1OYCA

Old yellow enzyme at 2 angstroms resolution: overall structure, ligand binding and comparison with related flavoproteins
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(flavoprotein)
molecule keywords OLD YELLOW ENZYME
publication title Old yellow enzyme at 2 A resolution: overall structure, ligand binding, and comparison with related flavoproteins.
pubmed doi rcsb
source organism Saccharomyces pastorianus
total genus 141
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1oycA00
2ZZ5A 5DCBA 3FKKA 2CLFA 2PRMA 1EUNA 3NZRA 2ZYFA 3KX6A 3TSMA 1ML1A 3LCLA 1XDMA 2YFOA 3I65A 3O06A 2WOQA 4AHPA 4GRSA 2VEIA 2B7PA 3EWYA 4X2RA 3MYOA 3STGA 4DO4A 2ABBA 4RX0A 1TPEA 2Y88A 3L9CA 4D2JA 1YXCA 2Y7GA 3MBDA 1TPVA 3UWZA 2D73A 5CPNA 1KM2A 2NUXA 4RLIA 3PB2A 2RDUA 4IGHA 1LOSA 1WDWA 5G1TA 5EY5A 1LYXA 3MYPA 2R14A 1H7OA 3LRLA 1GTEA 3B03A 2XN0A 5DLCA 4E0CA 1KBJA 5HWNA 5HR6A 4LV9A 4AB4A 1FCBA 4AVFA 2Y6ZA 4MFDA 1G7UA 3NQ2A 4IPJA 3QYQA 1GPWA 4N6FA 2A1YA 3B05A 2V81A 1OABA 4KFPA 2QJIA 3E49A 3GYEA 3WK2A 4ORMA 5D30A 3E96A 3QQ1A 2VC6A 4XZ9A 3W84A 3O6CA 3H53A 3GDKA 2V0TA 4K6AA 4JY8A 1A5SA 1OFAA 4JTKA 2V30A 3P8IA 1WBHA 3R12A 3PG8A 3EKZA 1WX0A 5DBTA 3SY5A 3W7KA 2WV8A 5HUOA 3PVFA 5H91A 1VHNA 1KV5A 1D3HA 5J5RA 5CPLA 1AK5A 3DHDA 4MYAA 5AYZA 1AW1A 3PR2A 3LV5A 3W2UA 1TV5A 1SZFA 1LRQA 2BXVA 5DN1A 2JGYA 5HUPA 1P4CA 3E02A 5LHEA 3LLFA 4Z1CA 3W1PA 4ZQOA 3IGSA 3GK0A 3KOFA 1SO5A 4LW7A 4O8RA 3C2OA 3BW2A 2W0UA 4LRTA 1VH7A 3HOJA 1CI1A 3GXNA 5EYWA 5TBOA 3W7GA 3W88A 1KFBA 5HQEA 4MFEA 3HBLA 4O10A 4X22A 5C54A 2ZRUA 5ABTA 4MOZA 1G4PA 4PFMA 3I7QA 3W85A 3W1RA 3BLIA 1D3GA 3CPRA 3H54A 3NXFA 5EBUA 1VYRA 1OFEA 3IIXA 1O95A 3P7YA 3EXSA 3W2KA 1FWNA 1H63A 1OFOA 1JUKA 5FEXA 5D2TA 3AO0A 2R8WA 1E51A 2A6NA 2QUVA 3W1AA 3KRSA 1R46A 4AWUA 3BK0A 1TYGA 5F4WA 3NQ6A 3THQA 4NX0A 1VR6A 1VZWA 3NR0A 4K39A 1V5XA 4ADTA 2EGZA 2R91A 4WUIA 2ZRZA 3MHFA 4K38A 4O12A 3WJWA 1JJKA 2EHHA 3GAYA 1FY6A 1ZHAA 3S42A 1AW5A 1VC4A 1N7KA 2VXNA 3VE9A 1Z42A 1YTEA 1X1OA 2E6YA 4M6PA 1OVDA 3P84A 3NPUA 1Q3NA 3WJZA 1W54A 3GDTA 2OMAA 2QCHA 3LHYA 4ZQPA 3OBKA 3F4WA 2C1HA 3HF3A 1OFDA 2DZPA 3SGZA 3M41A 6ALDA 2E6DA 3OVQA 4R33A 3S5NA 2Y62A 5HJLA 3GVGA 1SFLA 4AWTA 4DF1A 3UWVA 4UTKA 3WK0A 3B8DA 1DORA 4ZVJA 1XKYA 1XUUA 3QPYA 1KM0A 1WOAA 2CLEA 2I1OA 3PWAA 1K02A 3NQDA 4FB7A 1UCWA 4O52A 5KSWA 3M6YA 1PE1A 1DHPA 1GVSA 1Z41A 2GQ8A 1ZJIA 5EA9A 3Q37A 3GDRA 4Q32A 3W2MA 3MWAA 4JD4A 4J9JA 5FEZA 1MEHA 4JX4A 5D2VA 4XBSA 4GUFA 1G6CA 3W74A 1QPOA 5E93A 2E6FA 2HTMA 1H5YA 2JBMA 4ALDA 4OV4A 4EVZA 3B0UX 1VYSX 3VI2A 1YTDA 2BSLA 5EMUA 3IVUA 3UXAA 4L4MA 2FPTA 3LHWA 3LHTA 3NQ8A 4M6VA 4U4MA 3RMJA 1GYNA 2EKCA 5HULA 5FF2A 3TJXA 4IX2A 3L21A 3BG3A 2C14A 2QCEA 4TR9A 1RV8A 1W56A 3G0XA 3RK8A 4MY8A 1NF7A 4JR5A 4JIQA 2WNQA 2CLMA 4POCA 1HO4A 2CFFA 1ICQA 4JDBA 2W6RA 3G1XA 1R30A 1ZALA 3TQKA 1OF8A 4PL1A 4LU0A 4CNOA 3N14A 1U5JA 1SSDA 3LCGA 1TPFA 4FX6M 3O8AA 4OWGA 1W5OA 4EOUA 1KFLA 1W0MA 3TIMA 1LOLA 3NA8A 3TFCA 3L0GA 3W83A 3HGSA 4O1DA 3OHIA 4RXGA 4DXVA 4RZ5A 3DFQA 4LOCA 1FWWA 3TFXA 1DL3A 4Q33A 5LNSA 3FLUA 3MMTA 3W87A 1UUOA 1A5BA 3NPVA 3LOTA 4Y96A 4ML9A 1DQWA 1H60A 5LKYA 4JX6A 2J88A 1UJPA 4U28A 3LHUA 4KWWA 3NQCA 1XM3A 4JTEA 1NAL1 3TW6A 4HNVA 3GXPA 4OU1A 1ZAJA 3IVTA 3P62A 3W23A 2QCCA 4FIQA 4KWVA 1LCOA 3LDVA 1CX9A 3UY7A 4DO6A 2QJGA 3HG4A 4O28A 1RD5A 1XBVA 1ALDA 3G8EA 3W7IA 3P80A 4ZZ9A 2GOUA 2BX7A 4LRSA 5FF0A 3IRDA 5AHLA 1Z48A 2GPTA 3LGEA 1LBLA 1M7OA 1LORA 1PCKA 1MEIA 1ZAHA 4M6QA 1OG0A 3EWXA 5FF7A 2PCQA 3V1PA 5DBUA 4YL2A 2TSYA 3S1WA 1KFKA 2V82A 4DPQA 4Z1DA 2FFCA 5BRBA 4KKXA 5I3KA 2ISSA 1UASA 1THFD 1OK4A 3W7EA 4NUWA 6TIMA 4FX8A 1AL7A 3GXTA 1GEQA 3V75A 3RF9A 2A7RA 4JS3A 5C55A 3MI6A 1J2WA 1VPXA 2RH9A 1KW1A 5AC6A 3UPBA 3S1XA 3LHZA 4LWWA 2G5WA 1QDSA 2GUUA 3LHVA 4HSOA 1VLWA 3SFKA 3PBUA 1I2NA 3TKFA 1B4EA 2X1UA 1XI3A 3TR2A 1VCVA 2C16A 5AFDA 3IIZA 3W70A 4O50A 3NQVA 4UR7A 5FESA 2FQIA 2VKZG 1QPNA 1OX4A 4PEKA 2EPHA 4Y90A 2QF7A 3SGUA 1I4NA 4R34A 1EP1A 1A5CA 5CZJA 2YCEA 4NT0A 3HG2A 1OJXA 2H6RA 2FPYA 1FCQA 1GWJA 1K03A 1F6PA 2Q3OA 4O17A 5T26A 3ABOA 3TSBA 4CCCA 2F84A 1HFBA 4H3DA 3O16A 5DXXA 2G96A 5F1UA 4H4IA 1HO1A 3KVLA 3UQNA 1H7XA 1ZCOA 3W7JA 5H2ZA 4TIMA 1M5WA 1XBYA 3HGJA 4IPIA 1F73A 3IV3A 2X1RA 3ATZA 3O1NA 4IMFA 2FPVA 4FHAA 3LTSA 1P1XA 2J27A 4FNRA 1MZHA 2NZLA 3P60A 3G0UA 3DGRA 4HHPA 4JIPA 3QMRA 3HGOA 4R7JA 3W75A 4GFSA 1GYLA 3P67A 1SO3A 5LGZA 1WYIA 3WK1A 3JRKA 2Y63A 3TAOA 3B04A 3KRZA 3Q2DA 4IOTA 2FTPA 1FWSA 1EEPA 3CEPA 3VFLA 1G4SA 1NSJA 4LV4A 3W7MA 3KXQA 1OFPA 4HIBA 4UTUA 3LTPA 5D2WA 3W7CA 4NJGA 2CWNA 3GKAA 5IBXC 3BV4A 1FUYA 3FOKA 3KHJA 3LCXA 1W5MA 1IIHA 3O15A 1QWGA 1TRDA 1QPQA 2VFGA 4Y9AA 1GJPA 3GZ3A 2ZZ3A 5HMSA 2NUYA 3UZ5A 4UTJA 3NQMA 3TW7A 1OFRA 3B4UA 1W37A 1TB3A 4UTTC 3TQ0A 2A21A 3GDLA 1DJNA 1I8JA 2PRHA 3T78A 3P8JA 4O4WA 4IXHA 3NGJA 2OJPA 3PY2A 3FYOA 5CZ0A 2B4GA 4IMCA 4YMZA 2V2CA 1S5TA 1TJPA 1G69A 3PM6A 4K8EA 3TXVA 2HSAA 3O6DA 3W73A 4GUGA 1LTDA 3YPIA 3IIPA 1EWDA 3LXCA 4OBTA 4A3UA 3CHVA 4JNMA 4BI6A 3M1ZA 1Q6LA 1OF6A 4MY1A 3CTLA 1JVNA 4AXKA 4JXCA 3P81A 3SW6A 3GAKA 3JR2A 2QCGA 4FNPA 4IX0A 