4YL2A

Aerococcus viridans l-lactate oxidase y191f mutant
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
367
structure length
367
Chain Sequence
YNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHATKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKGDGATAIILTADSTVSGNRDRDVKNKFVFPFGMPIVQRYLRGTAEGMSLNNIYGASKQKISPRDIEEIAAHSGLPVFVKGIQHPEDADMAIKAGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Speeding up the product release: a second-sphere contribution from Tyr191 to the reactivity of l-lactate oxidase revealed in crystallographic and kinetic studies of site-directed variants.
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
molecule keywords Lactate oxidase
total genus 139
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4yl2A00
3CHVA 1DV7A 5D2WA 4GUFA 1QCWA 3MP4A 3TV8A 3MW7A 5LKYA 2EHHA 2ALDA 3A5FA 4EOUA 6ALDA 2FJKA 2FIQA 3M16A 2UV8G 3TJXA 1OJXA 4GC4A 5EBUA 3P82A 4JTEA 2PRMA 5FF0A 4FEZA 1O60A 1G4SA 3DKJA 4UMCA 3L2IA 3M5XA 1DOSA 2Y88A 2CLIA 3BLFA 1SSGA 2ZZ3A 1LOSA 1WDWA 1KM2A 3W70A 2WNNA 2VFDA 3W87A 3KVKA 4AWUA 4A2RA 3PSVA 1H7NA 2V5LA 3N9RA 3Q2DA 3HOJA 4JEQA 4JTKA 5DCBA 1ME7A 2ZBTA 1OFPA 4PH6A 4OT7A 3BV4A 3DFTA 1FBAA 1GYLA 2RHGA 3P5YA 1JCXA 1GTHA 2WQPA 1K8XA 1R2TA 2E5CA 5EMUA 4O4VA 3NPXA 1FWNA 3FS2A 4ZQOA 4KFNA 1P5BA 3NQMA 3FIGA 3LTPA 1W56A 2DORA 2NUYA 4JY8A 4EVZA 3GDKA 1QPOA 2A21A 4MUZA 3QQ0A 1PS9A 1OFEA 3TFCA 2PRHA 3P67A 4N9CA 3BW2A 4AB4A 2AAMA 4O10A 5AC6A 2ZZ2A 5D02A 4MY1A 3DBPA 5F4SA 1KFLA 4JTTA 1H63A 2HTMA 3PBWA 2CLFA 3W7CA 1H1YA 4FNQA 3T40A 3P81A 4CNOA 5LNVA 5AB3A 1OK6A 4OE7A 5FESA 3SZ8A 3WJZA 4LVAA 1TPEA 4UTTC 4LU0A 3BLEA 2QCMA 1K02A 3MMTA 5C2XA 4K36A 3L65A 1RR2A 5D03A 2A4AA 4BI7A 1SO4A 1TQXA 1B3OA 3TU9A 3DH7A 1KFJA 4QNWA 3NQFA 3W07A 1DJNA 1EX5A 4Z08A 4K6AA 3NM1A 5BNKA 2YCEA 1LLZA 1LOLA 2F84A 3G1FA 2Y6ZA 4L4LA 3CPRA 1U5JA 5K7JA 3H53A 4GWEA 4M19A 5DXXA 2WSRA 4M6PA 1AL8A 4DF0A 4IJBA 4QAIA 1TPWA 3L0GA 3NL2A 1AW2A 2OMAA 3NA8A 3EXSA 3E49A 2BWGA 2P10A 2V0TA 3TC7A 4AHPA 3QYQA 4ZL1A 1AG1O 1JUKA 4M5PA 1XCFA 3HG3A 2WOQA 1R2SA 1KFEA 2VELA 4UXDA 2BTMA 3GXTA 1JQVA 4DELA 1ZHAA 4NJHA 4AHOA 1OFAA 2DU2A 1GOXA 4WJEA 3MBDA 3THAA 2FPVA 2P0OA 1GJPA 4JTUA 5D2VA 2QCFA 2TMDA 3EWWA 3MI3A 3R2GA 5E1QA 1J5TA 2ZZ4A 2VOMA 4GUHA 4DO4A 3LHYA 1DKWA 3EKZA 4IMGA 1TV5A 3LXCA 4PL2A 3TW6A 2CZDA 2BSLA 1EPXA 1GT8A 2TYSA 2C16A 3VNDA 1VC4A 4QQ3A 1V5XA 4BWLA 5TQLA 5G4EA 4I9AA 4NNCA 1FWTA 3ELFA 3LTYA 7TIMA 4JIQA 3EWZA 3TAOA 4MFDA 3S5ZA 4Y90A 2V2HA 3GXPA 3W7LA 3MP5A 3L66A 2I1OA 2NXHA 1SQ7A 3C2RA 3B06A 3E9AA 2VC6A 3NO5A 5AYYA 2E6DA 1W3IA 1SFJA 4MLRA 1ICPA 1H7RA 3IRDA 1H7WA 2BX7A 1VGAA 2W0UA 4H3DA 4O15A 3GYEA 4LC8A 2BZNA 3NQ8A 3FKRA 3TQVA 4LW7A 4RCXA 3HGRA 1HTIA 4UTHA 3G3MA 1FDJA 3CM4A 4E38A 1GTEA 3R89A 1WOAA 4N6EA 2D73A 4K37A 2OJPA 5BMXA 4I7WA 2ZZ1A 4NT0A 2JKAA 3BGJA 4LS0A 1QOPA 3LCWA 5CZSA 3DI0A 3O1NA 1TRDA 1YYAA 4OQVA 4O57A 3L68A 1GG0A 1OABA 1HL2A 2B7PA 4HSOA 1KA9F 3JRKA 1IXNA 3KVJA 4DQWA 5F2GA 3ZWTA 4DXVA 1K03A 1OX4B 1GYNA 3N2XA 3WJSA 3KAOA 1JR1A 2A1YA 1YDVA 3HG2A 3F1QA 1TTQA 2W6RA 3G22A 4WX2A 2Y70A 4MY8A 2O7SA 3OVPA 4IX2A 5F2IA 4DPPA 1KV5A 3PSWA 2CZ5A 3LBMA 2B7NA 2AGKA 2H6RA 3UWZA 1GEQA 3YPIA 3S42A 2ZTKA 3W7PA 3IVUA 1O95A 4EF9A 2QDHA 4PA8A 4IWWA 4RV8A 1TTIA 3SW6A 3R8RA 1SW7A 4YL2A 2J9ZA 3MJYA 2ZA3A 5I3GA 2Z0IA 3FLUA 3QMSA 2GQAA 3W73A 5AYXA 1TSIA 3BVJA 1DBTA 4JTIA 1M6JA 1YXYA 1HUVA 1SU5A 4LVDA 3TKFA 3CTLA 2B7QA 3GB6A 4ONVA 3CU2A 1DORA 4IUOA 3H55A 4U28A 2NV2A 1TPUA 2QAPA 4Z1CA 1ONRA 1X7FA 2Y7FA 3VE7A 2YYUA 3MUXA 3UD6A 1IF2A 2QCDA 5LSMA 4WY0A 3TSBA 3BK0A 2HS8A 1G7UA 4UC5A 3G1HA 3NOEA 2QAFA 3MYPA 1O5KA 2ABBA 2QCEA 1GVOA 3N14A 3DHFA 1LYXA 4J9JA 2YX0A 5L9FA 5EL1A 2J9YA 3LCXA 1LBLA 2J88A 3B04A 4MIMA 4YLWA 1MXSA 3LV5A 1WX0A 4BI5A 3GDMA 1PV8A 4ZQPA 3TNOA 4AF0B 1FX6A 4UTMA 3U2OA 1QPQA 1ZNNA 3P8JA 2CZFA 1OFOA 3LV6A 1LORA 1EUAA 3VI2A 3TX9A 1UCWA 3W6YA 3TAKA 1Q3NA 5CGQA 1ZAIA 1QAPA 1TPDA 3DU0A 5LZLA 1HFBA 4WXZA 4Y8FA 3T4CA 4DBDA 2Y7DA 4JNMA 3I7SA 4HT3A 3LHZA 3UWWA 2R91A 5SWUA 3M47A 4IPIA 4DBEA 4MYXA 3LCLA 1X1ZA 4ADSA 1L6YA 1N7KA 4XTDA 4GUJA 2IQTA 1VHCA 4CNPA 4NZFA 4JYFA 1F5ZA 1OX5A 3W85A 4LY8A 3STFA 3GNNA 4KFPA 1X6UA 4WOZA 4Z1BA 3OEXA 4QSHA 3RU6A 3LXAA 1EP2A 3G1XA 3IIVA 1YDOA 2A85A 1TPH1 2ZTJA 1I2QA 3I68A 2A6NA 2A6LA 3SR7A 2QF7A 1XBVA 4UTWA 4N4PA 4JDBA 4LNYA 1QPNA 2FDSA 1KLYA 3B0PA 1KM5A 2PCQA 5F1VA 1I45A 4P2VA 1OF8A 2ZZ5A 3DENA 1VYRA 2TPSA 4IOTA 4BWLC 2Z1BA 1HO1A 1CX9A 1G69A 1C9DA 1I2PA 4O1DA 3W7GA 3KRUA 4UTWC 4LOCA 3R13A 4Z0JA 1WBHA 3A23A 4GXMA 5LHEA 3W71A 2G97A 1H62A 3M7WA 1YXDA 3NEVA 3ABOA 3LCGA 3CLMA 3E02A 5E0KA 5EA9A 3NVTA 4G1KA 4OV9A 3EXTA 4RX0A 1O4UA 3QPYA 4GFSA 1YTKA 3QM3A 1ICSA 1TPC1 2XN1A 3G1VA 3IVSA 3UZJA 3W74A 3E0IA 2C15A 3QH2A 3N2MA 3TXZA 3IGSA 3LHVA 3KX6A 5HINA 3ANYA 4JTHA 3TMLA 1KFCA 3NL6A 3NXFA 1G4TA 3A22A 4PCFA 3AO0A 1KTNA 3NQ7A 5D33A 5LNSA 4MFEA 3W7RA 3MP3A 4O4WA 2C1HA 3FJLA 2VKZG 3P8IA 4BF9A 1S5TA 1TQJA 4K8EA 3DAQA 1F6PA 1QPRA 2NX9A 4IPJA 3TSMA 2A7RA 4N9BA 2DZUA 1L2UA 3T55A 3PR2A 2X1SA 2A5HA 2E5BA 3NL5A 3LB0A 3NG3A 2CLMA 1GVRA 2X2GA 4S2BA 4TMCA 4QIUA 3LRLA 