1HL9A

Crystal structure of thermotoga maritima alpha-fucosidase in complex with a mechanism based inhibitor
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
442
structure length
420
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAELPGYKWEFTRGIGLSFGYNRNEMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Thermotoga Maritima {Alpha}-L-Fucosidase: Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords PUTATIVE ALPHA-L-FUCOSIDASE
total genus 150
structure length 420
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hl9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hl9A01
2F7QA 2W91A 2RGMA 1XSKA 4K68A 2YBUA 4P7NA 1FH9A 2BFGA 2GVYA 3PHAA 3ARVA 4GQQA 1C3FA 3A4AA 4DO5A 3OA5A 1KGWA 3BSGA 3AMGA 4ACZB 4IISA 3AS3A 4M56A 2VVNA 5EMYA 1TFVA 1Q6DA 3LX9A 4URIA 2WKLA 1JDDA 2BY3A 2FE0A 2DSUA 3LPPA 2WLZA 1HKIA 1H2JA 1HNYA 3VNYA 3ZT6A 1MW0A 3VD7A 2YLAA 1NWTA 1UKOA 2E3ZA 1R7AA 1JZ7A 2UWFA 1Q6GA 1J0JA 1UKTA 2WVVA 3APGA 4P8WA 3KL0A 1SR0A 5A8OA 2PF0A 2XJ7A 3NSNA 1G5AA 3VDCA 1E6QM 2QMKA 2YL8A 1WPCA 5D9MA 2F61A 3BCFA 1HJWA 4EKJA 5HPCA 1QHOA 2V3DA 3MMWA 3RM8A 2BS9A 1W9BM 3OGRA 2BY1A 3W53A 1WDRA 3VIJA 3UCQA 1UG6A 3NIYA 4AZ5A 5DF0A 3D50A 3THCA 2XYLA 2G8ZA 1V03A 1KXQA 4ACYA 1FH7A 3POCA 1JFHA 3MSDA 5JIPA 3W82A 1H5VA 2B31A 2PWGA 5D8ZA 4F8XA 2WHKA 1XD1A 2ZXDA 1MQPA 3VIIA 1LL4A 3T08A 3WKZA 1TQVA 4V28A 2NT0A 1EO7A 1G01A 1V0MA 1QW8A 4UFKA 2WMJA 2WVTA 1HF6A 1HKMA 3WDQA 1RPKA 3ARWA 1NWSA 4LXFA 4PTMA 3EDEA 4TXEA 5A6AA 3SCQA 5BYWA 4CCEA 1BAGA 3LXCA 1NWUA 3AMDA 2JEPA 4MNKA 5AYBA 4ATLA 2YKKA 1DWJM 4F9DA 1GQIA 4AMCA 3DX2A 2EPKX 5GNXA 4J3WA 2Y24A 1OD0A 3MO4A 1B3ZA 5DO8A 1KXHA 4UFMA 3BXWA 1PPIA 4PMXA 4P7RA 1BLIA 3OLEA 4DWSB 4JL1A 2X0YA 5AC5A 4GINA 2W62A 1W9XA 5BCAA 3VGEA 1ZS2A 4X0NA 2E40A 3CUGA 3PZUA 4WJXA 4UR9A 4QAWA 1GOOA 4XB3A 1E6NA 4E8CA 3ARTA 3BVTA 2J8FA 5IFPA 3WL0A 3GBDA 1H4PA 3EBVA 5CG0A 3EJPA 3DX0A 4MAVA 3AYRA 3FY1A 2F2HA 4Y7EA 4LYPA 1JZ6A 2YA2A 1CXLA 1R33A 1PX4A 4DM1A 3VMPA 5FL0A 2BVYA 2XHYA 5BWFA 1HJSA 4C7FA 1UWRA 3CZLA 3WF1A 3DDGA 3DECA 1QHZA 4P7OA 5BROA 2J79A 1NARA 1U33A 1BQCA 1EQCA 3W0KA 1H0IA 2DEPA 4BS0A 3THDA 2CCRA 2DT0A 1JF5A 4IPNB 4ZEPA 3VM7A 3VDHA 2VUYA 1JG9A 4UOQA 4QLLA 1B3VA 3ARSA 4D6IA 3OLIA 4N0RA 2VO5A 3VOCA 2A3AA 1MW3A 1BFNA 1VJZA 4TTGA 1VBUA 2D0HA 3BAWA 5E09A 7A3HA 2OLHA 7TAAA 5CXPA 4WKAA 5BRPA 1WZLA 3GZAA 2VTFA 4NRRA 1GONA 2GJXB 4PCTA 2XGBA 3OGSA 2XIIA 2XFYA 4W87A 3AQUA 3EDFA 3A22A 3VUPA 5JBEA 4C7DA 1V02A 3PZIA 1V0LA 3W29A 4JFVA 2CPUA 5AC4A 4AW7A 4XZBA 1QI4A 2WWCA 1V3JA 3DHUA 4W93A 2EPNA 1C92A 1OIFA 4KGJA 1FHLA 3AHVA 3KWXA 1KWKA 3OZOA 4R27A 2QHAA 3CLWA 3E1F1 4J3SA 3AS1A 3MKKA 1PIGA 3ZOAA 1ITCA 4P8XA 1GOKA 5FOOA 3OLDA 3CHEA 3W6LA 4CN4A 4PMQA 1E70M 1R75A 4HMCA 1XH0A 3GH4A 5LA0A 1E0XA 1M01A 2EPMX 3SCRA 2G3IA 3NDYA 4PYSA 4LGXA 4TX8A 2ZWZA 5GNZA 3WBEA 3VD5A 5I23A 4JFTA 1HX0A 1B30A 4FNSA 3GXFA 4QDMA 1QI3A 4MNLA 1FHDA 3L4XA 1QWNA 1E9LA 2Z1KA 1UQYA 1GCYA 1HL9A 3VGFA 5DEZA 2FDMA 1C8QA 2XVGA 4MDPA 2CBUA 2UY2A 1V3LA 4AMWA 4QCEA 5BXTA 1UD5A 4CU7A 3GH7A 4LPCA 3G6MA 5ABHA 4OKDA 5FD0A 2X0HA 3RM9A 5HNNA 4JFSA 3GXTA 1QNSA 5HOSA 3SCNA 3U5UA 1I1WA 2VCBA 4HA3A 5M3WA 3WY2A 3ARQA 1JI2A 3GXIA 1FFRA 5ECUA 1HKJA 1M03A 3WEMA 4WKFA 2O9OA 2VRQA 4GZEA 5BXPA 2EPOA 5CJ5A 1I1XA 2CBVA 4D6EA 3FAXA 3D3AA 1AQMA 3IAQA 1L8NA 1JYWA 4AEFA 4MJ2A 4YN5A 5LYRA 4UZUA 4FLSA 2YL5A 1SMAA 3HZ3A 3ZR5A 3QHOA 1QBAA 3MU7A 1QNPA 3DYPA 2DPEA 2J4GA 1JNEA 4HTYA 1MWOA 1PBGA 3VM5A 2EAEA 3MANA 2FH8A 1HN1A 2O9PA 3OGVA 2QF8A 3WMBA 4PSRA 1B0IA 3VDAA 1BG4A 3K1DA 3FNDA 2EJ1A 5M5DA 1LF1A 4UOZA 2PI6A 1UWQA 3SIMA 2E4TA 4WLCA 1JXJA 2WM0A 4ACZA 1BGGA 3PN8A 1W2PA 4HZ7A 3LPFA 4BQ4A 1E56A 2DSZA 3L4ZA 1VENA 2PC8A 3II1A 1B90A 5JUVA 3LMYA 4CCDA 1C7SA 4HMEA 1JZ4A 2OWWA 1AQHA 1LQ0A 3BMWA 1B31A 1TA3B 4S3KA 5JIWA 1QI0A 2VCAA 5IXEA 1C8XA 3WEOA 3LRKA 3BAYA 2EADA 1EIBA 2C7FA 4LYQA 1HJQA 3TOPA 3WD1A 3RJXA 1R86A 2G4FA 3WY3A 5ABEA 1RD6A 2O9RA 1KBBA 3ZR6A 5HDRA 1BF2A 1B3XA 3BVVA 2DSWA 4PMUA 1GOWA 1E6XM 3VSUA 1OT2A 1KB3A 1RH9A 2X2IA 2WC7A 3QOMA 4CVWA 4EK7A 3PTKA 2BXZA 1Q6FA 1GNXA 1HJVA 2F7RA 2CEQA 1CXFA 3CHDA 4KH2A 5CGMA 3GM8A 3VIPA 2XM1A 2JIWA 3HG3A 4Z2KA 2HISA 5CZKA 1UA3A 2X2HA 3IGUA 4HA4A 2J7HA 1BGAA 4UNIA 1E6PA 1CTNA 2FYVA 4CD8A 4UQCA 2WMHA 2PBGA 2GK1A 4L4OA 3VD4A 2PWFA 3MMUA 2J7CA 2VZUA 2WHJA 2YA0A 3VTRA 3H54A 3AZRA 4OOUA 3VGBA 1KR0A 1DWFM 3WDPP 1B1YA 4GO9A 1J11A 3HU7A 5CPSA 1QW9A 5EFDA 1DEDA 5DT7A 4DWSD 2XM2A 4LQ1A 3CZSA 4CD6A 3AIEA 4AZCB 1ODZA 3T0BA 1CXHA 4IM4A 4UFJA 5EFFA 3BVWA 1E4NA 3RPMA 1W3JA 3A21A 3JUGA 4WIWA 2CITA 2HVMA 3VKKA 1EH9A 2E8ZA 2YDQA 4CD5A 3MUIA 4TOQA 3D4ZA 3N12A 3S2CA 1I75A 2E9MA 3CHFA 2QMJA 3BUDA 4DUXA 2D2OA 2WKGA 3ZSTA 5FCZA 5I2UA 4AYGA 3DC0A 1VAHA 4HOXA 4H7VA 3RIKA 2VI0A 5EB8A 4MB5A 5C8BB 4R5EA 3BUQA 5E9AA 2PWDA 4Z2GA 1EOMA 3WQWA 5I6SA 4UFLA 1U2YA 1H49A 1HKKA 1KR1A 2WK2A 2YJQA 1GQKA 4A3HA 2W92A 5E1QA 2XFFA 3GXMA 1M53A 1QPKA 4FLRA 1HP5A 3CO4A 1QWUA 1W2VA 3CZKA 4AD4A 1KTCA 4ATWA 1JI1A 2AAAA 3K46A 2IXUA 1Q6CA 4W8AA 4NRSA 2PB1A 4H8HA 4X9YA 1MFUA 1IT0A 4U3CA 3OIHA 5CLWA 2OSYA 1ISVA 3VPLA 