3SJ3A

Crystal structure of the mutant r160a.y206f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTAPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIFLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sj3A00
1D3HA 2Q3OA 2QCLA 4Z1DA 1EUNA 1FWTA 3SIZA 4BWLA 5AHFA 4ZQMA 1OFQA 1LP6A 5A8GA 4Z1BA 5J5RA 3LCLA 1K8ZA 1QAPA 1Q6LA 3LERA 3QW4B 4A3UA 2WV8A 2RDUA 4QNWA 2OX1A 3JS3A 4NJGA 1A53A 3B04A 1YPIA 4LUIA 5D2YA 1WBJA 2JK2A 3A21A 4AHQA 2WO5A 4WD0A 3IIOA 1KFCA 5AHLA 3DGRA 1OK6A 2ZTJA 2VEKA 2AQWA 4JX6A 1XBXA 5EL1A 5LGXA 3I7SA 4RKAA 2G95A 4UTLA 2YYTA 1JCMP 1GWJA 3C8FA 1IIHA 1WV2A 1XUZA 3MO7A 3PUEA 1S3HA 1VLWA 4WZHA 4NQ1A 3S6DA 1VHCA 3I6RA 2ZCGA 3NQFA 3QEZA 4XZ9A 1Z42A 2ZZ3A 4MLRA 2NUYA 3KVMA 5HR7A 4ZQOA 3IVUA 2NUWA 4AHPA 1I4NA 1OYCA 1D9EA 5IBXC 2JGQA 2DZWA 4NX5A 5D03A 3ABSA 4QSHA 3W7MA 3FFSA 4S1FA 1LDCA 3PR2A 2B7OA 1XFBA 1W8SA 3O1NA 1Q6OA 3UPWA 4IXHA 1IXPA 4NNCA 1LZOA 1K03A 1EEPA 3Q58A 5D2XA 4FNTA 2GQ9A 4O10A 4DO4A 2NUXA 3MHUA 5KSWA 4PC8A 3G0SA 3W9ZA 2QR6A 3UWUA 1YXDA 4NUWA 4MJMA 3CT7A 3GAKA 3OA3A 3TJXA 1L2UA 1HO1A 3N9SA 1KLYA 4JTLA 4K8EA 1P1XA 4ZL1A 4DBEA 2YCEA 1D3GA 5MHBA 5D2WA 5LKYA 5FF2A 2A7RA 1PV8A 1NF0A 3MYPA 4JDYA 1J4EA 3EKZA 1FQ0A 5KZMA 2NZLA 1TCDA 7TIMA 1NF7A 2EF9A 3CIWA 3EX6A 3R8RA 3NQ8A 2DZPA 3W73A 3L0KA 4PEKA 4UMAA 3DKLA 2QKFA 3EXTA 3LCFA 1M5WA 5H2ZA 1MXSA 3EX3A 3WJYA 3LXBA 3W7PA 2ZRUA 3ZS4A 3PSWA 4NZJA 3P7YA 4UFJA 1AG1O 4C1KA 4UCGA 3N73A 1UB3A 1Q3NA 1JCNA 1H7RA 3UZJA 4HNVA 3HG2A 4JYDA 5DXYA 1S5WA 1GG0A 2VKZG 3PULA 2J27A 4TMCA 2Q3RA 3LCHA 2E6FA 1G4SA 4PTNA 3P61A 3FS2A 3BV4A 2DORA 1GVRA 3W7CA 3TNOA 3W2JA 3AO0A 1KM2A 5DCDA 3PM6A 3SFKA 1AW2A 4LVDA 3TC7A 2QCEA 3BW2A 5KZEA 2DJXA 1SUXA 5CZJA 2C14A 1TPC1 3QF0A 2BXVA 3BK0A 3FKRA 1FXPA 3NOEA 5C2XA 2QCDA 2A7PA 3TXVA 1F73A 1Q6RA 4OBTA 3W7GA 1YTKA 4R34A 3T4CA 3LV5A 3W84A 5AN7A 1A5BA 3VFLA 2BX7A 4N9CA 3C61A 1WOBA 3P74A 2I1OA 3W74A 3KRUA 2X30A 1VYRA 1LOLA 1QWGA 3DHDA 2X1UA 3O16A 3LXAA 3UQNA 2Y6ZA 3A5FA 1KM0A 2J88A 1R2RA 1GYLA 3O6YX 4K39A 1DJQA 2V9DA 3NPWA 3GNDA 3BGJA 3GDMA 2CZFA 3STFA 3W7LA 3BO9A 4TO8A 5HUOA 3OEXA 1O60A 2R91A 4LV4A 4XKYA 2D73A 1VZWA 3GR8A 3PC0A 5BMXA 2YW4A 3QQ1A 5F2LA 3S5OA 4AF0A 3TUUA 1UASA 3W7DA 1F76A 4WJEA 1BWLA 1QOQA 1VQTA 1OFPA 4M6PA 1SW3A 2W6RA 5D2VA 2WQPA 4UMCA 1XL9A 4MLJA 3I7RA 1ME8A 3VKJA 2Y7GA 4ZMGA 1LOQA 5K2ZA 4LRTA 1LOSA 5D37A 1JQXA 4IQLA 5CSRA 2J24A 1GVFA 3P81A 3PB0A 1QOPA 4JY8A 3PSVA 3DU0A 1QPNA 1ADOA 2H3BA 6TIMA 4C1LA 2C13A 4K7YA 2YYUA 5CG7A 1Z41A 5FEXA 2WJZA 3CPRA 2Q8LA 3TAKA 1XXXA 2H3DA 1KBJA 1DVJA 2QCCA 4XWUA 2GUUA 3DBPA 3TXZA 3STGA 2Y7EA 2KZHA 2YR1A 1I45A 3BARA 3B4UA 5BOOA 4FIRA 4FNSA 3W1AA 5BW6A 4YCPA 1RQHA 4LS0A 4CCDA 4FNUA 1LRTA 3DHFA 2Y62A 1TRIA 3M1ZA 3A23A 4R53A 3W7JA 4LWWA 2A2IA 3QMSA 4UR8A 1RD5A 4NVTA 3W7OA 2W79A 3LI0A 5E0KA 1FWSA 4YL2A 4JN6A 3S1WA 3RFAA 2E68A 2DZVA 5G2HA 3B0UX 1VCGA 1HG3A 4LVGA 1EB3A 1X1ZA 3LOTA 4TMBA 5I3IA 2H8ZA 2TRSA 1GVOA 5LZLA 3MP5A 5EBUA 2CLFA 4EWND 3N19B 1H7NA 5FF0A 4IWWA 1ICQA 3RLUA 5DN1A 4MY9A 3C0JA 2ZA1A 4K37A 2E1DA 4POCA 8TIMA 1Q45A 2Y89A 3KRSA 4LOCA 3LX9A 3HQ1A 3EX2A 3NDOA 3RF9A 4NNAA 1SZGA 2FIQA 2BWGA 1VLIA 4JNMA 2GJNA 4UFMA 1VHNA 4JS3A 5K9CA 3DKJA 3VE9A 4CCEA 3BPWA 1ZY9A 1YDVA 2VELA 1ICPA 4ALDA 3ABQA 2QDGA 2LLEA 4H3DA 2B7QA 1NVMA 4O54A 2R8WA 4O1CA 5I3KA 1AW1A 3NL2A 3I7QA 3W7KA 4BFAA 1WYIA 3P84A 1JR1A 1G69A 3MP4A 3NL3A 4CCCA 3W1MA 1F6PA 1H60A 2ZRWA 1EA0A 2C16A 4UR7A 4QITA 1MO0A 2IQTA 3B06A 2Z1BA 1SO6A 1V7YA 2FB2A 3QPYA 1FDJA 1XBZA 4XUGA 5K3VA 4MJZA 1KFJA 4TU1A 1VRDA 2E09A 3HGOA 3M5ZA 1VYSX 4A22A 3TAOA 4NZFA 1PIIA 4DPQA 4WOQA 4HT3A 3GR7A 4MUZA 2VENA 1THFD 5TIMA 3U6WA 2RKXA 1BKSA 3QJAA 4IXXA 4DF2A 2Y61A 5G2IA 4JTSA 2O7QA 4DF1A 1PVNA 3RNDA 1H7WA 3UZ5A 2A21A 4NXSA 3DFSA 2FDSA 2G97A 4GFSA 4GUFA 4O16A 1FBAA 2WPBA 1SU5A 5FI8A 1SZEA 3QH2A 4DELA 3O06A 2CLKA 2HMCA 1JCXA 2PURA 3P60A 5LNWA 3SSJA 4CNPA 1UUOA 3W1XA 3W75A 4IMDA 5LNVA 2JKPA 1FCBA 3Q94A 3NQMA 4OU1A 3T78A 1TJRA 3G22A 1OHLA 4S2CA 4BK9A 3DXIA 3MW7A 4DQWA 2B7PA 3TQKA 5F1VA 1RZMA 3C2FA 4X22A 2FFCA 4LVBA 1OFDA 3W1UA 4O50A 5F2GA 1NAL1 1RR2A 2C0AA 2QUTA 4HHPA 3CIXA 3CC1A 4LRSA 4OT7A 3LCWA 1RPXA 4LC8A 1OABA 3FYPA 4EF9A 1HUVA 3P80A 3P8JA 3VNDA 1TPVA 2FPVA 4DF0A 3W7IA 1G4EA 3GXTA 4YLWA 4O1AA 4X2RA 3EWXA 1WXJA 1J5TA 4UFHA 2DJLA 3NQ7A 1KFBA 3ATYA 4N6FA 3HOJA 4AEOA 3C56A 1TPH1 4GXMA 3GXNA 3LCXA 4K7VA 5AC6A 4MIMA 3GIYA 5AHEA 3W1LA 3M47A 3NL5A 3VE7A 4ADTA 2CZDA 4IOTA 3HPZA 1QPRA 1R46A 3USBA 3L66A 3NNTA 4DXVA 1XDMA 5AYYA 2V5BA 1H7PA 5CZTA 3W87A 4PH6A 1B9BA 4LS1A 4ONVA 3L9CA 3RK8A 1WX0A 3CQ0A 3S1VA 3PBVA 5IM51 4XTDA 4AXKA 3UY8A 3M5VA 3UNDA 3C6CA 3LHUA 3U2OA 2ATSA 1LRQA 4DO5A 1TV5A 3KRZA 1TPEA 4AWTA 1Z44A 1I8JA 4Z08A 4JTHA 5AC7A 5J5DA 3SI9A 5TQLA 4ICNA 5EKYA 4IUOA 2NLIA 2Z0IA 3KVLA 3MBFA 3WK1A 2Y88A 1ZAHA 1ZENA 4L4LA 3IVSA 5DELA 1GQNA 2AAMA 3NPXA 3GLCA 2YGYA 3M6YA 4A2RA 4MVAA 3THQA 1W5NA 1W3NA 2Y85A 3NVTA 4HNNA 2ZZ7A 3DI0A 3WJZA 1OX4A 1C29A 1KV8A 4I7VA 3WFAA 4RJEA 4O18A 4UXDA 1ZCOA 4O28A 3IEBA 3W85A 4FXSA 2RH9A 4HN4A 4UFIA 3B05A 5CPNA 