1HL9A

Crystal structure of thermotoga maritima alpha-fucosidase in complex with a mechanism based inhibitor
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
442
structure length
420
Chain Sequence
b'RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAELPGYKWEFTRGIGLSFGYNRNEMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ALPHA-L-FUCOSIDASE
publication title Crystal Structure of Thermotoga Maritima {Alpha}-L-Fucosidase: Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 150
structure length 420
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hl9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hl9A01
1EGZA 2WAGA 1QWNA 3L4WA 3CZLA 3G6LA 2UY4A 2PWDA 3PTKA 4PTVA 5M3WA 3TP4A 2GVYA 5KZ6A 1EHAA 1J18A 3WQ4A 2DSVA 5I24A 3ZT6A 4MNMA 3CUJA 4XZWA 1A47A 4U2ZA 4JFUA 1V6UA 1V3IA 2EXOA 1PEZA 2WCAA 1MW0A 1JGIA 2A3CA 4MB5A 4NRRA 9CGTA 4IISA 5I79A 3WIJA 4TOQA 2FDMA 3II1A 3VIHA 3W28A 4D6IA 3RDKA 1QBAA 1ZS2A 3M7SA 1JDDA 4AISA 1DWGM 1W3JA 1J12A 4W87A 4PTWA 3EDJA 1O7AA 5I5RA 2A3HA 4PMUA 2OWCA 3PZVA 2UY5A 3W82A 4LYRA 3SCWA 1V02E 5A69A 4Z2HA 5CPSA 1AQMA 3SCOA 4WK9A 1UA3A 3VGFA 2CBJA 1PX8A 1BQCA 4J7RA 2VVSA 1ITXA 1GPFA 3VSVA 3CZSA 5BROA 4E8DA 3AHTA 1BG4A 1WDRA 2V5DA 4LGXA 4PSRA 2J7CA 3VOCA 1W3LA 3K4AA 1NH6A 2E3ZA 4CCEA 3AS3A 5DF0A 1MYRA 1UKSA 3AHVA 2VX4A 2RGMA 1J0JA 4TX6A 1C91A 2XIIA 4HA1A 4IM4A 5CJ5A 2BY3A 3VM5A 2WW5A 1OCQA 3HMCA 4DWSA 8A3HA 2JEQA 1R85A 1X1NA 4YHGA 3WNLA 1D3CA 3VDAA 3MMDA 4FLOA 1ISXA 5A6BD 4WLCA 3SCUA 1JDAA 2XFFA 1KQZA 1OSEA 5JIPA 4BQ4A 1J0HA 5GNXA 3VM7A 3ZM8A 2EPNA 3AHZA 1V0LA 5BXPA 1DP0A 5BYWA 4QCFA 2YFOA 4OBRA 4FNPA 3WD3A 4TVUA 2PI6A 1W1VA 1WDSA 3CTTA 3WF1A 4P8XA 5HXMA 3OZPA 1UYQA 1UKQA 4WKAA 5D9PA 2VX5A 1JAEA 1QHOA 3LRMA 1B31A 1HJUA 2VX7A 4TTGA 4AD5A 1LG2A 3TV8A 2OYLA 1XRVA 4XV0A 1A3HA 1ZU8A 1EQPA 3TOPA 3CBWA 2NSXA 2XVLA 2YKKA 4W86A 3GNOA 2PBOA 1TFVA 5CXPA 2DEPA 4M81A 1HXKA 1R86A 1TG7A 3RCNA 2G4FA 3AMGA 4N0RA 4J3TA 4XZBA 4UCFA 3CZNA 1JYXA 3GTNA 1KXHA 1M53A 3I3BA 1JZ3A 1C92A 4HZ7A 2D2OA 5D8ZA 2BXZA 3WD0A 1RP8A 1H2JA 3EJTA 3CHCA 3AIEA 1LL4A 2BNJA 3BGAA 1SZNA 1BVZA 3WQ5A 2G3JA 4DO6A 5IHSA 2GJXB 3RMEA 1RP9A 3UEQA 2X2YA 3QHOA 5I2UA 1JZ2A 3CH9A 5I23A 1C93A 4JFVA 3WELA 2X2HA 2IGTA 3VMNA 1TVNA 1UD2A 1JZ5A 2E4TA 4K68A 1BPLB 1EQCA 3U5YA 3DHUA 4AW7A 4AIOA 3MSGA 2EJ1A 5C70A 1GJWA 3CHDA 2DGAA 3EJSA 5CSYA 4D6EA 5E9AA 5AY7A 4HZ8A 1OB0A 1JNDA 4F8XA 1VFMA 4W7VA 2Y2WA 5BWFA 1HL8A 3DDFA 3VDHA 1B2YA 2XFRA 2XGBA 3IANA 1UD4A 2XJ7A 5E6ZA 1QNQA 2WHJA 1R47A 1WDQA 3LPOA 2XSAA 1VB9A 3EJPA 3OG2A 4BQ3A 4KH2A 2V3FA 1H0GA 1E1EA 3N1AA 4FNUA 1HVQA 1K9FA 1WNOA 2VMFA 1XD0A 2ZUVA 1TQUA 2X05A 4DO5A 1KXQA 2ZX7A 1GOMA 2Y8VA 2VZVA 4F66A 1V3KA 1F4AA 1TVPA 4C7FA 4UOQA 3WH6A 1E40A 5A8NA 1J0IA 4W8AA 5DEZA 3DYMA 3GM8A 4J3XA 3NSNA 1B3WA 4UFHA 4AMXA 3EBVA 3L4ZA 4AD3A 1HJVA 3LXBA 2EPOA 4M80A 5C8BB 4W89A 5D4YA 3GH5A 2EEXA 3WH8A 2E0PA 4LXFA 1CTNA 3VDCA 1OIMA 5ABEA 2WKGA 4PTXA 1TZ7A 1AQ0A 3ZO9A 2ZWZA 3AQUA 5M5DA 2XVGA 3UG4A 4PUDA 4DM2A 2BHYA 5TD4A 1KQYA 1W2PA 4DWSB 3SURA 4AYSA 1V6VA 2JFEX 3EMQA 2VR4A 3HZ3A 3WDIA 3CUGA 3WENA 3FXYA 1CGUA 1J0YA 3QGVA 4GXPA 1NWSA 4URIA 2EAEA 4QDMA 2VL4A 1LLOA 4FNRA 1K9DA 2F18A 2ZUTA 3BH4A 2BVYA 1UD3A 1VEPA 3FY1A 3UESA 3A21A 2X8RA 1N82A 5AYBA 5CPQA 3WDPP 3W29A 2WPGA 4OOUA 2V38A 1UWSA 3WUFA 3EDKA 3WEZA 4PMDA 3PZTA 4W84A 3SCRA 2D0FA 2FGZA 2XSBA 5AYIA 5BXSA 2PC8A 2E9MA 1XH0A 2CBIA 1CIUA 2ESCA 3PZOA 3HG3A 3PZQA 6A3HA 1G9HA 5DT5A 1BYAA 3OLDA 3WBEA 1R87A 3SUTA 4OGZA 1GNXA 1E6NA 2J47A 1EHNA 4CN4A 5BRQA 1V0KA 4M82A 4M56A 5M03A 2BY1A 1JXJA 1UKTA 1OGSA 1VRXA 1Q4NX 2DH2A 3CMGA 3VO0A 4W7UA 4QFUA 1Q6GA 1W1YA 3WMSA 1WKYA 1UR2A 4W7WA 3FHQA 3I3DA 2GJPA 2CKRA 3L4VA 1KBBA 2PB1A 1XC6A 2WWCA 2ZICA 4AEEA 4H8HA 3ZSSA 1QI3A 3TTSA 3BAIA 5ECUA 1JFXA 2FGLA 2J75A 4XUYA 3BSHA 4QLJA 2WYSA 1E71M 3ZQ9A 1SMDA 1JYVA 3CZKA 1C7SA 3FHAA 1IV8A 4D6DA 5I78A 1Z32X 3WF2A 3S5YA 1UUQA 3DYPA 3W27A 1H11A 2J8GA 4P8VA 3U7VA 1BYBA 3ARTA 2XIBA 4CVWA 1F4HA 3CUHA 1XCXA 1OBAA 1GUVA 4NF7A 2D20A 4AZBA 1L8NA 2G8ZA 1MW3A 3GXIA 1KR0A 1WAWA 3DDGA 4DWSC 5I3DA 4AYGA 1BG9A 3TONA 3QOKA 3S6TA 1DWJM 3S2CA 1MQPA 4AC1X 4PTMA 3ZR6A 1FFQA 4CU8A 2W66A 4BQ5A 1CXKA 4AZIA 1HT6A 4CU7A 1XYZA 3NSXA 2VR5A 3N18A 1HNYA 4WKFA 4LX4A 1JG9A 2Y24A 1UHVA 5BCAA 1SR0A 4Z2KA 3POHA 3ARSA 1EOMA 2EPMX 3WQVA 1CLXA 5E6YA 1NP2A 4KWUA 1KFWA 4JZ5A 2VRKA 1FH7A 3WY4A 5E0CA 8CGTA 3AHYA 1V6XA 4E2OA 2D0HA 5DFAA 1G01A 2EBNA 1TA3A 2YOCA 4BA0A 2J7EA 3NCOA 1MQRA 2WKLA 5I77A 2Z1KA 3WFZA 2YL5A 4CD4A 2XGIA 2YL9A 1NOUA 2OYMA 1JDCA 5IFTA 3BVWA 5CG0A 2WHLA 5A94A 4D71A 1US2A 1K6AA 1BYDA 3O2LA 5D9NA 4JHOA 1E6RA 3CZEA 1KXVA 5CPTA 2WHKA 2O9PA 2WLYA 2EO7A 3LPGA 2CEQA 1PZ2A 5A8PA 2G41A 3VIMA 1EDTA 3SCSA 3BVVA 3EDDA 1UR4A 4FNQA 3MMWA 1NQ6A 4CUCA 1UZ1A 1E9LA 1V03A 3I3EA 1E0WA 1UWIA 3AIQA 1ZBCA 2WVSA 4Y7EA 2DT3A 2YJQA 3BUIA 1CEOA 4P7RA 1UR9A 2CKSA 4IUGA 3ARXA 3AXHA 1AMYA 5A3HA 1XSKA 3WNOA 1J10A 4RE4A 1ZL1A 1V3LA 2ZE0A 1DEDA 3T2QA 3OGSA 3NJ3A 4ZENA 3SIMA 1V02A 1FP9A 2J7GA 4PMOA 2ZX6A 2XWDA 2DQXA 2WZHA 4OZOA 4E4PA 1E3XA 5A1AA 5KEZA 4F9JA 3W24A 2CPUA 4MJ4A 