4YL2A

Aerococcus viridans l-lactate oxidase y191f mutant
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
367
structure length
367
Chain Sequence
YNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHATKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKGDGATAIILTADSTVSGNRDRDVKNKFVFPFGMPIVQRYLRGTAEGMSLNNIYGASKQKISPRDIEEIAAHSGLPVFVKGIQHPEDADMAIKAGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lactate oxidase
publication title Speeding up the product release: a second-sphere contribution from Tyr191 to the reactivity of l-lactate oxidase revealed in crystallographic and kinetic studies of site-directed variants.
pubmed doi rcsb
source organism Aerococcus viridans
total genus 139
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4yl2A00
3LCLA 5TBOA 3EWXA 1TPVA 3EXSA 3AO0A 3PR2A 3W2MA 3G1XA 4N9EA 4O12A 5F2MA 4IQLA 4LS2A 4O8RA 1SFJA 2H90A 4XBKA 1LRNA 3P7YA 1GG0A 4E38A 3QMTA 2WJZA 1XKYA 4MY8A 3DGRA 5D2WA 3B8DA 3ABOA 2CW6A 3KAOA 1WBJA 1OK6A 4ZQPA 3RNDA 2Z1BA 4JYEA 5CZSA 2Z6IA 4RZ6A 5LNVA 5F4WA 4LS0A 4E0CA 5EL1A 3W1MA 4PEKA 4IMCA 3QSRA 2NXIA 3KRUA 4DPQA 2VEMA 3O6CA 1F05A 1GQNA 1KFEA 4AWTA 1H51A 1RD5A 3M5YA 2Q3RA 5G1TA 4IXHA 4MOZA 2R14A 5LHFA 3GKAA 3BG9A 2C6QA 1TREA 1XM3A 2P10A 3DFOA 4X9SA 1WYIA 4AMAA 4A3UA 5HWJA 3W87A 1ZAIA 2FFCA 3UXDA 1KBJA 4NQ1A 1OFOA 3BGGA 3EX1A 3N3MA 4Z1BA 3WK2A 3S8HA 2ZZ6A 4DXVA 4WOZA 3I68A 2GVGA 2A7RA 3FIGA 2B4GA 3B0UX 1H7WA 3M5ZA 1GJPA 1GTHA 4UTJA 4QNWA 3A5FA 3D0CA 4E2BA 4NUWA 3C2RA 2PE4A 2X30A 1Q6OA 1XCFA 1S5VA 5DBUA 4A22A 2QAPA 1WX0A 3A9IA 4BI5A 4Q32A 1VS1A 3QPYA 2A0NA 5AHIA 4N02A 1I2RA 2O7SA 3TU9A 3QZEA 2YSWA 5FEXA 1Z48A 3QSTA 4UTMA 2ATSA 2GVLA 3PB0A 4JTLA 1TB3A 1SQ7A 4AB4A 2G97A 3NGJA 1SU5A 3UPWA 3UZ5A 3TMLA 2QCMA 2OJPA 3TNOA 4MVAA 3QEZA 3CIXA 3TR2A 1Q6QA 3VI2A 1T99A 2BWGA 4HN4A 3L66A 4YXGA 4S2BA 2E6DA 3L2IA 2CLHA 5D03A 1FCUA 3DXIA 3QQ0A 1A53A 3S5ZA 3O06A 3TAKA 2TYSA 3G1YA 1KA9F 3W75A 1KW1A 3WJWA 2OT1A 4UTWC 5KINA 2CU0A 3PUOA 1TTQA 2ZDRA 4XKYA 1LLWA 4WY0B 1KTBA 3IVTA 4N9DA 3E9AA 3W1QA 4FXRA 4CCDA 4JDBA 3C6CA 3NG3A 3WK1A 3UZJA 4MLRA 1H62A 3PUEA 2YGYA 2W6RA 1DJNA 2A2IA 2YFNA 1KLZA 1FWRA 2DZPA 2C14A 1GVQA 1PVNA 1TPEA 3DENA 2GPTA 3PSVA 3W2UA 1ZENA 3IIVA 1V5XA 1KTCA 1TIMA 2ZFAA 3GZ3A 3NL5A 4JTIA 3HMJG 2FB3A 3GIYA 4DF2A 1WOAA 4ZQOA 4O1AA 3TXZA 3W7HA 1TPFA 4K39A 3QH2A 2A6NA 1G4EA 1W3NA 5HUOA 2CLKA 1R46A 3BW4A 3W7CA 3DKLA 3CEUA 5LZLA 4O50A 1QO2A 5C55A 1XI3A 1VZWA 4H6KA 5D2YA 4A2SA 4U28A 1WA3A 3LGEA 4MJZA 2ZZ5A 2DJLA 3TSDA 2RHGA 4IMFA 1EPXA 2AQWA 1DV7A 1TJPA 5F1VA 2EGZA 4KWWA 1X7FA 5IM51 4LVDA 4HNUA 5K9CA 1HUVA 4UTHA 4GJ1A 4IJBA 2RKXA 2QCLA 3GDTA 4AAJA 2ZRWA 1SO4A 4GBUA 3P60A 1B3OA 4QM1A 4XUGA 1SZGA 3QC3A 3PG8A 1FQ0A 4CCCA 1IIGA 3LBMA 4NJIA 5CZJA 3MHFA 4AHOA 8TIMA 3TV8A 4N6FA 3T4CA 1Q6RA 2JGQA 3IRDA 2UV8G 1VPXA 2PURA 4Y9AA 3PB2A 3DU0A 3I7SA 4R34A 2PRHA 5HJLA 3EB2A 1OX4B 4FF7A 4RZ5A 5T26A 1V7YA 2NX3A 2H6RA 1TRDA 2GQAA 3F03K 3PBWA 3W1NA 3RLUA 1LRQA 3W2JA 2GUUA 3FKKA 3O8AA 5C5YA 4WXYA 3P67A 1TRIA 4JXCA 3LHVA 1LBMA 3NEVA 1KTNA 2JKEA 1TQXA 2CWNA 3LTPA 3A21A 3L5LA 3UY8A 3EWWA 5F4XA 1RVGA 2VFFA 4RR4A 3FYPA 3GDKA 3N34A 3W74A 1P1XA 5K3VA 4RZ4A 3L5AA 2CLLA 3BG5A 4BFAA 3LCWA 3TQ0A 1F73A 1NAL1 4LVGA 5U4NA 1M5WA 3WJSA 3W83A 5DXXA 2DORA 1UBSA 4AHPA 4AWUA 4JTHA 4K8HA 2H8ZA 5AHLA 1K8YA 5GVJA 4MYXA 3C2VA 3NQ7A 2YDAA 4K36A 1X8FA 4TIMA 1RQBA 1L6YA 3NPXA 2ZYFA 2FQIA 4PCFA 2Z6JA 3Q2DA 3GXPA 3OVQA 5FEZA 4WOQA 4RJEA 1BTMA 1OFEA 5DCDA 1FY6A 2X1TA 2C13A 5AYZA 1M7PA 4UTTC 4R33A 1GVRA 2H3BA 5HMSA 1YPIA 5EKYA 3LCXA 3NVTA 2ZTKA 2JGYA 4OGZA 3HO8A 3I7RA 3QW4B 4M6VA 1G4TA 4UCGA 2V5LA 3DFTA 3NL3A 1CW2A 1SZFA 1M7OA 1QOQA 3M5VA 3RF9A 3W2KA 3MYOA 2VFHA 4ORMA 4JTFA 3S0CA 3BGJA 1H7PA 1L6SA 1OFPA 4DBDA 3LERA 4RLIA 4LVAA 4MUZA 2EPHA 1L9WA 4NNBA 3SECA 5AYYA 4FEZA 2G96A 4NNAA 3LHWA 4XKYB 5EA9A 1DVJA 2CLMA 3UD6A 1HO1A 4Z1DA 5D37A 1OFRA 1H61A 4O17A 1OFQA 4LU0A 4UNKA 3NR0A 2NWSA 3M9YA 1QFEA 3ATYA 4Y8FA 3W84A 3O6YX 4I7WA 1VLIA 5I3JA 5IBXC 2DZUA 1F2JA 3G0UA 1X1OA 3LXBA 5HR7A 2HS6A 1TPWA 1A5AA 3UPBA 5F2GA 1ICPA 2FIQA 1OYAA 1OFAA 1PCKA 3TW7A 3IVSA 4FNQA 4M7SA 1IXOA 1HL2A 3LI1A 1P5BA 1C29A 3MUXA 1JUBA 3NM1A 1ICQA 4K6AA 5D2TA 2B7QA 4NXSA 4DBEA 3MMTA 3NQ6A 3LTSA 3VFLA 1O60A 4I7VA 4UNLA 3M5XA 4MY9A 3G1AA 1VYSX 1F5ZA 1LP6A 2Y88A 1N7KA 4Q4KA 3W7LA 3KVLA 5DXYA 4UTUA 3TIMA 1NVMA 1LRTA 5LGZA 4FX6M 4O19A 3RK8A 4M6PA 5AC7A 3G24A 2QCEA 4N6EA 4WY0A 1TTIA 3B0PA 3TUUA 2Y70A 2YPIA 1NEYA 2XN2A 1ME9A 2QKFA 4JX6A 2KZHA 4TU1A 1KV8A 5ABTA 2V8ZA 3OG3A 4BF9A 3W07A 1W0MA 3LI0A 4UC5A 4HNVA 3IIPA 1DL3A 3C2FA 3N14A 1JQXA 4N2YA 1ONRA 1SSDA 1RPXA 2NUXA 1U83A 1MO0A 4LRSA 1VHNA 1KBIA 3LCIA 3SGUA 1XBZA 3DZ1A 1YYAA 3G3DA 2RH9A 2ZRUA 5J5RA 2JBMA 2TMDA 3GXTA 3LLDA 3KVMA 3NQGA 2EF9A 3TH6A 1VHCA 3I6RA 3BLEA 4JY8A 3EX2A 5TQLA 3SZ8A 4FNSA 3AJXA 3M47A 4Y6GA 3SW6A 4GXMA 2GQ9A 4IXXA 2IQTA 4NX5A 2WV8A 3NQDA 5U7SA 3MYPA 3N9SA 2Y7FA 2P1FA 4HSOA 4UTLA 2EAWA 4ZVJA 3T40A 3HOJA 5K9DA 5D2VA 2YX0A 3NQ8A 2GQ8A 1LM1A 3IGSA 3DI0A 1KM1A 1IGSA 4M5PA 4UFKA 4YL2A 5K2ZA 1YTEA 3TA6A 3TKFA 3STFA 1P4CA 1KM4A 1TQJA 4M19A 3HPZA 5AYXA 