4ORIA 1PCKA 3W7EA 2V0TA 4JY9A 1GYNA 3E0IA 2G5WA 5FF3A 3LTSA 3W7NA 2VEPA 1FXQA 2Y7FA 2CU0A 2JKEA 5FEWA 4MZ8A 4LU0A 3VI2A 5LGZA 2VEIA 3TKFA 1QPOA 1O95A 1RV8A 3N34A 3KVKA 5E1QA 4HIBA 4N02A 4RX0A 4GUIA 3LV6A 3G3MA 2E5CA 3G3DA 4FF7A 5HR6A 3BW3A 2A6NA 2VFFA 3KHJA 2YFOA 5I3JA 3DAQA 3P67A 3MHGA 5FEZA 2TYSA 3E02A 3MI6A 4BI6A 3LLFA 4MYXA 2QUVA 3L0GA 3C2EA 5FF7A 4JIQA 2HS6A 2EAWA 1OYAA 1SZFA 2DZTA 3B0VC 3KXQA 3L5LA 3M0ZA 4MOZA 1YXYA 2ZYFA 3C52A 2V81A 3BG3A 3BGGA 1ZFJA 3O6CA 4FEZA 2CLIA 1K3UA 5G1YA 1SSDA 3C2VA 3TQVA 1I2PA 4ZZ9A 1AW5A 1JCLA 1SR9A 1SFJA 4ML9A 3R12A 1YTEA 4K36A 5F4SA 1KFKA 1LROA 4LV9A 1GVQA 2GQAA 1VH7A 3W70A 1W0MA 3R5EA 1KFEA 1TIMA 3NL6A 3NPUA 1EWEA 3M43A 3WJSA 3QPZA 1KTCA 1YYAA 1GT8A 1QDSA 4UTWC 2NWRA 2V8ZA 3W2NA 2ABBA 1P0NA 2RDWA 4IMFA 1K8XA 5LHEA 2EPHA 2ZFAA 3W07A 4WXYA 2YSWA 3W7QA 4BI7A 2NV2A 5I3FA 2ZBTA 3UD6A 4IX0A 3FKKA 5H91A 1IGSA 3E12A 2JBMA 1I2NA 1W31A 2OT0A 4FHAA 1WQ5A 1UUMA 2A6LA 4NNBA 3NEVA 4JYEA 2WNZA 3HIJA 1N7KA 2TMDA 1DKWA 1OFEA 4ZQPA 4JTTA 2Z6JA 2UV8G 4OWGA 3GNNA 1B4EA 5AOUA 2J6XA 1X7FA 4CQ8A 1Q6QA 4DPPA 4RR4A 2FLIA 3OHIA 2CLEA 3BLEA 1WAUA 2RHGA 5ABTA 3F4NA 3GAYA 1NEYA 2ZRVA 1OJXA 3IIVA 1PS9A 3LBMA 4YXGA 4JR5A 5IBXA 3L5AA 3P82A 4IGHA 4WY0A 1EP1A 3FJ6A 4RXFA 1TRDA 3GDRA 2QJIA 1QR7A 4GRSA 3RMJA 3GYEA 3LTPA 5C6MA 1X1OA 1WOAA 1TMHA 1YTDA 4FNRA 2YDAA 3QMTA 3R2GA 4TIMA 1IXOA 1JVNA 3L2IA 4Q32A 3F4WA 5HINA 4HSNA 2HTMA 1WA3A 1L6WA 2YX0A 2H8XA 3CU2A 3BVJA 3SZ8A 3W1PA 5CPMA 3B8DA 1RQEA 3C4UA 4W9TA 3EEGA 3MWAA 3G1XA 1TTIA 1B4KA 3LCGA 4N4PA 4IMCA 2WSYA 4Y90A 1SQ7A 4GE8A 3TSMA 2W0UA 1H51A 3KVJA 4KFPA 4WX2A 4U28A 3N3MA 2C19A 2V2HA 3HGRA 4UTWA 2VFHA 2R14A 1W3IA 1VCFA 2ZTKA 5D05A 4MYAA 4M7SA 4NX0A 4E2DA 3P5YA 4XBKA 3G8EA 5F1UA 3JR2A 5LNRA 4X9SA 3CWOX 5AFDA 2VFIA 3GDKA 4LNYA 4FB7A 4UNKA 2FPYA 4JGDA 1O5KA 3NQVA 2V2DA 2X1TA 3MJYA 4UFLA 3HMJG 2YPIA 5D30A 3LB0A 4GBUA 5U7SA 3SR7A 3GX9A 3G1AA 1W5PA 3S8HA 2A7NA 1DHPA 1AL8A 4BF9A 5DCBA 1C9DA 1UBSA 4WOZA 3KOFA 3F1QA 3PG9A 1A5CA 4KWWA 1TYGA 4OQVA 2A85A 2CZ5A 4GWEA 2GOUA 5DY3A 5I3GA 1HTIA 3HO8A 4MFEA 1U83A 5G2WA 5I3HA 3STEA 2OCZA 2NX3A 3WK0A 1HFBA 4O19A 1S5TA 1FX6A 3P62A 2JGYA 2I14A 4KFNA 1ME9A 3L67A 3A9IA 4N2YA 1AL7A 4UTTC 2PRLA 1F7BA 2VC6A 4NJIA 1ZJIA 3DFOA 3G1HA 1LM1A 3LCIA 3MUXA 1LBMA 1K7FA 3G0UA 1I2QA 5CKSA 2E6DA 2TSYA 2X1RA 1K02A 3G18A 2J9YA 4J9JA 2GJLA 1XDLA 5EPDA 2EHHA 2EKCA 3TSDA 4TR9A 1T96A 4JXCA 2VEMA 1R2TA 4JICA 5TBOA 2QEZA 3PAJA 3U8GA 3R89A 3HF3A 2QCFA 4QIUA 2AGKA 3LLDA 2YZRA 3CTLA 2XN0A 4UTMA 1XBVA 2ZRXA 4O14A 1KFLA 4PL2A 3LTYA 1R47A 3THAA 3W23A 1YDNA 5CPLA 4LVAA 3TJLA 4A21A 2Q8ZA 1I2RA 2NX9A 5G5IA 3GB6A 4O0ZA 1XKYA 3AJXA 4HSOA 1OVDA 3I68A 3QM3A 2I9EA 1DQXA 1T99A 5EYWA 1KBIA 1H62A 1LBFA 1SO5A 4O12A 3TFXA 4UTTA 2P1FA 5BNKA 3UXDA 5DBUA 4M6QA 1W37A 3A22A 4D2JA 3PG8A 1SO4A 1VR6A 1WBHA 4HPXA 2E5BA 2QF7A 4UC5A 4O1BA 3O8AA 1H7XA 2E6YA 1K7EA 1L6SA 1O4UA 3N9RA 4GNJA 1A5AA 3N2XA 3SECA 3PBUA 2B7NA 2CLLA 2P0OA 4G1KA 4O53A 4Q4KA 2GPTA 1JUEA 4O17A 1DQWA 2QCDB 4HKPA 5D33A 4WY0B 1FCUA 5AYZA 3P8IA 3UWVA 4QJ1A 4PODA 1JCYA 4UTIA 3Q37A 2C3ZA 2ZA2A 5LSMA 3UWQA 2FJKA 1JRBA 3W2MA 3V75A 3H54A 3PUOA 4EOUA 4S2BA 3GXPA 3HPXA 2CWNA 3INPA 3G1VA 1IXQA 1DL3A 1TTJA 1C8VA 2WNQA 1TB3A 2ZZ5A 1B3OA 2CLMA 1J2WA 3EXSA 5D38A 2NXIA 1RVGA 1JULA 4O4WA 3TU9A 4Z1AA 1OFOA 3L68A 3W22A 5C5YA 5T26A 3EXRA 3TH6A 4XKYB 4DEFA 4MFDA 1QPQA 2VFGA 3RLVA 5HWNA 1B57A 5KTLA 4N9EA 3KX6A 2OMAA 3IV3A 1MZHA 3K30A 3G1SA 3ANYA 4GUGA 1P0KA 4Y6GA 3UWZA 1MEWA 3I65A 1HL2A 2OT1A 3ABOA 3NQGA 1XBYA 3OVRA 2HS8A 3V1PA 3LXCA 3DFPA 1IF2A 4Q33A 2F7FA 2QCMA 2V30A 4EVZA 1KM3A 4RZ4A 2O7SA 2PCQA 1TTQA 3HGJA 3S1XA 4MKNA 1LTDA 1PL9A 2ISWA 1LCOA 3UPBA 2QCGA 3EKLA 1G7UA 4H4IA 1I2OA 5GVJA 1M7PA 3CLMA 4Y9AA 4FIQA 5HULA 5AC8A 3OBKA 2NXGA 1SZNA 3QSTA 4FNPA 2DZUA 4QAIA 2A1YA 5L9FA 3EWYA 3BLIA 3G1DA 3TA6A 1A50A 3FLUA 3G0XA 5EY5A 3P5ZA 4A2SA 4EF8A 2EGZA 3TFCA 2JKAA 4RK8A 3NQCA 4IJBA 5G4WA 3ATZA 4CLMA 4IPIA 1OK4A 1SFLA 1JUBA 1OFBA 1XCFA 3CB8A 1YADA 1FDYA 3MYOA 2B0MA 3KFTA 3QRHA 4N9BA 2ISSA 5CSSA 3CM4A 2WOQA 3N2MA 3E96A 2VXNA 3M44A 3QZEA 1W1ZA 3MI2A 4HNUA 3SY5A 1EX5A 3YPIA 2RDTA 2QAFA 3TQ0A 2C18A 5HNRA 4NU7A 1FCQA 1SSGA 3CEUA 1NFBA 4Z0SA 3LHYA 3OG3A 3A5VA 3ZFHA 4IPJA 5U4NA 1OF6A 2X16A 4FX6M 2BSLA 3UY7A 3UXAA 5DLCA 4LW7A 4LY8A 2VFEA 1DV7A 3BW4A 2A0NA 3SJ3A 4FNQA 4UIOA 5LNUA 2DZXA 1KW1A 2YW3A 3LHZA 1X8FA 3HPSA 3GDLA 3WK2A 1EIXA 4BWLC 1L6YA 1CI1A 2J9ZA 3HJZA 4Y96A 5F4XA 2WKJA 1JCJA 3BG9A 3ELFA 1VYPX 2NX1A 2ABAA 1VC4A 2XFWA 1TPWA 1FWRA 1IIGA 4MZYA 5K4XA 1SW0A 3W2LA 3TW7A 4O4VA 2B4GA 3W86A 4GUJA 3PB2A 4JTJA 3W1NA 5CGQA 3HG3A 2WSQA 3EB2A 2ATMA 1TJPA 2C6QA 2VFDA 4GJ1A 4JTUA 1N55A 3UYCA 3S5YA 2ZRYA 4I7WA 4UFKA 1GG1A 3DH7A 3NG3A 1DORA 1TSIA 4N4QA 2C15A 4M7TA 4OGZA 2GQ8A 5DXXA 1G4TA 2PRHA 3DFQA 4YWIA 5K9DA 2R94A 1KM4A 3QC3A 3HB9A 3M41A 2OJPA 2DZSA 4HNTA 1MSSA 1Y0EA 2CLHA 4I9AA 1SPQA 3TMLA 3WJXA 3TX9A 1QNVA 1H1ZA 4PCFA 4FO4A 2ZZ6A 1JJKA 3TK7A 5G1TA 4E38A 3DFNA 4XBSA 1W3TA 3FYOA 4CNOA 3W71A 3TE9A 1XI3A 4CQAA 3S42A 1W56A 3L21A 5FEPA 2TPSA 