3QR3A 1ECEA 3N13A 3HU7A 1FH9A 3WMCA 3AS0A 3DX3A 4Z2IA 3SUVA 3F5KA 3J7HA 3MUY1 1UQYA 2WCGA 1UOKA 3CO4A 4HTYA 4FF5A 3AIBA 3BLPX 3AIVA 1X6NA 1V0MA 4LYPA 1E73M 3AZRA 2QV4A 3GXMA 2YIHA 1HKKA 4PEEA 4PN2A 4GKLA 2B31A 4WKHA 1M01A 2X0HA 2OW6A 1NARA 1UASA 1KR1A 4AEFA 5CZKA 2VZSA 4UFIA 3EMCA 1V3JA 3RJXA 4B16A 3LMYA 2O92A 1B3XA 4LQ1A 2J8FA 4ACYA 3WH9A 1B3VA 2EADA 1XHGA 1HJQA 1E5NA 1ODUA 3VIKA 1DWIM 4JCMA 5GNZA 4UZUA 3B9DA 3VKKA 3VD3A 3N12A 2WHMA 3K8MA 2CBUA 3GXTA 3WQWA 4AXNA 3WUBA 4TVCA 5JBDA 2D73A 2CHNA 3WY3A 2VCBA 2QLYA 3TA9A 3VD7A 4B3LA 1R34A 4JCLA 1W2VA 1R33A 4CN6A 2QPUA 2WK2A 1JZ4A 3GH4A 3VILA 2WC4A 4D6JA 4UR9A 4JFTA 1JF6A 3ARPA 1KGXA 1E6PA 2J7FA 2XFYA 1JZ7A 2J7DA 1M04A 1CNVA 3O6AA 4NZJA 2X1IA 2HISA 1EO7A 3VD5A 2XVPA 4W5UA 2PBGA 2UWFA 3KL3A 3KLLA 2BVTA 1GCYA 1Q6FA 2D0GA 5CQ1A 1XSJA 4AZ6A 3CHEA 1NWRA 3MV01 3WDRA 1XH1A 4P8UA 4A3YA 1J01A 1H4PA 1DTUA 4HMDA 4XX6A 5A6JA 1TA3B 4R5EA 1E4MM 4MB1A 1I1WA 1CXFA 1Q6DA 2F7RA 1HJXA 4W88A 5AC5A 4EAMA 1R75A 5IDIA 1JYWA 2DSKA 2VZOA 1VF8A 2WMIA 3SCPA 3WDJA 2OSWA 5A2CA 1EH9A 2W4XA 3CLWA 5I0DA 3ZMRA 1UKPA 2QMKA 1QPKA 1UG6A 4V2XA 1O7DC 2DSUA 1H41A 4HPGA 2E8ZA 1TR1A 2Y8KA 1CDGA 1YQ2A 3AS1A 3WNKA 3RPMA 1BLIA 2XN2A 3PZGA 2WM0A 3M07A 5DMYA 4OUEA 3W6MA 5EBAA 3VX1A 1KBKA 1OWQA 2XHYA 1CBGA 3EJQA 4L4OA 4U5IA 2EPKX 1CLVA 1UD5A 3B8SA 4JKLA 3L4UA 4HP5A 1LJYA 1DWHM 4UZSA 3ARQA 1GONA 3TTOA 2E9LA 1TQTA 2WC3A 3A22A 3S5ZA 4FK9A 1B0IA 4W8BA 1PIGA 1UD6A 1X6LA 3BVTA 3LRKA 2XYLA 2OSXA 4PYSA 4CD8A 3W0KA 1G0CA 1QOXA 4P7OA 1NOFA 4UQBA 3RO8A 5CGTA 4QP0A 1HVXA 2DSZA 4WIWA 3D3AA 1XV8A 1OIFA 3PHAA 7CGTA 3BLKA 4AZCA 4PMZA 2ZXBA 4U2YA 2WBGA 1UZ4A 4MADA 4AZ7A 4GO9A 2WMJA 6CGTA 2OYKA 3M6DA 1B30A 2V3GA 3KZSA 1B90A 1B3ZA 2BVDA 4KRTA 4JHZA 3VIPA 2C8NA 1BSIA 1BVNP 1I75A 2D3LA 1VIWA 3QHNA 4W8LA 1HXJA 4J3WA 4BCEA 5EFFA 2GDVA 3WD2A 1ITCA 2YDSA 1FHLA 4D6HA 3EDEA 2VOTA 3N04A 3ECQA 1EA9C 1EDQA 2WMFA 3T09A 2TAAA 2EACA 1JI1A 1CXLA 5D9OA 2G3IA 3ZJKA 3IJ9A 3NDZA 4P7NA 1TQWA 3SUUA 3VD4A 4D6CA 2AAAA 4MB3A 4MNLA 1K9TA 3FN9A 2EPLX 1Q6CA 3ARVA 3F4VA 1KTCA 5EMYA 1EIBA 2VT0A 2W92A 4ATLA 3RIKA 1OD0A 2QMJA 5FD0A 1JXKA 1WZAA 1GVIA 3WSUA 1R8LA 1KGWA 3WUGA 1P6WA 5JBEA 1M03A 2XVKA 2ZX5A 1QW9A 3UETA 2Y4SA 3BUQA 2IXVA 1H5VA 3JUGA 2W91A 3WNMA 3BAJA 3MUZ1 4JIEA 2YL8A 2RGLA 4A3HA 2F8QA 2WVTA 2GJRA 4M1RA 4OJYA 4DUXA 1VBRA 4B9ZA 1GJUA 4PRWA 3WY1A 4BF7A 1JL8A 3TTQA 4CGTA 1ISVA 2VX6A 4EE9A 4AMWA 1FA2A 2BY2A 2WWDA 3BUBA 4TXEA 1GOOA 4U33A 2BY0A 5M17A 2ZWYA 3AIWA 2GDUA 3HN3A 1TMQA 2A3BA 2F1BA 4LYQA 1HKIA 4NXSA 1H49A 2J7HA 1UWRA 2VZTA 4UQEA 1ZBWA 2WMIB 1O6IA 3AI0A 3KEHA 2D24A 1GOKA 1RD6A 1ISWA 4MB4A 3MI6A 3OB8A 1KTBA 2FYVA 1J11A 4BZYA 3GXDA 2BFGA 1DWAM 1QI5A 3WEOA 4R27A 5A6LA 2X0YA 5ABHA 3MUIA 1VFFA 2NW0A 3LX9A 1OGBA 1J9YA 3VIFA 1MQQA 2CYGA 3SCNA 4F9DA 3OLGA 3IJ8A 3BAXA 3D50A 2ZX9A 2W67A 5JUVA 4AD4A 3A23A 2YLLA 3GYCA 3OGVA 4S3KA 4AIEA 1QNOA 1HTYA 4ACZA 3GBDA 3VSUA 1V3HA 3AIUA 4HPHA 3BAKA 1GOQA 3U7BA 3AFBA 2YFNA 3WL0A 2C7FA 1MW2A 5F7UA 4D1JA 1VFUA 4Z2JA 5IXEA 3WDHA 4JFWA 4RL3A 1ZBVA 4FMVA 2WMHA 4W5ZA 2WSPA 1W3KA 2IUZA 3A47A 2XTKA 3PZIA 2CESA 3WD1A 1US3A 3L2MA 5FOOA 1J0KA 3WUEA 1E6QM 4UNIA 2D1ZA 4AZGA 1J0ZA 1WZKA 1VFOA 3POCA 3VGHA 3H55A 5I6SA 2J78A 4MDOA 1QNPA 1BF2A 3D4ZA 3WD4A 4CKQA 1V6YA 1GOWA 1EOKA 3AMLA 2ZUUA 3VU2A 3F5JA 1CGXA 4HOXA 4PMQA 2QHAA 1E0XA 3GXNA 4AZCB 1SYTA 1MXDA 3GXPA 4MNJA 4HU8A 3D5HA 4H2CA 3AICA 4GPNA 3QHMA 1BGGA 1U30A 4H04A 3AMKA 2VRQA 3NIYA 1IT0A 5DT7A 1JIBA 4D1IA 3WQ8A 4F79A 1E43A 2NT0A 3WH5A 4QLKA 3CUIA 3T0DA 4AD2A 2J79A 3LXAA 3PZUA 3RM4A 3VINA 2ALWA 4YN5A 1E6SM 3MO4A 2WVVA 3VSTA 5BRPA 2XWEA 5C71A 1G1YA 1CGTA 4D72A 1PZ3A 4PSPA 3WQ6A 1WP6A 4X0NA 4MNKA 1UQZA 1MFUA 1XSIA 3DX2A 4Z2LA 2PWHA 1C8YA 4XB3A 5HNNA 1JD7A 3KWXA 4WSKA 1C8XA 1HP4A 1KCKA 3HG2A 1S46A 2Y5EA 5LA1A 1HX0A 3PTMA 3KLKA 3WDQA 2J25A 3VMPA 2VUYA 1JAKA 3N11A 3VIOA 3ZR5A 2XN0A 3GNRA 4AMCA 4E8CA 1UH3A 5IHRA 3CZGA 2JALA 2DT1A 1VEOA 4W93A 1UD8A 1CGWA 2CXGA 4UFMA 3RJYA 3BCDA 1RH9A 3BC9A 3EDFA 4H8VA 1B1YA 1FFRA 3DX4A 2GSJA 1U33A 1R46A 1BHGA 1DHKA 3N9KA 4CD6A 3CIVA 3AMDA 1JD9A 4H41A 3HJEA 3APGA 1EDGA 1QHZA 1VENA 2VCCA 4ZE4A 1W1TA 2X2JA 4CD5A 2W62A 2CHOA 5IFPA 2X2IA 1KWGA 2WB5A 4LPCA 1GVYA 2BS9A 3LXCA 2YA1A 4J3UA 2VZUA 5EB8A 3FNDA 2QF8A 1HJWA 4S3JA 3WBAA 4KMQA 3VGGA 1QHPA 3AMCA 2DT2A 4UQ9A 4D6FA 4DWSD 4HA3A 3WF3A 2JIEA 4DUWA 1OINA 5BXTA 4JAWA 5A6SA 2EQDA 3AJ7A 4PMVA 4TX8A 3LPPA 3L2LA 4W85A 4PUEA 4UQCA 1VJZA 2PWEA 2VC9A 3CC1A 5BXRA 4B3KA 3A6OA 3THDA 1QI4A 1C90A 2HVMA 4AIUA 1E4LA 4JFSA 4OKDA 3ARRA 5A2AA 2PF0A 2CERA 4GZEA 3DX1A 3MS8A 3CV5A 4ATWA 3MSDA 3K46A 5FIPA 3HG4A 4Q7NA 1C8QA 4BQ2A 3UG5A 4ACZB 5LA2A 4YPJA 4QCEA 2FH6A 2G3NA 2CIPA 3T0BA 2GUYA 4GIAA 1B3YA 5HOSA 2WSKA 4MTVA 1E5JA 3HG5A 4HA4A 5ABGA 3AZTA 3ARYA 4QLLA 1E1FA 2WZIA 4UOZA 5A8MA 4GO8A 1H09A 3OA5A 3EMZA 1TUXA 7TAAA 3VD9A 2FH8A 4EANA 1W9UA 2ZXQA 3IK2A 2DT0A 2W61A 1UWQA 3GDBA 3VIJA 4M24A 3OBAA 1ZB5A 4TVDA 1HKJA 2F7PA 3H54A 4PBGA 4A4AA 3O9NA 5FL1A 1M7XA 3UCQA 1LL6A 4OIFA 4P8WA 1CXEA 3BUDA 3WEMA 2QPSA 1B9ZA 1E15A 2VRJA 4YHEA 1GZJA 3PN8A 1LL7A 3A24A 1ESWA 2UY2A 