3MB9A

Human aldose reductase mutant t113a complexed with zopolrestat
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
314
Chain Sequence
b'SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3mb9A00
3BURA 3LZ3A 4JTCA 2DUZA 3V36A 2NVCA 5AZ0A 2PEVA 4GA8A 2BP1A 3UP8A 3V0SA 1Z8AA 3WBWA 1AH3A 1R38A 4LBSA 4LB3A 1YE6A 4JTQA 3F7JA 4JTRA 3T42A 3LEPA 4JQ4A 4LAUA 3MB9A 2ACQA 1ZUAX 2PD5A 4GACA 4WEVX 2IKIA 3EB4A 1UR3M 1C9WA 2PDHA 5HNTA 2FVLA 2FZDA 5LIXX 4JQ2A 1RY0A 4GQGA 2PZNA 4Q3MA 4F40A 3WBYA 4WDTA 4IGSA 4ICCX 1SM9A 2IS7A 2PFHA 4DBUA 1GVEA 4PMJA 1EF3A 1XJBA 4XZMX 2IQ0A 1S1RA 4YVPA 4DZ5A 2PDJA 3DOPA 3CV7A 5LIWX 3Q67A 4LAZA 1Z89A 4JIHA 2PDPA 2PDXA 1QWKA 4G5DA 3H7UA 4YVXA 3P2VA 1IEIA 3H7RA 4IJRA 4PRTA 2P5NA 1M9HA 2F2KA 4FAMA 3V0TA 5LIYX 2PF8A 1YNPA 3MC5A 3R8HA 4HBKA 1YNQA 4I5XA 2PDNA 2ISFA 2PDLA 3ERPA 3KRBA 4NKCA 4XZIA 3C3UA 4YS1A 3M4HA 2IKJA 3S3GA 3LQLA 3WCZA 3UZXA 5JH1A 2ACRA 4XVEA 3R43A 3U2CA 1AFSA 1Z3NA 1PZ1A 2HE8A 1ZSXA 5C7HA 2PDGA 1LQAA 2ALRA 3B3DA 3UGRA 5HNUA 3VXGA 3EB3A 4FALA 1J96A 4OTKA 5LIUX 1EXBA 4QX4A 5JH2A 3NTYA 2HVOA 4WRHA 3UWEA 1AH4A 1RY8A 1ZGDA 3R6IA 1S1PA 4JTDA 2CLPA 2FZ8A 3QKZA 4RPQA 1PWLA 2ACSA 1IHIA 3BV7A 5KETA 3R58A 2PDUA 5LIKX 4MHBA 4L1WA 3LBOA 4PUWA 1AZ1A 3CASA 1QRQA 3FJNA 5AZ1A 2I17A 2BGQA 3V35A 2IQDA 1Q13A 3RX3A 4H7CA 3R7MA 1XGDA 3WG6A 4R9OA 3H4GA 3LENA 2PDMA 1YE4A 1T41A 1HQTA 4PRRA 1RALA 2PDKA 4WDUA 1S2CA 5HA7A 1S2AA 4HMNA 3LZ5A 2IPJA 4L1XA 1US0A 3UFYA 1OG6A 2HE5A 2PDYA 4JIIX 4FZIA 2HV5A 4YU1A 4PR4A 4XZNX 2IPFA 1X97A 4GIEA 5M2FX 2PDFA 2IKGA 2QXWA 1AZ2A 2FZBA 4XVDA 3CAVA 3FX4A 4YVVA 2VDGA 3LNMA 4ZFCA 1PWMA 3G1RA 2IKHA 1ADSA 1MZRA 3UG8A 3DN5A 3RX4A 2A79A 2AGTA 4GCAA 1EL3A 4FA3A 3M64A 1LWIA 2FZ9A 2IPWA 3Q65A 2R24A 4AUBA 3LQGA 3UZWA 1Z9AA 2INZA 4PUUA 1PZ0A 1A80A 1HW6A 2INEA 2PDBA 2DUXA 4QBXA 2HEJA 3UZYA 2IPGA 4DBWA 4EXAA 2ACUA 4WDXA 4QR6A 3GUGA 4WDWA 3COTA 1X98A 3UYIA 4XAPA 4LB4A 3D3FA 2R9RA 4IJCA 4EXBA 2HDJA 4H8NA 4XZLX 1PYFA 4XO6A 1MRQA 2PDQA 4GABA 4Q7BA 4JQ3A 2NVDA 3GHUA 1T40A 3LN3A 1VP5A 3EAUA 3BCJA 3CV6A 4JQAA 1K8CA 2WZTA 3GHRA 3LD5A 4XO7A 4JQ1A 2F38A 2DV0A 3R8GA 2BGSA 3GHSA 3N2TA 3G5EA 2C91A 1XF0A 2HVNA 3O0KA 1MI3A 4JIRA 3GHTA 3M0IA 4XZHA 3V0UA 2PDWA 3UZZA 1EKOA 4LBRA 5DANA 1FRBA 2FGBA 2I16A 4QXIA 4JTAA 1X96A 3O3RA 3CMFA 4ASTA 1JEZA 4XK2A 3LUTA 2PDIA 4WGHA 4GQ0A 4DBSA 3ONCA 1ZQ5A 3R94A 3N6QA 3ONBA 1VBJA 2WZMA 2J8TA 3WBXA 3RX2A 3CAQA 2PD9A 3BUVA 1AH0A 1Q5MA 2PDCA
chains in the Genus database with same CATH superfamily
2Y8VA 5FAGA 2EJ1A 4Q8VA 2PA6A 3H2FA 1CCWB 4O0KA 3UG4A 1R38A 1TX0A 1YX1A 2G5WA 2NZLA 1TWDA 4IISA 3AFBA 2OT0A 1I0BA 3NQBA 4WEVX 1RPXA 1V0NA 3CL8A 2FVLA 1UKSA 1KGUA 3DBPA 3ZLFA 1A3HA 3TAKA 2Y62A 3KS6A 1T8QA 3TNOA 5FF0A 1DORA 3OEXA 1EX1A 1MQPA 1E4NA 3LCFA 2A7PA 1M03A 2WQPA 2ZADA 1VJSA 3LA4A 1FHLA 4MSSA 3VIPA 1EPXA 1KM0A 3U2EA 1R9ZA 2DEPA 2HQAA 1CLXA 2FPVA 2PDXA 4D6GA 3HQNA 3R11A 5DRIA 2WZIA 3OYZA 5G2HA 3RILA 4QITA 4FB7A 3I7SA 3PNZA 4JHZA 3VD3A 3PTMA 4FAMA 2DJLA 5BROA 2G3NA 1PX3A 4XX6A 2PF8A 1YNPA 3DH7A 1D3GA 1Q66A 5ECVA 4HBKA 3CIXA 1JUBA 4DLMA 3HGRA 3TVAA 4H9ZA 1X6LA 4IMDA 2AQWA 1YXYA 3S2MA 3AISA 3O2LA 1GVYA 2OWXA 3ZOAA 1BAGA 1KLYA 3BLIA 4GY7A 1ELSA 1P6WA 1RR2A 3N73A 1R2TA 1UQYA 2BFGA 4FK9A 3CH0A 2Z7GA 4IT1A 1Q65A 3LGDA 5ABHA 4NY2A 1XW8A 2PI6A 4JTTA 3E1F1 1XDMA 1E73M 3VIHA 4L9ZA 3L0NA 4ERIA 2IQTA 1VRDA 1DEDA 3BG5A 4U33A 3Q4DA 3TTEA 1WDDA 1GKPA 1HKMA 5T26A 3ARYA 3ENLA 3HGJA 3AMGA 2Z28A 3N9RA 1SFLA 1BVWA 3GRIA 1QW8A 8XIAA 3EEGA 5I7GA 1A4LA 3SUTA 3CUIA 1PV8A 5A8MA 4B5WA 3L5LA 4P7QA 4YMZA 5LKYA 1C92A 1A4MA 3KVLA 2DW6A 1UH4A 4B3KA 1F74A 3UF9A 1E15A 3CIVA 4GJIA 1CPUA 3RNDA 5JBDA 1AQ0A 5D2XA 3E2SA 1QOQA 4KCWA 4LYRA 1LL6A 1QPKA 3THQA 5HQLA 3JU2A 2PPGA 1TQJA 1DTNA 3BJFA 3QQ0A 3L4VA 1QRQA 1REQA 2Q09A 3FJNA 4CUCA 2BGQA 4KQNA 1IWPA 4XTDA 1O6IA 2IQDA 4H7CA 4M6VA 4DYEA 1CIUA 2W27A 2CBJA 2ZA1A 3OB8A 3T55A 4DWSA 1UASA 2CWNA 1VYPX 4AHPA 2JALA 1XSKA 2YX0A 5A94A 2EO7A 3VIOA 3W84A 3B0UX 3CUFA 1P5BA 2GJPA 4M7SA 1OSEA 2PRHA 4R5EA 4DJDA 1RUSA 3P3BA 2XVLA 3THCA 2J9XA 3W1PA 2POZA 3UA4A 2Y7FA 2Y8UA 4AC1X 1DBTA 1JDFA 3BH4A 2INFA 5D33A 1M7JA 3WDRA 2PDFA 2ONEA 1WO2A 2AQVA 4MF4A 1B3XA 3FX4A 1VBGA 3OQEA 3EDFA 1TWSA 2E8YA 4UWMA 1FWRA 3LBCA 4O15A 4YTSA 2EPHA 2Y85A 3T0DA 3PWIA 1OIMA 2VNCA 3UPWA 4TMCA 1W5PA 3HGSA 3UZ5A 3KTXA 2FZ9A 2P88A 2O9RA 2G96A 1UWTA 2ALDA 1XG3A 4CD5A 2IUZA 2INZA 4NRSA 5GNZA 3G1SA 4I9TA 1HW6A 2INEA 1XP3A 1E1CB 2J27A 1F61A 1WDWA 3H70A 3XISA 1X6UA 2H6RA 4HA0A 3KOWA 3R25A 4H1ZA 4RJEA 3IUDA 1U1HA 4J3WA 3KRUA 3ZM8A 2AMXA 2WZEA 2F84A 3PBMA 5J5DA 4AWSA 4XZLX 4GUIA 2W92A 3RCYA 4S3AA 4JQ3A 1JNDA 4P8VA 1OF6A 1WKDA 3ES8A 2NVDA 1RHCA 4HOXA 3N04A 4P7OA 2BXVA 1V93A 2JQXA 1S2TA 1KRMA 1VHNA 5D09A 1GEQA 5I5RA 1IXOA 1LRQA 5XINA 1XBYA 1MI3A 4WQ6A 3URAA 3HPFA 3IJDA 3GXDA 2XIQA 1RA5A 5DANA 2ISVA 4MJZA 3ITOA 2JFEX 4PULA 5CGTA 3KBSA 2WV8A 1US3A 3LUTA 3T40A 5C2CA 5I09A 3UU0A 1J0KA 4GISA 4OBRA 3BPWA 3FSTA 2QCDB 4DBSA 1FXQA 3ONCA 4UTHA 1E0TA 4LUTA 1ZJAA 3N6QA 2QHAA 2XM2A 4C60A 1IQ8A 3P0XA 3MUIA 