3SJ3A

Crystal structure of the mutant r160a.y206f of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor bmp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTAPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIFLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sj3A00
2J9YA 1EWDA 3TSMA 1B4KA 2YCEA 4JTJA 4Z1AA 4LVBA 2GQ9A 1OFQA 3P61A 3HPXA 5LSMA 3WK2A 2E77A 1G4SA 2Q3OA 4XTDA 4MZYA 2X1SA 3B05A 3QQ0A 3NZRA 4ML9A 5HINA 4O50A 1NSJA 4AAJA 1G6CA 3PWAA 5LKYA 5SWUA 3C2EA 4K8HA 5KITA 1KFBA 2A5HA 4XZ9A 3G22A 1LOLA 4UC5A 3T7VA 2X1RA 5HWJA 1JR1A 2QCGA 2FLIA 3DI1A 4POCA 3G0SA 3N9RA 4DPQA 5AYZA 1JCJA 3TE9A 2DORA 3LM7A 4NZJA 3G1DA 3O6CA 4AH7A 3G3MA 3N3MA 5EBUA 1JCNA 3NQ6A 4TU1A 1ZJIA 1SU5A 1GEQA 5AHMA 4QAIA 4FNTA 3TQ0A 1XCFA 4RCXA 1Q6OA 2RH9A 3N2XA 3EWYA 3VI2A 3NL6A 4UTHA 3F1QA 3TXZA 1H60A 3MJYA 2A6NA 1TPH1 3NO5A 3WK0A 3DAQA 4HNNA 2JGYA 2A0NA 4HPJA 5CPMA 4M5PA 2HTMA 4M7SA 1Q6QA 2E5CA 3V1PA 3TJXA 5AC6A 2CFFA 4JTUA 5LHFA 3FYOA 3G0XA 5CGQA 3LI1A 1ZAHA 4MOZA 3W7IA 3N9SA 2QDHA 1EP3A 3L65A 5FEWA 2V2DA 1KFKA 1WOAA 1TRDA 2OT1A 3LERA 1F6KA 1FCQA 2YSWA 1D3HA 1H7NA 2R91A 2DZTA 2F7FA 1DORA 1PVNA 3QPZA 2GQ8A 1LYXA 3W7KA 2RDTA 3UY8A 2TRSA 3GDTA 2OT0A 3G1SA 1JUBA 3M7WA 2BSLA 2ZRWA 2JK2A 3QF0A 1VQTA 3S5ZA 3M16A 1SZFA 1F2JA 3LCFA 4JTSA 4LVFA 5HQEA 4NJHA 3LCXA 1ME9A 4TR9A 2YFOA 3TROA 1K02A 1IXPA 3O05A 3NPVA 3UQNA 2YYTA 4X22A 4U28A 3TJLA 4O57A 4Z08A 2WQPA 4Z1DA 2OCZA 5K4XA 1JCMP 4QNWA 3GDMA 3GAYA 1YXYA 3KRUA 3W83A 2Y7DA 1AW5A 5HUOA 2A7PA 2ZQ0A 2BLEA 3P80A 4OBTA 1YLVA 2JKEA 2A85A 4JIQA 3USBA 2OZ0A 1XBVA 1M7OA 3CU2A 3P67A 3TSBA 1A5AA 4QJ1A 4LOCA 3EXSA 3LCWA 1NF0A 3L66A 3HMJG 3M5XA 1TV7A 4KFPA 4UFLA 5CZTA 5G4WA 5HWMA 5CPLA 5K4ZA 5KTLA 1LBFA 1FXPA 1QPRA 2X1UA 4PCFA 2FTPA 1PL9A 2A1YA 2VKZG 1RVGA 5K9CA 5EYWA 4QNEA 4AWUA 4LT9A 3HOJA 4MLRA 4JICA 3O07A 3INPA 1MZHA 4K8EA 3GR7A 2G97A 3DHFA 4XQ6A 3C2FA 2X2GA 3UWVA 1W1ZA 1SR9A 3SECA 3TW6A 3BO9A 4K39A 1TJPA 5LNWA 4OU1A 5HR6A 5CPOA 2QCFA 3M47A 1SW3A 4DO5A 2C15A 2RFGA 4JTKA 1XUUA 5GVJA 4O13A 3IGXA 4ONVA 3HB9A 1FCVA 3NG3A 3FKKA 4CQ8A 4N9DA 4YWIA 4O11A 4GUHA 4MY1A 2Y7EA 5G5IA 3C2RA 3JS3A 5TQLA 1FDZA 2CLOA 4WXZA 1TQJA 4YCOA 4JTTA 3W7CA 3NM3A 3WJZA 1FWTA 1ZENA 3BW2A 2OMAA 4UIOA 3N14A 3SZ8A 3BV4A 3LHUA 3QMTA 2B7NA 3CWNA 4S2CA 3EWBX 4LVGA 4QM1A 1F7BA 3P84A 1AW2A 3C4UA 4D2JA 3EX6A 1BTMA 3TQVA 3QRHA 1PS9A 3ATZA 2RDUA 3GDRA 1KM5A 2ZCGA 3P62A 1GYNA 3W1AA 2CLHA 1D9EA 4GRSA 3W72A 2ZZ4A 3Q58A 1SZNA 4EIVA 3GVGA 1W5NA 4I7VA 1IIHA 3O6DA 1Z42A 4H3DA 3O63A 3TC7A 1NAL1 1SO4A 2FIQA 3ANYA 4K37A 3EWZA 4DPPA 3PG8A 4CCEA 4N02A 3M6YA 2QR6A 2X1TA 4XKYB 5A5WA 4HNTA 4TX9A 3B0VC 3HGOA 4FNUA 2A21A 1QPQA 2NUYA 3UY7A 5D02A 1FCUA 3GXTA 5F1VA 1AL7A 1VJIA 3N19B 2FPVA 1K7XA 3F4NA 5U4NA 3LTSA 2ZZ5A 4AWTA 2ZDRA 4DF1A 2H6RA 4O17A 5G2HA 1QFEA 3LB0A 1DHPA 4Y96A 3I65A 1OFOA 1KFEA 2FQIA 3C0JA 1QR7A 4A2SA 4ZMGA 5AC8A 1KFLA 2TMDA 4OWGA 1QNVA 1BWKA 3L0GA 1OX6A 1EP1A 4N6FA 3TA6A 4B5NA 3MI2A 2I14A 4MY8A 1BKSA 1OYCA 3UWWA 1EIXA 1KM0A 5LNSA 1GVFA 1ZFJA 3LTYA 4X3ZA 4NJIA 2DJLA 1TYGA 4BWLC 4FNPA 1NEYA 2B7QA 5DXYA 2E6DA 1M6JA 4IMFA 3GXPA 1GVOA 5K9XA 2QUVA 2WNZA 2BZNA 1K7EA 2A7RA 2VELA 5AOUA 3THQA 4RXFA 4PEKA 3DI0A 4PODA 4WY0F 3E12A 3RFAA 2CWNA 3QYQA 1VR6A 4HHPA 2W6RA 5T26A 4J9JA 3SR7A 1RQBA 3W75A 3PB0A 5K2ZA 1V7YA 1B3OA 1SO3A 2DZUA 3SY5A 3HIJA 2PRHA 3E49A 1G7VA 4R34A 5ABTA 5AC7A 4WOZA 2C16A 2V81A 4GUIA 4GFSA 4M6PA 1OG0A 1L6SA 4GBUA 1M7PA 4OT7A 2Q3RA 4L4LA 1TPUA 3EB2A 1KTNA 4R7JA 1X1ZA 3MP5A 1FBAA 1GT8A 1OK6A 4IMDA 5I3GA 3W07A 1O5KA 3KAOA 1LOQA 4O0KA 3KVKA 3LHYA 2CW6A 1OFBA 1YXDA 1FX6A 1VGAA 1RQEA 2HS8A 3IV3A 3FFSA 3L67A 3MWAA 3R89A 4UMAA 4AXKA 3L5LA 2FB2A 1C9DA 4RZ5A 3MHUA 1K3UA 3OHIA 5G4EA 1TREA 3S9YA 3IIPA 4UTTA 3RF9A 3Q94A 2B0MA 3IIZA 4QIUA 4NXSA 4RXGA 4LC6A 2R14A 3PG9A 3H55A 4JN6A 3HO8A 2WNNA 3LLDA 4XKYA 2Z6IA 1IIGA 1ZALA 1W3TA 4NNCA 5HWNA 4N4QA 1OFEA 1TMHA 3R8RA 1VYSX 5DY3A 2QDGA 5F4SA 3NQCA 5D38A 4WQ6A 3ABRA 5A8GA 3UWZA 4NX5A 3CC1A 3HPSA 3NQGA 1WA3A 1I2PA 3G0UA 3RLVA 1OK4A 4MUZA 5HMSA 4WJEA 1I45A 1X1OA 4GC4A 1MEHA 2YZRA 3NPUA 3Q37A 2C3ZA 1J4EA 2E5DA 2NXIA 3O8AA 3L0KA 3N2MA 3NZ1A 1B9BA 2QCHA 1S3HA 2H8XA 4DO6A 4N6EA 4L4MA 3ZR4A 4O16A 2V0TA 3B8DA 1JQXA 2E6FA 1YDNA 1AK5A 3ATYA 3PM6A 2GVJA 3MP4A 5AHLA 1ZNNA 1WDWA 3O6YX 2Y7GA 1EWEA 4FEZA 4GE8A 4DF2A 4MYXA 4JTIA 1HUVA 3GZ3A 4PL1A 5DCDA 4MZ1A 4OHQA 4RZ6A 4WUIA 7TIMA 1VRDA 3HGSA 1TTQA 1N55A 3E02A 5KZEA 3PS7A 2GJLA 5C55A 1M5WA 3NM1A 4JTFA 1FXQA 3JR2A 3P8IA 2TPSA 1WV2A 2QCNA 4P2VA 2DZWA 3BW3A 4MFEA 1IXNA 3NPXA 2ZRXA 5L6UA 2ZTJA 3LHZA 1HTIA 2Z2UA 1SO6A 2O7SA 2WV8A 3IVUA 4LUIA 3KXQA 4A22A 1HO4A 1GZGA 1P0KA 3AO0A 4UMBA 3W85A 8TIMA 5EPDA 1UB3A 4BFAA 5F2LA 1FWSA 3NQ7A 3U2OA 2BWGA 1TTPA 2B4GA 1VYRA 1LBMA 1OX5A 1LRTA 1ZCOA 4FB7A 2CZ5A 1TPC1 4PH6A 1O94A 5D32A 5LZLA 1XL9A 3NQ8A 3PB2A 1XBYA 2QCDB 1TJRA 3TCEA 4P61A 3B06A 4FX8A 4Z0JA 2PURA 5H91A 4IMEA 4O52A 3N73A 4UNKA 5FEXA 4LS2A 3G1AA 1TTJA 3IEBA 2C19A 1R2SA 2W79A 5E1QA 1FQ0A 2ZA1A 5CG7A 1TV5A 3TFXA 3W1TA 3NQFA 1P4CA 1F76A 3S8HA 3C3NA 1JUEA 1LROA 