3MB9A

Human aldose reductase mutant t113a complexed with zopolrestat
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
314
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3mb9A00
3DOPA 2BP1A 5LIYX 3CAQA 2F38A 1YE6A 3FX4A 1PWMA 2DUZA 3RX2A 4JTCA 4XZLX 2PDIA 4XZIA 3V35A 1XF0A 2PDXA 4L1XA 3QKZA 4H8NA 5C7HA 2NVCA 4XVDA 2WZTA 4R9OA 3B3DA 1IEIA 3WG6A 1S2CA 2I16A 1YE4A 2IQ0A 4XAPA 1Z8AA 2A79A 5AZ0A 4L1WA 3F7JA 4LB3A 5HA7A 4Q3MA 4LBSA 1AZ1A 3ONBA 1Z9AA 4ASTA 4ICCX 4JQAA 2FZBA 1UR3M 2DV0A 3V0TA 1A80A 4WGHA 2WZMA 4PRTA 3UZYA 4JIIX 3WCZA 4PRRA 1OG6A 2C91A 1VBJA 1R38A 2IKGA 3N6QA 3BV7A 2PFHA 3BUVA 3UZXA 4GACA 1PYFA 1S1RA 3MB9A 3LZ5A 4JQ3A 2BGQA 3DN5A 3EB3A 2IPFA 4QR6A 4WDWA 1YNPA 3CV6A 4GA8A 1C9WA 3T42A 2ALRA 3UZWA 2IKHA 1SM9A 3ONCA 4ZFCA 2ACRA 4JQ4A 1RALA 2R9RA 3GHSA 2I17A 4JIRA 5LIWX 3G5EA 4JTAA 1X97A 1IHIA 4JQ2A 3P2VA 2PDYA 1YNQA 2ACQA 5HNUA 1T41A 1AH0A 1MZRA 2NVDA 1RY0A 3LN3A 4JIHA 2PDCA 3GHUA 3R94A 2IPWA 2HEJA 3N2TA 3CV7A 4IJRA 4QXIA 2P5NA 2IKIA 3LUTA 1PZ0A 4JTQA 2PDMA 3WBWA 3UYIA 4G5DA 3FJNA 1K8CA 4XZHA 3R43A 4DZ5A 4DBSA 4YVVA 2PDQA 1J96A 1X98A 4XVEA 4GABA 3LQLA 2VDGA 2PDGA 4PR4A 4EXBA 4WDXA 4WDTA 4WRHA 5KETA 2IKJA 4LAZA 1ZSXA 4JTDA 1RY8A 1LWIA 1VP5A 5DANA 5JH2A 4AUBA 3R8GA 2F2KA 1ZUAX 3COTA 4I5XA 4YU1A 4IJCA 2PDLA 3S3GA 3UG8A 2FVLA 2PDBA 5JH1A 1M9HA 4PUUA 2PDPA 4NKCA 3GHTA 4FA3A 3M0IA 2PEVA 1AFSA 4HBKA 4LAUA 4XO7A 3KRBA 5HNTA 3LZ3A 3VXGA 1AZ2A 4GQGA 3CASA 4FAMA 1HW6A 1EXBA 3CAVA 2R24A 2PDFA 1Q5MA 1LQAA 3LENA 2FZ8A 4HMNA 4F40A 1PZ1A 1X96A 4WDUA 4DBWA 2HVOA 3O0KA 5LIKX 2HVNA 2PZNA 2J8TA 3C3UA 3D3FA 4IGSA 2ACUA 3CMFA 2ACSA 1EL3A 4YVPA 1S2AA 3M4HA 3LEPA 1MI3A 1S1PA 4LB4A 4PUWA 3Q67A 1HQTA 1US0A 2HV5A 2IPJA 4PMJA 5LIUX 4FALA 3BCJA 3LD5A 2PDNA 1XJBA 3MC5A 3RX4A 3WBXA 4XZNX 1PWLA 4RPQA 3ERPA 4OTKA 4FZIA 3LBOA 3Q65A 2DUXA 3H4GA 3RX3A 3R6IA 2QXWA 2ISFA 1AH3A 3LNMA 3GUGA 3H7UA 1JEZA 1QRQA 3V0SA 4QX4A 2PD9A 2PDJA 2PDWA 2PF8A 2FZDA 2PD5A 4YVXA 4DBUA 4Q7BA 3R7MA 3NTYA 3R8HA 4XZMX 3O3RA 3BURA 1XGDA 1FRBA 2INEA 5LIXX 1ZGDA 2FGBA 3EB4A 3U2CA 4YS1A 4JQ1A 3H7RA 2BGSA 1ADSA 4GQ0A 3UWEA 3R58A 3EAUA 3UFYA 4WEVX 3V36A 5AZ1A 4EXAA 4XO6A 4XK2A 5M2FX 4LBRA 2IPGA 2HDJA 2FZ9A 2AGTA 2CLPA 4JTRA 3M64A 1EF3A 2INZA 3G1RA 4QBXA 3V0UA 3UGRA 1EKOA 2PDKA 1MRQA 2HE8A 1QWKA 2PDUA 1GVEA 1AH4A 3GHRA 1Z3NA 4GCAA 4H7CA 2IQDA 4GIEA 1ZQ5A 3UP8A 4MHBA 2PDHA 3LQGA 2HE5A 1Z89A 3WBYA 1Q13A 1T40A 2IS7A 3UZZA
chains in the Genus database with same CATH superfamily
3THCA 2B7NA 1YE6A 1HL2A 3UF9A 4JYEA 4HN8A 1J0JA 4HJWA 4NNBA 1IGWA 4UQEA 3VGDA 3WEOA 1HJSA 3SUVA 3VABA 4AIUA 4H8NA 4RPPA 4R9OA 4WGXA 1CPUA 1VPQA 2ZZ1A 3N3MA 4NX5A 1FKWA 5KZEA 5ECUA 2B7OA 3T0DA 3U7VA 4ZR8A 2X41A 2G50A 2C3ZA 4AF0A 3M0YA 1OF8A 3T1GA 1AZ1A 2DZWA 4MLRA 4E4FA 3S4TA 3QPYA 2JE8A 5AYBA 5K2ZA 4O54A 4ILSA 3N9SA 4IMCA 3TJ4A 2OPJA 3HV8A 1EB3A 5EFFA 4DY1A 1H7PA 3RO6A 3OIHA 4KWWA 3L4ZA 2A21A 1OFEA 1YW1A 1HN1A 3MB9A 3B05A 4LAKA 4L7ZA 3U7BA 3PP7A 3TSMA 4NNCA 1BXBA 2JKEA 2DW6A 3TE9A 3GG1A 1QOXA 5KZ6A 5AHLA 4KS0A 3F5JA 2IW0A 2ZA2A 1CW2A 2XDFA 3B8TA 3CIXA 5LYRA 1BFNA 2ZVRA 4UTHA 2QCDA 4MZ8A 3WF3A 3L5AA 4S1FA 4PMZA 5LIWX 4LY4A 3FAXA 2VC6A 3CIVA 2QJIA 4L4PA 4IIHA 4HNCA 3LPOA 2EBNA 1B3XA 2I5QA 3FXYA 1AH0A 2YDQA 4V33A 1YPIA 2NWSA 3UZ5A 2VRKA 3ZWTA 6A3HA 2XVNA 4J4KA 2WNZA 1D7KA 4PGLA 1XKYA 2WW5A 3LUTA 4B2DD 4FLRA 3U5UA 3DHFA 4QE1A 4ZVJA 3W22A 2PDMA 1US2A 5AFDA 3WBWA 5I23A 3CU2A 4JTKA 2Z1SA 1EGVA 5IDIA 2ZA1A 3S5SA 5FAGA 2OX4A 1LQ0A 3FJNA 3PZUA 3I10A 1S5TA 5A6AA 4YTQA 3GYEA 2D2OA 1J0KA 3T55A 1XIJA 4XVEA 3SN4A 3WLOA 2QMKA 1EP1A 1H1ZA 5AC7A 4H00A 3ECQA 1WZAA 1UZHA 1G7VA 2NWRA 1Z41A 1H4PA 4PTXA 3EA2A 1ZSXA 1B9BA 1CXHA 2O7QA 3UR2A 5FF3A 3W2MA 3E3HA 4A21A 4AUBA 4JIPA 1TTJA 2V30A 4ERAA 5EPDA 3RF9A 4UQDA 3S2JA 1HGYA 3SJNA 1GQNA 4GO8A 5BYWA 4QM1A 2DVXA 1OM0A 4IP4A 2QLYA 4RZBA 1TFVA 3KRBA 4FNPA 3RCMA 2J6VA 4KT2A 5LA1A 1AZ2A 3MKCA 2R24A 4H6KA 4AFYA 3KBVA 1PCWA 2VQTA 5EGRA 3KCLA 3TJXA 4ROPA 1TRIA 3MV01 1OHLA 3TIMA 3U0HA 4RXFA 3RM8A 4AHPA 1KBKA 1XLBA 3DHUA 2G37A 1SO5A 1Q2RA 1UBPC 2YZRA 3EKZA 5IFTA 1B3YA 3L2MA 4UR8A 1XSIA 2YPIA 4L6DA 3TQPA 3QZEA 1ZFJA 4IXHA 3V75A 1CLKA 4US5A 2NQ5A 3VIOA 4IHCA 3I4EA 3MDUA 1VFFA 3R0KA 2GVEA 2BS9A 3GX9A 1R3YA 3JRKA 2RFGA 3BLIA 5J5DA 3ITCA 1S1PA 3VE7A 4K8EA 1DWHM 2Q3OA 4JHZA 1KBLA 3G0SA 2QJMA 5CGQA 4A3UA 3ZZ1A 1VFHA 2CZDA 2X42A 2QVNA 4C6PA 3NO3A 4IFKB 1BWVA 3EXTA 4JL1A 2GQ8A 4LBUA 3AXKA 1W91A 3S9IA 3AICA 3C52A 4W4QA 2AQOA 1D9EA 2XFYA 3W7IA 2WB5A 3RR4A 4Q33A 3TOPA 3MUIA 3BG9A 5LA2A 3MKVA 3UEQA 2L5HA 4W85A 1THFD 3H26A 1Z69A 1VQTA 2DH2A 2OLAA 4NSBA 1G4PA 1XCFA 4HK7A 1QASA 4TOQA 4CN4A 2EPLX 2GJXA 1MW2A 5B7YA 2GVLA 3S6DA 1EWDA 4J28A 1O5KA 2DZPA 4AMCA 5FOOA 4DBUA 3RU6A 1LROA 3U8GA 4JFSA 3ZLGA 1EDQA 5EB8A 4JTJA 4M51A 4F4RA 3CZLA 2BV9A 4XQ6A 3UWZA 1HO1A 1NY1A 3O06A 1DOSA 5FL1A 5H91A 3RLHA 4K8GA 4RE3A 4XO6A 3T2PA 3TP4A 5M2FX 5HWNA 2R6OA 4FXJA 2GWNA 3W7DA 2OELA 4DJEA 3RCNA 4LX4A 2REQA 2E77A 5CLTA 5CPTA 5I77A 4JCMA 4QBXA 1V0LA 5G2IA 4LF1A 5DMYA 5KINA 3CUHA 2GJPA 1B2YA 3WUGA 