3AMKA 4S3DA 4F2TA 3PK7A 3ID7A 1A5UA 2DZUA 3SSJA 3BXWA 3B9EA 4NZFA 2D2HA 2EKCA 5DBUA 5BNKA 4BCEA 1VIWA 4X61A 5E0CA 2CEQA 3GVRA 4LFYA 1Z8AA 3MJMA 3UJRA 3NZ1A 1FKWA 4OU1A 1JPDX 1VD6A 4K6AA 4OECA 1QR7A 1DHKA 4G1NA 5EMMA 4QEHA 2YA0A 3GTNA 3TXZA 3T42A 1CT5A 3ANYA 3WJZA 1TA3B 1WYIA 4O50A 1V5XA 2ZX9A 5I24A 2GVYA 5E6ZA 3KBMA 2Z7KA 3TJLA 5IBXC 1SFTA 3PHAA 4W7WA 3THAA 4GQGA 3PF3A 1SSDA 1Y0EA 2WCSA 5HR6A 5EFFA 3GDRA 1SM9A 1RV8A 4FEZA 1FWWA 2Z1VA 3RXZA 3TYCA 3W76A 5LNRA 2VHLA 1PCWA 2OOFA 1S1RA 1W1VA 1DXIA 1WAUA 3W23A 3CV7A 3ECQA 2E3ZA 5H1WA 4XSLA 2DZVA 3I68A 3N2CA 2PWEA 3FOKA 5I07A 4WXZA 2YB4A 2HXTA 3W7DA 4AG0A 2ATSA 3P2VA 4JTUA 1KM3A 2RDWA 3WLRA 3LXBA 3ZZ1A 1JQVA 4JIQA 4O19A 1PHQA 3WLMA 4JTEA 3PJTA 3VM5A 3G6MA 4ICMA 4MPKA 2Y1HA 2NT0A 1N2VA 3TR9A 2ZC1A 4YIWA 3LYEA 1TCMA 1BYAA 3WF4A 2B81A 1JCNA 5LZLA 1AVAA 3M5VA 4CCCA 4DLFA 1JR1A 3CEUA 4XQ6A 1A5AA 5EL1A 4QDMA 5I0DA 2OX1A 4XZIA 2D24A 4ZSUA 3TQVA 4IUOA 1O94A 1POJA 1TFVA 2QYGA 4V1XA 3OZMA 3ITXA 4HCHA 3UG5A 4CQAA 1QCWA 1C8QA 2WC4A 1CTNA 3S1WA 4RZ6A 2CC0A 4HK5A 1XH2A 3B06A 1Z44A 4E4FA 2ALRA 1RSCA 1PIIA 1XYCA 1F5ZA 4OJYA 3WNKA 1K1DA 5A2CA 4K8HA 3WQ5A 1CI1A 3GXIA 3HPXA 3VGFA 1RY8A 2C1IA 4V1YA 2QKFA 4BFAA 4H41A 1W1TA 2C14A 3M0VA 3WQ8A 1WXZA 2CLPA 4IMAA 5FEWA 1AJ2A 1KR1A 4PUJA 4ZFMA 1BWLA 4W84A 3AJXA 4MNJA 2CW6A 1GVIA 4I9AA 5LIKX 4DJDD 4F0KA 5HOSA 1BGGA 3KL5A 2W6RA 1LRNA 1FBAA 1R3YA 2I17A 4IHCA 3MI3A 3E49A 2Z29A 1QI4A 3QZ6A 1XGDA 4JFWA 4YJ5A 1ISYA 4Q6XA 3KX6A 4BY3A 4GQRA 4LEFA 2RDUA 4G6CA 4DXKA 4D1IA 3TFCA 4PMRA 1ME7A 4H19A 5SWUA 2HS8A 1S5VA 3E2VA 1HGYA 1HQTA 3CMGA 2JF6A 4KT2A 4QCFA 1K77A 4D2JA 3VOGA 1H5YA 4DWSC 3S42A 4M5PA 2D0HA 1XRVA 1RBAA 3D46A 1M04A 1VPYA 3UD6A 1US0A 3N15A 4S3BA 1IEXA 5D4YA 3GTHA 3QYSA 1Q8JA 3EMCA 5HPOA 1EFZA 4NQ1A 1TV7A 1DTUA 1KXTA 3KDNA 4ZOEA 1JCJA 3QV8A 2P53A 4RE2A 1KWGA 3H23A 1XYZA 2Z6IA 1T99A 1FFQA 2ZZ1A 2WLYA 2X1IA 3MKVA 3PJXA 3W7JA 1FWFC 3ZQ9A 1XDJA 3P7YA 5KTLA 1US2A 3RX4A 2CXGA 4IF2A 4I5RA 4DXXA 3SURA 2TODA 1ME9A 4HNNA 1ZJHA 2VC5A 4GZ7A 1UUOA 3D3AA 2FB3A 3HFTA 3QR1A 2OGJA 4HPJA 1PTDA 1TMQA 4PRWA 4RDYA 4KEMA 5DMNA 1O5XA 4Z0SA 3UWQA 2H8XA 1LROA 3BQ6A 1EIBA 3GU2A 4AZ5A 4J28A 2GVEA 3WL1A 3WH8A 3YPIA 1OZMA 3QY6A 2TMDA 4NIRA 3T09A 4WDWA 2DPEA 3H2MA 3COTA 3WLJA 1UP2A 1H4PA 4R9XA 1GCYA 3M7WA 4Y6GA 2B7NA 1LLWA 4IQJA 4H6KA 1GG1A 5BU9A 4BWLC 4YN5A 3WF3A 5FJRA 4UR7A 4US5D 3ISIX 3LD5A 4L80A 3HPZA 3R0UA 4FOUA 1A3WA 3UWZA 1L0PA 1U2YA 3RMJA 3DC0A 3B8TA 1MMFA 2DVXA 5EY5A 4R88A 4GGBA 2VEFA 5IFTA 5CZKA 4M0XA 3SUVA 4H04A 2Z2UA 4XAGA 2OT1A 3IGXA 1AL8A 1SJCA 1W3JA 3L4ZA 3GC4A 3APGA 3HV9A 3CMFA 2VMFA 3VZYA 1KM4A 1VC4A 4PCPA 2GWGA 4C7DA 1XIDA 4QAIA 4JN7A 5CSSA 1UBSA 1H1YA 5DMMA 2JIWA 1RK6A 4NJGA 2GYIA 4HN4A 3VX0A 3BUVA 2Q8ZA 4QLJA 3OVGA 4Q8QA 4NAFB 6REQA 4MZYA 4Y9MA 5CC3A 4MYAA 1JG9A 1MNZA 2NVCA 3GXFA 3LXAA 4EKJA 1TPB1 4REQB 1FWSA 1AL7A 5ECUA 4L9YA 1KW1A 3WK2A 1KGXA 3H21A 1OC6A 2DIEA 3WSUA 3V18A 2GQ8A 4IGHA 3RN6A 3KS5A 2EXOA 4JTRA 3VZXA 4PB4A 1DV7A 3BOXA 2DQWA 5J5RA 2JGYA 3H4WA 1RQEA 1C9DA 4CNUA 5HMEA 4F4RA 2PLCA 3P6LA 1R86A 4PL1A 1OD0A 3UR8A 1M53A 4BF5A 3HG3A 4QJ1A 3S0CA 5B7ZA 1JIBA 4CQ8A 2BLEA 4DBUA 4LYQA 1JD7A 1XJBA 2XWDA 2HXUA 2WLZA 4GINA 2HJPA 1YTEA 2OCZA 2WJEA 1LUCB 3IJ6A 3NZQA 1A5OC 5DXYA 2C19A 4J40A 2GGHA 3W1AA 3VIGA 4QTGA 2YDSA 4O52A 1IEVA 4JKMA 3L0KA 1RP9A 3VNLA 2J7FA 2QLYA 4JX5A 3W83A 5E9AA 1QW7A 4B3LA 5A6LA 2E5BA 4P8XA 4LGXA 3WJXA 4RL3A 3GSMA 3VGBA 4RR4A 1EH9A 3KRBA 3LHWA 4QSFA 1R3WA 5CLTA 4GKTA 2QUNA 3FS2A 1CGYA 3GIPA 3TW9A 2VR2A 5IHRA 3KWXA 2YLLA 4ZXOA 3V4BA 1HIZA 3PSVA 1VAHA 3E5BA 3UZXA 3IUHA 3VE9A 5RUBA 3TN3A 1SQ7A 4UUIA 3IIOA 2ZUUA 1V6VA 4O53A 1J2WA 2HROA 1W5MA 1E6NA 2Y8KA 2VRQA 1H41A 1ZENA 3K8KA 3W24A 3LG3A 2NVAA 1VFHA 3DKLA 1OD8A 2WJZA 2W3ZA 3IJ7A 4BQ5A 1K9EA 2D73A 1BRLA 5I3KA 2YYUA 1JZ5A 2XN1A 4YWSA 3QHOA 3SZ8A 3RLHA 4UMCA 1H51A 4B4FA 3GY1A 2OYKA 7REQB 3R58A 4D6IA 1A5KC 5FEXA 3M41A 1CECA 1A5NC 4UFHA 2V3FA 4L56A 4UQDA 3AYSA 1JDAA 4V27A 3VE7A 4L6HA 1ZAJA 1C91A 3NL5A 1G01A 4GO9A 2X7WA 3NM1A 3FKKA 3NZGA 1NOFA 4PRRA 1KGWA 4TMBA 1QUMA 1RALA 2BY1A 3PP7A 1S2CA 3GNXA 3RMEA 4EE9A 3EWXA 2A7RA 1X7IA 2QW5A 3U4FA 1A5MC 3ARQA 1HVXA 1ITXA 1NQKA 3W7EA 3CT7A 4U28A 3AICA 3TC7A 1NDZA 3ZLGA 4XV0A 1TTJA 4YU1A 1G1YA 3USZA 4IOTA 4MFEA 2GWNA 4DY1A 1F76A 2FLIA 4XVDA 3QLDA 5K3VA 1E43A 1B3WA 1QPQA 2JBMA 3MO7A 5H2ZA 1EGZA 1K8XA 5A8GA 3AXMA 5H6HA 3P93A 1W32A 3WNMA 1AW5A 5C9WA 3VIMA 2G97A 3UG8A 2JKPA 2PTZA 4HSNA 3U2OA 2YZ5A 1GQLA 1WOBA 4FIQA 1KBJA 2A2IA 1LWIA 2R24A 4M56A 3VDHA 5H8UA 3N19B 5D2TA 4W89A 5C5YA 2I9UA 1XYAA 1VENA 1ZY9A 3MMWA 3NQMA 2AMGA 3ICJA 5DO8A 2J75A 3AHVA 3W7PA 3WZ0E 4H3DA 1C8YA 3M44A 2G50A 3VD5A 2RGLA 3DU0A 1ICSA 3G3MA 3O1NA 1H7PA 2GGEA 3QGAC 5D32A 1W9XA 2J7EA 5DBTA 3KRZA 4A3YA 5HMFA 3IWPA 1W1ZA 4CCEA 3UCCA 3AALA 4DN1A 1I8JA 1XYLA 5J8LA 1UR9A 4HTYA 2EG8A 5TNVA 1F7BA 1GOIA 1M6JA 4TO8A 3AWOA 3SRFA 4F9JA 1GQIA 1PVNA 2E28A 4ZMGA 5CPTA 1MW3A 4W93A 4AD0A 3MHUA 3GHSA 3WBEA 3MWAA 2VCCA 3BSGA 4CNSA 1ZAHA 5FD0A 5IOBA 3P8IA 1GNXA 1GW1A 1R8LA 3F5LA 3R0KA 1HN1A 