3Q2DA 2Y61A 2Z0IA 1A5SA 1VPXA 4GXMA 3QFEA 4K38A 3IGUA 4MFDA 2PC4A 4KFOA 3FKRA 1VYPX 1I2NA 1GG1A 4PL2A 3P82A 3TIMA 2YDAA 5D2XA 4K6AA 2QAFA 1R2TA 4QQ3A 1ALDA 2Y85A 3NQ2A 3LHVA 4IMCA 2GPTA 1PHQA 3M5VA 3C8FA 1EPXA 3EX2A 3KX6A 3G1YA 1LDCA 3NQMA 3VE9A 4ALDA 4FHAA 4JX4A 2ISWA 1W37A 4CQAA 3UPWA 1T99A 2A7NA 3LXBA 4CCDA 2NX1A 1UCWA 2ATSA 4HIBA 2I9EA 2DU2A 1JCLA 1MO0A 3W84A 3NL5A 2I1OA 3FEMA 3HGJA 3GXNA 2ZA3A 1VHNA 4NNBA 3MUXA 2PRMA 4NX0A 2EPHA 1W31A 2C6QA 1H62A 3L5MA 1SFJA 4O14A 4ZVJA 3C6CA 2D73A 4IJBA 3C52A 1UUMA 2J6XA 2DZVA 4GUGA 4XBSA 5G2WA 5LNRA 4N9BA 1OFAA 4UNLA 3NQVA 5AHFA 3CEUA 1TTIA 2ZZ2A 3PVFA 4KKXA 4E2DA 3UPBA 3VFLA 4JR5A 2Y6ZA 3MHFA 5CPNA 2X30A 1F05A 1GOXA 3HJZA 1KW1A 2Q8LA 4G1KA 1A53A 3OIXA 1KM4A 5FF7A 3R12A 4GJ1A 4JGDA 1XDLA 2H3DA 4ORMA 1PCKA 1GJPA 1ZAJA 4NUWA 4XUGA 3S5NA 3G1FA 4M7TA 4C1LA 3U6WA 3CHVA 5DLCA 5FF4A 4JDBA 1RQHA 4LS0A 4O1BA 3FYPA 3QPYA 1C29A 3E9AA 5BMXA 5F1UA 4MJMA 4EWND 3W7GA 2QCDA 1G4PA 3TAOA 3LBMA 3IGSA 2P1FA 1TV8A 1YPFA 3BK0A 1H51A 2HS6A 2DZXA 5H2ZA 3KHJA 1VS1A 2P10A 1I2QA 5C6MA 1H63A 3A5VA 3NDOA 3STCA 2H90A 4UFJA 1KTBA 4LC8A 3ELFA 4O4WA 3RNDA 3W88A 2VXNA 5DN1A 1VHCA 2Y70A 4Y8FA 3DENA 4DQWA 3UWQA 2EHHA 1XDMA 3DU0A 1T8XA 2J9XA 4OV4A 1JRBA 1UUOA 4NXKA 1LBLA 5D2TA 2Z6JA 1O5XA 1K8YA 3STGA 3W7DA 3EX3A 2R94A 2ABBA 2ZZ1A 3A24A 3TDFA 5KMYA 5DY2A 4CCCA 5DCEA 3SJ3A 1A5CA 2W0UA 5FF2A 3LBCA 1T96A 4IPJA 2NWSA 4WX2A 3T40A 5BMWA 5C5YA 3KVJA 5D03A 2FDSA 1G69A 4ZQCA 3FA5A 1H5YA 2E68A 3I7RA 3GDKA 1TRIA 2CU0A 3PULA 3QM3A 3BARA 4C1KA 2QUUA 1AL8A 2B7OA 3W7MA 4O1CA 3PR2A 4UTTC 3QSRA 1YPIA 5F2MA 2WSQA 1OX4B 5IM51 1W3IA 4BF9A 3BW4A 4NNAA 3GKAA 1PV8A 3MW7A 2FPYA 2J88A 3QJAA 3PBUA 1G4EA 4O18A 1IF2A 3PAJA 3NQAA 5FESA 1LOSA 3HGRA 3W1UA 1EUAA 2NUWA 4I7WA 3GR8A 3PUOA 4AEOA 4OV9A 4UTKA 3B04A 3L2IA 3CIWA 4LNYA 4O54A 1FDYA 1WOBA 4FNRA 3CT7A 3P7YA 2EAWA 2ATMA 2GUUA 2J27A 3OVQA 4RV8A 1J5TA 2BTMA 3F4WA 3UYCA 3SI9A 1KLZA 3W2JA 1BEUA 4H4IA 3G18A 4GUFA 3WJXA 2IQTA 1ZAIA 1O4UA 3UD6A 3FLUA 1KFJA 5AB3A 1SSGA 4CNOA 5F2IA 1ICSA 3S42A 2XN1A 5KSWA 3W70A 1EP2A 3G8RA 4Z1BA 2ZRVA 3THAA 1YTKA 4GNJA 3EX4A 2BX7A 3LX9A 2ISVA 4AWSA 3WK1A 1KBIA 4DBEA 3HG4A 3VE7A 2ZA2A 1GYLA 4IUOA 1FUYA 3EXRA 3SFKA 4MY9A 4O1DA 4JY8A 4YLWA 4CLMA 1H7RA 4ZQRA 3LHTA 3JRKA 3F03K 4UTIA 3DKLA 3S1UA 3P81A 2QF7A 4Z0SA 4GWEA 1UBSA 3W6YA 3TSDA 4FIRA 5C2XA 3QH2A 1V5XA 1I2RA 3KVMA 1SW7A 4GUJA 1GVRA 3WJWA 1KM2A 1R47A 1TQXA 4RX0A 2VFFA 2CLKA 1GWJA 1T0OA 4IWWA 4OE7A 4FO4A 2Y62A 5I3FA 3S1VA 3B0UX 1IGSA 4XWUA 3BLEA 4YXGA 2R8WA 4ZZ9A 2HMCA 3UWYA 3PC0A 3W7NA 3W1PA 1F6PA 2JKPA 5KZMA 2V8ZA 1OX4A 4NU7A 1TCDA 4Q4KA 4UTLA 1ONRA 1YDOA 3H54A 4EVZA 2NV2A 1UASA 3I68A 3TXVA 3LXAA 1DKWA 5IBXA 3R13A 5F4XA 4M19A 4W9TA 4O28A 3NA8A 2GOUA 3EWUA 4MYAA 1SO5A 3DKJA 4K36A 5EA9A 1WAUA 1G4TA 1TIMA 3EX1A 3NAVA 3LI0A 2PE4A 2Q8ZA 5EKYA 3UXAA 1DL3A 4M6VA 4AHOA 1JQVA 3MBDA 3GX9A 3WJSA 4NJGA 4KWVA 4LVAA 1A50A 3GLCA 3TNOA 1Q6RA 5J5RA 3HG5A 4FX6M 1I2OA 3W2NA 1I8JA 1GVSA 4IXXA 4BI5A 4WXYA 1HL2A 3NQDA 3MP3A 1N8FA 3GIYA 1KM3A 5F4WA 3NL2A 1Q3NA 2B7PA 1KA9F 1WXJA 4Y90A 3N34A 4HNUA 3C2OA 1HFBA 1E51A 1HO1A 4DELA 1P1XA 2V2HA 5HUPA 4A29A 1H7PA 2V2CA 2VEPA 4LU0A 1DVJA 3NL3A 3W2LA 4A3UA 1RPXA 1TPEA 3O1NA 4DF0A 1SQ7A 1WQ5A 3OVPA 1KLYA 3W1NA 1NVMA 2XN2A 1ZY9A 3M44A 1TO3A 1MEIA 3M5ZA 1F74A 5G1TA 3NQEA 2JBMA 2G5WA 2TYSA 4RR4A 2E09A 2V5BA 6ALDA 3PBWA 1H61A 5D2VA 2GVGA 2XFWA 3FOKA 3M9YA 4DXVA 1LM1A 4UTWA 3EKZA 4UR7A 3TU9A 1LCOA 4NT0A 3W2KA 3QMSA 3UZJA 3RMJA 4AF0A 3T55A 3PBYA 2VFDA 5HULA 1NFBA 4NJJA 4OGZA 3QEZA 1IXQA 1QMLA 1ICPA 2AQWA 4ORIA 1R46A 4WD0A 3W3OA 3LHWA 1PHWA 4IQLA 1KV5A 2GJNA 1VLWA 4O12A 1S5VA 6TIMA 4JDYA 4JTEA 3LRKA 5LGXA 4AMAA 1H7WA 1SW0A 1XXXA 2FB3A 3GB6A 4QITA 3DXIA 3RU6A 3ZWSA 1MEWA 2DJXA 3IIXA 3STEA 2LLEA 3LRMA 1H1ZA 3DFQA 2ZYFA 5AYXA 1Z41A 2X16A 1TPB1 4FXRA 4ICNA 3VNDA 3QQ1A 3IVTA 1JJKA 4JY9A 4ZQMA 3B4UA 1OF6A 1C8VA 1TSIA 1L9WA 2WSRA 3PY2A 2O7QA 4O0ZA 1WBHA 4N2YA 1R2RA 1VCVA 1W5OA 4NZFA 4CNNA 3SW6A 3NOEA 3GKFA 4UCGA 1H7XA 1O60A 2Y63A 4HPXA 1QOQA 3DBPA 4JEQA 4N4PA 2G96A 3P5ZA 4PA8A 3O15A 4PTNA 3T4CA 5F2GA 3A9IA 3RLUA 3ABSA 2PRLA 4JNMA 5C54A 2YW4A 1FWWA 3CEPA 4IPIA 3T78A 1DBTA 2YFNA 2QJGA 5FF0A 5HR7A 3ABOA 1KM1A 2CLFA 2QCEA 3W71A 3LCGA 3P8JA 4JTGA 2WKJA 3PUDA 5CZJA 2WJZA 3O16A 2QCCA 3L9CA 4LVDA 3TX9A 4HNVA 3V75A 3W2UA 3OVRA 3QSTA 2E6YA 3EEGA 3MI3A 3W76A 3GYEA 4LRSA 2J9ZA 1XC4A 1LORA 4XTIA 5FEZA 1W5PA 1B57A 2CZDA 1KV8A 2VC6A 1TPWA 1W54A 4A21A 1Z48A 3L68A 1W0MA 1KM6A 3W7OA 2ZBTA 3A23A 3A21A 3W1LA 1JRCA 1EB3A 2VENA 2V9DA 3GNNA 2DZSA 3CM4A 3PSWA 1W3NA 1ME8A 1L2UA 5K9DA 5D33A 2CLMA 5KINA 5BRBA 1VZWA 4UFHA 4LUJA 5DELA 1I4NA 5FF3A 3E0IA 3NGJA 3GAKA 3W7RA 1ZHAA 3R2GA 4TMCA 1IXOA 5FI8A 5LNVA 4NQ1A 1YTDA 3W7HA 3O06A 1LZOA 2VOMA 2WO5A 3SSJA 1EA0A 4ZQPA 1XBZA 4O53A 1GTHA 3S5YA 3HF3A 3BPWA 4EF8A 4JX5A 3STFA 4IX0A 4TO8A 5HNRA 5LGZA 3IVSA 2ZZ3A 3M5YA 2CZEA 3UNDA 2G95A 1FWNA 4DBDA 1XUZA 1VLIA 4Q32A 1H1YA 3TFCA 2VFHA 1DV7A 4UFIA 5D2WA 3IRDA 5L9FA 3P74A 5CZ0A 5D04C 2AGKA 1QO2A 4ZL1A 4O15A 1O95A 4UFMA 3T44A 3TQKA 