1HL9A

Crystal structure of thermotoga maritima alpha-fucosidase in complex with a mechanism based inhibitor
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
442
structure length
420
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAELPGYKWEFTRGIGLSFGYNRNEMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Thermotoga Maritima {Alpha}-L-Fucosidase: Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords PUTATIVE ALPHA-L-FUCOSIDASE
total genus 150
structure length 420
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hl9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hl9A01
1C8XA 3MUZ1 5KZ6A 3OA5A 5I77A 5CGTA 3RILA 4AD4A 2D0HA 2JFEX 2WVSA 1J0JA 1E1EA 4GI6A 1OBAA 1GVIA 5A8NA 2W66A 4W89A 1NWSA 3WQWA 1PBGA 2PWFA 3WNKA 1H41A 3N1AA 3VOCA 4AZ6A 3N12A 3MSGA 1HP4A 4JL1A 4B15A 2VO5A 3APGA 3SCWA 2A3HA 5GNZA 1JYWA 2G8ZA 1HIZA 2J7GA 5D8ZA 1TA3A 2VRJA 2YL5A 4DM2A 4QAWA 4NRRA 3CZNA 4FLOA 2VCBA 3BSGA 2YDSA 1Y7VA 1CIUA 3FN9A 3WNNA 4LYRA 4D1IA 2BXYA 1HF6A 5BYWA 1MQRA 1ZJAA 2DT3A 4D1JA 4EAMA 4PUDA 4CD8A 4J7RA 3GXNA 3PBGA 4E4PA 1BG4A 1OM0A 2OWCA 2VX4A 3S6TA 2X2YA 1SMAA 3BMVA 1VJSA 1XSKA 1J01A 2J7DA 1JAEA 4AYGA 3VTRA 3LRMA 5IDIA 2GJPA 3N17A 4M80A 1DWAM 4W84A 2OYKA 3BAJA 1KQYA 1XH0A 3WSUA 3O9NA 1UH3A 1B1YA 2CHOA 2A3EA 3M7SA 1HJSA 1AMYA 5D8WA 2F8QA 3J7HA 3WF2A 1XHGA 4PUEA 5A8QA 1QPKA 2WBGA 4U3CA 1I1WA 3K8MA 4CCCA 1W2VA 2J7HA 4ZENA 3IGUA 3ARVA 4Z2HA 2DIJA 4GZIA 4DUXA 4CGTA 1XD1A 1QNQA 3CC1A 1C8YA 2VZSA 1WE5A 1CGVA 5EFDA 3MU7A 2BV9A 2CITA 1HJVA 4F9JA 1ODZA 1WB0A 3BCFA 4CU8A 5LA2A 3UR7A 1T0OA 5CJ5A 5E0FA 5FL0A 4AYSA 1O6IA 3FAXA 3DYMA 4OKDA 2XGIA 5FL1A 2XVLA 3WUEA 4MADA 3T0AA 3B9EA 1G01A 2WHLA 4TVCA 4EK7A 4Z2GA 1HXKA 2D23A 3VIPA 2DIEA 3WQVA 3IAQA 1KGXA 2FHBA 4K68A 1RP8A 4E8DA 1UOKA 1V02E 4AD0A 1QW9A 4UQDA 1W3HA 1B3XA 1W3LA 4M56A 3U57A 3WH7A 1P6WA 1UASA 2WMGA 4WK9A 1US2A 4P8UA 3EBVA 1XC6A 1W9XA 2XN2A 1GQIA 3EYPA 3AHZA 3M46A 1E56A 1PPIA 3OLDA 3VMOA 3WUFA 3ZJ8A 1JNEA 5AC4A 1GHSA 1B31A 4WKAA 1WPCA 1U30A 1BYAA 1UKQA 2D3LA 1CXIA 1XYFA 3NDYA 1R85A 3W0KA 1DEDA 3AIQA 4UQBA 4X0VA 1V0LA 1MFUA 4UFMA 4AZ5A 3ZJ7A 3MS8A 1KBBA 1G5AA 3W6MA 1W2PA 4CN1A 2QF8A 2CETA 3WF1A 4B9YA 3GH7A 4AMCA 4CN6A 1AVAA 4UQEA 1YHTA 4QLKA 4WKHA 4ZEPA 2W61A 4HOWA 4W8LA 2YKKA 1PX4A 1QHPA 3CZSA 5E09A 4PMRA 4S3JA 1R7OA 5I3DA 3W38A 3WENA 5A2CA 1UR9A 3BVXA 1KGUA 3A5VA 3A4WA 3AICA 1VEPA 3AZTA 3GXIA 1J11A 4U33A 1K6AA 4TTUA 1XSIA 3SCQA 1GHRA 2HISA 3FW6A 4IPNB 2XYLA 2ZUSA 2XPKA 3WELA 1UR8A 3WH6A 3TP4A 2YLAA 4L4PA 2J77A 4BQ2A 4D6IA 1H11A 1E3XA 3SUUA 1GJWA 4GO8A 2D0GA 3LXCA 1O7DC 3TONA 2W62A 3THCA 5CZKA 2VUYA 5A2AA 2YL8A 1HKMA 2GDVA 2E0PA 3WY4A 3WD1A 5AYBA 5CPQA 1UUQA 5A6BD 3AXXA 2VVNA 4D6CA 3ZOAA 3SCSA 4X0NA 1GVYA 1JDCA 1JD7A 3UETA 2XM2A 3PHAA 5BWFA 3F5LA 4JFVA 3DYOA 1JAKA 4PTVA 3SUWA 2XVGA 2BVTA 3ARYA 3WMCA 3SUTA 1V6VA 3VU2A 1CGUA 4N42A 2VQUA 3I3DA 2UY2A 3TA9A 1GONA 2HVMA 1ZB5A 4CN4A 1HX0A 3CTTA 2J25A 4E2OA 3KL0A 4AW7A 1J0KA 1GOWA 2J74A 4FNSA 1UZ1A 4H04A 2GUYA 3VX0A 3BLKA 1GOIA 3KL3A 1E4MM 3U5UA 3T2PA 2CESA 7A3HA 1OD0A 3AZRA 4JCLA 5A3HA 1PAMA 3S2CA 3AYRA 4NX0A 2BVYA 5A94A 1E4NA 3GXDA 5BRPA 4DWSA 1SMDA 3VSUA 1SR0A 4RE3A 1UG6A 3L2MA 1KQZA 3M6DA 3WUBA 4ATLA 1Z32X 3VSTA 3AMLA 1H09A 4JIEA 4GKLA 2VX6A 2J7CA 3WD3A 3PZUA 1UKPA 1ZBCA 4EANA 3A24A 2VT0A 1BTCA 3KZSA 1WO2A 5GNYA 5HDRA 3K8LA 2E3ZA 1DWJM 1W1PA 2VOTA 2D24A 2J79A 3DDFA 3SCRA 5BCAA 3ZSTA 1XSJA 3MKKA 3RJYA 4HP5A 3GM8A 5I24A 4LYPA 4Z2IA 4QDMA 1LG1A 1GUVA 5HPCA 1GQJA 3AS1A 3VIIA 1V6WA 3PZNA 4UQCA 1MXGA 2CEQA 2V3GA 1MYRA 3BUIA 4PRWA 1OGSA 1JD9A 1E71M 1OCQA 3ARRA 2PWDA 1GQKA 3OGRA 4W88A 4QFUA 5IFPA 2WZIA 3CZEA 3VDBA 1HJQA 1HXJA 1PIFA 4AY1A 1FH9A 3NJ3A 4DWSB 4OBRA 4C7GA 4QLJA 2J7BA 5A69A 1CXLA 4PMXA 4P7NA 1LLOA 3MSDA 4W87A 2WZEA 3II1A 4D6HA 3OBAA 4QLLA 1G94A 3IJ7A 2OSWA 4RE2A 1EA9C 1B2YA 1VENA 3DX1A 3IAPA 4LYQA 1L8NA 3MO4A 1PS3A 1XCXA 3ARUA 2F7PA 1JZ6A 1HKIA 4OUEA 4NF7A 2EABA 2WHMA 4XV0A 4GZEA 3ARQA 1MQQA 3F4VA 3RM9A 2UY4A 2O9OA 4XZBA 2GJXB 5CGMA 1F4HA 3ECQA 3QR3A 3L4UA 3RIKA 3PTQA 1E72M 2FH6A 4NZJA 1E0VA 3ZO9A 4HMCA 1W9VA 3LXBA 4WSJA 3SUSA 2WMHA 4UFLA 3ZT6A 1QNOA 4MTVA 4MJ4A 3RDKA 1GORA 1QI5A 5I0DA 3BVTA 1OGBA 4JAWA 2XFYA 3EMCA 1PZ3A 4W7VA 3WMSA 3VDCA 2YL6A 3CUGA 2J8GA 1DP0A 3NSMA 1E9LA 3A21A 4YHEA 1E55A 3VIOA 5JBEA 4WF7A 2YFNA 1JI2A 4H8HA 1X6NA 1G1YA 2ZX7A 2BXZA 5A6SA 1QHZA 3U5YA 4CD7A 4D6FA 3AI0A 3DHPA 1OD8A 3AHXA 2YA0A 3PTMA 4X9YA 3HMCA 1MWOA 4PEEA 3BLBA 2J4GA 4AIUA 1RH9A 3WFLA 3RMEA 1KXTA 4P8VA 4WLCA 2VZVA 1OT2A 1XCWA 1RP9A 3N18A 4NRSA 2GSJA 5JIWA 1KWGA 5BXTA 1J0IA 3GXTA 5HOSA 4NXSA 1JGIA 4UZSA 5GPRA 2DT1A 1ZJBA 2VJXA 3VPLA 2XVKA 1KWKA 3CUHA 3OZOA 4GPNA 1JZ5A 3L2LA 4U3AA 2JALA 3RCNA 4MB4A 3A3HA 3CMGA 4PCTA 3W29A 1JDAA 4A3HA 5HXMA 2NT1A 3WH9A 1HN1A 3AS0A 1XGZA 3H55A 1EDQA 1FH8A 3WNPA 2X1IA 3BAYA 4PTXA 4B3LA 1HP5A 3I3BA 5FD0A 3VIKA 1UHVA 2DPEA 2DT2A 3WNOA 1FP8A 2ZUVA 3CUIA 1TA3B 3LPOA 4J27A 4PMDA 4FMVA 5HBFA 3ZT5A 1B90A 5CPTA 1L0PA 3AIBA 2CXGA 3L4TA 1K9DA 5A6AA 1U33A 4TUFA 1B0IA 5JBFA 4MB5A 2ZWYA 4W86A 3RM4A 3BXWA 5KEZA 3LPFA 3NSXA 3HG3A 