4FX7A 1UH3A 3DENA 1DE6A 4NI8A 3N14A 2DSUA 1UP3A 3TROA 3HG5A 2R8WA 2CZDA 1TJ2A 2ZCGA 3EX4A 1TJPA 4C1LA 1W1PA 5BW6A 4AMCA 4WGHA 2YGYA 1TV2A 1KM5A 2DP3A 1JCXA 4E2OA 4MB5A 5FJJA 3ZJKA 2V5LA 3EXSA 4IPLA 2QUMA 1UWIA 2MUCA 4WSKA 1AH0A 5CSRA 4JTCA 1XIFA 1D9EA 2PWVA 4MDPA 2UY5A 4ATDA 4S3JA 4HZMA 4BK9A 3WK1A 1S38A 1KR0A 3PBYA 4RNHA 4UZSA 1V3HA 4KH2A 1EYEA 1AH3A 3QXBA 3PWGA 4ZQMA 4U31A 1UA7A 1HJQA 4JX4A 3C2VA 4LB3A 4JTQA 3IJLA 3F7JA 3SY5A 1RLCL 3PG8A 3VILA 3BSMA 3MB9A 1B30A 2VGBA 2X40A 4UQCA 5HNTA 1CB7B 1EHNA 3UY7A 2WCAA 4NSBA 4LVAA 2ZZ5A 3CZKA 2YBVA 3SGZA 2YSWA 2BGNE 2OWWA 3LM7A 3WQWA 4XKYB 3PZ9A 4JNMA 4I6VA 3P81A 4P5UA 2NX1A 2ABAA 3CWNA 4GLEA 2V6AA 2HBVA 2X1TA 4GVFA 1QU4A 2D20A 2OZTA 2PDPA 3L4WA 1UR0A 1X7FA 2P5NA 1VBUA 4PTVA 1QHOA 3NG3A 1HJWA 1WNOA 2F2KA 4IMGA 4KESA 1L6FA 1KQYA 4KCUA 4NJHA 2ZUWA 4V15A 2GJXB 3MC5A 3H6OA 4YHEA 4K68A 5BMXA 2QVNA 2ZX5A 5AC4A 1H50A 1YBQA 3AXKA 2QCCA 2E9LA 3MANA 2PGRA 1YHTA 2B31A 3NPUA 4LVDA 3K4DA 4DYKA 1BWKA 3P8JA 4AXNA 4NKCA 3LBMA 1EEPA 1W9DM 3QMSA 3GVQA 4R85A 3V3WA 4KMQA 1YPXA 3A3XA 2VJXA 2XN2A 2UZ9A 1W3IA 4OUEA 1HO1A 2QPXA 1F3TA 2BMBA 4M24A 1QNOA 3WMBA 4QNWA 3VVGA 1PZ1A 2CZ5A 3RM9A 1XLGA 3W07A 3EEZA 1IWBA 1B3OA 2P50A 1TO3A 4UBPC 1BYBA 3A64A 2PCQA 1DWIM 4TVUA 1I2NA 1LQAA 3RM4A 1G5AA 4HCDA 5HNUA 3I6TA 1H49A 1PB0A 3HJEA 5D30A 5DCBA 1M7OA 2X0SA 2PGWA 4FI4A 4NZJA 1EZ2A 4NAEA 3PY2A 5FL1A 3T05A 1BF2A 3MUCA 4HZ7A 3G1VA 1AW2A 2VFFA 1OYBA 4YLWA 2G3FA 2DORA 2FZ8A 4P8WA 3RLGA 4L61A 4E2DA 2QJMA 1A49A 2POTA 4NT0A 3E9AA 3G1YA 1FHUA 4ZA0A 3E0IA 1PDYA 3XIMA 2V0TA 2V8ZA 4XWUA 3REQB 5I00A 3LY0A 3FNDA 3KRSA 3CEPA 2QAPA 4R7WA 4DX3A 3W7LA 1CYGA 4MADA 5AZ1A 2D1ZA 3IEBA 3WEZA 2PLJA 2BNJA 2AAMA 3WG6A 3HQ1A 3ITVA 4AC7C 1W3TA 3I7RA 3H4GA 5CZ0A 4IIEA 3B04A 2E1WA 2PDMA 3KL3A 2P3EA 3LCLA 3S9ZA 2ZUTA 4X2PA 3STEA 3W1XA 4WDUA 2WJDA 1NJJA 2ZOXA 1SZFA 3VNIA 1V7YA 1PKMA 3LCXA 1B4EA 4UTWA 1HTIA 4AH7A 3LZ5A 3EPNA 5M03A 3QSRA 1VFFA 2IPJA 5IM51 4AIUA 1PJ9A 1V79A 4RNFA 4IFKB 4LAKA 5CJNA 3CHVA 3KFTA 2VDHA 4Z1AA 2PAJA 1DQXA 3GLCA 3WO8A 5A6BD 2W5FA 3LLFA 5M2FX 1VJIA 1MNSA 3CAVA 4YVVA 3SQMA 4I9JA 3CAKA 3OVRA 1F73A 5JBEA 2PGFA 3TA9A 1ZPTA 4AZCA 5EPDA 4FPSA 3IIVA 5I3DA 3WFAA 1YTKA 1XR2A 4IXHA 2GK1A 4AUBA 3WUFA 3CUXA 4FR6A 1MQQA 1OFBA 1THFD 4XKMA 3A4AA 5HMDA 3NQ2A 4WJXA 4AD4A 4FS9A 3GDLA 3UW6A 5GNXA 2GUUA 3WK0A 4H9XA 1CWYA 3C0SA 3UZYA 3G6LA 5BOOA 1JPHA 1W31A 2X0YA 4GQBA 4IX2A 3AYRA 3B9AA 2IPGA 2JIEA 2UV8G 1H3GA 1K7XA 4GI8A 1NH6A 2E6FA 3GDMA 4DHGA 1FDYA 2E1DA 4KFOA 1X98A 1IT8A 2DZSA 2J74A 3GXMA 4PODA 1P7TB 4RE0A 2R1PA 4B5TA 2Q8XA 5D38A 4WSHA 1JCMP 4J3TA 3ZR6A 3TUUA 3VNKA 4I90A 1M3UA 3WLIA 3CK5A 4Q8MA 3PTDA 4AQLA 4YNGA 3S4TA 3PAOA 2QZRA 3E5PA 1KFLA 3F5KA 2WZTA 2VR5A 3UJEA 1HL9A 3W81A 5IRPA 4MM1A 4XBJA 4IMFA 5BXPA 1WB0A 1SPQA 4BI6A 4O1AA 5GJMA 3BLPX 3I6RA 1FH9A 3H26A 4TV6A 1TTPA 4AYSA 3TYBA 2FDMA 5FOOA 2DT1A 1W3KA 4MOZA 1EKOA 3LRLA 2G3IA 1BHGA 3SJ3A 2DVUA 4K8GA 2VCBA 3CZGA 1FRBA 2Z1KA 4GCXA 4JTAA 4IIBA 2E9MA 2PWDA 3N4FA 2BY2A 2CWXA 4CEXC 3KP0A 2ZWZA 3AIQA 2X16A 2VCAA 1EBHA 2VR4A 1XUZA 3AS3A 3MKCA 2ISWA 5DELA 3VPLA 1IYXA 1FWBC 1DHPA 3NGJA 4WJ8A 4O11A 3W2JA 4WHBA 1E1FA 4OKDA 3V0SA 1BSIA 3ELFA 4AEOA 3OO2A 4HYVA 4LNYA 2R91A 3SEPA 2AL2A 4LBSA 5D2VA 3UXIA 5EU9A 3MCMA 1ENUA 4HHHA 4ZENA 1SZEA 1FX6A 1UKOA 2PCEA 2O9TA 1VPXA 3PN8A 1T96A 3WMLA 1JZ4A 3MBDA 5TF0A 1A5LC 1TR9A 3L2LA 3CS2A 3FA5A 2QAFA 1B9ZA 3VGGA 1CNVA 2D3NA 4B4HA 8CGTA 3TYUA 4ICCX 3NOYA 4RDWA 4A22A 1GVEA 4H7VA 1P48A 4EVZA 4M82A 2CITA 1CXEA 3LI1A 1TJ1A 1RK5A 1ADDA 4AX7A 2BY0A 3ZR5A 1KFBA 3TMQA 2KAUC 3GNNA 3ZS4A 3H55A 5B7YA 5EYWA 3MZ2A 1IEIA 3TWBA 4IFOA 3A47A 5EA9A 1C8XA 4IQEA 2OLAA 3GE7A 1FUYA 2AGKA 3C0JA 3WBAA 2DIJA 2NX3A 7TAAA 1Z41A 1XCFA 4HSHA 1TUFA 4PMYA 1QDSA 3W9ZA 3MJYA 4ROQA 3ZWSA 1EP2A 7A3HA 4K2SA 4PUMA 4UIOA 1DPMA 1SW0A 3RLVA 4YTTA 3TH6A 2TPSA 1BGAA 4I5UA 3GNPA 3LOTA 2G4FA 3ABOA 3SIZA 1ESWA 1IZKA 2ACRA 4IL2A 3TQ0A 1NWTA 2DIKA 4J4KA 4M19A 1DXFA 2WSPA 1H5VA 1RD5A 2YPIA 1AA1B 1D8CA 1EZWA 2DSWA 4ACZA 5C7HA 3E02A 4RV3A 4HMEA 4CVUA 1XBVA 4UOQA 4A3HA 4BEQA 3PAJA 1B90A 5H91A 4O1FA 4EX4A 1XKYA 2PLMA 4DPQA 4POCA 4M51A 4KW2A 5CJ5A 4AIEA 4UXDA 2PBGA 1DQUA 3VGEA 4OZOA 1ZBWA 1RVKA 2CLKA 4K1WA 1UW9A 4F2BA 5CAKA 4D6DA 3N6JA 1UC5A 1XIIA 4MNLA 4O54A 3VKCA 5KETA 1HUVA 4BR1A 3FEMA 4CQ9A 4EPDC 2XSAA 1IZCA 3UR2A 3R12A 1LBFA 1IV8A 2ZUMA 4AY8A 5E1QA 3DYMA 4ZO9A 4CQDA 2XGBA 1BKSA 2X41A 4R9OA 1IWAA 3VNJA 5A5WA 2J47A 3VIFA 1JZ2A 4CGTA 1ML1A 3GYCA 3K8LA 3MUAA 1UR4A 1SZGA 2BTMA 1MO0A 1PBGA 2XIIA 3AIRA 1V6WA 2EG6A 3W29A 4HU0A 4IG2B 1I1WA 1HNYA 4UTLA 1UR8A 2C3ZA 3U5YA 1TTQA 4A3RA 4LT9A 4UQ9A 3TFXA 4HZ8A 1ZU8A 3GQYA 3A4XA 3ZIZA 1U30A 4LUJA 1XIHA 3O7UA 4B5UA 4CU7A 1TR1A 4UTWC 1TJ0A 3LPGA 4EXQA 1OK4A 4GZEA 1GTHA 1SO6A 2IKGA 3C2FA 1NOUA 3INPA 1JGMA 3QOKA 2CNCA 2I57A 1O5QA 4PMQA 4ERAA 5AC8A 3P0WA 3U6WA 2Y7GA 3H53A 1BQCA 3NGFA 3FKRA 3WJYA 4WKHA 1LWHA 4RDZA 3PB0A 4C6DA 5JXQA 1XLLA 2AKMA 3UZJA 2C6QA 4B5NA 2V63A 3CU2A 1QATA 2DH3A 3MTWA 1JAKA 3ZYZA 1Y5WA 4D9PA 3ARTA 4MKSA 3ITGA 4A8LA 3SJNA 4FIRA 