3R8RA 1FDJA 3PF3A 1W8SA 3P80A 2Y7EA 3C2OA 1UUOA 1AK5A 1O94A 2Y6ZA 5IBXA 1OF8A 5G5IA 2BLEA 4CQ9A 5EMUA 1QO5A 1ZJIA 3WFAA 4UXDA 1K02A 5EYWA 2I14A 4O11A 4O16A 3R2GA 5D02A 1H1ZA 3G8EA 4JR5A 1W5PA 1OX4A 3IEBA 1SR9A 5FEPA 3W7EA 4ML9A 3LRMA 4XTDA 4GUJA 4DEFA 1UUMA 2A6LA 2ALDA 1SPQA 6ALDA 1W5MA 4MLJA 4DQWA 2DZXA 3RU6A 3F1QA 1HTIA 4HNNA 4Y96A 4IPJA 4X3ZA 1K7FA 2J9YA 4LY8A 1EIXA 1R2SA 3EWYA 4UTKA 4PTNA 3QM3A 4LW7A 1GWJA 1EB3A 3G1VA 4UFJA 3MW7A 4O14A 1VYPX 2OZ0A 3W86A 5HNRA 3QFEA 1GVSA 5G2IA 1H50A 4I9AA 1PV8A 3SR7A 1SFLA 4FHAA 4YCPA 3W1UA 4NX0A 4O0KA 3IIOA 2B7OA 4JYFA 3OEXA 2QCHA 4DO5A 4O53A 2O7QA 3GDLA 1MEWA 2QR6A 2VXNA 1FWNA 4CLMA 5C2XA 1AW5A 4LV4A 1AG1O 2VFIA 4DELA 3BG3A 3LV5A 2HSAA 1IF2A 4JD4A 5BRBA 2VFDA 1CI1A 3CQ0A 2Q8LA 1WQ5A 2Y89A 4PC8A 5FF4A 4OT7A 2W79A 4DPPA 1VRDA 1QWGA 3TJLA 4AH7A 4YLWA 1G4PA 1D9EA 1BWLA 4WD0A 1G7VA 2VOMA 5FEWA 2ZCGA 4S2CA 4UMCA 5E0KA 2FPVA 1WV2A 3W1AA 3LXCA 4MY1A 1OK4A 4RX0A 5SWUA 3L65A 3LHTA 4RV8A 3PG9A 5G1YA 3P5YA 4NU7A 2V0TA 1WXJA 2WPBA 3PBYA 2CLFA 3HB9A 4UIOA 3P8JA 3LLFA 2QCFA 4MIMA 1TV7A 4OV9A 1JUKA 1JCYA 5D05A 1SW3A 3NZRA 3W9ZA 3SGZA 1QR7A 4GNJA 3W7KA 1Z41A 2CZDA 1EUNA 1VGAA 1FWSA 3WK0A 1A5CA 2YW3A 3TXVA 5BNKA 3BVJA 3CLMA 1SUXA 4JY9A 3UWQA 1AW1A 5DBTA 2ZBTA 5D09A 1BEUA 5CPMA 1SO5A 1EWDA 2QJHA 1FCBA 2E5DA 1F6KA 3T55A 4EOUA 2G5WA 5FF2A 4HSNA 3Q58A 3GXNA 2NUWA 2WQPA 3TQKA 4CCEA 3CU2A 1VH7A 3GR8A 2YYUA 3MP5A 1LOLA 1EEPA 1GG1A 1BWKA 1R2RA 3GDMA 3PBUA 2VELA 1BKSA 3TK7A 3L68A 4O57A 3IIZA 4IX0A 4WUIA 4IPIA 3DH7A 3PM6A 2Y63A 5D04C 2ZA1A 2QUVA 1KFKA 4MJMA 4N9BA 1SO3A 2J6XA 5FESA 1XL9A 3BW3A 3KX6A 3W1XA 5AOUA 1PHQA 3C0JA 2NXGA 1X6UA 3GYEA 2E1DA 3FKRA 3TC6A 4OHQA 3NL2A 3UY7A 5MHBA 3HGSA 4ADTA 3NO5A 4FX7A 2DU2A 3DAQA 4YCOA 1LLZA 3VE9A 3TE9A 1FX6A 2WNQA 4YMZA 2QF7A 1AL8A 2QUTA 2Y62A 3NZ1A 1YDNA 3TW6A 4WY0F 3W1PA 3M44A 1TV5A 3TROA 3W1RA 3STGA 1GYLA 4JGDA 4NZJA 4X22A 2YXGA 2GJNA 3BV4A 3BARA 3W7DA 3B0VC 1LCOA 3LXAA 4CQ8A 1XBXA 3M41A 4CNOA 3Q94A 2NXHA 3DFQA 2BTMA 1G4SA 4GUFA 1XC4A 4JTTA 4PODA 4U4MA 4RK8A 6TIMA 5L9FA 4A21A 4J9JA 2DZSA 1H7OA 3C8FA 3DFPA 3H53A 1FXQA 3LRLA 4K7YA 4Z08A 1EWEA 1MSSA 2YZRA 2ZA3A 3HGJA 1JULA 5C54A 4OU1A 1KFCA 2QUUA 3LRKA 1GYNA 3IGXA 4UFIA 5KSWA 1PCWA 3INPA 2B0MA 4QQ3A 3BLIA 4GE8A 5J5DA 3PY2A 5KTLA 4FIRA 3O1NA 3IV3A 1R47A 3TC7A 4ZQCA 3WK3A 1O5KA 3WJZA 4TR9A 5AHNA 3USBA 1X1ZA 1F76A 4ZQMA 3NDOA 1NF0A 3KXQA 1ZFJA 1XBYA 1CX9A 2DP3A 4WJEA 2C0AA 5K4XA 3MHUA 3M43A 3HIJA 3NQFA 5DCBA 4LVFA 5F4SA 1TO3A 4O54A 2WSRA 1A5SA 1YTKA 4LC6A 3HPSA 3EWBX 2V2HA 3SI9A 1GTEA 1LORA 4GUHA 3GAKA 1JR1A 3FEMA 5CPOA 1T0OA 3NQEA 1VC4A 1RQEA 2ZQ0A 4WXZA 4POCA 2J9XA 1OX6A 3TQVA 1SZNA 1F74A 2PRMA 3THAA 3EX3A 4MZ8A 1ALDA 4JX4A 5CGQA 5AN7A 3KRSA 1W5QA 1YTDA 1C8VA 5DLCA 4H3DA 2WSYA 2VEPA 5DCEA 3FJLA 4AHQA 1QPOA 1S5TA 5HR6A 5KMYA 2ZZ3A 5A5WA 3M7WA 3MHGA 5G2HA 1O95A 1W3TA 1Y0EA 4O1BA 5KZEA 2FDSA 2A1YA 5AHEA 5L6UA 1EA0A 1OHLA 4OWGA 1WBHA 4O18A 3CHVA 4TMBA 4JTEA 3CB8A 2W0UA 3R13A 3C2EA 1ZALA 1W31A 4JN6A 1EP3A 2RFGA 2V2DA 2AGKA 3OBKA 4QITA 4EF8A 4NNCA 2V2CA 2Q3OA 3R5EA 4E2DA 2X1RA 3NPVA 5D2XA 3IIXA 1GVFA 4FXSA 3GX9A 2NX1A 4QNEA 4PA8A 1GZGA 2QAFA 1W56A 3QPZA 1KM5A 3H54A 1I2PA 2F7FA 3QQ1A 2QJIA 2QEZA 1TPUA 1YDOA 2WNNA 4Q33A 2V30A 1TPDA 1B4EA 1WAUA 4TX9A 1G67A 2QCDA 3P62A 4CNNA 4MZ1A 2ZA2A 3DHDA 1QPNA 1J5TA 3W7GA 5I3GA 3W7IA 1UASA 4QSHA 2XN0A 4A2RA 3LBCA 3YPIA 4GFSA 4LOCA 3S1UA 1YADA 3DHFA 4MFDA 1FXPA 4PH6A 3LHZA 1OFBA 4QJ1A 3T44A 5FI8A 3TDFA 1KM2A 5H2ZA 3W70A 2Y7GA 2ZZ7A 3L0NA 3TJXA 1ZAHA 4MKNA 4I7UA 3OVRA 5LKYA 3MBFA 1JCNA 1I4NA 2J88A 3B04A 3G1FA 4ORIA 1HFBA 4AVFA 4UMBA 4JS3A 4XQ6A 1YDVA 4A29A 1J2WA 3NQVA 1ADOA 1L6WA 2JKAA 5I3KA 3VNDA 3NOEA 1FDYA 2TPSA 5BMWA 3G1DA 5LNRA 2E5BA 1SSGA 2CZFA 2J27A 3M6YA 1OJXA 3DI1A 4RCXA 4LTSA 3JS3A 3HG2A 5AC8A 4EIVA 4O28A 3NL6A 2PCQA 3LV6A 4Z1CA 4BWLC 3QYQA 1UJPA 4O4WA 4IUOA 1Q3NA 5EBUA 3CWNA 2WOQA 2ABBA 4UFMA 4N4PA 2QJGA 4DO4A 1TCDA 1NSJA 3MI2A 2E6FA 4Z1AA 3NA8A 3W85A 4HT3A 2ZRYA 3G1HA 5DN1A 3P81A 2A4AA 3KOFA 4Z0SA 3LHUA 2GVJA 1KLYA 2PRLA 3W23A 1S3HA 2NLIA 3CT7A 3W7QA 3LM7A 1LBLA 4O4VA 5I3HA 1IXPA 3PUDA 3E02A 2LLEA 1DQXA 4D2JA 4EF9A 5D33A 1I2OA 2Y61A 4MYAA 1F7BA 1EP2A 2XN1A 1A50A 1LDCA 5LNWA 4NT0A 2QCGA 3HG3A 3THQA 4IOTA 5F1UA 1M6JA 1W5OA 2YFOA 4KFNA 1OABA 3BK0A 3GAYA 4K38A 4IX2A 2ZRVA 1XUUA 3RFAA 5AB3A 4JTSA 5CZ0A 3S1VA 1XUZA 4O52A 1DBTA 2G95A 2ZZ2A 1NF7A 3W7JA 4IMDA 3QRHA 3GDRA 3FLUA 2WNZA 3W73A 2DJXA 1DHPA 4ZZ9A 1PHWA 1JCXA 2CZEA 3N2XA 1JCLA 3CWOX 3P8IA 4FNTA 3MP4A 2X16A 1ME7A 1RV8A 5DY2A 1Z44A 2Z2UA 2R94A 5HULA 1IXQA 3GNNA 1H7RA 2H8XA 2NZLA 1TV8A 5KITA 4XWUA 3G18A 4OQVA 2ZZ4A 1B9BA 4KFPA 3G22A 1G7UA 5LGXA 1T96A 2TRSA 4O1CA 3G8RA 1ICSA 4O13A 4UR7A 3CPRA 2J24A 1YXYA 2ISVA 3QMSA 3ATZA 2XFWA 4O15A 5KZMA 4TMCA 3TAOA 1SW0A 5H91A 4X2RA 4C1KA 1R2TA 3TX9A 4KWVA 2RDUA 4UUIA 2P0OA 4IMGA 1P0NA 3C4UA 4ADSA 3NAVA 3W7OA 3H55A 3CM4A 4IGHA 3GK0A 5D32A 4S1FA 2A7NA 4GUIA 4IMEA 3EX6A 3NNTA 2VKZG 4L4MA 2VFGA 3E49A 4UR8A 1P0KA 3PWAA 3N2MA 4PFMA 3TMQA 1UCWA 3NQ2A 4NJKA 1QCWA 4HHPA 5K9XA 1JUEA 4FNUA 3CIWA 3L0KA 2E77A 1N8FA 1JVNA 1U5JA 4B5NA 4O1DA 1G6CA 1YXDA 