4GZIA 2F61A 2YA0A 3T2PA 2D22A 4C7DA 4IPNB 3B9AA 4KRUA 4AZ5A 5E0FA 3BMVA 4AY1A 3MU7A 2V3DA 4AD0A 2O9OA 1FOBA 5DO8A 1H0IA 1LG1A 1V6WA 4U5KA 3ZJ7A 1V08A 2WVVB 1QI2A 4FNTA 3ZJ8A 1JZ8A 3VUPA 2J7BA 3WF0A 2J74A 4UOJA 1JFHA 4C7GA 4BS0A 3RILA 1OGGA 2FHFA 2ZUSA 2GK1A 1CGYA 4GI9A 3AIRA 4P7QA 1WZLA 4PMYA 4TTUA 1AVAA 4QAWA 1CECA 1QVBA 1UWTA 3THCA 2BV9A 4TUFA 4NX0A 1IZKA 2BHZA 1W9XA 2ZX8A 3LPFA 3VMOA 1U2YA 4GINA 3ARUA 3ZIZA 1D7FA 1QW8A 4B9YA 1WDPA 4UQAA 1E0VA 1W9DM 4CCCA 3WKZA 2FE0A 1GORA 4AWEA 1TCMA 1E6XM 2ZIDA 4UFLA 3WMBA 2WMKA 2YBTA 4DO4A 1NWTA 3IAQA 4MDPA 3NYDA 1NP0A 4V27A 5A8OA 1XH2A 1VBUA 1W32A 3K8KA 1PJ9A 2WVUA 1AQHA 4HMEA 4CU6A 5GQBA 3RM9A 1WB0A 4WJXA 4X9YA 4Q22A 1XYFA 5HPCA 2AMGA 1T0OA 5CSUA 4P7LA 4J3SA 2Q8XA 3WH7A 3GNPA 5CLTA 1ISYA 1KB3A 3L4YA 1WPCA 3GH7A 2J4GA 1HN1A 2W5FA 2ZXAA 4ML4A 2PWGA 3IJ7A 3A3HA 1FHDA 1R7AA 4GQQA 3SUSA 2JE8A 2E8YA 1V0NA 2O9RA 3EJRA 3DYOA 1E4NA 1LWHA 2FHCA 3W53A 3FW6A 4DM1A 3VGBA 1OT2A 3A4WA 5GPRA 3VIGA 3ZT7A 2CETA 3BLBA 3VGDA 3AYRA 1QNRA 1W1PA 2W63A 3A5VA 2VQTA 4GZJA 5A6BA 2YDQA 1IZJA 1OM0A 3U5UA 1FP8A 4PMXA 1EO5A 1BYCA 4MAVA 2VCAA 1OT1A 5D8WA 1HP5A 1WE5A 3BUPA 4CVUA 1HKMA 1LQ0A 4PMNA 5FKYA 4M29A 1VEMA 2YLAA 1CENA 2F2HA 2DIEA 4GI6A 2G3MA 1GQIA 3BAWA 2NT1A 4AD1A 3W37A 4RE2A 5A6AA 4NZCA 3VNYA 4PMRA 1KXTA 2CCRA 2E40A 4H8UA 1H1NA 3CMJA 4ATDA 2JIWA 3LRLA 3G6MA 4EK7A 5A8QA 3CUFA 3AISA 3OZOA 1TQSA 1CPUA 3D4YA 3AOFA 2OWXA 3WL1A 1JI2A 4ZXOA 1GW1A 2GFTA 1W3HA 3AROA 4JL2A 1HWWA 3WF4A 4U3AA 2XM1A 1GQLA 1UWUA 2OW7A 2OLHA 1WZMA 2YDRA 3SCVA 3MUAA 3PZNA 2ZUWA 3IGUA 3BSGA 3WY2A 1I1XA 1UA7A 1VJSA 1PAMA 3KL0A 4JL1A 1E55A 2WC7A 1GHSA 1CWYA 1CYGA 4JKMA 1PS3A 4UFJA 3OLEA 1OD8A 2YBUA 1ISZA 5A6MA 2Z1SA 3SEPA 1UR0A 1CZ1A 1GOIA 4J28A 3VPLA 4WF7A 3UR8A 3CZ8A 2DPEA 5JIWA 3PZMA 2XPKA 3PZ9A 4UTFA 4RE3A 3MMUA 4GQRA 3AHXA 1W9VA 1KCLA 4D6GA 1W91A 4FLQA 2DSWA 1DWFM 4FLRA 1MXGA 2V3EA 1G94A 3L4TA 3NUKA 4FNSA 4CN1A 3BMWA 1YHTA 1HL9A 1QX1A 3CZJA 3AZSA 1EXPA 1XCWA 3ALGA 4KGJA 1GQKA 2GK1B 4HZ6A 1QNSA 5A6KA 3WNNA 2ZUMA 3N17A 3T0AA 1C7TA 1MFVA 2VURA 5CLWA 5ABFA 4J3VA 1GQJA 3M46A 1JZ6A 3MKKA 2DIJA 3TTYA 3ZOAA 3GZAA 3ALFA 3NDYA 2ZUNA 3AS2A 4OBSA 4M8UA 1NM9A 2VVNA 1TQVA 4DUVA 4NZFA 3L4XA 4PCSA 4N42A 2WCSA 1UKOA 2D23A 1R7OA 3SCQA 3T08A 1Y7VA 1WO2A 2F1AA 2OWWA 2UY3A 3UR7A 1CGVA 1KGUA 3EJUA 1HIZA 3VX0A 3WNPA 4ZEPA 2JF6A 1PBGA 3B9EA 3WN6A 4B15A 3VNZA 3DHPA 2BHUA 1RPKA 2XM2A 1QWUA 1WCGA 3T2OA 4KGLA 1QI0A 2XVNA 5LYRA 3ZT5A 5GNYA 2ZXDA 2YA2A 2BXYA 2XN1A 4U3CA 4L4PA 1D2KA 2WNWA 3OLIA 4CCDA 1L0PA 2VJXA 2VQUA 4UFKA 2VTFA 3AXIA 1E4IA 3MANA 3UG3A 3GXFA 2WLZA 4MAZA 2WBKA 2WXDM 3W26A 2E9BA 3WFLA 1QBBA 3UERA 3A4XA 2FHBA 1C3FA 3W6LA 4PCTA 1G5AA 1W9PA 2DDXA 5AC4A 4JKKA 5E09A 1ZJBA 3KL5A 3ZJ6A 2F7OA 4NI3A 1ODZA 4CD7A 5LA0A 1H3GA 1V3MA 1KWKA 3VVGA 2A3EA 3VTRA 3VGEA 1MW1A 4NXKA 2J77A 2MANA 2ZOXA 2WZEA 3D51A 1PPIA 1ZBKA 1LF1A 2A3AA 3ARZA 4WSJA 2O9TA 3OIHA 2OSYA 3CPUA 2WMGA 5A2BA 3K4DA 7A3HA 1JYNA 4J27A 4AZHA 3BXWA 1NWUA 3CGTA 3DECA 3QOMA 1E3ZA 1CXHA 3W25A 3N15A 4UQDA 2AOSA 2X09A 3PBGA 4HMCA 2F7QA 4NRSA 1MWOA 3F5LA 2PWFA 1SMAA 1PX4A 2XG9A 3CHFA 2JF7A 3A4AA 1PIFA 3D52A 3GBEA 6TAAA 1FH8A 3RM8A 2D3NA 3BAYA 2JEPA 1XGZA 3VIIA 1E6ZA 1CXIA 4ZFMA 1ZJAA 3KE0A 1K9EA 2CITA 4NSBA 1Q6EA 4IPLA 1NOWA 2YL6A 1PX3A 3BCFA 3EYPA 1W9BM 4V28A 3K8LA 1BAGA 3OGRA 3DX0A 2VI0A 1VAHA 2CNCA 5A95A 3VDBA 5FL0A 2J62A 3W4RA 3BVUA 1UH2A 3ZSTA 1XD1A 2VO5A 4ZXLA 3NSMA 1UR8A 4GI8A 3W38A 2IXUA 3FAXA 3FAWA 1TE1A 4MJ2A 4MPKA 1E56A 5HDRA 1UH4A 1HJSA 3SCTA 4H7VA 3K1DA 3E1F1 4HU0A 2CBVA 3DC0A 1JF5A 4X0VA 5HPOA 3SUWA 5FCZA 3IAPA 1BGAA 2GJXA 4Z2GA 4HOZA 3AXXA 2EABA 5E70A 1E72M 5JBFA 1BFNA 5CGMA 1BTCA 1LWJA 2C0HA 4EKJA 4OOZA 3MV11 2VNCA 5E1QA 1SFSA 3W81A 5ABFB 1HF6A 2DH3A 3AYSA 3H53A 4FLSA 1MVYA 1UR1A 5EFDA 3U57A 3BVXA 1GHRA 3PTQA 3ARWA 1JNEA 4U31A 4ZE5A 1E70M 5HBFA 2V5CA 5D9MA 2WANA 2XUCA 4HOWA
chains in the Genus database with same CATH superfamily
1EGZA 4WI0A 3G6LA 1OEPA 4OIAA 3GU2A 1O9ZA 1SDDB 5C0BE 5CBJA 2XZ9A 1EBHA 4X0KA 2GVYA 4E9VA 1LTXA 1F86A 4PJGF 1E7UA 1MHEA 1J1PL 4JFUA 1V6UA 4F0SA 2EE6A 4E8GA 3KXFA 4J39A 3US9A 4YYFA 1NINA 5FXCH 4LRNL 4WRLA 5I79A 3II1A 1K4GA 1ETZA 3ULUE 1J12A 3SPIA 1DQWA 4LW7A 4WTWA 3BP7B 1BM3L 1O60A 4WIQA 3RU6A 2Q86A 3QG7L 2DQFB 1KBJA 3MCG1 4ZTXA 2DBLH 1I0DA 5E1AB 5F8QC 3I7SA 4DKFL 3QLLA 4RR4A 1C91A 2G0KA 4MMXA 5E5LA 3T4AB 3T6ZA 8A3HA 3FT4A 4PWGA 4Z7UA 3MMEB 3QRGH 3U30C 4FNLH 2CWRA 4I77H 1NGQH 5JHDB 4IBTA 5E93A 3ZM8A 3LNIA 1DP0A 3SJ3A 2YFOA 4P2QD 4E9RA 5HUPA 1G6VK 1OK4A 1DSFL 1NCWL 1YHPA 4KKQA 3GVRA 4AVKA 5DS8B 5E9DE 4B5TA 2OYLA 2BNRB 3RWEB 4M5SA 3TOPA 4I85A 2WGXA 1LHZA 1FIEA 1VCAA 1HXKA 1R86A 4N4PA 4PA8A 2W65B 3LKOA 4K8RL 3HQNA 3N14A 3GTNA 3GIPA 4HU3A 4DT2A 2O93L 1SZNA 1BX2B 3NK3A 4RGNB 3QHOA 1C93A 4JO1H 3WELA 2CLZB 2X2HA 4YX2L 4XCYB 3CV2A 1S38A 1UD2A 4P59H 1JZ5A 5BOJA 2PPFA 1CR9H 2AEWA 3SKUD 1GHFH 2EJ1A 1DQKA 5FGCE 5EF0A 2J8TA 4P5MA 2JKJA 1BZ9B 3ZDYB 5AY7A 2H1PH 1GVQA 4WDXA 1VFMA 3VNJA 3US1A 4OCYL 1JJKA 1CFQA 3MACH 2EDYA 2AJSL 4HALA 2YD5A 1GY2A 1KBWA 1YEEL 2F84A 2DQWA 3H23A 4XZMX 4L4VD 3H12A 