4YL2A

Aerococcus viridans l-lactate oxidase y191f mutant
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
367
structure length
367
Chain Sequence
YNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHATKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKGDGATAIILTADSTVSGNRDRDVKNKFVFPFGMPIVQRYLRGTAEGMSLNNIYGASKQKISPRDIEEIAAHSGLPVFVKGIQHPEDADMAIKAGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactate oxidase
publication title Speeding up the product release: a second-sphere contribution from Tyr191 to the reactivity of l-lactate oxidase revealed in crystallographic and kinetic studies of site-directed variants.
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
total genus 139
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4yl2A00
4PC8A 1QCWA 4LC6A 3SI9A 3ANYA 2I1OA 3HQ1A 2OZ0A 2CLIA 3LDVA 4O1AA 3WJSA 4DQWA 4ALDA 3DHFA 5EKYA 3W7OA 4JXCA 1OFQA 3UZ5A 4KFPA 1Q6OA 3ATYA 4GUFA 4WXZA 3PG8A 3V1PA 4BR1A 1T8XA 3PC0A 1TRDA 5DBTA 5F2MA 1RR2A 3W7IA 2G95A 5LSMA 1JCXA 3T55A 3SR7A 3BARA 1H7RA 3QMTA 3KOFA 3W2UA 4RLIA 3UXDA 4AF0B 3DFNA 1JQXA 3MI6A 1X6UA 3DI0A 2YYTA 4WX2A 1H61A 4UTTA 1KBJA 1WA3A 3R12A 1P5BA 2RH9A 1B57A 3FKKA 1F05A 1MEWA 2QAPA 5AYXA 3C2EA 1KM0A 2NUYA 1IXQA 3LHWA 1EEPA 1PS9A 4O18A 2BZNA 4K37A 4BF9A 2H3DA 3W2JA 4JYEA 4JICA 1EIXA 5DBUA 2D73A 3B4UA 3M44A 5K3VA 3HG5A 4O0KA 2V2DA 1WQ5A 1QPNA 3M41A 2A1YA 4UFLA 3FIGA 3PBYA 1AMKA 4JD4A 2FFCA 2IQTA 1YXDA 1TTJA 3GVGA 1A53A 2RDUA 4XTDA 1W3IA 4XKYB 3CEUA 4UTMA 4ICNA 3CEPA 2PRHA 1AK5A 4JGDA 1B9BA 3W85A 4A2SA 2Y85A 3LHYA 4O57A 3C2RA 5AHNA 4EOUA 2QCLA 2NWSA 2RDWA 1W5NA 4TMCA 3S42A 2DJXA 3BW4A 3TW6A 4WD0A 1JR1A 4X2RA 5AC6A 3LV6A 2TMDA 3T7VA 4QITA 4OHQA 4ZVJA 3C6CA 1KFEA 4GXMA 1OX4B 3VKJA 5T26A 3UWVA 3N73A 4LUJA 2OT0A 4LS0A 3MBFA 3H53A 3NQAA 2CWNA 1ZAIA 3E02A 3LXBA 3MO7A 5DCBA 3EX1A 3GB6A 3PVFA 3NL3A 3G1YA 1S3HA 2BXVA 3MJYA 1SU5A 1O95A 2ZZ7A 3E12A 1W5OA 2AGKA 3M16A 1XXXA 2NXIA 4NZFA 4TU1A 3TDFA 1L6YA 3GXPA 4RZ6A 1GOXA 3U6WA 3L65A 2CLMA 1FCVA 2WV8A 4MY1A 1MXSA 3NQEA 2VFEA 3LCGA 3TIMA 3B0VC 4FHAA 1Q3NA 2RDTA 3TX9A 3O15A 3S1VA 1T99A 4N9BA 1WBHA 2GQAA 1BEUA 1VLWA 3NL5A 4UUIA 1GTHA 1KV5A 3HO8A 3HBLA 3W76A 2DZWA 1FXQA 3SGUA 5LHEA 2QUVA 4FEZA 4I9AA 4OWGA 4MUZA 5HWJA 4PODA 1XL9A 1PE1A 1KA9F 1S5VA 1TIMA 2Y7DA 2VEIA 1ALDA 1FWTA 3MI3A 3K30A 5EA9A 1TPUA 1OYCA 1C8VA 2ZA2A 1D3GA 1H7XA 4HT3A 4K7VA 1YTEA 1FWWA 3EX3A 4LVFA 4NJJA 4CNNA 5HNRA 5I3JA 2DZUA 1U5JA 1YDOA 2NUXA 3B06A 5C5YA 3TXZA 3WJXA 1K03A 2V30A 5K4XA 2B7PA 3HPZA 4QISA 5HJLA 3G18A 1K7XA 5CZSA 3B8DA 2PE4A 4BWLC 3JRKA 1ICSA 1WOBA 1R2SA 5TBOA 1A5BA 2G97A 2YZRA 3R2GA 5D2WA 5I3IA 3BLIA 3TKFA 5U4NA 3R89A 3S5NA 4Y96A 4KKXA 4FNUA 5LZLA 4HPXA 1QOQA 1FBAA 3OA3A 3SJ3A 3NA8A 3P8JA 1J5TA 2EPHA 3EWUA 3WK3A 2CLHA 4GJ1A 2LLEA 2YGYA 2YSWA 3NVTA 1CX9A 1N8FA 3QF0A 1SSDA 2QCDA 1FWSA 3DAQA 3W83A 4X9SA 4J9JA 3TNOA 3TA6A 1KBIA 3GDRA 3OEXA 5KZEA 2HTMA 3O16A 2EHHA 2DJLA 1VRDA 3WFAA 4NUWA 1W8SA 3TQKA 4GC4A 4M6PA 3NR0A 4IOTA 3W7LA 1QOPA 2NX3A 3LXAA 1X7FA 3QH2A 4QSHA 1I2OA 3LHVA 4HNVA 4WXYA 4DEFA 4ZZ9A 1HFBA 2TPSA 1W3TA 3MYOA 1N7KA 3YPIA 1VYRA 4JX6A 3N2XA 3NL6A 4MLRA 1K8YA 2QCGA 5DCDA 3R8RA 1FUYA 3GZ3A 1TTPA 2I9EA 1TV7A 3GNNA 3HOJA 4UTLA 1TPFA 1M7OA 2W79A 3S1UA 4UXDA 5DN1A 4A22A 3UWUA 4IQLA 1R30A 4MYXA 3QC3A 1OFOA 3W7EA 4LNYA 1G67A 4AWTA 2A7PA 5DY2A 3QJAA 2P1FA 3DENA 3NGJA 4WY0F 3LCXA 4LVDA 2V2HA 3TCEA 2ZFAA 2YX0A 3AJXA 3A5VA 4K7YA 5CKSA 1T0OA 1XBXA 3O07A 4QM1A 4WOZA 3GKAA 4N9CA 4YWIA 4FNPA 1SZGA 4JNMA 4MY8A 4JEQA 2R14A 4KWWA 1CW2A 4IPIA 3RLVA 4N02A 1I2QA 1PCWA 1TV8A 5BMXA 3MUXA 3QZEA 4U4MA 4ADSA 2NV2A 2WO5A 2YFOA 4AVFA 2R94A 2X30A 3LBMA 1TJPA 4RXFA 1G4EA 2WPBA 4E38A 5LNVA 3NL2A 2E09A 2R91A 5FEPA 3NQ2A 4GUIA 1VPXA 1MEIA 2RHGA 3LM7A 5A8GA 2Z2UA 1ZENA 4FX8A 1T96A 3LHUA 4PFMA 4MJZA 3L9CA 2QCEA 6ALDA 2Y7EA 2ATSA 3TR2A 2VEMA 4IXHA 3IIOA 3GDTA 2HS8A 3SFKA 3W1RA 3QQ1A 4OE7A 3FA5A 2V5BA 3NEVA 5FF2A 4Y8FA 1MEHA 1K8XA 5CZTA 2A21A 2YPIA 5H91A 2VFDA 2ZRYA 1PHQA 2AAMA 4D2JA 1NSJA 1H7NA 1VC4A 3O6YX 4C1KA 4GUGA 4FNTA 4IMCA 4QNEA 4RJEA 3TMLA 4ZQOA 1W5MA 4PL1A 2JGYA 1L2UA 3TMQA 1KFJA 1RQEA 3W84A 3G1AA 3KAOA 2Y7GA 1QR7A 2ZCGA 5I3GA 4JTUA 1LOSA 1TYGA 1PIIA 3L0GA 4IX0A 3W7KA 3G8EA 5AC7A 3W9ZA 5E93A 3S6DA 1OG0A 1GZGA 1W0MA 3U2OA 3W2LA 3PWAA 5HUOA 3ZWTA 3NG3A 1GT8A 4L4MA 4QIUA 4DO4A 3NYZA 1H5YA 1W1ZA 3BO9A 4M7TA 3RMJA 4JYDA 4HSNA 1TPB1 3W7CA 4BFAA 3CWOX 5G2IA 5ABTA 4FNSA 1SZFA 2J6XA 3UY7A 4XBSA 2CZEA 5LNSA 1G6CA 1SW7A 3TV8A 1L9WA 1VJIA 3TC7A 5E1QA 5BRBA 4N2YA 3W71A 4IMFA 3F1QA 1IXPA 4CQAA 3QQ0A 2G5WA 2Y70A 5D2XA 5EPDA 3C3NA 1P0NA 4Z1AA 3QSTA 1TREA 2OJPA 4XQ6A 2NXGA 3DZ1A 1H1ZA 1VYPX 4O10A 1Y0EA 1H60A 2OMAA 4O12A 4AWSA 2WNNA 1G7UA 5HQEA 2Y63A 5AN7A 2NLIA 3QFEA 5D38A 4S2CA 2PRLA 1KFCA 1UB3A 4XWUA 1TRIA 3CPRA 5GVJA 4HSOA 2VENA 4MFDA 4XBKA 1TB3A 4K36A 4POCA 3CT7A 3STCA 1Q6RA 1OFPA 4GE8A 3NQMA 5FF0A 4C1LA 1TMHA 4ZQPA 3DFPA 3W75A 4HPJA 2YW3A 2FPYA 4O0ZA 3TQVA 1IGSA 4N6FA 5AHFA 2QCFA 2X1UA 1YTDA 3EWBX 3IGXA 4RR4A 1YDNA 3P67A 4GFSA 2QKFA 1XBYA 2HMCA 1L6WA 1A5CA 3N14A 1X8FA 1FX6A 1B3OA 4Y90A 4ZL1A 1JQVA 1JCJA 3GR8A 