1OYCA

Old yellow enzyme at 2 angstroms resolution: overall structure, ligand binding and comparison with related flavoproteins
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
399
structure length
399
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OLD YELLOW ENZYME
publication title Old yellow enzyme at 2 A resolution: overall structure, ligand binding, and comparison with related flavoproteins.
pubmed doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase(flavoprotein)
total genus 141
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1oycA00
2CZFA 4YWIA 2GQAA 3C2RA 1TPH1 3GYEA 3EX1A 2V9DA 3DGRA 4UTTC 3VI2A 4GJ1A 3T4CA 1FCBA 1LOSA 1OFRA 1XDLA 2YX0A 1DKWA 4ADUA 2YFNA 1K03A 1LLZA 1VYPX 3E96A 1M5WA 3WK2A 2H6RA 1ZFJA 5LNRA 1Z41A 4OWGA 4K36A 4AH7A 3TJLA 1RV8A 1KFKA 3LCGA 4UTIA 4FX7A 4AWSA 3PAJA 4NZFA 5HR6A 1GG1A 1YTEA 1G69A 1KFCA 1FWTA 5CPNA 1F74A 1KM4A 1YPIA 4P61A 4DQWA 3O07A 3VE9A 3BPWA 2DU2A 2OT0A 3B05A 3PG8A 2E6FA 3THAA 3NQEA 3RF9A 2NUYA 4UFKA 3W2NA 2HMCA 2X1SA 4MOZA 2EF9A 4ALDA 3QMRA 1GTEA 3UZ5A 2V30A 3QFEA 4JY9A 2J9YA 1K7XA 3C6CA 1N7KA 5AHEA 4A21A 3EX4A 5LSMA 1CI1A 2P0OA 2ZA1A 1DOSA 3QM3A 5G1TA 5K2ZA 4TU1A 2Q8LA 3P81A 4IWWA 3LERA 2LLEA 4WOZA 5EKYA 3QPYA 4PTNA 3QSTA 2TSYA 1J2WA 2PURA 4XTDA 4WD0A 5HQEA 3CHVA 1QO2A 1F7BA 1X1ZA 2A2IA 3HO8A 1DQWA 3QYQA 1TRDA 3BG3A 3EX6A 3T78A 3W9ZA 4YL2A 2RKXA 4QIUA 3U6WA 1DHPA 1IIHA 2FDSA 1TV7A 3FKRA 4FIRA 4UFHA 1M7OA 2JGYA 1O4UA 5DELA 3NZRA 4NJKA 3W86A 5LGXA 1LOQA 1OYAA 2QCLA 3F4NA 4M7TA 4EOUA 1IIGA 5HWJA 3LHZA 2ATSA 2FPTA 3KVLA 1IGSA 3W7EA 2J9ZA 4N02A 3MYOA 4UFJA 1QR7A 3GDKA 3S5OA 1LRNA 4O11A 3KFTA 3NM1A 5DCBA 3LTSA 5AHLA 3RNDA 3TUUA 3V1PA 3ABRA 4FNPA 3G1FA 4Z1DA 3W2LA 3W83A 3QSRA 4Y8FA 3F1QA 5CZ0A 3LCIA 2Y7FA 1K8ZA 1ZALA 4RKAA 1QCWA 4NJIA 1WDWA 1NVMA 2FPVA 2I1OA 1AG1O 4O15A 1C8VA 3SZ8A 1PE1A 4GXMA 1X7FA 5CPOA 5BMWA 2ZRYA 3HG5A 1O60A 4EF9A 1F05A 1QWGA 4UTHA 4MYAA 1K3UA 3L5MA 3HG2A 3E12A 4MY9A 3B03A 4XQ6A 3RU6A 3QF0A 4BFAA 3SI9A 3GNDA 4CCCA 3QMTA 2ZRVA 2NUXA 3S5YA 1V7YA 3TFXA 1LROA 2TPSA 4RZ5A 1KM1A 4JTHA 1VJIA 1SQ7A 4O54A 2E6DA 3P67A 4NX0A 2YSWA 2FLIA 3L65A 4JEQA 1F2JA 2VC6A 3I7QA 3UD6A 2R14A 7TIMA 4DEFA 4EWND 4DF1A 3BGGA 1EWEA 2Q3RA 1P1XA 3TQKA 1KTBA 2E09A 4JDBA 3HQ1A 2NX9A 2ZRZA 2WPBA 2X1RA 1TQXA 1NFBA 5AHIA 3EXSA 4GWEA 3QW3A 4IX2A 4I7WA 1OF6A 3DFSA 4JTJA 4MZ1A 3OVPA 2GPTA 4DPPA 4D2JA 4YXGA 4JNMA 2A1YA 4HNNA 1WBJA 3PULA 2E5DA 5F4WA 1L9WA 3MI6A 3PM6A 1YDOA 5J5DA 3E02A 3CT7A 1SZEA 3RLVA 3B06A 4PL2A 5AC8A 4NUWA 2ZRUA 2CLKA 2ZBTA 1OG0A 1TTPA 4RV8A 5T26A 4N9CA 3T40A 2QUUA 1TB3A 2ZZ5A 2TRSA 3CTLA 1VCGA 3AJXA 5K9CA 1SPQA 3THQA 3QC3A 1XM3A 3NL5A 1MEIA 1W5MA 4ORMA 3E9AA 1GJPA 3L2IA 3FEMA 2ZTJA 1QPNA 2Q3OA 3TU9A 5D2TA 3W1QA 2Y89A 4FX8A 1TJPA 5K9XA 3W1PA 2WV8A 5DY2A 4O4VA 2ABBA 3G1SA 2KZHA 3CWNA 4MLJA 1W3IA 1ME9A 2VFEA 1TMHA 3GDRA 5I3FA 4IXXA 1ME7A 3M1ZA 3C2FA 1UJPA 2ISWA 4EVZA 5CGQA 4LUJA 1LBMA 5I3IA 1Y0EA 1H7WA 3QZEA 4UTWC 4GE8A 3BG9A 1TPWA 3NR0A 3QPZA 3TA6A 4UC5A 4O10A 3SW6A 1UASA 3LX9A 1A53A 4R53A 3QEZA 1O94A 1EPXA 4XKYA 5D32A 4FXRA 2RFGA 1T0OA 1XL9A 4NJGA 1BKSA 3EWBX 1QDSA 3EX3A 3HPSA 3W73A 2GQ9A 3STGA 1SFLA 3A9IA 1L6WA 2QCFA 1VLWA 4O1DA 4IMGA 1H1YA 3W22A 3MBFA 4LS0A 4AWTA 3GX9A 4IMFA 4MPQA 2ZA3A 3N9RA 1I2NA 3LV5A 3W7NA 3WJZA 3MP5A 2V5BA 1UUOA 5G4WA 1L6YA 4HPXA 1EX5A 1KM3A 1SR9A 3DXIA 5AYXA 1GPWA 3DU0A 3SY5A 4Z0JA 1OFQA 1A50A 3R2GA 2O7SA 4O0KA 3CPRA 3IVSA 4NNBA 2B7PA 2ZDRA 1FUYA 5LZLA 5DY3A 5HWNA 2CLOA 1C29A 3LB0A 4OQVA 4J9JA 3NQCA 5LHFA 1GYNA 1ZENA 3A22A 2BLEA 1DJNA 2Y7DA 4UTTA 1XBVA 3W1RA 3FOKA 1EUNA 1RD5A 3R5EA 3W7GA 1CX9A 5F4XA 4CCEA 4JTTA 3ZR4A 4M19A 2QJGA 3U2OA 5HR7A 2NX1A 1YTKA 3S6DA 2ATMA 4JTLA 3OVQA 2ISSA 3P61A 1W54A 4CNPA 1OYBA 2E68A 2QJHA 2DJXA 3UXAA 1ZCOA 2EKCA 2DZPA 2G97A 1I2OA 1XUUA 3RMJA 3W87A 3B0PA 3MI3A 5I3JA 4L4LA 2OMAA 1QO5A 4E38A 5C6MA 2H90A 4LU0A 1PV8A 3DBPA 2Y61A 1SZFA 3SFKA 3T7VA 3LRLA 3TDFA 4NVTA 1EUAA 3SR7A 2GVJA 2JBMA 4N4QA 3ZWTA 2ZRWA 4FEZA 4ZMGA 3PS7A 3P5ZA 5BNKA 3ATZA 1TV5A 3UYCA 2AGKA 3NQDA 3TXZA 2F84A 3O63A 3S5NA 1W1ZA 4O13A 5MHBA 1MO0A 4LVAA 1R2SA 1QPRA 5F1UA 2VEPA 1SW7A 4FNSA 5G4EA 2VFIA 2E6YA 1SO4A 4ZQRA 1TPFA 3S1WA 1SO3A 3HIJA 1TSIA 1SSGA 2FIQA 4MFDA 1VGAA 2VXNA 1KM0A 1EWDA 2HSAA 4FNQA 1UBSA 1PVNA 5HINA 4ADSA 4OU1A 3C61A 1PL9A 1D3HA 1H7NA 3GAYA 1WQ5A 4UR7A 2I14A 3IIZA 5DCDA 5D2XA 2FQIA 3P84A 1SZNA 3L9CA 4FNRA 3S42A 4XWUA 3S1UA 3K30A 3UXDA 4XZ9A 1W31A 2WSYA 2YZRA 4GBUA 4MY8A 1T99A 2AQWA 3Q58A 2PE4A 1GVQA 1GT8A 4JGDA 2YXGA 2GOUA 5AOUA 3PBYA 4FNTA 1L6SA 2EPHA 2ZZ3A 1M6JA 4DO4A 3P80A 4GUFA 4GUIA 4LV4A 3M41A 3VFLA 1M7PA 3L0GA 4JYFA 4O1CA 4R34A 4WX2A 2NV2A 1K7EA 2CZDA 3UWQA 3N34A 1TRIA 1H7PA 3PG9A 1F6PA 2NZLA 4WJEA 5I3KA 3P62A 5HJLA 4PA8A 1TO3A 5G5IA 4JN6A 3LTYA 1LLWA 3EWWA 2QCHA 1I2RA 1QMLA 1HG3A 5CSRA 1H7RA 2H3DA 3NL3A 1JRBA 3JR2A 5F2IA 4I7VA 1H5YA 4DF2A 2QAFA 1JRCA 3PUOA 4UR8A 3YPIA 3DENA 1Q45A 1OFOA 3M0ZA 1XDMA 3TR2A 4LY8A 4AHPA 3LOTA 5HUPA 5TBOA 3IIVA 5AN7A 1KFLA 1TJRA 4X2RA 1LZOA 4JR5A 4QAIA 5AC6A 3LI1A 2JKPA 3G24A 4JS3A 2GJNA 3L5LA 3TV8A 3G0SA 3NAVA 