1HL9A

Crystal structure of thermotoga maritima alpha-fucosidase in complex with a mechanism based inhibitor
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
442
structure length
420
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAELPGYKWEFTRGIGLSFGYNRNEMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Thermotoga Maritima {Alpha}-L-Fucosidase: Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords PUTATIVE ALPHA-L-FUCOSIDASE
total genus 150
structure length 420
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hl9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hl9A01
5EMYA 1S46A 3GBEA 5KEZA 1ZBCA 4J7RA 1ZU8A 1CXKA 3EMQA 3G6LA 2PB1A 4ACZA 1EIBA 2UY5A 3ZSTA 3AQUA 4Y7EA 2D73A 3U57A 4B9ZA 1C3FA 1CZ1A 1WAWA 3VINA 5A6AA 1GW1A 4QDMA 2D20A 2F7OA 2ALWA 2F7QA 3L4TA 1E6QM 2BY2A 2QMKA 1NOUA 1JGIA 2DDXA 2X2IA 2J4GA 2XYLA 1HJQA 2JEQA 3VGGA 2FH8A 2QHAA 2GK1B 4NZJA 3K8KA 1XYZA 1I1WA 1J0JA 4LGXA 4CU7A 1WKYA 3B8SA 2BV9A 5A69A 2XN1A 2WMFA 3O2LA 2VMFA 2ZXAA 1H2JA 5DFAA 1ODUA 3NDYA 1FHLA 4PTMA 1C8XA 5A6JA 1KR0A 4XV0A 4FNRA 2A3HA 1IT0A 4AMWA 1KWGA 3WQ4A 4AZCB 1E43A 4PMZA 3LMYA 2BXZA 5JIWA 3VNYA 2X2JA 3LX9A 3MU7A 2BY0A 4U3AA 4GQRA 1N82A 2BNJA 2F61A 3BSHA 1Q6CA 2HVMA 1MW2A 5BWFA 2WWCA 4ZXOA 4WJXA 2EAEA 4D72A 3AHZA 3MKKA 4M82A 3WF2A 3DHUA 4XB3A 5I5RA 2G4FA 2FHCA 1JZ2A 1KWKA 1OGBA 1ECEA 3WNLA 3PZ9A 1KBKA 3AHTA 2YLLA 1EH9A 5CGMA 5A3HA 1Q6DA 1M53A 3IGUA 4J3WA 7TAAA 2IUZA 2VX5A 1GQIA 1V3MA 3BGAA 2BFGA 2XPKA 4JKMA 2CNCA 1IZJA 1RH9A 2VO5A 1C7TA 3SUTA 1UH4A 1PIFA 4CN6A 3FHQA 4E8CA 1GQKA 2DH3A 1VENA 5BCAA 1WB0A 3GYCA 3OGVA 1EOKA 2C0HA 4AD3A 3EDJA 3WDRA 3A4XA 1QNRA 2GJXB 4V28A 3ARPA 2EPMX 1XD0A 3VTRA 2EACA 3NSMA 3PZQA 3UCQA 2PF0A 2RGMA 3AYRA 1KFWA 4QAWA 3AZSA 5FL1A 2J7EA 3TTOA 3VX0A 1EDGA 3AIWA 1DWFM 2FGLA 3WDQA 5IFPA 3OLGA 2W5FA 2BHYA 4OGZA 3EDDA 3CO4A 2ZWYA 2BXYA 2FYVA 5M3WA 2CKRA 1E73M 1XH1A 4MAVA 1ZBKA 4D1JA 3VM7A 4OZOA 4A3HA 1V3LA 2WHLA 1HL9A 3ZT5A 5E6YA 2DIJA 2QV4A 1DWAM 4W88A 3VILA 4H2CA 4TX8A 1E6ZA 3LPPA 2IXUA 4AIUA 3AIBA 2VL4A 1R46A 1WZKA 3EDEA 2EEXA 3PZTA 2CHOA 1XSKA 1JI2A 4D6FA 4R5EA 3ARQA 5I3DA 2D0HA 1BG4A 4PTWA 5TD4A 1W9BM 2OWXA 1R34A 4E2OA 1ISVA 2ZUTA 3MSGA 1NARA 3DDGA 3WDPP 3WKZA 3QGVA 4JIEA 1H3GA 2PWFA 4WK9A 3BMVA 4BQ5A 1UH2A 4TVCA 3BUPA 4BF7A 3UETA 5HNNA 3EDFA 3F5KA 1XCWA 2OW7A 2J7GA 4MJ2A 2F7RA 1BYAA 3ZJ7A 3T2OA 4D6HA 1BYDA 1SMAA 3WD1A 1WZAA 2YA1A 1UHVA 3CZ8A 2AAAA 3PZVA 3VU2A 2PBOA 4KRUA 1RD6A 3VKKA 3W81A 2ZX6A 4UZUA 3I3EA 3NIYA 3ZJ8A 1HJXA 2W91A 1GUVA 1VBRA 2WC7A 3SCWA 3DC0A 3VDBA 1WNOA 1QNSA 4V27A 1UQZA 3T2PA 2YA0A 5CLTA 2VZSA 1J0IA 2ZXQA 5DEZA 3BAXA 4CKQA 3FXYA 3MMWA 1GVIA 3AXIA 2EPNA 3MSDA 4PUDA 1QVBA 1V6UA 1MYRA 1X6LA 1DEDA 1OIMA 4UFJA 5JUVA 1BG9A 3OZPA 1G94A 3WF3A 3VO0A 3GH7A 1QNQA 4U5IA 1BPLB 3AIRA 2WZEA 3WNKA 1PX8A 4W85A 3VM5A 1CECA 5I23A 1UA7A 5AYIA 2GJRA 3T09A 4TUFA 2V3FA 3CHFA 5IDIA 5E1QA 2DEPA 2E9LA 2DH2A 3CH9A 1ITCA 2DT3A 4H7VA 1V0KA 1I75A 3I3DA 3AZRA 1FA2A 1W3LA 5DT5A 4FMVA 2FHBA 1O6IA 4NXKA 4XZWA 4W84A 4TTUA 1UOKA 1MVYA 3L4UA 4CD6A 3DDFA 2QPSA 3DX2A 1HWWA 2G3NA 3GNRA 4NF7A 4Z2IA 3QOKA 4J3TA 3EJRA 2WSKA 4EANA 3N18A 1BGGA 1KXVA 1QBAA 1WDPA 3BCDA 4CD5A 3ARSA 4LYPA 3U5UA 4TX6A 3FY1A 4AD2A 1EQPA 4EKJA 1Z32X 3SUVA 4MB4A 1KTBA 4Z2LA 2UY4A 4M80A 4P7QA 1W1PA 3W82A 1BF2A 2Y2WA 3GTNA 4ACYA 1OCQA 2X2HA 3WF0A 2CPUA 2Y5EA 3A5VA 1LG2A 4CCEA 1BVNP 3NSNA 3CUIA 2YFNA 2IGTA 2PWHA 4HZ7A 3D3AA 1MW3A 4U2YA 3K46A 3BVUA 2X8RA 5A8QA 1UH3A 5EB8A 1V3HA 1D7FA 1UD8A 1MWOA 1UZ1A 3W0KA 1B1YA 3WFLA 1R33A 1CGUA 4CGTA 2JF7A 4UFHA 4AD1A 1XV8A 2EABA 5M5DA 4QFUA 2VR4A 3W53A 1MXGA 4PMRA 4P8XA 4NXSA 1NQ6A 4DWSC 1QI3A 2WK2A 4PUEA 4LQ1A 1F4AA 3JUGA 2WZHA 1OD8A 4LXFA 2J77A 1UR9A 2EPOA 2WWDA 3EDKA 2DT0A 3WH7A 1J0HA 1NOFA 4HZ8A 3NSXA 2J62A 5A6MA 5A94A 3WBAA 4JL2A 1ESWA 3NJ3A 5KZ6A 4LYQA 5FKYA 4GPNA 1QI4A 1B9ZA 1CXFA 3DYMA 4MTVA 4OKDA 3EJTA 3OBAA 2V3EA 2HISA 4AYGA 3W4RA 1JD9A 2YOCA 4Z2KA 4F8XA 3CUFA 2WPGA 2A3CA 4MDOA 1UWQA 4P7NA 1XYFA 3O6AA 3CHEA 1HKIA 1GZJA 1JDDA 3GBDA 1UWUA 4Z2JA 3VD9A 2WVTA 5D9PA 3T2QA 3WF1A 2WHKA 4JCMA 1GVYA 4MDPA 2XWEA 3IK2A 1W1VA 4WKAA 3CGTA 2VCCA 3RILA 1E1EA 3BUQA 5A6SA 2W61A 1EO7A 1LL6A 2DGAA 1HJUA 3GH5A 1OBAA 3KL0A 3BAJA 3WY4A 1E0XA 3GDBA 3BUBA 4X0NA 1J12A 3T0AA 3VVGA 1QX1A 5FIPA 4M24A 4W5UA 1J18A 3PZMA 3RCNA 4HA1A 2D3LA 1R8LA 1CNVA 2XSBA 3L4VA 2ZUVA 4J3XA 2CHNA 1LQ0A 4PMYA 2WVUA 5A6BA 4GKLA 3F5JA 2VQUA 3HU7A 3WQVA 3UR7A 3S2CA 3GXTA 1PX3A 1CTNA 5ABGA 1GJUA 2G3MA 4UFMA 5CXPA 1UD5A 1JD7A 1LL4A 2VZOA 3AHYA 1AQHA 1QBBA 3N15A 1JFXA 1JYNA 1GQLA 3A4WA 1R87A 1ISXA 3MUZ1 5HPCA 3TV8A 3GM8A 3WUBA 1B2YA 3AMGA 5DF0A 3VDCA 2ZUNA 1OGSA 4HA4A 1KGXA 2YDRA 4BQ2A 4ZEPA 1VEOA 3AXHA 2XVPA 2WANA 2VI0A 1M7XA 3HZ3A 5LYRA 1E55A 4AZ6A 3F4VA 1TZ7A 2WAGA 3CBWA 3H55A 1BAGA 1CGWA 1E71M 3WMCA 1HX0A 2Y8VA 4J27A 3S5YA 3PZOA 1XCXA 4S3KA 4B9YA 3OLEA 4F66A 1WCGA 4DO5A 2ZUSA 1JZ4A 1G1YA 1JXKA 2J74A 3VGFA 3WMBA 3MUIA 3WMSA 2YL6A 3ARUA 4OIFA 1LF1A 2VUYA 2ZX7A 4NI3A 3WD0A 5ABFB 3WY3A 3GXDA 3KLKA 4DWSA 3BUIA 2ZX8A 2J7HA 4TTGA 5FOOA 3BLKA 4XZBA 1LWJA 3TTSA 4U33A 