5AYZA 3OHIA 4MLJA 3BLIA 4TIMA 2QR6A 3PG8A 1KLZA 3JR2A 1PCKA 5AHEA 1A5AA 3OVRA 1GWJA 1EA0A 3NQGA 3M6YA 4ZQMA 2NUXA 1FWRA 1AW1A 4Y9AA 3O6YX 4IMCA 3ATYA 4GUIA 3TH6A 2FB2A 3G8RA 2XFWA 3A21A 1Q6RA 4DPQA 4XKYA 3GKFA 2R8WA 5FF3A 4BI6A 3NPWA 2ZRXA 2E77A 2RH9A 3FYOA 4AWSA 1VJIA 5K2ZA 1QWGA 4M6VA 1TMHA 1UASA 4HNVA 3NPUA 2V8ZA 1RZMA 3QFEA 3FFSA 1TJPA 3LTSA 2ZA1A 1F73A 3NQ6A 3M43A 1T96A 4IMEA 5BOOA 1TTJA 1SUXA 3RMJA 4O8RA 1W31A 4NJJA 5DBTA 2YPIA 3NM3A 1IIHA 1JCMP 3L5MA 3OVQA 3P7YA 3P5ZA 4N9DA 4KWWA 1VYPX 3L5LA 5ABTA 2G5WA 4LC6A 3S1UA 5K4XA 2YR1A 3A24A 2ISWA 1T8XA 2WKJA 4X22A 1FWWA 1SW0A 3S1VA 5LGZA 4FX7A 1KW1A 1A5BA 1FCUA 1EWDA 4JTSA 1S3HA 1ME9A 1XBXA 2C19A 2AQWA 4UFHA 4LRSA 3W1PA 3NQAA 3W86A 1W37A 1JULA 4RR4A 1W5PA 4HNNA 3KXQA 3O06A 1WBJA 5A8GA 5KITA 4O0KA 3UWYA 2ZZ7A 5LGXA 3LRKA 1ZJIA 1BWKA 4A3UA 1XXXA 2CU0A 4N2YA 4UUIA 4O1BA 5T26A 1WOBA 3W1AA 5KZEA 2YYTA 3VE9A 4RZ5A 2OT1A 2DZSA 5D09A 4UR8A 2GVGA 1ZAHA 4H4IA 3QJAA 3W72A 2V2DA 3O8AA 4RZ6A 3SECA 3KRSA 2C0AA 4NVTA 3TJLA 3N34A 3NGJA 1FXQA 1JQXA 3QSRA 3T44A 4ORMA 1K8YA 2NZLA 3LHTA 2Z6JA 1KFBA 1BKSA 2DZPA 1XKYA 3EX3A 3R12A 1TPFA 1R47A 2RDTA 4ZMGA 3HO8A 2A2IA 3I65A 3QEZA 3UZ5A 5D37A 3ZR4A 3EX6A 2Y62A 3L0KA 1GVSA 4ML9A 5J5RA 4NXSA 2H90A 1DQWA 1A5CA 4M6QA 3BGGA 3M1ZA 1SZFA 3BG3A 2C6QA 1W3NA 3MWAA 2BXVA 4AMAA 2JGYA 4ZVJA 1IGSA 4NNAA 3UWQA 1W0MA 4NNBA 3TXVA 2QDGA 1GPWA 1MO0A 3BG5A 4QNEA 5LHFA 1YLVA 3W7KA 2E68A 4WUIA 5D2TA 1P4CA 4CLMA 2ZZ6A 5L6UA 3FKKA 4DO5A 3DXIA 1JUEA 2ATSA 1NSJA 2VFEA 4Y96A 3HG4A 4R34A 4CCCA 2NUWA 2ZA2A 2C13A 2QJHA 2HS6A 4XWUA 3KHJA 4WXYA 1Q6QA 5EPDA 3TFXA 2FPYA 2CLOA 4OV4A 4RKAA 1ICQA 2ZCGA 4PC8A 4E2DA 3BPWA 1TPB1 1K3UA 4JD4A 4O16A 4MOZA 4UFLA 3PUEA 3RK8A 3RLUA 3W1MA 1IXQA 1NF7A 3OIXA 4O11A 3F4NA 3W1TA 4ORIA 3TROA 3G3DA 4LS2A 4HNTA 2JBMA 2NX1A 5H2ZA 2OZ0A 5KZMA 1OFRA 1NF0A 1Y0EA 2FTPA 4IMFA 3MHFA 1LRQA 3GAYA 1BEUA 4E2BA 3SGZA 3IIOA 1ALDA 3B8DA 4AVFA 4NJKA 2GVJA 1YDNA 3HGSA 5AHLA 4A29A 1EUNA 5BW6A 2CLKA 4O0ZA 1OFQA 3LHUA 1W1ZA 5G5IA 1RVGA 5AHMA 3PS7A 2VFHA 3W9ZA 2QCCA 4MVAA 1PHWA 4ADUA 3MHUA 4HNUA 2PURA 1XFBA 5D05A 4OHQA 5LNWA 3QF0A 3GZ3A 3FOKA 1KM1A 3W7EA 2WSQA 4P61A 2ZYFA 4RXFA 4ALDA 2HMCA 4LS1A 1OYCA 5C55A 3UNDA 3S8HA 2CWNA 5I3KA 3V75A 2ZRYA 5I3HA 5DY2A 4N02A 1OX4A 1TV7A 2Y63A 2A0NA 4NJIA 1L6WA 2V5BA 3I6RA 3C2EA 3LDVA 3LCFA 4JTJA 1LBFA 4XKYB 1XBYA 1LBMA 4O13A 3W88A 2B0MA 2JKEA 1SPQA 1G6CA 3EEGA 4FNTA 1ADOA 1KTBA 2VEIA 1I2OA 4FNRA 1T0OA 4R7JA 5CSSA 4AH7A 3E12A 1SSDA 4FNUA 5G2IA 3HBLA 2G95A 4NZJA 1TRIA 3WK2A 4KWVA 3THQA 1VCGA 1LRTA 1M7OA 1EP3A 1GQNA 3OBKA 3QW3A 3W2LA 4YCOA 2EPHA 1KM0A 5D32A 4HPJA 2WNQA 1IIGA 1THFD 2WO5A 3G0XA 2EF9A 3TMQA 3W7DA 1KBIA 3PG9A 3DFOA 5FI8A 2V82A 3TC6A 3UWVA 2ZQ0A 3Q58A 1XDLA 1JUBA 3GNDA 5D04C 3W1NA 4LUIA 1W5MA 3PVFA 1VQTA 1SR9A 2CW6A 3EWBX 4OWGA 3OG3A 4NQ1A 4A22A 3L5AA 1J4EA 4TMBA 2VFGA 2VENA 1W8SA 3Q94A 5HQEA 5C54A 3PM6A 2PC4A 2X1RA 3NAVA 1AMKA 1WYIA 2DJLA 1RPXA 1W54A 1HG3A 4CQAA 4UNKA 1YADA 4TU1A 5AC8A 4XBSA 3ZS4A 5DN1A 2GJNA 2RDUA 4XBKA 2F7FA 1UB3A 1XC4A 3GDTA 1QO2A 3SI9A 3N9SA 5DLCA 4PEKA 1QR7A 3QMRA 3IIZA 1LDCA 1R30A 3LBCA 3STGA 5D2YA 4JTGA 3LRMA 5I3IA 3C6CA 1L9WA 3IGXA 3PBYA 3MI2A 4UTUA 3UXDA 5H91A 1EEPA 4I7UA 4MY9A 4C1LA 2Q8ZA 6TIMA 4RLIA 1OYBA 1TB3A 3TK7A 3DHDA 1H5YA 4CNNA 3W1XA 3IV3A 4UFJA 4GUGA 3IIXA 4JX5A 1XDMA 4ZZ9A 4O17A 1SO5A 3LI0A 3HPXA 4RZ4A 1AL7A 1BWLA 2QJIA 3QQ1A 4IXHA 3W1RA 1YXCA 5C6MA 3PULA 1H51A 1M7PA 1DQXA 3TA6A 3W2MA 1XM3A 3TDFA 2WJZA 1P0NA 5KINA 1SW3A 4TO8A 1JJKA 3NZRA 1LROA 4M7SA 4Y6GA 3MBFA 5G1YA 8TIMA 1D9EA 5HWNA 1H7XA 1RQHA 3UQNA 4Z1AA 4Q4KA 4UTKA 2FB3A 5D2XA 3WK1A 3CT7A 3U8GA 3BW3A 4OBTA 3I7QA 4QISA 3MI6A 5HMSA 3LCHA 2CZEA 2P1FA 2GJLA 1JCYA 1QNVA 2OX1A 1XI3A 5F2LA 4GE8A 3KVMA 1VZWA 3SFKA 5DCDA 4RJEA 2B4GA 2YFOA 4HPXA 5CZJA 2ZRZA 5DELA 4JX6A 5CZTA 3FA5A 3GK0A 4HHPA 3ZFHA 3IGUA 1OK4A 1OHLA 3O15A 4NU7A 5AFDA 1L6SA 4LRTA 5HWJA 4FIRA 1KM3A 1YTDA 1G67A 5I3JA 2ZRVA 1G7VA 2C18A 5E93A 3PF3A 3N3MA 1I2RA 4AF0A 1OX6A 2H3DA 5FF2A 2QUUA 4CCDA 1F05A 4MZYA 1MSSA 1W3TA 1DL3A 1VYSX 1TREA 3PB2A 1RD5A 2V9DA 2NWRA 3HB9A 1UJPA 2FPTA 2E6FA 4GNJA 4D2JA 3NPVA 1CI1A 1NAL1 3LXBA 5D30A 3SY5A 3GDLA 4N9EA 4LVGA 4BR1A 1P0KA 4ICNA 3G24A 3G0SA 1X1OA 3CB8A 1TO3A 3RF9A 1U83A 1PHQA 1SZGA 1XBZA 3EX4A 3EWUA 3MHGA 5KTLA 3GLCA 4ZQRA 3TW7A 3F4WA 4IXXA 3FYPA 2ATMA 4Q33A 4FX8A 2DZWA 3W7NA 1GVQA 5HR6A 1ZY9A 1FY6A 5LNRA 2ZRUA 4WY0F 3PY2A 1VCVA 3MO7A 3M41A 2A7NA 3W22A 1F2JA 2NXIA 3S5YA 3QRHA 1VLWA 1F74A 5HUPA 2NXGA 3C2OA 3L21A 3PBUA 2Y7GA 4TX9A 1DHPA 4K39A 3EWXA 3HGJA 4UFMA 3W3OA 4E0CA 5A5WA 2YFNA 3C2FA 1N8FA 1CW2A 1FDYA 5HUOA 3C8FA 4EF8A 3W2NA 1VCFA 4X2RA 4IQLA 3A5VA 3C0JA 2ZDRA 4GRSA 2J24A 1JCNA 2O7QA 4BK9A 5KZDA 4WQ6A 5G4WA 2TRSA 3G8EA 2QKFA 3W7QA 4LWWA 1TYGA 4OGZA 3EKLA 4XZ9A 1S5WA 3PUOA 4BFAA 3KVLA 5CZ0A 1FQ0A 4UMAA 1D3HA 3CWNA 5CKSA 3W84A 4FNSA 4O52A 5TIMA 4Z0SA 1SFLA 3GX9A 3B03A 2VEKA 1K7XA 3INPA 1TPVA 3L0NA 3B0UX 3G1SA 3W2KA 4LVBA 5CG7A 1PE1A 4Q32A 3EWYA 3LOTA 5IM51 1LTDA 1TV8A 4GJ1A 3W1LA 5GVJA 3WJXA 1W5OA 4K8HA 1HO4A 1LP6A 3ABQA 2HSAA 3NZ1A 4ZQCA 1FCBA 4W9TA 3IIPA 4EWND 2ABAA 4O53A 