3MB9A

Human aldose reductase mutant t113a complexed with zopolrestat
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
314
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3mb9A00
1MRQA 3UZYA 3EAUA 2FZDA 4I5XA 4PRRA 1IHIA 1VP5A 2PFHA 1VBJA 3MB9A 2PZNA 4XZHA 2HVOA 3LENA 1C9WA 3LQGA 3MC5A 3WBWA 3WBXA 3P2VA 5M2FX 3WBYA 2WZTA 4YS1A 4XO6A 1X98A 3GHTA 4QXIA 3RX3A 4HBKA 3UP8A 4WRHA 2R24A 1GVEA 4NKCA 1PYFA 4XK2A 1RY8A 2HEJA 3ONBA 2PDFA 1QWKA 3V35A 2IPWA 1HQTA 2I16A 3FJNA 4JQ2A 2BGQA 3T42A 5KETA 2P5NA 4JQ3A 4FA3A 1AH3A 2A79A 1OG6A 2PDNA 2NVDA 4DZ5A 5DANA 4WDWA 5LIXX 1AFSA 4LBRA 4JTCA 1ZUAX 3LQLA 4FZIA 4JIRA 3UYIA 3CV7A 4QX4A 4WEVX 4G5DA 3Q65A 1ADSA 4H7CA 1AZ2A 3UZWA 1Z3NA 3D3FA 2HV5A 3FX4A 3V0UA 4GABA 3DOPA 3R8GA 4PMJA 2ACSA 4JQAA 4PRTA 2PDJA 3H4GA 2IKGA 2F38A 1ZGDA 3G5EA 4FAMA 4GACA 3UZXA 4JIHA 4XVDA 4ICCX 3LUTA 5HNTA 1Z9AA 3UG8A 2ISFA 3S3GA 3GHUA 4XVEA 2FZ9A 2PDLA 2PDBA 2DV0A 1XF0A 4GA8A 4GQ0A 4JTAA 4LAZA 2HE5A 2BGSA 3CAQA 3M0IA 1Q13A 1XGDA 2PDYA 1M9HA 5C7HA 3C3UA 4R9OA 3F7JA 2PDUA 4Q7BA 1SM9A 1YE6A 3NTYA 3WG6A 4JTRA 3V0TA 4PR4A 1ZSXA 5LIYX 3CAVA 3R7MA 4YVVA 4LBSA 4JTDA 1PWMA 4YVXA 2IKIA 3H7UA 1YNQA 1PWLA 2VDGA 1A80A 1AH0A 3BCJA 4XZMX 3R94A 1X97A 1Z89A 4PUWA 3EB3A 2PEVA 4WGHA 3DN5A 2WZMA 1YNPA 1T41A 1EXBA 3UGRA 3WCZA 1S2AA 3O3RA 3B3DA 3LN3A 4XZLX 3GUGA 1IEIA 2PDMA 4XO7A 4RPQA 3RX2A 3BURA 3UZZA 1PZ1A 2R9RA 2PDIA 2PDCA 2PF8A 1RY0A 2FZ8A 3G1RA 2F2KA 4LB3A 1S1RA 2IQ0A 5LIKX 3H7RA 4IGSA 2QXWA 3KRBA 1YE4A 2PDHA 3N2TA 5HNUA 4QBXA 3LD5A 3COTA 3R43A 3EB4A 2ACUA 3R58A 5AZ1A 5JH1A 3BUVA 3CASA 2PDPA 1K8CA 3LZ3A 1UR3M 1XJBA 1QRQA 3ONCA 4XAPA 3R8HA 1EL3A 2DUXA 4PUUA 2INZA 3O0KA 4L1WA 1AZ1A 2PD5A 2INEA 3GHSA 1RALA 4HMNA 4EXAA 4L1XA 2C91A 4H8NA 4YU1A 3CMFA 4GCAA 1HW6A 1EF3A 3RX4A 2IS7A 2HVNA 3LEPA 1PZ0A 4Q3MA 3M64A 2IPGA 4XZIA 2PD9A 5AZ0A 3UFYA 2FGBA 1Q5MA 1FRBA 2J8TA 2PDXA 2DUZA 3LZ5A 2FVLA 4OTKA 2CLPA 2PDQA 1T40A 4JQ1A 4IJCA 2AGTA 1S1PA 4WDUA 3CV6A 4QR6A 2IQDA 4F40A 3BV7A 4ZFCA 1JEZA 3UWEA 3M4HA 2IKHA 2IPFA 1Z8AA 2NVCA 4JIIX 2ACQA 5LIUX 4WDTA 4WDXA 2ALRA 5HA7A 1R38A 4AUBA 4FALA 4EXBA 3V36A 3LNMA 1US0A 4DBUA 4GQGA 3LBOA 1MZRA 4DBSA 2HE8A 2I17A 2IKJA 1S2CA 2HDJA 1X96A 4GIEA 3U2CA 1LWIA 2BP1A 4LAUA 1J96A 4YVPA 1EKOA 3R6IA 4LB4A 2IPJA 3QKZA 3ERPA 3V0SA 3N6QA 4MHBA 4DBWA 4XZNX 1LQAA 3GHRA 2PDWA 1AH4A 1MI3A 2FZBA 3Q67A 5LIWX 1ZQ5A 2ACRA 4IJRA 2PDGA 4JQ4A 4ASTA 3VXGA 4JTQA 5JH2A 2PDKA
chains in the Genus database with same CATH superfamily
4GJ1A 2C3ZA 1DE6A 2OFJA 1XCXA 3FLUA 1QAPA 1LOQA 2WNZA 3BGJA 3ORWA 4HOZA 4LW7A 4AY1A 3RO6A 5I06A 3MI3A 1Y5VA 3T0DA 3WH7A 3QBUA 1IYXA 3UR5A 4MWAE 4GC3A 1PXGA 5CSUA 2IMRA 3WL0A 1L6YA 3SO7A 2JKEA 1H7WA 1WAWA 5CC3A 5G4HC 4L7ZA 4ATWA 5CGMA 2X8RA 3W38A 1ZJIA 4HMCA 2HPIA 4AQLA 2R24A 3CH0A 4TV6A 3OGRA 4IFOA 3O06A 3UCCA 2WC3A 3T42A 1WCGA 3VNLA 5L6UA 4PCFA 1OG6A 1I6NA 3WSUA 5I09A 2DJLA 4GXMA 3ZYZA 4DBEA 4NVTA 1ZUAX 4Z1AA 4YTTA 1TWDA 6A3HA 3AJ7A 3WD2A 3CV7A 2E68A 4OT7A 3WQFA 4LU0A 4O12A 3AU2A 3MUAA 1GVRA 4A8LA 1KCLA 1UKSA 2FDMA 2PWDA 1MDLA 4TVDA 1C7TA 3VO0A 1FH9A 5LNVA 4ZB2A 1EJTC 1IXQA 2RJGA 5IHSA 5C70A 3G5EA 4R7OA 3S9ZA 3UESA 1CPUA 1T96A 3IS4A 1P0KA 1XIHA 3MYPA 4ICCX 1KBJA 4C6JA 1HJUA 3UG8A 4OKDA 3T0TA 1E3XA 1S39A 1KFJA 1JZ2A 4XISA 4MDOA 1XF0A 4GA8A 4QSHA 2YR1A 1WOAA 4JTAA 1CNVA 1ZTVA 5BMWA 1XR2A 3GU2A 3MI2A 1C92A 4I5RA 4LNCA 2FPVA 5A6BD 2ATMA 3UG4A 3LK6A 4JHZA 3QR1A 5KZMA 4H9YA 1QU4A 4H8VA 1WXYA 2UZ9A 3W01A 5C7HA 1U2YA 2VP8A 3MANA 1W3NA 5CBJA 5G4WA 1U83A 2NV9A 1EHNA 2D2JA 3V4BA 2XM1A 3W6LA 3AQUA 1AW5A 5F1UA 2WNQA 3P60A 1SO3A 3AXHA 3I3DA 4PR4A 1ITQA 3WQ4A 4B3KA 3KXQA 4IX0A 4IMAA 2Q8ZA 1CXHA 2YCIX 1KC7A 5CGQA 3W02A 4JTDA 4DELA 1PWMA 2R1KA 4K8GA 4IIGA 1Q4WA 3GDRA 4P7OA 1PWLA 4WKFA 1FKWA 1ODZA 3L12A 4XZMX 1ITXA 5EMMA 3IJQA 4S3CA 1AJ0A 1QI5A 3M6DA 1OFPA 4IIDA 3T0AA 1ISZA 1S3TC 1HX0A 1AA1B 1T41A 1DIKA 1S2AA 3UJ2A 4EF9A 3GUGA 3ARZA 1TELA 1RP8A 1Y8BA 3NL3A 3PG9A 1FH7A 1MW2A 5D09A 4F4RA 2PLJA 2EQDA 1HKVA 2FPTA 2PDIA 3GKFA 3R13A 5D9MA 4FK9A 3DHFA 3C4UA 1GOQA 2ZADA 1FWRA 3N17A 3F5JA 4EAMA 4O8RA 3F2DA 4Y96A 4QM1A 2H3DA 3M0HA 4JTJA 4M56A 2NQZA 1JCMP 3QFEA 1C91A 4ACZB 3NDOA 1QJWA 1E6PA 4X9SA 3EWZA 3EOEA 4HHHA 3BUVA 1VIZA 5L9FA 3IV3A 3TC7A 4ROPA 2TMDA 4MWAC 2HK1A 3PTKA 5AYXA 2ZVIA 3I4EA 3L5AA 4P8XA 2ISWA 4MZYA 3EOSA 3P8JA 3VDHA 4K7YA 2FHFA 4UR8A 2GK1B 4R85A 3QSRA 3TONA 3IGXA 1GUVA 4HU4A 1GOOA 3QW3A 3G0UA 2V81A 4HCLA 4QJ3B 2V0TA 2NX1A 3UF9A 5FJIA 3M5YA 2ZKMX 4PFHA 2E1WA 3W6MA 4GFSA 2HVNA 1OCNA 3PAOA 1LUCB 4IIEA 1SUXA 3W00A 2SFPA 4BK9A 3CPGA 3EX3A 1EA0A 2UBPC 4JKLA 1UH4A 4KCWA 4WZHA 3E6EA 4S3JA 1FKXA 1XLDA 1PIFA 2VQTA 5LA0A 4JQ1A 1E9ZB 1CTNA 2XPKA 4QR6A 3MTWA 1RK6A 4ZTYA 1Q66A 1FVPA 1ME8A 2XH4A 1DWJM 2ONEA 1SJBA 5AYYA 4DWDA 1WXJA 5JBFA 2QDHA 1B90A 5CC7A 1X8FA 3TQKA 2B81A 1PUDA 1DWAM 3CPUA 2PMQA 5I2UA 3M6YA 3ID7A 2C7FA 1H51A 2W66A 5CKSA 1SW0A 1XLCA 3WQWA 4QLKA 2EG7A 3BDKA 3ZT5A 3N2OA 2HCVA 3E0IA 3ITOA 4LV4A 3KOWA 5G4EA 4GIEA 1M04A 4JD4A 3PZMA 4HCHA 2NSOA 5CSRA 1IV8A 3QH2A 4NX5A 3SFWA 3F2CA 3TAOA 