3LXCA 4K39A 3M5VA 3W74A 4UR7A 4IGHA 1GVSA 3PF3A 1ZAJA 2TRSA 3KVLA 1U83A 1IIGA 5L9FA 1K8ZA 1QO5A 4QNWA 3M5YA 1VHCA 1R47A 3GXNA 3G0SA 5AOUA 1FCUA 2C3ZA 5E0KA 5TQLA 4TX9A 2WSYA 5F2IA 3VCRA 1BWLA 3EWWA 3PULA 4I7WA 1BKSA 2X2GA 4AWUA 5LNRA 3OG3A 5KTLA 1GVOA 1RZMA 2B7OA 3L0KA 3OVRA 3RFAA 3M6YA 2QDHA 2ZRVA 3LCIA 3W6YA 4AAJA 2VEPA 1UUMA 1QPRA 4LTSA 3S1WA 3S5OA 2GOUA 2QR6A 2XN0A 4G1KA 2OX1A 1RV8A 2J88A 1VH7A 5KITA 3W87A 3W1QA 4K8EA 3F03K 2FQIA 2CLOA 3W7QA 2ZZ2A 3IIPA 4UTKA 1LROA 1TPC1 3A9IA 1J4EA 3W70A 3G3MA 2QJGA 3W86A 5C2XA 3SECA 1AW2A 3NM1A 4DO5A 2DU2A 5KSWA 4YL2A 2Z0IA 4IPJA 3CWNA 3BLEA 3R13A 4O19A 2ZRUA 3EX2A 4LT9A 5LGXA 1KLZA 1RVGA 1TQJA 2J27A 2YDAA 2F84A 5AYYA 3D0CA 3LCWA 1LCOA 4B5NA 1KW1A 1DQXA 2ZYFA 4M5PA 5EBUA 6TIMA 1K3UA 3SGZA 2Y62A 2X1SA 5F4WA 3QW3A 4O14A 3BV4A 1EPXA 1HL2A 5BOOA 4MPQA 5J5DA 3EWZA 1OX6A 3PBVA 1LOLA 3PSWA 3E0IA 2V0TA 1I2NA 2FPTA 1LLWA 3N34A 4ORIA 1LDCA 1QWGA 1OFDA 3L21A 3FKRA 2B0MA 1VR6A 3I7RA 4WJEA 2DZSA 5BMWA 3EX6A 2QAFA 3S5ZA 3PS7A 4FIRA 2EKCA 3E9AA 3NQ6A 2V82A 3SIZA 1JCYA 1SO5A 2DORA 3PM6A 5KMYA 4UNLA 3HJZA 2ZRZA 3W73A 2FIQA 4CNPA 1KM4A 3LI1A 4WZHA 1MO0A 3CU2A 2ZA1A 3OIXA 2ABBA 1PVNA 1L6SA 5H2ZA 3DKJA 3IEBA 2FTPA 3O05A 5EYWA 5FF4A 4O1BA 5F2LA 4TIMA 4HN4A 1SO4A 1SZNA 4IX2A 3FYPA 4LOCA 1TTIA 4JDBA 3G1FA 4FX6M 1QNVA 1ZALA 1XDMA 4UNKA 2CZ5A 1KTBA 3A24A 3BG9A 3TK7A 3L68A 4PEKA 5D03A 4MOZA 1DBTA 4QAIA 1SFLA 1XM3A 3VNDA 3VE9A 3G8RA 1LORA 2E68A 4UFMA 3LCFA 2CZDA 4UTTC 2B7QA 1M5WA 2XN1A 3B04A 4WQ6A 3GDKA 1BTMA 1VCGA 4RX0A 2H3BA 1P1XA 1RD5A 4Z08A 2WSRA 3O06A 1EP1A 4AMAA 4K8HA 3BW2A 5CPLA 1ZHAA 1NEYA 4JN6A 5LHFA 1ZNNA 4HNUA 4EIVA 2B7NA 3THQA 2CFFA 8TIMA 3W7NA 3ABSA 4M6QA 3W7GA 1F6PA 1I2PA 2H90A 1VHNA 5F1UA 2NX9A 5A5WA 3QW4B 1RPXA 3N19B 3L5AA 3EB2A 4JTJA 3RK8A 4HNTA 4JTSA 3HF3A 2O7QA 3Q2DA 2OCZA 1G4PA 1EUAA 3OHIA 1F73A 1YXCA 4GNJA 1LOQA 1KM3A 5G4EA 3TQ0A 4K6AA 5F1VA 4O13A 4CQ8A 3P61A 2BTMA 4OQVA 4O8RA 1O5KA 1DQWA 3AO0A 1DV7A 3PG9A 4O4VA 1I8JA 4DF0A 3DFQA 2Y7FA 3G0XA 4AH7A 3P80A 1O94A 3MI2A 2VOMA 3M43A 3L0NA 5AB3A 1NAL1 4O11A 3FJLA 3EX4A 4FF7A 4HKPA 2E77A 4IJBA 2CW6A 1XBZA 3MP4A 3SZ8A 3NPWA 4Z1BA 2H8ZA 3HG3A 3W7JA 4NNBA 5K2ZA 1GVQA 3E96A 5G5IA 3VFLA 2GQ8A 2GVLA 3INPA 4LVGA 1X1OA 2QUUA 3PSVA 3W7MA 3ABQA 4JTHA 1ZAHA 1EB3A 4NNCA 1ZY9A 2R8WA 1LLZA 4TO8A 3FOKA 1IXOA 3DXIA 1YDVA 1DHPA 3KX6A 5HULA 2ZZ6A 3VI2A 3NOEA 2V9DA 3MHGA 2BSLA 4OBTA 2FB3A 3MP3A 3G1SA 2RKXA 3STEA 5SWUA 4BI5A 3V75A 1TO3A 4PTNA 1JCNA 2QCDB 4UMAA 3S9YA 4IMEA 4JTFA 3STFA 1O60A 3QPZA 3NPUA 3I6RA 5DXXA 1IIHA 3MYPA 5EMUA 1KM5A 4R33A 1I45A 3P62A 2E1DA 4PCFA 3S8HA 2QCMA 4NXSA 3LB0A 1GJPA 2EF9A 3IVTA 2VFGA 2X16A 4AHOA 1SO6A 2QDGA 2Q8LA 3LCHA 4UR8A 3W7PA 2P0OA 1FDJA 4IUOA 5K9DA 1JCMP 3UZJA 2ZA3A 3TFXA 4UIOA 1AW5A 3DFSA 4PA8A 1HUVA 2ZZ1A 1H7PA 4LU0A 4ZQCA 4UFHA 5C54A 3M5XA 2QUTA 3CHVA 4O28A 4LW7A 4IMDA 1F74A 1OK4A 4OV9A 5HMSA 2O7SA 2FB2A 1W31A 1F76A 1LRNA 1TPEA 3EXTA 2NUWA 4GWEA 5F4SA 4NX5A 4DELA 1XUZA 1WV2A 4MZ1A 4N4QA 3TXVA 2F7FA 1SPQA 5TIMA 3LTPA 2JBMA 3EWXA 4MKNA 2WSQA 2GPTA 3BW3A 5AHLA 4NJHA 4UTWA 1M7PA 1GVFA 3MBDA 3BG5A 1W3NA 3GAYA 5HWMA 2ZZ3A 3C61A 4I7VA 2DZXA 3EXRA 3IIXA 1QDSA 1XBVA 3PB0A 1H7OA 3GAKA 2GUUA 3BVJA 3P5ZA 2JGQA 5HINA 3P60A 5FEWA 5EY5A 3P82A 3Q58A 1A5SA 1JUBA 3LOTA 3W72A 2W0UA 3IRDA 4UTIA 4TMBA 1OK6A 4O50A 3CIWA 4ML9A 4P2VA 1ICQA 1OF8A 2E5BA 1R2RA 3TC6A 2ZQ0A 4FB7A 1AW1A 2HS6A 2YXGA 3TSDA 3WK1A 2YYUA 4O1CA 5G2WA 2QJHA 1OFBA 3USBA 3F4WA 2WOQA 1LZOA 2JKEA 1Q6LA 3KFTA 4X22A 3UNDA 3N9RA 2CLLA 3IV3A 1THFD 3F4NA 3HIJA 5IBXA 1H51A 3I68A 1XC4A 3CB8A 5FEZA 3O6DA 5AYZA 4YXGA 1WAUA 5LKYA 1DJQA 5BW6A 1WX0A 3L5LA 4JTLA 5G1TA 1K7FA 1M6JA 4DF1A 4EF8A 4NZJA 1FQ0A 5DXYA 4P61A 3NQ7A 4OV4A 3TSMA 4JY8A 3TSBA 3PB2A 1IXNA 1H7WA 3A23A 4EWND 5DELA 4JTKA 1B4KA 3NQCA 1KTNA 3CIXA 4DPPA 3SSJA 1EP3A 3NQVA 3BLFA 3P7YA 4UFIA 1QAPA 4Q33A 4AHQA 1F7BA 3HMJG 3LERA 4Q4KA 1FWRA 1R46A 5AFDA 1Z44A 5K9XA 1OX5A 1SW3A 5L6UA 1GWJA 3DU0A 4NJGA 1DOSA 1H63A 4JTEA 1TJRA 3NDOA 4QJ1A 3NM3A 3NAVA 1UCWA 3IGUA 2CLKA 4HIBA 4MIMA 2Y88A 2Z6JA 4ZQNA 2V2CA 1OABA 2C1HA 1LP6A 1TCDA 3C52A 3S5YA 3TW7A 1LYXA 3OBKA 4JR5A 4MFEA 5K7JA 2CZFA 1TQXA 4JIQA 1HTIA 1LM1A 2QCCA 1JRBA 3W1UA 2C19A 3NZRA 2DZTA 5CZ0A 2A6LA 3BPWA 1Q45A 4YLWA 4S1FA 2BLEA 1W56A 1PHWA 3O1NA 2P10A 1EUNA 4ADUA 1G4SA 2NWRA 4AB4A 4RKAA 4UCGA 3G1HA 4Z1CA 3HGSA 4ZQMA 2E6YA 2QF7A 1ME8A 3BK0A 4EVZA 4LRTA 4CCCA 4HNNA 4WY0A 4DPQA 1F5ZA 4NNAA 5C6MA 3SW6A 4NT0A 1AL7A 4FO4A 3EKZA 3MW7A 1JRCA 2A7RA 2FLIA 1GQNA 1KFLA 1I4NA 2ZRXA 1SFJA 3W1PA 4RCXA 1QO2A 1JJKA 3VE7A 1K02A 4YMZA 5MHBA 1V5XA 5CG7A 4N6EA 3FYOA 4MVAA 1SR9A 2ZZ4A 4UTHA 4U28A 2FDSA 2KZHA 3O63A 1FCBA 1FDZA 1JUEA 5FF3A 3GYEA 3EXSA 1G7VA 2EAWA 2E6DA 1UJPA 2VEKA 2X1RA 1EP2A 5K4ZA 2GVGA 3UWWA 2WJZA 2BWGA 3FJ6A 4BI6A 5LGZA 4K38A 3U8GA 2C16A 2C13A 1DJNA 1AG1O 4UTJA 1GEQA 1TPH1 2VKZG 3UY8A 4WUIA 4AHPA 3M47A 4LVAA 3MHFA 4O54A 2BX7A 4WOQA 4AF0A 3GK0A 3S0CA 1JUKA 2A5HA 3WJYA 3UWYA 3FLUA 1XDLA 5I3KA 4QQ3A 2ZRWA 1JCLA 3B0UX 2A2IA 4DBDA 5J5RA 1DORA 3CQ0A 4GBUA 5D2VA 3C2OA 1PL9A 3LI0A 2ZBTA 4O15A 3RLUA 5CZJA 2X1TA 4R7JA 1UUOA 1VQTA 4XTIA 