3W1TA 1GOXA 3TCSA 3DX5A 1L9WA 3LQGA 1UROA 3WBYA 2EEXA 5MHBA 4YYFA 1OGSA 3BQ6A 3UZZA 1VKFA 1P0BA 3RYSA 1R9XA 2XPKA 3UERA 5E9XA 1W3TA 2V2CA 3JUGA 2EPMX 3M1ZA 1GZGA 1A5AA 4MLJA 4XZIA 1G1YA 1NAL1 3H23A 4UZSA 3DERA 1IXQA 2NVCA 4B5SA 1B5TA 1WAUA 2ESCA 3WG6A 1SPQA 2WLZA 2I16A 3GKAA 2ZFAA 3MSRA 1F2JA 3AUOA 2YFNA 3IPWA 5AZ0A 1V02E 4NZ1A 1E4MM 4L1WA 4YWSA 3V5FA 4XKYB 1MEWA 2AL2B 2AMXA 1RCQA 3OZPA 3TQKA 2PGFA 3E2QA 3RUBL 3OJGA 3PPGA 3WQDA 2J6XA 2FZBA 1UR3M 3PSWA 2RJGA 3OLIA 1RCXB 1YDVA 4GCXA 1R38A 2G41A 3WLPA 1SW7A 3N6QA 4ZXLA 3TYZA 4AZBA 4ZMGA 3MCOA 4C6BA 1HJXA 4A2RA 1D8CA 3KZSA 4XSLA 1L8NA 5D2WA 3PBMA 5AHMA 3M0XA 3QW3A 3UVAA 2WMIA 3EDDA 3T4CA 3WH9A 4R3UA 4CEXC 4AVOA 4W87A 2OB3A 1X7FA 3UPWA 4P7QA 4YHEA 3L68A 2XVKA 3EWBX 1KKRA 3BC9A 3L4WA 4BQ3A 3FSTA 1XDJA 4PCNA 1XLLA 5EBUA 3IVUA 3NQDA 1FH9A 1Q6QA 3QMRA 5HWMA 4RE2A 1UR2A 3IGHX 4JFTA 3W1QA 3U2ZA 1YNYA 4UFLA 1KR0A 1OT2A 4F9DA 1JZ5A 1GHSA 1MRAA 4I90A 4HA3A 1H49A 1I6NA 3S1UA 4WZHA 4LUSA 4UNIA 3CPRA 4FS9A 4F0SA 1HNYA 1UWQA 3O9NA 2NT0A 3T40A 2XG9A 2FDSA 5EMUA 1GUVA 1BG4A 2I9EA 2PE4A 4JTQA 1DWIM 4PCTA 3UYIA 3GRIA 2V67A 2QULA 3L21A 3S83A 4CNUA 1CENA 3PAOA 4RZ5A 3T05A 3R43A 4NJGA 4DBSA 2LLEA 3HN3A 4ZXOA 1CTNA 4PTVA 2C1IA 3ZVIA 3TN5A 4HPNA 2ZZ7A 2NQZA 1OYAA 4V2XA 2PTDA 3L4UA 2OOFA 2FH8A 4O1CA 2CNCA 1E0VA 2E9BA 3TNBA 4HMEA 3LHUA 1BSIA 1KB3A 1LYXA 1H7NA 2EF9A 3ITLA 1ZUAX 5LHFA 4DWDA 3P82A 3SO7A 1FCUA 4UCFA 2FVLA 2A5HA 2D2HA 2E0PA 3EDJA 1UP0A 3RPMA 4NKCA 1P5BA 1SQ7A 3DKLA 1M3UA 4OE7A 3M0IA 2PEVA 4FNUA 3W7KA 3P67A 4LAUA 3KM8A 1TJ1A 1DVJA 5BMXA 1RA0A 1CBGA 2ZE3A 2HJPA 4JPGA 3CAVA 1R7AA 3M6DA 2PDFA 8XIMA 3CT7A 5AKQA 3E38A 1D3CA 3E5PA 3KVLA 2J79A 1U5HA 1QNQA 1EF2A 3ARXA 2Q01A 2HBXA 2XH0A 2CZEA 2C18A 2XIBA 2NUWA 1CEOA 2PZNA 4Z2KA 1NFGA 3VKDA 1KCZA 1LOLA 2CLKA 3RPDA 4NYYA 1H7OA 5C2XA 1ZHAA 1TV2A 3HZ3A 1UUMA 4UFIA 4C6OA 1EEPA 3KBSA 3QC0A 3RRAA 4U31A 3CJPA 4JYFA 4C7GA 3KUMA 3MHFA 4UXDA 2OXNA 3NUKA 2YOCA 3AXHA 3LXBA 2HS8A 1KM0A 4DN1A 5C9UA 3MI3A 4M7SA 1TO3A 2PDNA 3DYOA 2GVGA 4LVDA 4GGHA 1TMLA 1V02A 3ZS4A 3SCQA 1XDMA 4RPQA 5C2GA 3QOKA 3GXTA 3SCUA 3PZGA 1V3IA 1F7BA 5A1AA 4X61A 3GTFA 2G8ZA 2VCBA 3IAQA 1DXIA 1RK5A 2J27A 4JDBA 4L80A 1XYLA 2BBFA 4NJIA 3CB3A 3GXIA 3M9YA 1UCWA 1S5NA 4JD4A 2Q3RA 1EJUC 1ML1A 1UYQA 5D9MA 3H7UA 2Y5EA 4BA0A 3FYOA 4GK8A 1E1CB 4ALDA 2PF8A 2YFOA 5AOUA 4C6EA 3BK0A 3NQGA 1W5PA 1H63A 2OZTA 4XD4A 2JKPA 7ODCA 5IRPA 4I3GA 1FRBA 2WKGA 5J04A 3A4AA 3GTHA 1SZNA 2INEA 4TX6A 5JUVA 4R27A 2VRQA 1K1DA 4IWWA 5HJLA 4YWIA 5JVLA 5C0QA 2PWEA 4HYWA 3N13A 3A13A 2ZXDA 3U5YA 1SFJA 1TWIA 3B4YA 1NQ6A 3LV5A 5TD4A 1GVRA 4E4PA 4B15A 1EC9A 3URBA 3M0VA 1BVWA 1OEPA 3MSYA 4OHQA 1S2TA 5T26A 3UG3A 7TAAA 3PJUA 4LS1A 4AH7A 5M5DA 2D23A 1AL8A 3VNYA 1KM5A 4BF5A 4IUGA 3RO8A 1K4GA 1MRQA 4MZ1A 2FIQA 2HE8A 4R7WA 5E93A 3T44A 2HTMA 4FNSA 4PZVA 1I75A 1GYLA 3W85A 4HK6A 4E2BA 1FWSA 5GVJA 3DOPA 2BB0A 2VR2A 3WJZA 5GNXA 4JNMA 2G3MA 2VZTA 3GQYA 4Z0JA 1QI5A 1EPXA 2R1NA 3EWDA 5TIMA 5AY7A 3P7YA 2X1IA 4UR7A 1JD7A 5A6BD 3DG7A 1E1FA 1RQEA 5H6HA 2WV8A 3WKZA 2Z2UA 4K3ZA 4PA8A 3B0PA 1UA7A 3AIEA 3NFUA 4QQ3A 5EYWA 2OODA 4FNQA 5H8UA 1XL9A 1VFLA 4D8LA 4I7UA 3S2NA 5FF2A 2YXGA 2GFTA 5AHEA 3OGRA 4MSSA 1EJSC 2DORA 2QHAA 3W3OA 3ZM8A 1E0UA 2Y89A 1DKWA 2OMAA 2DEPA 2WZMA 6XIAA 3SECA 3AC0A 1BWLA 2ZQ0A 5A94A 2EXOA 5C71A 3N12A 5GQBA 3GR8A 1F05A 4JYDA 4U33A 3RPTA 2PFHA 2XN0A 1GW1A 3HTWA 1VYRA 3BUVA 5CAKA 3UZXA 1PBGA 1F3WA 3QYSA 2V63A 3ABQA 1PYFA 1GJPA 4JQ3A 4YJ5A 1P0EA 3GU1A 3IGUA 1Q45A 1JGIA 3VCCA 4HNNA 2ALRA 1CXIA 4GNVA 1LLWA 1RV8A 4CD6A 1SR9A 1W37A 4QE5A 4CCZA 3V16A 3WSUA 4JQ2A 1MVYA 1EQCA 1FWHC 2PBOA 4IQLA 5IOBA 3MP4A 3APYA 2JIWA 3MO7A 1J93A 4FX7A 1LRTA 2VOMA 3AHYA 4OBTA 3LN3A 4JIHA 3LGGA 4JX5A 2XH2A 1L6GA 4O10A 4UBPC 1GZJA 1MW1A 2QCMA 2WPGA 3UETA 4HMDA 3G6LA 2OO0A 5CG0A 2J78A 4MJ2A 4H4IA 3IK2A 1OK4A 3PFMA 3CBWA 4GMEA 3QFWA 1PKYA 4Y8FA 5KITA 5B80A 1N7KA 3IGXA 1E6XM 3WFAA 1XYZA 4XZHA 2J4GA 1Z7AA 2W4XA 3QY7A 3WLKX 4ACYA 4M5PA 3LHWA 1X98A 3LB0A 4H9MA 7REQB 1FA2A 1BKHA 4GABA 1UD6A 4FNTA 4GUGA 3ZVHA 3CM4A 4WOZA 2HK1A 1ZJHA 4M8UA 2VR4A 3F4NA 7A3HA 3ITXA 4PUMA 4UFMA 4OUEA 4JIQA 2MANA 1UR9A 2Y0FA 1JZ7A 5AVHA 1W17A 3M46A 5FSDC 2YJQA 4NP7A 2VDHA 4GFSA 2ZRUA 1HVXA 2NQLA 3XIMA 2XFWA 3ISIX 3QRHA 2CYGA 3RK8A 3FA5A 4AD4A 3NURA 3P8JA 3POHA 4AEEA 1XKJA 2WM1A 4CCEA 4O8RA 2WC7A 3TR2A 2WPBA 4N6EA 2BNJA 3LZ3A 3N3TA 2FTYA 1JD9A 1GW9A 4O1AA 1GOKA 1W8SA 2D3NA 4AB4A 1TV4A 2ZADA 1C8YA 2FZ8A 4XV0A 2C15A 3EXRA 3OLDA 1UIPA 3R8RA 1ODUA 1EH9A 3NPXA 4DBWA 3NZ1A 3KWSA 2D22A 3DC8A 3D3FA 3QKEA 1M7XA 2EO7A 4GI9A 1A5UA 4FXSA 1I2PA 2NUXA 2BGNE 5D9OA 4RXGA 1WBHA 3QQWA 3T8QA 1WDDA 1NFPA 1GEHA 4IJBA 2OU4A 5KEZA 1ME7A 3VKAA 3LNPA 4XAZA 1FOBA 4S2CA 5EBAA 5CBBA 4O28A 2GUYA 5H8PA 2ASHA 1FUYA 2DVTA 4LYPA 1GPFA 2G4FA 4L9YA 3EPNA 1B3VA 4F2UA 1V3JA 2VEIA 3N73A 1VAHA 3RGTA 4C6NA 1WDWA 3HGJA 3POCA 3RX4A 4ECLA 3TWAA 1QO2A 2XIQA 3AIWA 4R9XA 4MMWA 3KBMA 2I5IA 3WK3A 1XIIA 1TR1A 3QQ0A 1KXQA 4CCDA 1W1ZA 4W5UA 4GVFA 3LNMA 1YDOA 4GLEA 3UWVA 5B7ZA 1WCGA 3UW6A 1JZ8A 3V0SA 3ANVA 