3PZOA

Structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 in complex with three maltose molecules
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila rku-1
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
total genus 159
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzoA00
4UFHA 1KCLA 1JAKA 2VQUA 2DPEA 4QLJA 3DC0A 1J0IA 4AC1X 3I3BA 4OKDA 3AZTA 3UESA 1OGBA 2YBUA 3F5JA 3DECA 1ZBWA 1LWHA 3MUZ1 1PPIA 2CBJA 3ZIZA 2ZOXA 2AMGA 4H41A 4OBRA 3GDBA 4U3AA 3WDQA 3GH7A 1U33A 5BXPA 2WHJA 3WEMA 5BXTA 3ZR5A 1K9TA 4CD8A 2G3JA 1CGYA 1EA9C 1TVPA 3ZJKA 4EK7A 4TTGA 4JL2A 4GO9A 1W3HA 2WMFA 3WD2A 4PMRA 1OGSA 2O92A 1NOWA 5EFFA 2OSWA 3RMEA 1FH8A 1E3ZA 3O9NA 2QMJA 4TX6A 1W1PA 3VMPA 1UD6A 1IV8A 1J0KA 1QHPA 1EXPA 2EPLX 5HDRA 4U33A 3VMOA 2DDXA 2EPKX 2WB5A 3EYPA 4CU6A 1VIWA 1JF6A 1GHSA 2EBNA 2VOTA 1RPKA 3L2MA 2E4TA 5D9MA 3PZGA 5CLTA 3T0DA 3AHXA 3TP4A 4ZEPA 3G6MA 4E8CA 1UR0A 2G41A 4E4PA 4FK9A 1H5VA 1JYWA 1Y7VA 1UR2A 2WWCA 1G01A 2YL6A 5F7UA 5IFPA 2JEPA 5I79A 1XH1A 4M29A 2RGLA 1UR4A 4M80A 3AMDA 3BCDA 2WCGA 4HA4A 1XCWA 2VX5A 3BSGA 3VU2A 4JFWA 3WY1A 5KEZA 3DHPA 3AHYA 3OBAA 1JZ6A 2W5FA 2WBGA 4AEEA 2XWEA 4TOQA 4AZ5A 3AMGA 4HU0A 4AZCB 3GYCA 2C0HA 3ARYA 5ABEA 4D6EA 1QW9A 5CXPA 3UG3A 1WCGA 4GZEA 1HKIA 3ARQA 2F2HA 2BVTA 3VGGA 2WMKA 4WK9A 4HMEA 1BYBA 2ZUTA 1NM9A 1J18A 3N12A 3WUFA 3HU7A 3OG2A 5FOOA 3M6DA 1GOMA 1S46A 2PC8A 4DUWA 5CJ5A 4M56A 4PCTA 3K46A 4UZUA 1PAMA 3AJ7A 1UUQA 3OZPA 3WMBA 4K68A 1B90A 3O6AA 1VEOA 3MMUA 5A69A 1HF6A 1JXJA 3SCPA 3W38A 1X1NA 3WH5A 3WNMA 3WNKA 3CZ8A 3PZUA 1NWSA 1XSJA 2DT3A 1A47A 5I78A 1EGZA 1UQYA 1Z32X 4GZIA 2BY2A 2FH8A 3WDPP 1V3KA 4CN4A 1C8YA 3KE0A 4ATWA 1XSIA 4URIA 1V6WA 2YOCA 3N1AA 4HZ6A 3BGAA 3CHEA 5A1AA 1LL6A 5JBFA 2DSUA 3A6OA 3FAXA 2ZUNA 3SCRA 3E1F1 1J10A 5A8MA 1TA3A 4Z2LA 2O9PA 3MMDA 3CO4A 3BLPX 1GVIA 5I23A 3OLDA 1W9PA 1PX8A 1ZL1A 3ARSA 2A3EA 1H0GA 1GQJA 3SCWA 1GOWA 2CYGA 5CQ1A 2CHOA 1K6AA 1JI1A 4ZE4A 3ARXA 4GINA 1E0XA 4AD5A 4AMCA 4PUDA 1U30A 2W92A 1KB3A 3KWXA 2D24A 2Y8VA 1BLIA 4YN5A 2PBOA 4CD6A 1FP9A 2WLYA 2WM0A 4AISA 1WZLA 2J77A 1J11A 3K8MA 1V6UA 4HA3A 3S2CA 3NUKA 2GDVA 5FCZA 2E9BA 4P7QA 3GNPA 3WF4A 1XYFA 1ISWA 4QFUA 1KGUA 3WQ4A 5DF0A 3SUUA 3ZT6A 1ZB5A 4PMOA 1JXKA 4B9YA 5ABHA 2WMHA 2VX7A 2J7CA 5C71A 1SYTA 4W93A 4CD4A 3EMQA 1Q6DA 3CZGA 3G6LA 3PTMA 3NSNA 4AZHA 1BFNA 1MW3A 1J9YA 4XZWA 2VJXA 4AIOA 4W8LA 2J7FA 2XTKA 4X0VA 1E15A 3AXIA 3CZJA 2WZHA 4PSPA 2E9MA 3EDKA 2ZE0A 4D6HA 3RM9A 2J7EA 3AYRA 2OWCA 1HKKA 2D3LA 1C3FA 2PWDA 2VCCA 4HZ7A 3QGVA 4Z2KA 2WMIA 1V3LA 4P8VA 2G8ZA 1UD2A 1UQZA 2XGBA 2FHFA 3ARZA 1ITCA 1M03A 2CITA 2DSKA 4Y7EA 1Q6CA 2ZX9A 1MWOA 3AZRA 4U3CA 3NDZA 1E1FA 3OLGA 1TFVA 5EFDA 3T0BA 1CPUA 1E6ZA 3TONA 1BG4A 3O2LA 1DWGM 3MMWA 3MU7A 4UTFA 1QI0A 4F9DA 1HJSA 5CGMA 1FOBA 1XD0A 3W24A 4DWSA 2PB1A 1JIBA 1L0PA 5D9PA 2QHAA 3BAYA 3IJ8A 3PZOA 3PN8A 2YL8A 2IXUA 1VF8A 1E43A 2G3NA 4N0RA 2VVNA 4MB5A 5FD0A 5BRPA 4X9YA 2A3AA 3A4AA 2JIWA 2O9TA 2C7FA 2CKRA 4MJ2A 1UR9A 2MANA 1W9UA 1SMAA 1JFHA 3ZR6A 2D0GA 2D3NA 2CNCA 4U31A 5CSYA 4WSJA 3L4XA 4PUEA 5C8BB 4IISA 3VD4A 1GUVA 1H41A 4RE3A 4W85A 1H4PA 1VEPA 4MNLA 1V0NA 1UKQA 4BCEA 5I3DA 3AS3A 4QP0A 2BHZA 2YDRA 3SUWA 1E6NA 1JI2A 3MANA 3JUGA 5EBAA 1B3ZA 2NW0A 3N18A 1CWYA 5A2BA 3RJYA 3AHZA 3GXFA 3WNOA 1ISYA 3SCSA 4UQ9A 8CGTA 5ECUA 4XV0A 4NF7A 2FHCA 3OGRA 3VDAA 3LPPA 5LA0A 2JEQA 2J7HA 2ZXQA 3KL0A 1RP9A 4ACYA 4YHGA 2QPSA 3BCFA 3AIWA 1WDRA 3AICA 4IUGA 5BYWA 1SR0A 1UD3A 4YHEA 3AQUA 2VTFA 2X05A 1UZ1A 4CCCA 4P7RA 3VD3A 3CH9A 1JDCA 1US2A 4UOQA 2DSVA 4EE9A 1HXJA 3B9AA 3GH5A 3SCVA 3ALFA 3PZNA 1NQ6A 1R85A 1ZBCA 2NSXA 3IANA 2X8RA 1C92A 2ZUUA 3DYOA 4CGTA 4GQRA 1MVYA 5M17A 3TOPA 2VZSA 3IK2A 1XH0A 1E1EA 1UWSA 2Z1KA 3UR8A 2CBIA 3B9DA 1KR1A 4YPJA 3K8LA 3POCA 2YA1A 3RILA 4L4OA 4ZE5A 1JYXA 3CIVA 4PSRA 2FHBA 1QOXA 4JHZA 5IDIA 3WD1A 4LQ1A 1XGZA 3IAPA 3UG5A 1W2VA 4MDOA 4M1RA 4AIEA 4X0NA 1GOIA 1J0YA 1AQHA 3B9EA 1HP5A 2XYLA 3GH4A 2F61A 3ZOAA 4FLSA 5GNXA 3WNLA 5FIPA 1BF2A 2V3GA 2G4FA 3TTYA 1TG7A 1GQKA 3GXDA 4D6IA 1FFQA 3WEOA 5A6AA 4Z2GA 4CVUA 3WN6A 4NRRA 1JDDA 1BTCA 2YLLA 1V02E 3GM8A 1MXGA 2D23A 2V3EA 4FF5A 1TA3B 3AIRA 4FLOA 3VKKA 3QHMA 2OYLA 1VEMA 3HN3A 3TTOA 1V3MA 3CUIA 1NWUA 3CUFA 4DM1A 2AAAA 1K9FA 5IHSA 1QHZA 1QI3A 2XGIA 2DSWA 4J3XA 4Z2JA 3VX1A 5D4YA 1W1YA 4PMDA 5EB8A 3W37A 1QI2A 4MNJA 5E6ZA 5A8QA 4D71A 4AD3A 3L4ZA 1L8NA 1WDPA 4BF7A 3EMZA 3VIOA 3D5HA 4UFJA 3WFLA 4QLKA 5D9OA 4U2ZA 3OA5A 4IM4A 1BVZA 1JGIA 4J3SA 3CUHA 4TTUA 2DT2A 3RCNA 4HMCA 2VL4A 1JAEA 2VZTA 3UETA 1UWRA 3F4VA 2BY1A 4GI6A 1WB0A 3BAIA 1W9DM 3BMVA 5E6YA 1GJWA 3DYPA 1QI5A 5I77A 3VD9A 5I0DA 1MW0A 9CGTA 1CXLA 3OLIA 2ZX5A 2WVUA 1E70M 1B30A 3CUJA 4HTYA 1JZ2A 1W1TA 4ML4A 4OOUA 2PWGA 5LA2A 1C90A 2YJQA 1PIFA 4KGJA 4OZOA 1LG2A 2BS9A 5E0FA 1QNQA 3AIQA 2ZUVA 4D1IA 3PBGA 1EQPA 2XIIA 2V5DA 4JCLA 5BXRA 3T2OA 3W82A 5E9AA 1R87A 1CECA 4H7VA 4JZ5A 1WKYA 3VM5A 4ACZB 1OBAA 1AQMA 5A3HA 3UG4A 3GXIA 1E55A 1B3WA 3LPGA 4W86A 3AMKA 3AIUA 3GNOA 4PN2A 4W87A 4L4PA 1KXTA 4UZSA 1JD9A 1US3A 4A3YA 3AMLA 1EQCA 1DP0A 3FW6A 3MS8A 4CU8A 2Y4SA 4OJYA 2VQTA 1UH2A 