1OYCA

Old yellow enzyme at 2 angstroms resolution: overall structure, ligand binding and comparison with related flavoproteins
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OLD YELLOW ENZYME
publication title Old yellow enzyme at 2 A resolution: overall structure, ligand binding, and comparison with related flavoproteins.
pubmed doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase(flavoprotein)
total genus 141
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1oycA00
1E51A 3C6CA 2PC4A 1JUKA 1JJKA 2NXHA 4EF8A 2P10A 3NQEA 4NNBA 1GTHA 3L9CA 1XDLA 3L21A 4GE8A 4FHAA 1TPH1 1YPFA 5F1VA 3ZFHA 1TREA 4IX2A 3B06A 4EVZA 3S6DA 4O16A 5AC8A 4LV9A 4OV9A 2RDTA 1DJNA 1ICPA 2CLKA 4ZQNA 3W7IA 3FLUA 4JX5A 3P60A 4U4MA 3EX2A 1SO3A 4NJGA 5F4XA 1SUXA 2C6QA 2YSWA 4UFHA 5HQEA 1SW7A 1SZFA 2TYSA 3TV8A 2WV8A 1RPXA 3HB9A 1LP6A 3PUOA 4XWUA 1TRIA 3W22A 1FUYA 4JX6A 4LY8A 1EP2A 3LV6A 1OFDA 1GVFA 4UFJA 3W2MA 3WK1A 3SECA 4BFAA 4IUOA 1W5MA 4IWWA 2ISSA 4O28A 4LRTA 1GWJA 1KFLA 3M44A 2EHHA 3HPSA 5K9XA 4JTHA 1Q6QA 2DZTA 3LTYA 1XBYA 4O57A 2ABAA 4JTSA 2ISWA 3CTLA 4RZ5A 4HNUA 3S1WA 3B04A 2JKPA 4JDYA 4PL2A 3C61A 1SZNA 1K7EA 1F6KA 2YW4A 3DXIA 2J27A 2OCZA 1LZOA 5L6UA 5I3FA 3W7NA 2OZ0A 3TSMA 3IIOA 3QC3A 1XBXA 4Y8FA 3UZ5A 3KHJA 3R8RA 1A53A 4XBKA 3FIGA 3OA3A 1ZY9A 3ATZA 1HO1A 2C3ZA 1QFEA 5CZ0A 1JCLA 4AWUA 5CPLA 1TPUA 1K03A 1MSSA 2O7QA 3TROA 1H51A 1FXPA 4C1KA 2ZA3A 4BI6A 5G4WA 5F2GA 3SW6A 3P82A 5G2IA 3S5OA 4XKYB 4K39A 2ABBA 3DI1A 4OV4A 5SWUA 2A4AA 5HUOA 2NX9A 5AHMA 4HHPA 1FDZA 4NZJA 2VENA 3FS2A 3PG8A 3SGZA 3BG5A 3NO5A 2GQAA 1KV8A 3MI2A 3P8JA 4B5NA 4C1LA 1JRCA 3LRKA 1R47A 3G8EA 1W56A 4L4LA 3T40A 4FO4A 3TX9A 3EWUA 1OFPA 5G1YA 1TPC1 5EPDA 4GC4A 1VRDA 3KFTA 1A50A 2CLEA 1S5WA 2RKXA 1VLIA 3PULA 4FNUA 2BSLA 4PFMA 3MHFA 2ISVA 2GJLA 3OIXA 4GUFA 4OE7A 1WOAA 1TTQA 3EKLA 3F4WA 4S2CA 1SO5A 3TNOA 4CNNA 5EMUA 1TV7A 5LNRA 2GVLA 4LUJA 5HWMA 4AHOA 4MY9A 2GQ8A 3LV5A 2CFFA 2TMDA 2DZSA 4YWIA 1I2PA 4CQAA 3LBCA 4UIOA 3W7PA 4WUIA 2E6YA 1A5BA 1IIGA 1LROA 4OU1A 1FCBA 4DF0A 3W23A 2ZRZA 4DELA 3GYEA 2KZHA 4DQWA 2A2IA 2ZZ3A 1FBAA 4UTMA 2E6DA 3F4NA 3W71A 2JGQA 3N19B 4N4PA 3Q2DA 3U2OA 1UJPA 4NNCA 3LCGA 2FJKA 3JRKA 1KM1A 3FYOA 4HKPA 1F05A 1SFLA 2J9YA 1ML1A 1O95A 3L65A 2UV8G 4O4VA 3WJXA 3NQAA 4CLMA 4HSNA 3W6YA 4RK8A 1MEHA 4N6FA 4XBSA 1C9DA 4UR8A 1VGAA 3MW7A 5BMWA 3S42A 1KM3A 4O12A 4AF0A 3O6CA 3C3NA 3C2VA 3EX3A 1TPDA 4LW7A 4M6PA 2QCEA 3JR2A 4ZQRA 3RF9A 2BX7A 4UTTA 1MO0A 2CLMA 4QNWA 2HMCA 1L6WA 1W37A 2VFEA 2X1UA 5AHIA 3CLMA 2OT1A 3IIXA 3OVRA 1M7OA 3HGSA 1DOSA 1UASA 4NNAA 1XUZA 1QOPA 3QF0A 4BI5A 1FCQA 3TE9A 1N55A 1OK4A 1P5BA 4QSHA 5EBUA 1D9EA 