4QITA 3G0UA 4UFIA 3K30A 3HG5A 4R33A 3O16A 4PL1A 1UUOA 1NFBA 3JS3A 3W83A 2YDAA 1Q6LA 1ZCOA 1RV8A 3W76A 3WK3A 4EIVA 3PAJA 3LLDA 1S5VA 4FX6M 2GOUA 4UTIA 2H8XA 3LX9A 4FXRA 3SJ3A 3EB2A 3S6DA 1YTEA 1WXJA 2W79A 4TR9A 1Z41A 3HPZA 3PB0A 3RFAA 3IVTA 4MZ1A 2GQ9A 3N19B 1PIIA 4RXGA 1H1ZA 1RQBA 5BMWA 1G4EA 3FJ6A 5HNRA 1UBSA 3VCRA 1OF6A 4UCGA 2GUUA 1OVDA 3HGOA 2CLEA 5DY3A 3UPBA 3O05A 2C14A 5HJLA 4O1AA 4UTLA 4CCEA 4JICA 3DKLA 4LTSA 2J27A 2E09A 3S5OA 1OFBA 3NL3A 1QOQA 2GPTA 1MEWA 2I9EA 5BRBA 1C8VA 1DJQA 1EP1A 1KM4A 3OA3A 4MJZA 3TIMA 1A50A 5EYWA 2V2CA 4UTJA 3P62A 1VS1A 4K38A 1NVMA 3N73A 3CIWA 3R5EA 1TCDA 2Y7EA 1Z48A 3H54A 5DCEA 1XL9A 3NYZA 5EY5A 3P74A 1M5WA 3LHWA 4JN6A 1VPXA 2JK2A 1KV8A 4LV9A 1WV2A 5CPMA 1E51A 3BW4A 4O12A 3USBA 2QCDB 3HMJG 5F2MA 3ZWSA 1VLIA 2PE4A 3STEA 4HKPA 2NX3A 1PL9A 2ISVA 5HR7A 4C1KA 1FUYA 3TUUA 5C5YA 4IX0A 4FHAA 2NLIA 3NR0A 3ATZA 4AXKA 2BLEA 2GVLA 4PFMA 4O1CA 5DBUA 5KMYA 3UYCA 1JCLA 2CFFA 1WQ5A 3RNDA 2ZRWA 4XQ6A 3MYOA 5HULA 3QZEA 1QMLA 5DXYA 3UY7A 3NQEA 2E6YA 3KFTA 5I3FA 1XUZA 1OYAA 3W7JA 4YCPA 1F7BA 2EGZA 3O63A 3EXRA 1R2RA 3G1AA 1SZNA 1MEIA 4PODA 1F76A 2TSYA 1FCVA 5F4XA 1KFKA 3CEPA 3L9CA 1A53A 5FEPA 4O19A 2WV8A 4H6KA 3SIZA 1YPIA 1MEHA 5G2WA 2Q3OA 3I7RA 3RLVA 3C56A 1QDSA 2WPBA 2XN0A 3EX2A 4FXSA 3G1DA 2FFCA 3W1QA 1F6KA 1ZALA 3M5ZA 2FLIA 1DVJA 3DFSA 2X30A 1G4PA 1B4EA 1IXOA 3NDOA 4HN4A 4O50A 4LT9A 1LRNA 1JCJA 4O54A 5KSWA 3DI1A 2GQ8A 2JGQA 4NJGA 4ADTA 1VH7A 3W7MA 4MPQA 3GXNA 2E6AA 1GG1A 1ML1A 3HF3A 1KM6A 1C29A 2YSWA 1LLWA 1EB3A 1FXPA 3NQCA 4Z1DA 4ZQNA 5TBOA 1RQEA 3B0VC 3M5YA 3M5VA 4CQ9A 1LZOA 3TQKA 3UWUA 1ZAJA 3TCEA 1ZFJA 3CEUA 3BO9A 4WY0B 5LNUA 5AOUA 2VFIA 3EX1A 1PCWA 3GR8A 4JYEA 2OT0A 3UPWA 2J9XA 5MHBA 1W5QA 3P61A 5D38A 5K4ZA 4K7YA 3KOFA 4AHQA 3S0CA 2WNZA 3P84A 4JTLA 3DFQA 2E1DA 3CIXA 2X1UA 1B4KA 1N55A 3LGEA 4JYDA 2DZTA 1LOQA 4I7VA 4S2CA 4JXCA 4UFKA 1MZHA 2VFFA 3T7VA 1B9BA 5U4NA 4WZHA 3P80A 5FEZA 2Y89A 4NUWA 4JS3A 3NQVA 4JR5A 4NX5A 2DZVA 3NNTA 3UXAA 1H7PA 4UR7A 1PVNA 4DEFA 2H8ZA 3C4UA 1D3GA 2Z2UA 4PTNA 3DFNA 5EKYA 5F1UA 1J2WA 2E5DA 3PWAA 5AHFA 2FQIA 1GVFA 4NXKA 1SO6A 4L4MA 1FWSA 4N4QA 4GBUA 3B4UA 3M44A 4RK8A 2A7PA 3QSTA 3G18A 4OU1A 3SSJA 4AEOA 2Q3RA 3NQ2A 1P1XA 3L67A 4UIOA 3WJWA 3DFPA 4FO4A 3ABSA 2G96A 1GZGA 2JKPA 4MJMA 2PRLA 4FIQA 4DF1A 3B05A 1AK5A 4A21A 4FB7A 3QMTA 4JX4A 3IEBA 1T99A 3SGUA 1AW5A 3S9YA 3TQ0A 1TTPA 2J6XA 3S1XA 3W2UA 4O18A 3VKJA 3W7IA 3Q37A 1VRDA 3C61A 1Z42A 3G1YA 5AHIA 3GR7A 2CLLA 5AHNA 3W1UA 3GDRA 1JVNA 1O94A 2EKCA 2YW4A 2YXGA 1JRCA 5IBXA 2Z6IA 3C52A 3FEMA 1VR6A 3WFAA 5G1TA 2XN2A 3GAKA 3QW4B 1NEYA 5CPLA 2ZFAA 4UMBA 1H61A 4X3ZA 4S1FA 4AAJA 4WOQA 5F4WA 1K8ZA 3C2VA 2VEPA 3HPSA 1B57A 2Y61A 2YGYA 2C3ZA 2NV1A 1W5NA 4JGDA 1OG0A 3S1WA 3BARA 4YXGA 1WA3A 4POCA 3NQDA 1SZEA 1UUMA 4N6FA 4XTIA 2QUVA 4U4MA 1ZENA 3STCA 4LUJA 3GVGA 2QJGA 4JY9A 3HQ1A 2QUTA 4CQ8A 1Z44A 3C3NA 2X16A 2V30A 4MYAA 1Q45A 2DJXA 3O07A 3BG9A 1BTMA 4JIPA 3TSDA 3WK0A 3UY8A 3LCIA 1V7YA 4LVFA 2LLEA 2QCLA 4KKXA 3W7OA 4JDYA 4NX0A 5HWMA 2B7OA 2OCZA 4O28A 4MZ8A 5J5DA 2X1TA 4UTTA 5K9DA 3PUDA 3T78A 4X9SA 1TJRA 3HJZA 3QC3A 3AJXA 1I8JA 3F03K 3PBVA 4FNPA 1KBJA 1WAUA 5FEWA 1FDZA 3ABRA 2YZRA 5K3VA 4QJ1A 1O5XA 3CQ0A 4KFOA 1I4NA 1EIXA 2VXNA 3PC0A 1EWEA 1QFEA 3CC1A 3WJYA 2RDWA 1R46A 4JTFA 4XUGA 3O6DA 1XUUA 2R94A 1TIMA 3GKAA 3KRZA 3QPZA 3O6CA 4HIBA 5IBXC 1OFDA 4YWIA 3W7HA 1A5SA 5FF4A 2DZXA 4HSNA 3LM7A 5FF7A 2QCNA 4YMZA 1LM1A 4WD0A 5G2HA 2H3BA 1K7FA 4UNLA 3A9IA 2V81A 2VEMA 2Q8LA 3LLFA 3CWOX 3W75A 3S5NA 5CPOA 3W2JA 3LERA 1QO5A 1ME8A 4M7TA 4K7VA 5K9XA 1H50A 4DO6A 4LV4A 2I14A 2R14A 2QEZA 4O14A 2RFGA 5CPNA 3TR2A 1KTCA 3V1PA 4MKNA 3P60A 3M0ZA 4QM1A 4AWTA 2YW3A 3W23A 2QCGA 2KZHA 2WSYA 3DGRA 2RKXA 1H60A 5FEXA 1JRBA 5AN7A 1Q6OA 2QCHA 3DZ1A 3U6WA 3HIJA 1I2NA 2Y85A 5CSRA 2EAWA 1IXPA 2DP3A 2NWSA 2CLHA 3E96A 3GIYA 4A2SA 4IMDA 4B5NA 1LCOA 1X8FA 5AC7A 1H7OA 4DF2A 3LI1A 4R53A 3TE9A 1FCQA 1VHNA 3M9YA 5U7SA 2ISSA 1K7EA 1YPFA 3VFLA 5K9CA 1SO3A 3D0CA 4IGHA 4FF7A
chains in the Genus database with same CATH superfamily
4L9XA 3MP4A 3MW7A 1L6FA 2C1IA 2WVVA 1XIBA 3M16A 2DVXA 5EBUA 1IWBA 1I6NA 3ID7A 1PJ9A 2PRMA 4FEZA 1E4NA 4BQ3A 1G4SA 5A95A 1QATA 2VJXA 3M5XA 5FOOA 1DOSA 2GYIA 1SSGA 4LANA 3KVKA 3WIJA 4DLFA 3CZGA 2XG9A 4KCVA 5PTDA 2OYLA 5DCBA 1M53A 3BV4A 2FGZA 2HISA 2XUCA 3P5YA 1JCXA 2UZ9A 4DWDA 4I9JA 4ROPA 4NIRA 1R2TA 3QPEA 5EMUA 2OG9A 3FS2A 3N17A 4AD0A 3C0QA 3FVMA 3RITA 2WCSA 2Q71A 3KTSA 2XH0A 4I6VA 1XYBA 4FLRA 3GDKA 1XQLA 4S3EA 4MUZA 2QS8A 2EXOA 2WBKA 4YTSA 4FLQA 3AZRA 4YHEA 4GZ7A 1E3XA 3P67A 4N9CA 3HMCA 5CG0A 2ZZ2A 1UZHA 1MFUA 5EB8A 1RP9A 3E2QA 3QBUA 3PPCA 2WKLA 1MNZA 3VMOA 5I79A 1FA2A 4F3HA 4CNOA 2DSUA 4OE7A 5FESA 1MVYA 1TPEA 1QJWA 1C3FA 1C91A 3MMTA 2BFGA 4H9VA 4IPLA 3WQ8A 3L65A 4MNJA 1RR2A 3OU8A 1W8GA 1PYMA 1B3OA 3TR9A 4JTCA 4OBRA 1XGDA 3NM1A 5BNKA 3CHEA 3WDHA 3EA1A 3NJ3A 3ZSTA 2UY2A 5K7JA 3OGRA 4GWEA 4M19A 3N18A 4ZEPA 1TPWA 3CMFA 2OMAA 3EXSA 1J93A 3TC7A 3KBSA 4UOJA 3H4GA 3HG3A 2WOQA 2CC0A 1DPMA 3SGGA 7ENLA 2Y5EA 2VR2A 4AZ5A 1GOXA 3CUHA 2P0OA 1GOQA 1P0EA 2VC5A 1QHOA 5DANA 2OODA 4LEQA 3WH6A 1H2JA 3N11A 4GUHA 3LHYA 1DKWA 