1RQHA 3LHUA 3NQ2A 5D37A 2DZWA 4DO5A 1AW5A 3UWYA 2RH9A 1NSJA 3M9YA 1BTMA 4PC8A 3FKKA 1RPXA 2C13A 3TSMA 4ZQOA 2QUTA 3VNDA 4C1LA 3IGUA 3GR8A 3LLFA 2B4GA 4AHOA 4A2RA 5L9FA 5F1VA 3TW7A 3W7HA 4IMCA 4LW7A 3C8FA 3EB2A 4HNVA 4A2SA 1VYSX 3TXVA 1YDNA 5D04C 2VELA 5DXXA 3EXRA 4AMAA 4O0ZA 4Y6GA 3L68A 3LXBA 3TMQA 2R8WA 3FYPA 1ADOA 5EPDA 4HSNA 1S5WA 3P5YA 3IRDA 1NEYA 3NL6A 4POCA 4LTSA 1U5JA 2W79A 5BOOA 3NPUA 2RHGA 4JTGA 4UMCA 2ZZ6A 2WO5A 4Y9AA 1YLVA 2Z1BA 3BK0A 3EKZA 1FWNA 2QR6A 3IV3A 3E0IA 4MY1A 3I7SA 4ZQCA 3PC0A 3W1NA 2A21A 3NQ8A 4FHAA 2Q8ZA 3R13A 3UNDA 3LHVA 1A5SA 3O06A 1KLZA 4BI6A 3TQVA 4FO4A 1JCLA 3GDMA 5FF7A 3M7WA 1HFBA 4NU7A 2FTPA 3OVRA 1Q6LA 5DCEA 4K8EA 1OX4B 3GVGA 3FA5A 3M5XA 3WJXA 3USBA 3NZ1A 4NX5A 1IXNA 1YXCA 5K3VA 4HSOA 4IGHA 2F7FA 4ZL1A 4IJBA 1Z44A 4K7VA 1XCFA 5H2ZA 3HGRA 4LOCA 2OZ0A 5FF2A 2AAMA 3QW4B 1K7FA 2GJLA 1FDYA 4UTWA 4AVFA 3M16A 4Z1BA 4ML9A 1B4EA 2PRMA 2X1TA 1LOLA 1Q6RA 1ZJIA 2PRLA 3GAKA 5AHMA 5FF4A 1GG0A 2NXIA 2Y6ZA 5D2YA 2GVGA 3W2MA 3H54A 1AK5A 4DELA 1G67A 4Y96A 1I45A 4ZZ9A 3WJWA 1IXPA 4KFNA 3B0UX 1LM1A 3HG3A 1KV5A 4XBKA 3OIXA 3V75A 4H6KA 2BX7A 1H7XA 4JTSA 5CSSA 5EMUA 3I68A 1U83A 4WQ6A 2YPIA 3S1VA 3O6CA 2QJIA 1KM2A 1KTCA 2ABAA 1KLYA 1QOPA 3NOEA 4A29A 1J5TA 1W37A 3WFAA 1K02A 2PRHA 3Q2DA 4DBEA 5KINA 2E1DA 2J9XA 2JGQA 2A7NA 1QPOA 1S5VA 4NJJA 1NF7A 1YDVA 3UPWA 4JTFA 3BLEA 1R46A 1FWWA 3FJ6A 3FIGA 1OFPA 1FWSA 2Z6IA 4QQ3A 3W1MA 1MEWA 1JQXA 2E77A 3WK3A 4PODA 4TMCA 3N2MA 3CEPA 5HNRA 1MXSA 1QOQA 4WXYA 1VCVA 5K4XA 3G1DA 3DKJA 3UY7A 4JIPA 3G1XA 1THFD 4CNNA 2IQTA 1VHNA 1JCMP 2GVLA 1LP6A 3TIMA 3W7IA 5FF0A 2R94A 3PUDA 2VFFA 1EIXA 4LVDA 1ONRA 1R47A 2ZZ7A 2BZNA 5EYWA 2DZUA 4AF0A 8TIMA 5EL1A 1B3OA 2WNNA 2A4AA 3S1XA 3W07A 3W7JA 1BWLA 1OFEA 3W70A 3LXAA 3STCA 1ICQA 2G96A 3M5ZA 4Z1AA 3IVTA 4JIQA 1G4EA 1LRTA 2Z0IA 2ZA2A 1YTDA 4H4IA 2ZZ4A 4BWLC 4LRSA 4K37A 3JS3A 3NDOA 4RXGA 3Q37A 2OJPA 4H3DA 5HULA 2Y7GA 3BVJA 1FDJA 2DZXA 4IPJA 3S5ZA 1FCUA 4I9AA 2CZEA 1OJXA 4N9BA 4RXFA 4DPQA 3ABQA 1FXQA 3C0JA 3HGJA 1O95A 3PB0A 4JXCA 4WXZA 3TAOA 2TMDA 4FB7A 1PCKA 2QF7A 3G22A 4NQ1A 2ZCGA 4UNLA 3STEA 2WSRA 1GVOA 2C0AA 4MZ8A 4BF9A 5G2IA 3L67A 5D05A 4OBTA 3W7MA 6ALDA 2V2CA 4O1AA 5BRBA 1F6KA 2FPYA 2FFCA 3BW2A 2OCZA 3GKFA 5CPMA 1VC4A 3PSWA 2E5CA 1HO4A 3C2OA 4EIVA 5AHFA 4AHQA 2CW6A 3KVMA 4Z1CA 1TV8A 4IOTA 1LBFA 4O28A 4Z0SA 1AMKA 1QFEA 4CLMA 3LHWA 1OF8A 2VEIA 4NXSA 2W0UA 2B0MA 4LUIA 2Y62A 4QISA 4YMZA 4QITA 4K8HA 4M6PA 4IXHA 2BXVA 3W7QA 2I9EA 2ZYFA 1KTNA 1JQVA 5D33A 5DN1A 3TQ0A 4Y90A 1OHLA 4ORIA 4O57A 1TPC1 1R2RA 3DHDA 3NQ6A 4PCFA 2EHHA 4OGZA 3OG3A 2CLHA 2NWSA 3OA3A 4HNUA 2ZQ0A 4IUOA 5KZEA 2V2DA 4FXSA 3S0CA 1HL2A 3EKLA 3NPVA 5EY5A 3EEGA 3MWAA 2WKJA 5K9DA 1GWJA 1XBXA 3ZWSA 3A5VA 1EA0A 4YLWA 3FFSA 3NPXA 1FX6A 3VCRA 1SU5A 3GDLA 3BLFA 2CU0A 4GFSA 4HIBA 4JX6A 1VQTA 2CLMA 2X30A 4UTKA 3R12A 1H1ZA 3BARA 4R7JA 3TC7A 4MFEA 3PY2A 4M6QA 4O8RA 1FDZA 2EAWA 1LYXA 4S1FA 3P74A 1G4SA 3G3DA 5IBXA 3L0NA 1UCWA 4UXDA 4O53A 5D03A 4CQ8A 1CW2A 4NNAA 5FEZA 1WA3A 4IMDA 2V81A 3DFTA 1QNVA 4GNJA 3NQFA 1GZGA 1YXYA 3EX2A 1GQNA 1OFDA 5AYZA 3TMLA 4AAJA 3JRKA 2X16A 3HPZA 3ANYA 3SIZA 3C52A 3VE7A 4YCPA 4HNTA 5GVJA 2C18A 3IEBA 4N4PA 1W5PA 5BMXA 1ICPA 3EWUA 3RFAA 4DO6A 3W72A 3QJAA 3LCHA 1WBHA 1OX4A 2H8ZA 1TIMA 3LDVA 4E2DA 4Z08A 2A6LA 3OBKA 5F2LA 2J6XA 3TSDA 3L66A 1TPVA 3W1AA 3EWYA 5AB3A 1KM6A 2C15A 3TCEA 1VYRA 5HWMA 1TQJA 3HGSA 3A21A 1GTHA 1EEPA 3OEXA 4X22A 3RK8A 2VKZG 4KWWA 4NNCA 3N19B 1TTQA 4AF0B 3LCXA 4O12A 4X9SA 1AW2A 1TPEA 2JKAA 1FXPA 3GLCA 1WV2A 3L21A 4JTEA 2WJZA 3PR2A 1YPFA 3KHJA 2HTMA 2QDGA 3PF3A 4ZVJA 2D73A 4UUIA 2J88A 1YYAA 3QMSA 4B5NA 4JDYA 2C3ZA 3L0KA 1KA9F 1OFAA 3IIOA 5D2VA 3W2JA 3GXNA 2UV8G 4O4WA 5CZSA 4BI7A 5TIMA 4S2BA 3W3OA 4OHQA 3A5FA 1PHQA 3NNTA 3TK7A 3CIXA 4MLRA 4GRSA 1JR1A 3KVJA 1N8FA 2YFOA 6TIMA 3UQNA 4P2VA 3G1VA 4M6VA 3DFQA 2DJLA 4NT0A 3PUEA 1XBYA 3GZ3A 1ZAIA 3MBDA 5ABTA 5K7JA 1X8FA 3NQVA 1XC4A 4QNWA 1WXJA 2RDUA 1G7VA 5C54A 1B57A 3LV6A 2XN1A 4O19A 4TR9A 1WX0A 4RZ6A 1H62A 5E93A 4OV4A 3SGUA 2NV1A 4AEOA 2BSLA 5D09A 5FEPA 1G4PA 1AL8A 2W6RA 2CLIA 3GK0A 3UY8A 3ELFA 4JTUA 1KBIA 4N9EA 1WOBA 5LKYA 3B04A 2QCMA 1GEQA 4LVBA 3I6RA 3DFNA 4MJZA 2ALDA 1LRQA 2DZTA 3LBMA 4HHPA 2XN2A 2A6NA 3R8RA 1W5NA 3CU2A 3IGXA 3MHFA 3MP3A 2QDHA 3W7KA 4RR4A 1NAL1 2TYSA 2J27A 1H51A 4RCXA 4JICA 1J4EA 4Q4KA 3D0CA 2BWGA 1JCJA 4HKPA 4DF0A 4O1BA 3KRZA 3LHTA 4LC8A 3TNOA 5IBXC 2NUWA 1I8JA 4JYEA 3R89A 4CQAA 5IM51 3S9YA 3P8IA 3LBCA 5EBUA 3N2XA 1RQEA 1R2TA 3G1AA 3GXTA 3NA8A 3MUXA 2Y88A 1JJKA 3TE9A 2OT1A 1TPUA 3I65A 2H8XA 4ICNA 4DXVA 4UFMA 3UWZA 1VPXA 1H63A 4G1KA 5DXYA 5F2GA 4IX0A 4BI5A 2YYTA 3MHGA 1W3NA 3T44A 3TW6A 2QCEA 1B9BA 2NWRA 2QCNA 5AHNA 1FWRA 1VHCA 3G1YA 3O15A 2NXGA 4O16A 4TIMA 2RDWA 2DP3A 3W2UA 1ZHAA 2YR1A 1KW1A 1FY6A 2A85A 3TAKA 3G1HA 4PEKA 4JTKA 2G95A 5I3HA 1PIIA 4OV9A 3M5YA 1H61A 3INPA 4GUHA 3O05A 1LTDA 4MIMA 1LBLA 1OK6A 4IQLA 4UMAA 3S8HA 3NQ7A 4BWLA 3LCLA 4MJMA 3DZ1A 1MEHA 3O1NA 1HO1A 4JD4A 3G18A 3BGJA 2DZVA 1DQXA 3GR7A 2ZRXA 3C56A 2YW4A 1Q3NA 4E2BA 1GYLA 1P4CA 4HPJA 3UWVA 1TYGA 5FEXA 1OABA 3B8DA 5U7SA 4K38A 2YGYA 5KZDA 