1YPFA 3MP3A 1LYXA 4P2VA 1LRNA 4KFOA 5LHFA 3NQ6A 1OX4B 5K9XA 1F74A 3G24A 3DFTA 3PVFA 4JTIA 2QDHA 2A5HA 4O57A 4MPQA 4JX4A 3GZ3A 4DBDA 4I7UA 4B5NA 1ZALA 2QUUA 5KMYA 1GZGA 4KKXA 3L65A 1M7OA 4NJKA 5AB3A 1PE1A 1KTBA 3MBDA 1MEIA 4JTGA 4YCOA 3CHVA 1TO3A 5D04C 4AH7A 2V5LA 3HG4A 3NQAA 4ORMA 1L9WA 3LDVA 4M5PA 1W5QA 1UJPA 2E77A 4ADSA 3LHTA 3W3OA 1KM5A 2XN1A 1AK5A 3M16A 3JRKA 4O11A 1H7OA 2CZEA 4K6AA 1U5JA 3IGUA 4YMZA 2P10A 3C2OA 1KM1A 1TTPA 4QQ3A 3BLFA 3A24A 3W76A 3HG5A 3O15A 2DP3A 3TIMA 2A4AA 1OFAA 3NM3A 1XM3A 1FWNA 5FF4A 3IIXA 4JYFA 5BMWA 3TW6A 3PS7A 2Z6IA 1K8YA 1QFEA 3W88A 4JEQA 1G6CA 4AVFA 1F5ZA 3E49A 1SW7A 5EA9A 2E6AA 5F2MA 3FA5A 3W6YA 1QO2A 3E9AA 3BG5A 4UNLA 4UTKA 1X6UA 4AHOA 1TPB1 4CQ9A 2GVJA 3TV8A 1TV7A 3LBCA 3ZWTA 1YDOA 1OX6A 1GTHA 1LBLA 3QYQA 2QJHA 2QAPA 3M5XA 3S9YA 4M6VA 2BZNA 1TQJA 3W1TA 1G4PA 2FB3A 2Y70A 4HPJA 1G7VA 4PFMA 1QCWA 2J9XA 4KWVA 5G4EA 1BWKA 1OF8A 3UWWA 3GVGA 2FPTA 4ZQNA 3HGSA 2ZZ4A 1XC4A 4EIVA 1TPFA 1ML1A 3O63A 4O8RA 4NXKA 4O15A 3W2UA 1P5BA 3T55A 1XUUA 3DENA 3TC6A 4UUIA 1GPWA 3W72A 1T8XA 4WXZA 5HWMA 3IIZA 3W1QA 1Z48A 1ZNNA 3IGSA 4O13A 4WY0F 1IXNA 2BTMA 2CFFA 2CW6A 4PL1A 1GVSA 2ZDRA 3ZR4A 5AYXA 3S5ZA 1GJPA 4N6EA 3TROA 1TQXA 4AWUA 4Z0JA 3W7HA 3TMQA 1F05A 1UCWA 1H50A 4U4MA 5DY2A 1FCVA 1HO4A 2H6RA 5HUPA 3STCA 3TSBA 3CEPA 1QMLA 3LGEA 2X2GA 3S5NA 4L4MA 3IGXA 1VJIA 2GVGA 3UWYA 3L5MA 4UMBA 4A29A 1RQBA 4ZQCA 1LLWA 4N9DA 3QSRA 1FY6A 4E0CA 3EWWA 1JRCA 6ALDA 4JX5A 1FUYA 3MI3A 1EUAA 1EWDA 3EX4A 4UTUA 4LT9A 1YLVA 4X3ZA 1VPXA 2YXGA 4AF0B 4H6KA 3W1RA 3G8RA 3PWAA 3WK3A 3ZWSA 4CNNA 1OFRA 1E51A 2CLOA 3MHFA 3DI1A 3EWZA 3F03K 3GKFA 2ZQ0A 2FQIA 3NQ2A 3FJLA 4IMGA 4QISA 4Z1CA 3Q2DA 5DCEA 3T44A 1OYBA 3QMRA 4R33A 1S5VA 3M7WA 1M6JA 1ZHAA 1ALDA 1W5OA 4NJHA 4RLIA 2VOMA 1O94A 4AWSA 1KTNA 4IX2A 3LRLA 2Y63A 4LC6A 4RZ6A 1EP2A 1KV5A 3M5YA 3WJWA 5A5WA 1H61A 1DBTA 3IRDA 3G1FA 2BLEA 4OHQA 5K4ZA 4ADUA 2ISVA 1P4CA 4QNEA 3G1YA 2NXHA 4IMEA 4NT0A 3VCRA 1SO3A 3NM1A 3PF3A 4QM1A 1FDZA 3RU6A 2ZA3A 4RZ5A 2ZZ1A 4XTIA 1CX9A 5C54A 3NYZA 1A5SA 1O5XA 1DOSA 2G96A 5HWJA 1GEQA 3H53A 5DBTA 4WQ6A 1KA9F 2WSRA 2RFGA 3O05A 1NSJA 4ZVJA 5HJLA 3LI1A 3HBLA 4AB4A 4OE7A 3IVTA 3S0CA 1TPUA 3QFEA 3NR0A 4JD4A 3S1UA 1ZAJA 2PC4A 4BI5A 4O0KA 1PHQA 4UTJA 4Y8FA 1TV8A 1R2SA 1W5MA 4JTKA 5SWUA 4LUJA 1F2JA 1ME7A 1H1YA 5F2IA 4LS2A 1ZAIA 4JTFA 2YFNA 3NXFA 5K7JA 1BTMA 1QO5A 1VS1A 2V82A 4WUIA 1DJNA 1OX5A 4NJJA 1K7XA 4AAJA 1VGAA 1CW2A 2PRMA 2XN2A 2F84A 1R30A 1KM6A 4ZQRA 1V5XA 5KINA 4O1DA 5D09A 3LM7A 4FX8A 3NQEA 1MEHA 3O6DA 4R7JA 5CPOA 2X1SA 5FESA 2V2CA 3NZRA 4JDBA 3TR2A 1PHWA 2PE4A 3PY2A 3OVPA 3PUDA 1TPDA 3TCEA 1LLZA 5E93A 1TREA 4RV8A 3B03A 5CZSA 1GOXA 3LHVA 1BEUA 2ALDA 1JUKA 3C2RA 3LRMA 3SW6A 3W2KA 1EPXA 1G67A 3EX1A 1H63A 5EMUA 3GK0A 3B0PA 1T0OA 4FXRA 1AMKA 2E5DA 3DZ1A 3NGJA 4RCXA 3C3NA 3W7RA 3MMTA 4LTSA 1PCWA 1H5YA 1LORA 4K8HA 4RXGA 3CWNA 5L6UA 2Y7DA 4MY1A 3M9YA 1EP3A 2ZRZA 3NA8A 2QJGA 5AHNA 3EWBX 4AMAA 2DU2A 5AHIA 4TX9A 4XQ6A 3GDTA 5CZ0A 1KLZA 3NQDA 1GTEA 3QQ0A 1OG0A 5AHMA 4MY8A 1FWWA 4K38A 1F6KA 4OV4A 4MZ1A 5F4WA 3NAVA 1YXCA 5LNSA 2WNNA 2NWSA 5HMSA 4JIPA 4M19A 4GUHA 3PBWA 3LHWA 2H90A 3NZ1A 3FIGA 3H55A 1WDWA 1W54A 3R13A 2OZ0A 5BRBA 5D2TA 3T40A 3OVQA 2NV1A 3O07A 1JQVA 2Z2UA 3FOKA 1N8FA 5C55A 3D0CA 3SGUA 2QCHA 4UTHA 3FEMA 4GC4A 1ICSA 2C1HA 2QCNA 3L0NA 2FTPA 3ABRA 4P61A 3LRKA 4LVFA 2GVLA 4OV9A 1ONRA 5HQEA 2ZZ2A 5KZDA 3T7VA 3GKAA 1VCVA 3W83A 4BR1A 4E2BA 3NPVA 5D32A 3N14A 4PA8A 3EWUA 3SGZA 3IIPA 3QW3A 3NO5A 3OIXA 4O52A 3TDFA 5KITA 3PBYA 4JTEA 3KAOA 5D02A 2HSAA 4DO6A 4FX7A
chains in the Genus database with same CATH superfamily
1JZ5A 4WKHA 2Z4GA 4LALA 1V6VA 1FWTA 4HP5A 3CH0A 3DIPA 4ZQMA 3AISA 1M1BA 3NUKA 1LP6A 4PFHA 3SUWA 4LNCA 3DOPA 4YVVA 1US3A 1OINA 4F48A 4A3UA 2Z26A 3MSDA 1PDZA 2RDUA 4G7FA 1GW1A 3ITYA 1A53A 1DWIM 1WBJA 2O9RA 4AHQA 1X98A 4WD0A 3KLLA 5AVHA 3ZM8A 1YQ2A 3DGRA 3EB4A 4JX6A 3AIQA 3QTGA 2ANUA 5EL1A 1WB0A 2KAUC 1JCMP 5BWAA 3AUOA 1IIHA 3MO7A 3E5BA 4IFOA 4H9YA 5A8NA 2GGIA 1VHCA 4XZ9A 2ZZ3A 1XLDA 4IP5A 3KVMA 3CAWA 5HR7A 2NUWA 4J1OA 1FFRA 1FP9A 1F4AA 2JGQA 3FFSA 1LDCA 3PR2A 1U30A 1XFBA 3LZ5A 2ALRA 5EBAA 5G1MA 1M68A 2IKJA 1EJWC 1IXPA 4NNCA 1ONWA 4PCNA 3UCCA 3W9ZA 1W1A1 4DNMA 3GAKA 1RP9A 2PU0A 3TJXA 4P7LA 3ZJ6A 3N9SA 2G3NA 1P1XA 2FHBA 2YCEA 4MDOA 2RDXA 1UQYA 2ZOXA 1M04A 4M81A 4JDYA 4CQBA 3EKZA 3VYLA 3LNMA 1UD6A 5KZMA 3CPUA 3VM5A 1SVDA 2OSWA 3R8RA 1W3HA 3NQ8A 3W73A 4US5D 4F9JA 3M4HA 3DKLA 4OTKA 1L6GA 4TX6A 3VKAA 2BXZA 1M5WA 2GUYA 5H2ZA 3VFCA 3W7PA 2ZRUA 5BROA 8CGTA 4NZJA 3NQBA 5C9RA 4TV6A 1AG1O 1C8XA 1W1YA 5CLWA 4B92A 3N73A 3UZJA 1W1VA 5IHSA 3MU7A 3NGFA 3HG2A 1S5WA 3PULA 1B3WA 2FHCA 3F7JA 2Q3RA 1E5NA 4H6QA 4AEEA 3FS2A 5EGRA 3ZT5A 3W7CA 1S1RA 1KM2A 3PJTA 2WWCA 3DN5A 5DCDA 4ZGYA 3CUIA 3SFKA 4LVDA 3SUTA 5A6AA 4R7WA 4KWOA 3A47A 1JPHA 3DEQA 5JIPA 5C2XA 4QSFA 2A7PA 1DJWA 1MMFA 1YTKA 3T4CA 4GACA 5AN7A 1CWYA 4N9CA 3P74A 2I1OA 1VYRA 3SO7A 1W9BM 3LXAA 1CLXA 1GJWA 3UQNA 2Y6ZA 2AGTA 3B8UA 1KM0A 2BNJA 1Q65A 4JNYA 2C79A 4K39A 3EEZA 3N29A 3AUJA 1H41A 3GDMA 5ABFA 3ARXA 