1LL7A 2JE8A 2VNCA 1IZJA 1V3IA 1E4IA 1M53A 2VRKA 2XM1A 1G0CA 1QHOA 2J7DA 4JAWA 1UWIA 4PMNA 1ISZA 2WC3A 1GNXA 3K4DA 2Y5EA 1K9EA 2DT0A 4OIFA 1QBBA 3MSDA 4PYSA 1E4MM 4RL3A 4J3UA 3W53A 5HNNA 4JKMA 3AISA 4P8WA 3AFBA 5A2CA 1UOKA 2IUZA 2BVDA 1EHAA 1JF5A 4Q22A 1E0VA 5AC4A 3CUGA 3T0AA 4PMXA 3D3AA 3WH7A 2VZVA 4V28A 1MW1A 1UD8A 3EDDA 3W4RA 1F4HA 4WKHA 1C8QA 3ZMRA 3A4XA 2XIBA 4M24A 4TUFA 2ZUMA 4A3HA 1BPLB 1CXKA 1MYRA 1U2YA 1E72M 4MJ4A 3AXXA 1HL8A 4UOZA 1WP6A 3AS2A 1R86A 1WO2A 3PZMA 1KXHA 2BXYA 3T09A 3POHA 1LQ0A 5D8WA 1VJSA 4UQDA 3LMYA 2WANA 3A4WA 3PZVA 1VB9A 2JF7A 4GI8A 3ZO9A 3NSXA 4UOJA 4BQ3A 1HKJA 3NCOA 1V0LA 3FNDA 5E0CA 3PTQA 4MDPA 4W7VA 3GZAA 1WE5A 1BGAA 1NP0A 4JHOA 5CPTA 4P8XA 2DGAA 5E09A 4J3TA 2BHUA 4OOZA 3VGBA 1OINA 3VGHA 2QV4A 3WNPA 5A6MA 5DT7A 1ZBKA 5I5RA 2WBKA 1EHNA 1HIZA 2GSJA 1OIMA 3QOMA 4W5UA 4AYSA 1KQYA 2J47A 2WHMA 4HOXA 2GJXB 4HA1A 1GQIA 3WH6A 2PWHA 2OYMA 3N13A 1XCXA 3AS1A 2VR5A 1W3LA 2XFFA 3SUSA 2XUCA 4PCSA 2XWDA 4JKKA 4WLCA 3S6TA 5KZ6A 2D22A 4WKAA 2V5CA 2E40A 1WAWA 5D9NA 3AXHA 1B2YA 1WZAA 1JZ5A 3FHAA 1MW2A 3EDFA 4UQBA 4TVUA 2WSKA 5LA1A 4F8XA 4JKLA 3L4VA 4HMDA 2DSZA 2UY4A 5A6JA 2W91A 3CHDA 1SMDA 3GBEA 2E3ZA 1EIBA 1CIUA 2XFYA 4H8HA 4CKQA 3TTQA 4H8UA 4N42A 3IJ7A 3OLEA 1XRVA 1G94A 1UHVA 2CBUA 4W7UA 2EPNA 3LPOA 1NOFA 4P7OA 2GVYA 2Q8XA 4AD0A 4TVCA 3AHVA 5DMYA 5A6BA 1GQLA 1EO5A 3WELA 5CPSA 3L4TA 2WK2A 2GFTA 2X09A 1BGGA 1BSIA 3N11A 1E4LA 4JFSA 4DUVA 1PJ9A 3GTNA 1J0ZA 2CESA 1UWQA 3TA9A 4AZCA 2VRJA 1QI4A 3AZSA 2X2YA 2CERA 3WMCA 1OIFA 2D0HA 2XVKA 3FAWA 3SCUA 2YBTA 3VGFA 1R8LA 3U57A 2W66A 3VDCA 4W84A 4KWUA 3SCOA 1GVYA 1E5JA 3MUY1 1MXDA 3F5LA 5GQBA 1GZJA 2GJRA 4E2OA 4AZ7A 2GUYA 1W9XA 3U7VA 1AMYA 4GQQA 3NYDA 2WZIA 2VZUA 5BCAA 1V6XA 5DFAA 4M81A 4XZBA 4PTVA 1KGWA 2CBVA 2ZXDA 4ATDA 4W8AA 1DWFM 2Y8KA 2DT1A 3VIKA 1HJUA 5GNZA 3ECQA 4WKFA 1DHKA 3AIBA 1MFUA 1V02A 2BY0A 4W88A 3QOKA 7A3HA 1HN1A 2QMKA 1V03A 4U5IA 2CETA 2DIEA 1O6IA 3WUGA 5AY7A 1M01A 4AZGA 1UH4A 1GOKA 3L4WA 1UWUA 1NP2A 4R27A 2CHNA 2BVYA 3N04A 2D20A 1FH7A 3NIYA 4S3KA 1TVNA 5FKYA 1B31A 4P7NA 2J74A 2WVVA 1CBGA 3MV11 4B15A 1YQ2A 1XSKA 2UY2A 2G3MA 4PMQA 4AZIA 1JDAA 1UD4A 3WIJA 2DEPA 2ZIDA 4QAWA 5AYIA 1CEOA 2VO5A 2XHYA 3VM7A 4PMZA 2ZICA 1LL4A 3N17A 3AYSA 4M8UA 4AD4A 4UCFA 3CHFA 2E0PA 3ZM8A 4EANA 3WUEA 3CHCA 1FA2A 4WJXA 1J01A 4CN6A 1PX3A 4S3JA 5BRQA 1NWRA 3SCTA 1PZ2A 2XM2A 2QPUA 5CG0A 1DWIM 4LYQA 3WF2A 3AROA 1JG9A 4JFVA 5A8PA 2WKLA 3BLKA 1DWAM 1OWQA 3W0KA 1GONA 3AI0A 5AYBA 3WH8A 5HBFA 4B9ZA 1E6PA 3W28A 4V2XA 4UNIA 2VZOA 1NWTA 4B3LA 1OSEA 2Y24A 2VT0A 4PRWA 4MNMA 4F66A 4OUEA 2JIEA 5C70A 3MO4A 2NT1A 2IXVA 1HJXA 1PIGA 3RM8A 3W25A 3ZJ7A 1H11A 1VFOA 2EO7A 2WYSA 5HPOA 3NDYA 3A3HA 1ODUA 3M7SA 2GJXA 3APGA 2V3DA 2PF0A 3IJ9A 1PZ3A 3W6LA 3EDEA 2TAAA 1E73M 2HVMA 2Y2WA 2ZX7A 4D1JA 4MTVA 4P7LA 3KL5A 3KZSA 1XHGA 2C8NA 1J0HA 4MNKA 5JBDA 5ABFB 1VRXA 2EPMX 5A6KA 3WSUA 1GPFA 3RM4A 4UQAA 2DIJA 4D6FA 1MQPA 4MB3A 2YL5A 2OSYA 1AVAA 2ESCA 3ARRA 3AS0A 2VI0A 1D3CA 1F4AA 3DHUA 1H0IA 1X6LA 4B3KA 1CGUA 3VIMA 1W9BM 4J3VA 1W1VA 1V3HA 3M07A 3ZT7A 1VFUA 3W81A 5BXSA 3MUIA 5CLWA 1KXQA 3AMCA 3WNNA 1EDQA 3ARUA 3FHQA 1HNYA 2VUYA 3WMSA 2UY3A 4BS0A 5A6LA 4AIUA 2NT0A 1H1NA 5I6SA 4KRTA 2WLZA 4EKJA 2WVVB 5JIWA 4E8DA 1ODZA 5A2AA 3ZT5A 1SFSA 4RE4A 5DT5A 3WQVA 3MV01 3T08A 3LPFA 1CLVA 3ARVA 4NSBA 5LYRA 4Z2IA 2O9OA 2QLYA 3VVGA 2BV9A 4B16A 4JL1A 3NJ3A 4NI3A 4NZCA 1JYNA 4HPHA 2WWDA 3WKZA 1G9HA 4UFLA 5I24A 4EAMA 2XPKA 1RP8A 1LWJA 3BAJA 3I3DA 1E40A 1VAHA 4PEEA 2DH3A 3CBWA 3VO0A 1UKPA 2ZUSA 2XVLA 3RPMA 1C93A 1E56A 2OSXA 2CPUA 4BQ4A 1CTNA 1JZ4A 3U5UA 1KBBA 2EPOA 5IXEA 1VBUA 4KGLA 1GOOA 2E9LA 5CSUA 1OD8A 2PWFA 1BYDA 1CGWA 1MQRA 2JALA 4AXNA 1FHLA 4IPLA 2WAGA 2HISA 4Z2HA 1AQ0A 2EJ1A 1GW1A 1ISVA 1W3KA 3GBDA 4XX6A 4ZXOA 3OGVA 3VIPA 1KFWA 1EOMA 3VPLA 4HU8A 4CD5A 3BC9A 3WBAA 2V3FA 1CDGA 2CXGA 2GDUA 2VMFA 4J3WA 3RJXA 3PHAA 4CCEA 3ZQ9A 1PX4A 1BHGA 4BA0A 3CTTA 1CXIA 3CPUA 4CUCA 4ZXLA 2XVGA 3TTSA 2WMGA 6A3HA 1CGTA 1RD6A 4MAVA 1NOUA 1BYCA 5IFTA 3WQ8A 3WDIA 1XC6A 1KGXA 2W63A 2J75A 4NRSA 1WNOA 4LXFA 4W7WA 1WPCA 6TAAA 2UWFA 1FH9A 3AHTA 2VX4A 1A3HA 3F5KA 3WQ6A 2XSBA 1CGXA 2OWXA 4GKLA 1O7AA 1TE1A 1Q6EA 2GJPA 1JNEA 2J7BA 5ABGA 3ZSSA 2PI6A 2OWWA 5HOSA 1E5NA 2OLHA 2W67A 1KXVA 4M82A 3WD4A 4UFKA 5A6BD 3W26A 1VFMA 3M46A 4AD2A 1KR0A 4H04A 5DO8A 5ABFA 2ZUWA 3PZQA 1XD1A 4CN1A 5AC5A 1I75A 1UWTA 1UA7A 1XYZA 3VIHA 4F79A 3VX0A 2V38A 3CZLA 4XB3A 3VIJA 2YA2A 3VIFA 1M04A 1B3VA 3FN9A 1QNSA 4UQEA 3CGTA 1TZ7A 2VURA 4JCMA 3WL1A 2DQXA 1B9ZA 2WHKA 3CZKA 1QVBA 4HOWA 2W62A 1TCMA 4PTMA 4CD7A 3CLWA 1FP8A 4AW7A 3BXWA 1JYVA 7CGTA 3FXYA 4PTWA 2J62A 4TXEA 5EMYA 1V6YA 2RGMA 4AD1A 3U7BA 1FHDA 4BZYA 3SUVA 1C7SA 4MADA 2JFEX 1Q6FA 3N9KA 1CLXA 3WF3A 1PBGA 1EDGA 2O9RA 3ARWA 3BMWA 3KL3A 4J28A 2VX6A 3VUPA 4AEFA 5M3WA 1OCQA 2ZX8A 5A94A 1V08A 1QW8A 3KEHA 1EDTA 6CGTA 1HJWA 5CGTA 2VVSA 4AWEA 2GK1B 1VFFA 5M03A 1UH3A 1JFXA 2YLAA 2J8FA 2FH6A 2XJ7A 7TAAA 1KCKA 1UYQA 4J27A 2VC9A 3VNZA 2ZX6A 1HP4A 1B3XA 2XVNA 1E6QM 4HOZA 4DUXA 3RO8A 3VTRA 4DWSD 4C7GA 1W91A 2ZWYA 1GHRA 1G1YA 4C7FA 5A6SA 