1U30A 4S39A 1PHWA 2VMFA 4IPJA 1SUXA 1PHQA 5BW6A 1GEQA 1H11A 4AIEA 2OWXA 2P76A 3CHFA 1FWCC 4QAWA 2BVDA 3TEVA 2GQ3A 4NQ1A 5D2XA 4BHYA 3LTSA 1MMFA 1KM4A 3DCPA 4L6OA 2YCJA 1ZBCA 2PCEA 4AWSA 2WSYA 4XBJA 5HQLA 5F1UA 4P5UA 4Q4MA 2QCNA 1LM1A 1PX3A 1VC4A 4KFNA 4S3DA 3GVRA 3S2MA 4RCXA 5FIPA 1PIGA 4UB9A 2PWDA 5K9DA 1VYSX 5CPSA 1G01A 5C55A 5I79A 5LA0A 1UMLA 5FEPA 2WZHA 4KFOA 4N9BA 3DYMA 1E73M 2PDKA 3IJ8A 4TX8A 1TSIA 3CIWA 3HURA 3REQB 4FIQA 3EOSA 4FNRA 1K77A 3R13A 2A7PA 4AWUA 1Q13A 1EA9C 4C6LA 4AY7A 2XHYA 2V3DA 4EVZA 4ZTXA 2DUZA 5FJOA 4QJ4B 3FYYA 1EYEA 5I07A 3NZRA 2BY2A 4RDWA 3N18A 4YL2A 2XGIA 3UJ2A 4IM4A 3LYEA 1KFCA 2UY3A 2DZTA 2YIHA 2OLHA 4TMCA 1SZEA 4LVGA 1ISVA 3HA1A 4UTTC 4ZOEA 3V4BA 4C6FA 2WBKA 3MY9A 1WOAA 3USBA 3NDYA 5A6MA 3N29A 2ZTKA 3MU7A 3N4FA 2F61A 2BLEA 1A5NC 1K02A 4Q3MA 1NFBA 4O11A 1M01A 5HQEA 2DZXA 2RHGA 3FK4A 3N17A 1JAKA 2VGBA 4ASTA 5BRPA 3LOTA 4M1BA 1UUOA 4NRSA 1RD5A 4MNLA 2BVTA 3FYPA 4PRTA 2XJ7A 2DSWA 2QCFA 1TWZA 3IACA 2Q71A 1P0KA 3HO8A 1VBJA 2OZ0A 4ZODA 3BAJA 2PWVA 1OSEA 1QK2A 3GD6A 4NILA 5K9XA 3S6OA 1SO3A 2V5JA 2QIWA 2OSWA 4C60A 4QP0A 2CC0A 4MOZA 3KVJA 3RM4A 3PZMA 5CC5A 1H09A 2Q8XA 1KLYA 5D30A 4M0XA 4DAFA 2F6XA 3WDIA 1J6PA 1KGUA 3WK1A 5LNRA 3D47A 3F5LA 1VB9A 5C7VA 4OIFA 2SFPA 2YCEA 2GUUA 4EANA 1QOPA 4HSHA 2V3GA 4AG0A 2OQYA 3VZYA 2NVDA 4XBKA 3N04A 5D38A 4JIEA 3ME3A 5HR7A 2HEJA 5JIPA 3ZSSA 1UD8A 1MDRA 4AW7A 4PUDA 5F2GA 2FVKA 3CAWA 4RW5A 5TF0A 2WNNA 4HSNA 5FA5A 3KFTA 5TNVA 3FFSA 2FJKA 3EX4A 4G7FA 3SR7A 4IL2A 4TXEA 3GNDA 1V3LA 3PVFA 3NYZA 3XISA 6XIMA 3ZJ7A 1JZ6A 4BI5A 3HBLA 4LQ1A 4BI6A 1JYWA 1V93A 3TFXA 4F8XA 4J2MA 4GUIA 4CD4A 4B2DA 4Q6JA 2W62A 3FKKA 1H51A 1EHAA 3APTA 5TAOA 4HNVA 2V81A 1BYAA 3W76A 1RY8A 2X8RA 4E4UA 2XSBA 2HISA 2PRLA 1YIXA 3TYAA 2NVAA 5BXPA 3CUZA 1FY6A 3W87A 3LCIA 3VOFA 3Q2DA 4Z1CA 4BQ2A 2AAAA 3P93A 4H19A 1HX0A 1PSCA 3G3MA 3WENA 2A7NA 3HMJG 3HFYA 4AYGA 1LG2A 3F2DA 4YCPA 3PR2A 4KBXA 4JTGA 1OGBA 5CZ0A 4NJKA 3WEZA 3A4JA 4QFUA 3SW6A 5BMWA 4QJ3B 1GQIA 1I9CB 3ARVA 1XFCA 3QTPA 2ZCGA 3TU9A 1ZY9A 4UMAA 4HA1A 1X1OA 2QV4A 2EPOA 3H12A 1W9PA 1JUBA 3U4FA 1HKIA 1NJJA 4A29A 3MHUA 1KXHA 2WMHA 3WNKA 1JL8A 4PTMA 2ISDA 4FR1A 3H22A 8XIAA 2DSZA 3VD5A 2RDUA 4XBSA 2Y2WA 2C13A 5RUBA 4IQDA 1CGWA 6ENLA 1UZDA 4P8XA 3DFYA 1TWWA 9XIMA 3GWQA 3VIPA 4UTUA 4LUTA 3TR9A 1BF2A 4FALA 3BMWA 3IARA 3BH4A 4Y96A 4C1KA 1C8XA 3BZJA 4B5UA 4L9ZA 4ZSTA 5CC7A 4PSRA 1TPDA 1XQKA 3EMCA 2HROA 4PMRA 4B9ZA 1FVPA 3DECA 4LY8A 3MWAA 2P0IA 2IQTA 1DJHA 2J62A 3Q37A 3P84A 3VTRA 1SO4A 4NAFA 5AHFA 2X0YA 4B4FA 3GUGA 2VFEA 1EJRC 3QC3A 1J11A 4TTUA 2JGQA 2TSYA 4GINA 3SCTA 2VD8A 2YBUA 1YLVA 3ARZA 1TQJA 1V8EA 2BWGA 2IMRA 5I78A 3DIPA 2DZAA 2WZIA 4RLIA 1F3XA 2QKFA 2WCGA 4R7JA 1XCWA 4W88A 1OCNA 1UH3A 2FGBA 4HPJA 3GB6A 3W1RA 1DJIA 4GNKB 1WE5A 3URNA 4ZO8A 1L0PA 2J88A 3VIJA 3L2LA 4XAYA 3UFYA 3LLFA 2VWTA 3QH2A 2EPHA 3A22A 1WB0A 3GLCA 4E0CA 1JNEA 4CNPA 4FEZA 3VM7A 3OA3A 1Y65A 1B31A 1R3QA 3PTKA 4F0HA 1XPYA 2A3AA 3KL3A 3PJWA 1H61A 4LRSA 1JDAA 1IE7C 2HQAA 5GPRA 2NV2A 2E09A 2VEGA 4D8ZA 4R53A 4HCLA 1KM3A 4KF1A 4LYRA 3H2FA 1R9ZA 4RDZA 1XYFA 4PUEA 1DJNA 3CH9A 3C2RA 4Q7IA 3BPWA 1I2QA 3SRDA 3PZOA 3UXDA 2BP1A 3GYCA 4B3LA 4CQAA 1PWMA 1UWSA 2REQB 3WD3A 3ZR4A 4YCOA 4H9XA 1AQ0A 1C8VA 4KMQA 1UD2A 1GOWA 5F4XA 3TJLA 3KRZA 1H0IA 3CWOX 1H3GA 4LCSA 4IMFA 2FQIA 2E1WA 2CHRA 2RKXA 1ONEA 1XRTA 1UKTA 2WXDM 3MBDA 4QLLA 3KW3A 3EPMA 3MV11 3F7JA 1JCNA 2NW0A 3GXDA 3G1FA 1T96A 3VIFA 3HV9A 1NP2A 4DYEA 1TCMA 3M5ZA 2DPEA 2CLFA 2W0UA 3PZQA 4GX9A 2B31A 4GC3A 1O60A 4DXKA 1L2UA 5CXPA 3WFZA 1KC7A 4IOTA 3MMWA 3RDKA 4IX0A 3W1UA 4ZO7A 5M03A 1B1YA 4GYFA 4LGXA 5XIMA 1I0BA 1PDZA 1I4NA 3A21A 4BQ5A 2BGQA 3LHVA 4GQQA 4JXCA 3NQFA 1POJA 2WCAA 4YTUA 3LMZA 1ZPTA 2ACRA 1XLMA 1TZ7A 2GSJA 4RV3A 1H50A 3T09A 3D5HA 1GYNA 5F1VA 3BGJA 4Q4QA 3W82A 2P3ZA 4IQEA 2OZ3A 3EOUA 2PTWA 2PDYA 5KZMA 2V8ZA 4WR3A 1LRQA 3RLGA 1VCGA 1EIXA 5BRBA 1NOUA 3CZJA 4BF9A 2JIEA 3SCOA 4L64A 3CV7A 4IJRA 3ATZA 3QJAA 1ZRQA 3QXBA 3B9DA 1JZ2A 3ES7A 2WQDA 3D46A 1BXNA 5FJIA 5G2WA 4GJIA 3HPFA 4ICMA 4Q4RA 4B5XA 1WDPA 3LM7A 2Y24A 4GE8A 3C56A 4LUSB 1DE5A 1WNOA 3BV4A 2PTZA 3XINA 1TB3A 3JS3A 4OV4A 4JTHA 4HOXA 2Z1BA 1BG9A 3A3XA 3NVDA 4U2ZA 3CTTA 2FTWA 4H01A 4LF2A 4HTBA 1XBZA 1DQWA 1W9BM 2F8QA 4P7LA 3BGGA 4KCVA 3Q94A 3MS8A 3NGFA 1US3A 4OBSA 3AZRA 4K38A 1J0ZA 1UJPA 1GG1A 3LCXA 4X9YA 3IK4A 3QV7A 4Z1YA 3OVPA 4UTJA 1P6WA 2WJZA 4DJED 3TQ0A 3ITTA 1Q6RA 3AU6A 2BSLA 5T91A 1QNOA 2FHBA 3Q45A 3UR5A 4LH8A 3SUWA 3QV6A 4MWAC 3SN0A 4BY3A 1Y8BA 2D1ZA 1H2JA 4JEJA 2ZX9A 3NGJA 2O9TA 4WVXA 1L2QA 1PIFA 1O4UA 1Z48A 3ZT7A 2XIIA 2HBVA 2C7FA 3VNMA 1A5OC 4DVOA 2VP8A 2W3ZA 2ALDA 2Q09A 1D3HA 3T6CA 2WJFA 1PZ1A 1BAGA 4KRUA 4Q32A 2VTFA 2J8TA 4IGSA 1K9FA 2R1LA 3TN4A 1ZJBA 3KCOA 3AROA 1LZOA 2X7VA 2NQHA 3DU0A 3OHMB 3S5ZA 4S3JA 4JTUA 1TMQA 1O1ZA 2ZXBA 3PANA 1PTGA 3UA4A 2GK1A 5A2AA 3W7EA 2DSUA 2HPIA 4FOUA 2YL6A 3BICA 2HV5A 2CBIA 1IWPA 4XKYA 3UPMA 4B3KA 2AL2A 4IMAA 4DJDC 4U3AA 3VD4A 2WJEA 4QQUA 1MO0A 4G6CA 3T0BA 3WDQA 4AX7A 3K2GA 1C7TA 3TH6A 5EMLA 3BJSA 2C0HA 3PTQA 1UD3A 4Q8MA 3ERPA 