3R5EA 2XN2A 3IVSA 4MY9A 4MJMA 3HGOA 3UXAA 3PY2A 3T78A 3UD6A 3C8FA 3QMSA 3I7SA 4H3DA 3DH7A 5DY3A 3B03A 3NQDA 3UWZA 4AXKA 4EF9A 2J9XA 3BGGA 3B0PA 3HB9A 4XZ9A 3E49A 1VGAA 2PURA 3C0JA 4O52A 1UASA 1P4CA 3N3MA 1C9DA 4XKYA 1OVDA 2B4GA 4O53A 4X3ZA 2W6RA 3FS2A 1VZWA 1RQHA 4NVTA 4YCOA 1RQBA 3LBCA 3GDMA 3CLMA 3A5FA 1KM1A 3L2IA 4Z0JA 4FXSA 1S5WA 4JX5A 1GPWA 1DVJA 3M5ZA 4DF2A 1YXYA 3RU6A 4ZQRA 3TAOA 1OX4A 5K9CA 1LRQA 2VC6A 4N9DA 2YW4A 1N55A 4RV8A 3MWAA 3P74A 1ME9A 3LTSA 2J9YA 1OHLA 4R53A 3GXTA 3O8AA 4S2BA 1LRTA 3HGJA 1CI1A 1X1ZA 3Q37A 3LV5A 4RZ5A 4BWLA 1I2RA 3W2MA 1XUUA 3TU9A 5D02A 2E5DA 5AHIA 1ME7A 3PUDA 1SZEA 3W1MA 1W54A 3T44A 5CGQA 3NQ8A 2FJKA 3OVQA 1Z42A 1TPWA 4A21A 3W1LA 1SQ7A 4BK9A 4DXVA 1O5XA 4JYFA 1O4UA 3DHDA 4RZ4A 3I65A 3TFCA 1YLVA 3TJXA 3WJWA 1HO1A 3W1NA 4H4IA 4A29A 2Z1BA 2ZDRA 3BGJA 4LV9A 1F6KA 5HUPA 5G4WA 3G1DA 3ABOA 1EA0A 3W07A 5KZMA 2FPVA 3MMTA 2NZLA 3T40A 3KRZA 5HR7A 2I14A 1HG3A 1XKYA 2DZPA 4HHPA 2ABAA 3GNDA 1ZJIA 3W7HA 1WDWA 4DBEA 3FFSA 3C2VA 4UFJA 2Q3RA 3N2MA 1WYIA 1D3HA 3GR7A 1KLYA 1P0KA 5G1YA 4OU1A 3UPBA 1NVMA 2A0NA 2C18A 4BI7A 2C14A 5D30A 5DCEA 1SW0A 1VYSX 3JS3A 3GLCA 1FDYA 3DFOA 2WNZA 1FCQA 1UBSA 1OFAA 3QM3A 4N9EA 2VFIA 4UMCA 1QPQA 1IF2A 1KM6A 5HWNA 3LHTA 5CPOA 2QCHA 1NF0A 2GVJA 1ZFJA 3M1ZA 3KXQA 1LBLA 2Q3OA 4LV4A 3L67A 3LRLA 2ISSA 1LBFA 4DO6A 4H6KA 3RF9A 2C0AA 3P5YA 2Y61A 3HG2A 3ZS4A 2PCQA 3G24A 3OVPA 5KINA 1DL3A 2WKJA 3DFTA 3M7WA 4CQ9A 1DKWA 3GDLA 3LLDA 2VXNA 4NJKA 2Y6ZA 1TV5A 3G0UA 1ADOA 3H54A 1LTDA 3IVUA 4UMBA 2NV1A 2G96A 1H1YA 1OYAA 4ADTA 1YADA 1YPFA 1H62A 1GYLA 1QMLA 3G1VA 4FNQA 4GRSA 2A7NA 1XCFA 3KVJA 4LRSA 3G1XA 3IIVA 2YR1A 1GTEA 2RFGA 3LCLA 5D05A 2WQPA 3Q94A 3CTLA 5I3HA 3FEMA 2J24A 3PUEA 1ONRA 3I7QA 3CC1A 1W5QA 3M0ZA 4LC8A 1VCFA 3IGSA 1NF7A 1ZCOA 3EEGA 4O4WA 2YCEA 2E5CA 1SO3A 4LVBA 5DLCA 4AEOA 4ORMA 1D9EA 4Z0SA 3PUOA 3PAJA 2H8XA 1VLIA 1A5AA 2PC4A 3ATZA 3HGRA 5CPMA 3T4CA 5AHEA 5CPNA 4MYAA 5D04C 3NZ1A 2V5LA 3M9YA 3PBUA 3WK0A 5G2HA 3GKFA 1PV8A 5IM51 1FWNA 1G69A 3W2KA 4Z1DA 3UPWA 2E6FA 2C15A 3W1XA 5CSRA 3HPSA 3O6CA 3P84A 4CLMA 4CCEA 2CLEA 4GUJA 2VFHA 3LRMA 3LGEA 3LTYA 1W37A 3W7DA 3HPXA 1MZHA 1HO4A 1OFRA 3ZR4A 4UTUA 3LRKA 1WXJA 2Z6IA 5D37A 1JULA 2AQWA 1EWDA 3NQGA 3IIZA 3QEZA 1AL8A 3KHJA 5EL1A 2GJLA 4FXRA 2WNQA 1GVRA 4M6VA 4OT7A 5D32A 1VS1A 3W7RA 3QPYA 5AHMA 4LS1A 2GQ9A 3ZFHA 4W9TA 4JTGA 3H55A 3KRUA 2QJIA 3CM4A 3NPXA 4CNOA 1TPVA 3TAKA 1B4EA 2V8ZA 4A3UA 2A6NA 2OT1A 4E2BA 1K7EA 3NXFA 4MLJA 4A2RA 5F2GA 2UV8G 3JR2A 1FY6A 1YYAA 1VCVA 3QMRA 2EGZA 3G22A 4IXXA 4LWWA 5F4XA 5FF7A 3TE9A 3WJZA 3NO5A 4UC5A 2VELA 3EWYA 1OJXA 4ONVA 4KFOA 1BWKA 1TPDA 4E0CA 5LNUA 3SY5A 1FXPA 4I7UA 1PCKA 1GG0A 5I3FA 1KV8A 1KFKA 5FESA 3PR2A 2CU0A 4OGZA 1A50A 3MHUA 2JK2A 3TUUA 4L4LA 4N4PA 1J2WA 1F2JA 2H6RA 4MZYA 4NJIA 3DGRA 3A21A 2XFWA 5FEXA 4FNRA 2ZZ5A 1EWEA 4O1DA 2ZTKA 4RK8A 2DZVA 3P81A 1E51A 4JTTA 2JKPA 2ALDA 2TSYA 4JS3A 3P8IA 2C6QA 3W2NA 2GJNA 4PH6A 1KFBA 4IMGA 1TTQA 4UFKA 1YTKA 1Q6QA 1Z48A 3RNDA 2E6AA 2QEZA 4UTWC 1OYBA 4KFNA 3C56A 3QRHA 2ISWA 2Q8ZA 3W22A 3DBPA 1KM2A 2V81A 1QPOA 4RXGA 2A4AA 4FX7A 3UWQA 4FIQA 4M7SA 1SSGA 2NXHA 3UYCA 1TSIA 1GG1A 4CCDA 2J9ZA 3GIYA 1S5TA 4TR9A 1R2TA 2JKAA 3HG4A 3S1XA 1GYNA 1G4TA 3BG3A 3EKLA 4Q32A 2CLFA 4NQ1A 3STGA 2NX1A 4O16A 4NX0A 3KVMA 1ICPA 5BNKA 3L66A 4JY9A 5U7SA 5LNWA 3ELFA 3UQNA 5KZDA 1WBJA 1SUXA 5D2TA 3NNTA 1WOAA 3C4UA 1XFBA 2A85A 3MP5A 4YCPA 7TIMA 3NPVA 4NU7A 1Z41A 5D33A 2DP3A 5IBXC 3PBWA 1NFBA 3GX9A 5D2YA 5HR6A 3THAA 3TROA 2ZTJA 1OFEA 2HSAA 4M19A 3KRSA 4XUGA 3W88A 1C29A 2ATMA 4R34A 5CSSA 3W3OA 1ML1A 3KVKA 3LX9A 2ISVA 5D09A 4Y6GA 3N9SA 1W5PA 2VFFA 1QFEA 4LY8A 1V7YA 1H50A 1YPIA 1XI3A 1MSSA 4MZ8A 3QYQA 4O17A 3ABRA 4GUHA 5AC8A 1JVNA 4ZMGA 2QCNA 2PRMA 3A22A 3B05A 4LUIA 4WY0B 4JDYA 3L5MA 4KWVA 3LHZA 3G3DA 5FI8A 3W23A 2TYSA 4LS2A 4JTIA 3C2FA 3NQFA 3TJLA 3W1TA 3LLFA 3WK2A 3DI1A 1KTCA 2Y89A 1OF6A 4NXKA 3QSRA 5C55A 1LBMA 4JIPA 3DKLA 4IWWA 3TH6A 2YFNA 4JX4A 3ZWSA 4PL2A 4Y9AA 1EX5A 4E2DA 3W1AA
chains in the Genus database with same CATH superfamily
1CYGA 1ZSXA 1OZQA 4LAMA 2OWCA 3LDVA 4KWUA 1E3ZA 4ALDA 3LQGA 4GI6A 5ABFA 4KFPA 2UZ9A 1MRQA 1GOKA 5GJPA 4US5A 3DERA 1T8XA 3T6CA 3W7IA 5LSMA 1C9WA 3SR7A 3BARA 4C6LA 3NVDA 1HL8A 4LCSA 1W3HA 3W2UA 4RLIA 1JZ7A 3S2NA 1JQXA 3MI6A 2WMHA 1GQJA 3IGHX 1B2YA 1H61A 3R12A 2RH9A 2FGLA 3SCNA 3CH9A 2EJAA 3WQ4A 3GFZA 3C2EA 1KM0A 2QF8A 4R88A 1R6WA 1A0CA 1IXQA 1RD6A 3RX4A 2J75A 4UQDA 4NG3A 2FHCA 3M0KA 1CGVA 2X42A 3MPGA 2Z27A 1ZS2A 4MAZA 2O4MA 3AMLA 2QQ6A 5K3VA 3DYOA 3HG5A 3CO8A 2A1YA 3N17A 3CZKA 2X1IA 1UD3A 4JD4A 4DWDA 3GVGA 4XTDA 1T6MA 1A53A 1KXHA 3U7VA 1EJWC 1LL7A 3CEUA 4UTMA 4CD4A 1YEYA 2G4FA 1GYMA 4EPBC 4HMEA 4Q8QA 1B9BA 3IJDA 3BLLA 1J8VA 2QCLA 1W5NA 3CQIA 4TMCA 1WB0A 1EJTC 5A1AA 3TW6A 1JR1A 2QLYA 4X2RA 2VVNA 2V63A 2WM0A 2OYMA 3LV6A 4JTDA 1B31A 1OX4B 2OWXA 2XPKA 2P5NA 1PTAA 4IFKA 4L6OA 3URQA 2TAAA 4I8DA 4LS0A 3VM5A 3H53A 1ZAIA 3PHAA 4Q8MA 5DCBA 3EX1A 3GB6A 5C0QA 3NL3A 1W5OA 2QGYA 1XH1A 2OELA 4TU1A 1GOXA 5T91A 4MY1A 2VFEA 3ZMRA 3ITXA 4AC7C 4B16A 1ISWA 2RDTA 1KRMA 3RIKA 3TX9A 5M5DA 3MUZ1 3S1VA 1T99A 3VCNA 2YLLA 3FNDA 3UGRA 1E0UA 