3S9YA 4K7VA 5KMYA 4O0ZA 2BWGA 4KFOA 1TV7A 2WNNA 3C6CA 1QR7A 3ANYA 1Y0EA 5A5WA 4O4VA 4UFHA 3W6YA 1H7PA 2ZTKA 1QPRA 8TIMA 3HPSA 2B7OA 4IMGA 3NL2A 3G0SA 1LLWA 2CZDA 2VOMA 2A6LA 3QJAA 3O63A 3TXZA 4UTHA 3A9IA 1H1YA 2CLHA 2W79A 4DELA 1AW2A 2WSQA 1OX5A 3MI2A 1H62A 1DOSA 5MHBA 3HMJG 1I2RA 2CZFA 3C3NA 3R89A 1FQ0A 2WO5A 2E77A 5EKYA 1SFJA 1JUEA 1VYPX 1SO4A 4FF7A 2DZUA 4LTSA 3TC6A 4HPJA 1H1ZA 1T96A 1SW3A 4C1LA 4W9TA 4WOQA 3WJYA 5J5DA 1C9DA 1IXOA 3KRUA 1S3HA 4A21A 4JY9A 4WD0A 5I3GA 3EEGA 1XXXA 2E5DA 5EPDA 2CZ5A 3GLCA 3R8RA 3EB2A 1G67A 1IXNA 3G3DA 3NQ7A 3Q94A 4AHOA 1JCNA 1WV2A 5AN7A 3NDOA 3QMTA 4N4PA 3I68A 3M16A 2YGYA 5AC8A 2A5HA 2QAFA 1GG1A 3BG9A 1FDYA 4OT7A 1DV7A 2NWSA 2X2GA 1T99A 1I2PA 2YR1A 3DU0A 3QRHA 3M5YA 3KVKA 4MYXA 1RVGA 1EWEA 4AHQA 3M5VA 1Q6RA 4UTWA 1K8XA 2ZA2A 3C8FA 1QAPA 4FX7A 3W3OA 3TDFA 1KFJA 3W1UA 2V8ZA 3TMLA 4N4QA 4MLJA 1W5QA 3U2OA 1LP6A 4LS1A 2LLEA 1NF0A 4ZQMA 2OT0A 3ZR4A 1ME9A 2ZTJA 3S8HA 3W7LA 2VENA 5AOUA 1PVNA 2J9XA 3PBWA 4PA8A 3W1XA 3STEA 3G1YA 4FNUA 4WJEA 5D03A 3RU6A 4X3ZA 2KZHA 3LXAA 2V9DA 3PG9A 4RR4A 3N9SA 4FNSA 1TTJA 3QSTA 4QITA 4AF0A 3NG3A 3UWWA 3LBMA 1H61A 4MJZA 1NVMA 1F76A 3M9YA 1UUMA 3G1DA 4HKPA 4HNUA 1H50A 5K3VA 1TCDA 4AH7A 1ADOA 1ME7A 1VJIA 4RJEA 3LCIA 3CWOX 3TQVA 4N2YA 3LM7A 3QH2A 1F5ZA 3LV6A 5G1YA 5CPOA 3S1VA 3KFTA 1OYAA 3DZ1A 4AWSA 1JRBA 3LX9A 2G95A 1VQTA 1TPB1 2XN2A 4UFJA 3W2NA 1EX5A 1R2RA 1MSSA 3THAA 3G3MA 5CZSA 2JKEA 3CM4A 1X8FA 1GVOA 2PE4A 3P5ZA 4ZQNA 2WJZA 5DCDA 3N2XA 1LBFA 2ZZ2A 4BWLC 4TMBA 5DY2A 1GVFA 4OGZA 1K7EA 1QFEA 3ABQA 3FFSA 2VFEA 3HO8A 3W7OA 4ORIA 2JGQA 2CW6A 1WOBA 2R94A 5BMWA 3M47A 2P0OA 1OFQA 3HQ1A 4DEFA 2RDTA 4JTJA 3ATYA 3T44A 3EX1A 4CCEA 3ZWTA 1M6JA 3LI1A 1YDVA 4CNNA 2YYUA 2NXHA 3QEZA 4JTGA 5CSSA 2DORA 1BWLA 1X1ZA 1LRNA 3HGRA 3R5EA 4GE8A 4FNQA 1QMLA 3P61A 2H8ZA 4O14A 5IBXA 4KFNA 3VCRA 4DBDA 1CW2A 4WXZA 1MEWA 1FCUA 2Y70A 3C56A 3EX4A 2FLIA 3EXRA 4CQ9A 1YLVA 3PSWA 4NVTA 1R2SA 3GIYA 3MO7A 2Q8ZA 5F4SA 3IGUA 2IQTA 2GJNA 1ICPA 4ZQCA 4MIMA 1P0NA 2BZNA 4O53A 3DI0A 4UTLA 4K37A 4XTIA 3G1VA 2ZA3A 1ZNNA 3PS7A 3GR8A 4NJKA 1TPH1 2NLIA 3NYZA 1TPDA 4JTTA 4NNAA 4A29A 2HS8A 2HS6A 3UXDA 1GOXA 2H90A 4UC5A 5DCEA 3WJSA 4EIVA 3DAQA 2GVJA 4LS2A 4WY0A 1QO5A 4GBUA 4RKAA 3A22A 1EPXA 4GXMA 3TUUA 2P1FA 1GZGA 3C52A 3W2JA 4MVAA 2I9EA 1XL9A 4CQAA 1EB3A 4GC4A 4WY0B 4Z1BA 3T7VA 4HN4A 3N34A 3BW3A 1KM3A 1VHCA 4H6KA 4C1KA 2E1DA 3QM3A 1EP3A 4QSHA 4TMCA 1OFBA 3UNDA 4O19A 2VEPA 3E9AA 2QCDA 1XC4A 3DI1A 3L2IA 4TX9A 4A2RA 2ZZ1A 2ISVA 2PRLA 1IF2A 3HG5A 2ZRXA 1VLIA 4LUJA 3GKFA 3WFAA 4BI7A 2ZQ0A 4MPQA 1WXJA 4Z08A 3S1UA 4GWEA 4GUIA 2ZFAA 4EF8A 4MY9A 2VFDA 3M5ZA 4XWUA 3G1FA 4WZHA 3UWUA 1AL8A 1OHLA 3TA6A 4X9SA 4Q4KA 5HR7A 2H3BA 2G97A 4O57A 1JQXA 4MKNA 3SI9A 5HWMA 1TJRA 4XKYA 4N02A 3F1QA 3LI0A 3PC0A 4IMEA 1SO6A 3H55A 2F7FA 4N6EA 3DFPA 3G18A 1F2JA 5I3FA 2A2IA 1A5AA 2PURA 4UFLA 1BEUA 1OYCA 4A22A 3ZFHA 1VRDA 3W72A 3LXBA 3UWYA 1SSGA 1YTKA 4B5NA 4QM1A 4BFAA 5L6UA 3L5LA 3A5VA 5I3IA 2NWRA 4NJIA 3MJYA 2RDWA 4YLWA 3ABSA 4MLRA 1JCYA 1TSIA 1YXDA 3CIWA 1LOQA 3UPWA 3F4NA 5U4NA 4CCDA 3O05A 1KTBA 5KINA 5CPMA 3MP4A 5CSRA 3LCWA 4NU7A 5LSMA 3OIXA 2ATSA 3HG3A 3W2LA 4BI5A 2Q3RA 3SECA 5BW6A 3NPXA 3SSJA 2QJHA 3PF3A 1W31A 3G24A 3C0JA 1GTHA 2Q8LA 1NEYA 2OX1A 3L0KA 1SQ7A 1S5VA 1KTNA 4S1FA 5KZMA 3DFNA 4I9AA 1TRIA 5CZTA 3M7WA 5U7SA 3LRMA 1X6UA 2GQAA 3TCEA 1OX4B 1W5PA 1SUXA 1SR9A 4JTFA 2FDSA 2GVGA 5A8GA 1VS1A 4OV9A 1EIXA 3M0ZA 3NL6A 1TQJA 4UFMA 4Z0JA 1FWTA 1Q45A 3W1TA 1TTQA 1IIGA 1K8YA 2GVLA 4G1KA 4UXDA 3HPXA 2VFIA 3PB0A 3IGXA 4UMAA 2WNZA 3C61A 2QDGA 3C4UA 4YCOA 2NXGA 5FI8A 4NJJA 1BTMA 2P10A 3F03K 4UNKA 1HTIA 4JTHA 5K9DA 1TO3A 4JN6A 5TQLA 1P5BA 1KM4A 4QNEA 4O16A 1DQXA 1K3UA 3O6YX 3BARA 1YXYA 5E0KA 4RK8A 3M5XA 2ZRYA 2Z1BA 4K36A 3L5MA 3W7DA 1RR2A 3W71A 1TPC1 4UIOA 3T55A 2X16A 4N9EA 4PCFA 3TROA 2YW4A 4OHQA 3FJLA 5C2XA 3SZ8A 1G7VA 1GVRA 3LLDA 1LLZA 3RLVA 2Z2UA 3TJLA 2V5BA 1PIIA 3ABRA 3DXIA 4XBKA 3VNDA 5E1QA 1HG3A 5LNVA 4JTIA 3C2FA 4Z0SA 3SJ3A 3NL5A 4FNTA 2E68A 4R53A 3LB0A 3IIVA 4PL2A 1DVJA 3R2GA 1XCFA 2A7PA 5FF3A 1I45A 2CU0A 3C2RA 3NEVA 3FIGA 1YPIA 3NVTA 5AHIA 3EX3A 1F05A 2DZTA 3RLUA 3C2EA 3VKJA 2CZEA 5F4XA 5F1VA 2X1SA 3A23A 1VCGA 3DFTA 3I6RA 3NNTA 1OX6A 3G8RA 3STCA 3W7HA 1B57A 4UR8A 1K7XA 3BG5A 1Q6QA 2NV1A 1RQBA 3UYCA 5D37A 4QQ3A 3W1LA 3MBFA 3DFSA 1TQXA 4JICA 1DJQA 1I2QA 2GQ9A 2H3DA 2O7QA 5CG7A 2A7NA 4S2CA 3IEBA 3LRKA 2ABAA 3N2MA 5HWJA 3W7PA 2Y61A 3LCFA 1O5KA 4K7YA 5BNKA 4O18A 2C18A 1H51A 3PULA 1JUBA 4ZL1A 2Z0IA 5LNUA 2JK2A 3G1AA 1ZAIA 1KTCA 1Q6OA 1GT8A 3S6DA 1TV8A 3NPWA 3A5FA 3HJZA 4JTSA 5K7JA 2OT1A 2XN1A 4I7VA 4WQ6A 1KLYA 4QNWA 2DJLA 4UMBA 5F2LA 3NQFA 3RNDA 4E38A 4QJ1A 3S5ZA 3W1QA 5L9FA 3VE7A 1TTPA 4YWIA 4DF2A 3NQGA 1L6YA 5G5IA 3O07A 1KM5A 4YCPA 1G4TA 4O1AA 3G1SA 4PTNA 3BGJA 3FKRA 1C8VA 1S5WA 2GJLA 3NM1A 2QCFA 1UBSA 1H7NA 2NUWA 3P5YA 5D33A 3NQAA 2ISWA 3E12A 4GJ1A 4LS0A 1SU5A 3U6WA 5G2HA 2ATMA 3M44A 4LC8A 1P0KA 2ALDA 4GUHA 4AMAA 2YFNA 3TK7A 4WY0F 2DJXA 1NFBA 3A24A 1B3OA 1A53A 4MJMA 4CLMA 3HPZA 4UMCA 3NM3A 2NX1A 4LY8A 1W3IA 3QW4B 1HL2A 3G1HA 3CQ0A 2TRSA 3W7QA 5F2GA 