4FX7A 3DFSA 2Y89A 3TMLA 1CW2A 1XKYA 2PCQA 3ZFHA 2AAMA 2Y88A 3KOFA 1U83A 1VCFA 3B0PA 5D05A 2WPBA 3PUEA 4JIPA 2OJPA 2DZPA 4HSOA 3W87A 4E2BA 1GTEA 5I3JA 2XN0A 3W7LA 1SZEA 3KRSA 4O19A 4YCPA 3BGJA 2VEMA 3GK0A 1X6UA 3G24A 1VC4A 4O4VA 2YXGA 1RD5A 3B03A 1OVDA 3LV5A 4TIMA 3L21A 4Y9AA 2WOQA 5CZSA 4CNPA 2QCMA 2C0AA 3MO7A 3HBLA 4UUIA 2VEKA 1LTDA 2DP3A 4MLJA 3S5OA 3CLMA 1FWRA 3LCLA 5G2IA 1Q45A 5MHBA 1U5JA 5I3IA 3M1ZA 4ADUA 5BNKA 1UJPA 4TMBA 2NLIA 1SSDA 4M6QA 3BGGA 4IXHA 1CI1A 1A5BA 1TPFA 2TSYA 4BI7A 2QJIA 1S5WA 3DHDA 5D2YA 4OQVA 4JTLA 3TMQA 1SPQA 3CB8A 5CKSA 3LLFA 4AHPA 4Z1CA 1LRNA 3LRLA 5IBXC 1H7OA 4MIMA 1JUKA 4UR8A 1QCWA 3IIOA 4XBKA 4PFMA 1QPNA 4U4MA 5TIMA 1SUXA 2E1DA 2NX3A 4MZ8A 3LCHA 4LTSA 4RK8A 1G67A 1D3GA 3D0CA 3QZEA 1W8SA 5AYYA 5I3KA 3NEVA 1W56A 4BR1A 3S6DA 2YR1A 1YTEA 3KFTA 3DFNA 2E6AA 5EY5A 3HPZA 3DFPA 3S1WA 4JYFA 3NNTA 3WFAA 2QKFA 3OBKA 2H8ZA 2ZRUA 3LXCA 3MHGA 2ZZ6A 3W7PA 4RZ4A 3S1XA 2OX1A 2C18A 1Q6LA 1P5BA 2WSYA 3PF3A 3CPRA 1EUNA 4JYDA 3L0NA 3H53A 4LWWA 1FY6A 2NV1A 4CQ9A 1VH7A 4FXSA 1Y0EA 4HT3A 3YPIA 3BVJA 3UXDA 4K7VA 3R5EA 1RZMA 3OG3A 3UWUA 5AHNA 5DBUA 1KFCA 3C61A 4JYEA 3M0ZA 5TBOA 3VCRA 4FNQA 1THFD 3ZS4A 1OFPA 4I7UA 4RJEA 3E96A 4JD4A 1SFLA 3QMRA 4Y6GA 1Z44A 3I7QA 3KRZA 3MYPA 3P5YA 1ML1A 4UMCA 3HG2A 4IX2A 3RK8A 3W23A 3TR2A 3ABQA 2VEIA 5HJLA 4A2RA 3OA3A 4LV9A 4JX6A 2RDWA 4O1AA 1CX9A 4UTWC 1TB3A 4R53A 4LW7A 2Y7FA 2FPTA 4H6KA 5LNUA 1L6YA 4N9CA 1F73A 3TKFA 1AW1A 2CZFA 1QWGA 3I6RA 4IMGA 2YYUA 1DJNA 1KTCA 2ALDA 1PCWA 5AHEA 3EKLA 2Z1BA 3NXFA 3BLFA 1RV8A 1OF8A 1K8XA 4S1FA 4MVAA 1K03A 1LP6A 1OFRA 1S5TA 2VFIA 4JS3A 3DFTA 3W7EA 3FIGA 4MJZA 1W5MA 1OYAA 4QSHA 5AHIA 1GVQA 3MMTA 2EKCA 1WYIA 3TH6A 1JVNA 2P0OA 1OYBA 2F84A 5D30A 3AJXA 3G8EA 5EMUA 1EX5A 4AF0B 1FDJA 3A5FA 3A22A 4UTUA 1W5QA 2ZTKA 4HN4A 2V30A 2NXHA 2A6LA 1G7UA 4RLIA 5DXXA 3EWXA 4HKPA 1PE1A 5CSSA 1VCGA 3W7QA 2ZFAA 2VFGA 3I7SA 1PIIA 4E0CA 3S0CA 2VFEA 2NXGA 4R33A 2EF9A 1NF7A 4X9SA 1DJQA 1N7KA 2QCLA 3U8GA 1MXSA 3MYOA 3P60A 4AB4A 2ZZ7A 2ZRYA 2FJKA 3PSVA 4O8RA 5E0KA 4JTHA 2V82A 3TW7A 1WX0A 3FJLA 1OHLA 5DCBA 4IGHA 4WY0B 4LRTA 5EL1A 2FFCA 3SGUA 1YXCA 3PBVA 2NX9A 4KFNA 1TPDA 3W7JA 5BOOA 2V5LA 3C56A 3BG5A 4YMZA 2YW3A 3CIXA 3DH7A 2NWRA 1GQNA 4LV4A 3NR0A 4I9AA 1OABA 2H3BA 3NYZA 3CWOX 2CLIA 3NPWA 4WOQA 2UV8G 3W74A 1LLZA 3W9ZA 2E5BA 5AN7A 3W2MA 4UFKA 1K7FA 1JCYA 4FNSA 2ISSA 3NVTA 1RR2A 3KVLA 3DFOA 2C13A 1QDSA 4KWWA 2JKAA 4BI6A 3TUUA 4AVFA 1GPWA 3GDLA 3QW4B 5D37A 3TV8A 4JXCA 2CLLA 1AG1O 1ICQA 1MSSA 2C1HA 4O10A 4FF7A 5D09A 3QW3A 4BK9A 5I3HA 1LLWA 4WZHA 3WK3A 3LV6A 3W73A 5KZDA 1XFBA 1FCBA 5CSRA 3TAKA 4DO4A 3LGEA 3M41A 1J2WA 3LDVA 4ZQNA 3TK7A 3OEXA 4MKNA 3BG3A 4S2BA 2WNQA 2J24A 3LCIA 3CTLA 3QC3A 5U7SA 2NUXA 2CLEA 2ZRZA 1DQWA 4FIQA 5E93A 2HSAA 2YGYA 1F5ZA 4QISA 3K30A 2NZLA 5LHEA 1P0NA 3MI6A 1QOPA 1L6WA 4ADSA 2YX0A 3W1RA 1TPVA 3EXTA 2ABAA 1XBXA 4UTJA 1KBJA 4N9EA 1H50A 2RKXA 1XM3A 1WBJA 3W22A 1YADA 1EEPA 1ME7A 2KZHA 4X2RA 2QAPA 5DBTA 4ADTA 5K3VA 3FJ6A 4AHQA 1BWLA 4PC8A 4LS1A 3LTPA 3HG3A 3G1XA 3MBFA 5J5DA 1YYAA 1K8ZA 3BG9A 4UXDA 3C2VA 4ZQOA 1JCXA 2QJHA 3W1QA 2QUTA 3VKJA 1XI3A 3G3DA 4YL2A 1QPOA 4HSNA 1X8FA 4MPQA 1JULA 3SIZA 1QO5A 1DOSA 2YPIA 4K7YA 3IIVA 1OJXA 3LOTA 3EWWA 1DQXA 4WY0A 3ZWTA 2JGQA 4NVTA 1YDVA 3BLIA 4EF9A 5K7JA 1B4EA 1HG3A 5FEPA 1X7FA 4NJKA 3TC6A 2QEZA 3FS2A 3GNDA 3UZ5A 1SZGA 4IOTA 1OFDA 4Q33A 3G1VA 4RKAA 1GG0A 1LRQA 5AFDA 1ADOA 3WJYA 3W1MA 3L5AA 1QAPA 2RHGA 5BW6A 2C14A 2GVLA 2GQAA 2BXVA 4E38A 2A4AA 3W1XA 3CQ0A 3G1HA 1AMKA 4BWLA 1R30A 3M43A 3W86A 3HQ1A 4DEFA 3DGRA 2A2IA 4LY8A 2EGZA 3SGZA 3DZ1A 5G1YA 4UTMA 4EOUA
chains in the Genus database with same CATH superfamily
2MNRA 4Q4OA 5I03A 3RYSA 2GQ9A 1OFQA 5C71A 3HPXA 3S3GA 3WK2A 4C6LA 2D2OA 2E77A 4JTQA 1YQ2A 3K1GA 3I3EA 5ABHA 3VD7A 2YKKA 3PWAA 4E3VA 5LKYA 3C2EA 4XD4A 4K8HA 1QI3A 5A6SA 1U30A 1B3VA 5C70A 1LOLA 5HWJA 2FLIA 4POCA 3G0SA 2W3ZA 5AYZA 3GXIA 3TE9A 1N82A 4MWAB 4D8AA 3O6CA 4JFWA 3NQ6A 1KR1A 4HB7A 3SJNA 4GXPA 2OEKA 1WKYA 2PBGA 4UZSA 5AHMA 1CGWA 1IQ8A 4Q3MA 5FJOA 1OCNA 1SYTA 1ITUA 3VI2A 3GFXA 8A3HA 3NL6A 5A8OA 3JUGA 3MJYA 1TPH1 3NO5A 3EDKA 2F2HA 2A0NA 2JGYA 5CPMA 4M5PA 2POZA 4M7SA 5EU9A 1Q6QA 1J6PA 4ASTA 4L1GA 2CFFA 4JTUA 4L6DA 4PCTA 3G0XA 4WDTA 2BVTA 4ZBCA 1QBAA 3UJ2A 1FHVA 4FOJA 4XZIA 4Q8PA 2J8TA 2V2DA 3PZ9A 4W7UA 1WOAA 2YA2A 2OT1A 3K13A 1OEPA 4PUDA 1JZ8A 2YSWA 1H7NA 1TVLA 3PPGA 2X0SA 1DORA 2OPJA 3QPZA 3T42A 2GQ8A 2HCVA 1PBGA 4BQ2A 4G7EA 2ZICA 1EDTA 3ENLA 1FHUA 1UP0A 3G1SA 3ZSSA 1JUBA 1TJ1A 1D2KA 2E40A 1HJQA 3QF0A 3S5ZA 1IWAA 4D6HA 4F4RA 3T2QA 3LCXA 3BSHA 2B31A 1P0BA 5EMYA 1W1TA 4X22A 4U28A 2HRWA 4KF1A 4Z08A 1Q8AA 4AMCA 1OC5A 1UYQA 4Z1DA 2OCZA 3WFZA 1JCMP 4QNWA 1KGXA 3GAYA 3KRUA 2DZBA 2A79A 3WNLA 4HSHA 2A7PA 2BLEA 4I8DA 1V02E 4OBTA 1YLVA 2V68A 5DX7A 4QX4A 3WQEA 1XBVA 1A5AA 4LOCA 4INFA 1NF0A 1QXLA 4PSRA 2XFYA 4KFPA 5CZTA 5G4WA 4AZGA 3RHGA 4C91A 5K4ZA 1HJVA 1LBFA 2FVLA 4PCFA 2FTPA 1EF2A 1PL9A 1RPKA 2A1YA 4HGXA 3W4RA 3MZ2A 3BOFA 5BYWA 4JICA 1GZ1A 3GR7A 3IS4A 2G97A 1E4MM 4QQUA 3M0MA 3ITCA 1F3XA 2PDCA 3TW6A 1X38A 