3MUCA 1O7AA 1SMAA 3W76A 4IG2A 4OWGA 4MUZA 3WH7A 2XH2A 2HE5A 2V5DA 1KA9F 5LIKX 1S5VA 1FHVA 4ECLA 2VEIA 4GQGA 1ALDA 1F8IA 4KGJA 2E1WA 3MI3A 1Q6GA 4BEQA 1TPUA 1OYCA 1C8VA 2ZA2A 4HT3A 4K7VA 1XYBA 4ACZB 4Z2HA 3VIGA 4LVFA 4CNNA 2INFA 4G1NA 3B06A 4C7DA 4JPGA 3TXZA 1K03A 2J79A 3BCFA 1HVXA 2B7PA 4XD5A 3WMSA 4KCVA 2OYKA 4BWLC 2OEMA 1IE7C 4R85A 5TBOA 4B91A 5I3IA 1DE6A 3H2MA 1A5LC 3TZNA 1S2WA 1W32A 4GKTA 3S5NA 1FOBA 4KKXA 1E56A 1ODZA 4OUEA 3P8JA 3MV01 2GK1B 4GNKB 4H6QA 3SUUA 1BXNA 2YGYA 3KTSA 1LG1A 4DWSD 3WQWA 5I3DA 4Q4SA 2XFFA 1W9XA 2QCDA 4QTGA 1K9EA 1CNVA 4J9JA 3TA6A 3U5UA 1XICA 2CBIA 4CN6A 2DJLA 4JIRA 3QQWA 2AKMA 4NUWA 4A8RA 3WKZA 4Z2KA 5AYIA 4AY1A 4M6PA 3W7LA 3MMUA 3WDQA 2PAJA 3DECA 3AHYA 4ZB0A 3LXAA 5B7ZA 1YNPA 3ARVA 5ECUA 4IGNA 3H26A 3W24A 1I2OA 4C1NB 2W4XA 4ZZ9A 2TPSA 1W3TA 2RGMA 2HPMA 2PZ0A 1W9PA 1VYRA 3QHNA 2NQZA 3APTA 5BYWA 3EOOA 3SUSA 2GVEA 3E5PA 4KS0A 1KFWA 4EP8C 1UH4A 1TTPA 2PS2A 3GNNA 3HOJA 4UOJA 4WR3A 1OZMA 4UXDA 1W1A1 4A22A 4UWMA 4GGHA 4GH1A 1A5NC 3O2LA 4MYXA 5FJJA 2A79A 4HK6A 3C0SA 5DY2A 2OX4A 3NGJA 4XVEA 2VI0A 3TCEA 4QBXA 3A5VA 4K7YA 5A6JA 1XBXA 1M1BA 3DDMA 3VMNA 2F6KA 3TN6A 4JNMA 4JEQA 2ZDSA 3K5XA 4C6FA 1FWFC 3RLVA 1E1CB 4EWJA 1TV8A 4YVPA 4MUPA 3QZEA 1Q7MA 2NV2A 2WO5A 2YFOA 2GOKA 1TJPA 2HEJA 3N13A 4WKAA 2R91A 3UVIA 3NQ2A 2XH7A 2VEFA 1QU4A 3TONA 3QOMA 1ZENA 1T96A 1EO7A 4PFMA 1VEMA 4MNLA 2NT0A 2Z1VA 3DG3A 4HZMA 5ABHA 1OC6A 2OPJA 2V5BA 4Y8FA 1MEHA 4U3AA 4KH2A 4D2JA 3VX0A 4Q8VA 1H7NA 1ONEA 1VC4A 3AHZA 4J35A 1AH0A 4PMUA 4RPPA 4V33A 1V02E 2BMBA 4QJ5B 2I7GA 3N18A 4GIRA 3N11A 3S2JA 1ELSA 2BNJA 3KBWA 2Y7GA 1LOSA 1TYGA 1K6AA 3AYVA 2BFGA 5E93A 3M46A 1BVNP 3W2LA 3U2OA 3PWAA 3Q4DA 5HUOA 3NG3A 3NUKA 4L4MA 2OQHA 4DO4A 1V77A 3GH4A 2PGFA 4JYDA 1E6RA 4V2XA 3W25A 5G2IA 1JPHA 1XQKA 1WPCA 2CBJA 3VC6A 1FFQA 1QI4A 3W71A 4IMFA 4PR4A 3F1QA 1PSCA 3MS8A 1CPUA 1J2BA 1QXLA 4CQAA 3QQ0A 2IKGA 2Y70A 4MSSA 2Z24A 3QSTA 1TREA 2OJPA 4AIBA 3AI0A 1VYPX 2WNNA 2GGHA 1V6YA 3H2FA 1ZL1A 4I8YA 4JFSA 2VX6A 3R6IA 3QFEA 4S2CA 4QE4A 3W02A 3ARZA 3CPRA 1V6TA 3EYPA 2J6VA 5GVJA 3WNPA 4RDWA 4HSOA 2QDDA 2XM2A 4ERIA 5HPCA 3EGJA 3KLKA 3NQMA 4C1LA 3BCDA 4KWOA 2GSEA 4ZQPA 4HPJA 2YW3A 4O0ZA 4XAZA 3ID7A 1EDTA 1IGSA 4N6FA 5AHFA 1ENUA 1NWSA 2X1UA 4LPCA 3FAXA 3WMLA 4LNCA 1JPMA 4B9YA 4ZA0A 2XDFA 1D7FA 3MKVA 4LF1A 1OM0A 2ACSA 2H9AB 3PTMA 3IJQA 3OOQA 2IS7A 3A4XA 3TWAA 3LXCA 4QFUA 3E1F1 3AU2A 5CC6A 3H12A 2TRSA 4BQ4A 1U83A 3M5YA 1VHCA 3BSHA 3W01A 1R47A 4ZEPA 5FSDC 5AOUA 3WF3A 4TX9A 5F2IA 3GXMA 3EWWA 1NDVA 3WCZA 4I7WA 5KTLA 2CERA 3L0KA 5M17A 3OVRA 3T1GA 1A3XA 2DSZA 1CXIA 3W6YA 3W29A 2C8NA 4RNJA 2GZXA 4X60A 2GOUA 5M3WA 2QR6A 1RV8A 1XYAA 3TVAA 3CH0A 4DJDD 3E0WA 1A5UA 2GGIA 3W7QA 2ZZ2A 3C86A 3IIPA 4UTKA 4D6DA 4PRTA 4FOJA 5H8MA 1AW2A 2DU2A 3VABA 1J0HA 3KCLA 3R13A 4GX8A 5LGXA 3CPGA 4Q6XA 1BVWA 2PDPA 3ORWA 3SQSA 1UPMB 2VC5A 4B5NA 3S2MA 3GIQA 1JNEA 4Q8UA 2X1SA 3RLGA 1HL2A 3BLDA 2DPEA 1K9TA 3R8GA 3TTEA 1QW9A 5CGMA 3EDFA 1UW9A 3PBVA 3URAA 3PSWA 2V0TA 1TWDA 3T2PA 4RPQA 1MW2A 7REQB 2CHRA 3IK4A 2B0MA 1VR6A 4ZSUA 3BLOA 3EX6A 5EBAA 2EKCA 1DWHM 1REQA 3KWXA 1GJUA 3W73A 1KM4A 1DHKA 1MO0A 2ZA1A 3G5EA 3OIXA 5TAOA 1PVNA 2WCAA 3O05A 5EYWA 1FKXA 3E0VA 4O1BA 4TIMA 4E8CA 1SZNA 4NAEB 1I0BA 1SM9A 1QNVA 3WF4A 4UNKA 3BAXA 3OYZA 1I9CB 3B8WA 3BC9A 3BG9A 5D8WA 4BQ3A 3L68A 4GYPA 4I9TA 4TV6A 4MOZA 4QAIA 3HN3A 3SY1A 3TJIA 3E38A 1EF2A 3VNDA 2G3MA 5JVLA 4UFMA 3LCFA 3V5FA 1M5WA 3B04A 4TVDA 1P1XA 3THUA 1VIZA 4P7RA 4L1GA 1Z89A 3H4XA 3O3RA 3DHPA 4AMAA 4K8HA 1D8CA 1E5JA 1NEYA 3N2CA 4JN6A 4RE3A 3THQA 2CFFA 8TIMA 3XIMA 1M53A 1I2PA 4L1XA 3EB2A 1NOFA 2XIBA 3HF3A 2O7QA 3Q2DA 1LQ2A 5LA1A 1NP0A 1G4PA 4MWAA 4CD6A 4W8AA 4GNJA 2BS9A 2P50A 1AUSL 4K6AA 2JEQA 3C0LA 4Z1YA 4S3KA 4O13A 2BB0A 1AJ2A 2BTMA 2QGHA 1AA1B 4O8RA 1SJAA 1O5KA 1DV7A 2Q01A 1I8JA 4DF0A 1S2VA 2NQLA 1XLDA 4HOZA 3I4KA 1XD0A 3L0NA 2WCGA 3MC5A 4O11A 3CZ8A 3ISIX 2HK0A 1ISXA 5E70A 2OKTA 1BG9A 1XLLA 3MP4A 4Z1BA 2H8ZA 2J4GA 3W7JA 5K2ZA 3E96A 3RR4A 2HVMA 2ZUWA 4LVGA 3PSVA 2V6AA 2J74A 4IMAA 1PEZA 1EIBA 4NNCA 3DCPA 1ZY9A 2R8WA 4DYJA 4X0VA 3BMXA 3WF1A 3FOKA 3DXIA 3HQPA 1DHPA 1XPYA 2WKLA 5HULA 2Z2AA 2FZ9A 3NO3A 3NOEA 3E0FA 1LQAA 4FALA 2AL2A 4PN2A 4BI5A 1IYXA 3V75A 4DB7A 2R9RA 1JCNA 2L5HA 4UMAA 4AFYA 3STFA 5DXXA 3UJRA 3BAJA 4MNJA 1QHPA 1I45A 3H2AA 4PCFA 2E1DA 4FK9A 1JFXA 3OBAA 3CUJA 4RUBA 1GNXA 2F38A 2GDQA 2QJMA 4AVNA 2X2YA 4LFYA 4C6NA 4AHOA 2Q8LA 3LCHA 1LLOA 2BP1A 4OBRA 1FDJA 4IUOA 5K9DA 4CNSA 5JBDA 3UZJA 2ZA3A 3IJ9A 1AW5A 3DFSA 3RM8A 4E8DA 2V3EA 4C6BA 3WMCA 4EAYA 5C54A 1DYSA 4O28A 3CHVA 3J7HA 4LW7A 4IMDA 2O7SA 2FB2A 1LRNA 2NUWA 2BVDA 1XYCA 3M0HA 1NJJA 2OB3A 4H9VA 4DHGA 1WV2A 4Q8PA 3VDHA 1P7TB 2F7FA 3UZWA 1IWBA 1PAMA 3BW3A 4NJHA 2DT3A 1OB0A 3CWHA 3BG5A 3AIBA 4I7VA 1QDSA 4Q22A 5DRCA 3PB0A 5BU6A 3P5ZA 5FEWA 3BQ6A 3P82A 3Q58A 1RCQA 3LOTA 2W0UA 4UTIA 1V3IA 4O50A 4ML9A 4YPJA 1ICQA 5CJNA 2E5BA 3GIPA 3SUVA 4GVIA 3N6HA 1CXFA 4O1CA 5G2WA 1VFFA 3USBA 3F4WA 2WOQA 1GQLA 4X9YA 3IJLA 2J7HA 2XIJA 2CLLA 1R85A 1X98A 5IBXA 2XWDA 2WLZA 3DYPA 3R4IA 3TTSA 9XIMA 3CUGA 2V3GA 3CB8A 4IPPA 1OIMA 3A6OA 1DJQA 5LIYX 3MKCA 3M0IA 1UR1A 3WX7A 