3MVTA 4FZIA 3VOGA 3U2EA 3CV1A 3MSGA 2FB2A 2YCLB 3WUEA 3NWRA 1S2UA 2Z1KA 2VRJA 4LXFA 1K6AA 1Q85A 3NPVA 2HNHA 1RSCA 1NWUA 3CYJA 4E38A 4NASA 3R7MA 3NTYA 5A8GA 4M81A 1HJWA 3L67A 3FEQA 3IGSA 3F2BA 4YMZA 3HG3A 3EB4A 1FCQA 1NWSA 1PTAA 4MGGA 4JQ1A 3NNTA 4X0VA 4TV5A 4GQ0A 2CLEA 4EPDC 3C2VA 4OJYA 4MADA 3CMGA 4KETA 3UU0A 2VEMA 3KRSA 3VX1A 4RZ4A 1O5XA 1VJZA 3WQEA 2VT0A 3I68A 3W7PA 1P43A 2AOSA 4XX6A 4RUBA 3TLLA 3BMXA 2XFRA 2Q8LA 4LU0A 2VR5A 3N25A 3H53A 2V82A 1HP5A 4EACA 4JHOA 2E8ZA 4NG3A 2ZRVA 2QV5A 5C6MA 3N2BA 3VNJA 3USZA 3L0NA 2D0FA 6PTDA 3ORWA 4NZJA 2X05A 1Z89A 4JICA 4W7VA 2OYMA 5HATA 2UY2A 1NELA 1XG4A 2AQVA 3PFRA 2ZVIA 3W88A 3RX2A 2PP1A 2ZX8A 3NZGA 1W2PA 1UWUA 3RAOA 2FZNA 3MP3A 3EZ4A 3UCCA 2PB1A 4OZOA 5C9ZA 2IQ0A 4XAPA 5BWAA 4C91A 3EX6A 5A8NA 1XLGA 1I2OA 3L4YA 4J40A 2DW7A 1EPVA 2FGLA 2XGZA 4O50A 2CIPA 1IT0A 3BW3A 3OZYA 1U83A 2G3NA 3QLDA 4GY1A 4OFCA 4IFOA 4MWAB 1O5QA 5HJXA 2ONEA 2X1RA 2CZFA 3O0FA 1HKMA 1OFPA 4PBEA 1WXJA 2D3LA 2GUBA 3CHDA 2WHKA 3MVIA 1Z32X 3B8SA 4M19A 3PZ9A 1UWTA 3LZ5A 3DAQA 3W0KA 3U9IA 1UD5A 4CLMA 4MUZA 3BDKA 3CC1A 4DUWA 1K8ZA 4GG9A 2YYTA 5BOOA 2WM0A 2CLMA 1W8GA 1LWHA 1JFXA 3HM7A 3QHMA 1ZP4A 4FPSA 3GHSA 4U2YA 3W28A 2VXNA 5A5WA 1B3OA 2X1SA 3A24A 1T8XA 1MNZA 1QCWA 3O2LA 4KH2A 1PKMA 4UNKA 1YNQA 3RMEA 3DFOA 1T41A 3KOXA 4KIEA 1MZRA 3CEUA 4WY0F 2QJHA 1XYCA 2D24A 2ZBTA 3A23A 1CGVA 3KWXA 2A3EA 3P74A 2WYSA 4QJ5B 4V28A 2NXGA 2Y7EA 4HN4A 2GJLA 4RE4A 3S5NA 1E9LA 1LRNA 1QR7A 5T9BG 2UBPC 1DJGA 1SJBA 2QAPA 4H41A 1ZU8A 4F0KA 2YCKX 2C6QA 1U22A 3W7OA 5D2VA 1MZHA 4X3ZA 4IIGA 1W9VA 4HCDA 4OOZA 3NA8A 1AJZA 4M6VA 1F76A 4JN8A 1E1CA 1VZWA 3UY7A 1KWKA 4JTFA 3GSMA 1QATA 4GY0A 5I00A 5F2LA 3FOKA 1MWOA 4OWGA 2YGYA 3LSBA 3R25A 1ZALA 3HPZA 1LWIA 1KLZA 1HTIA 1FWDC 1M5WA 1Q7ZA 3R8GA 3OLGA 3CWHA 3LDVA 3AIBA 3B0XA 4YU1A 4TVUA 3LU2A 1DIEA 5E09A 2Y7DA 1M9HA 4G2DA 3TOYA 4JCLA 7CGTA 4O17A 4HMCA 2J9YA 1AFSA 2Y62A 3ANUA 4A8NA 4CD5A 1CXKA 2HWGA 4O57A 5G5IA 2ICSA 3FSUA 1SMAA 3NL6A 3N4AA 2Y70A 3VC5A 3LM3A 2NXHA 1AVAA 2J66A 1EP3A 1L8PA 4UTKA 3CQHA 1ME9A 4K36A 3B8VA 2W79A 5D9PA 1VBRA 4DEFA 1PS9A 3H2OA 5J5RA 2Y7GA 4XTIA 1S39A 3J7HA 1YTEA 1JAEA 5BXSA 2HVNA 3DFHA 3GNPA 1KFLA 2Z2BA 4ZEPA 3PZTA 4TX9A 2W66A 2D0GA 4MWAD 4DO6A 1RR2A 3VIIA 3OVQA 4NI8A 5DBUA 1CXFA 3W75A 3SFWA 3M4HA 5G4HC 1W5NA 2YZ5A 1D7FA 4J35A 5JU6A 2YDRA 4Q22A 4Z2LA 4H8UA 2YXXA 3VD7A 5DQPA 1VF8A 4GXPA 4DF1A 1O94A 3L0GA 4BWLC 1HQTA 2HZGA 4AZCB 4NJJA 1V3MA 4LCQA 1UG6A 2OFJA 4ZBCA 2VC7A 3T0CA 4E5TA 4DLMA 3AFBA 3VOJA 4GQBA 4MB4A 1QO5A 3KVMA 1LDCA 3K46A 2JKAA 3ZIZA 4OV9A 3BO9A 4DXVA 1TCDA 3TZNA 2E5CA 4YXGA 2ZX6A 2P50A 3UGVA 1WKDA 3UVIA 4O19A 1EGZA 1AH3A 1F61A 1P1MA 4Q7NA 1OC5A 1JEZA 3NG3A 4LOCA 1KGWA 2ZYFA 3W29A 4PTWA 4KCUA 5E6YA 4ZQNA 1E9ZB 4MF4A 1IZCA 4PBGA 2GWGA 1QBBA 4B5VA 5DELA 3QHOA 1U5VA 4J2PA 4PMVA 1FDZA 3GDBA 3VOHA 2ZUTA 4MG4A 3FEMA 3IJQA 4PTDA 1NOWA 4PMYA 3QMSA 3KDNA 1M03A 1TZ9A 3QV8A 1JPKA 1MQRA 2A3HA 1XRSA 3O16A 4MKNA 1R9YA 1Q6CA 1QTWA 3ITGA 4MJZA 2CCRA 1KQZA 4JFWA 4GIRA 1OC7A 3ZMRA 3A64A 3UWYA 1Y7VA 1G5AA 1TQXA 2DQXA 3IAPA 4JTRA 1W3JA 3ICJA 5D05A 4CNOA 1CCWB 3QGVA 1BQGA 3V0UA 3LGEA 3VGHA 3GUWA 3M0JA 1TPH1 4JTEA 1QI2A 3E6EA 1N55A 5DO8A 1EC8A 2GGHA 3G1YA 5DCBA 4IPIA 3QLLA 1K4HA 3NJ3A 4H7CA 3L7RA 3TAKA 1V51A 1JR1A 3W6LA 4GBUA 3HJZA 3W26A 4F66A 2E6DA 3B04A 2FMOA 5LIYX 1A0CA 4QNWA 3Q58A 4O4VA 1IT8A 4GYJA 4L61A 2WJDA 4JTCA 4XD3A 1A3WA 3KS5A 4AHQA 1MUWA 3PTMA 3BSGA 1XC4A 1OG0A 2EG6A 3T81A 1BVZA 2PGEA 1XP3A 3EWXA 3G8EA 4GI8A 1OJXA 3BTNA 5EL1A 1K70A 2FZMA 3SUUA 9CGTA 2CEQA 1LOSA 2BXYA 3UWQA 4JZ5A 3T08A 3VDCA 1R47A 2XIJA 3R4IA 5FKYA 4U5KA 1BQCA 4XKMA 3S1VA 1X8FA 4RK8A 4JL2A 3II1A 5IHSA 1ECEA 1WPCA 1K8XA 5IM51 3AI0A 2GOKA 2GJNA 3HIJA 1KTNA 3OIXA 1DJXA 3C0QA 1XHGA 1WOBA 4B91A 1D2KA 5FF0A 1EZ2A 3KOFA 3G1XA 3OU8A 1Z42A 3N34A 1OQFA 3W1PA 1V5XA 1CT5A 3TYDA 3HOJA 5GJPA 3W74A 3GTIA 4K39A 1HL9A 5MKGA 3AYTA 1REQA 3GTNA 2CBVA 3BLFA 1O12A 4JKMA 1HG3A 1HIZA 1WAWA 3T42A 4PULA 4LTSA 4AVFA 4ZFCA 3AYRA 3F4DA 5HDRA 5HNRA 4GJ1A 1KV5A 3P0XA 2J9XA 3TW7A 4JIRA 1TA3B 3N1AA 1R6WA 2V6AA 3PF3A 3QQ1A 4QDMA 3ANYA 3DFSA 4BZYA 3A3WA 3VX0A 3GW0A 1OWQA 3GHUA 3SY8A 1AL7A 3STEA 4YIWA 2UZ9A 3N2TA 2VZSA 4GX8A 4FLSA 3B06A 4R34A 3YPIA 1VJSA 1ITUA 3I3EA 3OYZA 3WNOA 1ADDA 2IKIA 1ITCA 1V0KA 2PUZA 5ABEA 3S5OA 1FWAC 1XUUA 2GOUA 1Q66A 5HINA 3EWUA 4PODA 4G5DA 3HG5A 1ITXA 5A6JA 1V08A 1PKNA 3W73A 1J0IA 3ITVA 4KKXA 4Z1AA 1AK5A 4Y9PA 5GNZA 6REQA 2Y7FA 3TCEA 1DBTA 3TTQA 3PBGA 4B92A 4JN7A 5AYXA 3O6AA 4AQLA 2BX7A 2G4JA 3WLMA 3TA9A 5I02A 4Z2JA 3NPWA 5ABTA 3W38A 1GVOA 2H9AA 1TPWA 1TPC1 1DJYA 5JH2A 4G1KA 1BVNP 4K8HA 3IWPA 3GAYA 2PTXA 3WLNA 2GQ9A 2PDBA 3VNKA 3M0MA 4Q8WA 4QNEA 1RBOB 1EXPA 3MUXA 4WUIA 4KIRA 4MB1A 4LNYA 1LQ2A 1BEUA 1JRCA 3IVSA 1OD0A 5FACA 2FHCA 1YEYA 1G6CA 4J3UA 4ZO9A 5CQ1A 1A4LA 1JCXA 1V7YA 1XDLA 1YTKA 1CNVA 5FJRA 3ITYA 5GNYA 5E5CA 4CD8A 4CNSA 3REQA 2ZUMA 3C2FA 1FH8A 3BWWA 4MJ4A 1CGXA 1KFKA 1U1HA 3VI2A 4MDOA 2CHNA 4FXFA 1X6LA 5LIKX 1XGEA 1Z6KA 2H6RA 3HMCA 3PPFA 1QI4A 4NZ3A 3IUHA 4FF5A 1KFJA 2G96A 1QNPA 