4UFIA 1EOKA 1UKOA 3ARPA 1QPKA 4H2CA 3VGEA 3PZIA 2J79A 3WQ5A 1TUXA 2WCSA 1E4NA 1VBRA 1ZJBA 5FL1A 1TR1A 1E6XM 1HVXA 2XFRA 4U5KA 3QHNA 5TD4A 1ZU8A 2YDSA 2PBGA 1R7OA 3SURA 3VIIA 3BH4A 3VD5A 4BQ2A 5BWFA 4PMVA 1D2KA 3W29A 4QLLA 1V0MA 3MSGA 4LGXA 1H3GA 1BAGA 4JIEA 3VD7A 1YHTA 5DEZA 3WDJA 1ZBVA 4GZJA 4HP5A 3AIEA 4WF7A 1VJZA 3N15A 3MUAA 1IZKA 4U2YA 2WCAA 1RH9A 2ZXAA 3W27A 1R7AA 4W5ZA 3T2QA 2YA0A 4UQCA 5M5DA 3SIMA 5I2UA 1Q6GA 3HJEA 2GK1A 4ACZA 3K8KA 4OBSA 3OGSA 3K1DA 3SCNA 1B3YA 1OT2A 4P8UA 1V3JA 3ZJ6A 1CGVA 1HT6A 1ZS2A 4WIWA 5JIPA 3RIKA 1UR8A 4FMVA 1K9DA 3ZSTA 3OIHA 1G5AA 3BSHA 5GPRA 1BG9A 3CMGA 1C91A 2E8YA 1XV8A 5CZKA 2DH2A 1VENA 3PTKA 4PMYA 1OM0A 4AZ6A 3U5YA 1BYAA 3EBVA 4GIAA 4KRUA 2WNWA 2W61A 2J8GA 2Z1SA 1BVNP 2BNJA 1LG1A 3FY1A 4MPKA 1DWHM 1JD7A 1QNRA 4F9JA 3RDKA 5HPCA 5JUVA 3MKKA 3VGDA 4DM2A 3PZTA 4FLQA 1HJVA 2WHLA 2W4XA 1E9LA 3UEQA 3WBEA 3UCQA 2WMIB 3THDA 3CMJA 1BQCA 1DTUA 4CVWA 4H8VA 4RE2A 3ALGA 2J4GA 3WFZA 1QNPA 4GI9A 5BROA 3WQWA 2CIPA 4MB1A 3W6MA 1UD5A 1CXHA 2WZEA 1OT1A 3WF0A 1E0WA 3WF1A 4D6GA 1ITXA 4JFTA 1ISXA 2XG9A 1WDQA 3AOFA 2PWEA 3ARTA 1CXEA 4CU7A 2X1IA 1J12A 4QCEA 2WPGA 2X0YA 2A3HA 1JL8A 1CENA 2QF8A 3EDJA 8A3HA 4QDMA 3WENA 1NH6A 4CCDA 1WDSA 2AOSA 3VDHA 3CZEA 3SUTA 4AY1A 3PZ9A 2EXOA 2UY5A 1W9VA 3IAQA 5JBEA 3L4YA 1GORA 4PMUA 1W2PA 4GPNA 2WSPA 3II1A 4MAZA 4W89A 3HMCA 4ZENA 1ZJAA 1CYGA 1OD0A 1HL9A 1I1WA 2WVTA 1CNVA 1DEDA 1KWKA 4GO8A 1KWGA 1JNDA 2BXZA 1CXFA 2FDMA 4UR9A 1N82A 2WKGA 4D6JA 2X0HA 1FFRA 1Q4NX 3T2PA 4LX4A 4ATLA 4JFUA 2CKSA 1J0JA 1TMQA 3A47A 3B8SA 2YKKA 3VMNA 1E6SM 2BY3A 4TX8A 4XUYA 3J7HA 2FGLA 2ZXBA 3ZJ8A 5HXMA 4ZFMA 5A95A 1V6VA 1M7XA 2G3IA 1OGGA 1UZ4A 1KQZA 4QCFA 3OB8A 1UKSA 1EH9A 2CEQA 3WL0A 1UKTA 2VRQA 1W32A 3VILA 3UR7A 1XH2A 1IT0A 2B31A 4BQ5A 4R5EA 1E3XA 1QNOA 1D7FA 4HZ8A 4A4AA 1C8XA 1JZ7A 4D6DA 3SCQA 2VR4A 3BAXA 3VOCA 3WD0A 4MB4A 1B1YA 1HKMA 3AIVA 4W8BA 5D8ZA 3WH9A 3THCA 5A8NA 4KMQA 1JZ3A 2CCRA 1P6WA 3NSMA 4J7RA 1LF1A 1ESWA 3VNYA 2F8QA 2D1ZA 1E71M 4D72A 1H2JA 2J25A 4DWSC 1GCYA 2VCAA 1EO7A 2WW5A 3BAKA 2WC4A 2BHYA 3EMCA 1KBKA 4KH2A 1E6RA 3WDHA 1C7TA 4IPNB 5E70A 2EEXA 3GXMA 4LPCA 4V27A 5A8OA 3DYMA 1MFVA 1V0KA 1UG6A 3WUBA 5IHRA 1I1XA 1WZKA 1MQQA 3GNRA 4Q7NA 4PTXA 3QR3A 4GXPA 2WVSA 3SEPA 3QHOA 1DWJM 3L2LA 2YDQA 1OB0A 4HPGA 4DWSB 1HJQA 1LLOA 2J78A 1CZ1A 2OYKA 4UFMA 3K4AA 1NARA 4TVDA 2EQDA 4AZBA 4WSKA 1GOQA 1HVQA 1GJUA 2JF6A 4PBGA 3BAWA 2WC7A 3L4UA 4FLRA 2A3BA 4C7DA 1JZ8A 2D2OA 2XVPA 4LYRA 2XSAA 2D0FA 2ZWZA 2YL9A 1QBAA 2FGZA 3WDRA 1H09A 5FL0A 1W3JA 1H49A 1PEZA 3UERA 3WEZA 1WZMA 5CPQA 2BFGA 3VIGA 1ECEA 3I3EA 5GNYA 3VINA 4LYPA 4D6CA 1LJYA 3OZOA 1HX0A 2VCBA 2WMJA 2YIHA 1UA3A 2A3CA 2J7GA 1UR1A 2E8ZA 3VDBA 1X6NA 2WXDM 1B0IA 3WD3A
chains in the Genus database with same CATH superfamily
1OFPA 4A3RA 3HFYA 2TPSA 4PB3A 4AC1X 4PULA 4WR3A 4LEQA 4AX6A 2YBUA 5AHMA 3E9AA 2ZC8A 1VP5A 3W7GA 3V4BA 1PPIA 3CV1A 5HQMA 4Q8WA 2NQ9A 2RDWA 4I8YA 5FJTA 4QAIA 3GH7A 5L6UA 3W22A 3OBKA 4CD8A 2XIQA 3MJMA 4LUTA 4RDZA 3O1NA 3QW4B 1XBZA 4L4LA 4TTGA 3A24A 3CV7A 2WMFA 3B04A 4V15A 4UR8A 1NOWA 2OSWA 3RMEA 4WY0A 1E3ZA 4UBPC 2QMJA 3W83A 3HA1A 1GWJA 1RXOB 4RE0A 1XIGA 4BEUA 3STFA 3VA8A 3WK3A 3CB8A 2EPLX 4U33A 1WAUA 2C1GA 3EYPA 2XZ7A 1VIWA 1XRFA 4IMCA 3K4WA 3EWYA 3L2MA 2Z1XA 1AD1A 1LOLA 4MY1A 5C9WA 5EPDA 4LNYA 1FCQA 2WNNA 2XFWA 4M29A 5D32A 1WKDA 3QTGA 1Q6LA 1OC6A 1UR4A 3MHGA 4PUJA 3BCDA 3H6OA 2WCGA 4F48A 1XCWA 1AL8A 3VU2A 1TTPA 1J2BA 3EX3A 3W76A 2DV0A 2W5FA 2WBGA 2VGBA 5CBJA 2XWEA 4TOQA 4AZ5A 1Y65A 4Q4SA 4B92A 4AZCB 1ONWA 4N7QA 1WCGA 3ARQA 3CL6A 2F2HA 4KW2A 3SJ3A 3VGGA 2F6UA 1NM9A 1J18A 3WUFA 5FOOA 3BG9A 4O13A 3TYUA 1T0OA 1GOMA 4DUWA 2Y85A 5CJ5A 5DY3A 3BO9A 4DJDC 3T9PA 1S5MA 3OZPA 3WMBA 4K68A 1XM3A 5D2WA 4IIGA 1HF6A 3NVTA 1Z41A 3SCPA 1DHPA 1TREA 4GKTA 4JEQA 3CZ8A 2BGQA 3PZUA 3T0CA 1XSJA 2DT3A 4KEVA 3H54A 4FXFA 5FA5A 8RUCA 3W7CA 4N9EA 1TQJA 4XISA 5H8PA 4MPQA 4IQLA 2BY2A 1MRQA 3KZPA 1XSIA 4URIA 2VWTA 4DQWA 1W5MA 1VC4A 3GU1A 4A21A 3CYVA 2E5DA 3A6OA 3FAXA 2FFIA 1J10A 4H9TA 4KRZA 2VOMA 2O9PA 3MMDA 1W9PA 3B8DA 4PODA 2A3EA 3L9CA 1BWLA 3UWUA 4ML9A 3IIXA 2MUCA 3DCPA 1O12A 1JI1A 2OZTA 4UTLA 1WOAA 4GINA 1SFTA 1XBVA 3XIMA 4G2DA 1VFLA 2W92A 3B0PA 1SJDA 2PDFA 2Y8VA 2EAWA 4HYVA 1LYXA 2PBOA 4JTAA 1FP9A 3CQIA 4QBXA 2WM0A 4LF2A 1WBHA 1W1A1 2V63A 4HA3A 3S2CA 4N4PA 4O28A 1KGUA 1UZDA 4OFCA 4Q4OA 3G1VA 1ONXA 1A53A 5J5DA 1W8GA 1KFBA 4WZHA 1SYTA 4Q4QA 3LLXA 2RHGA 3EMQA 3CZGA 4IG2A 3PTMA 3NSNA 1BFNA 2VJXA 3VKBA 3KXQA 3T8LA 2A6LA 1XYLA 3M0KA 4M6UA 3VFLA 4PSPA 2E1DA 4DO6A 5CBIA 4LVGA 2ALDA 3ONCA 4RDYA 1HKKA 2VCCA 1GT8A 2D2HA 4Z2KA 3W3OA 1OJXA 1UD2A 4MHBA 3NZQA 1G6CA 1Q6OA 3M0ZA 3UW6A 1RPXA 3MUCA 2HMCA 1Q6CA 2ZX9A 3AXMA 5D05A 4ENLA 5EFDA 2GVGA 2DZVA 1XI3A 1CPUA 3T0BA 1E6ZA 1ENUA 3UXLA 3MMWA 3MU7A 3ISIX 1HJSA 2E1WA 2PB1A 3MDUA 2ON3A 4C6LA 3O3RA 2YL8A 1K8CA 2IXUA 4B5VA 1VF8A 1JPKA 3W2UA 2G3NA 3N25A 3OJGA 3GDKA 2INFA 4UMAA 2O9TA 3LNPA 2GPTA 5DXYA 5BOOA 1UR9A 3PSVA 4ZB2A 2D3NA 5CZJA 3L4XA 4PUEA 1IWBA 1GUVA 4RE3A 1Z44A 4MFEA 4F0MA 3MUXA 4MNLA 4Q7IA 1KM3A 5I3DA 3AS3A 