4OUIA 4BEUA 4JTLA 5G1TA 1M6JA 4EF8A 1FQ0A 2VCBA 3UETA 2FHBA 2PEVA 4JY8A 3PB2A 2PWEA 1B3WA 1IT8A 4IHCA 5DELA 1QI3A 3UERA 2R82A 2V69A 1EP3A 1XRVA 2DH2A 3LPPA 1JZ5A 3POHA 2F61A 3AS3A 4FOUA 4Q6JA 5KZ6A 4B5TA 3HMJG 3KZSA 1M03A 1R46A 1UZ4A 2VO5A 3PK7A 3E3HA 1OX5A 5L6UA 3PN8A 3GHTA 3OJGA 4TQTA 1PKNA 3NDOA 4QJ1A 3NM3A 3KP1A 1M3UA 3PWGA 1Q4WA 3IGUA 4MIMA 3MTWA 2Z6JA 1JEZA 3A3WA 3KRBA 2HNEA 1QRQA 1TCDA 2PBOA 4EXBA 3U5YA 3T8QA 5K7JA 1C93A 3NDYA 2QCCA 4HJWA 1JRBA 3N6QA 3W1UA 5FJUA 4JOMA 4YLWA 4F9DA 5BWAA 3VILA 1W56A 2J7BA 3O1NA 1EUNA 2OSWA 1UMLA 2NWRA 4N42A 4AB4A 5LA2A 4JNYA 2E6YA 2G3JA 3OGVA 3BK0A 1T7LA 4AW7A 4WY0A 4WSKA 3TTQA 1BGAA 3OLDA 1PYMA 3SUTA 4QHRA 1EJUC 1BD0A 4URIA 1HL9A 2W67A 1MI3A 2ZRXA 1QOXA 3LS9A 2QVHA 4B92A 3VE7A 1K02A 1ZTVA 3O0KA 3FYOA 1HN1A 1SR9A 4US5D 1J12A 3VDCA 1T41A 5A8OA 3LGDA 2ZZ4A 2FDSA 2KZHA 1BAGA 5D9NA 5FF3A 4GOAA 3EXSA 1G7VA 2E6DA 2VEKA 2WZMA 2WJZA 2XGZA 1GKPA 4LH8A 3FJ6A 4LXFA 3I10A 3W6MA 4S3GA 3BJTA 4AISA 3U8GA 3AIEA 4FLSA 3AYRA 3UWEA 4L6DA 4OZOA 1AG1O 4QG9A 1J10A 3AIVA 4CU7A 4E2OA 4WUIA 3N25A 3LG3A 3VD3A 4AF0A 2QXWA 2OSYA 3CASA 5A8NA 3UWYA 3MSRA 4K1GA 2PDWA 2ZRWA 4DBDA 1DORA 4L5ZA 3LGGA 2YCLA 3RLUA 5C9WA 5CZJA 5HMFA 1RHCA 2X1TA 1C90A 4XTIA 6REQB 4HMCA 4MJMA 3KOYA 2GUBA 3UD6A 4WDTA 3NQDA 3UWZA 4HK7A 4HK5A 2PURA 1YE4A 1P4CA 1FWAC 1DJZA 1CGTA 2SFPA 1OVDA 2B4GA 1MNZA 2C0HA 4X3ZA 4NVTA 3CLMA 4TX8A 4NI3A 1EHAA 1S5WA 1JG9A 1JCTA 3FYYA 2PDXA 1E0WA 1TVNA 2DEPA 4P5UA 4DF2A 3KE0A 4D6FA 4ZQRA 5M2FX 1F61A 4PE8A 4L7ZA 1EC8A 3KL0A 4B5VA 4IF2A 4RV8A 3P74A 3TQPA 4IGMA 2PP1A 1M41A 3O8AA 4MWAE 3HGJA 5HQMA 3LMZA 3Q37A 3CUZA 2YDQA 4RZ5A 4WJ8A 4IIFA 3AWOA 4JL1A 1IEWA 4PUUA 5AHIA 5C7VA 1ME7A 2Q8XA 1SZEA 1EZWA 1U22A 2A3CA 2FJKA 3VDGA 3SCOA 4DUXA 2OLSA 3LSBA 4BK9A 2X40A 1O5XA 3QHMA 4L80A 4JL2A 1ZQ5A 3RDKA 3BJSA 4FSAA 3N15A 4JQ1A 5DMLA 1R9XA 1X38A 4LY4A 5I7GA 1F6KA 2V3FA 3ABOA 5KZMA 2FPVA 1QNPA 2ZXAA 3T40A 3L12A 1XKYA 2DZPA 5BROA 5GNXA 4JFUA 3TEVA 4DBEA 3C2VA 3CQHA 3HPAA 5FSEC 3N2MA 4QX4A 4JFVA 3ARTA 2WMIB 1F4HA 1WYIA 3T09A 3UBPC 4B5UA 3LZ5A 1IGWA 4DNHA 3AXKA 4CEXC 2HROA 1W1PA 1M68A 4PTDA 1TMLA 1QUMA 5DCEA 5REQA 1N2VA 1OT1A 1FDYA 3GTHA 5XIAA 1OFAA 1WZMA 3GBEA 1DTNA 1KM6A 5HWNA 3QVQA 5IRPA 5CPOA 3VAVA 2GJRA 2QCHA 4IZGA 3D3AA 2BBFA 4GYPC 1BG4A 2VC9A 1LBLA 3S47A 3WBXA 3QBUA 3L67A 1Y7VA 4WHBA 1B3YA 4H6KA 2GUYA 2C0AA 5JH2A 2Q02A 3CQKA 5FOOA 3OVGA 2E67A 5EB8A 4E5TA 1HKWA 4E4PA 2BXZA 1T40A 4KCTA 1DL3A 3OGSA 3AIWA 7PTDA 3V5OA 3OZMA 1LUCA 3M7WA 4BJHA 4CQ9A 1EKOA 2CKRA 4NJKA 4EPDC 1ADOA 1XW8A 3WELA 1LTDA 1VFHA 3TC3A 1UZHA 2GYIA 1GYLA 1XQLA 1RK6A 1QMLA 4FNQA 1UIOA 3VIIA 4MWAC 3FA4A 3RUBL 1GTEA 4ZB5A 1EOKA 5D05A 5MKGA 3PJXA 1Q2RA 2J24A 3PUEA 3GZAA 1ONRA 3I7QA 3CC1A 1VCFA 2O92A 1ZCOA 2YCEA 5CJMA 2OZ8A 4ICMA 3QY7A 5ENLA 5AC4A 1YNYA 4AEOA 3CV6A 1NELA 4Z0SA 1K4GA 3PAJA 1EYEA 2PI6A 3RPDA 1O66A 2PC4A 4PRRA 5CPNA 2UY4A 4GACA 1V4YA 1SGJA 4GZEA 1SJCA 4XSLA 1V51A 3HA1A 2A3LA 4G7EB 2O9PA 5BXSA 1O1HA 3GHUA 3GTIA 1G69A 5HAOA 3UPWA 1P0EA 2C15A 1XKJA 2PUZA 2WJEA 4CCEA 2CLEA 2VFHA 3LRMA 5HMDA 1EL3A 1I0DA 3P3BA 3PZNA 1JPDX 1KB3A 3H2OA 1WXJA 1D8WA 3OLGA 1GKQA 3UA3A 3IIZA 4TXEA 4QEHA 1O68A 1KBBA 1K70A 4AC1X 2R1KA 1QW7A 2NVDA 1YRRA 4HOXA 4W9TA 2CXEA 4JTGA 2WVSA 3UZXA 3R43A 4Y2WA 1ZRQA 1XLAA 3U2EA 1MVYA 1SJDA 4WKHA 1FY6A 4O1EA 4MM1A 1VCVA 3QMRA 3EMZA 3BGAA 4IXXA 2R1NA 3NO5A 5JBFA 4ONVA 4KFOA 1R7OA 3CUHA 2XVNA 3SY5A 4LUTB 4DJFD 2ZIDA 1GG0A 3VNIA 3U0HA 1S2AA 5C9RA 3M0VA 4GY1A 1SFSA 3TUUA 4ES4A 2B81A 4MZYA 2H6RA 3DGRA 3HQOA 2XSXA 3QV9A 2ZTKA 3SGGA 4NHVA 3CT2A 1J0JA 2QUNA 4JTTA 1OADA 1DIKA 5AC5A 2Z00A 1VFUA 4W85A 4IQEA 3KL5A 2GGJA 3QTPA 2O0TA 1YTKA 4YVVA 1Z48A 3VO0A 1RBAA 3SCPA 1B0IA 2ICSA 3RRXA 1KM2A 1WKFA 1Q8AA 3UWQA 3SEPA 4M7SA 2NXHA 1TSIA 4CCDA 3GIYA 1KC7A 2JKAA 3S1XA 3GXDA 3PPFA 4GISA 3VYLA 1G4TA 2NSXA 2C1GA 4HPHA 4LBSA 4O16A 2HPIA 2X41A 1PZ2A 2VZVA 4Q7NA 2GJXB 2V3DA 4QJ3B 1WBJA 1WOAA 3C4UA 3AS2A 3NPVA 3ZIZA 1UKQA 4AMCA 1GQKA 5IBXC 1WDQA 3GX9A 2ZUSA 5D2YA 2WANA 1HVQA 3WN6A 3PUGA 4M19A 1PO9A 3KRSA 2ZUTA 5CSSA 1HKIA 1ML1A 3KVKA 3R0UA 2EKGA 1ZBVA 3BMVA 4Y6GA 4JTRA 2VFFA 3AMKA 3AYSA 1H50A 3KOZA 3QZAA 1PWLA 1BVZA 1JVNA 3V5CA 3B05A 2ZICA 2QPSA 2X0HA 3LHZA 4HZ7A 3G3DA 1EBHA 2R1LA 4YJ5A 2TYSA 5CXPA 2BY2A 1UD2A 5I02A 2XWEA 2WBGA 2Y89A 3VU2A 1KRAC 1LBMA 3H7RA 2FZ8A 4IWWA 2VX7A 5LIWX 4HB7A 2RJGA 3W1AA 1MFVA 1PBGA 1QCWA 3UCQA 4LC6A 4L9XA 3SI9A 2WXDM 3HQ1A 3U2ZA 3R94A 4G9PA 1UWSA 4HJFA 5EKYA 3W7OA 3A3XA 4GUFA 4U5IA 4BR1A 4QS6A 3M64A 3LEPA 4PMXA 4GQBA 4IGSA 4REQA 5FJOA 1JCXA 3T55A 2WMJA 1YX1A 3QMTA 3WEZA 2IMRA 3KOFA 5B80A 3UXDA 4DBWA 1UWRA 2YYTA 1JZ3A 2ZX8A 3HURA 4B9ZA 1NDYA 4F9JA 1KBJA 2E8YA 3HJEA 1P5BA 3MO4A 4HU8A 1B57A 1US2A 1XGEA 3FKKA 4J3WA 5BRPA 1XWYA 6TAAA 1PS9A 3RXZA 2PTYA 4O18A 1XPGA 4K37A 3RO8A 2H3DA 3W2JA 3O7UA 1RCXB 2DW7A 5DBUA 1EIXA 3M07A 4ZO7A 2D73A 1XLEA 3B4UA 3P6LA 3M44A 4O0KA 4F2BA 2V2DA 3HFYA 2BY0A 3PBYA 5CBJA 2FFCA 4XKYB 3CEPA 3M0YA 4W87A 4DLMA 1AK5A 2VGGA 4LAKA 3W85A 4A2SA 4XD3A 2WHLA 1E70M 2NWSA 2RDWA 3ITYA 4BZYA 3FSTA 1UZDA 4NSBA 1OEPA 1J6OA 3WLTA 4OHQA 2QYGA 3TJ4A 4GXMA 1RBOB 4DUWA 