3TYBA 4F79A 3TC6A 5HUPA 4CN1A 1LL7A 1WA3A 3PUOA 1NVMA 2VUYA 1K9EA 4O15A 2TAAA 3WNMA 4S3BA 4C6MA 2DUAA 3W6YA 2OEJA 2VELA 1SR0A 3AAMA 4GD0A 1QNSA 4K2SA 4KCWA 2WMKA 2ZUVA 1QPKA 4IMDA 4CD7A 4REQB 1UJQA 3WIJA 3VMOA 1TVLA 3DG6A 3UNDA 1ZCOA 4PC8A 4LUTB 1YX1A 1TIMA 2VEPA 3THDA 4ONVA 2ISVA 1KBBA 4JN6A 4QTGA 5ABHA 4RW3A 3RR1A 2PD9A 2H8XA 1CYGA 2OTDA 3LK6A 1UPPA 2FPTA 3WLQA 1RJPA 2YBTA 2PMQA 1ZCCA 1VIZA 4HCHA 1FX6A 4HHMA 3VC6A 4LUYA 2UWFA 3EMZA 3GK0A 4NAFB 1ZGDA 2VFHA 2AL1A 3FA3A 3B8DA 1W1IE 4I9AA 1PEZA 2Z24A 3WD4A 1RHCA 2PWFA 1R46A 4TMBA 3D3AA 2NV1A 1XBVA 4XIMA 3NQAA 2CLLA 2O9RA 4GH3A 2EQDA 2JFEX 2QPSA 1JDCA 2J8FA 5KMYA 3VMPA 3WMSA 4YLWA 1PJ9A 1WKEA 3IIOA 3GE7A 2WVVA 1JRBA 5FF4A 4CQDA 4EK7A 4JNZA 3B4UA 1V0MA 3BG3A 1N8FA 2QAFA 2YW4A 3ARYA 3EX1A 3U4AA 3W7CA 3W24A 3FVMA 2JALA 1DJQA 1AH4A 5I3FA 2CWNA 4UCGA 3NVTA 1ESWA 3BSMA 2QGHA 1G94A 1TPUA 2NUYA 3C86A 3ZR5A 1IEVA 4ZQRA 6TAAA 3GVGA 3MUCA 5A2BA 4R7OA 3BOXA 1OC6A 4LVFA 1XH1A 3P60A 1B0IA 4N6FA 1GOMA 3PUGA 3ZR6A 2W63A 1XPGA 2E6FA 4O18A 1X38A 1TTIA 4D8AA 3M07A 1ICPA 3B3DA 2WWDA 4H7VA 3GC2A 4PL2A 1KFWA 2GGIA 3QTGA 4AWTA 2RDWA 4LB3A 4OGZA 4KEUA 1XFBA 3GNNA 2NT1A 3LPGA 1EC7A 3AS2A 1KRBC 4HHHA 1E4NA 2V3EA 5BOFA 3RN6A 2WOQA 7ENLA 6ALDA 1RZMA 4JFUA 2A6LA 4PRRA 2B7QA 4KEVA 3SIZA 1AW5A 3UYCA 1TJ2A 2E3ZA 3N11A 1HUVA 4LAMA 4JY9A 2C1GA 1LBFA 4HQVA 3A3HA 3U6WA 2D2JA 1D3GA 4JGDA 3SSJA 1ZS2A 1M6JA 2IPFA 2H8ZA 1XLDA 4WIWA 4KWVA 3FA4A 2FPVA 3E96A 3C2EA 3H54A 1SW3A 3HGSA 3UZWA 5EMKA 1AD4A 2JBMA 4GVIA 1TV5A 4DI9A 1NF0A 5IXEA 3SQSA 4QLJA 2E67A 1H7XA 1S5VA 4M29A 4LRTA 2WVUA 4IPLA 3AZSA 2VURA 1LL6A 1R2RA 1TPFA 1A0DA 1X97A 4H3DA 1FWFC 5I5RA 3PZNA 1CECA 4ADTA 4OBRA 4QSHA 1K03A 1W3KA 4AZIA 3NM3A 2X1TA 2W67A 1B4EA 1WX0A 3B8UA 5EMJA 1VENA 5A69A 5AC4A 4H1ZA 1AA1B 1OIMA 1PKLA 5T8GA 1XLKA 2V5KA 4JTSA 5HBFA 2VX7A 3WMLA 4LW7A 2CKRA 1MYRA 2NX1A 3NOEA 5U4NA 3MI2A 1DIOA 4XB3A 4Q6XA 2NSOA 1ADOA 2YKKA 4EX4A 3E0VA 2XTKA 1TPEA 2QCLA 1UKQA 1MFUA 2E6YA 3PAJA 4L65A 2VDGA 3C6CA 3FY1A 4KWOA 2RGLA 4WHBA 2NZLA 2EG7A 2IKJA 4GPNA 3AXMA 5CGMA 5D09A 4X63A 1QPRA 3QEZA 3TONA 3KAOA 4U3CA 1VPYA 2PWHA 4L56A 3OBAA 1MUCA 1C92A 3NQEA 2QR6A 3ARSA 2EGZA 1Y0EA 5BOEA 2RGMA 3R2GA 1Q6GA 3LMYA 3CL6A 2QIIA 3AZTA 2Y8VA 5CPNA 1DQXA 4TUFA 3WK2A 3GHTA 2QDEA 2Y63A 3G0UA 3M43A 2CLHA 1XLEA 3AIQA 3JR2A 1R5YA 1TYGA 4P8VA 1LUCA 3R1ZA 2YA0A 1HXJA 5HMSA 2VGGA 1UB3A 4GUJA 5E9AA 1DTNA 4FX8A 3VXGA 3SZ8A 3I6RA 1W3NA 4PRWA 2RDXA 1OYCA 3WNNA 1T99A 1RVGA 3S1XA 3LENA 4IMEA 5D04C 3ES8A 1DL3A 4AMAA 5FJUA 1PZ3A 5DXXA 1BHGA 2HVOA 3I7QA 3KEHA 1B54A 4A4AA 2YX0A 4J3VA 4R5EA 3WFLA 3EWCA 4QITA 3LXCA 3F4WA 3QR1A 1W5MA 2ACSA 1IZKA 2XH4A 4OOUA 5CBJA 2Z6IA 4F48A 5CSRA 3C4UA 1RP9A 5CPLA 3HJEA 4HZ6A 3BVJA 3DFTA 2WC4A 3A47A 4D1JA 4L1GA 5FEXA 4BQ4A 5IBXC 5ABGA 2XSXA 4J3TA 4HZMA 2VFDA 2ZRWA 4W7UA 1R3SA 1JJKA 3W71A 4LANA 3SGUA 5A8QA 5DBTA 2WNWA 3O15A 4OTKA 2NQJA 4N4QA 3WJSA 2GK1B 2WHLA 1IF2A 1PPIA 1ELSA 2EG8A 3E0FA 1MSSA 5CZJA 4LC6A 3JZUA 3ZJ8A 2YL9A 3V5OA 4D9PA 4AD5A 1V6WA 1V4YA 3DZ1A 2VNCA 1EJWC 3H4XA 3AJ7A 3DYPA 2Z2AA 4C1LA 3RFAA 1KA9F 1KRCC 1ZBVA 4ES4A 4NZ5A 1AUSL 3ABRA 4CN6A 2BY0A 3MZNA 3WNPA 1FFQA 2HSAA 3ZQ9A 1VRXA 1VPXA 1XINA 4H9UA 1XIBA 2IXUA 4YS1A 5MF5A 4NVTA 2F7FA 3UWEA 3UJEA 3MUY1 3R58A 3GBEA 1UHVA 3DI0A 2QCEA 4FIRA 3AU2A 1W56A 3LCLA 2EKCA 1N82A 3EBVA 2QJJA 3R89A 3OZMA 1UW9A 2VC9A 1TG7A 2J24A 4O14A 5J8LA 4W9TA 1IR2A 1UP2A 5EFDA 2YCIX 3LSCA 4QE4A 4A3YA 3FS2A 1YQ2A 1VGAA 5I24A 2ATSA 3KRUA 1ECQA 3FIGA 1MEHA 3HG4A 3W2JA 3RMJA 3P80A 3K4WA 2DT1A 1XSKA 1A5KC 5D37A 5EMMA 1U1JA 3N14A 4OU1A 2VO5A 4XZLX 2BXVA 1C29A 8CGTA 1XH2A 1KCLA 1ISWA 3KL0A 1YDYA 1E70M 3OPSA 2Y8KA 2Q02A 1T0OA 1GZ1A 4JEQA 5TBOA 3SUTA 4K1GA 3NQCA 4MWAE 4N02A 3OBKA 3W25A 1EO5A 4RDYA 5ABFA 3UJSA 3E0LA 3QHNA 2O9OA 2OQHA 4LEQA 3NQ2A 4M6UA 4GZ7A 1SU5A 4KQNA 1E9IA 1R87A 1XIHA 1WP6A 1N8IA 3OLEA 3KL5A 4I8DA 2C91A 4Y9OA 2WSPA 3ZWSA 4EIVA 2P3EA 4MNJA 4QG6A 4XZWA 5LNVA 8RUCA 3BAIA 3DN5A 3LG3A 3SBFA 4MVAA 5EY5A 5KSWA 2XH7A 3AXXA 3ENLA 1UKOA 2OKOA 1RLDA 1MXGA 4BJHA 4L4OA 5CC6A 3GR7A 5AN7A 1XBXA 3PG9A 3R5EA 3T2OA 1GK8A 2CW6A 2Y1HA 3WQGA 6TIMA 1JI1A 2C14A 4CNNA 4Y9MA 4JX4A 1SSDA 1WV2A 1JDDA 3V1HA 5C2CA 3HPAA 5HNUA 1S38A 5LXXA 2FPYA 4GGBA 4L4LA 5CC3A 3EWZA 4ZB0A 2P1FA 3U3HA 4S2BA 1KGXA 2FJUB 3FJLA 4H9VA 3A4WA 3GW3A 1HZYA 1PIIA 1UP3A 2VCAA 3MANA 3U57A 3DENA 2DIJA 1M7OA 3WF1A 2FYMA 2YCLA 1RK6A 3MUZ1 3GG8A 4DZ5A 3BXWA 1QWGA 1VR6A 1LG1A 1VFOA 1WQ5A 2VX4A 3GFZA 5M1TA 1CIUA 4S23A 2WVTA 3LRMA 2E9MA 3W1NA 1LLOA 3P62A 4IFRA 1VP5A 1OCBA 4WJEA 3TWBA 1TVPA 1Q3NA 2OJPA 1XG3A 1NTHA 3AMDA 1BRLA 3QYQA 4PUUA 1JCJA 1QFEA 3GG0A 3G1DA 4PTNA 3E0IA 3G24A 4HA0A 2DT3A 1VS1A 3G3DA 4XD6A 2YL8A 4D6FA 4XO7A 4MYXA 4DF0A 2WHMA 2FLIA 2VZUA 4TV6A 1DYSA 3NQBA 1UR8A 9XIAA 1UC5A 4W8BA 3IUDA 3NO5A 3WQ8A 1RBAA 3N6HA 3THAA 5DRIA 1VFUA 3A5FA 4GRSA 2YW3A 4WSJA 4GFIA 5CZKA 1KNWA 3DBNA 1R86A 1V3KA 2ZZ5A 3N4EA 4DUXA 3CZEA 3O6CA 3MKKA 3GNOA 1S5MA 3MP5A 3ZSTA 3GBDA 2A6NA 3TFCA 4ATLA 3L0KA 1FWNA 3PJTA 1RBLA 3BLPX 1BGGA 1OFRA 2P10A 1W1PA 3E0WA 2D73A 