1CEOA 3BUBA 3WNOA 3VU2A 4QLJA 1TCMA 4GO8A 3WY1A 1NOWA 4M80A 1KBKA 1UWIA 3N11A 4DO4A 3RILA 1UD3A 4FNQA 4PMZA 3ARXA 4P7LA 1UR0A 3I3BA 3SCPA 2WZEA 2DSVA 4P7QA 3WNMA 5A3HA 1XSIA 3W38A 4TX6A 3DX4A 1OINA 1ESWA 3VIFA 1BYBA 1US2A 3W25A 4OZOA 1R85A 2E9LA 4PN2A 2ZUVA 4KMQA 1E5NA 4BQ2A 1R7OA 4BQ3A 1WE5A 3AIBA 2XN0A 3I3EA 5AY7A 3PZQA 1ZBVA 1LWHA 3AIQA 5F7UA 4Z2IA 3N18A 1H09A 3GXDA 3UR7A 1C8YA 1J9YA 2WZIA 1DTUA 1A47A 3AJ7A 4AYSA 2BY2A 4UCFA 2ZUTA 2V5CA 2XIBA 4NF7A 2J8GA 3POHA 2BHYA 2VRJA 1C93A 4JZ5A 1CGVA 4AXNA 1AMYA 2OSXA 1LG1A 3WD3A 2X09A 4HPHA 1KXVA 1GVIA 4PMRA 5BRQA 2VURA 1R46A 4J28A 2CYGA 4MJ4A 1SZNA 3IJ8A 2XVLA 1Q4NX 1ITXA 2VZSA 4KRUA 3CUFA 1J0YA 2JALA 1SFSA 1M7XA 4A4AA 5C70A 2ZX9A 3ARRA 1CGTA 1OGBA 3O2LA 3WF0A 3S5YA 3TTOA 5M03A 1DWAM 2F8QA 4GI6A 3WQ4A 2UY3A 3GYCA 4AC1X 3L4UA 5ABFA 2WC4A 3M7SA 5IHSA 1VFOA 4OIFA 1EGZA 3EDDA 4HU0A 3EDJA 2BNJA 3ARPA 1R87A 2WC3A 2GJRA 2WVSA 3L4WA 4KRTA 3NCOA 1QI2A 1WAWA 1E3XA 2ZUWA 5A69A 5JBFA 1PIFA 1UR2A 1JIBA 2W66A 4PRWA 5I5RA 1TUXA 4CN1A 3CHCA 5DT5A 3DHPA 2WMIA 2G41A 2Z1SA 4FF5A 4OUEA 1TQTA 4CU8A 3A3HA 3B9EA 2VVSA 2O9TA 2J75A 2NT1A 5D4YA 2V3GA 1GVYA 1IZKA 3HMCA 3HG2A 4OJYA 1TQUA 5C71A 2DSKA 3WMCA 2BV9A 5E6ZA 4OOZA 3CBWA 1VFFA 3OZPA 1NP0A 3L4VA 4D1JA 1N82A 2QLYA 3PBGA 1JYVA 2WVUA 4W5UA 2WCAA 3VINA 4BA0A 5E0CA 2DIEA 1UASA 3EJTA 3U7VA 2V38A 4H04A 2V3FA 1CECA 1JYNA 2YFOA 1NWRA 4AZ7A 2X2JA 4J7RA 4JCLA 5A8MA 1UR4A 4RE4A 2VR4A 4PTWA 3KLKA 3WNPA 3AZTA 3PZTA 3GBEA 1NQ6A 2JFEX 3U7BA 4W8LA 2VT0A 1QI5A 4AEEA 1WP6A 3WBAA 3BVXA 5CGTA 3PZOA 3ZJ8A 3RDKA 2VL4A 4H8UA 4BQ5A 3CIVA 1S46A 3MS8A 6A3HA 4MDOA 1OB0A 2JIEA 3EJUA 3W37A 3ZJ6A 1J0HA 3UETA 3WDIA 4U5KA 1JD7A 2ZWYA 1LWJA 4JIEA 2VX7A 3ARUA 4H41A 2VNCA 4BZYA 1KXTA 1D2KA 3A5VA 4DUWA 3H53A 1U30A 3EJSA 1VF8A 3M46A 2WZHA 4IUGA 2YA1A 1XCXA 3DX3A 1DP0A 1MQQA 1K9DA 4ZE5A 1OGSA 1XH1A 4CUCA 2D24A 2D0FA 3MI6A 4UQDA 3IAPA 3QGVA 1FP8A 4LX4A 3QR3A 3HJEA 3GTNA 1TVPA 3T0DA 1OCQA 2VX5A 2DDXA 3SUUA 5A8PA 2VOTA 4PBGA 2WVVB 1KTBA 3WF4A 1B2YA 3ARZA 4LYRA 1E6RA 4AD3A 2J62A 1UWUA 1JNDA 1EHNA 4MB4A 1A3HA 1X1NA 4J27A 2YFNA 1TQWA 3WNLA 3T2PA 3CC1A 4FNRA 4V27A 3CZNA 3U57A 2VQUA 2GDVA 2WNWA 4U2YA 4D6DA 4JKKA 3WUEA 4F9JA 3K8KA 2DH2A 1BPLB 2D1ZA 3IJ9A 1W32A 2ZUNA 2VX4A 2YBTA 4HP5A 3MSGA 4WSJA 1CLXA 3BUPA 4QCFA 2VZVA 1QNOA 3GXPA 1BVNP 3U5YA 4JFWA 2X8RA 4BCEA 1W1VA 4CN6A 1J0ZA 3BGAA 4AD1A 1G0CA 2DGAA 3SUSA 3ALGA 4MAZA 4ZXOA 1V6YA 2CESA 7CGTA 3VILA 4XV0A 3WFZA 1ZL1A 1QVBA 2F7OA 2RGLA 1HIZA 3N1AA 2Y4SA 4UTFA 4FNTA 3BC9A 1GHSA 3KL5A 1MW2A 2GJXA 5A8NA 4MPKA 2CHOA 5I79A 1ZB5A 4XZWA 5A8QA 3UERA 2VR5A 1O6IA 3SCOA 1CPUA 3B9DA 3UESA 3WDRA 1XCWA 3WFLA 4W85A 3W27A 1UD4A 4WSKA 3D51A 4TVDA 3F5KA 3EJRA 4YHEA 1HWWA 3AROA 3K8LA 2DT3A 2OYMA 1US3A 4DO6A 1E43A 3NUKA 1XHGA 3AI0A 2WANA 1WZAA 3WDJA 2YIHA 3CH9A 1CLVA 9CGTA 1H11A 2IXVA 4AZGA 4TVCA 4B3KA 3BLKA 1F4AA 1CDGA 1TZ7A 3L4YA 4L4PA 1FFQA 3RO8A 1CIUA 3T09A 2XFRA 1UH2A 1OM0A 3OB8A 4D6GA 2WMKA 2PWHA 1JZ2A 5A6BD 1MVYA 1VRXA 2WW5A 4W7UA 2YL9A 4GZJA 4TTUA 3QHMA 4JAWA 4AY1A 5A6LA 1UH4A 3VIKA 1HP4A 1E15A 1JXKA 1E6ZA 3SCUA 4FK9A 3N15A 1G94A 2WAGA 4OGZA 3WQ8A 1ISWA 2J7FA 5IFTA 3MUY1 1WNOA 3F5LA 2NW0A 1MXGA 1BSIA 3AIUA 1CGYA 1ECEA 1J0IA 1QX1A 2CKRA 3EMCA 6TAAA 1UKPA 3UG5A 4PCSA 2Y5EA 3ZT7A 4PUDA 1TMQA 3WELA 4M29A 5BXRA 5FL1A 2WPGA 2XSAA 1WDQA 3BLPX 3I3DA 1P6WA 3LRLA 3KL3A 4CCCA 1VFUA 3SUWA 4Z2JA 5DMYA 3WQ6A 2CNCA 3LXAA 4A3YA 2WBGA 1GOIA 2WLYA 2D3NA 4UQEA 3WUBA 1UR9A 1ISZA 1FA2A 1BHGA 4M24A 1PZ3A 2C0HA 3TTYA 3VGGA 1GZJA 2J47A 1JFXA 4ATDA 2J7EA 1EXPA 3W4RA 1KCLA 1B3YA 1CWYA 3CV5A 3AXXA 1VB9A 5ABFB 4DUVA 4XUYA 4JKLA 3WD2A 3M6DA 3A47A 4HOZA 1K6AA 1DWHM 1CYGA 1UKQA 1SYTA 1AVAA 1UOKA 2XWEA 1UWSA 3AISA 2IUZA 4C7GA 4GIAA 4IPLA 2CHNA 1UZ1A 1HXJA 2WMFA 3PZVA 2EQDA 3OLGA 2CERA 3GDBA 1F4HA 1UD8A 1D3CA 3ZO9A 4W89A 1E6SM 4MB1A 1OIMA 3FW6A 1OT1A 4U3AA 1XYZA 2W67A 3AMKA 1V3KA 1K9EA 1VEOA 2PBOA 4ZXLA 2DT1A 3SCSA 1EHAA 3HN3A 2UY5A 3WNNA 1V3HA 3VD9A 3O6AA 3WMSA 1WZKA 3BSHA 2WYSA 1NOFA 2EBNA 1UWTA 1CBGA 1J10A 4EE9A 1DHKA 1NOUA 1PAMA 3FXYA 1TE1A 3AHYA 4RE3A 3WEZA 1TA3A 3EMZA 2XGIA 2FGZA 5I78A 2FHCA 4J3TA 1V08A 4U5IA 2UY4A 3ECQA 4E8DA 3VGHA 4Q22A 1E4MM 1QOXA 1KFWA 3EMQA 1J12A 3FHAA 2C8NA 1UR1A 3LPGA 2JF7A 3DYOA 4PUEA 4JFUA 4CD7A 2QPUA 3N9KA 2OW7A 4MADA 3SCVA 1ZJBA 2ZX8A 3BMVA 2ZX7A 1FH8A 3VSTA 1UA7A 2EEXA 4MNMA 1UQZA 1JAEA 2AMGA 2D73A 3RM4A 2E0PA 3HG5A 1R47A 2Q8XA 3VIOA 3AIRA 2J7DA 2OSWA 2DH3A 1OBAA 1UD2A 1W1TA 4D6JA 1W91A 3EDKA 1CZ1A 1UYQA 4FLOA 1BG9A 3IJ7A 4Z2LA 1JDCA 3BAKA 4B9YA 1HVQA 4MTVA 3IK2A 1NP2A 2GK1B 1LLOA 1UHVA 1JDAA 1IZJA 3BCDA 1LG2A 2XVNA 2YDSA 4D6HA 1W1YA 4E2OA 4NSBA 1LJYA 3WDHA 4YHGA 4FLQA 3MUZ1 1C7TA 3W6MA 5D8WA 4ZFMA 1VEMA 3UR8A 2XWDA 4WF7A 4HZ8A 3CUIA 1E1FA 3F5JA 2J78A 2BY0A 1WO2A 4B15A 1ODUA 3M07A 3N17A 2G3NA 4GZIA 1WDPA 3B8SA 4UFHA 2OYKA 4WK9A 4D6CA 1XH2A 3CMJA 4W5ZA 1JF6A 4NXSA 3W28A 3ARYA 2ESCA 3D4YA 4Q7NA 4D1IA 5D9NA 4JKMA 4PMVA 3MMDA 1E4IA 1UR8A 3GNRA 3LXBA 2F7PA 4N42A 1O7AA 3SUVA 3K8MA 1TQSA 1ZBCA 1ISXA 3VX0A 3TONA 4PTVA 1EDTA 1MYRA 3PZNA 5CSUA 4AD5A 1FOBA 3T0AA 4DM2A 1PJ9A 2WSPA 