4BWLA 3EWUA 1TPC1 3I65A 4R7JA 4MFEA 1D3HA 4AF0A 5BW6A 3W22A 4WQ6A 1JCMP 4QISA 3SSJA 1XDLA 4N4QA 1K7EA 1H1YA 3OA3A 3UWWA 1L2UA 3CEPA 4HPJA 4AEOA 1VYRA 4ONVA 3OVPA 3TSBA 1KM6A 1VCFA 2QCDB 5DY3A 1KFBA 1B4KA 4CNPA 3O15A 1YXCA 4BI7A 1B57A 4N9CA 1FWWA 4K8EA 4FB7A 2C19A 3QMRA 3I7QA 1EX5A 4JNMA 3SFKA 4JIPA 3R89A 1MZHA 3S5OA 2NWRA 4ZMGA 2YR1A 1I2QA 2OX1A 3W71A 3P61A 3A24A 4XBSA 3S5NA 2DZVA 1H7XA 1W5NA 2C18A 3M0ZA 2A5HA 4P2VA 1I45A 1THFD 1XDMA 4ZL1A 3FS2A 1KM0A 2D73A 2E68A 3JRKA 4HIBA 3PAJA 3PVFA 1AL7A 3KVJA 1DOSA 3SJ3A 3ABRA 4LUIA 1N55A 2ZRXA 5BOOA 3S1XA 3G1SA 3ZWTA 3A22A 4CQAA 2A7PA 5F2LA 5CPLA 1OF6A 3NQMA 1OG0A 5CSSA 1K8ZA 3S5YA 3HG5A 1S5WA 3O16A 4XTIA 3STEA 3L21A 3FJ6A 2DZTA 3LCGA 5DELA 2QDHA 2Y85A 3EXRA 3F4WA 1D3GA 2DZWA 1DORA 1Z42A 5CKSA 1VLWA 2WKJA 3R12A 3DFNA 5LHEA 4LRTA 2J9ZA 1VCVA 1QPRA 4UMAA 2I1OA 1DJQA 4ALDA 4LNYA 3TFXA 4HNTA 2YYTA 4NXKA 3ZFHA 4EWND 3UYCA 3E96A 2R8WA 1OX5A 1ZCOA 2YCEA 5A8GA 1K7XA 3DBPA 2V82A 2QCCA 4NJJA 4HPXA 1H5YA 3W88A 3G0XA 1JQVA 2TSYA 3C61A 3OHIA 3P5ZA 2PC4A 3LDVA 2CZ5A 1H63A 3KVKA 3IVUA 4KFOA 3GNDA 1OYBA 4FNRA 3B4UA 3A23A 3W3OA 1PS9A 2E6AA 5FF7A 1FBAA 1ME8A 4UFHA 3E12A 4EVZA 2CFFA 4AXKA 1F6PA 4PL2A 3QW3A 1NFBA 3MP3A 3MBDA 1GOXA 4FIQA 4LC8A 3EKLA 2H3DA 4P61A 2A21A 1PL9A 3GB6A 4NZFA 3UXAA 4HKPA 3RLVA 2E5CA 3GR7A 4JYDA 3V75A 2FJKA 4UTIA 1XBVA 1IIHA 2GJLA 1DQWA 4XZ9A 1JJKA 4QAIA 3LCHA 4GC4A 2C3ZA 3MI6A 5FF3A 1LYXA 2AAMA 1PIIA 2VFEA 1ZNNA 2HTMA 3GLCA 3LOTA 2X1UA 1PE1A 3UWZA 1QDSA 5E93A 2JK2A 3SY5A 3UWYA 1VCGA 4NVTA 3HGOA 1MEHA 3W72A 5HWMA 4DF0A 2BXVA 1EUAA 3NQCA 3FYOA 1QAPA 1HG3A 1RZMA 3CC1A 3TFCA 3W76A 1W1ZA 1E51A 3N73A 3LB0A 4L4LA 5D38A 1O5XA 2HS8A 5AC6A 3K30A 2ZTJA 1VQTA 3BO9A 2ZRZA 3CTLA 1RQHA 3M16A 1Q45A 2VENA 3U8GA 3TCEA 2E09A 4TO8A 3W2LA 2FPTA 2V5BA 3KFTA 1JCJA 4W9TA 3S6DA 3G3MA 2YW4A 4YWIA 4KKXA 1AW2A 4OBTA 3W7RA 1K03A 2R91A 4AF0B 3NXFA 4UTWA 5K7JA 1ML1A 2V81A 1FWTA 1T8XA 1UB3A 1TPB1 5BMXA 3C56A 2NV2A 3L5MA 1WOBA 2VEKA 5KZDA 1TJRA 1XXXA 3HBLA 3UWUA 3RMJA 3VKJA 1KM3A 1R30A 4OE7A 2WO5A 4DF1A 4RXGA 5HINA 4WZHA 3FOKA 2QCNA 2C1HA 1I2NA 1DKWA 1YLVA 5AHMA 5K4ZA 2OT0A 1K8XA 4IWWA 4ICNA 2JKPA 2F84A 5CG7A 3UNDA 3A5VA 1TSIA 2X2GA 3PBVA 3C52A 3L9CA 3MI3A 5C6MA 2NV1A 3BPWA 3GVGA 1TYGA 4LUJA 3KRZA 2HMCA 3ABQA 3T7VA 3W1TA 3PULA 4MPQA 3N19B 1OVDA 3NM3A 4NJHA 5G2WA 1VR6A 1TTPA 3F4NA 1QNVA 2EKCA 3Q37A 4UFLA 5HUPA 1QMLA 1LTDA 1H7NA 3BW2A 2FLIA 3U6WA 3G0SA 1Q6LA 4JICA 3IGUA 3EX4A 1ZY9A 3E0IA 3NPWA 4WX2A 5HWNA 5G4EA 2C16A 4LVBA 1H60A 3W7PA 2Z0IA 4JTGA 4AWSA 3ZS4A 4GUGA 5F2IA 3N9RA 5FF0A 3P74A 4NJGA 1LOSA 3PC0A 2Q8ZA 4JDYA 4QIUA 5I3FA 1KFLA 3NYZA 3EWZA 3B03A 3MO7A 3LHYA 5TIMA 5G4WA 1O4UA 2CLOA 3HGRA 2CLIA 3LTYA 2B7PA 4K37A 2RDTA 2NX9A 1EP1A 7TIMA 3GKFA 4O10A 3PSWA 3WJXA 3DFSA 4H4IA 4LV9A 1TPH1 4GRSA 5LSMA 1MEIA 1YPFA 2ISWA 1FCQA 4FNPA 1W37A 1IXNA 3OIXA 3ZWSA 4FX8A 1SZEA 3W1LA 4LWWA 2WSQA 3HPXA 4DO6A 3HF3A 3V1PA 2Y7DA 2BZNA 2I9EA 3T78A 1QOPA 2X1SA 1JRCA 3UWVA 3L0GA 3P84A 4Z0JA 5AFDA 1C9DA 2E6YA 2OMAA 5LNUA 3FFSA 4MZYA 3B05A 3W6YA 4O0ZA 2FB2A 3P82A 4RXFA 4BR1A 3ZR4A 1W3IA 2RDWA 1TMHA 3LCFA 3O05A 4ZQRA 3W2NA 3QF0A 1SW7A 2OCZA 5I3IA 1A5BA 3ELFA 4Y90A 1OYCA 1J4EA 4RKAA 1WDWA 3MWAA 4ZQNA 1LBFA 3UQNA 3STCA 3TSMA 3EKZA 2ISSA 3SIZA 1AMKA 3L67A 5CZTA 1GVOA 1ZAJA 1LOQA 2VEIA 3S1WA 3VCRA 5CPNA 1KV5A 1LZOA 3MJYA 5CSRA 1SO6A 3EEGA 3HJZA 2VC6A 4C1LA 4GWEA 1G69A 3JR2A 5AHFA 5E1QA 1GEQA 1FDZA 3M1ZA 5D30A 1K3UA 3HQ1A 3HG4A 4BK9A 2BX7A 4BI6A 2ATMA 4LS1A 2A85A 4K7VA 2EHHA 3B06A 3O6DA 4R53A 1VJIA 5LNSA 5EPDA 2ABAA 4JX5A 1GPWA 1GT8A 2FPYA 1W54A 3VE7A 1MXSA 3DKJA 4JIQA 4LT9A 1FCVA 3S9YA 1HO4A 2V9DA 4G1KA 3FA5A 3LX9A 1LROA 4M7TA 4UTTA 5HQEA 3U2OA 2FTPA 2GOUA 2QDGA 3PS7A 1QPQA 3ABSA 1KFJA 2NUYA 1JRBA 3WJYA 2C15A 3NQAA 1OFDA 4JTKA 4M6QA 3W7MA 4FO4A 3C3NA 4ADUA 1I8JA 3QJAA 1RR2A 3BLFA 3EXTA 1ZHAA 4PL1A 3ANYA 3NPUA 4JTUA 5EY5A 4JEQA 2B7NA 3KHJA 3O07A 1TTJA 1XFBA 2ZZ1A 4JTJA 2CLEA 3S42A 3O63A 2BSLA 1FUYA 3W7NA 4OV4A
chains in the Genus database with same CATH superfamily
3LCLA 1JYXA 4WJ8A 2V63A 3P0XA 3PNUA 2W63A 1EJTC 1TPVA 3PZVA 1HN1A 1FP9A 1EC7A 3G1XA 4C7DA 3SN4A 3P7YA 3GH5A 3QMTA 5ECVA 3QY7A 3S6TA 1XKYA 3DGRA 1EKOA 4DXKA 1BYBA 3KAOA 3O6AA 4HPGA 4ZQPA 3ARVA 2YJQA 3CK5A 4GZIA 5LNVA 5EL1A 4RDWA 4GYJA 1JCTA 4H04A 3QKEA 4DPQA 4PUWA 3O6CA 1GQNA 5FL0A 4IG2B 1RD5A 1XGDA 2WQDA 2R24A 3GKAA 5IDZA 1TREA 1Q6FA 1JYVA 1VBRA 2VDHA 3K8KA 4IJCA 1XM3A 3VCCA 4CNSA 2P10A 1FWHC 3IS4A 2L5HA 2BG5A 3U2ZA 1ZAIA 3S8HA 4Z1BA 3WK2A 3EX1A 2ZZ6A 4H8NA 1UWSA 2A7RA 2PPGA 2V69A 5CBIA 3VZZA 3B0UX 1GJPA 1GKPA 4UTJA 3F5LA 3U7VA 1OINA 4NUWA 3C2RA 1J12A 2X30A 5AKQA 1EJSC 5CPSA 5FL1A 1GW9A 2IPGA 4S3GA 1Z6KA 1VS1A 1RCXB 4N02A 1I2RA 2O7SA 5C71A 1XYFA 3SADA 5FEXA 2YOCA 4WGHA 2W66A 3QV8A 4MB1A 3ARUA 1S1RA 2G97A 3WBEA 6XIAA 2QCMA 3W6MA 3TNOA 2XFFA 4MVAA 2DVTA 2ZICA 4WDTA 3A4XA 1T99A 4NKCA 4WJXA 3BJFA 3WBAA 4AEEA 1MXGA 3L4TA 2PF8A 1R3SA 4NAEA 3A6OA 1A53A 4R7WA 1KWKA 3O06A 2TYSA 3GU1A 1EZ2A 2ZWYA 4UTWC 2CU0A 3PUOA 5GJPA 2WKLA 5CJMA 5J04A 1KTBA 4L5ZA 1EPVA 3TTOA 4B9YA 4WDUA 5C9ZA 4GQGA 4N42A 4PR4A 4RNIA 3AICA 3PTMA 3UZJA 