1UWRA 3MUAA 3VIHA 1JNEA 1JFHA 2X0HA 3CZGA 4AMXA 3ZT7A 1I1XA 4FNPA 4URIA 5EFDA 3QHNA 2VX7A 4MADA 4W8AA 3ZR6A 1V0MA 1E6XM 2O9OA 1HJSA 4QLLA 4CD8A 5A8PA 1JZ7A 1UWSA 4H04A 4B15A 4QCFA 4AIOA 2D1ZA 4IPLA 3AS3A 2F2HA 1CIUA 2B31A 3SUUA 1TQVA 3FAWA 3ZM8A 1L0PA 4JHOA 1X6NA 2D0GA 2CEQA 3SUWA 1LJYA 1FH9A 1US2A 1A3HA 2DPEA 5M17A 4GO9A 2W62A 3CV5A 3WNMA 3MV11 3BLPX 4C7DA 4FLSA 4GO8A 3MMDA 1XRVA 5D9MA 1E5NA 4AISA 1C93A 2YIHA 3MS8A 1IV8A 4UFKA 1CDGA 2E0PA 3ZMRA 1V0NA 2BY1A 1EDQA 3UG3A 3VIGA 1CBGA 1W2VA 1CPUA 2F7PA 1D3CA 2BVDA 1TUXA 2FH6A 2E40A 5JBEA 3SCNA 1Q6EA 4UCFA 4PCSA 3LXCA 1H0GA 1V02A 3N9KA 3HN3A 1JG9A 4LX4A 2GK1A 1TVNA 4BCEA 3T08A 2V3GA 1E6RA 1UD3A 3AIQA 3AOFA 3AS2A 1MQQA 1E4MM 3APGA 5I24A 4MJ4A 2J7BA 5GNYA 2XVKA 2GDVA 4S3JA 5E09A 2D23A 4D6CA 4DUVA 3TA9A 1PEZA 2CITA 1J0ZA 2QMJA 4FNTA 1R7AA 3HG4A 1EGZA 2WYSA 3OG2A 2XUCA 4PBGA 2V38A 3EJUA 1TVPA 4L4OA 4UFLA 4AZHA 4JKKA 5E0CA 3WNNA 4BQ3A 1UA3A 3VOCA 1HJWA 1U2YA 3OGRA 1E5JA 1DWJM 4NRRA 1TCMA 2UY3A 4OOZA 2WBGA 1R47A 3ARTA 1ZBWA 4F9DA 1SZNA 7CGTA 3W38A 1D2KA 1JYVA 3WY1A 4P7LA 4U5KA 2PWGA 3SCRA 1ITXA 4L4PA 4UR9A 4ZXLA 1W9DM 3ZJ6A 2E3ZA 1HXKA 5I77A 4OJYA 2XM2A 1BVZA 3U5YA 3BMWA 4FF5A 5A95A 2VCBA 3PTKA 4AEEA 4CUCA 2WSPA 3QR3A 6A3HA 3ZOAA 2GVYA 2WBKA 3AMCA 3EYPA 2JE8A 1SR0A 2QLYA 5IHSA 1XGZA 3TOPA 5BXRA 3AIUA 3WNPA 4PMXA 4X9YA 1W2PA 1NWUA 3DYPA 2RGLA 3SEPA 4W7WA 1CLXA 3FHAA 2GJPA 4CVWA 1JDAA 1E3XA 3HG5A 2VR5A 3VIJA 2YDSA 4D1IA 3WD4A 2VOTA 4OUEA 4AZCA 1R86A 1PJ9A 4JHZA 1W32A 3GXIA 4HPHA 4W7VA 2VCAA 2EPKX 3WD2A 3SIMA 2EO7A 3L4ZA 2DSUA 3WENA 8A3HA 4PMNA 2J78A 4P7RA 1KQYA 1KGUA 1QPKA 3WN6A 1QHOA 2EJ1A 3KL5A 1UD4A 3ZO9A 2XM1A 3CLWA 3VX1A 2C7FA 1B3XA 1OD0A 5CZKA 3VMOA 4D6IA 1V6YA 5DO8A 2VVNA 4D6EA 3BVWA 4CD4A 3WDIA 1QI5A 3SCTA 2Z1KA 3EJQA 3WIJA 3HG3A 5JIPA 5JBFA 5HBFA 2WMGA 1PZ3A 4PTVA 3KLLA 2W4XA 4B3LA 1UQYA 3T0BA 3BXWA 3BLBA 3T0DA 4E8DA 1DWIM 3VUPA 1QI2A 1UG6A 1OT2A 2AOSA 4W87A 2V3DA 2J47A 2WVVB 3CZEA 1QHZA 1VFUA 1UR1A 1GOWA 6CGTA 1GORA 1C8QA 2OLHA 2WHMA 2V5DA 1QW9A 3L4XA 4BZYA 2EPLX 2J79A 4UOJA 3U7BA 3L4YA 1UR2A 1W1YA 4BS0A 4JFWA 3ALGA 4W86A 4UQBA 3ALFA 3RPMA 1UKSA 3RM4A 5CPSA 5HDRA 1OINA 2E8YA 3CIVA 5C70A 1BYCA 1WZMA 3BAIA 4AWEA 1KXHA 2WHJA 4A4AA 1NWRA 2YL9A 2YKKA 3CHCA 2BHZA 1J01A 1NM9A 1GOQA 3LPFA 1DHKA 3KWXA 1G5AA 3LXBA 2DT2A 3OLIA 1DWGM 2PI6A 3D4YA 4M56A 1HT6A 5A8OA 5AC5A 2D3NA 2VURA 2XFRA 1NP0A 3MV01 5JBDA 1KCKA 4CU6A 1KR1A 3SCVA 2OWWA 3VSVA 3NDZA 1ZBVA 2JFEX 4KRTA 5CSYA 4PN2A 4EK7A 2CKSA 5D8WA 2XVNA 3LRKA 4UQCA 4IPNB 2WC4A 3UG5A 4UNIA 1HP4A 1BGAA 3DX4A 1ZB5A 2VRJA 4UZSA 5DMYA 3G6MA 2O9TA 3B9AA 1GHRA 1GQJA 4KWUA 2WCAA 1WDRA 4MB3A 3WDJA 3ZQ9A 5BXTA 4W8LA 2AMGA 3CMJA 5ABHA 1FP9A 5HXMA 1XC6A 5A8NA 1CGXA 4AIEA 1KGWA 4PMOA 2YBUA 2CBUA 3AJ7A 3HG2A 3IAQA 1GNXA 1SFSA 4CU8A 1OB0A 1ISWA 4WSKA 2VX6A 3KL3A 2ZOXA 3A22A 1SYTA 2WVSA 4H41A 3GZAA 2PWEA 3IJ8A 2ESCA 4J3UA 3CUJA 4H8VA 4AZIA 3PTMA 2Q8XA 3BVTA 3EMZA 1FP8A 3RMEA 5LA0A 3OA5A 4OBRA 1JF6A 4Z2HA 1R75A 3DX0A 3EJPA 5BROA 3QHMA 4NRSA 3PZIA 1K9EA 2NW0A 4GI8A 3UERA 3MI6A 3K4DA 4DO4A 1UKQA 2WVVA 4WKHA 4YHGA 3EBVA 4HOZA 1DWHM 6TAAA 1GOIA 4Z2GA 1HTYA 1OIFA 4MNMA 4V2XA 2W66A 3RM8A 4U3CA 3CZKA 4HPGA 3D52A 2CETA 4P7OA 4W8BA 5D9OA 2YA2A 5A2BA 4F79A 4JCLA 4RL3A 1HF6A 2YL8A 3II1A 1HKJA 1V3JA 1EHAA 1W9PA 4GXPA 3WUGA 3M6DA 1BLIA 1GJWA 1VIWA 5FL0A 4HMEA 4AZBA 2BY3A 2YJQA 3QOMA 5IFTA 3AI0A 2X0YA 5I6SA 1RP9A 2ZXDA 5BXPA 1A47A 5HPOA 1EOMA 1VFMA 4M8UA 1NOWA 3NUKA 1J0KA 3D4ZA 3W29A 2ZWZA 1UUQA 1ZL1A 4GI9A 3CC1A 4W7UA 3A4AA 3W24A 2NSXA 1VEMA 1AVAA 3W27A 4UQDA 2TAAA 3AIEA 5EFFA 1QOXA 5ABFA 1HP5A 1VJSA 2DSZA 1U30A 1FH8A 4RE3A 4GZIA 1KXQA 1NWSA 3PHAA 4GIAA 5E0FA 2DIEA 4DWSD 1E56A 3W37A 3CUGA 1PZ2A 1J0YA 1CGYA 2YFOA 2VVSA 1JZ3A 4HOWA 4ZFMA 5AYBA 4GZJA 4QP0A 3OIHA 1TQWA 1VFFA 1YQ2A 1HXJA 3DX1A 1AQ0A 2XJ7A 4JFTA 2OYKA 1BQCA 1JZ8A 1W3HA 2UWFA 1Q6GA 3LPOA 3N13A 1IZKA 2Y8KA 5A2CA 2PC8A 3TP4A 3RIKA 1TR1A 2WC3A 1E6SM 2BVYA 1E9LA 2ZXBA 1H4PA 3BAWA 1SMDA 1UR8A 4OBSA 2XWDA 4U31A 5IXEA 3VGBA 3WL0A 3PTQA 3WH6A 1Y7VA 2ZX5A 1EA9C 1EQCA 2G8ZA 4Q7NA 4UQEA 1TE1A 1RPKA 4D71A 2WLYA 5FCZA 2W63A 1Q6FA 4PSRA 3MMUA 2E8ZA 1UASA 4HP5A 3DYOA 3ZIZA 1W1TA 1P6WA 4CN1A 3VD7A 1MQPA 1MW1A 2WLZA 4AZGA 1B3VA 1OM0A 5I2UA 5GNZA 1KCLA 1JZ5A 2F8QA 3AYSA 3AMKA 2CERA 1HIZA 1E40A 1MFVA 5AC4A 5A1AA 3ZT6A 2JIEA 2WM0A 1PPIA 2ZX9A 3MUY1 2OW6A 3H54A 1B3YA 3VNZA 1KQZA 1ZS2A 2WCSA 5CQ1A 4MAZA 4AW7A 3IJ7A 3K1DA 4IISA 5LA1A 5CSUA 2C8NA 2D22A 4DUWA 5GNXA 3L2MA 2XIIA 1BTCA 1MXDA 1CENA 1C8YA 2O9PA 4XX6A 3W6MA 1PIGA 2J7CA 1ZJAA 1OWQA 4P8UA 3LRLA 4QLKA 1RP8A 1LLOA 3VGDA 3CZNA 3HJEA 3W6LA 1M04A 1CXLA 1UR4A 4WLCA 1B0IA 1PBGA 1QHPA 3VSUA 4FNQA 4JFSA 1TQTA 1WDQA 3W28A 3AICA 3VMNA 2XVGA 2CCRA 4RE4A 1B31A 3UEQA 4UFIA 4P8VA 3HMCA 3FW6A 5CJ5A 3PZUA 4FNSA 3POCA 1W9XA 3M7SA 1X1NA 1ISYA 4TVDA 4LYRA 1XHGA 2X09A 3M07A 5M03A 3A47A 1H1NA 1FH7A 2UY2A 3ARWA 2PWDA 4AXNA 2F18A 1HL8A 2GJXA 1E15A 1JYXA 1CWYA 2G3JA 5A6KA 2EADA 1V6WA 3AIVA 1HVXA 1WDSA 1O7AA 3N12A 1HKKA 4PMVA 1GOKA 3DECA 1G01A 2WMIB 3K4AA 4W89A 3ECQA 3WDHA 3L4WA 5I0DA 2XTKA 2WZIA 1V0LA 4AD0A 5I79A 