3KLKA 4K39A 3VILA 3ZMRA 5HR6A 3RDKA 5AZ0A 1W1PA 3AYTA 1V3JA 4JTKA 1WDPA 3IGXA 1W3LA 2JIWA 4GIRA 3W01A 3R8HA 3AALA 3BZGA 1XC6A 5AVHA 3PTDA 5G4HC 4N9DA 4YWIA 2HNHA 4GUHA 2OLHA 1E6RA 3PUGA 3JS3A 3UGRA 1TQJA 3PZOA 7PTDA 2EEXA 1V6WA 3TJIA 1FWTA 4JOMA 3SZ8A 3BV4A 4A05A 2YJQA 2B7NA 4Q8TA 1KBLA 4KWUA 3WQVA 4S2CA 3EWBX 1ODUA 1BFNA 4I9MA 2XVLA 3P84A 2PDIA 3OBAA 4QROA 4JEJA 4DJEC 4Q8WA 4LAKA 1CEOA 1MXDA 3WFLA 3ATZA 3P62A 1UOKA 3WNNA 2G3IA 3W72A 5MKGB 2ZZ4A 1OSEA 3Q58A 1SZNA 4EIVA 1W5NA 4MTVA 1IIHA 3O6DA 1Z42A 4F79A 2Q71A 3TC7A 1NAL1 1SO4A 3PHAA 4CKQA 1P0EA 3ANYA 3EWZA 3FK4A 3K8KA 3W6LA 2PD5A 1VFSA 4CCEA 3GTFA 4XKYB 4KRUA 4HNTA 1JZ5A 4W85A 4DYJA 3QC0A 2XJ7A 4KCWA 2OR2A 1I1WA 2NUYA 3UY7A 4IFRA 2O56A 2UZ9A 1YE6A 2HNEA 2OFJA 1AL7A 4LAOA 1TR1A 3GIQA 5U4NA 1E9ZB 1QHZA 1W9VA 4W87A 4E5TA 4DF1A 1DHPA 2YOCA 1X1NA 1WZKA 1NIUA 3EOSA 3TOYA 5D8WA 2TMDA 1PZ3A 4LCSA 4OWGA 1BWKA 1OX6A 5J04A 1EP1A 4N6FA 4WJ8A 2Y8UA 1W2VA 3R6IA 3SQSA 3PJXA 3GY1A 1JEZA 4MY8A 1BKSA 4GI6A 2Z00A 1KM0A 3KBNA 1OGGA 4X3ZA 3DN5A 5C9ZA 2DIKA 3RILA 4JFVA 3V0TA 4BWLC 5DXYA 4GOAA 2ACSA 1M6JA 4IMFA 4U10A 2GK1A 4EPEC 1K1DA 4A8IA 1CYGA 2NSOA 1K7EA 1R0MA 5AOUA 1XLBA 3VGGA 2GVEA 2PZNA 4PEKA 3FJNA 2CWNA 4HHPA 1OT1A 1RQBA 3PB0A 1DJYA 5K2ZA 1W3KA 5HDRA 1V7YA 2PF8A 1SO3A 4GQ0A 1OBAA 3C5QA 3KBJA 1ZU8A 3E49A 4GUIA 4GFSA 3U2CA 4P7LA 1L6SA 4GBUA 2OGJA 1VAHA 5FJUA 4GY7A 1PKYA 2GJXB 3HM7A 4GYPA 2WWCA 3MP5A 4IMDA 3A12A 3TZNA 1HW6A 3VC5A 3LGGA 4GC3A 1NQKA 3GW3A 4HOXA 3IV3A 2FB2A 3WMSA 1C9DA 4Q6XA 1K3UA 4KPLA 1NARA 2W27A 1JPHA 2Y5JA 4UTTA 3RF9A 2R9RA 2ZDSA 3Q94A 1MNZA 1NY1A 4NXSA 3AIQA 3BJFA 3H55A 3HO8A 3LLDA 1W3TA 3LY0A 4C6CA 4N4QA 4LXFA 3RM4A 2EJ1A 2Y24A 2GDQA 1VYSX 5DY3A 2WMIA 5DRIA 3MCNA 3UWZA 4NX5A 2X2YA 1OGSA 4TTGA 1I2PA 4Q7BA 3RLVA 1OK4A 3RXZA 4CU8A 3VOCA 1Q6DA 3NPUA 1OWQA 2C3ZA 2E5DA 3O8AA 2ZVRA 3KCOA 1B9BA 1EF3A 4S3JA 1S3HA 2D2GA 4N6EA 4L4MA 3MDUA 3VIHA 3CQIA 2CITA 3ATYA 4CVUA 4ECLA 1WDWA 3O6YX 4ACZA 4HBKA 1Q7MA 1LL6A 1HUVA 5FSDC 3GZ3A 3SCOA 4MZ1A 4OHQA 4RZ6A 7TIMA 2QDEA 4PMXA 1MW2A 1N55A 4C6EA 3HU7A 2QPXA 1M5WA 3NM1A 4XAZA 1FXQA 4ZB5A 2P50A 4XVDA 1H0GA 2CESA 3LHZA 1HTIA 1F9CA 2WV8A 3KXQA 1VFFA 4L6HA 1GZGA 3IAQA 3OZOA 3ZLFA 1XIDA 4ZO8A 4V1YA 4BFAA 1FWSA 1HJWA 1TTPA 3M0HA 1LBMA 4GBDA 2Z1XA 1OX5A 3NQBA 2CZ5A 3A9BA 4KCVA 5JXQA 1O94A 4D71A 3F7JA 3WQOA 3PB2A 1QW9A 4DZAA 1ZJBA 3CUIA 1H41A 3AMKA 4OJYA 3MT1A 2EG6A 3LU2A 1G0CA 5A6KA 1V3MA 2BB0A 1AQMA 2EG8A 2WCGA 3MSDA 3N73A 4PMOA 3AWNA 3E6EA 4IT1A 1RP8A 3G1AA 3LS9A 2QGYA 1UOZA 1M04A 2WQDA 2TODA 3NQFA 1F07A 2A3HA 1F76A 2Z0IA 1A5SA 1XRTA 3C0SA 1MDLA 4GXMA 2Q6ZA 3GBEA 4PRTA 3P82A 4LB3A 2HVNA 3MSRA 1RLCL 3NQ2A 3UCDA 4E4FA 1EPXA 5AKQA 5HNNA 1XG4A 2ISWA 1W37A 3NZQA 1UCWA 1JPDX 1M41A 2I9EA 1B9ZA 1OM0A 2DVXA 3B3DA 1YIXA 2VWSA 3FEMA 3HGJA 2IPFA 4TOQA 3ECQA 1M7JA 3MUXA 2PRMA 1NM9A 3FVDA 4H00A 1K4GA 2EPHA 1W31A 2Z7KA 4O14A 1J0ZA 2ON3A 2D73A 5E70A 3O6AA 2X40A 4JTDA 4GUGA 2V5KA 3MS8A 2X41A 4XISA 2X1IA 2XIOA 2EXOA 4M8UA 1LLOA 1TTIA 4ERAA 4E2DA 2BY1A 2AL2B 4JR5A 1CB2A 1F05A 1GOXA 3BGAA 5CC6A 4PGLA 2VRJA 4G1KA 1XH0A 3CGTA 2Z1VA 8RUCA 2EPKX 1XDLA 1GJPA 1K77A 4NUWA 3K46A 2JEPA 3JW7A 4JIEA 1KKRA 5HAOA 1BD0A 1U33A 3ZSTA 4LUTB 3V5OA 1RQHA 3EAUA 1RD6A 1VFOA 3N6HA 7ENLA 1NOUA 1KGWA 5F1UA 2QCDA 4PEEA 1MZRA 5CPTA 5FACA 3DOPA 2HS6A 5H2ZA 4RDYA 1I2QA 3IJ8A 1OADA 3AIBA 4UFJA 2AOSA 3POHA 2WBKA 1KCXA 4B9ZA 1VENA 3ELFA 3AJ7A 3R25A 3T09A 1HVQA 1R3RA 3RX3A 4ZE5A 4AZIA 1VHCA 4Y8FA 5ECVA 3DENA 3HFTA 2AKMA 1Q2RA 1XIBA 1F6YA 3KDOA 3BMXA 4KGLA 1LBLA 4LCRA 3L4TA 4E2VA 2GQ3A 5HA7A 2R94A 1MMFA 1TR9A 5KMYA 4CCCA 4EKJA 2G8ZA 1A5CA 3MUZ1 3CIVA 5BMWA 3KVJA 2GJPA 3T1GA 3OZPA 3NZPA 1UP2A 3I7RA 3VIIA 1W1A1 2CU0A 1OCJA 3QM3A 4G8TA 3UJEA 1AL8A 3VTRA 1Q65A 3PR2A 2IPGA 4IMAA 4TX6A 4K3ZA 3LA4A 1W3IA 3GKAA 2EPLX 3MW7A 2J88A 4JN7A 5C0QA 5CC3A 5FESA 3HGRA 1EUAA 3MV11 4CU6A 1Q7ZA 4W93A 4AEOA 4UTKA 3L2IA 2X7WA 1X97A 3GDBA 4RNIA 1VEPA 2OYMA 4LNYA 1UZDA 1WOBA 3CT7A 4HN8A 1LL4A 4B2DA 4TUFA 2EAWA 2OYLA 1CXIA 3OJGA 3DYMA 3OVQA 1PX8A 1ADDA 3QY6A 2BTMA 1VFTA 1EXPA 3CH9A 4H4IA 1OINA 2G50A 2NT0A 4GUFA 3GTNA 3OTRA 1ZAIA 4QAWA 3MMDA 1O4UA 2QPSA 3FLUA 5AB3A 1ICSA 3DIPA 7ODCA 4L4OA 4IQJA 1NDWA 3M0IA 1J12A 4E3TA 4CUCA 2ZRVA 2BOFX 4AG0A 2GFTA 1YTKA 4GNJA 1L8PA 3WK1A 3HG4A 4FA3A 2WC3A 4AZBA 1EEXA 2VX4A 4MB1A 2VYOA 3IUHA 4YLWA 2BODX 3O9NA 2HJPA 1MQPA 1H7RA 3LHTA 3JRKA 1BYBA 3P3BA 4QLLA 3P81A 2QF7A 2FZ8A 3IJLA 1OC6A 5A6MA 4GWEA 1V6XA 2UY2A 2ALRA 1ZJAA 3QLDA 3WJWA 2Z26A 1KM2A 4RX0A 1TQXA 3V5CA 4LUSA 3MJMA 5HMFA 2HISA 2ZUUA 4AD1A 2PTYA 1GWJA 4AEEA 3A4XA 2R1MA 4Q4SA 5ECUA 4V1XA 2Y0FA 2GVYA 3AXHA 1OGBA 2R8WA 1AJ0A 3UWYA 3ZYZA 3P0WA 4JFTA 2EO7A 1E0TA 2V8ZA 1OX4A 2DW7A 1FWIC 1TCDA 4NU7A 4CD7A 1YDOA 3H54A 2NV2A 1JPIA 3TXVA 1CECA 3LXAA 3VD3A 1Y5XA 5IBXA 4OIFA 1BVNP 4W9TA 4HPGA 4B5WA 3TCSA 1SO5A 1VEMA 4GJIA 1WAUA 4IGNA 4HMDA 4BHYA 3PANA 3EX1A 3NAVA 2WVVA 5EKYA 2OODA 5M5DA 3EDJA 1DL3A 1H0IA 5KZ6A 1TVPA 1QW8A 3MBDA 3VGHA 4C6IA 5T8GA 3QYSA 1SM9A 2QUMA 3OLDA 3TNOA 5IDIA 4LEFA 2IXUA 3K5XA 1CCWB 3W02A 4IFOA 