1HL9A

Crystal structure of thermotoga maritima alpha-fucosidase in complex with a mechanism based inhibitor
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
442
structure length
420
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAELPGYKWEFTRGIGLSFGYNRNEMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PUTATIVE ALPHA-L-FUCOSIDASE
publication title Crystal Structure of Thermotoga Maritima {Alpha}-L-Fucosidase: Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis
pubmed doi rcsb
source organism Thermotoga maritima
total genus 150
structure length 420
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hl9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hl9A01
2YBUA 3WQ4A 3K8LA 4GQQA 2EBNA 4W88A 5LA2A 1TA3A 4ATDA 2ZWYA 1BYAA 3NSNA 1HKJA 4JAWA 2PC8A 3BGAA 3ARXA 3DYPA 1H49A 4LYPA 2D73A 1M53A 2ZX9A 2JEQA 4AC1X 5DFAA 1QVBA 2F1AA 3B9EA 5FCZA 1I1WA 1EOMA 2F2HA 2UY5A 2X1IA 1LWJA 3AIQA 3AICA 3O6AA 4R5EA 4AZCA 3VNZA 5GNZA 4EE9A 1OWQA 1G01A 1E0XA 4ZFMA 2VOTA 2D20A 1JZ6A 3GXMA 4CVWA 1MQRA 3WF4A 1EH9A 4P8VA 2ZUVA 3WDRA 3SURA 1ZB5A 1KWGA 1E1FA 2VZOA 1HKIA 1N82A 3UERA 2BV9A 3MMUA 1NWUA 1OIFA 1JF6A 3W27A 1WAWA 1HF6A 4UFLA 2C7FA 1BYBA 1HJUA 4M82A 4FNSA 1CDGA 3OLDA 5LYRA 1ZS2A 1GW1A 3PZNA 4HMEA 4PMOA 3VM5A 2CNCA 1T0OA 2VNCA 1D2KA 3AMGA 3MANA 1JYNA 1E4IA 3W24A 1V3MA 1CPUA 4KRTA 4JL2A 3GXTA 2OSXA 3CUGA 1HJXA 2XWDA 4KRUA 5ABFB 6A3HA 4OBRA 3BUIA 5I78A 1DWGM 1V0NA 3VDCA 4F79A 2VO5A 3JUGA 2DSKA 1L8NA 2JFEX 1WO2A 1V02A 1HVQA 4K68A 1QHPA 3SUWA 1H3GA 2QLYA 4WKAA 1UWQA 4LYRA 3K4AA 1LL4A 2A3CA 3GH5A 2WMKA 2YLAA 3WF2A 1U2YA 3DDGA 3MSDA 4JL1A 3SCRA 1PX3A 3ZT6A 4WKHA 1UD2A 3AS2A 4E4PA 4BQ4A 3GYCA 1S46A 3BLPX 3HG3A 3WL1A 1JAKA 5M03A 2D23A 1H4PA 3MO4A 1QI3A 4L4OA 4PMUA 2NT0A 5A6JA 2DPEA 1NP0A 3CHEA 3DHPA 2AAAA 3WMSA 2NSXA 4TTGA 3I3BA 4AIEA 1FH8A 2Z1SA 4C7GA 2CBUA 1GCYA 4AD4A 2WPGA 2WYSA 1GOMA 4W85A 4EANA 3CLWA 3GXIA 2CKSA 1W91A 1JDAA 3M7SA 2EABA 3CZKA 1NOUA 1E0VA 2DH3A 2GJPA 4UR9A 1HVXA 1E9LA 4UOJA 4XZWA 1OGBA 1M7XA 5CJ5A 3HN3A 2VX7A 5JBDA 1V0LA 1HIZA 3WY4A 4Z2IA 1C93A 5CLWA 3VIOA 1OT1A 2OWCA 3LX9A 2WHMA 3TTSA 3PZMA 1SFSA 2C8NA 3DYOA 5CGTA 1GZJA 2OWWA 1J0JA 5HPOA 1ITCA 1CGXA 5CGMA 1U30A 3A4WA 1HL9A 1CGTA 4JHZA 1KXTA 1HN1A 3U7VA 5BWFA 4U2YA 1E73M 1E55A 3SCWA 1XGZA 1G0CA 1UR4A 3UG3A 1ZBCA 2GSJA 1JI1A 5BXTA 3IAPA 5I79A 3LPGA 3K46A 3W25A 5D4YA 3WN6A 2ZICA 3UG4A 2JF7A 3OGVA 1VFOA 4HMDA 1EHNA 8A3HA 7TAAA 1UQYA 2WC4A 2GJXB 4D6HA 1H1NA 4MADA 2CHOA 3BMVA 1JZ4A 2WW5A 2JF6A 2WB5A 4P8UA 3WBAA 2Y24A 2ZUTA 3WEMA 2O9OA 2XJ7A 4CN1A 3AS3A 3B9AA 1PBGA 4YHEA 2ZUWA 3DHUA 2BY0A 2WZEA 3WD1A 3VU2A 5D9MA 2Y4SA 5EFDA 1AQHA 2J7FA 1NWSA 3N13A 2D0GA 4H04A 4D6EA 3VDHA 1CEOA 2EPMX 2DT2A 3CO4A 2OSWA 4P7NA 3ARYA 5FIPA 4E8DA 3VGHA 2WCGA 2Y8VA 5AC5A 4U5IA 1GONA 1BHGA 3W37A 3BXWA 3CIVA 3EDDA 1G9HA 2BVTA 2VVSA 5CSUA 3L4UA 4BA0A 1B3XA 1MW2A 2GDVA 3K1DA 2ZXDA 2X05A 1QI2A 3EJSA 2IXVA 5IDIA 1C8XA 1CXLA 3K4DA 3AMKA 3RIKA 1JG9A 3OLEA 4BS0A 2WBKA 1UR9A 4J27A 1HP5A 3ZO9A 3CZLA 4MB3A 4FLOA 1E6XM 4AD2A 4TX8A 1BVZA 1DWHM 1B90A 1C7SA 3WNNA 4AZIA 5I2UA 4PTWA 5BCAA 1G1YA 3VUPA 4EK7A 3QR3A 5A3HA 4CD7A 3SUSA 1V02E 3N17A 2A3BA 3WD2A 9CGTA 2D0HA 3AIEA 4A3YA 4CN6A 3EJUA 2UY2A 4J3SA 4B9ZA 2J7DA 1OD0A 5AC4A 2YOCA 4NF7A 4LXFA 5HOSA 2E8ZA 4CGTA 5AY7A 2WMHA 2ESCA 1UR0A 2VZTA 4KGLA 3O2LA 4JHOA 1QWNA 1D7FA 1VJSA 3ZOAA 4DUVA 2EPKX 3N18A 1KQZA 4Z2GA 3VX0A 4P8XA 2B31A 2VL4A 3L4WA 1MWOA 1GOQA 3IJ9A 4HTYA 3ZSSA 1B9ZA 3CZJA 2CCRA 3QHMA 2DEPA 3WUEA 2OYKA 3G6LA 3PHAA 4D6CA 1TMQA 3VNYA 2X8RA 4DWSC 3CHCA 4M1RA 2PF0A 1DWJM 3CZSA 4TUFA 2DIJA 4PSPA 3BAJA 2WMFA 2J75A 3EDJA 4V28A 4V2XA 3WH7A 1QX1A 3L4XA 5TD4A 4PTMA 4UOZA 4M81A 3GDBA 1UYQA 1WPCA 1TVPA 4UFIA 2VCCA 3D51A 3WY1A 1BYCA 3VD3A 3A4XA 5A2BA 4UQBA 3VMOA 1W9XA 1C8YA 1J10A 1KTBA 5DMYA 2J62A 3MMDA 4AD1A 3RM8A 2E0PA 2WC3A 3BLBA 3LRLA 3AXHA 3AIBA 1GJWA 4NXSA 3EYPA 3ARRA 3GNOA 3T2QA 4N0RA 1W1PA 2XVKA 1WKYA 1JXJA 1V6VA 4QCFA 2W67A 2PWDA 2BNJA 2J7GA 3DECA 1CGWA 2NW0A 4Z2JA 4MDPA 2YDSA 4OKDA 1PJ9A 3BAKA 1E72M 1BG4A 4JFUA 3D4ZA 4WJXA 1JYXA 4PCSA 3WNKA 3WNOA 1B2YA 4KGJA 3EMCA 2VJXA 2QMJA 3KL5A 1J9YA 3L2MA 1W1YA 2D24A 5FD0A 4DO4A 1TQVA 3L4TA 4ZE4A 2WKLA 1LG2A 3KZSA 1NARA 2ZXQA 3VGDA 1VEPA 3ARPA 1H0GA 3MV11 5CPTA 2VT0A 4ZEPA 3MS8A 3G6MA 3AJ7A 1GPFA 4P7OA 3PTQA 1IZJA 1JNEA 1CGYA 2WWCA 5I6SA 3PZTA 4NZJA 2WHJA 3CV5A 1W9DM 1JL8A 4GO9A 4P7RA 1QHZA 1TUXA 1UKSA 1HKMA 2EAEA 3LXAA 1B30A 3UR7A 1F4HA 4HMCA 2WBGA 4PUEA 2DT3A 4RE2A 5I0DA 2XVPA 3K8KA 4J3WA 3T0AA 1OBAA 2YJQA 3WMCA 3M07A 4GO8A 2E9LA 3CZNA 3W6LA 1E3XA 2VRKA 4CD4A 2F7RA 2RGMA 3AYRA 3HJEA 4UQCA 4NI3A 4M56A 3DX1A 3ZJ8A 3W28A 4BQ3A 2J7EA 3ZM8A 3W38A 3WUBA 1QW9A 4H8UA 1LG1A 4TXEA 1QNPA 3AHTA 4DWSA 1PEZA 4ATLA 1K6AA 3AS0A 1OD8A 3SCQA 4PRWA 2VZSA 1RP8A 2ZUMA 3LMYA 1LJYA 2W91A 3AI0A 3NCOA 4MNJA 1MQPA 2CKRA 3VGEA 3PZQA 4DUWA 3BC9A 4X9YA 5C70A 3II1A 5A2CA 2BHZA 2CBJA 3BAYA 2VX4A 4JKKA 3BH4A 1NWRA 2XFYA 3U57A 1QI5A 3EMZA 2VCAA 3T0DA 1QBAA 2ALWA 1KQYA 1C91A 1FHDA 2G3JA 3VIKA 1M04A 4UFJA 4JIEA 3W81A 4AW7A 3N12A 4GZIA 1AQ0A 2BY3A 5EBAA 4HZ6A 1XH1A 