2DJLA 2EF9A 4LVAA 3CU2A 1I45A 3EWXA 3TQVA 1LOQA 2RH9A 1QDSA 6ALDA 2VFGA 2WNNA 3N9SA 2PURA 3SR7A 4PODA 4KFOA 3TJXA 1XFBA 5F2LA 1HFBA 2VOMA 1G4EA 4QJ1A 4O1BA 4FIQA 5I3JA 5AHNA 2E5DA 1ME8A 1TTJA 4Y90A 4GNJA 1B4KA 3UWYA 4AB4A 1TJRA 1FWTA 3NQ2A 4O18A 4UNKA 5IBXA 2QAPA 3L5LA 5D33A 2QCFA 2VEIA 1NVMA 4Z08A 3O6DA 3NPVA 2W79A 2C19A 5BRBA 1F7BA 4FNSA 3L0NA 3E12A 3FKRA 1HO4A 4LS1A 4LOCA 1C29A 1GT8A 1WBHA 2VC6A 3EX4A 3KX6A 4OQVA 5LNUA 4CCEA 2I9EA 2Y7GA 4O1CA 3HBLA 3NQMA 4MZYA 3DGRA 3DFNA 3HG5A 3P81A 1FWRA 3G1XA 1P4CA 1W5PA 3O8AA 1WDWA 1IXOA 3TK7A 1AL7A 3E02A 2H8XA 2ZA2A 3RFAA 2V30A 4MZ1A 4Z0JA 3P74A 5LGXA 2PRHA 1DJQA 4RXFA 3C0JA 4H6KA 4PC8A 1H60A 4JTEA 1WX0A 4UTTC 4H4IA 2VFIA 1TRDA 4A29A 1KTNA 1QWGA 1QNVA 3V75A 1OFQA 3W1PA 3RNDA 3A22A 3DZ1A 4IMEA 5BOOA 4Q32A 4E38A 5K4ZA 3NPWA 1EIXA 3S0CA 4WZHA 5DBTA 3BPWA 3DFPA 3T78A 4O17A 2EKCA 5FF2A 3NZRA 5F4SA 1NEYA 4GUGA 5D2YA 3B4UA 5I3IA 2V2HA 2WNZA 1BEUA 3MWAA 4OGZA 1KFJA 1ADOA 1HL2A 4RR4A 4A21A 1RR2A 2A6LA 5E93A 4FX6M 1OFRA 3M7WA 3I7RA 1YXDA 1TQXA 4JNMA 3L2IA 1SQ7A 3OHIA 3S1XA 3PSWA 5F2MA 2GUUA 5U7SA 3U6WA 2YX0A 1M7PA 1N7KA 3DFQA 4X2RA 4LU0A 3HGRA 1K8YA 1R2RA 1Z41A 3FA5A 4IMFA 1B9BA 3CPRA 5J5DA 1WA3A 2C18A 3M47A 1K7FA 1ZHAA 2CWNA 2NWSA 2XN2A 1GEQA 2YYTA 5IBXC 1NSJA 1GVQA 2V5LA 2GVJA 3WK2A 3QQ0A 3T4CA 3H54A 4EF9A 4EWND 1SR9A 4Z1BA 1TSIA 1QO2A 1XCFA 2CZDA 4JDBA 3W7DA 4LC8A 3VE7A 2QJHA 3OG3A 1VC4A 4FNQA 2AQWA 1JCXA 3CHVA 7TIMA 4AWTA 2GOUA 1SW0A 4I7UA 1YDOA 4JTUA 2QDGA 2CLHA 4XTIA 3UD6A 4NX5A 2Q8LA 2Y63A 3W7EA 2TRSA 3UWQA 4N4QA 1OK6A 4K37A 3U8GA 1MXSA 3HGJA 3A21A 3GNDA 1WOBA 2V2DA 1IXNA 4FIRA 4DO5A 2X1TA 4DPQA 3DENA 3W7JA 4HIBA 2ZRWA 3N2XA 2V5BA 3NL6A 4HSOA 1Q45A 3L66A 1TV8A 2DP3A 2E09A 3HG3A 3B8DA 1J5TA 1VH7A 4R7JA 3FOKA 2WOQA 3EX1A 1UCWA 3S1VA 3EXTA 1YTKA 2ZDRA 4XKYA 4UMAA 4MFDA 3S9YA 4Z1DA 2WSQA 4O0KA 1WAUA 3QSTA 1X7FA 1TPVA 3C52A 4NUWA 1TTIA 3QJAA 3L5MA 3W2UA 1AL8A 1EUNA 2QCMA 5C5YA 2CLOA 8TIMA 3A23A 3STGA 1KW1A 2WNQA 4K8EA 3GDTA 1TPEA 1EWEA 2JK2A 1PHWA 1YDVA 1U83A 2OMAA 3W1MA 3ZS4A 3CB8A 4IMCA 3VNDA 3SSJA 1LTDA 2GQ9A 3W1AA 3G24A 1OX4B 2BZNA 3ZWTA 1VYRA 4J9JA 4UMCA 4DPPA 2DZWA 3LI1A 2A1YA 1QPQA 4AVFA 4JS3A 5I3GA 1QPOA 4RZ4A 1J2WA 3W1UA 3H53A 4GWEA 5LNSA 4LTSA 3TA6A 3KRUA 4MYXA 4FXSA 2D73A 3C2RA 2Z1BA 4IPIA 1ZAJA 3G8RA 3LXCA 1GVOA 3BLIA 4FX7A 3M41A 4CQ9A 1KLYA 2Y62A 4ONVA 4Y96A 3PBUA 4A2SA 4AAJA 2X30A 4KFPA 4ZQOA 3M5YA 4IXXA 2Q3RA 1KM0A 1LBMA 4ZQCA 1R2SA 2ALDA 3LLFA 3QQ1A 3M5XA 5DN1A 3SJ3A 2QCLA 1N8FA 1DHPA 2NLIA 3NQDA 5HUPA 4UC5A 4OHQA 2A5HA 1TV5A 3PB0A 3W1NA 5K9DA 2CZFA 3RU6A 3W7CA 1ZJIA 1XBVA 4K8HA 4M7TA 4MLRA 3IVUA 3SGUA 2B7OA 3TW7A 4ORIA 1H7RA 