2OT1A 4KWUA 2V5LA 2PLMA 5FSEC 3WLLA 1SFLA 4QLKA 3TTYA 3CHVA 5JIWA 3L4VA 2Q8ZA 4UTMA 3NSXA 4O12A 1MI3A 1UR1A 4JAWA 5D33A 3M5XA 3VCNA 1E6ZA 4LFYA 3QR3A 4CKQA 3EX3A 3A9BA 1Q4WA 4GOAA 1LLZA 1R2SA 2XIOA 3O1NA 1JULA 1VEPA 5DCDA 5LNWA 3OA5A 3TN3A 3TQVA 1KXTA 2OCZA 1VH7A 3LHTA 4O0QA 4TQTA 4FO4A 4MWAA 3E49A 3QVQA 3ZJKA 2O7SA 1SFSA 3P61A 3NQ7A 4N4PA 4KGLA 1QNVA 1NQKA 1TR9A 3RX3A 1DV7A 3TAOA 3GZ3A 2ISFA 2HS6A 5DY2A 2BZNA 4JFVA 5HNNA 4AAJA 2IUZA 2EPKX 2ISSA 1Q6FA 4A22A 1DIDA 4Q7BA 4EPEC 4C65A 1EYWA 2VD9A 1XGDA 1TV7A 3H2EA 3S47A 3WDJA 4GNJA 1XD0A 1JVNA 2QJGA 3ELFA 4NX0A 3W84A 2J13A 3MI6A 5K4XA 4PEEA 4GO9A 1FHUA 3N2CA 4BF7A 4DZHA 1VLWA 2C8NA 2O92A 2PGWA 1J2WA 2I1OA 4WSKA 4Z08A 2F6KA 4DJDA 2ANUA 2BODX 2QUMA 5AC6A 1WDSA 2VFGA 3C2YA 5LZLA 5BCAA 4LT9A 4HU3A 5E70A 5M17A 1Y5VA 4ML4A 1PX8A 2INZA 1TJ0A 1TV8A 2QDGA 3VGBA 3QSRA 4C6JA 5A95A 5C9XA 2XYLA 4O1FA 3UXIA 4H2CA 4E3VA 2AKZA 3SN1A 1E40A 1T40A 3IJLA 3OO2A 3TTSA 1IQ8A 2JF6A 4S3KA 3DC0A 3WZ0E 5CAHA 4TO8A 5DMNA 2NV9A 2X40A 4X60A 3TMQA 2O0TA 4AXNA 1A47A 5DRCA 1J79A 3UY8A 2BHUA 4POCA 1NDYA 4LYQA 4DBEA 5C70A 3M44A 4Q8QA 3MMUA 5D2YA 1R3VA 3KS6A 5DF0A 2VL4A 2R94A 3URQA 1TVNA 2W92A 3G18A 2XGBA 4B5WA 4Z42C 3SQLA 4YTRA 2PSNA 4LBSA 3UA3A 1LBLA 1CGUA 1JUEA 4M6PA 2TRSA 1YRRA 3MHGA 3H2CA 4NY2A 2EAWA 3ABZA 3ZT5A 3NPUA 3VD3A 3UZYA 3LBCA 3DFPA 3O8AA 4KERA 3WCZA 2VENA 3H7VA 1C9DA 1XS2A 4O52A 2BOEX 2OKTA 4OQVA 2Y4SA 3S9YA 2QPXA 4NXSA 1FWJC 2TODA 3KOZA 4HOWA 4O0KA 2OT0A 3VU2A 1AJ0A 3EWYA 1AQHA 2P8CA 1E4LA 2WLYA 3EB3A 5BWFA 1EBGA 4DF2A 3E9AA 4IT1A 2BG5A 1C9WA 1T7LA 1HKKA 1ZJAA 1C91A 4WCJA 2DDXA 1A53A 1SM9A 3L66A 3VINA 2J7FA 5DT5A 5DX7A 4GUHA 1RQBA 4ZQOA 1RALA 2X2GA 3AIRA 3LX9A 3MPGA 3WH7A 3SRFA 5MKGB 4C5YA 2BOFX 4A6GA 4W86A 1REQB 3P2VA 4J3SA 2PPGA 4HZ7A 1BLIA 2VOTA 3OW1A 4MY1A 4F9JA 2CPUA 1OY0A 4W93A 3W81A 4GHRA 1E56A 2Y8UA 1K8YA 1GQLA 4MDPA 1VD6A 4AZCA 2IPWA 1I1XA 1W3HA 3G77A 3TNOA 4QXIA 1NWTA 1TUFA 5I2UA 1OCJA 3PC0A 2J8GA 1PZ0A 1LCOA 2G3IA 2PC8A 2PU1A 2HXUA 3ARRA 1HJQA 1AMKA 2W27A 3CH0A 1TTQA 2QEZA 4PMNA 4GIAA 3WBAA 1W5OA 4J3XA 4MIMA 2ZZ3A 4LUIA 5IHRA 4OECA 3WL0A 1OX4B 4QDWA 1GHRA 4HTYA 4V27A 1LL4A 1UOKA 3SDOA 1V7AA 3T07A 1GKRA 2C1HA 1PDYA 4QEHA 1GONA 1VCVA 4LNCA 4WXYA 2DJLA 4G9PA 4HB7A 3LPFA 3N6JA 2W91A 1VIWA 4QG9A 1NSJA 1J0YA 4Q4OA 1O5RA 4JTDA 4KESA 1JZ4A 4LALA 4CU7A 2QZRA 3NIYA 6REQB 1PYMA 4C7DA 3COTA 2PLKA 4PSPA 4IPNB 4P7RA 4B90A 1SZFA 3PZIA 1S46A 5G1TA 4EE9A 1QHOA 1IIHA 2D0HA 3VMNA 3H21A 4DZIA 1EJVC 3UZJA 5HPOA 2H9AB 4UQAA 3WH5A 3R0DA 1J6OA 1OZQA 3RCYA 3LCHA 1KV8A 4O13A 1JQVA 1OBAA 2QCHA 2KZHA 3GXMA 2PS2A 2X0SA 2GGJA 2O4MA 4PFHA 3K8LA 4Z17A 2J7EA 4FXRA 5I06A 1G0CA 4NZ4A 2QGYA 4ADUA 4FX6M 3CMJA 2VC5A 2G95A 3TROA 3CMFA 4MPQA 2OZ8A 3OTRA 4G56A 3OP2A 4YVPA 3H4WA 4GIYA 2J25A 2WK2A 1JPHA 2ISWA 4RNHA 4ERIA 5K3VA 2ZDRA 1AQMA 3VGEA 4CCCA 4HU4A 3DI1A 1UBSA 4QROA 3P8IA 1ISYA 3VDHA 2YSWA 5E0FA 3EA3A 1EUNA 3GO2A 3EDEA 1OFAA 1NF7A 3CZGA 3W01A 2DFAA 1A3XA 1S2WA 4ZE5A 3B0VC 1VEMA 2NX3A 5CJNA 4HGXA 2HCVA 4Q4PA 1K3UA 4U28A 1WZLA 3VAVA 3BANA 2BVYA 1JI2A 2ZX5A 2ZICA 3A12A 1K7FA 2Z25A 1M41A 2HNEA 5CG7A 2DUXA 5CGTA 3RU8X 3TW9A 4O0ZA 4CVUA 3KCJA 5H2ZA 3HQOA 2QXWA 4PYSA 3LERA 4DYKA 2YB1A 1NM9A 1EWEA 1UUQA 3CO4A 3SRKA 1QW9A 3H2NA 3UESA 2E1DA 2XWDA 3DHDA 3KLLA 4UTWC 1JF5A 5HANA 1ONRA 2Y5JA 1E6PA 4B5TA 4RZ6A 4DPQA 2CU0A 4A3QA 4Y9AA 5BZAA 2PAJA 5I7GA 4HT3A 4WOQA 1HT6A 3WDHA 1XISA 4IICA 2E6AA 4ZB5A 3G0XA 1G4TA 1TA3A 3IJIA 2OGJA 1XIDA 3AHTA 4WEVX 4UMCA 3PUEA 5HMDA 4BWLA 3TX9A 1E6NA 4ZZ9A 3QW4B 3PZVA 4RDVA 4HSOA 2IPGA 4INFA 2KX9A 4OKDA 4J5NA 5F7UA 3MBFA 3M64A 1CZ1A 3FAWA 4DNMA 2XINA 3S9ZA 3CYVA 2GL5A 2ZA3A 1XBYA 2Z1VA 2ZWZA 1Q4NX 4DWSC 3NL2A 3F5KA 1PZ2A 4GIEA 4LUJA 1EEXA 2PDHA 4WK9A 4GWEA 4V1XA 3UD6A 1XLJA 2PRHA 2VEFA 1MUMA 4C6QA 3WJYA 2WVVB 1KM1A 1JDFA 3VIHA 4EPKA 1QW7A 3G1AA 3WQ4A 3AHZA 3W2KA 1JPMA 1LT8A 3DGRA 1JNDA 4W84A 2X7WA 2V0TA 3CZ8A 4DQWA 3UXKA 1NARA 1R85A 4I9TA 4J3WA 5HA7A 3STFA 4HA4A 4GVGA 3MQTA 2ZWYA 4HPHA 4QISA 3TYEA 1VCFA 3WO8A 2D20A 1XR2A 2FHFA 5HQMA 1L6SA 3ABOA 4WD0A 3PPCA 1KBIA 1OFBA 2PODA 2ZUSA 3PSVA 1QPOA 2PRMA 1EJXC 1CWYA 1FCBA 2YA1A 1WXYA 1OD8A 2I5GA 4BI7A 1S1RA 1G7UA 3RNDA 2CESA 3BCDA 1DTUA 1FWBC 1R3WA 1RJQA 2CWXA 2A4AA 1FBAA 1JFHA 5IFPA 1QPNA 1AQFA 4PFMA 2XFFA 3BW2A 5ENLA 3GXNA 3VGFA 2IKHA 1JF6A 1PAMA 3EPOA 4P61A 1GWJA 1P4CA 4LVBA 1B30A 4NAEB 4XIAA 3FHAA 2PCQA 3EKLA 4O53A 2B0MA 3URAA 3G5EA 1C93A 1TJPA 3S5YA 2V3FA 1UA3A 3HG2A 3G2GA 1UMYA 4MJMA 3R10A 1B90A 2CKSA 3QM3A 1KM6A 1F73A 1VBHA 2BVWA 3AUJA 3QF0A 3BMVA 3SY5A 4D6IA 2XWEA 4Z2GA 1GCYA 4IF2A 4GYPA 2WAGA 4NU7A 1UZ1A 3AMLA 3G1HA 3ARTA 4AYSA 3PN8A 1U1UA 3WQ5A 4REQA 3S42A 3IIXA 2ODOA 3BLDA 3KOYA 2UY4A 4HU8A 2R14A 4NL1A 4AEFA 1BF6A 3VO0A 3PBWA 1OFOA 3GIQA 4JS3A 1OIFA 4XG1A 2X1UA 2AQWA 3PBYA 3QSTA 3W07A 1A5MC 4H9TA 4N7QA 1H1NA 3OYXA 1JCTA 1QT1A 4AY8A 5AB3A 4OUIA 4PUNA 3SCSA 3W4RA 5A8OA 3SSZA 4AU0A 1J5SA 3I3DA 5DANA 1QNRA 1V6TA 5CLWA 5I09A 3IIVA 4K37A 1FWIC 2OQLA 2PDLA 3S3GA 1BYCA 3NM1A 4GBDA 1IZJA 2GJRA 3BL3A 1KFBA 2AGKA 1E15A 3BAXA 