1O5XA 1VCFA 3B06A 1XDLA 1PHWA 2DU2A 1KFCA 4UTMA 1JCXA 1G4EA 3LCHA 2C0AA 2DZSA 1IXPA 4GUJA 5DY3A 1FDJA 4CQ8A 4LNYA 4EF9A 4HSNA 5LNRA 2OCZA 3EX6A 3RFAA 2XFWA 2QAPA 1YDNA 3D0CA 3TAKA 4IMDA 5LZLA 2DP3A 1KM1A 3UZJA 4UNLA 5FEWA 4WOZA 3STFA 3NL3A 4PC8A 4UCGA 2EF9A 5KITA 5AHFA 4LVDA 5D04C 4OQVA 2C15A 3QMSA 1RZMA 3N73A 4JGDA 1LBMA 2TPSA 1GG0A 5AHNA 3QPZA 2Z6IA 5HINA 4IQLA 5I3JA 2BLEA 4WX2A 4AF0B 3QW3A 1TMHA 3W86A 1DKWA 5AHMA 4QISA 4LC6A 4TO8A 2UV8G 2ZBTA 4LVFA 1W1ZA 1J4EA 1FXQA 1O4UA 4ZQRA 3M43A 3N9RA 5K2ZA 2A0NA 1FXPA 3NO5A 1WA3A 2I14A 4M19A 4S2BA 1EUAA 1QNVA 2BTMA 1TIMA 2ZA1A 5CGQA 4A2SA 1QOQA 5AC7A 5K4ZA 3S0CA 3CLMA 3OEXA 2CLKA 2Y7FA 4O1BA 1FX6A 3EKLA 4XTDA 2V5LA 5F2MA 4DF0A 5D02A 1H7WA 3T40A 5KZDA 1YPFA 2Z6JA 3BVJA 1D9EA 4FEZA 2VELA 4OE7A 3S5YA 2AQWA 3USBA 1IXQA 4N9CA 2FJKA 2QDHA 3GB6A 5G2WA 2WPBA 2YW3A 2FB3A 1FCVA 4GNJA 5AYXA 1SZGA 2RHGA 2NV2A 3QSRA 1UB3A 2JKPA 1BKSA 4LVAA 4MUZA 1QCWA 1A50A 1WQ5A 5G4EA 4IXXA 3MI3A 7TIMA 1QO2A 5DELA 4HNNA 3GR7A 5LGXA 2PC4A 1R2TA 2EAWA 1B4KA 3DKLA 2TYSA 5BMXA 3NZ1A 1F74A 3CEUA 4YXGA 5SWUA 2J9YA 3N3MA 4RV8A 3P74A 3PUDA 4NNCA 3EXTA 3L66A 3CWNA 3OA3A 5LNWA 3E0IA 4IUOA 1R47A 4LUIA 4MZYA 2QUTA 3PBYA 2RFGA 1KBIA 1F7BA 3C2VA 4XUGA 3NAVA 2WSYA 4PH6A 4RXFA 5IM51 3EWWA 1JCLA 3MUXA 4UTTA 4O54A 1JCMP 1OYBA 1L9WA 1VGAA 4O0KA 1O60A 1DBTA 3BGGA 3LTYA 4N9DA 5AHEA 1XBZA 1JR1A 4LT9A 4M7TA 1M7PA 2CLOA 4ICNA 2RKXA 4NNBA 3TMQA 5BOOA 1EP2A 4HNTA 4N9BA 1KM6A 2YSWA 2ZDRA 3L0NA 3OVPA 2FIQA 4NXKA 3SR7A 1B9BA 1FWRA 4UTIA 4WXYA 1FBAA 3W7NA 4JX5A 2Y89A 2V2DA 3W07A 4M5PA 3QFEA 2ZZ7A 1W3NA 4E2BA 1WBJA 4Y6GA 2C3ZA 2WSRA 3IIOA 1I2OA 2B7NA 3S5OA 2V2HA 3TSDA 3TU9A 4L4LA 1YDOA 5C6MA 2CLIA 4BK9A 3OG3A 1RQEA 2QCNA 3TV8A 3W1MA 5HNRA 3MP3A 4NZJA 3W9ZA 3W7RA 4FO4A 2QCDB 5I3HA 4RZ6A 4I7WA 1W8SA 2Y85A 4JTLA 2YYTA 3GNDA 3INPA 4Y8FA 5F2IA 2ZCGA 4K8HA 2TMDA 2YPIA 4HT3A 5K9XA 5D32A 4PODA 5AB3A 1L6WA 2QCLA 3ZS4A 1SW0A 2C6QA 2DZVA 2J6XA 3KVMA 1XBXA 1SZEA 1KLZA 3MP5A 3BO9A 2YX0A 5KTLA 5G4WA 4JEQA 2QR6A 3PUOA 1OK6A 3DKJA 4FXSA 3KVJA 3EX2A 2E5CA 3BLFA 4XKYB 1AG1O 3QZEA 4P61A 4QIUA 4O1CA 3P82A 2HMCA 5K9CA 3CC1A 1XFBA 2X1TA 1O94A 2OZ0A 3G22A 1JQVA 3EWZA 3FJ6A 2E09A 5D38A 1TPUA 1MXSA 3WK3A 3I7RA 1ONRA 1BWKA 4UTWC 3IVSA 3MHUA 2E5BA 3B0VC 3BLEA 3DENA 2A85A 3FYPA 3DFOA 1PCWA 4O13A 2VEKA 5KZEA 3JS3A 5CKSA 1YYAA 2E6AA 4M7SA 3W76A 3CIXA 3AJXA 1C29A 1XUZA 3TX9A 3FEMA 3W1NA 2Y7DA 2X30A 2VEMA 2ZZ6A 3TC7A 4MZ8A 2NXIA 2WKJA 5K4XA 3GDMA 1IGSA 1ICSA 3ELFA 1T0OA 1W3TA 1QOPA 3PBVA 3QC3A 4XQ6A 5AYYA 3B0PA 3GX9A 4NX5A 3DBPA 3DH7A 3NOEA 4QAIA 1HUVA 5GVJA 4ONVA 1ZENA 3NQEA 3QF0A 5G2IA 3I7SA 4DO5A 1MO0A 4NZFA 1LRTA 4LVGA 3HIJA 3T4CA 2VFHA 1T8XA 1U83A 3ZWSA 2QUUA 3WJXA 3L5AA 2ZRVA 4DPPA 3LBCA 1KV8A 4JYEA 2J24A 1TREA 3R13A 2QCMA 1N8FA 3LERA 3L65A 4AEOA 3MW7A 4P2VA 1JRCA 2QEZA 1EA0A 3TH6A 3KAOA 4AAJA 5D05A 3QQ0A 2J9ZA 3L67A 2YZRA 4ZMGA 4UFIA 2C13A 1PS9A 1JULA 3OVRA 4JDYA 3TNOA 1X7FA 5DXYA 5LHFA 1J5TA 1N55A 1ME8A 4JTUA 3L68A 3K30A 3PUEA 3HB9A 4BF9A 4MZ1A 1L2UA 4RZ4A 4JYDA 5D09A 1GVQA 1K7FA 4BR1A 1RPXA 1FDZA 4FIRA 1V7YA 2WQPA 1RQHA 4UFKA 2AAMA 3EWBX 3EWUA 3PSVA 5D2YA 4IWWA 4BWLA 2QKFA 3CB8A 5C5YA 1AMKA 1K8ZA 3UY8A 3CT7A 2CLLA 3MHGA 2O7SA 2YXGA 1ZFJA 2A4AA 4DBEA 3SIZA 1LROA 1PL9A 2DZWA 1JCJA 4HPXA 1YADA 1WAUA 1PHQA 4O11A 5FF4A 1F6KA 3DHFA 2NX9A 1LM1A 1LZOA 4O15A 3U8GA 2ZZ4A 4NJHA 4ADSA 4E2DA 4Z1AA 1ZY9A 2C19A 3Q58A 3W22A 1TPWA 4EWND 1GQNA 1SZNA 3TE9A 1W5NA 4FXRA 4DQWA 4ADUA 2YDAA 2ZRWA 1H7RA 4IJBA 1SPQA 2B7QA 1TTIA 5FEPA 1SW7A 3PAJA 3A21A 3UD6A 2DZXA 5TIMA 3N19B 3BW4A 4LVBA 2FB2A 4TU1A 3CU2A 1LDCA 2VFFA 1KA9F 1Z44A 4JYFA 4UUIA 3FS2A 3GNNA 4RCXA 1KFEA 3UWQA 4NQ1A 5D2XA 2B0MA 4I7UA 2NX3A 2Y7EA 1PV8A 2JKAA 3BPWA 4CNPA 5EL1A 2AGKA 1L6SA 2H8XA 4NXSA 3FA5A
chains in the Genus database with same CATH superfamily
3GW0A 2CHRA 1EUNA 3KX6A 3TSMA 2IKIA 2R1KA 3VO0A 3ES7A 3TWBA 4PB3A 1E4LA 1XYCA 2ZUVA 5CSUA 3D47A 1EL3A 4X2RA 3STGA 2ABBA 1OD8A 1TPEA 2Y88A 4F79A 1Q6GA 3VINA 1JDCA 3L9CA 4D2JA 3OU8A 3FAXA 1TPVA 3UWZA 4ZTXA 1KM2A 4DBUA 1CGTA 1HXJA 4FR6A 4BEQA 4RLIA 4FA3A 1OADA 4IGHA 3MC5A 1LOSA 1W9BM 2J25A 3UR8A 3WLIA 5FCZA 5LA0A 1MWOA 3K46A 1JFHA 5EY5A 3OLIA 3MYPA 2EBNA 3HV9A 4CQDA 4V1XA 4E0CA 3WUBA 5HWNA 5DQPA 5HR6A 4LV9A 4X60A 1EZWA 1H0IA 4AB4A 3QV6A 2Y6ZA 2I17A 4U3CA 2A1YA 2V81A 3K4WA 3GYEA 2Q6ZA 4YHGA 2VRJA 4HNOA 3BSHA 3O6CA 1TE1A 3TYDA 1A5SA 1OFAA 1UROA 1JF6A 3MSGA 3P8IA 4IG2A 2F6KA 1UC4A 3EKZA 3SY5A 2PUZA 3CH0A 3KOYA 4MWAA 2J7FA 2R1MA 1TUXA 3GD6A 1CBGA 3GU1A 1RH9A 4XV0A 5HUOA 5H91A 1D3HA 5CPLA 1GVIA 3FSTA 4LYRA 3P93A 3T4WA 4OVXA 1KXVA 5DN1A 3GO2A 2JGYA 1P4CA 3E02A 4Q7BA 2PBGA 4JL1A 3GK0A 3GQYA 2VYOA 2PTXA 4ZENA 4BCEA 4O8RA 4LW7A 3C2OA 2X0YA 2CCRA 3UW6A 1UWAA 3GXNA 2VWSA 5EYWA 1UD4A 2YA2A 3W88A 3V36A 2XWEA 5BU6A 3T0CA 1G4PA 3W85A 2MUCA 4DWDA 5CXPA 5E6ZA 1L6GA 1H63A 5FEXA 3WLLA 4YJ5A 2QUVA 1XC6A 2BV9A 3BK0A 1V6UA 3NQ6A 3THQA 1FHLA 2A3EA 1VR6A 1VZWA 3GFZA 4AYSA 1LL4A 4IJRA 4K39A 1BKHA 2YCLB 1XCWA 4B2DA 2R91A 2VQTA 2NT0A 3CZ8A 4HTYA 3WJWA 1JJKA 4HD5A 2NQHA 3KTSA 4HCHA 3GAYA 4ZGYA 1AW5A 