1H62A 2FVLA 5C8BB 4K68A 1FWRA 2C14A 3HPFA 3W2UA 3APGA 1CXFA 4Q4SA 4C6QA 1SFSA 3GZ3A 4IM4A 1J0ZA 5A8MA 3JVAA 4HZ6A 4O1AA 3W7HA 1N82A 1TPFA 1S3TC 3QH2A 1GVYA 2VOTA 1V02E 5BROA 8RUCA 1W3NA 2CLKA 1R46A 3DKLA 5LZLA 4C6FA 4O50A 1QO2A 3TN3A 4J3SA 1NFGA 3OTRA 3BURA 1HX0A 5D2YA 2VGFA 4A2SA 3B8WA 1QWKA 4MJZA 2ZZ5A 2DJLA 4GG9A 2RHGA 4IMFA 1M03A 3HA1A 1TJPA 2EGZA 1PAMA 2HROA 1JGMA 4LVDA 3TJIA 3URAA 1HUVA 2AQVA 3ONBA 4IJBA 2RKXA 4KEZA 2QCLA 3VC5A 1SO4A 4GBUA 4QM1A 3MSDA 2IKGA 3QC3A 5I24A 1I0DA 5GPRA 3FJ4A 1S2WA 1WKYA 2P50A 1P0EA 5CZJA 1ZGDA 1QJWA 1XLJA 2PAJA 4JFSA 3TV8A 3CAQA 3R8GA 1WE5A 2JGQA 4QS6A 4MDOA 2F6KA 2I57A 1S1PA 5A6KA 3EB2A 1NWSA 4RZ5A 7ODCA 4D6CA 3UJFA 1EL3A 4A8RA 3CL7A 2GQAA 2XVGA 4DZIA 3BLDA 3W1NA 1YX1A 2DW6A 2UY4A 3ZXWA 1H4PA 4TVDA 3T1GA 1UZ1A 3THCA 3O8AA 1WZMA 3FVMA 4B3KA 4JXCA 3TOYA 3NEVA 1KTNA 2VZTA 2G4JA 3LTPA 1V3MA 3RUBL 1FWFC 4L56A 3K8LA 5CCZA 1JAKA 3GBDA 3N34A 4G8TA 3W74A 5K3VA 4XD6A 2CLLA 4Z42C 1W32A 3WMCA 1EJWC 2HVMA 3KL5A 2O0TA 3GVVA 3KP0A 2HVOA 1M5WA 3WJSA 3W83A 3PJTA 3WEMA 2I56A 4X0VA 1HGYA 3QR1A 3OVGA 1V3HA 1WPCA 2YDAA 1X8FA 3R58A 5GQBA 3KS5A 2ZYFA 1DJHA 4KQNA 3GH7A 2Z6JA 4M81A 7ENLA 1YNYA 5FEZA 3WNKA 2X1TA 2PCEA 4UTTC 1IQ8A 4EXBA 1CGUA 1E1FA 4KGJA 4GZ7A 4H6QA 3I7RA 1BKHA 3HPAA 4UCGA 4ROQA 3WUFA 4NRSA 1VEMA 3PFRA 2QLYA 3W2KA 3MYOA 2VFHA 4NAEB 3VIMA 3TYAA 2HK1A 2P3ZA 3C0LA 2EPHA 2YZ5A 4GNVA 4MADA 5GJMA 4GINA 5EA9A 3UD6A 4BEQA 1OFRA 1JXJA 1H61A 1Q2SA 2WCSA 4Q8MA 3M9YA 3NCOA 1UMYA 3ATYA 4MWAE 3W84A 2EO7A 1HVXA 2VEGA 1KO0A 4FSAA 2Z29A 1OGBA 4FK9A 1HT6A 3VX0A 3PPCA 3G0UA 5HR7A 1PCKA 5E6YA 3JU2A 4CNUA 2XVPA 3S2CA 3MUXA 2PDWA 1JUBA 4EP8C 1EX1A 1ISXA 1ICQA 4K6AA 4NXSA 1TVLA 3B9OA 1O60A 4A8LA 4UNLA 3MB9A 3M5XA 1YQ2A 1F6YA 1F5ZA 5I23A 3T0DA 1HKIA 3TIMA 1LL7A 4FX6M 4O19A 3D46A 3NYDA 3RK8A 4WY0A 1TTIA 2CETA 3UNTA 4K2SA 1NEYA 2A3HA 4JX6A 1JZ7A 1FH8A 3PNZA 5ABTA 3RDKA 4GCXA 3LI0A 2PZNA 3TN4A 1DL3A 3C2FA 1SM9A 2PDHA 3KWXA 2NUXA 1UQZA 4LRSA 2OLHA 1DXIA 3LCIA 3GYCA 2PP1A 3SCPA 1XDJA 3WL0A 4FLRA 3G3DA 4V15A 5J5RA 3NQGA 3TH6A 5CG0A 2GLKA 4AD5A 1RK6A 3R43A 3AYVA 4XZNX 4Q8PA 3CMFA 4FNSA 4AIEA 2OYLA 3SW6A 3DN5A 2IQTA 4IP7A 2WV8A 5U7SA 3MYPA 4C90A 2EAWA 5K9DA 2YDRA 5D2VA 3ARSA 3GH4A 3MY9A 1PJ9A 3ISIX 3BC9A 4OIFA 2REQB 4IFRA 4M5PA 4YL2A 5K2ZA 4I90A 2OKOA 4JL2A 4BQ5A 4ZFMA 3DBNA 3H2MA 3F2BA 4DJFD 4M19A 5AYXA 2E3ZA 1FDJA 3PF3A 2Y7EA 2X41A 1US3A 4JIRA 1X1NA 1AK5A 5G5IA 3LNPA 1QO5A 3BLKA 1GVIA 1ZJIA 4Q8VA 3WFAA 1YPXA 4UXDA 4GIEA 3R0KA 5D02A 3GWQA 4JR5A 1W5PA 1SR9A 3V1HA 2OVLA 2VC5A 2A6LA 2ALDA 4XZHA 1R0MA 3KLLA 4DQWA 1ZRQA 2VDIA 3EWYA 1GHRA 3QM3A 1HW6A 1Q4WA 3Q65A 2V5CA 3OLDA 4UFJA 2OZ0A 4B91A 3QFEA 1GVSA 4A3QA 4KIRA 4PN2A 3SRKA 3VGGA 9XIAA 1A4LA 3FXGA 3TTQA 4FHAA 5EB8A 2PDFA 3M0HA 3W1UA 4JYFA 3OEXA 2O7QA 3WF0A 2WZMA 4US5A 2PEVA 7XIMA 2QR6A 2VXNA 2GSEA 4CQBA 3R11A 4U5IA 3T42A 3W27A 3CQIA 4DELA 3BG3A 3MZ2A 3PJUA 2VR4A 3AUOA 4V33A 1K9TA 5BRBA 1CI1A 4BZYA 3UCCA 1R7OA 4GABA 4YN5A 2RJGA 1R8LA 2Y89A 3O2LA 4W89A 4OT7A 4DJFC 1JZ5A 1KXHA 4I6VA 3U0HA 4AH7A 3L4XA 3RRAA 3B97A 2JALA 3LXCA 4HOWA 3ITXA 4ACZB 3PG9A 5G1YA 4F0KA 1K9DA 1KXQA 2J47A 2QT3A 3LPGA 3R10A 3ZSTA 1JPMA 4UIOA 1RY8A 3P8JA 3RN6A 1J96A 2QCFA 3OZPA 3UCQA 4OV9A 1XINA 1SW3A 1GZ1A 3XIMA 1T40A 1QR7A 4GIYA 3CZEA 1HKMA 3W7KA 2CZDA 2J13A 1FWSA 1IWBA 4GJJA 2BMBA 4H41A 3BVJA 3OGRA 1SUXA 4JY9A 3UWQA 3CAWA 3SGGA 4ZSUA 2QV5A 3HURA 1BEUA 3PZUA 5CQ1A 2J8FA 4PUDA 4Z2KA 4LY4A 3T55A 2G5WA 4HSNA 4LH8A 3CU2A 3ZR5A 3BLPX 2ZUTA 1ADSA 3TLLA 3LN3A 1BWKA 1E4LA 1R2RA 4AD4A 4EXQA 3O7UA 1BKSA 4Q8UA 1J6PA 3L68A 4O57A 3T08A 4AUBA 3GU2A 1DP0A 3GFYA 4P8WA 4A8NA 1XKJA 1E6ZA 1KFKA 2J6XA 3GNPA 2X8RA 2FVKA 3QXBA 3RM8A 3C0JA 3NL2A 3RX3A 1AD4A 4I5XA 2HXUA 4Q7BA 5C7VA 1JPKA 3LS9A 1FX6A 2O9OA 4WY0F 2Q01A 1TV5A 5M5DA 2BVTA 4JGDA 2R1NA 3M6DA 3BMXA 4NZJA 3W7DA 3BARA 4M56A 4C6EA 2F6XA 3DFQA 3A9BA 1JYNA 1QHOA 4PODA 4QAWA 5L9FA 1KD0A 3H53A 5C70A 4M8UA 1NDZA 5AC4A 1FHUA 1J0IA 3CHCA 1ZPTA 1Z3NA 5C54A 3AU2A 2QUUA 2HBVA 3LRKA 1P6WA 3B8TA 3IGXA 4FAMA 1ENUA 3URBA 1M7XA 4GE8A 3PY2A 4FLSA 3WF1A 5BZAA 2XGZA 5C9WA 2RDXA 4I5UA 1BG9A 2ZUUA 3P3BA 1LJYA 1O5KA 4XX6A 4ZQMA 1UD3A 2WZEA 1ZFJA 2PTWA 2DP3A 3DG7A 3HIJA 3NQFA 2VZVA 2WSRA 1X39A 4TOQA 4U5KA 3HPSA 3EWBX 1OT2A 2V2HA 1WKDA 4KPLA 1ODZA 3RCNA 4YTQA 1L8NA 3GAKA 1VC4A 3UP8A 3VMPA 4WIWA 2ALRA 2INFA 2J9XA 4POCA 3TQVA 1SZNA 2W91A 2J7DA 1GORA 1ALDA 4JX4A 3DIPA 3IUDA 1CZ1A 1XH0A 3GZAA 4Z2GA 1ZTVA 1UKPA 3KOWA 1I0BA 1AH4A 1VAHA 1VPYA 4OWGA 1WBHA 5CAKA 3B9EA 3UEQA 3FSUA 2BXYA 3LSBA 4JQAA 2C8NA 4JTEA 1QNPA 4PGLA 5A6AA 2GL5A 2PD9A 1W31A 2RFGA 3OBKA 5EMJA 4J3XA 4EF8A 5I3DA 3VD5A 4NNCA 1U5VA 3WD1A 1AQ0A 3BQ6A 4PBFA 4XAFA 3IIXA 1GVFA 5HK4A 4A4AA 4QNEA 5A8QA 4PA8A 1TJ1A 4ERAA 1RVKA 4LEQA 4HJFA 1VD6A 1YDOA 1TR9A 4H8VA 1UD4A 1TPDA 1B4EA 1G67A 3UESA 2V3FA 3WIJA 3ZT6A 1M65A 3BSHA 1J5TA 4PB4A 1IZKA 1RCQA 3H2NA 2VZSA 3CJPA 4A2RA 4L1WA 3CLWA 4LOCA 1BYAA 3S1UA 1XLIA 3DHFA 3QOMA 4PH6A 3VIHA 1K6WA 1OFBA 3WQ6A 4YTSA 1LLOA 2OLSA 3RGTA 1ISVA 1KM2A 5H2ZA 2O9RA 3TJXA 2GYIA 1B2YA 1Q6DA 3OVRA 3CZ8A 2J88A 3MA8A 1EYEA 4LCRA 4AZBA 1HFBA 1QHZA 1YDVA 1R38A 