5AY7A 1NWTA 4DUXA 5CPQA 3VIPA 5E6ZA 3THDA 1WO2A 1V6XA 2X1IA 1LL7A 3KZSA 3VIMA 3WFZA 4PMDA 5F7UA 3THCA 5A2AA 4H8HA 4U2ZA 2Z1SA 4AD4A 1K6AA 3PZGA 3WQWA 2WXDM 1TFVA 3K8MA 3AHVA 3PN8A 3D5HA 1MQRA 4EE9A 1KB3A 1CXHA 3GH4A 2ZUMA 5ABEA 3N1AA 3BCFA 4PCTA 5CPTA 1B3WA 1FHDA 4N42A 2WKLA 4HMDA 5C71A 2BS9A 3N17A 4YN5A 1E4LA 3S5ZA 3GXMA 2G41A 3GXNA 4MNLA 1XD1A 1B90A 4F9JA 1GONA 1XSJA 3N04A 4D6GA 1VJZA 2W92A 2QPUA 1AQMA 1UR0A 1G0CA 4UQ9A 2OYLA 5CLWA 1E4NA 2WW5A 2WMHA 1E70M 4M81A 1JF5A 1DP0A 1V02E 4JKLA 2CESA 4CCDA 1UKTA 1EDTA 3ZJKA 1QNPA 3WH9A 2XN2A 3VGEA 3M46A 4UQAA 2E9MA 2D0FA 4HU8A 1W9VA 1DTUA 3A24A 4ZE5A 1UKOA 4MNKA 3CTTA 1B30A 4JFUA 4C7FA 4HOXA 4C7GA 5A6LA 4ATWA 5BRPA 1ODZA 1UYQA 4MNJA 1MW0A 2GSJA 2VC9A 2MANA 1OGGA 4IM4A 3WSUA 3AMLA 2NT0A 3N11A 4YHEA 4PSPA 3LXAA 1E1FA 2YDQA 3VD4A 2ZICA 4GI6A 4FK9A 2FE0A 1V08A 2DT1A 1UWIA 1E4IA 1KTCA 3PZNA 3VIIA 4D6DA 1LG1A 1M03A 4WF7A 2JIWA 3SCPA 2A3AA 4GZEA 3OB8A 3U7VA 1WPCA 2Y4SA 4B3KA 3B9EA 3ZR5A 3NCOA 3BVVA 1CYGA 2VX4A 2X2YA 1QWUA 4AZ7A 2F1AA 3UESA 5EBAA 1NH6A 2GFTA 1XSIA 2XFYA 3BC9A 1QI0A 2E4TA 2J7DA 2CIPA 1V03A 1H0IA 3WEMA 3WEZA 2XIBA 3AMDA 1CGTA 3WQ5A 1B3ZA 2NT1A 2DSKA 3KE0A 2VTFA 1PS3A 1BHGA 3IAPA 1E6PA 3OLDA 2XGIA 2J8FA 3AROA 4BQ4A 4JL1A 4X0VA 2ZE0A 2WNWA 2YBTA 3H53A 1W91A 1GPFA 3BAYA 4OOUA 2CBVA 4CN4A 2ZIDA 3L2LA 4HA3A 3VD5A 1KXTA 2D24A 3D51A 3WH5A 5E9AA 3D50A 4M1RA 3W25A 3E1F1 2CXGA 2O92A 3SCQA 2O9RA 4FLQA 1OSEA 3RM9A 3GXPA 3CZLA 4AC1X 1E72M 4ZENA 5BYWA 2XG9A 1W9UA 4W5ZA 3GNOA 2IXVA 4TXEA 1K9DA 2VZUA 1FFQA 1MFUA 2WKGA 2A3EA 1UD2A 1K9FA 2OWCA 1US3A 3SCUA 2GDUA 5GQBA 5CGTA 4QCEA 3PBGA 1E0WA 2J25A 3WH8A 1L8NA 2YLAA 3VGHA 4PTXA 3B9DA 3F5LA 4D6JA 5HOSA 1BFNA 3CUHA 7A3HA 3WF4A 3AFBA 4LPCA 4AEFA 1UZ4A 3AS0A 1H09A 3WQ6A 3RJXA 1GHSA 3CMGA 4YPJA 3S6TA 1KBBA 4PEEA 4NSBA 1V3KA 1JAKA 1WE5A 4H8UA 4CCCA 1CEOA 4AD5A 3AS1A 1C92A 1QNOA 2EQDA 2CBJA 1JI1A 2VQTA 1HVQA 2XFFA 1XH2A 4WKFA 1J11A 5FD0A 5D4YA 1FOBA 3BH4A 1VRXA 1HN1A 3BVXA 4HTYA 4N0RA 1V3IA 1O7DC 1C91A 4AYSA 1UKPA 4JAWA 4AZ5A 2A3BA 3NYDA 2VRQA 3MO4A 1Q4NX 1H5VA 1EO5A 1JDCA 1VFOA 3VPLA 4MB5A 3A3HA 1V6VA 4PMQA 4ML4A 4Q22A 2ZUUA 4JFVA 1LWHA 1H11A 4R27A 2XHYA 5IHRA 1EXPA 4EAMA 4J3VA 1VBUA 1NP2A 4HU0A 1E6NA 2FGZA 4KMQA 3FN9A 2DSVA 3OGSA 4FLOA 4BA0A 2DSWA 1TA3B 3A6OA 4GQQA 1PAMA 1G9HA 1VF8A 3IJ9A 3KEHA 1HJVA 4ACZB 1WP6A 2BVTA 3SURA 1TQSA 9CGTA 1JAEA 2VZTA 4DM2A 3VIOA 3ZSSA 2GUYA 3VDAA 3OZOA 1K9TA 1UD6A 1HNYA 2D2OA 2VRKA 3WUFA 4M29A 5GPRA 3AHXA 4J3SA 2EBNA 1OT1A 2QF8A 5CG0A 4WSJA 2J8GA 5D9NA 4K68A 3VIKA 1H41A 1E3ZA 1PX4A 3SUSA 1TA3A 3LPGA 1WZLA 2VNCA 3SCSA 3ARXA 3WD3A 4B16A 2EXOA 1F4HA 3AXXA 3RDKA 3VDHA 1U33A 2OSWA 4PRWA 4GINA 1JYWA 2WB5A 2XGBA 5BXSA 1C7SA 4KGJA 3GXFA 3K8LA 4FLRA 2FDMA 1CXEA 3ARZA 4DWSB 1GOOA 3RO8A 2JALA 1FFRA 3SCOA 3CPUA 2WMKA 4W93A 3FNDA 2OYMA 2WCGA 4MPKA 5DT7A 3BUDA 2F1BA 1CLVA 3WEOA 5I78A 3AZTA 5A8MA 4IUGA 4AMCA 4FNUA 4DO6A 3VIFA 1UWTA 2G3IA 5A6BD 4J28A 1AMYA 4A3YA 5BRQA 1TMQA 4P8WA 1HKMA 4AY1A 1VAHA 2JF6A 3WY2A 3WBEA 2OSXA 1BSIA 8CGTA 4CD7A 4E4PA 1TG7A 3QHOA 3CZSA 2Y24A 2OSYA 2E9BA 3DX3A 1R85A 1CXIA 1JXJA 4ATLA 3A23A 4QLJA 1VEPA 3WQ8A 2VT0A 1YHTA 2CBIA 4XUYA 1TQUA 3BAKA 1T0OA 1J10A 3WUEA 3EJSA 3EMCA 3IANA 2XN0A 1H49A 4HMCA 1JIBA 5E70A 2JEPA 2X05A 2FHFA 2BHUA 3CZJA 3I3BA 4NX0A 3TONA 5LA2A 4TVUA 3GNPA 4PMUA 3CHDA 2DQXA 3VD3A 4JZ5A 3W26A 3TTYA 1QWNA 1EHNA 4WIWA 4DM1A 1JNDA 4PYSA 3UR8A 1GOMA 4KGLA 4ATDA 1VB9A 1CGVA 2PBGA 2J75A 3UG4A 1ISZA 1M01A 1R7OA 3J7HA 4ZE4A 4TOQA 2WMJA 3WNOA 4KH2A 3TTQA 3ARRA 3LRMA 3WL1A 1J9YA 1JZ6A 3BSGA 4UOZA 3MANA 4RE2A 3VMPA 4HZ6A 1E0VA 3VSTA 1JL8A 4MB1A 3O9NA 1W3JA 3ARVA 1XH0A 5C8BB 3ARYA 3FAXA 2ZUWA 2W67A 2WMIA 2YL5A 1QW8A 2VJXA 1ZJBA 2CYGA 4NZCA 2V5CA 1GCYA 2J7FA 3WELA 1BYBA 3DHPA 3A21A 4NZFA 2XVLA 3POHA 1W3KA 2XSAA 4UOQA 1C90A 3AISA 4UTFA 2VZVA 5D8ZA 5ECUA 4CVUA 3RJYA
chains in the Genus database with same CATH superfamily
2AEPL 4ZW8A 1NFGA 2MSPA 3PQYE 4U1SA 1O1ZA 3NMEA 1ZU8A 2FYMA 3MYOA 5DVLA 1UUMA 2ZF8A 3JTSA 4HCIA 3OWEA 4LCIH 4KK5C 5HDBF 5JQHC 3HAEA 3NCBB 2GJLA 1TZAA 1E9OB 4AYMC 1R9YA 3G5ZB 2OX1A 3ZE2E 3ZSTA 4FKHA 4X61A 2UXGA 3U57A 3J07A 1WAWA 3FT4B 4I9MA 3VINA 5A6AA 2YZ8A 1LE5B 3CL7A 4NKOA 1VFHA 2L8AA 3ZTCC 3TK7A 4CRPA 2CLVA 3VWKD 2F7QA 5BZAA 2BY2A 4M6NL 1NOUA 2G0LA 5KBKA 3OF6D 3RWDA 2BH0A 2F84A 2Q8ZA 2F74A 1NWOA 2X2IA 4L5FL 4JHWL 1RKRA 1XTMA 3JT2A 4KDTC 3SN1A 1XF5A 3D33A 3N19B 3W2NA 4DYJA 2D2GA 3CPLB 4K3EL 1YQVL 3VGGA 3WTWA 4H9VA 3KCLA 2Q2EB 3EB4A 3VCRA 5C0GB 3AAZB 3QI9C 1IE4A 1DLHA 2H7WA 5CMAA 2UY7B 3AXKA 3L5LA 3K8KA 1A7RL 3URNA 2CZDA 1B4EA 4PD4K 3HKFA 4U1MA 4D8PB 2BV9A 2INZA 1R5WB 5F4WA 3VABA 5A69A 2XN1A 1R2SA 2ZKXA 3IJIA 2OEKA 2JCCF 4NM4H 1O9VA 4Y0GA 3O2LA 4RAHA 5AL8A 4GFIA 2VMFA 4Y2OB 2AZUA 5IHLB 4KUCF 5KW9L 1LO0L 4HGKC 4WUUA 5JUEL 4IBUA 4RJEA 3F3HA 1ODUA 5F1SA 4KEZA 3NDYA 4BKLA 1FHLA 4GLRH 3KH3A 3MLYH 4GBXB 3T6ZA 2CCLA 5AKSA 3F64A 4XV0A 2A0LC 3C60D 5GZNA 4FNRA 4LUSA 1I9JL 4NZRL 1YRRA 2B9BA 3PU7A 1JPGB 7FABL 5IQLA 3WSQH 3W85A 1XSOA 3PPSA 4I3RL 2DJSA 4IKIA 5AZ2H 2Z29A 3BJFA 1NC4D 4NDMB 3JQOB 1SSGA 3LQAC 5LBSL 