1MXGA 1IT7A 3ZJKA 1KNWA 3UWVA 3VKKA 2OT0A 2REQB 3MBFA 4GO9A 4GLEA 4WIWA 1QI0A 3PZMA 4MKVA 3M0MA 3B40A 3PVFA 4NZ4A 5E6ZA 3G1YA 3MJYA 1R38A 3TYCA 3RU8X 3AALA 3BCJA 4IL0A 5DRIA 2AGKA 1TFVA 4PMVA 3TDFA 3B9OA 1L6YA 3GXPA 3FGCA 3L65A 2WV8A 1V6WA 3LCGA 3TIMA 2CITA 1A5KC 4IP5A 4ZODA 2FZMA 4GQRA 1EF3A 1Q3NA 3O15A 3TP4A 4IH3A 3WQ6A 3LENA 2GQAA 4GXWA 4C6QA 2PWGA 3ZYZA 1KWKA 2VTFA 1OG6A 2DZWA 2QUVA 1JPIA 1VBGA 5HWJA 1XL9A 3PZQA 2WZEA 3ARQA 2Y7DA 3A9BA 1WP6A 2XGIA 4UQAA 5EA9A 3O0FA 5E0FA 2VVSA 1YTEA 1FWWA 3GDBA 3MUY1 3ZSTA 4QLKA 5I3JA 3VNLA 4F0KA 2DZUA 1YDOA 2AQVA 1EDQA 1H41A 4B3KA 4YS1A 3OQEA 2V30A 5K4XA 2WC4A 3HPZA 1K7XA 1R87A 3REQB 1R2SA 1A5BA 3R2GA 1J5SA 3A13A 4G7FA 3SAZA 3NSNA 3E2QA 1QOQA 2VDHA 4WJXA 3OA3A 3PBMA 1J5TA 1XLGA 3EA1A 2EPHA 1UBPC 1IZJA 4J40A 3CYJA 1JZ4A 2PWUA 1XIBA 2LLEA 4DZAA 3NVTA 1CX9A 3MJMA 1N8FA 3EPOA 4H9MA 2C71A 3PZGA 3TNOA 1PKLA 4ENLA 4YTUA 3O16A 4H19A 3S2CA 1VRDA 4LUSA 3WFAA 9XIAA 4IISA 3NR0A 3VPLA 3GVQA 4W5UA 7A3HA 3VOGA 4HNVA 4JKKA 3NQBA 1HFBA 3CV1A 1UD4A 3MYOA 1IWPA 4J5NA 4HCHA 3YPIA 3OB8A 4UOZA 1MNSA 2P3EA 4KRTA 2Z7KA 1Z3NA 1XLFA 6A3HA 4UTLA 3WQ5A 1V0MA 1M7OA 3S1UA 5CG0A 1XSKA 4IQLA 5FAGA 1OFOA 3W7EA 2OR2A 1G67A 1H0GA 3H70A 3QJAA 3W81A 3DENA 3WNNA 4LVDA 1RPKA 4ATLA 3AJXA 1T0OA 3PPHA 4QM1A 3FV9A 4FNPA 3WENA 3KZPA 4MY8A 4R5EA 4IPIA 4F48A 3COTA 4N02A 1I2QA 4DM2A 4A3YA 1RH9A 4A8IA 4ADSA 2ONEA 3WH9A 3LBMA 4RXFA 3L7RA 5LNVA 2XU2A 3NL2A 4AZ7A 3GY1A 1B90A 2YBUA 1VPXA 1MEIA 3PPGA 2PDYA 1TUFA 3L2MA 1GOMA 2DDXA 3LHUA 5BOEA 3KDNA 4B2DA 2VDGA 2QCEA 6ALDA 2Y7EA 1RP8A 3GU2A 1FWDC 3IIOA 3VIFA 3SO7A 2HS8A 5HJYA 3W1RA 4OE7A 2CBUA 3DC8A 4FXJA 3U9IA 3NEVA 5FF2A 1K8XA 2A21A 2YPIA 2VFDA 1V0NA 1KXQA 1PHQA 5M03A 2AAMA 4EXAA 2HXUA 4GI8A 4IMCA 1B9ZA 4RJEA 1ADSA 3TMLA 1R3QA 2YL9A 2JGYA 2BGNE 3W84A 3KAOA 2F8QA 1QR7A 3W37A 2ZCGA 2P8CA 4H6EA 4MTVA 4HPGA 2PTDA 3CHDA 3VIJA 3G8EA 2VNCA 3W9ZA 4L4PA 3S6DA 3WLMA 1K1DA 2C7FA 3UR5A 1GZGA 3T9PA 2P88A 3QKEA 4XAFA 1C7SA 2D3NA 4XZIA 4QIUA 3SB0A 3NYZA 4D6IA 3N4AA 3VD4A 4AYGA 4M81A 4F40A 4M7TA 4TOQA 1TPB1 3W7CA 1BF2A 5ABTA 1YIXA 3GTFA 2CZEA 5LNSA 2YA2A 3TC7A 5BRBA 1IQ8A 2PFHA 3L4ZA 2P0IA 3SN4A 1IXPA 2ACQA 2G5WA 3C3NA 1PZ1A 2NXGA 1Y0EA 1YQ2A 4O12A 2OSXA 1G7UA 1N8IA 2Y63A 4PMZA 5AN7A 4ZBCA 3UF9A 1VIWA 2PRLA 3VXGA 1E4LA 4JFWA 1E72M 4XZWA 4K36A 3STCA 1Q6RA 1OFPA 3RHGA 4DYEA 3L4WA 1TMHA 1XIIA 2W62A 3TQVA 3EA3A 4CVUA 4RR4A 2OG9A 3P67A 4E3VA 3R25A 2HMCA 3N14A 1A5CA 2J7CA 3PZTA 1IV8A 4LBRA 1B3OA 4ZL1A 2BY1A 1E9IA 1JCJA 4J3TA 3CK5A 3M5VA 3W74A 1GVSA 3PF3A 2GSJA 1ZAJA 1VFOA 2WZIA 2OQLA 1K8ZA 4LYKA 3S9ZA 2E28A 3GXNA 1FCUA 4YIWA 5E0KA 5DQPA 3WDHA 3GFXA 2ZX6A 1EGZA 2X2GA 5LNRA 1GVOA 1XFCA 2I56A 3EPMA 3AZRA 2WW5A 3M6YA 1DXIA 1ZJAA 1QPRA 3BSMA 2WMKA 3S1WA 2VP8A 1CENA 2HWGA 2XYLA 3EKGA 4G1KA 1F3XA 4GJIA 5I0DA 1OY0A 1X7IA 1W3KA 3T0AA 3A9IA 1J4EA 1FH7A 2QJGA 3W86A 1YBQA 3FK4A 3LK6A 1N8WA 4YL2A 4IPJA 2Z0IA 3R11A 3BLEA 4BY3A 1KLZA 3UG3A 1RVGA 2X05A 1UYQA 2F84A 3D0CA 2VR4A 3TNBA 4H04A 1LCOA 2ZYFA 2PU1A 4M5PA 5CPQA 1K3UA 3SGZA 3S4TA 3QW3A 2WCSA 4H1ZA 1IEXA 1EFZA 4S39A 5J5DA 1TJ0A 3CL8A 4GMEA 2WMFA 2G50A 1UR8A 4W8LA 3UNTA 1CDGA 4LEQA 1I2NA 1DXFA 3BURA 2FPTA 1RSCA 1LLWA 4ORIA 1DQUA 1OFDA 3EA2A 3L21A 1AH3A 3ITCA 3WLIA 1JI2A 1VFLA 1K8CA 3NWRA 4FIRA 3WQEA 2X09A 3AHVA 3SIZA 1SO5A 1UMYA 3PM6A 3HJZA 1MWOA 3UYIA 3ZVHA 4W88A 3AMDA 2FIQA 3LI1A 3CJPA 3MWCA 2QUMA 5HXMA 5D9MA 2ABBA 3R79A 1V03A 1OGSA 3VK5A 1QNQA 5T8GA 2EPNA 4US6A 4IX2A 4TUFA 3RN6A 4JDBA 1BRLB 1FWJC 1B5TA 4GVFA 3TK7A 1YPXA 3GO2A 4PEKA 5LXEA 6XIMA 4JIHA 3D6NA 1JF6A 3UJ2A 2B7QA 3GDKA 2HNHA 1FWCC 1BTMA 2E9LA 2H3BA 1RD5A 4Z08A 2WSRA 5A6TC 1MW3A 5D9OA 1B3ZA 2I16A 3BW2A 5CPLA 5LHFA 1ZNNA 2B7NA 5C71A 3W7NA 3ABSA 4M6QA 5CSYA 4TX6A 1XYFA 4EACA 1RPXA 3FX4A 3L5AA 4JTJA 1F3TA 4EXQA 5JQ9A 3ZM8A 1UG6A 4ZOBA 4WF7A 3IJ8A 2HXTA 2OCZA 2A3HA 4XK2A 1F73A 2J8FA 4DZIA 1KM3A 7XIMA 1R3RA 4C6OA 4OQVA 2VD9A 4P8VA 1I60A 2CHOA 1HJUA 3VVGA 2Y7FA 4J28A 3G0XA 4L9YA 1XF0A 5HA7A 1US3A 3FXGA 3LPGA 3FJLA 1MQRA 4V1XA 3EX4A 3WD0A 4GHRA 4GA8A 2CBVA 4PTWA 3SZ8A 5I06A 2R6OA 3WUFA 1UHVA 3HG3A 4NNBA 4AG0A 1GVQA 4RNIA 2GQ8A 2GVLA 2VRKA 3INPA 2QUUA 3ARPA 4JTHA 1NOUA 1PX3A 3BH4A 3VA8A 1IXOA 1K6WA 3B8VA 4XSMA 3VI2A 3GQYA 4R9XA 2BSLA 2RKXA 4FMVA 1TO3A 4AX7A 3UT0A 4ZCWA 2D24A 3AHXA 3LMYA 3WL0A 3S46A 4AD0A 3I6RA 1S2UA 4V15A 1DJGA 4GXPA 1FVPA 1V8EA 3Q67A 3CMGA 3LB0A 1W9DM 1GJPA 3MQTA 2EF9A 4XAYA 2VDIA 4H9ZA 2X16A 3AJ7A 2OKOA 4LQ1A 4NRSA 1QT1A 3W7PA 1ZCCA 2XIOA 4D1JA 1H3GA 3ZR5A 3HMCA 2EPOA 2ZUMA 5GPRA 2VUYA 1V3MA 3PBGA 4PA8A 1E6ZA 1HUVA 1S2TA 1SFTA 1H7PA 2PF0A 2QT3A 4GINA 4UFHA 3IANA 4RZBA 4F2TA 1V6UA 2QUTA 9RUBA 4OV9A 2WVVA 3GWQA 1TPEA 5A2BA 1A4MA 2W3ZA 1WE5A 3TXVA 5EMYA 3VIMA 2DY3A 3OO2A 1E4MM 2GPTA 5AHLA 5C2GA 3F2DA 2VRJA 2HDJA 3L4VA 1JNDA 5HWMA 3C61A 3FVDA 4CQBA 3EXRA 2QJNA 3IIXA 1GEHA 2XVPA 3VFCA 3GAKA 2GUUA 3AXXA 4IUGA 3R58A 1W3LA 1A5SA 1JUBA 3W72A 2UY3A 3N2TA 4P2VA 1S1RA 1OF8A 1U5VA 1R2RA 3W27A 1DPMA 3V0UA 2VQTA 1OFBA 1R9ZA 2QDEA 3ME3A 1Q6LA 1AJ0A 3N9RA 3U7BA 1I1WA 1THFD 3F4NA 4QJ4B 1KBLA 1UR4A 3EMQA 4S3DA 3I68A 5DT7A 1JYXA 5FEZA 1NU5A 4ZR8A 1KRCC 