3T2PA 1VC4A 3G5EA 1OZQA 2IPGA 1XLHA 1Z42A 2RAGA 3W02A 2IS7A 4M6PA 1OVDA 1LG1A 1PIGA 4AWEA 3USZA 2C1HA 1OFDA 2DZPA 4DUWA 2VR5A 4R33A 3MSRA 5A2AA 3GVGA 5D8WA 2GLKA 1BYDA 4BA0A 1MDRA 1B90A 3A64A 2DT0A 1VF8A 1C8QA 1TWIA 2CLEA 4N42A 3PWAA 4H8VA 4EAMA 2G4JA 5KSWA 3UG8A 1FWJC 1IWAA 1QUMA 5EA9A 4D6HA 1EGVA 3BH4A 4MKSA 1MRAA 2ZC8A 3WLOA 1Q66A 2YL5A 3ZVHB 1UKPA 2PZNA 3UZYA 4R88A 2VGIA 1MQRA 1FWAC 3EOUA 3PANA 3WN6A 1H5YA 2JBMA 5A94A 3VI2A 3T9PA 1YTDA 4EPEC 3CXOA 3EDFA 4AEEA 1KXTA 2PTZA 2FPTA 3C8NA 1XRVA 1R9ZA 2EKCA 3NSNA 4ERAA 3ITCA 1WZLA 5FF2A 4D6IA 3N17A 2PWUA 1TR1A 2C14A 3GVWA 1LL6A 4TR9A 1RV8A 2E8ZA 4J3VA 4DM1A 3I3EA 1Q6EA 4QJ3B 3ZIZA 1A49A 4JR5A 1W32A 1Y8BA 2CFFA 4JNZA 1EHAA 3G1XA 1ZALA 4KF1A 1QNSA 3H26A 4C1NB 1U5JA 1K70A 1A5KC 5I5RA 4JFWA 4NY2A 1W0MA 4UQCA 3TIMA 1LOLA 3HN3A 3RR4A 1TA3B 3HGSA 4O1DA 3OHIA 4DXVA 3M64A 4RZ5A 1V08A 4Q8QA 3QFWA 2RGMA 1FWWA 3FLUA 1UUOA 3LOTA 3M6DA 1H60A 3QZ6A 3R10A 3MCNA 2OLAA 1UJPA 4U28A 3LHUA 4KWWA 1S3TC 1H4PA 4GI4A 1NAL1 1BXNA 5D9NA 4F0SA 2OO6A 4FAMA 5A3HA 3GXPA 3IVTA 3FW6A 4KWVA 5LYRA 3LDVA 1CX9A 4DO6A 2XH4A 3EA2A 5EMJA 3WMSA 2QV5A 1ALDA 2YCIX 2VJXA 3A3XA 4HYWA 4L9YA 4S3KA 4A3HA 3CUHA 1X97A 1VEOA 4B3KA 3OPSA 4P5UA 3CAVA 3LGEA 1M7OA 4Z2JA 1PCKA 1ZAHA 4M6QA 3PZNA 2ZXAA 3EWXA 2PCQA 5FF7A 2PDCA 1WPCA 4TVUA 2TSYA 3TCSA 1J18A 1KFKA 1PUDA 4KKXA 4AZ7A 2DDXA 3UGRA 3EOEA 1AUSL 1OK4A 3L4YA 1M1BA 1V4YA 4C6PA 4QE1A 2A7RA 1AQFA 1VPXA 4KCVA 2J7DA 3LHZA 3EMZA 5XIMA 3N6JA 3SFKA 1W3KA 2X40A 3PBUA 4A8IA 3PZQA 2VDIA 4PYSA 3KBSA 2WW5A 4LH8A 1YQ2A 3UU0A 2X1UA 1E1CA 1X7IA 1VCVA 2QDEA 3CPGA 4UR7A 2FQIA 1OX4A 4PEKA 4YVPA 1P7TB 2G3MA 4Y90A 3WEOA 3UXLA 4R34A 1DJYA 2YBVA 4RNIA 3S6OA 3PZOA 4A05A 1Y65A 2H6RA 1TV4A 1N82A 4JQ3A 3ONCA 1F6PA 3POHA 2OGJA 1Q7ZA 1DJZA 4CCCA 1QBBA 3O16A 3O2LA 3L4XA 4H00A 1VB9A 2D1ZA 1HN1A 2PWDA 1M5WA 1AH0A 4LEFA 4EX4A 3R8HA 1F73A 1TELA 1DP0A 3O1NA 1ZB5A 2CKRA 3L4WA 5DFAA 4X61A 1MZHA 2NZLA 1Y5XA 3EEZA 3P60A 3DGRA 3POCA 3UVIA 3CAQA 3BANA 4JIPA 3WQPA 3HGOA 4L1WA 3P67A 1WYIA 3SN4A 3JRKA 3II1A 2Y63A 3TAOA 3B04A 4IOTA 2C7FA 4L7ZA 2OWCA 3CEPA 3ANUA 3RX4A 3HQOA 4W4QA 2Z24A 5D2WA 1EJ7L 3GKAA 3BV4A 2VC7A 1FUYA 4CQBA 1W5MA 1O5RA 4MF4A 3P2VA 3O15A 1TRDA 3RRAA 3VU2A 3F4VA 2VFGA 2FHFA 2ZZ3A 3UZ5A 1UJQA 3NQMA 4DI9A 3B4UA 3BAKA 5I06A 3S1GA 3T78A 4PUEA 3V0UA 5E9XA 1VFFA 4YMZA 2V2CA 1TJPA 1G69A 1C7TA 3PM6A 2HSAA 3DYOA 3YPIA 2Z28A 2EEXA 5BZAA 3AXHA 3CHVA 2WHJA 2IKHA 3BJTA 2REQA 3RPDA 1VFLA 2PDWA 1JVNA 1BFNA 2QCGA 4FNPA 4F8XA 3S9YA 1E9ZB 4K7VA 5FSDC 2YOCA 4O4VA 3GFXA 1CWYA 1MFUA 3B8WA 1AFSA 1AZ1A 1TZ7A 4GI9A 1QPRA 8TIMA 2B7OA 2OX4A 3BCDA 7A3HA 1LLWA 2GK1A 2VOMA 3E1F1 3QJAA 2XZ9A 3OVGA 4NILA 2MNRA 4AG0A 1XKJA 4DIAA 2CZFA 4C6DA 2D2OA 2R1PA 1FQ0A 3H24A 2WO5A 5EKYA 4Q8VA 3D5HA 3TC6A 4HPJA 4C6QA 4MB4A 1C9DA 5BWFA 1IXOA 1ZTVA 1LF1A 5C71A 1EBHA 1S3HA 3VIOA 4E3VA 3AXMA 3MMUA 5I3GA 3SADA 2E5DA 5G4HC 5EPDA 3GLCA 1BF6A 2Y5SA 3SRDA 4F3HA 1FFQA 3LPFA 6TAAA 4EKJA 3NDOA 4DYKA 1GJUA 1TWSA 2CHNA 3E0LA 4H7VA 1XDJA 4PMVA 1D8CA 1W9XA 1RK5A 3KHDA 1T99A 2YJQA 4GGBA 3DU0A 2PI6A 3QRHA 2PP3A 3M5YA 1WE5A 2J7GA 4MDPA 4AHQA 1Q6RA 3ITLA 3W3OA 4CNSA 4F66A 1J0HA 2V8ZA 3TMLA 1W5QA 3U2OA 4LS1A 3RJYA 4L1GA 2OT0A 1CZ1A 5DT5A 2ZTJA 3W7LA 2VENA 1HVQA 2Z4GA 2PDJA 4B4HA 3URAA 3KWXA 1EDQA 3N25A 2C1GA 2WAGA 3TYAA 4J3TA 4L80A 3PPFA 4NIRA 5D03A 4X3ZA 3MB9A 2V9DA 4GQGA 4ZXLA 3QSTA 4AF0A 3UWWA 3MPGA 4ZBCA 3ZZ1A 1UWQA 1UUMA 4AC1X 4JCLA 4JCMA 1YRRA 1TCDA 4AH7A 3TZFA 1VJIA 4RJEA 4BKNA 2VRKA 3LM7A 3TEVA 4HA0A 5G1YA 5ABHA 5IFPA 5CAHA 3KFTA 3K1DA 3DZ1A 4XAFA 2BP1A 2XN2A 1UKOA 4W7UA 1RHCA 4XSLA 1J11A 2Z1VA 3KZPA 4GVFA 3TC3A 1BYAA 2JKEA 3CYVA 1X8FA 4LUSA 1QPKA 3WNOA 2QIWA 3FJNA 3WQCA 1GKRA 3VXGA 4Q4RA 2WJZA 3GY1A 5DY2A 3OW1A 1RCQA 1EKOA 2F6XA 1KQZA 2VFEA 3HO8A 1NWTA 4J40A 1PAMA 2A79A 2JGQA 2CW6A 4H9TA 5BMWA 2QHAA 4JTDA 1OFQA 4DEFA 2RDTA 4AIUA 3KLLA 1F3WA 3ZLGA 4JTJA 3VZYA 1A5NC 4LF1A 2OTDA 2NVCA 4P8VA 4RV3A 4IL0A 5E9AA 3ZWTA 3BLDA 3AIVA 1NOFA 2DORA 1R7OA 4HCLA 4MUPA 1X1ZA 1J6OA 3DCPA 3W25A 4FNQA 3WDJA 3N2OA 3B9EA 3ES8A 4ASTA 1MEWA 1FCUA 3SRKA 1K1DA 3EX4A 2AOSA 4GNVA 4GBDA 2FLIA 4CQ9A 5REQB 2W92A 2WLYA 3IGUA 4ZQCA 4KETA 4O53A 3WMLA 2FYMA 4W5UA 3KOWA 3G1VA 2HROA 1TPH1 2NLIA 1I1XA 4WRHA 2YCKX 4JTTA 4NNAA 4Y7EA 1RSCA 2HS6A 2NT1A 1GOXA 5DCEA 3WJSA 3WQDA 4EXBA 4GJIA 3A22A 1EPXA 1PYMA 4GXMA 3S2NA 4KRUA 1MDLA 3W2JA 4MVAA 4D6FA 3H7VA 4Q22A 4C65A 4WY0B 3N34A 2YIHA 1EFZA 1R3WA 1POJA 2E1DA 2QVHA 1YNYA 4TMCA 4O19A 3VM5A 3E9AA 1SMDA 3DI1A 4M51A 3KCLA 2DUXA 4EACA 3BQ5A 2ISVA 5LIYX 4R27A 2UWFA 3HG5A 4GABA 2VGGA 4LUJA 3GKFA 3WFAA 4EAYA 2J13A 4GISA 1WXJA 2D2JA 4GWEA 4GUIA 1J6PA 2ZFAA 2J66A 4HA1A 4XWUA 3QHMA 4Q4OA 4WZHA 3UWUA 1SJAA 3O7UA 4X9SA 2NQJA 4XG1A 1JQXA 1BVZA 1TVPA 1HL9A 2VCCA 3THUA 4IMEA 1HKMA 1XRFA 2F7FA 4N6EA 5A6JA 3G18A 4NZ1A 4QX4A 1A5AA 2PURA 2Z29A 4UFLA 1GYMA 2J78A 1U30A 3W72A 4O0QA 3LXBA 3TLLA 2BFGA 4I90A 4RDYA 5L6UA 3W29A 4NJIA 2WMIB 4KESA 2IQ0A 1TJ0A 4M24A 4LBRA 1YXDA 3AFBA 3CIWA 3BSGA 3UPWA 3NXLA 1XSKA 2OOGA 4KMQA 3MP4A 3E3HA 4GINA 1RVKA 3WDQA 1C8XA 1GJWA 2Q3RA 2RDXA 3SECA 