B 2PZ0A 2NV2A 3G1FA 2Q02A 2IPJA 1OADA 3NWRA 1P43A 2YDSA 4TVUA 4UCFA 1LZOA 4H6RA 3G22A 1NP0A 3QR3A 4CQDA 3IGUA 4L7ZA 2V69A 4GUIA 3BQ5A 1K9FA 2WMKA 2A1YA 4CNUA 4UB9A 2G95A 1Q3NA 1O95A 1X98A 3OTRA 1IXOA 1BG9A 5EYWA 2YXXA 3L4WA 1YQ2A 3N11A 1K9EA 4E6MA 3Q2DA 1EYWA 1SUXA 1K1DA 3EYPA 1XJBA 2EG6A 4P8UA 1DV7A 2ISSA 3EX6A 5CBBA 3GTXA 1V7AA 2AL2B 4JBRA 2HCVA 4BHYA 4UUIA 4NNCA 1CEOA 2PWGA 2V5LA 3PF3A 4JTFA 3UWZA 1PUDA 3W82A 1RK6A 2Y61A 3RLVA 4LB4A 1MRQA 2IKJA 1E6NA 2JGYA 3L2LA 3A23A 3M5YA 3MWAA 3SUUA 3DCPA 3PBVA 3BJSA 1VD6A 2PDIA 3W73A 1ZRQA 3TONA 2E9LA 3TIMA 3WSUA 5DCBA 3OG3A 3B4YA 5AYYA 3W26A 3ZR5A 4F79A 4DYEA 3W71A 2J74A 3AYRA 3OODA 4MOZA 3W7GA 3CLWA 4ZFCA 4DO4A 3RN6A 3WQPA 4H9XA 1UUOA 4J3TA 4DI8A 5LA1A 5FSEC 3RDKA 4UZUA 4IPJA 1XYLA 3HGRA 4Z1BA 2GUYA 1OX4B 4C90A 3QQWA 3G77A 3L0KA 2HE8A 1Q6GA 2VRJA 3TW6A 1UOKA 3VIOA 2GGEA 1WZKA 3TCSA 1LT7A 3ZLFA 4W84A 1I2RA 3WF4A 2QYGA 1M7PA 1YNYA 1JRCA 4FZIA 4EAYA 4GY1A 1SZFA 4M19A 3GUWA 4OOUA 2I5IA 3SM0A 1E43A 4GZIA 3T2OA 1CXLA 2YCLB 2V6AA 1AH0A 2ZXAA 4KFOA 4J1OA 1BYCA 3C3UA 1U1JA 1V02E 4MY9A 2VFFA 3AI0A 3IVUA 1GKPA 3EDEA 5HK4A 2XWDA 2NQJA 4RDZA 4DZHA 1H2JA 3TROA 4DZ5A 4Y90A 1OIMA 2WM0A 3ZSSA 3PK7A 3H7UA 4JHOA 2W9MA 3NIYA 2W92A 3GC2A 1Q6OA 3DBNA 3FA3A 4FNUA 5BMXA 2WLYA 3HU7A 3PNUA 3EEGA 1T96A 2YL6A 1I0DA 2HK0A 4WHBA 1CT5A 3AALA 2NQLA 3OHIA 3WNLA 4ML4A 3T81A 3ALFA 1EJWC 3L4XA 2QMKA 4XIAA 2YIHA 1HN1A 3DAQA 4URIA 3NDYA 3ZVIA 4DELA 4LXFA 3QPEA 3O06A 1W2PA 2MNRA 4IMCA 4ZZ9A 5EFDA 2VC7A 3WUGA 1PE1A 2Y7GA 5HQLA 1JDAA 1TPC1 3W9ZA 4NYUA 3WK3A 1VPQA 4FNQA 4U3CA 1YDOA 5D2XA 1HXJA 1W56A 3V1PA 2V68A 1FCBA 2DUXA 1CI1A 3SCPA 4RUBA 1SW7A 3NQVA 1UR8A 2GSEA 