3NO1A 4K36A 3PR2A 1JI2A 2X40A 3RF9A 3JUGA 3W7DA 3KVMA 2NW0A 1BD0A 1R38A 3RJYA 3QTPA 3WNOA 3IIVA 3WX7A 1Q65A 5PTDA 8CGTA 4QIUA 3S8HA 1A50A 1PZ0A 3LPPA 1AMKA 1TZZA 2ZXQA 4GNVA 1RP9A 2X1UA 3KOXA 1IWAA 5DBTA 3JZUA 2GWNA 4GCXA 4IPPA 3CUXA 4GNJA 2E6YA 3AQUA 3WBYA 2VTFA 3VD3A 3H2NA 1AUSL 3NDOA 2Y5JA 2DSVA 4XZNX 3V18A 3F4CA 3SCVA 4HSOA 2NSXA 3CWNA 5K4XA 3IANA 2X8RA 2ZUUA 3DYOA 3NTYA 1L6YA 3RHGA 5M17A 3TOPA 1KD0A 1WUFA 2Y0FA 1XH0A 3DFYA 3IK2A 2OX1A 1UWSA 2CBIA 2IQTA 1EP1A 4ZE5A 4PSRA 1ZQ5A 5DN1A 2FHBA 4LQ1A 3UG5A 3QKZA 2FMOA 4IJRA 4MDOA 1FUYA 4H01A 4O19A 3UR2A 5EMJA 1O4UA 5FIPA 2P76A 1BF2A 2AGTA 1G4TA 4IMAA 1YPXA 3TTYA 2QCMA 1GQKA 3WEOA 4XKYA 3ITLA 4NRRA 5AYXA 4FB7A 3EB4A 4GC4A 2YLLA 3GM8A 4F0SA 1B57A 4FLOA 4ROQA 1FWWA 3VKKA 3QHMA 2OYLA 1LCOA 1NWUA 4Y8FA 5G1MA 4DM1A 3PJUA 3ABOA 1K9FA 2RKXA 1SSDA 5HNRA 4US6A 4DNMA 5I3FA 2XGIA 3S2LA 4PMDA 5D09A 5EB8A 1YXDA 3W37A 4NUWA 1QI2A 5AFDA 3SECA 1WQ5A 5A8QA 4AD3A 3L4ZA 1WXYA 4KFPA 3VIOA 4BF7A 3D5HA 2YB1A 3RMJA 3T4CA 3O6YX 4LBUA 5D9OA 4F0RA 2OZ8A 3LHVA 1R30A 3ZLFA 2AL2B 3W87A 4TTUA 2DT2A 1FX6A 4WXYA 1EYEA 2VZTA 1UWRA 3F4VA 2BY1A 1WB0A 4I7VA 3FDGA 3SQLA 3BMVA 4RXFA 1UP2A 2EGZA 1X96A 3B8TA 4XAGA 5I77A 1MW0A 9CGTA 3OLIA 4FP1A 3UVIA 1ZAHA 1B30A 3WBXA 4JQ3A 3CB3A 3OQEA 4OOUA 3VABA 1X39A 4HCHA 1OQFA 1KNWA 3R11A 3A4JA 3EX1A 3HF3A 3RLUA 1TPFA 4OZOA 1LG2A 4UTIA 3B06A 3AIQA 2ZUVA 3IJDA 4Y6GA 3PBGA 3B9NA 1NDZA 2B81A 4QISA 2HK0A 1CECA 5A3HA 1AQMA 4JOMA 2QKFA 3TN6A 3AIUA 1PKLA 1KXTA 4L4PA 1JD9A 1DP0A 3CV6A 4OJYA 1Y8BA 2VQTA 4R34A 3NQ2A 2BSLA 1V3IA 1E9IA 4LY8A 1E4IA 3GAKA 4HYWA 1TTJA 2XM1A 3DFOA 3H22A 1P0KA 3M44A 2VFFA 3KBVA 2D73A 1GNXA 3V35A 5DMNA 3O6CA 2DT0A 1QBBA 2I1OA 4B4FA 1JCLA 4B90A 4Q8OA 1E4MM 1MUMA 3W1RA 4O54A 2VEIA 3LTYA 3TAOA 3AISA 4P8WA 1AW5A 1PDYA 2IUZA 4FNRA 5IM51 5CPNA 1O5XA 5DRCA 4Q22A 5AC4A 3CUGA 3WH7A 3AUJA 4V28A 2CLFA 3H4XA 1XYCA 1HUVA 3BJSA 4A8IA 1C8QA 3G77A 1S2TA 4TUFA 4GVFA 2Z1WA 4BEQA 4IFKA 4EPEC 3AXXA 4DUOA 3P7YA 3K1GA 4DY1A 1WO2A 2R1KA 1PWLA 1LQ0A 1VJSA 3IS4A 1OFEA 3NR0A 4MWAA 3GLCA 2YCEA 2PUZA 3GVRA 4UOJA 4BQ3A 3QMSA 4JTEA 3GX9A 1YNQA 2B4GA 3PTQA 4MDPA 3Q37A 3TC7A 2HNHA 4A3QA 4P8XA 2XH2A 4J3TA 3TSMA 2QUNA 3WNPA 3OHMB 3URBA 5DT7A 1ZBKA 3FK4A 4YU1A 3WJZA 3U4FA 1VGAA 1EHNA 3E2VA 1OIMA 4K1GA 4H4IA 1E0UA 1VCGA 3MYPA 2J47A 2WHMA 1LP6A 4AUBA 2ISDA 3WH6A 3AS1A 2VDIA 3LNMA 2JKEA 3P67A 1L2QA 1OYCA 1W31A 3RPDA 5H1WA 4JTLA 5IOBA 1M3UA 3LMZA 5KZ6A 1EZWA 4EOUA 2V5CA 2E40A 2PD5A 1VYSX 5D9NA 1FWNA 1REQB 3FHAA 2OQLA 1M5WA 4A35A 5C7VA 2QNEA 4JKLA 2H90A 3L4VA 2DSZA 5A6JA 5DRIA 2HJPA 2QCDA 2V2DA 3GBEA 2E3ZA 2XFYA 4CKQA 3DIPA 3UXIA 4AC7C 4O11A 3OLEA 1XRVA 5G2HA 1J5TA 4FPSA 4XTIA 2CBUA 2EPNA 3UA3A 2P8BA 3WJWA 3TXZA 1QW7A 4TVCA 3AHVA 5A6BA 1GQLA 1EO5A 2YR1A 3WELA 3A5VA 2X09A 4RZ5A 3N11A 3TUUA 3S5ZA 4JFSA 3GTNA 4MKNA 1UWQA 4I5RA 2V68A 3GNDA 3TW7A 1QI4A 3WMCA 2X2YA 2ATMA 3W7IA 6XIAA 2XVKA 2FPVA 4KWUA 2VFEA 3SCOA 3HG4A 2FPYA 1Q85A 1W54A 1OG0A 2F38A 4A05A 2NSOA 3RK8A 4PMJA 1OCJA 1KO0A 4YVXA 5EKYA 4C90A 4GQQA 2VZUA 5DY2A 3WQPA 1B4EA 5DFAA 3I6RA 1DOSA 3DERA 3TROA 4CNPA 3B03A 4A8RA 1RAKA 5H2ZA 3SRKA 1S2WA 3CPGA 4WKFA 4QQUA 3AIBA 5D04C 3KVJA 4W88A 2BY0A 7A3HA 3QOKA 1EJXC 3EKGA 2XN2A 2QMKA 3S2JA 3UY7A 2CLOA 4HJWA 3WUGA 5FJJA 1AH4A 4AZGA 4H9MA 1KRMA 4CQCA 3L4WA 3W72A 3N2CA 4UTHA 2OJPA 1S2CA 3UPWA 1SO3A 3LLFA 3N04A 4LAKA 4NAEA 2D2GA 4S3KA 3DU0A 2G95A 1ZRQA 3GR8A 1CBGA 3MV11 4NJKA 1YQ2A 5LZLA 2G3MA 4PMQA 2V81A 3ELFA 2ZIDA 4QAWA 1CX9A 5CSRA 3GDTA 4Z08A 3PG9A 3G1AA 4IGNA 1QWKA 3H4GA 3YPIA 2ZICA 1LL4A 4XO7A 3I65A 3AYSA 3L23A 2DVTA 3CHFA 3ZM8A 4GUJA 3JU2A 2FJUB 2DZTA 1XYBA 3H7VA 3DI0A 2XH0A 5EMUA 3L0GA 4S3JA 1OHLA 2P1FA 2GL5A 3LCGA 2I17A 1PZ2A 3C0SA 4JPGA 5CG0A 4FNSA 4IFRA 3Q2DA 5HQEA 3SN1A 2QCDB 4K6AA 3HQ1A 3HJZA 1FVPA 1F2JA 3OIXA 3DI1A 1IHIA 3OW1A 4AYGA 3W0KA 3WH8A 3ES7A 4I5UA 2I56A 2BZNA 3GC5A 1NWTA 4O14A 3FV9A 4B3LA 1OSEA 2Y24A 3NQEA 4PRWA 2VELA 3UWWA 3C8NA 2O56A 1A5KC 3GVGA 1H51A 1PIGA 1YADA 1ZY9A 1Q8AA 3WCZA 4DJDD 4JTUA 1QOQA 1DIEA 2R1MA 2DQWA 4WDXA 1RVKA 1PZ3A 4F40A 2TAAA 4D1JA 4MTVA 4P7LA 1XHGA 3IJ6A 3IWPA 4WCJA 4DBSA 1O94A 4PH6A 5A6KA 4I3GA 3KWSA 2DIJA 3LBCA 2FZDA 2ESCA 3ARRA 3HGJA 1O68A 3QGKC 3KOFA 1EEPA 1H0IA 4PBEA 3MSRA 4M19A 1FWBC 3CLMA 1VFUA 5BXSA 5CLWA 3VNMA 1LOQA 4IX0A 4MZ8A 1EDQA 4LWWA 1PE1A 2UY3A 1P48A 4QQ3A 2E6FA 2V69A 4JQ4A 4GH1A 1ZENA 4AIUA 1Z89A 1F3TA 2ISVA 3L0NA 3P82A 4EKJA 3QF0A 4JIIX 5BU9A 3ZT5A 1TZ9A 3PULA 3RLHA 4DPQA 3MV01 4ORIA 4R7OA 1H1YA 3GC4A 1CLVA 1QK2A 1IEWA 4BWLA 4DHGA 3VVGA 3H55A 3QSTA 1XUUA 3U2ZA 1O5QA 4LAUA 3MO7A 4XD3A 1G9HA 3DN5A 3TA6A 3WLRA 1Z69A 1W5OA 3G1DA 2QCCA 3CBWA 1UKPA 1EGVA 5HJXA 3IJLA 4BQ4A 1JZ4A 3GXNA 3V1PA 4U28A 1KBBA 3TJLA 5IXEA 4CNOA 1VBUA 1G67A 1GOOA 3PJTA 4ORMA 3VKCA 4IPLA 4CEUC 4Z2HA 3NOYA 3ZVHB 3N29A 2EJ1A 1GW1A 1ISVA 4XX6A 5JQ9A 3LSCA 2QGYA 1KFWA 3OA3A 4HU8A 1R0MA 1XLEA 4KEMA 4GY1A 4HNTA 1XGDA 4MY9A 3WBAA 1K7XA 3QGAC 4IMGA 1LM1A 2CXGA 2BB0A 5KSWA 3RJXA 3EPNA 3PHAA 4EVZA 3SY1A 1PX4A 1BHGA 3PWAA 1XLIA 2EF9A 1FWCC 1NFGA 3P62A 1CGTA 3WDIA 4ZTXA 3MTWA 