4QEHA 1V51A 2E67A 4W93A 4EE9A 4C1NB 1E1CA 3TW6A 1W3KA 2CZDA 3UETA 1EPXA 4N0RA 1GT8A 3STPA 4XAPA 2F61A 1B1YA 4GD0A 1UP0A 4GQRA 2OELA 1X8CA 4IMAA 4Q7NA 5TQLA 4EAMA 3S2CA 4HMDA 1FWTA 1OD8A 7TIMA 1HGYA 4JIQA 3PHAA 2QPXA 3S5ZA 1Y7VA 3IWPA 3VKBA 4A3RA 1NDZA 4DY1A 4Q4PA 2I1OA 2YDQA 3B0XA 3RO8A 4H2CA 2VC6A 2ZUMA 3NO5A 3OGSA 1W3IA 4MLRA 1BLIA 1OC5A 3IRSA 5DMLA 3DG3A 3QHMA 4GIYA 3UXLA 2W0UA 4H3DA 4O15A 2PDPA 5IHRA 3OO2A 2XYLA 3BSHA 3FKRA 5EGRA 3KCOA 1NOWA 3NUKA 3SDOA 4CN1A 1FDJA 2R24A 3UNTA 3CS2A 4E38A 5DF0A 1DWFM 1FVPA 2DZBA 4XSMA 4Z2KA 1K6AA 4N6EA 5BMXA 4WK9A 4JFWA 1CB2A 4EXQA 1W17A 3L4XA 1DIKA 1QOPA 4BF5A 1O1ZA 1KRBC 3BC9A 3AAMA 3WMSA 4XD3A 4OFCA 3U9IA 4B5VA 2B7PA 2ZXDA 2Y5SA 2XFYA 3QGAC 4DJED 1EJUC 4DQWA 3ZWTA 1OX4B 1GYNA 1S5MA 1J01A 4YJ5A 2A1YA 1X6LA 3WBWA 4D9PA 3HG2A 1ITCA 3G22A 2AAAA 2V38A 2XIBA 5F2IA 4DPPA 2CZ5A 3P0WA 1C7TA 3S42A 1E56A 2ZTKA 1XYMA 3IVUA 1XKJA 4DJEC 2OEJA 4RV8A 1TTIA 3SCRA 1W9XA 4UZUA 2ZA3A 1CPUA 3FLUA 1SJDA 2DSWA 2CBJA 5AYXA 3THCA 2KAUC 2XHYA 1A5MC 4HU4A 4L6HA 1E0XA 2ZWZA 5H6HA 4LFYA 3RGTA 4I5XA 4ONVA 4IUOA 4B9ZA 3V0TA 2FDMA 3H55A 1TPUA 2QAPA 4Z1CA 3BLDA 2Y7FA 2VX4A 1N2VA 3T1GA 4PSPA 3SN1A 1JCTA 3KBWA 1GOMA 3KZPA 1FFRA 1XF0A 1S2TA 3CQKA 4UC5A 2BBFA 4XISA 1O5KA 4JTAA 2QCEA 1GVOA 4QJ3B 5EL1A 7XIMA 1WP6A 2YCKX 3B04A 1R8LA 1KFWA 1Q7MA 5I24A 1XINA 1H5VA 4IP5A 1PV8A 4ZQPA 3TNOA 1QW9A 4KRUA 4AF0B 4UTMA 1OD0A 1EQPA 3P8JA 1T41A 4JL2A 1E4MM 1Q63A 3LV6A 3VI2A 1DXIA 2QPUA 3DU0A 1A47A 1HFBA 4WXZA 2L5HA 3M7SA 1O5QA 4ZENA 4DBEA 4MYXA 3WNMA 1X1ZA 4WLCA 4ADSA 6PTDA 2X09A 3TJIA 4JYFA 3STFA 3NVDA 4Z1BA 1FWAC 3WNNA 2I5GA 3WLOA 3LXAA 3PFMA 4Z42C 3IIVA 2A85A 1I2QA 3EOEA 1HZYA 4H7VA 3UJSA 1EYWA 4XO6A 4LNYA 5AC5A 3GUGA 3B0PA 4MAZA 2PCQA 1I45A 1RPKA 2ZWYA 1NWSA 4Q4MA 2R1KA 4IOTA 3IUIA 1BPLB 1C9DA 4L1GA 1E1FA 3MB9A 3KRUA 1W1B1 4LOCA 3R13A 2PFHA 2O55A 2G97A 1H62A 1E9ZB 2Z1XA 3H6OA 4J4KA 3CLMA 5EA9A 4G1KA 1VFMA 3KWXA 4OV9A 5CSYA 4PCNA 3WLTA 3AWOA 1KCLA 1ICSA 1TPC1 3G1VA 3JZEA 1UYQA 5T8GA 1QI5A 5LXXA 3QH2A 2VZVA 1DIEA 3N2MA 3CNYA 2FZ8A 3BJTA 7ODCA 2WWDA 4PMQA 3TMLA 1KFCA 3NL6A 4PCFA 3TCSA 2XINA 3Q67A 2PDFA 2VD8A 2RJHA 5BYWA 3W7RA 2VKZG 1JFHA 3P8IA 1GEHA 5A6BA 5A6BD 4HNCA 4K8EA 3DAQA 1F6PA 1SFTA 2NX9A 2A7RA 2GGHA 2C8NA 3RDKA 1TWSA 4Q8PA 4Q7IA 2X1SA 1W3JA 4FR1A 2VCAA 4L1XA 2HXUA 4HZ6A 4S2BA 3I6EA 3ONCA 1AD4A 4QIUA 5BXSA 5G1MA 5AYZA 4LQ1A 2VD9A 3PG8A 3U7BA 5HMDA 3IUHA 4RNHA 5CAKA 2C71A 2I16A 3O6YX 3TH6A 2FB2A 4I6KA 3W00A 1B3ZA 2PA6A 2RJGA 2VQUA 3EA2A 4QDMA 3SUUA 2OZ3A 2QV5A 4MWAA 5CPQA 1R3VA 4C6MA 2ZRXA 4Y9OA 4M56A 4PYSA 2Z29A 4C6BA 1P6WA 1VJIA 5K2ZA 1WDQA 4M6VA 2P76A 2E4TA 3UJ2A 4HNVA 4JQ2A 1P43A 2V8ZA 1RZMA 3SY1A 3QFEA 1TJPA 4PUKA 3LTSA 1F73A 4IIDA 1JPMA 4R9XA 4IMEA 1YNYA 3RXZA 5AVNA 3FW6A 4O8RA 2F2KA 5LYRA 2VM8A 1E3ZA 4AIEA 2C91A 2G5WA 5K4XA 2HK0A 3A24A 3W82A 1IWAA 1PO9A 2WKJA 4X22A 3S1VA 1VEMA 4PULA 4FX7A 1KW1A 1S3HA 1ME9A 1XBXA 2WPGA 4PBEA 3W1PA 3I3DA 1RHCA 4GQGA 1UPMB 1JULA 1UQYA 2NSOA 4HNNA 4CCZA 3O06A 4G7EA 4QHRA 1BQGA 3EB3A 3LRKA 4A3UA 4TVDA 1UP3A 1XXXA 4N2YA 4UUIA 5T26A 5KZEA 3VE9A 2DZSA 1TCMA 3AIQA 4H4IA 3AICA 2NW0A 1UR1A 1CENA 2V2DA 2I56A 3O8AA 3BUVA 1VENA 3QR3A 4NVTA 2XGZA 3FSUA 1FXQA 4ORMA 4PUWA 1PAMA 2NZLA 2Z6JA 5JH1A 4ATLA 1BKSA 5JBEA 1XKYA 1W9DM 3R12A 1TPFA 4A6GA 2A2IA 1EO5A 3QEZA 3GG8A 4TX8A 3L0KA 2Y62A 5J5RA 3UVAA 3VKKA 2H90A 4GVIA 3AMDA 4XBJA 3WUFA 4Q6JA 3VILA 1FH8A 3WBEA 4I9MA 4XX6A 2BXVA 2F2HA 4S3DA 4AMAA 1Z6KA 4EPDC 4HCHA 1XPGA 4HCDA 1W0MA 4NNBA 2ISDA 2QDGA 2WMIB 5LHFA 1I75A 4CLMA 3QOKA 2VC9A 3WO8A 4J3ZA 4JIEA 5L6UA 2OR2A 2ATSA 1JUEA 2VFEA 3HG4A 1AUSL 2GSHA 4C6JA 3E74A 1AD1A 4XWUA 1UWAA 3ARPA 4LYRA 1XR2A 5C9WA 4RKAA 3NWRA 2ACSA 4GKTA 2ZCGA 4CEXC 3A4WA 3MMWA 4UQDA 1L8PA 3RK8A 3W1MA 1IXQA 3T08A 3CV6A 3OIXA 2GJPA 2QNEA 2O4MA 2JBMA 2NX1A 3LQLA 3AIVA 1OCNA 1OM0A 2PWDA 3WFLA 2BXZA 3SCWA 1NF0A 2FTPA 1LRQA 1BEUA 4E2BA 4EAYA 2GVJA 3H21A 4MB3A 3VOHA 1VB9A 4HYWA 4XZLX 1J0IA 3ZJ7A 3PJUA 3SQLA 3ZMRA 5AHMA 2VFHA 3W9ZA 1OSEA 4MVAA 4HB7A 3VNYA 3MHUA 2P5NA 5F7UA 1P7TB 5D05A 1ISWA 4OHQA 3TTEA 4PCTA 3VAVA 3KDNA 5C9RA 4NP7A 2YA2A 3VGFA 1OB0A 2PZ0A 2DQXA 4LS1A 2DSZA 4UZSA 1EBHA 4FF5A 5DY2A 3APGA 4E3TA 1Q6GA 2Y63A 2JALA 2DGAA 4M6UA 4NJIA 4F2UA 1L6WA 2QJJA 5A1AA 1MUCA 4DYEA 1NIUA 1BVZA 2HV5A 4AZCB 1HKIA 3F5JA 1G6CA 4GYFA 3N25A 3H2AA 4UOQA 3LA4A 1SSDA 3UERA 2DQWA 2XU2A 5G2IA 4BKNA 2G95A 1TRIA 1POKA 3AMKA 1XS2A 3THQA 1LRTA 1GQNA 3W2LA 4YCOA 4H8NA 2EPHA 5JVLA 5D32A 5FJTA 1UR4A 3CHDA 1THFD 4A05A 3LBOA 3TMQA 3W7DA 5FCZA 3DFOA 5FI8A 1NQKA 1ZJAA 4LUSA 1M41A 3H2FA 1ISYA 2BGQA 1B31A 5A8QA 3Q58A 1XDLA 3W1NA 2OZ8A 3L5AA 2VENA 3CMGA 1W8SA 3NCOA 3PM6A 4E4UA 3NAVA 1U2YA 2Z7GA 1HG3A 3E0VA 4US5A 1NFGA 4G8TA 3FAXA 1E1CB 3CHFA 2Z7KA 3FDGA 1B3VA 1QI2A 3ZVIA 4XAFA 4REQA 2GJNA 2VUYA 3VDGA 4B16A 1P7TA 1UB3A 4DBUA 1XC4A 1V6XA 1I60A 3N9SA 3LNMA 3M64A 5T91A 3P6LA 3WF3A 3AXHA 3STGA 2AKZA 1BFNA 1L9WA 1CLXA 3IGXA 2GVYA 3WSUA 4UTUA 3SCPA 1YNPA 2P0IA 4AEEA 2XH2A 1U5VA 4RLIA 4C7DA 2G41A 2G3MA 2J79A 2WLZA 1H5YA 4URIA 4QR6A 5T9CE 2G0WA 3PPGA 4XIAA 3SY8A 1CLVA 2Z1KA 2B81A 4GUGA 3IIXA 4JX5A 4C6IA 2YB4A 3DIPA 