2LHAA 3T3PF 1H0GA 4JZJB 1CZ8H 4XMWA 3LSOB 2CIIB 1CL7L 3KTXA 4KDTC 4X9BA 3LJ3A 5H8PA 4GJ1A 1UUMA 5ECVA 5IMMA 3F8UB 1OX6A 1OAXL 4HH9B 1MIML 1OIOA 4FFVD 4C7FA 5A8NA 4LEXL 1YNTA 5DEZA 5FB8A 2K3TA 1DZBA 2EPOA 5C8BB 3IRPX 2FO8A 3F83A 2ZDRA 1LMIA 2E0PA 3UWVA 4W9ZA 3KYOB 1AQ0A 4P3DB 3NO1A 4LO9A 4ZMTA 4JPGA 3HZMA 4B50A 5GZOA 2Z8RA 4MLRA 4JO4H 4GBUA 3UIZA 2V5BA 4XN1A 3LBCA 3T6WA 4A3UA 5BRZE 1UB6A 4Y4HD 1VFHA 3FTVA 1J0YA 1CMOA 1RBLA 1NWSA 1LJMA 5I1JH 2F18A 2J6XA 2BVYA 3HR5A 1UD3A 2MQ0A 1ZAHA 3QO1B 5JNYA 5HNRA 3AQDA 2WUCH 3SGZA 5AYIA 1ROCA 2UY7A 4Y2OA 1ZT1A 1EDYA 3MRKA 1BYAA 4JFEE 1NCBL 1E6NA 5H8MA 5J6SA 1IBDA 3TVMD 5E5UB 3QPZA 2ONEA 3VWJB 3DKLA 5EIIB 5KOVC 4NO5A 2N7BA 4WTZG 3LQAC 3VXOB 2ZICA 1WAAF 3ZYIA 3B7UX 4XX1G 4L1XA 1QI3A 4V1XA 1OK0A 2J75A 4XUYA 1WH0A 2NY5H 3CZKA 5KUMA 1MCIA 3UOAB 3WF2A 4TRPL 1UUQA 3DYPA 2ZE3A 4WI5A 1BZ7A 3ZE0F 3OVPA 3PWPD 1YDPA 4OJDH 1GSKA 3ALWA 3MRNB 5BVPL 2Q7YB 5AKVA 4YJ5A 1LO0L 1HZKA 3QOKA 2G96A 5EMJA 3TO4D 5KJ4A 4P2OB 1KGCE 1BVNT 3P3SA 3MBFA 2X0WA 1G9NL 5KYYA 2YC1A 1XIMA 3ARSA 3KMDA 3MLVL 3PPGA 4OT1L 1EGJL 2VRKA 3IPEA 5KJRL 5L4JA 1G01A 4C58B 4ES4A 4IIQC 1PF3A 2AZUA 4UTLA 4OY9A 1KRMA 2HPMA 4RDZA 3GMMB 3GT6A 2VLLA 5DD5L 1IM3B 4I1NB 1OF8A 1HQRA 4N8PA 4PRIE 4PJHF 1KXVA 1MZRA 2WLYA 1XH3A 4I48B 1PZ2A 4LEOA 3CFDB 1BXBA 2QVTA 4OF3A 2OMYA 3TJEL 1V03A 3AAZB 4ZO9A 3ZWTA 1JF1A 1UR9A 4GZ7A 1Q90A 2QR0A 4NM4H 3UBGA 3MCMA 2JFCA 1XSKA 4HJUA 4OD1L 4WY7H 1WQ5A 1UWGH 4MCZA 1ET8A 3BQ5A 2VJ0A 1DEDA 2COVD 4HWEH 1KMGA 4PJAF 2HFTA 3HFMH 5IB1A 2IDQA 2DJSA 2DQXA 3EYQD 2J43A 1TJHH 3TEVA 4MJ4A 4C6EA 3RX3A 3CFBA 1VHCA 1NBZA 1H8OA 4FF5A 3SAZA 3TASA 1K3ZA 1IAOA 2V0TA 4Z7VE 4LP5A 1UASA 1JVNA 3I6SA 3IMRA 3WIIH 4E5XA 1S7UB 3SKNB 3L3OC 5HHME 1SJAA 5HGHA 5EUOE 4F2FA 1HHIB 1M42A 3ZE1B 3ZKXB 2OV0A 4HYRA 4UTTC 4XSLA 3H3PH 3JUYA 2WHMA 4RVBA 3MBWB 1IAIH 3WTVA 4RZ5A 1HNFA 1TEFA 2PXYA 5G4NA 5EZIL 1Z1WA 4QRFA 2HA1A 4XNBA 3E2VA 1UWYA 2V67A 4RUBA 5FEPA 1M9WA 4N26A 4K8GA 5IFAH 1M3UA 3NFPB 3DX7B 3HUJA 3CB3A 3UWEA 1KNWA 1V27A 3QSRA 5JHBA 3TBWA 4M1DL 1H5BB 1XH1A 2QPDB 4LCIH 1N2RB 4E41A 2VN3A 4ZQRA 4P3CL 2QVKA 4JTEA 4M93C 4O15A 5EU4B 4FXKA 4J3OF 1KRCC 2QMKA 2YKLH 1H8SA 2FB4L 4GQ9L 3LZQA 1V51A 4RX4D 3FT9A 2NY7H 2AXGB 1BLIA 3S7GA 3MREB 1H7OA 3R8HA 2APTA 1KYOK 1R30A 4P4RA 3OQ8A 3UDWC 1S7VB 3C60B 3EG9B 5ENWA 6PAZA 3O6CA 5D6CA 5MEPA 4Z3IA 1YEIH 2EZ0C 4CD8A 2XWXA 3QCUL 1HHGB 5IQNA 1GEQA 4RAVA 1MFDL 5EU5B 1Q6QA 5C0GA 5JORB 2I5GA 1WV7T 4LPTA 1QMLA 4U1GB 4WI4A 2E7LC 1KFLA 1G7LB 4BK4A 2JQAA 5T5FH 4Z7WE 4GSDL 3LV6A 5D4HA 4FADA 4AVJA 1S2VA 2V2HA 3DV6A 1UJQA 3MZ2A 5JXEA 3E0IA 2NW2A 2FATL 3STPA 1BFVL 5E6SB 5KOMC 4YFDB 1UFUA 1YC7A 2DQUH 3F4VA 3MZNA 3WKMH 3KPSE 2NQ5A 12E8H 5AHLA 2IV9A 4WEMB 1VSCA 3I7QA 5ABAA 1YMME 5F2IA 1MFEH 2EH7H 3G04A 4JO5A 3CV1A 3DX5A 1JK8B 2VXTH 4PRWA 3WY1A 5LGJA 1BD2A 4XO3A 4DJED 1OC7A 4PJFA 3CH8A 1Q9KB 2PA6A 3TW6A 4KV5F 2M83A 3P0YH 3V5DA 1NGPL 1AJ2A 5C07A 1FZKB 2D24A 5IOPB 4N9CA 2UZIL 2AVGA 1WBJA 3GXDA 4HZLA 1AKJB 2VM8A 1E4XI 1C12A 5T5FA 5CN1A 4YL2A 3CVIL 1YXYA 2EDLA 1DZ0A 2IQ9H 2ZX9A 4K5NA 4MWAB 4I9WD 4A35A 5KYXB 4AD4A 4ZD3L 2YLLA 1L2QA 4UWQB 1NFDB 4IIEA 1NMBL 5TGBB 5KS9E 3AIUA 3O11B 2DEXX 4RMUA 1FA4A 4WI8A 3R8QA 2B20A 2YQ2A 5L6YH 3LKRB 5JMRA 5IB3A 3AUOA 5FYJU 2QTEA 3IDJB 4FMVA 4YHZL 4APQD 4JRWA 3BQUC 1I1RA 5DMLA 3QHTC 1E6QM 3MWCA 5IVOA 4LUJA 2AP2A 1I1AA 2VDOH 1AJZA 1EWEA 2GOUA 1FVCB 4MNJA 4FP8H 4DIXA 5JDSB 1TMLA 4OV6F 2VDNB 2Z31B 2YK1H 1EBGA 1IU1A 3T0DA 4XNYL 5BZWB 1T22B 4A3QA 2J79A 1NPJA 1YXCA 1IGCL 1Q13A 1G1YA 1MHCA 3Q2CA 1XLFA 4PSPA 4IBQA 5DY2A 2P53A 3WQ6A 5CZ0A 4MA7H 2AL2B 3HE7A 3LVTA 2CZVA 3X1EA 1QSED 5RUBA 4ZSOA 4Z3JA 3VMPA 3W9DA 3JWOL 5TDNA 2J88H 2DQEH 4WO4A 4ALAC 1UD8A 4HF5H 4FXSA 1KYOJ 3V7PA 4Q9CA 1AIFA 1RJCA 1W0WB 5DJCA 3FOLB 1B1YA 5REQA 4H41A 5DCBA 4NJJA 2WY3B 4KXBA 2VCCA 1HDMB 4QCIB 2C9SA 1GVYA 5SWUA 5EOTA 2D2JA 4BQBA 3LXCA 4KTEL 4MAYA 4FXGA 1QHPA 4B90A 4JRXA 2ZNXA 2J2ZA 1MRQA 1OINA 2HPTA 2AANA 3KGUA 2EQDA 1GPOL 5SWZB 5ICUA 3CC1A 4XVJL 1AHWC 4JIPA 3NO5A 1OB1B 2GTZB 2AGJL 3GSVA 1C8QA 2OR9H 2ZKMX 5JXQA 2M2DA 1YNLH 2OMZA 3X3GH 1W72B 1BJ1J 1ZLSH 3W76A 3E8UL 4EF3A 3QQDA 5HHQB 2Z2AA 4WWID 3BCJA 3IETA 3GZOA 3P0GB 5CJBA 1VYSX 4LVAA 4OLXH 4NHUB 2J88A 3WIHA 4BY3A 5JW4Q 3CQJA 3PF3A 1JNNL 4UTCA 1UVQB 3VXQB 2MCMA 5F7WC 3EOAA 2DT0A 4MKNA 4XB8A 1RZGA 3VFTA 5E6ID 1WV2A 2JKXA 3L3KB 1QQDB 1OM3H 3QDAA 4CEUC 4NQXA 3LSBA 3DRQB 4LVFA 4QHMB 1Z5LB 1KN4L 3CAWA 4P5TD 4XK2A 1P7TA 4AZ5A 2DBJA 1K7EA 4ZW6A 4F0HA 3V0VB 1JVLA 5F3BB 3RRAA 3V5OA 2VLRD 4LANA 3S6CA 4ELMB 3V8CA 1DO5A 2VUNA 2AJVL 2YPLE 4YE0A 2J74A 2ZUQC 1PG7H 4LQFL 2MOGA 4TTUA 2OMBA 1AVAA 1IEAB 2V9QA 3HBZA 4E0RA 2QAPA 1AGDB 4QE1A 3S2LA 3MUJA 3EB2A 3FU5A 2OFJA 3FRUA 1A9EA 2CG9X 1I85C 5I1HH 4MDPA 1NGZA 1IL1B 5I1IH 3EFFA 5GQBA 4OCWL 3OKYA 1Z8AA 2OTDA 2ZP0T 1XYFA 4KTYA 5CR1A 3UPAA 4IXXA 3GNPA 1NGYA 3L1FA 4KDWA 3BSZL 5C08A 1N67A 2OOFA 3BG9A 1IXQA 2HSAA 3DKHA 4M7LH 4MNQE 1FO0H 5IY5B 3VGBA 1OT2A 4ODTL 4YVPA 3I9AA 3ZT7A 3OTRA 1HE7A 5DD1H 4S1DC 3CV6A 5DFVD 4MQ7B 1OM0A 2ZCKH 5DHXB 1MI3A 1BYCA 4IBLT 1URLA 4MHHG 4OZFB 5C2BH 5LDSA 