3PUEA 4AHPA 4Y9AA 3TAKA 3W2NA 5AN7A 5BNKA 1XDMA 3KVJA 2CU0A 3TDFA 3EEGA 3GKFA 4JTGA 3B0VC 3W1TA 3ZR4A 3KOFA 3DBPA 3YPIA 4KKXA 2A21A 5HWJA 1OFOA 3NAVA 5KZMA 4H3DA 1IGSA 1WV2A 4K7YA 3LHWA 4LRSA 2A7NA 5L9FA 5AC6A 2FB2A 4JICA 1S3HA 1DQXA 1WYIA 1H1YA 4ZL1A 4MVAA 4MOZA 3G0SA 3LHVA 2ZQ0A 2HS8A 4BK9A 1SSDA 4UTUA 2Y89A 4DF2A 4LT9A 3NPXA 1SSGA 3AO0A 1TCDA 4M5PA 3O06A 4N9EA 3QPZA 4UTLA 4IPJA 5G2HA 3EB2A 3RK8A 1K8XA 5I3KA 1OF6A 1UUMA 1JUBA 3GAKA 3W84A 1TIMA 4CNPA 4LS2A 2Z0IA 3B0UX 1YTEA 4TO8A 3GB6A 3S5YA 5G1TA 1KBIA 3UZJA 1LRQA 5HNRA 2C1HA 1H7PA 4BR1A 3IV3A 3W74A 5DY3A 4M7SA 2PCQA 1ICSA 4JXCA 3TJLA 3IIZA 1JVNA 3SIZA 3WJYA 2DJXA 1OVDA 1W31A 3KRZA 3O05A 4EOUA 2G97A 4WX2A 5F2IA 1PCKA 2ZFAA 1BKSA 1AK5A 3INPA 2DZXA 2ZBTA 3NDOA 1LYXA 2P1FA 2Q3OA 5G4EA 5KTLA 5LGZA 3S1UA 1EX5A 3BGGA 1LLZA 5DCBA 1SZGA 4XUGA 3W2LA 3LERA 3W1QA 3GR7A 3CIWA 3A24A 4O13A 4UTIA 2E6FA 2YZRA 3HQ1A 3BW4A 1PV8A 3NQFA 4CCCA 2V81A 4PTNA 3BARA 3UYCA 4N6EA 1VCFA 3MHGA 1V5XA 1NF7A 1TPFA 4JTLA 1BTMA 4E2DA 5CZJA 2QCNA 3QFEA 4QQ3A 3EWWA 5TIMA 1OX6A 3CIXA 4GBUA 1H7XA 3UQNA 2R8WA 2JBMA 4ORMA 3P61A 6TIMA 2LLEA 2Y70A 3EWYA 4QIUA 1X1ZA 2QAFA 2DORA 3W7GA 3G1SA 2WSYA 4NX0A 1GG1A 2DZPA 3R13A 1G7UA 2PRLA 5H2ZA 1H5YA 3GKAA 2CW6A 3CT7A 4NU7A 1OHLA 2H8ZA 2GVGA 1QCWA 3PAJA 1G4PA 4N2YA 1YPIA 5LNVA 1L6YA 1IIHA 3IRDA 3I65A 3GR8A 2Z6JA 4O14A 4LNYA 2QUTA 2X1RA 4NQ1A 1TB3A 2NXIA 3PUDA 4MJMA 4BF9A 1HUVA 2FFCA 4KWVA 2AAMA 5BW6A 1P0KA 4ADTA 1TMHA 3W7MA 1FWWA 1H1ZA 3W75A 1P0NA 2YFNA 3EXRA 3NPUA 4YLWA 3FEMA 4BWLA 2J6XA 2VKZG 3W73A 3PBVA 1OABA 2DZVA 3CWOX 3G3DA 2CZ5A 2YXGA 2YCEA 1GPWA 5LKYA 3GDLA 3QW3A 4RZ6A 2O7SA 3R12A 1GVSA 2H6RA 2HSAA 1YYAA 3RLUA 4AMAA 2C16A 1AMKA 4GUHA 4ML9A 3W2KA 4CNOA 4ZQPA 2XN1A 1QOQA 1T96A 3PG9A 1I2OA 1LOSA 1I2NA 4FB7A 1J4EA 2C13A 2QCDB 5CG7A 4HNNA 3M1ZA 3USBA 2JGYA 3P67A 5CGQA 1PE1A 5FEZA 1JCNA 3TW6A 3IGXA 2NX3A 3G1FA 5DXYA 3L5AA 1DORA 3NL5A 4TX9A 2H3DA 1VCVA 5D02A 3O6YX 4UNLA 3HG4A 4M6QA 5HJLA 5K2ZA 2NUXA 2ZCGA 4JN6A 5EKYA 1BWLA 2P0OA 2Z6IA 2QJGA 4K38A 4D2JA 1KFKA 1FDYA 4M6VA 1JULA 5KSWA 2EGZA 3ABOA 3THAA 4DXVA 1W3IA 5GVJA 3THQA 1ZNNA 3W7LA 5ABTA 4QM1A 3W76A 5KITA 4PEKA 2Q8ZA 4FF7A 5E1QA 3TKFA 5CZTA 4IOTA 4JEQA 1TJPA 3QMTA 1B3OA 2ZRVA 4JTFA 5FF3A 3I7QA 3OEXA 3WFAA 4DBDA 3TR2A 4QNEA 3IEBA 1RQEA 3TC6A 1HTIA 3BO9A 5A5WA 3M16A 2FLIA 1TQJA 2FPTA 5AB3A 4LVBA 3FYPA 5HINA 1EP1A 4R53A 1XXXA 3MYPA 2VEMA 4S1FA 1R46A 1VHNA 4N9CA 4K7VA 3UNDA 1H7NA 4IJBA 3B0PA 2BXVA 1XBZA 3MBFA 2XFWA 1NFBA 5C54A 3TXVA 1Q3NA 1VZWA 4FXRA 5CSSA 5AFDA 1F2JA 3KVMA 4TU1A 3HPZA 1EA0A 5EL1A 3QSRA 4RLIA 2X2GA 2E68A 3NEVA 4M19A 4DF1A 4WXYA 1TPB1 3QH2A 1GOXA 1OX4A 4BWLC 