2BOGX 1XYZA 1VKFA 3MA8A 4TO8A 4C6JA 4KEUA 4UQAA 4DIAA 4LV4A 1TX2A 5F2LA 4AF0A 1F76A 2WVVA 3WH8A 3TC3A 2G3JA 1QOQA 4NF7A 4D71A 2BHUA 1XL9A 2VRKA 5CPQA 2Y7GA 5D37A 1AD1A 4CNUA 5JVLA 3UVAA 3EZ4A 2DSWA 1BPLB 1PBGA 4B15A 3M6DA 4JY8A 1J0IA 3GDBA 4EPKA 1W3KA 2H3BA 6TIMA 4F66A 1TWWA 4K7YA 2YYUA 1SMAA 1XXXA 2H3DA 1DVJA 4XWUA 3SCPA 2J8TA 2YR1A 2E9BA 1NM9A 2HPMA 2CNCA 3PZOA 4GLEA 3MDUA 4FNSA 4OJYA 4JIRA 2PZNA 3K8MA 2VHLA 4FNUA 3NVDA 1DJHA 3SAZA 3DHFA 2Y62A 2CBJA 3J7HA 2XH7A 4XIMA 1UA7A 3PZMA 4B3ZA 5I24A 1J6PA 4YL2A 4JN6A 3S1WA 3ITXA 1VEMA 5G2HA 4ZEPA 1VCGA 3B0UX 3BXWA 4LVGA 1EB3A 3T2OA 3KL3A 4TMBA 2H8ZA 2TRSA 4Z2JA 3WMBA 3EDKA 1J9YA 3MP5A 4EWND 3IJIA 4IWWA 2P3ZA 3DFYA 2ZA1A 4IGMA 1MQQA 2E1DA 4LH8A 1R87A 4POCA 4H9UA 4LOCA 3KRSA 3RDKA 3R0DA 4KQNA 3ZR5A 3RF9A 3S1GA 3WNLA 3VPLA 1B9ZA 4UFMA 5HATA 1J79A 4GJJA 5DRIA 1CGUA 2WMKA 2Z2BA 1ZY9A 1YDVA 4QR6A 4GKLA 4ALDA 3ABQA 4H3DA 2LLEA 1KRBC 2ZXBA 3OZYA 3MCOA 3G6MA 4O54A 4O1CA 3W7KA 5FCZA 4CCCA 4HU0A 4UR7A 1E6XM 2GFTA 3K4AA 1F61A 4C6FA 4EP8C 3S2LA 2QULA 3QPYA 4PMUA 3GG7A 2W27A 3B9EA 2AL1A 2YZ5A 4I8DA 3FAXA 3HGOA 4LUYA 1VAHA 1VYSX 4GC3A 4A22A 1KWGA 4NZFA 1E1CA 2OX4A 3PTQA 5REQB 3F4DA 1GOWA 4FOJA 1V7AA 1A0CA 2RKXA 1YW1A 4IXXA 5G2IA 2D69A 4BQ4A 3QY8A 4CVUA 1UPPA 2QJJA 2YCLA 4NXSA 1PB0A 3DFSA 4FSAA 4GUFA 1AODA 1PAMA 2C1IA 2GJRA 5FI8A 2QYGA 4DELA 3O06A 3BGAA 2VI0A 4FXJA 3EA2A 3K8LA 4IMDA 1V6YA 1XRVA 3AROA 3DXIA 4BK9A 4AG0A 3FJ4A 1RZMA 2FFCA 1S38A 1Z9AA 1OFDA 1UD5A 3F2BA 1G01A 1RR2A 2C0AA 2QUTA 3CIXA 3JU2A 1F07A 1S5MA 4MHBA 3NDZA 2PODA 4EF9A 3P8JA 2VMFA 3R0KA 1R3SA 1G4EA 3LSCA 4ZSUA 4NASA 3HZ3A 3WUBA 1C8YA 2PDNA 3I6TA 2O9TA 2DJLA 5J8LA 4H8HA 3DX5A 4PEEA 5I79A 2Q01A 1XYFA 4DRSA 3PZIA 3GXNA 3LCXA 3W1LA 3NL5A 3VE7A 4LUTA 4ZE4A 3L66A 8XIMA 2V5BA 3TJIA 1NTHA 3W87A 1H49A 1B9BA 3CHDA 3NYDA 2I5QA 4LS1A 4ONVA 1O6IA 5JU6A 1XG3A 5IM51 4OZOA 3LYEA 4YTQA 3ITVA 1RHCA 3HQNA 3VNIA 5J5DA 4XO6A 3WNPA 1UWRA 1ZENA 5E5CA 4L4LA 2AAMA 3PPCA 4ZA0A 3CAQA 5CXPA 3FDKA 1RBAA 1OQFA 3NVTA 1TA3B 1GYMA 2R1KA 4H9VA 2PA6A 3ANUA 3RUBL 1R3TA 5AC5A 3AHYA 2XVLA 3AYSA 5DRCA 3IEBA 4UFIA 1GNXA 3B05A 5A8MA 1PCKA 3BLLA 4YVXA 2FTYA 5FF3A 3M64A 3W7NA 2VEPA 3M46A 2CU0A 2JKEA 2WMIB 5FEWA 1YDYA 4IP7A 4IFKA 1RV8A 3KVKA 4Q8QA 3WEMA 3ARYA 1WKFA 3G3DA 4FF7A 1RLDA 5HR6A 3O9NA 6REQB 5A6JA 1REQB 3P67A 1V6WA 1V3IA 5FEZA 3L4WA 3E02A 3MI6A 3XISA 2VWSA 4BI6A 4IGNA 3LLFA 5XIMA 2QUVA 2J25A 2Q6ZA 2EAWA 4JIHA 2A3BA 5CLTA 1GVYA 4PULA 4KIEA 2ZYFA 4JZ5A 4FEZA 2CLIA 1K3UA 4I90A 5TAOA 3ZXWA 3VOIA 1CLVA 2OGYA 1VFFA 1I2PA 3W00A 2OWXA 1JCLA 4R3UA 4RDVA 2C8NA 1Q13A 3R12A 2NVDA 1YTEA 2YOCA 1VH7A 3W70A 2GK1A 3NL6A 3F5JA 3NPUA 4HZ8A 5I03A 4ZTXA 5FOOA 4JKKA 3AU2A 3N1AA 3WNNA 4DLMA 2JF6A 4UOQA 3RCMA 3W2NA 1P0NA 1V0LA 5FSDC 3TN6A 2EPHA 5DMNA 2QVHA 3P2VA 2R24A 3W7QA 1RK6A 2NV2A 4G9PA 3U7VA 3UD6A 4IX0A 3WQDA 3FKKA 2W5FA 3E12A 1I2NA 4FHAA 2A6LA 4I5UA 4DYKA 1JPIA 2EG8A 2ON3A 3WLOA 4H2HA 1DKWA 3AI0A 2Z6JA 3PTDA 1UR4A 2J6XA 2PWHA 1X7FA 4GCAA 4Q8TA 4CQ8A 1Q6QA 3ZOAA 2FLIA 2CLEA 4AIBA 4A4AA 1NFGA 4YS1A 2HQAA 1MUMA 2ZRVA 2G4JA 3IIVA 4YXGA 1TFVA 4WY0A 4RXFA 1TRDA 3GDRA 1M41A 4EKJA 4GIYA 3GYEA 1E40A 4Z2IA 1QBAA 1IXOA 1MUCA 2CBVA 1XRSA 3TW9A 1LUCB 3OLIA 1N8IA 5HINA 3WQPA 1L6WA 3LK6A 3CU2A 1KKRA 2AMXA 3RX2A 2XSXA 1ZJAA 5I02A 3VNKA 2WSYA 3A6OA 4Q8OA 4AZHA 3TSMA 2W0UA 4U28A 3RRXA 2VUNA 1US2A 2R14A 1OADA 4DAFA 1WAWA 5CCZA 1RH9A 1P1MA 5F1UA 4XBKA 1JAKA 3CWOX 3LBOA 3A4WA 1O5KA 2PWGA 3KP0A 3NQVA 2AAAA 2X1TA 4UFLA 1KCLA 2YIHA 1Q8JA 2CETA 4KRTA 2Y24A 5FD0A 4B4HA 3QOKA 3VOHA 3O0KA 4WLCA 3U2CA 1AL8A 4ROQA 4Y8EA 4WOZA 1EFZA 3VGHA 3PG9A 3MMUA 2XH4A 1TYGA 3E2VA 4B5TA 2A85A 3K4DA 3HO8A 3RCNA 2H9AA 1GZ1A 4AZCB 4QE4A 4NAFB 5HK4A 1YNYA 3W0KA 1UD2A 2I14A 4KFNA 1ME9A 3A9IA 4N2YA 2PRLA 3BAXA 1F7BA 3GTHA 4HA0A 2XJ7A 4NJIA 3Q65A 1ZJIA 3GTXA 1F8MA 3G1HA 3LCIA 3WLKX 2DIKA 1RY8A 1WDPA 3BZGA 4W89A 9XIAA 2F2KA 3QV7A 1TV2A 3T0CA 3PHAA 4RZBA 1NP2A 4L1WA 2X1RA 3GUWA 4FLSA 2FGZA 1K02A 4LUTB 4C6MA 1XDLA 2EKCA 3TSDA 2XIOA 5C7VA 1T96A 1HJXA 2AMGA 2Y1HA 4JXCA 1EOMA 1SJCA 2VEMA 4JICA 5TBOA 2NQ5A 3U8GA 3DDMA 4AYGA 1QU4A 2YZRA 3CTLA 2XN0A 3GXMA 3TN3A 4HU3A 3BJTA 3QFWA 4O14A 1KFLA 1QNRA 3EGJA 2YCKX 1R47A 3VNZA 2PSNA 4ACZB 5AY7A 3QGVA 2PDHA 3LQGA 2CBIA 4AD2A 3S47A 4A21A 3UG5A 5G5IA 5JH2A 2F2HA 2XWEA 4IG2A 4O0ZA 1PZ1A 4HSOA 4IM4A 1GJUA 1OVDA 3I68A 1EJRC 2I9EA 1VBRA 2WZMA 5EYWA 1U1HA 2F6UA 3AU6A 3B9AA 4M6UA 4DWSA 2GYIA 2ZVRA 1TMQA 3ALGA 3EAUA 3A22A 4UQ9A 1SO4A 1VR6A 1WBHA 2E5BA 3KL0A 1A3WA 1T6MA 4UC5A 5H1WA 2PB1A 4JFTA 1C9WA 4FOKA 1ZJHA 3O8AA 1H7XA 2O4QA 5CEWA 4U3CA 1AZ2A 4KCWA 4IICA 4CNSA 1W32A 1C91A 2B7NA 2CLLA 1XIIA 4HGXA 1QT1A 2FVKA 3MO4A 2GPTA 4MNJA 1VPYA 2QCDB 1XKJA 2A3LA 1DWJM 5AYZA 3P8IA 3JW7A 3UWVA 4QJ1A 2E40A 4AMCA 1JCYA 1MFVA 4UTIA 2C3ZA 2A79A 2ZA2A 4FI4A 1V02A 2FJKA 3QR0A 2VWTA 3GTNA 3W2MA 4S2BA 1E6SM 3THCA 1TTJA 2XM2A 1TB3A 4P7NA 5TF0A 2CC0A 1Q7MA 2DUZA 3EXSA 1IEVA 2PGEA 2WJFA 3H2EA 4XD4A 3EDDA 4LAZA 5JUVA 1OFOA 3AHZA 3W22A 3R6IA 3WDIA 3H2NA 3EXRA 4DEFA 4XKYB 5JBDA 3I4EA 1RPKA 3RLVA 