2C8NA 2WC7A 1CTNA 4PTWA 4W7UA 1UA7A 2WVUA 3WDJA 1J10A 1QNRA 1ZL1A 4UNIA 1PZ2A 1H0GA 1HJXA 1ISYA 1CWYA 3SURA 2OYLA 4P7LA 3DYPA 4QP0A 2CBJA 3CHFA 2ZXDA 4ACYA 2OW6A 3VIHA 4AD2A 4JFSA 3VSVA 4CVUA 4W8BA 5CQ1A 3JUGA 1S46A 3AROA 4U5KA 2X2JA 3D4ZA 3WQ4A 3VX1A 4DM1A 1V3HA 2X2HA 5FKYA 2VI0A 1MW0A 2EQDA 2GJRA 3T0DA 3N15A 1CNVA 4P7OA 1C90A 3ZSSA 2BHZA 1JFHA 2PBOA 4BQ5A 2ZICA 4BS0A 2IXVA 2V5CA 2PI6A 1JYXA 2AMGA 1JYNA 5IXEA 8CGTA 4UOQA 2IGTA 4L4OA 4HPHA 3I3EA 1VFFA 4XUYA 2ESCA 3SCVA 2ZUWA 2Z1SA 2CBVA 2ZXAA 4HTYA 4AZHA 3L4ZA 3SCNA 2NW0A 4MB3A 1GOQA 1EIBA 2OSXA 3D52A 4ZXOA 3VNZA 2J8FA 5DMYA 4KMQA 3F5JA 1KXQA 1GQLA 4IPLA 3WH5A 1LWHA 3PZTA 3NUKA 3UR8A 5D9OA 4AC1X 3LXAA 1E0XA 1IZJA 5CXPA 1TQVA 1K9TA 1KCKA 3WNMA 3W4RA 2ZX6A 1Q6EA 4DUVA 5CG0A 1QI3A 4NZCA 4R5EA 1E6RA 1TQSA 4FF5A 2JEPA 1GPFA 4V2XA 3QHOA 3PZQA 3K46A 4DO4A 3NSNA 5DO8A 2FGLA 2O9TA 3PZIA 4XX6A 2GJXA 4U2ZA 2DSZA 3VIMA 4FLSA 2XN1A 1UH2A 4V27A 1VBUA 1SZNA 1C7TA 3FHQA 1C8QA 4MNLA 4ACZB 2DSVA 1HWWA 1FHLA 3G6LA 2XWEA 2CIPA 1C92A 5LYRA 5HNNA 1GOMA 3WD0A 2JF7A 2F7QA 3WY2A 1TE1A 3WIJA 3WDQA 1KR0A 1I1XA 3WD4A 4AD1A 3OG2A 1WAWA 1BYBA 4KGLA 4BZYA 4HA3A 3AHYA 2XSBA 1J12A 5BXPA 2WK2A 3CUFA 1QBAA 2YJQA 3BVUA 3W27A 1VAHA 4EE9A 2VRQA 1B3YA 3T08A 2CKRA 1E0WA 3ZT7A 1UWRA 2VL4A 3L4WA 3OGVA 2CKSA 4M24A 1BF2A 2WLYA 3ARSA 3CZ8A 3MMDA 1IT0A 2FYVA 1FH7A 3ZQ9A 1V6UA 1Q6GA 4U31A 1KFWA 5M17A 1TQWA 3BC9A 3EJTA 1UWTA 1CPUA 2OLHA 1E6XM 2X09A 2Q8XA 2QPSA 2WBKA 3W6LA 4HMEA 4Q7NA 2DDXA 1TVNA 3LRKA 1GZJA 1ISWA 3OGSA 4MNJA 1XYZA 2Y5EA 5LA1A 8A3HA 3VD3A 1LF1A 1QI4A 3VVGA 3VD4A 1WZMA 1IV8A 1QI0A 1BFNA 3GYCA 2WB5A 3O6AA 5AC5A 2WVTA 3DX4A 1KTBA 3WEMA 1YQ2A 1G9HA 1H5VA 4OIFA 1JNDA 2WWCA 4UOJA 4D72A 5E6ZA 2V3DA 2WSPA 1KGWA 3ZJKA 4KWUA 1W1VA 2VZOA 3BAXA 1W3KA 3GNOA 2E9MA 3K4DA 2JIEA 3ZR6A 4HA4A 4JL2A 1R7AA 4Z2LA 1RD6A 3WQ8A 1V3MA 3WNLA 4OBSA 4AZCB 1V03A 1VFOA 3CMJA 3LRLA 4UCFA 3N13A 1ZBVA 2EPKX 1E4LA 3GXFA 3MUY1 1UWUA 3VGBA 4UFJA 3POHA 4KRTA 3MANA 1GNXA 1ITXA 1NWRA 2WKGA 4C7DA 4HPGA 1QBBA 5GNXA 4LQ1A 1UWSA 3T2QA 3D50A 1QOXA 2YA1A 1NH6A 2WW5A 2W63A 4WSKA 5LA0A 4FNQA 3AISA 4J3XA 5CSYA 3DDGA 5EMYA 3VGGA 2VRKA 2EPOA 1CXKA 3BUBA 2PC8A 2D0FA 3OB8A 1KBKA 4MNKA 2CHNA 1SFSA 4CD6A 4S3KA 3AIRA 2XHYA 4TOQA 3SUVA 4UZUA 2Y4SA 1F4AA 4PMQA 3EJPA 2GK1A 3AIEA 4M29A 4CVWA 4Y7EA 3ALGA 3WDRA 2QMJA 2VURA 3EJSA 1V0KA 1R46A 2WZHA 5IHRA 3AMCA 1W9UA 2WM0A 2W4XA 3VIFA 3ZIZA 1HKKA 3BSHA 1ZS2A 5A6MA 4F9DA 1ISXA 1HJUA 4ZXLA 3MUIA 1E4IA 4R27A 2CERA 1KXHA 3LMYA 4PTMA 2WWDA 5FOOA 1PX3A 2CCRA 5M5DA 2ZXQA 4FLQA 1JFXA 2WC4A 1OGGA 3EDJA 5JBDA 4AMWA 3IK2A 2XTKA 3AMDA 1LL4A 4YHGA 1HVXA 1R87A 1UD5A 1UD6A 5D9MA 1HVQA 1LL7A 1R47A 4HMDA 1W1TA 4HA1A 1BAGA 2XFRA 2OWWA 1AQMA 5I5RA 4W85A 3TOPA 1EDTA 1W32A 3IJ9A 2E40A 3HG5A 2VQTA 1CXFA 3AFBA 4U2YA 1UR2A 1LG2A 2WLZA 1VEMA 2VZTA 4IUGA 2YBUA 3NYDA 2Y8KA 2ALWA 3W37A 2PB1A 2Y8VA 4AEEA 2WVVA 2DEPA 1CDGA 1ISZA 2GK1B 1V0NA 2ZE0A 1TZ7A 3VMPA 4IM4A 1SYTA 1J18A 3GNRA 4PSRA 2XIBA 2JE8A 4D6GA 2VR5A 5ABFA 4TVUA 4HZ8A 3GH4A 4TX6A 4J28A 1CGYA 2CBUA 2XJ7A 2TAAA 4MDPA 2V3FA 3CHDA 5JIPA 2GFTA 4UFKA 3D5HA 2YA2A 1EHAA 2OW7A 4YPJA 4J3TA 1BYCA 3WF0A 1B3VA 2FDMA 5EB8A 3VUPA 3UG4A 4JHZA 3UCQA 1E6QM 1JF5A 1M04A 1CGXA 4AEFA 2G3NA 4AZBA 3LX9A 2XVNA 2E9BA 1QNSA 6TAAA 3VD7A 1VFMA 3E1F1 4ZE4A 3GH5A 5I79A 3EDDA 1GOKA 3T0BA 2VTFA 4ATWA 3QOMA 3HG2A 1HKJA 1J0HA 3BGAA 4M82A 1WCGA 1OB0A 2DH2A 4M8UA 1UD8A 1XH1A 3SIMA 4BQ4A 2DGAA 3WN6A 2X0HA 4W5UA 4AZIA 4M81A 2ZX9A 2X0YA 4UFIA 2FHCA 2EEXA 3POCA 1UD3A 2MANA 2QV4A 4AIEA 1EXPA 2BS9A 2RGLA 4H8VA 1H49A 4JKKA 4W93A 3PZMA 1Q6CA 3CPUA 5CPSA 4PBGA 3PZ9A 4JKMA 2E8ZA 3GXPA 4LXFA 4C7FA 2WAGA 4HOXA 3OLIA 4MJ2A 1W1YA 4HOZA 2VCAA 4P8WA 1UKSA 4PSPA 3D3AA 4B9ZA 1LJYA 2WANA 5A6KA 3ARXA 4TVDA 1R34A 3WD2A 3EMQA 2Y24A 3THDA 5ABHA 1JZ4A 2AAAA 3W26A 4Z2KA 3ARPA 2XVPA 4F66A 2FHFA 3WDIA 1IZKA 1E3ZA 1ZBWA 4NI3A 3CHCA 1OT1A 3TV8A 3IJ8A 2NT0A 1MW1A 1E40A 3CO4A 3WDHA 4CUCA 2ZWZA 4GQQA 1OSEA 1R75A 3GNPA 3AMGA 4PMUA 1W9BM 4BA0A 2V38A 2F1BA 3ZJ6A 1O7AA 1V3KA 4ZFMA 2ZX5A 4NZFA 1PIGA 1WDSA 3W28A 1JG9A 1GW1A 2EO7A 1TR1A 1BGAA 1VB9A 4GI8A 1TCMA 3VD5A 5TD4A 1EO5A 2YFOA 1C93A 2XFFA 4DO5A 2VX5A 2E9LA 2ZXBA 2A3BA 4UQ9A 2DT0A 2ZX8A 1JZ7A 1PJ9A 4ML4A 1A3HA 2Z1KA 2UY3A 4BCEA 3GTNA 1W9PA 1NWUA 5DF0A 1EQCA 3PN8A 2F1AA 3L4VA 4A4AA 4KGJA 3N04A 1LWJA 4GQRA 2F18A 1DWHM 2V5DA 3B9DA 4UFHA 5JUVA 1AQHA 2BHUA 3WDPP 2ZUTA 2WMFA 2G3IA 5M3WA 4CU6A 1OIMA 3O2LA 2C0HA 4GO9A 3SEPA 1ITCA 4P8XA 2QPUA 2BY1A 3BLPX 2YLLA 2PBGA 1QVBA 5I2UA 1CENA 3WKZA 1UD2A 1CYGA 1XH2A 4NXKA 4H41A 2D2OA 4XZWA 1UYQA 4OOZA 4UTFA 4HZ7A 3VDHA 1LL6A 1NP2A 3WY3A 4GXPA 1MQPA 3DX2A 3RJXA 2O9RA 3BAKA 1QNPA 3DC0A 3FY1A 2W5FA 2ZUNA 2V3EA 2OWXA 5DT5A 1E6ZA 5D9NA 1A47A 2F2HA 3CZLA 4HU8A 4HU0A 1B9ZA 3AYSA 5ABEA 1TMQA 1ZBKA 4CU7A 1JYVA 3AQUA 1UKOA 1TQTA 1WNOA 3WUGA 1E6SM 4AMXA 1W9DM 3DECA 2DH3A 1TG7A 5E6YA 4N0RA 1EDGA 3SCTA 4NSBA 3EJUA 2PWEA 3W82A 4MB1A 5A2BA 3RPMA 3CZGA 2WHJA 4OZOA 3BCDA 4OOUA 1E6NA 2A3CA 4D6DA 1MW3A 1HL9A 1XD0A 1DHKA 5A8PA 4RL3A 5I23A 3NIYA 1E5JA 2W67A 1J0ZA 3G6MA 5ABGA 2DQXA 2J7FA 4J3WA 3M07A 3MUAA 