2PTUA 4HPNA 4AZCB 4UV7L 4BFOA 3OPUA 2FB4L 1VA9A 5LNVA 5EA0L 1IEQA 2XKUA 1F8IA 1F8MA 2RHGA 3KJ4B 4OLWH 2N56A 2NYYC 1E65A 2X2JA 4GXVH 2YBGA 3ZX1A 3WTUA 3BSHA 1Q6CA 2HVMA 2ICEB 3PBWA 32C2A 2WXGA 4IFRA 5LA1A 2EAEA 3MTRA 4L4VD 4OZGA 1XF4A 4DAGL 5KSBA 5HQMA 2C3HA 5REQA 3SPIA 4A63A 4GY4A 2WWMD 3EXSA 3HR5B 3PUCA 4IBQA 1I9IH 2QGBA 3C6EA 5I66A 4MJIE 4TV5A 1YPZF 1FV1B 2K4WA 3ES6A 4XVJH 3WBWA 5IHZA 5T9CE 2WXIA 4GSUA 4LCCA 4JM2F 2WV3A 5DK0B 1KBKA 1XYMA 4F7MA 5I0WA 2YLLA 3WO8A 3WLJA 5A3HA 1Q6DA 1KC5L 5JMUA 4IKJA 4AWSA 4BM7A 1TJXA 2YARA 2WCPA 2DW7A 2J5LB 4FX5A 2DWYA 4XAWH 5E6RB 1M7IB 1RK1B 1TJHH 4HJ0D 3KXFD 4ZS7H 3QQXA 1V3MA 4OIIH 2XWJA 1HXYB 5E51A 3BP6B 2XPKA 1KBGL 3TJXA 4N9GA 2CK0H 4PCPA 1B9KA 4JO3H 4NO5B 5JW4Q 1KM5A 3TIMA 4K8RH 1EF3A 2XETA 3B4UA 1KGCE 4IL2A 4IRJB 3O63A 3T4AA 1O68A 3COOA 3EKCA 4F57L 1LP6A 1UH4A 4KI1A 4GRLC 4F93B 3FHQA 5KYYB 3TCSA 2CJSA 4UYPA 1GQKA 5AHMA 4E8CA 4Y2NA 4IGMA 3QM3A 4LS1A 1N7KA 1VENA 2H9AA 2WTPA 4XKYA 4KXBA 5AN7A 2ZONA 5EOTA 1MJUL 4WUUD 1NELA 3WJXA 3GIYA 4XAKD 3EO0B 2YAHA 3OGVA 1INDL 1KTRL 3TJHC 5M2FX 3LHZA 5JOFA 2VEFA 4HSNA 4Y5YC 1B2WH 2R1XA 4RVBA 4POYA 4A3RA 1IZCA 1QNRA 2GJXB 5EIIG 2A7NA 3OX8B 1XD0A 3TVMC 1Z9SA 1H62A 5DWPA 4DKEH 1FBIL 3SD5A 3PZQA 3UCQA 2RGMA 3RX2A 1IAIL 3AYRA 5CBJA 3RPKA 2WNQA 1XH3B 3AG4B 3HRZA 3QUHA 3C6CA 4GKSA 3AZSA 5ABZA 1C9SA 4BWTA 4GP5B 5B3NA 3A6CL 3TTOA 5FM5M 1NEZA 4W6WB 1EDGA 1KNOB 5L88H 1DWFM 2FGLA 3PGDB 4OLEA 5KS9F 4Q8UA 3V5CA 2BHYA 5ANMA 3MC0A 4FA7B 2OP4L 2VLKD 5H37H 1NDGB 2UV3A 1UP2A 2R8WA 3R58A 2ICES 1WFMA 1HHJA 1UYWH 3CO4A 3D3FA 2HTMA 2YRBA 3M5YA 2XG5B 4JAMA 1SJHA 1JHLH 3FV9A 3N25A 3S1WA 2Q76B 1V51A 1DANU 2R0LL 4L3AA 4KZDH 1UZHA 1AC6A 4JVUA 2ZRWA 5F1NA 3E8UH 5IT2L 1C16B 2B39A 4QITA 4E3VA 1XF5B 3R4IA 1F3TA 5E1AA 4C1LA 1W72A 3VA6A 3RVTD 4L61A 5I09A 1MF2L 1V3LA 4NGHL 4Y4FD 2Q01A 4ACZB 1JGVH 5BXFB 1TVDA 4FXSA 4LB3A 1WTGT 3E2HB 3TF7C 2YRLA 2QV4A 2VC2H 4RAVA 5KVGL 1NC2A 2Z28A 1W5PA 4JBRA 3HNSH 2H8PA 1GS8A 1F42A 3H42H 4W88A 1VLIA 3NIGE 5EZOH 3WNIA 3O3BA 1GYMA 2NZ1A 2WQPA 2HVJA 4U6YB 5I1AA 1NEPA 4HZAA 3RWHB 3SAZA 3PAVA 1ZNNA 3O81A 3NM3A 5G1MA 3MJGX 5D8JH 1MNUH 1ROWA 4IBTA 1WZKA 1FRGH 3S8HA 1W6LA 4S1SL 2XN9A 4K55A 5GGVH 2VGLM 3HJZA 4Z0JA 4K8HA 5CGYC 1SEBB 1EO8L 1XSKA 2OL3L 2Q5BA 3MMTA 2QIWA 2BOFX 4LKXA 4R5EA 4D6FA 4DAFA 2CIIB 4FP8H 3TJPA 3CDCA 4G8IB 5I3DA 1W9BM 5DU7A 3RX8A 4G5ZH 3NTCH 5A2FA 1A7OL 3BQUB 3NQDA 3PL6B 4PVLA 4LS0A 4R4BB 1SBSH 3ZTNH 3DDGA 2WD0A 1ETB1 1KTNA 3KCOA 3KVJA 3K2KA 4FQHB 4GQGA 4DYKA 4O14A 3TV3H 1D5IH 3QZLA 4JIEA 1UH2A 4K39A 3W71A 3B2VL 1NAMB 1NLBL 2AQ2A 3UETA 3I75A 2NMSA 1IKFH 4H13C 2NNAA 2DU2A 1AZVA 1DDTA 4PGZA 3U1SL 4HLZH 3VFPB 4EQ2A 1JQVA 4A2FA 2YAQA 3F5KA 3I2CL 3KLDA 4KNTA 2J7GA 3MRKA 3T40A 3UT0A 1DKWA 3I6LE 2C3ZA 2YUZA 4LSQL 4Z3FA 5C54A 4DPQA 4UYQA 4DH2A 1Z9LA 1SMAA 5C86A 3MACL 3WD1A 1N18A 1ZWIB 1ZSDB 2AAAA 4KMTL 3T65B 4E41A 4ZYKA 2J71A 4ZDHA 5I82A 3RGBA 3LKSA 4HTYA 1IWPA 1RD6A 1DUZB 2HZHA 4MLIA 1U91A 4R9HA 3W81A 3AAMA 4KRUA 3F6LA 3VKKA 4AX6A 3IE9A 1EGVA 1QBLL 3HMXL 3I3EA 5MEOA 1VESA 2V68A 3QQ1A 4L8DA 1O5XA 3EO1A 1GUVA 3MRLA 2INEA 2ITFA 1KD0A 1MDAA 2I5YL 2WC7A 2CRMA 3HV9A 1S3HA 5CU5A 4O2FB 1Q3NA 1J9CT 3VDBA 4M1CC 5HVGB 1WNOA 3WLSA 1KTLA 1SJBA 4QROA 1NUNB 3GDRA 3AY4A 5BS0D 3T2PA 1XQKA 4RGOL 3L2IA 5LGHH 4DF0A 3W7GA 5F9JA 2O93L 2I5QA 5DEZA 2FIKA 3BAXA 4CKQA 5B8CC 4IRJA 1K6WA 4YCOA 4APQD 1RZFL 2DQEH 5EO1A 4Q8VA 1BIIA 3HC4L 3HBGA 2AEOA 2CLRB 3CHSA 2UZIL 4PJFB 4JYEA 3E80A 5I6LA 1GVIA 4PBDA 5KVFE 2CMRH 2EPNA 4K36A 1HCZA 3VCLB 1MN4A 1XR2A 3CFIC 2OQHA 1ACCA 1MYRA 2MNJB 3JBG7 2AL1A 3B4YA 1SXAA 2HJLB 1P4UA 3GY1A 1C1EL 1BG9A 1XR8B 1KMGA 4NY2A 3OZPA 2GAZA 1WBYB 5LNDA 1RJRA 1YEKH 2PYED 5SV3A 4Y4KD 1TENA 5BOJA 4GJIA 5FKPA 3HS9A 2O5ZH 1DFBH 3ZLQC 3GH7A 3LQLA 4U5IA 3W2JA 1CFSB 4BFAA 1MCOL 4FHJA 3HPJB 4ALAH 4NVTA 3SBRA 5D05A 2E9IA 2QGDA 2HAZA 4U1GB 3BRDA 4JRYB 4JQVA 2ZOKA 3WHE1 3RL2A 3EPMA 4AF0A 1RZQA 1MREH 1RPUA 2OQLA 3L16A 5I23A 5KZCD 1G4TA 2Z7GA 4QISA 5B1KA 2NXYD 3QPQD 5IB3A 1FE8L 5I1KL 4HEPG 3SDDA 2GJRA 3T09A 4B0MM 4PS4H 1Z5HA 3S36L 2PS2A 4F33B 2X42A 5E9DB 4DEPC 5MENE 4QQUA 2DEPA 3FN3A 2G60L 5HGGS 2TSBA 4WY7L 3HQ1A 2IDCA 2HV5A 2QCMA 4H9TA 1HL5A 3I50H 1R4XA 4RA3A 4RWHA 5DJ6B 4DK6A 2H2PD 1GT8A 5REQB 4C6NA 4JTRA 5IVOA 3LV3A 2ZCKL 3C2SA 5DT5A 1MOEA 1J9SA 1DLFH 2PW2A 1KB5B 3MDJA 4JQIL 4NXKA 4Q2ZB 4AZ8B 1S7WB 1ONQB 1O6IA 1S2CA 1T2XA 3RAJH 4UU9B 3T4YA 5LNEA 3DBXA 4TOYL 3HOJA 3B9KD 3G1DA 2EG8A 4Q4PA 2QCFA 4BF9A 3V7AE 1UOLA 3AREC 4QJ4B 4KQ3H 4AVJA 4ZPTA 4PLKD 3B5HA 4NN6C 5G4OA 4N2KA 4IH3A 4F48A 2P5WA 4XP6H 4NSKB 3K72B 2CDEB 3ZUNC 5IESL 1GEQA 5DC4B 5C07B 3ZVVA 2K6WA 3O3BB 3RU8X 3UPBA 2CFFA 4L1HA 5HVHB 1GIGH 1CLYL 4AMKH 5C7XL 2WHVA 1FYTA 3VRLF 3ARGD 2HFTA 5FSDC 4JS3A 1L6FA 3EJRA 1HXYA 4JANA 3IUIA 1GZGA 3N18A 4N8PA 4GT7A 4ODXA 2X10A 2MNUA 4IIQC 5EO0B 5FWQA 3V4PB 5I0ZA 3DX9B 3C2AH 1O6SA 1EHLH 2Y7QB 4HKBB 1FDJA 3H6OA 4CD5A 4NENB 5ECJE 1BEYH 1DBMH 2NYYD 3IRPX 4S1RH 3SYOA 5C09D 3B9OA 5DXYA 3P5ZA 3PNWB 1P0NA 4POUB 5HR6A 4IRSA 1QABA 4JTUA 3DX8A 3L5MA 5C6MA 2X4PA 3EYSH 2P8MB 2H9AB 1KIUB 3WIHH 1A80A 