1NKOA 4XKMA 3ZTNH 3U36A 1OP5H 2DLTA 4M29A 2OX1A 1NCCL 1SF3A 3R1GH 2F2HA 2P1YA 2ZA3A 3BAWA 4URTB 4AD1A 3IEBA 3TO2A 3VNYA 3P4NB 4H8UA 4ATDA 4JQIL 1LWRA 4GVGA 4MLIA 4ELKB 5J06A 3VD2A 1N64H 5ADPL 2R8SL 3D08A 3JZ7A 1I7UA 4PJDE 4MKSA 4PV1C 1JCXA 2OWXA 3KBNA 5EBGA 4ZXOA 5CILL 3F5WA 5I1GL 2HJFA 4HGWB 4L61A 5I1LA 3NOYA 2YDRA 3QTGA 4OQVA 3IGUA 4W9EC 2X4QB 3OMIB 3WY2A 4WCYH 2WSYA 3HHSA 4JL1A 4UM9B 4LASL 1CZ1A 2VERN 3ARDA 1XICA 1OCZB 1FO0A 4P99A 3VFNA 4HSNA 1AW1A 5HYSB 3WNJA 3T6XA 2OX5A 7REQA 1NDTA 5IKCB 3MROA 4FNSA 5DCDA 2EZ0D 4D0DB 1ZP4A 3CH1B 3T0EA 4GY7A 5BUGA 3C5ZC 5D96B 3AYTA 3MWAA 3NGBB 2R1WA 2DIJA 3ZOAA 4QTIL 3UZWA 4AV4A 1T7ZA 4NQEB 4AY0A 5DMNA 4N42A 4YFLI 4L23A 3TYGL 1EJUC 4ZAKB 3UR7A 4XCFL 4WNQA 4HIEB 1M2VA 4OCNC 1NELA 1QI0A 3T2NL 2D7TL 4R7VA 3O15A 3DRTA 3W7HA 2FQIA 2V4LA 5D2NB 5IZ7A 1GTEA 2VXUL 4RH4A 3DHJA 5CAYB 5ID1B 3BFWA 2NY0B 3PGCB 4GAJL 4TSAH 2A7PA 3KTSA 3U2EA 2E9BA 3WFLA 2FHBA 3EX3A 5FAJA 1FWEC 1G5AA 1RY7B 3C8KA 4INFA 4HUWB 3V6FA 2PGWA 3NQEA 3TDFA 1TQJA 4DBEA 4PS3A 3O3AA 4E3TA 5DGQA 5A2IH 3A9BA 1XQLA 1UQSA 1EHKB 2QQNH 2E77A 2WZEA 1PPIA 3W57A 4XGZB 3GMLB 5TFSL 1KYAA 2AERT 1KLYA 2F15A 3FO9B 4DEFA 2PRMA 1HCZA 3UR5A 3FO0H 2Y89A 1NAMH 3MUGA 4GW5B 4JZNA 3RM8A 2D3NA 5SV3A 5BXFA 4F7TA 3NG3A 4RCXA 3S3JA 3DFPA 1T4KB 1W9BM 1TWZA 3FSUA 3M0IA 3FUNA 2IPWA 1UR8A 3GO2A 4Z6AT 3HV8A 1FL5B 4PY7A 3OZ9L 2BSLA 3TEXA 3FTZA 5HDRA 2BCKA 4PTTB 1VR6A 4B9PA 2L5HA 4I0PB 3PWLA 3UTSB 4IDJL 4LVBA 2X6CA 3GJEB 3KNBA 4HUNB 4A6YB 3DN5A 3W86A 2WLIB 1ZGLA 3ELFA 4ADGA 1TVLA 4PJIB 1LE9B 5FM5O 4DGIH 4O50A 1MVYA 2BIQA 1I0BA 2VLME 3OB0H 4WWKB 1NAMA 1A9BA 2DKSA 2P5EE 3IRSA 3E2QA 1BECA 1L0YA 4MVAA 1LUCB 5I1DB 1X5MA 3UAEA 1JGVH 1I82A 1TPEA 1ITBB 5DVKA 2JLPA 1N0LB 1DJGA 1ZVSA 3IMSA 3TA3A 4R26L 1WQVT 4AJWA 3FFCD 2EDBA 2HRHA 1YY9C 4JZOB 2BOBB 3V4VH 1BQHA 4S2SA 3SQRA 3H7VA 2CM6A 2ZFAA 1I45A 4APXA 4ERSL 2OGYA 3VWKC 2CGYA 4KO6A 2QZ5A 3HNTL 2E3ZA 2NXZC 5IB5B 3PG2A 3AW5A 2ICEC 3RWCA 1XGQA 3D8MA 4MD0B 2BVOA 3QWRD 2AJYL 4TX6A 2XIIA 2ZWLT 3N43B 5BW7A 1AO7D 4PG2C 5I3GA 5CD5D 1P4BH 2XV2A 4N2LA 4AEIL 4BJLA 3JZYA 1BF5A 4FNPA 5TE6H 3QDGD 4PJXE 4RW3A 3G5EA 1XIJA 1KC5H 4P8XA 1IO4C 4M00A 4B2DA 3TV8A 2PP0A 2YKKA 3IN0A 4ZFGH 1PFOA 4OFDA 3RCNA 1TREA 3V4VA 5EOQH 4UTBL 1TQBB 2J1XA 1AZUA 1RP8A 2WTRB 3DARA 4K37A 3UYCA 4MD4A 4YLBA 4LPVA 1GZHA 4HLZG 1UCBH 5IB4A 4D9QE 3VKBA 3E5BA 4GNVA 1A5KC 2A7BA 2ITDA 3T0XA 4HYVA 1A25A 3SY8A 1DVJA 3I65A 2Y85A 1BGXL 4HGMA 4OLZH 4TV3A 4Q9BA 4KTGA 4F7EA 3AQZA 4NVTA 3O9WA 4R5VA 4F3FB 1G7QB 1U21A 1HL8A 1Q6OA 3K71A 3L3HA 5I1AA 3BRDA 5E6ZA 4ZS7H 5BQDA 2BP1A 5I6PA 1GVFA 3D2UA 3HI5L 3VKCA 2H2SC 4M7JH 2AK4B 1QEXA 1P1MA 4FFYL 3U46A 2ZX7A 3BPLC 3DURB 4AGQA 4IICA 4FR6A 1JPGB 3WH6A 5C3TA 1DBAL 1MVUB 1K8IB 2F5AH 1B3WA 1QSVA 1U2CA 4WW2B 3MYJA 1REIA 2RIKA 5HK4A 4LXFA 3LH2H 3S88H 2A77H 1J8HA 1N0XL 3AQUA 4LBAA 4Y5VB 4LZKA 4H1LH 1KGIA 3CUGA 1XBRA 3MV9E 3QIUC 3H9SA 4GXPA 4Z1BA 1K9DA 1NL0H 3KPRA 5GZND 2X8RA 4NIKB 5AYBA 4G8GE 3PABB 1YEKH 3S8GB 5GS0L 4NO0B 1TZZA 3EDKA 5ERWB 3SE9H 2WNNA 1UURA 2P8CA 3OLDA 3APYA 3LCLA 3O6FA 2ODIA 1U8NA 3SIKA 3QV9A 1FGVL 4ONGH 2FT7A 2V33A 4FQCH 1Q4NX 2ZZUT 1M3JA 5DA4A 3VB9A 3EGDA 4CQDA 4HHWA 3RBGA 4PJ9B 4XC1H 3QZNA 4OLWL 2QQKL 3T65A 4WDTA 4XOCA 3BSHA 4DOHB 1CE6A 1RZFL 2WYSA 1E71M 3LS5H 2WIIA 3B9KB 1Z6KA 3G0UA 3OAYK 1OARH 2CMRL 3BEVB 4H1LA 3TF7C 5DVPA 1KBLA 3BT2H 4DWHA 2O55A 5D9SA 3MLSL 4HIQA 4BHUA 3PJLA 4QI3A 4O4VA 3PF2A 1E6JL 2C4XA 5L9DH 2XWTA 4LTSA 5ISZD 4DERA 4JFPB 4XCEA 2PO6A 4KTDL 2J1KA 1JR1A 2EPMX 1CLXA 3RY4A 4TLKA 2HH0L 4XPBL 3NA9L 3E7JA 5ITBH 2J7EA 3MYZA 5DK2A 2Z1KA 3DJZA 2XGIA 5KVFH 2IPTL 2VDLL 2PW1A 4FQLH 4JHOA 3LCHA 1EERB 2XH7A 5C0BA 4HGXA 3XIMA 4QEEA 3IGXA 4CMHB 1D3GA 5C55A 3BWUC 4C56B 2HUEA 3L3DB 3ABKB 4CQAA 2DWYA 3MRBA 1NVMA 3K6SA 1AMYA 3WFHA 4FABH 1DLHA 2VIRB 3L2IA 5J5EA 3NJ3A 1DJIA 2A74C 2QVNA 3VC5A 1NOLA 2IAND 3NFNA 1TPB1 4FYSA 4AH7A 3OX8A 3QEQB 3DH7A 3E49A 3N4FA 3CXDL 4YXLH 4LKXB 5I8EA 3JV4B 5ICYB 4XH2A 2X1QA 3FSOA 1TEYA 4ELMF 3BLPX 4UTJA 2CLOA 3LIZA 2WWKO 1UCWA 4Q4PA 2NY3D 3HS0C 1FWTA 5C0CD 3L7FA 4HAGA 2O26U 4IQEA 4U6TA 1P1XA 4E9XA 4RXGA 4IKNA 4KWVA 1LP9F 1Y6KR 1X7QB 3WH9A 4PP1C 1HJQA 3DMMB 5GNZA 3CD4A 1VCFA 4GYJA 4P5UA 2BPBA 1INDH 3EWBX 3VA6A 4IHCA 2ZYRA 4Y1SA 4RNIA 2FL5B 5E9DA 1R34A 4FULA 2R14A 3E2HC 2XNAA 4K7PH 4WI2A 3UEZA 3KRUA 2GEEA 1ZK9A 4L1LA 3QUYA 1JZ7A 4ISVB 3D9AH 2EUXA 3HG1B 5IBUG 3RUGB 2HISA 5F8RC 4MX7A 2BVTA 4HJ1A 4KRMB 4L6OA 4U1IA 4O02L 4NKMB 3DFYA 2JKWA 3WDRA 4JY9A 2IPKB 1Q8MA 1MI5B 3FUJA 1L5GA 3FB7A 1P4LB 2KLSA 4FHAA 5LXGL 3KYKL 4JG1L 4JN2A 3U6RA 2ZADA 3FONB 5JQIB 4N6EA 1GCFA 2LLLA 1P0KA 5F1OB 3BE1H 1ZHBB 1H41A 3VI3E 3KPMA 1E0OB 1YY9D 2O7QA 2L8AA 4K9JA 2OJ1A 3P4OB 4RISH 2WBJB 4IRSD 5D1ZB 4NP9A 3G6DL 4AQEA 3RFRA 2CLVA 3L95B 4OGXH 4UIMB 1HQTA 2NTFB 3VWKD 5DS2A 3BI9X 1JZHA 2VC7A 3QY6A 3BPNC 4ZRGA 2NXZD 3QJFA 5KYUA 1Z9SA 2IMMA 1W1A1 2I16A 3P54A 4Q6IB 4PZVA 2L7UA 4JM2B 4F9LC 2P7TA 2R7EB 1TTGA 1X6UA 4DI8A 1R24B 3NQVA 5INCA 4L0YA 1LQSR 5F7MC 2ZCGA 3RGVA 5BRZA 3FA4A 4GAYB 4P9HH 3WHE0 1JCMP 4BCEA 1XMWA 3GS4A 3CFNA 4X8CA 1KIUA 4ZZ9A 2PYEE 