4PUUA 1R5YA 4DO6A 1V4YA 3GDBA 3CAWA 2J7BA 4Q7IA 1PTAA 3M5YA 2VVSA 4A8RA 1GHRA 2VC7A 3KZSA 4QLLA 4C5YA 2UY2A 2C0AA 2FHBA 1QWGA 3GUGA 1N55A 2CHNA 1X8CA 4JDBA 1E9IA 3VI2A 1G7VA 3D3FA 4F0LA 3QLLA 2R9RA 1E5NA 4BS0A 3P61A 4PUKA 1TUXA 5CAHA 1T40A 4KWOA 1HGWA 1BVNP 1TWWA 1VLIA 1I2QA 3R10A 1BYDA 5BMWA 4B2DD 1EGVA 1L8PA 2Z4GA 3GHRA 2ODOA 2WMFA 4XO7A 4N9DA 2WBGA 2J66A 3GO2A 3AZRA 3V1PA 4CN6A 1XYMA 1HP4A 3RO6A 4NJJA 4WOQA 2V68A 3ZFHA 2VGIA 4ECLA 3N2OA 5AYZA 2V5CA 1XF0A 4WIWA 1KBBA 2WM1A 4JIRA 4UTMA 1QAPA 4C6FA 5JU6A 2R1LA 1KNWA 1LDCA 3TWAA 3SRHA 2B7QA 3VNZA 1R6WA 3RGTA 1NTHA 1MUMA 4JTJA 4QXIA 3DC8A 1V3MA 4JL2A 4XK2A 1L2UA 2J79A 5E09A 3L9CA 4GKLA 1UKTA 2C1GA 2HPMA 4RNIA 1ONXA 2XFRA 1VFMA 1CW2A 3WNLA 2D22A 3CAQA 1FHVA 4A2SA 4ZB0A 1TVNA 5I06A 2OEKA 1P0NA 3LZ3A 3QY7A 5MHBA 5EFDA 5CG7A 4GA8A 3WJWA 2I1OA 3SO7A 1J01A 1SFSA 3KVKA 1E4LA 3UP8A 1RJQA 1YIXA 3EOUA 3TJ4A 2G41A 4DBEA 1DJIA 1YNYA 1DP0A 4F8XA 4GXWA 4JQ4A 1BXBA 1Q6GA 3W02A 3NYZA 1HL8A 1J6PA 1OX6A 3OGSA 1HT6A 4QE5A 3T0TA 4AD5A 1EJXC 4UNKA 4M80A 3W4RA 2P0IA 6ALDA 4W85A 2FTYA 1K6WA 1HFBA 5CSUA 4JDYA 1I0DA 5BCAA 3WNNA 3WBYA 4LC8A 3ARVA 3OTRA 5DY2A 4HPHA 3WDQA 3WEMA 4DZ5A 3WQVA 2QJGA 1FKXA 1GOOA 2H9AA 4QAWA 3N3MA 4E38A 2XU2A 2DY3A 1OFQA 3RPMA 1IT7A 5MKGB 3LV5A 3OOQA 2ZKMX 4UTKA 4FSAA 1RH9A 2QMJA 4NASA 3G22A 3ITLA 5AECA 1UD6A 1IF2A 3PZUA 3RITA 4RV8A 2Q71A 1H7XA 4PEEA 3KWSA 3E2QA 4QROA 4LSBA 2UY3A 3W7IA 5HANA 1N7KA 1GJPA 5D8ZA 2J9YA 3HIJA 1QTWA 4HT3A 1XV8A 1WKFA 4I5XA 3OGRA 2PDNA 1DJNA 4PZVA 3TLLA 1Q6EA 3LCGA 4XD5A 1H7RA 3M0KA 4XISA 1S46A 4JTIA 4IGMA 1JDEA 1E0VA 5I3IA 1MVYA 3QZEA 1EUAA 3IARA 1SSGA 2PTWA 4S23A 1HJXA 4YCOA 3EMQA 5G4WA 3C3NA 4J5NA 3MV11 4QG9A 1GOXA 1K70A 3NVDA 2NW0A 3C0LA 3T1GA 3G1DA 4PTXA 4HNLA 5HATA 3GFYA 4HYWA 4NRRA 5HWNA 2V69A 4QNEA 3GR4A 5CEWA 3BW2A 2FPYA 2BV9A 2FH8A 4MB3A 3CJPA 1UKPA 3B8VA 3NPXA 4C6QA 1CXIA 2PMQA 3NIYA 2VZUA 4EAMA 4G7EA 1VRXA 3AI0A 3NEVA 5HNRA 2HVOA 5AKQA 2ESCA 5LNSA 1RD6A 3WL0A 1WCGA 4F3HA 2ZRUA 4PSRA 5LA2A 1QOXA 4GC3A 3EA2A 4A21A 2IW0A 1JCLA 5K4ZA 4HOWA 2XM1A 3IIPA 1VR6A 3BLLA 3VKJA 1A0DA 4XAFA 2EBNA 3L5MA 2OLSA 4ONVA 1XCWA 1TZZA 3B8IA 2OQYA 4MFDA 3DUGA 3WX7A 4D6EA 2YBUA 3DERA 1QK0A 4AZHA 2PURA 3LPOA 3E3HA 4A6GA 4MIMA 5GJPA 5G2IA 1GHSA 4BKNA 4JKKA 1Q13A 1JCTA 3U3HA 3R7MA 3DECA 3GFXA 1IZJA 2XHYA 3IS4A 3N34A 4QSHA 1L6YA 2VO5A 4BF9A 1B9BA 3MYOA 3QJAA 4WY0B 4F9DA 3OLDA 2VWTA 3P14A 2OSWA 4QLKA 1AUSL 3EPOA 4IX0A 3CXOA 3VIKA 3VNYA 4HB7A 3M6YA 3TYAA 4X63A 3QFWA 4AZ6A 2DZXA 5FJTA 1CEOA 3A21A 4WF7A 4IJBA 5ABFB 2R94A 1XFBA 1FH8A 5DT5A 4US6A 3TSDA 3UFYA 1B31A 3SIMA 1BPLB 1H1ZA 2VENA 2IPFA 1HJUA 3NWRA 1OINA 3OG2A 2WPGA 3W70A 1AZ2A 3PJUA 3SUSA 3SFKA 3MMUA 2GJLA 2OKOA 4GBUA 2VELA 4YCPA 2PRMA 4JAWA 1TPFA 4C6EA 3R0DA 1Q7MA 3O07A 1KRBC 4LUIA 4NAFA 2GGIA 4GO8A 1OFAA 3QMRA 1EDGA 3QRHA 1B5TA 3K8MA 3S1XA 1H2JA 5C71A 3Q65A 5AHMA 4A2RA 1WP6A 3UY8A 4J3VA 1ISZA 1MSSA 3SQLA 1GW9A 2FH6A 2XVNA 4N9CA 3W82A 2PDBA 3V5OA 2DUXA 3DYPA 3H12A 2ZBTA 1GOMA 3LMYA 3UXKA 1JDDA 3TP4A 3EYPA 4HA4A 1HL2A 3DDMA 3C86A 3OBAA 3AIWA 3RLUA 4C1NA 2NQHA 4IJCA 4ZE4A 1DIOA 2CPUA 1PYFA 3H4XA 4KPLA 4QE1A 1IGSA 1VFSA 3HQPA 4ZO8A 1JRBA 2O92A 4C6PA 3FJLA 2YL5A 1F3XA 2C1HA 1LUCA 2WVUA 4FLRA 5C8BB 1NFPA 3T07A 3I7QA 3DFOA 2F6KA 1IR2A 2PTXA 5I02A 1V77A 1ZZMA 2FB2A 2QUTA 1XBZA 3RU6A 1P6BA 4LW7A 4JIPA 3NQCA 3G5EA 4CNNA 3FYPA 3L66A 4GQQA 6XIAA 2DH2A 4QQ3A 3EKLA 3NQAA 3CH9A 4NZ1A 4DEFA 2HWGA 1DWGM 4KWVA 4R53A 3GIYA 1YXCA 2Q01A 1P1XA 1W91A 3C0QA 2I16A 1O5KA 2G4JA 1SR0A 3DI1A 1CXHA 2IXUA 3PNUA 4W9TA 1RP8A 2FMNA 3I4KA 4DUXA 5FJUA 1MW2A 3W1MA 3K2GA 5A6KA 5ABGA 4DBDA 5LA1A 3H2EA 2UY4A 4LBUA 4DRSA 2E25A 3LRMA 1ECEA 3A24A 1OFPA 2OXNA 3BAJA 2WC7A 4QS6A 1TE1A 2W0UA 3LERA 3BURA 5E6YA 3BJSA 1VQTA 3LHTA 2J24A 1C7TA 2VQUA 4OE7A 4K36A 1AJ0A 4FNSA 3H2OA 4FLSA 3VD9A 3T4WA 3APYA 1J0JA 4TVDA 4JNZA 2WXDM 3E0FA 1V03A 6TIMA 1DOSA 1R2RA 4LAUA 4ZR8A 3A23A 3DXIA 4ZGYA 2ACQA 3B4UA 2CKRA 2WO5A 2YXXA 3WMCA 1EHAA 1UR3M 2AAAA 1UR2A 1S39A 2A6LA 3H7VA 1R9XA 1TIWA 2NQZA 2BVTA 2PZNA 3AWNA 4Q3MA 5F7UA 3GH7A 5M1TA 4BZYA 4PMJA 1REQB 1QJWA 1H63A 2J62A 5EMUA 3TCSA 3WD4A 3V7PA 1GT8A 1UZ1A 2PUZA 2B4GA 3MBFA 2GQAA 4JIHA 2ICSA 4G5DA 4DWSB 4IJRA 1SR9A 1V08A 4M1RA 4O10A 3VU2A 2YB1A 3BLOA 3GZAA 1AMKA 3V0TA 3LX9A 1NAL1 3BDKA 2PP0A 5A2AA 1QO2A 3LNPA 1Y5VA 1JF5A 1TV5A 4DF0A 2CBIA 5KITA 3IV8A 4MWAD 1FWCC 3QC0A 1EF2A 1CZ1A 1TX2A 2PGEA 3VO0A 1S2VA 1R3QA 4XAZA 1H7WA 2NWSA 1ZL1A 5JQ9A 1P0BA 5LSMA 1R3TA 1WZKA 4IFRA 2J25A 3ARXA 1CGTA 2XVKA 4DUOA 3S3GA 1KM6A 4PL2A 3DHDA 1J5SA 3KTSA 3TNBA 3K5XA 1ISXA 3FXYA 2C13A 1LOLA 3I6EA 3URNA 3U2CA 4MZ8A 4S39A 2VX5A 1QHPA 1W1IE 3MSGA 4CNPA 2GQ9A 1EBGA 1GJUA 2ZFAA 1ZSXA 3AIBA 1FXPA 4YYFA 2VUNA 3HTWA 5TD4A 3SY1A 2PDGA 1EP3A 2VOTA 1HJVA 3AS2A 1Z6KA 3SR7A 3T8LA 1J96A 3PS7A 1E6ZA 3N4AA 5GVJA 4DM1A 1EGMA 3WENA 4V2XA 2WMKA 3WQDA 4X60A 1S1PA 5F2MA 1PWLA 1G4SA 5REQA 3BV7A 4KBXA 3P67A 2X2YA 5BRQA 3K30A 1MZHA 3TQPA 4E4UA 2ZUSA 3UVIA 5TAOA 3F2CA 1LLZA 4HMCA 1E3XA 1FP9A 1ZBVA 2W79A 2X42A 1QI3A 2Y6ZA 2WHJA 4PUWA 4INFA 