3W7RA 3TFCA 1K8XA 4XBSA 2O7QA 3W1UA 4ONVA 4O52A 3CM4A 1GOXA 3DH7A 4TO8A 2C19A 3DAQA 3W7PA 4MKNA 3P60A 4YCOA 1H60A 1HTIA 2VEMA 2CZ5A 2C16A 1OYCA 4WY0B 4MUZA 1ZAJA 3NO5A 5AC7A 5G2WA 1EB3A 4W9TA 4KFPA 2E5BA 2YYUA 3RLUA 1PS9A 1KM5A 3N14A 2Y70A 2P10A 5E0KA 1SZGA 5D2WA 1JCYA 1JUEA 5CZTA 3TX9A 2DORA 2J24A 3L5AA 4K6AA 5CPLA 2V0TA 1EP3A 4FIQA 2C1HA 2EGZA 4FNUA 5C5YA 1DVJA 4UNKA 3SJ3A 3BLIA 1GVFA 3ZS4A 4M5PA 4N6EA 1L2UA 3A23A 3N73A 4O18A 5FI8A 3GB6A 4PH6A 3WK1A 1EP2A 1P0KA 3CQ0A 1TPB1 1YXDA 4LS2A 2NLIA 2VENA 4BK9A 4M7SA 1S3HA 1W5OA 2RDTA 3LRMA 4LV9A 1I4NA 3W7CA 3N3MA 3PBUA 1OX6A 3KRUA 4RZ4A 2C6QA 4HT3A 3W84A 2NX3A 1SFJA 1T96A 5BW6A 5LNVA 2FB3A 1OX5A 1VH7A 4WY0F 1SW3A 5F2MA 1IXQA 5D38A 1SO6A 3DFPA 5A8GA 2YW3A 2CLLA 3MO7A 1ME8A 4ZQNA 3NM3A 1AL7A 1UB3A 1YADA 1XUZA 2VFGA 3UWWA 5D02A 4U28A 1SW0A 5CKSA 1FQ0A 3NXFA 1LCOA 1T8XA 1WAUA 2VOMA 4QSHA 5HMSA 1E51A 3CWOX 3SGZA 2QCGA 3PBVA 4UCGA 4MZYA 5EA9A 3WJSA 1DJQA 5LHEA 4OT7A 3LCWA 3N9SA 3DI1A 2QCDA 1OFBA 3CIWA 3H55A 2V8ZA 1IF2A 3M6YA 4LRTA 1XXXA 2X1UA 2WQPA 2Y7EA 4WUIA 4L4MA 3W7OA 5SWUA 3W76A 1G6CA 1SSDA 2HS8A 5L6UA 1XBZA 1F73A 2C14A 1W3TA 1ZY9A 1IXOA 1G7UA 3HOJA 3IGSA 1LORA 3NYZA 3HMJG 1UUMA 1FBAA 3W1TA 3W2KA 1XI3A 3HB9A 4LVGA 4HN4A 3KVKA 2WNQA 3GIYA 2QAPA 2YCEA 4GUGA 3QQ0A 3TSBA 3W71A 4LC6A 3W88A 1H50A 3LTPA 3HF3A 4E0CA 4QNEA 3H53A 1MSSA 2HS6A 4TMBA 4R33A 4JTIA 1W56A 3A24A 3MHUA 3M44A 3O8AA 3WJYA 1BWKA 3AO0A 3NPWA 4AXKA 1XFBA 4PFMA 3W74A 3C2VA 2A7PA 5DBTA 4GUJA 3PVFA 2JKEA 4IPIA 2YDAA 3MMTA 2ISVA 3KRSA 3G0XA 4IMEA 1EP1A 1DBTA 2Z6JA 2V2HA 3STFA 2WSQA 3FYOA 1SUXA 3E49A 3G0UA 1QPQA 4CNOA 3LHYA 4FF7A 2ZZ2A 1RQBA 3MJYA 5FF3A 3U8GA 3HGOA 4JX5A 1N55A 1TTIA 1RVGA 1TPDA 3NL2A 2CLEA 1P5BA 2Y85A 4QM1A 3NQMA 3FJLA 1JVNA 2GQ8A 2ZFAA 4KWVA 3O16A 1TCDA 3LRKA 5E1QA 3P8JA 1DORA 1KV8A 1VCFA 3ATYA 4BR1A 3IIXA 4NXKA 2VFDA 1Q6OA 3LGEA 1W0MA 5KITA 4XTIA 1QAPA 3TROA 1MZHA 4XUGA 1BEUA 3EWZA 3PBWA 3VKJA 3HBLA 3UPBA 3SSJA 1I2PA 5DLCA 1WOAA 3PWAA 3TH6A 3G8RA 4K39A 4X3ZA 1D9EA 4GC4A 3WK0A 3GXPA 1JCXA 3ZFHA 1RZMA 5F4SA 2OX1A 1F76A 5KSWA 3NVTA 4Q33A 3DFOA 4OE7A 1JUBA 3CB8A 1VR6A 3M43A 3F4WA 4RX0A 1O5XA 4JX4A 4UIOA 4N9DA 4NZJA 3KAOA 4KFOA 4RLIA 3G8EA 2E6AA 1ML1A 1VS1A 2A7RA 5D30A 4O50A 1JULA 4Q32A 3M5VA 3P82A 1ICSA 5J5RA 1XKYA 4K7YA 5LNWA 5KMYA 3FLUA 2NXHA 1RR2A 5K4ZA 3QRHA 4WOQA 1VLIA 2JK2A 2PCQA 4LS1A 2CWNA 3DI0A 4JYDA 3F03K 4LVFA 3T55A 5G1YA 1B4KA 3LM7A 5KTLA 1VZWA 1D3GA 3B0VC 3GNNA 1K8YA 1LDCA 3C4UA 5CZJA 1F5ZA 4LNYA 1W5QA 4AWUA 3BG5A 2CLFA 3LXCA 2Y63A 4ZQPA 2DZSA 4UTMA 2X2GA 4UTUA 3GDTA 3OHIA 3SECA 3BW3A 3QQ1A 3W7DA 1OVDA 3NQGA 5LNSA 3KX6A 3MW7A 1V5XA 3LCFA 2V5LA 3KXQA 5LGZA 3ABSA 2R91A 4UTJA 1NF0A 4TX9A 4EF8A 3EXTA 4DBDA 2B7OA 4S2CA 3HJZA 2BTMA 3W1LA 1GVRA 1JCNA 5C55A 4WY0A 4CQ9A 3W85A 4A22A 1FCVA 2CFFA 5FEWA 4NJHA 1ZNNA 1H7OA 2QCDB 1C9DA 5CG7A 3DKLA 1TTJA 4U4MA 1X6UA 5LNUA 1W8SA 3NGJA 1DL3A 3EWXA 3GKAA 4UTLA 3IIPA 1PHWA 4N2YA 5AYYA 5HUOA 2QEZA 2ZZ1A 3DHFA 3UZJA 5I3GA 5KZMA 5C2XA 1GVSA 4RK8A 4JY8A 2VFHA 4I7UA 4LT9A 1I2QA 2QCCA 3P7YA 4ADTA 1TREA 3UWUA 1AW1A 3QH2A 3Q94A 1S5TA 5FESA 1Q6QA 3MYPA 4LWWA 4UFIA 4KKXA 1KFJA 3TJXA 3NEVA 1ALDA 2P1FA 2FJKA 4PL1A 4A3UA 4RJEA 4FX6M 1WYIA 3B4UA 1O5KA 1VRDA 3MP4A 5H91A 1A5AA 2ZTKA 2WOQA 1OK4A 1HUVA 3NG3A 2B7NA 2Z2UA 5DBUA 1A5BA 3C2EA 4WZHA 2V82A 3W23A 4C1KA 3C3NA 1KFBA 1KFEA 4QJ1A 1DV7A 2VEKA 3W6YA 2FB2A 2PC4A 5U4NA 3ABOA 1Z48A 3LI0A 3W1XA 3HPXA 3G3MA 1JUKA 1R30A 4O17A 1P0NA 2XN0A 5A5WA 3BW4A 4MVAA 3CLMA 3I7RA 2H3BA 3O6DA 4O14A 4AB4A 3FS2A 3M47A 3W7LA 4UMBA 5AFDA 4CCDA 3W75A 2A5HA 3NQAA 5G2HA 2G5WA 2XFWA 3CEUA 1SO5A 3BO9A 1ZAHA 3IVUA 4N6FA 4UFLA 3CC1A 3MI2A 4ZQMA 5TQLA 3KOFA 1FCQA 2A0NA 3TKFA 3PSVA 4MYXA 3HG4A 1X1OA 3TC6A 2B7QA 3BV4A 1PCWA 2QUVA 1G4TA 2QKFA 3PB2A 3O6YX 2GUUA 3LLDA 1A5CA 1KBJA 4XKYB 2WNZA 1Z42A
chains in the Genus database with same CATH superfamily
2ZUVA 1HJWA 3GQYA 1FKWA 2V9DA 3DGRA 1YE4A 3GY1A 4LB4A 2Z4GA 4H41A 1HZYA 1DKWA 1LLZA 4L9XA 5C7VA 1E9YB 3QKZA 3SRDA 3E96A 2NSXA 5LNRA 1XIEA 3VD7A 2FJUB 5I24A 4UTIA 3CAKA 3OYXA 3R1ZA 1XS2A 2FDMA 2REQB 4H1ZA 3B97A 2XIJA 3CZEA 2F6UA 1ESWA 1F74A 1YPIA 3T2QA 3F2CA 1WXZA 3O07A 4GYKA 3VE9A 3BE7A 3GHTA 1C8YA 1G01A 1JDDA 3THAA 3RF9A 1UZHA 2WZMA 3T2PA 3UXIA 4MOZA 2EF9A 4DBWA 4UQBA 1BTCA 4LJ3A 1K7XA 4PTMA 2VNCA 4A21A 3S47A 8RUCA 2UZ9A 1CI1A 2P0OA 2ZA1A 1C90A 3QM3A 4TU1A 3H2MA 4IWWA 1Y65A 3E5PA 5DANA 3R79A 4Z42C 4U2YA 2PURA 4HYWA 4XTDA 4DUWA 2BY0A 2E9BA 5HQEA 2YL9A 1F7BA 2A2IA 4KGLA 3QYQA 4H9UA 3T78A 3W9ZA 2RKXA 1IIHA 3FKRA 2Q09A 2XG9A 1E70M 2QCLA 4M7TA 1IIGA 2ZDSA 2ATSA 2FPTA 1F07A 4UOQA 2J9ZA 2WJEA 3ARRA 4O11A 4K1WA 4GYPA 1XLGA 2XZ7A 4WVXA 1TUXA 3OJGA 5DCBA 4B3ZA 3TUUA 3NQBA 3HA1A 4FNPA 3G1FA 3W2LA 5E0FA 1E6ZA 2D0GA 3UW6A 3CQJA 4IHCA 4IPNB 2Y7FA 1RVKA 1ZALA 4RKAA 4E2OA 3AIWA 4S3DA 4NJIA 3KP1A 4JIRA 1RA0A 2FPVA 4DM2A 3LY0A 1AG1O 2DW6A 4NIRA 1IT0A 3WQVA 1VRXA 1XIIA 2OYLA 4GXMA 2V69A 3B8IA 2WWCA 1QWGA 4UTHA 4GISA 3T0DA 1V77A 3L4YA 1QRQA 1BHGA 3S5YA 1V7YA 4YIWA 3ZXWA 5C9XA 3TZFA 5GPRA 1VJIA 3CMGA 4NX0A 1P0EA 2I7GA 4ZB0A 2GJPA 4KEZA 1OC5A 4FOKA 