4YHGA 2HISA 4NZCA 4WSJA 2PB1A 1XD0A 3T2OA 3GXPA 4D6JA 1V6XA 6TAAA 4TX6A 4TVDA 3W29A 1QWUA 2W63A 2Y5EA 3VDAA 4CU8A 5CSYA 1BAGA 3WNLA 1FA2A 1C90A 1MW3A 1VAHA 3W53A 3THCA 4M80A 4Z2KA 1K9EA 3W6MA 1K9FA 1UR8A 4AXNA 1FFRA 3S5ZA 2JIEA 1SMDA 3FAXA 1WZAA 1I1XA 4PTXA 1E6ZA 3WF0A 3HMCA 1JYWA 1R85A 1UH3A 1QNQA 4A3HA 2XPKA 3D5HA 1D3CA 4GIAA 4L4PA 2EO7A 2OW7A 5C71A 3WEZA 1BF2A 2X09A 4QLJA 1DWAM 3ARUA 2Y2WA 2MANA 1LLOA 1J0HA 4B9YA 3BMWA 5A6AA 3MV01 4C7FA 4FLRA 2YL6A 1EXPA 4AD5A 3SCOA 4FF5A 5GNYA 4F66A 3EDKA 4UQAA 1NH6A 3VOCA 2WLYA 3BCDA 1VRXA 4AMCA 3NDZA 1JDCA 1O7DC 3VGBA 2HVMA 3OG2A 3W26A 4UTFA 2TAAA 3WQ6A 3WELA 3AHYA 1ZJBA 2WCSA 3H53A 3AOFA 3WQ8A 4J3TA 1GORA 4IM4A 1JZ2A 1KB3A 5E1QA 3TP4A 2J8GA 3ZJ6A 5I5RA 2DGAA 1CZ1A 1W3HA 2DQXA 3PTMA 4OBSA 5A6BA 1VIWA 4UZUA 2C0HA 2ZIDA 3WIJA 4WIWA 1JFXA 4HPGA 3OGRA 1UA3A 3MMWA 1E4NA 3D3AA 5JUVA 1QNSA 1YQ2A 4S3KA 7CGTA 3RDKA 1ODUA 5HPCA 3WDJA 4P7LA 2X0YA 2BVYA 1HJWA 3LPOA 5A94A 4BCEA 3AHZA 3AIVA 4FLSA 2VR5A 3U5UA 4U2ZA 3WF1A 1FH9A 4NXKA 1US2A 4P7QA 1JD9A 3CTTA 3MI6A 4ZE5A 5DEZA 3CUFA 3MUZ1 2JE8A 1E3ZA 1E6NA 4HU0A 3BVWA 1A47A 4AIUA 4F8XA 4W84A 1JYVA 3AMLA 3W0KA 2GJRA 1BQCA 1JZ5A 2Z1KA 4W86A 4WK9A 1XV8A 3PZUA 3WENA 1JZ7A 1HT6A 1V6WA 2PBOA 1M01A 1G5AA 1KBBA 2CITA 3T0BA 2ZUUA 1B3VA 5HDRA 5KZ6A 4W5UA 3NSMA 3LPPA 1WZKA 4GZEA 1XSJA 4S3JA 1DHKA 3DDFA 1MFVA 2A3HA 1GQJA 1W1VA 1R86A 3VKKA 2XIIA 4PEEA 4GXPA 4NX0A 3FY1A 4ZXOA 1VFFA 5GQBA 2J47A 4TOQA 2NT1A 4DO6A 3O9NA 1WB0A 2J7HA 1VFMA 3A24A 2UWFA 1PX4A 3GZAA 2GFTA 2Q8XA 1GHRA 3F5KA 1V3HA 1UQZA 3IAQA 1LL7A 2WLZA 1XD1A 3GBEA 4E2OA 3RJXA 1E6QM 3RILA 2VRJA 2XVGA 5I24A 1PX8A 1HXKA 4PCTA 1UWTA 1GOWA 1DEDA 1FP8A 3DX0A 1CBGA 3RM4A 4FNPA 5C8BB 3TTYA 3VIJA 4CU6A 4P8WA 2X2HA 3LPFA 2QV4A 1VFUA 2VZUA 4TVUA 1XH0A 1XHGA 1BPLB 4W93A 4OJYA 1MXDA 2G4FA 4W8BA 3KL0A 3SUTA 2G41A 1V3LA 4DWSD 2V5DA 2VZVA 3T09A 2CYGA 4UZSA 1MFUA 3E1F1 1EDGA 4D6GA 3CGTA 1Q6FA 1MW1A 3ZT5A 4JZ5A 3BCFA 5D9PA 1TR1A 5E9AA 1AVAA 3EDFA 4XB3A 4FNUA 1RD6A 3GNRA 5E70A 4H41A 1ECEA 1W32A 4NSBA 3SCUA 4PMNA 2WMIA 5FOOA 5ECUA 5IHSA 4B16A 2D3LA 4KH2A 1JZ3A 2WKGA 3VIHA 1TQWA 2VMFA 2XIBA 5LA0A 4TVCA 3IANA 1EO7A 2WZHA 4JFSA 3VVGA 4EKJA 1TQSA 1XRVA 3T2PA 1JXKA 4GI6A 3WSUA 4PSRA 4X0VA 4B3KA 4AEFA 2V3EA 2WWDA 2FGLA 1KFWA 1US3A 2IGTA 3KLKA 4PMVA 5DT7A 2BHYA 1R7AA 1HL8A 2YDQA 4MAVA 2WVVA 1B31A 1UWRA 1ZL1A 3EMQA 5A6KA 3AMCA 3F4VA 3RO8A 3W82A 1R46A 4HZ8A 4ZENA 1E71M 2FHBA 1OGGA 3QOKA 1CLXA 3WUFA 4H8HA 3ARQA 4X0NA 1ZU8A 3BAWA 3GBDA 4PBGA 4HA1A 2DIEA 1JIBA 5D8ZA 4AZBA 1W3KA 6CGTA 2XN2A 3WQWA 5BYWA 4CUCA 3MUY1 4CCEA 5M17A 2V38A 1TQUA 3IJ7A 3WDPP 1UD6A 2WSKA 4MNKA 2XM1A 3PZIA 5I3DA 1H2JA 2O9RA 4AZ6A 2BY1A 2WNWA 3TONA 3VDBA 5JIWA 2D2OA 5A6MA 3MSGA 1QOXA 2XGIA 4XZBA 1GQLA 2W5FA 1BVNP 1V0KA 3ARZA 4LX4A 3CZ8A 4Q7NA 4C7DA 2XFRA 4MNMA 3ZIZA 2A3AA 3FXYA 4OZOA 4UFHA 3CMJA 2DT0A 1JI2A 3L4VA 3WQVA 4AISA 2ZUSA 1B3WA 4DM1A 1UZ1A 1MW0A 5A2AA 3FW6A 4UFKA 1BGAA 4W7VA 2V5CA 5A6BD 5D8WA 1ZBVA 2J79A 2WVSA 4F9JA 1KGUA 2ZX8A 3UESA 5D9NA 1CYGA 4EAMA 4H7VA 1LWHA 1JD7A 1R34A 1HX0A 1UASA 3WH5A 3PZOA 3A47A 3WH9A 1E4LA 3CUIA 1O6IA 1ITXA 3FNDA 4CVUA 5BRQA 1W3LA 3IK2A 2CHNA 4DO5A 2FYVA 1KR0A 2BXYA 2ZE0A 3QHOA 2YLLA 4AWEA 2WK2A 1VBUA 3N1AA 4NRRA 1WNOA 2PWHA 5IFPA 4N42A 1TG7A 1BSIA 1RP9A 1TFVA 2YIHA 3UCQA 2GK1A 3HG2A 1GOKA 4OOUA 4F9DA 2RGLA 2F1BA 4D1JA 2J4GA 1BFNA 5ABEA 1G94A 1HJSA 4PMXA 3BLKA 3EJQA 4PTVA 1BYDA 4DWSB 4MNLA 5I23A 4ACYA 1LL6A 5KEZA 4CD6A 2F7QA 1DP0A 2BVDA 2F7PA 1KCKA 1CENA 3BSHA 1E43A 1NM9A 3AXIA 3CBWA 2VI0A 1H0IA 4AD3A 3IJ8A 3ZSTA 1HXJA 3DX4A 4WF7A 1CECA 2WMGA 1NQ6A 1MXGA 2X2YA 2PI6A 1QI0A 4HPHA 3A21A 1R33A 2J78A 1PPIA 2QF8A 2W92A 1ISZA 3AISA 3GXNA 2O9TA 2D3NA 1DWIM 2WHKA 3TTOA 3GH7A 1TA3B 5ABHA 4E8CA 1WDPA 5LA1A 5CG0A 2XTKA 4B15A 2V3GA 1HJVA 3CH9A 1W9BM 3BSGA 1WDRA 2FGZA 3CHFA 1KWKA 4UCFA 3B9DA 4OOZA 1GVYA 2J25A 3GXFA 3VD9A 2YA1A 1ISXA 4MTVA 1MYRA 1X1NA 1CXIA 2BXZA 3LRKA 1XYFA 1EQCA 4OGZA 3H54A 4D6DA 3TV8A 4AZCB 1XSKA 2YA0A 4FNRA 3SUUA 2G3IA 4WKFA 4FK9A 1NP2A 3PZVA 1XSIA 2PWFA 1ISWA 4GZJA 4AZ5A 2UY3A 3TA9A 3ALFA 2ZUNA 2XN0A 4J3UA 5AYIA 1E40A 3SCSA 4BQ2A 2W62A 4Z2HA 1E15A 3AHVA 1LQ0A 3N11A 1UR2A 5JBEA 1BTCA 1VENA 3GTNA 2EXOA 4LQ1A 3VMNA 1UG6A 5BXSA 3M46A 5BXPA 3ZJ7A 1I75A 2WAGA 1HTYA 1L0PA 1JGIA 4XUYA 2QHAA 1J0YA 2VCBA 3UR8A 4HOZA 1J0KA 3DX2A 1E4MM 4AIOA 1GHSA 1CXFA 1EDQA 2VC9A 2FHFA 4QP0A 2X2JA 4D6FA 1PIGA 3MU7A 2EJ1A 1TE1A 1PAMA 1RH9A 1UKTA 4W7UA 2XHYA 3BAXA 4J3VA 3WUGA 3EDEA 3J7HA 2CPUA 1GNXA 5DT5A 5IFTA 2J74A 1Q6CA 4U3AA 3OBAA 5AYBA 3WQ5A 1IT0A 4AZGA 3N15A 2DSUA 1EGZA 1AQMA 3WY3A 1EHAA 2WC7A 2CIPA 7A3HA 3ZR6A 1ISYA 1QNOA 4RE3A 4PUDA 3M6DA 3ARVA 3ZR5A 2V3DA 3RM9A 2XFFA 5HXMA 1A3HA 3L4YA 3VIMA 1IV8A 5E09A 3A3HA 2IUZA 4MDOA 3VINA 5EB8A 2F18A 1CTNA 4MPKA 1VBRA 3F5LA 4XX6A 2F8QA 1WZLA 4BF7A 2XSBA 4U33A 1V03A 1WDQA 4GPNA 4A4AA 4QLKA 3BAIA 3HG5A 3VSVA 2D1ZA 1Q6GA 2AMGA 1XCWA 4CCDA 1UD4A 3WD3A 3MUIA 1JFHA 2BY2A 1KTCA 1CWYA 2WHLA 2PBGA 2WANA 3U7BA 3FHQA 5HNNA 4D6IA 4GINA 3GNPA 3SCNA 3ZMRA 3ECQA 4JCLA 2GDUA 5IXEA 4D71A 1E1EA 3SCVA 5A95A 4IPNB 3SCTA 3VGFA 1UKOA 3AMDA 1NWTA 3BUDA 