1E9LA 2Y5JA 3E38A 1F8MA 3RUBL 1W5NA 5A6MA 4DJEA 1E6RA 2CXEA 2ZRWA 3LI0A 3UXAA 3V35A 4E5TA 2BSLA 4NJIA 2P76A 4L4OA 7CGTA 4O0ZA 4LOCA 4AAJA 1ITCA 1MFUA 4LYPA 3LENA 3RPTA 1H0IA 4MB1A 3VM7A 1SJAA 1HKWA 3RU8X 5HJYA 3GD6A 1FP8A 4FHAA 3QMTA 1TPDA 4HMDA 1JYNA 3UNDA 2ZTJA 5A6JA 2OPJA 1S2AA 4DUWA 4AY7A 4UR9A 2I7GA 1XS2A 8TIMA 2NQJA 4QFUA 4G56A 3QBUA 3C52A 4LUSA 2OR2A 2ZZ4A 3SCRA 4LUTB 1PCKA 1SU5A 1VFTA 2GGJA 3GU9A 4NZ4A 2HV5A 5CLWA 1B0IA 7ODCA 1T6MA 4RZ5A 3S5SA 5ABEA 3P74A 1SO4A 3LNMA 3ZLHA 1KFCA 3C8FA 5T91A 1FDJA 4Y8FA 1V51A 3B05A 1UG6A 1QO5A 2AGTA 1XLIA 2PE4A 1C3FA 2G3JA 2ZQ0A 4HHMA 2WJFA 4A3UA 3GH5A 1RQBA 5BYWA 2GDQA 4ZQPA 3CB8A 3CL6A 3STGA 3MPGA 1U83A 2V3EA 4W87A 1CGWA 3FVMA 4PTNA 2AOSA 5IBXA 1XLBA 4UR8A 3RCMA 1QBBA 2Z1XA 4DYJA 2NXIA 2XH0A 2RJGA 4GFIA 2A3EA 4XBKA 3WLQA 3GKFA 4I7UA 3TXVA 2VXNA 3WLSA 1GZJA 3UCQA 2WWCA 3B8UA 2PSNA 3PSWA 3KP1A 4S3GA 3SGUA 3S9YA 8XIMA 2EPNA 1V8EA 4ZTYA 2AQOA 1F07A 3HQOA 3GHUA 1B3YA 1VP5A 2X05A 1UOZA 4AZ7A 2HPIA 4Z2HA 4JQAA 1U5JA 4JTLA 1GJWA 4L1GA 1LBMA 2OTDA 1KFKA 3MA8A 2BHYA 4PBGA 2QNEA 3MCNA 1Z69A 5CPQA 5BXRA 4X3ZA 1H60A 4MKNA 1UOKA 1E0WA 4FLQA 4MNKA 4DELA 1VCVA 2HRWA 2WNNA 1HXJA 4QGCA 5FKYA 4LUYA 4WSJA 3TTSA 5CPMA 4XG1A 3QGVA 3NDOA 4Q4OA 3V0UA 1UJPA 4JD4A 3UVAA 5DEZA 3WLKX 1LZOA 7TIMA 4ES4A 4PTDA 4IQDA 5LYRA 3T78A 1NELA 3KBWA 3MHFA 2VM8A 3B0VC 1BEUA 5D9NA 3O8AA 4JYFA 1S3HA 3AXHA 4BA0A 1VYRA 3R13A 3R8RA 4KWWA 1Q4WA 4PTMA 5AN7A 3ZMRA 3B0YA 4O17A 1UYQA 1Q85A 3GW3A 1J11A 1EDQA 1ZQ5A 4NG3A 4E2VA 1EA9C 4GIRA 2KX9A 5J04A 3K1DA 4XUYA 4O16A 2ASHA 2ZVIA 4UNIA 4QJ5B 3PR2A 4H7ZA 1KRCC 2FDSA 3QR3A 4KFPA 4I8YA 5CPLA 3NSNA 3UA3A 1WBHA 4I8DA 4LS1A 3GXPA 4XIAA 5HBFA 2PBOA 1XSJA 4LY4A 3GIQA 3T44A 3APTA 2J8FA 3VAVA 3ZVHA 3QM3A 4JICA 3UERA 5FEZA 2BASA 1SYTA 3HV8A 3PZOA 1X1ZA 2EQDA 4NHVA 1RY0A 4QEEA 1KFWA 3GG0A 4LPCA 1XQLA 4UNLA 4OBTA 4URIA 4KS0A 2A1YA 2JGQA 3C61A 3M43A 2B7OA 2BS9A 1SGJA 1IXQA 2P0OA 1FH7A 2SFPA 2HK0A 3E0VA 2R1KA 3EWYA 4A8IA 3T6CA 4YVXA 4IZGA 3WLPA 4H9YA 3UBPC 5JMUA 3HB9A 3VFCA 5LIYX 2DZTA 1IIHA 4MAZA 2NSOA 3L4YA 3R8HA 2W4XA 2CERA 2FTPA 3HURA 5ENLA 2LLEA 1JXKA 5LXEA 2J4GA 4Z2LA 3QTGA 4R33A 1B3ZA 3KHDA 4WR3A 3QH2A 1J2BA 3RRAA 3GTFA 4FR1A 3QQ1A 5G1MA 3EA1A 5I79A 5FSDC 3RDKA 1QNSA 4LRTA 3GH4A 3CWHA 1V6UA 4P61A 2VRKA 1QI2A 4RLIA 3UEQA 3OZPA 5KMYA 4OQVA 5G4HC 4L5ZA 3ANVA 3CWOX 4K1GA 3EMZA 1XYBA 2WB5A 1O7AA 1V3LA 3W1TA 5EGRA 1JZ8A 3AIEA 3EB3A 4L9XA 3QOMA 1FOBA 3CQHA 2A7NA 3W7GA 5CGQA 1W56A 3S47A 5LIUX 3GXTA 5AHFA 3G1FA 1EJTC 2I14A 4KETA 4WRHA 2V67A 3PJWA 3B40A 3W01A 4J3ZA 1W54A 3MI6A 3NPVA 4XAYA 2R82A 3NPWA 1GONA 3I4EA 3G1XA 1YTDA 2H3DA 3N17A 1J5TA 5AY7A 4D6JA 1W37A 5D2WA 4ACYA 3TMLA 4ZSTA 2PDUA 4MHBA 2VEGA 1CBGA 1P7TA 3IAPA 1EO5A 2YCKX 4BWLA 2W66A 3LBOA 1Z48A 4R7OA 3DYOA 1PIGA 1FA2A 3KL0A 1TV3A 1S5TA 3N6HA 4O1DA 2Y70A 4NUWA 7ENLA 1SVDA 3ORWA 4Q8WA 3THDA 1QBAA 1XUUA 1I6NA 1O4UA 1UKQA 1RBOB 4DJEC 4ICNA 3AZSA 2CLHA 1JDCA 2W67A 3RIKA 4M1BA 1SMDA 4M7TA 3AIVA 3T2QA 3DFNA 3NO1A 4ZEPA 4G9PA 1WKEA 4D1JA 4C91A 3RJXA 5C2XA 1G4TA 4P8UA 2XYLA 1DQWA 3BOLA 3HO8A 3C2EA 5A95A 1BTCA 1QNRA 3GFZA 1OC7A 5DT7A 4PMDA 2FZNA 3AAMA 3F2DA 4K37A 2JK2A 4GJ1A 4KRTA 1F6KA 2ZICA 4AF0A 1GVFA 2XVGA 4HGXA 4NILA 3VIJA 3TAOA 2E40A 1DL3A 2GQ3A 1RCOB 3AHTA 3AS0A 1W3NA 5H8MA 6REQB 1MXDA 1OCQA 4C6IA 3AXIA 3BZJA 2R14A 4JCMA 4ZFCA 1TPEA 4MUPA 3A5VA 3LCIA 3B8SA 4HP5A 1B4KA 4KCVA 2QDGA 3GTIA 3DHPA 1L9WA 2A79A 5HJXA 3VUPA 4GCAA 3GK0A 3TC6A 4W5UA 5CSYA 5A8QA 3CZEA 1Q8AA 5F2IA 3W72A 1DJXA 2QJNA 3UZWA 2D23A 4Q4MA 2V2DA 3GM8A 5DF0A 4C5ZA 4LRSA 1E70M 3W22A 4GUFA 3HZ3A 3CZJA 1F4AA 3FCPA 1WDQA 1LP6A 4GI4A 5FIPA 6A3HA 2VFEA 4W7VA 1W8GA 3NO5A 3H54A 1QASA 3M0JA 1HP5A 3M6DA 3CHEA 4H8HA 2OO6A 2X30A 1Q6DA 1UBPC 3BK0A 1NP0A 2BX7A 1OYCA 2YKKA 3BVJA 3T2OA 3N2MA 3TA6A 2VGFA 1VS1A 4GVIA 1Q7QA 4XO6A 2YL8A 4NZCA 3W2MA 3IIXA 4KRZA 3TW6A 2Q3OA 1LLOA 4TIMA 1PPIA 3T0AA 2GVLA 3P5ZA 4I9MA 4O12A 4MB4A 2DT3A 4Y9AA 1PYMA 3BZGA 3AMCA 3G8RA 1HKVA 4U5IA 2EPOA 5M3WA 1D8WA 1YW1A 1KM2A 2GVJA 1OK6A 4WXYA 3LPFA 1UD8A 4XZHA 4AISA 4UTTC 1GPWA 1RLDA 3UZZA 4OT7A 4Z42C 4UOZA 4GPNA 1W17A 4HPXA 1E51A 5F2GA 4W8BA 3UWVA 4NYUA 4B91A 4LVGA 3QV7A 3N12A 4IP7A 3Q37A 4B9ZA 3GUWA 4KIRA 3OODA 3CBWA 3I65A 4CQBA 5FJIA 5LA0A 2YDQA 2OGYA 1XI3A 5DY3A 1OWQA 4HD5A 2NV9A 2WVVA 3EKGA 2TRSA 5M17A 1GKRA 3G18A 4WUIA 3VA8A 3ABXA 3PUOA 1XLJA 1OFDA 4GNKB 1OCBA 1BRLB 4PMOA 2CLIA 2BDQA 4Z2KA 1W1B1 1SW3A 2GSEA 3IVSA 1N82A 4D72A 3BW3A 2VKZG 4S3FA 3LEPA 5KZ6A 1X6NA 3QV9A 5XIAA 3L21A 4GI6A 2XIMA 3MUXA 3O63A 3VC6A 2VWSA 1GTEA 1GGOA 1LOQA 1OADA 1H0GA 5I77A 2YDRA 1WZLA 2PU0A 3G0UA 4E8GA 3DFYA 4DWSD 5K7JA 5IHSA 1OFRA 3TJXA 3KVMA 4WDTA 4C6OA 1AODA 3DX5A 1QPNA 2CLFA 5TIMA 3QC3A 4N4QA 2REQA 4GGHA 3C8NA 1JI2A 1NARA 5AC6A 1GKQA 1Z89A 4H9UA 4Q22A 3CHDA 3SECA 2PF0A 3H7UA 4NNBA 2HZGA 2GSJA 2G0WA 3HJZA 3CHCA 3GVVA 1O1ZA 1LYXA 5AYYA 3JVAA 4L4LA 3PZGA 3W0KA 3ZXWA 1B3VA 1LL4A 1YDNA 3B03A 4MJ4A 3T0CA 4C6MA 3SCPA 2NQLA 4UMBA 3WY1A 1XGEA 5CBJA 4IIFA 3DI0A 2WK2A 3ABSA 4AEFA 2CLEA 3QHMA 4MVAA 4C7FA 2J78A 2QPSA 