3CS2A 3TEVA 4HK6A 5I3KA 1IE7C 2XVNA 2GK1B 3G1DA 2HXTA 1NTHA 1KNWA 2CZFA 1XIGA 4RE0A 4Q6XA 3SQSA 5AC8A 4EIVA 2VQUA 1GQKA 2E4TA 2PCQA 3SO7A 3LV6A 4IUOA 1Q3NA 2BDQA 5EBUA 5C2GA 3WDJA 2ACSA 4N4PA 1TCDA 1NOFA 1NSJA 1YMYA 4QJ3B 1SMAA 2ANUA 3GHSA 3G1HA 5XIMA 3KOFA 4AYSA 3A4JA 1KLYA 5KEZA 2C0HA 2WMKA 3KOYA 1XJBA 2B81A 3CT7A 3QHNA 1E43A 3PUDA 3QHOA 4GO9A 2OLAA 1I2OA 1FWBC 5JUVA 2Y61A 3UT0A 1E9YB 1F7BA 4HCHA 4FF5A 2XN1A 3QYSA 6XIMA 5LNWA 4NT0A 2QCGA 3T0CA 4HNLA 4IOTA 5F1UA 1NELA 3A3XA 4J1OA 2PDNA 4YVVA 3PBGA 3ZZ1A 3GAYA 5E9AA 1GCYA 4IX2A 4KETA 2EQDA 4AX7A 1XUUA 5CGTA 5CZ0A 3E2SA 4LB3A 1DBTA 2AGTA 2OKTA 5M3WA 4IMDA 4QHRA 1V6XA 4V2XA 2GGGA 2WNZA 3T9PA 1IWAA 3H4XA 2DJXA 2X0YA 2XSXA 1GOQA 1O5RA 1TWSA 5E0FA 3CWOX 4FNTA 3EPMA 1ME7A 2Z2UA 2NZLA 1TV8A 3BLOA 5KITA 4XWUA 4F0LA 1IT0A 3ALGA 1G7UA 4B4FA 1ICSA 3CPRA 1J93A 3TYEA 3ATZA 1ZZMA 4UB9A 3TAOA 4RW5A 1R2TA 4KWVA 4UUIA 2P0OA 4IMGA 4XUYA 1UKTA 1UW9A 3NAVA 3W7OA 4ADSA 3H55A 3TC3A 2BP1A 3IACA 4S1FA 3GBEA 4NL1A 3TYZA 3VUSA 2QULA 3GW3A 1PX3A 4PMJA 4ZTXA 4NJKA 2F61A 4PCNA 4FNUA 4HYWA 3L0KA 1A5KC 2IKHA 3MTWA 4O1DA 1JI2A 2V3GA 1G6CA 1YXDA 3N4FA 4BWLA 3GDBA 3QY6A 3EWUA 3I65A 3WELA 1JCMP 3SCSA 3CV1A 3TW9A 4QISA 3SSJA 1HXJA 4N4QA 3APYA 1K7EA 3OA3A 4A6GA 1L2UA 2ZOXA 5AYBA 3KZSA 3TSBA 7CGTA 2IXUA 3FXYA 3SURA 1EFZA 1YXCA 1DHKA 2XH4A 1E72M 4PRWA 3SCQA 3EPOA 1WDRA 4K8EA 2OG9A 4FB7A 3OLIA 3I7QA 4JIPA 1QW8A 4IIDA 4S23A 1EIBA 1POKA 1YDYA 1I2QA 4Z1YA 3W71A 3DUGA 1ECEA 3WSUA 3M0ZA 3VMNA 4P2VA 1I45A 5CBBA 1CBGA 5GJNA 3SEPA 1KM0A 2YDSA 2D73A 3M0MA 1OD8A 1AH0A 3PZOA 3SJ3A 3ABRA 5I5RA 4LUIA 2ZRXA 3T0AA 3CL6A 3A22A 4Q3MA 1HQTA 3MO4A 3SBFA 1OG0A 1K8ZA 2W27A 1QT1A 2WJEA 1OEPA 3O0FA 1S5WA 3O16A 2CERA 1EDTA 1R85A 3W26A 2YXXA 2DZTA 3LCGA 2E9MA 1MMFA 1Z89A 5DEZA 1F07A 1KCKA 1M53A 1Q5MA 4JTDA 2WKJA 3DFNA 3ERPA 3VD3A 1VCVA 2I1OA 1DJQA 2J62A 3OW1A 3BCJA 1KRAC 4R3UA 4IH3A 4HNTA 4UQEA 1K4HA 3S3GA 4CN6A 3WQVA 4QEHA 1GQIA 2JFEX 5A8GA 1K7XA 3WH7A 3DBPA 2V82A 2WZTA 3AXXA 1JQVA 2TSYA 3C61A 3OHIA 4MSSA 4WCJA 3LDVA 3MKKA 1O7AA 4CD6A 2YLLA 3B8UA 2WMIB 3W3OA 5FF7A 1RK5A 4YYFA 4XBJA 1M04A 1QK2A 4P7OA 3KTCA 2ZVIA 4EAYA 2IUZA 2PWEA 1Z9AA 1E6PA 3QW3A 1NFBA 1P43A 3MP3A 5HATA 3E2RA 4AU0A 4UOQA 4FIQA 3EKLA 3LD5A 3UXAA 3RLVA 2WNWA 4JYDA 1KWGA 2FJKA 3L4ZA 1SMDA 3MS8A 1NOUA 4KF1A 2ACRA 1IIHA 2CHOA 2GJLA 4TQTA 4JAWA 4XZ9A 2C3ZA 5FF3A 2R6OA 2XIIA 1ZNNA 3GLCA 1LUCA 1XCXA 3UWZA 2Q71A 1H0GA 4WGXA 4NVTA 3HGOA 3W72A 5HWMA 1AVAA 4AC7C 1GKRA 3WQDA 2CBIA 3VFCA 1EUAA 2WBKA 1O1HA 4I8YA 3FYOA 1I75A 2OEJA 3WQFA 1EDGA 3CC1A 4S3JA 5DMNA 3UXLA 3ICJA 2CHNA 1B54A 1XX1A 3FN9A 2ZTJA 4M3PA 2G3MA 1MRQA 3CMGA 5HNUA 1TJ2A 3AHTA 1IEXA 3DC0A 3WDHA 1RQHA 2FTYA 4LUYA 4MMWA 5DQPA 3FDGA 2DSWA 2VENA 1A5MC 3SY1A 3WZ0E 3U3HA 2FPTA 3IANA 3MJMA 2NLYA 1PYFA 4YWIA 4GVFA 1AW2A 4LJ3A 3W7RA 3VOIA 1MXDA 4UCFA 2G41A 3VVGA 1T8XA 3WLPA 3CIVA 4D72A 3A4WA 1TJRA 3EB3A 4OE7A 5HOSA 4QG9A 4H1ZA 4IHCA 1DKWA 3M64A 4GPNA 4ICNA 2JKPA 1UD2A 2F84A 4PCPA 1ELSA 2OFJA 3BPWA 1D2KA 4LUJA 2VCAA 4GFIA 1WCGA 3EBVA 5CC3A 3VOFA 1OVDA 3NM3A 1VR6A 3B0YA 5I77A 2EKCA 1H7NA 3ARRA 4GK8A 3I3DA 3G0SA 1YW1A 4FLOA 5HWNA 2ESCA 2WANA 1H60A 1V0NA 1YRRA 4JTGA 1PYMA 2ZUSA 1JPIA 2Y2WA 3TR9A 1UKQA 2C71A 3N9RA 3N2BA 1XLMA 4HCLA 3UJ2A 5FF0A 1MUWA 1LOSA 4LQ1A 3PC0A 1L6FA 2Q8ZA 1KFLA 4W4QA 2VM8A 1X6NA 2P88A 3AISA 2DT3A 1O4UA 2RDTA 3E38A 1Q6CA 4GOAA 1TV3A 4EAMA 3GKFA 1EZWA 3WJXA 1TPH1 2CPUA 5LSMA 2PLJA 1FCQA 4FNPA 4CD4A 5B7YA 1IXNA 4FX8A 1SZEA 1YHTA 4KWSA 4LWWA 1TCMA 2ZE3A 3HPXA 4GQRA 4DO6A 3CTTA 3PZNA 3VGFA 3T78A 4W87A 4W93A 3L0GA 1P6CA 1EQCA 1EHNA 1C9DA 3ITGA 1E5JA 4GZJA 3FFSA 1SR0A 4RXFA 2GDQA 2R1PA 1SGJA 1BQCA 3W2NA 4R27A 3XINA 1MQPA 2GQ3A 5I3IA 3EWCA 3PUGA 3ELFA 4B5WA 1OYCA 1S46A 1J4EA 1WDWA 3MWAA 5XINA 3SAZA 1XIDA 5DANA 3L67A 3AMCA 4HHMA 2D0GA 1TWIA 1EC8A 4PMOA 4DUVA 5A6BA 3ES7A 5JXQA 4DZHA 1UWUA 3EOLA 2C1GA 1EJVC 3QGVA 2QPSA 5FJUA 3EEGA 5HAOA 1EJ7L 3PWIA 3HQOA 4KWUA 5E1QA 1GEQA 1FDZA 2AL2A 1K3UA 3VNMA 2ATMA 4K7VA 4V1YA 3B06A 4R53A 1ZUAX 2ABAA 4JX5A 3VDGA 3GUWA 4PMRA 3S9YA 2BY1A 2YL6A 4G1KA 2V9DA 2W4XA 3LX9A 4M7TA 1KRBC 5HQEA 2GOUA 4H9YA 3PS7A 4DJEA 3ZJKA 2FKPA 2NUYA 2EG7A 1XG3A 4EKJA 4P8UA 3WJYA 4JTKA 3UERA 1JIBA 2YXOA 1MNSA 4ADUA 3DG3A 4YU1A 3H6OA 4DAFA 1LWHA 1RR2A 4PL1A 2ACUA 3VZYA 2B7NA 1PUDA 3RLHA 3M0KA 3KHJA 3O07A 2X42A 1OM0A 4JTJA 3E74A 3CV6A 1KR1A 1CDGA 1HP4A 3EXSA 2WPGA 3AO0A 3KUMA 4OVXA 3W2MA 5BU9A 4N9EA 2QJJA 4IQLA 3V3WA 2VX5A 4XBKA 1QRQA 4INFA 2WJZA 1BSIA 1VFTA 2F38A 3KDOA 4MY8A 4QG8A 4FLQA 3B8DA 4G7EB 3ABOA 2I9UA 1B0IA 5GNZA 2CW6A 4F0SA 1OK6A 2X7WA 2Z1BA 2YIHA 1JD7A 3CQHA 5CZSA 3GXIA 3W1MA 2XINA 4JHMA 4QBXA 1U1JA 3F5KA 3KRUA 1EJUC 1F05A 1KFEA 4QEEA 4ZGYA 3WQOA 3M5YA 4PRTA 4HU4A 4MB4A 2YBTA 2OGYA 4MOZA 2R14A 5LHFA 3BG9A 1A0EA 2C6QA 1EXPA 4WDXA 1V03A 2CIPA 3DFOA 2G3IA 4LUTB 3CUGA 2PGFA 3W87A 2FFCA 4NQ1A 1OFOA 3N3MA 4DXVA 3REQB 3IJ9A 3IJIA 2B4GA 3OIHA 2BY0A 3VGBA 3CMJA 2XFRA 1H7WA 3M5ZA 3A5FA 5FJJA 1CYGA 2WHKA 1S5VA 4Q4PA 1ITXA 3LNMA 1A49A 4A22A 1E71M 4ZENA 4X0NA 3AIRA 3A9IA 3JZUA 3K13A 4Q32A 1TKKA 1L6GA 4HU8A 2A0NA 3TU9A 2J75A 1IZCA 2YSWA 1A5OC 1ZP4A 