1JDDA 3KLLA 1JNDA 1B3YA 3DYMA 3PZGA 5I77A 4MB1A 3N9KA 3U5YA 4WSKA 4WLCA 4ACZA 2FE0A 2F61A 1KXQA 1UD8A 3WL0A 4PMZA 3WD0A 4MB4A 1UWSA 2WMJA 1W9PA 3LXBA 3ZQ9A 2CETA 1CNVA 2XG9A 2G3MA 2ZX5A 4HU8A 1E56A 1HKKA 4W7WA 3EJRA 5E6ZA 3I3EA 1LF1A 4H2CA 4Y7EA 1OT2A 4UNIA 8CGTA 3WY2A 1GQKA 3IGUA 3VTRA 2JEPA 3CMGA 1CIUA 1HJQA 2E9BA 2EPOA 3ARTA 3NIYA 1EOKA 4AYSA 1WZMA 2FH6A 3FAWA 3VSTA 1FH7A 1P6WA 1R47A 2XSAA 1EIBA 1R75A 3WFLA 3VD4A 3AFBA 2VVNA 4IUGA 1WP6A 4UQ9A 3A23A 1ESWA 3VSUA 3ARWA 4QLLA 3EJTA 2VX5A 1V6UA 2YKKA 3KWXA 3S6TA 3HZ3A 4JFWA 2OYMA 3AIWA 5DF0A 2V3FA 2QPUA 3VIIA 2XYLA 5CLTA 4MAZA 1XH2A 1X6NA 3CPUA 3NDYA 3WDQA 2YFNA 4U5KA 5A1AA 5JIPA 2X0HA 3VIPA 3RJYA 5CZKA 3OZOA 2YBTA 1H11A 2QPSA 2D22A 2J8FA 2YFOA 1JZ8A 1CXKA 1SR0A 1V0MA 1VB9A 1UZ4A 3WDIA 3WD4A 2CXGA 1QNRA 4AD0A 1R7OA 4CN4A 2E40A 3WKZA 1PZ2A 1O7AA 2DT1A 5A8OA 1UOKA 4AEEA 3A4AA 5ABFA 2XWEA 1F4AA 2WMIB 1XYZA 4NRSA 2WXDM 4UQDA 2W66A 2XM2A 3GH4A 3BUPA 2WM0A 2VUYA 2WVUA 1UH2A 1KGXA 3SCPA 4M29A 5CPSA 2W4XA 2DSZA 3EBVA 4KWUA 3POHA 3VILA 1QI4A 3THDA 2YDRA 3VD5A 2VQUA 3AROA 2VTFA 3AZSA 1B1YA 1GQIA 5BRPA 2OW6A 1UHVA 1FFQA 3BVUA 2XGBA 1UR1A 2ZOXA 3AQUA 1E6PA 3UG5A 1C92A 1HP4A 2CEQA 1NOWA 2O92A 1QHOA 2XVLA 1UKPA 2WVVB 4GI9A 3CC1A 3PTKA 2CESA 1EA9C 3VIGA 1WDSA 1DTUA 1FHLA 3HU7A 1AMYA 1KXVA 4PYSA 3L4ZA 3WF3A 2ZXBA 2G3NA 3OB8A 4ZXLA 3AYSA 4HOWA 2ZX7A 4OUEA 2OWXA 3I3DA 3QGVA 2FDMA 2DDXA 2XN1A 5A69A 2X2IA 4MJ2A 5A6SA 2DSVA 2YA2A 1V3KA 5CPQA 2ZWZA 2QMKA 1GUVA 2J7CA 3D50A 3CZEA 1TVNA 2WVTA 4NZFA 3AZTA 4QAWA 1GJUA 2ZXAA 4RE4A 3NYDA 3WNPA 3RMEA 3TTQA 3ALGA 1H41A 5A8MA 2Y8KA 4FNQA 3AS1A 1R8LA 4PMQA 2CERA 2YL9A 4LYQA 4QCEA 3OIHA 4D72A 4R27A 3F5JA 2EEXA 1H09A 2GUYA 1KXHA 2AOSA 1WCGA 3VPLA 1E6SM 3VGGA 5EFFA 1CXEA 3A6OA 4GI8A 3GM8A 2OSYA 1U33A 2DSWA 3WH6A 3AXXA 1QBBA 1C7TA 1B0IA 1GOIA 4HA3A 2CBVA 3PBGA 2PWGA 5A8PA 3NSXA 1HNYA 1EO5A 1BG9A 2BHUA 4UOQA 1UD5A 3W4RA 1GVIA 2E8YA 3D52A 4CU7A 1TQTA 3BUQA 5FKYA 1IZKA 1OB0A 1WE5A 1OM0A 2E9MA 2EQDA 4J7RA 1DWFM 5HBFA 1FP9A 2EPLX 1R87A 1CGUA 1Q6EA 5M5DA 2F7OA 5E6YA 1MQQA 5A8QA 2OLHA 3WNMA 2GJXA 2FH8A 5FL0A 3SEPA 5DO8A 1TZ7A 2GK1B 4W8LA 3LRMA 4YPJA 1OCQA 3KE0A 1M03A 4PMRA 3OGSA 1HWWA 3UETA 1KR1A 1VEOA 2E4TA 1UUQA 3OA5A 4GKLA 4YN5A 4MJ4A 1UD3A 2WZIA 4LGXA 2E3ZA 1VF8A 1J18A 4AMWA 1BGGA 4FNTA 1BLIA 1UWUA 3CUHA 4URIA 1Q6DA 3MUAA 5GNXA 5M3WA 3ZJKA 5E0FA 3S5YA 3AZRA 1E6RA 4U3CA 3QOMA 4RL3A 3VM7A 1UH4A 1J12A 4XV0A 3CZGA 3FHAA 5F7UA 2IXUA 1QW8A 2W61A 2GVYA 3ARSA 3MKKA 4LPCA 1X6LA 1V3IA 4CCCA 4FLQA 1JAEA 2J7BA 3OLIA 3DC0A 2DH2A 3S2CA 3UEQA 3TOPA 4MB5A 2UY4A 4M24A 3WMBA 3NJ3A 4OIFA 3PZ9A 1SZNA 1EDTA 3VX1A 1K9TA 2EPNA 3B8SA 1GOOA 1V3JA 2JALA 1Q4NX 5A6LA 5FL1A 4W5ZA 2J77A 4M8UA 5EMYA 3D4YA 3N04A 3BVTA 1UKQA 4JKMA 4ML4A 4U31A 4PN2A 1W2VA 4UQEA 3BUBA 4IISA 4B3LA 2BS9A 2BFGA 1C3FA 3APGA 1XCXA 2YL5A 3KL3A 5IHRA 4HOXA 1VEMA 4AZHA 4Q22A 1QPKA 3PN8A 1CLVA 4JCMA 1E5JA 1W9UA 4J28A 1PZ3A 5BROA 3RPMA 3SIMA 4DUXA 4AMXA 4QFUA 4JFVA 3FN9A 2ZX6A 4CD8A 3AHXA 1K9DA 1CXHA 3CUJA 4W87A 3A22A 3SUVA 3WFZA 1OIMA 3VIFA 5JBFA 3VO0A 4PMYA 2D0FA 1W3JA 2EADA 1J0ZA 4AY1A 5GPRA 3H55A 3WH8A 3OLGA 2O9PA 4W89A 3T08A 4Z2LA 1KGWA 1E0WA 5CQ1A 1V6YA 1EQPA 4CKQA 3BVXA 4ATWA 1ZBKA 1J0IA 1KBKA 4PMDA 1NOFA 1OSEA 1J01A 3L2LA 4HP5A 2VQTA 2FHCA 1FOBA 4BZYA 3AIRA 3OZPA 2YL8A 1XC6A 3EJPA 1E5NA 3RCNA 3GXDA 2EACA 1TCMA 4HA4A 1VJZA 1CGVA 3K8MA 4H8VA 4KMQA 3LXCA 1OGSA 1YHTA 4D1IA 4BQ5A 1JF5A 4UFMA 2G8ZA 5E0CA 3BVVA 3ZT7A 1PIFA 4AZ7A 3WBEA 3WEOA 3DX3A 1H5VA 1ZBWA 2WCAA 5CXPA 4TTUA 4GQRA 2CBIA 2VR4A 2A3EA 3HG4A 3POCA 3QHNA 1Z32X 5D9OA 1V08A 3VMPA 1ISVA 1E70M 1ODZA 4JFTA 4J3XA 4JKLA 1B3ZA 1C8QA 2JIWA 1UA7A 1Y7VA 4IPLA 1KCLA 3AIUA 3NUKA 3A5VA 3WDHA 1UWIA 3VD7A 4FMVA 2VRQA 3CHDA 2XUCA 5BXRA 4AYGA 4HZ7A 1W2PA 1W9VA 1J11A 2XVNA 3KEHA 2PWEA 4V27A 4DM2A 2VX6A 1ZJAA 4QDMA 1OINA 1SYTA 2OYLA 2WSPA 5A8NA 4ACZB 4CD5A 1SMAA 1W1TA 1MVYA 4W8AA 5ABGA 1PS3A 2VURA 1RPKA
chains in the Genus database with same CATH superfamily
3BPCB 3MNZB 3R58A 1IGCH 2VDOB 1U8HA 3UFYA 1SUJA 2C9PA 3NSNA 1B3OA 1Z69A 3O45B 1KJMB 3QZWG 5T1LD 2OZTA 2HVJB 1JUFB 2OPJA 1K5WA 3HNSH 4WY7L 2WUCH 2ALRA 5JXED 1OF8A 4U49A 2Y63A 2BX5A 1MFEL 1VACA 4R90H 2GTZA 3HM7A 4YL9A 3OAZK 3LXUX 1NC4B 4WK2B 3OG4B 4FKHA 4MSWB 3RITA 1BYBA 1HJUA 3H24A 3OLDA 1AGDA 1GW1A 2CNCA 4GE8A 1KPRA 1D2KA 2CZEA 2ZDSA 3I6SA 3AGWA 3Q9QA 2CLIA 2VITA 4N24A 4UV4L 3PJLA 2RDXA 5KVGH 4B3ZA 1OK8A 4FAAB 1J9CT 5F70A 1OTUC 1CURA 5DD3L 1RBAA 3BUIA 4PY8J 2E59A 1A5KC 4H3DA 2RD0A 3JTSA 4F33B 2ZOLB 2VO5A 4N2MA 3NQ2A 1HVQA 3PBYA 1HILB 4HDIA 1QHPA 1NY1A 5HJBA 4JHAH 4E2BA 4YLWA 1G0DA 3MKVA 3KBHE 1XIIA 5DJAA 1LQ2A 2X1QA 2MCAA 1H8OA 1T1YA 5E0KA 3FHEA 4JJ5A 3I2CL 2H3NB 1WICA 2ACQA 2ZWNA 4YUEL 1IXPA 3QPQD 5IJVB 1UWGH 4UR8A 2FQIA 3G18A 1NDZA 3FUDA 5F4WA 5AVHA 1DHPA 1GOMA 5GIRB 2DM3A 1W91A 4P99A 1L2QA 1KBIA 3BPOB 4DGVH 4XAYA 4G3YL 2YZRA 1KGCE 3S3JA 1EUAA 2Q09A 2X1RA 5CC7A 4JRWA 5C0BE 2ZUQB 4FX8A 3LSOA 1OP5H 5FCUH 3UJSA 1NLBH 3NACH 1TVHA 1P0DA 1ITCA 4L1XA 1JHTB 2FVLA 1QMUA 3UC0H 4JS7A 4KI1A 2AQ2A 2ZXCA 4KAQH 2X6MA 1OABA 3CFQA 3QULB 1ZQ5A 2NWSA 3GRWA 