2EXOA 2X2YA 1E40A 2F1BA 4GXPA 2WCSA 3RJYA 4EAMA 5IHRA 2W4XA 3WD4A 5A6MA 1HVXA 3VIGA 5E70A 2A3CA 2G3MA 1CXIA 1H0GA 2ALWA 2BHUA 4MNJA 3WQVA 3VMOA 4AD2A 4JHOA 4CD4A 1QNQA 4PSPA 1Q6EA 3W81A 2YLLA 4J3XA 1W3LA 2J7GA 3B9AA 1JL8A 1RP9A 4PTXA 4QP0A 4F79A 1VBRA 1BYDA 2OW6A 1XSJA 1E73M 4D72A 2MANA 3W26A 5CPTA 2G3JA 1X6LA 1E5JA 2ZIDA 4AZBA 1J0KA 1HXKA 3ZQ9A 2QV4A 3VVGA 5E6YA 3L2LA 1W9PA 4D6FA 1W9DM 2VCCA 1CXKA 1RP8A 2CETA 2VX6A 3RCNA 3A6OA 1OSEA 3WH8A 5FKYA 1OD8A 1IV8A 5AYIA 2XN1A 4NZJA 1GJUA 3PZGA 4UQ9A 3AIWA 1EA9C 4J3VA 4FNPA 5CLTA 3WUFA 1W9UA 1H41A 2XTKA 3OBAA 3RMEA 1WDSA 1UKSA 4JHZA 4OBRA 4FNUA 5CSYA 2O92A 2ZUUA 4PEEA 5M17A 2GUYA 3IANA 2W63A 1AQ0A 3CZ8A 3VX1A 2XPKA 3A4WA 1JAKA 2E8YA 3GH5A 1KCKA 1CGWA 5A2AA 1E55A 2V5DA 2DIJA 1V0NA 1E0WA 3G6LA 1BYCA 3CPUA 1C91A 4M81A 3AMLA 2XG9A 1ZBKA 3GNPA 5A1AA 3BAIA 2IGTA 2XUCA 5BXSA 3WF3A 4B16A 3NSMA 1GQLA 1OWQA 2GSJA 2BVTA 3PTQA 4GKLA 1CNVA 3AS0A 3AHTA 4HPGA 1T0OA 3L4TA 3CMGA 1PEZA 1UD6A 3WIJA 3KLLA 2A3HA 2VZTA 1C90A 3N13A 1H1NA 4E4PA 4CVUA 1FP9A 3TV8A 4P8UA 1V6VA 5DFAA 2D23A 4QLKA 3T2QA 4BF7A 5JBDA 3WH6A 4KWUA 2A3EA 1V3MA 2WMIB 4HOWA 3HG4A 3AFBA 1MXDA 1GORA 2FH6A 2CIPA 4GQRA 3MUAA 1KWGA 1MW1A 1UUQA 1Z32X 1KGUA 1BTCA 3PZMA 3DYMA 3VIHA 2DQXA 3SCTA 1E71M 2J74A 4Z2HA 2QPSA 2VMFA 3NDZA 3O9NA 1CXEA 3TTQA 1EO5A 2ZICA 4QFUA 1XC6A 1EDQA 2WMGA 3FAWA 3SURA 4W7WA 1WZMA 2CBIA 1V0KA 1PS3A 1PX3A 2ZUSA 4S3JA 3BVUA 1XRVA 5D9OA 1BYAA 3QHNA 1EQPA 3BUIA 1NM9A 4HZ6A 1HJUA 4AIOA 1GHRA 5KEZA 1XD0A 3ZM8A 8A3HA 3UG4A 2ZUMA 2X05A 4NZCA 3AYSA 1HTYA 1QBBA 1V6WA 4B3LA 4U2ZA 1XGZA 3AOFA 4CKQA 1KQZA 2EABA 5TD4A 1HL8A 4B9ZA 3AMCA 4H8VA 3AZSA 2Y8VA 2ZE0A 2XVPA 1O7DC 3S5ZA 2BVDA 6CGTA 3NJ3A 2JE8A 3MV01 1J01A 1DWGM 4GI9A 3WSUA 2WXDM 4D71A 1EOKA 2OYLA 1LL7A 1DWIM 3ZSSA 2WB5A 2V3EA 3WY4A 3DX1A 1TVNA 1NH6A 3H55A 1WKYA 4UQBA 2F1AA 3SEPA 4TUFA 3BLBA 2ZXAA 3VIMA 1R8LA 4DWSA 3LPOA 2JF6A 2VQTA 1ISYA 1QHPA 4HU8A 1H3GA 3CZJA 1UH3A 2E9BA 3EJQA 5HXMA 3QOKA 5FIPA 1G1YA 3WUGA 4UOJA 5HPOA 3AHZA 1CGUA 2J25A 1GPFA 4PMNA 2XN2A 3W24A 2A3BA 1UZ4A 4KGLA 1BVZA 1V6XA 1B9ZA 5IDIA 2D22A 1G9HA 3CGTA 1D7FA 3TTSA 3EYPA 2XSBA 4PMYA 2EACA 2CXGA 3A24A 4FMVA 1KQYA 4UZSA 2FGLA 4M82A 3A4XA 5EBAA 3CTTA 4ML4A 2ZX6A 1SMDA 3PTMA 3TP4A 4RE2A 1JGIA 4NZFA 3AICA 1V3IA 4AISA 3PZ9A 3KE0A 2AOSA 3TA9A 1W9VA 4XX6A 3CUHA 4AMXA 1TR1A 2VC9A 5A2BA 2DT2A 2WWDA 1GUVA 5A6BA 5ABGA 4AZCA 3VNZA 5A2CA 2ZOXA 3GXNA 5E0FA 3A23A 2YDRA 3DDFA 1VEPA 1E3ZA 3N04A 1V6UA 5A6SA 1JYXA 4RL3A 2WCGA 2VJXA 3VD3A 3ZJKA 2NSXA 3FN9A 3D52A 1GQJA 4X0VA 2XVKA 2CKSA 3CZEA 2WHLA 2ZX5A 5GNYA 4JCMA 1B3WA 3T2OA 4AZIA 1JZ8A 5I0DA 2YL6A 1XV8A 1ZU8A 2FHFA 5LA1A 5GPRA 3WL1A 1M04A 2ZXQA 5A6JA 4AZHA 1KGXA 4NI3A 4W84A 3WQ5A 3ZIZA 1E4LA 4AZ6A 3AIVA 4AWEA 1LL6A 1WB0A 1JZ3A 2X1IA 1PX8A 2VRKA 4JL2A 4HMDA 3ZMRA 1E1EA 5D9PA 2EPLX 1J18A 1GOQA 3WF2A 8CGTA 3FHQA 1YHTA 2TAAA 4GI8A 4V2XA 4AD0A 3D5HA 2CBJA 1K9TA 5A95A 3AXHA 3WENA 1TG7A 2BXYA 2YOCA 4H2CA 3K4AA 3KZSA 4EANA 4PMOA 1L0PA 4W88A 5GQBA 2D0GA 2D3LA 3CZGA 3BH4A 5A6KA 4CU6A 1GJWA 2PWEA 4U31A 3WH7A 5HBFA 1ZJAA 2GFTA 2WSKA 1XYFA 2OWCA 4WKHA 1ZBWA 3AXIA 4P8VA 2W61A 3WH5A 3AS2A 2JEQA 5LA2A 2Y8KA 3NYDA 4J3UA 5I3DA 5I77A 1VFMA 3ZT5A 3L2MA 4W8BA 5CPQA 3GNOA 4CGTA 2WHMA 4AIEA 4PMDA 3VSVA 1E0VA 4MB3A 1MQRA 1K9FA 3KEHA 1MFVA 4UQAA 3BAXA 3AHXA 1YQ2A 3BAJA 4NX0A 1CGXA 2GDUA 4W7VA 1JZ5A 2WBKA 3UEQA 4F66A 2BHZA 3NSXA 5KZ6A 2J7BA 3WN6A 1E72M 3SUTA 3S6TA 4M1RA 1GOMA 2EO7A 1HJXA 4W86A 1W3HA 1Y7VA 3ALFA 1W3KA 4NXKA 5I24A 1VIWA 2GJPA 4ZENA 3OG2A 1VJSA 2VZOA 1V02E 4ZE4A 3VO0A 1QNRA 1JD9A 4TVUA 2FHBA 1EDGA 2F18A 4DWSC 4OBSA 4GPNA 3VGDA 3LRMA 2D20A 1X6NA 1R34A 3MV11 4UFIA 3UG3A 5A94A 2W5FA 4U33A 1WCGA 1PZ2A 3F4VA 4AIUA 2Y2WA 1W1PA 3VMNA 3ZJ7A 3J7HA 3WD0A 1GW1A 4YPJA 3WNKA 1CENA 1HT6A 3K4DA 1OGGA 3CUJA 3SCWA 2J77A 3VDBA 4M8UA 2ZXBA 4HA1A 5CQ1A 2OWXA 3WH9A
chains in the Genus database with same CATH superfamily
1KCVH 3E3QE 3OKOA 3HNVH 4JY5L 2YD1A 4WW2F 4QGTA 3FGCB 1T2JA 4PV1C 2RQ8A 3FEMA 3GB6A 3O6FB 4ZFQA 1JCKA 2R2BA 5I1KH 4K68A 5FHBL 3UZYA 4P7NA 4PRPA 5EG6C 2GVYA 2DY3A 2A38A 1CCWB 1ZTXL 2FO4A 1IAKA 5BV7B 1C3FA 3VWKA 1DVFD 3MLYL 1K3ZA 1P1XA 3KPMB 1ZT7A 2VLJE 3AMGA 2Z0BA 2WNGA 1A3WA 4NRXA 2XWBB 2FT7A 1OLZA 2BRRL 3LX9A 4BQBA 2FB2A 5E6UB 4URIA 4E5TA 4IS6A 1GMEA 3QSTA 1JDDA 2WSQA 4RNRB 2POZA 4JKPH 1UACL 3MRQA 3B9KC 1K70A 3GHRA 2FE0A 2DSUA 1N4XH 4XNUH 1DQQB 4K2UL 1U8MB 1HKIA 3EF4A 1F42A 4RIRB 3TNNA 3MV7B 1HCZA 3B2VH 2X6AA 1UROA 2XG4A 4HBQA 4ICWA 4X3ZA 1NWTA 5AQ0A 1DN2A 4XNUL 1OFPA 4LLUB 3DKLA 1KJ2L 3U1PA 3MP5A 2E3ZA 1N9PA 5H4ZA 2PYEE 2Q10A 3ABQA 1JZ7A 4G72B 2AXFA 2NX5A 4OV5B 3O8AA 1Q6GA 4U1IB 1UKTA 3GI8H 2JJVA 3QG7H 1M1BA 5E2WH 3EO9H 4PS4H 4IKNA 4N2LA 4ZZKA 3UCRA 1VZWA 3MV8E 5A8OA 1AJ7H 4B5XA 5IBXC 3C60D 1WPCA 5BRZB 5DK3A 2F61A 5J57B 2QZRA 4ALDA 3DHFA 2VN6A 5ECGA 3VWKD 1M4KA 5KBDA 1AGDB 4IGBC 4N0FA 1ZVSB 4U3XA 1UGNA 3TJEL 1WUNT 3UABA 1W9BM 3LM3A 1MH5A 4Y5XB 3NJFA 1KCRH 3RVWC 2F1EA 4W9GC 4F7EB 4JTAA 3R0DA 1KEGH 4PWHA 1UXSB 3DNKA 3NPZB 1UG6A 1WDRA 4AIZA 3C5JA 2H1XA 1XT5A 2DLTA 3HPLB 1P0DA 5AOKA 2ETWA 2XYLA 4CADA 