1PCWA 2WO5A 3O63A 2NUYA 1T99A 3GDKA 3LHUA 5H91A 2WJZA 4HPXA 3TC7A 3DKLA 1HG3A 1I8JA 1ME9A 1W3TA 3DKJA 3N73A 3GVGA 4LVFA 1VS1A 1JCJA 5DBUA 2NXGA 4UR7A 5CSRA 1KM5A 2Z2UA 3EWZA 5HWNA 4IGHA 1JR1A 4LV4A 2X1SA 4GRSA 2YW3A 2DZUA 1LBLA 2A7PA 1RVGA 3A9IA 3A5FA 3BVJA 3M9YA 4TR9A 2A7RA 3T7VA 2NX1A 3O1NA 4ZZ9A 2R14A 1H62A 1EUAA 5CPOA 1CI1A 1SFJA 3LCWA 1SU5A 3C4UA 2CLLA 5EA9A 3N14A 1K3UA 4RCXA 4ZQMA 2Y7DA 3ABQA 4LUIA 4MZ8A 5LHFA 1UB3A 3TSBA 1Z48A 2Y6ZA 4NJHA 1I2RA 3BG9A 4KWWA 2FIQA 2WSRA 2RHGA 3KVLA 3TUUA 4GJ1A 2TPSA 4ADSA 3MYOA 3W2JA 3NXFA 4IXHA 5K9CA 3DHDA 1VLWA 5I3HA 1VHCA 2OT0A 4L4MA 3LDVA 1YXYA 3VI2A 3W85A 1XUUA 3GXPA 3LXBA 4IMDA 2YR1A 1G6CA 4LVGA 4LS0A 4JYEA 1A5SA 1RQHA 3PVFA 4O54A 5TQLA 4EIVA 1L6SA 4IX0A 1O5KA 1ZAIA 4LWWA 2VEPA 2H3BA 4O53A 1KFBA 1WBJA 2QDHA 1W5NA 1YLVA 2B4GA 2FTPA 2PRMA 1S5VA 3K30A 3BG3A 4AH7A 3AJXA 2FDSA 2YFOA 3TCEA 4O19A 4XTDA 4S2BA 4UTHA 3PR2A 1PS9A 1Q6LA 1VR6A 3UY8A 4MFEA 4PA8A 4JTTA 5K4XA 3MBDA 3PWAA 5D2WA 1XI3A 3A5VA 3NA8A 2YYUA 2FPYA 3GIYA 3CEUA 5DLCA 3UWZA 1M5WA 2F7FA 2FQIA 5U4NA 5HMSA 3KVKA 3VKJA 3G1AA 4UTKA 5FF7A 3WK3A 3EXSA 3NQ7A 3LX9A 1FWNA 2J88A 2NV2A 3B05A 2CLFA 3VCRA 4P61A 3C2EA 3IIVA 1H61A 4KFNA 3GX9A 1QPNA 4OBTA 1OJXA 1YADA 4N9DA 3EWBX 1FY6A 1DBTA 1I4NA 3N9RA 4UMBA 2Y88A 2OX1A 3NYZA 1JUEA 3HJZA 2WQPA 3EKZA 1SPQA 3NVTA 1Z42A 4Y6GA 4QITA 3QEZA 4FNRA 4O8RA 3W1LA 1F76A 2G96A 3IGSA 3NL3A 5D2TA 4YCOA 2Y7FA 4JD4A 3LTSA 3MP5A 4WQ6A 3LBMA 3L0GA 2QJIA 4TMBA 2VFFA 2I1OA 1XC4A 1YTDA 5D05A 1L2UA 4X22A 3VE9A 4R34A 2E77A 1VJIA 1QMLA 3QM3A 1GQNA 1KFCA 1K8ZA 2VEKA 1CX9A 3BGJA 3CQ0A 3M5ZA 3IIPA 4DBEA 5DCDA 3STCA 1LM1A 3ATYA 5TBOA 1SW3A 3SFKA 5FI8A 2QF7A 1IXPA 2ZZ4A 3LXAA 1KLZA 1UBSA 4WD0A 1X1OA 1C8VA 2ZZ1A 1KM6A 2FB3A 3LCLA 4UTWA 1VQTA 3T55A 1MEWA 3R2GA 3C2FA 4O10A 2CLIA 4WOZA 3STEA 3CM4A 3P8IA 4WJEA 1KM2A 3NM3A 4Q33A 3JS3A 1L9WA 3W7RA 2F84A 2X16A 3ELFA 3P7YA 2A6NA 5DXXA 2H90A 3ABSA 2R94A 3PBWA 4HNTA 3PC0A 2CZEA 4JX4A 4QISA 1G4TA 1GG0A 3NNTA 1FCVA 1KBJA 5D30A 4UFMA 3UY7A 3W86A 2ATSA 3KAOA 3HMJG 2ZZ2A 4CCDA 4A2RA 1O60A 3TIMA 1ONRA 3N34A 1TTPA 2W0UA 2W6RA 3S5ZA 1NAL1 1VYPX 2E1DA 2DU2A 5HULA 3I6RA 1G7VA 3HO8A 4A22A 4O52A 2RDWA 4JYDA 3UXAA 2ZTKA 1SZEA 3GK0A 2Y61A 2QCDA 2ZYFA 3ANYA 4RX0A 3L0KA 5LSMA 3O15A 5AYXA 1PVNA 3DHFA 1KV5A 4YXGA 1FX6A 3W88A 5FEPA 4NZFA 3QW4B 1BWKA 1H50A 3DFOA 4MIMA 3UXDA 1ZFJA 1QAPA 2V0TA 3B03A 1KTBA 3W1RA 3WJWA 4JTIA 2E6AA 5D2XA 4HT3A 3NZ1A 3LTPA 3O07A 4Z1CA 1P1XA 2J9XA 3PF3A 4GFSA 5K3VA 2PE4A 3L67A 3CC1A 4WY0B 3E0IA 2C15A 1G69A 4YMZA 1FXQA 4Q4KA 2ZRUA 4IQLA 5AHEA 3DU0A 1IF2A 3O16A 4RXGA 3G3MA 3M43A 2NUWA 3LOTA 3TH6A 1D3GA 1ME7A 4YL2A 3MJYA 