3BWAA 4LIQE 3CHQA 3ENEA 2W65B 5ABAA 3WBDA 2QQKH 3OGVA 4WSHA 2DTML 7TAAA 1DUZB 3MRBB 3HI1B 3QVAA 1NANI 3BO9A 2Y24A 4CN1A 1NEYA 5DDHB 3RJDA 3B9AA 5DVLA 2ZUWA 3K81A 3MLPA 2NZLA 1SJBA 5IM7B 3ARBC 5EFDA 4X8CA 1YEFH 4AGQA 3V5OA 3LS5H 4NHCL 2YAOA 4JPIA 4AYBA 1G7MB 2CU9A 4TVSa 1M05A 3FNKA 1BFOB 3P5YA 4GH1A 1EV2E 3RWCA 1J9TA 1Q65A 4QHKI 3EDDA 3B2VL 2BVTA 2C5DC 2ZAIA 5CFAA 1I8MA 3KM2A 3VG0L 4Q8OA 5LGHL 1E1CA 5D1XB 3QUXC 3KYOA 4FO4A 4JJHA 3Q05A 4XC1L 3X17A 1IGJA 3P82A 5I2UA 2A74A 4K39A 1M4KA 4TQEH 3Q01A 4OJEH 1UPPA 4GABA 2H3KA 3KLSA 3G3MA 3ZMNA 4G6AC 4B5XA 3NL2A 1E9YB 5E6UB 4GIYA 4Z1DA 4DN3H 2HKFL 5K9QG 5HY9B 3B4UA 3VX0A 1XF4A 4X9HA 3DIVA 3U25A 1GOQA 1QBLH 4MKSA 5JPNB 4NP4H 2RQEA 2VDOL 4FNLL 1DWJM 2OMNA 4E41A 5HGGS 1QLFA 5H37G 5G1MA 2MOGA 1FVCB 1CGSL 4UMAA 3HC0A 4WDIA 4HK3N 4UQBA 3QFWA 4HWBL 1J10A 1KTBA 2IKHA 1OGAD 2AQQA 3IGHX 3IMSA 2ICEC 4IDJH 2OMUB 2BOBA 3DO4A 5CEZH 4NXSA 4H7ZA 4H9XA 5IW3A 1H61A 4PU2A 1TDQA 3I65A 2FATL 4KGJA 4N1HB 1R3SA 5T1KA 5F96L 5GGRY 5DI8A 4NO5A 2J8UB 3DU0A 4FXTA 2FECL 3UGVA 2CIKB 5IMKA 1H0GA 3MV11 35C8L 5KAQF 3AJ7A 2AV1A 3URQA 1CGYA 4U6XB 4PUBL 3L9BA 4PG2A 3K7UA 3ORWA 3FZUD 5C2BL 3TV3L 4UINH 1KFJA 3G77A 1YBQA 3WLRA 4RE2A 1S5NA 2XQBH 4TUOB 3V4BA 4JDZB 3QIUC 2Q7YB 3FT4B 3WMCA 4GY4A 2H1PH 3RKDC 1DN2A 2VRKA 4IRJD 3TC9A 1XR9B 2BWQA 2GJ6A 4IGSA 1TRDA 3L9EA 2J7EA 5DD1H 3BVDB 2MWCA 3SE9H 3QIBC 4PRIA 5A2FA 1GEQA 4AM0Q 2ESVE 4RNHA 3AHTA 3Q58A 4UTBH 4ATLA 3Q6FA 2WWOA 4GAGL 4WWNA 3AC0A 4ZZ9A 4K71C 1M1SA 4IIEA 1G7LA 3LQZB 3R94A 3QDMD 3AI0A 4YHLH 1L9OA 3KRZA 4X9YA 4WUKL 2NY4D 1XI3A 1KN2L 4C6PA 1L6XA 4YPGA 2ALWA 4XB8A 1FHDA 4C60A 4AZ8A 3CM4A 2RH0A 2O5NA 4JNMA 4RMVA 3CUPA 5J89A 3H7LA 2HXUA 4B0MM 5IM51 4BRVA 3C8KB 2Y5EA 1NFAA 5EY5A 4BV1A 1MW3A 1P7TA 4CNIB 4OHQA 3W6MA 1AOZA 2YARA 5AYUL 3DJZA 5ID1B 4JQIH 4B9FA 3FTUA 3B05A 4X4KA 1L5GB 1A65A 4Q7BA 2XZ9A 4IK7A 2P5WE 3UJTL 3BWUF 3IFOA 5IROC 2ADJB 4NUJA 3K4WA 4AD5A 2Y69B 2NNCA 1FZJA 1QG3A 1ULVA 2WLYA 4B9GA 2K4AA 4AMCA 3LEYH 3LKSA 4P5SA 3OMAB 3VGBA 4UTFA 5K4XA 3WQ6A 3O6KL 3CN3A 2V9TA 3FQTA 3RLHA 3BQUD 1BD0A 4QT5A 4Y96A 5AVTB 2C19A 3NZHH 4OM1H 4UZUA 2XDFA 4GW5B 4D8AA 1ONQA 2YXMA 2PYFA 3U0PB 3NRPA 5HPCA 4RBPH 5B39B 4N0CC 3TBWA 5BRZA 1QUNA 1Z5YD 4LKCA 4FLSA 1PKOA 3ABKB 1K4DA 2NCEA 5T5NF 3WQEA 1ZENA 4EDWL 1JQXA 3MI6A 3CTTA 3JZEA 1UB6A 4P46A 4QEGA 3ABSA 2H2PD 3F83A 2C1PB 2QV5A 5L0QC 4KWSA 2YLKA 3JT0A 1JZ5A 1RXLA 1XV8A 2I9UA 1JZ7A 4AQ1B 1YEEL 3TYFA 3L9CA 3U0HA 4ZSOB 4M0XA 5IWLC 5DEJA 3H7RA 2CITA 3T0BA 3U0TB 3P4MB 5HDRA 4JANB 5JZ7D 5CNHA 4L9XA 1WZKA 3MQTA 4E3TA 5FF3A 4GXPA 4JTFA 1TE6A 4GBXC 4POCA 3QEZA 3MODH 3N91A 1VFAA 3PQYB 5ESAB 4OJDH 3W7LA 4M5TA 3TJLA 2O7QA 2PF6A 4HJ0C 2EDYA 4GFTB 5IEKA 5EPMA 1A9EB 1XGTA 3U6XS 4F2TA 3HE7B 4HUUB 2NW3A 2DV0A 2QR6A 4OD3H 3GSVB 1ACCA 3U6RB 4BH7A 4CU6A 4D0BB 4F7MA 3N3EA 4NKIL 3G1SA 5E9DA 1BPLB 2V17L 3PWVB 4PVBA 2VN3A 4P06A 5HYQB 4ICMA 5DHVH 5D72H 2E46A 3ABMB 3NOIA 2FPVA 3ES7A 1WFOA 2YUZA 1LO4L 4ABVA 1EO8H 4WUUA 3P9MA 3ALWA 4NFCA 1KFBA 2C14A 4XPHH 1PCWA 5IHSA 5DRXA 1DSWA 3ZDZB 1DFBL 1PYWB 4BGDA 4LT7A 3TIDB 2BNRE 1XAKA 2P24B 3R06B 3PLYA 3UXLA 1JXKA 4V2CB 4K9EL 1IEWA 1KFWA 5DT7A 2G9HB 4H20L 4MAVA 5C2CA 3I9PA 2VR3A 3MLZH 4HZ8A 3FBKA 3TEXA 3FIGA 4AU0A 3EA1A 1WYIA 2CR0A 2DIEA 3RWJA 2X7WA 3RDTB 1K1DA 2YGVA 3JWOL 2BIIA 4OD1L 3V4VB 4Q4SA 3RJOA 3FGCB 1ONWA 1MFCH 1YKWA 5D7LA 1IO4C 4LHJB 3G6AA 4TQIA 3TPUB 3L5LA 4P3CH 2VN7A 2BY1A 4ZZKA 3THUA 1VHPA 2D2OA 3HB9A 2XFRA 3ZIZA 3VW3H 1UCWA 2W79A 2FT7A 3DI0A 3D4GA 5D8WA 4LL1A 2HCVA 3GAKA 2AXWA 1HZKA 3QM3A 4N20A 4GY0A 1PKLA 4XZUB 4OFPA 1EFXD 1CI5A 3ITLA 3QQ1A 1CVRA 4R7NA 2WYHA 4QQUA 4JRYA 5EBWB 5GGRA 1T0PB 1RZKL 2N3JA 1X4XA 3D18A 4JUTA 2CALA 2GGJA 5D71L 5EEWA 3C6EA 1TPWA 2FJFA 2CHXA 4YSSA 5BOFA 3QC3A 2APBA 1IZCA 1Q9KA 3HG2A 1Y6KR 1ND0A 4PBXA 1CW2A 4YDLB 2F1BA 1YLVA 3LHTA 3NEXA 1BFNA 5DFTA 1CU4H 5LIYX 5KSAD 4G8FB 1TB3A 4OV6F 5FEWA 2Z8WC 1AD1A 1WIOA 3BSHA 5KVDE 3X3GL 2EEBA 2F08A 3DNKA 2F5BL 3EYVB 2J78A 4RAUA 3WLBA 1OAQL 3T9PA 1S5TA 3RGVC 4UT9H 5I30L 3REWB 5FM4A 1AKJA 2XTKA 1RIUH 5HDLA 1IAIH 2X1XR 3CHFA 1TUFA 3B9DA 1DVXA 1JXGA 4U4MA 3PP3K 2YA0A 4LLWB 1IT9H 3WFCL 4IS6B 3MVSA 2R94A 4ZFOB 1MEWA 3BP4A 4ANUA 1EBGA 3S1WA 1J2BA 2ZCLL 2ENQA 3ROLB 4MNQB 4Y2NA 1DSFH 3AU6A 5ETUB 1UG6A 3OKEB 5IFHL 3QV9A 3GNNA 5B1KA 2CHDA 1GHSA 4XNBA 5JIHA 1H3XA 1T04A 2ENPA 4XI5C 1S7UB 1U4FA 3AYTA 3AUOA 1T66D 5K9CA 1ZXKA 5DT5A 3STFA 3AADB 4EIGB 3NQEA 2PP0A 5K33A 2GFBB 3WY3A 1QNOA 4NYLB 5TE6H 1F3TA 1T6VN 5K9QI 3L4YA 3PCYA 1W72H 1T22A 4MDOA 3VINA 5EB8A 3EJYC 2WHVA 5D33A 4QLKA 5HHMD 1XCWA 1XTMA 4NQEE 2UX7A 3FCTA 4I5BB 4LS0A 2ORBH 4Z95L 3FHQA 1D6EA 1DXEA 2V82A 3UAJD 3ECQA 4D71A 4Y2DC 4WTZG 3TXZA 3INOA 4MLRA 3KPTA 1UKOA 1KLUA 4P2RB 3V4PH 2BM3A 3KVMA 1KXVC 4HIPA 3K1GA 3ZL4H 4PMZA 4KNQA 1UWSA 1X96A 1MEXH 4XTIA 3CB8A 3DTXB 4XP6H 1GQKA 2NXHA 4JBRA 3GO1L 2P5PA 3MBXL 1R3VA 3Q37A 4Z6AT 3UP6A 4WO4D 1IGIH 4XWGL 2QUVA 1ZCOA 3WLPA 4JO1H 3TA3B 1GS7A 3NCJH 2H1XA 3KTXA 1DQMH 3S6TA 5AB9A 4IEFB 4LSSL 4Z7QB 4DBUA 5FA3B 1ZLUK 5CLTA 2R4SL 2A99A 3N9RA 4EE2A 3SO5A 1OO2A 4HSQA 4PJDB 3QT2A 3CFMA 3L3IB 4I0CC 