1XR2A 4MA7L 1O66A 3QV9A 4OU1A 3HZYB 4D8AA 1DANU 1FH7A 4URTB 3POCA 3BP6A 3HBZA 1VADA 2CO6A 3QUML 5B3JE 1MFDL 4N22A 5IWLC 1H7PA 1X9QA 1JWSB 1R5VA 2ADIA 4K3HA 2B31A 4OTKA 5ISZD 5F9JB 1MJ7L 1XD1A 4D7BA 2A5UA 5CIPA 1MQPA 4H7CA 4MJJA 1IAMA 3T08A 3UBXI 2PDJA 2C1PA 1R9FA 4LL4A 3WKYA 5EU3B 4L9YA 4I2XE 4PJ8C 5ITFB 3WAJA 1V0MA 3IJDA 1FH2A 3QRFM 3C75A 1MN4A 4ONVA 4D9QE 2N1KA 2PYFA 3M5VA 3KVQA 2PCQA 5EYWA 3WDQA 1SXCA 2XQBL 4YHYB 3R94A 4YHKL 4DPQA 5G4OA 3SSGA 3WKPA 1RPKA 5MKGB 3ARWA 3UVAA 4LXFA 3KPRB 4O58H 3TN0B 4HETA 1KV3A 1IGTA 2OM5A 2Y7GA 1KCSH 3GG7A 1OF2A 2AXJA 2EC9T 3I6LD 4PJFF 1J5OH 1PYMA 2ZPKH 3MLZL 5A6AA 8FABA 3SCQA 5KSAD 1TJPA 2XZQL 3KLHD 1SJEB 2IPWA 1HS6A 1QU4A 4JDVA 1BAGA 3TLQA 1NWUA 1Y5XA 3LN5B 2CK0H 2JEPA 3LMZA 1KNOB 4MNKA 2YKKA 5AYBA 3WOVA 2CR3A 4I5RA 2YSSA 1EHXA 4Z1AA 1FVDA 1LD9A 2H32H 3O3UN 1QBLH 4ONOA 4M1CC 1N8OE 4ZPVA 3UDWC 4EI5B 5E1HB 2A6LA 2EPKX 3P84A 8TIMA 2JFCA 4NRZB 3L3DB 4OGYH 1W54A 2Y24A 5FI8A 3MO4A 3I6KA 4P2RB 3PGFL 4KI5C 3TBCA 3NH7L 5DUPL 3BXWA 4PGCB 1PPIA 2V9UA 1HXYA 5F8RC 4PMXA 5EGRA 1ANUA 1QSED 1HESA 2CXKA 4Y9MA 5DRWA 1RIVH 4DWSB 1FX6A 4GINA 2O0TA 5FXCH 5IMOB 1IFHL 2C3GA 4X0NA 1IGFH 4NQDD 4JM2A 4YEEA 5AB1A 1XBZA 1XIBA 3CUGA 3MRHB 4WJXA 5IRPA 3VSQA 1QABA 3SRFA 2XT1B 2H2PC 4AYFB 2N4IA 2JTYA 3JWOH 3M43A 4XB3A 3KNBB 4CNIA 4E8CA 3OKMA 4F2FA 5KSVB 4PUWA 5L9DH 4HXBL 3GMPA 3S3GA 3WLHA 4DP9X 3UXFA 1H4PA 1YY8B 1ZT1A 4I4WA 2YAQA 3EJPA 4MAVA 4HWUA 3KS0J 5KSAA 1KFCA 1GZ1A 2R82A 4ODSH 3AYRA 4JYEA 4QG8A 3V1PA 4EACA 3S5SA 4Z7UF 4HBCL 4KJYA 3VI3F 5DD1L 3WLSA 1IAOB 1ZLSH 4DM1A 3S4SB 3VMPA 3MHGA 3EX3A 2GUOB 4MBOA 2XHYA 5BWFA 3WTYA 3S36L 1TG8A 2P42B 1A0QL 1IT9H 1GCFA 2P48B 2I5QA 4HH9A 3MO7A 1D2PA 4O1FA 3A13A 1NY1A 3RRAA 3DDGA 5L2KE 4KO6A 3ORWA 3WTWA 4HFWB 5E5RB 4KV5F 2ZUYA 1DIKA 3N44F 1SBBA 1IKOP 3BSZL 4QOKD 4B9CA 1R4XA 3CUXA 2FUQA 1CR9L 1BQCA 4HG4J 3LN3A 2BOBB 4PFHA 4ODUB 1H0IA 2G2RB 2G4GA 1T7LA 4TKWA 1F5WA 3BJLA 3SSJA 5FM8A 1G0DA 5IQNA 3TBSB 4CNNA 4HCFA 3HR5A 5IY5B 2ZSVA 3ZDXF 1FL3A 2C3HA 2VMEA 3QJRB 1ZHNB 4G1MA 3AQDA 3VM7A 3WLWD 4IPNB 3THAA 3T1WA 4ADUA 4WTQA 4N0YH 3KBHE 4GRMB 3SOBH 3UTZA 4OZIB 2AERT 5K69A 1B3VA 1XYMA 4HJGB 4MNGE 1KJ3L 12E8H 2EDLA 4JDEB 1CUOA 4QRRD 3V6OE 4U4IA 1T0MB 5EO1B 1MW3A 4HK3J 4GNJA 3LNPA 2FPVA 4TTGA 3US9A 3SGGA 3PL6D 3G7TA 4YSQA 3S37L 3H2EA 1EHLH 1R3JB 4QRRE 3NJXA 4MWFA 3UOAB 3V9CA 5I30H 1M41A 1Y0LA 4DKAA 4WKAA 3BIKB 1LQBC 4KUCD 5BRPA 3WS6C 3D85B 1T0NB 4Y5VB 1TZIB 4HU3A 5TIMA 1S7VA 3VXRD 3VXUD 2W0FA 3C08H 1ZNNA 2BP3A 3DTUB 4XRCA 2PSNA 3QJVB 4BQ9A 2QGEA 1WA0X 4RDBA 4X6FA 1YEFL 3L1GA 2XGBA 4A3RA 2J2ZA 4HSOA 1SJHB 4UAOB 1KM6A 1YNKL 2PTVA 3G6DL 3K1KC 5ID0B 5LNGA 4RFEA 4X5XA 4DVBB 3GS4A 4KDTC 4F7CA 4IXHA 4KXAA 3VCRA 3QCUL 4F2MA 15C8L 5CP7A 3VUPA 4UB0L 5IHZA 1YJDH 1HQRA 1TJ0A 3KYAA 4K1WA 4UF7C 5FAJA 4JVWA 1TZ9A 3Q2VA 1GTHA 1NCDL 2ZTJA 2CHDA 1B57A 4K71B 1AD4A 1ONXA 5AC4A 5IROD 4P2RD 1TZ8A 3G9VA 5TFSH 2QPXA 1FC2D 5H94A 3N5AA 3ARGD 1UQSA 2JKWA 5LXEA 1B3IA 3MXVH 5JHDE 2AK4D 4KRZA 3FB5B 3HAEG 5F21B 5IFJB 4ODHH 3DHUA 4MMZC 3Q5YA 1TZHB 4NZTH 5KVGH 2V5BA 2CK2A 4N6FA 1CWVA 1LILA 1KWKA 3OZOA 4K5MA 3LKSB 1SPQA 1VBHA 3BUYB 1I9IL 5SV4A 3EIFA 4EOWL 1FVEA 2XUWA 1Z0NA 2VWEE 3FU5A 4Y16B 2NX5D 4G5AA 5HHPB 2MHAA 4EE2A 4ZG1A 3AS1A 3GUWA 1PIGA 1PE1A 3LTYA 1OW0C 1SVCP 5FOOA 3FTXA 4FKKA 4L8SB 5JIMA 2WJ7A 4XCCH 5IW1A 1J4EA 1BFOB 2F54D 3G18A 1S39A 2J1XA 1Z9NA 2A0LD 4WY7L 4H2HA 1XF5B 3O8XA 2YGVA 4K23H 1RBOB 5LBSH 2ACQA 3CHVA 4OZFA 4TUKH 5IOPA 2LAGB 5FF6A 3WTTA 2APFA 5KVFH 2FO8A 2EPMX 3QG7L 4OZIF 3SCRA 3ONCA 4LU0A 2C0AA 4PYHA 1INQB 3SKJH 3R8RA 1U8IA 5CP3H 4PYSA 4ZI8A 5B39A 1S6NA 1K8DB 3ECUA 4TX8A 4LAMA 3VFTA 4RDWA 4ZS6C 3ITXA 3UVIA 1ODAA 2FCBA 3NN8A 4IRSA 2NQ3A 4X8XA 3RGVB 3L3KB 4KTDH 1KCSL 2WGNB 2O5ZL 5I18L 3O4OB 4YXHL 4QHMB 4F1SA 3LRHA 1JRHL 3I6RA 1F3EA 2GTZB 4DY1A 5F7EH 3SDXF 1DJHA 2AQ3A 4JTJA 1DJIA 3LH9A 3V7MA 3T3PE 1FCVA 2CWXA 3AXKA 3KS6A 2NY1C 1LDPH 4MWAC 1KENH 1HH6B 3FT1A 4X8GA 4R96A 1IKFH 4QJ1A 1MVFA 1FFTB 2NLIA 3VZZA 3W7NA 2IADB 4GS7C 4LVNC 1P0SE 3LB0A 4H0LC 4HC1A 2OXHB 5KW9H 4H20H 5K93A 2XIDA 1T1YB 4N8VG 2XTLA 2QGHA 2G3XA 4UTJA 5H37G 3H7BA 2F54A 5DHVA 4DP1X 1A4JB 1QQDB 4RAVB 3GNXA 2CBUA 3GJFA 1B4JL 4L8BA 3AG1B 1BW8A 1NLBL 2BP0A 3N43B 1UD5A 3WUWG 4HWEH 3GH7A 5IEHA 4LPCA 3LZ3A 2UY6B 3IMVA 4H4NA 1IM9A 5IFAL 1M9WA 1IC4H 4AIBA 4AVFA 5ABHA 4OKDA 1XGTB 5JW4N 4HNOA 4U1GC 4C8XA 2X0HA 1B54A 3QWNA 1SFHA 5G5DA 4QWWD 5B8CC 4LLDA 4FFZH 4JFSA 4M3JA 1NUFA 5TGBA 4JTFA 1ZHLB 1P0KA 2E6DA 4JY6B 3HJ0A 1KV5A 3SCNA 4GFSA 1HHHA 6TIMA 1G7JA 1E1CB 2V33A 2GIXA 2V8MA 4PJ7A 4P2YA 5JIKA 4B9GA 3LCYA 5FM4A 1LQAA 3WLKX 1FFRA 2R29A 4O4YL 3C60C 5F7DA 5SX4I 3HW7A 1JJUA 2XV0A 5ITBL 3SDAA 1IEQA 3BT0A 2JGQA 3L3HB 4PWGA 4QRNA 4HIJB 3RGTA 3W9DB 4XXWC 4PJAA 4HUUB 4GG8A 3VB9A 2AGJL 2FZ9A 3QFJD 3KGRA 4A55A 1I1XA 1UP3A 1W17A 3KDMB 2F8XC 1MLCA 3FAXA 4JQIL 4J5NA 1AQMA 1DQXA 4ILSA 4M48L 3TVMC 1TTBA 3MV9B 3NABH 1AGCA 4OF3A 2X28A 2IVFC 2QVNA 1XLLA 5IG7A 1WBYB 3QDJD 2HJLB 1EPFA 5I17A 1VFAA 2MUCA 3T77B 5HYSB 1A9EB 1QNZL 4JX6A 2DLEA 3TPKA 3WSQL 3SKOB 4YN5A 4MIMA 3WLOA 1C5CH 1ETJA 