4QS6A 1HO4A 1OADA 5TIMA 1ZP4A 3NZGA 4LXFA 3S1WA 1Y5VA 1FH9A 3CIWA 3EWCA 1A3HA 2XSBA 3FGCB 2OPJA 4GKLA 1O7AA 3GW3A 4Z1BA 3HPFA 3HV9A 5IRPA 2WJZA 2C16A 4M6PA 1KRBC 4O50A 4QE1A 1SW7A 1VFMA 5ABFA 3QLLA 1JPIA 2QDGA 4CQ8A 3OODA 4CN1A 1PCKA 3N4FA 3VX0A 4XB3A 2YA2A 3VIFA 4UQEA 2OTDA 5JU6A 1CI1A 4HOWA 4I9AA 1TCMA 1TCDA 3LI1A 4CD7A 2GOKA 4AW7A 7CGTA 3FXYA 3PTDA 1AJ0A 4QJ5B 4XKYB 4AD1A 3U7BA 3VDGA 4TV5A 3QXBA 2O4QA 3SUVA 1C7SA 2JFEX 2ADAA 5TQLA 1EDGA 4GMEA 3RRXA 5FI8A 3BMWA 4AEFA 5M3WA 3EOUA 2OGJA 2ZX8A 1TPC1 1W5NA 1EDTA 1BQGA 1NDWA 5CGTA 1F5ZA 4GI4A 2VVSA 1UWAA 1VR6A 4GJIA 1W1B1 4A3UA 4OTKA 5M03A 1TJPA 1K03A 4JTCA 2F7FA 1TPWA 4XZMX 5A5WA 3ZYZA 4I6KA 1Q66A 3VNZA 1B3XA 1E6QM 2FTPA 4DUXA 4ONVA 3VTRA 1QRQA 5KZEA 1GHRA 2VFDA 1C9WA 3HG3A 1IZCA 3GIQA 4C7FA 5SWUA 3IIPA 4UFIA 3VGEA 1QOPA 1B9BA 4B91A 5JXQA 1XLAA 1IGSA 3WQ5A 5LIXX 1TUXA 1CB7B 1E1CB 1TO3A 5FL1A 1E6XM 1HVXA 3QHNA 3ZWTA 3SIZA 4S3EA 1DIDA 1P1MA 3TNBA 3LBOA 3VCNA 4M0XA 5IBXC 4Q4MA 3TC3A 4ZO6A 2EKGA 1YHTA 7ENLA 4QEHA 5HAOA 1TV3A 3LHZA 1T40A 2JKAA 2EJAA 3AIEA 4WF7A 4OWGA 3LYEA 2WCAA 3W27A 4XKMA 2QDHA 1PSCA 3GFYA 4UQCA 5M5DA 4OBSA 3CEPA 3K1DA 3UF9A 4F0KA 3ZJ6A 3WJXA 1UR8A 1MO0A 1K9DA 2UV8G 1F8IA 3SW6A 3BSHA 5GPRA 5LHEA 4YMZA 3A23A 3VC5A 1C91A 1XV8A 3FEQA 4ECLA 2GWGA 1WUEA 1PUDA 1SW0A 3G8EA 4FO4A 2PGEA 1X8FA 7XIMA 1EZ2A 1VHCA 1E0TA 2Z1SA 1BVNP 2X7VA 4QX4A 1JD7A 2J9YA 3RDKA 5K3VA 4TIMA 5FJPA 4FLQA 2W4XA 1V5XA 3MI2A 3B40A 3HB9A 3EWXA 4MF4A 1BQCA 1J79A 4O1DA 1NAL1 4IX2A 1AA1B 2W6RA 1X38A 1QNPA 4GI9A 3FGCA 1FWDC 3DFTA 3DFNA 3KOWA 4RXGA 4FXSA 1VYRA 3H21A 3MT1A 2E25A 4Q8VA 1QPRA 1XLCA 5FF2A 4D6GA 3M0VA 4EIVA 1ITXA 1ISXA 3THAA 3E2SA 4CU7A 2X1IA 3UWZA 4QCEA 1VJIA 1R46A 2FZMA 2QF8A 2IMRA 8A3HA 3DHFA 2PS2A 1F61A 1ZAIA 3WENA 1NH6A 4CCDA 2OKTA 3P81A 2HBXA 1WDSA 4LH8A 1W56A 3VDHA 2V9DA 1MXSA 3CZEA 2C79A 2WNZA 2EXOA 3NL6A 4PMUA 1W2PA 1SFJA 4GPNA 5EBUA 1XLHA 4MAZA 4E5TA 3HMCA 3KHDA 1J8VA 4MSSA 4E8GA 4YTUA 3PUEA 1I1WA 1ICPA 1OX6A 4YTRA 4XAPA 5BW6A 2OO0A 3Q94A 3GUWA 4Z1YA 4I7UA 3EB2A 4FNQA 1TMQA 3UZZA 1IYXA 4Q32A 1EIXA 3MP4A 3LB0A 3R13A 1V6VA 1XIEA 2WSQA 2EG8A 1M7XA 5LHFA 2PRLA 2PDLA 3PBVA 4OBTA 4HK5A 4LB4A 2GSHA 2IKIA 3FIGA 1UKTA 4Q8UA 1G4PA 3HTWA 2DJLA 3VILA 4PRTA 1XH2A 4BQ5A 2Q71A 3P6LA 3W1AA 1D7FA 1C8XA 3TYAA 3LU2A 4KIRA 4H6QA 4D6DA 1QATA 1XG3A 5FF0A 1FWAC 2WKJA 3IVSA 3VOCA 4LVAA 2RJGA 5D8ZA 2PTYA 3WH9A 5FACA 5A8NA 3AU6A 1FWIC 2ZKMX 2CCRA 3ATZA 2DUXA 3VNYA 4K7YA 2F8QA 2D1ZA 2QS8A 1H2JA 2J25A 4ZQOA 1GCYA 2ODOA 4B5UA 1EO7A 1OX5A 2WC4A 5T9BG 1KBKA 1E6RA 1U5JA 4IPNB 3GXMA 4V27A 3DYMA 3C3UA 3G24A 1V0KA 2WJDA 2BASA 5IHRA 2C0AA 1R2TA 3EKLA 3NPWA 2PCQA 4Q7NA 4WD0A 1XX1A 4JTKA 3SEPA 4IIDA 3QHOA 2Z27A 1DWJM 1TIMA 3W7RA 3DG6A 5AECA 3TC6A 1OB0A 1GYLA 1LLOA 3HPSA 2J78A 1CZ1A 4FR1A 3UWYA 3W7QA 1MI3A 3GR4A 1YX1A 5G2WA 5EL1A 2DW7A 2G50A 4GIEA 4WSKA 3IV3A 2YCKX 4GUIA 1WX0A 1HVQA 1GJUA 3KDOA 2WC7A 4LCRA 2D2OA 2D0FA 1FWHC 1KCZA 4UUIA 3P8IA 5I07A 2FGZA 3WDRA 1W3TA 3T42A 1GKRA 1LTDA 1NJJA 2ALRA 2HEJA 1OFRA 5AHFA 1W3JA 1H49A 3HV8A 3LGDA 3H26A 1PEZA 4I5XA 3O6DA 1WZMA 4IGMA 2BMBA 2BFGA 3WEZA 3VIGA 4BK9A 5GNYA 3MKVA 5FAJA 5D33A 3IVUA 2OT1A 3W7PA 2J88A 4O57A 1UA3A 3HQPA 2J7GA 1US0A 2RDUA 4AY8A 1X6NA 4AWUA 1VQTA 4ZZ9A 4UFHA 3LD5A 1JAKA 3AXKA 3I3BA 2I5QA 2OT0A 3G1RA 1FWJC 4JNMA 3SRFA 4ASTA 4G8TA 3RUBL 3UESA 4EP8C 2NWSA 3F5JA 2VGIA 3MPGA 2P5NA 5AZ1A 2CBJA 3PP7A 3W7HA 3RLVA 2AMGA 2HRWA 1FCBA 3E0VA 3MP5A 3G1SA 4U3AA 3TN4A 4C65A 5BXPA 2WHJA 3WFAA 2CZVA 4S2BA 5BXTA 3DHDA 2OQYA 4B5TA 1H60A 4GABA 3M7WA 5ECVA 4GZ7A 1TVPA 2XIOA 3ZJKA 1AK5A 4JL2A 3TYBA 1O5KA 4PMRA 3WG6A 2O92A 5EFFA 4O16A 1VKFA 4JN6A 3VMPA 1UD6A 3VE9A 3LHWA 2EPKX 4OT7A 1JF6A 1GHSA 1HFBA 2E4TA 3BV4A 3EEZA 5D9MA 3PZGA 2R14A 2PGRA 3IIZA 3A64A 2Z7KA 3G6MA 4G56A 2G41A 3HPZA 4FK9A 4DVOA 4PEKA 1UR2A 2JEPA 4YIWA 1LRNA 2RGLA 4AHPA 3AMDA 4C6KA 4QE4A 2XU2A 5HJYA 3M0MA 2VX5A 4JFWA 2ACQA 1KTCA 3DHPA 3OBAA 4MWAC 2OKOA 3R94A 1JZ6A 1GZGA 2QEZA 1QJWA 4MJMA 1DE5A 3AMGA 4HU0A 2QJMA 2Y7FA 3ARYA 3BLDA 5ABEA 1QW9A 2ICSA 2G5WA 2JQXA 3UG3A 4GZEA 4F2UA 4NI8A 2XH4A 1I4NA 3I7RA 2ZUTA 2HROA 1WDDA 4UTUA 4AWTA 3OG2A 5C5YA 4PBFA 3M6DA 4PFMA 1S46A 1W8SA 4PCTA 1VIZA 3K46A 1Q2RA 1UUQA 2HE5A 3MMUA 1R3RA 5A69A 1FRBA 1JXJA 3EX6A 1I2QA 1SSGA 3R10A 2IW0A 4DZ5A 1LQ2A 3SI9A 5I78A 1EGZA 5LIUX 4AEOA 5D2YA 1WXZA 1Z32X 3ITTA 1H7NA 5CZTA 3KE0A 1OZMA 4ERAA 1EP3A 3R25A 3XISA 3NZ1A 1V6WA 4LOCA 1I60A 5A1AA 5JBFA 1W3NA 5AYYA 3LXCA 4PL1A 4HBKA 3CO4A 4R88A 1GVIA 3OLDA 3LHUA 4UXDA 1H0GA 2DY3A 2ZVIA 1A5LC 5CQ1A 4ZQMA 1HQTA 1UPPA 1B54A 4I8DA 3OOQA 1E0XA 4NZ3A 4AD5A 2Y63A 1MSSA 1SJCA 1U30A 3LS9A 1KB3A 5CPOA 4HB7A 4P61A 4EWJA 3CQKA 4AX7A 4CD6A 4QJ1A 3CAKA 1WA3A 5FCZA 2HTMA 4P7QA 4O17A 3GNPA 1XYFA 4IIEA 4PMOA 3BICA 1JXKA 5F2LA 4B9YA 2WMHA 2VX7A 4YCPA 2J7CA 2H8XA 4FEZA 4W93A 1JULA 4QG9A 3G6LA 4KWWA 4IP7A 5E1QA 4JTSA 3FYPA 5FF3A 2J7FA 2XTKA 3C2RA 1E15A 3AXIA 3LM3A 1GJPA 1H5YA 3MCOA 3W1NA 2E77A 3PPCA 4WGXA 3KVKA 2E9MA 1F07A 2ZE0A 3GTXA 4EPKA 2J7EA 3AYRA 2PWDA 4O0QA 4HZ7A 2G8ZA 1PZ1A 1FDJA 1M6JA 2FHFA 3ARZA 3R5EA 