3QYSA 1Q7MA 1K8CA 2BASA 3MQTA 2QJHA 2KAUC 4NZ3A 3C0JA 1GTHA 3GUGA 4G5DA 3L0KA 2P0IA 2XVGA 4IMAA 3M7WA 1IE7C 3LRMA 2AKZA 1X6UA 2QJNA 3FAWA 1E0UA 1W5PA 3R11A 3A9BA 3MUZ1 5A8GA 1HKIA 2E0PA 4IH3A 3NL6A 4INFA 4RNJA 1IIGA 1PZ2A 4G1KA 1EC8A 3A4XA 3HPXA 2VFIA 1TUFA 4DYJA 2NXGA 5FI8A 2ANUA 5CBJA 2QNEA 4L61A 5BWAA 3ARSA 2PLJA 4N0RA 2QS8A 3AWNA 2A3LA 2BVYA 1WZMA 4J27A 3F03K 1KO0A 3UJFA 4IJCA 4JN6A 2C71A 2PU1A 1KM4A 3PWIA 1PO9A 4F0HA 1A0DA 4PSPA 4RK8A 3M5XA 3ZLFA 4WKHA 2ZRYA 2W5FA 3W7DA 4ACZB 3K8KA 3VMPA 1IGWA 3AHZA 1HJSA 5M17A 3TROA 2YW4A 4OHQA 3FJLA 4IF2A 1E73M 1UOZA 2WM1A 3QY7A 2Y8KA 3VNIA 3ABRA 3MJMA 4XBKA 5LNVA 4NRSA 1XYLA 2E68A 4MM1A 3TYBA 3IIVA 1DVJA 2WBKA 1XCFA 1E56A 2CEQA 2CU0A 4XAZA 3FIGA 3VKJA 3RLUA 2CZEA 4XSMA 3RILA 5F4XA 1K9TA 4Q8UA 3IGHX 4R7WA 4HYRA 3I6RA 2G8ZA 3G1RA 2CKSA 3W7HA 1K7XA 2YA0A 3BG5A 2X42A 3NZGA 3UYCA 5D37A 3MBFA 3DFSA 3AMKA 5DO8A 2GQ9A 2O7QA 2A7NA 2IPWA 3EKGA 3EMQA 2Y8UA 3EWCA 3N2MA 1H11A 5HWJA 3GXMA 2Y61A 4K7YA 2YL9A 3QGVA 4MGGA 1KBKA 2C18A 1UG6A 2E40A 4JOMA 4MB1A 4QGCA 1WDPA 3ALGA 2VDGA 1ZAIA 1KTCA 2Z2AA 3VKKA 3HJZA 2OLHA 1KLYA 4QNWA 5F2LA 4XKMA 3RNDA 4QJ1A 2X05A 4TV5A 1JL8A 4DF2A 1SJBA 1L6YA 4O1FA 1G4TA 4PTNA 4KEUA 5H1WA 2QCFA 3QKEA 3DOPA 3E12A 4LS0A 4IFKA 3HM7A 3PNZA 5LXEA 4ZE4A 5C7HA 3M0IA 2ALDA 4GUHA 1ZPTA 2YFNA 3TK7A 3A24A 3GTNA 3GIPA 3DYPA 4D6EA 1HL2A 3GNRA 2QIIA 1ZQ5A 3F2BA 3B06A 1DXIA 2DU2A 4BF7A 2NQZA 3UCDA 3C0LA 3DC0A 2DZSA 1IXPA 3NIYA 4MKVA 3H2EA 3UZXA 2OCZA 4LPCA 1VBJA 1OCJA 2QAPA 4IMDA 5M2FX 5LZLA 1KM1A 3UZJA 4UNLA 2PF8A 3WLMA 4QR6A 4TOQA 1ZUAX 4Q8PA 3EA3A 5AHFA 4OQVA 3LBOA 3OGRA 1QI5A 2QGHA 4JGDA 1UH3A 2TPSA 5E6YA 2BY0A 3UERA 2Z6IA 2IKGA 5HANA 5I3JA 2OPJA 3QW3A 5MF5A 1QI2A 1W2PA 5AHMA 4L56A 4LC6A 4TUFA 4PUUA 3N9RA 2A0NA 4B5SA 1E0TA 2I14A 4M19A 4S2BA 1W3LA 3VIGA 1AQMA 1TIMA 1GVEA 2GYIA 1QOQA 2D2GA 1BVNP 2INEA 5AC7A 5K4ZA 3S0CA 1XWYA 2Y4SA 1FP8A 1FX6A 3EKLA 4XTDA 2X8RA 4HU0A 1X39A 5H8MA 5M03A 3GS6A 4PFHA 2WMKA 1YBQB 2I5IA 3IK2A 3SQLA 2GGEA 2FJKA 2QDHA 3GB6A 1EOKA 2WB5A 1MQPA 2YW3A 5GQBA 1OIFA 3KM8A 5B80A 1SZGA 1T8QA 1UB3A 3ITYA 4GQ0A 1RJPA 3QV9A 4JTRA 3BLOA 1QHZA 1E0WA 1VFHA 3N9KA 2G3JA 5LGXA 5ECUA 2NQ5A 3VOCA 1S2WA 3WMBA 4ZO7A 3PNUA 1AH3A 4DY1A 5BMXA 3NZ1A 4GQRA 1F74A 3CEUA 4PB4A 5SWUA 3GG0A 1LUCB 3TN6A 3N3MA 4PUNA 4BHYA 3EXTA 2CPUA 3E0IA 1R47A 3VD9A 2RFGA 4HVXA 2IKJA 3C2VA 4XUGA 4DLMA 3CUFA 5FL0A 4PMQA 3EWWA 4US6A 3REQA 3CB3A 1T6MA 4DYEA 3WENA 1DBTA 4E4PA 2XJ7A 2ZWYA 3DESA 1WKEA 4M7TA 1M7PA 4HU8A 4NNBA 3KUMA 4HA3A 3IJLA 4C6MA 4IQJA 1ODUA 3MVIA 3HJEA 3DIPA 3WF3A 3W7NA 2Y89A 1ITXA 4F2UA 1JGIA 3W07A 3SB0A 4E5TA 2ZZ7A 1CLVA 3WD4A 5C0QA 1UD3A 4YTRA 3M07A 4Y6GA 2Y2WA 3IIOA 5LIUX 2B7NA 2V2HA 3TSDA 3BC9A 1YDOA 3SRFA 5JU6A 2PU0A 1UKQA 4ERIA 4B91A 3TV8A 3GVVA 3MP3A 3ARUA 5I3HA 2FHBA 4HZ6A 1VD6A 2XIOA 3DERA 4JHZA 4K8HA 2PDYA 1H5VA 1RK6A 5K9XA 1F3TA 1MQQA 4NYYA 1L2QA 1XLCA 2C6QA 1XBXA 3MP5A 1O5QA 2QR6A 5CG0A 1OGBA 3VKAA 1OK6A 4RNFA 3A4JA 3DKJA 4HHHA 4FXSA 3GVRA 3IJ6A 2E5CA 3BLFA 3KBVA 4UQBA 4A8LA 4LCRA 2O9RA 4H7ZA 4P61A 2AGTA 4O1CA 1GZ1A 2ACUA 3MV01 5K9CA 3CC1A 4GY7A 2OZ0A 3G22A 2QYGA 3FJ6A 1TPUA 1G9HA 1W3JA 1V6XA 2X09A 3H12A 1ONRA 5A6BA 4DUXA 4UTWC 3CS2A 3K13A 3B8TA 2XG9A 3DENA 4O13A 5CKSA 4H6RA 3WQ6A 2XH0A 3DFYA 2CITA 3LSCA 4IGMA 5IXEA 2GDVA 1C29A 1QVBA 1XUZA 4LGXA 2PGRA 1OGGA 3W1NA 2X30A 2OELA 2AL2A 4MZ8A 2CIPA 2WKJA 2XU2A 5K4XA 4XO6A 3VGBA 1IGSA 2H9AA 1T0OA 3L4UA 4FPSA 4XQ6A 3B0PA 5EFFA 3DBPA 1HUVA 3FJ4A 4PMXA 5GVJA 2FJUB 3NQEA 3BL3A 4JIEA 1MUWA 3C2YA 3T09A 2XGZA 4NZFA 1LRTA 3EBVA 4M1BA 3T4CA 1T8XA 1GNXA 3A13A 3QLLA 1US3A 3HQNA 3UCQA 3ZWSA 3FK4A 3L5AA 3QHNA 5DMNA 3KS5A 5AZ1A 3VOFA 3WNMA 2J24A 2PC8A 2YDSA 3AIQA 1P48A 4DJEC 4P2VA 4MADA 5EFDA 2BGSA 5M3WA 1YX1A 3XIMA 1V0LA 2J9ZA 3L67A 1UUQA 3M4HA 4LQ1A 3WNNA 1ESWA 1A80A 2PAJA 3R0UA 4UQAA 4WKFA 1XF0A 5E0FA 7XIMA 1UP2A 4F0MA 2AMGA 4HGXA 1YIXA 1TJ1A 3A47A 4L6DA 4MZ1A 1OZMA 5D09A 1RPXA 4FIRA 5C7VA 3HPFA 3WQVA 1KGXA 3WQEA 3PSVA 1R86A 4IWWA 2OZ3A 2YCJA 5C5YA 1KKOA 1AMKA 2WHLA 3FA3A 1IEWA 1OC5A 1LLOA 2KX9A 4ZEPA 2XUCA 1UR4A 1RLCL 4I6KA 5AVHA 3MHGA 2YXGA 4F9JA 2DZWA 2QJMA 4GHRA 3ENLA 1YADA 1WAUA 4O11A 3LGDA 3WX7A 2NX9A 3WUEA 4O15A 4D6CA 3GHRA 3AWOA 3AZTA 4E2DA 3VDBA 4C6EA 7REQA 5JBDA 2OO0A 5ABFB 5FEPA 5CC7A 1GHSA 2INZA 5EB8A 3BW4A 1BLIA 4LVBA 4KWUA 4CD7A 1PWMA 3CU2A 4B3ZA 5IRPA 4A8RA 4JYFA 1KFEA 2OWWA 3WY1A 3V1HA 4EXAA 3C86A 1CGUA 2B31A 2POZA 3KEHA 2I56A 5EL1A 1DYSA 1V0NA 3FA5A 2W3ZA 1ADSA 1KCKA 4X63A 2FVMA 2CLFA 2PRMA 3NZRA 2Z25A 1ML1A 2OWXA 3LCLA 3AMCA 4MNKA 3BURA 3CUIA 1UP0A 3SQMA 2VEIA 3W28A 1ITCA 3VNMA 1ISZA 6A3HA 3AJ7A 5CPNA 2OQYA 4IPLA 4FOJA 2NUXA 3ARQA 1EDGA 3LPOA 4D8ZA 3PB2A 3QXBA 3VDAA 2XN0A 1H7OA 4QJ5B 2PZ0A 5CLWA 3FVMA 2ISFA 3FSUA 4MFDA 4V33A 3UBPC 1QI0A 4W5ZA 2VWTA 4ZODA 4XBJA 4IPJA 4LYKA 3QYQA 4N6FA 1P0EA 3EOLA 4KFPA 4ORMA 2VC6A 3H70A 3GDKA 1J9YA 3VPLA 3L4ZA 1HKKA 1BRLA 1WX0A 5DBTA 3FA4A 3FX4A 2I9UA 1XLGA 3OOQA 3W7KA 2WV8A 3GHSA 1YDYA 5J5RA 1AK5A 1Q4WA 3DHDA 2VX6A 5AYZA 4EXQA 3VNKA 2YXOA 4CD6A 1SZFA 5BYWA 2ZX7A 3KRBA 4ZQOA 2VEGA 4QDMA 2PTWA 2Y5JA 