1J9SA 4RFOL 5IQLA 2LLNA 4G6FB 3WDIA 3CVHA 3GI9H 1QHQA 2Y6SD 3C0SA 1T2QH 4LVEA 1D9EA 4YAQA 1RQEA 3LH8A 1FP5A 2VISB 4KPHL 3QQ3B 1I7UA 4S2SA 4C6MA 1A53A 1EEPA 3WFHA 2VTFA 2I5IA 5D7EA 3TYBA 4QAMB 3FPYA 4G2AA 4P4RB 3S3SA 4X9BA 4JGUA 4MA7L 2IMNA 4B5TA 2ZX7A 4PGZA 3PUOA 5JOPE 4W9TA 3V9CA 3BI9X 4ELKB 1O4UA 2YX0A 2A1WH 5FEXA 2KLTA 5K9KB 4ZFQA 3KYAA 2ZWZA 2NLYA 1MNSA 4GKZB 2E6JA 3ARGA 2Q3ZA 4RGNE 3L2IA 5HDOA 2O55A 3DVIA 1NFPA 4PRHB 2VEMA 2GSGB 3TYAA 3E8UL 1JDEA 3AS1A 1UR3M 1R8LA 1S8DA 3TEZA 1VKFA 2X9YA 4R27A 3DUSB 5D38A 3FA4A 3GHTA 4UV7L 1YW1A 3LVTA 3NIFE 2X4TB 1MH5B 1P4IL 1F4WL 1R3LB 2B1AH 2G75A 4P5KA 2OTUB 5A8PA 3MX0B 1KBGH 4FIQA 4HKPA 4UANA 3SYPA 1RK5A 1GVEA 3QYCA 1DWFM 3MV7A 2PW1B 1PTZA 3STPA 1D5ZB 5EC2A 1QWHA 4ZFOL 1R6VA 3DRTA 4X5WA 3QXDA 5EZOL 1RSCA 3OA5A 1NKRA 4EWJA 3FO2B 4MJ4A 2D9QB 5CBEA 1BYNA 3V52H 2DZVA 3HV9A 1L9NA 5G4MA 2VGBA 5HHVH 3N2CA 1IFRA 4X4YA 1BVLA 2X53A 3FFCB 3QOMA 4DP5X 3GJEA 4L4TA 1UH4A 4PRRA 1G9ML 5F7LB 3HS0B 1DVFB 4M62H 2GIXA 2KKQA 3OAYK 4Q8PA 3ARSA 1I3VA 1DBJH 1DZBA 4LVOB 5GHWL 3QEGL 4M93B 3WOVA 4GNKB 3CAKA 1KJ3L 5I71B 3K71A 1I2QA 5BW7A 1FVDB 2HRGA 3BYTA 3IPBA 4Y8AA 4DEUA 2E27H 2XTJD 3U4BL 3GTHA 2J77A 3MJ9L 3OSKA 3DEQA 2PO6B 2GUBA 4M1CC 3BUBA 1OFBA 5ADPL 1NCUA 1ENUA 4N2FA 2ARJQ 3K1KC 4JX4A 1OF6A 3C5SA 4NDMB 1N55A 5BROA 1UM6H 2JJSC 3OP2A 2XA8L 2OXHB 4LF1A 4HCDA 5HMDA 3WFZA 1DQLH 1OIMA 3VO0A 5EIIA 2WBWB 5CBAB 1P5VB 5B8CC 1SHWA 3VH8A 1SXCA 2J88H 4IHOB 2F15A 1XXFC 3QUMB 4HK5A 2MRYA 2OXNA 1D5IH 2R83A 4WHTB 1QDSA 4HYRA 4JTDA 1TCMA 3QLDA 5MEPA 4F57H 1IUZA 2V68A 3TCLB 5KTLA 4WFEE 4DK5A 4RK8A 4DXVA 4R5VA 3N55A 1RLDA 1OC5A 2HT3C 2HWZH 3QHNA 4AG4H 3QW4B 1SGJA 1R5IB 3WD5L 1ODZA 5GZND 5E00B 1SO4A 3VCNA 1GS6X 4IPLA 3NUKA 3ETBJ 1FWRA 3QGKC 1X5FA 3GUWA 3FCSB 4JPWL 1FCQA 3T8VA 2OQJA 3K74B 1OC6A 5DJYA 5FGCE 2BSED 4QDMA 1AZ1A 5C08E 2EVJA 2GIYA 2DQJL 4LSTH 4KRPD 1YUKB 4YLQT 2OXGA 5IEHA 3V0UA 3ULUF 3B9KB 2AJVL 1RY7B 4DBSA 2PETA 4A66A 3VCCA 2CO3A 2PCPB 1PGRB 3MC5A 3DUGA 2RMNA 3UO1L 3V0EA 1UXSB 2E28A 2DJ4A 4WOZA 1EC7A 4BM7A 3NQ8A 1LWJA 4XK2A 4OCXH 2NX5E 5IZ7A 2VOTA 3D2UB 1MFBH 3HNTL 3EWDA 3WDRA 4N2NA 3C12A 1MIML 1MHHB 4RGOL 4P2QB 2M2DA 3ZKQD 3FO9B 1RURL 2OMZA 5A43C 3KLDA 2AITA 5C09B 2YD6A 5I1IH 3PIQB 5KVEH 4NPYB 1N3NA 3C5ZB 4ZTXA 1X7SA 4I2XA 3QQ4B 4W68A 3C6LB 5AL0A 1DQQB 4TMCA 4K3DL 5KZCD 2XISA 1WITA 4XZLX 1Q2RA 2W9EH 4E9RA 3NK4A 4GEJA 2IDUA 4LAKA 1QKZH 1BEXA 2YLAA 1GTNA 2GTWB 3ZTJH 2XWBB 4X4XA 2VM4A 4LAOA 2YUXA 3EOUA 3GDCA 1L6SA 4L4OA 2JB6A 2Z4GA 4QRAA 4X83A 3WK1A 4NOFA 3TVMA 4LLMB 2WPGA 4TVPD 1JDAA 4JM4L 1BVNT 2VE6B 2X0WA 1XCQB 4XXWC 1L9PA 3RPIB 3SDCA 2AQVA 3SKUD 4Z1PA 1V0LA 2G5UA 3WY4A 4BJHA 2FTWA 1E8ZA 4JO4L 3TTSA 5FC9A 4EP8C 1SFSA 3FB5A 4QRPB 1J0JA 2RGSA 4NQDD 2Z34A 2UZIL 1I3UA 1YUHA 2CNYA 5ISZE 4N6RB 3WIFB 3EWZA 5DSCA 1SUHA 3SN6N 4A7UA 1MCPL 4LC6A 4FQCL 5TDPB 1S2TA 3MUGB 4LEOB 3SDYL 3F7LA 3MCLL 2EE6A 4KDVA 1T2XA 5D4YA 1V5XA 4DGWC 2VXUL 3FO1A 2PXYA 4A2SA 5IFAH 2IKIA 4ZOCA 4R96B 5D1ZC 1OIOA 2HDJA 1DBAL 3T4AC 4LCIH 2Y62A 3SKMB 3LKOB 1D3HA 4IRSD 1S7XA 4WWKA 1FNGB 1SQ2N 2X70B 4RWYH 3EB3A 1U8LA 5DEFA 3FQUB 4ZMYA 1KFAL 4G56A 3QRGH 3KTCA 5D7SH 4MD0A 1TCRB 2G5BA 3VGHA 1KIPB 4ZX6A 2PDWA 4JR9H 4NJGA 1SM9A 4XKYA 5B39G 1XFCA 5F4XA 2GDVA 3D34A 2MNWA 3WK0A 4MB3A 4NI6A 5BPPA 2JLLA 2ILLA 1OXYA 4PFEA 2Q3XA 4LUJA 3FFOA 1DDTA 4E9TA 4DPAX 3R43A 4DJFC 3ZHKA 4BCXA 2P9RA 1T4KB 3EJUA 4HJWA 3OAUH 4HCGA 3B2DC 5KVGE 4WJ5A 4ONHB 4PVNA 4D0CB 4OUIA 4MIMA 3O2LA 2DJSA 5JNYA 3A6BL 4AYMC 3HCVB 4WEVX 2B31A 2DLFL 4OVXA 4BZ1L 5DY2A 3SGEI 3UYCA 4JDVB 2DYPD 1EAPA 2RTTA 1JGUL 4FYTA 4V1DE 3LCFA 1P84K 2X2UA 3FF8A 3WH7A 1Z5LB 2VDIA 2WKJA 4C56E 4UTAA 2VCCA 4I1RA 1VRSA 3TZVB 3M5ZA 2MQCA 3AVEA 4OJFL 4KKQA 2EC9U 2P3EA 2CJUL 3MMDA 5L9FA 1WUFA 3PWIA 1GJWA 2C34A 4OB5H 2W67A 1VZIA 2X0VA 4YHKH 3ML8A 2Y6TE 2DD8H 4JFUA 1KIUA 4CRPA 3MBEC 4H83A 5EBUA 3TMQA 1Q94A 4IOIA 5C9JB 2VFDA 4UU9A 5MKGA 3FVMA 1BBJA 4AQLA 4IJTA 3SGDH 1O5XA 1BVKB 4NZRH 2PTTA 4J1OA 2HNHA 5CFHA 4LMQI 3BSMA 2IH3B 4P7OA 4NSKB 4EI5A 1AL8A 3T4WA 3NCBB 4ZMNA 4ZTEA 2DJMA 4JHUA 3PZTA 2PCXA 4JFDB 5AOJA 4QRTB 5FFOA 3K5SA 4ZYKA 2FJGA 3QC6X 4OGQC 1EEYA 4QYAA 3T0AA 4I77L 1E3XA 4CD4A 3WFBH 1R5VA 2AQPA 3KCJA 4BQ3A 2AXFB 4DP2X 3O8XC 2Z1XA 5FJRA 4DAGH 1IGTA 3F85A 4IG2B 5D8JH 2J44A 4WOQA 3IMBA 4FQXA 4KJYA 1NL0H 5I1JL 2W91A 3FTZA 1G7UA 2OEKA 2X1WL 4LOEA 3R12A 3LN5A 5C70A 3MHGA 3VFNB 2MFNA 3LZNA 4G72B 3PNWB 4JIEA 1AQ0A 5IDZA 2V33A 5JMRA 3IJEA 4HWNA 2VSMB 3T2OA 4PJHE 3F2LA 3GMRA 1S5MA 2Q7NA 1BAGA 1CF8L 4JRXB 4YE4L 4JFFA 1A0DA 2QT3A 2J73A 1FG9C 4NKMB 3MPCA 3QIWC 5INCA 1D3CA 1SQMA 2X7LB 1UVQA 4NRXB 3WEZA 5J8LA 3S7GA 3ATFA 1MCOL 1N18A 3HEIB 1SUXA 3JT2A 3ARDC 4XD4A 1JDCA 3OKNB 1VZWA 1AR1B 1ACZA 4LP4A 3BFQG 1WV7T 2Q2LA 3WQ8A 3PG9A 3TP4A 2E6DA 1UIOA 5C3IA 3ARFA 5FR3A 1A0CA 3O0KA 3QKEA 3V0HA 1OAJA 2H26A 1FO0L 1IM3B 3OU8A 1NEUA 2ZG3A 2MMXA 4KHTL 3AXLA 1ODUA 1B4KA 1HJWA 3FC8A 1BXXA 3VKAA 4Y8EA 3NZPA 4LVBA 1OTSD 1T1XB 1UFGA 3PWUB 5CEZE 3RHWK 2VR5A 4JS3A 4LVGA 3LV6A 3UXIA 4NJHA 2N4IA 1MCFA 1BM3L 3JVGC 1TJHL 4G7EA 1MJ8H 4DPQA 3AMLA 3DFNA 2C1IA 5LUMA 4RRPA 4XNDA 3NCXA 