1NVMA 4ADUA 1GJPA 5HHQB 1KTBA 2R9HD 2XV6B 4H0IA 5A3IC 3TH3T 1J05B 4JB9H 4HB7A 3JVFC 3AM8A 2HS8A 1MELA 1U3HC 3GB7B 1IGSA 5E5MA 1TVHA 4N2CA 2CO6A 1BJMA 3G5EA 3S8GB 3OV6A 4LCWA 1YNLH 1J01A 1X8CA 2B4CH 2NY2C 3GTNA 4PIRF 5IB1B 3PREA 2LFGA 3GI9H 1XLDA 4MRBA 2LR4A 3FZUC 3DU0A 3Q8BA 4UI2A 3Q2VA 4LSUH 4BFJA 2X7VA 1LG2A 3B0UX 4G5DA 2OOFA 4L18A 2EINB 1LO5B 1U8QA 1WRFA 2CGYA 3RVVD 3L1EA 5CBAA 5IROD 1Y5VA 2NX5B 2ZRZA 2IGTA 2PWHA 2VC2B 2GHZA 4O5LL 4X6CB 5GSVB 5TJWK 4U2YA 3VFNA 3BVUA 2X6BA 5MERA 3E8VA 2ONEA 1WGOA 1GZPB 4LHUG 4N0FA 3AYVA 5HA7A 1ZAIA 1BZEA 2CR6A 1UH3A 4FX8A 3T0TA 5GIRA 4UCGA 1D7FA 1FG2A 1UD8A 2D03H 4RSVA 4A7SA 1B1YA 2QNEA 4FABH 5C9JA 3RTQD 5HGBA 4RRPA 4MY8A 1CGUA 1WZ1H 2Q3XA 4CGTA 4UILH 2JF7A 4L9XA 1I60A 4AD1A 3CFJA 5GS0L 1FNEB 1HQ4A 4LSSH 2VFEA 2PDMA 5LXXA 2ZUQC 4RNRB 3S4SB 3FDKA 4K9EC 4YU1A 3W53A 3W5NA 2OULB 4PMRA 3X3GH 2XQYK 4XMKH 4CC4A 4JTFA 1TV3A 5HQEA 4XO8A 4QLRA 1VGEH 4BA8A 1PB0A 4S1QL 2J1WA 3NPXA 1AK5A 5T1MA 4DWSC 2VDRL 1JGLL 2WK2A 5CP3A 3NQAA 1R30A 5B3SB 1JWUA 5T1DH 4QTHB 4ZO7A 2XXMB 3QK0A 2J88H 3JUGA 2C34A 4IHOB 2AV1A 2CDFB 1RI8A 2ZWNA 4L48A 3RZCD 2EPOA 3LHYA 3NGBC 1QA9A 4L3FA 3B3IA 3DJTA 5KVDE 4DGUA 2ZKHL 1BRLB 5M1TA 3D1MC 1KCUH 1U8PA 2BOCB 1PD6A 1P1VA 5DMGD 3MCOA 5JH2A 2ZYSA 2J62A 2DQGL 3TVAA 3UZVA 5JDSA 1ESWA 3DETD 1WC7A 3MUJA 3BSZA 5E23A 5CJ8A 3VFRB 4LYQA 5FKYA 5C8JB 4HIQA 4D0BA 5KZ6A 4HF5H 3ULSA 1AJ2A 3OTRA 4KFOA 1MQKH 1QSVA 4OCXL 4OKDA 1FVPA 5CZ0A 3OBAA 3G1YA 2GFBB 3FT3B 2XTJD 2GBVA 2UYLA 3F83A 3FU9A 5DR5H 3RWCB 3I68A 4F7TB 3VFSB 3CUFA 5AZEH 2A3CA 3C4UA 4JXCA 5MI0C 3Q7JA 4QRUA 4AXWA 1RULH 3O6AA 3S3GA 3CHEA 2WZPD 3OPZH 4TNEA 2NQZA 2YC1A 5T3ZH 1R3KA 3BW3A 2EVGA 1FO0L 2WVTA 7TIMA 3BP7A 3GR4A 4FLHA 5C0JB 1BQKA 4QF1B 3REQA 1CS6A 3S42A 1IU1A 4JCMA 5F6IC 5JHBA 3BURA 4O50A 4MDPA 3RAOA 3PV7A 2B8OT 5IUSA 3QPYA 1RZJL 3DKLA 4WKAA 4DI8A 3MBXH 1BZOA 4FXGB 3LMJL 1W8EA 5D4IA 3JWNE 3S48A 5E5RB 3VI4F 1HHGA 1U91B 1RLDA 4PV1C 4ROQA 3UZQA 4E0RA 4OCSH 5D71L 2VCCA 3BUQA 2GT9A 2PA6A 2XKNB 4OE7A 5C0BD 1T5WB 1FHVA 2V7NB 4ZQMA 4G1KA 2W61A 2PDPA 1MSSA 4WK2B 3D09A 1LLZA 2IMMA 2MCMA 1OAQL 4XNQA 1AW2A 5EULV 1UPPA 4QOKA 1E0XA 3VVGA 1B3IA 5CLYA 3T0AA 3NFUA 4H20H 4L2LA 3UGVA 2QKIA 4US5A 2A4CA 5KOVC 3UP6A 3S37X 5LWYH 1AG6A 2NY4B 4GFTB 5DRZB 4WW2C 1AD4A 2OS7A 3C56A 3G1SA 3KVKA 3QJHB 5E6ID 6TIMA 1E2VA 2H2SC 2OMXB 4E5XG 1U5HA 3PZMA 1RZPA 5D1QC 3EOUA 3GFZA 7ENLA 4GAJL 4HFUH 4X7CC 1QSZA 4YEFA 1PYWB 1A8JH 2UWEB 4DGYH 2JQAA 3ES7A 1JHKL 4UMAA 5H6HA 2D3LA 3CLFH 3L1FA 4GG9A 2A73B 2A9BA 2BSRA 2XSBA 2ODHA 3BOVA 2CHNA 1X38A 4G9FE 3TN0B 3MNWA 4N2DA 1DVZA 4BV1A 2QJHA 4D3CL 5A6BA 5HNRA 4JX0A 3DWTA 2IOMA 3GPEA 4OV5A 4FFWC 4XP4L 3MRMA 5DD3H 5BRZB 3CFCL 4D9RD 5F7WC 1FLRH 4DESA 3S2CA 3GXTA 2EYRB 1CTNA 1ERNA 1NIAA 1WLHA 2AJ3A 3M0ZA 5ABGA 5H2ZA 2ALAA 4BE5A 4N2OA 5I1DA 1UWFA 1UD5A 4Q8WA 3D08A 3N41F 1MMFA 3RI5F 1T03L 4AG4L 1KF9B 2AXGB 4NO3A 3VI4A 3M5ZA 1YEJL 5DQDL 1JJKA 4NLHA 3L23A 3U2EA 3N15A 5A7EA 3NO5A 5EIQA 1ISXA 3MUZ1 3Q2NA 3RKDD 2ZA3A 3H2NA 1XFPA 5HPCA 1TNNA 4HXAH 3V0UA 5AWNH 4ZXBB 2OODA 2Q7AA 4FQ2H 1ML1A 2V9RA 1OGPA 1OGSA 5HANA 5DRNB 4H0LC 3QHFL 2Y6SD 1LQBC 3UTTB 1X7QB 2EXWC 2PLKA 4D9PA 4ZMWA 3FUDA 4LV9A 4ZEPA 3B8DA 4CADB 4XMUA 1YEDB 4QDGA 5J13C 1IGFL 2HX7A 5C0FB 3WLWD 3EB2A 3AUOA 4XXCA 4LAZA 7REQA 1EZVX 2CWRA 1PV8A 4XBKA 4BH7A 3RCYA 4QIUA 4P3CH 4M6OL 1WFNA 2UX6A 1RERA 1TCRA 3EGSA 2DM2A 4J4PC 3ABGA 4HJSA 4JRYE 3VWJD 1NGYA 4B3VA 4IRZL 4KPHL 2ARJA 1D3GA 3NXLA 5LGXA 5JPMC 5T1MB 1GSKA 4G6FD 1E71M 2E28A 1I8JA 3WMCA 3QA3B 3L5XH 4P46A 1ADQH 1HX0A 5HTSA 3ILQD 4J27A 2Q20A 4F91B 4IKLA 4YHKL 1PHWA 1ZT4A 4M7JL 2CDFA 5AOUA 4DZIA 1H0DA 3T0EE 3MYJB 3QHZH 2HTKC 1GVRA 4S3KA 4Z7WA 4FHKA 4B9YA 3OLEA 1A0QL 4JY4A 4G80A 3LU2A 4XVUC 3NTYA 2NV2A 2VXQA 3AQXA 2VLLA 3PYCA 4ODBD 5L0QB 1G1YA 4ODHL 4Y2DC 2OL3B 3D9AL 1QTWA 3KEDA 1JXKA 4Y4KC 3KRBA 1AGBB 2XZZA 1JCYA 2H26B 3FU0A 4CSTA 2EDEA 1FCQA 1F2QA 3CO8A 4R97C 4AZUA 1R9FA 1KLYA 5FOBA 4C6JA 1YMMA 2DQ6A 3FN0L 2V4LA 2ABBA 1XUUA 4HWUA 4HHAA 3ERPA 3FU6A 1AL7A 4OIFA 5F9WC 2ENYA 2BCMA 5D7IB 3RB7A 1BBDL 3RWIB 4LC8A 3LN5B 4JZNB 2ATKB 3V4PH 3WY3A 3FJNA 1TVHB 2ERJC 4AGNA 1JXFA 3KLKA 4BFKA 1EEXA 1FAKT 1BVKA 1OANA 2XPYA 4GYBA 1M05B 4XI5C 3TZVA 1R3KB 5D70L 4I6KA 3BUIA 2ZX8A 4XO7A 5BMFL 3CB3A 1Z6KA 4K3DL 1KCSL 1MI5D 5I30H 4N2YA 2FX7H 3BLKA 2WBWB 4HQQH 3WJLC 1GJIA 4XZBA 1WBZA 2H32A 5I73B 4ODWA 2I9EA 2W38A 1UWRA 3DTUB 4HFWB 3QC3A 1XRTA 4FP1A 4IPJA 3SFKA 2IQ9L 5EOCH 2X0HA 4ESKA 2IQDA 3BG5A 1NGPH 4CNSA 1VBHA 3ZT7A 3D85D 4P3DA 3LUTA 4H88L 3P4NA 4R0LB 5FGBC 4C6LA 1WH0A 4R53A 4NOBA 5DD6A 2EH8H 2OR9H 4Z0XB 3QHNA 3ARDC 2KI6A 1QTSA 5EB9A 3QPZA 1ET5A 3R06B 1PG7L 2E7DA 2X16A 1RLCL 2PTTB 1I8UA 4K94L 1V0MA 1E6XM 1O6TA 1LBFA 3SB0A 4FMFA 1TVBB 3B7UX 1XF2B 3QIWC 5EU6D 4ZBJA 1QYGL 1Q94B 2BFVH 3O8XD 3RJDA 4RNRA 4BI5A 4TNFA 4MCZB 2Z31D 2DL9A 4H04A 2VIRB 4M5ZL 5HQLA 3TT1L 1FN4B 5BV7H 1ECQA 3AS3A 3P9WB 3HIZA 3SUUA 4AB4A 3SGEH 5EOQH 4S2SA 2NY6C 1L0XA 4PJ8A 2AJYH 3E7JA 1L0PA 4TUKH 4ZSUA 5DBTA 5D2YA 2DKUA 3IPFA 5EC1B 5JVLA 2OMUA 2PYFB 2D0GA 1K2DB 5TE4L 1GPWA 1IM3A 1H3XA 1US2A 4XNAA 