1KBBA 2ATSA 1W1A1 1HJUA 3IUIA 3LZ5A 4JTLA 1GONA 5EGRA 5EMKA 3NGJA 6PTDA 3GHUA 4I9TA 1ISYA 2OJPA 4HA3A 3QEZA 1B3ZA 1S38A 3KDNA 4W88A 2BWGA 1XRTA 3U9IA 4L7ZA 1FCUA 3DXIA 3QQ0A 4O8AA 4DWSB 5LIWX 1HKVA 1KA9F 1KW1A 3VIFA 3NJ3A 7PTDA 1TTQA 4W86A 4H7VA 3VOCA 3NZPA 3WF3A 3IVTA 3W1QA 4XZLX 4GI4A 1ZCCA 3WFZA 3WK1A 4MLRA 4PMQA 3PUEA 2YGYA 5REQA 1KLZA 2FZNA 2XUCA 4DY1A 2BVYA 2DZPA 3LGDA 1GVQA 1PVNA 1TPEA 4OOZA 2QUMA 3KTXA 2PWHA 3DENA 3PTQA 5MKGA 3PSVA 1ZENA 1MVYA 1V5XA 5D9PA 2HJPA 1KTCA 3FX4A 2ZFAA 1UOZA 3HMJG 2FB3A 3GIYA 4DF2A 4ATWA 1WOAA 4YHEA 4FZIA 2QPXA 2YL8A 4TX6A 3WCZA 3AAMA 2A6NA 3IK2A 1H0IA 4IL0A 3BW4A 2DT2A 4DWSD 1E73M 1VIWA 1UOKA 3W7CA 3DYOA 4ZTYA 3CEUA 4GVGA 5C55A 1BXBA 1VZWA 4H6KA 4C6JA 1I6NA 3MMUA 1V3LA 5DFAA 3ITLA 4E2VA 1WA3A 3LGEA 3DX5A 3TSDA 2Y5SA 1DWIM 1E1CB 4BEUA 1CGVA 1DV7A 3AMKA 4KWWA 1CT5A 2GFTA 1LQ0A 4HNUA 4UTHA 2UWFA 2WKGA 4AAJA 2XIQA 1ZP3A 1SZGA 1JL8A 4GD0A 2WHJA 3MCOA 4OECA 1XIBA 4B16A 4W8LA 4AHOA 8TIMA 4V28A 3T4CA 2QDDA 4B5XA 3EKGA 1X96A 2PDXA 1Q13A 2JIWA 1V51A 3EMCA 4MAVA 1QI3A 4PMNA 1V7YA 2NX3A 1XIIA 1TRDA 2I16A 3UW6A 4W7UA 3LQLA 3RLUA 1LRQA 1H41A 4S3AA 1AZ2A 3SB0A 4Y9OA 2GUUA 2WC4A 1OGGA 1R7AA 5D8ZA 3WLHA 1TRIA 5AECA 2XVLA 1LBMA 4UNIA 3U4AA 2JKEA 1TQXA 1P48A 3L5LA 3EWWA 4DWSC 5F4XA 1E0UA 1JZ8A 3S2JA 1CNVA 3PN8A 1J01A 2D1ZA 1P1XA 4RZ4A 2FH6A 2V67A 2JEPA 3BUVA 1BVNP 3CPGA 3AIUA 4AHPA 3FCPA 1FTXA 4E8DA 4JTHA 3BOLA 3H2OA 3RCYA 2PLMA 1I9CB 1W3KA 5AHLA 3KBMA 1RJRA 3S5SA 4WK9A 5JMUA 2UZ9A 1Y5VA 3C2VA 3NQ7A 4WRHA 1B3VA 1RQBA 1L6YA 1OZMA 3NDYA 4F8XA 2EG6A 2FQIA 4PCFA 2XIJA 4HP5A 3E0FA 2AAAA 3GXPA 2ZWZA 1BTMA 4F0RA 5AYZA 1M7PA 1VJSA 4U3AA 4R33A 1GVRA 2H3BA 1NDVA 3WLSA 2WYSA 4DJEC 4D1IA 1Z32X 4OGZA 1PB0A 3QW4B 4M6VA 4MKVA 2V5LA 3DFTA 4L61A 2G3NA 3V4BA 1IEWA 1R87A 3BOXA 1QU4A 2GSJA 4DBDA 3F4DA 4LVAA 4MUZA 3ZOAA 4DZ5A 1G1YA 1BYCA 2G96A 4FEZA 4NYYA 3K4AA 2VMFA 2CLMA 5D37A 2FGBA 4RNJA 4LU0A 2WZHA 2NQ9A 1XW8A 2CXEA 4I7WA 1PBGA 1VLIA 1NU5A 5H8MA 2QPUA 5IBXC 4ZE4A 1DJXA 2DZUA 5MKGB 3AIBA 2Z1SA 3LXBA 1A5AA 2FIQA 2Y8VA 2VX4A 3TW7A 1MW0A 5HNTA 1HL2A 4C1NB 4HBKA 1C29A 4JHOA 1OCBA 1W91A 3NM1A 4GO8A 4LSBA 3VIJA 3LTSA 4M0XA 4I7VA 1LP6A 1N7KA 4QJ5B 3TYUA 5LGZA 1GEHA 3G24A 2QCEA 4MNJA 2D24A 4GKTA 3B0PA 4RPQA 5LIUX 2YPIA 5JQ9A 2KZHA 4G6CA 2V8ZA 3N14A 1G0CA 1ONRA 1SSDA 1REQB 4IPPA 3KM8A 4RNHA 3KLKA 1R3VA 1E4MM 1XBZA 3DZ1A 1YYAA 2DSVA 3GXMA 4KH2A 3K5XA 1UZ4A 2OO0A 3KVMA 3VX1A 5ABFA 3T07A 1FHDA 1JI1A 3AZRA 2XHYA 3E6EA 4DVOA 4LBUA 1B3WA 4Y6GA 3GHRA 2GQ9A 4LCSA 2HRWA 4CU8A 5DRCA 3GC5A 4NX5A 4BCEA 1E70M 2XWEA 4IIGA 5GNYA 2RUSA 4DBWA 2P1FA 4C6BA 4HSOA 4UTLA 4XAZA 1CLKA 3KCJA 5MF5A 2DH3A 1XYZA 4GKLA 2O9PA 4AY8A 3TP4A 2GQ8A 2FH8A 4LGXA 1SVDA 4UFKA 3W02A 1LL4A 4CN1A 2G3JA 3STFA 4MTVA 3SCTA 4DWDA 1PTAA 1P4CA 1TQJA 2I7GA 1UKOA 2BOGX 2EJ1A 3C2OA 4F9JA 4IIFA 1OF8A 3BMVA 5EMUA 3WD2A 3BH4A 1JZ2A 1K02A 4O11A 2O4MA 4O16A 1OX4A 5CBJA 1KBLA 1HZYA 1UUMA 4URIA 3AWOA 4WSHA 4NY2A 3RU6A 2ODOA 2GJPA 1HTIA 3B8SA 4X3ZA 2BOFX 5A8PA 1UR3M 4PTNA 4LW7A 3G1VA 3L23A 3A3HA 1CLVA 4O14A 1VYPX 3W86A 5HXMA 2CYGA 4I9AA 1QI0A 1SFLA 1EQPA 4O0KA 5I07A 4B2DD 3AC0A 1DTNA 2JQXA 3SN0A 3T05A 1R5YA 2D20A 2QCHA 4L9YA 1XGZA 4HU3A 4PRRA 1W3JA 4CLMA 2VZOA 4JKMA 4J40A 2AKZA 3SUWA 3WQGA 1A4MA 4ENLA 2F2KA 3QOKA 2HSAA 4C6LA 1IF2A 5HPOA 2VFDA 3CQ0A 4IIBA 5HQLA 1XRFA 2Q8LA 2WWDA 4DPPA 1VRDA 3FYYA 6REQB 3VM7A 3AYSA 3TJLA 1W9VA 3GM8A 1G4PA 3TTSA 1B9ZA 1D9EA 1TUFA 2CBJA 2VOMA 5FEWA 3CPUA 4AY7A 4UMCA 8CGTA 3UG5A 4M24A 4YYCA 5BRPA 1SYTA 5SWUA 3L65A 3LHTA 3UFYA 1Q7ZA 1XRSA 2WPBA 2CLFA 1EGVA 1U1HA 4J3WA 2QZRA 1E4NA 3IWPA 1YE6A 2TAAA 1EGMA 3LLFA 4LX4A 1TV7A 1PPIA 2Z1WA 1CXLA 5D05A 1R86A 3W9ZA 3SGZA 1Y65A 2WHLA 3WMBA 3WK0A 1A5CA 3H4GA 1EBHA 5D09A 4RDVA 4QP0A 3IARA 2ZXQA 2PDGA 2E5DA 3AYTA 3VO0A 4EOUA 4REQB 4GH3A 3M4HA 2WCGA 2NUWA 2WQPA 3TQKA 4PB3A 1VH7A 3GR8A 1AZ1A 3ITYA 2YYUA 4LYRA 4GYKA 1LOLA 1EEPA 1GG1A 3GDMA 3OPSA 5TF0A 4IGSA 4R88A 5A6MA 3CUHA 4FR1A 4IPIA 3OBAA 2Y63A 1A3HA 1SO3A 1XL9A 4LF2A 3R4IA 3BW3A 2Z1KA 1CLXA 2OR2A 5DO8A 1PHQA 5ABFB 3UY7A 3TC6A 4ADTA 3NO5A 2D23A 4HTBA 4ZBCA 3GXDA 3VE9A 2QHAA 1LT8A 1G5AA 3TE9A 3TYCA 3ZVHB 1GQLA 4YMZA 1KGXA 2QF7A 3VPLA 2QUTA 1F61A 1E3ZA 1YDNA 3UF9A 3M44A 1TR1A 1GYLA 4X22A 3B0VC 3EZ4A 3M41A 4H9XA 4PZVA 1DEDA 1G4SA 5BYWA 5FOOA 3SCNA 1CECA 4L9XA 3CH9A 1TE6A 1H7OA 1FXQA 4ZOEA 1X6LA 3GU9A 2HVNA 3LRLA 4K7YA 1MSSA 3RAOA 3VAVA 3VOGA 4D6IA 1JULA 4AZCA 4QROA 4LF1A 2ZC8A 2XH2A 1O1ZA 2YCLA 4E5TA 4OZOA 3RYSA 3OLEA 4DHGA 5J5DA 5KTLA 3ZJ8A 3O1NA 1BG4A 3IV3A 3KW3A 2Z4GA 3V0SA 2V38A 1R47A 4ZQCA 3WK3A 3E2VA 4ASTA 3E1F1 3WJZA 5I06A 2C1IA 4HOXA 5FAGA 1H3GA 1X1ZA 3USBA 1NQKA 1F76A 4CGTA 1CX9A 1XIFA 1DTUA 4KCWA 1X97A 1US2A 5F4SA 1TO3A 1A5SA 3OODA 1IZJA 5HA7A 4ZB2A 4GUHA 3MVIA 4HU0A 1MWOA 3DHUA 3NQEA 1RQEA 4WXZA 2VJXA 3MQTA 4EPDC 3AHZA 1W3HA 3PPHA 3THAA 1KC7A 2EBNA 3EX3A 4CUCA 1TUXA 1N8WA 5AN7A 3S2NA 3KRSA 1W5QA 1C8VA 5H8UA 2WSYA 3QLDA 4JEJA 2OTDA 5HR6A 5KMYA 4GNKB 3S47A 5A5WA 2ADAA 3RR4A 1P7TB 3MHGA 5G2HA 2OELA 1GVEA 4FXFA 1PX8A 5L6UA 1EA0A 3O9NA 1ITUA 5A6JA 4LYQA 3WL1A 4NAFB 4YS1A 5A6SA 1JPDX 2D69A 1ZB5A 1TV4A 