1B57A 4RV8A 3B03A 3MZ2A 1TZZA 5HJYA 1GTEA 1A4MA 2HMCA 2DIKA 3CASA 4FAMA 2DGAA 4L9XA 3GNXA 2QF7A 3B8WA 2BMBA 4DWSB 2WO5A 1Y5WA 4HMNA 1JYXA 3WK0A 3PB2A 3VUPA 1C3FA 2ZC1A 1A50A 3VKKA 2NLIA 2JEPA 1LUCB 3C3UA 3FV9A 1B3ZA 4S3CA 3W9ZA 3L4TA 5CEWA 4IMGA 1FKXA 1P48A 3R79A 1AW2A 1W6TA 5FD0A 3VGGA 2PWUA 4UFJA 2Z6JA 4ROQA 1SFTA 1XIFA 2WVSA 4HD5A 1X1ZA 4BCEA 2PWGA 2FDMA 1K9TA 2PURA 3HB9A 1EP2A 4QS5A 4PMDA 4Q8UA 2Z29A 4LB4A 4HNUA 3CUGA 3FLUA 1X1NA 3T78A 4JY8A 1VRDA 4I6KA 4A8LA 3UXLA 3L9CA 3OZOA 3ARUA 1WKFA 3THQA 3UJRA 5I3HA 1S5WA 2XU2A 1W9XA 4MNKA 1RLCL 2Y6ZA 3KBWA 1LT7A 1EIBA 4K7VA 1IXNA 3IV3A 7XIMA 4IISA 1H7RA 4JBRA 4DRSA 1GTHA 2PU0A 4DB7A 3EA1A 3BE7A 3D6NA 3BAYA 1GOQA 1E0WA 3CEPA 1I8JA 3VYLA 3VE9A 3AIVA 2FTPA 3KOWA 5CPMA 2PDWA 2VVNA 3EB2A 3DUGA 3VOCA 3CPGA 1W1TA 3WD2A 3O6YX 3CS2A 3R8HA 2E7FA 3CAKA 1BYBA 1VHCA 3BURA 1B4KA 1EGMA 3SGGA 1ALDA 4HOZA 4PEKA 4JTTA 1CXLA 1ZB5A 2YB4A 1W9UA 3CLMA 4FMVA 2QCCA 4Q8VA 4HK5A 3KE0A 1J12A 5AYYA 3SFKA 3ABXA 3V36A 2B7PA 3E2RA 4PN2A 2YLAA 4HZ8A 2PA6A 1E55A 4EWJA 1PX4A 3GVQA 4LBRA 4NJHA 5LNUA 5K9CA 1ICSA 1QXLA 3W7QA 4H9YA 2FFIA 3FGCB 1E71M 3GDMA 3IIZA 1TE6A 3CPUA 1YBQB 1JUKA 3CK5A 1QUMA 3QFEA 1UZ4A 5FAJA 5DMMA 3LXAA 4D72A 1WZKA 3GVWA 1ONXA 4GZJA 4IG2A 5DMLA 1C8QA 1XIMA 4MHBA 4PMXA 1E6RA 2OR2A 4FP1A 4ADSA 4DI8A 3N9KA 1OF6A 4W8AA 5BROA 2IS7A 5HMFA 3WBEA 1VJIA 3G1VA 2F38A 3FX4A 1M7JA 2QW5A 3LV6A 3GC5A 2PDIA 1TV3A 1GQKA 4M3PA 1YKWA 4ACZA 3WLHA 4YTSA 3CUJA 1HO4A 2BTMA 1W3IA 1IEIA 1Q6LA 3TK7A 5D2TA 4JR5A 1Z8AA 3H70A 4QCFA 5LKYA 3PNZA 4TU1A 4DWSD 3RIKA 4IX2A 2E9LA 1HJUA 3PPHA 1IGSA 3LI0A 3N9RA 4FI4A 1HKWA 4PMQA 1V6XA 4KCTA 2V2DA 2ZZ2A 2Y88A 4ICCX 1GKPA 3VKBA 3TA6A 4F2BA 3BOLA 1PUDA 5H8MA 3HQ1A 1OG6A 2JGYA 4F3HA 3GR4A 1I2NA 2DY3A 1VFSA 3GXPA 5HMEA 3WLJA 7PTDA 5ABFB 2X09A 5HWJA 3RITA 3BZGA 5D03A 1JGMA 5REQA 2AKMA 1YNPA 4DBDA 4UTLA 5TQLA 4M6QA 3ONCA 4BK9A 2ZZ4A 4JQ4A 3TMLA 1E6QM 4DJFC 3PB0A 3DFQA 3ZLHA 3RLUA 1JCYA 3T9PA 1F07A 2I17A 2GSEA 2O4QA 2B81A 2QDHA 1EUAA 4GZEA 5A3HA 1DWFM 5I3GA 1J01A 3UR8A 2AMGA 5FJTA 3FHQA 5AVNA 3O05A 3WD0A 2FB3A 4PB3A 1RCOB 3AS0A 1R3TA 2DP3A 2NLYA 3W83A 5EKYA 3R94A 2XUCA 1ZBWA 5CSYA 3FN9A 3L5LA 4E3TA 4F0MA 5FEZA 3PHAA 5FESA 4TVCA 1UQYA 1W1VA 2ABBA 3EX2A 4E8GA 3SURA 3C2OA 4KGJA 1EOKA 4NF7A 4F0RA 4GXWA 3VFLA 4UQ9A 2TMDA 1GVFA 2PLJA 5E0KA 1K8CA 4ZE4A 3AJXA 3TSDA 2BHYA 2H90A 4IH3A 1RH9A 1SJAA 1ZAIA 3F4CA 1E72M 2DQWA 1G69A 3LBMA 3KXQA 3W02A 1MQQA 2A1YA 2DZSA 3N2MA 1LBMA 5T9CE 4DO5A 5F4SA 3VD9A 2ZRZA 3AS1A 4EXBA 2NQ9A 4WDTA 4FOJA 3A4XA 5BXRA 3EWWA 4RL3A 4UTFA 3W7GA 3T2QA 1JZ3A 4UUIA 4LAZA 3SCRA 3OQEA 4WJXA 1CB2A 3PK7A 4WKAA 2POZA 2G3JA 4ORMA 5K4ZA 3PY2A 2OGYA 4I5XA 3SCPA 2R1PA 1J18A 2F84A 1QJWA 3TSBA 5JBFA 5JH1A 3W70A 1OINA 2JK2A 4M80A 1RP8A 1XD1A 4B9YA 2DT2A 1GOIA 2WC3A 3C8FA 4KPLA 1EQPA 1WUEA 1IWBA 1HW6A 1EXBA 4I9JA 2ABAA 2Y61A 2A3LA 1BKSA 5D8ZA 1BRLB 4ICNA 5E6ZA 5SWUA 1GVYA 4XISA 3WDPP 3VNLA 4NZCA 1XIGA 5C9RA 1M53A 2WWCA 4QHRA 4FOKA 3ALFA 4CQCA 3UG5A 1YPXA 2V9DA 3GY1A 3NSNA 5BRQA 5A8PA 4O8AA 5FF7A 2WNQA 3STPA 4AXKA 4D1IA 3BARA 4Z1BA 2OYLA 3WX7A 2ZTJA 2DU2A 3CTLA 1I2RA 3CHEA 3GDLA 2QNEA 3K4DA 1U33A 4ZQMA 1S3TC 3DG3A 1DJWA 3VA8A 2PGRA 4JKLA 2BHZA 1P6BA 2H3BA 2QYGA 4GH1A 3UG4A 2CZVA 2IPJA 1TTPA 5LIUX 3ID7A 4GY7A 4P2VA 4J9JA 3K8MA 4AHOA 3PJXA 2X16A 2ZRXA 2F9RA 3B8IA 3GDKA 4XZNX 1CLXA 1JXJA 4BFAA 1IWAA 1WDRA 1HF6A 1ZENA 1YMYA 3H6OA 1T6MA 1GVSA 4H7ZA 1Z44A 4MZYA 1M1BA 2I14A 4A3HA 5BU9A 4J7RA 1TWDA 1BYDA 4A35A 4CGTA 3SY1A 1AW1A 5JBEA 1O66A 1DWAM 3LPPA 3AMGA 2DZUA 3AS3A 1NDZA 3QPEA 1QMLA 1SZRA 5CZSA 4EAYA 1XYAA 3EDKA 3S8HA 2XVLA 1F5ZA 2VHLA 1VHNA 1EX5A 3DFNA 3WUBA 4C6CA 1KR1A 3MCMA 3E5BA 4PBFA 1SMDA 3O7UA 4PUJA 1A5BA 2DIEA 3H7RA 2E28A 1F4HA 4GI4A 1X8CA 4PMUA 4KWSA 2VKZG 3EAUA 1A5LC 2EJ1A 3FVDA 5IBXA 2Y85A 3ZYZA 1F9CA 1S2VA 1J2BA 4GVHA 2CLPA 3PUDA 1ONWA 3V1PA 3L4XA 2R1MA 3EXSA 1PTDA 4W7WA 3E74A 4LEFA 2CETA 1PCKA 4MM1A 5BXTA 4GCAA 1XH0A 4OVXA 1O7AA 2V5BA 1OGGA 4Y7EA 1M04A 3ZXWA 4UR9A 4ATWA 3GTXA 5EU9A 3CXOA 3QV9A 2YDSA 3AMCA 1LORA 3PS7A 5AHIA 2ZXAA 3VILA 2GDUA 4W89A 3WH8A 4HPGA 2UY5A 3NQVA 4BKNA 1EDTA 3V35A 3QKZA 3WYZA 3WJXA 4N0RA 1IR1A 4ZOAA 2BDQA 2WBGA 3AWOA 1XGZA 3BG5A 2WZEA 1DJZA 2WHJA 3W00A 1OK6A 2GGEA 5LSMA 3M41A 1YE4A 1FCVA 4DIAA 5IDZA 3DEQA 2A79A 2DSKA 1TWSA 4FF7A 5XIAA 4AZ5A 3DESA 1XYBA 2I7GA 3NQMA 1J8VA 1UH4A 1V3HA 3PWAA 4D6JA 1ZP3A 3FJ4A 3NQ6A 3WEMA 4J3ZA 1H0GA 2PP3A 2VVSA 2DV0A 5FJJA 3V0TA 3WLSA 1A80A 3NZPA 3WQWA 5I3KA 4WY0B 2E8YA 2QMJA 3LA4A 1ME8A 5AHNA 3E12A 4LWWA 1MFVA 3H2AA 4AD0A 3ARPA 1FWRA 1H5VA 1SGJA 1AODA 1KWGA 1V77A 4HVXA 1RQHA 5G1YA 4KEZA 4P7OA 4H8HA 1Q6EA 1FDYA 4LAOA 4AWEA 4QR6A 4WDWA 3CV6A 1JG9A 1KTCA 1ZL1A 4MNMA 4DZAA 1FHDA 3F4VA 4PB4A 1RPKA 1FWTA 3JU2A 3KVKA 1P6CA 3M6YA 4C6DA 1OFQA 4IIDA 4JTAA 4IGMA 3FDGA 3I6TA 3TVAA 3W1AA 2ACQA 3EOOA 1HKJA 4QSFA 3M0LA 1CGTA 1FFRA 2IXVA 2PDCA 1F6PA 1QW8A 2VUNA 1GPWA 2CERA 2G97A 5A6SA 4N9DA 5FJPA 2P5NA 1IEWA 3VUSA 3P0WA 3WLRA 4DJFD 3A6OA 2J7DA 3P3BA 2WKJA 2WANA 4GC4A 3Q4DA 5AECA 5E1QA 1HJVA 2PC4A 4L6HA 