1AL7A 6CGTA 1BWLA 2QJIA 4IXHA 4XG1A 1A80A 3W1RA 3URNA 1E55A 1CGWA 3BMVA 1P0NA 1SW3A 2WW5A 1JJKA 2POTA 1D9EA 1H7XA 4Q4KA 2XSXA 4BF7A 3BW3A 3HZ3A 1WDRA 3MZNA 3B8UA 3U57A 1X98A 5HMSA 2HVMA 2CZEA 3LCHA 1JCYA 2OX1A 3SCNA 1H09A 1XI3A 3ME3A 1H1NA 4HPXA 2ZRZA 4QQUA 5CZTA 1TMQA 2VMFA 3H8AA 3ZFHA 2ZUTA 4NRSA 3VIPA 4DHGA 4ECLA 3GIPA 3O15A 4NU7A 3CL7A 5AFDA 3H12A 2ZC8A 5G4HC 1YTDA 4KIRA 1YBQB 2ZRVA 1IEIA 4A3YA 1KR0A 3SRHA 3PF3A 4B4FA 2HK1A 3GU1A 5C71A 4KEVA 5MKGB 2QUUA 5GQBA 4CCDA 1I0BA 1E4LA 3N2TA 3HQPA 2BOFX 2JEQA 1W3TA 4YVVA 3PNZA 1DL3A 2EEXA 1VYSX 1R9XA 2V9DA 3URAA 1OIFA 4NSBA 1J10A 4GNJA 3NPVA 3GFYA 1CI1A 3BJSA 3WD2A 1UWSA 2VVNA 1VFTA 2E9BA 3QGVA 3SY5A 4N9EA 1VFSA 1UC5A 5DO8A 4OVXA 4ICNA 3DBNA 1V0MA 1X1OA 3CB8A 3RF9A 1SZGA 1XBZA 1Q8JA 1JG9A 2INFA 2Z28A 3E0LA 3F4WA 3N6JA 3KS6A 1MWOA 3LZ5A 4IXXA 3AXKA 5AY7A 1EO7A 2ATMA 5HR6A 4IIFA 3VIIA 1CIUA 4C6FA 5KETA 4NHVA 3W22A 4D6IA 4B15A 3WENA 3NZPA 3QRHA 3EOUA 5DT7A 1TA3B 1VPYA 3S5YA 4FA3A 2NXGA 4UOZA 3L21A 3PBUA 3NGFA 4P7RA 4QFUA 2X7VA 2YFNA 4IGMA 1VBRA 4DI8A 4EF8A 3C8FA 3W2NA 4X2RA 4IQLA 3E0WA 3U0HA 4QJ5B 3C0JA 4GRSA 2O7QA 2V5JA 1KRCC 3WBYA 3H2OA 5KZDA 4E5TA 3OG2A 1TYGA 1F4HA 2QF8A 1SZRA 3NOYA 4PMXA 1DXEA 3PUOA 3OW1A 1S46A 5CZ0A 1US0A 5CKSA 3CWNA 3FVDA 1Q7QA 4ASTA 1RJPA 1OG6A 4B90A 1K7XA 3INPA 1FHVA 3PZTA 4PMOA 2YKKA 4LVBA 3BAYA 2ZICA 3LOTA 5A3HA 5KZ6A 3EDKA 3NXLA 3ABQA 2QUMA 1NDWA 1QTWA 1O5RA 3NZ1A 2ONEA 4R88A 4ZQCA 4W9TA 3AXXA 1R9ZA 1ZZMA 3G0UA 1HKWA 4YVXA 1DJYA 3O16A 2NVCA 3GNXA 1G0CA 4GINA 2YDRA 3S6TA 3T09A 4H01A 4JQ1A 4EIVA 3PAJA 4FX6M 3VCNA 3CV7A 2NQ5A 4XAZA 3LX9A 3VIHA 8XIMA 2ZUVA 2DUXA 3RFAA 1ZUAX 5ABEA 2EPNA 1ECEA 4FLOA 5HNRA 1JPIA 1TVNA 1OF6A 2D0GA 2GUUA 4LUTA 3UWEA 1UA3A 5DY3A 3V7PA 3O05A 5HJLA 1CYGA 2FHBA 4CKQA 2PWUA 3DKLA 1IWPA 5AYBA 3AIBA 2J27A 4Z2LA 1OFBA 3MA8A 3NL3A 3BMXA 3SO7A 4RNIA 5BRBA 2XIOA 1XG3A 1EP1A 3CIVA 2Q01A 2EPLX 1KM4A 3ARRA 4M0XA 3QTPA 1RAKA 1KC7A 1A50A 4UTJA 4YVPA 1PX4A 5CC6A 1BF2A 1VS1A 3R5EA 5BWFA 1Z48A 3IK2A 1LWIA 2HBVA 5CXPA 3LHWA 2Q8XA 1KV8A 5CPMA 1P0BA 3MSRA 3ZWSA 1MNSA 3KRBA 1A0CA 1B54A 1VLIA 2VYOA 4DJEA 4EPBC 3STEA 3E0FA 5MF5A 4HSHA 3TUUA 5B7YA 5C5YA 2VR4A 2PMQA 2GDUA 4G7EB 3WMCA 2GVLA 4O1CA 3R8HA 3A4AA 1CT5A 1JCLA 2CFFA 2ZRWA 2HCVA 1X1NA 2BVWA 3USZA 3RX4A 1L6GA 3FX4A 5I3FA 1XUZA 5HNNA 3VIMA 1F7BA 2EGZA 4OIFA 3FK4A 4GCXA 4BEUA 1JI1A 1MEIA 4D8ZA 5F4XA 1FCVA 2TSYA 2MANA 3L9CA 5CCZA 4O19A 4OOUA 4KPLA 3GU2A 4WCJA 5HOSA 4A8IA 1MEHA 5G2WA 3M0JA 3RLVA 1V93A 2XN0A 1EGMA 5J8LA 2FFCA 1F6KA 2F6UA 1KCXA 1C93A 2FLIA 2CHOA 2CKRA 1DVJA 4Q4SA 3R4IA 1MW2A 2FGBA 2GQ8A 2VQTA 3SRDA 2PTXA 2JGQA 4NJGA 3B8VA 4C6CA 8RUCA 5HNUA 5I5RA 5CLTA 4JPGA 4MPQA 2F9RA 1ML1A 3URQA 2NQ9A 1KRMA 2XISA 3VUPA 3NQCA 1L0PA 2HNEA 5TBOA 1PWMA 4ZODA 1B3XA 3O2LA 3WLPA 3T2QA 4MJ4A 1XHGA 3CEUA 2QHAA 4WSJA 2PDMA 4IFRA 2WMKA 1QT1A 1UOZA 1PCWA 2WNWA 3GR8A 4JYEA 2OLSA 2J9XA 5MHBA 1V6WA 4KW2A 3GVQA 5K4ZA 3S0CA 3KOFA 2QIIA 2Z00A 1FWHC 3AROA 1B4KA 3RJYA 1N55A 7PTDA 4JAWA 4JYDA 2DZTA 4S2CA 4JXCA 1S2AA 2VFFA 2BGSA 2JE8A 5E9AA 4WZHA 4JR5A 3UXAA 1FH7A 5HA7A 1JDDA 1TR9A 4HPGA 3A64A 3DFNA 4GYPC 3OLEA 2FQIA 2I5QA 1SO6A 4N4QA 4CNSA 2XSBA 4GBUA 3M0HA 3ITVA 1AQMA 1XLDA 2Z1WA 4RK8A 2A7PA 5XINA 4OU1A 3SSJA 1TJ0A 1EJWC 3NQ2A 1BXNA 4KEZA 2O56A 1V3JA 4A21A 5A8PA 4DM1A 3IEBA 1AMYA 1T99A 1AW5A 3AUOA 1PEZA 1TTPA 3CZ8A 1RA5A 2J6XA 3PNUA 3OLGA 4GXPA 1BSIA 4GYKA 3ZT5A 1VRDA 1Z42A 5AHNA 4DJFD 3GWQA 4JHOA 3GDRA 2O92A 3W1UA 4C90A 2EKCA 2YXGA 4C6DA 5IBXA 1HIZA 3MV11 1K9DA 4GK8A 4YNGA 3W4RA 4QRNA 2YLAA 2Z6IA 5A2BA 1WDDA 5G1TA 4NI3A 3F7JA 1UKTA 1NDYA 4X3ZA 4ZBCA 5F4WA 3C86A 2YGYA 5JXQA 3TN3A 2DT2A 1Z32X 3WUEA 3LG3A 4ZOAA 3BARA 1WA3A 1XDJA 1UUMA 3FGCB 2G3NA 1ZENA 2XZ9A 3UESA 4RDYA 1EF2A 4CQ8A 3C3NA 2X16A 4MYAA 4RPQA 1EC7A 3E5PA 3WUGA 1WNOA 2BGNE 3BG9A 4WHBA 2HDJA 4JIPA 2PDGA 1JZ8A 3OZMA 3VX1A 3TZFA 2QCLA 1OBAA 3W7OA 4JDYA 3BSGA 2OCZA 3EPNA 3H2NA 4O28A 2X1TA 3HJEA 1DTNA 3U2CA 3E6EA 5HQMA 3T78A 4C6EA 2ZXAA 3KE0A 4X9SA 1UMLA 1EH9A 1BGAA 4MF4A 4DWSB 1O6IA 3F03K 1QNOA 5FEWA 1FDZA 4Q8TA 2YZRA 2PU1A 1DEDA 1E5NA 1EWEA 3WF0A 2OLAA 1QFEA 3CC1A 2RUSA 3IPWA 3WJYA 2RDWA 1RA0A 1R46A 4PUMA 3O6DA 1XUUA 3BCJA 3O6CA 3IUDA 4XZWA 1EJVC 1A5SA 3WD3A 2DZXA 3ALFA 3IAQA 2VURA 1Z7AA 3WMBA 2H3BA 5GJPA 1K7FA 3TYAA 3H4WA 3MVTA 2INEA 4U31A 3S5NA 2J8GA 3K8LA 2V5CA 3C3UA 1OGBA 5CPOA 3W2JA 4GI8A 5K9XA 4AXNA 1A0EA 1HP5A 2I14A 2R14A 4IUGA 2QEZA 4O14A 3SQSA 3CUXA 1TV2A 3GH5A 4TV6A 4AWTA 5CPTA 1CWYA 1XGEA 2WSYA 1TZ9A 5FEXA 2DT3A 1JRBA 3LUTA 2PUZA 5CSRA 4YTQA 1IXPA 2NWSA 4A2SA 4IMDA 1LCOA 2QW5A 1RVKA 1U1UA 5I77A 1FWGC 1LF1A 4R53A 2CCRA 3TE9A 3WQOA 1LUCB 3RG6A 1G94A 4MB5A 4UNIA 3D0CA 1XYLA 5D2WA 3TV8A 5A69A 2X0YA 3KLLA 3AHVA 3A5FA 6ALDA 3VC6A 2I57A 1W9VA 3P82A 5FAGA 3K46A 3A9BA 5FF0A 5IHSA 3TYEA 4JTRA 1UA7A 4UMCA 3Q45A 4HNOA 1BXCA 4GKLA 3BLFA 3I10A 5I2UA 1LOSA 2YJQA 3WKZA 2VFDA 3W87A 1UP2A 3GXDA 2WSKA 4A2RA 3B4YA 1GOOA 3Q2DA 4A8LA 3HOJA 4JTKA 1OFPA 4PH6A 3DFTA 1FBAA 1RK6A 1GTHA 2I17A 4IICA 3S2NA 2WC3A 1CGUA 4OUIA 3NQMA 3TYCA 3LTPA 2DORA 2NUYA 4EVZA 2CPUA 5FL0A 4EACA 3QQ0A 1PS9A 1K1DA 1OFEA 2J62A 3ARYA 