2DIJA 1R0MA 4OOZA 4R88A 1UZHA 4M1RA 2OMAA 2OXNA 4PR4A 4HN8A 3E2QA 4AZ5A 1P0KA 3UWZA 3RG6A 1JI1A 1MEWA 8A3HA 5HBFA 1QI4A 1T41A 3TTYA 1XR2A 3FXYA 3L4XA 3QZAA 2VURA 4IL0A 4L80A 5GJMA 1DXIA 2O7SA 3BURA 1CPUA 3HGJA 4W5UA 2PD9A 5CSYA 3VKDA 1PL9A 2AOSA 3UPBA 1GUVA 1ZBCA 1XLAA 3AS2A 2J66A 1Q63A 4KWSA 1M7PA 4W93A 3QBUA 1H0IA 4UB9A 2NXGA 3QSTA 5L9FA 4W4QA 1MNSA 3G1DA 3DBNA 1A50A 2JIEA 3T07A 1EDTA 4A2SA 3WF1A 2PDQA 2DH3A 2JKAA 4RK8A 4B91A 2IS7A 3C0LA 3ATZA 4ATWA 1KCKA 4IPIA 1OK4A 1SFLA 1JUBA 2DQWA 3UG4A 1MDLA 3K8KA 3U5YA 4OUEA 3E2RA 3I3EA 2E3ZA 3SY5A 2PWVA 2V5JA 2RDTA 3N6JA 3EOOA 1MYRA 5HNRA 2QF8A 1SSGA 1NFBA 1XISA 1U1UA 3ECQA 1JDAA 2DT2A 1XRTA 3BOFA 3UY7A 2BSLA 3QQWA 2PDPA 4LW7A 2IKHA 2VFEA 1WKDA 3SJ3A 1PYFA 1A49A 2QHAA 4UIOA 2DZXA 3TNBA 2YW3A 1J5SA 3LHZA 5HPCA 3HPSA 1EDGA 1EIXA 5FIPA 3MKVA 4BWLC 1L6YA 1CI1A 4Y96A 3GBDA 1JAEA 4B2DA 3OYZA 4S38A 4V33A 3UZWA 3ELFA 1VYPX 4FZIA 3RM9A 2ABAA 1UKPA 1XSIA 2XFWA 1TPWA 1AQHA 1FWRA 3MS8A 3QY7A 2WC3A 1IIGA 2BDQA 1K4HA 4GABA 2B4GA 4NSBA 4O4VA 4AD4A 3PB2A 8XIAA 1UP2A 1DYSA 4M8UA 4AIEA 2VFDA 4GJ1A 4JTUA 2G4FA 3BOLA 3BAYA 4MUPA 1EJXC 1LT8A 1IZCA 3UYCA 4YHEA 2ZRYA 1GG1A 1CXKA 3NG3A 1TSIA 3DESA 1CBGA 1OCJA 2PRHA 3DFQA 5K9DA 4RPPA 3M41A 3ZYZA 5LYRA 1UUQA 3UGVA 1Y0EA 2CLHA 4X60A 3TMLA 3SN4A 1VFOA 2F6KA 4ZO6A 4PCFA 3VNYA 2ZZ6A 3IARA 1D8WA 4FR1A 1FHUA 1XI3A 4H04A 4M24A 1DJZA 1YPFA 2X0SA 4P2VA 1LRNA 2AQVA 4LAKA 1EA9C 3DFTA 3PVFA 1PDYA 5CGTA 3ZLFA 1KB3A 2AKZA 2AQOA 3FVMA 3GNXA 4KKXA 1KBLA 1R85A 5AB3A 3ALFA 1QK0A 1PE1A 3LPPA 4NZCA 1SFSA 3A12A 2C91A 5LIKX 2VD8A 4GD0A 4YCOA 5LXXA 4AQLA 1TO3A 1YKWA 3KS6A 1GQJA 4D1IA 2FHFA 2V5LA 2WYSA 3F4VA 3HG4A 3KCOA 4XD6A 4M5PA 1MXDA 1W5QA 2ACUA 3JZUA 1A5KC 3LHTA 3W3OA 3GG8A 4BF5A 3JRKA 4QLLA 3K2GA 1FTXA 2CZEA 1TJ2A 4AWEA 4Y9OA 5BOEA 1P6WA 1A5NC 3AHVA 4QQ3A 3A24A 3URNA 3O15A 1ZQ5A 4MF4A 4U31A 4LAMA 4FAMA 1JCTA 2A4AA 3NM3A 5I3DA 3IIXA 5BCAA 1WO2A 3KEHA 3TW6A 3BC9A 3VXGA 1E15A 3HA1A 1SW7A 2E6AA 2VT0A 1KRCC 3LY0A 1P0DA 2WSKA 4UNLA 4AHOA 2NQHA 2XIJA 2GVJA 1TCMA 3ZWTA 1GEHA 1GTHA 3QYQA 3ZVHA 5TNVA 3M5XA 1DXEA 3QN3A 1FWJC 4M6VA 1B5TA 1HZYA 3RR4A 1TQJA 2FB3A 4HPJA 2OGJA 3VKKA 1POKA 4PFMA 4KWVA 5G4EA 2MNRA 3VD3A 2XINA 2FPTA 4ZQNA 2ZZ4A 3DC0A 3SQMA 4QJ5B 4PMQA 4C7GA 3GO2A 3W2UA 2IXUA 3WQWA 1GPWA 3W72A 1ISWA 3GFZA 4MWAD 4DJFD 3OTRA 1Z48A 3IGSA 4O13A 3GVRA 2CW6A 1E0VA 3ZR4A 3S5ZA 4WSJA 4AWUA 3CT2A 3LNPA 1KGXA 4ICCX 3CUJA 4U4MA 2H6RA 1T5AA 4I6KA 2I16A 3S5NA 3REQA 3VD4A 4B5WA 4QJ4B 4ZQCA 2ASHA 2ZUVA 4GH3A 4GZEA 4E0CA 4JX5A 4QS5A 1BXCA 3DECA 4J3VA 1FVPA 4RE4A 1YLVA 1VPXA 3CV2A 2YLAA 4AX7A 4CUCA 2PTXA 2QXWA 3BSMA 4H6KA 3QLDA 4GIEA 5I09A 3G8RA 4CNNA 1OFRA 2CLOA 3ARSA 2ZQ0A 1Q4WA 4DUXA 1EX1A 1PSCA 3UT0A 3AZSA 3QMRA 1MFUA 3PTMA 1M6JA 3QC0A 1ALDA 3VMPA 3W25A 2WZTA 2F38A 1F6YA 1EP2A 5AVNA 1KV5A 2BS9A 2Z1KA 1EGVA 4P8WA 4CU7A 2V69A 3WUFA 5C7HA 3IRDA 2HK1A 2FMOA 4ADUA 1P4CA 2OQHA 3VO0A 4J7RA 1Q5MA 2Z2AA 8RUCA 4OBRA 4ZB2A 3E0LA 1UKTA 1SO3A 2VZVA 3H7VA 3SCTA 1XLKA 4GNVA 3U2EA 2X41A 4FPSA 3TLQA 3EOUA 5C0QA 3BTNA 2J62A 2G96A 4S3AA 4C6KA 4TV5A 1LL7A 1Q66A 1W3JA 3PAOA 1D2KA 2F9RA 3LI1A 2ICSA 3IVTA 3QFEA 3NR0A 2WWDA 4JD4A 3KDNA 2BODX 4Q4QA 7A3HA 2FMNA 3WDRA 4FXFA 1TV8A 4D1JA 5SWUA 4LUJA 1ME7A 4HU4A 1DXFA 2ZUWA 3RLHA 5F2IA 4LS2A 2F6XA 2YFNA 5D9MA 1WDSA 1VS1A 2UY5A 4WUIA 4C6BA 1DJNA 3ZLGA 4L5ZA 4NJJA 1K7XA 1VGAA 4KETA 2PPGA 2I56A 2F84A 2YLLA 3WO8A 1V5XA 3ARTA 4O1DA 2WC7A 3E3HA 1F3EA 4XZWA 2X1SA 2PGWA 5FESA 3K5XA 3TR2A 2V5CA 3WH9A 5DANA 3FGCA 3PY2A 3PUDA 3UWEA 3TCEA 1TREA 4BF7A 4C1NA 1GOXA 3LHVA 3C2RA 3IWPA 3W2KA 1OC5A 4AFYA 4DNHA 1H63A 1OT2A 4BJHA 1B54A 3GHUA 5IHRA 2DPEA 3W7RA 3PNUA 3R58A 4RXGA 5FJIA 2BY3A 5L6UA 3GFXA 2FGBA 3GHTA 4H9XA 1B3ZA 4J28A 2J7CA 3GDTA 5CZ0A 1FWDC 4IPNB 4GO8A 1FWWA 2OB3A 2YB4A 1XH0A 2NLYA 4DO7A 5CPSA 2G3FA 1J6OA 3CHCA 3A13A 2X05A 2JALA 4QG9A 4M51A 3EWCA 3R13A 1PIGA 1JL8A 2DV0A 4KH2A 3ZVIA 2NV1A 1UQZA 2QCHA 4UTHA 3RN6A 1JZ4A 2EPLX 1XH2A 4AX6A 2QCNA 1XYCA 1OT1A 2ZVIA 3LRKA 3OVGA 2VL4A 1ISZA 1ONRA 2Q71A 2ZZ2A 4GI9A 5KZDA 3S46A 3GKAA 1VCVA 4WR3A 5D32A 2VQTA 3N14A 4PA8A 2PDXA 1JGMA 4XZIA 3STPA 4XAGA 3LN3A 2XISA 3GNOA 2VR2A 5D02A 3ITGA 1TUFA 4H00A 1GOOA 1XGDA 1EHAA 1D3HA 4OIFA 1C92A 2E7FA 1EQPA 1IWBA 2Z27A 3H4GA 1Y5VA 4I9JA 4PUDA 4XD3A 1I6NA 1OD0A 4RE2A 3LCLA 4QROA 3SSZA 1CDGA 3QW4B 4CD7A 4ZXLA 1GZJA 3RPDA 4QNWA 2OX1A 4NJGA 1E9YB 3B04A 1YPIA 3RHGA 1ECQA 3POHA 4NYUA 5D2YA 2GWNA 4HZMA 2X40A 3A21A 3RU8X 1YPXA 3VIIA 3HPAA 3FNDA 3IIOA 4XO7A 2VRQA 4M80A 1QHOA 3L4TA 1XBXA 4AZCA 1ITXA 2G95A 2PBOA 4UTLA 4NRRA 1XUZA 3PUEA 1S3HA 3CQKA 1M7JA 5DEZA 1LQ0A 1VLWA 1B3VA 3ES7A 4D6FA 3ZSSA 4ZQOA 5E9AA 3IVUA 5CG0A 4AHPA 3SCWA 2J7EA 4ZB5A 4WSHA 1I4NA 5IBXC 2XFFA 4CQDA 4YWSA 1U1JA 4NZ5A 4TQTA 3UPWA 1H5VA 1K03A 2W67A 5D2XA 1FWHC 4O10A 3CIVA 4B5UA 2NUXA 4HCDA 3WD4A 1Y7VA 1YXDA 1L2QA 4MJMA 1FWEC 2FZ8A 1L2UA 2Q02A 4YTUA 1AH3A 4JTLA 3LM3A 1JYXA 5T8GA 5GNYA 4DBEA 1Q4NX 1D3GA 5D2WA 1HVQA 5LKYA 1PV8A 1NF0A 4X61A 3MYPA 3WLMA 2MUCA 1MZRA 1OC7A 3VUPA 3BDKA 3H8AA 1EEXA 4HA3A 1FKWA 7TIMA 