3AISA 1QT1A 1YE4A 1N8FA 4DBSA 1KM3A 5F4WA 1MFVA 1LUCB 3AHTA 1Q3NA 3BLPX 1WXJA 1YRRA 3N34A 1E51A 1DWGM 2V2HA 1H7PA 2VO5A 3P2VA 4HMNA 3ERPA 3GXMA 3NL3A 1R86A 1VB9A 2OLSA 4HZ6A 5I78A 4DF0A 1EX1A 5JQ9A 3W1NA 2GGEA 1N8WA 4CN6A 1NVMA 1TO3A 3A4JA 2GDUA 1E9YB 3M5ZA 3NQEA 4H8UA 1V0KA 3OVGA 1KC7A 3WD1A 2E09A 2V5BA 3SIMA 4WKAA 4XK2A 4YHGA 4UR7A 3TU9A 1LCOA 3ONBA 1IEQA 6CGTA 1CBGA 1WDRA 4AD0A 3T55A 4BS0A 2WHKA 4H6RA 4L5ZA 5HULA 3ITGA 2HVOA 3QEZA 1QMLA 2OWWA 3V3WA 4ZOEA 3N6QA 1IR2A 1WZLA 1VLWA 6TIMA 4JTEA 3I6TA 5LGXA 3C2YA 3QZ6A 1H7WA 3GB6A 2VL4A 3RU6A 3VD4A 2LLEA 2E0PA 3D46A 2CBIA 1JXJA 4PMZA 1AH0A 2Z1KA 3VNDA 4X60A 4ZQMA 1R3YA 1A49A 3BANA 1V93A 4EPKA 1XLDA 4H2HA 5A2AA 4O0ZA 4N2YA 5HMDA 4CNNA 4CN4A 3LEPA 1QHOA 2Y63A 5XIAA 4HPXA 1Q4NX 2VR5A 1W3HA 1XKJA 3IJDA 3P5ZA 3O15A 4PA8A 5F2GA 3KOYA 5AYBA 4P7QA 4EAMA 3PPCA 3FW6A 3U2EA 7A3HA 5HR7A 2VOTA 1E6ZA 2CLFA 3MANA 3BURA 1EJRC 2WKJA 4AQLA 4J2MA 2PGWA 3O16A 3L9CA 2I16A 2X42A 2JEQA 3TX9A 2DSVA 1J79A 4I6VA 1UG6A 3OVRA 2E6YA 1HL8A 1REQB 3GYEA 2J25A 1ADSA 5D9MA 5A8MA 1W5PA 1B57A 1VIWA 5H6HA 4RPPA 1TPWA 3VDBA 1Z48A 3L68A 4UQEA 4YYFA 5C7VA 4QJ3B 1KM6A 3W7OA 4WEVX 1JRCA 1JFHA 3UG5A 3DERA 1XYBA 3WQWA 1L2UA 3CQKA 4IPPA 5D33A 4DJDA 4A35A 4ICCX 1VFLA 4UFHA 4LUJA 4DAFA 1SJCA 3GAKA 4GKLA 3I4EA 1P43A 4V28A 1T5AA 4MB3A 3KOWA 4NZ4A 7TAAA 1AFSA 4CD4A 4F0MA 3MA8A 1EA0A 4PTWA 2IPWA 4F8XA 7REQA 3RG6A 3S5YA 1VP5A 1B31A 4IX0A 3IVSA 2ZZ3A 2CZEA 2G95A 4LBRA 1DWJM 2J77A 1HNYA 3DYPA 4DBDA 1XUZA 1XYLA 3BZJA 4S39A 1F4HA 1VLIA 1H1YA 3VMPA 4I9TA 3OOQA 1AH3A 2A3LA 4W5ZA 1GUVA 3IRDA 5L9FA 2EPOA 1JD9A 2W4XA 2ADAA 4ZL1A 4K8GA 3T44A 3TQKA 3BQ5A 1X39A 2EJAA 5CSYA 2WVSA 2WC4A 3WUFA 1BKHA 1VD6A 2DT1A 3GC2A 1E72M 1WE5A 1OVDA 1UR9A 2VEGA 1Q63A 3L21A 3Q67A 4Y9AA 2VEFA 3PK7A 4MDOA 1KWGA 4S3FA 1PSCA 4HHMA 2DP3A 1W32A 5G2IA 3CYVA 1U5JA 5I3IA 4EPBC 4TMBA 3L2MA 4M6QA 1QTWA 2TSYA 3WLJA 3TYAA 3DHDA 4HJFA 3EOUA 4OQVA 4JTLA 1KBBA 3TMQA 3V1HA 5CKSA 3AYVA 1KXQA 2J7BA 3QQWA 1PWLA 1AUSL 1J0JA 4WSJA 2C7FA 1VF8A 4MWAA 4LAUA 1QPNA 4M56A 1BSLA 1JAKA 1B0IA 4D8LA 4H83A 4MZ8A 1E71M 3AU2A 3UPMA 4HK6A 4RK8A 1G67A 1D3GA 2BY0A 4PCSA 5A6LA 2IKGA 1NDZA 3S6DA 1J6OA 2P5NA 2WHLA 4NYUA 3NNTA 2QKFA 2ZRUA 3BMWA 3OBKA 3SN1A 5I00A 2FH6A 2OX1A 1Q6LA 1PIGA 1PPIA 4JL2A 3U0HA 4JYDA 3L0NA 1MXGA 3VGBA 1H09A 4LWWA 3CAKA 3LGDA 3YPIA 3R5EA 5DBUA 3C61A 2VWTA 1E15A 2X09A 4HA3A 3M07A 3VCRA 3SDOA 3WDQA 3E96A 5BU6A 3WLRA 4JD4A 4Y6GA 5FJIA 5M17A 1POKA 2Z1WA 1ML1A 2J4GA 3ARZA 2CBUA 2XINA 3IJQA 4IX2A 3TR2A 4GH1A 2VEIA 4JFSA 1FWDC 1M65A 4C6BA 4REQA 3M4HA 2Y7FA 2FPTA 4H6KA 4TVCA 3GG8A 5LNUA 3SUWA 2ODOA 1UH4A 3GHTA 4IUGA 1QWGA 3N15A 5EGRA 3WLQA 5T9BG 3FAXA 3PP7A 3EKLA 2Z1BA 1XINA 3NXFA 3BLFA 1OF8A 4ZO9A 1K8XA 4UNIA 1CXEA 1S5TA 6ENLA 4D9PA 4YVXA 2NW0A 5BOEA 3W7EA 3PZIA 1MI3A 1JZ6A 2EKCA 2E3ZA 3VXGA 2P0OA 1XLGA 4GZIA 3AJXA 4MSSA 3A22A 1LJYA 4HN4A 1OT2A 3GR4A 2ZXAA 3BICA 5A6AA 4UOZA 1G7UA 5LYRA 4J40A 3S2NA 3U4FA 2CIPA 1VCGA 4IHCA 2ZFAA 3S0CA 2CYGA 3EGJA 2VFEA 4YPJA 1XIMA 3LPFA 4R33A 3TN4A 4BY3A 5FA5A 4BQ4A 4EXAA 1DJQA 1LL7A 1MXSA 3VK5A 1V6YA 4AB4A 1AQFA 4GO9A 1PB0A 4GZJA 2ZZ7A 2VCBA 1J96A 1E6NA 4PB5A 1JNEA 1NDYA 5M03A 3WD0A 4O8RA 4C5YA 4JTHA 3GFZA 2DQWA 1BPLB 3A13A 3FV9A 1OHLA 4UTFA 4OFCA 2VCCA 4MGGA 4HTYA 3G5EA 3S2LA 3KP1A 1YXCA 5I7GA 1YNQA 2INEA 4LPCA 3W7JA 3RM8A 3CL7A 3DH7A 3MSYA 1GQNA 2VGIA 4X61A 1XV8A 3BC9A 3BCFA 3CWOX 2D22A 2UV8G 3W74A 1LLZA 2E5BA 5AN7A 2WMJA 1JCYA 2CBJA 5DANA 4IZGA 1HL9A 3L2LA 3UJRA 2VQUA 4MNLA 2FFIA 1Q5MA 2D2JA 2GL5A 1GOOA 1GPWA 3GDLA 3QW4B 1QNQA 3PNZA 5HXMA 1XRVA 5REQA 4O10A 1EBGA 2INFA 1JYVA 2PDFA 3QW3A 5MKGA 2V67A 3EMQA 4WZHA 3WK3A 4NI8A 1FCBA 3TAKA 5CG0A 5BXPA 1RY8A 3LDVA 4E6MA 3E0WA 3BG3A 5E0CA 1GONA 1UD6A 1BSIA 4JCMA 3NFUA 3RCYA 5U7SA 2NUXA 2KX9A 4HJWA 4FIQA 2HSAA 3FCPA 1F5ZA 2NZLA 3LBOA 1TIWA 4J7RA 3EXTA 2YB4A 3AHYA 3AFBA 1AJZA 2G3NA 3TYBA 4KT2A 1KBJA 4N9EA 4J3ZA 1CTNA 2CERA 1WUEA 1EEPA 2Q02A 2KZHA 3N11A 5DBTA 1OQFA 4PC8A 1C92A 4LS1A 3Q45A 3MBFA 1TKKA 3MVTA 3IANA 4PYSA 5J5DA 5C8BB 1L6GA 3QOKA 1NQ6A 4UXDA 3WEOA 2QJHA 3WL1A 3AQUA 3L7RA 3DBNA 4B2DD 4NZ3A 1UUQA 1UD4A 3IUIA 1X8FA 1QVBA 2OWXA 4B16A 3CPUA 2HROA 2YXOA 1XIJA 1XJBA 1A5MC 3CMJA 3EWWA 4WY0A 3ZWTA 1XYZA 3N6JA 1HKWA 4G7EB 3QV9A 3VGFA 4C6OA 5LIKX 2ZX7A 4G5DA 3UZ5A 3G1VA 2WB5A 4QFUA 1LRQA 3W1MA 3L5AA 1QAPA 3IJ9A 2PD9A 3ZIZA 2BXVA 2GJXA 3W1XA 3CQ0A 1RSCA 3G1HA 4RE2A 1AMKA 1R30A 2YB1A 2BDQA 3HQ1A 4GYJA 2EGZA 3SGZA 3DZ1A 5G1YA 2PLMA 2J9YA 1EWDA 4JTJA 4Z1AA 2XU2A 3ANUA 4AYGA 1VRXA 2Q3OA 4XTDA 2WVUA 4AZ5A 1I75A 3ZO9A 3W82A 3QQ0A 3NZRA 3B97A 1DJXA 5EMLA 2V3EA 4O50A 4M0XA 1ZZMA 3G6MA 3VDCA 1QU4A 3HJEA 5KITA 3DHPA 2A5HA 1RBLA 4XZ9A 4Y9MA 3T7VA 2X1RA 2QCGA 4TVUA 5AVNA 2HQAA 1OY0A 2AQOA 3WZ0E 2O9TA 3VMOA 1UA3A 3NO3A 1MDRA 4YVPA 1SR0A 4AH7A 3N3MA 5EBUA 4BF5A 3WLSA 3QLLA 1GEQA 1SJDA 1UD5A 4RCXA 4W8AA 4XVEA 3ALGA 3MCMA 4UTHA 2A6NA 3ZR5A 4HNNA 4HPJA 3T0BA 2HTMA 3MUIA 4S3DA 3R8GA 3W37A 3EMCA 1WCGA 4GI9A 3R7MA 3CO4A 2CPUA 4HTBA 2A3BA 2R82A 4L56A 3A3HA 4MOZA 3W7IA 5CJ5A 1ISXA 1MW1A 9XIAA 1P48A 