4XD3A 4IFOA 1F6YA 2Z28A 1GOKA 2VURA 1UWAA 3PZOA 1EC8A 2Y8KA 1TQXA 1WXYA 1D8CA 1NFBA 3EMCA 4DIAA 3EXSA 4GWEA 3LSBA 2OTDA 1O12A 3KL5A 4D2JA 4W93A 4TOQA 3FDGA 4L61A 1IE7C 1GQIA 1WBJA 4TVDA 1YNPA 2E5DA 1REQA 1TR9A 3PBGA 4E8GA 1U22A 4H9ZA 3CT7A 1NDYA 1SZEA 5GJPA 3RLVA 3B06A 1VBUA 4J35A 4PL2A 4NUWA 2ZRUA 1T5AA 4D6IA 4H8HA 1OG0A 4RV8A 3VO0A 1HKMA 2ZZ5A 3WBXA 2X09A 3AJXA 4DYKA 2ZWYA 1XIHA 3QC3A 4EXBA 3ARVA 1GJPA 3FEMA 4AD4A 1QPNA 1VFFA 2P0IA 4H9TA 4IT1A 1OSEA 3W26A 2XINA 4Q8VA 4PCPA 2FMNA 2Z1SA 1S2AA 2HISA 4JOMA 3GDRA 4XD6A 1TMHA 2IPFA 4EVZA 4FK9A 2NQ9A 2V3EA 4LUJA 4I6VA 1OINA 3C2YA 3QZEA 1TPWA 3ARZA 3NR0A 1CT5A 4UC5A 4O10A 1WO2A 3IRSA 4H83A 3UETA 1W9XA 5DQPA 1A53A 3AMDA 1O94A 1EPXA 3L4VA 4FXRA 2RFGA 2XFYA 2PWUA 1BKSA 1QDSA 2PDWA 3P0XA 3HPSA 3BC9A 1WCGA 1KKOA 3P0WA 3A9IA 1L6WA 1UR9A 4DJFC 3CUIA 3W22A 3MBFA 3SQLA 3HN3A 4AWTA 3GX9A 4UNIA 3EBVA 1HJVA 1I2NA 3LV5A 3W7NA 2DVTA 3ITGA 1UUOA 3F4DA 3N1AA 2NQZA 4J3UA 5AYXA 3DU0A 3SY5A 4Z0JA 1OFQA 4JKKA 4ZTYA 4W5UA 4NNBA 2B7PA 1IWBA 4HD5A 3JVAA 5JH1A 1C29A 3LB0A 1Z6KA 2PD9A 4KF1A 4OQVA 4Q4RA 3VOJA 2JF6A 3KRBA 4ZO9A 2ZE0A 1J0HA 4UTTA 3FSUA 4XAZA 3W1RA 5A1AA 4NYYA 4CCEA 3U2EA 2MUCA 4AX7A 4IQJA 3OVQA 1R9ZA 1OYBA 5E6ZA 3L4XA 5CQ1A 2DZPA 4LALA 1MQPA 1CIUA 4K2SA 4ZO7A 5JMUA 2G97A 3WLOA 3XISA 3RMJA 3MTWA 5I3JA 3UVIA 3KCLA 4E38A 3DBPA 4DY1A 3A4AA 4QJ3B 1EUAA 3SR7A 2GVJA 2ISFA 2JBMA 4N4QA 2XSAA 1X8CA 3PS7A 5BNKA 3OQEA 3UYCA 3O63A 2VI0A 4ZR8A 2I56A 3GVRA 4US5A 1KBLA 4O13A 4D1IA 3IGHX 5F1UA 4PMZA 2H9AA 2VEPA 1Q4NX 2OGYA 3PPCA 5DMMA 2E6YA 2WJDA 4ZQRA 1OG6A 5AVHA 5DMYA 2TODA 4E8CA 1J0IA 3S1WA 1TELA 5D9MA 1TSIA 1OGSA 3ZJ7A 2EG8A 5AVNA 3WMCA 3TLLA 3AALA 3VNKA 3S1GA 2HSAA 1EFZA 3WMSA 4ADSA 2YL6A 2BGNE 4LUSB 2CIPA 1WQ5A 4UR7A 1GPFA 3LMYA 1RJRA 1SZNA 3L9CA 3S42A 1PIGA 3K30A 4LEFA 1W31A 2PUZA 1GVQA 4IQEA 1R85A 4V15A 1GT8A 1XICA 4GVFA 3RN6A 1RA5A 4V1XA 1M6JA 4DO4A 4HOXA 3P80A 4GUIA 1JAKA 3VFLA 4H9MA 1G1YA 4UB9A 1K7EA 2CZDA 1TRIA 3PG9A 1F6PA 2ACRA 2VYOA 2DSKA 3P62A 4PA8A 5JXQA 3IJ8A 4M1RA 1ITCA 3ENLA 3OB8A 1HG3A 1JD9A 2H3DA 3NL3A 1H5YA 4X0VA 2BVDA 4RNFA 3YPIA 1Q45A 4NHVA 3CUXA 1Q5MA 5REQA 3M0ZA 4Y8EA 2X1IA 1E3XA 3IIVA 1KFLA 2WVUA 4X2RA 1WDSA 2DIEA 2J7CA 2YB4A 3BAYA 2GJNA 1P0DA 3TV8A 3T0AA 3NQ2A 4RL3A 4S3JA 2DZWA 5FJOA 4DI9A 3QKEA 2PTZA 2Y5EA 4XUYA 3KCOA 2QUTA 4C1LA 3GR8A 2B4GA 1O5RA 4A2RA 4H8UA 5F1VA 1TZ7A 3TW7A 3W7HA 1FWCC 4IMCA 4I5UA 3DFHA 3SN0A 3BSHA 4AZGA 2VELA 5DXXA 3EXRA 3FGCB 1V51A 4QE4A 3SCUA 2E7FA 1UR4A 2OLSA 1Q2SA 3MSDA 2R8WA 2XU2A 4HSNA 3P5YA 2EJAA 1V6VA 1H5VA 3FY1A 3NL6A 4GI8A 4LTSA 3NZGA 3GSMA 3NPUA 2POTA 2ZZ6A 2WO5A 2GGHA 4XZBA 3TJIA 2ZUNA 4FALA 4OECA 3EKZA 5A2CA 1WUEA 4B4HA 2QR6A 3QY6A 4IG2B 1UD4A 3W1NA 1XLIA 4ZE5A 1E4NA 1JF5A 2OSXA 3LHVA 4PCTA 4BI6A 3EOEA 1IEXA 3CHFA 1XYFA 1BLIA 4NU7A 1XPYA 2QGYA 3QGKC 4K8EA 4IL0A 3KOXA 1GEHA 1K4HA 3FA5A 4NX5A 2WPGA 3N2CA 1YBQB 4HSOA 1S2TA 4IJBA 2GYIA 1Z44A 3AI0A 1MDLA 2DQWA 3ZZ1A 3TTOA 1EJXC 4LOCA 1QOXA 4UQDA 3I4EA 3BOLA 3KS6A 3M16A 1GUVA 3WLHA 2R1LA 4FOJA 5I09A 4YVXA 3GAKA 1UQZA 4GI9A 5FF4A 5GNZA 2Y6ZA 3CYJA 2ZVRA 3K4WA 2PTWA 3H54A 4BQ3A 1G67A 1I45A 3WJWA 4JIEA 3LQGA 1LM1A 3BURA 2C1IA 1QPKA 2BX7A 2ZX5A 4B2DA 2C91A 5A3HA 4H6RA 2QUNA 4ACZB 3S1VA 5LIXX 1KM2A 1KTCA 2ABAA 4N42A 2G3NA 4MGGA 1KLYA 3VKKA 1XV8A 1CXHA 2E1DA 1YEYA 4LCSA 2A7NA 5EFFA 1QPOA 3OPSA 4R27A 1NF7A 1YDVA 1X39A 1ZJBA 1EQCA 5RUBA 1IZCA 4QQ3A 3W1MA 1DJGA 4LYPA 3WBAA 4PODA 1XR2A 4LH8A 2R6OA 2VT0A 1MXSA 4M80A 4WXYA 4DNHA 5DMNA 1VJZA 3G1DA 2Y8VA 3E2QA 4JIPA 1QVBA 2YDQA 1ZJAA 2IQTA 1K77A 2GVLA 5A2AA 1KCZA 1LP6A 2ZE3A 5CBBA 4JL1A 1EIXA 4LVDA 1ONRA 1Q6GA 2ZZ7A 5EYWA 4H01A 1B3OA 3WLRA 1N8WA 3DGBA 1OB0A 2YBVA 3STCA 1BQGA 1ICQA 3IAQA 2W9MA 3QV8A 1AUSL 1G4EA 4JIQA 2W92A 4H4IA 4O1EA 3NDOA 4RXGA 5CSYA 3NO1A 2Y7GA 3NIYA 2PGEA 4IPJA 3S5ZA 1FCUA 4I9AA 2HDJA 3SCPA 4DPQA 4MKVA 5FJIA 1MW2A 3RLHA 3HGJA 3VUSA 3G77A 3AZSA 4JTDA 2QF7A 2ZCGA 3WQ5A 2WSRA 4C6JA 3E38A 4WSHA 3WF1A 1XP3A 6ALDA 2V2CA 4O1AA 1I9CB 4Q6JA 3GKFA 1AH3A 2OELA 1VC4A 4EIVA 4FI4A 2PTDA 4JFWA 3N29A 3KVMA 1XD1A 2BHYA 3EOLA 4DUVA 1F8IA 1A5MC 3ARQA 3V0TA 3LHWA 2J8FA 2VC7A 2W0UA 2QPSA 3IANA 1US2A 4LUIA 4LUTB 1JNEA 1L6FA 4F40A 1W1A1 2BXVA 4DZAA 1BF6A 2EJ1A 2I9EA 4HPGA 1KTNA 5DN1A 2HRWA 4C91A 3UA3A 4QQUA 3DHDA 1IHIA 1I75A 3NQ6A 2HPMA 2EHHA 3J7HA 4JN7A 4OGZA 3S3GA 2CLHA 3OA3A 4HTYA 4HNUA 4LEQA 2V2DA 4JL2A 1LUCA 2X0SA 1U2YA 2WSKA 4AIUA 4GI4A 2OR2A 4RNJA 1T8QA 1UP3A 2INZA 2O9PA 2WCSA 4D8AA 3OLGA 1FFRA 3FFSA 5ABFA 1FX6A 4XIAA 1SU5A 3BLFA 4JAWA 2CU0A 3D3FA 4MWAD 4JX6A 1UWUA 2X30A 5M5DA 4O8RA 5FJRA 3LS9A 1FDZA 4JFVA 2DSVA 3F7JA 2Z1XA 3ERPA 2EPMX 4XD5A 2CITA 1G4SA 3NDYA 3VX1A 3L0NA 4UQEA 1BVNP 4AC1X 7PTDA 4UOJA 3AIVA 3EX2A 1XQLA 1GQNA 3TMLA 4FXFA 4AAJA 3ANYA 4G7EB 4YCPA 3KBMA 3AAMA 2C18A 5GVJA 3FNDA 1ZL1A 4MF4A 4N4PA 5FAJA 4J3TA 3W72A 3QJAA 1OX4A 2J6VA 3WH9A 4M56A 1JYXA 4H04A 1DEDA 2QUMA 1VAHA 2GGGA 4YJ5A 1ISWA 1FOBA 1DP0A 1ONEA 1XF0A 3KWSA 2DT0A 2R1KA 3OEXA 4R7WA 4DXXA 1DWGM 3RYSA 1M65A 5IHSA 1PKMA 2WLZA 1TPEA 2ANUA 2C1GA 1WV2A 5BZAA 1YKWA 2OG9A 3LM3A 4HJWA 5B7ZA 1OGGA 3KHJA 