3S34H 1YDOA 2Q8ZA 4MYPA 4M6QA 4R88A 5AKQA 2BK8A 4ADUA 4XN2A 2HWGA 1K5WA 4D6CA 1RL1A 3BZFB 2PDGA 3EOSA 2DS4A 5A7BA 3WJYA 4MNLA 4HSCX 4JFEA 1UOLA 3AT8A 4GFSA 5HAOA 1AYOA 3WN5A 3KBMA 4G5DA 3SY0A 3NZ8A 3L45A 2VSMB 3LNEA 3ITOA 3V16A 1P6WA 6ALDA 3L08A 3MUZ1 4NC1E 3HMJG 2OP4L 2I07A 4LHQB 4GW1B 2R23B 2F8QA 2GJRA 1RXLA 4OTXL 3OHXC 4QWWC 1JL8A 1WAUA 1AKPA 3U0TB 2ZSWA 1S7XA 3K81A 1ZTVA 4DP7X 3IMWA 4LYQA 1HKIA 2J7HA 4KY1H 1SXCA 4MB4A 2HE8A 2ZUYA 5ESQA 2NW0A 1R38A 1BXUA 3UZVA 4P57A 1K2DA 3IS4A 3IJ8A 5EMLA 4PRPB 2Q1EA 5E94A 5J9PB 3ESNA 1IAKB 1DN0A 4PCNA 2QUTA 2B1HH 4X9SA 4PGEA 1IQWH 2YFNA 3K80A 1F97A 2XPGB 4P5KA 2PCPB 1CLYL 1KRBC 3BO8A 4UM8B 3PZIA 3FTGB 2XTKA 1ORSB 2ADYA 2Z91A 4FZEL 4N86A 3DUHA 4IJCA 1KJVA 4Y9GA 4BZ1L 3RMJA 3KHJA 2BRRL 4CKQA 2ROXA 3B2DC 1F0LA 4PRIA 2V2TA 3FPYA 5GISL 4XP6L 1MXDA 1ZLVH 3PNWB 2KDYA 3GSMA 3RDTB 3FUIA 4W9JC 4TSCH 4G1MB 1MQKH 3LS4H 1WISA 3HE6C 4KQ3H 2FX9H 1VS1A 3QUZD 2FTWA 5FA4B 3UP8A 1AI1L 4Y9FA 1FDLH 5ESAB 2ZTKA 5HMEA 3EBHA 1O7DE 4PJIF 4YN5A 3G1RA 4C47A 3LGDA 2NYKA 1IFHL 5DA0B 1WP6A 5FUCC 4GOSA 3ARBC 2EDDA 4ZUSA 3CV7A 5FSEC 2ENYA 4QRSB 1JAKA 2EXSA 3N11A 2ADGB 2PS2A 1UH3A 3H85A 2AJ3B 4H44C 4W93A 4GMTL 4R5XA 3QJVB 3SOBL 2ADIB 2WXKA 1IZCA 1F5ZA 4HQQL 1UB6B 2H32A 3FSZA 1OGAB 4FOUA 4Z7VA 3FQWA 1HHHA 3ZXWA 1A4LA 1VENA 4ZE4A 5CLZA 2G4EA 4FPSA 5EUOA 1AIZA 1A1MB 3FT3A 1FNAA 3WLIA 1NCOA 4O53A 1U3HA 5J6GA 3LLXA 4JX0A 2QUNA 1F13A 3EIFA 3PJNA 1RCOB 1S3KH 1ZHKA 1P53A 3ULVD 4QBXA 3HAEG 3IKKA 4HKBA 3G08B 4K38A 3A6OA 1Q0YL 4IP7A 1TYJA 1GYWA 3DK0A 3DX1A 4JDYA 5B21A 1JPSH 4Q7NA 2XKNA 3SDCB 3TT1L 3DSFH 1RUSA 3UAJC 2CIPA 3C6LB 4ORGB 5DJ8A 4WKZA 1BZ8A 1YZZA 2WLHA 3G1SA 3VZXA 2Q6ZA 3WMPA 5J11B 4EIGB 2PR4H 3SZKC 4DVBA 3JVGA 3W3BA 2JIXB 3RCMA 1K3IA 4KT2A 4M24A 3RVVD 4TVDA 4QF1B 2ALDA 5FL1A 5EBMA 1IYXA 3IGSA 3MV8D 1WS7A 4CVXA 1FHGA 1ULVA 1E15A 4QQ3A 2LAAA 1X5JA 2VRJA 3OOQA 3FYEB 3A24A 1ESWA 5I6XC 2VC2L 2Y7QA 4EF9A 2IAAC 3P2BA 1WIUA 2Y7NA 4ABUA 2O6DA 4DCQA 3LKNA 3MTRA 4WY0F 2YC1B 5JYLA 4JFZL 2Q3XA 5KVFE 3ZJ7A 3UGRA 3NPSB 2CR3A 3P0VH 4HXAH 1PZCA 4GI9A 4Y1AE 3L7RA 4JMNA 3S5NA 4IMKA 4WSGA 3ZL1A 2VXVL 4XIMA 1S2UA 3FRPG 4PV9A 4H26B 1FCBA 3LD5A 3D18B 5K59E 2BSED 3RM9A 4PP1D 4WJXA 4KMTH 4ODXB 3G6AA 2YEZB 4NNYB 3DPDA 3BD5A 2LGNA 4QAIA 5CLTA 4Z7WA 3QUXA 3LHPH 3JQOB 4LAQL 3OJDA 1FHDA 3Q5TA 3RTQC 2FECI 1E4NA 4WW2F 1NUGA 1PKYA 3JV6B 1AH3A 5DQJB 1ED3B 1W1PA 2J1YA 3IB4A 3R0UA 4LVNB 1YEDB 2GJZA 4X2PA 3SCMD 1XRFA 1LLZA 2XC8A 2OJZH 4Y89A 3KPSA 5D5ME 2VCAA 3IYLW 3MGTB 5GJTL 4LKCB 3LHTA 4HETA 4I7ZC 1YMMA 3L48A 1PYWB 1LEIA 1XEUA 3F7YB 1CENA 4GI6A 1GQIA 1L6GA 4E5XB 3IWPA 2AABL 2ERJC 3B3BA 2D4FA 4F0LA 5ICXB 5MKGA 3DU0A 3O3EA 1JGLL 4WUUD 4KEVA 2H8PA 5JIHA 2D2CC 4YHIA 3WLPA 1J1PH 1HCVA 5FKPB 3SCVA 4ERIA 4LRNH 1IWAA 2X44D 2DMHA 3LNMA 4JKMA 4OSUH 1J5OL 3TFXA 1ORQA 5LCVL 3VPLA 4WF7A 5I9QB 3HUJB 3ROLB 3MNWA 2NV1A 4V1YA 2F7IA 5KS9A 4GWEA 4ROPA 3H8NA 5HI5C 4E9LA 4FLRA 3QG7H 3OF6A 1N6VA 1OK6A 3AZSA 1Q85A 5A6KA 2RD0A 3FULA 2V6AA 4WHCA 4DKFH 3FTWA 4LS0A 4DESA 2QTVA 4JFDD 1OALA 3O2DH 4F57H 4PJ5E 1RCYA 4PJ7E 3EX4A 4I8YA 4XBMA 4E9YA 4GE8A 2YQBA 1NM9A 1TQVA 3UCCA 2OMXA 1F8IA 3ATEA 2QLVB 3CXFA 1RZJL 1W5MA 5IEKA 3WN6A 2BXVA 3VNZA 5D7EA 5DJXA 1QSFE 2DZSA 5CD3B 3QIBB 1NCWH 1UA6L 2E1DA 5AVRB 4M4PA 5DLML 5IBTH 3UJIL 2A38A 1M71A 3MANA 3GXFA 5DVLA 5D6CB 4LCRA 4K8RH 2WXDM 1A4CA 4F2MB 4GGHA 4R96B 2XI9A 3IDGA 2J44A 1RK6A 3SBPA 4GFTB 3ETBF 3E1ZA 1EEUA 4F2TA 5FYKE 4O28A 2P47B 3OKNB 5LA0A 4YX2H 5DHYB 5FHAL 4YH6A 4Y8AA 1GKRA 3UC0L 5BOFA 3O2DA 1JNHA 2XBZA 2NZ9C 4QTHA 1URIA 4HEPG 4NRSA 3QEHB 3CDGA 4OCYH 2VITB 4RGMB 1MZYA 1NUFA 1UZ6E 3PDOA 4EN3B 3VOGA 3EGSA 4NQDD 2IGFL 1A0DA 4V28A 3AG3B 3IFOA 2VI0A 5EU9A 5FL0A 1CL7H 1ZS8A 1IBYA 3VRJA 2ADJA 3D3VB 3A9IA 4ZXLA 3PV6B 5IR1A 3RLHA 1OAXH 4GG8A 2C14A 4JREB 2N59A 4K5OA 4LRTA 4LEXH 5CHNA 4H7VA 3NNTA 2CBVA 5DSCB 3GLZA 1F74A 3R0KA 3SUWA 1B0WA 3GTFA 3SGJA 4Z2GA 5DRNB 5IMOA 4G7SB 2MUCA 4Y7OC 5CGMA 1NOAA 1LWJA 2VNCA 3G3LA 1NUNB 3FF8A 1C12B 4HIIB 4F37K 1ANUA 1TTCA 2ATMA 1Z0NA 5IM51 2A4AA 3RUGF 5KVGL 2Y5JA 4ODUB 3GLEA 2EJAA 3Q8CA 3C3UA 1IEXA 4WEVX 5IB3B 4KWSA 4MB5A 5ABTA 3ARBD 4F58L 4KFMA 2EIZB 2WNQA 1XYBA 3AQXA 1NCBH 2YPLA 1XLCA 2NTSP 3SODB 3L66A 4N8CH 3I6LE 4F1SA 1RLCL 2FZBA 3N06B 4U1SA 1XLLA 2HB0A 1Q9LB 1TR9A 1MCRA 3CK5A 4QS6A 4JLRB 3LGEA 3U79A 2FIQA 3ATBA 4RZBA 3H70A 2F7FA 2F2KA 4NUQA 2VH5L 4DWSA 2J13A 3L3GB 3WNLA 2PLMA 1JV2A 3H56A 4LT9A 4P2RE 1KQZA 2XYBA 2VM3A 4BQ4A 5BVPH 3HMWL 2QUUA 4NQCE 4MNQA 2X9WA 3T77B 5KZDA 5HXMA 3AG1B 5D9PA 8FABA 4NQ1A 4U6VH 3RYSA 4WGXA 4AQAB 1KPVB 1KFGA 5FO8A 1BLNB 4LLYA 1MRCL 5F7LB 2MQCA 4OZ4A 1AIFB 3UD6A 2PBOA 5IHHA 3MLVH 4OT1H 3HKFA 2VMJA 5KJRH 4AUUA 3QEGL 1NFIA 4PW3A 3EJTA 3N29A 5DD5H 3H21A 2X2YA 3UEQA 5I2UA 3MOBL 5GGSY 1RR2A 5CAHA 3ZZLA 4PJDA 2J2ZB 3H7UA 4TVPE 3HM7A 1TVHA 4IU3A 4AW7A 5HDBE 3SKMA 4RDWA 4LC8A 1MCWW 4ZBJA 5I76A 1K77A 1UC4A 5D72L 3N6QA 1YUHB 4DNHA 4W7VA 2Z7YA 5E8EA 5BWFA 2HT2C 1LO4H 2VN6A 3FFDB 4Y4KC 3HQOA 1DEEB 5JIQA 2XXCB 1UD4A 1YUKB 1QNQA 3QH3A 1L8PA 3OG2A 4KH2A 2V3FA 2R59A 2XZQL 3PJSA 3ZPDA 1S5NA 3CN4A 4C8XA 4I90A 