3WIJA 4JQ4A 1XLKA 4RL3A 1XW8A 1D3HA 1E40A 2R91A 2DZTA 5H8UA 2VRQA 1DIDA 3NDYA 3KTSA 2WK2A 1EHAA 3N2TA 1NH6A 2VZOA 1LYXA 2E67A 3W7KA 4M82A 1LQ0A 3H4GA 4GPNA 3CLWA 1TWZA 1XCXA 1S2TA 5DF0A 2BSLA 2ZRWA 2JQXA 3TVAA 3DGBA 1EGMA 3M16A 1SZFA 3PJUA 5CJNA 1F2JA 4LVFA 1EZ2A 5DO8A 3THDA 4S23A 3VDAA 4DWDA 5XINA 4AY8A 4Y9NA 3TROA 3CAQA 1JZ4A 5LXEA 1F4AA 3BAIA 4NASA 4GX8A 4MKSA 1K6AA 1UW9A 5G1MA 2PU0A 3S6OA 1QK2A 1ONWA 3THUA 4O57A 2PDPA 4OZOA 2P76A 2WQPA 3IJ6A 5K4XA 1X96A 1DE6A 3ARXA 3W83A 2Y7DA 1AW5A 5HUOA 3TTOA 3S47A 2JKEA 3TYZA 1PX4A 2OZ0A 3ARWA 3P67A 3TSBA 2FZ9A 5BOFA 1JF6A 3BV7A 4L9ZA 3L66A 5JIPA 3WENA 3ITXA 3ARYA 3SO7A 4UFLA 5HJXA 1ISVA 4H9YA 4I5UA 2PGRA 3P6LA 5KTLA 3W0KA 3SUUA 1QPRA 1FP9A 1FXPA 1FWJC 1RHCA 2I57A 5IHRA 1RLDA 4QNEA 4AWUA 2Y5EA 3HOJA 4V33A 3MY9A 3CT2A 4E8DA 3DHFA 4B5UA 3CHCA 1V3LA 2IW0A 1YDYA 5C9XA 1W8GA 2UY4A 3SECA 1PXGA 1W3JA 1TJPA 5LIWX 4OU1A 5EFFA 1WNOA 3C0QA 1O1ZA 3M47A 1SW3A 4GG9A 1MWOA 1TG7A 5I3DA 4ROQA 3WLPA 2EPNA 4J27A 3MWCA 3IJ7A 4CQ8A 1E9LA 4O11A 3CV7A 3KM8A 1XYMA 2VTFA 3C2RA 5IXEA 4WXZA 2WVTA 4YCOA 1EJWC 4JTTA 1JYWA 2FGBA 3WJZA 3UR8A 2OMAA 5I77A 3GZAA 3NSXA 2NQJA 3S5SA 1JZ2A 2AL2A 4LVGA 4QM1A 5BRPA 1G94A 1AW2A 1WZAA 1DXIA 1ZUAX 3C4UA 2WM1A 1BTMA 3N29A 1F3WA 3UNTA 3TQVA 3KL0A 2I17A 3WQDA 1PS9A 2OTDA 2ZCGA 3EA2A 4H7CA 3V0SA 2CLHA 4XD6A 2WMKA 4ZE4A 4U2YA 2ZUTA 3GVGA 3UCQA 3SRFA 2PDJA 4IQEA 4LUTA 3SSZA 3OGVA 3WDRA 4GY1A 1PKMA 2DH3A 4DJDD 4H8HA 3PG8A 4ERIA 4PN2A 2QR6A 5A5WA 4TX9A 4WGXA 3B0VC 1QJWA 3M0LA 4FNUA 3CWHA 2A21A 1NFGA 9XIMA 3T81A 1FCUA 3KBSA 2HBVA 3SUVA 2OEJA 4IPNB 1VJIA 3N19B 3F4NA 2CNCA 2ZZ5A 3DC8A 3LTSA 4L4PA 5FL1A 3SY1A 4O17A 3NEHA 3E5PA 3BAYA 4Q4PA 1KFEA 2WMHA 2FQIA 1KFLA 2V5CA 3PZQA 1FKWA 1EHNA 3N13A 3SRDA 2GGHA 4YN5A 1QOXA 2OOGA 4XAGA 3TA6A 4JHMA 4U3AA 1FOBA 1W9DM 3MI2A 4B4FA 3UG3A 2UY3A 5LNSA 1GVFA 3LTYA 4LY4A 5JBEA 2DJLA 4YTRA 1UKPA 3LG3A 4FNPA 2B7QA 3QBUA 4ACZB 3GXPA 2QUVA 2WNZA 1XHGA 2BZNA 4J3WA 2VELA 1YNPA 3H4XA 4DBWA 3DI0A 3VOJA 1GVYA 4WY0F 3B9NA 1CIUA 3E12A 3G6LA 4U33A 2W6RA 2YDSA 4J9JA 4HNLA 1HN1A 2E8YA 3WNPA 4S3AA 1WKFA 1XD1A 1V6TA 1G7VA 3D3FA 5ABTA 1Z8AA 3VO0A 4Z42C 2D3NA 1UKQA 2Q3RA 3OGSA 2P88A 4L4LA 4FXJA 1TPUA 4HK7A 2J47A 1X1ZA 1FBAA 1OK6A 4X0NA 3GHSA 3MUAA 2DGAA 2VC5A 2J74A 3KAOA 4PMUA 4O0KA 2PTWA 3KVKA 3LHYA 2CW6A 1OFBA 1YXDA 3MSGA 1VGAA 4ACYA 3FFSA 3B8IA 3EPMA 3ES8A 5CC7A 3LK6A 1F8MA 1NP2A 1GZJA 4QTGA 3IIPA 1DWFM 3DCPA 3FN9A 2WSPA 1XR2A 4QXIA 3VZZA 3ES7A 4MWAD 4RDZA 2QXWA 3PG9A 4JN6A 3TYCA 2G3MA 1UR2A 1ZALA 1CGUA 2XSBA 1E3ZA 3UA3A 1TMHA 4AZHA 2HE8A 5F4SA 4U5KA 5D38A 1W9BM 2A3AA 3CC1A 1EQPA 1VBGA 4NAFB 4MAVA 5KETA 3BUVA 4GQQA 3UERA 5HMSA 5M3WA 4EANA 1I45A 4QEEA 4GC4A 1MEHA 2YZRA 4JKKA 1J4EA 4YIWA 2BG5A 2VGGA 1UPPA 4DI8A 1UD2A 1XICA 2V69A 2QCHA 4DO6A 3ZR4A 2V0TA 3B8DA 4TXEA 4AY1A 3C86A 3VVGA 3H2AA 3CHDA 1ZNNA 4K1GA 5FCZA 3WCZA 1EWEA 2YCLA 4DF2A 4MYXA 2ACUA 1GNXA 6TAAA 3USZA 4WUIA 3HGSA 3VCCA 1RA0A 2YL8A 5KZEA 1W9UA 2CKRA 5C55A 4PSPA 1CGYA 4D72A 4IIGA 4HPHA 3P8IA 4AU0A 1UJQA 4WR3A 4P2VA 1UQYA 2DZWA 3NPXA 1RK6A 2ZRXA 4IL0A 2ZTJA 4P7OA 3UXLA 2Z2UA 1VBJA 4UCFA 1Q6EA 3MKKA 3NQ7A 3U2OA 1LWJA 2BWGA 3GWQA 2B4GA 4MWAC 1M3UA 3E2SA 1ITCA 4FB7A 4PH6A 3NQ8A 2QCDB 1BXCA 4LYQA 3TCEA 3B8UA 1JCTA 3OP2A 5H1WA 4Z0JA 5I02A 4IMEA 4O52A 4L7ZA 4NP7A 2X7VA 4LS2A 1XLEA 4DJFA 1LUCA 1TTJA 2Y1HA 4IQDA 3PPHA 1AZ2A 2QJJA 3GNOA 3IEBA 3WQ4A 3QY7A 4I90A 1EGVA 2ZA1A 3W1TA 1P4CA 4D8ZA 2V5JA 3S8HA 3AXXA 3EYPA 1VBUA 3B9EA 3C3NA 2E25A 3BDKA 3CAVA 3BSMA 5B80A 1XLLA 3CL6A 3AS0A 4MFDA 4LF2A 2J7CA 3TIMA 4GMEA 2YDAA 3WEMA 5D2XA 2A3CA 2QAFA 1QBBA 2ZXQA 1R2TA 4QQ3A 4XX6A 1ALDA 5KEZA 3B9DA 2PODA 2GPTA 1PHQA 4WDXA 3C8FA 3EX2A 1DXFA 1S39A 3SCRA 2YBTA 1ZS2A 4HNOA 2INZA 4FHAA 3UZZA 1D8WA 1HGWA 4MJ2A 3UPWA 3ZJ6A 4CCDA 1S3TC 1E55A 4LAZA 2NT1A 4CEXC 2ATSA 4HIBA 1BHGA 2DU2A 1JCLA 2WCSA 3NL5A 4OECA 3QHMA 2VM8A 2ZA3A 4NNBA 1BAGA 4OBRA 3BAWA 4B4HA 5HJYA 3XINA 1R9XA 4FLOA 4NX0A 6A3HA 8XIMA 1T41A 1H62A 3C6CA 4ZODA 4IJBA 1UUMA 5G2WA 4F2TA 4N9BA 1JFXA 1OFAA 5AHFA 3CEUA 4DLFA 1ODZA 3H2MA 3UPBA 3VFLA 1A0CA 1XPGA 2X30A 1KW1A 2P8BA 3WLTA 3UR5A 2OSWA 1A53A 3OIXA 1KM4A 3R12A 3U3HA 2ISFA 3VNLA 4B91A 4P8WA 2V38A 4ORMA 3U9IA 4B15A 1ZAJA 3S5NA 4C1LA 1VFUA 4JDBA 4LS0A 3O0FA 3E9AA 1IHIA 1NU5A 5A8PA 1G4PA 3LBMA 1TV8A 1YPFA 1C3FA 4XIAA 2BV9A 1H51A 4C6PA 4IIHA 1JDEA 1RCOB 3URNA 1X6LA 1H63A 4IP7A 2D0HA 4FPSA 1T8QA 1UZ4A 3WDPP 1Z32X 4D6EA 4IJCA 3N2OA 1DYSA 1REQA 3CUXA 4O4WA 3VIOA 1WO2A 2QVNA 3W88A 5DN1A 1XGEA 2Y70A 3NGFA 4GIYA 2OQHA 3SN4A 2J7DA 3GRIA 2VC9A 1XDMA 4GIEA 3LNPA 1T8XA 3DHUA 3B8TA 3E0VA 4G1NA 5D2TA 5ABGA 2Z6JA 1O5XA 2FZBA 3W7DA 2R6OA 1O12A 2ZZ1A 3TDFA 3FGCA 4JAWA 3TN5A 5DCEA 3U4AA 1YNYA 1Q6GA 4CQCA 4JQ1A 1G1YA 2IQDA 1BXNA 1V77A 4FOUA 3T40A 5C5YA 1FA2A 3QV8A 1GQLA 2GGJA 1IEVA 3GDKA 1TRIA 4C1KA 1LT7A 2B7OA 1QNPA 3W7MA 4CCZA 2VD8A 5LA2A 3NVDA 1RUSA 1YPIA 2WSQA 3QGVA 1DXEA 1OX4B 1GKRA 5IM51 4Z2LA 4H6QA 1XIEA 1VFMA 3GYCA 1PV8A 2CHRA 4JFUA 2DT3A 4H9MA 1G4EA 4LGXA 4NYYA 1IF2A 3WMLA 3NQAA 2PAJA 3W1UA 1KKOA 1EJTC 2JFEX 4I7WA 