1UD2A 3PF3A 3CZ8A 4Q7NA 3KW3A 4UUIA 4DO7A 1YYAA 3QMSA 5T91A 1KA9F 2UV8G 5HDRA 3BMVA 3W82A 2OODA 4P7OA 3CIXA 2J25A 4PULA 3N13A 1V6YA 4QGCA 5FSDC 2G3IA 1RJPA 1XLCA 2A3HA 3GZ3A 1UD6A 5M2FX 3UJSA 4HHMA 1X8FA 4KEVA 3NQVA 2J62A 1XC4A 4AD2A 1OT1A 1B57A 1WX0A 4AEOA 5FEPA 2W6RA 3BOFA 5FL0A 1A5LC 3BL3A 3KDOA 3TTYA 3WG6A 1KGUA 4N9EA 2E9MA 2NQJA 3B04A 2BNJA 4Z2KA 1IR2A 3WLMA 3E5BA 1W1PA 2WVSA 4NAEB 4LYRA 8A3HA 1XSKA 2HEJA 2HZGA 4GO8A 4KEUA 2TYSA 3RPDA 1RCQA 1L0PA 4JICA 4DF0A 3TNOA 1OD0A 4J3XA 5TNVA 5DT5A 3S9YA 5EBUA 1RQEA 2OQYA 1R2TA 3CUGA 3GXTA 3NA8A 3MUXA 4GVIA 3PAOA 3PZVA 3TE9A 4YTQA 4MAZA 1C91A 3SCNA 3VFCA 1ECEA 5BXSA 2ZX8A 4ZCWA 1PYMA 2CHNA 4G1KA 5DXYA 4BI5A 4CD4A 1AD1A 4CQBA 3S2CA 4MB1A 2NWRA 3S5SA 1V6TA 6ENLA 2HE5A 3PANA 1FWRA 2HXUA 3G1YA 2NXGA 2X8RA 1QWKA 4O16A 1HKVA 2WMJA 1C7SA 4MAVA 1I6NA 2BVYA 2A85A 3RM9A 3OQ8A 1QASA 4PEKA 4WJXA 4I8DA 4Q8OA 2G95A 2CHRA 3INPA 3O05A 3L7RA 1LTDA 4UMAA 3S8HA 3R0UA 4JQ1A 2VJXA 3SJNA 4BWLA 3BAKA 3THCA 4MJMA 2CKSA 1XIDA 1HO1A 3GW3A 4JD4A 2OQHA 3EA3A 1DQXA 4QX4A 2XIBA 2VO5A 1QI5A 4GINA 4HPJA 1MFUA 5FEXA 3B8DA 2YGYA 3W0KA 3BV7A 2X2YA 1VFHA 2O7QA 2Z26A 2PTXA 4ONVA 3M64A 4RNHA 2Q71A 3DH7A 2JFEX 3DAQA 1XH2A 3AHZA 4MKNA 1K8CA 3BLPX 1IEWA 4PMOA 2CZ5A 3S2JA 3V1HA 3AROA 4CQDA 2C16A 4WY0B 4MUZA 3NO5A 1HKIA 1EB3A 4W9TA 2E5BA 3AZRA 3N14A 2P10A 3PZMA 3QVQA 3RO6A 1MNZA 1M7XA 1JCYA 3GXDA 1CGXA 1E40A 5HPOA 3L5AA 5CPLA 2D1ZA 1E4IA 2D2JA 3SJ3A 3BLIA 4WKHA 1FH7A 3ZS4A 4M5PA 2PP3A 2EBNA 3U5UA 3WK1A 1K1DA 1CENA 3TONA 3UJ2A 1X6NA 3TN3A 1DXIA 1VFUA 2RDTA 4HBKA 3W7CA 2A3BA 1XFCA 1VP5A 3OZPA 1AFSA 4RZ4A 3S46A 4HT3A 4PUKA 5LNVA 2FB3A 1ECQA 1OX5A 1VH7A 2DGAA 4WY0F 1JZ6A 2XJ7A 1SW3A 1LLOA 5D38A 3KBJA 2EG7A 3DFPA 3VMNA 5LIKX 3MO7A 2ZX6A 1DWHM 2IS7A 3WKZA 4GO9A 5D02A 1SW0A 5CKSA 1FQ0A 4DN1A 5HMSA 1O66A 1JYNA 2FHCA 3SGZA 2QCGA 4UCGA 3W37A 2P8CA 4F3HA 4R9OA 4GY0A 1E9ZB 4OVXA 5KETA 6CGTA 4OT7A 4YVPA 3DI1A 2AGTA 1OFBA 1EXBA 1XXXA 1QUMA 2WHLA 2OZTA 1BG9A 4MDOA 1F73A 1PB0A 3UCQA 1UUMA 1D7FA 1FBAA 1RJQA 3BJSA 4QG8A 4QLLA 1O68A 1PJ9A 2YCEA 4GUGA 3QQ0A 4LAZA 3T8QA 3H2EA 1EGZA 4Y7EA 4OBSA 3HF3A 2C79A 3LPPA 2HS6A 4TMBA 4M29A 1W56A 3A24A 3MHUA 4HOWA 5I23A 3TLQA 4L80A 3WJYA 3MJMA 3WLJA 4AXKA 3W74A 3WNMA 2GK1A 3FN9A 5G1MA 5A6JA 4RE4A 3MSYA 2ISVA 3KRSA 1UPMB 1VJSA 4DJEA 2XVLA 3BLKA 3ARXA 1SUXA 2NVCA 2UBPC 3LHYA 2ESCA 1D3CA 4FF7A 2ZZ2A 4WRHA 4YHGA 5FF3A 3VNZA 4A8NA 5HQMA 2BHUA 1N55A 5ECUA 2G50A 4MTVA 4PRWA 2EQDA 3AJ7A 2GQ8A 4V28A 2ZFAA 2QF8A 3LRKA 1KV8A 1VCFA 4QG9A 1Q6OA 4QCFA 2G3JA 3DC0A 4XTIA 1QAPA 3TROA 1MZHA 1HKJA 4HQVA 3R11A 3K5XA 3EWZA 3WENA 1U1HA 1XLHA 1I2PA 2CBIA 1WOAA 5BOEA 3TH6A 3RR4A 4K39A 4GC4A 4WKAA 2QJMA 1GKRA 3VILA 3WK0A 2R1PA 1KFWA 3GXPA 4KWOA 3VOIA 3URAA 1E1FA 4L64A 3DFOA 1IZJA 3B8SA 4EWJA 5CC3A 3IARA 1ZTVA 3NURA 4RX0A 3GRIA 3E2SA 2XIMA 4JX4A 2OEKA 2OO0A 4DZIA 2GDVA 3G8EA 1US3A 4ATDA 1R3QA 1YNQA 1SJBA 1E6PA 1JULA 4Q32A 3P82A 1ICSA 5J5RA 4IH3A 3UCCA 4K7YA 2W62A 3ABXA 2VRJA 3FLUA 4A3HA 2PPGA 4NZ1A 2BV9A 1VLIA 3UT0A 4LVFA 2V68A 2VX5A 1O5QA 4RE2A 1VZWA 1D3GA 3ME3A 3VIMA 3GNNA 3VIKA 1LDCA 4B9YA 1Z9AA 4AISA 1F5ZA 1Q8AA 4AWUA 1PSCA 3UZXA 2Y63A 2GDQA 3CL6A 4MPKA 4MNLA 4GHRA 3QQ1A 4GCAA 1XD0A 5LNSA 2J7EA 1Y5VA 4CVUA 2ZUTA 1V5XA 2V5LA 4UTJA 1NF0A 2WNWA 4DBDA 4S2CA 3DHUA 1UWQA 2YCJA 5C55A 5DF0A 4CQ9A 1HJXA 4A22A 1Z8AA 3KTSA 4NJHA 1KBBA 4IGSA 4XG1A 3ZJ6A 2FZMA 4DJEC 5LNUA 4Y9MA 3PTDA 1UWSA 1WKYA 4QBXA 3WNLA 4HU4A 3EWXA 4UTLA 1EEXA 4N2YA 2RDXA 1J96A 3DHFA 2AQOA 1GVSA 1F8MA 2G0WA 3N9KA 4JTAA 1A4MA 4I7UA 4WEVX 1I2QA 2VD8A 1S5TA 1KFJA 1TV2A 2QW5A 3DG7A 4LAUA 2VQUA 1B54A 4FX6M 2UWFA 1WYIA 4BJHA 2XGBA 4S3CA 1O5KA 1VRDA 2Z2AA 1YDYA 1XKJA 1OK4A 5HBFA 1Y5XA 2DSZA 2PAJA 3OHMB 1MW1A 3C2EA 4WZHA 3W23A 4PMQA 3T42A 3H2FA 4QJ1A 1DV7A 2VEKA 2PC4A 1Z48A 2BHZA 3PNUA 4O17A 1R30A 4GXWA 3BW4A 5D8ZA 1EGVA 2H3BA 2D2OA 1W9DM 3M47A 4UMBA 1A47A 3W75A 3NQAA 5G2HA 2J7FA 1IZKA 4N6FA 2DZBA 2FHFA 4CVWA 2WYSA 2ZC1A 3TKFA 4IIDA 2F2KA 4AZBA 3PSVA 3WNKA 3DDMA 2X7VA 1X1OA 3BOXA 3K1DA 1GCYA 2QUVA 3POCA 2FGZA 3L4ZA 3PB2A 3NFUA 1TJ2A 1KBJA 4WDWA 1F3EA 5FL1A 4D72A 2CZFA 4YWIA 2GQAA 1TPH1 3GYEA 3WLTA 4D6CA 3N18A 3KCJA 3ARPA 1J93A 1OFRA 1JDEA 1KCLA 1XDLA 2YX0A 2DZAA 3U5YA 4ADUA 4I8YA 4PN2A 4C6EA 3WK2A 1M5WA 2JIEA 4A05A 2P8BA 4AH7A 1MUMA 1RV8A 4M6UA 5LA2A 3E0FA 3LCGA 1LL4A 1XSJA 5EGRA 4FX7A 1WKFA 3PAJA 4ATLA 3UYIA 1YTEA 1NQKA 1MWOA 1KFCA 3OLIA 1FWTA 1E1EA 4DQWA 3GNRA 3PK7A 1JEZA 1J18A 3BPWA 2DU2A 3DN5A 1RSCA 4NZCA 3N11A 1ZP4A 3PG8A 2E6FA 3GG8A 4EPEC 4RUBA 1M41A 3HQOA 2NUYA 3HPFA 2X1SA 4E6MA 4DWSA 1GTEA 3QFEA 4AZ7A 1N7KA 2PGWA 5CJMA 1JD7A 2Q8LA 2OX4A 2W66A 3WDHA 2LLEA 3TN4A 4PTNA 5A6MA 3E2VA 4C6QA 1WKEA 3D6NA 2AAAA 4MJ4A 4B3KA 4WD0A 3TOPA 3CMJA 1QT1A 1PXGA 3CQKA 4S3KA 3HO8A 1DQWA 4XD4A 3VM5A 5CLTA 3EX6A 3CMFA 1KR0A 4YL2A 3U6WA 1HL8A 1TV7A 4XVEA 4DJFD 3OP2A 1LOQA 1OYAA 5A6SA 3II1A 2VGBA 4DUXA 3KVLA 3W7EA 5AECA 2XVGA 2H9AB 4N02A 5CC5A 5JVLA 3S5OA 3WH8A 3KFTA 4FLRA 2RAGA 1B9ZA 3RNDA 2Z00A 1SYTA 2XH2A 4CNUA 3W83A 1XISA 3NSXA 1CGVA 3MWCA 3MZ2A 4Y8FA 3H4XA 5CZ0A 1K8ZA 1F4HA 1WDWA 1HKWA 2PSNA 4O15A 