1O4UA 4DEFA 3UWWA 1O94A 1H63A 5J5RA 1LBFA 3TMLA 4HN4A 4UTWC 4U28A 1LRNA 5CPNA 4I7VA 4QAIA 2VFHA 5FESA 1DVJA 1RQBA 3FKKA 5C2XA 4CQ8A 4G1KA 3BW2A 4K6AA 5G5IA 1PHQA 2A85A 3FFSA 1FQ0A 3HPXA 1X8FA 3DFSA 5FEXA 2VELA 3UWUA 3G18A 3H55A 1X6UA 1OFAA 3IGUA 3MHUA 5HR7A 4HPJA 4P2VA 4HNVA 1K7XA 1I2QA 3G22A 3P80A 3TU9A 2E5BA 4Z1AA 4RV8A 4ZMGA 3GNNA 3HGOA 5KZDA 3Q58A 3W07A 1QPRA 5G2WA 1ALDA 1F6PA 4MPQA 4O11A 1PIIA 5F4WA 3RLVA 1TO3A 3DI0A 3G1VA 2YPIA 5AYZA 1T8XA 3SI9A 2GPTA 3W87A 5FF0A 3OBKA 5D03A 3F03K 3IVTA 5CZSA 1KTCA 3PSVA 3MP4A 4E2BA 1S5TA 5D09A 1NF0A 3ABRA 3QRHA 4WOQA 4JYFA 3HIJA 1THFD 5K7JA 3LM7A 1W5QA 2NZLA 2WPBA 3C2OA 3NOEA 3W7QA 4MLJA 3LHYA 1K02A 3NG3A 4FNTA 4PCFA 3MO7A 1JRBA 4JR5A 3TFCA 2OJPA 3LHTA 3S8HA 5AC7A 3IVSA 1B57A 3S5NA 1V7YA 2G95A 1LORA 3GDRA 1DQWA 4AXKA 1VYSX 1RZMA 1JCYA 1OYAA 2IQTA 1GVRA 2HTMA 3W83A 2V8ZA 1EP3A 4WY0F 2QCCA 3GLCA 1EB3A 1VPXA 3NM1A 1FDJA 1YDNA 3LCFA 5E0KA 1Q6RA 3E9AA 4N9BA 5DCEA 3NQ8A 1KFEA 1AG1O 1JCMP 3W9ZA 1T0OA 5AHLA 1OYCA 3DAQA 3NGJA 5D04C 5D38A 4DO4A 3LRLA 3NQVA 2V82A 1LRTA 1WQ5A 1ZAHA 3PM6A 3W3OA 4XZ9A 5KMYA 4AWSA 4ADUA 2J9ZA 2ZRXA 1B4EA 3W7KA 2QUVA 3MUXA 3P5ZA 2RFGA 3P62A 4JIPA 3Q37A 3KRSA 5CKSA 1YXCA 3KXQA 3UPBA 3MI6A 4JIQA 1MEIA 3LCIA 1MZHA 1LDCA 4TIMA 2ZZ6A 5AHFA 4O0ZA 5IM51 4O1DA 3OVPA 3TQKA 2Y7EA 1GYNA 4NXSA 1RV8A 4MY1A 4DO6A 1EWDA 3GDMA 3VFLA 3MP3A 3NQGA 4X9SA 1ICQA 4JTJA 2G5WA 5D32A 1GJPA 3STFA 1D3HA 1GZGA 4RJEA 1M6JA 5KZEA 1TPWA 1F5ZA 4GUJA 3RMJA 2ZRYA 1DL3A 3W7OA 3M5VA 4Z0SA 3M0ZA 3NR0A 3FJLA 2QKFA 1PL9A 2B7PA 1TYGA 1VCGA 3LLDA 3N2MA 3TQ0A 5DELA 1W5OA 2A0NA 3LCXA 4RKAA 2I14A 4PH6A 3BV4A 1XM3A 2AGKA 2TSYA 1OFBA 4POCA 1W1ZA 3TMQA 1Z44A 5LHEA 5MHBA 3W70A 1A5AA 1KM4A 1FWSA 3LCHA 4AEOA 5HR6A 2B7NA 4IMGA 4W9TA 1SO6A 3TAOA 3BLEA 4UFLA 1W3NA 4UFIA 4E0CA 2WKJA 3QZEA 3I68A 2NWRA 3LGEA 2QUUA 3QMRA 3Q94A 3G0XA 3OVQA 4NJJA 3GAYA 2ZZ5A 1OYBA 2Y85A 3L68A 4NJKA 1R2TA 4GUIA 1CW2A 3UPWA 2JKAA 3PY2A 3UWVA 4GXMA 2RDUA 4FX8A 1WXJA 4TMCA 3FJ6A 1F73A 3BW3A 2QEZA 1JQXA 4WXZA 1W8SA 1H7WA 2ZTJA 3F1QA 4NVTA 3LI0A 4A3UA 5LZLA 2C14A 4JTKA 3LHZA 4OWGA 2BLEA 2C0AA 1LCOA 1QO5A 4FNPA 3QPYA 5C6MA 3I7SA 3C56A 1FCUA 5A8GA 3WK0A 1GTEA 1LOLA 2V2CA 4R33A 3WJZA 3SY5A 3G0UA 3EX6A 4LVDA 5C55A 5FF4A 3WJSA 3W7HA 5KINA 3GXNA 3R89A 4AF0B 1AW2A 3P84A 5BMXA 3LB0A 3M6YA 2EAWA 3E96A 4O1AA 3HOJA 1AW5A 1ZENA 3GZ3A 2V9DA 3PS7A 3PB2A 1OG0A 1EPXA 2VFDA 4ALDA 2HS6A 1KA9F 1SO4A 2B7QA 2ZA1A 2R91A 1A5CA 4MJZA 1Y0EA 3QYQA 3D0CA 2FPVA 3SZ8A 2JKEA 2QR6A 2E5CA 3W1XA 4YCPA 3R5EA 2EPHA 4BI7A 2XN0A 4I9AA 1W54A 5FEWA 1G67A 4ZVJA 4MKNA 1XKYA 1ZALA 3TXZA 1W0MA 3QMSA 1OX5A 3N3MA 3NL2A 5AYYA 4NXKA 2BTMA 3NQ6A 