1WZAA 5AYIA 1D3CA 3NCOA 2WKLA 5A6LA 4UOZA 3BUPA 3TTOA 3ZM8A 1QWUA 4ATDA 3B8SA 1R33A 4QCEA 3EDFA 4BQ3A 5HPOA 1WDPA 2GDUA 1JXJA 1HNYA 1MFVA 4DUWA 2WNWA 4V28A 3AXHA 4J3UA 5FIPA 1V0MA 2XSAA 3WMBA 2VZUA 1I75A 5E0CA 1OIFA 3N11A 3S5ZA 4CCEA 3ALFA 1WDRA 2X8RA 1FFQA 3HZ3A 2UWFA 3VMNA 2QLYA 2VR4A 4CD4A 3UG5A 1ODUA 4CKQA 5BXSA 5GQBA 2WPGA 2X05A 1BSIA 5E1QA 3MMUA 3BMWA 1X6LA 1BGGA 5IHSA 3KLKA 3N9KA 3WQ6A 1E73M 3MV11 5D9PA 4P7RA 3AS3A 1J0YA 1CGWA 3WF4A 1VRXA 4JFWA 3WEZA 5C8BB 2IXUA 1TQUA 1UQZA 4U5IA 3CH9A 1UWQA 2PWGA 1B3WA 1Q6DA 2E8YA 1JZ8A 1D2KA 2D3NA 1BQCA 1H1NA 3FXYA 4H2CA 2JEQA 4RE4A 3EDEA 4A3YA 4TXEA 1KTCA 2XWDA 4ZE5A 3NDZA 3A4XA 5CLTA 1PX8A 2WMIB 4YN5A 3VDAA 2OYMA 3VGFA 1E70M 2PF0A 5ABFB 1C7SA 2DSUA 3A47A 2WMJA 2XUCA 4TX8A 1EOMA 1QWNA 3GBDA 1MXDA 3VNYA 3ARWA 1XV8A 2XIIA 1NOUA 2YIHA 3WL0A 3PZOA 2WVVB 4GINA 2O9PA 1NWTA 2PWHA 1CXEA 2YDQA 4FNTA 5E9AA 3GBEA 3CIVA 2WXDM 1JIBA 3FNDA 5D4YA 6A3HA 4PCSA 5IFTA 2GVYA 3OIHA 1BVZA 2JF6A 1FHDA 3ARZA 1KXVA 4AD3A 3EJRA 1UQYA 4CD5A 4MPKA 1EGZA 4JKLA 3KEHA 1V3IA 2C7FA 3KL5A 4AISA 1CEOA 2G3JA 3WF3A 2VNCA 2WSKA 2RGMA 3TTYA 5DEZA 3TTQA 4TTGA 1E1FA 2VCCA 3ARTA 3AHVA 2BHYA 4Q22A 2EXOA 5BROA 5CLWA 1E43A 1OWQA 2JIWA 3WBAA 4W5ZA 2G4FA 1R8LA 3WY1A 4PMNA 3L4XA 3AIVA 3EMZA 4W8AA 3CZKA 3KE0A 3VIGA 3ZMRA 1WP6A 3WFZA 1HL8A 3A6OA 3DX0A 3SCOA 1Q6FA 1FP9A 2BFGA 2J47A 1FA2A 4QCFA 4J3SA 2WCGA 3KLLA 9CGTA 2X2IA 2EADA 4LGXA 4F79A 1UKTA 1CGTA 4AWEA 3W24A 1X1NA 6CGTA 2WMKA 4KRUA 3GZAA 4PN2A 3WBEA 3SCPA 1FFRA 1EQPA 3W53A 1BYDA 2CNCA 3DHUA 3H53A 3VO0A 1WZKA 1M01A 3KWXA 3CLWA 3VGDA 1WDQA 1LQ0A 1UWIA 1M03A 5C70A 3OLGA 3FAWA 4HZ6A 3UESA 3IANA 1AQ0A 1R86A 4P7QA 5A6BA 3BAIA 3VM5A 2WMIA 2BY0A 2J62A 2D1ZA 3AS2A 3LPPA 4DWSC 5DFAA 2FH8A 2F7RA 1B30A 4GIAA 4F8XA 3HJEA 1UR4A 1NQ6A 3PZGA 3BVWA 3MI6A 4Z2JA 3WEOA 5BRQA 3S5YA 4H7VA 2XG9A 4AIOA 3BUQA 3PZVA 1NOFA 2FGZA 4UR9A 4B16A 3AIWA 2FE0A 1CXHA 1JF6A 2XGBA 3AXIA 4AD5A 1U2YA 1G0CA 3AHTA 3CZJA 2ZUUA 2EACA 5F7UA 3QHMA 4PMVA 2WCAA 2BY2A 4FK9A 2D20A 4JHOA 1HJWA 2VMFA 2DSWA 3BUDA 1VJZA 4PYSA 3A23A 2OSYA 3K8KA 3VGHA 3RO8A 2B31A 3T2OA 1EOKA 3D51A 2WC3A 3OZPA 3U7VA 3L4YA 5I78A 1DWGM 2F61A 1DWIM 1JZ3A 1NM9A 4WIWA 2EAEA 1H2JA 3K4AA 1VBRA 3UEQA 4OJYA 4MAVA 1E5NA 2NSXA 4IISA 4DWSD 1V02A 1C91A 1UR0A 1ESWA 2D22A 4GZJA 1KCLA 1JZ2A 5EFFA 2EJ1A 4MNMA 2QMKA 2ZOXA 1ISVA 1JI1A 3ZR5A 3WQ5A 2G41A 2CBIA 4E8CA 7TAAA 1KR1A 2AOSA 3HU7A 1BPLB 4PMOA 5A6JA 4EKJA 4D71A 2QHAA 2ZUMA 1QI2A 2J78A 3QHNA 2YDRA 4CCDA 1ECEA 3VD9A 1HT6A 4FNPA 3W25A 1Q4NX 2G3MA 3SCUA 1JL8A 1CLVA 3BVVA 1V3JA 4UQAA 2F7OA 2W92A 1UA3A 3F5KA 1N82A 3MMWA 3WH8A 3OLEA 3H54A 3GXMA 1NP0A 4JZ5A 4AZ7A 4W7WA 1UZ4A 1CLXA 3AJ7A 1DWFM 1EH9A 3UG3A 3QGVA 4JCMA 4PMZA 2BNJA 4LPCA 1KB3A 2O92A 4H8UA 1WZLA 1E15A 5A1AA 4URIA 4KH2A 3FHAA 4JFTA 3W81A 1VIWA 1GJUA 1NARA 2Y2WA 3B9AA 1H0IA 3A22A 2VX7A 4FNRA 1CZ1A 4LX4A 1EO7A 1NOWA 4WKFA 3VINA 3VILA 2XM1A 4J3VA 4ACZA 2YOCA 1J9YA 2J7EA 2UY5A 1PEZA 2WYSA 3DX3A 5BXRA 1ZU8A 5I6SA 2E4TA 3TTSA 1DTUA 1UD4A 3A4AA 5A8OA 5FCZA 3RM8A 5EBAA 4AZCA 1W3JA 3GDBA 4B3KA 3HN3A 3K1DA 1CECA 5CSUA 1TUXA 1RPKA 1OINA 2YL9A 1FOBA 4FLRA 3PTKA 1TVPA 3VGEA 5ECUA 4D6JA 4PMYA 3VIJA 4M1RA 1HTYA 2A3AA 4WJXA 2XN0A 1K9EA 1MVYA 3EJQA 1V3LA 4BF7A 1BHGA 1M53A 2CYGA 1GCYA 3U7BA 1JDDA 2W91A 1UR1A 1V08A 2ZIDA 1XRVA 4MDOA 3AMKA 5A8MA 4MAZA 2VC9A 2WHKA 2YBTA 3CV5A 1W91A 2BY3A 1V6YA 5DT7A 3CBWA 3AOFA 1QX1A 1C3FA 5E70A 7CGTA 3WL1A 4DO6A 1VEOA 2CPUA 2BVDA 3CUJA 3D4YA 2VVSA 5C71A 3UERA 2EPNA 3CGTA 5AY7A 4OGZA 3VKKA 4D6EA 4JFUA 3BAWA 3HG4A 2D73A 3LPGA 3EDKA 1US3A 1JXKA 3AZSA 1GOOA 2J75A 1V6XA 1QHOA 1QW8A 1B3ZA 1H4PA 1WKYA 4GI9A 2EPMX 1K9FA 1M7XA 4AXNA 3BH4A 1TFVA 5A95A 1UH4A 3AIUA 1MW2A 5M03A 1H3GA 2EPLX 2EBNA 1BVNP 1D7FA 4AZGA 4XB3A 3VM7A 2DSKA 1BLIA 4FNUA 1VFUA 1EHNA 1BG9A 2IUZA 1VF8A 1CBGA 3MV01 3T09A 3QOKA 2WCSA 3CHEA 1E6PA
chains in the Genus database with same CATH superfamily
3MUZ1 5EZOH 5DD3L 2Y1HA 5CEZH 3NK3A 3LTVA 3HNTH 4I2XA 5F72S 3RILA 1IVTA 1DN0B 3EYSL 2IFFH 5I9QB 1SBSH 4TULH 5KVEH 4U0RC 4O02A 4H7ZA 4HCHA 1QMUA 3QIBC 1F42A 5AC7A 3FTSA 1GVIA 3V8CA 3OYXA 3F84A 3L2IA 4X22A 1G7QA 4PJHA 2R56H 3NZPA 3CDFA 3TA6A 5A8NA 4HS3A 2W66A 4KVNL 4DKFL 4ZW7A 2QDVA 2WKJA 5E51A 3P60A 3KPOA 1RLBA 2WAQA 2OZ8A 1Y1UA 1DQML 3BOVA 4FFZL 1E9QB 4XN7A 1AL7A 1T6BX 2YQBA 3V95A 3FKKA 1Q0EA 2DIBA 1VGKB 2PWFA 3WNKA 4OIBA 1V4YA 2FSDA 3TIEB 4KU1A 4QRNA 4B50A 4AZ6A 1NIUA 2EC8A 5E8OB 3AGVA 1XKYA 2YYUA 5I0ZA 3GUFA 3WQEA 3HZKB 1SXBA 2Q5BA 3S96A 1H5BC 3ILEA 5IB4A 2N7SA 1KW1A 1SN2A 5D7JB 1ED3A 2LOEA 4HHHA 4XAZA 3AU0A 1JYWA 1YPZA 4C4BA 2XU2A 4XPHH 2NXGA 5FSEC 1J1PH 2G8ZA 2J7GA 4A21A 3CVHH 2J57A 2J8OA 2GJLA 3MCKB 4V33A 2YL5A 2R0WH 1XBVA 2BP0B 4TL4A 1XYCA 3GG0A 1FL3A 1EP3A 1KN2L 4QYOA 1UB5B 4U6HB 3UBPC 4U3SA 3NPSC 3U7YH 1KN2H 4XVJL 1MHCB 3MYZA 1Y7VA 4FFZA 2O0TA 2D8KA 5GXBB 5DXYA 4X50A 3TC7A 3MUHL 3PUGA 4G6AD 4WI3A 2ED8A 2ZD0A 2CRYA 3ALPA 4LYRA 5I76A 1L9NA 2CLOA 4NYLA 5A6SA 4GCAA 5AOUA 1YEWA 2IFGA 4NUQA 3EYOA 4JJ5B 3RVTD 4JDVA 4F7EA 1MQRA 1LO5A 1ZJAA 2DT3A 4O2FB 4J4PA 4PS7A 3UBFA 4OVUA 3F03K 4PFHA 5F6IC 1JK9A 