2IW0A 2EF9A 3AMLA 3CIWA 2V5DA 2QKFA 1ADDA 1ELSA 1MXSA 3LXBA 1BAGA 4QEHA 3V0UA 2RGMA 3EPOA 1KXVA 3TWBA 1OGGA 1H7RA 1TWDA 2PLMA 4JYDA 1DEDA 2QZRA 2VKZG 4HMDA 3KP1A 2DORA 5AZ0A 1UWUA 3WFZA 3AO0A 3VDCA 4C6IA 4M56A 2BVYA 1XYAA 1AW2A 2VYOA 3BW2A 2QS8A 1O1ZA 2DJXA 2C71A 4OECA 1AJZA 3GW0A 2BXVA 4FLOA 1FXPA 3NOEA 2QCDA 3V18A 1Q6RA 4OBTA 4J3ZA 4CD6A 3RXZA 1A5BA 1J8VA 3C61A 1WOBA 3W74A 4NRSA 2X30A 4KESA 1LOLA 1ZP4A 2R9RA 4I5RA 2HISA 2D24A 5CC7A 1H4PA 4B5VA 4REQB 2J88A 3CMFA 2IKGA 1GYLA 4HYVA 3TOYA 3WQCA 5EMJA 3SCVA 1FP8A 2CZFA 5HUOA 4JQ3A 5HJYA 3SRDA 3DYMA 2R91A 4XKYA 2D73A 1VZWA 1RCQA 1WE5A 5BMXA 1WP6A 2D2GA 2X7VA 3W7DA 3T1GA 3PNZA 2WHLA 1VQTA 4QQUA 1OFPA 4GGBA 4M6PA 4IQEA 2NV9A 2W6RA 3CS2A 2WQPA 3SCQA 4GYPA 4UMCA 4IIBA 3CQHA 3DG7A 3L4ZA 1JQXA 1BQCA 1UWIA 2QGHA 3WBEA 5D9PA 3VZYA 2VD9A 2WM1A 2QJNA 3DU0A 1QPNA 4V1YA 4GFIA 1EBGA 2QUMA 4C1LA 2OYLA 1Z41A 4EAMA 5ABHA 3TAKA 2PS2A 2GGHA 3GIQA 1IT7A 2GUUA 3SEPA 1K4GA 3G5EA 2KZHA 4R27A 1PO9A 3BARA 1TZZA 1CTNA 3B4UA 5BOOA 5CC6A 2E25A 4FIRA 5HNUA 2O9PA 1RQHA 2G41A 4UBPC 3VGFA 1WZMA 3O6AA 2PDCA 3M1ZA 2TAAA 3A23A 4L1XA 4LBSA 3KBJA 3S2MA 3W7JA 4BQ5A 1KXHA 1XWYA 4LWWA 2VX7A 3LI0A 3SB0A 5E0KA 1FWSA 3HV9A 5M17A 5A6BD 5JIWA 2E68A 2GVEA 4JTAA 4MB3A 3LPFA 5I3IA 4QS6A 4UWMA 1FHLA 2XGZA 3VGBA 3N19B 2FYMA 3MUCA 1ICQA 3OLEA 5DN1A 1V3HA 4DY1A 4KEVA 4K37A 4W88A 3WQ4A 4S3JA 3WFLA 5C9WA 8TIMA 4LBUA 3LX9A 5BZAA 4LAOA 4NNAA 4PTWA 2FIQA 5I7GA 4RPQA 3VOJA 4JNMA 2GJNA 2CCRA 4Q8VA 1GCYA 2DSVA 4CCEA 1PTDA 2XFRA 1V3KA 3BAWA 4GVGA 1HJSA 4KRZA 4PMXA 3ERPA 1SGJA 3O3RA 1XLCA 1KD0A 2BGSA 1S2TA 1NVMA 2R8WA 3PPHA 1IZJA 1AW1A 5I3KA 3NL2A 2V38A 1WYIA 4BFAA 3S2NA 2ZX8A 1G69A 3MP4A 3NL3A 2WMHA 1ZBKA 3W1MA 3OZPA 5EFDA 2ZRWA 3DCPA 2C16A 4CD8A 4HJFA 2IQTA 2X1IA 2Z1BA 1LL6A 1SO6A 4H9TA 5K3VA 4MJZA 2XVKA 1GK8A 2REQA 1S2UA 3ME3A 4TU1A 2VO5A 1AQMA 4F0RA 3VIOA 1PIIA 4DPQA 5CC3A 1NU5A 4IJRA 2R1LA 4IHCA 4HT3A 2OPJA 4MUZA 3BQ5A 3QJAA 4DF2A 2PDLA 4NI3A 2J7GA 2O7QA 2ZUUA 1H09A 2G97A 3B4YA 4O16A 2YXOA 4F2TA 1SZEA 3ZIZA 2CLKA 3TWAA 2PURA 2HWGA 1ZUAX 4GBDA 2JKPA 1FCBA 1OHLA 1EF3A 3TR9A 5TD4A 2ZE3A 2W4XA 3VNJA 3MW7A 5LA0A 2B7PA 2ZICA 3TQKA 3S6TA 1BYCA 4JN8A 1UYQA 2CWXA 3MB9A 4JHOA 3W1UA 4YNGA 4H7CA 3AALA 4O50A 2PGRA 4HHPA 3CC1A 4LRSA 4OT7A 3LCWA 3E2SA 3V35A 3VX0A 2OYMA 3FYPA 3IUHA 3P80A 4Q8NA 4BS0A 3WMSA 3THUA 1TPVA 2FPVA 4DJDD 3L4UA 3GXTA 1I1XA 3TYUA 3VIPA 4G7EA 4O1AA 4WGXA 3F2DA 4BA0A 4Z2KA 3U4FA 3FVDA 1P43A 1J5TA 1O1HA 4UFHA 4KCVA 2QDEA 5D8ZA 1BYDA 4IFKB 2QGYA 1MQRA 1CENA 3C0QA 3HPZA 4ZSTA 5AYYA 1H7PA 4PH6A 1IR2A 1U33A 3FN9A 3L9CA 3RK8A 4XTDA 3SY1A 3M5VA 3UNDA 3C6CA 3LHUA 1LRQA 1OCBA 1TV5A 3VGDA 1Z44A 2NVCA 4JTHA 5AC7A 4BCEA 3SI9A 1NOUA 4PMVA 3WK1A 5DELA 4ZOCA 1JFHA 4KWUA 3T42A 4A2RA 4GYPC 2PDBA 4GNKB 4HNNA 4MB4A 2ZZ7A 1LL4A 2P8BA 3H24A 3KTCA 4XSLA 4RJEA 5I78A 2QVNA 3GC4A 3L12A 3APTA 4O28A 3RPTA 1WKEA 3W85A 4HN4A 4HMCA 1B31A 2CBUA 3UGRA 2V0TA 4JY9A 3V5FA 4MWAC 5CGMA 1F3XA 1J0YA 2YA0A 4GY0A 2A3AA 1FXQA 4FK9A 2Y7FA 4GQ0A 2ZWYA 5LGZA 2CHOA 4Q4RA 2VX6A 1EC8A 5B7ZA 3QKEA 5EMMA 4GUIA 3NOYA 2E5CA 3MVTA 4GGHA 2VFFA 2YFOA 3H6OA 1SYTA 3DAQA 1N2VA 4AIOA 2QJMA 2TYSA 3L0GA 3OIHA 2PP3A 5LIWX 2VZOA 3OBEA 3L5LA 3M0ZA 2BVDA 3OOQA 4MOZA 1DIDA 3NZQA 4D6HA 4JFVA 2PDFA 2VR5A 2VUYA 3EDFA 3O6CA 4V1XA 3C2VA 4LQ1A 3WLJA 3CZGA 1NDWA 2JE8A 1VF8A 1SFJA 4IZGA 2POTA 4LGXA 4LV9A 4M0XA 5KZ6A 1XSJA 3M43A 4ERAA 4DJEA 4HTYA 5DX7A 4RNFA 3IJ8A 4R9OA 4UTWC 3IANA 3AICA 1UR0A 4RNHA 4IMFA 3B97A 1UJQA 5LHEA 3W07A 3C0SA 3LGGA 4WXYA 2YSWA 1U22A 1Y5WA 1UZ4A 4LFYA 1ODUA 5I3FA 4WDXA 3CK5A 3CH9A 5H91A 2XWDA 5A3HA 4WDUA 2JBMA 1W31A 1WQ5A 2ZX7A 5FL0A 5CZKA 4JYEA 2WNZA 4KRUA 4YPJA 4F3HA 1OFEA 4ZQPA 1VFTA 2PEVA 5AOUA 4IQJA 1LQAA 4AC7C 4DPPA 4RR4A 3OHIA 1WAUA 1WXYA 1X6NA 3GAYA 2OG9A 4PYSA 1OJXA 1QNPA 3LBMA 4JR5A 3L5AA 3P82A 6XIMA 4MG4A 3S9ZA 4GRSA 4D8ZA 5C6MA 1TMHA 2YDAA 3QMTA 4F8XA 4Q6JA 4HK7A 4KCUA 1JVNA 2PDIA 3O2LA 3F4WA 5E6YA 4HSNA 1JPDX 3CUHA 2YX0A 3ZLHA 3UPMA 2ADAA 3SZ8A 3CWHA 3EEGA 1TTIA 2POZA 4N4PA 3C3UA 3JUGA 3U0HA 4Y90A 1SQ7A 1TVLA 3KVJA 2C19A 4F2BA 1CECA 3HGRA 4UTWA 2VFHA 5JBEA 4M7SA 1WDDA 3V16A 4E2DA 2BMBA 5LNRA 3GVVA 1AVAA 4LNYA 4FB7A 3KHDA 1ZU8A 1IYXA 2V2DA 3MJYA 3HMJG 4P8VA 1Z32X 3PZUA 1HT6A 3LB0A 3MUIA 3SR7A 3GX9A 1DWFM 2I5IA 2A7NA 4H83A 4U5IA 3N2OA 1P6CA 1UBSA 3GH7A 3UZZA 5JXQA 1V02E 2W92A 3ZSTA 4A8IA 5DY3A 4RNIA 2MANA 2VCBA 5DT5A 1HTIA 2W66A 1DJGA 4MFEA 5G2WA 4PTVA 2SFPA 2WC4A 5I3HA 3BANA 2OCZA 2NX3A 2XTKA 2GDUA 3BAJA 3WK0A 1QATA 3KOWA 4IG2B 1XIHA 2XPKA 1XGZA 1OIMA 4QHRA 3TTOA 4UTTC 3PK7A 3GNPA 3QYSA 3VD9A 5HQLA 4FALA 4JQ4A 1LM1A 3MUXA 4S3DA 3VKCA 2D3LA 3CYJA 5ECUA 2QIWA 4Q3MA 1GKQA 3WQ5A 3CUXA 3G18A 3PP7A 1QHPA 2HCVA 4TR9A 4AZIA 3CQIA 4GMEA 1Z6KA 3PAJA 4Y9MA 1J0JA 1U2YA 3R89A 3HF3A 1PWLA 1PKLA 4DB7A 1XBVA 1IGWA 3A3XA 3T81A 2FZNA 4CQCA 3TOPA 3N04A 3THAA 4H8NA 3W23A 4G56A 1M9HA 1WZAA 3MV01 3TJLA 3M0XA 3EB3A 4AIUA 3UZXA 1I2RA 1SJAA 3N11A 1XKYA 3AJXA 3DG6A 3ABZA 2XIQA 3H12A 1FWGC 3QM3A 1GPFA 1T99A 1XV8A 4XZNX 1FWAC 3ZO9A 3VZZA 4O12A 4QP0A 2P1FA 