2B0MA 5AOUA 4O15A 2YGYA 3W72A 3HF3A 3G1DA 1H7OA 4O4WA 4OT7A 2VXNA 3MMTA 4UTJA 1DKWA 3G1HA 3C8FA 1R30A 4UXDA 2J24A 3PBYA 4NT0A 5LNWA 1AW1A 2NV1A 2YDAA 3CWNA 3BLFA 4FEZA 4MUZA 4JY9A 2ATMA 4WY0A 3T44A 4MY8A 5DY2A 1G4SA 3HG2A 3TSDA 5D37A 3E49A 1XL9A 2BWGA 4UFKA 3P5YA 4MYAA 2ZZ7A 2QCHA 4I7WA 3MI3A 4O50A 1OFEA 4NJIA 2QCGA 1U5JA 3TFXA 5D2VA 5CPMA 3DH7A 3GXTA 5T26A 4XQ6A 1JQVA 4UCGA 4N02A 1Q6OA 4X3ZA 5F1UA 1GYLA 5EYWA 3CEPA 1RD5A 1UUOA 4AHQA 3BK0A 4ICNA 4LC6A 1IXQA 1OF8A 1O5XA 3DFTA 4JY8A 2GJNA 1ZCOA 4UUIA 1QR7A 1DV7A 1LLWA 3ZWSA 3V1PA 4PL1A 5EY5A 3G1YA 3LRMA 3NQCA 1EEPA 1F74A 4K36A 4JGDA
chains in the Genus database with same CATH superfamily
3C6CA 1RCQA 2Z1KA 2OVLA 5C9XA 1VFHA 3NQEA 1WDRA 2W66A 2WLZA 3KL0A 3L21A 4QAWA 1ODZA 1Z8AA 1TPH1 5F1VA 3ZFHA 4IX2A 3B06A 3S6DA 1DJNA 3IANA 2B31A 3A13A 4QG9A 1PXGA 3GQYA 3FLUA 4GYPC 1POJA 3QTPA 1RBLA 2CKRA 1SO3A 4HTYA 4NJGA 5D8ZA 5HQEA 4OUEA 1SZFA 3W24A 3TV8A 2WV8A 3UJEA 3HFTA 4D6FA 3RLGA 1LP6A 5CAKA 2QJJA 4LJ3A 1EP2A 1Q4WA 1IQ8A 3VGEA 1E56A 4BFAA 2ISSA 2EHHA 2HNEA 3HPSA 5C7HA 3PPGA 3KDNA 5MF5A 4O57A 3U7VA 2PTYA 3MY9A 2ISWA 3S1WA 5A6AA 3E5BA 2JKPA 1C93A 1BXBA 1L0PA 1D8CA 3GUWA 1F6KA 3IGHX 5I5RA 3NGFA 1NWUA 2PGRA 4HYRA 3TSMA 1XBXA 3VVGA 1A53A 5I77A 3GBDA 1JXJA 3WEMA 4HZ8A 1ZZMA 5CZ0A 2GDVA 2R1LA 3F5JA 3WH5A 1VENA 1DTNA 1MSSA 4Q8VA 4LAKA 1H51A 4C1KA 2ZA3A 5F2GA 1YMYA 2NLYA 4DWSA 3P82A 3H7UA 3U7BA 2AAAA 4PMOA 4K39A 5SWUA 2PB1A 3PZQA 5HUOA 1ISWA 2CITA 2WCSA 3FS2A 3BG5A 3GC4A 2YOCA 2QPSA 3MI2A 2VL4A 3P8JA 1R47A 4JN7A 3T40A 2PWDA 2DH3A 3AQUA 4MAZA 5EPDA 3UCQA 3TN5A 5FJUA 2J8TA 3AMDA 3NOYA 5AY7A 1OCJA 3EOOA 1C92A 1S5WA 3DERA 3OZYA 3RR4A 3QXBA 3PULA 3DIPA 4FNUA 2BSLA 3WF0A 3WD2A 4PFMA 4FLRA 3UVIA 2GJLA 4YTQA 2J7DA 3OIXA 4GUFA 3F4WA 4E2VA 1M65A 3TEVA 2Q8XA 3TNOA 5EMUA 2GVLA 3BURA 3RU8X 4MY9A 2GQ8A 3ARVA 4YWIA 2AMXA 3W7PA 2HJPA 4WUIA 2E6YA 1LROA 3GNXA 2D2JA 2ZRZA 4DELA 2J7CA 2A2IA 1FBAA 1YHTA 4B3LA 3W71A 3N19B 1E3ZA 3MCMA 1PDZA 2FTYA 1VF8A 1F05A 2VX4A 3CL7A 4ATLA 3KLKA 1E6NA 4WKFA 3WF2A 5DO8A 3WLIA 4PZVA 3BLOA 2UV8G 1JIBA 5I02A 3QY8A 3SM0A 3WJXA 4HSNA 1FP9A 3W6YA 3U4FA 1MEHA 4CN1A 1C9DA 3T8LA 3VOCA 1EBHA 1Q7QA 3H2NA 3WLSA 4LW7A 1XIHA 3W6MA 2PDCA 4ZQRA 3FJ4A 3FY1A 4DWSC 3SDOA 3WDPP 2NVCA 2GK1B 1I1XA 2PDUA 2HMCA 3VIKA 1L6WA 2VZVA 1UZ4A 2VFEA 4V15A 3BLKA 2YL6A 1M7OA 1IZCA 3CUZA 2WC4A 3C0SA 3SCPA 3TE9A 7CGTA 1N55A 3I4KA 4M80A 4QSHA 4JQ3A 1UOZA 4H8UA 1JI1A 2EF9A 3CMGA 4D6DA 1KGWA 2PDGA 1OD0A 4H8HA 4YHGA 2PURA 3CV6A 3VO0A 2R1PA 5DMMA 8XIMA 1OT2A 4QJ1A 4O1BA 5I3JA 4BQ3A 2HXTA 4GNJA 3CZ8A 2PWGA 1B4KA 2BVYA 3NQ2A 2XUCA 2QAPA 2QGYA 3L5LA 5D33A 3JVAA 4Z08A 2HVNA 3NPVA 