1XHGA 1BGAA 3B9NA 1B1YA 4H2CA 2V2CA 3DHPA 3R5EA 1A0DA 4E2DA 3KTSA 3C8NA 1D7KA 2DZAA 4CEUC 2PBOA 3MPGA 4TV6A 4FXSA 2NX1A 4GYFA 3L4WA 4YTTA 1TA3B 4BHYA 3WDPP 3BJTA 3H54A 4W7VA 3QQ1A 4DRSA 2WNNA 5IHRA 1QVBA 2OOGA 1WAUA 4TX9A 4L1GA 2JF6A 5CGMA 1V7AA 1I1WA 3H2EA 1Y5WA 2ZA2A 3DHDA 1YBQA 1BPLB 1LWIA 3W7IA 2XN0A 2P3EA 2HPMA 2WMJA 4GFSA 5A95A 5LIXX 4IJRA 4MFDA 1CWYA 3UVAA 1GPFA 4QJ1A 2HISA 3KBJA 4J27A 3TDFA 2JF7A 3T2PA 3W70A 2ZZ7A 1PZ0A 1ZAHA 4MKNA 4I7UA 4F0HA 4JCLA 3N2CA 3VCNA 1JNDA 1V02A 4Y8EA 2ZUMA 3B04A 1NOWA 3OQ8A 3OQEA 3N4EA 5T91A 2VR2A 3QTPA 2PDLA 3H70A 4L64A 3IAQA 8A3HA 1L6WA 2OXNA 1XWYA 1Z8AA 5GNXA 1FDYA 3SSZA 1AA1B 5BMWA 1OJXA 1DYSA 2Y8KA 2ZUWA 2PLCA 2FGLA 3NL6A 5AZ1A 1DIOA 2UY5A 4UFMA 1OG6A 2C91A 2GZXA 3ZJ7A 3W85A 4HT3A 1VFOA 3AQUA 2VRQA 2XM2A 3GTFA 1UZDA 2A4AA 4Z0SA 1IWPA 3NGFA 3MMWA 2VEFA 2P53A 2NT1A 1V77A 4PYSA 3O0KA 3R1ZA 1LBLA 3SCUA 1H11A 1F3EA 3FGCA 4EF9A 1ONXA 4PTMA 4MYAA 4FS9A 3AOFA 2XU2A 1OY0A 1W1TA 1WUEA 2YCLB 1W2PA 3THQA 1V6TA 1M6JA 3WENA 4AG0A 1MFVA 1UMLA 2J7FA 2D2HA 1D3CA 5AB3A 4JTSA 3QGKC 5A8NA 1XUZA 4BKNA 2OU4A 2ZZ2A 3WQEA 3W7JA 1J6OA 2V5KA 2CLPA 2EPOA 1FHVA 3D3FA 3W73A 1BF6A 1DHPA 4HZMA 1PHWA 2ZUVA 3N2XA 3H8AA 1UKSA 2X16A 3NOYA 2R94A 5HULA 2BHZA 2H8XA 3VIOA 4J2MA 4Q8TA 2Q02A 5PTDA 3KBVA 4OQVA 3G77A 1IT7A 2VDGA 2FGZA 4O1CA 4QRNA 3G8RA 3BTNA 4JNZA 4UR7A 2J24A 2ISVA 1J9YA 3I4EA 1WP6A 2XFWA 4O15A 5KZMA 4TMCA 3CAKA 2RDUA 1P0NA 3P14A 1X8CA 3UZWA 3CM4A 1C90A 4H6RA 4S3EA 3L2MA 4XZBA 5FCZA 3COTA 4WKFA 5FA5A 4IMEA 4TTUA 4DLFA 1F4AA 3AIWA 3EX6A 7REQA 3LK6A 4HMDA 2VFGA 2V6AA 4RE2A 3PWAA 3N2MA 4W85A 3NTYA 1V08A 2BXZA 2E77A 1N8FA 2HNEA 2YA1A 4GI6A 4HPHA 1B30A 3AHVA 1IEVA 1TPC1 3VNYA 4CD8A 4R7JA 4K3ZA 4KRUA 4AF0A 2NQJA 1AD1A 4H2HA 1XDLA 3FW6A 4MB5A 1C93A 4AEOA 1VYRA 1D8WA 3OVPA 3QHMA 4NF7A 1EF3A 1RH9A 1KM6A 1VCFA 2BBFA 3FA3A 4CNPA 4MWAA 2EG8A 3ZSSA 4D8ZA 2J6VA 2W67A 3QMRA 4RNFA 1KQYA 3SFKA 2VTFA 2NWRA 4ZMGA 3AMLA 2YR1A 3UG3A 3R7MA 2OX1A 3A24A 2BOEX 1YIXA 1H7XA 2C18A 1THFD 4ZL1A 3FS2A 3WLRA 3K4DA 2E68A 3JRKA 3PAJA 3TNBA 4UQDA 1QNOA 4IZGA 3MMDA 4ICCX 1ZLPA 1Y7VA 1N55A 4ROPA 4HA1A 2FVMA 3G1SA 3VD4A 5F2LA 3K4WA 1OF6A 3NQMA 3AMDA 4J3UA 3S5YA 4US6A 1OCNA 3APTA 4ZXLA 2BSLA 1HNYA 1ZSXA 5DELA 2VX6A 4WR3A 2PDBA 1DJWA 3TZFA 3BOFA 3LZ3A 3QKZA 1UR1A 2ZVRA 2J9ZA 2VUYA 3NDZA 4UMAA 1QPRA 5LYRA 1V6YA 3F4CA 5E6ZA 2YYTA 3VIGA 2BS9A 2GWGA 2ZXBA 3E96A 5FJIA 2VI0A 4O1FA 4IQEA 4A3HA 4XD4A 3URNA 2HK0A 3UVIA 2QCCA 4IFKA 2AOSA 3KE0A 4HMCA 1UR4A 4HPXA 3G0XA 1BF2A 3WNLA 3WLNA 1OYBA 4FNRA 6ENLA 5T9BG 3B9DA 4TVUA 4I3GA 4JKKA 3W37A 1EOMA 1C3FA 3U4FA 3UETA 1XYBA 4GVIA 4M6UA 1DWAM 1F6PA 4JN8A 3QVQA 3MBDA 4AXNA 3BAWA 2YKKA 4LC8A 4NP7A 4V1XA 1SJCA 2DVXA 3WBYA 3GNOA 1GGOA 4KIEA 2VX7A 1GOWA 1R3WA 4PULA 3GB6A 4IPNB 2XGIA 4NZFA 4HKPA 2E5CA 1VKFA 5I79A 3H2AA 2VD9A 3EDDA 2Q6ZA 4C6OA 5ABEA 1DQWA 4QAIA 1CPUA 1VFSA 4GC4A 3OZMA 1LYXA 4MG4A 4NZ4A 2VFEA 2HTMA 3G6MA 2X1UA 3EWDA 1RBOB 1WB0A 2VO5A 5E93A 3SFWA 4OJYA 1MEHA 4PMDA 4DF0A 3BE7A 2BXVA 3SUSA 2YB4A 4LUSA 1HJSA 3NQCA 1QAPA 4J3ZA 1HG3A 2DIEA 1E51A 3CZGA 5AC6A 4GI8A 3FV9A 1HVQA 4R5EA 4GYPC 4XAPA 4X61A 5B7ZA 3SJNA 3BO9A 1NH6A 3M16A 1QNQA 1Q45A 5CAHA 3TCEA 2E09A 1JCJA 1QW9A 3G3MA 4DJDD 1OGSA 4KKXA 3LG3A 3R94A 2W5FA 2J79A 4AF0B 3EMQA 3B8VA 2HBXA 8XIMA 1UWQA 5K7JA 4F2TA 1UB3A 3RM9A 5BMXA 4L4OA 3L5MA 2VEKA 1DIDA 5KZDA 1S2AA 3U57A 4B92A 4E6MA 4RXGA 5KETA 1AJ0A 4WHBA 4WZHA 3FOKA 3L7RA 3RPMA 4J2PA 1G01A 4IWWA 2WXDM 4BA0A 2WC7A 1TSIA 2X2GA 4PTXA 3P6LA 3MI3A 4DI8A 4KEMA 3KRZA 4G9PA 1RA5A 3ABQA 3PULA 1JD9A 5G2WA 5HUPA 3MUY1 2FLIA 1Q8AA 5FAJA 4ATLA 1LQAA 4YTRA 3IGUA 2TODA 3NPWA 3MZNA 2PMQA 5G4EA 3W7PA 2Z26A 2Z0IA 4AWSA 1RPKA 4GUGA 1CGTA 1TELA 1Q4NX 5F2IA 3QPEA 4Q4QA 1FKWA 1W9XA 4PFHA 1FHLA 3W29A 4QIUA 2Y8UA 3EWZA 3MO7A 3UA4A 1C8YA 3CAVA 5TIMA 4GCAA 4QE4A 3LTYA 2B7PA 1Q7MA 4K37A 1OB0A 4DJDC 2NX9A 4DM1A 4JOMA 1NFPA 4Z2JA 5DRIA 4LV9A 3VGDA 4OOUA 3SY8A 1E6QM 2DW7A 1HL8A 4IFKB 1W37A 3OIXA 4AX6A 3NUKA 1S2UA 1UJQA 1ZBCA 2PWVA 3CNYA 3V1PA 2BZNA 1BAGA 4OBRA 4IQDA 4JL1A 2INEA 5AFDA 1P0DA 2CCRA 4B3LA 4MZYA 1DPMA 3AIEA 3B05A 2FB2A 3ZR4A 1W3IA 2POTA 3LCFA 3WMLA 1AFSA 4ZQRA 4Y90A 2WLYA 2O4QA 4WVXA 3ZR6A 2FZDA 3WNMA 1XIEA 1QBBA 1OT1A 5CPTA 2ISSA 1UP0A 2IKIA 3IRSA 4WKHA 1AMKA 3VOJA 1GVOA 3AXIA 1BFNA 1LOQA 3VCRA 3TLQA 3EYPA 1PTDA 1UC5A 2ZDSA 4M1BA 4RPPA 3WLJA 4CEXC 4H9VA 1SO6A 4RE3A 2VC6A 4O0QA 4C1LA 1G69A 3JR2A 5HNNA 1LL6A 2FDMA 2XM1A 4GXWA 3PBMA 5D30A 1OQFA 1HJQA 4BK9A 2BX7A 5C9RA 1PKLA 4ZSTA 1VJIA 4M29A 2NQLA 1UWTA 1GPWA 2FPYA 3VINA 3VE7A 4LUSB 3DKJA 3FA5A 2DIKA 4U10A 1K9EA 1NWTA 3GTNA 1KFJA 2XG9A 5M2FX 4GGHA 4LANA 1MQRA 1VFHA 1A5NC 3WQPA 2C15A 2D22A 4Q4OA 4PSPA 3A3WA 4H8HA 1E3XA 1I8JA 3QJAA 1Y5XA 3BLFA 1BWVA 4PUNA 1ZHAA 3TQPA 3NPUA 4H8UA 3KRBA 3LU2A 4W7WA 5TBOA 3EWXA 4FOKA 2INZA 2VRKA 1QPKA 1E40A 3N11A 1JZ4A 5F2MA 4D6JA 2WVVA 4O8RA 1GG0A 5JBFA 2FHBA 3R0DA 1E55A 5D2WA 3HFTA 1WBJA 4YPJA 3I6TA 2CWXA 3RNDA 3M0JA 4JYEA 3N6QA 2Z6IA 2VZUA 4LS0A 2PBGA 4E3TA 4PEKA 4IMCA 3QSRA 2PDUA 2R82A 1VBUA 3THUA 1XSJA 1H51A 2BGQA 1QI4A 1PZ2A 2Q3RA 1DJGA 2VCCA 4XK2A 5G1TA 1E5NA 4D9PA 3MVTA 4OUIA 