2VWSA 1M01A 1GKQA 2V2WB 1GZ1A 5I1AB 4UTUA 2LT9A 3L13A 4ZG1A 3KLAA 4PEEA 1FCUA 3INPA 4PJ5D 1EJ8A 3OJVC 4BD4A 4NC1E 3HTWA 2Y72A 3ZLQC 2OMBA 4L9DA 3O9NA 1E6OL 3LNIA 3S5SA 1P48A 6PCYA 2UWFA 1AG1O 1EZ2A 2P49B 4CMHC 2WLZA 5F1KC 3V8CA 4X7TB 5C3TA 1MPAL 1OOWA 2EDDA 1PX8A 4JE0A 1A5MC 4BZ2A 2YXVA 5C07E 1DEEA 4ZXBD 1WV2A 1G1CA 1GY2A 5IQ7H 5AW9B 4MZ2A 2CGRL 4W93A 2G4FA 4FG4A 4JLRA 3CDGA 3FXIC 1I8KB 4BFAA 2RA1A 3UYOD 2CYGA 3D05A 4JFEB 1PDKA 4OCYL 2J56A 4GVFA 3ZKSD 5EC1A 4P5TA 2GOUA 4RVBA 2PTDA 2BO0A 2A4CA 5BUAA 5AW7B 3S46A 5ECUA 3UA3A 1K7XA 3GDTA 2XFXB 2ABBA 4FTVA 1XLBA 2YD4A 1FRGL 4TNGA 4JFSA 3IXTB 3BKJL 1PTGA 4NILA 2AJUH 5BMXA 1N0LB 3UTSA 4LSPH 2V3EA 2P80D 1ZL1A 3EMQA 5LN8A 3F4VA 2F5AH 3KHJA 1CR9H 2CNZA 2C3WA 3WUFA 4PJGA 1PE1A 5KYYB 4HA1A 2KS0A 4AM0B 4L29A 4M6OH 3VRIA 2CO2A 7REQA 4N4YB 1ECYA 3FCGA 5LG6A 3CC5B 1XL4A 4OF0A 1EEZB 1EKOA 3VDBA 2ADYA 5EZLA 1QOXA 4PJ9C 4XZBA 1S1PA 2N0KA 1T7WA 4IM8A 2H41A 3IPWA 4XCYB 2F53A 5BVJA 3WQVA 3DVGA 3R1GL 2AEQL 1HH9B 2CKBB 3L67A 5CP7A 3HNVH 5BOZG 4MRBA 4L6OA 4PRPA 4P2VA 4ZQMA 5GS3A 3WYRA 4AE0A 1CDCA 4P9HC 4CVUA 1PG7H 3WTUA 4B92A 3MROB 3BXNA 2RCSH 1KMGA 5G4EA 3FT3B 4UNUA 1Z9NA 4EPBC 4XBJA 4PJGF 5CCJA 3ECWA 1PYMA 4Z3EA 4MF4A 4F9DA 3RVWD 5IREA 1U93B 1WAAA 2J4GA 1G94A 1LOQA 3AM8C 3NA4A 1FYTB 2HS6A 4PJHF 4Q8NA 1M1XB 2VDNH 3OKKB 3WJLA 3Q8EA 4QRRD 3Q44A 2VI0A 4F24A 2P5ED 4A2EA 3ZSTA 4IGBC 3BZFA 4UYPA 2PDFA 5K9OB 2X2YA 1AR2A 4JO3H 4N22A 4F2EA 4ISVB 3NO1A 4RCXA 2Z31B 3EOSA 5CJOL 1NPUA 2OCFD 2IAMC 2VYOA 2GUOA 1B2WL 1YPZB 2V0AA 2OVLA 1GVFA 2VXSL 1HSAB 4AV5A 4AZCB 3VI3E 1FZKA 3V4UL 4PJFE 2DLEA 4G1MA 3Q1EA 3TA9A 1D5BB 3RUGA 4HNOA 4M6UA 4JY4A 1MAMH 1LK2A 4JX0A 1MFAL 4LQ1A 5HHOD 2VDLL 3HF3A 3C08H 5BXSA 3T0VA 5K93A 3K2GA 3TROA 3DX2A 1LILA 3T3PB 3ANVA 2AV7A 4MLIA 2FIQA 2NY6C 4A55A 4JPQA 3WUGA 4FQ1L 4BK8A 1MCEA 1QPOA 3MKGA 5DS1A 2P4AB 3ZQWA 3IIOA 7A3HA 4XOEA 2ZQKA 2HJFB 3NQIA 3M6DA 2DEWX 3ITTA 3DJTA 4DJEA 2WQWA 4BFGA 2A3LA 4YXHH 3IFLL 4XVEA 5K1NA 3SE3A 3KPQB 1Z9PA 2CLKA 3FJNA 2L5HA 1RZGA 5FYLH 1UZ6E 4L1BA 4FXLA 2QQNH 4U33A 5T33L 3FH7A 3VSVA 1UC4A 2NZIA 3EX4A 1FNSH 4D9LL 1Q6GA 4J8QA 2FTAA 1XUZA 4LSBA 3Q8AA 1CX9A 2PBGA 2AEOA 3WTWA 3FA5A 2QT6A 1N64L 1TZIA 5FO8B 1YJDC 5D09A 3RUGF 2Z2UA 3MRKB 3BLDA 2CH8A 5FLUA 4LLDA 3SE4C 4N9DA 3H0TB 4WSKA 3LQGA 4YWSA 1E5ZA 3FKUS 4KK5C 2CKNA 4RFEA 1ZGLA 4D8PA 1NCBH 3F12A 1OX4A 3VFGH 1MJJB 4P3DB 5FM5O 2HK0A 3EXTA 3J8F7 2OYPA 4WFHD 2ERJC 1RUAH 1A4JB 1UM5L 2Q5BA 3RWEA 4N02A 4JTJA 5IJKC 3T44A 4LQFL 4S1RH 2JNZA 3NGFA 4TSCL 1QRND 1ICSA 2EIZA 3S2JA 4NKOB 4DEPB 3TN4A 3PWPE 2XYLA 2R0KL 4H1LB 3UR5A 4PA8A 1KGJA 1NCWL 1CG9A 4WVXA 5KSUB 3PHQA 2J8TA 2QVMA 4C6BA 4IU2B 1DJNA 3ME3A 1P4LB 3DRQA 3ECBA 3WD4A 3S37X 3DVFA 3VOHA 1S3KH 3SY8A 1SJHA 3VNDA 4FXKB 2GGHA 2CKBL 4XN4A 2WMIB 1XYZA 2D7OA 4QLRA 2YB4A 5DA4A 3FONB 3KGSA 4PJBB 4JOMA 3EH3B 4O8AA 4QNPF 2VSDA 3UOAB 3FUJA 4RNFA 1MOEA 5TDNB 2OJZL 2YUVA 2OS7A 4ZSUA 1W6LA 5I5JA 3AREB 2BC4B 5KITA 2ZXEB 4PYSA 1LO3H 3L4ZA 2YEVB 1AG6A 5XINA 4MZ1A 1D9KC 4L9ZA 3VI2A 2XZ7A 4E8GA 2UV8G 5J6SA 5C55A 3D50A 1TVNA 2WVTA 2DW6A 1O9VA 4N25A 1N5AB 2DVXA 2MOQA 3UZEC 1HKVA 3M1CA 1HHHA 2VH5L 5CAYB 3QPQC 1UM4L 4XIMA 1KXHA 4E9VA 1DN0A 4QWWD 1LE9B 1JNNL 4O0KA 3FFDB 4LCRA 2EDNA 3LHWA 3VXUD 1YMME 3GMPB 4DJMA 5TQ2L 1GOIA 1EBAA 3ROOB 3PBGA 3ES8A 3DUUB 2RFGA 4ODTH 3WCYA 1MCSA 6XIMA 1UD5A 4JM2C 4ZFZB 3D52A 2LTQB 2JCCB 3V0TA 1FL3B 2WQSA 1GKEA 2CZFA 5FPIA 2WKOA 4LC8A 3QG7L 3MNVB 5F4SA 5D7JC 4QTIL 2I5YL 4CL7A 1ZVNA 2W9DL 1TJGH 3LRMA 4OE7A 3KE0A 5E94B 4KK9C 4MQ7B 2YD5A 4JQXC 1KUMA 4GXVL 4XNXL 1XLFA 4TLUA 1R3QA 4KF1A 3HE6A 4XGZB 4GLRI 3GX9A 2FWOA 3UJEA 1B0RA 2KZHA 5D1QE 5BWAA 1JPGB 3VU1A 3B97A 4YHOL 3R5EA 3AQDA 3NFUA 4PJFF 2V2CA 5F7DA 4HISA 3P9LB 2NYKA 1A7QL 2APSA 1X6LA 4RXGA 3H4FA 1ZLWK 1TG8A 3HG0A 3NJ3A 1HDMA 1SZNA 3LEVH 2JALA 4W5ZA 3GSQB 1ID2A 4XOCA 1QR1A 3MA7B 4ML4A 1E2ZA 4KUZH 3UFIA 2BFGA 2WKOF 1XR8A 1C3FA 4DVBB 4P2RD 1N2VA 3S97C 3STZB 4Y0GA 2PPEA 4JCMA 1Z3GH 4HC1A 1KPUB 3VFTB 2PDKA 4PY7A 3B9NA 4M9PA 3QWNA 3KDMB 1SY6L 2AJZB 2D0FA 1KJVB 1NA8A 2NR6A 1XH3B 1W3JA 4XRCB 3N4EA 3ZHLA 4YMZA 2OK0H 3T08A 1UZ6F 4IQEA 5FHBL 1V6YA 5E08H 2XTSA 2DV6A 1U91A 3SQOL 1Q9LA 2CCWA 1NGQH 6TIMA 1FOBA 4YIWA 2GPZA 3W11C 3CFJA 3SQMA 4KK6D 4LT9A 4XN8A 2IPUG 4BQ5A 4QXUH 1YRKA 1QSEB 4NNBA 1RQ5A 1G7QB 1U8MA 4GRSA 5EO0A 1TJPA 3U4AA 4IBSA 3F7YB 4MCYB 1BOGA 5DU7A 1Y7VA 1EBPA 4KOCA 3HZVA 3LZLA 2JLPA 1L7TL 5FYKL 3NGBB 3QNXA 2PWEA 4GGHA 2I9EA 1MIEL 5LNUA 4OLUH 5B7ZA 5T1MB 2MH4A 3QCTH 4JNXA 4G7QB 4MA1B 4YR6A 5C6WH 2R0LL 1PG7W 3CMOH 1K8DA 1GY1A 2ZWYA 1CICD 1R9ZA 3VXME 2BMKB 1I7TA 1WJ3A 2F1AA 2Z25A 1EOMA 5CILH 1HWGB 2I07B 4BSWB 4W9LC 2Y6ZA 4K8RD 4HSCX 3F84A 4NQ1A 5I8OL 1XPGA 3LB0A 2BV9A 2FLRT 3UO8B 5F7EH 4TLTA 2Y5TA 4YLCA 2BOCA 4UR7A 3RY6A 1W0YT 5EOCJ 3SOTA 4XP5L 4G7VH 2E56A 4JPSA 1MRDH 3ANUA 3AMGA 2AQWA 2EYTB 4QTHB 3UR2A 1SZRA 1LL1A 2R69H 3OZKA 4JL2A 4IRJC 2C4FU 1E6JH 5DMMA 1M7DA 3D09A 5I78A 1MFNA 1DJIA 1GJPA 4HX1A 4QRQB 2P46B 2TSAA 2QQ6A 4BHUA 3B04A 2BK8A 4MAYA 1VFHA 2Z7ZA 5CBIA 1F3JB 1VLWA 4BEIA 3W39A 2W0KA 4N2GA 1JVNA 3NPSB 4K7PL 2REQB 1J8HE 3TK7A 