4X63A 1CGWA 2VUNA 3AXIA 3DCPA 4JKMA 3FKRA 3B8WA 2VC6A 2RGMA 3EX4A 3TYUA 3A4XA 2QMJA 3F7JA 1P0BA 3KX6A 1YKWA 2ZX6A 5LYRA 3AMGA 2Y7GA 3HBLA 3NQMA 4KERA 1ZBVA 3DGRA 3TONA 3HG5A 3E0FA 3USZA 1IWBA 1WDWA 1IXOA 1AL7A 3VIIA 2C71A 2WNWA 4PTMA 4W7WA 1RJPA 2UWFA 4HMCA 2PRHA 4RXFA 1XSIA 4C7DA 4CVUA 2OO0A 4A3RA 2VFIA 2QNEA 3WKZA 2NT1A 4LPCA 4A29A 4DZHA 2XFRA 3KBVA 1GVYA 3GD6A 3VDHA 3WUBA 4Q32A 3KCLA 1CLVA 1EIXA 1G1YA 4KEZA 4QXIA 3UJ2A 3T78A 3L23A 3DFPA 4PMQA 1FKXA 1NDVA 3DG6A 2VDGA 1BEUA 4NF7A 4PUUA 4A21A 1DWIM 4IQDA 4PRRA 1XPYA 2WMFA 4F3HA 3GHUA 3R8GA 3WX7A 3M0KA 1SQ7A 4HN8A 1DXFA 2VR4A 4IT1A 3WLLA 4MM1A 4GY1A 2C79A 4IMFA 1P7TA 3CPRA 4KBXA 5J5DA 1RALA 3E74A 2XVNA 2P88A 1K7FA 2NWSA 3POHA 4UQ9A 1GZJA 2XIIA 4WJXA 2XN2A 3O0FA 3GHSA 1XLGA 4XD4A 3JW7A 2V5LA 2GVJA 3WCZA 4Y9PA 1DWJM 1QOXA 3WK2A 2RDXA 1PUDA 4EF9A 4YVPA 1SR9A 3AALA 3S9IA 4JDBA 2QJHA 1VC4A 1JCXA 1JZ6A 3NCOA 3BV7A 1ZS2A 1BVWA 3QGAC 2CLHA 1U2YA 4NX5A 3WY1A 2Y63A 4L9XA 2V5KA 4IJRA 1T40A 4N4QA 2JIWA 3HGJA 1MQQA 1WOBA 1IXNA 1R7AA 1FP8A 2XM1A 5HQLA 1TE1A 3DECA 2YDSA 2DP3A 1ECEA 1WAWA 4L4PA 4FA3A 3ALFA 4ZO7A 3FOKA 2WOQA 3EX1A 1Q8JA 3UR5A 3WBWA 1XYAA 3EXTA 1YTKA 4XKYA 4CD7A 1BYAA 3GTHA 3QSTA 4ACZA 2DSVA 3QJAA 3VUPA 1EUNA 1WZMA 1HL8A 1DIEA 4KT2A 5LIWX 5BCAA 3HPFA 1KW1A 2WNQA 4C90A 1JZ2A 1FHUA 3GDTA 4D8AA 2UY2A 2OMAA 3UESA 3CB8A 3G24A 1A3WA 1OX4B 2O9TA 3VOHA 3FDKA 2BZNA 1UP0A 1VYRA 4J9JA 5EMLA 1V93A 1EHAA 3MB9A 2FMOA 2DZWA 2A1YA 1JYNA 4RZ4A 2HEJA 1ISZA 5BROA 1J2WA 3VIJA 3W1UA 3ZR6A 3UJRA 4NZCA 3PTKA 4FXSA 4IPIA 1ZAJA 4G7FA 1GVOA 4HU8A 4CQ9A 4OECA 2Y62A 4Y96A 4KFPA 4IXXA 2E8YA 1MW2A 1W9PA 3GG7A 3BDKA 3LLFA 3N11A 5DRIA 5A6JA 1K9DA 4IFRA 1V8EA 1H0IA 1W6TA 1XIJA 1QK2A 2CZFA 4DO7A 4MLRA 3P93A 4LYRA 1HL9A 4ORIA 4L6DA 3CAKA 3Q65A 1G5AA 4ZXOA 2E9LA 3W2NA 3FJNA 2TODA 5A6KA 2AMGA 3TDFA 4C60A 2JEQA 1ADDA 4JTGA 1OBAA 3ZR4A 3EYPA 3LD5A 4S3KA 4CGTA 1IGSA 4ATWA 4V27A 3LU2A 2D69A 2ICSA 3CHDA 3R0KA 1YNYA 1GOIA 2WYSA 3DC8A 5L9FA 4NZ3A 3UR7A 1QNQA 4AZGA 1EJRC 1XD1A 4RNJA 1TIWA 5J04A 1WYIA 3FA3A 1H1YA 4H8NA 1QU4A 4S3EA 2ZQ0A 3ZVHA 1BG9A 2HK0A 3KM8A 3AO0A 1J8VA 4DBSA 1GJUA 4MWAD 4IPJA 3N12A 3F4DA 1OF6A 4F2UA 4H01A 3NO3A 1TIMA 5LXXA 2PTZA 2XZ9A 2W3ZA 2C1HA 1OWQA 4YPJA 3W74A 3M07A 4JFTA 1XICA 2PCQA 4JXCA 1GCYA 3TJLA 5FD0A 3IIZA 3OB8A 3WUEA 3OQEA 3SIZA 1VIZA 1OVDA 1W31A 2OSXA 1E6SM 3QKEA 3N18A 1QI0A 1QHOA 4NYYA 1PCKA 4JKKA 2J62A 3NJ3A 4EX4A 1AK5A 3INPA 4PTWA 5G4EA 5KTLA 4Q8PA 1O5RA 1YBQA 1SZGA 3MTWA 4XUGA 3W1QA 3CIWA 2ZICA 3UA4A 4MSSA 1GQLA 3WH9A 3ANUA 4O13A 2FYMA 4UTIA 3QHOA 2PDLA 2PDFA 4P5UA 5E0FA 3BW4A 2V81A 4PTNA 3BARA 2Y1HA 4N6EA 2DFAA 1H3GA 4B3KA 4JTQA 