1C8VA 3SZ8A 3KTXA 1X7FA 5BMWA 1F05A 4U2ZA 1PDZA 3E12A 4XQ6A 3GH7A 3QF0A 4IISA 4FSAA 2G4FA 4XAGA 1PTDA 2QPXA 1WP6A 2ZRVA 1U5VA 4RZ5A 2WANA 3BSMA 3WF4A 1GVIA 1K6WA 3WLQA 2O92A 1Z7AA 2YSWA 3L65A 4JEQA 1F2JA 1LL7A 4AY7A 1WZKA 2FGBA 5E70A 7TIMA 1EYWA 2VOTA 4EWND 3IAPA 3KZPA 1BRLB 1P1XA 3QGVA 3TQKA 1M68A 4JDBA 5H1WA 2VWSA 2X1RA 3UCDA 3GXFA 3AXHA 2PLKA 1OF6A 3DFSA 1EDQA 1XLJA 5REQB 4MZ1A 8XIAA 1V3MA 2QULA 1LJYA 3QV7A 1YDOA 4IUGA 3WL0A 1ZBKA 5J5DA 3WBWA 1AQHA 2YA0A 3E02A 3S2NA 1QNPA 3FHAA 3HQPA 3MVTA 1EC9A 4J2MA 1QBBA 1MRAA 2ZBTA 1TTPA 1PWLA 4P8XA 5M1TA 1X98A 1JYWA 4S3BA 4LUSA 4NYUA 3CUFA 1VCGA 4PMYA 3O0FA 3THQA 4BEQA 1D2KA 4ZO8A 3THUA 1XM3A 3NL5A 1GORA 1HNYA 4ORMA 2CWXA 3R0DA 2D22A 3FW6A 3L2IA 2WK2A 2Q3OA 1XLEA 2Y89A 4FX8A 2VZOA 1L2QA 5K9XA 5DY2A 4PRRA 3CWNA 3D5HA 4MLJA 2PDCA 4OZOA 2VFEA 1ME9A 3HPAA 4IXXA 4DZ5A 2PDHA 3M1ZA 1UJPA 3MUAA 2ISWA 1O6IA 1CLKA 1C92A 1LBMA 5I3IA 4F66A 1N82A 3TN5A 3QYSA 1Q6EA 3BG9A 3QPZA 3TA6A 4XX6A 3WLIA 1UR8A 3UG3A 1PZ2A 5ENLA 4DJDA 2WM0A 5D32A 2ZADA 4WGXA 3AHVA 4NJGA 1E3ZA 1EF2A 4E4UA 4CQCA 3GG1A 2I5QA 4YN5A 3PTQA 2DUAA 4JFTA 3MC5A 4O1DA 4IMGA 2W61A 3VDGA 1VFLA 4MPQA 3N9RA 3WJZA 3MP5A 4HVXA 1WDRA 3VGBA 4L6DA 3EOUA 1VBHA 3TYCA 5G4WA 5C0QA 5B80A 4HPXA 4NZ5A 1SR9A 4MHBA 3OGRA 3R8GA 3CPRA 3MA8A 2ZDRA 3GUWA 1ZRQA 2GUBA 5LZLA 2VCBA 2E25A 3CZJA 3M7SA 3A22A 1ZENA 2XH4A 2Y7DA 1JL8A 3M0LA 1XBVA 4GNVA 1R87A 4L56A 1UWIA 3FOKA 1EUNA 4US5D 3M0XA 1CX9A 2E40A 3AMKA 3TN6A 3MMDA 2QJGA 3CQHA 3S6DA 2ATMA 4KWSA 1AA1B 4PUJA 3EPMA 3FK4A 2ISSA 4OOZA 3P61A 1W54A 2R24A 2VVSA 1Z69A 2E68A 3I6EA 4CNPA 2QJHA 4JHZA 2DJXA 3PNZA 2EKCA 3QR1A 5IRPA 4F9DA 1QO5A 4KS0A 3VX0A 5KZ6A 2WHMA 5C6MA 2H90A 2WBGA 1PV8A 4XAYA 1SZFA 3T7VA 3LRLA 3TDFA 4NVTA 2WZHA 3GNXA 2A3LA 4ZMGA 1V0LA 1TV5A 3N2BA 2FH8A 4F2BA 1YBQA 3I3DA 3NQDA 3MDUA 4G6CA 2HK1A 1GONA 2VD9A 5T9CE 3M0JA 1W1IE 3QBUA 4P5UA 4PZVA 5MHBA 4LVAA 2VZSA 1R38A 3VZZA 1JAEA 4FNSA 1SW7A 1S1RA 2VFIA 1GKQA 4C5ZA 2ASHA 3VD3A 1SO3A 1AD4A 1A0DA 1I1XA 4HU0A 1WZMA 3EYPA 1JDAA 1EWDA 4C1NA 1UBSA 1PVNA 5M3WA 3SY8A 4ZGYA 4OU1A 2J75A 4WF7A 1D3HA 3TYBA 2I14A 3IIZA 1KD0A 4C7FA 4DJDC 3P84A 4XWUA 4BHYA 4PRTA 4ACZA 3UXDA 5AC4A 3KBWA 4GBUA 3P3BA 1R9YA 3PPFA 1A5KC 5M03A 1PKYA 3WL1A 3F4CA 3VPLA 2GOUA 3ITCA 4J1OA 3PHAA 3SUUA 4JIIX 2EPHA 3IK2A 1R3YA 1M7PA 4ACYA 4GY7A 4LCRA 5CEWA 5FKYA 1OIFA 2NZLA 3V7PA 1TO3A 5G5IA 2HWGA 3U7VA 1GJUA 3LTYA 1LLWA 1QMLA 5CSRA 2FMOA 1CXIA 3JR2A 3MDWA 4I7VA 3TTEA 4U10A 2XGIA 4DF2A 2ZXAA 5H6HA 2NT0A 1JRCA 5TD4A 1UC5A 4UR8A 4KW2A 3ES8A 3DENA 3RX3A 2DH3A 1GZ1A 3TR2A 3ZM8A 5CG0A 4TVUA 3L4WA 3T0BA 4L1XA 1W9UA 2GWGA 4L4PA 2D2HA 1RQHA 3UPMA 1W3JA 2G8ZA 4EXAA 1OGBA 2PEVA 1DQUA 1NWRA 4QEEA 4W89A 1HVXA 1AW5A 3UWYA 4UBPC 2WHKA 3ZR6A 4PMJA 3GIQA 4PC8A 1LUCB 1UW9A 3VNDA 3LLFA 4AHOA 1WB0A 3N6HA 1JPMA 3MUCA 2Y2WA 1S2VA 1Q7MA 3C8FA 5BRQA 3EB2A 1P0BA 4QHRA 4A2SA 1YDNA 2GGIA 5D04C 5ABFB 1V3KA 3USZA 3N2TA 4O0ZA 3H2NA 3L68A 3S6TA 1OY0A 2ICSA 3RRAA 1XCWA 4B5SA 1KRCC 3GC2A 3IRDA 1NEYA 1U5JA 4CNTA 4JTGA 3GR4A 1R8LA 1X38A 1NWTA 4Y9AA 3EOOA 1B3ZA 1YLVA 4JCMA 3N6JA 3E0IA 1SJCA 4ZQCA 1XIBA 1MUWA 3ZVHA 5C9RA 2IQ0A 4PYSA 4FHAA 2AOSA 3AIBA 3T9PA 4I9JA 1A5SA 3O06A 3SRHA 1KLZA 4KPLA 4GX9A 5BXRA 3RCMA 1J0KA 1PPIA 1XGEA 1OX4B 3R58A 4B2DD 3USBA 1YXCA 2PWEA 4V1YA 4IMAA 2BOGX 2J78A 1BWVA 2D69A 3WUGA 2F7FA 1JZ2A 3OG2A 3G2GA 1MW3A 1V79A 2WM1A 2WJFA 4H19A 3HGRA 1E6SM 6XIMA 4UTWA 4AVFA 1E0UA 3B0XA 4Z1BA 3AIQA 3HFYA 2X1TA 4XSLA 1ZJIA 1Q65A 4C6IA 2GZXA 4OKDA 5D2YA 2GVGA 1AK5A 1W3LA 1P6CA 4Y9NA 3IWPA 3HG3A 3V75A 5FIPA 1RD6A 3I10A 4GVGA 5EMUA 1U83A 4NAFA 5E9XA 3P6LA 1HJQA 1C9WA 3O6CA 4DAIA 3WUBA 4TV6A 2QJIA 2IQDA 1AODA 3CL8A 1BQCA 3GH4A 3T05A 1J5TA 3WFAA 1K02A 2PRHA 3Q2DA 4DBEA 5IDIA 2J9XA 2EPKX 1AJ2A 4G7EA 4RPPA 4NJJA 4Q7BA 1HQTA 3FJ6A 2Z6IA 5KEZA 3S9IA 4PUNA 5D8WA 1FP8A 3QC0A 5HXMA 2F6KA 5HNRA 4DX3A 2V38A 5K4XA 5FJUA 3CUHA 3DKJA 4LFYA 2G3FA 3KEHA 4ZB2A 3G1XA 2QJJA 1UMLA 3RHGA 2G41A 4RDVA 3TIMA 3W7IA 2F2HA 3N15A 2R94A 3K8LA 2VFFA 5G4HC 4LSBA 1JF6A 1R47A 2BZNA 1IYXA 1TWWA 5AZ1A 4F9JA 5AC5A 1UR0A 5EL1A 1TVNA 1TVPA 4US6A 2GFTA 3QR3A 2WNNA 1Q2RA 2VDGA 3W7JA 3W70A 3R43A 1JDCA 3SRFA 1AJZA 4H2CA 4Q7IA 1LRTA 2Z0IA 3K1GA 4LRSA 3N17A 5AKQA 3V3WA 3E0VA 2OJPA 4H3DA 1FDJA 2J7BA 2PDNA 4RXFA 3ABQA 4F0KA 3RG6A 1TKKA 2NW0A 1O95A 5C70A 1KKRA 2PDJA 3OLEA 4WXZA 2TMDA 3UGVA 3G22A 2VVNA 4BF9A 2C0AA 3L67A 2PDYA 4OBTA 3T09A 4FOUA 7REQA 5BRBA 1F6KA 2YCIX 1XLMA 5CPMA 4H7ZA 2V5JA 1ZP3A 2E5CA 4AC7C 1HO4A 3GVQA 1Z3NA 4XO6A 1TV8A 4TTGA 4QLKA 1SGJA 4Z0SA 4NL1A 1JXJA 3ZSTA 5I07A 1Q6CA 2V5KA 2OU4A 1QFEA 3E1F1 4CLMA 4HSHA 5CPTA 2XFFA 4C7GA 2YL8A 5D9OA 3CYVA 3HV8A 3GFYA 2B0MA 2NT1A 1DTUA 2PTYA 3LEPA 2CKRA 4QISA 4YMZA 2VHLA 3UR8A 4QITA 3NVDA 3PZIA 4M6PA 2CXGA 4C6KA 3AOFA 2ZYFA 2X7WA 1JQVA 1GOQA 1OHLA 1PBGA 4YNGA 1R7OA 4ORIA 3PJXA 1R2RA 4PCFA 4IQDA 5D4YA 3KBVA 3OG3A 1GOOA 3W81A 2IPJA 3R25A 1SR0A 1KNWA 4HK5A 4FXSA 4W88A 3NPVA 4AZHA 3EEGA 3MWAA 2YDRA 3GE7A 1XBXA 1FWHC 4HYVA 3MV01 2A3EA 3RLGA 3WCZA 4YLWA 3T2OA 1LL6A 3NPXA 2ADAA 3VCRA 8CGTA 3VAVA 1NJJA 4IIHA 2CLMA 3BCJA 4UTKA 4HA1A 