1QA9A 4BQ4A 1S46A 3LM3A 3VWJA 4A6YH 4A7TA 2EIDA 1I1AA 1QI3A 2LABA 3H9YA 2DQDL 5CJBA 1BX2A 4IYKA 1XINA 1CK0L 2FO8A 5HPMA 3GBMH 1GCYA 1LZOA 1IGSA 3QPXL 3W83A 3UTOA 4INFA 2V63A 1K02A 1TR7A 3T2NH 4UR9A 4XO3A 2WIIA 4FI8A 4AQOA 1ZS8B 1OGBA 5DJCA 5FYJD 1N10A 3HMWL 3HN3A 4BFRA 5F9WB 3CDFA 3SFWA 4Z2IA 3DXAE 2XY1A 2NSOA 4ZQRA 2WHMA 3PZMA 1F6FB 3OPZH 4HIJB 2WTOA 3BP6B 3OR6B 3TM6A 3WZ0E 1DL7L 3LKNB 1HS6A 3RY4A 3QAZB 5I18L 1YTDA 3RGTA 1EMTL 4Q6IC 2ARJB 1THFD 5HUPA 3D08A 4H6QA 3AAZB 3SCMC 3M5XA 3L4CA 5BOOA 2V5MA 2C4XA 4FXGB 5E8DL 2EILB 2VABA 4GIRA 4Y4KB 3FB7A 2NUWA 1UYWH 5DVNA 4FABL 4FJZA 2PCEA 4KY1L 3DVNB 1KELL 5DRZB 3A67H 8RUCA 3H21A 4PB3A 4P8UA 4JPKL 1XIWD 5CSBA 2RR3A 2QHRL 2EDBA 2CSPA 2C1OB 4DK3A 3O6FA 3G0SA 2FZNA 1T1ZA 4TXVB 5JR1L 3FKRA 3IAGC 3WNIA 3SKOA 4YSCA 3S96B 1NUFA 3QMSA 4OZGE 4GYKA 4FHBD 4JR5A 5GXBB 3GU9A 4RIRA 5GGTL 2QGBA 4EVNB 3NAAL 3H2WA 4HIXH 2IAND 1G6VK 2NZ1A 3T0EB 2ESVA 5DWUH 3MQIA 3TN0D 5C0CB 2CRIA 4B53A 2E7MA 3DK2A 2X05A 4JFXA 3EJSA 1PHWA 2IXVA 1H3TA 3DSNB 5BNKA 3QH2A 1DUYA 2PRHA 1B4JL 5E6SB 1HP5A 3SADA 5FGBA 4PJEE 4AD2A 4JFPB 3MRRB 1B90A 4Y1AB 5F1UA 1FWAC 2E9WA 4CQ9A 5E2WL 1IBZA 5AZ2L 4QHMB 5KVEE 5DUBA 3QUYC 1G7JA 4B9ZA 5AD0B 4IFOA 5HOSA 3L6FA 4KETA 2RIKA 3LCHA 2PABA 2B0SL 5D32A 4WKZA 4YCOA 2TSBA 5F7AA 1S7WB 4UDUB 3X11B 3IMWA 3INUH 2R1MA 2P5WA 3QDGB 1JFQL 2WMFA 4ODUB 4Y16D 3LGEA 4O1EA 4MBOA 4PJCB 4IJCA 4UFIA 3PYCA 3C60C 4LAMA 3VD3A 4AEOA 3QUKB 4E4UA 5AZ0A 3CVCA 3F03K 2GUUA 5AAPA 5DMYA 2QJJA 4B96A 3A6CL 1U83A 2BGSA 3LRLA 2R0WL 3IVKA 2DQIH 1BYPA 1DQWA 2WN3A 2WLIA 2BNJA 4Z7VE 1Z7AA 1MAKA 3MRLB 4OKDA 4ABWA 4L6DA 3KS0J 3C5ZD 4XPFL 5EF3A 3GUTA 5E5CA 2QMJA 3TOYA 2X28A 2XWZA 4IRZA 1UQSA 1RVFL 1JTTA 1TPXC 5ICZB 2VLMD 3JRKA 1HK6A 3ZE1E 2Y8UA 5C0RL 2VUNA 4ZEPA 3K3QA 4WFFD 1K8IA 4OT1L 2QPEB 4PL2A 1AHMA 4Z8FH 4OF5A 4KKBC 3FQRA 2OAAA 3ZHFA 4YDKL 3S35L 4GUIA 2J5LB 4L1SA 3F01A 3BOVA 4PV9B 3BN9D 4A39A 2YEZA 4XCEA 1OSPH 1YECL 2YPVH 3EYSH 3QWOA 5EBLA 4UQ3A 4BINA 2VEPA 3W28A 3ISIX 3D6NA 4BY3A 3Q2LA 2PYED 2J71A 1OPGL 4RRPM 1NKGA 3T9WA 5DMIH 4W9GC 1LDCA 4LUYA 2JJTA 4QRPD 4S39A 2CGZA 3QUZB 3TJXA 3N0AA 1LDPL 2AJXH 4AQEB 5C0EA 2X3BA 3KCLA 5HHNA 5ECGA 4HZ6A 4GP8B 4NZCA 5JIDA 2PB1A 2FJHB 1X4YA 1SGKA 5K69A 3N41B 3MBWA 3VDAA 5KSAC 1FWNA 3DMMB 3ZZQA 3FN0L 3SJVD 4KROB 1NGYB 1UH3A 3DO7A 4QHUA 2XPKA 4JVPA 3FUHA 1ITUA 2HKHH 3KEDA 4I5UA 3N4AA 2XX1A 1UJ3A 2FEEI 1QCWA 2X09A 1DDHA 3IS4A 4YXKL 4OIBA 4KU1A 2MTAA 3EOAB 3SO3B 1VPXA 5CUSL 3NA9H 4XNAA 3D3VE 5E6IB 4X0KA 3ULVE 4XHJD 3RY5A 2H6RA 3KOWA 2BFVH 1F74A 2B4CH 3IUIA 5E5MA 1R1CA 2VAAA 1P1VA 5EO9B 1JZ2A 5E1QA 1CZ1A 1K2DA 4QJ3B 1OW0C 4NM4L 4Z7UB 4GG9A 4LLQA 1IQDB 3GFZA 1SJMA 4L4JA 3BH9B 1QNSA 1YQ2A 3E7JA 3WDJA 3UX9B 3LPOA 3C4UA 8FABB 1G7PA 3LRGA 2E09A 3GW3A 1PDYA 2V9RA 4KTGA 43CAA 1RY8A 4PFHA 4R2GB 1XX1A 1T20B 3IWVA 4W84A 1A5CA 3TLQA 1AZBA 4GVGA 4OIIH 5CEYA 3JQOB 1MZRA 4ZQKA 1FIGH 3F8UB 2LVCA 4YDIH 2VGIA 1G5AA 3GJFH 2WLLA 3LPPA 2YAQA 1CYWA 1VERA 3D0AA 5EMMA 4EX4A 3FY1A 4JDTH 1INEL 1LVEA 4MJID 3BIKB 2K0RA 4DO6A 2Y0FA 1OCJA 4OY9A 5LNWA 4NM8L 2XJKA 1I4NA 3H2FA 1PJWA 1ZP3A 3OHIA 3O9WB 4NNYA 1NDGB 1H15B 3GSXA 3KVKA 5EH1A 3C5QA 1GVQA 1TPC1 3V3WA 2PLTA 4WV1A 4TVUA 1O5KA 1ZTVA 4N2DA 3UZXA 3RIAK 1MHEB 3K5RA 2PTVA 4UAHA 1WF5A 1EDGA 2FNBA 3D0CA 3T77B 1TWZA 1AHWC 2Z1WA 4DZAA 3BW3A 2VM3A 5LCVH 1UA6H 4WO4C 3LZOA 2J4WH 3GNRA 3QYMA 2Z7UA 4U6HB 4QSHA 2XACC 4PMNA 4F27A 5MEQB 5KBPA 4N4PA 2D3LA 1VIZA 4CBZA 4RMWA 5ABZA 2L7EA 4NASA 1NC2B 3C2EA 1SOQA 1LRTA 2H47C 3KXFB 5FW6A 3OWRA 2AQOA 3WBYA 1F2JA 5CSZA 3S47A 2GIMA 1JIBA 2WJDA 1MCHA 1QK0A 4M6NL 5BYWA 5I28A 3B2XA 4H1LG 4YXGA 4APQB 5M17A 1DCLA 4U1SA 3MSYA 4PREA 1R3JA 5ID0B 3QFGA 2OLSA 3RWIA 1QEWA 5A6MA 5J12B 2KDGA 4Q7NA 3PL6B 1Q1JH 1S9YA 1ZHNA 3MV9E 3FN3A 3W7HA 1YEKH 1GOHA 1U58B 2ZUSA 1FE8H 1PXGA 4Q9RH 5A2AA 4U7SA 2QGHA 3BD3A 5DLLA 2G3ZA 2MQGA 2EDMA 4NQEA 3OKLB 4JFYB 1HX0A 3VA8A 4I9WD 5HYJD 1O6IA 2A7RA 1BIIB 3EWUA 1EVTC 3P8JA 1Q72L 4NCC1 3IJHB 2ZE0A 1U8IB 2WK2A 2F68X 3TO4D 1H9DA 4DN4L 2WZTA 1XKYA 5AN7A 1NMBH 3C56A 4R3UA 3V6OC 1E4XH 3HLAA 2PDMA 2D9CA 3UCCA 1JVLA 4G82A 4H0LC 4YX2H 3PJXA 1TMCB 5I2IB 1PLCA 4PMXA 3FT9A 4WGKA 3BGGA 4ZVJA 4O02H 3IJYB 2YSSB 3LCIA 3WYZA 4UBPC 1XLGA 1ASQA 3TJIA 2CU0A 2OTWA 2Y3AA 3DX4A 4WF7A 5IIEB 3ZS4A 1WBXB 2B15A 3PP4H 2PI6A 2FR4A 1ISZA 3AISA 2Y7QB 3VXSD 2H9GB 4QEHA 3TTEA 5DMJB 3DGGA 2KL6A 1ZGLM 4M7ZC 2A4EA 1E4KC 3MLRH 4YDJA 3E6FA 4O5LL 1H0DB 2J25A 1MCRA 3GXFA 3KPRD 3OZ9L 3DBXB 4JB9H 3SDDA 1XYFA 3ULVF 2XZQH 4NJKA 1FWXA 1YNLH 4ZT1A 3KHDA 4GZJA 2NY5L 1XC4A 2W62A 1OM3H 1BTCA 4ANXA 3QS2A 2EXOA 1ZAHA 2H9AB 1UZ8A 4LL9A 4NG3A 4PP2A 5BXPA 4JTLA 4NKQB 1B5TA 3LOWA 3BO8B 4C6EA 3K6DA 4X7EC 4GMTL 3L9YA 4NP9A 3O11A 5ALBL 4CNNA 1HSBA 2J74A 2BSTA 4FQHA 3VXNA 4AZGA 1IT0A 4G9FE 2X6CA 2GC7C 4HJSA 4M4RB 4LCYB 1O6VA 3ARVA 4QTFA 3SO7A 5HXMA 3PNRB 2VKWA 3HGOA 3NQFA 3LN3A 4QDPA 2Z27A 3V18A 4GJIA 4XX6A 3GSWA 5DHMC 4HD9A 4A4AA 2P8MA 2HVOA 3HG5A 1IC5L 5F89A 2QCDB 4QHLA 4F7TB 2AK1L 3KD4A 2Y36H 4DW2H 3SCNA 1MY7A 4B5EA 3O2DH 2JXMB 1J5SA 3SCTA 4F80A 1O7VA 3AMDA 3KLLA 5KINA 5CGYC 1NDTA 4A04A 3ABQA 1OZTG 