2DPEA 2Q3ZA 4LAKA 2BSRB 3O45B 4PJXF 2W62A 4R5XA 3QRHA 4IMFA 4JFXA 3JV6B 3N85H 1L5GB 1X5YA 1XIWC 2R1YB 2WIMA 3DI3B 3W7EA 5AZ0A 5A6IA 1E1CA 1LO4L 4C7DA 2R23A 3A6BH 4G71B 1YLBB 2NW2A 1REQA 2FZDA 1R17A 2BW4A 5EFIA 3MMDA 1XRVA 5D9MA 4YAQA 5TH2A 1E5NA 3O8XB 1UGNA 4ONVA 2P5WD 2YIHA 4R96B 1UOZA 1ZRQA 3MS8A 4BSVA 4LIQE 4BEIA 5AAPA 3LKNB 3TBWA 4QJ1A 5JW4N 4WJEA 4DF9A 3ZMRA 3ECWA 4U10A 4OLVH 1V0NA 4K2SA 4UV4L 4B5EA 1KBVA 3WHXA 1QUNA 1S7SB 3QH3B 5IROC 3NPUA 3BSZH 3UG3A 4K2UH 2B7NA 4YCPA 1QFUL 4LESA 4HNOA 4DEFA 2DWEA 2ZOWA 4ZXBA 2GK0A 5H4YA 1D3CA 1RMFH 3FCBA 4Y2DA 4H3DA 1RIUL 4GYKA 1BQLL 1CICB 3PWPA 2XTJC 2WWOA 4JFFD 4DB7A 1VIZA 3SCNA 3R7RA 3GZQA 1X7QA 2QVNA 3MKCA 4JQIA 3N2XA 3O6FD 5AB9A 5GGTA 4PCSA 4CADA 3S37L 4EN3A 4YHML 2UZ9A 3GLCA 2IADB 1L7TH 3UFYA 3BZFA 1XP3A 5L6YL 3ANUA 4I7VA 2D2HA 5FF7A 3O3UN 1V02A 4G8IA 4OM0L 5HDBB 4LRIA 2WQAA 2APTA 3QZWG 1HHGB 4HUNB 3D34A 2BOBA 1G69A 1P7TA 2E74C 2P1YA 1YO4A 4J8QA 3REVB 3RPDA 1U8MA 5B7ZA 3GSVA 4PFMA 3W72A 1PY4A 1N3NB 4JGNA 1TZIB 1MAKA 4GQ9L 1G7HA 4DP0X 4V1DB 4YHYC 3QFDB 3G6DH 2NY0D 3AIQA 4XPTL 3RL1A 4DEWA 4O02L 3AT0A 2FBJH 1B0GA 3QW9A 1DOSA 1MQQA 3ABQA 2NQ9A 3EOTL 2XC8A 5E7BA 2MRYA 1XICA 3LHAA 2XXCB 1OCOB 3WZ0E 1DCLA 2DTML 1JMXA 1A9EB 2V2CA 3QGKC 4AVKA 2WQWA 4KRMB 1L7IL 2J7BA 5I8CB 2GDVA 4JY9A 4FQIH 3RZCC 3BUYA 3GLZA 3GG7A 4KEUA 4NZ5A 4PPTA 2D23A 4IG2A 3BOLA 4IX2A 3UXAA 4D6CA 1JV5B 4JLRA 3ZKMD 4V15A 5JO5A 3QJHA 1W6WA 1B54A 1GPOL 3UTSD 1LD9B 5CS7A 4LCUA 4YDLC 1Z69A 2CITA 3E0WA 4BRVA 3ALXA 2KQMA 1EGZA 2DVXA 2WNGA 5A5WA 3VXMD 2FYYA 2V38A 4ZDHB 4Y9MA 3EJUA 3ZLFA 1TVPA 1QWKA 3W0WE 1JRCA 4L4OA 4HGXA 4JKKA 5E0CA 1XGUA 4B90A 1KT2B 5EZPA 5HNUA 1MCWM 1PZ1A 3IEBA 1KJVA 1P69B 3N14A 4S3AA 3WHE0 4KUZL 3FK4A 3EF4A 4Y5XB 3L3OA 3WN5B 1CGSH 2HRGA 2PDUA 3RWIA 2CKNA 3RU6A 5KAQF 4GGBA 1U2YA 1E5JA 3LEVL 3DJSA 3B37A 4X6DE 2OM5A 4MASA 2ITDB 1E9PB 3ARTA 4LAJH 3WXVH 1X5KA 4YFLF 2X0WA 5A16A 4JY5L 1SZNA 4WKXA 7CGTA 1JYVA 1ACYL 1ZALA 4RKAA 5CH9A 3HZKA 5CILL 4P7LA 1XIIA 2PWGA 1BQUA 3BO8A 4HKZA 4LB8A 2V67A 4L4PA 3SCRA 2YZRA 3TJ4A 1SDAB 3BP4B 2G3ZA 2QVHA 5KYWB 1SVZA 4ZXLA 4F2BA 3MV9A 5J89A 3FSVA 5IM7A 3Q5OA 5CFHA 2R69L 1I1CA 3FQRA 3HMXA 3NH7H 2E3ZA 4IICA 3W75A 1AO7D 3LI1A 3QFJD 2BNRD 3FMGL 2FL5A 3D48R 5DELA 3W00A 4MJHA 3FEQA 2YD2A 5HYJE 2OJEB 4I5BB 5I9QB 3IFLH 2IO5A 3MMEB 4W81A 4BSWA 4YNYB 4TNVK 3B03A 1WBYA 4ZFZB 4AEEA 3OAWA 1KJ3L 2YD6A 5I3IA 1CFSA 2Y2TA 1FDLH 2O72A 1NCWH 2WBKA 4M1GL 3SGJA 3QIUB 5F7LB 2BSLA 1SR0A 2EKSA 4P59H 4WEVX 2C1OA 1VPOL 3CHQA 3GUFA 3MO1B 3NJMA 1RUKL 3QJVB 5I17B 1ZVHA 2YCKX 5EU4B 4G56A 4LBRA 2Z9TA 4G70B 5ANHA 1BYNA 3GIVA 5C0DA 4E9VA 3BPNB 5FDWB 2XN9D 4E38A 4WGWB 4K7FB 1AR1B 4H25B 3K80A 3SPGA 1ZTXL 3FHAA 3N42F 4UTAA 1XF3A 2GJPA 5FYKH 2HFGL 4L4LA 3WQDA 1A7NH 3ZHDA 3PANA 1Q72H 3SY5A 3HZMB 4MXWL 3DC8A 3UXDA 2WB7A 2D7QA 3TCLA 4WHCA 4HIIA 4O16A 2YDSA 2OL3A 3VOIA 4S0SD 3F00A 2X44D 2NY0B 3I84A 1AGCB 2GW5A 1K8ZA 4XO4A 1J1PH 1OHLA 3GC5A 4LAQL 3LOTA 5DJAA 1IT9L 2JB5L 1R86A 1PJ9A 1Z3RA 4OLZL 4AQEA 5F7FA 2ASHA 4QOKD 3CH1A 4U6VL 4MGXA 4HPHA 1W32A 4W7VA 1KENL 5EHFA 2P3ZA 2VCAA 3N6JA 1S7SA 2Z4GA 4GO6B 4O53A 3WD2A 3R1GL 4P4KC 2X4QB 4X9HA 4ZPTB 5DK2B 4X6DF 4AEOA 5FDYA 2FO4A 2OZNA 3TBCA 2KQNA 1BOGB 4HJJH 2HKFL 1ETZA 3L4ZA 5ENLA 2DWEB 4CMHC 2Y06L 4ICNA 4W9TA 5DFWH 2BWDA 4KVCL 3DA0A 1W3IA 1KGUA 4LGRB 2I07A 1QR1B 3BJSA 4G1NA 4PJ7F 1OP3H 1N5AB 4H8WL 2DQIL 2EJ1A 3IJYA 3KZ8A 2Z2AA 4I6VA 4B3ZA 4ELMA 1NDMB 1JK9A 4AIXA 1O4UA 3KL5A 4JO1L 1BZ9B 4I2XE 1EFXD 3L3HB 1RFDL 3T2LA 2FZMA 1H5BB 2YPLD 3CLWA 1RCYA 4QHKI 3DG6A 5CJMA 3VX1A 4EO5A 2WZTA 2C7FA 3RU8L 1B3XA 1A64A 2IBZX 4K7PX 4P2QE 1MFNA 2J8UB 2XU9A 1RLWA 3MBED 5DO8A 2VVNA 1OTSD 3S4SG 5RUBA 1JUBA 3P30H 2R4RL 2AEQH 3RL1B 5DUMH 2P45B 1X1ZA 1KY6A 2XY1A 3JWDC 3KVQA 1QMLA 1LDPL 2DY3A 1MIMH 5I1EH 3GB7A 4GNVA 4ONGL 5CZJA 1A9EA 3SCTA 2CO6B 1Z3NA 3ARDD 3SY0A 4Q7BA 3R8HA 3DMMD 3THQA 5GRYA 4I8YA 2JQXA 2IPUK 1DCEA 1ND0B 1TYJA 3HN5A 1K8IB 3H9SE 2BNQE 3B9KB 4XP5L 2VM4A 5EEVA 3CT2A 5C9RA 4NKDA 4R83A 5DS8B 5C0AD 4UOW1 3O9WA 5H37G 1NFBA 1T6MA 3CXDH 4Y8FA 2W4XA 3O4LD 3EJCA 5EF2A 5IW3A 3NP3A 2LVEA 1DVJA 2HROA 3AWGA 4AUBA 1XDJA 1X97A 4Z7OE 2WTRB 3NO1A 3PUGA 5AKRA 4TU1A 2TRSA 3UY7A 3GNNA 5CKAA 1U4EA 4ES9A 5L9DL 1QPQA 2KS0A 3UWZA 5E56A 1FPTL 2VGGA 1IXNA 3DFYA 1E90A 1XGPA 3MXWH 2J47A 4HIXL 3W7IA 5D2XA 2WXLA 3TF4A 5EO9B 3TBSB 3NZUA 4QMEA 5G1TA 3C8NA 3V95A 2CLFA 1K7EA 2WHMA 4LASH 4RZCB 4BGLA 3LNMA 1DBAH 2EVIA 2C1IA 4PVMA 1FH5H 3O4LA 1AY1L 2QSVA 1IGWA 1Y5WA 2EPLX 1Q1PA 4A1RA 2VZ3A 2A6KB 5BUGA 4BS0A 1UJ3C 3HZKB 4X6EB 4JFWA 1FTXA 4HDIB 3TA9A 1XC4A 2V7HA 1V7AA 2P53A 1UKSA 3KP1A 4JPIA 5CPSA 2OXGB 1CZ8H 3OR7A 3LRSB 4NNPL 3GSOB 4QTHA 4WNQA 4G8GE 3T1FB 1IEAB 2E8YA 1EEYA 1EWDA 5C70A 2VABB 2Z7ZA 1DJQA 2SODB 4ZJ9A 4Q7DA 1WZMA 4WD0A 5HHPB 4XKMA 1Z9NA 4L3CA 3RG1C 5FJRA 4QRPD 3CFMA 3W1LA 3BAIA 3UPAA 5CC6A 3X3FL 4AWEA 4GCXA 1Q1JL 4ZXBC 1M6OB 2WBXA 3ECBA 1J4EA 3DO7B 4JTHA 4YBQD 2ZA1A 5IBTL 1T5AA 1JGEA 2PRMA 1E9ZB 5FS5A 3JWOL 1XINA 3IBEA 4P8QA 1G5AA 3MRBB 5T8IA 3FYOA 3CH8A 4O4VA 3GI8L 2HYMA 3KR3H 3OLIA 4XMVA 2FT8A 2VDLB 4YQXL 4MNHA 