2A5HA 4YHGA 3M5ZA 3WLLA 1F3EA 4XIMA 4R34A 1HKIA 3G77A 3SAZA 2VVNA 1J18A 1DVJA 1RCQA 1Y65A 1X8FA 1S5WA 4DJFA 1FWDC 2QCFA 1GVOA 3VMOA 3LQLA 2WMIA 1ZP3A 3UXDA 4QS5A 2RJHA 5LGXA 3UJFA 1SUXA 5T9CE 3L2MA 4D8LA 3K4AA 1DJHA 1TSIA 1UR1A 1Z3NA 3OIHA 2WWDA 4B3ZA 1A5BA 4KGJA 3VKDA 1OX4A 5GNYA 5C9UA 4JFSA 5IDZA 4ILSA 1M68A 2F8QA 2Y5EA 3U48A 3B3DA 3PZMA 3F2BA 1K7EA 4KEVA 3VXGA 2J8GA 1W1A1 4I7VA 2L5HA 3LHUA 4FMVA 4OTKA 3CQ0A 1Z42A 3NSXA 2XTKA 4NVTA 3KM8A 3M0XA 3OBEA 4JIEA 4J3UA 4OWGA 3QF0A 3UR7A 4LAMA 3FDKA 2VFDA 3HGOA 2ZXBA 3KOXA 3NQ7A 2EPLX 3CQJA 2PC8A 1O95A 5C9ZA 3FW6A 1JUEA 2CCRA 2RHGA 2Z2BA 3WH9A 3ZVIA 3DZ1A 1IGWA 4GYJA 3GBEA 5JVLA 1DJGA 2DZPA 2PRLA 5LHEA 2QCHA 3PBVA 5AB3A 4NZ3A 3RX3A 3VFLA 3AYTA 3DHFA 3CIWA 3WLTA 4JN8A 3I3BA 2VGGA 3LTYA 4P7LA 4U3CA 3UPBA 5CC5A 1V02E 2DUAA 1B54A 3A9IA 5BU6A 4UMAA 3DEQA 5FI8A 4GOAA 1OZQA 1X38A 4J3SA 1ALDA 1P4CA 5I6SA 2E7FA 4W8LA 2YOCA 2ZX6A 4M81A 3FLUA 2CESA 3W7HA 4JTKA 4RW5A 3SW6A 4DF1A 4DO4A 2E0PA 4FXSA 3V75A 3DESA 3IACA 5E93A 4RX0A 2PP1A 2ZE3A 1W5OA 1W3LA 3PTKA 4JIIX 4BEUA 2PS2A 2VZTA 4QJ4B 4V33A 3WQFA 3W75A 3NDZA 4NXSA 2Z00A 1YKWA 3G1RA 2C7FA 3MV01 3ZWTA 3KE0A 2D2OA 3N18A 1YPIA 4FNRA 1I75A 1XLCA 2YA1A 4ORMA 1DJYA 2ZA2A 3DN5A 1UZ4A 2Z6JA 4DI8A 1ZRQA 4FA3A 1W2VA 4X0VA 4H8VA 2BXZA 4F2UA 3W1NA 1FVPA 1OF8A 4HTBA 2ZXQA 4PB5A 3WF1A 2CKSA 3BOFA 4ZOBA 5HINA 3IVTA 1CLVA 1LQ2A 1ISWA 3P5YA 1KWKA 4J35A 4YYCA 1EDTA 5DMLA 4H2CA 4DBWA 4EXAA 4UFKA 1N8WA 2HVMA 2R1MA 5FSEC 4LB4A 1GPFA 4UQBA 5TBOA 2FGZA 1JZ7A 4TV5A 4E0CA 3WH6A 4Q7BA 3GC5A 1G7UA 1KC7A 4QHRA 1O12A 4U3AA 1VCFA 1PUDA 4U5KA 2HMCA 3CTTA 2WHKA 1R9YA 2YL6A 1XPGA 1EP1A 3WYZA 3ARRA 1YBQB 3CQIA 3O15A 4IPIA 3G1HA 4AYGA 3WUBA 1UHVA 4MDOA 2OYMA 3S2CA 1A47A 5CC6A 1FDZA 3O0KA 2VFGA 3ZSSA 2PODA 2FZMA 2MNRA 3M0IA 2DT0A 1DXEA 2W9MA 4JS3A 3CUHA 1TREA 4D8AA 1YEYA 2P8BA 1J10A 4N6EA 3CZ8A 3BWWA 4KF1A 3M1ZA 6PTDA 4K39A 1J0YA 1NDVA 2WZHA 1PDZA 4AB4A 3VTRA 5CZJA 3R94A 2NX9A 1L8NA 3RAOA 1VBJA 3M9YA 2A21A 5EMLA 2PB1A 5G1YA 1D3CA 1XRTA 3DG3A 2PDCA 5JBFA 1LOSA 4J3XA 3FGCA 5FCZA 3RM8A 2DUZA 2CHRA 3DGRA 5C9XA 3HFYA 4RNJA 1E71M 4H6RA 3H2AA 3NQVA 2H3BA 2DU2A 3W87A 2V3DA 3G2GA 4NAEB 4AIOA 3N29A 1YE6A 5CJMA 7PTDA 1S2UA 3NUKA 4Q32A 4GACA 1TELA 3GNRA 3SUWA 2DZBA 5I03A 1C9WA 1K4GA 3EPMA 3Q45A 5LIXX 4NU7A 5D04C 1HJSA 2DT2A 3GR8A 4IGSA 1QXLA 3WFZA 4YTQA 3AC0A 1EF3A 4IMCA 2IQ0A 1AMYA 3JRKA 4DWDA 2YXGA 1S2WA 2PDJA 1ZB5A 1EEXA 4TVCA 5LIWX 5G4EA 1WDPA 1CX9A 3EX1A 2DSVA 1QWKA 2GDVA 4PRTA 5HXMA 1BG9A 2HNEA 4GC4A 5A2BA 3RYSA 1VYSX 1ITUA 4B5VA 4LEQA 1M5WA 2V5JA 3I3EA 4WY0A 1MYRA 1ZP4A 4HK7A 4H9TA 1YLVA 3TC3A 3MVTA 4LQ1A 2D2JA 3IV3A 2PDLA 3NCOA 4AD3A 5JIPA 3M7SA 3W38A 1R87A 3AUOA 4GHRA 2VD9A 3CUZA 4J27A 1JYVA 3A4JA 3BLEA 2A0NA 4Q8NA 4NX0A 3L67A 4A8NA 4GX8A 4L64A 2VZVA 2PTYA 3POHA 3FFSA 4LVFA 2YFNA 3QTPA 4AZCB 2I5GA 3LHYA 4NNCA 3WDHA 4DJFC 2CLMA 3EOOA 4C7GA 2GK1B 3W86A 3LPPA 1PEZA 3H2CA 3CQKA 4UTFA 2TSYA 1DJQA 3WK3A 3TSBA 2GJRA 3UGRA 4HNVA 2YFOA 4ZBCA 2WSQA 3BL3A 2ZRVA 1EXBA 1F9CA 3IVUA 3UWEA 2OX4A 4H9MA 5AVHA 3R6IA 4MLRA 5FF4A 3HMCA 3TW7A 5CBBA 3MW7A 5DFAA 3E6EA 4C90A 2QR6A 2GOKA 2ACSA 1EJSC 2ZRZA 3ZSTA 3QPYA 1BG4A 3NEHA 5BWFA 5FF3A 1UP0A 4FX8A 3P80A 2ABBA 2J88A 4L1WA 4B5XA 4Z2JA 4ZB5A 3EWCA 2OVLA 3U7BA 4HN8A 5KZEA 4AZBA 4P7RA 1AG1O 3FEQA 4D6CA 4GH1A 1VEOA 2A3CA 1TMHA 3IIZA 4FX6M 4GYKA 4IP5A 3LGGA 4B9YA 3JZEA 4K8EA 4UFIA 4H4IA 3PFRA 4S3KA 5L6UA 4UCFA 2PWHA 1KCZA 4RPPA 3QZAA 2PDKA 3NQFA 4J2PA 2QT3A 3URBA 4AD1A 1LJYA 2C15A 5AC7A 2EPMX 2Y2WA 1JYXA 3GDTA 2VEMA 2AL1A 3LV6A 4IWWA 2ZX7A 2QV4A 1XDLA 2WPBA 4QE4A 1KA9F 4L1XA 3U57A 1PS9A 3WLHA 1SW7A 2DGAA 3VOCA 1Y8BA 3KLLA 1VCGA 2ZDRA 4S1FA 4BHYA 2FZBA 1JVNA 1LT7A 1WE5A 2YCLA 1PWMA 3WD3A 1TVPA 1Q2RA 1OIFA 1ISVA 2IKHA 1QMLA 2Y7EA 3VZZA 4EOUA 3E2RA 1UCWA 2AL2B 1PHWA 3AXXA 3MUZ1 4WVXA 1EL3A 1EA0A 3ITTA 4B15A 3RRXA 5C55A 1PL9A 4S38A 2YDAA 1OABA 3GDKA 2ISDA 1RQHA 1CDGA 3GW0A 1PSCA 2O9OA 3UCDA 4WY0F 2WBKA 1LF1A 4GBDA 1M1BA 4QISA 2A3BA 4Q4PA 3S6TA 3W2NA 1VPQA 2OZ8A 5AFDA 1OC5A 1EJWC 4JTHA 1FHDA 4MZ1A 2XISA 4AY1A 3QHNA 3UYIA 1HX0A 4OOZA 4EXBA 3VOFA 4P7NA 3ABZA 1NU5A 3OW1A 3VUSA 4LCQA 4N9EA 3LN3A 2YZRA 2G8ZA 1XPYA 1M7PA 3OJGA 4PCNA 1K8CA 5D9OA 4WD0A 1RZMA 3T0BA 2WQDA 2QUUA 3A6OA 4JCLA 2F38A 3R79A 2CZVA 1H62A 1XIJA 1FCVA 2P8CA 1UIPA 4IL0A 4ZB2A 2C91A 5AHNA 4E2BA 1J0IA 3MZNA 1UD5A 4CU8A 4QM1A 3L4XA 4PB3A 1IE7C 3DFTA 2CLOA 1E40A 1AK5A 4EANA 1XRSA 5T8GA 1IXPA 4AZIA 4ZOAA 2QMKA 3O3RA 4N02A 1JPIA 5FACA 5C9RA 3EZ4A 2WW5A 1XLKA 2D0FA 4H2HA 4JHOA 4NF7A 2GFTA 3HU7A 4RXFA 3QEZA 4J9JA 4IQLA 4GUJA 4OV9A 1FWJC 4ACZB 4Z1BA 4GUHA 1EWEA 4RKAA 3W1UA 1EWDA 3IK2A 3HPAA 4EACA 3WBWA 4HPGA 4FXJA 3S1GA 1XCXA 1UD2A 3B97A 3EBVA 3F5JA 1E4MM 1L6WA 3R4IA 4F66A 3AQUA 2E5DA 4IH3A 4AIBA 5DLCA 3GWQA 2VD8A 4X9SA 2NV1A 4DQWA 2RH9A 4R3UA 3OQ8A 5BWAA 3A4WA 4Y9PA 1XIMA 3CV2A 3CYJA 4N9BA 1G0CA 2IS7A 1P0DA 2BOFX 1MDLA 4XZMX 3PWAA 3DOPA 5CC7A 2ZDSA 1TZ7A 4H6EA 1I9CB 4Q8PA 5LXXA 1L6SA 3ANUA 3HN3A 4PEKA 3SCUA 3Q94A 3ZT7A 1EUNA 4LVBA 3S83A 1JXJA 3ZJ7A 1EOMA 4PMUA 1OJXA 2YCJA 