1NCGA 1JUBA 4O1EA 3ARDC 2PCPA 2DY2A 2J8UA 5LGYA 4XNXH 3PFQA 3SYQA 1EZWA 3DTXA 1S3KL 1SMAA 4YXKL 4X80L 1N2VA 4KNUA 3K5XA 4YHLL 5PCYA 4KKBC 3RAOA 2QQNH 1ZP3A 5E6IB 3ZR5A 4M7KL 2IBGA 3QHOA 3QKZA 3KPRD 2G37A 1S3HA 3WIAA 3ZDZB 4GCAA 5E56A 4RX0A 4Z5RB 1FVCB 1RQ5A 3FH8A 4ICXA 4KUCF 4P3DA 1SSDA 3I10A 5HNUA 4CCZA 3JUYA 2C1IA 5HYJE 1JUEA 1ZRUA 3RB7A 1A3RL 2Q9OA 3N50A 5EBMA 4WR3A 1HN1A 4IKJA 2I14A 4KVCL 4LJ3A 4LCYB 3SDAD 1VCGA 1Z9OA 4K7FB 1L8PA 5JYLA 2WJZA 4QSFA 4W9IC 4ZXBD 1G67A 3ZLQC 4BKSC 5ETUA 5GS0D 3EYQC 4OY9A 1LNUB 3WMBA 3QULA 4EIUA 2AAVA 2BVQB 3RPTA 3QUYC 5CNHA 2YX0A 5AZ1A 1DDHA 1LF1A 4WUKL 3N91A 1M6OA 4C1NA 4H8WL 4PTTB 5FJTA 4OZHB 3TYGH 2NZLA 3QNYA 5CR8A 4QYOB 4HYWA 3VXSA 4FABH 1LXMA 4A66A 4PJIA 1XEUA 4P5KB 1ZAJA 3GNDA 3D2UD 5LLIC 1NCWH 4WUUA 4HZ7A 4LB4A 4J40A 4ROPA 3WKQA 3GZQA 4GKNA 2NY4C 1BRLB 3EPNA 4BQ4A 4KU1A 4MRCA 4R7DB 4JPVL 4CSPA 4YVXA 4NAEB 2X44D 5I1DA 2ZKHL 2DSZA 4OSUL 2FIKB 5D2NB 4FHJA 1AC6A 1VENA 5JDSB 4AG4H 3II1A 4Y0GA 5EEWA 3LKQB 2PC8A 4CL7A 2KZWA 3UPMA 4HMEA 2ERJC 1JZ4A 4MJHA 1I3UA 4LDLB 1YTDA 1W16A 3ZJAA 3US0A 5ICXA 2IPGA 3H9YA 1G4EA 3RI5K 4OSUH 1TA3B 2GJNA 2KH2B 3IDNA 4BF5A 1Z89A 2APVA 1UCBL 4FI8A 4GUQA 4O2FB 5G4NA 4BRVA 4AYMC 5JMUA 4GG6A 1A1NA 1YECL 1EIBA 4NPYA 3UAFA 1DYSA 1Y6KR 3RWFB 3N29A 5DRCA 1YMHA 4LYQA 5A5WA 3G04B 4PW4A 4XZLX 3N2TA 3FQYA 3OHXC 1RIUH 4KROB 4CC1A 1OLLA 4GW4A 1UPPA 1NCHA 2X4RB 3UL4A 4YSCA 1F2JA 1F6KA 1R86A 4L37A 4FFVC 1J05B 3RFZA 4I90A 3QRGH 1F02I 4K2UH 1MF2L 4WXZA 1RD6A 3K5SA 1KBBA 4XPHL 2V2CA 4G9FB 3D3VE 2DW6A 4W1TA 1NL0L 3FT2B 5HDRA 1BF2A 1I8LC 4FTDA 4TSCH 2Y61A 4K5OA 4PMUA 3DPDA 5CPNA 3M1BB 3SGEI 4L9LA 4Y4FA 5C0JA 2ZA2A 3VSUA 3MRPA 1J2WA 1SGJA 2OODA 4IGNA 1RH9A 2X2IA 4LGSB 5DMIL 4JYDA 4OFYA 2NXHA 5HTSA 2G9KA 4MA8L 1DLHA 1SF5A 1R3RA 4NZ5A 1NL0H 4IU2A 4H9ZA 1RU9L 3GI8L 3U2EA 5ICZA 2CD0A 4PJEE 2XRAL 3E2QA 1OYBA 4W68A 3K91A 5HDWA 2Q3RA 1Y18B 1KYOJ 4I3RH 5DVLA 1OTSC 3AW5A 3MCG1 4JFXB 1Q6FA 1TREA 3C2AH 2ZRUA 5CIPH 3BG3A 5BQ7A 3K71B 1IWAA 2YN5A 3CHDA 3IGHX 3GM8A 2WINA 2KLTA 3BD3A 5DEGA 1YEFH 4GKSA 3X1BA 1D7KA 3EYOA 3PU7A 3EPMA 2C9XA 2X2HA 3NXFA 2EG7A 4ZO9A 3FO1B 3QEUA 4OZ4A 4W9HC 4RW3A 1W56A 2VW7A 4UIOA 4IICA 5D2LA 1RALA 4Z1DA 5C0DB 1GT8A 1I3RB 5GGRB 4CD8A 1UJ3B 4B5VA 2WMHA 1BVKB 1FE8L 2EE9A 2EKJA 3C8KB 3S34L 4L4OA 4ZW8A 5BW7A 4PBFA 1OGPA 1BOGA 3O8XD 3NJGA 5HI5C 2VZUA 1A4BA 4RRPM 1JCTA 1LT7A 1JPFA 1MQ8A 4Z8FL 4F2UA 2YA0A 4KQ4L 3WQCA 2HNHA 4ZMOA 2BZDA 4QRPA 5C0ND 1OX4B 3V9FA 2EIJB 4TUJA 1BG1A 1TU2B 4P0DA 4ZQOA 2Z7YA 5C3LD 1CDYA 5EOQH 4S3DA 2DUZA 5C0BA 5DK2B 5L8LB 1DWFM 3E9UA 4X9SA 1J11A 3LZPA 2ARJQ 3P61A 5F0MB 5EDXA 2OGYA 2J13A 1KW1A 5EFDA 5DT7A 4YVUA 2FB4H 1AAJA 2R56L 2XM2A 4S39A 4N5ED 1Q45A 3KOXA 3M5YA 2V0AA 2XWZA 1KN4H 1EFZA 1KIQA 3DUGA 1HHJA 4PGZA 5C9WA 1KLYA 2NY3C 3GTHA 1FFNA 1CXHA 1AJ0A 2KI6A 3EOAB 4EOUA 1HKWA 3BVWA 4F15C 1KGYE 2PW2A 1JGUL 2OMWB 4MGGA 4WTWA 2CA3A 2QDVA 4B53A 5B38A 3RPMA 2CFFA 3IPBA 2VXTL 3GSVA 5MENE 1W3JA 3C52A 3NCMA 4K5PA 3JUGA 1CDUA 2OMZA 4NC1E 1GOGA 4LVDA 5DZNA 1QATA 2W1NA 3LI1A 4G6JL 4PLKC 1T6MA 5LUMA 5LBSL 5GRWA 4BWUA 5FKAB 3WKML 5PTDA 4FQHA 3TGXA 2BX7A 2JJSA 3DBXB 2E7CA 4BE6A 4ACPA 2J6VA 3S42A 2A83A 2E8ZA 2NWRA 1PB0A 3MUIA 4TOQA 1SM9A 5EUKA 2IDTA 5TE7H 1XCTB 1A5FL 1YUKB 3N12A 2LU4A 4QTGA 4JO4H 3IETB 1I75A 1KJMA 2B4GA 3GW0A 2E9MA 4NZUH 1YQVL 2QELA 4FF9A 5E2TL 4AHQA 3T65A 3BUDA 3GKWH 3T3PB 3ZL4L 3EKZA 5ADPH 9PCYA 2ZADA 4ZUWB 3P81A 4H83A 4ONHA 3SRDA 3TMLA 2NXZB 3ZSTA 5FCZA 3LKPA 1U0QA 3IACA 3F85A 5D1XE 5I18H 5T3ZH 1RAMA 4Q6JA 4H25A 4KKAC 3VAVA 1NC2A 4PJBE 1AFVL 1A6VL 4H7VA 2GSIA 1FWEC 1RLCL 1OGTA 4A6YA 2PDKA 2Z26A 1A6ZA 1FORL 2R23A 1YDPB 4GKOA 1RJYA 3IDYB 4D9RD 5JHLH 4PUJA 1R3HA 4UBPC 4G8FB 4HUWA 5LNVA 3BUQA 1URIA 2PWDA 3I50H 2ZWKA 4L4TE 5AVNA 1O9ZA 5G5IA 3QFWA 4MOZA 3WQWA 4JOMA 4Z2GA 1NFDB 1FZKA 1OTTC 1HKKA 2A4EA 4P8QA 4LFYA 4KUZL 2XIJA 4FQXC 3HR6A 2XFFA 1FLRH 4OD2B 2X41A 5DGQA 1T83C 4GH7B 1P4IL 2A6JA 3UZEA 3RVVC 1KKRA 1M53A 3CO4A 3ZMEA 4EMZA 3MPGA 4FXGB 3K6DA 3QUMB 1QWGA 1PGRB 3N44B 5KZCD 4KTYA 4CSSA 3UBHA 4Y2OA 3DESA 1E9OB 5IJCC 3R8HA 3ZKND 4AD4A 3RU8X 1N0XH 5LN8A 2WNNA 5IDIA 2EDYA 3S1UA 2AAAA 3GIVB 4NS0A 5KN5B 3O6FC 2ZONA 3ZVHA 1CICD 4W8AA 3MYJA 3W85A 3LVTA 4HV8B 1FCQA 2NVDA 3MLSL 2CKBB 2PB1A 4H8HA 4M8QB 1MFUA 3NJHA 5EOCL 2ACUA 3GZ3A 1N0XL 2XCMC 4OM1L 2VH5H 4U3CA 5C07A 1ZLUH 4EN3C 5KAQG 3OIHA 4F0RA 1B4EA 1MLBA 5CCGE 3QO1B 4TVSa 4NDMA 2IQTA 3CFNA 3NOIA 1HGYA 1NF0A 4JBRA 2QCDB 4JTIA 3WNOA 2ZP8A 5CBJA 4QLJA 1TCMA 3WAKA 4GO8A 3RHWF 1VP5A 1EWEA 4E9TA 5D1QC 1J8RA 1KBKA 2HRPH 1UWIA 2TRYA 2Z3FA 3D1MC 3MRGB 1UD3A 4ZYKA 1OPGH 2DYRB 4NQEB 1HU8A 1Y8BA 3M0JA 1A3ZA 1WFMA 2EXWD 2NDFA 3ARFC 3NIDF 4OCYL 2WZEA 3LLFA 3ZHKA 1Q9KB 1NKRA 3ECBB 4JB9H 5KYYB 3LGEA 4Y9FA 3P0YL 5I19L 3VXSD 5TQ2H 3SJVE 2PN5A 1CD8A 1KB5H 2IBZX 2ZXGA 5F2FA 2DJ4A 4WHTB 5KSUA 4O10A 4XNXL 3TA6A 2HLAA 3RZWA 4DZHA 4IMKC 2VLKE 1XDJA 3VIFA 3CVBA 3ULUC 1TX2A 3LQAH 2YMOA 5DQJB 5I76A 4OF7A 3TESA 4BA8A 4LASL 3ABMB 4NX5A 1ETZB 3TH6A 2BDNL 3W6MA 1GS8A 1N7ML 4LK4A 1CL7H 1XF1A 1X9UA 4QD2E 4OZIE 2IANB 1BF6A 2QUNA 4HQVA 1R7OA 4BQ3A 