2YPLA 4CD8A 2WLNA 3EZJB 5H2BB 3X12B 4J7RA 1NDMB 3CV2A 3ES8A 5GRYA 1QBLL 5KUMA 4JB9L 4D2NA 4C91A 1P0DA 1BG4A 1SO4A 1KJVA 2Y1AA 5BMFL 2OWCA 1L9SA 1BXVA 2X2YA 4Y2DA 3ZTDC 3T0CA 1JPEA 1VJSA 3APFA 4X99A 5J8OA 1IL1B 2B0MA 3DROB 3RU8X 3K6IA 4G56A 4KK5C 4PCNA 3TJIA 3RDJA 3TSBA 4HCIA 2FYMA 2F58H 5L0QB 2B0SH 1RBOB 3A9BA 1VGKA 3ESPA 3VXMA 1IR1A 5KBLA 3TMQA 2OLDA 4MZ8A 5F6IB 3WSUA 2DZEA 3F12A 1X1ZA 5AG9A 1UH3A 5MHSE 2ERJC 1N19A 4LQFL 3MDUA 3D39E 4F3FA 2PC4A 4TLKA 3MRCA 1TSIA 1AGDA 3SSJA 1T5AA 1XHGA 1SN0A 1DJWA 1YPZB 5H94B 4IMAA 1JUFA 4V1YA 4G43A 3OXRB 1Q6RA 2GK0A 2JI3A 1KFBA 2J7HA 2C7UB 4K37A 3W7OA 4ZENA 4LCCA 4I9JA 1SXSA 2PF6A 1F76A 1X7QA 4Z2HA 3CBKB 2HN7B 4C5ZA 1HS6A 1SLXA 3ARGA 1KPUB 4NUJB 3H3PH 1HZHL 3P02A 3OMZA 5D7LA 4LVEA 3TBCA 3TIEA 2DWXA 4GUCA 1B0GA 2J8HA 1TYEB 3P9WB 4H40A 4KK5D 4LHQB 4XC1L 1UXWB 1V8HA 3TPKA 4FE9A 1F90H 5FDWB 2GQHA 1MJUL 1TT6A 3STCA 2BV9A 1CG9A 3JVFC 3OVRA 1ES0B 4AV4A 4AXWB 4Z1PA 2EG8A 3BCFA 2E3VA 1HKFA 4CU8A 4FKHA 3QDGD 1VCBC 5LA2A 3W1AA 4R97C 1FO0A 2F54D 4XNXL 5DS1A 4N2FA 4ZMTA 4LVOC 3TK7A 1RURH 2A0LC 1ZJHA 1F6YA 3FAXA 5LVEA 1ADQH 3BGFB 4L9LB 4O02B 2PR4H 1V79A 5L7XH 4X3ZA 2PP9A 4OKDA 1V93A 4WWKA 2XVLA 4WKXA 2IWFA 2EIJB 3MLWL 2QUTA 1DSFH 1E8ZA 3OX8B 2Z27A 3SJVE 2R4RH 3GTTA 3USZA 3T0AA 3ZIYA 2NLYA 3MRMB 4LUYA 3V1PA 5C09B 3TH6A 3XISA 3EA1A 4WJ5A 4XBPA 5DRNB 1OAKH 2HSAA 4LSTL 4FFYL 1P7BA 1SHSA 1G01A 2WHLA 2FJHA 1SO5A 3GJFH 1PZ0A 1AH4A 1F6AB 4TVCA 2XINA 4G9FB 4O19A 1HXKA 2DZWA 4JEJA 3I6TA 3VIPA 2GSIA 2RJMA 2WN3A 4DNMA 4IPJA 3WQVA 2VSDA 2VIRA 2VL5A 4HQQL 2Y7EA 5E2VH 3CVHL 2YGYA 4XH2B 4E8DA 2CCVA 1U93B 5IB1B 5JZ7D 1V02E 1W5MA 1ZAGA 3ECVA 1QW9A 3JUYA 4YXKH 3B8TA 3WE6B 1W3HA 4PGDA 5I00A 3FCPA 1W3LA 4LCVA 5F9WC 3RDTB 3W7PA 5KYWB 3GTXA 1UASA 3U57A 1JFQH 1XB3A 4MKVA 2WMGA 4P2VA 3ATAA 4NNYB 5FAAA 4HJWA 3N06B 4Z7OB 5I8KH 3CT2A 5LHEA 5KSUA 3QY7A 5LNEA 1AGEA 3QIWC 3FVDA 5D2XA 2X12A 2PDFA 3MLTA 3M46A 4WTQA 1V7ML 1SJEB 4KRLB 4N3UA 3CVHB 5CZVH 5I66A 1FWGC 1MNNA 3APNA 2OR9H 3WUFA 1D6EB 4JRXE 3C2SA 4IMKA 2Z6JA 1GKRA 2I9UA 1GYVA 4Y16A 3UXKA 4X5QA 4P4RA 5E9DB 4EZMA 2QCLA 5C08E 3PFRA 1LYQA 4ADSA 4E3TA 1WGOA 1UACH 1A1NB 1WPCA 3FC8A 3LIZL 3PPSA 4G1MB 1BYAA 1GJIA 1DHPA 2BSLA 4XC1H 1KYFA 5HHPB 2DORA 2GK0B 5FM8A 1IAIL 3T3MF 1OALA 4KZDH 4PJBA 3AIQA 1SJMA 4JQIL 3T4YA 5IBLC 3HG1A 2DYSB 1UPMB 1V0LA 4Y2DD 4O57A 4JB9H 4AZ5A 4AGMA 2H47C 2ZOKB 3V0IA 4EWND 4WSGA 3MS8A 1H3WM 3HBQA 1G5AA 4PVLA 2YPIA 1EAOA 4JVUA 1W2PA 1NQBA 1WH0A 3LBOA 3MT1A 3DVIA 4B9YA 3SYOA 3SDAC 3O0KA 2GVGA 1MCSA 1ADDA 4AMCA 4W9TA 3N42B 4OQ1A 2H0JA 4N2EA 2MOVA 3Q2VA 5AWNH 5IFJA 1YHTA 2VEPA 2DJSA 1ES0A 2H0EA 5CR8A 2NSOA 1H3PL 1UURA 3ULUC 4LCCC 3U2CA 3OODA 1SN5A 4AE0A 4HOWA 2Z1BA 1WFTA 4BZ1A 3TAKA 4EIVA 2QDGA 2J27A 1NAML 3I6RA 3FA3A 4F0MA 4APXB 7REQB 4W8LA 1PX4A 2YKKA 1A6AB 3VACA 2P5EB 3CZSA 3KWWA 5DN1A 1A21A 2IALB 2OOFA 5IDZA 3VOHA 3RURA 1T20A 2KLSA 3C60B 4MXWL 2PUQT 1TLKA 3DKHA 3N2JA 4UMGA 4ZMXA 1XCFA 5F0JB 5DMKB 3S0CA 4Y4KC 3EPOA 3C6LA 5IHUL 4IDLA 1OW0C 5A2CA 5EEZA 3PABB 1VFTA 5HGDA 4MUZA 2N59A 1Z3GL 3KPSA 4KHTL 3ITTA 3CXOA 4KQ3H 3KGUA 1OGTA 4PIBA 2DZSA 3AICA 1AMXA 2Q7YB 4Z7VE 1M7IA 4UV4H 2XC8A 4ZFFA 2F74A 4KO5A 2H6PA 3AZTA 4FQ2L 1T04B 3GK8H 5D71H 3UH8A 3X3FH 1DE4A 4K7YA 1IBHA 4PRNA 4F24A 1XLDA 4PH6A 3QYSA 4BSJA 2BVQA 2IPFA 3SCQA 1A5MC 1GHRA 2N4IA 4PLKC 5JHAA 2ZUSA 3CXHJ 3I50L 4ONVA 1A53A 4U1MA 5HI3C 3NCCB 3WELA 3SE6A 3CJPA 3LCXA 3WH6A 2YRLA 5AUMA 3HFMH 2YLAA 3GYRA 4PCFA 1H7PA 4L4PA 3QEGL 1H0DB 1BVKA 5CKSA 1TTGA 4O1BA 4KDVA 1E3XA 1FLRH 1WEJH 1VZHA 1MIEH 4GO8A 1BQ5A 4WI2A 3LNDA 5LNDA 3KM8A 5TQ0H 3LXCA 3T8VA 2F7IA 1O7DC 1ZSXA 3AQDA 3ZL1A 4ORGA 5I66B 4I89A 5CZKA 4HIJB 3BG9A 2R1WB 2ZOTA 5LUMA 2P1FA 2Z35B 5I1CH 3SE9L 4HU2A 4XNMA 1OG0A 2AEQL 2GQ3A 3I10A 3RFAA 3P9MB 4HAFA 3R0NA 3S6CA 3RWJB 4PREB 4Q2ZB 4PBFA 5FGBA 1A7PL 5HD8D 5I3KA 3D7PA 4WCYL 3CJJA 1I1YB 2VC2H 5T9BG 3MJ8B 4UTTC 4D2JA 5A6BD 4UF7C 1LTDA 2EKSA 4H1LB 1K02A 3PYCA 4M7KH 1UM4L 3VXTB 4O15A 4HKPA 5DJDB 3NXFA 4M7KL 2DL9A 4GYFA 4HWBL 3K2KA 3ZDYB 1AO7A 3DRTB 4IRSB 1RK1B 1THFD 2XFXA 5LAPA 2GTQA 4TUOA 4KJYA 4LDLB 5F3FA 3QFDB 2BWDA 4HFUL 5EUOA 4PRID 1KRBC 3E9AA 1D5BA 1K8XA 5CZXC 5FJJA 1GKEA 4ML9A 32C2B 4HD9A 4IRJB 4JFFE 3FUJA 2ABBA 5BWFA 1B4JH 1FCVA 4NQCA 3QK0A 3WS3B 1F3JA 3L6FA 1OOWA 3U0TA 1KG0B 4JPSA 5AB3A 1W5NA 3FH7A 1TIWA 1D5MB 2XVGA 3GMPB 5DJ2B 3Q4DA 3QQ0A 4HG4K 2DLFL 1XF1A 4KZEH 3SUTA 5BMXA 3SBWA 1AR2A 3SDYH 2OZ3A 1NPJA 3QC5X 2IPTL 3TT1H 3I3DA 1E8WA 3LMJL 2R39A 1AZ1A 2A7BA 3LS4H 1PDYA 4PWKA 3G1RA 2QVTA 3LK6A 4HB7A 1SSGA 2F19H 3CZFA 4N2IA 4L65A 3L3KA 1DL3A 2XX0A 5F6HI 1VFLA 1MRCH 2H2SD 1HX0A 3LNGA 4QXTA 5DO2D 4WV1B 4U1SA 1TENA 1SY6H 2X1OA 3C9NB 2J88A 1W54A 4HT1H 4I18C 1PLBA 3KYMA 1J0KA 1MEHA 2F74B 2J74A 2HWZH 3ABMB 3COOA 4FNSA 2WZ6A 1UZ1A 1DEEB 2G37A 1R3KA 3PGDB 4EZLA 4IRSD 1GOIA 3IDNB 3KL3A 1O5RA 4LU5L 2Q20A 3ABOA 3T2PA 5ALBH 1WIOA 3BPLC 3WFDH 2BIPA 4F2UA 1EXUA 1PDKA 3W1LA 1OXYA 1J1OL 5F1NA 2G97A 4HOMA 3H2FA 1CI5A 2FO4B 5ABAA 4IGSA 1RZ8A 2ZCLH 5JHLA 2C3GA 4MY1A 1E4NA 3RFZC 3GXDA 4ETYA 1QR7A 5BRPA 3P1VA 5BJTA 2NNFA 2WQSA 1SMDA 5EBMB 