3L2MA 1UQYA 4N02A 3VX0A 1US2A 4DXVA 1V6TA 5FIPA 2BZNA 4X9YA 4IJRA 1QVBA 3U2OA 3Q2DA 4RV8A 4JHOA 3BW4A 1TSIA 1KCXA 4FXSA 2YGYA 1SR9A 1TIMA 3MHFA 4FNSA 1WZLA 3TSMA 1BAGA 4ZMGA 2ZDSA 1POJA 5D9PA 3BAWA 3W7OA 2VZVA 3UW6A 4Z1YA 1EYWA 3N04A 4UQ9A 2WKJA 2W5FA 4DWSC 1BEUA 3QHNA 1EJVC 5FKYA 3MY9A 3R0KA 2A5HA 4LRSA 3ZO9A 4GWEA 1DORA 1OCQA 3IK4A 1A53A 1VBUA 3C2YA 2ZRVA 1EDQA 3WUEA 4ORMA 1KFEA 1VR6A 2ZICA 3W7HA 2BWGA 4ES4A 4FOJA 3XISA 1RVKA 3CWHA 2AL1A 4PTMA 4BEQA 3NR0A 1UR1A 1TX0A 3GVWA 3GXIA 1L9WA 2VC5A 5EKYA 2YXOA 4O1CA 1S2TA 3VM7A 1BXCA 1V3LA 3KBVA 4BWLC 3BH4A 4AF0B 3H26A 3P5ZA 5J5RA 3HGSA 5FAGA 3SCQA 1RVGA 4F9JA 5DT7A 4FNPA 3PWIA 3M44A 1S46A 3FAWA 1QNSA 3SUSA 1ENUA 1Y65A 1LL6A 4Z2KA 4DY1A 4IMFA 4UTTA 3RXZA 4JYDA 3T07A 1Q65A 5LKYA 4XZ9A 3R8GA 3NSNA 1A47A 1O7AA 1QPKA 2Y7FA 2X40A 2DZBA 1ZY9A 4XBKA 5CXPA 1KRCC 5HNTA 3TYZA 1T8XA 2CLKA 4GVFA 1OIFA 3ZFHA 4LUSA 2OR2A 4Z17A 1FBAA 1E4MM 2J7HA 4UTHA 4HQVA 4Y90A 1HKWA 3HF3A 1OFEA 3USBA 2QCDA 2DZTA 3S5SA 3LTPA 1PL9A 3M0IA 5J04A 3KVLA 5BWAA 3B8VA 3RF9A 4QITA 3K4DA 2NZLA 1E40A 2VM8A 2V82A 2E6AA 3NQDA 5EY5A 3VI2A 4GPNA 5DBTA 2OZ3A 2V2DA 4ZZ9A 1TPFA 2E7FA 3MUZ1 3GK0A 3PNZA 3CAVA 4GY0A 3GXFA 1A5LC 3TJXA 3L0KA 4JEQA 3BGGA 1PZ2A 4TU1A 3ZSSA 3NDZA 4RV3A 5H6HA 4S3KA 3HQPA 3C56A 4J5NA 1TKKA 3PPCA 4AZCA 2V3DA 2YOCA 5AC4A 5BXRA 3N3MA 1ZHAA 5C9XA 4AYSA 3UGRA 3BC9A 4O52A 3LTSA 3LN3A 3UGVA 4K1GA 3N12A 4OVXA 3N15A 3IVUA 3I3EA 4DBDA 3W27A 1A4LA 3GR4A 5JIWA 2PODA 1EQCA 2GVLA 2PDCA 4IQEA 3SSJA 5I5RA 4LGXA 2QEZA 4AD2A 2J13A 4NRSA 1UWUA 4A3YA 2EEXA 3B9DA 2CWXA 3QQWA 1OF6A 4Q4SA 5HNUA 2EKCA 2NWRA 1JCNA 4G6CA 3D6NA 1VFSA 4MAVA 1NTHA 5JMUA 2VMFA 4BJHA 2QIIA 4PCTA 2ISDA 4GG9A 3GG0A 4E4PA 3LI1A 1E5NA 4JDYA 4FIRA 4C1NB 1GEQA 2Q8XA 1RA5A 1I2RA 4NASA 1E4NA 5REQB 4R53A 2CCRA 4C5ZA 2RDWA 2ANUA 4XKYB 3S2MA 5GQBA 4W8AA 2OO0A 3NM1A 4B9ZA 5CZTA 1AMKA 3FXYA 1JPDX 4Y9OA 5HUPA 2QDEA 3IWPA 3N13A 3JVAA 1GYLA 1FFQA 3UWQA 1IE7C 1MRAA 4XZIA 3TYAA 3WNKA 1V6WA 3U0HA 2A3HA 4DAFA 2ATSA 2V2CA 4A4AA 3EA1A 3BMWA 1Y7VA 3LERA 3VD7A 3CWNA 4IJBA 4M6PA 4M81A 4QHRA 4MUPA 1BXNA 2GJNA 1W31A 2Y8VA 1UB3A 2Z0IA 1J0YA 2VR4A 1ZB5A 4XAGA 3EWWA 2IPFA 1NWRA 2PRLA 2GGIA 2J27A 4DXKA 5C9UA 1K9FA 2YW3A 4Q7IA 1WDSA 4LCRA 2C1IA 4Q4KA 3OZOA 1Q6FA 1A5UA 2X1TA 5TF0A 2OPJA 4EXBA 3CYJA 1XQKA 3HG5A 3W1XA 1OX4A 1OJXA 1TB3A 2YKKA 4MYAA 3STGA 2UY3A 3FA4A 5FEXA 4UTKA 3SUVA 3GXPA 2Y5JA 1SO4A 2D3LA 4ZCWA 2H9AA 2PWEA 4NAEA 1YDNA 4QDWA 3I6RA 5K3VA 4O10A 4CQDA 4BR1A 4U5IA 3O07A 3ABSA 4REQB 3GWQA 2V5JA 1EKOA 4I9JA 3PJXA 1ONRA 3EXTA 3NZRA 4BQ3A 5JIPA 3UJRA 1PX3A 2EG8A 5A2BA 4LT9A 1AH4A 4QAWA 3B4UA 4QJ1A 3PZVA 3Q67A 1XKJA 3IK2A 4YTUA 1XIJA 4JTQA 2QW5A 3AIVA 2YL5A 4CCZA 2OG9A 3GAYA 4PRRA 1TX2A 5HOSA 3PPFA 5J8LA 4KWUA 3V75A 3JZEA 3STEA 3MKCA 1OFAA 4NJKA 3MCMA 1V3JA 1GOXA 2YB4A 3V5CA 2A7NA 1MFVA 3EDDA 4C6OA 2EJ1A 2P8CA 5GPRA 1O4UA 3QR0A 2HZGA 1XCWA 3M41A 7REQA 4DF0A 1KV5A 3IAPA 4QXIA 4LUTA 3GBEA 3BAXA 2YDAA 3TK7A 8A3HA 4A29A 5G2WA 2WPBA 3LRMA 3PJWA 4XK2A 4FIQA 4B91A 1JD7A 1XLEA 3NNTA 3W3OA 4H83A 2AQVA 5KETA 5DRCA 1S5WA 1KLYA 2XH7A 4HK6A 5DY3A 2NW0A 3NCOA 3OIXA 3L4VA 1TUFA 3ABRA 2W67A 4F48A 5B7YA 2XTKA 3W82A 1ZJHA 4H2CA 3QHOA 2A3AA 2H8XA 3TU9A 5DT5A 4J35A 1VEPA 4D2JA 2HK0A 3OA3A 1SJCA 4L9XA 2CHNA 2Q8LA 5DMNA 2DT1A 1FWAC 1M41A 3FAXA 3T9PA 5BXTA 1IF2A 5E1QA 3W7RA 4GFIA 4L4PA 1W3JA 2GZXA 1RCQA 1AG1O 4S3AA 3KLKA 4MNKA 3WK0A 2J47A 4RNIA 1KKRA 4GABA 4KW2A 3FA3A 1J2BA 4YYFA 2QULA 1BXBA 2E1DA 2V2HA 3UWZA 3LTYA 4Q8QA 4NJGA 4YYCA 2E6DA 2YFNA 4MFEA 2XN2A 2PGFA 2WLYA 4DJDA 4EX4A 4K8EA 3VGEA 4JN7A 3APYA 3FHQA 1PCWA 1W1B1 3GDTA 3R25A 4Y9PA 2PZ0A 3PBGA 4GI6A 1TWIA 1IT0A 4IFKB 1RPKA 1FHLA 1FWGC 2DIKA 2W91A 4CQCA 2QPSA 1R8LA 3FDGA 2Z00A 1YE6A 4BI7A 1J4EA 2VOMA 4Q22A 3NGFA 7A3HA 3PSVA 3LB0A 1DL3A 1VFTA 2QQ6A 1R3SA 4F0LA 1W5QA 4WSKA 1EGVA 3BTNA 1YKWA 4YVVA 4LBSA 3MP3A 5C54A 4NU7A 1K7EA 1AL7A 2WB5A 2XIQA 4G7EA 4IH3A 3MWCA 1UHVA 3N25A 3D3AA 1B0IA 2AQOA 2D0HA 2Z2BA 3CBWA 2Y70A 2WVVB 2JKPA 3WBAA 3OOQA 1GYNA 4R34A 4DYEA 4KS0A 3S47A 2FB3A 1J6PA 1A3HA 2QGYA 2WZMA 1OHLA 1OGBA 5M3WA 3EOLA 2VUNA 4A05A 3WCZA 3NG3A 1DHPA 4XO7A 3GFXA 2ZX6A 3BAJA 4ZBCA 3UWYA 3I65A 3SI9A 2PWFA 1A0EA 3DBNA 3O05A 3PANA 3MV01 4EPEC 1S1RA 3BGAA 1H41A 1OFBA 5FL0A 3L4YA 3L68A 1OQFA 1XP3A 2J8FA 2AAMA 5EFDA 1TPVA 4IPLA 5CLWA 2Z6IA 4F0KA 4X22A 2W3ZA 2FJUB 1JFHA 2HS8A 2PLMA 2L5HA 1OD8A 3QLDA 2WMIA 2Q01A 3LBCA 3GXNA 2PLKA 4ZO7A 4D9PA 4DZAA 3W81A 4C1KA 4UIOA 4LUJA 4B9YA 3OBKA 2E8ZA 1TCDA 3OGVA 1OFOA 2PTXA 3UERA 1LCOA 4A35A 3TNOA 3DDMA 3ITVA 4MADA 4YTRA 3GYEA 3DX5A 3ATZA 1RCOB 1X39A 2XDFA 2OO6A 1FCBA 3AUOA 2Q71A 4JXCA 4KKXA 4DYKA 1IT7A 2AMXA 1RD5A 3UJEA 5GVJA 5EL1A 5KTLA 1R46A 3U2ZA 3Q94A 3SQLA 1HGYA 2OCZA 4H9UA 1HP5A 1JJKA 2Y5SA 5FF0A 5LXEA 3I10A 4J3UA 3AWOA 4CD4A 4ZA0A 2DSUA 3KBWA 1GPFA 4MSSA 3GH5A 1ESWA 4AD0A 5H8UA 3BO9A 4K2SA 3DC8A 3YPIA 4LCQA 1XLBA 2AKMA 3GU1A 4MY9A 1B9ZA 3M4HA 3CMJA 1O5KA 1SU5A 4MPQA 3TEVA 1XS2A 5LA1A 4LY4A 2WZEA 3AMLA 4M7TA 1R9ZA 1NY1A 4GOAA 2YA2A 3KL0A 1OT2A 1EGMA 4Y8FA 3AALA 1HIZA 