3IJIA 4AVNA 3VD7A 3M47A 3PUDA 3QSTA 2NSXA 4UCGA 1HG3A 1AQMA 3M0LA 1GEHA 1O60A 4ZO7A 3WF2A 3ERPA 1OM0A 2QIIA 1A0EA 3FHQA 1NF0A 1ONWA 4G8TA 4JGDA 3P60A 3Q2DA 4US5A 1F6PA 3NQGA 3A9BA 4MG4A 3EWUA 2E6DA 4GNJA 2OU4A 2FHFA 4EPKA 3WD0A 2D0GA 4AHOA 1KBKA 2VX6A 4KEUA 4DNHA 4Q4KA 3L12A 4BJHA 1NDYA 4Y8EA 4ML4A 4IIDA 5CH9A 3WDPP 3A12A 3BAYA 1OGGA 2B0MA 1Q45A 3AJ7A 2VZSA 4JYDA 4F0SA 4JZ5A 4PFMA 3XINA 1V02A 3K46A 2BVDA 3C4UA 4RUBA 3TK7A 3VINA 1R3VA 2C18A 3W71A 5LHFA 1UWAA 1TPVA 4Z17A 4Q4RA 2H90A 1O66A 1T5AA 5D2YA 2Q8LA 3N2XA 4HA1A 4W86A 3CLWA 3NFUA 5D9MA 1NEYA 4N2YA 3TN4A 1WAWA 4PMZA 1ZJIA 2RDXA 2Z0IA 1OT1A 4U2ZA 4ZODA 4DZIA 2WKGA 4J1OA 4ROPA 4IP4A 1OYAA 4JR5A 3WDJA 1W6TA 3M0YA 4EIVA 1MQRA 3BGAA 5H8PA 2DQXA 1TPUA 3DFSA 3EWBX 4OIFA 1T0OA 1CLKA 4Z08A 1JNEA 2OWCA 3C2RA 3S2LA 3KW3A 3ABQA 4JY9A 4R27A 5GQBA 1UWUA 1LG2A 4AHQA 3D5HA 3GNDA 1UMLA 2NV2A 4MNMA 2Z2AA 3TN6A 1K8ZA 3W2UA 2GJNA 1XFCA 1LT8A 3KZPA 1XIGA 3ARSA 1J9YA 3K4WA 1KTCA 5HDRA 3GNOA 3FA3A 1TJRA 1LTDA 2ANUA 3QYQA 3PG9A 3D0CA 1R3RA 3EA3A 4S3CA 2V30A 1QOPA 4PYSA 3UNTA 4DUVA 3O9NA 5I3JA 5DN1A 2QCNA 3GAYA 1MZRA 3AOFA 4E4PA 2V2CA 1JAEA 2V38A 1K4HA 4DZHA 4LYKA 3ARWA 1GYMA 2XG9A 4TTGA 4CLMA 2FQIA 3AUJA 3MY9A 1LORA 3A3WA 4FP1A 1FCQA 1GVSA 1PZ0A 2VTFA 3RR1A 1VFUA 1U5HA 5CZSA 1TTIA 1UC4A 3WD2A 1G4PA 1VGAA 2Z1WA 1VBRA 2Y63A 2OZ3A 1AD1A 2F6UA 3MHGA 1W5QA 2A3LA 1EB3A 1NY1A 2GZXA 1WXJA 3BLKA 1MUCA 1XICA 2ATMA 4DIAA 1TWZA 4QR6A 2XPKA 3UPMA 2QPUA 3GR7A 1KV8A 3SQSA 2H9AB 3WNOA 2BB0A 1DWFM 2BVYA 1XLHA 3V1HA 4FNUA 2WKLA 2OLHA 4L4PA 3CV6A 1Q6OA 1CXLA 2EF9A 2YYTA 4FNQA 2AKZA 4M6QA 4N4PA 4HPNA 2BGSA 5A8OA 1LL7A 4DM2A 1ZAIA 5EMYA 4BQ3A 3EDKA 1ME8A 2J7CA 3PZVA 3CPRA 5EMJA 2CYGA 5HPCA 3WLNA 4IXXA 4WGXA 4EWND 1CGXA 1D7KA 1SZNA 2FGBA 1VZWA 1Z32X 3T4CA 1E3ZA 3AYVA 4DJDC 2WMGA 4YXGA 4IPPA 1S5MA 4GQ0A 2XUCA 3EXRA 3C2YA 4Y7EA 2XZ9A 2ZVRA 3FSUA 2XFFA 3W00A 5C70A 5CPOA 1EXPA 3VDBA 3ZJ8A 2WVTA 1O68A 3DIPA 2QVHA 1RXOB 1N8IA 4MWAB 3A22A 1NM9A 1UIOA 5F4XA 3TJIA 4CVWA 1UPPA 2CIPA 2EHHA 3UETA 2BP1A 3WELA 3CGTA 3BC9A 4G7EB 4RE4A 5D9PA 4Q8TA 1W9PA 2QDDA 3SN1A 3PM6A 1AD4A 3AROA 4RCXA 1YDOA 4E6MA 3TV8A 4UQAA 3ABRA 3BJTA 4E8DA 4O4WA 4KKXA 4JX6A 1WOAA 1OY0A 2QCLA 2O7SA 1UZHA 1U22A 1KTNA 2OG9A 4RZBA 3R2GA 4O1BA 3GXNA 1E1CA 2RUSA 3I3DA 4I6KA 2OEMA 1J0HA 1ZTVA 2YIHA 4GK8A 2I9EA 3T7VA 3MKKA 3L65A 3S5OA 3Q58A 4Z1DA 3GVWA 4JFUA 3H8AA 3AHYA 4UOJA 3FA4A 2YL9A 3FJ4A 4JTGA 2OQLA 3M0ZA 4GXMA 2BHUA 1DWHM 1V3IA 3LS9A 1QT1A 3SADA 2E6YA 3EX3A 3TYEA 3W7KA 5EBAA 3PZNA 3PANA 4CQCA 1KRAC 3ATZA 2O4QA 2XJ7A 1L2QA 1UD3A 1RJPA 4FOJA 5ABTA 3OLGA 3DG7A 1Z7AA 3CTLA 1I4NA 1MW1A 3ZJ6A 2ISFA 3M16A 4CKQA 4LH8A 4XUGA 3QR0A 1KM1A 3QVQA 4P2VA 2A3AA 1UH2A 3MVIA 5DX7A 2DSZA 2DDXA 3EXTA 3FVDA 4EF8A 3C5QA 1QI0A 5A69A 1KXHA 4GFSA 1EC7A 2QCDA 2MANA 3ALGA 3R43A 2ZXAA 3VCRA 1TVLA 4I3GA 3NURA 1TMLA 2NXGA 3VOJA 3NZPA 2BVWA 4ZL1A 2DZAA 3P82A 3VKAA 4OHQA 2O55A 2CFFA 4RDVA 2QDHA 1ZNNA 2OFJA 4B90A 2E8ZA 2EEXA 2XIJA 2Z24A 4DVOA 1SJDA 4TTUA 5B80A 3BMWA 3BQ5A 1Q6CA 4HYRA 3BMXA 3O6AA 4W5ZA 1ZFJA 3S1VA 3EB2A 1TA3A 2J7DA 2W61A 3QKZA 1CENA 4RPQA 5FA5A 1GYNA 1M7XA 3FYOA 2RGMA 2X7VA 4C1NB 1IHIA 3CO8A 4UFMA 3JR2A 3MP3A 3S5ZA 3WUEA 3QQWA 1GZ1A 2JEPA 2XWEA 1G94A 3IJ8A 3P84A 1E6QM 4NZ5A 3EWZA 1DIDA 4Q4SA 2HISA 2JKEA 2VQTA 4OBSA 3IJ9A 4RK8A 3FY1A 4EWJA 1GUVA 2NUYA 5EKYA 3WJSA 3UYCA 4LNCA 2C79A 1WA3A 2I56A 5D05A 1J8VA 3U9IA 1T41A 4GG9A 1I2RA 4XBSA 1G6CA 4HMNA 2EG7A 4A05A 1UA3A 5D03A 4UTUA 3ES7A 3U2ZA 1P0KA 4ZQCA 4IIGA 4KIEA 2TAAA 1GQKA 1NVMA 5G1TA 1A0CA 6XIMA 2HE5A 4X9YA 3W28A 2OJPA 1E9YB 4GE8A 5KZMA 3GYEA 3NXFA 2QXWA 1KBLA 3HBLA 3FN9A 4PUEA 3OLIA 5G2WA 5FL0A 4AEEA 2V3GA 1JUKA 1OVDA 5FAJA 3PZQA 3NO3A 3OA3A 3N9KA 3LGEA 3UJ2A 3R5EA 2ZC8A 4HJWA 5F4WA 3UWWA 3OLEA 1FWHC 4ZOCA 1O5RA 2WOQA 4JPGA 3TQKA 2OSXA 5LGZA 5C6MA 3MCOA 3GBDA 1DIEA 2NLYA 4MY8A 2X1RA 1EC8A 1G4EA 3NVTA 3GZ3A 3SCTA 4TUFA 3USBA 4O28A 5E9XA 3SI9A 4AMAA 4IPNB 1XBXA 3UJSA 2CBUA 4WZHA 5C0QA 2EAWA 2CETA 3T81A 4F0MA 1Q4NX 2FMOA 2EPKX 3LCWA 3WQGA 2E5CA 1GZGA 4RXGA 1GQJA 1XLEA 3T9PA 4MUZA 4H8UA 4GABA 1CXFA 1OCNA 1W1YA 4WX2A 3TN5A 5F2LA 3EAUA 3PUGA 4ZVJA 1ICPA 3TTYA 1M01A 2CHOA 2VP8A 1FY6A 3ITCA 4WLCA 4C6JA 4WKFA 3PFMA 3GTXA 4C6KA 1GOKA 3O6YX 4AVFA 3G3DA 3NL2A 4N42A 3TDFA 2VYOA 3KUMA 4UZUA 4CD7A 3FHAA 1SO5A 4K3ZA 2PDWA 1SFJA 3BMVA 3CNYA 2Y89A 3O05A 5HQMA 1JEZA 3PC0A 4E3VA 4R7JA 2PDIA 3IK4A 5AYXA 3O6DA 5K9XA 3SCVA 4JBRA 3EGJA 1Q6FA 1F2JA 5HK4A 3VKKA 3LTSA 4AW7A 1VBHA 2QGYA 1KFEA 3LSBA 3FAXA 3B0XA 4JTFA 1UUMA 4J2MA 3W7NA 4UQEA 2QF8A 4PSPA 3W7RA 2CZFA 1OCJA 3OZYA 3NQDA 2D2GA 2VC6A 4HU8A 1XLAA 3W7MA 3S5NA 3SRDA 5AVNA 2ADAA 2IMRA 3PVFA 1V6XA 5A6BA 1VEPA 4D6HA 2C8NA 2PD5A 4LX4A 5BRPA 1GOWA 3U8GA 2IKIA 3W2LA 4JYEA 3EB4A 2XIBA 3CUJA 5REQB 3N1AA 2PDHA 4C6LA 4V28A 1JZ6A 2X2GA 5I3FA 1RVGA 2WCGA 4F40A 1PX4A 1H7OA 3AZTA 1QFEA 1W2PA 4JFVA 4E3TA 1TWIA 1YPFA 1E0XA 4HU3A 1F4HA 5KEZA 3CUGA 4Y9OA 4LAZA 2YJQA 4M3PA 3PTQA 1C90A 1JPKA 4GYPA 3S1UA 4IGNA 5D02A 4Z2IA 2J13A 2WSRA 2JF7A 2UWFA 3MYPA 4YTUA 4HHPA 1UPMB 3WQ6A 3IGUA 