4PP2B 1XXFC 5EF2A 3QUHA 3T0WA 3TF4A 3MUGB 1RXLA 1V8HA 2PP7A 4FFTA 3PZQA 5HGGS 1LWHA 3VKDA 3W74A 5BO1H 4F40A 3EYSL 3DX9B 2P76A 4UMSA 2WZIA 3HM7A 1T40A 1T20B 1XL9A 1Q94A 1REQA 4Z3IA 3H24A 3FO0H 3BWUF 2ZKXA 3HBPA 3PQYB 2ZUTA 3ZK0A 4A2EA 2VWTA 2WPBA 3VFNA 1JPEA 2PDWA 1RCYA 3POHA 5C0AE 2Z1XA 1RBLA 3FTVA 4JZ5A 3LXUX 4QGYA 3S3DB 3NA8A 3GK8H 2DLGA 2OSXA 3EJYC 4NO2A 3FO0L 5IT2L 4GVHA 1A7BA 2X7LA 3MRMA 4U3SB 3WD3A 1U2CA 3P11L 3C5SA 4WK0B 5IKCB 2OCFD 1I7RA 5HHOA 1KXVA 2Z6JA 3DBNA 3G6AB 4M6NL 4PMRA 1CE6B 4Q7DA 1P48A 3OKYA 3RUGE 1M2VB 1JPGB 5MERA 2CYGA 1SZNA 4PUKA 3IJ8A 2F53B 3IIVA 1I0BA 2OQJA 2WXPA 3BP5B 4JO8A 1TXKA 3RURA 1MCEA 1NCCH 3QRHA 3SBWA 5DANA 5DRZB 1AO7B 4DPRA 5KSBB 1G4RA 5CINH 2JALA 4IFRA 4IHCA 3IPFA 1OP4A 1KXQE 4DKFH 1KIRA 2QUUA 4A4AA 1IE4A 2XYCA 1CGTA 1ZTXH 2ESVD 4B92A 4Y4HA 1CDHA 3S5YA 2NY5H 4UTIA 1TJHH 1UYWL 1DWAM 3EWYA 5GRUL 2GJ6E 5M03A 2W5PA 3MCKA 2X9ZA 4Q89A 1AACA 4R7NA 3VFPB 4XXCA 3JV5A 4JJ5A 3QF0A 4PS7A 3GR4A 1EGZA 2R56H 4HUMB 3EDDA 3I02B 1JCLA 1RK5A 4S1RH 3BP4A 4HU0A 3A4FA 3EDJA 4M5YL 1TJHL 1UYWH 2Q20A 5ESAB 4BBWA 1SYSA 4ORMA 4WO4A 4NUWA 2GJRA 4S2SA 5DUML 1QPNA 2HSIA 3GO1L 3ZTJG 4GUCA 3NCOA 1TETH 3IJEB 1VRDA 3J07A 3T8XA 3NPWA 4M7SA 4A2LA 4ENEC 3H56A 5F93C 3DVNB 4AWJC 2HJKB 3L3GA 4OZFH 5AW0B 4MA8H 1KG0B 3TN6A 3F2DA 2BOGX 2GIYA 4KW2A 3C8DA 5T1DL 1YSOA 3GSOA 4JFFE 1MFCL 2XPGB 3DHPA 2WMIA 3N25A 4AGOA 2EHHA 4OTXL 4PGBB 1GJIA 4OUEA 5DJ6B 3A3HA 1XR9B 1ZLVK 2VVSA 4MPQA 3B2XA 2E5EA 4LDOB 3AAZA 2NT1A 1WD8A 4B97A 3WF4A 2RDUA 2Y85A 2BB0A 3VFVA 3HG2A 4FCAA 2DQDL 1ITUA 2B4CH 3WQEA 1M2OA 3B05A 4YC2C 4V33A 2C1GA 3QPXL 1E8WA 3JVGC 4P9ML 3KBNA 4LBRA 4HSCX 3UNDA 3B4YA 1DIEA 2ESVA 1D5BA 4ONGH 4Y4HD 3O0RH 3PWVA 5ESQB 4GX8A 4H9UA 2BV9A 2UYLA 3SD2A 3H4FA 4G8IA 3OR7A 3VD2A 1FF5A 2ORBL 3AXLA 1KCRL 3N1MC 3CBWA 3WEXA 1VFFA 2Y1HA 3EXTA 3IDXL 2AQPA 2QQLH 3GSWA 4QOKE 4CVXA 1OP5H 4W4OA 4OQTA 1WTLA 2QLYA 4G7VL 3IXTB 1S3RA 3PBGA 5IV2B 2NR6D 3HB3C 4UQ3B 4PMEA 4YSUA 4IMFA 3FYIB 3PWJA 1TRDA 4R26H 1Z6KA 3N2BA 2VC2B 3UF9A 3EJTA 1QPPA 3U7VA 4D8LA 1R9XA 4ZFOA 2ZXWB 3G3DA 5I26A 3CB8A 3KAOA 1ETA1 3FTGA 3U9UA 4HEME 1JYNA 2VERA 1A5SA 1O6TA 5AUMB 3C9NB 3O63A 1QUMA 1F6AB 1ZIAA 4XP9L 3PY9A 3TA4D 2JKAA 2G4JA 1TYJA 3AUOA 4J7RA 4KK8C 4Z7UB 2P0OA 3BPCA 2K1MA 1DE5A 1E9QB 3FONB 4AM0B 2VR4A 2ZWNA 1E4WL 1EX0A 2HFFA 4JFHD 1NC2D 1AD0A 2QSTA 4ZQCA 1L0QA 2I60L 3KLKA 3AZTA 2DQ6A 2GZXA 3GBEA 2VDPH 1DQLH 1LOQA 5C9JA 1XGYL 1KJVB 4HCIA 3AY4A 4UTBL 5T1KA 1NQ6A 4XBMA 5AW7B 1BTMA 2CZEA 1O1HA 3G2GA 4IIBA 4AWUA 1T4WA 2HH0L 1NPJA 2R1WB 1YQVH 3BVXA 3PZOA 2TMDA 3OGCB 4YGAB 3RA7L 4NNYA 3UMTA 3RDKA 1J1OL 2FUTA 2VL4A 5HYIA 4PJFA 3BURA 5DD3L 4PREA 1LJMA 1VFLA 1ZZMA 3BVDB 5ACLA 1RZ7H 4HD5A 4YOKA 1O60A 1XG4A 3EJUA 1Z5LA 4X99A 4B2DA 3FUNA 5DJ8A 1RHCA 3K72A 4QLRA 3MGTB 4XBEH 4C56A 3HMXH 2ZAGA 3DX8B 1JD7A 2A73B 3OF6A 3EZ4A 5E08H 4LRTA 1OAJA 3H4XA 3N6JA 2DYSB 3N9RA 3AITA 2P3YA 3SGDI 2VO8A 1Q4WA 2AJXH 5I09A 1RJRA 3UWZA 4NJKA 4JUTA 3CHRA 2X70B 1QUPA 2YPLA 2ZZ7A 1D2KA 4HS8H 3ROOA 5FEXA 3PDOB 4L4VD 5E9XA 5CZVH 5BOOA 4K9EL 3H0TB 1ZT4A 4LSPH 4YR6A 3L65A 3KGSA 1QACA 2RAGA 2P8LB 4NN6C 4NQUA 1FNGB 4MSWB 5DQ9B 2E7DA 2Q1EA 4K71C 4OJFL 5EUOE 5F6HJ 5CAKA 1ZE3C 3CXHJ 4JFDA 5CC5A 1EEZA 4MGXA 2D2GA 4IFKA 3PF3A 1WFJA 3DOSB 1TNNA 3MI6A 3JWNH 1CE1L 2YEZA 4R0LC 5JIDA 3UY8A 1AS8A 3FV9A 3D3VB 3SAZA 3Q0HA 1BM3L 3GMMA 3Q01A 5ICYB 4HS3B 2APBA 1FP8A 1U6AH 2VDKH 4XMKH 5FF7A 5D1ZB 4BKTC 3QR3A 2GEEA 5AAMC 4HKBA 5HPMB 2CLPA 3SSZA 3LN4A 3R19A 2IS7A 5FA3A 4MUPA 3HA0A 1KKOA 3I4EA 4ODSL 2P0IA 3QDMD 4U0RC 1MIEL 3VI3A 5DJAB 3MOQA 4FP8H 5A8PA 4P46A 5C09D 3UMNA 1K4HA 2X1OA 2VOTA 3ETBF 3LKNB 4JQIA 4K7PY 4FABL 4FSAA 3CWHA 4PBGA 1KTBA 1CFTA 4LYRA 2OJPA 3U36A 4WFFE 2EEFA 1E6RA 2YC1A 3W88A 4EPBC 1UWYA 3VFLA 3BKYH 5F97E 2DYPB 4Z0XA 3ECVA 2EKCA 2YPLD 4JN7A 3FUDA 7PAZA 4H2AA 4MB4A 2GOKA 2FX9H 2AVGA 2DL2A 2YFNA 4J27A 3T4AC 3HFYA 1QEXA 4G8GD 1WIUA 1JNNH 5FKPA 3QWRD 1Z69A 3V3WA 5EZIL 3TO2A 1NPUA 7FABH 4UQ2B 1H3PL 3U57A 5FO9B 2XISA 4CVZA 4IGBD 2ABAA 1LL1A 4JKKA 3GF8A 3WUEA 4F9JA 1HL4A 3AWNA 1NINA 2DH2A 3BWZA 3JUZA 1WBHA 2VXNA 3F7JA 3WHE0 3DSFL 1QPQA 1TO5A 1LM8V 4MJIA 4K3DH 1UOZA 1AZBA 3CFTA 4HP5A 1MHCB 3NJJA 1XP3A 2E67A 2VX4A 3ENLA 4GVGA 3O4OC 4OVXA 3HFML 1NCAL 4LSUH 5D33A 1L6WA 4WSJA 5C6PB 1ZGLM 3PUGA 1G69A 4EAYA 1BZ7A 2BFVH 4Q9RL 1T7WA 4IRJC 1P4LA 4X9GA 5ADOL 4BR1A 3RKDC 3HS9A 5HHOD 4XHQA 3N3TA 3CLMA 5G4WA 5HJ3A 3FO9B 1JCMP 3QBUA 2W88A 4FR6A 4N25A 3MGOB 4GYBA 5E1IA 5I30L 4X8JB 1H7WA 3C2SA 3KYMA 4BSVA 1S7TA 1ID5I 1GSMA 3EFDH 4ZVJA 1G9ML 4BCEA 4YBQD 1DCEA 1PZ5B 3FT4A 1RZKL 3REWA 3O3EB 4Y5YC 3QW9A 4YPGB 2DGAA 2EAWA 3V0SA 4PJGE 3UEZA 4CGUB 4XOAA 1XM3A 1U92A 3O05A 2IOMA 3CFUA 4K9EC 1XBVA 5D2YA 3LIUA 3SKMB 1V6YA 1TKWA 1L6ZA 5B3JF 2GIMA 4PJBF 5T3XH 2L3BA 1EJOH 1FPTL 4NKDB 1L2QA 15C8H 2WUCL 3AWOA 3KMDA 4PRNA 1UBPC 4HKZB 5JZ7D 5D2TA 1XFCA 1LK2A 2OSLA 4MD5A 3WFZA 3HBLA 6FABL 2AF2A 4YHZH 4NN5C 2F7OA 1QVBA 5IQLA 1EFXD 3IBEA 1BIIA 1HIZA 3L0GA 3N1AA 3MJ8B 1J9RA 5AHNA 4NQTA 4XX1G 5T1LA 3WFHB 2MSPA 2I9TA 1JHLH 4KRPD 1RZJC 3HTLX 1EXHA 1EJUC 1HOEA 4I2XA 5IM7B 5A8NA 