4NZ4A 2VFIA 1WKDA 4L6HA 3DXIA 2RDXA 4Z2HA 4Q8WA 1DXEA 2X7WA 3RPMA 1PDYA 2FDSA 2VHLA 3MV11 1PTAA 1F5ZA 1M1BA 4TTUA 4W7WA 3WLJA 3UXDA 3RR4A 4ZTXA 2OJPA 2IPJA 4H01A 3N6QA 2QJJA 3BAYA 3DHUA 2TPSA 3QEZA 3GHRA 4HPGA 4LPCA 4JL1A 5KZEA 2ZDRA 4E6MA 2GDUA 3BSHA 2D24A 2P1FA 7PTDA 4ASTA 1S5NA 2W79A 1WZMA 1DJQA 5CGTA 4KCUA 1P48A 2Z6JA 1ZBWA 1S2UA 5G5IA 3O2LA 4XAFA 3HURA 1XW8A 2G8ZA 4LWWA 5TNVA 1XG4A 2GSEA 2WNNA 1I4NA 5DX7A 2VKZG 4KMQA 3GB6A 1LRNA 1V0LA 4YTSA 3WBWA 2XFFA 4J3ZA 3REQA 3TAKA 2ZZ7A 3SCOA 1XRSA 4KBXA 7CGTA 3AWNA 4OJYA 4WRHA 4QSFA 4R5EA 1T6MA 2GOKA 3EXSA 2CZEA 3KAOA 2ZX5A 3KWSA 5EBAA 2QCNA 2XWEA 2V67A 1VCGA 1JUKA 3GRIA 2FJKA 2ALDA 2HXTA 3WUGA 2NWSA 1XSKA 2VWTA 3GX9A 3LQLA 1JZ6A 2Q3OA 1XLIA 1OD0A 1OGSA 2ZZ5A 3TN4A 5CC6A 2XN1A 1UP2A 1M5WA 3L4WA 2RDUA 3MWAA 4F0RA 3VFLA 2ZA2A 5EMUA 2ZC8A 1EGZA 1CW2A 2V5KA 4CVUA 1Z3NA 1TPC1 3JZUA 3HPXA 3EX2A 4H00A 2GOUA 2C16A 4B16A 1XPGA 1UKPA 1IXNA 1I75A 3EX4A 3VGDA 3SSZA 4RE0A 3SUTA 4AZHA 3LPOA 3LCWA 2NUYA 3LOTA 4FOKA 2J8GA 1NELA 5FF7A 5D05A 2WM0A 2DV0A 4FPSA 4JN8A 2PE4A 5BRBA 3PVFA 3JRKA 2D2GA 1M3UA 4HYRA 3QSTA 3GLCA 3LA4A 4DJEC 1F61A 1TV3A 3O63A 2Z1KA 4JTSA 1P7TA 1QI3A 2X1SA 3FSTA 1BHGA 3VKCA 3GTXA 1SM9A 3CQIA 1EC9A 4Y6GA 1PSCA 1K7FA 4DPQA 4L9ZA 4ZB0A 4CNUA 4D6CA 3OLIA 3R7MA 4V33A 3W7QA 1DXIA 1V02A 1EWEA 2GVEA 1IGWA 1UBSA 5FJOA 3APTA 2E28A 1UQZA 1XGEA 3SZ8A 2VDGA 3G6LA 4M6VA 1QNPA 2FHBA 1E9IA 1QNRA 3S1VA 3K8LA 4EK7A 3E2RA 3CZGA 5E0KA 1XL9A 1W17A 2ZUVA 3LCFA 1EJ7L 3BLIA 4JTTA 1JDEA 3MSGA 5IHRA 3W7PA 3F5LA 4MB3A 1HJXA 3B06A 5D04C 1JD9A 1XD1A 4HVXA 7TAAA 3RN6A 3H22A 4XUGA 3QRHA 4HNOA 2A6LA 3LCIA 4D6HA 5FOOA 1V6VA 2WJZA 4L61A 4O1DA 3N2MA 3VGGA 2E0PA 4DO4A 1J10A 4HTBA 3TC6A 2GPTA 3S1UA 3T05A 1B3VA 2R94A 3UR2A 3SB0A 1HVQA 1B54A 2J74A 3GC5A 2VFHA 4GVGA 5A8QA 3E2VA 1P0DA 1YXYA 1CLXA 4PMYA 1EJUC 1JYVA 3NOYA 2DUXA 3VC5A 1DTUA 1V0NA 1KM6A 4LEQA 1JDFA 4J3WA 1A5AA 5D2XA 3RU8X 4W93A 1JNEA 1RBAA 2X16A 4UFHA 1C8QA 1GOKA 3ZOAA 3QYQA 1TV7A 3WZ0E 1XISA 3GU9A 3W7GA 2PUZA 1V3KA 1MVYA 3ANYA 4HZ8A 4B5NA 2UY2A 4LH8A 2R1MA 2ZZ4A 1H1ZA 4XD6A 1W9UA 3A23A 3SCUA 5CPTA 2QAFA 3C2OA 4HOXA 2J8TA 3BPWA 2EBNA 3NWRA 4LYPA 3QZEA 2EGZA 2YBVA 4D1IA 1W1A1 1IWAA 2WJFA 4C91A 2B7NA 4AAJA 1JR1A 3BOFA 2D1ZA 1VPXA 3WEOA 3KOXA 4AXNA 2Y88A 3E5PA 4XIAA 2IKHA 3S83A 4C90A 3M16A 5GNZA 3G1XA 2J6VA 3V16A 3PN8A 3WUBA 5FF4A 3TN6A 4DJFA 3DC0A 1Q2SA 1PKLA 4AB4A 3HO8A 1FWDC 3HM7A 1UJPA 4JN6A 4X0VA 4DN1A 4GQGA 4JX4A 1MZRA 4PUJA 1US3A 2TRSA 4G1KA 4IP4A 1E1CB 3FXGA 1U30A 4XBJA 2MUCA 4GISA 4R88A 1J96A 3STCA 2CLIA 3HPFA 1VCFA 3URNA 4M29A 3NO5A 1T5AA 1K02A 3AI0A 4MKNA 4ZQRA 4L65A 2G3MA 1CLKA 1R7AA 3UNDA 2H8ZA 1FOBA 5A6BA 1TWSA 4Q4RA 1E71M 1M01A 4PMQA 1TQXA 2BVTA 3C86A 3T08A 3VXGA 1LQ2A 1WZKA 1ICPA 2VENA 4AX6A 1B3ZA 3H2NA 3NM3A 4ACZA 1YADA 1K03A 4RZ4A 3UZYA 3KOFA 3NXLA 2X0SA 1KRMA 3GDLA 4W9TA 4CN6A 4XSLA 1PX4A 3AYTA 3FSUA 1NOFA 5FSEC 2VUYA 3PTDA 3NZQA 5CSYA 5LHEA 3OU8A 3IPWA 4UNLA 4WR3A 4GBUA 4FXJA 4PTVA 8CGTA 3ALGA 3L4XA 3L4UA 5E5CA 5F1VA 2HISA 3UJSA 4E2VA 1LLZA 3TIMA 4XO6A 1PHQA 3GNNA 3RCMA 1R85A 4E8GA 4NRRA 2FYMA 5ABFA 3FA5A 4M6UA 2FQIA 5HWMA 2ZFAA 2WVTA 3VNDA 3NPUA 2DSKA 3BLFA 1LUCA 4MG4A 3TW6A 1GG1A 4UTJA 4Z1DA 4JQ3A 2J9YA 1SJAA 3DH7A 4EPBC 3GIQA 1AFSA 1XH0A 3DHDA 4BEUA 1VRDA 5DF0A 5D8WA 1TTJA 1MUMA 2VFGA 2DY3A 4W4QA 3TQPA 1GQIA 3AHXA 3QQ1A 1RBLA 1GJPA 5T9CE 1YRRA 3DHPA 1EX1A 3AYSA 1E4LA 1UD4A 4GNKB 3WN6A 5A2AA 2VX7A 4NZ5A 1UASA 2INFA 5I24A 3ZT6A 3AIUA 3OZYA 1GEHA 3GBDA 3SRFA 2WV8A 1VCVA 4QFUA 3VIPA 5CBBA 4CNPA 4XVDA 3CS2A 3THDA 5I3DA 5K7JA 4NT0A 4XVEA 3VD9A 2PU0A 1W8SA 1XBZA 2NQHA 3F5KA 1L6WA 3WMLA 8XIMA 4ZOBA 5CCZA 4MAZA 5I0DA 1GZ1A 2DSWA 1BD0A 4HYWA 1Q13A 1UD2A 4EANA 2Z4GA 3PBUA 1GONA 2Z24A 1K1DA 4IQJA 3IIZA 1TPH1 4M19A 2ZC1A 2OWWA 3ZJ8A 3WQCA 3WDQA 1I0BA 4QE1A 1AQ0A 1J5SA 4MOZA 4KCVA 2QUNA 3BANA 1UH2A 4ZGYA 3MSRA 5HJXA 3UY8A 3MKVA 4NNCA 3HBLA 5ECUA 3GTFA 3PZOA 3S6OA 1H7PA 1XYFA 3VKJA 1XRFA 5CZJA 5DRIA 1YNQA 2HJPA 2HVMA 3F4WA 1X6LA 3O0FA 5C9ZA 3SRKA 3P14A 3MUIA 1A0CA 3UG5A 3EB3A 2PLCA 3LXAA 4JFWA 1BF6A 2DUAA 3G1YA 3N73A 5HNRA 3DI0A 1EF2A 3RX2A 1SYTA 2FIQA 3GD6A 5B7ZA 4E4UA 3WQOA 3P93A 4MNMA 4L4LA 1GVIA 2C18A 2Z1SA 3VIKA 2CNCA 3GZ3A 5K2ZA 2PCEA 3L67A 4TX8A 3CTLA 3GFYA 3H23A 1EDGA 1H1YA 4P7QA 3N2TA 4F0HA 4I7VA 3FEQA 4B5WA 1OADA 1ZRQA 3ZM8A 3AIWA 1Q8JA 4MTVA 3P82A 3NQ8A 5I3KA 1L0PA 4Q7NA 4POCA 4PEKA 3NAVA 4GC4A 1E0UA 3CAWA 4KFNA 4B15A 4DM1A 3QY6A 4HU3A 2XJ7A 1YXDA 4PUUA 1XYCA 1EUAA 1JL8A 5C71A 4AIUA 2VELA 4L1WA 2J9ZA 3N34A 1K6AA 3E49A 4EXQA 1Q6QA 4TVCA 1NM9A 2REQB 1FH8A 1E56A 2EPNA 2DSVA 1OYBA 1JVNA 3NFUA 2V3GA 1KA9F 4GCAA 1TRDA 2FVMA 4NAFB 1LWJA 4NI3A 2O0TA 3STPA 4PMVA 1LL7A 1CXEA 3CB3A 1A5CA 5AZ0A 3A9BA 5CPSA 4E38A 4XIMA 1Q5MA 2OXNA 2VD8A 1SZNA 3W2MA 1V7AA 2DUZA 1H4PA 3N9KA 2OQYA 2OKOA 1VENA 3M5XA 2ZCGA 5LXXA 3S42A 1UBPC 4IJCA 3QMSA 1MQRA 3VC6A 1E9LA 3P3BA 1BKHA 4ZFCA 1TR9A 2RH9A 3H2AA 3BLLA 2B7QA 3UWEA 3R1ZA 3VNKA 1TJ0A 1YBQB 3A12A 4AMCA 1HG3A 1V77A 2DP3A 4J7RA 4W5ZA 3DG7A 4IT1A 5EMYA 1VFLA 1I60A 2ALRA 3NEHA 2ICSA 