2BS9A 4CEUC 5AC6A 5F4SA 3DBPA 3AISA 4KGLA 3TNBA 4H6QA 3UPMA 2QV4A 2Z2BA 4JTTA 1PX3A 5H1WA 3WZ0E 2ZX6A 5JUVA 1ZRQA 5EFDA 1H1YA 4MKSA 1GK8A 2CHNA 4MNMA 5AB3A 2WJFA 4C6OA 1OK6A 3SZ8A 3ERPA 3S9ZA 4LVAA 2QCMA 3F2CA 5C2XA 5JQ9A 1Q5MA 4K36A 4BI7A 4IFKB 3TU9A 1F07A 1KFJA 4QNWA 3NQFA 4GGHA 1ESWA 3BAJA 4GYJA 1NWTA 2YCEA 3GBDA 1ZJHA 4PTMA 3TTYA 3IJQA 1RBLA 2W62A 3CPRA 3H53A 5DXXA 4HPHA 2WSRA 1SM9A 4S38A 1AL8A 3AMCA 4DF0A 4IJBA 4QAIA 9XIAA 3L0GA 1A4LA 5E09A 5IOBA 1NDVA 2PZNA 3NA8A 2V0TA 4NZ1A 1S1RA 4AHPA 4K68A 2GUBA 1DWAM 1XICA 5CPSA 2AMXA 1PKNA 2PDQA 2R1NA 3K8MA 4UXDA 2BTMA 4JFVA 4C6NA 3BTNA 4DELA 1ZHAA 2WM0A 1OFAA 2DU2A 3G5EA 1M03A 3VPLA 3T81A 1GJPA 3M0IA 4L7ZA 5D2VA 2QCFA 2TMDA 1PWLA 1W2VA 1R3RA 3KLKA 3CAVA 2ZZ4A 4DO4A 5EMJA 2VGIA 1ZBWA 4IQJA 4IMGA 1C9WA 4XD4A 4YYCA 1WPCA 1X96A 4W8BA 3KOXA 4UQBA 1H3GA 3B8WA 5FJRA 3FXYA 3WBXA 3MCNA 2GGGA 1HNYA 4H8HA 4CNUA 3LTYA 5A6SA 3SCQA 1LWHA 2YBTA 4Q8WA 4Y90A 1XIIA 4B92A 2NQZA 2V2HA 3GXPA 3FGCA 4HU0A 4DUXA 3B06A 3E9AA 3ZIZA 5AYYA 4AY8A 2UY5A 3IRDA 2BMBA 3PZUA 6REQA 1JZ5A 1VGAA 3CH9A 3GYEA 2PCEA 2F6XA 4LAKA 2BZNA 3NQ8A 5JBDA 5IXEA 2PDNA 4LW7A 3IACA 3HGRA 4UTHA 1SR0A 1N82A 2AGTA 1JI2A 1QBBA 3MKKA 1GTEA 3R89A 3W25A 1ENUA 4I7WA 2JKAA 2WKGA 4LS0A 3V3WA 3DI0A 3O1NA 3AUJA 3QN3A 4P8WA 3VXGA 3L68A 2DUZA 2DVTA 1OABA 1HL2A 5ENLA 3K13A 1XP3A 4HSOA 2FZBA 5F2GA 3ZJ6A 4J28A 1K03A 2XH4A 1CXFA 1E15A 1DIOA 3KAOA 1EFZA 2HE8A 2O4QA 1LT7A 5TF0A 2PGEA 1E43A 3F1QA 2ZC1A 1R87A 2RDXA 4H9TA 1UKQA 2O7SA 3UR8A 3DHUA 1KV5A 2CESA 4TOQA 2B7NA 4C5YA 2H6RA 3UWZA 1GEQA 2QZRA 4WDTA 3W7PA 4KRTA 1O95A 5JIPA 1UD5A 4IWWA 3ICJA 2Y24A 1SW7A 4FSAA 2IPWA 4CQDA 2Z0IA 2PSNA 1RY0A 4H9XA 1V3HA 2QXWA 1U30A 3REQA 3UZZA 4PTWA 1TSIA 3PZOA 4JTIA 2AL2B 1Z8AA 2B7QA 5ABHA 3GB6A 1TWZA 2VHLA 5DMNA 4KESA 2OEMA 2VCBA 3T2PA 2X42A 2YYUA 3MUXA 3UD6A 2GZXA 4WY0A 4W84A 3OTRA 2HS8A 3WLHA 3MYPA 1OQFA 2NQJA 3FAWA 4MTVA 4F0KA 3TTQA 2YX0A 1W3HA 5L9FA 4HA4A 4GGBA 1LBLA 4ICCX 1MXSA 1WX0A 2BVDA 4HCLA 5JU6A 3NFUA 2VL4A 3U2OA 5HXMA 1KQZA 4OOZA 1QPQA 1ZNNA 3EDJA 4PN2A 2X1IA 1Y8BA 1OFOA 2V3EA 3QVQA 1UCWA 3TAKA 2XGIA 5CGQA 1WAWA 5LZLA 4UQCA 1SJBA 4QJ4B 3UYIA 3LHZA 3UWWA 2WHMA 2E25A 3MKVA 2HVOA 3LCLA 2O9PA 1L6YA 1N7KA 2UBPC 4XTDA 3PTDA 1E73M 3LZ3A 4CNPA 3V5CA 1VHCA 1OX5A 3TLLA 4LY8A 2ZX8A 3GNNA 2OXNA 1X6UA 3V0SA 3AIRA 4WOZA 2W61A 4QSHA 3RU6A 1J0JA 1TPH1 1X7IA 2ZTJA 2A6LA 3SR7A 4PMUA 4N4PA 4PR4A 3KL3A 1JZ7A 3BLLA 1GQIA 1KLYA 2OKTA 3TC3A 4ZCWA 1TV4A 4P2VA 3VDAA 1R3WA 3DENA 2W3ZA 2TPSA 4QX4A 2Z1BA 3UXKA 1CXEA 4YPJA 3M46A 3UCCA 4TQTA 3VVGA 3CUJA 1WBHA 3BH4A 3W71A 4PUNA 1POJA 3WCZA 3M7WA 3NEVA 4S3AA 3ABOA 2EG6A 3LCGA 3ZZ1A 4F4RA 4IIGA 3AS2A 3DUGA 5E0KA 1HKKA 4GXWA 2OFJA 2OQYA 4HHMA 3NVTA 1LG2A 5A6AA 4U5IA 4RX0A 3QPYA 2PAJA 1YTKA 3JZUA 1UD4A 4LAMA 5FJUA 2D1ZA 1CBGA 4K8GA 4IIHA 3UZJA 5IFPA 3M07A 3POCA 3WQ4A 1P48A 3ANYA 1RJQA 1R3YA 3NXFA 4JNYA 2YL6A 3FCPA 3NZQA 3K1DA 4WDWA 4ZOEA 3V4BA 1KTNA 3NQ7A 4MFEA 5A6TC 3CQHA 4BJHA 5GNZA 1S5TA 1NARA 3GD6A 3LGDA 4GYPA 2ISFA 2HRWA 3BOFA 4ZB5A 3NL5A 4QE5A 2CLMA 1GVRA 3LRLA 2CBIA 2ACUA 3LYEA 1GVIA 3ARQA 1IR1A 1J12A 4F66A 1EA0A 3NQGA 3M6YA 1FWRA 3ATYA 1JAKA 1NTHA 4BQ4A 3A21A 4DBSA 4A4AA 6XIMA 3A47A 3ZT6A 5FF3A 4D6FA 4PCSA 3ZR5A 3BMWA 1AJZA 2JFEX 2DIJA 1ADDA 4LYKA 2RH9A 1GVEA 3FYOA 4WKHA 1VFUA 2HEJA 1XD1A 4RW3A 3R0DA 1QW8A 1TMHA 2ZXBA 4LH8A 1BYAA 3NPUA 4GQQA 4IL2A 4HPNA 1PUDA 3U3HA 3M43A 5E6ZA 1NWRA 3RMJA 3T0CA 4NJJA 5BXRA 4JNZA 2VZOA 4KWWA 1VYPX 3L5LA 2FTYA 3EOSA 3S1UA 3FEQA 1Q65A 5E70A 3H26A 1FWWA 1SW0A 2Y0FA 5CGMA 5LGZA 1EWDA 1PZ1A 2G4FA 1UWTA 2AQWA 1GZ1A 4LRSA 4U33A 1XLCA 5C9ZA 1E1EA 3NQAA 1BRLA 4OJYA 4WR3A 3MS8A 3W86A 1W37A 4G7FA 1UZ4A 4RR4A 4PMVA 1TUFA 1WBJA 3QC0A 4PSRA 4TVUA 3ITOA 3QV6A 5KITA 4O0KA 1BWKA 3W81A 4PRTA 3DGBA 2OWXA 1WOBA 1VJSA 2YYTA 4UR8A 2V67A 1AZ2A 4FALA 3B8SA 4JFTA 1F3WA 1FWDC 3SECA 3KRSA 4J35A 2FH8A 3APYA 1UKOA 3NGJA 4E8GA 3T8QA 1GQJA 3WNPA 2PU0A 1KFBA 1QW7A 4YHGA 3EX3A 3PK7A 1AH4A 2RDTA 4ZMGA 3HO8A 4WVXA 2XPKA 4IGSA 2PGWA 1DP0A 4JZ5A 2X8RA 4MDPA 1SFSA 3EX6A 1GVSA 4ML9A 1ODZA 3AHTA 3J7HA 4NXSA 4XO7A 5CC7A 2H9AA 5I03A 1BD0A 2C79A 4JIRA 3BGGA 3B8TA 4UQEA 2ZE0A 1BG4A 2VRJA 1SZFA 3BG3A 4QDWA 2J7FA 3QOMA 3SRFA 1DTUA 1OIMA 2XM2A 1TWDA 1TUXA 4ZVJA 1IGSA 3GG1A 2YCLB 1FKXA 2C1GA 3WQGA 1UG6A 4PMRA 1KR1A 1S5NA 3W7KA 4C6PA 2E68A 5D2TA 4XD6A 2QJMA 1H0GA 4PMNA 3M0YA 1V02A 3NO1A 1A5OC 3FKKA 3DOPA 4DO5A 3DXIA 4R34A 4S3CA 1ECQA 1E9YB 2ZA2A 4WXYA 1Q6QA 5EPDA 1ZP4A 4PC8A 4E2DA 3KM8A 1TPB1 1K3UA 1FOBA 1P0DA 4UFLA 2Y4SA 1J9YA 3ES7A 4XAGA 4LS2A 3FXGA 3O7UA 4EPKA 1RK5A 4WF7A 5KZMA 4BS0A 1OFRA 5I02A 3OLDA 3CH0A 4IMFA 3MHFA 1VBGA 4MB4A 2VEGA 3SGZA 2DIKA 4OUEA 2WMJA 3B8DA 1XLEA 4MG4A 1VF8A 3RPTA 1YDNA 4A29A 2J4GA 2HE5A 2CLKA 4O0ZA 1OFQA 5A6KA 1QHZA 4PGLA 3A6OA 1ZSXA 4QG6A 3MDWA 3U5UA 1PHWA 1JDCA 4ADUA 1HJUA 1IQ8A 1PIFA 1XFBA 3F5KA 3WLRA 1H4PA 1DXFA 2VRKA 3QF0A 1TWIA 3FOKA 1HKVA 1G5AA 1FWIC 1MRAA 4NYUA 3W7EA 1MQPA 2PWVA 3IJIA 3O6AA 5BXPA 4RXFA 3VOGA 2HMCA 5C55A 4QEEA 2JIEA 1Q6CA 5I3KA 4MNLA 4DWSC 2AOSA 1OX4A 3AZTA 4GA8A 3UGVA 3WD1A 3AIUA 2A0NA 1FKWA 3SN0A 2FHFA 1EZ2A 3I6RA 3LDVA 1IT0A 