1PTGA 1IM3D 5I79A 2PTUA 2XDHA 4Z3GA 1W5PA 4G8TA 2XVBA 3ORJA 1KYFA 1KEML 2YD4A 5F1UA 3RK8A 2CLRA 3OC5A 2QSCH 4R9HA 3SCOA 5IMLB 4E68A 1HDMA 3U6XA 3WDRA 1QKZH 1XCWA 2VERN 3V5HA 4TX9A 2NLJA 2ICEC 5I5JA 2ZCGA 3OA3A 3WFLA 1XMEB 1Q8AA 1RY0A 5XIAA 3VRJB 3PWUA 1T1XB 2CALA 8XIAA 1ZEAH 1FWIC 1HWWA 4UXDA 3MOAH 3AROA 5D7JA 3A4EA 4A2FA 5CFHA 3HC4L 2Z7GA 2DT3A 4LCSA 1S4IA 4LL1A 1Q9LA 2OYMA 3P3UA 5E6IC 4DO6A 2W9MA 1NFIA 4M1DH 3VWJB 1K8IB 3MUCA 2BZNA 4R97B 3PBWA 4HU4A 3S2JA 3SBFA 2H45A 3HAEB 4FX5A 3W75A 5JLZB 3F64A 3E3QC 1XHGA 1YE6A 1YBQA 2YIHA 4JKNA 2WV8A 4REQA 4RWYH 5FDWA 4P2VA 4FXKA 3AWGA 2FDSA 1NJ9A 1E4XI 4CW1A 4YLCA 1JPHA 3MV7E 4LZKA 2NX1A 3BLKA 4R5XA 4P4KC 4GY0A 1TYEB 2CRZA 3D34A 4ZJ9A 2WLMA 3UACA 5IVNA 3P7YA 3N42F 2X4UA 5AD0A 1QPOA 3KDOA 4EN3D 5C0CE 4K3EL 1MWAB 1MKFA 4MCZB 5I1HL 1E28A 2D31B 4JZNA 4U49A 3MV7D 3ITVA 3T09A 1JRHI 5JOFB 3U25A 1EEQA 3BW2A 4YJ5A 3DGGA 3MNWA 1TPXB 1DVUA 1XJBA 1S1PA 5HMDA 3VCLB 1REIA 1UH2A 3QPXH 3R06B 4P9MH 4QHKJ 1M7IA 4PN6A 4AY0A 3LZFL 3TFXA 4K1GA 1FC1A 1P7KB 2IPTH 3CSFA 3GT6A 3CFCL 4ZUSA 4ONGL 2PWHA 4R7JA 2EG6A 5E4EB 1UB6B 3MJ9H 2NY4B 3T3MB 2MTPA 3RHGA 1OVZA 5CEXB 2C1OA 3NIGF 3ZRCC 3X17A 5E03A 3NL3A 1IF2A 1S2VA 3FRPG 1VRXA 4WDUA 4MBRA 3MVTA 4ZT1A 5D2NC 2XG5A 4I9AA 4QE5A 1A02N 4EZJA 4PB4A 3VAEA 3Q6FA 1T89C 3CFMA 3UAJA 1OTUD 4JAWA 4F33A 3EX6A 5A6LA 2HUEA 1NC4D 3ASWA 2R1MA 1XYBA 3EKGA 2E77A 1SQ2N 4PLJC 5I6XB 2IPFA 3VTTA 3S1XA 5IJVB 5FHAL 4ES9A 1E6ZA 3SCUA 2CJSA 1E0TA 2B08A 3RO6A 3GY1A 4YHML 1YVLA 5CUSH 1NIFA 3WQGA 1OK6A 4AGPA 4NZ3A 2GW5A 2OV0A 1XF4A 4OGZA 4QRSA 5E9DD 4EI6B 3TS8A 3CXDL 3WQ8A 4HS6B 1BJ1H 5AZUA 3PV6B 4YE4H 5IFTA 3MUY1 1F3DJ 5I74B 2NW0A 3MLSH 4S1FA 4JFPB 4ES4A 4L6DA 5F7BA 1PFOA 2XICA 3GZKA 3GRBA 1G7IB 5KAQF 1OYCA 4AWSA 4X80H 3SZKC 4G6MH 1INEH 3QA3A 4JFFD 2MRYA 4XP6H 2VRAA 5DUJA 5I1CL 4RXGA 3FDWA 1PU0A 3CDZA 5C0EB 1ECEA 3AIUA 4EDXA 5DCEA 3VFSA 4GW1A 3G6JE 1MJUH 5FGSA 3NABL 3C0JA 3UPRB 4L61A 2Y5EA 3WLTA 2NLYA 1BKHA 4YWGL 1A3LH 1JGVL 3D30A 4ZFZA 3N41F 4F80A 4JHAL 4HLZG 4IMLA 1TMQA 5FOBB 2P88A 3WELA 5BXRA 3TU9A 3BPNC 2J8HA 4F7PA 4ONFH 4L1SA 4XN2A 4OV4A 4LVOC 1LO5B 1WDQA 5ABZA 2XSAA 3QQ1A 5IROC 1SY6L 3LRLA 4DNMA 4CCCA 4WSGA 2IAMB 3OSVA 4E9QA 2CR6A 1MCOL 1M71A 2VQ1B 5DMYA 2ROXA 3IPWA 3CG8A 4J4KA 1CQYA 3AM8A 3FBQA 4UNVA 3NIFF 3V0VB 2Y23A 1H7NA 2PS2A 1KPVB 2WXIA 1GZQB 5I8KL 1KO0A 5MI0B 3LQGA 3SDDB 1X6UA 3NQFA 4K9EH 3TC9A 3FX4A 2GJZA 2WLYA 3FBKA 3BQ5A 1E6JL 4K94C 5EA0H 1UR9A 1XDLA 4PTUA 3BQUC 1FA2A 2E59A 1BHGA 4QMEA 3OV6A 3GMLB 3FB7B 1SUHA 3LEXA 3P9LA 3KXFE 4LP5A 4XR8C 5DZAA 2AEQH 5FYKL 2WV3A 4WGKA 3S5LG 1ZGLP 1UZDA 4HIIA 4DPPA 2J47A 4DGIL 2J7EA 1EXPA 4MMXB 3T6QC 1LK3H 1TMLA 4DIXA 4O15A 3TPUB 3AREA 4ZTXA 2CBTA 5IK3B 4DXVA 3OKOB 4ZUTA 2F84A 3DSNA 4RR4A 5AYZA 1NBYB 3QUXC 4WWKD 3OHMB 3QV7A 4DUVA 4S3CA 4HBCH 1NGXB 3C6SB 2AV1B 1BX2A 4CQ8A 4JKLA 3WD2A 3N2OA 4IOIB 2R4SL 4HJJL 3QCUH 3VQ2C 2GITB 3CFKB 2QQKH 4NM4H 3OB0K 3CDCA 2ATKB 3OKNB 4MXWH 4R5TA 5A16A 4QRUA 3FS2A 4PQXA 4JZJA 1II4E 1CYGA 3F2LA 1PKQA 1UKQA 4Y19A 3GSXB 3HVNA 3RX7A 1YPXA 2XWEA 3M5ZA 5FA4A 1YEHH 3GZPA 3PBVA 2F5BH 3E8UH 4I0PD 4APQC 4MYXA 4NOFA 4Q2ZB 4G43A 3CSYB 2Q87A 4F2BA 4XE0A 1L9QA 2AV7B 3N9SA 2IUZA 1XSOA 3MRQB 3NJIA 4APXB 4C7GA 4UWMA 2RIKA 1WXZA 4NQVA 4GIAA 1KBWA 1D5ZA 3H8NA 1FKWA 3WO3B 4P49A 2L7UA 2E1WA 3N3MA 2Q6WA 1EP3A 2FVNA 4KKNA 4LSUL 5LIKX 3L45A 3LU2A 3ABSA 1VGKB 3DMMA 1J8SA 5DWUH 3INUL 3WTSA 1Z3NA 4UTAH 1PTAA 3UP1A 4WW2C 4NLAA 4MD4A 4TLKA 1RR2A 12E8L 3P8IA 3BEVA 4JN2B 1SO3A 1EQWA 1U3HB 2JXMB 3W7DA 5C08E 3PJTA 3ZLFA 4TLTA 1OT1A 3ARED 5DYOA 2NXYD 4TTDC 4U3AA 2X4OB 2W67A 3BJ91 5CN3A 3FCBA 2EYRA 2WKJA 2BWIA 2ZRZA 4F7MA 3KLAB 4QF1B 3BH9A 2J1KA 5C2BL 3P0WA 4K9JA 4W6WB 3SCSA 4P57B 1EHAA 3FC8A 4OJAA 3W0WE 3IXAB 4ZPTA 3ZZLA 5TAOA 2HYMA 4PJ5B 3OAUH 2H5UA 3WNNA 5ANMB 1NWOA 2A77L 3QARA 1XGQB 3ZE1E 5KBLA 2Y70A 4B9PA 4UM9D 1UC5A 1YNYA 3JW7A 3DVGB 4US6A 2ZJSL 2F74A 4S11A 3HC4H 2B4CL 4EXQA 1W72L 1QFWL 4HIXL 2DZUA 2BNQE 3P4NA 3NZ8A 3A0OA 4E42B 4F1ZA 5IIEA 1I8KB 4PW9A 1DHKA 1NOUA 3E0FA 5CEZH 4KTEH 5KVGL 1DBBH 4DNHA 4NEHB 2GFBB 1IQDA 3EGDB 3PWPE 5D7IB 3Q3GA 1VADB 2CO6B 3WJYA 2F2KA 1PZ1A 4G8AC 2WLLA 3P80A 1ME8A 5I78A 2FHCA 3DMMD 4PRIE 3O2DL 3S0PA 4PP1D 5E4OA 1DO6A 2UY4A 1M7UA 3ML9A 4LU5H 4F7KA 3VGHA 4IMCA 4DP0X 4R2GC 1HHIA 3GYRA 4N8CL 3DXIA 1N18A 3QIWB 2AMXA 5GGQL 1IKFL 2LT9A 4FI6A 3ZDXB 3FHAA 1LUCB 3P2VA 3VTAA 3SJNA 2Y3AA 1RFDH 1QO3A 4IIDA 4YCPA 4G6FB 4WFFD 1E3FA 4JGMA 4JFUA 4PUEA 5IB2B 3UTQB 1JGUH 1OPOA 1ZJBA 3SCVA 2EXYD 5F1NB 4HCHA 3JWNC 3SO3C 1B4JH 3LZFH 3C5ZC 4XSLA 5HGDB 3BD4A 4OQTH 3ZDYF 5CBEB 5IVOA 4BWLA 2Y5QA 4HWEL 2C13A 5D1QB 3AJXA 5HD8C 3IU4L 2E0PA 4HJTA 1SYVA 4LLQA 1UM5H 4KCWA 3IRSA 3EHBB 4ALAH 5LIWX 4XVJL 3ARFB 1KIPA 1QAWA 3I6EA 1DL7H 3SE3C 4IH3A 1UD2A 4EVNB 1W1TA 5CZ0A 5E6SB 3BG5A 4F3FB 4LKXB 1Z41A 1JRHH 1CZ1A 3Q67A 3S2NA 2OFQA 3IKCA 1GYNA 3BPLC 2IC2A 5DEFB 1AHMA 1RD5A 1VZGA 2GGHA 2I32A 3O4LB 3WIFA 2XV6B 1RZFL 4S10A 4E9WA 3NG3A 3L9BA 4TNFA 4BKLB 3IJ7A 2HWGA 4Z2LA 4EZKA 1TPDA 1HVQA 3KS0H 3IK2A 3KPLB 4JR5A 4LPUA 4QQUA 2D9QB 5HQMA 1JDAA 4PJGF 3CQKA 1RZFH 1IZJA 