4J28A 3TTYA 4FALA 2VFFA 3V36A 3NQFA 3LNMA 2ISSA 4X2RA 4IL2A 3WH6A 1FHUA 3KS6A 4WUIA 2VOTA 2I17A 1EEXA 1GNXA 1KQZA 3F2BA 1U1HA 1YTDA 5IBXC 3OO2A 3RILA 3ZVHB 3VIFA 1P4CA 2V5LA 3KBNA 2ODOA 4GNVA 2WO5A 4HNLA 1LDCA 4H6EA 5K4ZA 2ZWZA 3FHAA 3SR7A 3FVMA 2ZZ1A 4NYUA 2HNEA 3T40A 3WDHA 4IL0A 1GTEA 2XVLA 2DVXA 5DMMA 3H7VA 3TYCA 3TCEA 4QE5A 3DFSA 3S9YA 2VZOA 1KBKA 2JFEX 2QCCA 2PDKA 3PZ9A 4PB3A 5D30A 4GX8A 2VCCA 3QV6A 5BZAA 4FLSA 1VP5A 4WD0A 4X3ZA 3T55A 1VBJA 1EOKA 3C6CA 5HMFA 3AZSA 4AWSA 1S5TA 4AIOA 1KFKA 4XKYA 1B4EA 3O9NA 1TJ1A 4UFLA 2WZTA 3WKZA 3URAA 4X61A 1SR0A 5AECA 1KXHA 3NPWA 3OLGA 4AD5A 3DFOA 4N2YA 2OLAA 3ITXA 4NXKA 1BGGA 1HJQA 4LUIA 1HZYA 4JZ5A 2V68A 1O95A 3W26A 1FHVA 3P61A 3P0XA 3ZJ6A 1TMQA 2I57A 3GXDA 2ZRZA 4C6IA 1E43A 1BYDA 4JQ2A 2BGQA 3FKRA 3ZIZA 2OOGA 1S3HA 1FXQA 3WK3A 1LJYA 1N7KA 5LIXX 2DEPA 5C7VA 2ZZ6A 1U5JA 3LS9A 5KMYA 3U57A 3UYIA 3H2OA 4UMCA 1YLVA 4CD6A 2NQ5A 2A21A 1GQKA 3AU6A 2QKFA 4H6RA 1BWKA 3PNUA 3B9AA 2EJAA 1QBBA 3AXKA 1SFSA 3ARRA 1VJIA 3NO1A 3P67A 4TO8A 2IKGA 3VK5A 1R3YA 4B90A 1LWHA 3ARSA 2W92A 3UZXA 3EPMA 4PMOA 1YPFA 4UTWC 3M0VA 3WYZA 1W9PA 5E09A 2WVUA 4IMGA 3WFAA 1NSJA 5D8ZA 2WJDA 1AL8A 3C8NA 4WQ6A 4OWGA 2HS6A 4AWUA 1IEVA 1BWVA 3L65A 1LBMA 2DZAA 4UFIA 1W6TA 3DU0A 1QATA 4DJDD 4EPKA 5EU9A 1H5VA 3B04A 3NQAA 1EO5A 1QW7A 3P5YA 3O16A 2IW0A 3B4YA 4YMZA 4F3HA 2J66A 5LNUA 9XIMA 4PSRA 4E8CA 3S9IA 1F74A 3NPXA 3VNYA 1BTMA 3WQVA 2QJGA 1GK8A 4D8AA 1CECA 3EWUA 3IAQA 3CQKA 3CB8A 3O8AA 4E3VA 1HXJA 4HNUA 3WMSA 1FQ0A 3H7UA 3AHZA 5CH9A 2CZFA 1TPB1 2AQWA 3LV5A 3ARWA 5AY7A 2OTDA 4GI4A 5CBIA 1REQA 4INFA 3OVPA 1HN1A 3VPLA 3VD5A 2QIWA 2J79A 1EFZA 1P0NA 1BRLA 1WDQA 5CJ5A 4V2XA 1E5JA 3SJNA 2OSYA 4AZ6A 3UG3A 1XC4A 1WZAA 3WF4A 2E40A 2XZ7A 1H5YA 4B2DD 5CAHA 3G1RA 1ELSA 4ZO9A 2IQ0A 4LYKA 3A47A 2XVNA 2Z1WA 1NH6A 2QXWA 5U4NA 2QZRA 4XSMA 1SSGA 2JALA 3TOPA 1YE4A 3N4AA 5A6MA 4AY7A 1UWSA 2I5QA 4KWOA 1ZS2A 3KX6A 2DH2A 5E93A 5A6AA 3A13A 3ITLA 3R43A 1VEMA 5A94A 5KSWA 3KLLA 2WHLA 1GVSA 2E8YA 2XUCA 3DFHA 3TDFA 2QJNA 2ZUWA 5A1AA 2J24A 2ZXBA 1GQLA 3EB2A 1E1EA 4TQTA 4FX6M 4P2VA 1EJRC 1RXOB 3N18A 3TSDA 3AJXA 3FYOA 4JTGA 4ZO8A 3TTSA 4DPPA 3W4RA 1FWCC 3DKLA 5IXEA 4UFMA 4L1XA 1H7OA 1TR1A 4O28A 3CUJA 3ZLFA 1VFUA 1U5VA 1OYCA 2DT0A 3VCCA 4C7GA 4ORIA 2E3ZA 4KETA 4QEHA 3UA4A 3BVJA 4E0CA 4HHLA 3GO2A 1RHCA 3WH5A 2NUWA 2PB1A 1J93A 4NILA 1C90A 5F4XA 4IFKA 1XCFA 3CQHA 3KRUA 3MMDA 1WNOA 2BG5A 3PULA 1MXGA 1WKEA 3UVAA 3ARQA 4ZQMA 4F79A 1UZHA 3TTEA 3WJXA 3PUEA 5BNKA 3LCLA 3WD0A 2PWGA 5EA9A 1YDYA 4HGXA 1KFWA 1JDDA 4MIMA 1P43A 1KXVA 5HULA 3SCSA 4PCPA 1JPKA 3WF2A 3PPGA 3WH9A 4LNYA 3U7BA 2PP0A 3ZMRA 6XIAA 2ON3A 4JTIA 1GW9A 2ZUMA 3BLEA 4KIRA 2ZUTA 4N9CA 1B31A 2WWDA 1D8CA 4PMDA 3WLRA 1Q4NX 4D8ZA 5HA7A 3GYCA 3RPDA 1UWRA 1XLMA 3E0VA 3B0YA 1FWNA 3VILA 1XYMA 2FH6A 3M0KA 1R2TA 4W5UA 2WSRA 2Q6ZA 4IOTA 5F4WA 2Q3RA 1M7JA 1LLOA 3U2CA 2FTWA 4LSBA 3BJTA 1JPMA 4RUBA 3I4KA 1H0GA 1XSJA 4ICNA 3G2GA 3DFYA 4WHBA 3VUSA 2Y61A 1PCKA 1E70M 3LHUA 1JI2A 4PMUA 4K36A 2DU2A 1CXKA 4BI5A 5LIWX 1VB9A 2V5DA 1DTNA 2PDGA 3HGJA 3NQVA 4PMXA 2OZTA 3NSXA 2HSAA 5I6SA 3SJ3A 1Z69A 2J78A 3C3NA 1FWFC 1X1ZA 3CO8A 3HJZA 3V1PA 2PWUA 4W7UA 1LF1A 2C14A 4PBEA 3XIMA 4P8VA 5M5DA 2ZA3A 4MGGA 2GUBA 1R6WA 4H9ZA 4RE3A 1ZENA 3G1AA 3P2VA 4BQ2A 1PS9A 2DJXA 3CL6A 5M2FX 1OG0A 2J7DA 5KITA 3SFKA 4JTKA 3UP8A 4MY8A 1KTCA 1A49A 3OYZA 3VIGA 1PJ9A 2KX9A 1RY8A 2QF7A 1LYXA 1NP0A 4N9EA 3WD1A 1L8NA 3FY1A 3S6TA 3DYPA 9RUBA 3CL8A 3VU2A 4XB3A 3MO4A 2A7RA 2A85A 3VM5A 1X1OA 1OFDA 4X0NA 4DQWA 2A79A 1JYXA 4FXRA 1MMFA 4CD5A 3BQ6A 3STFA 3WENA 3MSDA 4GYPC 2O9PA 4JTCA 1UD6A 4JFSA 4FSAA 4OIFA 3PWAA 4JIRA 3K4WA 4HSHA 3SRDA 4DEFA 4TMBA 4DAIA 4O0QA 5DCDA 3C0LA 5FSDC 2WMHA 4WSHA 1HJSA 2BVWA 1LLWA 4A3QA 4OUIA 2DVTA 4P5UA 3DYOA 4YN5A 3PZUA 1JF6A 1XDMA 4F2TA 4O57A 2ZXDA 4QRNA 2IUZA 3UU0A 2P50A 2VZUA 2AKZA 3PS7A 3CYVA 4JR5A 1F9CA 3W28A 4GQ0A 4OFCA 1DXFA 1M7XA 3VNIA 2VYOA 1OWQA 1W54A 4LXFA 1GJWA 2DZWA 2B7OA 3PAJA 3MT1A 2Y7GA 3BAKA 4UOJA 1VHCA 4GGHA 2PDYA 2D2OA 3R8RA 2OEJA 5D4YA 4PH6A 3QTPA 1TJPA 4RCXA 5HWJA 3CV2A 3F7JA 3G0SA 5A6JA 4IIBA 3R4IA 1HKJA 4UB9A 1LRQA 2WHMA 4UNKA 1Z6KA 2PI6A 2DDXA 2NQJA 2OT1A 3TMLA 3NO3A 5HPCA 1CIUA 1PPIA 3T2QA 4R7WA 1JPIA 1AUSL 4YVXA 5I79A 4J4KA 1XPYA 3G1HA 1QOPA 3A3XA 4I3GA 1UC4A 4FXFA 3GNOA 4HKPA 4KH2A 4PMRA 3VIHA 4ZOEA 1YQ2A 3AXXA 1VRXA 4RPQA 1E9YB 3GUWA 3UZZA 2FFIA 1H60A 3BCFA 1XXXA 1TJRA 3QTGA 2J7GA 2EF9A 4MJ2A 4GKLA 4IMDA 3V3WA 3QZAA 4B5SA 1HNYA 3M46A 5CG7A 1BLIA 2WOQA 3VX1A 6REQB 3WY1A 2C15A 3A4XA 5BRQA 3K8KA 2CW6A 3HPAA 4UTFA 3UD6A 1YEYA 3P62A 3OHMB 1OCBA 2NXIA 4HNCA 1C8VA 2MNRA 3V5FA 3RLGA 4TMCA 4O14A 1H2JA 4RL3A 5FCZA 1RD6A 3XINA 2NV1A 4WKAA 3U6WA 4HMEA 1HFBA 4R7JA 1IIHA 2Y1HA 2XYLA 4NJHA 1BYBA 4Y9AA 3CZEA 1EL3A 3M0MA 1ECQA 4XAYA 5E0FA 4B5VA 2ABAA 2DZPA 1O68A 4AZ5A 5G1TA 4O18A 5HMEA 1GPWA 3UEQA 4CEUC 4HA0A 1RALA 4HMNA 3ITTA 2VTFA 3TA6A 3CC1A 2G96A 4DHGA 1W0MA 3ATYA 3WMBA 1FP8A 3LXCA 1JUBA 1BGAA 2WM1A 1X7FA 1SFJA 2ASHA 2IS7A 3MMWA 1WDPA 3MHGA 2UV8G 3P84A 5F7UA 5CPMA 4W8LA 2VC6A 2P10A 1B3XA 