3HV8A 6CGTA 2XSBA 3URQA 3BW2A 2W0UA 1YMYA 4IICA 4LRTA 1I6NA 4ZOEA 5HQEA 4MFEA 3HBLA 2V67A 3CBWA 3C3UA 5C54A 1ZBWA 3MVTA 5ABTA 3N6QA 1E6XM 1X38A 3W1RA 3CPRA 5EBUA 1VYRA 3S47A 2NQLA 3IIXA 3OBAA 1O95A 3P7YA 3RITA 4F0KA 2J74A 3W2KA 4O8AA 1KGUA 5D2TA 2E7FA 2ALRA 5CC5A 4IP5A 1XLAA 1TFVA 2J77A 2A6NA 3W1AA 3KRSA 1TYGA 4L9XA 3AALA 3UEQA 1JNEA 1OT2A 4IIHA 2WVTA 1AJ0A 3MHFA 4K38A 2ZUSA 4US5A 1CXEA 1J93A 2BHZA 3A4AA 3CZGA 1QATA 1NELA 2V5KA 4WSKA 3R58A 3CHEA 3VE9A 1X1OA 4B5VA 1Q3NA 3WJZA 4OJYA 1DE5A 2OMAA 3LHYA 4FMVA 8XIAA 4DX3A 3OBKA 3F4WA 4XZWA 2XDFA 4C6IA 2PDBA 3HF3A 3R79A 4I3GA 3M41A 4S39A 3OVQA 2Y62A 1L8NA 5JIPA 1XQLA 4DF1A 3DBNA 4UTKA 1FTXA 4B5WA 3WBWA 1R3SA 1XUUA 3SQSA 3QPYA 4EWJA 4QS5A 4O52A 3GFYA 1DXEA 1DWGM 1JI2A 5E09A 3VIJA 1GVSA 2FMOA 1UR9A 1NDVA 4NI8A 1ZJIA 5HJXA 2G0WA 4AMCA 5JQ9A 3GDRA 4Q32A 4TV6A 5HBFA 1MW2A 5FEZA 1E6QM 4C6BA 3LN3A 1EGMA 1ZSXA 1B54A 1ZJAA 2XVLA 2E6FA 3PUGA 4OV4A 3B0UX 1TJ2A 3VNZA 3IVUA 1TKKA 2NLYA 2XVPA 4L4MA 3AISA 2C1IA 4U4MA 3RMJA 4AD0A 4E8GA 5HULA 4LALA 4US5D 3TJXA 2PDXA 2O9TA 3VUPA 4F2TA 3IJ9A 4DJED 1FH7A 2W63A 4IHCA 1W56A 3RK8A 1Q2RA 1BTCA 3EYPA 1BQCA 4MY8A 4GO9A 1TV3A 3H2OA 1NY1A 4POCA 3B4YA 2W6RA 2DZBA 3SDOA 4LU0A 3V7PA 3KP0A 4U31A 5GNZA 1LT8A 2VTFA 4M81A 1W5OA 4OWGA 5HA7A 1HL8A 2HZGA 3TFCA 3W83A 4DAFA 2G37A 3SN1A 5FJPA 3LPPA 4B5UA 4HPHA 3TFXA 1DL3A 4Q33A 2VR2A 3JVAA 3NPVA 4QSFA 3GNXA 4JX6A 1C9WA 4GO8A 3QN3A 1XM3A 2G4FA 4U2ZA 4HNVA 4FS9A 1ZAJA 1VFMA 3PBGA 3W23A 1E3ZA 2QCCA 1NM9A 2QJGA 5T8GA 4O28A 1XBVA 4ZZ9A 2BX7A 4PRTA 4LB3A 4LRSA 5FF0A 4L1XA 3CMFA 4B3LA 4LAKA 1LBLA 1LORA 1LQAA 3VCNA 3V1PA 1ECQA 5C70A 2DUZA 1MMFA 1J0KA 4YL2A 2WMFA 1UIOA 3WLPA 1KRBC 1U22A 1E70M 4JN8A 3KWSA 1WDQA 4GY1A 4X0NA 1UR1A 4UOZA 2MANA 1AL7A 4I5XA 1V8EA 3GXTA 3V75A 4GFIA 4JS3A 4HBKA 3N12A 3BV7A 2C0HA 4H9XA 2RH9A 5AC6A 4PBEA 1JIBA 1XIEA 3E2VA 4DWSB 4LWWA 3UR5A 2GUUA 1I2NA 3AIBA 1B4EA 2FGBA 2GWNA 4Q4MA 3RXZA 2WLZA 1XI3A 2D3LA 2C16A 3MT1A 5AFDA 3W70A 5IFTA 3NQVA 5FESA 5IOBA 2VKZG 2EPHA 2QF7A 1I4NA 5BRQA 4OBSA 2P76A 4HQVA 4NT0A 5FSEC 2Y8VA 1TX2A 1SFSA 1OJXA 1K03A 2VNCA 4LUTB 3ABOA 3TJ4A 1YE6A 4H3DA 3UCCA 1HO1A 1H7XA 1M68A 3CASA 1PKYA 2DW7A 3W4RA 2OEKA 1XBYA 1Z32X 1R6WA 3SCPA 3BMVA 4A3YA 2Z1WA 1O7AA 3ATZA 2CC0A 3EOSA 2O4QA 1P1XA 2J27A 1EH9A 3ARYA 4WVXA 3W75A 4GFSA 3WK1A 5C9XA 3KRZA 1FWSA 4RW3A 3LM3A 4Q8NA 1S46A 3VFLA 2BVDA 2PDHA 1NSJA 4LV4A 3CQIA 4UOJA 4D9PA 3VFCA 2CWNA 2WXDM 4ZTYA 1KKRA 3LCXA 3AHYA 4LNCA 3PZ9A 1I75A 1QWGA 3F5JA 2UY4A 3CH9A 1AD1A 5HMSA 4MSSA 2ZUUA 5HATA 3UF9A 2NUYA 4WSJA 1OFRA 4CVUA 4UTTC 2E67A 3AMGA 3TQ0A 3WL0A 1R5YA 1V93A 4H9VA 3P8JA 4O4WA 3NGJA 5I23A 1ZLPA 1KXHA 5CZ0A 2JEQA 1S5TA 3UZWA 1XIHA 1JPDX 4C91A 3TYUA 1E1FA 3O6DA 4GUGA 4E8CA 1O68A 3LXCA 3FN9A 4GYPC 4JNMA 3M1ZA 1Q6LA 2BVTA 1ZZMA 3SW6A 3ZT7A 2VZVA 4IX0A 4R9OA 4URIA 1A5MC 2PDPA 3C6CA 1Y0EA 5A5WA 3SO7A 3PZUA 3IJIA 2JF6A 1DIDA 4QTGA 3NL2A 4OECA 2VGFA 3O63A 4UTHA 4KRZA 1M04A 1AW2A 2WSQA 3MI2A 1DOSA 1RBOB 4OOZA 3HMJG 1FHVA 1E4MM 2INFA 1JUEA 1SO4A 1T96A 4C1LA 4W9TA 3DX5A 3KRUA 2V5CA 4JY9A 4ICCX 3NUKA 3ARVA 1YEYA 4PTWA 3KBMA 1XXXA 2CZ5A 3R8RA 1G67A 4A8NA 1JCNA 2Y5EA 1PIFA 1NIUA 3GHTA 1FWIC 2J4GA 5JH1A 4N4PA 4IG2B 1UZ1A 5AC8A 1GG1A 2WVVA 4IQEA 4MWAB 3NQBA 1DV7A 2NWSA 3QOKA 1GQJA 2X2GA 5FJUA 3TYCA 4QE5A 2YR1A 1DJIA 4PMZA 4DN1A 1QHOA 3LNPA 4H01A 1E0XA 4LXFA 4MYXA 7ENLA 4W93A 1E72M 1K8XA 2ZA2A 3C8FA 1QAPA 3W1UA 3I3BA 4MLJA 4MPKA 1LP6A 1S1RA 1NF0A 3FVDA 1XYFA 3KS6A 4DWSC 5CJ5A 1ME9A 3E6EA 1BGGA 5I0DA 1N2VA 1V77A 1Z3NA 4GXPA 1NH6A 2J9XA 1L6FA 3CV7A 3STEA 2KZHA 3T0AA 3PG9A 4FNSA 1TTJA 4QITA 1QBAA 4MJZA 1NVMA 3M9YA 4GKLA 1EHNA 3MA8A 3G1DA 3SY1A 2E9LA 3ZLHA 1DQUA 2WKGA 1ADOA 1ME7A 1DXFA 2V6AA 5J8LA 1FRBA 3ZR5A 3AZRA 1O1HA 1F5ZA 4KWSA 4GIEA 3S1VA 1LT7A 1QW9A 4AZGA 4AWSA 3LX9A 2G95A 3N4FA 1E71M 1PDZA 1V6WA 1EX5A 2W9MA 3THAA 1VBHA 3WLHA 1YPXA 1Q8JA 3GG7A 1S2AA 1HZYA 5DCDA 4TMBA 1YNPA 3PFRA 1JYWA 3W7OA 3SCTA 3TTQA 1K6WA 5LIXX 3ITOA 5T9BG 1WOBA 3M47A 2P0OA 1ZJBA 3PZGA 4K1GA 4K1WA 4Q4PA 3ATYA 3T44A 3EPOA 4CCEA 2PP1A 4ZCWA 3LI1A 1EF3A 1CB2A 1YDVA 1JG9A 3BXWA 2NXHA 4Q3MA 3KDOA 4M3PA 1BWLA 1EJSC 4NAEA 1PKNA 1IYXA 4AYGA 1LRNA 1YKWA 1QMLA 3FDKA 1Z89A 3AS2A 1ZBVA 4DBWA 4XD5A 4GIRA 4W7WA 3VCRA 4JQ2A 1CW2A 4WXZA 2Y70A 1QU4A 3C56A 1VJSA 4QBXA 3EXRA 4ZSUA 4LF2A 1YLVA 1OEPA 3PSWA 2GDUA 2AQOA 3GIYA 3MO7A 4NVTA 1JDEA 4W8BA 2IQTA 1ICPA 1W1IE 1KQYA 4AY8A 5HNTA 3DI0A 2QDDA 4UTLA 3W6MA 4EPBC 5I07A 3SUVA 3PS7A 3GR8A 5BXPA 3NYZA 4AVNA 4Y9OA 2HS8A 3ARXA 4HNCA 4EIVA 3EB4A 3H2FA 4DB7A 4WY0A 2WKLA 4GYPA 4HJWA 3TNBA 2CETA 4J2MA 5AY7A 2D22A 1XL9A 4CQAA 4P7OA 1ITQA 1EB3A 3ZT5A 3DEQA 1R3YA 4H6QA 4W86A 1T41A 3BW3A 1NTHA 1OT1A 4I9MA 4H6KA 1F4HA 1V3KA 4J3WA 3U57A 1XRTA 2ZZ1A 2PRLA 3B8UA 5JIWA 1RJRA 1VLIA 3IAQA 4BI7A 2ZQ0A 4Z08A 4JHMA 3V3WA 3AU6A 3MDWA 2XWDA 2Q01A 4AW7A 4EF8A 2QJJA 5XINA 4WR3A 3G1FA 4Q4KA 4ROQA 1MFVA 3UESA 3SI9A 1TJRA 4XKYA 4MWAC 3PC0A 1PTGA 3U4AA 1F2JA 5I3FA 1IHIA 1QT1A 2VZUA 2JE8A 4CGTA 1BEUA 3R0KA 3PJUA 3CHDA 1VRDA 4DI8A 3LU2A 1G1YA 1SSGA 1TWDA 1YTKA 2FGLA 3QY6A 3NYDA 1J01A 3W0KA 1IZKA 