3BE7A 4M6QA 4DJFC 1W37A 4ZCWA 2ZWZA 1FFQA 3U9IA 4A6GA 1H2JA 1P0EA 2JEPA 1J12A 1SR0A 1E70M 6CGTA 5MKGA 1KRMA 5EU9A 1YE4A 3BQ6A 1XCXA 5FJRA 2DH2A 1O4UA 3GXIA 3NURA 3UZYA 1BSIA 1ZSXA 1VFSA 3N9RA 3ZZ1A 1O5RA 4LCRA 1HL8A 3R8GA 4GNJA 1A5AA 3N2XA 5XIAA 1A3XA 3GTIA 3PBUA 5EB8A 4O53A 1EGZA 4AVNA 1XLJA 4JL2A 1DQWA 4HKPA 4HOXA 4WY0B 3KL5A 2VDIA 2OKOA 6TAAA 3EA3A 3R8HA 1VBGA 3AJ7A 5LSMA 4ENLA 1JRBA 3WQOA 3VDBA 3WLTA 3V75A 3H54A 3FK4A 4L9XA 2X09A 3POCA 1EQCA 3G1VA 4JKMA 3GC5A 5BU9A 4G6CA 4YIWA 4A8NA 2NXIA 4XX6A 4H19A 3L68A 5C5YA 4KS0A 3UCQA 3WF2A 3HFTA 4MFDA 1DIEA 5HWNA 3M0MA 2HROA 1TMLA 2O92A 3IRSA 3H2MA 3IV3A 1NOFA 3K30A 3ANYA 4AZBA 2Z1SA 3EMZA 3SRHA 4PSRA 3FJNA 4XVDA 1HL2A 2OT1A 3ABOA 3NQGA 3S83A 4HOWA 2HS8A 1XG4A 3W4RA 1T40A 2ZKMX 4RL3A 2F7FA 2QCMA 4EVZA 1KM3A 4V2XA 4RZ4A 3VIKA 2X7WA 3AXMA 4DN1A 2PCQA 3WSUA 1RALA 1Q6DA 2ISWA 3E1F1 2G0WA 1G7UA 2GJXA 3V4BA 1E73M 1I2OA 1M03A 4K3ZA 3CZJA 3CLMA 5HULA 1FOBA 3OBKA 4C5YA 1YEYA 1NJJA 4FNPA 2A1YA 4QG8A 3BL3A 3PBGA 3G0XA 4YJ5A 4R5EA 5LA1A 3OQEA 1RK5A 4CCZA 4EF8A 1MW0A 2QV4A 3UCDA 5G4WA 4CLMA 1A5UA 1HKKA 2D0GA 4C60A 1P0BA 1OFBA 3GVWA 1FDYA 3QOMA 1M3UA 2B31A 3KFTA 2ISSA 4XZMX 4HCHA 2WOQA 4I5XA 2IQDA 2Y8UA 2EPNA 3QZEA 3A9BA 4JCMA 1W1ZA 2F8QA 2JEQA 3SY8A 1NDYA 3MCMA 1RXOB 2QAFA 4NU7A 1FCQA 2R1NA 2ACRA 4IIFA 3OG3A 3A5VA 3ZFHA 3NDYA 2X16A 3MTWA 4XV0A 2DVUA 2CLPA 3WBXA 1XP3A 1VIWA 3RM8A 1HP4A 4DHGA 2Z28A 4LY8A 4UQBA 2YL8A 3TYEA 3BW4A 1TVNA 1BVWA 1BRLB 4W85A 1TKKA 1XLIA 2Y8VA 4FNQA 5LNUA 5D9OA 1JZ3A 3BLDA 3IACA 4PRTA 3SUVA 1X8FA 5HMDA 1EOKA 3GDLA 4Y9PA 6A3HA 4QJ3B 4J35A 2J9ZA 5F4XA 3ANVA 1UA3A 2WKJA 1JCJA 2QMJA 4JL1A 1EDQA 1ZLPA 2WANA 3E5PA 1MQPA 4DWSC 1VFLA 4MZYA 5BU6A 4XD5A 3TTSA 4D6EA 3W86A 4GUJA 4Q8WA 2DZAA 2CERA 1L0PA 4JTJA 3HG3A 2P50A 1JDEA 4H41A 2X8RA 3EB2A 1XIMA 4UTFA 3FCPA 4IP4A 3SRKA 2OOFA 4GHRA 1N55A 1O7AA 3OW1A 4UFKA 3DH7A 2BV9A 3NTYA 4OGZA 2ZUMA 5DXXA 1W9PA 2WHJA 3VTRA 5CBBA 5CBIA 4UR9A 3HB9A 1V77A 3T08A 3WLRA 4DM2A 3U5UA 2HRWA 1IHIA 2PDJA 1HKIA 2OLAA 2ZIDA 5FJOA 1P7TB 3UXIA 3WJXA 1UPMB 4HVXA 1JJKA 4HJWA 3QV8A 4E38A 2OO6A 1TELA 2GDVA 3S42A 1W56A 3MSGA 4ACYA 5FEPA 2HNHA 5LHFA 2DSUA 4E4FA 1OX4B 1O68A 2HBXA 3FY1A 3OLGA 4O57A 4C6CA 4QE5A 4MPQA 4OBSA 4JX4A 1UC5A 2IXVA 4I7UA 4C6PA 4KGLA 1ZALA 1E4MM 4E4UA 5KMYA 4NZ4A 7ODCA 1O66A 1XD0A 4NJKA 1ONEA 1J11A 1HL9A 1JZ6A 1NELA 2GK1B 5A2AA 1KTBA 3VOCA 1GORA 1PZ2A 1P48A 3WELA 5D04C 2DT3A 3BAKA 4XSMA 4AH7A 1BQGA 2VX5A 3NQAA 3RMEA 3FSUA 4ORMA 1L9WA 2HDJA 3BJSA 4ADSA 2Y2WA 3S2JA 3CQJA 1AK5A 2OZTA 3M16A 1RSCA 1FKXA 1TZ9A 1H7OA 4K6AA 4DXXA 2PBGA 1NARA 3IGUA 3C2OA 1TTPA 2GUBA 3CL6A 5A2CA 4HQVA 4DM1A 3HG5A 1BYAA 3TIMA 3QY6A 1H3GA 1OFAA 2L5HA 1Q8AA 5FF4A 2D0HA 3NZGA 4JYFA 3GU9A 3R10A 2Z6IA 4Q8MA 3VM7A 3WKZA 1G6CA 4AVFA 4CKQA 1F5ZA 5C70A 2EG7A 1DTUA 3W6YA 5FAJA 3VILA 1PTAA 2CEQA 1HVXA 1TPB1 1PX3A 2QNEA 3LBCA 1RJPA 3E38A 3NSMA 3OYXA 1MVYA 4PB4A 4V15A 2GZXA 1CIUA 3M07A 2QJHA 1S1PA 3L4VA 3WF4A 1G4PA 1Z3NA 2XG9A 4D6CA 4EXAA 1F4HA 4WJ8A 1SFTA 5F7UA 4GKTA 1X97A 3D47A 4Q8PA 3T8LA 3WCZA 2VEGA 3S9IA 4JNZA 3CL8A 4GG9A 2HBVA 3TN5A 3IK2A 4NXKA 1CXIA 1P5BA 2GWGA 1XUUA 3NZPA 5T91A 3DENA 1M53A 4ROPA 3BH4A 4LSBA 2BTMA 2HVMA 1GVSA 2ZDRA 4XUYA 5AYXA 1CXLA 1GJPA 1XW8A 4Z0JA 4GQRA 1UCWA 1H50A 1RJRA 3UYIA 1HO4A 1X8CA 3LGEA 1IEWA 2X2GA 4L4MA 4AZGA 4O1FA 1VJIA 1R6WA 3D46A 2GVGA 4N9DA 4BY3A 2WW5A 2ONEA 1JRCA 4L7ZA 1MW1A 4IT1A 4HHHA 5ABFB 4GYKA 1E56A 3EX4A 2PWFA 4LT9A 4RNJA 4PMZA 4X3ZA 3VOGA 3H26A 5M5DA 3ARRA 4AF0B 4UQEA 3WK3A 2GSEA 1E51A 4FP1A 4W8LA 1GHSA 3EWZA 1IEIA 3GKFA 4UZSA 2EPMX 2FQIA 4IMGA 4Z1CA 5DCEA 2CIPA 2ACSA 1E5JA 1PTGA 1S5VA 4GIRA 1ZHAA 5A6MA 2OZ3A 1NWSA 1XYMA 1E6PA 4ML4A 3OZMA 4RLIA 2YKKA 3GNRA 4G2DA 1K1DA 4LC6A 4RZ6A 2DSKA 1US0A 2WCAA 3M5YA 3MT1A 3VIMA 1UWSA 1UBPC 4QXIA 2EKGA 3ONBA 1HKJA 4XZHA 5K4ZA 2BLEA 1E4LA 3VVGA 2E67A 2NXHA 3BMXA 1R7AA 1ZZMA 3FGCB 1AH4A 3NM1A 4WDTA 4QM1A 1XS2A 1XDJA 5MF5A 3LMZA 1NIUA 4RZ5A 3FEQA 2ZZ1A 3GW3A 3TZNA 1CX9A 3TYDA 3IGHX 1EO7A 3WY1A 1N82A 3DG3A 5A6TC 5DBTA 2RFGA 3O05A 4ZVJA 5HJLA 5I07A 3FXGA 1Q6FA 3ZT6A 4XB3A 1DPMA 1ZAJA 4KF1A 1ZB5A 2PC4A 4BI5A 3N15A 2O55A 1PHQA 3GHRA 4UTJA 2HPIA 2XSBA 1BG9A 4JTKA 5A95A 4JTFA 5K7JA 1QO5A 3SADA 2V82A 1I0DA 4AAJA 1RUSA 3OQ8A 1CW2A 4U3AA 2WZHA 3WD0A 4WJXA 4JBRA 4AXNA 4ZQRA 3OJGA 3SIMA 4HZ7A 5LA2A 3LM7A 4JOMA 4R7JA 5BOFA 2V2CA 3SGGA 1GOMA 3NZRA 3WX7A 5I77A 2IMRA 5HNTA 3HFYA 2PE4A 4MMWA 3EOSA 5E93A 1LLZA 4RV8A 1VBUA 2J79A 5CZSA 1BEUA 2OQYA 4RDYA 3GBEA 3LRMA 3SW6A 3LENA 1EPXA 4C5ZA 4MWAE 1EXBA 1IWPA 1HW6A 1EC9A 4U5KA 1YX1A 3MMTA 3RCYA 4I8YA 3VMNA 2GGEA 3MUAA 3M9YA 1VIZA 1UOKA 2D3NA 3E74A 3NA8A 5AHNA 4J2PA 3GIPA 1KLZA 1PYMA 3KBVA 4A05A 1O12A 3NQDA 2G50A 2ZXDA 3BSGA 2PU1A 4CU6A 1QPKA 1Q2RA 1XGEA 4JIIX 4DI8A 4H7ZA 1Q2SA 1YXCA 3WF0A 2WNNA 3UEQA 2KX9A 5HMSA 4G5DA 5C9XA 4GUHA 1WZKA 4JQ2A 2H90A 3H55A 1W54A 3FYYA 2E4TA 1TZ7A 4WGHA 1CT5A 4HK5A 5D2TA 4D6IA 3O07A 1JQVA 3XIMA 3D0CA 2OELA 2BBFA 4AISA 4QLKA 2C1HA 3DC8A 3L0NA 3FDGA 3IJLA 3MDWA 1V08A 3LPOA 2P5NA 2BB0A 3VK5A 4TTUA 1FH7A 3LD5A 