3WQ6A 4JCMA 3QC0A 3QPYA 2BHUA 3QW4B 2QV5A 2Y4SA 1T40A 3PUDA 2WJEA 3SURA 3BL3A 1TV4A 3GG7A 4GXWA 3F03K 1CDGA 3T44A 1MZHA 1CZ1A 3O1NA 4ZB5A 1I2QA 2GWGA 1FWBC 4KIEA 1QNQA 1RA0A 3K2GA 1Z8AA 5EMLA 3ES8A 4D8LA 1EC8A 1H1NA 3ABZA 3KTCA 1ODUA 3FKKA 2I7GA 3W72A 2JF7A 2VEPA 3CJPA 4JICA 4O1EA 2Y85A 2NLYA 4WIWA 1J12A 4BZYA 4D6EA 4AU0A 3M5ZA 4J1OA 4QISA 1L6SA 1ZU8A 2F61A 4AFYA 5MKGB 4FB7A 4RDYA 1GKQA 4DJFD 1KXQA 3BJSA 5CC5A 4DIAA 1EYEA 1YPIA 4E5TA 3HG2A 1OFRA 1VH7A 1WKYA 2OX4A 5ECVA 2BOGX 4ADTA 3ERPA 4UZSA 3EDEA 2X1UA 1LQAA 1HUVA 3KS5A 3D47A 3SW6A 4M80A 3MUY1 2VEFA 1AW2A 4JKMA 2QAPA 4GK8A 2EPKX 4NYYA 1AQMA 3AYRA 3LCGA 2YXGA 5KINA 4NZJA 3M0JA 2ZE0A 5JUVA 2ZTJA 3INPA 1W5OA 3TJLA 2V38A 3DERA 2VX6A 3W1UA 1QTWA 3MDUA 4Z0JA 4GX9A 3WJYA 2VGIA 1UOKA 2PZNA 3TTOA 4R27A 4JNZA 3LENA 1W9BM 4HTYA 4CN4A 2OYKA 4HPNA 1X38A 1Y5XA 5CG0A 1K3UA 1J0HA 1NEYA 3GFZA 1MQQA 4JGDA 3E2QA 7TIMA 1YYAA 1D8WA 4QP0A 3NURA 1D3CA 2Y8KA 4MB5A 1JQXA 1EXPA 2HBVA 2OVLA 2HEJA 1W9DM 5CPOA 5EBUA 3ZVIA 1HTIA 2GL5A 5FA5A 1G6CA 4OBTA 1E6ZA 3IJIA 4WDWA 3CK5A 1DJYA 4NHVA 3WLKX 3VGFA 3HA1A 4JKKA 4W87A 3ZR4A 3VOHA 4UTMA 4NZCA 3Q65A 1QPOA 3UVIA 3WF3A 2ZE3A 3DIPA 3WLIA 4LUSB 1XIDA 4JY9A 3QVQA 1W1ZA 5FF3A 3PBMA 1Q7MA 1EC7A 1JCLA 5H2ZA 5I78A 2GJXA 3R89A 2QCDB 3IIVA 1YXCA 4EE9A 2GJLA 2QCMA 3LGGA 3LLDA 4PMJA 2TAAA 1A5NC 2AOSA 2VRJA 2QJMA 1CGVA 1XLHA 3ZXWA 3IUHA 4FAMA 4GACA 2YIHA 1QDSA 2YW4A 4JIHA 1DWIM 2UWFA 4AHPA 1K7XA 4IUOA 4FI4A 3GHUA 1ZAJA 3LSBA 3FVDA 1XYBA 4WJ8A 2PDLA 3VOIA 3TH6A 4S23A 4GUHA 2YYTA 3OG2A 2ZRWA 1WB0A 2B7PA 2OLSA 1W2VA 3UR8A 2V63A 5A8GA 2R1PA 3CTTA 4R3UA 2FFCA 1LL4A 4HHPA 3RCYA 4O1BA 2O9RA 2VGFA 4Q7BA 2WHKA 4O19A 3LLXA 4U4MA 4DUVA 1XSIA 5A8MA 4RE4A 1W5NA 3EMQA 3TQVA 4AZCB 4UQDA 3IV8A 4LFYA 2JF6A 5BXPA 1YHTA 3IJDA 1J8VA 1ZBKA 2B31A 3B40A 1JXKA 3NQ2A 1OF8A 2VZTA 3ALFA 4M6QA 1KQYA 4CCCA 4OBRA 4PRWA 5I3GA 3RG6A 4A3RA 1X97A 2YCKX 1EJXC 4O1AA 3WDRA 3HOJA 1MSSA 4HJWA 2C1HA 3DN5A 4ATLA 2P88A 5D03A 4DB7A 3GTNA 4AEOA 4MZ8A 4IWWA 4FOUA 2YSWA 5HR7A 1V93A 2D0GA 4HB7A 3IJ7A 1EQPA 3TNBA 2R9RA 1SO5A 4QG9A 4CNOA 1NDYA 4H3DA 2HMCA 1HP4A 1UW9A 1QXLA 2W9MA 3H7RA 3NUKA 5LA2A 4CN1A 3MBFA 4C6DA 4N9DA 2CU0A 2F2HA 4L6DA 2ZUSA 3I7SA 3G77A 3MP5A 3RJXA 1V7YA 5DFAA 1XINA 4MB4A 1GYMA 1NF0A 3A4JA 2MANA 3ZWSA 3UYCA 3BOLA 1SMAA 2ACUA 1I2PA 3OYXA 5HINA 1HKMA 3TN3A 1B3YA 4HSNA 5K9CA 1K8CA 4YWSA 2VCAA 3AZTA 3VZZA 1VZWA 3GAKA 3O7UA 2Y62A 3EDKA 1WOBA 5JVLA 3SBFA 2INZA 3W71A 1R9YA 4ZQOA 4L6OA 2QMJA 1G9HA 5AN7A 2CXGA 1LOSA 4MYXA 1MEWA 3TQ0A 3UR7A 1B9BA 1YW1A 5A3HA 1EH9A 3UT0A 1LTDA 4HNNA 4GUFA 3GNPA 3W87A 2PWVA 3LGDA 1BFNA 4QJ5B 3W86A 4YU1A 5CEWA 4JAWA 1JI1A 5EMKA 3P81A 3WMCA 1TQJA 4C6FA 5CPLA 5DMLA 3W7KA 3LM7A 1PZ0A 3CEUA 1L2UA 3CPRA 3G8RA 4C5YA 1WA3A 1NQKA 2R82A 5F2MA 2FGBA 2DZUA 2VX5A 4HHMA 3M1ZA 4NG3A 2VFEA 4V1XA 4LVBA 4OTKA 2RAGA 4YLWA 3A21A 3B03A 1ZAIA 1EOMA 3EA3A 2C13A 4NZ3A 2D20A 2IQDA 1FXPA 2VURA 3ARXA 4IXHA 3W84A 1YNYA 2JE8A 1F8MA 3O6AA 7ODCA 3W1PA 4M0XA 1Q6GA 4PZVA 1FCUA 1XDLA 3LHWA 4H2HA 2A3CA 3VINA 3KBJA 4NAEB 1GVQA 4ERAA 1O66A 4J3SA 3IUDA 4IGNA 3W75A 1R38A 4O11A 2J7CA 4RLIA 1SW3A 4AW7A 3PTQA 4J3VA 3H2FA 1P6CA 1UMLA 3BMXA 4DBSA 1FDYA 4C7FA 1S2CA 3U5UA 4DNHA 3EX1A 3W1TA 1SPQA 1FY6A 4N7QA 1TPUA 3T1GA 1GT8A 3W1LA 5AC8A 3MU7A 3QHMA 3AS3A 4BA0A 4HIBA 1HT6A 4K3ZA 3ARYA 4O0ZA 2W63A 4JYEA 4BY3A 2DW6A 4Q6JA 4Q4QA 4PGLA 1U33A 4XZNX 3GVRA 2QMKA 4N6FA 2JIEA 1G4PA 2PF0A 4K1WA 2QUTA 4I8DA 5D2WA 1R0MA 2BSLA 1EJWC 2VRKA 7REQB 3KM8A 4ZSUA 3A5FA 1T99A 4IPIA 1IHIA 3ENLA 4Q6XA 2PFHA 4X63A 2WKGA 3L5MA 1JF5A 4UWMA 3VE7A 4A3UA 1AD1A 5DEZA 3C0JA 3DEQA 3E74A 1UWIA 3L2LA 1VKFA 3N1AA 3NL2A 1XICA 3LQGA 1BQGA 3BOXA 3EWCA 3GNRA 3WBXA 1XIEA 3K8MA 4U28A 2E5CA 1EB3A 2FPYA 4H7ZA 2CHRA 2GGJA 2GJRA 3HQNA 1ONXA 4LVGA 2ZXQA 4AYGA 3BG9A 1GVEA 3S8HA 2H6RA 4B3LA 4JNYA 1FA2A 2E6FA 5SWUA 2J7FA 5A5WA 4HYVA 1QT1A 2FKPA 2JIWA 6TIMA 3RYSA 2YXXA 4JX6A 1C8YA 3CO4A 3PUOA 3KCJA 3NEVA 1B5TA 2C71A 4H8HA 2QLYA 4LBRA 5KZDA 3B0VC 3TYEA 3GVQA 1EBGA 3DI1A 4GZEA 4C6LA 6ALDA 3GG8A 1F73A 1AW1A 4AHOA 1E6NA 1ADSA 3EX6A 1IZJA 4O54A 3UZWA 3N11A 4I6VA 4S1FA 3D3FA 1GW1A 3H12A 2JQXA 1XC6A 1BYAA 2OGJA 3CQJA 4Q8TA 5DMYA 4S39A 5E70A 4DUWA 1ZAHA 1VLIA 4JTEA 2JKAA 1NF7A 2OODA 3RCNA 3FYPA 1Z9AA 5A8NA 2ISFA 1UWTA 2FZ9A 3Q37A 2BTMA 5A95A 3DENA 4QIUA 4HZ7A 4OE7A 2FTPA 4UTTC 2XFWA 3SCPA 3G1SA 1A5BA 4WSJA 2FGZA 3BLPX 1M9HA 2ZVRA 4J3XA 3ITGA 4LF1A 1UR9A 2YA1A 1HO1A 3N2BA 2ZX7A 2J7EA 3NVTA 2NX9A 2AAAA 4JTRA 2WCSA 3LHYA 4RZBA 3GTHA 1JPHA 1HL2A 5DCBA 1OK4A 4A8IA 1QPNA 1ZSXA 2F6KA 4UXDA 3C0SA 3CHVA 1BVZA 4P7RA 4QCFA 3GDKA 4UQBA 1MDRA 4TVUA 4DLFA 3LCHA 3WIJA 2OB3A 4IF2A 4UOZA 1VPQA 2YB1A 3TTQA 2ZRXA 2XIOA 1EHAA 1N2VA 1A80A 2VZSA 4FLOA 4C65A 1HKKA 1H7RA 4J3TA 3MVTA 1SZGA 4UTLA 3GNDA 4AHQA 5FEZA 4WGHA 2J7BA 1VYRA 3S2NA 4HD5A 4UQEA 3GXTA 1TYGA 4V27A 1VFOA 3B0UX 4FX8A 3O3RA 4TIMA 1ZJAA 2RJHA 4Q8OA 1IEIA 3CIVA 2FVKA 4RW5A 2NX3A 4AY8A 3T7VA 3GSMA 3VOJA 5AHMA 2I56A 2WMIB 1DJXA 8XIAA 3ANVA 3AXMA 5AYIA 2VEKA 2ZRYA 4IZGA 1QI4A 2X41A 3CT7A 4QBXA 4WF7A 2X42A 