2C79A 3W72A 2OWCA 5HULA 4Y9NA 4C6IA 4DO7A 1U5JA 4QAIA 2WMGA 2FMNA 3UXAA 1BTMA 1J96A 2W5FA 4P7NA 1TUXA 5M3WA 1HFBA 1B3WA 4GI6A 4J27A 1ZBKA 3LQLA 5DEZA 3SGZA 4WRHA 4URIA 4G7EA 3S1WA 5E0CA 2VWSA 1M68A 8TIMA 3CB8A 3ALGA 2QUVA 1UQZA 1LTDA 1CXEA 2YL5A 3W2LA 2GLKA 2Y5SA 4IGHA 1IYXA 3GIYA 1G4SA 4DJDD 4UZUA 4AF0B 4N2YA 4AZGA 4CUCA 1XICA 2E25A 3MSDA 4QGCA 1O68A 3WD1A 4HP5A 2PLCA 3H8AA 4XUGA 5D9NA 1LOQA 1W5QA 4KRZA 2Z4GA 4C1NA 4Q8OA 5C9WA 5HNTA 5CSUA 1MW0A 4AISA 3THUA 1F3EA 4V1YA 3M0KA 5A2CA 1KFEA 2CXGA 4AIBA 5ECVA 1FWEC 3C0LA 2J74A 4EF9A 1Q5MA 2HRWA 2P8BA 1XLCA 1ZJIA 4UMBA 3CUXA 3SI9A 1W0MA 4DAIA 3CQJA 1PL9A 4FLOA 1KO0A 2OSYA 3IIPA 1N2VA 1GVIA 1CLVA 1DHPA 4RKAA 3DBPA 5C54A 5C8BB 4X2PA 3N2OA 5AC8A 3VIKA 2ZKMX 1ODZA 3QZAA 4M82A 4D6CA 2FH6A 2ACUA 3TW6A 3SB0A 2QUUA 4N42A 4GZIA 2QCDB 1IXOA 4ZB2A 4PB5A 2J77A 2Z7GA 3APGA 4YN5A 4JKKA 4O16A 1KW1A 2CZ5A 2RDTA 1MXSA 3H2MA 4WF7A 3Q67A 1US0A 1P7TA 4CNTA 5FL0A 1KM2A 5EA9A 1A49A 3W7LA 1XLAA 1EHNA 1XJBA 1JPDX 3WBXA 4DJEC 4CQBA 1W3LA 3L5MA 1W9DM 1L6WA 3P14A 3MA8A 3ZO9A 1TELA 2VEKA 3M7SA 4HNOA 3GKFA 3JZEA 3LBOA 5JBDA 3Q65A 3KZPA 3E1F1 2R91A 4WQ6A 2ZRYA 3LGDA 4NYUA 1NH6A 3M7WA 2HVMA 4QX4A 3V7PA 3GVVA 1J9YA 5DN1A 2PDJA 4PH6A 1A0EA 1QHZA 3CLWA 1LWJA 4ZTYA 4AX6A 4XZMX 5EMYA 4ZOCA 2C16A 1MXDA 4H6RA 3QBUA 3TKFA 1UPMB 3T0AA 3IJ7A 4D6DA 4AZ7A 1NIUA 5CCZA 1CX9A 3U2CA 5G2HA 4LYKA 4QCEA 1XYMA 2QJNA 1RXOB 1ADSA 1POKA 4I5UA 3T4WA 4UQCA 2GDQA 2QPUA 1VYPX 3CWNA 1UKPA 3WELA 4XK2A 4K1WA 5GJNA 2X2YA 3CUFA 3OBEA 3MCNA 3S0CA 9RUBA 1Q63A 3EGJA 4D2JA 2A3CA 1RAKA 3A9IA 3N15A 4UOQA 2QCGA 3KP1A 4AEOA 2OWWA 1FDJA 3MJMA 2YR1A 3ZFHA 1VFMA 3CO8A 3SADA 2PDUA 3PWIA 1BGAA 4ZCWA 1Z3NA 1W31A 2WMJA 1N8WA 3W86A 2F2HA 2HE5A 1ZLPA 1OX4A 5HPCA 2GGGA 1ZZMA 3IANA 4A8RA 4IIFA 3CNYA 2JF7A 5DXYA 1K7EA 3PNUA 1Q8JA 1NDWA 2YYUA 4D6EA 3EEZA 4FSAA 1P0DA 1OCQA 3PG8A 2PDXA 3TDFA 3N2XA 4MTVA 1E6SM 3TV8A 1HL8A 3F03K 1S2CA 3GDTA 4IQJA 3T0TA 1XCXA 3WQVA 4CEUC 4D6GA 1RUSA 4N9EA 1XRFA 1CDGA 1VBGA 3FCPA 3DHPA 3PBVA 3QY6A 1BPLB 1WYIA 2PF0A 3VFCA 1QU4A 1H60A 1IEXA 3S6TA 4QIUA 3V18A 4MB3A 2HXTA 3QN3A 4UNLA 4GYKA 1P1XA 2ZUWA 1EOMA 3DXIA 1NOFA 3IJ9A 4S38A 4ORIA 3KHJA 1RJRA 2EKGA 4G1NA 4WGHA 1SW0A 3PWGA 1R0MA 1YADA 1TKKA 3BJFA 1FWWA 4A05A 2BXZA 5G1MA 1WXZA 1TE1A 2Z26A 3BV7A 5D8WA 1ZTVA 4LV4A 2RH9A 1IIGA 5C5YA 2ZOXA 3MYOA 3AYSA 4M7TA 5A8MA 1OABA 2GJXB 4IXXA 3JVAA 4KEMA 3WLIA 2XN2A 2BASA 1W1A1 4MFEA 4GA8A 3IRDA 3NCOA 3ARQA 1G9HA 4XTDA 1YPFA 2VM8A 4HNTA 2GZXA 5JMUA 3NZQA 3GS6A 3OGSA 4Q8PA 5LXEA 3UWWA 3I7SA 2R9RA 2D2GA 4XUYA 3OG3A 4ZQPA 3WJWA 3MUAA 3F2CA 1ZNNA 2Z1XA 1IHIA 1JPIA 3NOYA 4LC8A 1C90A 4LS0A 4X22A 5G4WA 1ENUA 4H6QA 1OX6A 4W5ZA 1OFDA 4MAZA 2Z7KA 4JHMA 4L5ZA 4CU8A 1DHKA 2ZZ6A 3W2NA 4E2DA 1TMHA 4H8VA 2QDDA 3BLKA 3W6MA 3SUSA 3MTWA 2J7BA 1TX2A 3SM0A 2PP0A 3DGBA 4CVWA 1DWGM 2GDVA 2WMFA 3D0CA 1YTDA 1DWJM 1R30A 3C61A 1H5YA 3W53A 1UR0A 3MMDA 4RNJA 4QEEA 2OSXA 1QBAA 1Y5XA 3TLQA 3QZ6A 2Z27A 5DT7A 3MT1A 2PDQA 3WN6A 1GOOA 3WQCA 4D6HA 2OO6A 1MQPA 3VOIA 4JTIA 2DZVA 4CQ8A 3QOMA 4ZSUA 1BSLA 2PDGA 4PR4A 4WDXA 3UWUA 5KETA 4U10A 3RJXA 2KAUC 5FCZA 1YXDA 2ZX7A 3EOEA 3OODA 4XWUA 1MDLA 3TC7A 2Q6ZA 1FXPA 2F2KA 3ABSA 4ZL1A 3VNZA 4F0LA 1WUFA 3M47A 4IJCA 1BD0A 3UG8A 4UC5A 3GH7A 1HP4A 4MYAA 3C0SA 3WMBA 4D71A 3VIGA 1M65A 2ZXQA 4PL1A 4FA3A 3NDZA 1GT8A 1TJRA 5F2IA 3GU2A 4HBKA 1WBJA 1G4EA 1FWGC 3NXFA 3VNDA 3EDFA 4AC1X 4P8WA 4US5D 4GQGA 1XSJA 4V15A 2ZIDA 3UJFA 4HHPA 4LS2A 4WKFA 4ML9A 3K4AA 1O95A 3ARWA 4U4MA 3AMKA 2WMIB 4JOMA 1A5SA 1X96A 3QGKC 3M5YA 1V0NA 3VZXA 3B0UX 3W23A 3NL3A 4R33A 2C0AA 4NIRA 3NQ8A 2BOGX 3W7JA 3UR7A 3WUFA 1EJTC 1UD4A 3I6EA 4GISA 3T7VA 4BEQA 1O6IA 2OYKA 1Q6DA 5JQ9A 4IFKA 4B4HA 2VQUA 4E8DA 1S2AA 3MWCA 3LEPA 2QQ6A 3AWNA 4JNYA 1DPMA 4HHLA 4US6A 2V5CA 1UR4A 1DXFA 2I57A 3SRHA 2YLLA 1GORA 3C3NA 2JEQA 4PMJA 1S3HA 2Z1WA 3KBNA 4R88A 3L12A 3NSMA 3EOLA 2HK0A 3CQKA 3PBUA 3BCJA 3STGA 2UV8G 3K13A 3B9AA 5I3JA 4B16A 4MUPA 2V38A 3DKJA 4HU0A 3VM5A 3BSHA 1H1YA 4YTTA 1CGYA 4WSHA 4GKTA 1XRVA 2OG9A 1FP9A 3W37A 2EJAA 4HNLA 5DCEA 4XZBA 1SSGA 4P8UA 3R6IA 1E51A 3R11A 3LHZA 4PCSA 3BJTA 1DP0A 4F2TA 1DXEA 3HPSA 2INFA 4X2RA 3C0JA 3VKCA 4YVXA 3OOQA 2CITA 1F74A 5CZTA 4JTLA 3BW4A 4TIMA 1M7PA 4UWMA 4NAEA 3SQMA 3TYUA 3FDKA 3G6MA 4E8CA 3LCFA 2VFFA 1LP6A 1QI0A 1KD0A 4KRTA 4NNAA 1TRDA 1F6YA 1XXXA 3ATYA 3K8KA 1KXVA 3WMCA 4EXAA 3I3BA 3VNIA 4H83A 1XWYA 1PO9A 3EMQA 4HKPA 2V5DA 1PXGA 2VI0A 4MB5A 4AD2A 3KLKA 2R8WA 4E2OA 2HDJA 2FZ9A 4W8LA 1UWRA 4CQ9A 3GXFA 1MW3A 4EF8A 2YBVA 4UTTA 4ATDA 4HJFA 4AVNA 4QJ1A 3M16A 2YA2A 4Q8TA 2ADAA 3TTOA 1MEIA 1ZQ5A 5BU6A 2P88A 4LSBA 2XSAA 4XZ9A 4UTWA 3IEBA 3E2VA 1FHLA 4RX0A 2BY3A 2NXIA 4AZHA 5CBIA 3EEGA 3W27A 3V5CA 3JW7A 4NZFA 3VZZA 5A6KA 4L1XA 2A0NA 3BLLA 4PE8A 4XVDA 1WZMA 4QDPA 2POTA 3HU7A 3I7RA 1R2TA 4IG2B 1IT7A 1R3RA 3W1MA 2J7GA 1F8MA 4TTGA 1EX1A 4LVAA 3L65A 3GFYA 4M24A 3FNDA 1Z9AA 2E5BA 4E2VA 3FXGA 4ACZB 1KTBA 4EXQA 1QDSA 1AG1O 1GG0A 2FFCA 1BXCA 4ZENA 3CGTA 4JIIX 2QVHA 2DJXA 3QPZA 4K6AA 3GAKA 3AHXA 1HGWA 3LTPA 2E68A 4GACA 4DWSA 2XM1A 1C7SA 4MY8A