3T65B 1QUNA 3QAQA 3VSUA 4P5MA 4PB0H 1Y6MR 1CFSB 4TYUA 1FORL 3MC5A 3NL5A 3L2MA 3M6DA 1PZ5A 2D7MA 2WSDA 3ZVIA 4DQWA 1YYLH 2BWIA 5E9DD 1LT8A 3N4EA 2J6WA 1XW8A 4ZSUA 2XSKA 2NOYA 4HGXA 4Q0XH 5IW6A 1TVBB 2NRDA 4MDIA 3VSTA 2SFPA 5I1JH 5FCUL 4KX7A 5C07D 4GKLA 2FJKA 1MCOL 3U0TB 3FCSA 4TQPA 1DFBH 3REWA 1M2VB 2NY1D 3H6AA 2PTZA 4NZTH 3AALA 4JHMA 4ICWA 3SDXF 5IJKA 2QAPA 3R94A 5GNYA 3V4BA 1NFIA 1X5XA 4L5FE 4AGOA 2E3ZA 4XBKA 3UC2A 5LBVA 5TJWK 2XFWA 4JN2B 4ZQKA 4HK0B 3ARFD 4L3ED 2J79A 5BCAA 4L1GA 4LW7A 4N1EA 3DVNB 2HNHA 3LOWA 3RJYA 4KKBC 4LBEA 3JTTA 3KH3A 1OP5H 5GRUL 4K7VA 4HNVA 4IW4C 1G4TA 2RCSL 2ZKHH 2ZUXA 3RL2B 1GUVA 4LLAA 2F6AA 4J1OA 1U8KB 3CS2A 1AGBB 3HZYB 2KZ1B 2JIXA 1V6WA 2UUDH 3UZJA 2AJXL 3S7GA 1MNSA 2X9WA 3Q8CA 1KDIA 2Y1VA 5EU6E 1AIZA 4XMLL 1MYRA 2ONEA 2V3GA 5A2KH 4PJ6A 3TKFA 2PCFA 4NT6A 4O58L 4LF3B 1R5YA 4I9TA 3W9EB 4XNMB 5IGXL 3GVWA 1W0YT 1GQKA 4AEOA 4XCFH 4DHLA 2HE8A 4HIXL 4MGXA 3QORD 5T1MB 3S96B 2IMRA 1PIFA 3FO1B 3KJ4B 1DJNA 5GJTL 3WJWA 2X41A 5DCEA 1GGCL 3CDGB 1FH9A 1MCBA 3LRGA 4WW2A 3T81A 3NCMA 3I6KB 4HK5A 4C7GA 4HAKA 1XCQA 4XVDA 3BARA 3E2SA 3NCWA 1S9YB 2WLIA 4OFYA 3FMGL 1US0A 3MRJA 4X63A 4P7NA 1BZOA 4WO4A 3MSDA 4F27A 4DXVA 3KYKH 3OBAA 5DJZB 4HKXA 3PWGA 1HQRA 4QLLA 3AQXA 4TNWF 1M3IA 2NXYC 3IJ7A 2Y5TB 3T77B 2R9HD 4QNWA 5DURD 3EOTH 2XQYA 3LS9A 4PB4A 4Q8MA 1F3JB 4PQXA 3W3BA 4BH8A 2J66A 4YHKL 4O1FA 3QAZB 3VOFA 3ARUA 3FYPA 1D5MA 1V27A 3GMPA 2GJ6A 2F7PA 4Y9BA 3ALWA 4K3EH 3QUKA 5TDOB 1R3HA 4NUMA 3ZHDA 5PCYA 2C3VB 3IDMB 4NP4H 3GSXA 2WJEA 1MFCH 2WHMA 2FIRT 1G6RA 5I5IA 4XV0A 5FR3A 4WDIB 5IESH 2W65A 3QZOA 4MQXC 4N90D 1MWAH 4YSRA 4ZOEA 4JTLA 1FUNA 5JW5A 3O05A 4LV4A 2UY4A 4GUGA 4XCEA 1MDLA 4JTQA 3RM9A 4K36A 2PTYA 1BZDA 1RLWA 4K7PY 5DRXB 1IYXA 2J1KA 4I48A 1C5DB 1VDGA 3OAZK 1S7RB 1PY0A 3IF1A 3RVXD 3BN3B 3UTSB 5CGMA 5DLCA 5PTDA 3ECQA 2X4OA 1TREA 2APTA 2Y36H 3VXMD 8RUCA 9RUBA 3H3KA 5HHVH 1I3GL 5HYJA 2VFFA 3QUYB 3CAFA 3V1HA 4NO3B 1E72M 1JNJA 2RIKA 1TZHB 5EOCH 5I3GA 1YMMB 4IJCA 2EDXA 1W9VA 1HXYA 4P99A 2OAAA 4R85A 1A22B 2ADJB 4GGBA 2YK1H 4JREB 4LOUD 4S11A 4ZNEE 1IWBA 4PG2C 2WMHA 1KCRL 3DOSA 4LUJA 3MLVL 3TEWA 1QSVA 3OGOE 4O58H 1OK4A 1ID2A 4MJ4A 3RDKA 4H1ZA 2AQNA 4V2CB 1TV7A 3FQ1A 1VD6A 3GVGA 1NFDA 5CEZD 5I0DA 1I0BA 4QSHA 1MI5B 4BDVB 2XFYA 1T40A 4BE6A 3WMSA 1JXGA 2LT9A 5L2JB 4KJWC 3CUGA 3UTZA 1NGZA 1DP0A 2GC4C 2QJDA 3EYVA 4IOIB 4QHUA 5DDHB 5HI5D 4MX7A 5I0YA 1E55A 1NPUA 1E9LA 3KW8A 2QVFB 3CXHK 1FC1A 1K77A 3URBA 3TN0B 4JFDD 3GO2A 5FDWA 2M83A 3UPAA 5DUPL 1JI2A 3G08A 3WQFA 1OTUD 2ZJSL 1M7DB 1RUAL 5DHYA 3CC5A 3QZLA 1LE5B 2QYGA 4WHDA 3ROOB 3P3UA 3RU8H 5D4JA 3U5YA 2UXFA 3BPCA 1RY0A 4E2BA 3QXDA 1E2ZA 2GABA 1K2DA 3D34A 3DHPA 3K0WA 2KMWA 4TUUA 5D2NA 1BZ8A 5I1GH 1OD8A 3CB8A 1ZA3A 3PTMA 3HMCA 1MWOA 3ZO0A 5DQDL 3VE7A 2BZDA 4PEEA 1YMMD 1E50A 2NQLA 1RH9A 3L5WA 3V9EA 4OZHE 3QJSB 3O3AB 4LAZA 1KY6A 3LIZH 1KXTA 1RAKA 1G7HA 3KBPA 3RMEA 5C55A 1M9WA 3LI0A 2Z65C 4P8VA 1X8FA 2X88A 3S98A 2QDHA 1MFNA 3SOTA 1IBGL 3DPBB 4OY9A 1QOPA 2QCMA 2JIXB 3D6GA 1T66C 3N18A 5GSVB 1AACA 4ZW6A 3VRLF 3PR2A 4GVHA 4NRSA 5AHEA 3TN4A 5D6CA 1V7MH 4BQBA 5KYNA 1EGMA 1BX2A 4IEFA 1NANH 4AJVA 1OANA 4DGIH 3MCMA 4BXVA 2F68X 2YKLL 4CGUB 4NXSA 3CFDA 1BAFL 5CIPA 4YO0A 5T1DL 1VPYA 3MHFA 4QG6A 3WLIA 4EX4A 2DQJH 2E7HA 3V4PB 2VJXA 4LT7A 1L6XA 2L7EA 3CH8A 1QEWB 1P4LB 4RMVA 4JQVA 2XVKA 2V2TB 2H3DA 3U9UA 1KWKA 3OZOA 2JB6A 4GPNA 5D96B 3G5EA 1TU2B 3L2LA 4U3AA 5A16A 1XWVA 1CZ8L 2AK4B 3QCVH 4PR5B 5HR6A 1W80A 5SX4I 1QNZH 2X6BA 3OAUH 3W29A 5E2VL 2Z92B 4FP8H 3MOAL 5HXMA 5KSAA 1F73A 2PZNA 4I7UA 4X9FA 3TPUB 2NT1A 2RHEA 1HN1A 2C9QA 5G4EA 4QT5B 1NFPA 3OB0H 3HG0A 5F7EH 3S4SG 3X3GL 2X1IA 3KG5A 5E03A 4L3EB 1DQMH 1X38A 5C2BH 1HP5A 1LWIA 4IGBC 3HV9A 3P5YA 5FD0A 3T44A 1NEZA 4MQ7B 3WFEL 2NZ9C 5C0RH 4ECNA 4AF0A 4BY3A 3EH2A 4FZEL 3ASWA 3Q45A 5L2KA 2DT2A 2B20A 2Q87A 2QADC 3IK4A 3OXSB 3BP6A 3GRWA 5F9JB 3CUIA 1D5RA 1DN0A 3QDJE 4M7ZC 4Y9EA 4ABVA 4PJ8C 5D7LD 4J27A 5DA4A 1P5UB 3QJUB 5JQHC 2IS7A 3HQOA 3MGOB 4PMDA 1FZKA 1CE1H 1JWSB 4YS4A 1J5OL 3MBWB 2VAAB 2JVUA 3RP1A 3RWGA 2NV2A 1JWMA 3NTCL 1IGIH 1U33A 5BXFA 4TRPH 1B0IA 3G1SA 3SCWA 5A6AA 4XWGH 4UAHA 2KZWA 1TWZA 4J3OD 1QSEB 4X9IA 3RM4A 1MDAA 4PRPA 5KYUB 3W56A 5DZNA 5J4MA 2A6DB 1FE8H 4MAYA 1IO4C 1T1XB 3QB7C 1KTRL 5E1GA 4TNWK 3IUDA 3NSXA 3VE0A 1KLGA 5D6CB 5JORB 1L6SA 2WC7A 3IU4H 4DK3A 1RU9H 4PTWA 5E6IB 3CFBA 3T4WA 3SGJC 1P53A 4M6UA 4S23A 2ZXWB 1LO4H 5IVXB 5C0CB 3B0PA 4MDRA 4BD4A 1UP3A 4ES9A 3QJHB 5I74B 2OYLA 1ZDSA 3H2OA 3W2MA 4QS5A 4MS6A 4PJFB 2CBJA 3SKNA 4XB8A 3CHFA 4JHAL 2OW6A 1TJHH 5EMUA 3MRRB 3MJYA 5CEWA 4CVUA 1F3RB 3JBG7 4KKLD 1Y1DA 1U8IA 3JUGA 1E4KC 2HXAA 3VFPA 4IU2B 1PJWA 3JT0A 3QWRA 1G0XA 5DWUL 5B3NA 4DBUA 4X6CE 3W7DA 1HCVA 1ZS8A 3QJRB 4Q6KA 1NTHA 4N0YL 4F7MA 5ISZB 3B4UA 3S48A 4EOUA 5DBTA 1PTZA 4XBGB 3GSWB 2DWEB 4DM1A 4C4KO 1H7WA 4HQQH 5E08L 4LS1A 2A9NL 3LZNA 3W1UA 4HNNA 1I9CB 2OKMA 3TN0A 5CD3A 4I5UA 1CNVA 4P7OA 3ZKNC 2EXYC 5FO8A 2HMID 4OGYH 5KBNC 3INOA 3WG7B 5FJUA 3NGBC 1MEIA 1JFHA 3MP4A 5IMMB 4LAJH 5JUEL 1UOLA 3LNPA 1LBLA 5A16B 4HJFA 3FU9A 3DBNA 3D3VD 3SDCC 1JYXA 1XLLA 2CR6A 4N0UE 3X1GA 