2DQWA 3EMZA 4LF2A 4U10A 3R58A 3UCQA 1WDDA 4Y9NA 4S3DA 1SO6A 4E2BA 3LZ3A 5XIMA 4JIEA 3UY7A 2FHCA 1QRQA 4XAPA 4M24A 1U1JA 5DQPA 1E55A 1UUOA 2VD9A 3WF1A 4QROA 2Z1XA 2C6QA 3W29A 3BZGA 3K46A 1XYZA 2OEKA 1FWJC 4P8UA 2QCHA 1JRCA 3BW3A 3FEMA 3T81A 2O4MA 1X6UA 2VEIA 3B97A 4S38A 3WEMA 4DI8A 4E2DA 1J2WA 5AC5A 3QOKA 4TX6A 4KERA 2CLFA 3CZKA 3W7JA 5CPQA 3LEPA 3TSBA 4WY0F 4EIVA 4AIEA 3SIZA 1UYQA 4PA8A 4MPKA 2XG9A 1K9EA 1OK6A 3S0CA 1J9YA 5CSSA 5LNRA 4GQQA 1TJ2A 4PCSA 4RPPA 1KV8A 1IWBA 3GW3A 5AC7A 1KTBA 5HQMA 3MHUA 4W8BA 4LTSA 4PUKA 3CL7A 2E6YA 3OGSA 4P8WA 1P0EA 2VGBA 3BV7A 1W3KA 2DORA 4PMNA 4UC5A 1XBVA 3R10A 2E67A 3AO0A 3RJYA 3UPBA 1OVDA 5K9DA 2VCBA 4Q33A 4WDTA 5DCEA 4GGBA 1H61A 5BW6A 4NNAA 4O4WA 5E6ZA 3EKZA 4LY8A 4K8HA 4CNSA 3LBOA 1M65A 3KW3A 4U3AA 4UMAA 3UXKA 2G41A 4FNRA 4KPLA 1MW1A 1XIIA 3WK2A 2GYIA 5AHNA 5FJPA 4A8RA 3AZRA 1GZJA 3AIRA 3S5OA 1IZCA 2I1OA 5ENLA 3VDBA 4UTUA 2J9XA 2D3NA 4PUDA 3AMKA 1QI2A 4MZ1A 3CUGA 1GHSA 4LB4A 3SIMA 3F4DA 5J5DA 2CXEA 4GZ7A 5H8PA 1CGWA 4RK8A 5EYWA 2PDWA 3R5EA 1MI3A 1V4YA 2G3FA 3BARA 4AZBA 1PDZA 1E1FA 4LVDA 1XLAA 1H63A 2XFYA 2BY1A 1L2QA 1NWUA 5K4XA 3HB9A 3DG6A 2D0FA 2OX1A 3S5NA 4D6GA 1XIGA 3T8QA 5DLCA 3GIPA 4PL1A 8TIMA 3B0XA 3BSGA 4QDPA 3KOYA 4FMVA 2WMKA 3LHZA 5C5YA 3VGBA 3UWVA 1N82A 3W53A 1A5KC 4L4OA 3CLWA 5DELA 5BOOA 1E51A 5C9RA 2V5BA 1W37A 2YCLB 3W7MA 5HWNA 1H7NA 4BI6A 3A5VA 4NP7A 4HBKA 1CGXA 3W1AA 4HU8A 4ADUA 3HQ1A 5AVNA 4LJ3A 3HV8A 4WOQA 4HA4A 4EWJA 3FYYA 4MM1A 5FEPA 3ARVA 4IM4A 4KGJA 1RAKA 4CD8A 2UY4A 1FHDA 3A6OA 3CAKA 2NVDA 2D2HA 5IM51 4ACYA 1G0CA 1UOZA 3DGRA 1G4TA 3TWBA 4AD3A 4C6BA 3RM9A 1OYAA 3CLMA 4B2DA 3N9RA 3USZA 3LBMA 5A6KA 3BJFA 1W1YA 2O9TA 2VGGA 1YX1A 2GQ9A 1W3IA 3FJLA 5B80A 1KFCA 1AQFA 4NZ1A 4H7CA 3EOUA 4J40A 4DZHA 1VFMA 3A4WA 3K4AA 3SUUA 4ZL1A 3FX4A 3W83A 1F2JA 4OUEA 3HJEA 3SADA 1ISXA 3W1RA 2IXUA 4NUWA 3DOPA 2WSYA 4QLJA 3N2XA 3U4AA 1UP0A 5MF5A 4CGTA 2E25A 1LOLA 3ABQA 4GYKA 1SFLA 1MEHA 3GC2A 3OLDA 4A2RA 1Q63A 2G0WA 2A4AA 2GQ8A 2NXGA 2BY2A 2PS2A 3GKAA 3V7PA 3MZ2A 1KBIA 2GVJA 1MYRA 2QR6A 3CH9A 4M51A 1JZ7A 4YTQA 2JK2A 4QG8A 3GH4A 3TZFA 1NIUA 1A3WA 4KGLA 3F4NA 1OZQA 3BLKA 1XX1A 1J5TA 3ICJA 1ITCA 2AGKA 2P0IA 3CZ8A 2CHOA 1RUSA 3NSMA 5EFFA 1QK2A 1H11A 1PTGA 2GGGA 4RXGA 1FUYA 1I9CB 3ARUA 1UG6A 3T8LA 5LGZA 1NFPA 3MBDA 3T4CA 3G3DA 5LIYX 4DJDC 3S1WA 1F76A 4AEFA 1DJHA 1WKFA 1JCJA 2A3LA 2NUXA 2V69A 4XBSA 4WK9A 3VNZA 2PTZA 3OVGA 2WCGA 4JOMA 4C7DA 4MKSA 1UPPA 3ARPA 2OU4A 3SECA 4HCDA 3CHEA 5AOUA 1GORA 2ZWYA 1NOWA 1TREA 3EGJA 3TCSA 3QC3A 1YNPA 4U3CA 5G1YA 1VS1A 4LVFA 3B9OA 2WZHA 3RIKA 4A6GA 1EPXA 3BURA 4AX7A 1PX8A 1VIWA 2GSHA 4QCEA 3SGUA 3W23A 1PZ1A 1W1VA 3TXVA 4MWAA 4ZODA 2ZBTA 2FZ8A 1F6KA 3OJGA 2Y0FA 4N4PA 1OINA 3VKBA 3G6MA 3CUIA 3U5YA 1KM0A 2E9BA 3AYVA 2X09A 3DKJA 4WY0A 4L56A 3RGTA 1J0IA 5F2IA 2XSAA 1T7LA 1KGUA 3RMEA 4UCFA 1S2VA 2WC7A 4ZQCA 3VMPA 3FCPA 3CASA 3VKAA 3M5VA 3QMRA 3I6TA 2C8NA 2YBTA 3MI6A 3CV1A 1QR7A 1TVLA 2YCJA 2V30A 4BHYA 5GJMA 1E6RA 3TP4A 3VVGA 4AIBA 3SN4A 5BROA 4DXXA 2QUVA 4KFPA 4GIAA 3V5OA 2H90A 1E15A 4EP8C 3MP4A 1Y0EA 3CT2A 3E0LA 3GM8A 5FF2A 4H8NA 3WX7A 4XD3A 3OVQA 3M0ZA 1BSLA 1HJWA 1VAHA 3T0BA 3OHIA 5C0QA 3IGHX 1WE5A 3RX4A 4D71A 1XRVA 3UWWA 2OGYA 8RUCA 3VIIA 2WMJA 2PD9A 1EWDA 3PJTA 4LC8A 3PHAA 3H2EA 2XU2A 3U4FA 3IIOA 2PDXA 4HA3A 1CB2A 1MNZA 1OT1A 1BWLA 4ZSTA 2ZQ0A 4C6PA 4LAOA 4MDPA 3FGCA 5DN1A 3L5LA 4CLMA 3TV8A 2ESCA 4HA1A 3ES7A 3TMQA 3HZ3A 4IHCA 1XLJA 4TXEA 3LMYA 2OLHA 5BRPA 4I7WA 3I68A 2W6RA 4C60A 2F8QA 1A5OC 2FGLA 3EDFA 1AK5A 3MA8A 2O56A 4NJIA 3WJZA 1QOQA 2J4GA 1MXDA 3RNDA 3BV4A 1DHKA 2X30A 1W1TA 3THQA 1TMLA 1KGWA 3OPSA 1IEXA 1TA3A 4OZOA 5I3HA 4EAYA 2EPLX 4GQRA 1FWEC 2XN0A 3VABA 1O5QA 5AHFA 1OSEA 1LQ0A 1JCYA 2F84A 2NQLA 4IUGA 1EJSC 1V02E 1KM5A 3QJAA 7ENLA 1TZZA 2FMOA 3V0SA 1RLCL 2DFAA 6REQA 4LRTA 4GD0A 3PBYA 2PURA 1JGMA 2ACRA 2VC7A 2BY3A 4LUYA 4DWSA 1KTNA 3HMCA 4X2PA 1F3XA 4UZUA 1KBLA 1W3TA 1JZ4A 1VHNA 3TOYA 3BCDA 5AC6A 2BDQA 4TV5A 4KT2A 5I03A 3EAUA 5ABFB 4CU6A 3VOGA 4K37A 2QDGA 4AZIA 2Z1VA 1U1UA 1WBHA 3MB9A 1L6FA 4L80A 4MLRA 2GQ3A 1H50A 3S2JA 4JFUA 1NFBA 1C9WA 4BF9A 3WF0A 1KM3A 1W9XA 3THCA 3R12A 3GZAA 3N6HA 1J0ZA 1SZFA 3L0NA 4XTDA 3T2PA 4BWLA 3H53A 3PK7A 1ZP3A 4Z2IA 2OEMA 3WO8A 1EZWA 1THFD 4GI9A 4ZE4A 1PYFA 4IIFA 3SRHA 4DVOA 2CIPA 3V35A 1K9DA 1YDVA 2G3NA 4FLQA 2VT0A 1MUWA 2P5NA 4LAMA 1QW9A 1TV5A 1E0TA 4DZ5A 4PODA 3UCDA 5G2HA 5E0CA 1RQEA 3A64A 4G8TA 4OOZA 2R6OA 4YCOA 1J11A 2QS8A 1GTHA 3UWUA 3A4AA 2E9LA 2P0OA 3NXFA 3PFRA 1OY0A 4EWND 4TX9A 3AAMA 4Z2GA 1AZ2A 4TUFA 1JGIA 3TA9A 2C0HA 2PGEA 3NQCA 2QPUA 3N14A 1XH1A 1UKOA 1W2PA 3T4WA 3B9EA 2NV2A 1ADOA 1G7VA 5HANA 4V28A 4EVZA 3TYBA 1RCXB 5MKGA 5HPOA 4QLLA 1ME7A 5ABGA 1OIMA 4C1LA 3WD3A 4FR6A 3BG3A 1UA3A 3U48A 1GHRA 3FFSA 1WV2A 1ZP4A 4FHAA 3UXIA 4RDZA 3CM4A 4MJMA 3GS6A 5GJNA 3K13A 2HE5A 3ZR6A 1Q6LA 2GVGA 3CIWA 4NSBA 3EMCA 3ZS4A 1SJDA 4DYJA 2JBMA 5BXSA 3C3UA 1UD5A 3SGGA 5KZ6A 1SZRA 5AFDA 1LG1A 4ADSA 3TROA 4H4IA 2WNWA 3VA8A 1XIBA 1AD4A 4AVFA 1FWWA 4AD4A 4FX7A 2R14A 3U7VA 4AZGA 4GNJA 2G3JA 1C29A 3PBWA 3ZLHA 3T0CA 