4DJFA 4MNKA 5I00A 3W83A 3NPVA 4I9TA 3EWDA 3SN1A 3EWUA 3BOXA 3IIPA 2CHRA 3QW3A 1ZCCA 1W9UA 4ES4A 2QIIA 3TDFA 5KITA 4JTEA 1Q85A 4NI8A 3ARZA 1MRAA 4QCFA 4HNLA 1W1IE 1VPQA 2Q3OA 4Z1DA 4W87A 2VR4A 4IJCA 5AHFA 1OFQA 5A8GA 4DJDA 1W9XA 4PUJA 2YXXA 5J5RA 1JNDA 1K8ZA 1Q6LA 3D6NA 3UG8A 3LERA 4W7WA 3CO8A 2WV8A 1XQKA 1TWIA 4IIDA 1NDVA 1R5YA 4FA3A 1XIGA 4LYKA 2PTYA 4J27A 4GZIA 2JK2A 2WO5A 4Z17A 1V6UA 2NSXA 2FJUB 2ZTJA 3VIGA 5LGXA 1GKRA 3I7SA 3V3WA 1XLFA 2Z1WA 4K1WA 1GWJA 2G8ZA 1WV2A 1KFWA 1OY0A 4LJ3A 3TYCA 2OLHA 4O0QA 2ZXAA 4QRNA 3S6DA 2ZCGA 1Z42A 4MLRA 2NUYA 1IEQA 4JKLA 1ZBWA 5LIUX 1OYCA 2PLJA 4GXPA 4TUFA 4NX5A 4U10A 5D03A 4QSHA 2B7OA 2OU4A 2YCIX 1UZ1A 4IXHA 4PMOA 4E6MA 4IUGA 3OGSA 1LZOA 5M1TA 1EEPA 2OR2A 1REQA 1OIFA 3G0SA 4L65A 1NP0A 2QLYA 3CT7A 1DE5A 3OA3A 4MJ4A 4M82A 1HO1A 2EXOA 4EANA 1FH8A 4QBXA 1A5LC 3RRAA 3HPFA 4ZL1A 2DW7A 3AYRA 3L2LA 4O8AA 2A7RA 3WDPP 1J4EA 2BHYA 4LPCA 3PPFA 2NZLA 1X39A 3AHXA 1NF7A 4D8AA 2WVTA 3EX6A 4TVDA 1QW8A 4KERA 2VZUA 2WJEA 3EXTA 3LCFA 3EX3A 3I6EA 3WJYA 4LF1A 1R38A 3RJYA 3DHUA 4NAEB 4FF5A 3P7YA 4GO9A 3R1ZA 4UFJA 2E1WA 3BAIA 4UCGA 2VNCA 1Q3NA 4XBJA 4U2ZA 2WK2A 3CZKA 4HPNA 2Z1XA 3CXOA 2WCGA 5DXYA 2QDDA 1GG0A 1VFHA 3WQVA 3L7RA 2XDFA 4GA8A 3LCHA 2E6FA 4Q4MA 1G4SA 3FHAA 3BV4A 3P0XA 3B8TA 1GVRA 3TNOA 3W2JA 5DMMA 4NL1A 3N9KA 5A6BA 3CZEA 3PM6A 3ZJKA 2OODA 3TC7A 3CMJA 5KZEA 1BD0A 3SBFA 5CZJA 4B16A 2C14A 1TPC1 4A8LA 1QI2A 3A4XA 3FKRA 5IOBA 3TXVA 3VU2A 1UG6A 2XU2A 3B9OA 2O0TA 1RAKA 4R34A 3W84A 3GRIA 4IF2A 3KRUA 4PMJA 4EACA 3MKCA 3O16A 2Y0FA 3A5FA 4U2YA 2EPKX 3OHMB 3DHPA 4ZFCA 4AEFA 3NPWA 3BGJA 3TYZA 1CGXA 4X63A 3VINA 3OEXA 3VIJA 3GG1A 1O60A 3SCSA 3GR8A 3AIUA 3QQ1A 3FW6A 1Y65A 3AMDA 3TUUA 1UASA 4WJEA 1IQ8A 4NHVA 4WRHA 5B80A 1SW3A 5D2VA 2BP1A 4KEMA 2Y5SA 3R43A 2W61A 3I7RA 4NKCA 4ZMGA 2WMGA 1LOQA 3OGVA 1LOSA 3QR1A 1PWMA 3APYA 4IQLA 4IIGA 5CSRA 4L6OA 2WKLA 3PB0A 1QOPA 3PSVA 3W37A 2C13A 3CZ8A 5CG7A 5FEXA 1WXZA 2WJZA 2Q8LA 1IV8A 2DZBA 4W8BA 2XSAA 3DBPA 1GOQA 1QK2A 3STGA 2ISFA 2Y7EA 2J4GA 1I45A 3GE7A 3WDJA 1YBQA 2V6AA 2INFA 1EJTC 2CKSA 4J3TA 4YCPA 3KBWA 4CCDA 1CXFA 3CAVA 1TRIA 3ARUA 4XAZA 1JZ8A 4R53A 1RD5A 3BLPX 2GGGA 4NVTA 3W7OA 2W79A 3ABXA 2DZVA 4EX4A 1HG3A 1X1ZA 3LOTA 1GVOA 2BVTA 1SJDA 1EF2A 4E8DA 5M2FX 3AS3A 3RLUA 2VGGA 4MY9A 3C0JA 2QUNA 2O9OA 4QTGA 4B4FA 4F0HA 1Q45A 2Y89A 4W7UA 1GW9A 3HQ1A 4UNIA 3EX2A 3BLKA 2PUZA 4QCEA 2VDHA 2VP8A 4ZOBA 2ZXQA 3T9PA 3Q4DA 1UOZA 2CKRA 1VHNA 4ZO8A 4RDWA 5FACA 3DKJA 4H6RA 3RPMA 3BPWA 1TV4A 5T9BG 4S3GA 3TYBA 3CYVA 3A4JA 3N4FA 1FRBA 1ICPA 1UR9A 1VB9A 2XFYA 1EJ7L 4AC1X 2GJXB 1UKQA 3VNMA 3I7QA 4PCSA 1QNOA 3P84A 2GVYA 1F6PA 4NYYA 4D8LA 4QX4A 1Q7ZA 1MO0A 1AD4A 4WCJA 1KBBA 1NWTA 4J3UA 2FB2A 1FDJA 4ATDA 3M5ZA 2Z29A 4S3BA 4G7EB 3HV8A 4JTCA 4WOQA 3VZXA 2VENA 4HD5A 2DQXA 1THFD 2PLKA 4PBFA 1HJQA 1W1PA 2Y61A 1NFPA 3NWRA 4INFA 3CO4A 3OLDA 4JTSA 3N18A 4IH3A 3UZ5A 5C2CA 4ZB0A 1OG6A 1SU5A 3VDAA 1JCXA 3P60A 4Z42C 3B8SA 3SSJA 2D22A 4CNPA 1UUOA 2BG5A 3W1XA 3W75A 5LNVA 3Q94A 4RUBA 3NQMA 4GX9A 2BY2A 1UR3M 3EOLA 4WKAA 1UHVA 2JFEX 2BASA 3LU2A 1M65A 3MJMA 3KBNA 2PI6A 2YDRA 4LVBA 1LWJA 1XFCA 4XZBA 1LWIA 1CCWB 1QW9A 3S3GA 1G1YA 5F2GA 3V0TA 3R94A 1WDRA 1RPXA 5HQMA 2YJQA 2OYKA 4QG6A 1S3TC 2R1MA 3W7IA 3CJPA 2EO7A 4LBRA 4Y9NA 1V3JA 3EWXA 1WXJA 3EA1A 3LQLA 3EMCA 3ATYA 4N6FA 1JD9A 3HOJA 4AEOA 1TPH1 4K7VA 5AC6A 1XX1A 5AHEA 1DE6A 1PEZA 2CZDA 3C5QA 3AZRA 1QPRA 1R46A 3W28A 2PP1A 3NNTA 4DXVA 5CZTA 3R79A 1WX0A 3CQ0A 3HU7A 1R9XA 4UQCA 3PBVA 1UROA 1R9ZA 3E6EA 4AXKA 1I75A 3CHFA 4X9YA 3U2OA 4OFCA 3IJ6A 1ISXA 1I8JA 4ZXOA 4Z08A 2FH8A 5TQLA 4IUOA 2NLIA 4HBKA 3KVLA 2Y88A 1GQNA 3NPXA 2YGYA 1XQLA 4MVAA 5CQ1A 3THQA 1W5NA 1W3NA 1QWKA 2Y85A 5BXRA 4S3KA 3DI0A 3WJZA 1OX4A 1X96A 4RW3A 3GC2A 3WFAA 5KETA 3WQFA 4O18A 1NY1A 5FSEC 1UW9A 2P0IA 2RH9A 2YA2A 3IV8A 1HX0A 1I60A 5CPNA 4ORIA 4D9PA 1W3LA 4NIRA 4DUOA 3E0IA 1PKNA 4GVHA 3LTSA 4ZBCA 3AYVA 4WEVX 4MZ8A 4LU0A 3VI2A 1RY0A 2VEIA 3TKFA 1QPOA 3ARQA 2YL6A 1O95A 4PBGA 3AOFA 3N34A 4HIBA 4PUWA 4A8RA 1TR9A 3ID7A 3LV6A 1S5NA 2A6NA 5I3JA 1E3XA 4WDWA 4J40A 1XPYA 1DWGM 1XPGA 4DUVA 2B81A 4MYXA 3HTWA 2P3EA 5FF7A 4JIQA 4DBSA 3B0VC 4P8UA 1KC7A 4X0NA 2QPXA 2GQ3A 4I3GA 3C52A 3RJXA 3BJFA 3BGGA 2EEXA 1YBQB 4PUMA 4ZZ9A 1AW5A 4LB3A 4MADA 3CUZA 1G94A 2WVUA 5F4SA 1KFKA 2Z00A 3AMKA 4TTGA 2GQAA 5CC5A 1W0MA 2IKIA 2W3ZA 3C8NA 3HMCA 4HSHA 2J8GA 3FA4A 4MNMA 1QDSA 1W91A 2NWRA 2V8ZA 2ABBA 2RDWA 1LG1A 3W38A 5EFFA 2ZFAA 4DZAA 4US6A 1MDRA 3WUEA 4QDMA 4BI7A 5GNXA 1XLMA 1JYVA 1OSEA 2OT0A 1BVNP 1UUMA 4NNBA 3NEVA 1OGBA 2OQLA 4PB3A 1N7KA 4HCLA 2UV8G 3GUGA 2RJGA 1J0ZA 3GNNA 1B4EA 5IDZA 1X7IA 4IIEA 2RHGA 1HJUA 1NEYA 4LUSB 2J7DA 4KCTA 4ZOAA 3DFHA 4IGHA 3B8VA 1EP1A 4EAYA 2DGAA 1HGYA 3RMJA 1X1OA 1WOAA 3R11A 4FNRA 2A3EA 3R2GA 4BQ2A 4TIMA 2CYGA 5I06A 1EKOA 4Q32A 1TA3A 3TYAA 1WA3A 7REQB 1OB0A 3CB3A 3BVJA 4RV3A 3U48A 1QJWA 3W1PA 5CPMA 3B8DA 3UJEA 2WAGA 1V6TA 4W9TA 1QI5A 3MWAA 3G1XA 4IMCA 4WHBA 3N3MA 2V2HA 3SURA 2WMIA 1S2AA 5D05A 3CMGA 4MYAA 3G8EA 1PUDA 4F40A 4AZ7A 3TCSA 2VFIA 3GDKA 3UJRA 2FPYA 4JGDA 4L1GA 3UA4A