4C56D 4FGMA 1KJVB 3PJUA 2QCNA 1YECL 2QADD 2IGTA 1HILA 4ZUVA 4KKAC 2PXYB 4RISH 1XL6A 1VFFA 4GRMB 4AYEC 4YHNB 4WOQA 4IXXA 3SB3A 4REQB 4XUYA 4Q6IA 3N2XA 1LJMA 5AW5B 3PNRB 3NJIA 3CE1A 4I85A 2NY6B 4K2SA 1DV7A 4OFQA 4HUMB 3SPGA 1CFMA 3E0VA 3EGJA 4TL5A 3HHSA 5FA5A 2CBVA 3QDGE 3U4BH 3NEVA 1FP5A 3L4ZA 4LOFA 3R13A 3PDGA 3MWCA 5AYXA 2NW0A 2PDJA 3IMUA 3QRGL 1JPMA 3WIFA 4DVRH 4WY0B 4MCYA 4NILA 1GOQA 2W0KA 4LHUA 3BQVA 3GTFA 4OCSH 3F2DA 3NFPA 2CDGA 1S9WB 3OPSA 3RX4A 3TTEA 5BW7A 1JPFB 4KMQA 4XZ4A 1KIUA 4OF5A 1CU4H 1JUFB 1LWHA 1EBPA 3IKCB 5B38A 1LOLA 3DROA 3QPQD 4OF3A 3GRIA 2HRPL 5TE4L 3UR8A 2F8OA 3V75A 2PRMA 2WUCH 3EFDH 3S5LG 5CAKA 3P11L 3O4LE 1VFAB 3LXAA 4G6FB 1SM3L 1S7TA 3LRHA 4XZLX 5AB9A 3CSGA 2R2HA 2PS2A 3QDME 4PGEA 3IGAA 2PXYD 4AJWA 5BV7B 4R90L 5IVXA 4QJ3B 4R5EA 3O3DA 1TQSA 2OXGA 4FF5A 1JZIA 3II3A 1HGWA 2ZAIA 3LKPB 1PKYA 2W9MA 4MNGE 4RCXA 3ARDB 1H8NA 3K46A 2VLMD 4DO4A 2QCFA 1WA0X 4LDEB 3X17A 2Z31D 3B7UX 1DO5A 4PRDB 3AT8A 2FGLA 1P4CA 2NXYD 4XN2A 3SADA 2DSZA 3L65A 1LM8V 1CICA 2YPVA 3FUEA 2NUTB 1KB5B 3X3GH 2BVPB 1IGSA 4LS0A 3L81A 3S36H 3K30A 1MRFH 3V7MA 4Y7OC 4ZFOA 3QIBA 4IKJA 1AGEB 1TZOA 3PGFH 4PTUA 3T9WA 3RY4A 4ZXBD 1C8QA 4ACZB 5CZTA 1Q0XL 4QBXA 3BJ91 1BSLA 1W8SA 2P5ED 5HBBA 2YBGA 4ZQMA 1J88A 4B3EA 4A2LA 2XWEA 4LARH 4Z76B 3G6LA 4K7PL 3INPA 1PKQE 1VCVA 5E6IC 4MBRA 3EOTL 1UZDA 4NZUL 3QPXH 3LKOB 3GU1A 5EBWB 2W8CA 5CJ8A 2JF7A 4B5TA 4PBDA 2PDYA 2JLLA 2ZPKL 3QORC 3WY2A 3IETB 4MVBC 4Y9PA 4NO5B 4WIQA 1XJBA 2P80A 1KR0A 3MBFA 3WD4A 3THMH 4ZTYA 1U8NB 2EEDA 3BLLA 3BW3A 4GEJA 3WLHA 3MNVA 2QCHA 1WKDA 3L0KA 4PGZA 4XAWL 4KNUA 1NLBH 3FQNB 3ZL4L 4W81A 3ARDD 2VXUL 4FX5A 1X5GA 4DZ8B 4ZFGL 2J9XA 2XG5B 1SVZA 3S8GB 2VEMA 4UTBL 1UWRA 3KM1A 2VL4A 1T7ZA 3L4WA 1MCRA 5B3SB 2EYSA 1AJ0A 3MA8A 1NAKH 1IEIA 3IV3A 3PJTA 1TJHL 2BOBB 1NF7A 1KF9B 3CZ8A 4P23A 3B2VL 5ETUB 4ZBJA 2HT3D 2WXQA 5FA3B 2H3XC 2FB4L 1KLFA 2YPVH 4P9MH 4QAMB 1TR9A 3ZHKA 1DIOA 3W73A 1KCSL 1JZDC 5E9DE 1R5IA 1TVDA 2DUXA 3VXRD 2J7LA 4KKXA 3EOOA 4F0SA 2VSMB 5MI0B 3PJSA 2AHIA 3DRQA 5I8OH 1BOGB 5I03A 1I9RH 1TZ8A 3BC9A 1UWTA 1AOZA 4HAGA 3U2IA 4MCZB 2WPBA 1FHUA 4KOCA 2G50A 3B8VA 2WBKA 3WJLC 1FGVH 2X4PA 4P2QD 2A9DA 2BX7A 4AKQA 1ACYL 4LKCB 2OELA 3W6LA 1TKWB 2TSAA 3NTCH 1BFSA 3RL2A 3S37X 2DDXA 3M0HA 1ZTVA 5KBPA 3ALXA 1GZJA 2A6JA 4D8OA 2PXYA 4Y4HC 2D7PA 5IBUB 3OGSA 5A2JH 1HKWA 5LA1A 1DFBL 4FTVA 3BKML 4RLDA 2HX7A 4P2YA 2HVOA 2DI8A 3LJ3A 4XAYA 4RH4A 1J4EA 3SRHA 3W9EA 1O68A 2GTWA 3VVGA 2VLRB 2AJSH 1LQSR 3PF3A 4ZTXA 1PKQA 1WZMA 2L4OA 5I30H 3MCNA 1QI0A 3SDDB 1H8SA 4YGVA 3GYCA 4M4RA 4W9ZA 4KWSA 4Z7NB 1K8IB 1TPVA 1AFVL 4OD1L 3AABA 5K59F 3NSDA 3Q2WA 1F4WL 1A7RL 5JO5A 2CDEB 5JLZB 3LYRA 4GKOA 1RMFH 4PJXB 3DX4A 4I88A 2M2DA 4HZLA 4UM8B 1QPPA 3QQWA 4A3RA 1U8LA 2OO6A 3MHGA 4O1DA 1SLWA 5EO1B 2QTVA 1Q66A 4QDWA 5I1EL 4D72A 4OF0A 3AG4B 5E6ZA 2V3DA 3GPSA 2WSPA 5J56B 3MMEB 2ICEC 4PJDE 3I7RA 4H8NA 3TVMD 3M1BB 5GS0D 1W1VA 3BAXA 1I53A 4W70A 4G7YH 3SDXA 2I7GA 1KLUB 4JFYB 3PP4L 2QUUA 4HA4A 3CK5A 1RD6A 4PBXA 2DOCA 2GHZA 4YX2L 3WQ8A 5K4XA 4X5RA 1V3MA 2DMBA 4M1BA 3CLFL 3WNLA 5J3HD 3OB0K 1BQGA 4KQ4H 2ZUYA 3QA3A 1MRDH 1UM5H 4TSBL 2KAUC 2CHDA 3FKUS 3LRLA 1XP3A 4AUBA 4YGAB 4WVXA 4D94A 4EN3B 2XFXB 1VH7A 4MCZA 3LV6A 1E4LA 2PDKA 2V81A 4NWTH 1A8JH 1AXTL 2X4PB 3MANA 2Y7MA 5KVGE 1GNXA 3PCYA 4RFEA 4NM4L 1ITXA 1RZPA 1F9CA 1NWRA 1YYMH 3KR3L 3FQ2A 3QEQB 1B6UA 4BK8A 4L9YA 2UY7A 2ISDA 1AHWB 2NYZA 3TLRA 3E1ZA 4ANWA 1EBAA 2NY1C 1ZLSL 5GNXA 2A85A 4Y4FA 4LQ1A 1BEUA 1UWSA 1M6JA 1FDYA 2E5CA 1S5VA 4LRNH 1RPQA 4UQ2B 3M86A 4HGWA 3GDRA 2I32A 4L61A 5IHBA 1ZVYA 4HUCA 5TH2A 3I9GH 2R0KH 4PRNB 1WBYA 1S5HA 2FQFA 3F7QA 5JPMC 2YQGA 3CPGA 3H2NA 4QR7A 2DDQL 2YR3A 5LA0A 3OKLB 3Q2NA 4ZMLA 5B3JF 1TVLA 2HFGL 4OZ4B 4J3XA 1G4SA 3HFTA 4FQLL 5CSSA 4PD4J 4MOZA 4NRXB 1C5BH 2EPOA 2PC8A 2D0FA 4K3JH 3OB8A 4N9GA 4WFHE 1H3XA 2CIIB 4R7VA 3BURA 4MNKA 1SFSA 3WFHA 3ZLHA 3O15A 4A63A 3S4SB 3MC0A 5JLZA 4FOKA 2NXZB 3M44A 3PV6B 2R0LH 5B7FA 5AD0A 1TETL 2BINA 4CAGA 2A4ZA 3FQNA 2A6JB 3OKDB 3QC3A 3QV6A 4WDTA 5IHHA 3SUVA 4LIQL 4FABH 4OD1H 3ABXA 3NRQA 1IQDA 4MYPA 2NY0B 3RTLA 5D1ZD 4ZO6A 5REQA 2RFXB 3B2UC 1TZIB 3U2JA 1OY0A 2VLRA 3EJPA 2D9CA 3KPRD 4G6ML 1ZEAH 4JFDA 4M29A 4NWUH 5DRWB 3RNKA 1OPGH 1NUGA 2Y2TA 4CVWA 4O9HH 6REQA 5JMRA 4P23D 5EEWA 3LDVA 3UO1H 4WHCA 4OR1A 5FA3A 2G60L 1E4XL 4Z7NE 4FG0A 4MKTA 4JGUA 2VURA 4C4KT 1V0KA 4AZCB 4Q89A 2WZHA 5EIIB 1M7UA 3AU1A 1OVZA 1FG9C 2H2SC 3WE6A 4X4XA 4CSSA 1XDMA 3UWUA 1I0DA 5DJDA 1P0SE 1MFMA 4P5MB 2XPYA 2YXMA 2GZXA 4PVMA 3QY6A 1AO7B 1JE6A 3DRTA 4QE1A 1ZKAA 2YD7A 3BSHA 4FQ1H 1M65A 4RFEB 5A6MA 4KMLB 4XC3L 1BP3B 4N0CC 4QXTB 4BZ1L 5IUCA 3MRBB 2A9ML 3C4UA 4P2OD 4AQEA 4XI5D 2J1WA 1CB2A 4PR4A 2QCDB 4KROB 2OCJA 1K3UA 5EY5A 1WAAA 4K8HA 2P5WA 1N55A 1F2JA 2FLIA 4U49A 1RZGA 4GQGA 1DQJA 1SLVA 2VDQH 5LGKA 3LMYA 3VXOA 4QCIB 1U36A 4J8RA 4XPAH 5FM5M 2GY7B 2ISVA 5FOOA 3VNMA 3NEXA 2CCRA 2YSSB 4Z1BA 1U4EA 1U41A 3WO3B 2VDQB 4QIRA 1J8RA 2DQTH 2LV4A 2WC4A 5BU9A 1OGGA 3UBHA 4AMWA 5MEQA 1K8CA 3DV6A 2DQTL 2SEBB 1T83A 3V79C 1T6VN 4JR5A 3NJKA 4NC0B 1HVXA 1R87A 5I8EB 4K5MA 3MKVA 12E8L 2ICWB 4ZFQA 3O0FA 