3O6DA 4YXGA 1FWIC 1BYBA 1WX0A 2OOFA 1H5VA 2QZRA 1K7FA 4L9ZA 4NZJA 4P61A 4LAOA 3TSMA 1GOIA 3TSBA 1RALA 2PF8A 3A23A 4HD5A 3DG7A 3CIXA 3KS6A 3BLFA 1SZRA 3NSMA 1LF1A 4BA0A 1VFTA 4JFTA 1QBAA 1QAPA 4Z2GA 4AHQA 1F7BA 4D8AA 2NV9A 3H6OA 2R24A 3N1AA 3ONCA 4QG6A 3VZXA 1FWEC 4JKMA 2NW0A 4NJGA 2WPGA 3L4XA 2FDMA 2WSKA 3NAVA 4NAFB 1ESWA 4F4RA 4WGXA 2CLKA 1AFSA 4ZQNA 5EMLA 1L6FA 2OGYA 1M9HA 4GNVA 2C1HA 2GFTA 1LP6A 3WUGA 4AVOA 3T07A 2IKIA 3TW7A 2E4TA 1TV3A 4MB3A 1TQXA 1LM1A 3PFMA 5CAHA 5A6LA 2DZTA 1XG3A 5M1TA 4AQLA 1PHWA 4W7WA 1TR9A 1FH9A 1I6NA 2YCKX 4UCGA 3SBFA 3GG8A 3C0QA 1Q13A 3V16A 4HNNA 1F5ZA 1EGVA 4NNAA 4B3ZA 4NT0A 4F0SA 8A3HA 4H01A 1JRCA 2A7RA 4MDPA 1GQNA 3WUEA 4IM4A 3MZ2A 1SFJA 2WC7A 3W1PA 4RCXA 2EEXA 5MHBA 2VZSA 3TYZA 4N6EA 2D0GA 4DX3A 3A3HA 4MKSA 3WD3A 5JBEA 4GQQA 3AS1A 4K2SA 2Q71A 4UTHA 3FSUA 3O63A 1BPLB 1FCBA 1FDZA 3FJNA 1JUEA 3U57A 1UKOA 3GYEA 4GYJA 3N12A 2EAWA 1UJPA 4TTGA 1LL4A 3LNMA 2PTWA 3WQOA 1TMQA 3R7MA 3UGVA 4BI6A 2F9RA 1XRTA 2C16A 2VR2A 5TF0A 4Q4PA 3QOKA 1GEQA 1TPH1 3UY8A 4LVAA 3TWBA 2R1PA 5FA5A 4WDUA 3JVAA 3FLUA 1XDLA 1L6GA 2ZUVA 2VEGA 4CQDA 1ZB5A 4M1RA 1PL9A 4P8UA 2PGWA 2YXOA 3K46A 4R7JA 3EDDA 1UUOA 1ONWA 2BY3A 1TV4A 1LL6A 4MY9A 3AAMA 3PY2A 4KCWA 4D6CA 1J9YA 3C8FA 3SCRA 4H3DA 5EGRA 3W26A 3DH7A 5DY3A 3B03A 2J9XA 3B0PA 2G3FA 4XV0A 2D2JA 1EBGA 1AVAA 1UASA 5A2AA 1C9DA 3VX1A 1BWVA 1OT2A 3FS2A 4YCOA 5I09A 1CB2A 4Z0JA 1EC9A 4FXSA 1GPWA 3VGBA 1DVJA 1YXYA 2DH3A 3RX2A 4UB9A 1IT0A 3LUTA 1W91A 3QTGA 4AX6A 1XSIA 4C5YA 4MF4A 1JDEA 2OODA 1OX4A 5K9CA 1VAHA 1UKSA 3DESA 2AGTA 2YW4A 3TN3A 4ZB2A 3LTSA 5CQ1A 1GOQA 1CI1A 3Q65A 3LV5A 4PEEA 4PB3A 1Z69A 1I2RA 5TNVA 1A47A 3W2MA 1XUUA 3TU9A 1XIGA 2E5DA 1HX0A 1W54A 4MADA 2Y5SA 1JZ2A 5BRQA 1T8QA 3CV7A 2BG5A 3L4UA 1SQ7A 3LSCA 4DXVA 3OZYA 5FAJA 2JIEA 3IUDA 4RZ4A 3APYA 1LWHA 1WUEA 4PMJA 1SYTA 3WJWA 1HO1A 1KCZA 3IJIA 4QE5A 4U10A 3CAVA 4H4IA 1W2PA 4A29A 2Z1BA 4QDMA 3BGJA 5AY7A 5HUPA 5G4WA 3FY1A 3G1DA 4B5SA 1J96A 1EA0A 1W17A 3MMTA 4ACZA 3KRZA 3B9NA 3ANUA 5HR7A 1HG3A 3AMCA 2ABAA 3O9NA 1DWIM 1WDWA 3IPWA 4G8TA 2PGEA 2Q3RA 1TA3B 4XD6A 4CEUC 1P0KA 3CUIA 2PODA 3UPBA 2A0NA 2RDXA 5GQBA 4BI7A 1OSEA 5AVNA 4V28A 4LAUA 5D30A 2ALRA 1SW0A 2XIMA 3GLCA 3DYMA 1UBSA 3QM3A 4OOZA 4DZHA 4UNIA 2VFIA 3RLHA 4EKJA 2GK1A 1QPQA 4UMCA 1Y8BA 3UG8A 2WHMA 2PCEA 1NF0A 3WF2A 4D6EA 3K4DA 3AUOA 1R3VA 3XINA 1SJBA 2Q3OA 1KBKA 4TV5A 2MNRA 4NKCA 5I24A 1AQ0A 4G6CA 1UR9A 3KP0A 2ASHA 4Q7IA 3B8TA 4H9UA 2JE8A 5CC7A 3P5YA 4M80A 3AZTA 4NZ5A 2Y61A 3HG2A 3JW7A 1EGMA 4ACYA 4S3BA 5EFDA 4MJ4A 2FMNA 3ZLFA 4C1NA 5LIXX 2WKJA 3STPA 4EK7A 2GDUA 3RCYA 1DWAM 3WBYA 1TV5A 2J47A 3H54A 1R7AA 2IPWA 1R9YA 1XDJA 3IVUA 1XISA 2PP3A 4B4FA 1H1YA 4ADTA 1YADA 1YPFA 2HBVA 1X6LA 3BJFA 1X8CA 2Y24A 4GG9A 4CD8A 3G1VA 1CXKA 4ZXOA 3GFYA 4QP0A 4GRSA 2A7NA 1XCFA 2PDIA 3KVJA 1O5RA 3T8LA 5E5CA 2YR1A 3TYBA 2RFGA 3CTLA 3PANA 5I3HA 3FEMA 4QSFA 3L4TA 4YHGA 3KW3A 2C91A 4LC8A 1FH8A 3CZJA 1WKYA 2PD5A 2PLJA 2QMJA 1YNQA 4WSHA 4A3QA 3AFBA 5DLCA 4OJYA 4ORMA 5CLWA 4D1IA 3PUOA 2H8XA 3HGRA 3T4CA 1E1CA 3RITA 1QVBA 3NZ1A 2A3EA 1CWYA 4DWSB 3GKFA 1PV8A 4B2DD 1FWNA 3ALGA 2E6FA 4XZMX 3LNPA 3O6CA 1ZJBA 2XM1A 3K13A 3QHOA 4GUJA 4R7WA 2CNCA 1W1YA 3VM7A 1CGXA 3LGEA 1UKPA 3LTYA 3W6LA 3W7DA 4QROA 2HVOA 1HO4A 1OFRA 3LRKA 3UCDA 3WQ8A 4QS5A 3NQGA 1B30A 1EWDA 4CU8A 2AOSA 3NOYA 1P0BA 9CGTA 1YW1A 1MDLA 2QMKA 4FXRA 2FKPA 4PCTA 2Z4GA 4NILA 4OT7A 4E4FA 1VS1A 1G9HA 4QAWA 3QPYA 4JNZA 3WNKA 2GQ9A 4KF1A 4IFOA 3ARUA 2WKGA 3NPXA 5GNZA 2A6NA 2OT1A 1QJWA 2IXVA 1XIEA 4GPNA 4MLJA 4JEJA 1HP5A 2XHYA 5F2GA 3CZEA 1BTCA 3JR2A 4BHYA 1KGXA 4E8GA 1H4PA 2EPMX 3TA9A 3WJZA 3TE9A 2DIKA 1EEXA 2VELA 1TG7A 1OJXA 3U4AA 1BWKA 1TPDA 2GJPA 1FXPA 1V0KA 3AYTA 5FESA 3PR2A 2NT1A 4HA1A 3LZ3A 3EOEA 2CHNA 4CN4A 3NO1A 2YL6A 1F2JA 2ZVIA 4GK8A 4FI4A 2FH6A 3NURA 4FNRA 2ZZ5A 1EWEA 2D22A 4O1DA 4GZJA 4RK8A 3GNOA 2DZVA 3P81A 1JAEA 2ALDA 3VIOA 2TSYA 3IUIA 4JS3A 3P8IA 3W2NA 2GJNA 4PH6A 3GC5A 5FCZA 4HU3A 3LM3A 3AUJA 4RDZA 1VBRA 3WLQA 4HNLA 3K8LA 4GBDA 2BVYA 2E6AA 1EX1A 1PDYA 1PZ0A 2Q8ZA 3WMBA 3DBPA 2V81A 1H1NA 2A4AA 2OXNA 1BYAA 4U33A 3UESA 5EFFA 1GG1A 3QPEA 4TR9A 1R2TA 3VGEA 3I4EA 1G01A 1XYZA 1U2YA 3BG3A 4P7LA 1XLIA 4Q32A 1E1EA 1XGZA 5AECA 3STGA 2NX1A 2B31A 1H11A 3KVMA 1RXOB 3OQ8A 3UPMA 1ICPA 4JY9A 1E3XA 3VGHA 5LNWA 3HTWA 1HT6A 5KZDA 1JDAA 3RYSA 2A85A 3NZGA 5ABGA 1UA7A 1Z41A 5D33A 1SVDA 1GK8A 1AJZA 2FJUB 3THAA 2JALA 1KGWA 2HSAA 4OOUA 3TYUA 5CSUA 1HIZA 1J79A 1K77A 4LSBA 2ATMA 1L8PA 3VNMA 4UZUA 4Z17A 2ISVA 3V36A 3VNYA 4K1WA 3N9SA 3BOXA 3OIHA 4IPLA 4LAZA 1J01A 1E6QM 1MSSA 4MZ8A 4O17A 4GUHA 5AC8A 1WXYA 3N6JA 3A22A 4TTUA 4JCMA 4HBKA 2VR5A 2YB4A 3PTKA 4UR9A 3RGTA 5FI8A 1BHGA 3WNMA 2DVUA 3MVIA 5A8QA 4JTIA 3W1TA 3BOFA 1JD9A 1KTCA 1Q8JA 1X6NA 3QSRA 5C55A 3E2RA 3GBDA 1HJQA 4AD5A 3BZJA 3DKLA 2NSOA 2DUZA 3CL7A 4PL2A 4FLQA 5AVHA 3URBA 4J3VA 3N4EA 2I57A 3ANYA 2I1OA 2OZ0A 2CLIA 1HJVA 5JH1A 2XJ7A 3WJSA 4DQWA 3WQGA 3DHFA 4MPKA 3P93A 1OFQA 3UZ5A 1JAKA 1Q6OA 3ATYA 1P6CA 4HYVA 1YE6A 3V1PA 5KEZA 1FFRA 2QV5A 3PC0A 4H8UA 1TRDA 4WSJA 1LQ0A 1O6IA 3AOFA 5F2MA 1NWTA 1MUWA 1RR2A 3M0LA 2G95A 2D2GA 3DX5A 3FHQA 2YZ5A 3THDA 