3L5LA 2WC7A 1CYGA 2DIJA 9XIAA 4YLWA 3AIUA 3U4FA 1NP0A 3WFZA 3URNA 4CCDA 3SCUA 4M1RA 2OZ8A 4WEVX 5LSMA 3KOZA 3W2LA 4BI5A 2PFHA 5BW6A 1KXQA 5C9RA 3SSJA 1V6TA 2QT3A 1BSIA 3PF3A 4G56A 2D0FA 2Q8LA 2CBJA 2JALA 1SQ7A 3DG6A 5BOFA 5FACA 1S5VA 1IT8A 2OR2A 4ZA0A 2VZOA 3EDJA 1A47A 1TRIA 2YBTA 5CZTA 2FMNA 1QNOA 3IACA 2CERA 2QZRA 3F2DA 1OX4B 1CNVA 4S3EA 4G9PA 4JTFA 3C0QA 3NDYA 1WDDA 1Q45A 3CLWA 3GC4A 2QULA 3EMCA 4GKTA 3PB0A 3IGXA 2FH6A 4UMAA 3VAVA 2WNZA 5G1MA 3C61A 3RX3A 3STPA 2WNWA 4NJJA 1M9HA 4LSBA 4PCSA 1QTWA 2P10A 1SGJA 3HPAA 4UNKA 3UJRA 2I5GA 1M3UA 4ZFMA 5TQLA 2WHKA 4ACZA 2YZ5A 3GH5A 3WNPA 1K3UA 3O6YX 2HISA 5E0KA 3QKZA 3AIRA 2Z1BA 3L5MA 4M29A 4I6VA 2EG6A 1D7FA 1C90A 1W9VA 3SZ8A 2Z2UA 3TJLA 4DWSD 2V5BA 5I6SA 1HG3A 4MB3A 4GYJA 1Q4NX 1DWHM 1WXYA 4R53A 1JAKA 5JBFA 4PMUA 2A7PA 5HOSA 2PDQA 2XINA 3B3DA 2CBIA 4F40A 1HW6A 1F05A 2P50A 1ECEA 2WM0A 3QR0A 4IP4A 2XVKA 3EDDA 2ODOA 2G3IA 1DWIM 4GA8A 4Z42C 3NNTA 4PMNA 3STCA 3CIVA 4S38A 3LUTA 1B57A 3S2LA 4UR8A 2DSWA 5ABEA 1Q6QA 4G7FA 1RQBA 1WP6A 2PWVA 3W1LA 4ZOCA 1R8LA 3VKCA 1VFTA 4JFSA 4HMDA 4DZIA 3IEBA 3LRKA 1GORA 1MUMA 3Q65A 3W7PA 1O5KA 2REQB 5BNKA 3WFLA 3MANA 1NFPA 2RGLA 4PMRA 3R0DA 4XAPA 3PULA 3T81A 1KRMA 6REQA 5RUBA 4I5RA 2DIKA 1M01A 1O6IA 3QBUA 3S6DA 1TV8A 5T91A 2V38A 5K7JA 2QQ6A 2XN1A 6XIAA 1VIWA 1XISA 2DQWA 2EPMX 1S2UA 5C8BB 3W38A 4TX6A 2HVMA 3GRIA 4YTUA 2GK1B 4NZCA 4E38A 3W1QA 2J79A 2YXXA 3AMDA 4WSHA 1CENA 3BAJA 1AJZA 3MO4A 4PTXA 2GJLA 1U1JA 3NM1A 1UBSA 1H7NA 4DM2A 2NUWA 3VD7A 3VOJA 1BPLB 1SU5A 3EDEA 3U6WA 1P6CA 4LC8A 4AMAA 3OIHA 1ODZA 4JBRA 1A53A 1UP3A 4QDPA 4A4AA 4BS0A 3NM3A 2NX1A 2FZ8A 1VBRA 3G1HA 5CZKA 4J28A 3CQ0A 1OD0A 3ZT6A 2FVLA 1A4MA 3PZTA 1P43A 3P3BA 1KFCA 1W6TA 2IXVA 1G4EA 4MMWA 1RA5A 3LCHA 1XYAA 1VFUA 3H4XA 1TVNA 4PCPA 4HPNA 4ZOAA 4G7EA 1FDJA 4CQ8A 3GC2A 2I57A 4LNYA 3P0WA 4EF9A 4CQCA 1FOBA 4PUJA 3EPMA 2XFWA 1YDNA 4CN4A 1CLXA 1NWSA 3AHVA 4PSRA 4WOZA 3STFA 2VC9A 1PJ9A 2EF9A 4IIDA 4JHOA 2YB4A 1P6BA 4JFVA 5I02A 1J0JA 3V5CA 3AS0A 3N73A 1JDAA 1LBMA 1GG0A 1TVLA 5GNYA 4CNUA 3SJNA 1EJTC 3OZPA 2BLEA 4WX2A 4AF0B 3WG6A 1TMHA 4QISA 4W84A 2UV8G 5KEZA 1ITUA 1J4EA 3M43A 2GSEA 2J7BA 1FXPA 4LJ3A 1WA3A 4ZB5A 3MKCA 3U2CA 1EUAA 2XZ7A 2ZA1A 1JPHA 1B30A 4A2SA 1W3HA 1E6ZA 3B9AA 2OEJA 4HTBA 5HNUA 2VCBA 2ZVRA 3BOLA 3RYSA 4O1BA 3PWGA 4AC7C 4ATWA 2V5LA 4DF0A 1H7WA 2I5QA 3T40A 5KZDA 3U48A 2Z6JA 1CT5A 4MWAD 1D9EA 3GVQA 5C2CA 3NTYA 5HDRA 3USBA 1E1EA 5HK4A 2PD5A 1J8VA 1XGDA 1Q8AA 4FXFA 3B9DA 2FDMA 2RHGA 3IS4A 2JKPA 3VVGA 1A50A 1WQ5A 4HJFA 4DUVA 2RUSA 3WF4A 1RAKA 1QO2A 4IGSA 4HNNA 4GZIA 1EDTA 1F07A 3OA5A 2IXUA 5A2CA 4ZE5A 2VRQA 3HZ3A 4QFUA 3RMEA 4YXGA 8XIMA 1QWKA 2J9YA 4CD4A 5DF0A 4RV8A 2DVXA 1TV2A 5LNWA 1T5AA 1WCGA 3RUBL 3PBYA 1J12A 2ZUNA 2WSYA 4RXFA 4KQNA 1UD8A 4GQBA 5D8ZA 1OYBA 1VGAA 1B3YA 4O0KA 1O60A 3NZQA 5M5DA 3SCOA 3WBXA 4C7FA 1OCBA 3E0WA 4N9DA 2XIIA 2XSAA 4B2DD 4AZHA 1WZAA 1YNQA 1JXJA 2OSXA 4ICNA 2RKXA 1OM0A 1EP2A 3BCJA 4HNTA 1C8YA 1CXIA 2PGFA 4LCQA 2YSWA 5EU9A 2FIQA 2JF7A 1B9BA 1FWRA 1KCLA 3H23A 4WXYA 1FBAA 4JX5A 3DHUA 4NZ5A 3CZEA 1EEXA 3IUHA 4M5PA 3QFEA 5KETA 1BAGA 1WBJA 2OGYA 3COTA 2WSPA 3UGVA 2F61A 3XISA 1I2OA 3MZ2A 3TU9A 2D3NA 4D8LA 3OG3A 5HNRA 4NZJA 3W9ZA 2BGQA 4WDTA 4TX8A 4FO4A 5FJJA 3N15A 3RM9A 3SCSA 1JD7A 2Y85A 1DIEA 3GNDA 3INPA 2ZCGA 4IL2A 1OGSA 3BAWA 2DGAA 3R8GA 2BGNE 2TODA 3UJ2A 2DSUA 5AB3A 1OB0A 2WJFA 4HK7A 1L6WA 2QCLA 1SW0A 4P7QA 3FYYA 3KVMA 3BO9A 2YX0A 1NU5A 4JEQA 5AC4A 4RDVA 1MZRA 3PUOA 2VX5A 4KRTA 3KVJA 4GGHA 2D23A 3TR9A 4GIAA 3EGJA 1AG1O 2BHUA 3QZEA 4QIUA 3P82A 4YNGA 2CZVA 1JQVA 2BOEX 3EWZA 5CCZA 4J2PA 1NDYA 2FZDA 1BWKA 3PZIA 2DIEA 3QVQA 4RZBA 1V3MA 2VMFA 3CMGA 1X8CA 2A85A 1I0DA 3W53A 4NAFB 2E6AA 1UQYA 1BXCA 3CIXA 3AJXA 3AS3A 1WXZA 2GJPA 2ZE3A 2HNHA 2NXIA 3PN8A 1PKLA 4H83A 1F61A 4AIBA 2ZE0A 3T0DA 1XLMA 1UWTA 1K77A 3DH7A 2V5JA 4K3ZA 1PX3A 1LQ2A 2BS9A 1XLIA 4LVGA 3DUGA 4MNLA 1UW9A 4ZB2A 2QUUA 2B81A 5CBBA 1VEMA 4AUBA 1KV8A 3N18A 3ABZA 1V03A 2QCMA 4AEOA 3MW7A 3FGCA 3T2OA 2QEZA 3H22A 4AAJA 4MNMA 4AZCA 3BMWA 1W9PA 3BSMA 5DXYA 2WZMA 1N55A 1H3GA 3DG3A 4XIAA 3CYJA 1J0ZA 1UKTA 3FXYA 3TN5A 1CTNA 1ELSA 4JTUA 2ZWZA 3L4TA 4AX7A 4BF9A 3MCOA 3TN4A 1OY0A 1L2UA 4RZ4A 4Z17A 4JYDA 3UP8A 1K7FA 3IAPA 1FDZA 3K8MA 1V7YA 3T2QA 4UFKA 3EWUA 1NQ6A 1K9FA 4BWLA 2QKFA 3CB8A 4KT2A 3PJXA 3CZLA 1K8ZA 3C5QA 3G2GA 3UY8A 4GCAA 3ZXWA 2QUNA 2CLLA 3KLKA 4GI6A 3SM0A 1ZFJA 2A4AA 4PUMA 3M0LA 4DBEA 3SIZA 1LROA 4CUCA 1JCJA 1E43A 2WC3A 4HPXA 1PHQA 5FF4A 1GKPA 1E3XA 1F6KA 2BXZA 5A6LA 5ABFA 2ZZ4A 1B3WA 1UWIA 2O0TA 4IIFA 1ZY9A 1TPWA 1M41A 7TAAA 1W5NA 4DQWA 4QDWA 4ADUA 1HKVA 4OIFA 4DRSA 2ZRWA 1SPQA 3UD6A 2DZXA 4UB9A 5TIMA 1ZU8A 2YBUA 1LDCA 2VFFA 4UUIA 1U1UA 3GNNA 4RCXA 1UR8A 2WANA 4I7UA 2IMRA 5FKYA 1PV8A 3BPWA 4R5EA 4CNPA 4NXSA 2ZZ5A 4DNMA 5HNNA 3FKKA 3WF0A 2ZYFA 4HYVA 1UQZA 4TXEA 3GR4A 1XDMA 2YFOA 3I65A 3O06A 2WOQA 4AISA 3EWYA 3V18A 4JNYA 4DO4A 1O12A 4JIHA 1OC7A 2CXEA 1MNSA 3MBDA 3WMCA 1LQ0A 3CL6A 4QLLA 4HNLA 2R14A 1GTEA 2OB3A 1KBJA 3RG6A 4MTVA 3SCQA 3QC0A 4HU3A 3VKDA 2YL6A 4AVFA 5FAJA 1NARA 3UETA 2OVLA 3WH5A 3B05A 4GH1A 2QJIA 4ATLA 