3I3EA 4M6QA 8XIMA 1J10A 4GQRA 1LYXA 1VFMA 3GM8A 1V0KA 3G3DA 3H2CA 4O53A 5A8OA 4JPGA 1CW2A 1M9HA 1PKNA 1WA3A 1FHDA 4IMDA 5C9UA 3ZOAA 2V81A 2O55A 4A35A 4R9XA 1QNVA 4GNJA 3NQFA 3M0IA 1ODUA 1LQAA 1OFDA 2E8ZA 3JRKA 3B8TA 3HPZA 5IDZA 2HROA 3C52A 4DI8A 2PDXA 3APYA 3U57A 1W5PA 3SN1A 1ICPA 5C2CA 1XCXA 3RFAA 1K9FA 1WKDA 3WLKX 3LCHA 1TIMA 2FKPA 2OO6A 4O8AA 4JTQA 4Z08A 2BDQA 3OBKA 1VPQA 2ACSA 2W5FA 4KMQA 1JXKA 1BYAA 1KM6A 2CHOA 3RK8A 4ECLA 3GC5A 2VUYA 2FTWA 5GQBA 4B5UA 3LCXA 1AW2A 3UFYA 3VINA 3L21A 4JTEA 1M53A 1YPFA 3QY8A 1QNSA 2HCVA 2D73A 3F5JA 1VBRA 4XSMA 2PP0A 3IIOA 4O0QA 4J3SA 3NGFA 4BI7A 5TIMA 3O0KA 4S3FA 1XLLA 2CESA 3A5FA 3LPFA 1UROA 2VZVA 1JR1A 3KVJA 3TCSA 3W6MA 3EMZA 6TIMA 2YL5A 3K2GA 3G1VA 4M6VA 3DFQA 2DJLA 3GDBA 3DHPA 4AWEA 4I5RA 2QIIA 1KXVA 2GK1B 1WUFA 5K7JA 3TW9A 3RX4A 4F79A 2P53A 3F2DA 4QNWA 1G7VA 2WMHA 5C54A 3LV6A 3VDAA 4OV4A 3SGUA 2BSLA 2WWDA 1KBIA 1XJBA 1I60A 1I0DA 1NWUA 1DHKA 5CC6A 3UJRA 4RV3A 2QIWA 2CEQA 4MB4A 1W5NA 3IGXA 1E6QM 3VC5A 2ZX9A 2QDHA 3W7KA 1W2PA 3B9EA 4RCXA 1J4EA 5JH2A 3D0CA 1JCJA 4O1BA 4LC8A 1QXLA 2NUWA 1BVWA 4CQAA 1Z32X 3DYOA 1MFVA 3LBCA 3C3UA 4Q4SA 4B90A 1DIEA 2J7GA 4F0RA 1UD3A 2WB5A 2OT1A 1ITQA 4KRZA 1TPUA 4FMVA 3VNLA 3VOCA 1H63A 5F2GA 2YYTA 2V67A 1W3NA 2YLLA 3CJPA 1US0A 5AHNA 4U5IA 4URIA 1RBOB 3CUZA 9RUBA 4PBFA 1BD0A 2DW7A 1U1JA 3CNYA 3O15A 4TIMA 2X42A 4I5XA 2DP3A 2YR1A 4W87A 5C9WA 7ENLA 3G1HA 2PDMA 1CXLA 1NP2A 3VGFA 3GUGA 2Q6ZA 1DWIM 1OC6A 3CH0A 1XINA 1H61A 4RW5A 4MIMA 1LBLA 3K8KA 1OK6A 1IV8A 1PX8A 1TE1A 3M0MA 1XX1A 3BANA 3GBEA 4LANA 2V5DA 4C6FA 4PUEA 3URQA 1FWEC 4CU6A 1RHCA 5IFPA 2ZRXA 3VGHA 1VIWA 3AWOA 1Q3NA 3C56A 4ZOCA 5HATA 1TYGA 1XRTA 3RUBL 1S5MA 2ZC8A 1JGMA 3U4FA 1K8XA 4YTRA 4XBSA 3DYMA 1QHPA 2PDPA 4O52A 1GOXA 3E0WA 3W7PA 3A4WA 3EA2A 4YCOA 3EDEA 4JIHA 1HTIA 2VEMA 5HMEA 1OYCA 3ONCA 1DJWA 2YYUA 3RLUA 1PS9A 4BQ4A 2BOEX 1S39A 4LBRA 5E0KA 1WZLA 5D2WA 3ITTA 1V93A 5FCZA 1JUEA 2J24A 6XIAA 2IPWA 3RJYA 4EANA 3UG4A 1UHVA 4G56A 1LQ0A 2R9RA 5C5YA 1KB3A 1S2WA 3VMOA 2FZDA 1IT7A 4B5WA 1GVFA 1UJQA 4QXIA 4N6EA 1TV3A 4PTWA 1L2UA 3BJFA 5DT7A 3A23A 4PSPA 1XC6A 1OC7A 3GTXA 4BK9A 3S2MA 5JUVA 4G5DA 1S3HA 2Z24A 3N3MA 3ZMRA 3AC0A 3PBUA 1KRBC 5BU6A 4CGTA 2OXNA 3VOGA 1R3WA 4Q6XA 4E5TA 1SO6A 3UR2A 4QCEA 1ME8A 4ZQNA 1TWZA 1AL7A 1UB3A 1YADA 2BP1A 2DVXA 3NXFA 2GSEA 4GIAA 1H41A 2VOMA 4QSHA 1E51A 1TVLA 5BWFA 3CWOX 4C60A 3PBVA 4DYJA 5A8NA 3R94A 2E28A 4MZYA 1NP0A 5T9BG 3WJSA 4HJFA 3WUEA 4A3YA 3LCWA 3MUY1 3QV6A 3ARYA 4YYCA 2E8YA 3MV11 4IP4A 3NXLA 3VD5A 4DJED 2BXYA 4L4MA 3MUIA 1G6CA 4IZGA 3U4AA 1E71M 5L6UA 3BCDA 1XIFA 1XYLA 1ZY9A 1VFTA 1IXOA 3MANA 3HOJA 3HMJG 3LSCA 1XI3A 1ZCCA 2ZOXA 1RH9A 1DWAM 4HGXA 4GOAA 3GIYA 1VB9A 1E72M 1E4MM 2ZIDA 5J8LA 4MNKA 2BMBA 4FZIA 2FH6A 1E1CB 3LTPA 2PA6A 1Q13A 3LN3A 2PS2A 1XFBA 2GQ3A 4HNCA 3L4TA 2A7PA 1VFSA 3VDBA 4W4QA 1ONXA 1A5OC 1PUDA 1J0YA 4IPIA 2YDAA 3GHRA 2XGZA 2XWEA 4G9PA 1BYDA 3BAIA 2NV9A 2V2HA 3STFA 3K4DA 4DXKA 3FYOA 3GYCA 1QPQA 4L1WA 3AMLA 1G94A 1RQBA 3MJYA 1RXOB 1LWIA 3HGOA 2D0HA 3RILA 4JX5A 1TMQA 3T1GA 2CLEA 4DWSB 1B3YA 2HBVA 2KX9A 5ABGA 3WZ0E 2DUXA 3NQMA 3FJLA 3FHQA 3VIHA 1TCDA 5BWAA 3QTGA 3ATYA 1B0IA 2DQXA 4Q8WA 4NF7A 1W0MA 3W27A 4WDTA 3H2OA 5KITA 4GYPC 5CZKA 2AQVA 2IKJA 3NYDA 3A13A 3OW1A 5DLCA 3W4RA 3PWAA 3G8RA 4X3ZA 4HPNA 3IACA 1ZLPA 1NDVA 3RRXA 3WMLA 4OE7A 1JUBA 2OWXA 3N6QA 2VR4A 3F4WA 1XRFA 5HPCA 4AYGA 1O5XA 4UIOA 2GSJA 3KAOA 2Z1VA 4RLIA 3GFXA 2AL2A 2E6AA 3LPGA 3FVMA 3CZLA 5D30A 1ISVA 3F4VA 3Q65A 1XW8A 3M5VA 1QI3A 5BRPA 2PF0A 1XKYA 4BQ5A 3MCMA 4ASTA 2HXTA 1RR2A 2PODA 3CK5A 4WOQA 2EG6A 2CWNA 2VDIA 4PCSA 4GVHA 5CAHA 3H24A 1Q85A 1XYAA 2WMFA 4UZSA 2GJXB 1NDWA 2BODX 2XTKA 3CV7A 1P7TA 5DRIA 5CZJA 4LNYA 3AS3A 1ISZA 4ZQPA 2DZSA 4UTUA 3W38A 3GDTA 4HHLA 3W7DA 3NQGA 1NFGA 4HMEA 3MW7A 3AIEA 5HJYA 3LCFA 5LGZA 3ABSA 2R91A 4PMNA 4TX9A 1OCJA 3HJZA 5CBIA 1DPMA 1DYSA 1GVRA 1JCNA 1H09A 1G9HA 2J79A 1KWKA 5TAOA 1NWSA 1H49A 4JQ4A 4U4MA 1ZPTA 1X6UA 6REQA 3AXIA 3NGJA 4Z2HA 3IIPA 3P14A 2DSUA 3GWQA 5JBEA 3SM0A 4LT9A 2QCCA 1TREA 3UWUA 3Q94A 5FESA 1MYRA 5J04A 4FR6A 4UFIA 3WD3A 2QXWA 3GHSA 1ALDA 3Q45A 3ZJ8A 4A3UA 4LPCA 2PDUA 1RP9A 4JFSA 4HMDA 3B4UA 2PDFA 4RPQA 5H91A 1DIDA 5CCZA 4FLOA 3ID7A 3NG3A 2Z2UA 3RM8A 4CNSA 1KWGA 1KFBA 5BYWA 4EPKA 1KFEA 3W6YA 2OKOA 2FB2A 4GYJA 3KS5A 3R7MA 4AZCB 1WPCA 3W1XA 4L6HA 3HPXA 4F0MA 1JUKA 1P0NA 3B4YA 1W8GA 3CLMA 3DERA 1JZ8A 1Q66A 1WDQA 4AB4A 3FS2A 5HMFA 2UY5A 1A3XA 4C90A 3B0YA 4TTUA 1SO5A 3BO9A 2GJRA 3UEQA 2PDLA 4GJIA 4OJYA 1HF6A 4XK2A 1ODZA 1RCOB 3U0HA 1Q6FA 1FCQA 2YDSA 5E0CA 3UG8A 4YS1A 1Q8JA 1BRLA 2W3ZA 3ZO9A 5JIPA 3TC6A 4KIEA 3LA4A 2OEJA 3SADA 4LAOA 3O6YX 2A79A 3LLDA 1PX3A 1Z42A 4CN6A 3CV1A 3MS8A 2PB1A 3C2RA 3EX1A 3LNPA 3E3HA 4QAWA 2ZUMA 2PCEA 4UTTC 4GJ1A 2CERA 3T4CA 1FCBA 1LOSA 2YFNA 1K03A 1V03A 4Z1YA 2VGIA 3W53A 2H6RA 4OWGA 4K36A 3TJLA 4HCDA 4Q8QA 1KFKA 3AHTA 1K9DA 4AWSA 1R9XA 1YRRA 2IKGA 1V6UA 1M04A 4NZFA 3RPMA 5HR6A 3AXKA 1G69A 4BEUA 1L6GA 4QRNA 1KM4A 1OZQA 1XRSA 4CU7A 3F5KA 1DE6A 2OT0A 3B05A 4Q4OA 3NQEA 1H4PA 3LUTA 4N0RA 3NCOA 4UFKA 4U31A 2HMCA 4I9TA 3W2NA 4ALDA 7XIMA 3GS6A 5ABEA 