3GR8A 4DZ5A 4ZOCA 4MNKA 2XIBA 2WVVB 1AQHA 1EZWA 3WDJA 5IDZA 3RO8A 3P7YA 4H8VA 1GHRA 4QEHA 1AVAA 4Y9PA 1TZ9A 1J5TA 1OIFA 3SI9A 3H26A 5AECA 3CTTA 4MJ4A 3G18A 5F7UA 2IQTA 1JDDA 4P5UA 4HCHA 3NYDA 1FH8A 1FWAC 3LPOA 2IKJA 1KFJA 4CNOA 3H7RA 2P3ZA 5F2IA 3PZTA 3WLNA 3Q4DA 3A64A 4M3PA 1FH9A 1SMAA 4DUWA 3TTSA 1ECEA 4GH3A 2E9BA 3GM8A 2WANA 2PBOA 1J0KA 2HXUA 3ITLA 2ZUVA 4Q4QA 1KBIA 4YTSA 1AQ0A 3TR9A 1D7FA 3VE7A 2ZA2A 4JKLA 4F0KA 1JF5A 7XIMA 5CC5A 4IUOA 1XG3A 4GABA 5CBIA 4PUEA 1Q4WA 3EXRA 3S2JA 2YL6A 3SFKA 4O1DA 9RUBA 4MDPA 1DWHM 3A3WA 4C7DA 2ZXDA 3U57A 4J3TA 4ZQRA 3GD6A 3WQPA 3DKLA 3S1UA 5C9WA 3CAWA 1RK5A 5BZAA 4FIRA 3QH2A 4L9YA 1FVPA 3CMFA 1E56A 2Z27A 1GVRA 4PMVA 1KGUA 4ZGYA 3CK5A 3T9PA 5CCZA 3BCJA 4F9JA 3M0JA 4FO4A 5H8PA 3REQA 1UD3A 4YXGA 1NWTA 1KBKA 2DW6A 2Z2BA 3UU0A 4H01A 1XSJA 2O55A 3PC0A 4W84A 5GJNA 5KZMA 1FWBC 1K6WA 1CENA 4Q4KA 1V7AA 1UASA 2V6AA 1U5HA 4RE4A 1TVNA 1DKWA 5CH9A 3EWUA 3RGTA 4IP4A 1TIMA 3KCJA 2PE4A 3UXAA 3UZYA 7CGTA 4Z2KA 3K8MA 3MDWA 4AHOA 3GX9A 4QBXA 5XIMA 1ZGDA 2BHUA 3CS2A 4XAFA 4NJGA 3Q65A 4LVAA 1B54A 3KUMA 1UMLA 4LCQA 2PSNA 2WBGA 3HG5A 3R0DA 4DY1A 1I8JA 2VX7A 2OQYA 3ZT5A 1W9PA 4IXXA 2RGLA 4BI5A 4QG8A 3IARA 3NQDA 4R9OA 4AD3A 1E5JA 1A3XA 3NL2A 1V0MA 4WK9A 3PZNA 3BAXA 4HNUA 1JL8A 3C2OA 1HFBA 4B5SA 4D1IA 4DELA 1H1NA 5JU6A 2Z1SA 2OELA 1TPEA 4PMYA 3O1NA 1SQ7A 1WQ5A 3OVPA 1KLYA 1ZY9A 3M44A 3NCOA 2DSKA 2J13A 1WP6A 5J8LA 2Z25A 5EMKA 4QG6A 1H61A 1YW1A 2PDMA 4JQ2A 3ZJ7A 3M9YA 4ZENA 1UKTA 3DG6A 3UZJA 3RMJA 3H21A 3ARRA 4E8CA 1C93A 3LMZA 4E2OA 3N04A 1JDAA 3CBWA 4OGZA 2ZIDA 2AQWA 7REQB 1R46A 4WD0A 3WNKA 3IK2A 4CNSA 4JDYA 2PTZA 1XXXA 1W2PA 2XZ9A 4ZTXA 2DJXA 3STEA 1IR1A 5D9PA 2D0GA 3LRMA 4W88A 2D69A 1W9XA 5TF0A 2ZYFA 5AYXA 4NF7A 4FXRA 4ICNA 3IVTA 1JJKA 1OF6A 1C8VA 1TMQA 4W89A 5DMYA 1TSIA 2YIHA 3PY2A 1O5RA 1WBHA 5ABFB 1R2RA 1W5OA 3NOEA 3S2CA 1IGWA 1UWTA 1O60A 3DDMA 3ID7A 3DBPA 1C8QA 4PTNA 3A9IA 3LZ5A 3RLUA 3ABSA 1A5KC 2DVUA 4JNMA 3T6CA 4GZEA 3CEPA 1EO5A 3H7UA 4IP5A 3T78A 1V02A 3ABOA 2YCJA 1XX1A 4B3LA 3LCGA 3UT0A 2WZMA 4US6A 3PUDA 4B9YA 2DT2A 2WJZA 4HNVA 1WKDA 3POCA 3TYEA 3MI3A 3T0TA 4LRSA 2J9ZA 1LORA 2VURA 4LBSA 2BHZA 3GHRA 1KV8A 3G77A 4X9YA 2C0HA 3HMCA 1I0DA 5E0FA 3ARTA 1GCYA 3KHDA 2WKGA 3A23A 4Y8EA 4HYWA 1UKSA 1J8VA 1M53A 2V9DA 2DZSA 3V7PA 2GYIA 3BE7A 4GI4A 1KRMA 1NWUA 2CLMA 5KINA 5FAGA 1XLAA 1VZWA 3ITOA 3N4FA 1DJZA 3NGJA 1ZHAA 5FIPA 3XISA 5LNVA 1YTDA 3W7HA 3O06A 2VOMA 4CNTA 3SQLA 4O53A 1WZMA 3K4DA 3HF3A 3BPWA 2EG7A 4JX5A 4XO6A 5LGZA 3M5YA 3EOLA 2O4QA 1PUDA 1FWNA 3S2MA 1X6NA 3T0AA 2Y5SA 3SB0A 4Q32A 5I0DA 1GVEA 4UFIA 3P74A 1PTDA 5FOOA 5D04C 4YTTA 2AGKA 1QO2A 1TZZA 4WLCA 1IWPA 2QF8A 4UFMA 3GVWA 4LEQA 5CPSA 1R6WA 3ZFHA 3TW9A 2Y88A 4R9XA 2WPBA 1P1MA 2OJPA 3WQFA 2DZPA 4HSOA 3CZEA 1GTEA 5I3JA 1JGIA 1L2QA 3CNYA 3W7LA 3AMDA 1KRAC 3KRSA 1JDFA 2VEMA 4OTKA 4Q8VA 1EJUC 4PR4A 4REQB 3WQCA 2W62A 1E0WA 2XM1A 2WOQA 3IV8A 4B3ZA 4GZ7A 1O6IA 3BLLA 2F61A 2VEKA 1LTDA 2PWHA 3GC5A 4OOZA 3LCLA 2UY5A 3I3BA 1HT6A 3M1ZA 1AJ2A 1W6TA 4Y7EA 4BCEA 4IXHA 3L4WA 1S5WA 8XIAA 4IIEA 3CB8A 4Z1CA 4MNJA 1LRNA 3GXDA 1H7OA 2I56A 4KRTA 4H8NA 4RDVA 2DQXA 4AZ7A 1XYFA 3URQA 1CB7B 3AUJA 3IIOA 1KD0A 1PTGA 4U4MA 4JQAA 2RJHA 3H70A 4GCXA 2NX3A 4JHOA 3T8LA 3LLXA 1FWEC 1IT8A 2I7GA 1U22A 2QYGA 3MKVA 4H9VA 1W8SA 2C91A 3VKDA 2YR1A 3KFTA 2WJFA 4Q8QA 3TTEA 2PI6A 3HPZA 4AD5A 3S1WA 2VNCA 3WFAA 1QPKA 8CGTA 2OQLA 3W7PA 3S1XA 3AC0A 3KW3A 1KQZA 3CPRA 1EKOA 2YXXA 3H53A 4ENLA 2Y4SA 3L12A 5I24A 1FY6A 2IQ0A 3BLKA 1VH7A 4FXSA 2E4TA 1XIHA 3D3AA 4K7VA 4GI8A 1XLHA 3C3UA 3SCWA 1E1EA 4H6EA 1KFCA 3PZMA 2NVDA 4JYEA 3M0ZA 1H49A 1A5OC 1SJAA 4MADA 4AX7A 4DZHA 5TBOA 3U2ZA 3O2LA 4FNQA 1THFD 4RJEA 4QE4A 3PBMA 1SFLA 4QCFA 2I5IA 1Z44A 4DJFD 3CB3A 3KRZA 1UZHA 1ZQ5A 4GGHA 3HG2A 4S3KA 3URAA 1XLMA 2IPJA 3OA3A 4LV9A 4JX6A 2FTYA 4O1AA 1CX9A 4UTWC 1TB3A 3SRKA 1J2BA 4NL1A 1TA3A 5REQB 3GTHA 3SUSA 1G5AA 4N9CA 1P6WA 1AW1A 3I6RA 5A6TC 4IMGA 2YYUA 5AHEA 1EOMA 3M0KA 3RJYA 4MVAA 4YTQA 2SFPA 3FIGA 3WF1A 2DSUA 1OYAA 4CN1A 5AHIA 3UFYA 1XPYA 1CPUA 3TH6A 4S3GA 1JVNA 4NIRA 2E7FA 1OYBA 5AZ1A 1CGVA 4NSBA 4DWSB 5IHSA 5EMUA 4RW3A 3GTXA 1K4HA 4AF0B 1FDJA 1W5QA 1IEWA 2V30A 2FZMA 2NXHA 1NDVA 2QPUA 4DHGA 3EWXA 1PE1A 3CQHA 3S9ZA 2PLKA 3WBAA 1C7SA 3W25A 1IZCA 1NF7A 3WNMA 1KXVA 1JPMA 3U8GA 3ARVA 3QR0A 3P60A 2VRKA 5C9RA 3NSMA 1CT5A 2ZRYA 2FJKA 3FSUA 1JYNA 3V4BA 2YZ5A 4JIHA 2VC7A 1WX0A 3FJLA 4EX4A 4IGHA 4W86A 4WY0B 4PB3A 4C6DA 2FFCA 1QI0A 2O9PA 3H22A 3BL3A 2NX9A 2KAUC 5BOOA 3S83A 3VZXA 4PBFA 3OB8A 3BG5A 4EXBA 3CIXA 3UR2A 3WN6A 3ANVA 4K2SA 4I9AA 1UWIA 5C2CA 5CBJA 3KCLA 3NPWA 3VNZA 5BCAA 1DE5A 4LX4A 2D1ZA 1ITQA 4UOJA 2J6VA 1QDSA 2OOFA 3LSBA 1EC7A 3WBWA 1B30A 4JXCA 2F6UA 2CLLA 1ICQA 4BF7A 2PDGA 3SCUA 3GU9A 2XDFA 1LLWA 1QW7A 1XYCA 3QHNA 1QNRA 1TUFA 4Q8OA 4NAEA 1VPQA 2WKLA 3SCTA 3WLKX 1E43A 3M41A 4J3XA 4DYEA 3F4DA 3QR1A 2ZVIA 2V5DA 1R9YA 3TK7A 2WZTA 4Z2HA 2ANUA 4KW2A 1LWIA 2J24A 3FJ4A 5LIUX 3AUOA 1ZPTA 2PUZA 3LCIA 3VIFA 2ZRZA 2CLEA 5E93A 3WD4A 4DJEA 1ELSA 4QISA 1QOPA 1L6WA 3W1RA 2ABAA 4P8UA 1YPXA 3EZ4A 4LYKA 3IACA 5I09A 