5DF0A 4JN7A 4V1YA 1RLDA 1X6UA 3BUVA 2DW6A 7REQA 4WX2A 4UTTA 1WA3A 3MU7A 3G1RA 1TUXA 4ZO8A 3WDIA 1X96A 3AXHA 2WAGA 1F05A 4Q8WA 2QAPA 3KBVA 5AYXA 3RG6A 5DFAA 4WK9A 2NUYA 5I79A 3GH7A 4WDXA 2W91A 3N3TA 3PWIA 3LHWA 1IR1A 1XLCA 1XX1A 1E43A 4JICA 4A4AA 1QPNA 4PMDA 2P8BA 4UFLA 4NAEA 5HNUA 1V3KA 2F6UA 1YXDA 5D9PA 2RDUA 1W3IA 3BL3A 2INZA 3UXKA 2PRHA 5CBBA 4JGDA 3NGFA 3LPFA 3NFUA 1LG2A 1V7AA 3KBNA 3LHYA 4O57A 5ABEA 3OW1A 4PUJA 4EOUA 4BF7A 4DI8A 4HU4A 3UCCA 1JYWA 5AC6A 4QITA 3C6CA 4GFIA 1OIFA 2G41A 3N73A 4LUJA 2BODX 3NQAA 3E02A 3LXBA 3NJ3A 3EOSA 3MO7A 1KRBC 4YYFA 3UZYA 1S3HA 2BXVA 5BU9A 4P7QA 1SU5A 3M16A 1JDCA 4NZFA 2XINA 2W5FA 1FCVA 3ZQ9A 1MXSA 4HTBA 3ALFA 4YVXA 3NQEA 3CHCA 3S6TA 2PTXA 4L64A 4ZFCA 1UWTA 4Y9OA 1E55A 3R8HA 4I9JA 1WBHA 2G3NA 1BEUA 3NL5A 1GTHA 5TD4A 1KV5A 2DUXA 5I5RA 1FXQA 4FEZA 4I9AA 2DT1A 3K4AA 1R86A 4J2PA 1PE1A 4F79A 3NCOA 4QXIA 3UP8A 1ZBCA 3FHAA 3EAUA 1EQPA 3K30A 3DOPA 1H7XA 3EX3A 3RAOA 3LN3A 3WEMA 5HNRA 4ZOAA 3QGKC 3VKAA 4EPEC 2NUXA 4LYRA 3WJXA 1WDPA 1UC5A 1RVKA 4I9MA 3E5BA 1GZ1A 2ESCA 2HCVA 4GZIA 4QISA 3B8DA 2OZ3A 4D8ZA 1TCMA 3MT1A 3BLIA 3TKFA 4XO6A 1UUQA 3B97A 3R89A 4J7RA 4FNUA 4XB3A 1KR1A 4HPXA 1BXCA 3CUFA 1FBAA 1VB9A 2WQDA 5BXRA 3A4JA 2ZWZA 1TKKA 5CH9A 2OTDA 3EWUA 3CUXA 2FZBA 3HM7A 3URNA 2VT0A 2CC0A 2EPKX 2HBXA 2PDGA 4ML4A 1FWGC 4DJEA 1ISZA 3CHFA 2G8ZA 4H8VA 4ILSA 3PJUA 3W83A 4X9SA 1KBIA 4I90A 4GD0A 5AZ1A 2NQ9A 1W8SA 4GC4A 3SM0A 4IOTA 2Z1KA 2YDRA 3QH2A 3GC2A 4QSHA 1U1JA 4WXYA 1F3EA 4DEFA 3V18A 2VZTA 4K8GA 2VRQA 4ZFMA 1N7KA 4JX6A 3ZSSA 4RV3A 3NL6A 1K8YA 5DCDA 3R8RA 1FUYA 3GZ3A 4IIDA 3T0DA 3L4YA 1TPFA 4LX4A 1R3SA 3EEZA 3KHDA 2QPUA 3VMOA 3UWUA 4AZCB 1P7TA 3QC3A 2FHFA 1Z8AA 2RUSA 4LNYA 4AWTA 3K8MA 4PYSA 5H1WA 4A6GA 1PTDA 2C79A 1XR2A 1HGYA 2Y8VA 3I6EA 3LCXA 3F5JA 3JUGA 2V2HA 2YX0A 3WZ0E 4Q4OA 5CKSA 2TODA 4N9CA 3VKBA 3VDBA 1A3HA 4KWWA 1H49A 2VQUA 1HF6A 2GDVA 1U1UA 4U31A 3MUAA 1KCXA 1Y65A 5G1MA 3HV8A 4AVFA 5FD0A 2R94A 4Q4RA 3W28A 1DTUA 5FEPA 2YBVA 4GUIA 2WWDA 5H8UA 3PZUA 4Y9PA 2RHGA 2DSKA 4AZGA 3LM7A 2Z2UA 4FPSA 4FX8A 4DXKA 5MF5A 1VJZA 1E73M 4AD2A 4MJZA 3DFHA 3L9CA 3GHRA 3ITOA 4LF2A 3CQJA 1PKMA 3RJXA 4IXHA 1EO5A 1UWIA 3OZPA 2XIQA 4E3TA 4ERAA 1E40A 3CB3A 4H83A 3SFKA 2PZNA 2Z7GA 4DWSC 3ERPA 3CBWA 1E9YB 3QQ1A 4CD5A 3FA5A 2YL5A 4S38A 3AS0A 3T08A 5H91A 3EDEA 1EXBA 1NSJA 3UJSA 2OO6A 4C1KA 4GUGA 4FNTA 1W5MA 4PL1A 4XAGA 3H8AA 1IHIA 1L2UA 5FKYA 3TMQA 1KFJA 1RQEA 3EMCA 2O9TA 3G1AA 1CEOA 4UQ9A 3UR8A 3BTNA 3ECQA 5I3GA 4JTUA 3L0GA 4FZIA 1Q6FA 3W7KA 2VCAA 4DUVA 3BLPX 1XCXA 1OG0A 4WCJA 1W0MA 2UBPC 3ZWTA 3QR0A 1GT8A 1MQQA 3GYCA 1Z9AA 1W1ZA 3BO9A 3LY0A 1WKDA 4BFAA 4JTAA 3D3FA 3P14A 4FNSA 3L2LA 3UY7A 4XBSA 1G6CA 3TV8A 1GOOA 1L9WA 4N2YA 4W5ZA 4G5DA 5A6AA 5IDIA 2WB5A 3WLSA 2XFYA 1PB0A 5EPDA 4PUMA 1PUDA 1H1ZA 4GZ7A 2OMAA 1H60A 1S46A 4AWSA 4LUYA 2ZX7A 3GXIA 5CEWA 2NLIA 4EAMA 2MUCA 5D38A 1KFCA 4XWUA 3IAQA 4MB5A 5LYRA 1LJYA 4MFDA 2VENA 4HA3A 1ZUAX 4HHMA 4FR6A 4POCA 3CT7A 3QV7A 4EX4A 5FF0A 1CB7B 1ZLPA 3F2CA 4PMOA 2V68A 4DIAA 4C5ZA 5HMEA 3QGVA 3EWBX 3IGXA 1UOZA 1YDNA 4GFSA 4WGHA 1ODUA 2QKFA 1XBYA 1L6WA 1EJVC 3WUBA 1X8FA 4QQUA 4Y90A 1JQVA 3GR8A 5CPSA 2YBTA 3N2BA 4IGHA 2NVCA 4HMDA 3KVLA 4NYUA 1IIGA 4KETA 1GONA 1QO5A 1R8LA 2C3ZA 2WYSA 1HGWA 5TQLA 1AZ2A 8CGTA 2BGQA 4JTCA 3PULA 3R0KA 1BKSA 1ZPTA 3OG3A 1RZMA 4AIEA 2B7OA 3RFAA 3BAWA 1ADDA 4UQEA 3LCIA 1RUSA 3IWPA 1XLHA 1XV8A 4DM1A 3JU2A 4DAIA 1PXGA 3POCA 1KO0A 2XN0A 3T0BA 2OX1A 1IEIA 1NFPA 3W1QA 3F03K 2FQIA 2CLOA 3S9IA 5CC3A 6REQA 1J0YA 3OBEA 4WEVX 4HA4A 1DIOA 5C2XA 3TYDA 3SECA 5D4YA 5DMMA 4DO5A 1W9BM 5KSWA 2ZRUA 3EX2A 4S3JA 4DY1A 3TCSA 2J27A 5AYYA 3GG7A 5ABFB 2X0SA 3BICA 3NZPA 5AYBA 5EBUA 6TIMA 2W92A 3VZZA 3K1DA 4O14A 3BV4A 1EPXA 4GO8A 1E71M 3KOXA 1OX6A 2EG7A 3QGAC 3UVAA 3E0IA 1LDCA 2ANUA 4JN8A 4C90A 3WQDA 3FKRA 5I00A 2DZSA 4GCXA 5BMWA 3RCNA 1OBAA 4J3ZA 5HANA 2G3IA 4XG1A 2P3ZA 3S5ZA 4J3SA 3E9AA 3NQ6A 3DG6A 1SR0A 1JCYA 4FF5A 3G6LA 5KMYA 3BAYA 4UNLA 2YCJA 4DBUA 4WZHA 4S3CA 1XIJA 3CU2A 2UY2A 1LT7A 1L6SA 3VIKA 1WCGA 3PNUA 2FTPA 1EYWA 5FF4A 5F2LA 4HN4A 4LYPA 2D0HA 2PDFA 3FYPA 1RY8A 1TTIA 3GNPA 2PMQA 1QATA 4FX6M 4U2ZA 1ZALA 2AKZA 1XDMA 2JEPA 1OINA 3A24A 3PNZA 1KQYA 3KOWA 3BAKA 4JTQA 4YWSA 3SDOA 4GJJA 4MB4A 3VD5A 1WUFA 4XVDA 3CMJA 4J27A 1XM3A 1LORA 2W63A 1WO2A 3SSZA 2CZDA 4UTTC 3PTDA 2XN1A 4DJDC 4WQ6A 2Y2WA 3MMWA 4WDWA 1B3XA 1VCGA 5GJNA 3U4FA 3QR1A 3H24A 4IFKB 1W1VA 4I6VA 3UW6A 2O9OA 2Y4SA 4ZE4A 2ZE3A 3MB9A 2WMIA 5I78A 4EIVA 3CPUA 3ZT7A 5CAKA 4Z2IA 2QS8A 3WH6A 1F6PA 2VX5A 2H90A 1VHNA 3KS5A 1Q7QA 2NX9A 1FRBA 3QW4B 5A5WA 5HQLA 3GNXA 1WZKA 4JTSA 4BKNA 3A4AA 1EUAA 5HATA 2ZC8A 4I5UA 3TQ0A 2HE8A 4CQ8A 2OEKA 4IG2B 3AO0A 1S1PA 3PG9A 4O4VA 2WK2A 5FIPA 4AH7A 3P80A 2QVNA 2YXXA 4Z42C 1ECEA 3ZVIA 3RILA 3ARXA 2VOMA 3M43A 5AB3A 2DSUA 1JYVA 4HKPA 2E77A 1TX2A 2CW6A 4PTVA 3NPWA 4ZO6A 1TJ2A 3RM9A 5G5IA 5LA0A 3VFLA 1PJ9A 4H7VA 4M24A 3W7MA 4QG8A 1LLZA 3WDJA 1CZ1A 3S2LA 1C91A 1YDVA 3UG5A 2J8TA 1UOKA 4AY8A 3G1SA 4MMWA 3SRKA 3GHSA 4JQ4A 4PTNA 2QCDB 3S9YA 1AODA 4IMEA 4N7QA 3V0SA 3QPZA 3NPUA 3MYPA 3P62A 4NXSA 1BSLA 4JHOA 1U1HA 3MCNA 1WNOA 2EBNA 1TWWA 3IVTA 4Q4MA 1J0IA