1EGZA 2IPGA 3EDJA 1DJYA 3I6RA 4ICCX 2GUBA 3EB3A 4JX4A 4XZNX 5FAGA 1DJHA 4HHPA 3CHCA 1TTQA 4P8XA 4Z2GA 1CXIA 4DJDA 4AD2A 2KAUC 5I2UA 3W2NA 1JPMA 3UY7A 4BF9A 1ML1A 4ZB5A 4L1GA 2QJIA 2Z1BA 2G3MA 1Q6LA 5FF0A 4V27A 2Y70A 4OV4A 3A4AA 3HPSA 1PIGA 2VOTA 3ZT7A 2Z2AA 3VIIA 2H3DA 3LU2A 2QZRA 1GOWA 3TJIA 4DIAA 3ZJKA 3N6HA 3P74A 3C3NA 4CVWA 3M41A 5T9BG 4H8HA 2PBGA 4J2PA 4DBUA 4NZJA 1ICSA 1XPGA 3UZ5A 2WMIA 2QIWA 2CLMA 4AC1X 5C2CA 1ZY9A 4JTKA 1KGUA 1XIJA 4FXFA 4XUYA 2Y5EA 3PB2A 3PZUA 4QS5A 5EFFA 2ZX7A 3PUGA 1GVYA 4ROPA 4AX7A 5C54A 1KD0A 1Q2RA 4D9PA 2CZ5A 4UTHA 2FMNA 4OOZA 3S3GA 7XIMA 3QMSA 3S1WA 3DYOA 4KRZA 1B57A 4GXWA 1W91A 4S3GA 3WELA 2EG7A 8CGTA 2OJPA 1E1EA 3VKKA 3MUCA 1YLVA 3VIFA 3GDMA 1DYSA 3BOFA 1J0IA 1Q45A 4IUOA 3DU0A 4X0NA 4GIRA 1QI2A 3W81A 1GEHA 2QUUA 4S3KA 3W6YA 2DDXA 3N2BA 2X05A 1BHGA 5HINA 3AUJA 3BMVA 1PKNA 4IHCA 1TV4A 1HIZA 4KKXA 3S2JA 3ITCA 4CUCA 1JG9A 4PFHA 4HBKA 1ICPA 5LNUA 4ZXLA 3GW3A 5CJNA 1ZAJA 4BI6A 2ZCGA 4AZCB 4EKJA 3TAKA 1WDRA 4L1XA 2FTPA 1TTPA 4MWAC 1KM2A 1XR2A 2FLIA 3MV11 2B0MA 3VK5A 4F0MA 1JULA 4JX6A 4XV0A 3SAZA 4FXJA 4PTVA 3AJ7A 4YNGA 4X2RA 1RA5A 4IQJA 1H5VA 3P8JA 3W2MA 4JHMA 2ZZ2A 1VP5A 3IGHX 3T07A 3W0KA 4L9XA 4HB7A 4O16A 4V28A 3GTIA 2WPBA 2GOKA 1EUAA 2DP3A 3EX4A 2X1RA 1A5NC 1BSIA 5GJPA 1K9TA 3NJ3A 1OFRA 1KGXA 3HV9A 2WSQA 4GBDA 3DI1A 2A7RA 3T2PA 1SZNA 3NGFA 3ZO9A 1AD4A 1Q65A 3N9RA 1NQKA 4M0XA 2NZLA 2PGWA 4GK8A 3PFRA 3ZMRA 2QJNA 4ZENA 4DF2A 5CG0A 3GBEA 1UC4A 1Y5XA 4C1NB 2E5BA 2J7BA 3AXMA 1TJ1A 5A2BA 1XYAA 1KTCA 4W7VA 1FXPA 4HHLA 5LGZA 4IISA 1QW9A 1S2UA 4LRSA 3U2OA 3OVQA 4N4PA 3ABXA 3NQFA 5D8ZA 5ABFB 1MUMA 2NVDA 1A3XA 1VJIA 4PCPA 1UQZA 1PZ2A 2XH0A 3EPOA 4H6QA