1LBFA 4XKYB 4A8NA 4LUSB 2RAGA 1LBMA 1F8IA 4J3UA 1M3UA 1ZCCA 1JFXA 3EEGA 4FNTA 3MSYA 1I2OA 4FNRA 4R7JA 3E12A 4AZBA 4FNUA 3BURA 3M0KA 5CJNA 1WZLA 4HPJA 4P8VA 2WO5A 3BLOA 4PRWA 1IE7C 1A3XA 2HPMA 4X0NA 3H2MA 1HJXA 3UWVA 2ZQ0A 3VOJA 3CL6A 1JUBA 5D04C 3T0AA 2CW6A 2C0HA 3EWBX 4OWGA 3ZVHB 4A22A 3LGGA 3A4XA 4TMBA 2VFGA 2W27A 4BQ5A 2D0HA 3Q94A 1CGVA 1J6PA 3M0VA 5I6SA 3VINA 1WYIA 3AS1A 4S3FA 3BCFA 4CQAA 1JYXA 1QK2A 1YADA 3PZNA 3ZS4A 5DN1A 1W1PA 4XBKA 3K4DA 1C8XA 1HL9A 2IQDA 3GDTA 3SI9A 1DE6A 5LIYX 4PEKA 1QR7A 2D2HA 3MUZ1 4F2BA 1F8MA 3LBCA 4LYQA 3H2EA 2OYMA 1XX1A 4JTGA 5I3IA 3C6CA 4JFSA 5A8MA 1JD9A 3AJ7A 4D6CA 4MY9A 4TXEA 2ZVIA 2Q8ZA 5DEZA 3L12A 2PDWA 5LA2A 3OZYA 1EC9A 1ITUA 1UR8A 3WDQA 3NSNA 3N2CA 1LJYA 1QNSA 3IV3A 4DM2A 1HT6A 2YA0A 1XDMA 4DXXA 3KEHA 4IG2B 1V8EA 3RLGA 2W9MA 2G3FA 2POZA 5C6MA 2D2JA 1H51A 3W2MA 3DHPA 3TA6A 5GNXA 5KINA 3LMYA 4TO8A 1TVPA 4M7SA 4F0MA 3MBFA 2IKIA 8TIMA 2DUAA 3UQNA 4AZ6A 3IK4A 4UTKA 1SMAA 2FB3A 3H7VA 4U3AA 5I06A 4HA3A 2CBUA 3CT7A 1FP8A 4WIWA 4OBTA 2P1FA 2XWEA 3MQTA 1WDSA 1QNVA 5E6YA 4DNMA 3NZGA 1QNPA 5F2LA 4GE8A 1VZWA 5DCDA 4RJEA 2CXGA 2YFOA 3O0KA 1IEVA 3AHXA 3AXMA 2DDXA 5DELA 1ONXA 3GK0A 3VGBA 1YHTA 3IANA 1B9ZA 4GABA 3BANA 4HJWA 4LRTA 5D9NA 5HWJA 2DSVA 2J7HA 1KM3A 1UWRA 2OX4A 5I3JA 2H9AB 1G7VA 2CETA 2C18A 5BXTA 5C2CA 1XSJA 4KWUA 1I2RA 4AF0A 2EPKX 4P8XA 4MWAC 1F3XA 4RUBA 4EKJA 1F05A 2DH3A 4GOAA 1XD0A 4GHRA 1C8QA 1PKLA 3N4FA 4Z2IA 4IGNA 3HB9A 4S39A 3GR4A 1E6RA 4D2JA 2CERA 3MUCA 2ZXQA 5D30A 2B31A 4LVGA 5REQA 4DJDC 3G0SA 3RMEA 3IJ9A 1PHQA 1T40A 2NSXA 2J78A 3ZYZA 5KTLA 1Z89A 3REQB 3ARXA 4B9YA 4Q33A 3UW6A 4D6JA 1D2KA 2WVVB 1GVQA 2OO0A 4HD5A 4GC3A 4ROQA 5LNRA 2ZRUA 4MSSA 5FKYA 4HZMA 2PODA 1VLWA 2YDSA 1V6YA 1LT8A 1F74A 4MDOA 1TZZA 5CBJA 4XZBA 3G6LA 5I00A 3W3OA 4E0CA 5A5WA 4IJRA 3C2FA 1N8FA 3MUAA 1E9LA 1XIEA 4E2OA 1AJ2A 4EXBA 2ZDRA 1Z9AA 5HMFA 3GXIA 3SCOA 3K4AA 3TN6A 3OVGA 4DXKA 5G4WA 2WC4A 1WXYA 6A3HA 1RALA 1H0IA 4LWWA 1ELSA 4L80A 4XZ9A 3MTWA 4H1ZA 1D3HA 3SCSA 1PIGA 3W84A 2I5IA 2YL8A 2ZOXA 4O52A 5TIMA 1LQ2A 4B4HA 3WN6A 3GX9A 3K2GA 2G50A 1TPVA 1TJ1A 3CUFA 3ARWA 3RX3A 3B0UX 3G1SA 1PE1A 3SFWA 1JEZA 1TV8A 3WJXA 1W5OA 1RLCL 3KOYA 2V5DA 4PTVA 3WDPP 4E3VA 2HSAA 4F79A 1FCBA 3SAZA 2NT1A 4O53A 3AYVA 3HG5A 1UUOA 1NFBA 1AODA 3N4AA 2YDAA 2ODOA 4GJJA 2YL5A 3LLXA 3H7UA 1V3MA 1MFVA 1S5VA 4UBPC 3IARA 3NSXA 3XINA 1WXJA 4Q8QA 3L4YA 1Z41A 2WMFA 3HPZA 3WX7A 3JW7A 2BODX 3IVTA 1MXGA 4RXGA 1O68A 1H1ZA 4D6HA 1J5SA 2F8QA 3DFYA 5BMWA 2BY0A 3FJ6A 3VCRA 3BICA 4UCGA 2GLKA 2CLEA 3UPBA 2C14A 4LAUA 4V2XA 4HOXA 4CCEA 2VDHA 3PWGA 2EJAA 4AD3A 1EZWA 1ISVA 3F2DA 1T6MA 3R11A 1DJQA 3OA3A 4MJZA 3TIMA 4A35A 2R9RA 4KCWA 3HPAA 1IGWA 4GCAA 4K38A 2D3NA 3N73A 3CIWA 4F0SA 5CC3A 1TCDA 2Y7EA 1XL9A 1M5WA 1MW0A 4Z1YA 3W28A 2QQ6A 1UWQA 3BW4A 3USBA 3DFHA 3HMJG 5F2MA 4HKPA 2D20A 2ISVA 2YCIX 3EEZA 3FJ4A 2PP0A 1NJJA 4IX0A 1XYZA 5AVHA 4HYVA 4FHAA 3K1GA 2BLEA 4PFMA 4I9TA 4XK2A 3UJFA 2GVEA 4H6EA 3M6DA 4Y9NA 3QZEA 4J3TA 3UY7A 3FSTA 3KFTA 1QXLA 3CQJA 1US2A 1OYAA 5BU6A 1E40A 3O63A 3G1AA 1SZNA 1CXIA 5AC4A 4LB4A 1GJUA 3CEPA 4WSHA 1A53A 5FEPA 3T42A 2W91A 4FPSA 1ZBKA 3C56A 3EX2A 3A4JA 1ZALA 3TYZA 1QU4A 3DFSA 2X30A 2OTDA 4DN1A 3NDOA 2XDFA 7TAAA 1E70M 4W7WA 4O50A 4DAIA 4LT9A 1LRNA 1Q2RA 4O54A 3DI1A 4FMVA 3BCDA 1O12A 4DUVA 3WBAA 1VH7A 3I3EA 2IXVA 3GXNA 3TWBA 1GG1A 3HF3A 1KM6A 4LEFA 4F0RA 1EB3A 5T9BG 1FXPA 4JKMA 4Z1DA 2OSWA 4Q4OA 3M5YA 3M5VA 5REQB 3N2OA 3B9DA 5H8PA 4CUCA 3UWUA 3E3HA 1KGUA 1KBKA 4HK5A 3CV2A 2OYKA 5AOUA 2FZMA 1W9UA 1J79A 2OT0A 4AC1X 1W5QA 4FOKA 5D38A 4K7YA 1HKMA 3QZ6A 2WNZA 3P84A 2E1DA 1MYRA 3V0UA 1W9PA 1Z3NA 1UH2A 4ZGYA 3T7VA 2GDVA 3RU8X 3T2OA 4Q22A 5U4NA 5FEZA 3OQEA 1GZJA 2DZVA 1G9HA 1ZB5A 4BZYA 2Q6ZA 3C4UA 2YCLA 4LNCA 3D3AA 3SADA 4V27A 5F1UA 1J2WA 3BE7A 4EX4A 4LBUA 2A3CA 1FWSA 3LK6A 2Z4GA 3GU9A 3S5SA 1P1MA 1HJVA 1QWKA 1BG9A 2WYSA 1P1XA 3L67A 4UIOA 3GE7A 4MWAE 3ABSA 4MGGA 2G96A 3AIWA 3QGKC 4MJMA 4DF1A 2OEKA 1AK5A 3SIMA 4FB7A 5C9UA 3GFZA 5FSDC 1U1JA 3S1XA 3CBWA 4O18A 3SN4A 3ALGA 3NYDA 4HQVA 2VGGA 4LCSA 3G1YA 5AHIA 2QVHA 1JVNA 1OCJA 2V68A 1TX2A 2PTYA 3QW4B 2V3GA 2GK1B 1H61A 3ENLA 4PRRA 3WNLA 3I6TA 3LM3A 2C3ZA 2OWWA 1W5NA 4RZBA 1Q13A 4JL1A 4K2SA 2XM1A 3DEQA 3WF2A 2PLMA 1R85A 1S2UA 3GXMA 4ZO9A 2E28A 1SZEA 4UCFA 4XTIA 3WQDA 4U4MA 4FS9A 1HKJA 4LUJA 3GVGA 4MHBA 3PTQA 3ITGA 4JY9A 3HQ1A 2QUTA 2YXXA 1Z44A 2AKMA 4WJ8A 3GNRA 3EMQA 2J47A 3TSDA 3UY8A 3AALA 2ANUA 2LLEA 4KKXA 4NX0A 5HWMA 4B3KA 3TP4A 2B7OA 3E1F1 2HZGA 4UTTA 5K9DA 1S2CA 1TJRA 4J3SA 3P2VA 2IKJA 3PWIA 4ZXOA 2QVNA 2OQHA 3PBVA 4PFHA 3KW3A 1VP5A 1XRTA 3ZVHA 3GTIA 4W5ZA 5CSUA 3SRKA 1O5XA 1I4NA 1EIXA 3ZLFA 4R5EA 1Q6EA 5BROA 1WCGA 3U7VA 4JTFA 1JGIA 3QPZA 3RRXA 4GH3A 4HIBA 1OFDA 3UR2A 3W7HA 2D24A 4HSNA 2WANA 2QCNA 2CWXA 2IW0A 1RY8A 3PZGA 4U10A 4G9PA 3R10A 1V02E 3A9IA 3EDFA 1JNDA 1F61A 3WLLA 3W75A 4GH1A 3TZNA 1HQTA 3CT2A 1W1TA 1K70A 4CQCA 1C92A 3LERA 3THUA 1QNQA 1ME8A 3AWNA 3U48A 2VX7A 4MAVA 1QBAA 4K3ZA 4C7FA 3P60A 1TX0A 2CIPA 2WWCA 4HVXA 1I9CB 3DGRA 1D3CA 4PBFA 5AN7A 1M1BA 1Q6OA 3U6WA 4FXFA 3VM7A 1AJ0A 1I2NA 2E8YA 2J75A 4TTUA 2DP3A 2J13A 3E96A 1X8FA 5AC7A 