5J1AB 1DWGM 1SGJA 2GFBA 3B7TA 3FT3A 2PAJA 1AQDB 3V6ZB 2WTOA 4D9LH 1UFUA 3HRZC 2VURA 4I9JA 1U3HD 1G4EA 5K93A 4HSHA 2EDNA 3F85A 2HLAA 3V52L 5DURB 4QRUB 4AXWB 1ZHLA 1XF3B 2FAUA 2VLRE 2UBPC 3LKOB 1YHPA 1ONRA 3GMRA 3M0KA 5CSYA 5E9XA 3SJVD 2A83B 2CKSA 2LAGB 3FO0L 4ACPA 4G1MA 4Q9RH 2CE6A 2XVNA 2E9GA 2I85A 4GACA 1TEYA 1KFGA 5D8WA 1RU9H 3DK2A 4NZDA 1E4KA 2HVKA 3B7YA 4NQXA 3RHWK 3UWVA 3AACA 5E99L 2HJFA 3EYFA 2MOQA 3UOAB 1G7UA 5HHVH 1YEFL 2GG1A 1WAUA 4UZSA 5DMYA 2Z65C 4HVBA 3CS2A 3OYXA 5L2JA 4UQ3B 1ZXQA 1GYNA 3QDJA 4GH7B 1AG1O 3GR7A 2WCAA 5B7YA 2ZE3A 3RDJA 5IHBA 4QHPA 3CSBA 1YPFA 3GYEA 5LN8A 5BXTA 4U0QB 4NO0B 4YLBA 2AMGA 2BOLA 5M7QA 4YOKA 5TF1H 3QG7H 4HPXA 3UAFA 4ANXA 1R0AH 4I0PC 3CMJA 4PBXA 4AC7C 5JHDE 5D96B 2YGVA 2BK8A 2QQKH 3UBHA 1JUKA 1XC6A 1BVNT 4O0QA 1H7XA 3HUJA 5HJDA 1E9PA 1PZ5B 5GZOD 3R8GA 2JELH 4NAFA 2DQJL 1J5OL 4UTWC 3TXVA 4PI0A 5CU9A 1QCWA 4QTFA 1F4WL 4JN2B 4CU8A 3G6JB 1ISWA 1UZ8B 4WSKA 2XZAL 2XHNA 4HHGA 1XIJA 1WUNT 3MNVB 1HI6B 2OMXA 4B9JA 2VX6A 3KL3A 2ZOXA 1TEFA 1YEHH 5SWZA 4YGAB 4HNNA 3BGMA 4JJOA 5SWSB 4QEGA 3W1MA 5DVOA 1ADQA 1IKNC 2QDVA 5CGBA 1TPEA 1DV7A 4CVZA 2OMWA 2D9QB 1U6AL 3IN0A 4LHUD 4PJIA 3NZ1A 4H8VA 4AZIA 3PTMA 4WI2A 1YDPB 1FX6A 4JQVC 2F9RA 3F7KA 1A3LH 2Z35A 1ZSHA 3BVTA 3EMZA 1FP8A 1XVSA 4JKNA 4HCRH 4BHUA 2Q71A 1X4YA 4JREB 2HKHL 2JCCE 2P5EB 2IEPA 5ILTH 3S2MA 3FFCD 4LDEB 4KXZH 3G24A 4YSSA 4Z7QE 4L1DA 4O1BA 1R75A 3DX0A 4J2QA 3EJPA 3N0PB 1P4CA 1T89C 3BPCB 5GGTL 5IIEA 4TQIA 2FIQA 3MJYA 3APTA 3MRIA 2AJSH 4U3SB 3UERA 4F7EA 4JNXA 4AIZA 3K4DA 2YCIX 3QMSA 3WAKA 5DS8A 4H44C 3SQOH 4H00A 3D25A 3UVIA 2MTAA 3G1AA 1A8ZA 3C75A 3EBVA 3HQNA 4KKPA 3ULVD 2G95A 4DJMA 4GYFA 1UWGL 4XB7A 1HTYA 4GKNB 3SPCA 3WFHA 1GG1A 4JG0H 5JOPE 4QHRA 3M0XA 4MNMA 3PBUA 4U3CA 2VSDA 3BRGC 3CZKA 2ZOUA 5JW4M 3D52A 3RFRA 1GCFA 1SEQH 5D9OA 1U8OA 4PUBH 1BQ5A 2VXSH 5PCYA 5D2TA 1ORQB 5HJGA 3MLUH 3X1GA 4EVNB 4RESB 3QYNA 3IM1A 2A21A 4L1GA 2Z4TA 2YL8A 1S9YA 3IGXA 5I1AB 4XNUL 4OUIA 1HKJA 1DBBL 2EDOA 5GS1C 4NWUH 4QHLB 8PAZA 1V3JA 5KG9B 4I0CC 1W9PA 3HCVB 5I74C 5E8EA 2AP2A 1EAQA 5E6SB 4DPAX 3NO3A 4N2NA 5I07A 4RMWA 2WZPA 1IEBB 1K4DB 3M6DA 3OXSA 4GFXA 4PRPB 5TK2A 3FQXB 2RR3A 1I1AC 5C08A 1ZLUK 1WFUA 4KKBD 4XC3H 4A67A 1NFPA 3CHVA 5FL0A 3SN6N 4AZBA 1KUMA 3KLAB 3QOMA 2J5LC 3B1TA 3P60A 1ASOA 1XMWA 1AW5A 1CFVH 2VABA 4YSOA 4FJYA 4M1DL 1A5KC 1KFEA 5BJTA 4K9EL 3V4VL 1DJXA 4RBPK 2PP1A 1T1WA 3BO9A 3VJ6A 4PA8A 3S46A 2PPDA 3MBFA 1I0DA 1QO2A 3W29A 1QFHA 1ZL1A 5LQBH 1ONEA 5ECVA 1JRBA 4KKQA 1GS6X 3KCWA 4L29A 5FHAL 5FFGA 2NSXA 1NF7A 3UW6A 4LEBA 4FIRA 4C6OA 4OLUH 1PD0A 2O5YH 3GRWH 5F9DC 4Z3IA 4XK2A 4GAGH 3R7QA 3QUMA 4UQDA 1WUZA 3DERA 1WICA 1I9EA 1YY9C 1XXFC 4BGDA 4FB7A 1QSFE 4MCNA 3FQNB 2C13A 1NCBL 1F4YL 2VMDA 2YJLA 4DXVA 1QOXA 1HP5A 1YUHA 1VJSA 4TSCL 4X4ME 5C0QA 4H0GA 4DNHA 1RUQL 1RUPL 3AG3B 1KXQA 1NWSA 4A2HA 5GGQL 5K9XA 2B15A 3TZVD 3BLOA 3L3KA 4G9DB 4H26A 3QYSA 2OJZH 3JWOC 5DHMC 4AGPA 4OVXA 3WCZA 1UG9A 3BP5A 4M61A 4NKMA 3MCKA 2HG5A 1U58A 2HG0A 5LLIC 4UQ2B 4ZCWA 4JN8A 3W02A 2ENSA 2ZSWB 3TBYA 1JNLL 1NCNA 2VEGA 2ZC1A 3LDVA 4PMJA 5E0KA 5AOZA 2Y1ZA 4ZFMA 4X6DA 5AYBA 3NCYP 3V3WA 4PZVA 5ID0B 4WSHA 3PWNA 1D9KA 4KROB 1NJJA 1FORL 3QQWA 4PJHF 1DBJH 4APQA 2G37A 4JFTA 3F2DA 1N6QH 3A4EA 3IXTA 4G9FB 4XXCC 1FGVH 4KUCD 1NSJA 1XLIA 4OZFB 2FEEL 2CHRA 1OGTB 5DYFA 1Q6GA 2DQFB 3QNZB 5JIDA 4DVOA 3F2LA 1KLGB 4I48B 1OK4A 1H50A 4PB4A 4F8QA 3N29A 5I28A 3GSRB 4GRWB 4EIVA 3NACL 1GTEA 4WHBA 4X6FA 1NDWA 3PTDA 5LG6A 1W17A 3VOJA 3LI0A 4Q9BA 4B41A 4HUUA 4QE1A 2QQLH 3N44B 4Q6JA 3B0VC 5EEWA 3GBML 3P77A 5LCVL 2IV8A 1BFVL 4P2AA 1RZ8B 2VISA 3KBPA 2AJZA 3LSOA 3PWUA 4CCEA 4AQ1B 2J1ZA 5E9NA 3PC0A 1A0DA 4E6MA 4AJWA 1MNNA 4N86A 4KK6D 5HWJA 1D6VH 3VGBA 4E8GA 1OV8A 4G9PA 3PTQA 1ZEAL 3WL0A 3WH6A 4O4WA 5F70A 1Y7VA 3G6JE 1NSNH 2ZX5A 3EFFA 1E27B 3ZTDC 2YXXA 3FULA 1EQCA 3EEZA 3GJFH 2EP6A 4UQEA 3V7MA 4PJXA 5FW8A 3O4OB 1I2PA 1MFAH 3KAAA 4GY0A 4OCWH 4KRZA 4XTDA 1RPKA 4U6XB 4UTMA 1K4HA 5DJDA 1LRTA 4MHHG 1TKWB 2ADIA 2DQUH 2FDMA 1NCOA 3BOXA 1UFGA 1B6DA 2BZCA 2H9GB 1Q6FA 1E9IA 1UASA 4HP5A 4LU5H 4KZEH 1XBXA 2BRRH 3THAA 4KY1L 4J6RH 3P4MB 1I0BA 4DERA 2QADB 4YVPA 1HHHB 1S7WA 1MHCA 3KS6A 1QATA 3X11B 1OTTC 1LZOA 3DBXB 1URLA 3S0PA 5BW6A 1H3UA 2BVPB 1DN0A 4YUEL 4YHOL 1MQPA 1XYBA 3RUGB 4AJVA 2WLZA 3H12A 2CW6A 1O9ZA 4AZGA 1DXFA 3WYZA 1M7JA 3GBNH 5I2UA 3DIDA 2IALB 3GHUA 5K9OA 1WAAE 1FFPA 5E03A 2F8QA 1ZJHA 1A6VL 1N2RB 4KDVA 4YDKL 9PCYA 4U49A 3KXQA 4P2QA 2JKTM 5MKGA 2ICWA 5KVGE 2B20A 2CRYA 4X8CA 2YEZB 3QDJB 1EX5A 3M44A 4ZAKD 2VXUL 1VGKB 3ARFD 2YQ2A 4Y9PA 1AD0B 1RIHL 2KLSA 3VRIA 4LS2A 3TR2A 2WCSA 2NX3A 4UZGA 4LLUB 4L0ZA 4LGPB 3VIHA 2IAMA 3IJ7A 1LBMA 5HJ3A 5EU3A 3HAEB 1NAKL 1TSRA 2WSQA 4XVTH 3SQBB 3E3QE 5T33L 5AD0A 2C8NA 2ILLA 2Y3AA 4L8BA 1FNLA 5F8RC 1Q65A 4C60A 4D0DA 2QULA 2X4PB 5TPWH 1NCTA 4IKKA 1OHQA 4XGZA 3C08H 2PTVA 4MYXA 1X5AA 4DK5A 1CENA 2JQMA 4AX7A 1S4IA 5FAGA 3FSTA 5CCKL 3F4CA 2B14A 2PGWA 4CMHB 3Q3GB 1OWQA 3R4DA 5LBVA 5EV7A 3OQ3B 3PM6A 4P8UA 3T0WA 1XLCA 3SGUA 1RP8A 1LLOA 1EZVY 3VGDA 1V27A 3WKML 3CZNA 4AK2A 2EDLA 2NXYC 4X3ZA 5KETA 4WLCA 4GUQA 3FT4A 4FNQA 1XT5A 