1WBJA 1BRLA 1J11A 3B8WA 1KO0A 4PRRA 1M7XA 4ADTA 1S2CA 3FJ6A 3A4WA 4AHQA 1BWLA 4KESA 5CAHA 4DX3A 2PWEA 3TYUA 3WYZA 3AIVA 4M1BA 1JCXA 1BQGA 4I5RA 3VKJA 2VD9A 3KL3A 3KOZA 2EBNA 3SBFA 4DBUA 1QI5A 1JULA 1Q7QA 3SIZA 3TWAA 3UZXA 1DOSA 2OGYA 4K7YA 4IH3A 3QHOA 5IRPA 3RPDA 4PULA 1R38A 3MC5A 5K7JA 1B4EA 1HG3A 1Q8JA 4WDUA 2Z2AA 4AC7C 5FEPA 2BS9A 3SUTA 4CQBA 4KEVA 4XBJA 3CUGA 4IOTA 4Q33A 1OFDA 3SRHA 5LIYX 4RZBA 1GG0A 4HU8A 2RHGA 2GVLA 3ORWA 2RJGA 3VAVA 2A4AA 4BQ3A 4BWLA 3W86A 2VP8A 3DGRA 2A2IA 2GSHA 1EJ7L 2YBUA 1PZ1A 4UTMA 4EOUA 2E9LA 1RCQA 3TSMA 1B4KA 2YCEA 3EBVA 5FD0A 3N2BA 5CXPA 4MZYA 3B05A 3MO4A 3F2DA 3OGRA 4ML9A 5HINA 3TEVA 1B3YA 4F40A 4RPQA 2QQ6A 3LYEA 1KFBA 2IKHA 3CV1A 3G22A 3CPGA 4UC5A 1JR1A 3N9RA 4DPQA 1B3WA 1JCJA 2DORA 3LM7A 4NZJA 4UZUA 3WBYA 2DIEA 4TU1A 2ZX6A 2QZRA 4FNTA 4YNGA 3TQ0A 3QOMA 3N2XA 2IKIA 3KZSA 3LUTA 5MF5A 1EOKA 4NAFA 2QT3A 1H60A 3ISIX 2ZWYA 3WK0A 3DAQA 1MRQA 4HZMA 3P93A 3VGEA 4PUKA 1XIGA 4QJ4B 4ZB2A 5EMJA 3ITYA 3UVAA 2E5CA 3TJXA 5AC6A 4QR6A 1ECQA 1US0A 1DHKA 1HKVA 5CGQA 3QVQA 3W26A 3DG3A 4HP5A 3WF3A 3N9SA 1K9DA 1EP3A 5FEWA 1UKOA 1TRDA 6XIMA 3KS5A 4GVGA 4GQGA 3BLOA 3LERA 2GZXA 2F7FA 1PVNA 1Y5VA 1R7AA 3R43A 3E38A 3UY8A 3UYIA 4CD5A 1O66A 1J18A 3LCFA 5HQEA 4NJHA 2BP1A 4TR9A 3KBMA 1K02A 1IXPA 4F66A 3GH7A 4L65A 4XG1A 4GNKB 1KCLA 2V3FA 4PMDA 4HHLA 3VGDA 1Z7AA 3W29A 1QRQA 1WB0A 1POJA 4HA1A 4HQVA 2ZQ0A 1OCQA 2WSKA 2A85A 2Z24A 5TD4A 2BGNE 3AMGA 3HZ3A 1X98A 3BLDA 4GLEA 3HMJG 3M5XA 1TV7A 2G3FA 1TWIA 1XFCA 3UGVA 3NXLA 5HWMA 4MMWA 4C90A 1XWYA 2WMFA 2XHYA 1RVGA 4WKFA 5EYWA 4YTUA 4U3CA 3K8LA 4MLRA 3U48A 3O07A 3INPA 5CJMA 1MZHA 4BEUA 4FS9A 1CDGA 2QJMA 4XQ6A 2VX6A 1GVIA 3UWVA 1SR9A 4EK7A 3SCPA 4FLRA 2QCFA 1Z3NA 4DO5A 1XUUA 3H2EA 4J3UA 5GVJA 2G0WA 4O13A 1K70A 5HATA 1Y5WA 1JXKA 2OO0A 4GFIA 1FCVA 3EA1A 3NG3A 5GNXA 2XH2A 5JBFA 4MY1A 1GKQA 5G5IA 5HOSA 5TQLA 1FDZA 2CLOA 3W7CA 4W8LA 4PFHA 1ZENA 3RMEA 3QMTA 4B92A 1HP4A 3U5YA 3CWNA 1F61A 4YYCA 2OG9A 4PZVA 3GC4A 3QGAC 4MB5A 2ZE3A 3GVQA 2OX4A 2VZUA 2X8RA 3EX6A 1UROA 5PTDA 1IE7C 3KLLA 1PEZA 3GDRA 3MB9A 3W1AA 4GRSA 5DMLA 4I7VA 4H3DA 3O63A 1RJPA 3GTIA 2ZKMX 4DPPA 4RNFA 3M6YA 1PAMA 2X1TA 4M29A 3E0LA 1OD0A 3CUJA 4BQ5A 1QPQA 1NFPA 2YBVA 5FJJA 3ARUA 3GXTA 1DP0A 3R58A 3UXKA 2FPVA 1VKFA 2E8ZA 3CUFA 4AWTA 1TELA 2GLKA 2ZDRA 1HJSA 2H6RA 5G2HA 1QFEA 1TWSA 2PFHA 3I65A 1RJRA 2L5HA 4IIFA 1OFOA 1E4LA 2NQ5A 4A2SA 3WH9A 2XWEA 5AC8A 2I9UA 3VCNA 2BOGX 3L0GA 5EMMA 3KEHA 2XZ7A 4NKCA 2I14A 1IZJA 3WQ6A 1OYCA 1DTNA 3A3XA 2GGGA 4QDWA 3GIPA 2VUNA 1TYGA 3H8AA 2J75A 3GUWA 1GOQA 3VMNA 2YCLB 5K9XA 1GVOA 2A7RA 4XKMA 3THQA 4RXFA 4FSAA 2OEMA 4XV0A 3RX2A 2VR4A 3RFAA 3QYQA 1VR6A 1GPFA 3PFMA 3CL8A 3SR7A 1J0YA 1EYEA 3N4AA 2NV9A 1B3OA 3WO8A 2DZUA 4I5XA 3HIJA 2PRHA 3OU8A 5AC7A 3IWPA 3K1DA 3PTKA 1M7PA 1IEIA 1GQKA 3EB2A 1WDDA 5I3GA 5JMUA 1HX0A 4HU3A 3CHEA 2VZVA 3EKGA 1S5NA 1Z69A 3AAMA 3GNXA 1FX6A 1Q2SA 1RQEA 2HS8A 3BMVA 4AXKA 3L5LA 2NSXA 3U5UA 4G6CA 3MHUA 5B7YA 4GD0A 1TREA 5G4EA 3S9YA 5JIWA 4IIDA 4LJ3A 2WJEA 1R8LA 1ZSXA 1FFRA 2B0MA 2AGTA 2J7GA 3EDFA 1A4MA 2O0TA 2FHCA 1UR1A 3VD9A 1IIGA 3OA5A 1P6BA 4G7FA 4NNCA 4FXFA 4O8AA 1XQLA 1OFEA 3EPOA 3WKZA 4LSBA 4U5IA 2QDGA 1MQQA 3ABRA 1DJGA 5AY7A 3RU8X 4MPKA 3LPGA 3HPSA 4C7GA 4GVHA 3APTA 2PWFA 5CLTA 3G0UA 2PGFA 4MUZA 3UBPC 4WJEA 3E2VA 2C1IA 3URBA 3Q37A 3CZLA 2BOEX 4HA4A 1PKNA 5A1AA 1B3ZA 2E6FA 5LIXX 1HIZA 1YDNA 3GNRA 3PM6A 5M1TA 2Y7GA 3V36A 1XD0A 4JTIA 4UQ9A 3WH6A 1RH9A 1R3VA 5C9UA 1GW9A 2FGLA 4PL1A 3N2CA 5DCDA 1DWIM 5HMEA 1VRDA 3VM7A 3PS7A 3ZR6A 3DG7A 4JTFA 5C2GA 5EB8A 2PWDA 4J3SA 1WV2A 2PP3A 3VKAA 2QCNA 5I79A 1S46A 3BW3A 3WQ8A 1IXNA 3G1RA 3OYXA 5L6UA 4JKMA 4Z17A 2PP1A 1SO6A 2O7SA 3IVUA 4LUIA 2O92A 3MV01 1SMDA 3VZYA 1P0KA 2XH4A 2XSXA 2ACQA 4DVOA 4UMBA 3W85A 8TIMA 1C7TA 1UB3A 4DYKA 3TA9A 1LRTA 1ZCOA 3GVRA 3MCOA 3UG4A 2DSZA 1TPC1 4KEUA 2ZX5A 1XL9A 3UJSA 3B4YA 2D0FA 3WELA 2UWFA 3B06A 3FY1A 5A2BA 3UP8A 3V18A 3LMYA 4DUVA 5H91A 4UNKA 5JVLA 4QJ5B 2WZIA 1UC5A 3MKCA 3LD5A 5IOBA 4Z2IA 2V3DA 2W79A 3SCVA 5E1QA 4AW7A 1FQ0A 1HVXA 5CG7A 3AI0A 4W7WA 5DMNA 3OO2A 2QMJA 1JUEA 1LROA 1VPXA 4IFKA 6PTDA 3QFEA 4PTXA 1TUXA 4K38A 3V5FA 3IGUA 2XIIA 3UEQA 3FKRA 1SFSA 1I2NA 3VD5A 4KH2A 4PL2A 3MPGA 3ITTA 1CGXA 3N3TA 4K6AA 1V8EA 2MANA 3FGCB 1I1XA 3QGKC 2QDDA 2BBFA 4IIBA 4Q6JA 2Y85A 1RVKA 5D9NA 4GJJA 3ICJA 1I60A 1Q6FA 2XFRA 4QLJA 4JX4A 1W17A 1FWHC 5LA1A 2BY2A 3GXNA 4AVOA 2ZXBA 3CZGA 1V0NA 1SFTA 2F6XA 2HK1A 3TTYA 2J7FA 1XIFA 3FXGA 3L5MA 1SFJA 4ZVJA 2X0YA 2BASA 3EWCA 3C52A 2J6XA 4XBSA 1K9EA 1KRCC 4OVXA 5BROA 4UNLA 2Z7GA 3EDEA 3FVMA 4GYFA 3M46A 4AIEA 1WXZA 3KOXA 3B9OA 5I07A 2Y6ZA 3MHFA 4MNMA 3RO6A 5CPNA 3NOYA 3HJZA 2HBXA 2Q8LA 1JNDA 3IPWA 5FF7A 1XLCA 5ABFA 4GJ1A 3EB3A 3HV8A 2H3DA 5CQ1A 1OZMA 3NO1A 1EA9C 4GQBA 4XUGA 3WF4A 4ILSA 4ERGA 3U6WA 5FF4A 4FOKA 4O1BA 5HNUA 3FYPA 3QPYA 1GJUA 2QV4A 1C29A 5BMXA 5I23A 1QHPA 4EWND 1FFQA 4DJED 4R3UA 3TAOA 4MKVA 2OLAA 3IGSA 4AWEA 4P8VA 1VPYA 3PAOA 1VS1A 2P10A 2PDWA 5C6MA 4QDPA 2CC0A 2H90A 1KTBA 3AXKA 4DI9A 4GVFA 4LC8A 4YS1A 3WDHA 1QI2A 1V3KA 5LXXA 4TQTA 2XIMA 2F8QA