1KNWA 4ZR8A 3TJ4A 1IEWA 1R3RA 3KVKA 4GXPA 4JY8A 4OGZA 5HMDA 1KWGA 3ELFA 1PIIA 3TC3A 3SDOA 1WUEA 3DFNA 3W7IA 1D3GA 5D9NA 4HSOA 3CXOA 2EXOA 3B8SA 4S2CA 4FF5A 2OWXA 4LV9A 1AQHA 4E3TA 2CBJA 1F05A 3MKKA 4I90A 5LSMA 5HK4A 4CEXC 4RZ5A 3B3DA 2ZUUA 1QK0A 5BU6A 1Q6OA 4XZLX 4DX3A 2PDMA 3VZYA 3QGVA 2ADAA 2QCEA 4FR1A 3E12A 1UD8A 3PB0A 1G5AA 5I3FA 3H2CA 2PF8A 3AISA 4GQBA 3JR2A 4PL2A 4CKQA 4EACA 1RP9A 3BE7A 3G18A 2Z28A 4IGSA 2YJQA 3KRBA 2FB2A 3GDBA 1LM1A 1VD6A 1H7XA 2P76A 4AZ7A 1V3MA 3TFCA 1Q6CA 1BKSA 3POHA 2YLAA 1FP9A 2WWCA 4CD7A 1BVNP 3OQEA 4WOZA 2AL2B 1UR3M 4KWSA 3HG4A 3CIXA 3NYZA 1F3TA 1Z32X 3NQGA 4L4MA 2HQAA 2VDIA 2YDSA 4Q8MA 5HATA 3BLDA 1G94A 3HTWA 1J6OA 4MLJA 4Z2LA 2PD5A 3W7DA 4ZE5A 3A9IA 2ZYFA 2WQPA 3EKLA 1G01A 4Z1BA 3KHJA 3E2SA 3WDIA 3UBPC 1OABA 5H1WA 4GJIA 2YFOA 4M1RA 3I7QA 2WSQA 1R2RA 4HP5A 2CKSA 2DVUA 4FNQA 3K30A 3GNXA 3IVTA 2BOFX 2NT0A 1NARA 3TW7A 5FACA 5BCAA 2GK1A 1R87A 3VTRA 1B1YA 4HPHA 3GH7A 3LYEA 1ZNNA 2O9OA 4X60A 3BMVA 2VR2A 3LU2A 2GFTA 2O92A 4PYSA 4N42A 3PB2A 4IP7A 4PE8A 3HGRA 4PULA 1CCWB 1V6UA 2BV9A 3GQYA 5GJPA 3ITYA 2NSXA 2JEQA 4E4FA 4H6QA 3AHVA 1ONWA 2E77A 4WKHA 1ME9A 4AUBA 1DJGA 1SW7A 2I9EA 2VWSA 5CPNA 4IG2B 1Q6DA 1K4HA 3MVIA 1AODA 3N29A 1A50A 2CLHA 1VF8A 4HNTA 3NA8A 2OWCA 1E6QM 2BP1A 3C2FA 3GE7A 2Z1BA 1Q6EA 2G3IA 2QYGA 3B8UA 4DZIA 1HGWA 3NIYA 4DJFC 2XM2A 3SCRA 1XDJA 3W88A 2D22A 5BU9A 1Q85A 2I14A 3TZNA 1Q2RA 1BVWA 2YA0A 4O15A 3RR1A 1E4IA 3PPHA 1TUXA 2RDTA 2C79A 3GW0A 4RNJA 1V03A 2VNCA 1CWYA 2QDDA 2OSXA 3VCRA 2G5WA 4B4HA 4E2OA 4V15A 2VDHA 3QGKC 4HT3A 3LXBA 4IFRA 1CENA 1K6WA 3GIYA 1V3HA 3W73A 3NQ6A 1AMYA 4Q8PA 3PY2A 1EP1A 5FL1A 3ME3A 1R3VA 4E8DA 4Y7EA 6CGTA 2HVOA 3MCNA 2CKRA 1DWHM 1OCJA 5HR6A 3SGZA 2W62A 3M0XA 4LYRA 1E6SM 2ZX8A 1B3WA 2PGWA 1UMYA 4DF2A 4PFMA 3KVMA 3AMCA 1X98A 2WW5A 3R0DA 3PBVA 2VXNA 3QV8A 4ZEPA 4DF1A 3U9IA 4OQVA 1PE1A 2IPWA 1NAL1 1JULA 1RK5A 3DUGA 5JBEA 1IEQA 3LNPA 2YZRA 1YPXA 4UCGA 3EKGA 4FA3A 2Z7GA 2POTA 3P6LA 5HAOA 1RZMA 1KWKA 2JGYA 1N55A 1EUNA 1IXOA 3EA2A 2OZ8A 3P0WA 1QI0A 3PM6A 3IGSA 3KOZA 4JFTA 4QX4A 4WEVX 3W7EA 3CGTA 2PRHA 1R3QA 4G9PA 4IISA 5LYRA 2J25A 2EPHA 1DOSA 2ZOXA 3W2NA 3DAQA 5I3IA 3E0WA 2HV5A 3ZR5A 3OB8A 3F4VA 3SUWA 3B05A 3G24A 2DSZA 3M7SA 4HK7A 4IPPA 2O4QA 1MUCA 2TODA 1FWIC 1ICQA 5IDZA 3OBAA 3FK4A 4JQAA 3AROA 5FJJA 1V3IA 4PRTA 4OHQA 4AF0A 3NDYA 2F38A 1G69A 3ZJ7A 3G1FA 1JYNA 2A0NA 3CZJA 5ABTA 2WK2A 3WNNA 3WLPA 4W7VA 3QV7A 2Z2UA 4Z0SA 3IIXA 4CQ8A 2IXVA 1MW0A 3SQSA 3H55A 5F4SA 4LAZA 1PEZA 5FJTA 4P7NA 1FCVA 1SSDA 3WLNA 1KCKA 1YMYA 3DFTA 1Q45A 5I23A 4QGCA 5BMXA 4LCSA 1LT8A 4G56A 1TG7A 1SZEA 5IFTA 1W8GA 2R91A 3RLVA 1REQB 1LT7A 4WLCA 4XX6A 2Y63A 2OQHA 4Y8EA 5AYBA 3VGHA 1H49A 3K1DA 1BRLB 3EEGA 3AC0A 3WQGA 4AD1A 4WVXA 1K8ZA 2H3BA 3W1MA 3CUHA 1G4EA 4M1BA 4LALA 1CYGA 3DG3A 1QASA 9CGTA 4WGXA 5XIAA 4YPJA 4GVIA 1DIOA 2NVAA 1EZ2A 3OZPA 4YXGA 3BCJA 4M7SA 3R94A 3N2CA 1KR1A 3WLTA 1W1IE 2QUMA 5D2YA 2PEVA 1YTEA 1E0WA 1VFFA 3W2KA 1CXIA 1TE6A 3QM3A 3CNYA 1M53A 1ISVA 5C9WA 1XBXA 4S3EA 3A3WA 3DCPA 2PCQA 1TVPA 4XKMA 3QR3A 3AFBA 4P61A 4B5TA 4H9VA 4KEVA 3AS2A 4I9MA 1JG9A 1XKYA 1A4MA 3TVAA 5FI8A 4Q4OA 5LIKX 4B92A 2WHJA 3LPPA 3L0GA 4Z2JA 1Z44A 4YIWA 5CZSA 1J0KA 1DV7A 5BYWA 4HK5A 3AICA 1GZGA 1EPVA 3RITA 3MMTA 3DZ1A 4EOUA 3RM4A 2HPMA 4YWIA 3E9AA 4MMWA 6ENLA 2X2YA 5AYZA 3IGUA 2WAGA 3MO7A 2CWNA 3S2LA 1NU5A 4YL2A 1KFLA 3T6CA 1OX5A 1FWTA 2FTYA 1Z41A 3VMNA 5HQLA 3O0KA 5HNNA 4IMCA 1TCMA 4O50A 2INEA 3W22A 5HJYA 5E9AA 1T0OA 3S6DA 4AH7A 2C91A 3EWXA 3T78A 4GLEA 4GYFA 3E0FA 3W70A 1I1XA 3NJ3A 3GXMA 3RPTA 1EA9C 3CMFA 4I8YA 2CZVA 1W3LA 3WDJA 3KDNA 1WXZA 4C1NA 4HZ6A 4K39A 4TTGA 3THAA 3M64A 5REQA 5C2XA 1GKPA 2IPGA 3UZ5A 3DFQA 3TR9A 3WNOA 3LLFA 1ALDA 4DI9A 1B30A 1PV8A 3MJYA 1DWFM 1YIXA 4W85A 1CBGA 3KRZA 1MQPA 1XG3A 1O6IA 3BK0A 3OW1A 1WDRA 3BSMA 2TYSA 1XIMA 3NZGA 4F40A 4MY1A 3U3HA 4IPJA 1J01A 2G50A 2BXZA 2X7VA 1F07A 3O6CA 4FNTA 3W25A 3WLHA 3KCLA 4ONVA 4WJEA 4FF7A 4O0KA 3WBEA 5LNWA 2BASA 1N8IA 4B3ZA 3LHTA 4V1YA 2TSYA 1UROA 4S3GA 3VZXA 1EEPA 1JYWA 1D7FA 2XIBA 3WQEA 1HJVA 5D2VA 4PN2A 3W0KA 3EXRA 3Q4DA 1I2OA 4LX4A 3MYOA 3PZGA 3HPZA 2XH0A 4QJ4B 1DJIA 3PR2A 5TAOA 2KAUC 4ILSA 4US5D 2YPIA 1KM1A 2GSJA 4DUOA 5JQ9A 3C52A 2DT3A 1L8PA 4KRTA 2PWHA 5TD4A 1DQWA 2CLMA 3TJIA 4IMEA 3G22A 2HRWA 3LMZA 1X1NA 1PBGA 2XGBA 3HG3A 1I2NA 1GVYA 5JH2A 3IJ8A 2F6XA 3AIEA 3W37A 4AG0A 2VFDA 3E38A 4REQA 1VQTA 4QQ3A 4CCEA 4H19A 5LHFA 4HPXA 1G7UA 3LV6A 4L1GA 4HOWA 4CQ9A 1DJNA 3VD4A 2QNEA 3PP7A 5E9XA 1S38A 2BB0A 1V8EA 3WBYA 2EO7A 1ZLPA 2YBUA 2XWDA 1F3WA 5IFPA 3IJLA 3S2CA 1VC4A 4J2MA 4C6KA 2V3FA 3W7CA 1A5MC 1PZ3A 4EPDC 3URQA 1B3OA 1PYMA 2E4TA 2O7SA 1S5VA 4URIA 1A5SA 1HKIA 2PP1A 5C6MA 4K68A 1XHGA 1WPCA 4I7UA 3WLLA 1RJQA 3JS3A 4JIPA 5XINA 4GINA 3U8GA 4C6CA 1AH3A 2WPGA 1EP2A 3OG3A 2PBGA 4BF5A 2J62A 3PF3A 3W85A 3N4EA 1DBTA 1UPMB 2XSBA 3AHYA 3N6JA 5HMSA 5KEZA 4ZQPA 4FZIA 4XUYA 2O7QA 1DQXA 3E3HA 2PGRA 3MUXA 4G5DA 7XIMA 5FJUA 1BTCA 3DECA 1UA7A 3G0XA 9XIAA 4LAKA 4JTUA 1M7OA 3DGBA 3D46A 3HN3A 4BFAA 1XYAA 4DJEA 2QUUA 2C0AA 3O6DA 4TR9A 3TX9A 