2JQAA 2F9BT 3LNMA 1JZGA 1VKXA 1XDTT 2ZKYA 2ZQKA 4F9PC 5CZ0A 1UT1A 1BMZA 1P1ZB 4HMDA 4HZLB 4DGYH 3VZYA 4TPRL 3KH4A 4G8EA 5DFWH 4ZTOL 1TX2A 2OWWA 4JOMA 1L0QA 3MRHA 3S42A 4MLJA 1AP2B 5CJQL 1AQMA 4W85A 4YHYB 1UP0A 1NDGA 2GK1A 1WTLA 3DIPA 1S7SB 3F4DA 3IJ9A 3BWSA 1ZALA 4KCVA 1XEDA 1U22A 1PLGH 1KCUH 4X80L 3TT3L 1EXUB 4WCJA 1TTPA 4U2YA 1YY9C 4WHTB 4YH6A 4ZB5A 1U6AH 4QNPE 1WGVA 2WLZA 4GFXA 4PW4A 5IFAL 1L9TA 4U1HB 2MCG1 3GZ3A 5EIIA 4IUGA 3MTWA 3DXAE 1DOSA 2DBJA 4ZZKA 2YBUA 3O07A 3H4WA 5HHQA 2OMWA 3FB8A 5JW4R 4NYUA 4J5NA 1BFOA 3UJIH 2DF3A 3NYDA 2QZ5A 2XIOA 2Y8KA 1UEMA 1M1XB 3G8RA 3N6HA 4U4IA 4WW2F 5EBMA 2VYRE 3S36L 5JW4N 1EBHA 2QQ6A 2Y8VA 2WVVA 1GA2A 8FABB 4F7PB 1XF4B 4PRHD 2FUTA 1CDGA 1ISZA 1K03A 2P1YA 5JW4M 3G77A 2LTQC 3HNSL 4TQEH 5BZZA 2A74C 3VMPA 4YMPA 4W7WA 3BPWA 1WKFA 1QLRB 1BTMA 4FQJL 1J18A 2RB8A 3ZRCC 2EF9A 1T6WA 3CFBB 2C1OA 2JE8A 1YMHB 4G42B 1Z1WA 3U48A 4CMHB 4QLRA 1B4TA 3GH4A 4NNXB 1NMCC 1CGYA 1VGEH 2V37A 3LEVL 1X7TA 5C3TA 2O4MA 4O00A 1TPEA 3MP3A 3EXTA 4MDPA 2H32B 2ZXCA 4FQLH 5EZLA 1VACA 3CHDA 1NJ9A 3D09A 2B1OA 2X4UA 3UZYA 5J5EA 1U58B 2Y2YA 2FFIA 2YA2A 2W9LA 5M1TA 3B37A 4H7CA 1A6TB 1JNNH 4J3TA 3WF0A 3ULUD 3GB7A 3F62A 3HURA 1U93A 5IB1A 4BFBD 1KYAA 2WNZA 2CZ5A 4S1RH 3QUYA 3ARGD 3G5VA 4PGDB 3VQ2C 1TJIH 2GTZB 4JREC 4BZ2H 4ZI8A 1C08A 2A6IB 1CGSH 1S7SA 4JHZA 4DKEH 1EVTC 1YJDC 3B9KB 3QQDB 1F00I 2VLLA 4OLZH 3EYFA 2PTUA 1JF5A 3NABH 1E6QM 3P2DA 4XMKH 1CGXA 5CZSA 3FO2A 1NGQH 2PYEB 1GY1A 5JTWA 4LLYB 3MJ8A 3W84A 2G3NA 5H8UA 2PO6D 3ZE2B 4AZBA 5BZWB 4F40A 2IV8A 3TAOA 1W0WB 1H1YA 3TZVA 1W72B 3PQYD 5EPMB 3RB5A 3HGOA 4R7LA 4DJMA 3MLWH 4LCYA 3VD7A 3ZDXB 6TAAA 1TV5A 5GJPA 3E1F1 3BGJA 1FYTB 3SKUD 3VFGL 4GUIA 3BEVB 3JV0A 3FQRB 4NO2B 4UV4L 4HDIB 4U1JB 4GXVH 4J3BA 5DZLA 5A2IH 3FSVA 5ALBL 1OJXA 2CA4A 3MREA 4LUTB 1NEYA 1GC1L 3NDZE 1JNHA 3V5DB 4HSHA 1G6RL 3GMQB 3BRDA 3C6LC 1SJCA 3BGAA 5I16A 1O66A 3WLSA 3BZEB 1HZKA 3MVSA 4UILH 1YY8A 2G5UA 2FMNA 4YHOL 1ZLSH 2YX0A 1F02I 1WFUA 1ZSHA 4F8NA 2JGYA 35C8H 3WI9A 3ILQC 1TITA 2ANUA 2X0HA 4H25B 1CFQB 4OB5H 4ZX5A 1K72A 3U0PB 5AKQA 4YXGA 3SGKA 4AZIA 4HHAA 4U1LA 4KH9A 4NWTL 2FQGA 3SBRA 5A2FA 4UANA 1C8PA 4GRSA 1QWGA 4UFIA 4IGMA 2J72A 2JKTM 2Y07H 5FYLH 5BRZD 3RBSA 1KTKE 4AV0A 4RW3A 5C7VA 1L7IH 4Z0JA 1H7RA 4LWWA 4KFNA 4GLEA 5LZLA 3CH0A 3K2UH 1VFSA 2BS9A 3QEHB 2VKZG 2CZFA 3PQYB 3F6IA 5AHMA 4HIIB 1RVFL 2W0FB 3QXAA 3JVAA 2A7NA 3CFEA 4W93A 1ZXKA 1WYJA 2BH0A 4BWLA 4DF1A 3PZMA 2ED9A 4JY8A 1Q6CA 3GIZH 5FCSH 5CBAB 1RCXB 2IALA 4OIIH 3CQIA 1LEGB 2HG0A 3HCVB 3RX9A 3R25A 5AAMC 5T9CE 5IQ7H 2H0FA 4Z3EA 1OX6A 1D7BA 3BP4B 2D2HA 3PZ9A 2BLFA 1R38A 2JQZA 1X5HA 3VFLA 3LKPA 2EUXA 2WAGA 5C0AB 4HWBH 2OQHA 4WTXA 1W1YA 4NQSA 4OJCA 2VDML 4WU5A 1ET5A 3F1QA 3I2CL 4NZRL 3UCCA 3IDYC 3EGSA 2Z91B 4F33A 4O13A 1FZJA 2DYPA 4CSTA 1U58A 2EEBA 1R34A 4TVDA 1KCSH 5CAYB 5D5ME 4HVXA 3M1ZA 2EC9U 2Z92A 2Y24A 3FUDA 4JEGB 5C0CD 1R6VA 2IBBA 2G0LA 3LH2L 4LDCA 2BGQA 3QUYD 3TPUA 3TC9A 5E8PB 4ZXBC 2XLLA 3U9WA 4ELME 4LOCA 3ARPA 4FXRA 3P0GB 4LHUD 4L5FH 4LP4A 3VH8G 3OG6B 2XVPA 1KRCC 3U4KA 4L9DA 3B2PA 5IG7A 4F66A 1UFGA 2ZOLB 3BUVA 1OK0A 5BPPA 2FHFA 1JHTA 5AL0A 2Z1VA 3FCUB 3WDIA 1URZA 5LAXB 3UZEC 4BF5A 1QO3A 1E8YA 3S9DB 2PFHA 3N5AA 5C0IA 1IGCL 1W6WA 1HJBC 5BZWA 2A1YA 2VERN 4QTIL 5ALCH 4JNZA 1LO5B 1UPPA 4BH7B 5JHLH 1IC4L 1OT1A 4JO4L 1ACYH 1GXEA 5A6TC 4JDTH 2AZAA 1E40A 2E6JA 2PXYC 1JEZA 2EXSA 3CO4A 4M4PA 3V0GA 3EPMA 2PDHA 2PW2A 4JG9A 2GGHA 1OSEA 4K3JL 1ZHBB 3I4EA 1H15A 1XX1A 4KXCA 4ZAKA 2EDDA 3FQWB 1OAUL 2OZNA 2K4WA 3C5SB 4L80A 4PMUA 3D2UA 4AYBA 4O16A 2F1BA 1L3WA 3O3AA 1CR9H 1KIPA 4HGKC 1ADWA 2AK4A 3ETBF 4Q52A 2WBXA 3K72A 2WZTA 4MXVF 4YNGA 5KITA 3HNVH 5ID1B 1JN6B 1WHPA 3WJMA 3RFZB 3C6LD 1PIGA 5D1QC 7PTDA 3BO8A 3B4NA 1GW1A 4I18A 3ZHFA 2BIIA 4DZHA 1QFUH 3CQHA 1LE9A 1OE2A 2EDNA 2VAJA 1DXFA 4C6QA 1VB9A 2XWJA 2LU3A 4I9WD 4G8IB 3SD2A 5C0CA 9PCYA 3C0SA 4GXWA 4HISA 4DN3H 1FKXA 5BV7H 4GI4A 4UTBH 3VD5A 4O54A 4AFYA 3MRLB 3C5ZA 2EHHA 1ZLUH 4ZOCA 2V8ZA 4HJUA 2VEKA 4GW4A 4PY7B 2RAMA 1C93A 2XFFA 3QWOB 5BS0A 5ERWB 3BD4A 1NGPL 3UABA 1QOQA 4Q6JA 4QHRA 3FJTA 3NDYE 4C59B 2ZXBA 3MW7A 1NCWL 1H7XA 3T0WA 2W27A 4FX6M 5KANG 2DT0A 2G75B 5I1IL 4JIIX 1JZ7A 1Z2KA 1G9NL 1DUYA 3T4AC 1SXZA 3T5WA 4WV1C 4BWUA 4GOSA 4IXHA 2BNQE 1AQKH 1PWLA 1WUFA 2JCWA 4IG2A 2ODHA 4Y1SA 5FV1L 2ZOLA 3BH9A 3GTNA 4UTAH 1NWUA 5C9RA 4J1UA 4BFJA 2EE9A 1Q9WA 2MQ0A 2VM8A 3T77A 2RDTA 2WNXA 2I07A 3NQIA 2FB2A 1T03L 1XLKA 3K91A 3B9DA 2QSTA 3IWUA 5IVXF 1Q3NA 2V5DA 4MQ7A 1DO6A 3BSZA 3H4XA 1YY8B 2QT6A 2R29H 4WZHA 3KS6A 4Q8OA 1KLZA 2Z91A 3HM7A 2IDFA 3RAJL 1MRFL 5ADPH 4KTEL 2ZUTA 4Q7IA 4MWFB 4PP1C 4WEEA 2X4NB 1T89C 3S97C 3VXSB 5IKCA 3ZLGA 3D48R 2GCYB 4CSPA 4AC7C 5ANMA 4LCUA 1LILA 5FGBC 2PLKA 3B4YA 2P9RA 3GJFB 3AQZA 4ZW3A 1OIMA 2C0HA 4NJGA 4MHHI 3SEPA 2GGIA 2OTPA 4NIKB 2BY1A 1PZAA 4I48B 2V2DA 3WKZA 3UXLA 1XH2A 2NV1A 4FA8A 1H60A 1DBKL 1MCIA 4KKQA 2UZIL 5IIEB 1BREA 1JGLL 4H41A 2W0FA 4OCLC 3MRKA 4P06A 4M1GL 1YW1A 4BFOA 3VB9A 5JPNB 2QDEA 1KLUA 1EAJA 3W7NA 4J3OH 4HZ7A 1HNFA 1A64A 1HOEA 4GBXB 4X8CA 2EDLA 5F1IA 3SGDI 3SODB 3W5NA 2R8SL 4MJ6A 3WY3A 1LZOA 3ID7A 1Z3RA 