3H2EA 1V77A 1ITCA 3I7SA 3GG7A 3PBUA 1F3EA 3LXAA 1ICSA 3UCDA 1M9HA 3NDZA 3OLGA 3WLPA 3TONA 1UROA 1BG4A 3O2LA 3K5XA 5ENLA 4UTFA 5CGMA 3VAVA 2QZRA 1LZOA 1L0PA 4HMNA 3BAYA 3IJ8A 2V6AA 3PZOA 4GG9A 3I68A 3ITCA 3VOFA 3OTRA 1YXCA 2VVNA 5BRPA 4X9YA 5K9CA 2JIWA 3C2OA 4Y9AA 2PGFA 1R3SA 2QCLA 1TTQA 4L4MA 1W9UA 2FFCA 1JFHA 3SN4A 4U31A 5CSYA 1F3WA 3DAQA 2CLMA 3G2GA 4GUHA 3VD4A 1H41A 4YCOA 1QO2A 1XPYA 1V0NA 3W7JA 1P6CA 4D8ZA 3ZFHA 3MANA 1AG1O 3N18A 3GWQA 1ADSA 2OEMA 1ZZMA 1YW1A 1IEQA 1ISYA 3SADA 4UQ9A 3H7RA 5ECUA 1T6MA 4JIPA 4NF7A 3OGRA 3R4IA 3S9YA 4XAZA 1UIPA 2WJEA 3KL0A 1A49A 1DVJA 4PUWA 4C1LA 2QPSA 2VENA 4C1KA 4Q8PA 2PGWA 1ITUA 3BK0A 4HYRA 3COTA 3TNOA 4AVNA 1WDRA 3B0VC 1AFSA 1ZTVA 1UZ1A 4LW7A 1I45A 2AKZA 1O60A 4EE9A 4Q3MA 3HGRA 5CCZA 3VZXA 3TE9A 1EBHA 4CGTA 4GQRA 1MVYA 3IACA 5BMXA 2VZSA 3GR7A 4F3HA 1MEWA 4NQ1A 3B9DA 1KR1A 1XICA 3K8LA 3CIVA 3TQKA 4GQ0A 1QOXA 3PBMA 3SSZA 3P61A 5HR7A 4M1RA 4AIEA 2VD8A 4X0NA 1J0YA 3W00A 1HP5A 2XYLA 4GIRA 2FKPA 3ZOAA 1SO4A 3KBNA 2A79A 2V3GA 4ZBCA 1X7IA 1TG7A 1KFCA 3QPYA 4BI6A 3GXDA 2YYTA 1UCWA 1FFQA 2L5HA 4L9YA 4QJ3B 1MEIA 4Z2GA 4CVUA 1UP0A 1JDDA 1V02E 1Y5XA 1WOBA 1MXGA 2D23A 3E49A 3NEHA 5KITA 2A0NA 3EA2A 1IXOA 1TX0A 3JVAA 1VEMA 3TTOA 4PB5A 4LS2A 3N4AA 1NY1A 3TZNA 3S46A 5IHSA 4J3XA 2ISWA 3VX1A 1EGMA 4LUJA 3UJSA 4EXAA 4MNJA 5EA9A 4D71A 1L8NA 2NVAA 3E38A 1XLBA 2O7SA 3PUOA 3OA5A 5K9DA 2ZADA 2Y62A 5I09A 3VE7A 3NOEA 4IM4A 2J13A 2VL4A 4MZYA 3TJ4A 3UZ5A 4AHQA 3GK0A 4GI6A 1EJUC 1MMFA 5E6YA 3TYCA 1GJWA 1QI5A 4DF1A 3TN5A 4R53A 3OHIA 4XQ6A 3VD9A 5RUBA 4OHQA 3NQGA 1VFHA 2NZLA 5I0DA 1CXLA 4BFAA 2ZX5A 2GLKA 1E70M 3QYQA 1YLVA 5K2ZA 1W1TA 4ML4A 2OR2A 2Z1VA 1C90A 2ZVRA 1PIFA 1WV2A 4Q33A 4KGJA 2YXXA 5E0FA 3WQDA 4D1IA 1EQPA 2V5DA 1R47A 3W82A 4DAFA 1ZJHA 3KRBA 1R87A 3W1MA 1QASA 2Q8LA 3OVQA 3LPGA 1Z42A 3LXBA 1KTNA 3OVGA 6PTDA 2J8TA 4YS1A 3TMLA 2QUVA 4W87A 1FXQA 4A3YA 1YPFA 2F84A 1EQCA 1AW2A 4L56A 1I6NA 1R9ZA 4K3ZA 4Z17A 1UH2A 1RA0A 3QKEA 4XG1A 1LL7A 1LUCB 2JE8A 2VNCA 3C8FA 1NEYA 1F8MA 3IUDA 3DFQA 1M53A 1M7PA 4P5UA 4H9ZA 3PS7A 2Q6ZA 4JQAA 2Q02A 3K4DA 2ZZ3A 2OOGA 4PYSA 4RL3A 5MF5A 4KEZA 5L9FA 4J3UA 2QYGA 3W53A 4JKMA 4GUFA 4PZVA 5A2CA 1UOKA 4X3ZA 1PV8A 4XZ9A 1QWGA 3RX3A 1YNYA 4LU0A 4DWDA 3GO2A 3NO3A 1FHVA 4PMXA 2VZVA 4HNCA 1UD8A 3EDDA 1F4HA 5E5CA 4QE5A 4CQBA 4IWWA 1OF6A 3VKDA 3ZMRA 3A4XA 3N6HA 1EEXA 4M24A 4WRHA 1VFSA 3NQ7A 1CXKA 1MYRA 1SVDA 1E72M 1U2YA 3ZS4A 4QG6A 3F4WA 4OU1A 1TPEA 3EZ4A 5CC7A 1R86A 3SBFA 3PZMA 1KXHA 2QV5A 4I90A 5EY5A 4NJJA 1MEHA 3LMYA 4MKSA 2ZBTA 5KZMA 3G3MA 3R79A 1XYMA 4J9JA 5AC8A 1CT5A 2JF7A 3UPMA 1R2SA 3ORWA 3LTPA 4AFYA 1EX5A 1RQBA 1UW9A 3DGBA 4NNBA 3L66A 4W7VA 2C6QA 1WE5A 2GJLA 4S3CA 2QCGA 5CPTA 3BLIA 5E09A 2BHUA 3VGBA 3U0HA 4AWSA 3PG8A 2QV4A 1TMHA 2P3EA 3H2AA 5AC6A 4POCA 2FVLA 2GSJA 1K1DA 1SPQA 3KLLA 4PR4A 4RX0A 4AYSA 1VZWA 3I4EA 2VEGA 2GJXB 1VBGA 1QPOA 2PWHA 4ZOCA 3N13A 1XCXA 4NL1A 1W3LA 2XFFA 4LUYA 2G96A 2XUCA 1F73A 4ICCX 2RH9A 1GGOA 2FZ8A 4OV4A 1WZAA 2X1SA 3F2CA 1MW2A 3EDFA 2VD9A 4UQBA 1GOXA 5LA1A 2WSKA 3PNZA 3LCXA 1OK6A 5AVNA 1JCJA 5CH9A 3ANYA 3H2MA 1SMDA 3EB3A 4AH7A 1CIUA 2QT3A 3ID7A 3WMLA 4I9MA 1UHVA 4W7UA 2F2KA 4WDWA 1SM9A 4P7OA 1NOFA 2DZXA 2Q8XA 3KBMA 4G9PA 4J40A 5DMYA 3QV9A 5GJNA 3FJ4A 3LLDA 1KV5A 4IMDA 2BOFX 4XBSA 3HFTA 2GFTA 1BGGA 4NKCA 7ODCA 1FTXA 1PJ9A 4AZCA 2Z4GA 4V1XA 2VRJA 2IQDA 3AZSA 2CERA 1LBLA 3HO8A 3SCUA 2YBTA 3QZAA 3VDCA 3PBWA 4W84A 4FXRA 3USZA 1HKWA 5CZSA 1A3WA 1E5JA 3MUY1 3H8AA 1XG4A 1Z7AA 3LA4A 4FX6M 1W9XA 3NEVA 4JTHA 3C61A 1AMYA 4C6JA 2Y61A 3NYDA 1A5UA 5DCEA 4JTJA 3TVAA 4M81A 1KGWA 1QMLA 1XCFA 4O1EA 4ATDA 4W8AA 2DT1A 1HJUA 1G69A 3ECQA 1MFUA 4OGZA 4REQA 2HE8A 4U5IA 1BVWA 2QPXA 3BOFA 3TW9A 5T9CE 4GXWA 3IGHX 2I5IA 3TTEA 2XISA 3NVDA 4M6VA 4CNUA 2PU1A 1NP2A 2H6RA 3BZGA 4Q4KA 4DJDA 2BVYA 4JN7A 3KDNA 1TV4A 3H4WA 4DJEC 1B31A 2J74A 3V1HA 2UY2A 3OEXA 4LUTB 4AZIA 1YBQA 3MW7A 2P3ZA 2VGGA 1I8JA 4GISA 1CEOA 2HXUA 3MP3A 1VBJA 1K7FA 2REQA 1VPXA 4DPPA 4AD4A 2E0PA 4DI9A 2C71A 3DGRA 3WUEA 3PVFA 5E93A 2PFHA 4CN6A 1PX3A 5BRQA 3CAQA 4G1KA 1NWRA 4CCZA 3C56A 2DORA 2XM2A 2PTWA 2QPUA 2V5LA 4LYQA 3AROA 4QDPA 3MVIA 1K8XA 9RUBA 1DWAM 4S3BA 1OWQA 1GONA 3AI0A 5HBFA 4B5XA 3RNDA 3GIYA 5T26A 4MNMA 4M5PA 2Z1BA 3BG5A 4KBXA 2JIEA 4HIBA 3GE7A 4EPDC 2NT1A 2IXVA 3IGSA 3RM8A 4R9OA 1M68A 3ZJ7A 3ABSA 1V93A 2WYSA 4J1OA 2BGSA 4ZQPA 3WLSA 3M7SA 2GOUA 4RDVA 3APGA 3KBJA 3KUMA 5HK4A 1E73M 2HVMA 1U1JA 3V0SA 3KZSA 5ABFB 3G0XA 1VRXA 3GQYA 1GPFA 6REQA 3W7EA 2EKCA 3T07A 2VKZG 5CG7A 2YL5A 4MB3A 2QCNA 2Y70A 4MM1A 4WY0F 1EUNA 3LX9A 4INFA 1XBXA 3TYEA 1G7VA 2VI0A 4JBRA 1I0DA 3DHUA 1X6LA 3VIMA 1XLKA 3TFXA 1W9BM 2NVDA 4DBUA 3FEMA 1D8CA 4ZSTA 3AALA 3LZ3A 3ZT7A 3W81A 4H6KA 1KXQA 3AMCA 3CL7A 3ZLHA 5C55A 1Y5WA 3ARUA 3FHQA 1YYAA 2DFAA 2VUYA 5HWNA 5G4EA 1HGYA 2Z28A 4IUOA 4BS0A 2NT0A 1XJBA 3SY5A 2X1RA 2WVVB 3LGEA 5JIWA 4E8DA 4GLEA 3MA8A 4KESA 1F05A 3PANA 5TNVA 4UMBA 5DT5A 4GVHA 3W7LA 2ZZ7A 4A22A 1U83A 3RCYA 2H9AA 1J96A 5HUPA 1OFOA 2C13A 1UC5A 5LYRA 4B2DA 4B16A 4JL1A 1VPYA 4YYFA 4NZCA 4Y8EA 3ZVHA 1RBLA 2WWDA 5LIKX 1TPDA 5I24A 