4DF2A 1FCQA 1MMFA 3WQ6A 1K7EA 3GS6A 3DCPA 2XIIA 1OGSA 4GO9A 4X61A 1KXVA 2MUCA 5BCAA 1FHDA 4GUFA 4W86A 2EHHA 2JF7A 2ALDA 4EOUA 2R1LA 5B80A 3ITXA 1OJXA 4JTEA 4PZVA 5DMYA 4TVCA 1O60A 1QI3A 1JYVA 3R58A 3WG6A 1XFCA 1XYCA 1FWFC 3L4VA 4IF2A 2CLIA 4P7NA 2E9MA 1E6PA 4YS1A 4IQDA 1WDWA 1KM2A 4WJXA 3W70A 4GY7A 2WNNA 1HW6A 3T6CA 1BAGA 4B5XA 3GIQA 3MSGA 1B30A 1H7NA 2BY1A 3N9RA 4ZE4A 3GYCA 1R7OA 4M81A 1GYLA 2RHGA 2WQPA 1PZ2A 1RSCA 3PAOA 2E5CA 3FJNA 4AZHA 3NPXA 1FWNA 3DG6A 4DAFA 4HHHA 2PDKA 3UEQA 1WKDA 3LPPA 2BNJA 4DYJA 1X97A 2WAGA 1QPOA 2A21A 4HZ8A 1QVBA 1IZJA 1EEXA 4LUTB 1JDFA 4QS5A 5DMMA 4JIIX 3BSMA 1I1WA 3BW2A 3OZPA 4H9UA 1UD8A 5D02A 4PCPA 3LNPA 4MY1A 1KBBA 1FTXA 3E5BA 3VIJA 2RGMA 1H63A 4QLJA 2JEPA 2GWGA 3WQEA 5A6LA 3F5LA 4FNQA 3T40A 1E4IA 2PDLA 2CITA 4AYGA 3GTXA 1NELA 4GX9A 4UTTC 4LU0A 1K02A 4H8UA 4US5D 4IH3A 4C60A 2A4AA 4NAEA 1KRAC 4ZSUA 4R7WA 1RXOB 3DH7A 1DJNA 1SJCA 1EX5A 5DQPA 1XSIA 4ICMA 2BASA 3WH9A 4O8AA 3G1FA 2Y6ZA 5HQLA 4L4LA 4J2PA 4IG2A 1B0IA 1VKFA 1O1HA 1AW2A 3E49A 1CXLA 2PDXA 5CH9A 4L64A 2P10A 3MZ2A 2WVUA 3B9AA 3QYQA 1R3QA 1JUKA 4M5PA 4UR9A 3WD4A 4GACA 1KFEA 2VELA 3GXTA 3RUBL 1JQVA 2PBGA 5AYIA 2P50A 4NJHA 4I90A 4AHOA 2ZDSA 4WJEA 4O1EA 2FPVA 3GHSA 3WF4A 3EWWA 3R2GA 4J3XA 5E1QA 1J5TA 3VNKA 3LXCA 5J04A 2G4JA 4C6LA 2BSLA 2BP1A 1EIBA 1OCQA 2TYSA 4S3BA 2FGLA 4LYPA 4UQ9A 1UKSA 3VNDA 1VC4A 2PLCA 2YXOA 1TV3A 2HBXA 1V5XA 4BWLA 5G4EA 3H24A 1EXBA 3GNOA 4KS0A 4G2DA 3ELFA 3TAOA 3ITCA 3GUWA 6XIAA 2J7EA 4P5UA 4AMCA 3MP5A 3L66A 3AI0A 2OQLA 4QXIA 2E6DA 1SFJA 3VDBA 1ICPA 1H7RA 1H7WA 5HK4A 3SUWA 1KCKA 3OOQA 3KWSA 1CGYA 4ZB0A 5BWAA 3TQVA 4H7CA 3PTMA 3PN8A 4UTFA 2R1MA 1HTIA 3CM4A 4ACYA 2OZTA 4GO8A 1WOAA 5I23A 3RHGA 2D73A 2OJPA 3EKGA 2ZZ1A 3MVIA 2HPIA 3LCWA 1PTGA 1TRDA 1XIDA 4O57A 1GG0A 4MB1A 3LSBA 5I7GA 3JRKA 1IXNA 3THDA 3KVJA 1YDYA 4DXVA 3R7MA 1AH0A 3N2XA 3WJSA 1VFFA 3VC5A 3OHMB 3C0LA 4AD2A 1DQUA 2Y70A 4NAFA 8A3HA 2V5KA 1AZ1A 1S38A 3LBMA 3KP0A 2AGKA 3YPIA 1K9FA 4EF9A 2QDHA 4PA8A 3ANUA 2XVPA 5HPCA 5LIWX 3SW6A 4QLLA 3R8RA 4YL2A 1X38A 3R1ZA 5I3GA 4CD7A 3W73A 4PMJA 3BVJA 3TN5A 4FZIA 1M6JA 4LVDA 1HUVA 3TKFA 1O66A 5D9MA 3CU2A 1DORA 1YNQA 1IV8A 2NV2A 1ZS2A 1ONRA 1X7FA 4AUBA 4IQEA 4D6DA 2WZMA 2PGRA 1IF2A 5LSMA 3BK0A 4TTGA 3VOCA 3KL0A 1G7UA 1BVWA 3VOFA 4LBRA 1J0HA 1DWIM 1LYXA 1V3IA 4J9JA 3A3HA 2QULA 2Y1HA 1K8CA 3LCXA 2J88A 4L6OA 6REQB 4YLWA 4AG0A 3BDKA 1XG4A 3KBMA 1BXBA 3GDMA 1R0MA 2A3AA 1JIBA 1MRQA 4US6A 3MC5A 3EDEA 1TG7A 4HHLA 1GW1A 2WMIA 4INFA 4WEVX 4QGCA 1LORA 1DJXA 1EUAA 5AZ0A 3W6YA 3TJ4A 1GOIA 4G6CA 3GHRA 1QAPA 3QV7A 4WDUA 3E2RA 3OQ8A 4Y8FA 4DBDA 2Y7DA 4V33A 4JNMA 4PUEA 3VNIA 4C91A 4HT3A 5SWUA 3M47A 5B7ZA 1F3EA 4G1NA 3R43A 2EBNA 3L4ZA 4GUJA 2IQTA 2ZUNA 2FYMA 4O0QA 4NZFA 3U4AA 1M01A 1VFOA 3W85A 4N42A 1KB3A 1QASA 2A3HA 3RM8A 1EP2A 3G1XA 2CBVA 3N15A 1FH9A 3V18A 3I68A 2A6NA 1TWWA 2QF7A 4F0LA 4UTWA 1GKRA 4JDBA 1ZL1A 1QPNA 3WF1A 2FDSA 5FSEC 3ITYA 2X41A 1GPFA 1OY0A 1KM5A 2J66A 4KBXA 1OF8A 1VYRA 1UOKA 3CYJA 4BWLC 1JDAA 2YIHA 4H00A 2FJUB 3W7GA 4RPPA 3SURA 2D3LA 3A23A 4GXMA 3QFWA 2F38A 5CZKA 2HJPA 2PI6A 4PUJA 4RDVA 4BQ2A 1HF6A 5M1TA 3FA4A 3GRIA 3T4WA 3MUY1 3E02A 3EGJA 8CGTA 3EXTA 5FACA 3W53A 1O4UA 1TFVA 3COTA 4GFSA 4ZE5A 1EXPA 3QM3A 2PEVA 4HNLA 3RYSA 1OC6A 3W74A 3E0IA 3TXZA 3VNLA 2BOGX 3RCMA 3IGSA 3EOLA 3MV01 3H23A 3LHVA 4MUPA 1KKRA 5HINA 4W8LA 1VFHA 1G4TA 3BXWA 4GMEA 1M7XA 1YE6A 3A22A 3AYRA 3CB3A 4HK6A 4IJCA 3N12A 3O0FA 4PB4A 5LNSA 1J11A 3LS9A 1RBAA 2C1HA 4O4WA 4WGXA 1TQJA 1UUQA 4XAYA 1XIFA 3AYTA 3TSMA 3K8KA 4N9BA 4DJDA 2DZUA 1L2UA 3T55A 2JF6A 3ONBA 9CGTA 3WEZA 1LWJA 4QCFA 2E5BA 3V1HA 2XVGA 4NZ5A 2X2GA 3DX5A 3OHIA 4KH2A 1QI4A 4MLJA 2I7GA 2QR6A 1KLZA 1A5AA 4F9DA 4NILA 3NDZA 1GWJA 4ZQMA 2UY3A 1AW1A 4Y9AA 3QKZA 1Q6RA 4DPQA 4XKYA 1UC4A 4BI6A 1F9CA 4Q3MA 3GW0A 1VAHA 1SJAA 1XJBA 1EJ7L 3NPWA 1JGMA 3LPOA 5HAOA 3ISIX 2E77A 1TVLA 3VTRA 3SEPA 3AU2A 4GG9A 4CN4A 3L2LA 5HJXA 1XCXA 1DIDA 5A6JA 2ZA1A 3NQ6A 4L5ZA 4KGJA 3IJ6A 1T96A 5BOOA 4H2HA 1TTJA 3KS5A 1SUXA 1ISZA 3PJXA 5FD0A 5DBTA 3NM3A 1IIHA 1T8QA 3PTKA 3L5MA 3P7YA 4N9DA 3QY7A 4IFOA 4G56A 1EQCA 4DVOA 2VTFA 3CZEA 3IJ8A 1K77A 3CUZA 4LC6A 2YR1A 1J96A 1S2WA 3R79A 1TR1A 3QV8A 3QV9A 3SQMA 1KXTA 1EJXC 1N8IA 1MQQA 1A5BA 3RRAA 1CTNA 2C19A 4FR6A 3BAIA 2CKSA 2PF8A 3VKCA 1W5PA 2PWGA 5A94A 5A8GA 3CZKA 3UWYA 2ZZ7A 1UHVA 5LGXA 1ZJIA 2CU0A 2TAAA 5TD4A 2WZEA 3LEPA 2E7FA 3W1AA 3O9NA 2OT1A 1M65A 3U2ZA 2GL5A 3M0LA 1ZAHA 2IPGA 3PZMA 3CXOA 3QJAA 3SB0A 3MMUA 4IIBA 3TJLA 1JQXA 2X2YA 3QLLA 1YQ2A 3T44A 1K8YA 1F4AA 3LHTA 3AYSA 3UVIA 2BY3A 3GC2A 1AQFA 5CQ1A 3I65A 2EJ1A 4Y9MA 5D37A 3ZR4A 5C7HA 1XLJA 1Q6FA 4YU1A 1SVDA 5BZAA 4IPNB 3M1ZA 3KCJA 4TUFA 2C6QA 1W3NA 3W0KA 1CXKA 3LD5A 4WKAA 3H4XA 3WLIA 4NNAA 6TAAA 1GPWA 2YBVA 3BG5A 1Q2SA 2WC7A 3TQPA 1DYSA 2O9TA 2XVNA 3H2CA 5HBFA 3B9OA 1GNXA 4IP4A 2CHRA 1NSJA 3GVWA 4CCCA 2NUWA 3BLPX 2GJRA 2Z25A 3TFXA 2FPYA 4OV4A 1EBGA 1CLKA 2XSAA 3BPWA 3Q65A 1E71M 3GQYA 4O16A 3GTHA 3CHCA 3RLUA 5JMUA 1DHKA 1NF7A 1YE4A 3EWCA 4O11A 3TROA 3G3DA 3VIGA 1LLOA 2OZ0A 2GJXB 4KWOA 1GKPA 3BZJA 3WDIA 4RNFA 2VC7A 4R7OA 1E0TA 3TA9A 1MUWA 1Y0EA 4L6DA 3E2VA 3GAYA 4GY0A 1KWGA