1FWTA 3AIUA 3V16A 1TYGA 1TG7A 1YNQA 2J6VA 2VFIA 3MI2A 1QNVA 5L9FA 3TEVA 1NWRA 3C56A 3FIGA 3HF3A 4LUSB 4C6CA 3WFLA 4HNTA 2HK1A 4ORIA 1EO7A 3OVPA 1K03A 2OB3A 2J7GA 4CNOA 2ZXDA 1ICQA 1B1YA 3M4HA 3VGHA 2VFHA 4MY9A 3CV1A 5LNVA 1X1OA 1HKKA 1F8IA 4JFTA 4LF1A 3TONA 3QV6A 4O18A 2YLAA 1B2YA 4LV9A 4XVEA 1DIKA 2F9RA 2VOMA 4LU0A 4GY1A 1XYFA 3O6CA 2NLIA 4JN6A 4GUGA 3II1A 1XX1A 4GZIA 2Q6ZA 2ZX8A 1MEHA 4A35A 4O13A 3LM3A 2OZ0A 4REQA 3NQ8A 2ZZ6A 4HOZA 1AJZA 1XC4A 3N25A 2HTMA 5I2UA 4QX4A 4C6NA 4DO7A 2VI0A 4C6BA 1IT0A 1VHCA 4PCFA 5DQPA 1ZGDA 4K38A 3URQA 2YR1A 1RAKA 2BOEX 3ARPA 3STCA 3BTNA 3G0XA 4GH3A 1V6TA 4U2YA 1PE1A 3OBKA 5IDIA 4NJKA 3UXLA 3NR0A 1DKWA 1KTBA 3L7RA 4QCEA 1C93A 1XHGA 2JKAA 3KCOA 3GAKA 3OHIA 2ZZ3A 3ARUA 2NUWA 3NDYA 3TTOA 3CASA 2DZWA 3BAXA 2OQHA 3W7CA 9XIMA 3WEOA 2NUXA 3E96A 3FAWA 2FVMA 3SBFA 2XINA 3AU2A 3EDJA 1CGVA 2Y7DA 2XIOA 2WVSA 1PTGA 2R1NA 4G7FA 4PGLA 1YE4A 5I3HA 4F0RA 2QGHA 2WYSA 3RR4A 2OELA 4MJMA 4Q33A 1BTMA 1BXNA 3UT0A 3GU1A 3QGKC 4QJ3B 3LU2A 2X09A 1W3HA 2F61A 1JF6A 4OGZA 4KWSA 1MXGA 3RG6A 3TCEA 3T2PA 3KHJA 2B7PA 4ZQOA 4LS2A 1OG6A 3NQ6A 3BCDA 1P1MA 5HULA 2G37A 4XZNX 4JXCA 2Z1BA 4L65A 3KVJA 4IIHA 2VEIA 4ZO6A 4B5SA 4KRUA 4IUGA 4WK9A 1JJKA 3FV9A 1KKRA 4WJEA 2YW3A 4HIBA 3NJ3A 1EC9A 1QHZA 3B9DA 5HR7A 3MO4A 2GVGA 4AVOA 2KZHA 1E6PA 1R0MA 1OFOA 3SB0A 1V7AA 3ZVHB 4PMNA 1TIMA 4QG8A 1R7OA 5FJPA 1ZLPA 4MJ2A 2HEJA 4OV4A 2C71A 1QPOA 3SSZA 3W25A 6ENLA 3PULA 3RPDA 1V0LA 1HVQA 4XAPA 1DWJM 1S3TC 3RO8A 3BARA 3O06A 2E4TA 7REQA 4H8NA 1OEPA 2XH4A 2O7QA 2W62A 2XSBA 3NYDA 3E0LA 1VFLA 3BCJA 2P10A 4MWAE 4F79A 1KO0A 3NM3A 3WF0A 2FHCA 4ZCWA 1R2SA 2WSYA 3MSDA 3QKEA 2QCMA 3V5CA 2IXVA 3N2TA 1U1UA 1EQCA 3PPFA 2V2HA 1QW9A 1AQFA 2GLKA 2HVNA 4OUIA 1CXKA 4CCZA 1ZJBA 1NWUA 3NQEA 4GWEA 1MXSA 4RE3A 1JD9A 5CPNA 1BSLA 1ZS2A 3LTPA 3RF9A 3G8EA 4OVXA 1EYWA 2QJIA 1GWJA 2I5QA 3W53A 1JL8A 1OB0A 3STFA 3LSCA 2WMJA 1Q63A 3KBJA 4ZQNA 1BWVA 5XIMA 1EJUC 2WZMA 5E0FA 2J8TA 5AHLA 5AOUA 4AWTA 2NQ5A 4XD4A 3VIIA 4ZQRA 3GG1A 3L2IA 1Q5MA 3HPSA 3LDVA 2WNQA 3KBNA 3BICA 1E55A 5C7VA 1Y5XA 3SCOA 2BHZA 1K6AA 1IIGA 1FWAC 1FWNA 1PAMA 5KSWA 3B8DA 2ZTKA 1BQGA 1F05A 2WC3A 2Z25A 3OYXA 3IPWA 3W85A 1R3SA 3WLOA 3AU6A 1OBAA 3KBVA 1ZUAX 2OEJA 4A4AA 4GNVA 4Y90A 1JFXA 1MFVA 4TU1A 2PWFA 4B92A 3LK6A 2J77A 5D37A 3KAOA 4O1EA 1TPC1 5F1VA 3HG2A 4GX9A 2PFHA 3LRKA 2P3ZA 3N4EA 3KOFA 1HF6A 1ZBKA 3N11A 4XZBA 3AHXA 4GVGA 4GY0A 2WMHA 2OOGA 9XIAA 4LTSA 3Q67A 1J0ZA 1XC6A 2Z27A 1LM1A 3BAIA 3JW7A 1A5CA 5D8WA 3WMSA 1UQZA 3N9SA 4O1CA 5I23A 1XH0A 1WX0A 2XZ7A 2WKJA 3TOPA 3S46A 4CD8A 2VRJA 3SM0A 4QP0A 3MUY1 2PTDA 4GYPC 1G69A 4X2RA 1XIEA 2QUVA 4O8AA 3KCJA 1KBIA 3WH5A 1H11A 4PA8A 4H00A 3GG8A 2F2HA 3NOEA 2HCVA 1UB3A 4AF0B 1K3UA 2XGZA 3SGGA 4AU0A 4OOUA 3F4DA 2ZA3A 3TIMA 1FWGC 4B2DA 2YXOA 4MLJA 2WM0A 4ZTXA 1I2OA 4PCTA 3QW3A 3BG9A 5G5IA 5DCDA 3QN3A 1O1HA 5JH1A 3VNDA 4YPJA 1JPMA 2J7HA 4A29A 4LCRA 1NP2A 3MMTA 1OG0A 1AFSA 4ADTA 3HOJA 3B9NA 2FIQA 1GVRA 4MYXA 2ZWYA 1VEMA 5BRBA 2VZOA 2HSAA 3W27A 1FQ0A 1GK8A 3I10A 3EDDA 3M46A 4PTWA 1JFHA 3GS6A 5JH2A 1JYWA 1NWSA 2F7FA 4LCSA 1AH4A 3VOIA 4H83A 3UR5A 1D2KA 2XFYA 3OHMB 3UWYA 4HU4A 4W8AA 3PBGA 4UTIA 5KINA 1KQZA 2PP3A 2GDUA 5C54A 7XIMA 3DKJA 4W4QA 4BI7A 4IMEA 4FLOA 3PPHA 1Q6QA 3D47A 4XKYA 3BLFA 1P6CA 1T8XA 1G67A 8A3HA 1XINA 1E72M 1XM3A 1PIFA 4W88A 5U4NA 2V5BA 3ZT6A 5GJNA 2ZUNA 3JZUA 4UTJA 1DWAM 3WQPA 1WUFA 3CO4A 4H01A 4UTTA 1V0MA 4YWIA 2V81A 3E74A 4CD4A 5HWMA 1W8SA 2PLKA 3TYZA 1PKYA 3BAKA 3UGVA 3IJQA 2GJXA 1AQHA 4GRSA 1X1NA 2E09A 4KGLA 5A3HA 2X0HA 1VF8A 1NOWA 4AZGA 1TPWA 2G3MA 2BWGA 3ALFA 4K7YA 3PB2A 5K9DA 4CN4A 3GVGA 3EOEA 5CZTA 3BGGA 4NI3A 4HQVA 1RCXB 5CCZA 3MDUA 2WVVB 1PZ2A 1DYSA 3W6LA 4EAYA 1YYAA 2C16A 1WKYA 8RUCA 3H24A 4L6DA 5BXSA 2VDIA 3UESA 4AWUA 1LRTA 4TX6A 2YBTA 4F0HA 3W3OA 2CZEA 2FTWA 2UBPC 1UWSA 5C2GA 1KCXA 5KZDA 1Z9AA 2NXHA 1DJZA 3RCNA 3V5FA 3GB6A 2E77A 1OQFA 3RFAA 2WNWA 1GYLA 1J6OA 1A80A 4H6QA 2XDFA 1JZ3A 1WDSA 2G95A 2XN0A 4PN2A 1IXNA 2QCEA 3BLDA 2ACUA 1K7FA 4WDXA 1MEIA 3R1ZA 1E5JA 2REQB 3O16A 4CN1A 3TR2A 6CGTA 1LQ0A 1WUEA 1KD0A 1Y7VA 3OU8A 1ADOA 1X39A 3NSMA 5A8NA 2PDQA 3SCWA 1LBLA 5T9BG 3TOYA 3REQA 2YA2A 4GYFA 4Y96A 3RHGA 4MGGA 1YDVA 2ZRXA 1NQ6A 3L5AA 3FK4A 1A53A 1SJBA 5HAOA 1YDYA 3IUIA 5A1AA 1R85A 1MWOA 3MQTA 1E0UA 1GG0A 5A6AA 2OODA 1JQXA 3HM7A 3P62A 3VK5A 3OP2A 4XZ9A 2ZRYA 4Y9NA 3PZIA 3BE7A 2QEZA 3L4TA 3VMPA 3GHTA 4ADSA 1PXGA 1KB3A 4A3QA 5BZAA 4LBRA 4MMWA 1J79A 1ODZA 4KCTA 3FXGA 4ENLA 1H1NA 1UWRA 3KDOA 3O0FA 5BOFA 4YTRA 4WCJA 4TOQA 2W63A 1K9TA 3DFHA 3DFPA 2WMIB 1XLFA 5K9CA 3B9OA 1K9DA 4S2BA 4IFKA 1FWIC 2PC4A 4MAVA 4L7ZA 4Q4QA 4DB7A 1U5VA 3W1QA 1ZBCA 4DAIA 3KTCA 3RX2A 4NX5A 1XISA 1NFGA 3T8QA 2PD9A 1OX4B 3W7OA 4HNCA 2QV5A 2A3HA 1EIXA 3F4VA 2V5DA 4MPQA 1NIUA 2VEKA 4PMVA 1K9FA 2PEVA 1UD4A 1RBLA 1BF6A 3W2KA 5K2ZA 1NFBA 1C8VA 2ON3A 3CHFA 4Q8UA 2WNZA 4OFCA 5IFPA 4O14A 4DJED 2DJXA 3E0WA 4EF9A 2CLLA 1YQ2A 4O8RA 2XH7A 1ECQA 4DPPA 3VDAA 1UJQA 1RPKA 4JHMA 1XIBA 2FJKA 2VX4A 3M5XA 4JQ2A 5HUOA 1OGBA 1VKFA 3A5FA 2X1SA 3T08A 5AC5A 4GD0A 1WZMA 4FF7A 2VC9A