1FWEC 3QHOA 3RM8A 1XFCA 2AAAA 5D30A 3E96A 3U2ZA 3M0KA 3QQ1A 4XZ9A 5A1AA 4JTKA 2V30A 1K9EA 4Q7NA 3PG8A 3QOMA 3VNYA 4YS1A 3MUCA 3WLSA 3EWDA 1DTNA 2J62A 1CCWB 3PVFA 4ZO8A 1VHNA 1KV5A 4NP7A 3WQFA 5DMYA 4IFRA 4H19A 1P0BA 4REQA 3LV5A 3W2UA 1HP5A 1TV5A 1IV8A 2D0HA 4PTDA 1POKA 5HUPA 2Q02A 3W1PA 4CN1A 1BF2A 4S3AA 4YYCA 1GOOA 3TP4A 3KOFA 1SO5A 4DXXA 3K8LA 1AZ2A 1W9DM 2ZUTA 1WDRA 3LA4A 3HOJA 3CL8A 2E25A 4FOKA 5TBOA 3W7GA 4MOZA 2PDKA 3BLIA 1D3GA 1VKFA 1GOQA 1TE6A 3EXSA 1Z7AA 1KD0A 1OFOA 2QV4A 2X7WA 3VZXA 3SURA 1DE6A 2WBGA 3R6IA 2R8WA 3VKBA 4AWUA 4DJDA 2OU4A 4GG9A 5F4WA 3NR0A 3H8AA 3KTXA 3SCNA 3UXIA 4H8UA 1IWPA 1D7KA 3VMNA 2FH8A 2ZRZA 3DFHA 3IJQA 2HDJA 1FY6A 1ZHAA 4DBSA 4AVOA 2VXNA 3PZVA 4M80A 1YTEA 4BY3A 2ZDSA 1I1WA 3GDTA 2QCHA 4ZQPA 4GPNA 2DT2A 3RO6A 3SGZA 5GJPA 1UPMB 3S5NA 1D3CA 4H41A 4AWTA 3IUDA 3AXXA 4B4FA 3UWVA 2WMGA 4C6OA 1CECA 4HSHA 2WK2A 4ZVJA 1E6NA 1CGVA 3N11A 1KM0A 1WOAA 1K02A 3MV11 3NQDA 4C6CA 4FB7A 5FAGA 3UR2A 1M53A 2EPKX 3EOOA 3M6YA 1PE1A 1DHKA 1DHPA 3CHFA 1VBUA 2GQ8A 1W1TA 5I7GA 2V3GA 3NOYA 3I10A 3MWAA 2R6OA 4JD4A 4J9JA 4DXKA 1AJ2A 4JKLA 5D2VA 1S2TA 2FGZA 3GHUA 4GUFA 3VIIA 1Q6DA 3W74A 1BSLA 5FJIA 1EXPA 4PMOA 3TJIA 2NSOA 2BOGX 3UXAA 2P53A 4XISA 3LHTA 1GYNA 3ID7A 1PZ0A 1ADDA 4IX2A 1JNDA 3L21A 3RIKA 1CB7B 4H04A 4HOZA 4UNIA 5I00A 4R9XA 1XICA 1OINA 1JD9A 2CLMA 4F4RA 1HO4A 4XB3A 4JDBA 4HP5A 2DH3A 1S2VA 1AVAA 1OF8A 2HK0A 4ROPA 4PL1A 3LK6A 3N14A 1SSDA 3LCGA 3WLKX 4FX6M 3BLLA 4UQ9A 4EOUA 1KFLA 1J0IA 3H2CA 1XIGA 1W1VA 1TCMA 3WBEA 4YVVA 3WDHA 4LOCA 4B90A 3I4EA 1RLDA 2PLMA 5LNSA 2WC4A 1A5BA 4Y96A 4ML9A 1DQWA 3VNLA 4NI3A 4B5XA 2J88A 1QASA 3NQCA 3QQWA 4M8UA 4PN2A 2EXOA 4JTEA 1A3WA 2J6VA 3TW6A 1NP2A 2OXNA 5I3DA 3JZEA 3KTCA 3P62A 4FIQA 1LCOA 4GZJA 1JZ7A 1IZCA 3G8EA 3W7IA 4JFUA 1WZKA 2BOFX 1KR0A 1Z48A 2PMQA 4GCXA 1SYTA 4H2CA 2GPTA 3W26A 3F5KA 3EAUA 1MEIA 2FHCA 3FXGA 3CL7A 4U33A 1XLJA 5CC3A 1JZ8A 4PULA 4DPQA 2WJDA 2FFCA 1BG9A 5CAKA 5I3KA 1UASA 4H1ZA 1THFD 4NUWA 5A95A 3GE7A 6TIMA 4GYFA 1GEQA 1TWWA 4TVDA 3RF9A 1FHDA 2OYLA 3O9NA 2AL2B 3NCOA 1M65A 3A4WA 5TD4A 3ANVA 1KW1A 1XHGA 2YLAA 1AMYA 2H9AB 3LHVA 4HSOA 4QEEA 3UG3A 1NOUA 4O50A 1QPNA 1ISVA 4H8HA 2O56A 3M0VA 5GJMA 3GTFA 4H7CA 1B3XA 4EE9A 1ZRQA 1A5CA 5CZJA 2VVSA 2YCEA 1LL7A 3KBJA 3HG2A 3BICA 1AQHA 2FPYA 1FCQA 4O17A 5T26A 3TSBA 2F84A 3OP2A 3BZGA 3GTXA 2PDNA 4BQ3A 5I24A 2G96A 4H4IA 3KVLA 3UQNA 2Q8XA 4Y8EA 2ZXBA 3OGSA 5H2ZA 3IWPA 1BYCA 4TIMA 3S9IA 2PEVA 3CK5A 3GM8A 3WQ8A 4IPIA 1R9XA 1JF5A 3MSDA 1GCYA 1HKJA 4PBFA 5I77A 4IMFA 2FPVA 4FHAA 1CEOA 3LTSA 4CEUC 4FNRA 1U2YA 2W27A 3G0UA 3DHPA 5CEWA 1R3VA 3QMRA 1GYLA 1SO3A 3HTWA 2VURA 3VD5A 3SBFA 2FTPA 1EEPA 5IDIA 1H49A 4D6GA 2WZHA 3W7MA 2IQDA 3KXQA 1OFPA 4UTUA 3LTPA 3W7CA 2QW5A 1UZ4A 4PZVA 3UA4A 1JCTA 2PDGA 2FVKA 4NF7A 1ZJHA 1XLEA 3TTOA 3FOKA 2HBVA 1IIHA 5HPOA 1QPQA 2BBFA 4Y9AA 4XO7A 4GH3A 1W37A 1TB3A 2A21A 3LS9A 3GDLA 1I8JA 2AQVA 2OJPA 3LQGA 4QJ4B 3FYOA 4WGHA 2B4GA 4IMCA 1EX1A 1FWHC 4QROA 2DQXA 4B16A 1F3EA 2Y1HA 2GUYA 4K8EA 3TXVA 3WLNA 3W73A 1BYBA 2Z26A 4CNTA 2XIMA 3UZZA 1EWDA 2VI0A 4ZO9A 3I6EA 4OBTA 2XTKA 2JIEA 4A3UA 1Q7QA 4AXNA 1OF6A 4C7GA 2ADAA 3MTWA 3CTLA 4IT1A 1JPIA 3MY9A 4YU1A 4AXKA 4JXCA 3WH7A 3JR2A 1B1YA 3TWAA 3B0YA 3RX2A 5KMYA 4O0ZA 4E2OA 1XQKA 2BWGA 1TV7A 4KFOA 1QR7A 1KGWA 4JQ1A 1TR9A 2QGYA 4RW5A 4JQ4A 4UFHA 1UWUA 3W6YA 1H7PA 3JUGA 2BHYA 1B31A 4XVEA 1GEHA 3G0SA 4WHBA 2ESCA 1AQ0A 3VILA 1ZCCA 4QLKA 2CLHA 2W79A 4DELA 1XPGA 5B7ZA 3RHGA 4A35A 2HXTA 5MHBA 4KIRA 1I2RA 3DGBA 4XZIA 1B2YA 4Z2IA 3OBEA 1VYPX 2ZC1A 4LTSA 1R85A 5BOEA 4UWMA 1SW3A 3WD0A 4FALA 1V02E 5J5DA 1J96A 1EZ2A 1S2CA 4A21A 4DO7A 3EB2A 3T05A 1IXNA 3G3DA 3NQ7A 5FA5A 4AHOA 2R1LA 3AUOA 3E2SA 1Q63A 5AN7A 1UBPC 3PK7A 5CQ1A 3M16A 2PDMA 4GIYA 1PZ1A 1W1PA 1BRLB 2QAFA 2PGEA 1MXGA 3BG9A 1FDYA 4OT7A 3WEZA 1I0BA 1IEXA 5FOOA 2DT1A 9CGTA 1G94A 1KRCC 1EWEA 3M5VA 1PTDA 2D20A 4QHRA 1KFJA 3RR1A 4QG9A 2LLEA 4ZQMA 3VD4A 4YTQA 4FF5A 3SRHA 4ECLA 3N13A 4OBRA 3ZOAA 3CUGA 3WD1A 5AOUA 1X1NA 3PBWA 3G1YA 4WJEA 3RU6A 5FL1A 2WCAA 3GU2A 3LXAA 4RR4A 3N9SA 4H9MA 1JDFA 5DMMA 2HV5A 4PTMA 5E0CA 5C9UA 2VT0A 1R38A 2EPOA 1CGXA 1XYMA 4HNUA 1H50A 4AD3A 1JI1A 1TWZA 3LCIA 4RE0A 3LY0A 3UT0A 2QPUA 3AU2A 3AICA 3GG8A 4N2YA 3DECA 4JFTA 3LV6A 1JDDA 4MB5A 3T8LA 5CPOA 1P6WA 1OYAA 3CV2A 1JRBA 1VQTA 1TPB1 2C91A 4GZEA 5CZSA 3KZSA 1GVOA 3OLEA 4GXWA 1SJCA 3V16A 4ZB0A 3P5ZA 3K4AA 4ZQNA 2UBPC 4C6FA 1LBFA 2ZZ2A 4ILSA 1EC9A 4OGZA 1REQB 2R1NA 1QFEA 1HIZA 3FFSA 3PHAA 3ZVIA 4HK5A 4ORIA 3ICJA 2EQDA 3RLGA 4J5NA 1MYRA 4LAMA 3PPHA 4QQUA 1KRAC 4AQLA 2WZIA 1CGYA 1M6JA 7ODCA 1GVYA 3KCJA 2YYUA 1LJYA 3QEZA 1M7XA 5CSSA 1K6AA 2GWGA 4WCJA 1FA2A 1XYBA 3CTTA 2HQAA 4G1NA 4PB5A 2GJXA 5LA1A 2BMBA 2AKMA 3U2EA 3P61A 2I16A 6XIMA 5J04A 4HMNA 3E5BA 4D72A 3WCZA 3U5UA 5EBAA 3QV7A 1R2SA 2Q8ZA 5F4SA 4AD1A 2FKPA 1KNWA 2GJNA 4JEJA 4S3BA 1P0NA 2BZNA 4AIOA 1V3LA 2VQUA 4K37A 3S6TA 1ZNNA 4JKMA 3GTHA 2ASHA 2H90A 4UC5A 2GVJA 1QO5A 1UHVA 3NGFA 2Y0FA 2WHMA 1HJXA 1GZGA 2I9EA 3U3HA 2ZOXA 4GC4A 4Z1BA 2W67A 1KM3A 1VHCA 4C1KA 1EP3A 1G01A 3OQ8A 4QSHA 1DWAM 3UNDA 2VEPA 3WELA 1S39A 2QCDA 3PJWA