4MLSA 3QUZB 3S35L 1WIOA 4MFHA 4N26A 1FFPB 4OFKA 2JIXD 4KCTA 2YQGA 1W1YA 4XMLL 4X6BB 1G6CA 1OFBA 4YHGA 3QI9D 3MUZ1 2NCMA 4LSQH 5D8WA 4ZFMA 1VEMA 3KPOB 4QKTA 4WF7A 5GS1A 4MA1B 3BESR 1I9CB 1E90A 4FOMA 4PIRF 1N70A 1GOHA 2R6OA 3CUIA 4G7YH 5I1HH 3MXWL 2AKRB 3NH7H 4U1SB 5DUPH 1ODUA 2X9WA 1T4KA 3NQMA 5BMXA 1EC9A 5I06A 4HEPA 2V9RA 3FF8A 2WO2B 4JY4B 3U1SH 4K8HA 4GZIA 1O7DE 3QZWA 5AYQA 5MEOA 4HX1A 3RGVD 1OF6A 3TWYA 1WDPA 2CO1A 2HT3C 1X97A 2B4CC 3CNKA 1RZJH 3B8SA 1IAOA 2KDYA 4KOCA 4M00A 3LTSA 3S4SA 3VE0B 4IP7A 4PB9H 2R29H 2Z4QA 3CFEA 2OYKA 3SQOH 5FR3A 1KZQA 4LARH 3P6LA 4OLUH 3WJLA 2JI1A 2ZYSA 3MRRA 3MRNB 2YARA 4M43L 3QDME 3LM7A 2PPDA 1P1ZB 4HH9B 1HZHH 1VCAA 3FSZA 2D9CA 3E1ZA 4NXSA 3ARYA 4DP6X 3UZXA 2AJUH 4MCMA 3V8CA 4WI3A 2C3WA 2ZC1A 2CZFA 1IC4L 4PB9L 4U05A 3U30C 5I8KH 3N2CA 4RZ4A 3HCVA 5FAGA 2D4FA 3X1EA 1K8XA 3CAKA 4M48H 1EEPA 5CU9A 2CMRL 2H9GB 4RW5A 5TK2A 4TMBA 3SUVA 3MRBB 2P1FA 3I7SA 3CQ0A 1MFBH 4ICCX 3DG3A 2WXOA 4LDCA 3U6XS 1SRDA 5E2VL 2GTQA 2Y1AA 3ES6B 4HQQL 4B5ZA 5CGQA 3WFDL 4DXXA 5CWSB 4M03A 4M4RB 4WU7A 1UUNA 5I0ZA 2OKMA 1I4NA 2ZOKA 3TONA 4Y16D 3HZKA 1T5XB 3QI9A 4EF3A 1NTDA 1I8MA 1EDTA 2CC0A 3QSRA 5MEPA 2FTAA 4JN8A 1WCQA 5DZJA 4MAYA 5C0RH 5INDB 2GJLA 5CSUA 2ZKHH 1OP9A 3BP7A 3ANVA 4A05A 4LHQB 4ZBCA 5IB4B 2HTKD 4ZMQA 1IILE 1ZENA 5FCUL 1ES0A 3DIVA 4MHBA 4AY7A 1RSFA 3E6HA 3H4HA 3UJIH 4L18A 1X38A 3N42B 1B0GA 1LO3L 1HJCA 3SPCA 2XY2A 1A6TB 4KI1A 2F1BA 2YR1A 2WCSA 2NUWA 3QXDA 3RJYA 3KHJA 1BWMA 4JG0L 3D85A 2MOGA 4Y5VA 5BOPA 4OCYH 5HMFA 1YECH 5IMMA 3I7QA 5I9QB 3TWCL 3TTEA 2A3CA 4UV4H 5ENWA 4XRCB 4B41A 3P5ZA 4O8AA 5GZNC 4JPKH 4RA3A 3ULAB 1GAFH 4QROA 3VMOA 3IARA 1JK8B 2FWOB 4AD2A 2H26A 4Y4KA 1QEWB 1TNMA 3JTBA 4PP1C 1SJHA 2GCYB 4QCIA 4HNTA 3QHFL 5AWNL 4PSPA 4IW4C 1VFSA 4KAQH 3GRWL 4QWWC 4WTZG 4ZSOB 2X6CA 3S96A 3C09C 3W1AA 4UNTA 3U9WA 1RP9A 2R7EB 3K81A 4CC0A 1BBJB 4HAKA 3RWCA 2O1AA 1SEBB 5JW4R 2C4FU 4E41A 1VBRA 1DEEB 4F79A 3AC0A 5CLXA 1OGAB 4F0MA 2BSTA 3ULUF 1G7QB 1WFOA 5D6CA 2EPHA 1K8YA 4D72A 1XZ0B 5ADOH 4L5ZA 4NI8A 1BD2D 1KM2A 3CDGA 1QSEA 1YDYA 3V0GA 1J1PL 2VSKB 1XCQB 2AK4E 4RMWA 4YNYB 4WNQB 1E5JA 3LCGA 1XIDA 1Q0YH 2OMTB 3BZJA 1U8PA 1WBXA 2ZIDA 3U79A 1PQZA 4JM2D 1K72A 4PG2C 4UT9H 5FYJD 1YEEH 3P30L 3FT0A 3ZUNC 2WKOA 1FY6A 1NGYA 1YEHL 3OMZA 4RRPA 1N3NB 1VA9A 3BLLA 2LU7A 4NNPH 1GOXA 4XMWA 1GTFA 3FFCB 1CXKA 1X5ZA 5SWQA 1AO7D 2FYYB 2DKUA 2WCPA 2J88A 3DI1A 1YYLL 1FIGH 1OSEA 4GQBA 5EBLB 1S7UB 3U0TB 5FKYA 3SM0A 1DBBL 2M1KA 4BFBD 3GMRA 4TPRL 2X4SB 2BNRD 2WD0A 1FN4A 4RVBA 4IG2B 3OOQA 2LLGA 4NNXA 4Y4KD 1KEMH 3P4OB 5FJRA 1XTLA 3B6SA 1BZ8A 3KOYA 1JPST 1K6QL 4H0GA 4AX3A 1A2YB 2A9DA 3ZL2A 5B7MA 1W3NA 3KG5A 4IEFB 5I1IH 3PUDA 4HGWB 3OBAA 1KLUB 4AV5A 4FX8A 3UJRA 5C7ZA 2GQ3A 3IPEA 1M05B 3S6OA 4FNUA 2VXQH 3VXTB 4EAEA 1TTCA 1RIUL 3TC3A 4FS9A 3TQ0A 3IUDA 5F6IC 5M17A 3MOAL 2X42A 3V5DB 3IANA 2FJKA 4ZFGL 3MQTA 1F0LA 1VFBA 3IN2A 3SKJL 3RVXD 3B04A 1AQ0A 3I2CL 5KOMC 2BRRH 3IJYB 3KPRE 2BMKA 3RR4A 3NIFE 3QCVL 3ARBB 3QVAA 1EF2A 3U83A 4LV4A 5L88H 4C6OA 1HH9A 4JRYE 2LU3A 4XO4A 1S9WA 3HNSL 2P50A 3GUTA 1IBHA 2Q3ZA 3EBHA 2YRBA 3L8QA 2R8WA 1HH6A 1I1RA 4M1GL 5CEZL 1BQLL 2IV8A 1A4LA 4F0SA 5I6MA 3BJTA 1F6LL 4G6JH 2QF7A 4O2EA 3D39B 2VDLB 1A7NH 2QKSA 4JPIA 2DQJH 4NUJA 1X7FA 3GNPA 5B7FA 2OCZA 3HQPA 3PBMA 4RBPH 2P47B 4PJHA 5TF1L 1NMBL 3BAIA 2Z93A 4YGVB 1AKPA 4AX6A 3RX5A 5AAWC 5BRBA 4LUJA 3NSMA 4YS1A 1OWQA 5IR1B 2GSJA 3GLZA 2O5ZH 1EAOA 3PTQA 1OALA 7TIMA 4FXLA 1OB1B 4NQQA 5HDBE 2UVEA 1OKEA 3NACL 3AHTA 4IK7A 4HPGA 4HVXA 3AGWA 4R0LB 3RTQB 1E9IA 5HVWA 1TTGA 4YDKL 2OI9C 1V7NL 2FSEB 3WIJA 2EE6A 3GHEL 2VLLA 5CJOH 5D1ZC 1XINA 2A3HA 4L6HA 5TGBB 1C90A 4K3EH 5T5FA 2CUMA 4CVUA 1VYPX 3TQVA 3VA6A 1YMYA 2QJIA 3U6RB 2PTZA 5JHDA 4ETYA 3EH3B 4U0RB 1EWHA 5BS0D 5EZLA 4ZRGA 3QV8A 5JBDA 4KTGA 4PFMA 4AB4A 4N4PA 4JBSA 2CH8A 2QKIB 3F7PC 4YIWA 1MY7A 2V2TB 4KWUA 3H7RA 3WH6A 3CPRA 1YRRA 1U1HA 1ADQA 5D55A 2QQLL 1IGIH 1OAUL 3WO4B 4A7GF 2LLEA 2Z8VC 3MACL 1XX1A 4A8NA 1KSRA 4HZ1A 3X12B 2ZZ6A 1USZA 4KFPA 5DRXB 1XGYH 4C83B 3KDMA 1Y5VA 4EXPX 3VFRB 4UR8A 5DELA 4GQRA 4X6DA 4O13A 3AYTA 1NOLA 2Z7ZA 2HH0H 1J79A 3SDCB 1J8HA 5GJTL 1ROWA 4AUYA 2AZUA 3TU6A 1UUQA 2X1TA 3CYJA 3FB6A 4M43H 3P5YA 4WQOA 1Z9AA 1BTCA 3MX0A 4G7EA 1B6UA 2DZTA 3TK7A 2QDDA 1FWGC 4ZMAT 1SUJA 1A1MB 4IIQA 3APNA 1TTQA 1TPWA 4JQXA 3QIUA 4F7TB 2J74A 5K1VA 2H6PB 1DFBL 4KHXH 5DMKA 4PJEB 1I1FB 3IV8A 1RJLB 4GYFA 2CGRL 5JPMB 1J9TA 4ODVH 5BS0B 2CBOA 1EO5A 4YN3A 3GPEA 2R94A 3IDGA 2X1UA 3KBJA 3NRPA 2CLOA 1XC6A 1L6XA 1EDQA 1F5ZA 2LABA 4QTIL 5DN1A 1BVLA 2NUTB 4YU1A 5AEAA 3OJDA 4WHCA 1AMKA 4W7WA 1U8LA 4HXAL 1SUXA 1ZAHA 3URQA 1HYRC 5JH2A 3DV6B 4GKZB 1OAKH 2WO4A 4L8DA 5D7KE 1WAPA 2I5IA 4GYKA 1HILA 2HX8A 5HI3C 3W22A 1U8HA 4XCEB 3I7RA 4JHUA 1S7WB 4B5WA 2FBJH 4KROD 2MJWA 3JWOL 2KUTA 1LORA 3WE6B 3QULB 3EG9A 3EAUA 1JGLL 3NM3A 1KT2B 4CNOA 4LEBA 3BOFA 3OIXA 3FB8B 1L7IL 1NM9A 1HJUA 1ZHKB 5I16A 4AIOA 1XDTT 1R5WA 2G75A 4H8PA 4JFEE 1NCBL 1XGDA 3VXME 3ULUD 4NQSA 1OAZL 2WSRA 4MJ6B 5B21A 4NZCA 3U2ZA 2C7UA 1BM3H 4BIKA 1S7QB 3AYSA 4CKVX 4D0DB 1NDVA 1XIGA 2PWUA 3JTTA 5DBUA 1A3RH 2W0UA 1M3UA 5KSWA