2OQLA 4HPXA 1AODA 3D69A 3TCTA 1WAEA 4R9HA 2WBJB 5CGQA 5TQ2H 2DV0A 3NZGA 1AFSA 1XZWA 3R1GL 5EC1A 3MLXH 3DC0A 3O2DA 4MHHG 1K4DB 1MEWA 5RUBA 3G5YB 4C83B 1WX0A 5E8DH 2JKPA 3N19B 4AVFA 5DT5A 2XIJA 5D05A 3LS5L 1MUWA 1F3EA 2JQXA 4DP4X 2VP8A 4BEUA 4S10A 4IOIA 3B2VH 3TO4D 4QQ3A 1SQ7A 2R1YA 4C1KA 2DZAA 2AZUA 2F2HA 4PJIE 4AQAA 4IL0A 4BSWB 4EQ2A 4O11A 1WA3A 1RSFA 1L9PA 1WIUA 1XBDA 2C3XA 2YUVA 4B9JA 3NQGA 1OYBA 4A8NA 2FZ3A 3BKCH 2YAFA 4R4FL 1B9ZA 4DXKA 5ABEA 1TV3A 5E95B 1A4JA 1CQKA 1TMQA 3CC5B 2V2XA 3OKLA 4FFVC 4CU7A 1ICPA 1KFCA 3R10A 3AQUA 1UKOA 1BBJB 3LSBA 5B1JA 1CYXA 1OAUH 1KBGL 1WNOA 1E6SM 1IXQA 2HH0L 2AJYH 3DECA 1SVBA 4P46A 3M5XA 5CKGA 5F7AA 4IFRA 4IQLA 4HCRH 3NJHA 4N28A 4XAFA 4AU0A 5F7DA 1TJ0A 4JDTL 1MVFA 2ZKMX 4WI9A 3HC0A 1EC9A 5XINA 4N1HB 2OMUA 4K7FA 5KS9E 5LG6A 2M26A 4PJHB 4NSBA 5LXXA 4L1DA 4WFGD 2XICA 2DTSA 4YHLH 1A6ZA 1C12B 2YXGA 5GS2H 2LFEA 5BVJB 1KRAC 2JKXA 2PWEA 3FUFA 4MB1A 3RPMA 4FHKA 2WHJA 3GBLA 3V6ZA 4OZOA 4LNRB 2DIKA 4XCCH 1E6NA 2R2BB 1WKEA 3LQZB 4DEFA 4H8QA 1XD0A 4PVBA 4X83A 1AXSA 5E6SB 3H4FA 4QHMA 5EIVA 5LDSA 4RL3A 4D9PA 5H37H 1LO4L 2H6OA 2BXVA 2ENJA 3FT3A 1DE5A 3QDJD 4KXBA 2QJHA 3NIYA 3QMSA 4HKXB 3N40F 4HIEB 1EEZB 4QM1A 5T1LA 3BKYH 5ABGA 1LLAA 3CD4A 3JWDC 5H2ZA 2BP8B 3G1AA 4HF5H 4A8IA 3IPWA 4E41E 1MCEA 1Y07A 5SWSD 4AH7A 1JVKA 2ARJQ 4NJKA 3HC3H 1OK6A 4KKCD 1B88A 5T8IA 3NCOA 3U8GA 1J5HA 4UT6A 5D5MF 2YEQA 4NN5B 4GY1A 5JW3H 3ZM8A 3KLAA 3VA8A 2HJFA 1T3FA 1T04A 5I3JA 1LRNA 1X4YA 5F1IB 1WDPA 4GH1A 1UW9A 2FJGA 2ZCKL 5IJVA 2VGFA 1DDHB 3K6NA 1H62A 4O14A 2WSQA 3MSPA 2YSSA 2G9HA 3LHUA 2WNWA 4QE4A 2AKRA 5BW7C 1LTXA 4V28A 5TAOA 2QV2A 4ZTPH 3EPNA 3KNBB 4M61A 3IGXA 3IEBA 3LTSA 4J3UA 3V4UL 5C8JA 2OA9A 2K8MA 3WMBA 4XP1L 5D2LF 2BOEX 1KJ2H 4NO3A 1PL3A 3QXWA 1QLFA 4N2CA 4GUFA 4HXBL 4KTEH 2M8XA 4PJFF 3OQEA 3GJFA 2R1YB 1B3JA 2V9TA 4CCEA 1Q8AA 1WDRA 2VCOA 3QQ4B 1W3TA 3W2UA 3HZ3A 3QAZC 2A73B 2NY3C 2QLYA 3VMNA 2UWFA 3G1XA 2XN9E 2NXHA 3UG5A 4CKQA 5IP4A 1BRLB 4R7JA 2X05A 4OHQA 2EJAA 1JZHA 3WXVH 1W6LA 4R7NA 5E1QA 4JRXA 3BMWA 3UTPD 1R3JA 1X6LA 3PANA 1R5WB 4LL1A 1H6TA 2PDUA 1YEKH 4FYSA 5L4IA 4M3PA 5KVEE 4OM0H 2FGWL 4QKXB 2NQZA 3MV11 5D9PA 4KQ0A 4P7RA 3AS3A 4DGIL 2IWEA 4YBLC 1S5IL 5LBSH 3VH8B 1CR9L 4Z7WF 2D69A 3FV9A 1KYUA 5EO1A 2P53A 5CJBA 1UQZA 4FXGC 3CH9A 1EF2A 1MRCL 3AFLA 2ZSWB 4MSSA 1CD1B 1MN4A 2PWGA 3TVMC 1PTDA 1XXFC 3L5XH 2NUYA 1GPOL 1Q6DA 4LSQL 3ZZLA 4BF9A 1S7VB 1D2KA 1ZGLA 2ISFA 3HI5L 2D3NA 3UTTA 1BQCA 3N14A 5HGGS 4H2CA 1IAKB 1PZ1A 1U8JA 1EIXA 1FCCA 1I82A 2A38A 3C8KB 3QA3B 3BT2L 4A3YA 4ZE5A 1KTCA 1ZPLA 4N2DA 4PJDA 3DC8A 1NCUA 4AHOA 5I02A 3A4XA 1TQXA 5CLTA 1PX8A 5B7ZA 2PGFA 1OPOA 2DD8H 5ENLA 4PJ9B 2GSGB 3TWCH 5KSBF 3AWNA 2R69H 4IMGA 4YN5A 2UZPA 4GMTL 1H9DA 1FNGB 4HNCA 2G4JA 1AHWA 3VGFA 3C9NA 4NOBA 5FUZH 5SX5K 3BKJL 1BLNB 2XUCA 3ITOA 1ZVNA 4WO0A 2P0OA 4NNBA 5J9PB 4Y2WA 4ZMAT 3LN4B 1J5IA 2DWYA 3GR8A 5E4AA 3ARWA 4C54A 3FTYA 3DZ1A 4EF8A 2YPKB 4DAGL 1F6LL 2V5SA 3RB7A 2Z0IA 3SSGA 5AN7A 1W1A1 1OAYL 1SW7A 2B15A 2FB3A 2ZDRA 1SJHB 2GAZA 3KNBA 1R9ZA 3FB5B 4HKJA 5JQIB 1UIPA 1MFCL 3M7FB 4IFKB 1K8IA 1B0RA 1KM0A 5ESVA 1OD9A 2PNDA 5TE7L 4AG4H 3WLNA 3FUMA 2EVHA 3ZYJA 2OZ0A 3TNMA 1ETZB 2VGBA 6A3HA 4G70B 4PCSA 3WFCH 3JVGA 4QXUL 2L7UA 3W39A 2E7LA 3ZPDA 2WQ8A 2BOCA 4WGWB 3DVFA 4P2QE 4GFTB 1UMYA 1BVZA 4ATTA 1KXVA 2BP8A 5KOMC 4QRSA 3EYOB 4JJ5A 3PU7A 3MHUA 4KKBD 2DN7A 3G6DL 2VEIA 1K4GA 1CT8A 2PDBA 2NY4B 2B1HL 4NHUA 4B7IA 1UQYA 3NO1A 5LIWX 1L6GA 3DDMA 4IOSA 4MKMA 4WNSA 4OD3H 4JKLA 1VLIA 2O30A 3U36A 4K71C 4DGUA 1YN6A 4KRNA 4LAQL 1TJ2A 1V3IA 3PBUA 2POZA 1GKQA 2JELL 3P67A 3RHWK 1BQUA 3KL5A 3VU1A 4C8XA 1TPC1 3VDGA 4WHYG 4QO1A 3N73A 3FU5A 2KYIA 3O6FD 3P3RA 4LESA 5T1KD 2CLMA 3NG3A 3OZYA 1P48A 2GSGA 3MV9D 3CFNA 3TTYA 3B0YA 4M61B 4Q9RH 4PLOB 5F6HJ 3BE1H 3ARTA 4IKKA 2Z4QB 1CI1A 2R59A 2YLHA 4KHXH 3UL4A 5FAJA 3EWYA 4IOFC 4N5ED 3CVIH 3VI3B 1OWQA 1L6ZA 3HG1B 3TEYA 4LCIH 4ZO8A 5E6ID 4AUUA 1ADOA 4A2EA 4GG6E 2Y63A 3GMLB 2ZOKA 3IJEB 1S38A 1JGMA 3EMZA 3I9PA 1EP2A 4E0RA 2IAMD 5HGHA 3CZKA 3KE0A 3CMOL 5EWIL 4X6EB 4GNJA 4O17A 4LSVL 3KXFB 3DFTA 1YDPB 5DFVC 5HJ3A 3MROB 3I68A 5HANA 5CJMA 4BEQA 4XNQB 3O8XB 3CIAA 2EVFA 1TJIL 1H51A 1AG0A 1NCOA 1G5GA 2BFGA 2X0WA 4NRXA 5LWYH 2AQRA 2YARA 4A7UA 1IM3D 1P6CA 2J47A 3QNFA 2O5XH 1OSPL 1FA2A 4P2OA 5CD5D 1UP2A 3LUTA 4XVSH 3KLLA 4IRSC 4U1KA 4YK4C 1XIMA 1F6KA 1M6UA 1GSKA 1O9ZA 2HRHA 3L5IA 4OGXH 4G8FA 4ZS6C 2MPAL 4JUTA 2WYIA 3SPIA 1QFWL 1D5ZB 4DF9A 5SWQB 1ZT7B 4Q9QL 2B4GA 3QFWA 1ANUA 3T2NL 1UKTA 2WBJD 2RMNA 1BD0A 1UOZA 3U6RB 4EVZA 2E4FA 3LGEA 4ASTA 4HN4A 5MP6L 3U4EB 4EUPG 4S38A 2XTJB 6CGTA 3WMPA 3NACH 4HWBA 4BZ2L 5HDWA 1BQSA 2X3CA 3W7CA 4AGLA 1G4EA 5AYYA 4GYBA 1CL7I 3FTGB 3ES7A 4XWOC 1BQHB 1IR2A 3QISA 2NX3A 1J2BA 1J9CT 4FI4A 4YLWA 1QLEL 1AC6A 1UEYA 5FOBA 3G0UA 4JFEA 4W9JC 4WJ5B 1LQ0A 4MNGB 3IBOA 3OXRA 5C70A 3FAWA 3U2EA 5I8KL 4WTWA 2EE6A 4E9VA 1WG3A 1R86A 5FUOL 4P7QA 1KBPA 4A3QA 1I7RB 1NGXA 1CUOA 1NCJA 3ASNB 2ACSA 2J62A 3X14B 5FKPA 5EA0H 3R89A 1TCDA 5CJOH 3T0VA 2GBTA 2NX5E 4LL9A 5DFAA 2MNUA 4OLUL 1FWCC 1OIOA 1B30A 2VIRB 4GIAA 2A21A 1D5IL 4X5XB 2A4CA 3FO0L 4F8XA