2NXGA 1RP8A 4NAEB 4TQTA 1LWJA 4Q4PA 3I3DA 1RALA 1VAHA 2IQ0A 4PEEA 2O7QA 1DXIA 3KTCA 1W37A 3RPMA 2XVLA 3M5XA 1C93A 4NAFB 4IMEA 2GQ9A 1CTNA 5DCBA 5M1TA 3TV8A 2NQZA 3HQNA 4HT3A 1ZUAX 1FXPA 1S38A 2EPHA 3LCHA 1OD8A 1SZEA 1XLMA 2QCFA 4XVEA 2BVWA 2PF8A 1FHLA 1AD4A 1IGWA 1JCTA 7REQA 4JTTA 2E5BA 5D2VA 2HISA 5CPMA 3RPTA 1W5PA 1MDLA 4Q8TA 3TOYA 3QY8A 1W3KA 3VK5A 5FEWA 4ZXOA 3OGVA 2OU4A 1EOMA 1TQXA 3PPGA 1TTIA 3BC9A 2OEKA 3W01A 1POKA 1XLJA 4CCEA 3VOGA 3ZQ9A 5I03A 3OVPA 2CLLA 3IGUA 3BL3A 4BA0A 3CTTA 1HKVA 5AN7A 1SZNA 3CPUA 1CW2A 2XVGA 5A8GA 1CCWB 2G3FA 5FEPA 4LRTA 2HV5A 4G5DA 1H62A 1NOUA 3WQ8A 2IKGA 3GFXA 2DZWA 2J75A 1EBGA 1WNOA 1GQNA 1JQXA 4W7WA 1WPCA 6TAAA 4ZOAA 3GG1A 3UGRA 2V5JA 2VX4A 3WQ6A 1UOZA 3DKJA 4HKPA 1TKKA 3PK7A 4UB9A 1TE1A 3H53A 2GJPA 3FXGA 4FHAA 3ZSSA 3PAOA 2PI6A 3INPA 5LNVA 5HOSA 1G4SA 2OLHA 5I3JA 3WD4A 5A6BD 1SZRA 3PZQA 4AU0A 1JJKA 1I75A 1XYZA 2R1LA 4HHHA 3R58A 3CZLA 3BJTA 2GVLA 2HS6A 3VIJA 1GVSA 3M64A 1GZ1A 5EU9A 3IVTA 5C9RA 3CGTA 5HJLA 1EJTC 4JCMA 2DQXA 1SW3A 1B9ZA 2WHKA 3CZKA 3N2OA 1IWPA 4YWIA 3LHYA 4KWOA 1ZJIA 2W62A 3BOXA 1FP8A 5B80A 1JYVA 3VNKA 1F6PA 4TXEA 2BOEX 2OXNA 1V6YA 4JS3A 4BZYA 1FWGC 3STCA 4MADA 4LNCA 1Q6FA 1KKRA 1EJ7L 2Q09A 3R1ZA 4J3ZA 3ARWA 4X9SA 2PTZA 3LV6A 1LWIA 4O10A 3KEHA 1QTWA 3WZ0E 2ZQ0A 2PDUA 1N8WA 4I7WA 4AWEA 2YGYA 4DYEA 3D47A 4WSHA 5CC3A 2Q01A 3KX6A 4WOQA 1F3XA 4WXZA 2ZX6A 3NURA 3DC8A 2PRHA 4ZQCA 4HOZA 1EFZA 4Z0JA 1YPIA 5EMLA 6TIMA 3W71A 3AYVA 4OE7A 3DFPA 4J5NA 1T5AA 4MWAB 4K2SA 3P74A 1EOKA 1MUWA 3EKZA 3Q45A 5JVLA 1DE6A 1PKYA 2WCSA 1VBRA 1O1ZA 4K37A 4N9BA 4Y2WA 2XFRA 5TD4A 3RCMA 1S3HA 1DJNA 3GD6A 2PBGA 1R7OA 2POTA 4WX2A 3SURA 3S5SA 4F2BA 1ELSA 2YFOA 1OCBA 3SB0A 4PMVA 3K13A 3MSGA 3R0KA 4GGHA 1BWKA 2A4AA 3LN3A 3B9OA 2QCHA 4LVBA 1WKEA 4GZJA 4HP5A 5I3HA 2O55A 3K2GA 4W5ZA 3NYZA 3IRDA 3T2QA 2YA0A 4EXQA 3HJEA 3P2VA 2GK1A 4ACZA 3KBSA 4GFIA 3SCNA 4DJEA 3RIKA 1P1XA 2J9ZA 1NF7A 3ZSTA 3OIHA 2PDJA 2PZNA 5LXXA 2ZA2A 1TRIA 2RJHA 2V2CA 4DXKA 2WSYA 5C2CA 3PTKA 3VNLA 4L9XA 3U5YA 4KIEA 3W6YA 2WNWA 2W61A 2J8GA 2NX3A 2C1IA 1QT1A 2BNJA 4AY7A 3OZMA 3S9IA 3GU2A 1KFEA 1EKOA 3FY1A 3R2GA 2CLHA 2VFGA 4F9JA 2HWGA 5JUVA 3VGDA 4DM2A 3HG2A 4GGBA 2TMDA 3M9YA 3B97A 3UEQA 3WBEA 1Q7QA 3CK5A 1JCYA 3CMJA 4CVWA 4RE2A 4X2PA 2JBMA 2J4GA 1R9YA 2GVJA 2NV9A 1S5WA 3WFZA 3O7UA 1M1BA 4NIRA 5BROA 1NF0A 1U22A 4MB1A 3KW3A 5D02A 3ABXA 4PE8A 1UD5A 4QR6A 1CXHA 2FZ9A 1XF0A 1F74A 1E0WA 3GHSA 1WDQA 3WLLA 2PWEA 4YLWA 1L6FA 3CM4A 3WLNA 2X0YA 1JL8A 3RU8X 3TWBA 1CENA 3LCFA 2VEPA 2NQJA 3F7JA 1ZAJA 4DAIA 1QCWA 1QPNA 3W1QA 2UY5A 1GORA 1ZFJA 2NUXA 3UYIA 4NG3A 1HG3A 3F1QA 2WSPA 3M43A 1LLZA 3HG5A 5AC7A 3B8WA 3VUSA 4Q8QA 4RV3A 1VPQA 4NYYA 3VXGA 1KWKA 2Z2UA 1R2RA 2QDEA 1S2AA 3NQ8A 3UT0A 3CS2A 5DANA 4LX4A 1PCWA 2CKSA 4L6OA 1VBHA 4AB4A 3VMNA 1E6SM 4TX8A 4XUYA 2FGLA 3KRSA 4O1FA 1YMYA 2GGHA 3S83A 2Z24A 1W5QA 1WDWA 3BW2A 1KQZA 4G1NA 4QCFA 3IUHA 1JDEA 1RLCL 2V8ZA 2CEQA 1XISA 5AVHA 5HR6A 4EAYA 1H7RA 1AL7A 3UR7A 1V8EA 1RBOB 4FI4A 4R5EA 4DJFD 1JCMP 5F4XA 2IPWA 3RITA 1TJ2A 4HZ8A 4MLJA 1UUOA 5K4ZA 4RNJA 3V5CA 1XDMA 2W27A 1B1YA 2R94A 3PJWA 3LG3A 4QNWA 1POJA 3R43A 4Z1AA 2DZAA 1E71M 3O63A 4NNAA 4D2JA 2VCAA 4DO5A 1KRAC 3EXTA 5FSEC 5JMUA 3CUZA 4PL2A 3N34A 2HZGA 1MFVA 2AKMA 3DG7A 3F4DA 3L0KA 4JNYA 2ZTJA 4JYEA 2QAPA 4GXPA 2ZE3A 1SUXA 2E6DA 3CH0A 2OGYA 1C8VA 4DWSB 3EOSA 3DEQA 2FGBA 3VCCA 4H6RA 4NASA 5D30A 1XQLA 3REQB 1NARA 1X7FA 2V5BA 3HBLA 1TPB1 4UIOA 3WLIA 4PBGA 4FLRA 4JTIA 4C7DA 5LNSA 2Y7DA 1OC7A 4FIQA 2XVPA 2ZWZA 4YJ5A 1NELA 3OG3A 1QBAA 1QAPA 1A5AA 3VNDA 4NP7A 5CPQA 1BKSA 1UMLA 3FSUA 4FAMA 4DXXA 3A13A 4R9XA 3LCWA 4DNHA 1LRTA 1R3WA 3W1LA 4JIQA 1LJYA 1HX0A 2WMJA 1V4YA 4S38A 3B0UX 3VDBA 2AL2A 2FTYA 2ZRVA 2CW6A 3W9ZA 1H7PA 2VQUA 3UWQA 3MCNA 3DC0A 3M41A 5LNWA 3WYZA 4N9CA 2VEFA 3AZTA 2ZRUA 1F6KA 1ML1A 1FWRA 3PFMA 2DZBA 3BPWA 3DECA 1LWHA 3MUZ1 5D2TA 4BJHA 3ZIZA 2ZOXA 4IG2B 4OBRA 3ITYA 3WDQA 3TKFA 1K8ZA 1YDOA 5GVJA 3NQDA 2C14A 4PCNA 1TWZA 2FB3A 5CPLA 1KRCC 1IQ8A 3V36A 3NPVA 2G3JA 3PAJA 4ZR8A 4KWVA 1CGYA 3TW6A 3URQA 1EA9C 3R8RA 2QCEA 1KW1A 2NVCA 4TMBA 3WLJA 1LDCA 3MHUA 3L67A 1XLDA 4FX7A 1OCNA 2OMAA 1IV8A 3P80A 1GKQA 5HDRA 3VMOA 2AAMA 2DDXA 2WB5A 4HNUA 3N73A 2OLAA 5CKSA 2EBNA 2VOTA 4UTTA 1TSIA 4XAYA 1BF6A 3HM7A 3RFAA 5CLTA 3WQCA 3C0QA 4LT9A 3AAMA 5DQPA 1IXQA 3T8QA 5BOFA 3AHXA 3MWAA 4Y9OA 3QM3A 4E4PA 4LALA 1H5VA 1JYWA 2WWCA 1G01A 2YL6A 3NQCA 5F7UA 1ITQA 4MYXA 5I79A 1V7YA 1XH1A 3BE7A 4M80A 4IXXA 1Q3NA 3L5AA 4HA4A 3S42A 5T8GA 4HNOA 3WQGA 5KEZA 3AHYA 3TX9A 1E51A 5MKGA 3G3DA 3GHRA 4AEEA 2Y1HA 4C6DA 2ABAA 3R0DA 3GYCA 2C0HA 4DBWA 4NVTA 3UWVA 1DL3A 1J5SA 2BVTA 4ZQRA 2WMKA 3E2RA 3S3GA 1BYBA 4AQLA 2FIQA 4LAOA 2PC8A 3HGOA 4M56A 4UZUA 3APYA 3MZNA 4LRSA 1DQUA 1SO6A 2FZBA 3O6AA 1VEOA 1BEUA 2PTXA 2DZUA 3IARA 5DX7A 5AB3A 1XKYA 1OG6A 3W38A 4C6PA 1AODA 3WH5A 2XGZA 1D9EA 3WNMA 3WNKA 4EX4A 2ZDSA 1ALDA 1A47A 2XIJA 2NV2A 2PLJA 1UQYA 4IPIA 2FH8A 3WDPP 1C8YA 4ATWA 1DTNA 3N1AA 2PA6A 3UXDA 3CHEA 1LL6A 2DSUA 1IEXA 4MUZA 5A8MA 1FY6A 1TA3A 1BXBA 4Z2LA 3BLPX 1PX8A 1ZL1A 1O66A 3LTSA 3S1XA 1GQJA 3SCWA 