4D6GA 1QHOA 4JQ3A 5DMLA 4ICCX 2V30A 4KCUA 4JY9A 4AFYA 1DOSA 5K2ZA 4GKTA 3BLOA 4J27A 2ZUWA 3P81A 1EIBA 3B9AA 3LERA 4H8NA 1W3HA 4HCHA 4LCQA 4WOZA 3ONBA 4GQBA 2TSYA 3DOPA 4ML4A 2PMQA 4FXJA 2YOCA 4D8ZA 2F8QA 3H4GA 3LD5A 4GI6A 3A12A 2YZ5A 2ZICA 1X1ZA 4IICA 2OKTA 4ZXOA 2VZUA 5CJNA 3NWRA 1NU5A 4FIRA 1XLFA 1DJYA 1EHNA 3DFYA 4DBSA 5DELA 1AVAA 4NJKA 3W86A 2O56A 3L2LA 5LGXA 4EOUA 7A3HA 1JI2A 4BQ2A 3FX4A 1EGMA 2X40A 4GH1A 1IGSA 4C7DA 3VNIA 1F3XA 3MYOA 4UFJA 4PUUA 3QHMA 2J77A 1QR7A 3GDKA 2FZNA 1LRNA 2GWNA 3NM1A 3IJQA 5AHLA 4GNKB 4Z1DA 3AWNA 3W02A 1UP0A 3QSRA 4LF1A 4PGLA 3LCIA 2WKGA 2POZA 1QW7A 4C1NB 4OTKA 2IXVA 4DB7A 1C7TA 4MG4A 2NSOA 5CPOA 2ZUUA 1KCKA 2ZRYA 3EGJA 3FA3A 3WF3A 1K3UA 3L5MA 2ON3A 2EPLX 4CCZA 1FH9A 3B03A 3RU6A 4INFA 2ACQA 3SI9A 3GNDA 1UZ4A 5HK4A 1NOUA 3QMTA 3WH6A 1LROA 1DJZA 3HTWA 2XISA 4DWDA 1SQ7A 4O54A 1ISXA 2PZ0A 3I7QA 1C8QA 2XVKA 2WMKA 3UD6A 1X96A 2R14A 4QSFA 2W63A 4GQGA 2Q3RA 3ZSSA 1KTBA 3HQ1A 3OU8A 4KCVA 2P88A 4LYKA 3UR7A 3S9ZA 1VD6A 3S4TA 1H0IA 4O1FA 4IF2A 5AHIA 4HU3A 3QW3A 4IX2A 2ZXQA 3ARUA 4GBDA 3OVPA 2GPTA 2J7HA 4YXGA 4JNMA 4XZHA 1AH0A 3ITVA 1EHAA 2HJPA 1L9WA 3MI6A 3UESA 4CKQA 3PM6A 4MDPA 5EMMA 1LT8A 1A4LA 1RLCL 5IHRA 5EBAA 4E3TA 5HQLA 2NQHA 2GUYA 5C2GA 5AC8A 5I77A 2FFIA 2YA2A 4LF2A 2CLKA 2P50A 3VU2A 1IT8A 1BSLA 1N8IA 5T26A 2QUUA 1TB3A 4MJ2A 4J7RA 2TRSA 3CTLA 3WSUA 4Q8PA 1G5AA 3WEOA 1XRVA 4DJDD 2ODOA 3OGVA 2GGEA 3AS2A 5JQ9A 3QFWA 2Y5JA 3TU9A 5D2TA 1MQQA 1A5UA 4GGBA 3M0YA 1TJPA 3BAJA 3W24A 2WV8A 2VGGA 2QPUA 2ABBA 2PWDA 3G1SA 3DCPA 1W3IA 3AICA 5I3FA 3PP7A 2X05A 4L4OA 3C5QA 4GPNA 2PLJA 1R86A 1H7WA 1GK8A 4GE8A 4C6LA 4HP5A 4GZIA 3LX9A 4ZOBA 2EEXA 1A49A 1GKPA 3V5FA 3ZVHB 1A0CA 3V4BA 1V08A 1T0OA 4P7NA 3QGAC 1PEZA 2BB0A 3WDIA 3EWBX 3R4IA 4QS5A 3ALFA 4L1GA 3W73A 2GQ9A 3JUGA 2CC0A 1SMAA 1UIPA 1E6RA 1XDJA 1VLWA 4WLCA 3UBPC 1H1YA 4WR3A 4LS0A 4D8LA 1J5SA 2ZA3A 3CZGA 4M81A 2PWHA 3ZIZA 4V33A 1XLDA 1H2JA 1OADA 4LGXA 2Z1KA 1EX5A 1KM3A 3DXIA 3CO8A 4GX8A 1HN1A 3R2GA 1W1VA 3KL3A 4NRSA 3IVSA 1BF2A 3OBEA 1FUYA 2Z27A 5DY3A 2A3CA 3VKDA 4QE1A 4J9JA 5LHFA 1V6XA 4XISA 2BLEA 4XZLX 5EMYA 1DJNA 4GJJA 3WX7A 4MWAE 1S46A 1WDDA 2XIQA 4JFUA 3R5EA 5BCAA 2XFRA 3WLNA 4NAFB 1J0ZA 3U2OA 5HOSA 5HR7A 5JBFA 1YTKA 3W29A 1NIUA 3CLWA 2CNCA 2XDFA 2PBGA 4R5EA 4ZA0A 4JTLA 3VDCA 4AYSA 1QJWA 3UXAA 3CXOA 3EEZA 2IW0A 2HV5A 3GW0A 4GMEA 3MI3A 4C6MA 2OMAA 3NDZA 3E2RA 1HW6A 3SFKA 3F5LA 2QJNA 5A94A 1W1TA 3NZPA 3ZWTA 3ARSA 4PE8A 2ZRWA 3ZYZA 3GTHA 3ATZA 3SCOA 4HTBA 3TTQA 2F84A 3L12A 3KDNA 3WUFA 5ABHA 1W1ZA 2QGHA 2OSYA 4JKMA 2HBXA 1MO0A 1R2SA 3BAWA 3GTNA 1PYFA 5G4EA 1SO4A 1KO0A 4B5TA 1DWJM 1TJ1A 3NZQA 3V0SA 1SSGA 3EMQA 2WVVB 1HL9A 2IXUA 4W8BA 3CT2A 4MFDA 2F9RA 2I16A 4GK8A 1J8VA 1KM0A 4JEJA 3TC3A 3H22A 4FNQA 1T40A 1JZ4A 3GAYA 3IK4A 5DCDA 4FNRA 4P8VA 4XZ9A 1V0NA 2YZRA 1OZMA 4AEFA 1T99A 2AQWA 3WQOA 5I7GA 2J8GA 4PMDA 2WC7A 4QROA 3KZSA 3PBYA 5FJJA 1L6SA 2JEPA 7REQB 3WDQA 4GUFA 4KEMA 2IMRA 4LV4A 3SB0A 3M41A 1NH6A 3OIHA 4JYFA 4R34A 3UWQA 1ZJHA 2DVUA 4LUYA 4F4RA 3AFBA 3QHNA 2L5HA 2YB1A 1V02A 3MCOA 4JN6A 1VBGA 2QCHA 1H7RA 3QPEA 4MM1A 1JRBA 3PUOA 1JPDX 4GZJA 3RO8A 2YIHA 1OFOA 5TBOA 5AN7A 3TVAA 2NVDA 3SEPA 5CSUA 1LZOA 5AC6A 3LI1A 1ISYA 2WW5A 4JS3A 3AQUA 4LNCA 3HQNA 3G0SA 3NAVA 5A8QA 3AZTA 1I0BA 3PBMA 1XH1A 4HA3A 3AHXA 2RH9A 3M9YA 1BTMA 1ZGDA 1UD5A 3FKKA 3TSMA 4AQLA 7ODCA 4ZQOA 4L6OA 3IGUA 4B91A 4Q4QA 5L9FA 1EC7A 3FV9A 3ANUA 3AS0A 1TA3A 1BKHA 4HNVA 3T0TA 1VYSX 3TXVA 1BYBA 4AMAA 4Y6GA 1A3HA 1WZAA 1MDRA 3LXBA 4NZ4A 4MB5A 1OCBA 2OSWA 1ADOA 1S5WA 1UKQA 3LQLA 4POCA 4H6QA 2RJGA 3AYRA 4ZE4A 4TUFA 1UPPA 1SVDA 1PZ1A 2Z1BA 5I78A 1FWNA 4KRTA 4D6HA 2R1MA 3UNDA 1WAWA 1ELSA 4A8RA 1MQRA 3VMPA 2ZWZA 4PTDA 4XO7A 1JCLA 3GDMA 3C8NA 4EAYA 3GTFA 3TA9A 1KCXA 3GVGA 1WDPA 1UBPC 3IS4A 4M82A 2FHBA 4ZSTA 5IFTA 5K3VA 3RXZA 4UTFA 4IGHA 4ERGA 1V7AA 4K7VA 2VCCA 1E73M 4X61A 5EU9A 3IJ6A 4W85A 2OZ0A 3CAWA 1UKPA 4MSSA 2GJLA 3LU2A 3M6DA 1GQLA 3WNNA 3ZQ9A 1X97A 4ML9A 4ZFMA 1B4EA 2PRMA 1JFXA 1QBAA 5AHMA 1GG0A 2AKZA 3W2MA 2FVLA 4EE9A 4A3QA 4Y96A 4ZZ9A 5MF5A 4UR9A 1IXPA 1S2UA 3KOZA 1I1WA 1KV5A 3OIXA 5BXTA 1H7XA 4DJFA 4GACA 1HXJA 3I68A 5DO8A 3CQIA 5LXEA 4WQ6A 4I6KA 4XZIA 3BWWA 1MI3A 3B40A 1QOPA 1TX0A 1W37A 3M4HA 2Y24A 4A6GA 4ROPA 5KINA 1TMLA 2AKMA 4XV0A 4GY1A 4BS0A 1CYGA 2J4GA 3D47A 3H7UA 3UPWA 1IEVA 4JTFA 1R46A 3R6IA 1FWSA 3BMXA 3GNPA 2BGQA 1MEWA 3SBFA 2E77A 3R8HA 1C93A 4TMCA 4LB3A 4F0SA 2V3DA 3NEHA 1AH4A 2VZTA 4AD3A 1UOKA 1QOQA 2OLAA 4JQ2A 1EJ7L 3FCPA 2DT1A 3SCRA 3UY7A 3FJ4A 4A8LA 1THFD 1VHNA 5EB8A 2PC8A 5DEZA 3QY7A 3O6AA 3WMBA 3WEZA 8TIMA 1S5NA 5E09A 5B7YA 4N7QA 3S1XA 5BOFA 2HNHA 2IKHA 1OFEA 1UH4A 1Q7ZA 2FVKA 2G96A 3M5ZA 4DUOA 3IVTA 2ZA2A 4BWLC 3V0UA 3JS3A 3Q37A 3BVJA 3OYZA 3WD0A 2DZXA 3PJWA 7TAAA 2CZEA 1OJXA 1BGGA 1FXQA 3POHA 3UA4A 3FA4A 4AW7A 4JXCA 3TAOA 4FB7A 4NQ1A 4UNLA 1GVOA 5GNXA 5G2IA 1CDGA 4LYQA 4CN1A 4JNYA 5D05A 3WQGA 3W7MA 2O9OA 3FDKA 1JDFA 2FPYA 4GG9A 2FFCA 3BW2A 2OCZA 1V8EA 4X60A 3PSWA 1UKSA 5AHFA 2J7DA 4HZMA 5FJTA 1Q7QA 4AHQA 3COTA 2CW6A 4I90A 4Z1CA 4IOTA 4Q4MA 1Y8BA 3KWXA 1AMKA 5LIUX 3FSTA 2P3EA 3FEQA 4HA0A 4MKSA 1Q4WA