3BKYL 4EN2A 1G1CA 1UM5L 3QUKA 1FWGC 3T7VA 5DJ0A 3I2CL 2NXHA 4MF4A 4TNGA 3GH5A 3F03K 1JFQL 5F9JB 1HFBA 4AJYV 4EAEA 4BE6A 4XPGL 2BW5A 4L5ZA 3RTLA 3CVCA 4HHHA 2FLIA 5E5RB 4JGUA 3DENA 4F15B 4P4KB 4HK6A 3SJVB 5F71A 1WT5A 4NQVA 4LLDA 3MV7E 4X4XB 1Q5MA 3M4HA 1UJ3A 1NFAA 1DQXA 3SCRA 4O10A 2PC8A 5E8OB 1NDVA 4L6DA 1CDBA 3TCTA 4OGZA 4S3GA 5DHMC 5BRQA 3HW7A 5EEUA 5EUKB 4YSRA 4PH8A 4QTGA 5IV2B 2BY1A 1TYRA 3DFSA 4R4BB 1E28A 1DE6A 3GIVB 3W1UA 4P3CH 4PAZA 3ZKMC 3WLMA 2AKZA 1XR8B 4R2GC 4DW2H 2HX8A 2F68X 2PTWA 3PPSA 4U1HA 3VH8B 5DZVA 1FTXA 2PW2A 2X7LB 4CVZA 5TE4L 2FB4H 4GQ9H 5I78A 5D1QC 1Z32X 3NIDE 3SPVB 1QP1A 3P3UA 43C9B 3PP3K 1DQML 4FG4A 4WFFD 1CICC 4FJZA 2XN9E 5E56A 4KFZC 3FEQA 2BHFA 1X5LA 4FA6A 1EJ6A 3WS6C 4OW6A 5B39G 2GK2A 2V5YA 4NOFA 3FU7A 1XGUA 1AFVL 2A79A 3VXMB 3M44A 3PWJA 1PCWA 3U0PB 3WCYA 2YPKA 5AVVB 4QJ5B 1MFDH 5LGKA 2Y23A 1I3UA 4FA7B 1GG0A 4QRTB 3WLRA 1ZWIA 4G6JL 4GRMB 2XU9A 4TUJB 1IGYB 1VHPA 2IWFA 5IFTA 1DQJA 4BUGA 4GXMA 1W8SA 3DTUB 4ZYKB 3CZEA 4TYUA 5AW0B 4GSDH 4ZX3A 2VGLM 2FKPA 1B0GA 2P5EA 3B0YA 4QOKD 3BVJA 1T1WA 4TV6A 2OEKA 3RA7H 1NCDL 2FAUA 2GSEA 1M9HA 4C1KA 3UBXG 1KGYE 1E0WA 1UWIA 4C1NB 1SN5A 1BVKA 3B7RL 1I31A 3X14A 3GINA 9XIAA 4AVFA 3ARXA 2FATH 1BFVH 3K6DA 1CGSL 3EO9L 3U1SL 3HPJA 1SXAA 3T2QA 1CYXA 4JO3L 3AUWB 1FP9A 4AX3A 2PTYA 3S42A 5MERA 2BGSA 1M1SA 2FX7H 1HHJB 2FMOA 3DX3A 4XD4A 3NCFB 1EJOL 4J8RB 2DD8L 1XRTA 4PEEA 3WHE1 4LLUA 3H0TA 1LDCA 4DEUA 1NARA 2UZIH 1FXPA 4LFHD 4B16A 5U7SA 3KOZA 3CVIH 3ASOB 4YQXH 3H4FA 4PJXA 3FU8A 3IXAB 3TE9A 1N4XL 4ZD3H 3GE7A 3CFEA 5KWYC 3PHSA 1NMBH 2FD6H 1FCQA 2NY2B 2CO2A 2ZCLL 2NYZA 3BV4A 4JCLA 1P0NA 1OC6A 2GITA 3RZCC 1D5MB 3S1GA 1JF6A 5L8JB 5ACLA 3P9MB 4PPTA 3GIYA 1M6UA 3ILPB 3ECBB 3QIWB 2RFXA 1MEXH 5JA8B 2FJGB 3ZO0A 3EJYC 5DRXA 1NJ9B 3FJ6A 2ZCHH 1H4PA 1DTUA 4I9AA 3NPUA 4GNKB 1I9RH 2DQHL 1W8OA 3ZDYF 4UI2A 1SVDA 3UL4A 1EH9A 3CLWA 4XNYH 3FB5B 4MQTB 1IGCH 1FG2A 2CE6A 3NL3A 2BP0A 3RHWF 4Q33A 1TJXA 4PN6A 2Y8KA 2C9QA 3SSJA 2DJ4A 3V0WL 1ONEA 4GAAA 3L67A 2OQHA 4GIYA 1KBGH 2CLMA 3JWOH 4AWSA 1E2WA 5FESA 2XBTA 4HP5A 5MEQA 3TTOA 2APBA 2BNQE 1THAA 3S5ZA 4J23A 2H6PA 1OGPA 4QDWA 2I1OA 5IB2A 4JDTL 2QQLL 4LCWE 4YDNA 1PE1A 2DTML 1LLAA 1TIMA 4WIWA 4K15A 3MCNA 3NVQA 3NYKA 1XDLA 5FHBL 4I2XE 3JWDL 4N2DA 2RACA 4LY4A 1ZVSB 3GMNB 3QR1A 5FJOA 2XZCL 3B40A 1GPOH 5GGRY 4O2FB 1E2ZA 4RAHA 4YSQA 3MV9A 4O51B 1XLEA 4XVJH 1IC5L 3GU1A 4KF1A 1LO5A 4B92A 3V9CA 4S2SB 2GDVA 3LRSB 2NSQA 2VOTA 1R0MA 1NF0A 4PRRA 1EA0A 1A6WL 4APXB 4NNAA 4G8GA 4X7SL 4QXTB 1TSRA 1YEFH 3OJGA 2XPYA 2R1YA 1WKEA 1MJUL 1WWWX 2OEJA 3WOVA 2ZRUA 2H1LM 3IRCA 1MCKA 1SJEA 4L8BA 5CSBA 2BVOB 4IIBA 1GGIL 1OD0A 2AW2A 1JNNH 1GVIA 1MRFL 3DVGB 2ZX5A 3GSWA 3BMXA 3WFCL 1G7HA 3SBWC 4M6VA 3KJ4C 1EANA 3AXLA 3QWQB 5D2LE 1KN4H 2OOGA 3TCLA 1D2OA 3HN3A 1H49A 3UIYA 1W0VB 2VZTA 2CUAA 1VPOH 3GB6A 1HH9A 1OAJA 4ZG1A 2YCIX 4WI9A 2XXGA 1ISWA 2IH1B 3MI6A 2XHNA 1J11A 2UXGA 2B1OA 2AJVH 5ABHA 5CZRA 1VFFA 1PV8A 3AYVA 2NX5B 3Q7JA 1MQQA 2CYGA 3SCNA 4BCZA 3VACA 1VGAA 3S4SB 2Y1HA 2BMKA 4QRUA 3OGVA 3LEYL 3GBDA 1E1CA 4L4TB 2Q8AH 4M7ZB 1FWAC 1EO8H 3BV7A 4DIAA 2JGQA 4RL3A 4W9DC 4QRPD 5EDXA 1ZV5A 1VADA 4N6FA 3BH8B 2L7QA 3T1FA 3VA2C 1REQB 3R25A 4OCWH 1SYSB 3POCA 3H55A 2PURA 1AY1L 4JTAA 3S2JA 2ZUUA 4ZFZA 2QHAA 2CRZA 5FLUA 4ODWA 1JWSA 3N2BA 1QK0A 5ACZA 4IG2A 5LGYA 4NKDB 2ZG3A 2WXOA 4ODTH 5TDPA 3FB8A 4F79A 4MASA 4YWSA 3VSTA 5BRPA 3W83A 3N40P 5AFDA 1MEIA 2PDWA 3DX2A 1GZGA 3S0CA 4OF5A 1WFIA 1NCCH 5EMUA 5FEXA 2YGYA 4W9GC 2VUYA 5T9CE 3GNRA 4ILSA 3ZKMD 4JQIH 2FZDA 4PB3A 5ADPH 4K71B 3TA4D 3QYNA 2BGQA 4X98A 2ZRWA 3MJ8B 3D85D 4P5SA 3MRIB 5CILH 1BHGA 7PTDA 3N9KA 5I1GH 3AMDA 4GP8B 2YXXA 4HAKA 4S3AA 3IWUA 3A4JA 3B37A 5E7BA 3BQUD 2MPAL 3D33A 1Q9WA 3ZE1F 2VMCA 3QXVA 3GMPB 1CICD 4J40A 2IADB 4LASH 1TVDA 2P3ZA 4XVDA 3HLAA 1T5WA 5D7KE 2GJ6B 1WITA 4PMVA 1YPXA 5DJDA 4LSPL 4Y9CA 4Y19B 5A2AA 4U10A 2H45A 3MLXL 5HYFA 1BBDH 1F9CA 3W0WB 4LB4A 5FIPA 5LA2A 4N2OA 1GR7A 5IW3A 5CCKL 2H3DA 3SKJL 3T65B 4H9XA 3HG5A 1GWJA 5GGQH 2Q02A 4GRLA 3TYGH 1YEWA 1E1FA 1GC1C 3QULB 3F7QA 4XCFH 2PMZA 1ZT4A 3RX9A 3MI2A 1MCWM 3TN6A 2ZXQA 4CQ9A 4NPYA 2HT3C 3V7AG 3T2NH 4H5SA 2OKTA 2F7PA 1AZ2A 1WFMA 3H54A 4PBGA 5GRVL 4NDMB 3M0LA 4WGHA 1O66A 1DVFC 4HD9A 4ZQKA 5F2FA 1CVRA 4W4OA 2AAVA 2NLJA 2VXUH 3VI3A 2EEFA 1GZQB 2DIAA 3SFKA 15C8L 1YN7B 1FL6B 2PO6B 1EP1A 4LBEA 4AD0A 1OANA 3FU3A 4KHTH 4CLMA 2W79A 3MRGA 4QT5B 4U5KA 1H1YA 1R2RA 1XIWA 3DJRA 4LFYA 2VABB 2GK1A 1S78C 5DK2B 4PYHA 1CGYA 4AYEC 3WBWA 2G60H 1QVBA 5TH2B 1DQQB 2ZX8A 1M5WA 2CRMA 4IGBC 1XIEA 4AKPA 1J8RA 4B9YA 5I00A 2QF7A 1U1UA 4R84A 2JKAA 2J5LB 1SSDA 5CBBA 3WLSA 2EKSB 3WMQA 4N8VB 1KLFB 4QLWA 4LHUD 5E9XA 4TPRL 1XDMA 3HRPA 2XWBA 5FJPA 2VLKE 2YXWA 4G6FB 4GQQA 1VERA 3OYXA 2PYEA 1UXMA 4NJGA 2O9RA 4YHNA 3TIDB 2R9HC 3GEFA 4DM1A 5EZLB 4UQ2B 5DD3L 2QKIA 4HCFA 1YTDA 5DHEA 3ROOA 1I8IB 1FP8A 2XWCA 5CZXC 3AG4B 5HHOE 4BKSC 5MHSE 4IJTA 4IDJH 1HL2A 2OL3B 3IWVA 4BFGA 3G1VA 4Q6JA 1XIIA 3DBSA 2E7FA 5FM4A 3R94A 1D5XA 5CSZB 3U2OA 1KJ2B 3WTXA 5MEND 3SDDC 3HPAA 4BINA 2JSFA 1O5QA 5IG7A 1T8QA 1ICQA 3UBXI 4ODSL 4F7PB 1TWIA 4TKWA 1XF4A 3I50H 2GUOB 