3UBPC 4C5ZA 2AQOA 3HQOA 2CHOA 3PM6A 1ZGDA 4ZE4A 2BOGX 3ARXA 4J2PA 3ITVA 1AJZA 1JVNA 3P93A 4R3UA 3STGA 3FFSA 1KC7A 4PUDA 4IJCA 3KWXA 3W86A 5G4WA 4QXIA 5AHNA 4YN5A 2ZZ5A 4GJ1A 1JCNA 3D0CA 3EOLA 3SJNA 1PTGA 1LRQA 3CIXA 5J04A 3VOIA 4RNIA 3FOKA 3MI3A 2WLYA 2G37A 4RKAA 4AISA 1WZLA 2J77A 1E1CA 5GJMA 2WOQA 5FJRA 3LRMA 1MZHA 2GDVA 2ABBA 4RW3A 1UP3A 3WF4A 4HK7A 4HN8A 1ISWA 3WQ4A 5DF0A 3SUUA 2H3DA 3OP2A 1ZB5A 3V5OA 3RRAA 3HZ3A 4HTBA 3A9IA 3B4UA 5C71A 1XIBA 4KCWA 4LS1A 1Q6DA 3O16A 4DYKA 4AZHA 1IEVA 3V75A 1ZLPA 4AIOA 4X0VA 3XINA 3W23A 1BTMA 2WZHA 3BANA 3EDKA 4B2DD 4FOUA 1C3FA 3GKAA 2WMIA 1QFEA 3E5BA 4BI7A 1ME7A 3H2OA 4L64A 1UQZA 4ERGA 4FNUA 1BWVA 2PDXA 2POZA 2PU0A 2DSKA 4EXBA 3CAWA 4XIAA 1LBFA 3ITXA 3AZRA 4U3CA 1E1FA 3LV5A 3BUVA 2ATSA 3DH7A 3UY8A 1S2UA 1DWGM 4QJ4B 3GC2A 3KS5A 2HNEA 1FOBA 3W24A 4Z42C 4R7WA 5D9PA 4UTKA 2GGEA 2CLIA 4X60A 2V82A 3W2NA 1E43A 3S5YA 3ABZA 4JHMA 3EWBX 2A5HA 5FD0A 3G8RA 3QPZA 3A4AA 1TELA 2C7FA 4IGSA 3U8GA 2BODX 3ZR4A 4E2BA 2CKRA 2FVMA 3GG0A 3QR1A 1BKHA 4ZB0A 1SMAA 2CNCA 5I3KA 1KM0A 5C8BB 4GVIA 1L9WA 1FWSA 2MNRA 1GEHA 4E38A 4XSLA 1VEPA 3PB0A 5D2XA 1UKQA 3KCJA 4GK8A 3DUGA 3DDMA 3SUWA 1E6NA 1D7KA 1SQ7A 1RQEA 3M6YA 3UGVA 2Y89A 3EWUA 3GG8A 4Q6JA 2YFNA 4HCLA 5A2BA 4MKVA 4XV0A 3W1TA 4FSAA 4PC8A 3VDAA 4BWLC 2A1YA 4JDYA 3UXAA 2J7HA 3QBUA 1UMYA 3B8UA 4ACYA 3C3NA 2F6KA 4YTSA 1A5BA 1X1OA 1RA5A 1EUAA 4QM1A 1LBMA 3WK0A 4NJGA 3NM3A 2CHRA 3WJSA 1W1ZA 3QQ1A 1OFBA 2HDJA 2X05A 1PL9A 1D8WA 4P7RA 3CH9A 4UOQA 3PF3A 2WPBA 3B9AA 4HSHA 3ALFA 4DZAA 1R85A 1ZBCA 3QH2A 2A3LA 1KA9F 3LHTA 1RVGA 1MUCA 3LOTA 1KV8A 1TIWA 1QXLA 2HPIA 2Z1KA 3UR8A 5HMDA 5CEWA 4YPJA 1EPXA 2YCJA 3RILA 1JYXA 3EA3A 4ICNA 2C91A 1DXFA 2OO6A 4JHZA 5IDIA 3WD1A 1XGZA 1Z3NA 1RLDA 3IAPA 1W2VA 1GG1A 2FTWA 1H63A 3H70A 1AQHA 3EOEA 1ADOA 3B9EA 3EX4A 3GH4A 3UZYA 3MSYA 2RDXA 4FLSA 4E0CA 3ICJA 4DJFA 2G4FA 3VNIA 4D6IA 3BSMA 4G7EB 1GVFA 1M7JA 4H3DA 3ZZ1A 2I9UA 3WN6A 2DVXA 5FAGA 4H8NA 1BTCA 2V3EA 4FF5A 2OX4A 4DBEA 3IGXA 1TA3B 2IKJA 1PYFA 1V3MA 1YDYA 3CJPA 4LFYA 3I6TA 4NJHA 1IIGA 2P0OA 4E4FA 1QI3A 2V5KA 2DSWA 4Z2JA 1ZHAA 4KFOA 5E6ZA 3DX5A 5CGQA 3GHTA 3P84A 2JGQA 3WFLA 2PDNA 3W2LA 4PA8A 2Z2AA 1JGIA 1IXPA 3CUHA 4J3SA 4QDWA 3NA8A 5H8UA 3AC0A 1NIUA 3UETA 3PPHA 2UBPC 3KFTA 1MNSA 3BAIA 1W9DM 3DYPA 4BI5A 3BGGA 3UXKA 2QIIA 1VCFA 3PSWA 1VYPX 3MVTA 4IHCA 3QFEA 3T44A 4HTYA 5MKGB 1LLWA 1RR2A 2YJQA 4KCTA 2BS9A 1QNQA 4ICMA 2ACRA 2XIIA 1XIDA 4JCLA 2FYMA 5BXRA 1DJIA 3SN0A 3T2OA 3MKCA 1EPVA 5E9AA 3QLDA 3VM5A 1XFBA 4H7VA 4JZ5A 3S1VA 1OBAA 4WOZA 3GXIA 1B3WA 3T81A 1OX4B 2ZZ1A 4E2VA 5HMSA 3GNOA 4PN2A 1US3A 3AMLA 4ZODA 5E0KA 4CU8A 2Y4SA 2NUWA 4RNHA 4US5D 1IZJA 4MFDA 3D46A 1HZYA 2J7DA 1Q45A 1UWIA 1ISZA 3QPEA 1SFLA 1K9EA 2PDBA 5EMMA 3STPA 2PE4A 2CXEA 4GVGA 4OIFA 4HVXA 4JY8A 3EXSA 4NY2A 2VDHA 5TF0A 4JTDA 2QJNA 3AFBA 5DXXA 3RX2A 3WK2A 4RV8A 1EHAA 1JF5A 2BDQA 1E0VA 1R5YA 3UCCA 2OEJA 4CLMA 1XIJA 3W4RA 1PDZA 1IR1A 4WKHA 5HNUA 2ZUMA 4AF0B 1XXXA 4DJED 4A3HA 1HL8A 4UOZA 1WP6A 5BMWA 2YZRA 3AS2A 4MOZA 1PTDA 3AO0A 1T96A 3TQ0A 5D8WA 4UQDA 1NVMA 3PZVA 1VB9A 1GVOA 2HXTA 5DMLA 4V33A 3NSXA 3PBYA 4JDBA 3VYLA 1HKJA 3NCOA 1V0LA 3G1XA 3TCSA 3TK7A 3RGTA 1UIOA 4WUIA 3GZAA 5I02A 4UTWA 5CJNA 2NXHA 3TLQA 2CZFA 8TIMA 1NP0A 1XLLA 4GXMA 1B5TA 4GQBA 4MLRA 4MVAA 3OU8A 1LQAA 3FKRA 1YDVA 3VGHA 5A6MA 3APTA 5I5RA 2WBKA 2PP0A 1B4KA 4XVDA 3STEA 5BWAA 2ZTKA 1KQYA 1XIIA 1TJ0A 1T99A 4FXJA 4HOXA 2WSRA 4OECA 1DV7A 1GQIA 3I7QA 3GS6A 2VR5A 2X41A 2I5GA 3REQA 1RD5A 2XWDA 3S5NA 4JKKA 4WLCA 3S6TA 3L12A 4UWMA 4WKAA 2PURA 2PP1A 4RDWA 1JZ5A 3Q58A 2ZA3A 1YE4A 2NQHA 1O1HA 2ZZ4A 2WQPA 3HPAA 3KCLA 1FWTA 3JRKA 1FDZA 3CHDA 1EIBA 5DLCA 4H8HA 2Z6IA 1TR9A 4H8UA 4N42A 4LUSA 4ZOBA 3IJ7A 1G94A 1TPVA 4PCPA 3VKAA 3LPOA 5TAOA 1KM2A 2PDWA 4GY7A 4D8AA 1A5NC 2QXWA 3SO7A 3S9ZA 2DVUA 4RPQA 3FJ6A 3OYXA 3L4TA 2R6OA 4S3DA 4YXGA 1REQA 3O0FA 3KCOA 3LK6A 4S1FA 1BSIA 5XINA 1E4LA 4O1AA 2WQDA 1QPQA 2CESA 4HN4A 3S5OA 3TA9A 3WLQA 2Y5SA 4HNLA 3KAOA 3E3HA 2C19A 3VGFA 1TVLA 1R8LA 2W66A 2PCEA 5C7HA 4IQJA 1VCVA 3D6NA 2YB4A 3MBDA 1DIOA 1GVYA 1YRRA 1MXDA 2X2GA 4DBDA 3F5LA 5GQBA 2GJRA 4E2OA 8XIAA 2RFGA 1N2VA 3U7VA 1RK5A 3CMFA 5BRBA 2WZIA 6ENLA 4Q6XA 4E3TA 4XZBA 4PTVA 4IGHA 3GAYA 2D69A 2ZXDA 2Y8KA 3JR2A 3VIKA 2XH7A 1DHKA 1Q7ZA 1T41A 1W1IE 1V02A 1RJRA 3LENA 3P5YA 4IICA 1XQKA 2DIEA 4R85A 2HCVA 4C5YA 3URNA 1M01A 2ACSA 3LRLA 1S5VA 4D9PA 4JQ2A 1UH4A 4WDTA 3NFUA 4C6OA 1KM5A 1VD6A 4H7CA 4R27A 2ACUA 3E12A 4IFKB 2D20A 1T7LA 3BWWA 3W07A 1FH7A 1XKJA 3PWGA 5FKYA 4P7NA 4IIBA 2NX9A 3A22A 1JDAA 4JX6A 3AU2A 2DEPA 3S2NA 1K4GA 3LEPA 1DJXA 4LTSA 2X0SA 1S1RA 3BGJA 3V16A 4QG8A 4HNVA 2OVLA 3T6CA 4EWND 3G1YA 1M41A 4FA3A 1M7OA 1W17A 2P10A 1R3VA 1TMLA 3QSRA 3CHCA 4O4VA 4WJXA 1XINA 4IH3A 4ZTYA 1JUBA 1J01A 2Q3RA 4F2TA 3EPOA 1OZQA 3E0LA 4S39A 4B5SA 3HURA 3A12A 3B0XA 1DWIM 3WF2A 3WLHA 2NX1A 4JFVA 5A8PA 2Y6ZA 3BLKA 4U10A 2D2JA 3GXPA 5AYBA 4EF9A 3UJRA 2BP1A 4J4KA 4UNIA 4V2XA 5HINA 3R0UA 1G4EA 2VZOA 3EA1A 1B3OA 2VT0A 1GG0A 4OUEA 3NQAA 3MO4A 1EWDA 1YIXA 3CC1A 3W25A 1X6UA 1RCQA 4GYKA 1H11A 3FVDA 2AMXA 3BLLA 4DEFA