4WFHD 2ZWSA 3FUEA 3AICA 3VMNA 2C7UB 2Z93A 3KDPB 3NG5A 5ICXA 1B31A 4R2GD 4HHHA 5DQJB 4X5RA 3B3DA 3UJEA 5DQ9B 3NAVA 1TB3A 4YE0A 4CMMB 1YUHB 3OB0K 2Y22A 3D85B 1KIRB 3ABLB 4O17A 4RGNE 3FSAA 1EGJL 4LO9A 4KO9A 5E2VH 2XSXA 5FUCC 3W2MA 3STPA 3GPSA 3AXMA 4P23B 1TQBB 3P0WA 4G7SB 4F7EB 4FA8A 4KU1A 3WU1A 3HZYA 3NIFE 3D2UD 5EUKB 5A16B 5CBEA 3SBQA 2PWDA 1XLEA 2R1XB 2Y8UA 3D6NA 3C60B 3D25B 1G6RB 2GJXA 2XKSA 2CM6A 2A9NL 1DQDL 2EDKA 2YLHA 1E15A 2QCCA 2HQAA 1A6WH 4LAMA 1Q0YH 3P11L 3WUWA 4PLKC 3O3RA 1CWYA 2FECL 3ECUA 4C54A 1W1B1 5IM7B 1G7PA 4JZJA 1V6WA 4M7KH 2DZWA 3NZHH 4EUPA 2D3VA 3N12A 1TJMA 1TETL 1MFDL 4OVVA 4EI5B 5BS0B 3GG1A 1DVFB 2HN7B 3LYEA 3CFBB 4WJ5B 4YK4B 1YPZB 4DVBB 1YJDH 1T04B 2WYHA 2DLFL 5JA8B 1BF8A 4WUUB 2WMIB 3ROOA 2AGTA 3LHVA 4JDTH 3WDHA 1BZDA 1B88A 3L4WA 4C83B 2WSYA 3S34H 3OBEA 1XCQB 2EC8A 2WZIA 3FXIC 4NNCA 4LUSB 4W9FC 4N9EA 4GNKB 2X7WA 5I79A 4F2TA 4IQJA 4DUXA 4ZAKA 2V0AA 2NW3A 3H9SB 3HI5H 1IGIH 1QFPA 1HSAB 2FJSA 4O2EA 1OF6A 3FH8A 2J6XA 2PLTA 4LL9A 3S8WA 1FWCC 2VKZG 1EERB 5IJKA 4O8RA 4B5ZA 3IIPA 3T6CA 4FAMA 2B7PA 4FG4A 3BWWA 1LL7A 3GSNH 3KZSA 5T1JA 1AKJB 4Y19E 1UR3M 2KZBA 5CBIA 2FLBT 4FZ8L 4LCWD 1FVCA 1F6KA 2V30A 2V2WA 4O2CA 4AD4A 4ZUTA 1I2NA 1K6AA 3KPNB 3WQWA 2WXDM 3NCMA 4ZQKB 1J8SA 4ZAKC 5I26A 2J6WA 2ISVA 3JYCA 3AHVA 3PN8A 4M62L 2EZ0C 1E28B 3FH5A 3MLRL 5F9OH 4H9MA 5C5YA 4Z7IA 2UYLB 2WWNA 3OSVA 3JUYA 5JQ6L 4Q6XA 3EX3A 2Z8VC 1LEIB 4ZFGL 3GYRA 2Z6JA 4I89A 3WX7A 2RFXA 2OR7A 2XH0A 1J8KA 3QCVL 3MSYA 1DQXA 3MA7B 4TL4A 4F2MA 3ME3A 4CNUA 2YPVH 4WI5A 4ZMPA 3ES6B 2YSWA 1K8YA 5EIVA 1FHDA 2VQ1B 1RQHA 4N42A 2R2CA 1N68A 2NXHA 4FI7A 5D5MB 4JPKL 1EJXC 3PSWA 4FJ6A 4OV4A 3I74A 4B60A 1E4LA 3N73A 3Q1SL 2O30A 1Z7AA 3FKKA 3JTTB 2G41A 4PFHA 5LN4A 2B4CC 4Z77A 3I4KA 4JEQA 4F9JA 3HFMH 1Q7QA 5C2CA 3W2DL 3ELFA 1KYUA 4QYAA 3RUGA 3VXMA 4X7TA 1PSKL 1WBXB 1VJZA 2W92A 3FOKA 3IS4A 5HJXA 4KTEH 3OKDB 3PGFH 1BXBA 4ELKB 3MCKB 4LOUD 5CLWA 2R8SL 2WW5A 2IPKA 5E8NB 4ZUVB 2WMHA 1CLCA 1JF5A 5B38B 1F07A 4P4RB 4JM2D 1CE6A 1Z2KA 4JO4H 5I8OH 1UW9A 5EN2A 3WJMA 2O6EA 2XISA 4J9JA 3DGCR 4X8XA 3OJDA 4X98B 2QEZA 4P2YA 1XF1A 1T7ZA 1KN2H 3U2ZA 2Q8BH 5KBMA 1XX9C 4JHAH 4DBEA 3TOYA 5FEXA 1QO3A 1QW7A 4I2XB 3CQQA 3M46A 4XP1H 3CK5A 3ID7A 3BQ5A 1EAOA 3JW7A 4FR6A 5KZDA 5E2TL 3CFEA 3V0AC 3DJ9A 4EUPH 5CEZE 1CG9A 1FYHB 3SCUA 3WQOA 2Q8BL 3A24A 3UJ2A 1T0NA 1OGAD 2JJUA 3NDYE 2R1MA 2ODIA 3SM0A 2Y7FA 1W5QA 3HAEH 2WJZA 1B30A 4C6DA 3QC6X 1FC1A 3PS6A 2VXQH 4IRSD 1IM9D 3P77B 2IKGA 1FCCA 3LCXA 1FHUA 5CZRA 4C7GA 4PJEA 4B5WA 2WQXA 4ICCX 1DVQA 2YS4A 3TIDA 2R4SH 2R8SH 1YKWA 2POTA 2AJUH 2WTRA 1MKFA 2J13A 1N64H 4R33A 2C7UA 1MHEB 3PGFL 3AUVA 1G6CA 2WIIA 3VH8B 4NO3B 2MANA 5JDJA 4IM4A 2F58H 2EDYA 2F68X 4MA3B 5KTEL 2VC5A 5J8LA 3BKCL 1UIOA 3AREA 4KITB 1Z44A 5MHSD 2R2EB 3WAJA 3QN3A 4V1DD 2VN3A 4BZ1A 3HZVA 3I65A 5C2GA 3ZE0E 1LRQA 4XMXA 4PSPA 4Z3HA 4PJHE 4YSEA 4YFLI 5IBXC 2PLCA 1ZE3H 4JPKH 1BFSA 3EWBX 4X9GA 1TT6A 3GJFA 1FA4A 3BH8A 3RVXD 1VFAA 3TNMB 2QL1A 1N8ZB 2BVWA 3VRLE 1E67A 1IM9B 3SODB 2ZCHL 4ZNEA 3F4NA 3KTSA 4M7SA 1V08A 2DT1A 4B7IA 3QH2A 3S1XA 5AB3A 1L4IA 1I8AA 1IBBA 1KCBA 2JJTA 2MHAB 4LLQA 4Q52A 5CC5A 1IYXA 4DUOA 3SCPA 2IH3A 3H2QA 3CXFA 2AV7B 3VZZA 1WAEA 1JVOA 3MLRH 2AITA 4NBYB 1ZCOA 1J8HA 1OL0A 4UXDA 2XXFA 4W1TA 4NJIA 1IMHC 4AV4A 1E3FA 5EOCJ 3B9EA 1RSYA 4HJTA 4U28A 3EHBB 3NCOA 3RWFB 2VX4A 1ZLWH 1TYEB 3O6YX 4L8CA 1R3IH 1IR2A 3LS4H 2LQRA 4E41D 3GSNL 4FXGC 3WEBA 4OD3L 2XFYA 4WEBL 4NUPA 4AQ1C 2CLOA 1QI0A 2E4TA 3LH9A 2DMCA 1TIWA 1VBGA 2CNYA 1XW8A 4YBHA 1V03A 1N59B 5MHSE 3IGLA 1BWWA 4OUUB 3WEXB 2ZKYA 3QP3A 1SRDA 4P5KA 3KS5A 2WNXA 1NBVH 2YK1L 3AMDA 1CGTA 4OGAC 4DKTA 4JDTL 5BO0D 5I2IB 2BASA 4YSRA 4S1FA 3TLLA 4L1LA 3WNJA 5GRVK 1GKOA 2AJXH 3EH5B 3KGUA 5DMJB 2KAUC 1P7QA 3SO5A 1TWSA 1ML0A 2O7QA 3NQBA 4US6A 4MNGB 3NPSB 1WJ3A 5HR7A 1AO7B 1GZQA 1TETH 3QZWA 1HZKA 2VTFA 4JIHA 4RK8A 3R5EA 3MOAL 3Q3GA 1PS3A 3TLQA 3P81A 1CDHA 2ZOOA 1T1YB 3US0A 1E6PA 5DA4A 1JPEA 1ZSDA 2VDMH 3T65A 2BSTB 1ID2A 3AROA 4H2AA 5K1JA 4E41B 1QG3A 3S35X 2QADC 3E2QA 3N3MA 4ZTYA 2A9NH 2VAJA 2FWOB 4ORGA 4X0VA 3WI9A 2WNWA 1H19A 2HLFD 2YBTA 4NHUB 3CVIL 1X5JA 4IGBD 2DM3A 1F3EA 1GPFA 5FYKU 2FB3A 4OOUA 2VGIA 4YX2L 3NIDB 4ODWB 3UACA 2PWVA 4HA3A 2D24A 4ZX6A 3JTTA 2P49B 1UJ3B 2P80D 1BIIB 3D50A 3QUZB 3N1GC 1U8JB 3OKLB 2Z7WA 1EL3A 3MTWA 3EPOA 2YGNA 2XZQH 2CXGA 4JRWA 4KXDA 4IMLA 1XQLA 3SCQA 1QD0A 5TQ0H 4U1HB 4M43H 1IFGA 3VDGA 3GXPA 4X8JB 3WLWC 4S3FA 1E72M 1SUXA 1W31A 1XR8A 6PCYA 1JPKA 3SCMC 2COVD 3EGDB 5KUMA 2V17H 1MVUB 4OIAA 3WO4C 5I3JA 3TTEA 4TXEA 3C5SB 1FFQA 5DC9B 5E2UL 4LNRA 3ZE0F 5L2KA 3L13A 1K9FA 1HHKB 4JFEA 5I03A 3BOFA 5EUOB 1YNTA 43CAB 4PY8I 2GDUA 4XNMB 1T04A 1A6UH 1HXMA 3FO2A 4K07A 2GJZB 3WD5L 4RETB 3CLEL 3RITA 1H7PA 1K2DA 1HILA 1L8NA 1GR7A 2X1SA 4PTXA 4D7PA 2NQDA 3F5LA 2P42B 3LHPL 3CFEB 4PBVC 3H4WA 5BZDB 7A3HA 4J3OD 4N2MA 3PP3K 1M7UA 3H9SA 4JJ5A 2I9LA 1ZGLB 2E7LC 1CD1B 1YE6A 5HHNB 4TSBH 4CDHA 2VXUH 3WLIA 1BLNB 3C6LD 1DANT 4LRSA 1QLEL 5AB0A 3CMGA 4YPJA 5FF3A 2FZ3B 1WKDA 4R96A 1KBBA 1NGWA 4PEEA 3F7YB 3QYMA 3TA3C 2ALDA 4QHMB 1K8DB 2VN5A 4ZUUB 5INCA 4GH1A 4YMZA 1CEOA