1T0NB 3CFCH 4N90D 4FXSA 2Y1AA 2A9NH 4Z5RB 1VZHA 3C8DA 1DPMA 2G97A 1LQAA 1SM3L 2X41A 3TZNA 3VTRA 3WFEH 5DJ8B 3CMGA 3L81A 3NRFA 3GNXA 4XNUL 4Y4HA 2W9MA 3ATBA 3II3A 4KJQC 5DJXA 4GYPA 3QRHA 1S78D 4RZ4A 3HBQA 2OZ4L 3TCTA 4R6UA 3THMH 3DLQR 4KRPC 3RTQD 2PLKA 3LHPL 4XO6A 2SEBB 4GQPH 1P7QD 1I9JH 3GMOA 4J4KA 3GF8A 3O3UN 4YBHA 2C15A 3PP7A 2WIMA 2YBTA 1YX1A 3NIFF 2FZMA 1D5XB 1CXKA 4C1NA 3U0WL 2SFPA 4CN4A 1H5YA 2DT1A 3CBJB 4OV4A 2R29H 5ABFA 5AW6B 1F4AA 2PGEA 4ROPA 5LGZA 3LZQA 2YKLL 4K3JL 3MUXA 2FEJA 2WM0A 4OQTA 2D8KA 2VFGA 2R9HD 4GRMA 2DS4A 1F4XL 5JOEA 3TQKA 4WEEA 3QJUB 1KV3A 2I7GA 4U1GB 1GQIA 2OSLA 5IQMA 1UHVA 1GHFL 4EIUA 5LIUX 1IGYB 1FAIH 2G60L 3BHBA 2GQ3A 2XVLA 1UKPA 1OHLA 1VFBA 2VR7A 1P1ZA 3N40F 2G3NA 2Q6WA 2MQ0A 2E4FA 1RSYA 1VC4A 1NAKH 3R10A 3BT0A 3GKWL 3Q67A 2CO1A 4KKAC 3CWOX 4R5TA 2ZQ0A 1SHSA 5KETA 3JR2A 2ZWKA 4QRFA 3L95B 3CB3A 4WTWA 4IBLT 2ED9A 4G8IB 3ILDA 3C2AH 4KQ3L 4HUXA 5FKAB 2QFPA 2FZBA 4R3SA 4U1MA 2DQTL 1D2PA 5FYLE 1WEJL 2APFA 1INQA 3HBPA 1FO0B 3MJYA 1K8YA 2KQNA 5SWUA 4FFYL 5HDBE 4O50A 3W4RA 2Y7OA 1I1YB 1MI5A 2OULB 5HSFA 2B2XL 5AHFA 1BAFH 5HBFA 1E65A 1R87A 3KYNB 5C08A 5J1AB 1YEHL 3N6JA 4MFEA 1QBMH 4X7DC 3S2AA 1COBA 4MXQD 4ZMWA 1AO7B 2YPLB 3OQ3B 1YYMH 2E4TA 3H9SE 4KW2A 2ICES 1R17A 1U8PA 3QEHA 4GRLC 1YE6A 4EN3B 3V7AG 4IW4C 2EYSA 4TF4A 1DBMH 3MCOA 5DQDH 3BKCH 3AY4A 4FS9A 4YFDB 5DRWB 2NX5A 3PG8A 2HFGH 5I17B 4FYSA 1YYCA 4JGJA 3DIPA 2O5XL 4X42A 2VXQH 2W61A 2YBRB 1GZHA 3UIYA 3NZSA 3DC0A 3ATAA 4HNNA 4NX5A 2ZT9C 4WJG3 4YFLI 5KTEH 2BVUA 3E96A 3G0UA 5FL1A 3WIHH 3AQYA 1HQ4A 2VD8A 2ODHA 1R24B 3PDDA 2KDYA 4KUCD 1NC4D 3KOYA 3HHRB 1IJNA 2YL5A 2EUVA 1A22B 5IB1A 2V5TA 2QKIA 1D8CA 4GW1A 1FFNA 3BG9A 3S5LA 5HYEA 1CXHA 4PTDA 2OMVB 2QQLH 3IN0A 4K5PA 1E51A 1FKWA 3WH8A 1CL7H 2O9PA 3BKMH 1P6FA 3UJJH 1I3GL 1RQBA 2LW3A 3BVXA 1PSKL 5LG1A 1XIHA 2VQTA 4HIQA 3AIRA 2YL8A 5BOJA 4P9HH 1OGSA 2EDRA 1VFTA 2HT2C 3T4YB 5I0WA 1M3IA 4AZ7A 2DQHH 5FUOH 1EQWA 4KRNA 5CXPA 2A9AA 1V08A 1Q8AA 4F91B 2FECI 4XX1G 3PPHA 3STLB 4GCAA 4C5ZA 3MRGA 4HK0B 4KK8D 4LOVA 3O06A 4MWAE 5IVNA 4KTYA 2Z92A 3AUVA 4Y88A 5TE4H 4UT6H 1P2CA 4QHNA 1K4CB 4CD5A 2XZCH 1W1TA 5EUOB 5FJTA 4UIKH 1OCZB 1JPTH 3K8LA 2EBNA 2VLKE 3S3GA 4PJIE 2XSKA 5J11C 1H8SA 2WOYA 4ZMTA 1MCWW 2PCFA 4XNZC 1LBMA 4MJ6A 4KCUA 3HAEB 1T41A 5I3JA 1OAKH 1G01A 1HUVA 3QPYA 1MNUH 4L6HA 1MQRA 3EO1A 4GP4B 3SURA 3P0YL 1HKIA 2VFHA 3VI4B 3UERA 3DROA 3U9UA 1KO0A 2VN6A 3BFWA 1SJAA 4JTKA 4K1GA 3CQIA 1B54A 2JIXA 4LBEB 2N7AA 2R2EA 4OV5A 5TFSL 2HZHA 2R2CA 3IU4H 1GZQA 4PUNA 2IFFH 1DSYA 1MJUH 2V2TB 3QRFM 1PVHA 1BECA 2XDHA 2OZ8A 1JK9B 3B0PA 4QXWA 3BH8A 3QO1A 1JGMA 4DTGL 2JFEX 4LCUA 4Y4FB 4GSDL 2HB0A 3KZPA 2QLYA 3K4AA 5D1XD 4IMCA 1AS6A 4QOKB 4H40A 4XHQA 3UP1A 3OXRB 2XXCB 4PM1A 3L3HA 5HDWA 1I4FB 1QFWH 3FQNB 3OV6A 3H3BC 4M5ZL 2OX1A 2FMOA 4XNQA 4IKKA 4NBZB 1Q8MA 1BW8A 1H3PH 1H4PA 3FYPA 5C7ZA 2ZP9A 1AJZA 1UUSA 2OO0A 4DNMA 3NM1A 3QFDA 5B21A 1U3YA 1UP0A 1IKNC 4L4VB 3F65A 2CKSA 1QMLA 4V1DA 4FFWC 3S9IA 5A7BA 4Q9CA 2VDLB 1ZTXL 4C56A 3EYQD 4E9WA 1EP2A 4O2CA 3WS3B 2HROA 4WEBH 3RZCB 2GVLA 5M95B 1YQVH 2JJUA 3CAVA 4WWOA 4RDQG 4WI7A 4GFSA 4Q8WA 1A3LH 1YEDB 3WKMH 3MYZA 2H32H 3BISA 3V5FA 1UEYA 3C09B 2NWRA 1JPST 2C9QA 3SZKC 5EKYA 3MN8A 1UIPA 2ZICA 3ZW3A 2JF7A 4MMXC 4ORMA 3US1A 1E90A 1KG0A 1M3JA 2MKWA 3FJ6A 4IIHA 2PMZA 2XJ7A 1JGEB 4YK4C 2B08A 3EIFA 3ATDA 2XINA 2BY0A 3WJMA 3WXWH 3TZFA 4BFIA 5JO5B 3IKKA 2K3HA 2OR9L 2H45A 5IV2B 1NWSA 1Z0NA 5EWIH 3ZTEA 2QKSA 1BWLA 4ZOAA 2VQ1B 4NJ9H 5AYYA 1BHGA 2QKFA 3W37A 3BXWA 3U30C 3L54A 5CSUA 2ZYIA 3V0WH 5JXAH 1BVZA 5G2HA 5M94B 4GO6B 1KYAA 4ERGA 1NWOA 3KPMB 4D9RE 5H91A 1X6UA 4LY4A 2DDQH 4OLEA 4PEKA 3VZYA 3GMLA 1VGEL 4QXGL 3W2UA 3FU0A 5E4EC 1JRCA 3L45A 4PJHA 5EL1A 2ANUA 2ESCA 4AGPA 3QXWA 2W60B 1RLWA 2YC1A 1VGKA 3IFNH 2BSSA 1L8PA 1M56B 4IU3A 2CLZA 3CVDA 3R8HA 1Q6OA 4M1RA 1DE6A 5FA5A 3BAJA 3EEZA 4LRIA 5GGUA 2D03L 1OEZW 2XKSA 4N2CA 2ZOKB 4OCLC 1X5YA 2O7SA 5FGRA 4H88L 3HPLB 2ZCZA 4S11A 2E0PA 3AIBA 3S0PA 2AJ3A 1VBHA 1TO3A 3MA8A 4W4OA 4YL4A 2YDSA 4XVSL 2CRMA 1E72M 3CFKB 1YE4A 5I76B 4CSTA 2I26N 3WNOA 1B2YA 1KFGA 3VNIA 3S8FB 2QTEA 1XF5B 4UNVA 1JCYA 2WWNA 3QE5A 3T8XA 5MHBA 4EI6A 1NCDH 2E7LC 1XICA 4URTB 2GT9A 3SYQA 4OCWH 1IIGA 3HN5A 2V2XA 4Z08A 3K6IA 4BQ6A 4E5XA 4F2ME 4NZJA 1VP5A 2QHLA 1MREL 3P0VH 2I1OA 3CCHB 3W2DL 1DQXA 2DLGA 3U2SA 4H44C 4ALDA 4N0YL 4MA8L 4DEWA 3DJ9A 1L7IH 3E6HB 2B1HL 1CYXA 1EL3A 4NN6C 5GRJL 4PH8A 4WW1B 1TEFA 4P4KA 5RUBA 3GU1A 2XWTB 2IXQA 4WI0B 2FVNA 1JPFB 1DXIA 1XQKA 4N0UB 2QEJA 4JO2H 5C07A 1FWWA 1MQPA 4S3EA 3ILPA 3PQYD 1R30A 3QHFH 4ZUSB 1BZ8A 3AT9A 2NQ5A 1GWJA 1LM8V 3FCUB 1EAJA 4UTBA 2GVEA 1TQCB 1WBHA 2PDLA 3HE7D 4X5XA 3E2HC 5BVPL 4W4NA 4IIQB 3RFZC 5FESA 3DX6A 3N06B 1FLRH 4M80A 1KT2B 4GWEA 3WF0A 4B4FA 3IFPB 4A3HA 5KZEA 4R4FH 4AOFA 2BZCA 1U36A 3MGTA 3R8QA 2ZP8A 3ESVF 4F1ZA 1RCYA 3SW6A 5TQ0H 3OGCA 3NTCH 4AZUA 1NIEA 4L3CA 4LRNH 4I9AA 5GRUL 3N1PC 1EXPA 4TNWF 3SRDA 5CJXC 4ZFCA 5ICYA 4J3OG 4ORGA 1BDYA 1ZJBA 5KSVB 2H3BA 2J8GA 5I5RA 3UF9A 3EZ8A 5IB5B 1FVPA 4DCQA 4PGEA 4UIMA 2KBGA 1MLBB 3UBPC 1KB9J 3Q0HA 4Q6JA 1DV7A 2BSLA 5FCSH 4P23B 1KXTB 4M6QA 3L23A