1G7JB 5D7JA 1DSWA 4G70B 2W8CA 3GRGA 1W6LA 1ZTXL 3LDBB 5I3IA 3SE4A 3VXRB 3CVHL 3PZNA 4R26H 1E6OL 2RB8A 3HHRB 1QLFA 1IM9B 2AEPL 2PU1A 1ESOA 1R3JB 1KCZA 3V0AC 3IJLA 4PEKA 3HFYA 4D8OA 1RVKA 1NFDF 2Z1SA 4PS7A 4US6A 5I09A 4UTFA 4ZUTB 5LJYH 3TMLA 4N6QA 1CFTA 4QG8A 3BLEA 5HYEA 4CJ1A 3VFUA 4GRWB 2PDNA 4ERSH 1A6TB 3D39E 2VEIA 3TU6A 1T83C 2MHAA 3D69B 2E6QA 1GS6X 2JJVA 3KDPB 4C90A 2EHHA 4S1DD 2QJJA 4PI0A 1BD0A 2X4RB 4EXPX 3IDYC 1N9PA 2YR3A 2C13A 3NEVA 3Q5OA 3VZZA 1MY5A 2Y1ZA 1TUFA 3L4XA 3DX6A 5ILTL 4UU9A 4AEIH 3QQ3A 2J4WL 4YYCA 4HFUL 4UANA 1HIZA 1F8TL 4ZR8A 5F0PB 3HZYA 1U8CB 2ZA2A 3DHPA 5M94B 3UACA 5IOKA 2VD8A 4BWWA 3MFGB 2VJXA 1L0PA 2MCAA 3LDVA 1I8KB 2K6YA 4JDEB 2BVEA 4RBPH 4MA1B 3W26A 1T6MA 1XHHA 3QV7A 5FCSH 5HDLA 4UTBH 4PE8A 1RIUL 4BGLA 3RWHA 4YSAA 4F0KA 1KNOB 4B96A 4IHOB 5LIUX 1L0XA 1CTMA 4ZMAT 2DI8A 5EPMB 3L8QA 2WXIA 3WK2A 4OFPA 1RK1A 2F7OA 3PAOA 3TK7A 3EOUA 3RWDA 3MW7A 3HJZA 1B5TA 1NEZB 1V3MA 2A3EA 5BV7C 2Z93A 1ZIAA 3OV6A 1ZBKA 1Y0EA 2CDEB 5GRWA 4J9JA 2E47A 5EN2B 3NQGA 5K1NA 3IBOA 1KDIA 4O1DA 3GJFH 3C5ZD 1KXTB 1BXVA 3FUFA 1HOCA 1N8IA 2HN7B 2YCLB 2XG9A 3WG7B 1KPUB 5FKAB 2JF7A 3A4AA 1PIFA 5C9WA 1TJIL 5CCZA 1RSFA 3OBKA 3VXNB 3KE0A 3VKAA 1NIBA 1FZOA 5C54A 2YL6A 3EYPA 3GSNL 3B8YA 3QORB 3HI5H 4ZW7A 2JELL 2Q9OA 3DX0A 4M1GH 2WXHA 2OVLA 4AGPA 5A95A 4FZ8L 2NNAA 3WHXA 1G7MA 4OD2A 1X1OA 3MGAA 1XUZA 2C91A 4UF7C 2VR7A 1NJJA 1ZPTA 4FFYH 4YEEA 3GMOB 2AHIA 4ZUVA 4MPKA 5I71C 1BZQK 3DC0A 1D6EA 2YCEA 5AVWB 3BUYB 3V0UA 3NJHA 3IAPA 1XGRA 4HOZA 4MDRA 2ZOKA 1BFNA 4L8SB 1OX5A 1OF6A 1ZT7B 3W85A 5K1VA 1N0XH 9XIMA 4YHYC 5EIVA 2VISA 1U83A 2E9JA 1YYLL 2B77A 5IJVB 1IVLA 1DN2A 4AKQA 3GJFA 2X12A 5J1AB 3L4WA 3M7OA 3LCIA 2FTYA 3NJFA 1CD8A 4LSTL 2HXAA 1O9WA 4M8QB 3QYMA 4DJFC 1HINL 4JJ5A 3BANA 3ZT6A 4XWUA 2PLJA 4XZWA 4BZ2L 4P5KB 4X5WA 4XO9A 4X83A 5CKGA 4OGAC 3ZJAA 4MCNA 3VIHA 1U3ZA 3WTTA 2AL1A 3RDKA 1EUUA 2IKHA 1FGVH 3HF3A 1RFDL 3TFKC 4GKSB 2IAMA 4Y1AA 4WFGE 4HJFA 4Z2HA 3SCOA 1U8LB 4GBXA 4WVRA 4O4YL 1L9TA 5BROA 1BG4A 1NC4A 2J8UE 4YDIL 2IEPA 1NIFA 2QQKH 1ECYA 1RZFH 3FQRA 3NM3A 2KHAA 3V4PL 2CMRH 5EFIB 5HP5A 1G84A 2AFNA 3HZVB 3SDAA 3I9GL 2PPAA 1FBAA 4KXZI 4A7VA 5IRPA 3MR9A 5CJOL 1OGTB 3GSOB 5TDOA 5B80A 4G9FB 1DL7H 3MLSH 1R3TA 3KM8A 4JFFD 1JS4A 5ICZA 2VSCA 1V0LA 2LE9A 4AQOA 4C83A 3VUSA 1QBLL 3FTXA 5C8JA 3T71A 2Y3AA 4N0FB 1A3HA 3NRQA 2DZWA 4KTDH 2WWKT 2ZKXA 4GUOA 2V5SA 1QVOA 2UXVA 5K1JA 5D5MA 2HH0H 4XPBH 4AUBA 4O0QA 4DBUA 2H32B 3NA9H 3MRRB 4Z7VB 4YJZL 4UCFA 2C9PA 4G1EB 3MJ9H 1Z9AA 2BXZA 4H00A 1LL4A 2IPTH 3O2VH 2VDLH 1RIHL 3EBIA 2HT3D 5C0JA 5B38B 3BGJA 3P62A 2XWRA 2NCEA 4TNEA 2G2RB 4FZIA 3VMNA 3BZEB 1DVFD 1ZHKB 3LQLA 3NQ2A 4AIOA 2EUZA 5C70A 1MCFA 2PUQT 4WI0B 3EJSA 4H20L 3T6QC 1SEBA 2QEJA 4X0KB 3EJCA 2HJPA 1PVNA 1J1XH 1MHEB 2Z4QA 2CNYA 2Y7FA 4WKZB 1TTFA 3KXFB 1WDQA 5IDZA 2DIBA 5FYKH 4IGNA 1ETZB 3VFWA 4JHMA 5CU9A 3M1OA 1WA3A 3N1AA 4GMEA 5EU6D 1HVQA 1XD0A 3QVQA 5XIMA 3IK4A 1NCUA 3TN0A 1K1DA 5DHDA 3BIKA 3MJ9A 2Q86B 4PJ5A 4B9KC 1ZE3H 4PJ7A 3V5KA 1PO9A 1OF0A 5AAMA 4L1SA 5GJPA 2I26N 5GGUA 3TN5A 4DCQB 4U1NA 3LKNB 5M5DA 4S0TD 2X38A 4IBVA 1QSFA 4MMXB 2VDPB 3FT4B 4Z7UB 3LCYA 3O8XA 2NQ3A 1CGUA 4R4NC 1AZRA 4BCXA 2QJMA 2EAEA 5FYKU 4TS6A 2DKUA 3VDGA 1SY6L 1PTGA 3BQ6A 1KM0A 4XD6A 1KFAL 5CPQA 1NIEA 1WA1X 3KS6A 3WEZA 3UYIA 2E9MA 4L37A 1XLHA 1G4TA 1HSAA 4HA0A 5IFJA 3ES8A 4O02H 2AQWA 3SDDD 4R0LA 2Y5TA 4PTUA 1FVDA 1HL5A 3LKOB 3QNXA 4PTDA 5EG6C 3KBSA 3G6AB 1T03L 4QRRD 3T78A 2H2SD 4FALA 3KYKH 4JFHE 2OCFD 3GZQA 4JS7A 3ZL4L 4PV8A 4O8RA 3GBNH 1OV8A 3SRDA 2A4EA 2WLKA 4EI5C 2DP3A 1V8EA 1BYBA 5IVXE 1MCEA 4HHLA 4P5MB 2ROYA 2VN4A 1F4HA 2D20A 3G6DH 4AZBA 1TCDA 4GI4A 2QCDA 1CFQB 2JI3A 1QLRA 3QHZH 4Z7QE 1T7VA 3Q2LA 3QIUD 4RV8A 1CXKA 2G95A 4AZIA 1ZCRA 5F4SA 2GCYA 4JK0D 1IWBA 2QIIA 1HCFX 1HW6A 1SR0A 2M8XA 4YWGH 2X9ZA 2MH4A 4RNJA 2H8PB 4F9PA 3ANUA 5FECA 3N44B 4FQXA 5IMMB 3WY4A 4P2VA 1ZCOA 5K5YA 2D0HA 3F7KA 1FDJA 3NR0A 1YNTB 2YL5A 3QC3A 4J5NA 3CC5A 3DO7A 5FB8B 3QISA 3X11A 2HVOA 5CS7A 1E6RA 2J21A 3AWNA 1KBPA 1XR9A 1BQLL 3SCSA 3HZMB 2XQYA 4G42A 3G0SA 1OFDA 3VRLF 3KWVA 1SM3L 2W27A 3KCJA 4FEMA 4PJ6A 2BINA 4B6ZA 1CB7B 5BOPA 6PCYA 5HVHC 3CIXA 4YDZA 2GOKA 3ZHLA 3WNOA 3HR5B 2QCCA 1G7PA 5JNYB 3HC4H 4PMOA 1ETA1 2BASA 2OP4H 2UY7B 1ODAA 4Y2OB 1ZT1B 3MRKB 4XNUL 2Z8VC 2OU4A 2DQJL 1MFBL 4WEEA 3EF4A 4HTYA 3N43F 4TVPH 3C8DA 1ET7A 4G71B 5BW6A 4IMDA 4NO5B 3OC8A 4ECNA 3RFZC 4P2RA 4R3UA 5DRIA 4ODHL 3QA3A 4L9ZA 4LQ1A 3UXKA 5BZDA 2P52A 4NQCA 2HROA 5EZOH 5HHPA 3W7NA 1RQHA 3FSWA 3QI9C 3B9DA 4WJG3 4AAJA 3VD3A 1BZ7B 3N12A 3K8MA 4J3OG 1YDPB 3ERXA 1I2NA 1RHCA 3TAOA 1Q6RA 2X3CA 1CLYH 3HNVL 3GH4A 4JNZA 4KS0A 3S36X 5JIMA 4X3ZA 3RZWA 4FZEH 4W9LC 1CNVA 4B5VA 3O6AA 4XP1L 1WIPA 3STGA 4BZ1H 2GHWB 5KYYB 2ACRA 1F4XL 3NIGE 2BWQA 4XP6H 2WKOA 5H8UA 5A6JA 2Q09A 4GVIA 4Y4FA 1SHSA 3S36L 1S3HA 1CI3M 3TEYA 3NCYS 2VLLB 2OSWA 1AI1H 1HQRB 1JV5A 2RTTA 3O81A 3ALPA 4E3VA 2C1OA 1XH3B 4HS8L 1IFHH 4LEOB 3NEHA 5LIKX 3CLMA 2OMYB 1RUKL 4OQTL 2CZNA 3W6MA 1JF1B 1QWKA 1QO5A 2J71A 1UUSA 2QR0B 4M6OH 3MRLA 4JEJA 4GMTH 2XACC 4MCZB 3SOBH 2DMCA 1XLIA 4HQQH 5IB1B 1ONXA 5D7IE 3LV3A 2A6IA