2E8YA 3GNXA 4HOZA 4X9SA 3N29A 5CSUA 4AMAA 4A3UA 3UXDA 2E25A 1KBJA 3BGGA 3NO1A 1GK8A 2PWFA 4WOZA 2GVGA 3FIGA 1AODA 4AQLA 2FZ8A 4HQVA 4UQBA 1M68A 1XLCA 1WDSA 3BGAA 3SUVA 1GTHA 4B5TA 4IF2A 4QNWA 1KBKA 4R85A 2VURA 3LQGA 2WVSA 1Q6OA 1XYMA 1E0VA 4F0MA 2ZADA 4XB3A 4J7RA 3H22A 2VGBA 1FP8A 3SQMA 2QXWA 1WDDA 3QPYA 5DMMA 3N6HA 5AHIA 1M41A 4D6GA 3QZEA 1Z48A 1OWQA 4IQJA 4M82A 2QIWA 4UTMA 3NZGA 4TUFA 3HM7A 3UPWA 3UZ5A 3TMLA 3N04A 3FHQA 1EYWA 3CIXA 3L4VA 2ZC1A 5BU6A 4KWOA 1TV2A 3L66A 5HANA 4RDYA 1FKXA 1IR2A 3L2IA 3AS0A 1QUMA 3QV7A 3S5ZA 1K1DA 2ISDA 2OSYA 1XFCA 4Q22A 1PWLA 3W75A 3VUPA 1A3XA 2QJMA 2OT1A 4C6CA 4DNMA 3CUXA 4XKYA 1LLWA 4PMXA 4QX4A 4WY0B 4Z2IA 4N9DA 3EDJA 3E9AA 4FXRA 4IIHA 2AMGA 2DUAA 3C6CA 1V79A 3NG3A 1V8EA 3MWCA 1R3TA 4Z17A 2E1WA 3WD3A 2W6RA 2A2IA 2OWWA 3VYLA 1T5AA 1X38A 4AVNA 4AIOA 1ZBWA 2P0IA 3AIQA 4AD1A 2J7EA 4I9MA 3IJDA 4HCDA 4JTIA 3OG2A 3LPOA 3P0WA 5D9OA 4ZQOA 4GHRA 2QNEA 2P5NA 3JW7A 2E9LA 2VGGA 4K39A 5HMEA 1G4EA 3E0LA 3NWRA 2Z2AA 4OFCA 5HUOA 3RHGA 1NWRA 4R7OA 1OIFA 3G6LA 4CU7A 1XI3A 1VEPA 2PZ0A 3WNPA 4CVUA 4DN1A 1O12A 4U28A 3ITCA 2ASHA 2Z28A 4P7LA 2E40A 1FA2A 2XJ7A 1EPXA 2X09A 1DE5A 5F1VA 1X7FA 5IM51 2G37A 5FACA 3HQPA 5K9CA 4GJ1A 1Q66A 3GDTA 2DUXA 6TAAA 1XQLA 2OZ8A 2PC8A 4XUGA 3RITA 3PG8A 1UWIA 1CIUA 1FQ0A 4CCCA 1IIGA 3LBMA 2PDQA 4NJIA 3MHFA 3GVWA 3OZOA 1J5SA 2YLAA 2I5IA 3DESA 1Q6RA 3IRDA 1L2QA 2UV8G 3AU6A 1VPXA 2PURA 3CGTA 3VKKA 3RO8A 4X2PA 4Y9AA 3PB2A 3DU0A 3I7SA 1M3UA 2PFHA 5T9CE 5HQMA 4FF7A 3ZMRA 3CWHA 4CKQA 4PMYA 1E6XM 3PBWA 3V18A 3V0TA 4TX8A 3WQWA 2ONEA 3W2JA 4L65A 1V3IA 3QGAC 3E5BA 2W3ZA 4XD5A 5C5YA 4WXYA 3B40A 3E3HA 7A3HA 1C7SA 3LHVA 3UA3A 3OU8A 2GVEA 3THDA 1NDYA 4P8XA 1H49A 3ONCA 2CWNA 3UY8A 3WUBA 1RVGA 2VFFA 1UPPA 4RR4A 3SUTA 1VENA 4PCTA 1UG6A 4ZO7A 5U4NA 2G0WA 5DXXA 1SJAA 4IT1A 5C9XA 2H8ZA 3VKBA 2O55A 1K8YA 1TZ7A 4DXXA 3KWSA 4MYXA 3FY1A 2HZGA 3IJ8A 2YCKX 3L12A 4TIMA 1EDQA 4IG2A 3GG8A 2J25A 4JN7A 5FJPA 3OVQA 2OEKA 4GQ0A 5DCDA 3LEPA 4QE1A 2C13A 2ZXAA 1V6UA 4FXJA 3NVTA 2ZTKA 2JGYA 1EF2A 1DWHM 3HO8A 1V0LA 4IISA 1SZFA 1UBPC 3GG0A 4F3HA 3AWNA 4ZE5A 1QOQA 4US5D 2GGEA 3RF9A 1XR2A 4ORMA 1BQGA 2V3EA 4L6DA 5FD0A 3BGJA 1L6SA 1OFPA 3CUZA 4JQ4A 4RLIA 2DFAA 1CXIA 3DEQA 2A3EA 2OZTA 4NNAA 3BAYA 5BOFA 3V35A 3LHWA 4XKYB 3WBWA 3SIMA 3NXLA 1HO1A 2QV4A 2GSHA 4Z1DA 1FWIC 1VFLA 3E5PA 4DM2A 1IGWA 3NR0A 2NWSA 1QFEA 4ZR8A 3O6YX 4GY7A 3OYXA 5I3JA 3EA2A 4ZOCA 3AXKA 1N2VA 4LBRA 1F2JA 3VNKA 2WSKA 1AUSL 4GA8A 3RILA 1ICPA 1NQ6A 1H2JA 1UIPA 1XRVA 5BOEA 3IVSA 1UWRA 4M7SA 3VILA 1HGWA 3FDKA 4EXAA 3LI1A 5D2TA 3NQ6A 2WC3A 3VFLA 4MY9A 2NSOA 1VYSX 2XDFA 4GQQA 2Y88A 4Q4KA 3W7LA 3RIKA 1DJYA 4UTUA 1LRTA 5D9NA 2HCVA 3WH9A 1Z7AA 2PUZA 3CUIA 2NVAA 1J0HA 1ME9A 2GJXA 4TU1A 1KV8A 4BF9A 9CGTA 4UC5A 3IIPA 3CZKA 1CCWB 1GW1A 3OZYA 4WF7A 4IUGA 4JQ3A 1JQXA 1RPXA 1U83A 3PZTA 3BZJA 1W3LA 2G3FA 3M0LA 3V7PA 2GDUA 1E6NA 3SGUA 5CLWA 4MNMA 4JTAA 4EACA 3EA3A 1H09A 3LLDA 4S3KA 4I5RA 4TVCA 2VC7A 2PDMA 1VHCA 3GNRA 4F48A 3I6RA 1ITQA 3BLEA 4JY8A 3FNDA 3EX2A 5TQLA 3SZ8A 5AY7A 2PDPA 4TXEA 1EHAA 4IXXA 4NIRA 1SJBA 4ZFCA 3S2LA 3N9SA 3MSYA 3ZT7A 2Z1XA 2GUBA 4ZVJA 4KESA 2B31A 3M0VA 2OB3A 2CHRA 2YL5A 2YX0A 3NQ8A 1MNZA 1LM1A 3DI0A 2F2HA 1KM1A 2QVHA 3EA1A 3PPFA 1HP5A 1WNOA 1KRCC 1YTEA 2QGHA 1VRXA 4DUXA 3BJSA 1ZL1A 2W61A 4KEUA 3P80A 1OADA 3GG1A 6CGTA 1JZ3A 3BDKA 1UUOA 3CHEA 3LGGA 4CQ9A 5EYWA 2I14A 3VM5A 2WMGA 2HPIA 3IPWA 4EPKA 5DT5A 2PTXA 1CENA 3LRMA 4XTDA 4XVDA 6ALDA 1CXEA 1SPQA 3PK7A 1M7JA 3BSMA 4C60A 4IPJA 3VMOA 4W8BA 1K7FA 4LY8A 3UR5A 3QC0A 5BXTA 2XIMA 5JIWA 3UWEA 3UZYA 4B15A 3SCVA 2NVDA 1EB3A 3FA4A 1J11A 3MW7A 4A3RA 2UY2A 4KMQA 3PZGA 5G2IA 2MANA 1XH2A 2W92A 2WBGA 1KCLA 3W00A 1BTCA 3A12A 4YCPA 4NX0A 4A35A 3L4YA 3VGEA 2PLKA 4DO5A 4O53A 3GDLA 5BRQA 1W1VA 4CQDA 2NW0A 5C2XA 5EFFA 1AG1O 3GR4A 2UBPC 4FOJA 3KL3A 5CEWA 4GY1A 3GFXA 4JD4A 2D2JA 3L4UA 4PC8A 5FF4A 5EFDA 3B8IA 1K4GA 2ZUNA 4CCZA 4IP4A 3I4KA 4E8CA 3JUGA 2IXVA 4N7QA 4WD0A 1G7VA 2XIBA 2ZCGA 4S2CA 5E0KA 2E67A 2CKRA 1WV2A 4ILSA 3W1AA 2AQOA 4K8GA 3ES8A 1G9HA 3RLGA 3Q67A 1S5MA 4OBSA 4RX0A 4RV8A 4W84A 3P5YA 3WO8A 4NU7A 3ITTA 1NWUA 4IGNA 1WXJA 3HMCA 3PBYA 3HB9A 4MIMA 1UR8A 1RJPA 1JPHA 4QQUA 4HTYA 1JUKA 3BANA 3F5JA 1JAEA 2ZKMX 4HMNA 1QW7A 1VGAA 1NDWA 5F7UA 2YW3A 4H01A 3TJ4A 5BNKA 3CLMA 3VABA 2POZA 2WM1A 1AW1A 5DBTA 5CPMA 2VRJA 2GJXB 4LB4A 3GRIA 5FF2A 1XLHA 1EO7A 3Q58A 4G7FA 4L9ZA 4CCEA 2XH7A 3NEHA 2IQDA 3ZO9A 3W24A 1U5HA 3QV6A 4JTCA 5E5CA 3PBUA 1R9XA 1QI5A 4D71A 4Q4MA 2WLZA 2PGEA 2PTZA 1RD6A 3VKAA 3IIZA 4WUIA 4A3YA 3DH7A 3PM6A 5D04C 2ZA1A 4MJMA 4N9BA 5FESA 3NSNA 3KX6A 4NZ3A 5AOUA 3TN5A 2NXGA 3GYEA 5ABHA 2E1DA 3FKRA 5MHBA 3HN3A 3HGSA 2VYOA 3MUIA 1PIFA 4FX7A 1LLZA 3O3RA 3GQYA 3LYEA 2R1LA 2DEPA 3C0QA 4Q8OA 2Y62A 3NZ1A 3UU0A 3TW6A 2F8QA 1KR0A 3TROA 3W1RA 1XIMA 3VDBA 4IGMA 2YXGA 3LXAA 4CQ8A 1XBXA 2GUYA 4CNOA 1TIWA 3Q94A 2NXHA 2BTMA 2PTYA 4GUFA 1M1BA 2PSNA 5IXEA 4RK8A 4A21A 1DJZA 1Q8JA 3AUJA 1IR1A 1YE4A 3WQCA 3AYRA 3C8FA 4DJFA 4Y9NA 4Z08A 1EWEA 2YZRA 3ANUA 3HGJA 2QJNA 4YWSA 2W62A 5AYIA 1GYNA 4UFIA 4E4UA 2E7FA 3INPA 4QQ3A 3BLIA 3VIIA 1KCXA 4FIRA 1Q85A 4IFOA 4NILA 4DYJA 3VNZA <