3C2RA 1K77A 4I9AA 2BHZA 1FCQA 2A7PA 4Q4MA 1SVDA 4Z42C 3S3GA 1KRBC 1QBAA 3CZLA 4MKVA 1V6YA 3MW7A 3OIHA 3CQ0A 2D23A 2PDBA 3A22A 2Z7KA 3WK1A 3VDCA 4EF8A 3ANUA 3EEZA 2PBOA 2OKTA 4N4QA 2BODX 3DESA 5DXYA 4GMEA 5TQLA 3GG1A 1O12A 4RDVA 4QS6A 3CAQA 4H9XA 4D6JA 4Y9MA 2XVGA 2EAWA 3IJ9A 1IQ8A 3OP2A 5FEWA 3ZSTA 1BG4A 3R11A 4R9OA 3C5QA 3BICA 3N3TA 2GJPA 2A6NA 5BOFA 4O53A 1XRTA 3GY1A 4IPNB 1HL9A 4GHRA 3G8EA 4KWWA 3M7WA 2WANA 4MNJA 3KTXA 2I5GA 1XLFA 4GUIA 2EKGA 5M1TA 3JW7A 1IWPA 2BMBA 2GUUA 3IJ6A 1CLVA 1RH9A 1F6PA 2VX4A 3TLLA 1VJZA 2W61A 1ZCOA 4M3PA 3DBPA 3W2UA 4F66A 1VBRA 3ZJKA 2FH8A 3UETA 3PUGA 2BS9A 3LM3A 1I8JA 4UTIA 2P8BA 4AWTA 5JXQA 2YCLA 1KM4A 3C0QA 1QO2A 3W9ZA 4XZBA 5A2CA 1Z48A 3QY7A 3M0YA 4F9DA 1CGYA 2PA6A 3WNLA 2E5DA 4A2SA 1QOXA 2OMAA 1NWSA 3L4ZA 4JL2A 4O8AA 4H04A 3SY1A 2WVVA 1G4SA 1O5RA 4CU7A 1GOWA 1ONEA 2PDHA 3P80A 2G4FA 2Z27A 1ISYA 1NDZA 1K8YA 4MWAD 1RLDA 2XGIA 3MMUA 2DGAA 1QO5A 1JFXA 3FJ6A 1RV8A 4NJJA 4K7VA 4J27A 3KL3A 1HVXA 4WXZA 1XJBA 1QUMA 1XIFA 3R8HA 5LGXA 2WKLA 4KEMA 1GG0A 3ABXA 2EPMX 3VCNA 4QTGA 4ZOCA 2CZDA 2BX7A 1NP2A 3FOKA 3G3MA 1E72M 3L23A 3EYPA 4EXAA 5C2CA 4A22A 2D69A 4IICA 1QHPA 4IGMA 1UP3A 2IQTA 5FJRA 3SM0A 1NOUA 5E6YA 1ZFJA 2CFFA 1ZBVA 5C2GA 1L6GA 4BCEA 2ABBA 4RNHA 2YX0A 2W0UA 5CZKA 3I7RA 3UFYA 4FS9A 3WQ5A 5M17A 1MW3A 2X0YA 3C61A 2Q09A 3V1HA 4QE4A 3ECQA 3W1QA 1JRBA 1QHZA 4AWEA 3WD4A 3TFXA 2CLPA 1SMDA 4U2YA 1V5XA 4G2DA 3A3HA 1PTDA 1S1PA 1DYSA 1HF6A 3S4TA 2QGHA 5D9OA 2QVHA 2QVNA 1GVOA 4NX0A 4PTXA 3WQDA 3WLOA 2ISVA 3OEXA 3LDVA 1R2SA 2ZA1A 3A24A 3B8WA 4JTFA 3VIMA 4HU0A 5D38A 1UCWA 4WDXA 3CHFA 1PVNA 4MUZA 3SAZA 1J18A 3WFZA 1LP6A 3NL5A 3HV9A 1LRTA 4DLMA 3M43A 1PHWA 2HBXA 3H24A 1WO2A 2XIJA 1C3FA 4GIYA 2HXUA 1Q6RA 2HE8A 2DZSA 1KRAC 4P7LA 2XIMA 3NZPA 3OODA 3MCOA 4FP1A 3KTSA 5HQEA 1DP0A 4O1FA 1ISWA 3QKEA 4DO6A 1POKA 4WXYA 2WCAA 2EPOA 3R6IA 3KBSA 3PFMA 1TO3A 2LLEA 1LBLA 3WNPA 3HFTA 4Z1CA 4C6MA 4L64A 4CCDA 5F2LA 3IUIA 5IOBA 3SCVA 4B4FA 4C6QA 3N4FA 3MJMA 2VR5A 3VIOA 3TYDA 5TIMA 1ML1A 1EBHA 1FWSA 1CT5A 2OELA 4JNMA 3JU2A 1B57A 4RXFA 3R0UA 3TWAA 4HPJA 4ECLA 3HMJG 2FZDA 4RR4A 3TR2A 4DWSD 3GVVA 4NI8A 3TE9A 3KCOA 3W76A 2VEGA 3QPZA 4K38A 4NNBA 2AMGA 2NXHA 1W56A 2ZRUA 2Y89A 1O1HA 1W91A 1X6NA 1NVMA 4ZO6A 2A3EA 1TPWA 1XBYA 4JDBA 1TRIA 3GHTA 3LCXA 4I9TA 1VFHA 5MHBA 4GYJA 1KGXA 2VEMA 4KESA 1ECEA 3GC4A 3PZIA 2XH2A 1E3ZA 1OEPA 4BQ4A 1ZALA 3IANA 4AVOA 1HQTA 1TV8A 3FJNA 2RGMA 3CHCA 4ML4A 3QY8A 1U5HA 1NDVA 2PDNA 4O17A 3CWOX 2B0MA 5DANA 3M07A 3RLUA 3APGA 1AJZA 2GJXB 2GQAA 3QLLA 2QV4A 3K5XA 2WSPA 4BF7A 3UPMA 2NT1A 2FMNA 3SY8A 4GRSA 3LGEA 3QFWA 1SQ7A 3VD3A 5I77A 2CESA 1OGGA 3W24A 4RE2A 2QJIA 5K9XA 4RW3A 3BAIA 3VDAA 1E73M 2G95A 3TN5A 3OLEA 1F3EA 2ZX9A 4LC6A 2GGEA 1GWJA 2PDJA 4JS3A 3KP1A 1FTXA 4U33A 5T26A 1GQJA 2FZNA 2OYLA 2XISA 4IQLA 4JPGA 1JNDA 2V5CA 4IIHA 3LUTA 5CQ1A 2RHGA 3NPVA 1V79A 2RGLA 1W32A 2X1RA 4JEJA 1PB0A 1H3GA 3OA5A 2X1IA 1O94A 1R86A 4XWUA 3W7NA 1A3XA 1HL8A 1LORA 4ALDA 1BYCA 3LG3A 1CGUA 4K6AA 5AHLA 4YHGA 2OQLA 2WC4A 1VLWA 5GNYA 1K70A 3NGJA 4CNNA 3UNTA 3NTYA 4U2ZA 1D9EA 1D7KA 2RUSA 3VNJA 3RMJA 4S3FA 2WBKA 3M9YA 3T2OA 4QG6A 3WJSA 2E9MA 1RR2A 1TVNA 3M47A 1UIOA 4L5ZA 2IKIA 3QPEA 1XI3A 2ZZ2A 4GO8A 4KF1A 4GVHA 3WQPA 1JCXA 1Z89A 3TW9A 2Z25A 3UZJA 1WQ5A 2CBIA 4PTDA 1FWHC 2PTDA 3KP0A 1EIXA 1EXBA 4HNVA 1F7BA 2GLKA 1JXJA 1P0BA 3MUCA 3C2EA 2EHHA 1DPMA 1TZ7A 2A2IA 4CVWA 3P74A 5FD0A 3W6YA 2E5BA 4QAIA 4QDMA 1TWZA 3LHVA 3JUGA 1UUMA 4JTHA 1FFRA 3IACA 1RY0A 4GJJA 5CLTA 4Z08A 4LB3A 4CQAA 5PTDA 4ZXOA 5IRPA 5A8OA 4PCNA 4UQAA 3G1VA 2ZUNA 1XH2A 2DH3A 1UKQA 3IRDA 2PAJA 1IR1A 3EPNA 4UR7A 1RBOB 2DT2A 4GUJA 1XUZA 2DIJA 3GR8A 1JQVA 1VJSA 4A3HA 3QYSA 2PSNA 3POCA 4RZ6A 3S46A 3LSCA 4GO9A 2XZ9A 1EIBA 4KCTA 3W07A 1R30A 3ZZ1A 3CMGA 3ONCA 1WX0A 5D37A 4YHEA 5CJMA 3BZJA 5A6TC 2GVYA 3EDJA 3QQ0A 3I3BA 2DZVA 4XV0A 1OX6A 3ISIX 4WJXA 1C8XA 2Y7EA 2PC8A 1OM0A 2VO5A 1TTIA 3RK8A 3MZNA 4AXKA 4ZVJA 1UR2A 2CC0A 2YL8A 2OT0A 1XUUA 1VBHA 1UR4A 4GY1A 4LYQA 3IARA 1CX9A 2WSKA 1DVJA 4C6NA 3BQ5A 4FO4A 5I7GA 3PC0A 1V08A 5T91A 1KBBA 1QWGA 1M7PA 2BXVA 2XIIA 1CEOA 1UD3A 1VGAA 5C8BB 2WLZA 5U7SA 3SCNA 2DIEA 5T8GA 1WUFA 4UR9A 4UNIA 4Y2WA 2JEPA 5F2GA 4US6A 3PWGA 1XLGA 5I00A 2J6XA 1XYLA 2Z29A 3OZMA 4MB1A 4GIRA 1M6JA 1P6BA 5IBXA 2DZXA 4NQ1A 2CBUA 4PTWA 1V51A 4B5XA 3QOMA 4QQUA 4PBGA 3VYLA 1P1XA 4OOUA 2NVCA 1X8CA 3WNMA 3AOFA 3VMOA 3TYUA 1SGJA 4FNUA 1C9DA 4DUXA 1DEDA 1WP6A 4I5UA 1UWQA 4MJ4A 2PTWA 1US0A 3ZQ9A 3EWDA 4DBUA 4M5PA 4KFOA 4JFVA 1QMLA 3I6EA 4GH3A 2IKJA 4UOQA 4H6KA 2HDJA 3RO8A 3NL6A 4BS0A 1D3HA 1W1PA 1P1MA 1CB7B 4AC1X 3RLHA 4ATDA 1PKNA 4LAUA 2GDVA 1JUEA 2P53A 3OTRA 4XAZA 3PG8A 1FDZA 1UZ4A 2HWGA 4MHBA 5G2IA 1UH3A 3VDGA 4DRSA 4W89A 1H62A 1O1ZA 1BF2A 4D1JA 1OFQA 1S5MA 1E1CA 3S5ZA 3VIJA 3BW2A 3RDKA 5AKQA 3IEBA 5EGRA 1JIBA 3LPGA 1AJ2A 2POZA 1GGOA 3HIJA 3EWYA 2AL2A 1GQNA 3HQOA 1VPYA 2BOEX 2Y7DA 4XZHA 2CYGA 4JIQA 2R1LA 4O4VA 3FJ4A 4OV4A 2Z26A 3N9SA 3L7RA 3MC5A 3TKFA 1T8QA 3WFLA 1B4KA 4JTLA 4YS1A 3VAVA 4YNGA 2V3EA 4RKAA 4KEZA 3RX3A 3SN0A 2NLIA 1PO9A 1W5PA 1VEOA 3AS1A