2NVAA 3VOGA 4E2DA 4DAIA 5CZJA 4GVHA 3QFEA 4K1GA 3CS2A 2G0WA 2CBIA 3CIXA 1H7XA 2R8WA 2JBMA 4FSAA 4ORMA 6TIMA 5C9ZA 3EWYA 3ZJ7A 2QAFA 3QBUA 4S3BA 1C9WA 3G1SA 3R13A 1G7UA 1BVNP 4NU7A 2HWGA 1OHLA 3GRIA 2Z1XA 1PX3A 2NQ9A 2IS7A 5LNVA 2PDQA 3H4WA 1IIHA 4HGXA 4A3HA 1QT1A 4O14A 3NVDA 2NXIA 3EMQA 4MJMA 1O7AA 1CT5A 4MJ4A 3FXYA 4KWVA 3VDBA 4L9ZA 5BW6A 4ADTA 5BXTA 4DI8A 1WKDA 4YLWA 5EMYA 4B5UA 2VKZG 4IMAA 3MPGA 4AUBA 4UQEA 2CZ5A 2HPMA 4IL0A 1I6NA 2YCEA 3TOPA 1CLKA 5LKYA 1EX1A 1K8CA 3GDLA 3ITGA 5EBAA 2VO5A 3R25A 1GVSA 2XHYA 3H21A 2C16A 1Q66A 3CAQA 4GUHA 1UWTA 2Z25A 1B31A 4IG2A 3OW1A 1LF1A 4FB7A 4U5KA 1J4EA 2C13A 2WKGA 3KP1A 4HNNA 2OEMA 3P67A 1JCNA 2PUZA 1R86A 2H3DA 1VCVA 4ERIA 5D02A 4C6NA 1YPXA 2Y8UA 2YCKX 3HG4A 5HJLA 4MB5A 3GM8A 1W9DM 2RJHA 2QJGA 2DH2A 3VKCA 5C7VA 2EGZA 3ABOA 4DXVA 3THQA 4D8ZA 4DN1A 1TWSA 1ZNNA 5CAHA 5KITA 1VFUA 1AJZA 2A3LA 3TKFA 5CZTA 4IOTA 1XG3A 4Q8UA 1B3OA 2X42A 2ZRVA 4JTFA 2PP3A 1EOKA 2RGLA 1CWYA 3TC6A 4D6HA 2JFEX 1TQJA 4OFCA 5AB3A 4LVBA 4RE4A 5HINA 3MYPA 2PI6A 5C9UA 4JN8A 3UNDA 1EDQA 3R43A 3UYIA 4J3ZA 4RDZA 4LALA 3MSGA 4C6KA 3N25A 3BZJA 5JQ9A 1V6VA 1UZHA 3QLDA 3O7UA 3NEVA 2E68A 3VABA 1TPB1 2X7VA 1MW1A 3ZLHA 3SN1A 3AXMA 4XSMA 4L6OA 4LX4A 3GVQA 1ME9A 3BC9A 3GVGA 1HN1A 1Q63A 4G9PA 3PNZA 1VAHA 1XIMA 2XPKA 3EWZA 3GC5A 3CASA 2WVVA 1XQLA 1JR1A 4YTSA 2YW3A 3SCSA 3ZJKA 1ZBCA 2ACQA 1E0VA 2HV5A 4Z2JA 2EXOA 4ZZ9A 1H62A 4S3AA 4GIRA 3NQBA 5CPOA 1P6CA 3M6DA 1SFJA 3LCWA 4B3ZA 3C4UA 5GJNA 4W87A 4LUIA 1UIPA 1PWMA 1I2RA 5D8WA 3KP0A 1TZ7A 3VGFA 2WSRA 4ML4A 2GL5A 3E2RA 4GJ1A 4ADSA 4MJ2A 3DN5A 2OGYA 3MKVA 1T6MA 1OC5A 1VLWA 5I3HA 3ES8A 3GFZA 2OT0A 3T0CA 3VI2A 1DWAM 2XSAA 2WVUA 4IMDA 2OQLA 1WKYA 1VD6A 1PSCA 4X9YA 4XD3A 1GW9A 4J2PA 5EMJA 2BGNE 1UH4A 4KIEA 1F4AA 1O5KA 1ZAIA 1S2UA 4LWWA 5FJOA 2DGAA 1YE6A 5BRPA 5AC4A 1W5NA 3KOXA 2VURA 4QRNA 2YFOA 4O19A 4QQUA 4AMCA 4CU8A 3PR2A 4H83A 4MNMA 3EAUA 3MMUA 3SEPA 4AD3A 2PLCA 5H8UA 3CEUA 3AIEA 3UWZA 4LB3A 4DM2A 5U4NA 4V28A 4UTKA 3A3WA 1X6LA 2FMNA 3EXSA 3GNPA 3GU9A 2E7FA 2X05A 3B05A 2ON3A 1EL3A 3GO2A 4KFNA 1MUMA 1OJXA 1CLXA 1PWLA 4N9DA 4QLKA 2DQWA 3EWBX 1FY6A 1I4NA 4UMBA 3ALGA 1RCXB 1WDPA 1R85A 1Z42A 3CL6A 4Q6JA 4QITA 3QEZA 1EYEA 4O8RA 1TJ0A 1XIGA 4YTUA 3NL3A 2A3EA 4BEUA 1EQPA 2Y7FA 1YIXA 1JZ8A 5FL1A 1BWVA 3LBOA 2OGJA 3LTSA 4ES4A 1L2UA 3L4YA 2E77A 1VJIA 1Q6FA 1K8ZA 1ZUAX 1CX9A 1YRRA 4HOWA 1WO2A 3REQA 3P14A 1PTAA 4J3UA 1T5AA 4ZTXA 1SW3A 4QJ4B 5MKGB 1IXPA 4ZODA 1X98A 1X1OA 1EF2A 2FB3A 3WFZA 1N8IA 3LCLA 1XLEA 4WOZA 4TX6A 3P8IA 3NFUA 1XDJA 3AMKA 2F84A 1XC6A 3P7YA 2VZOA 1RY0A 5CC5A 5DXXA 2FVMA 4D1JA 4NAFA 2R94A 1MXDA 5A2CA 4JX4A 4QISA 3P0WA 4JCMA 2D0GA 2BVTA 4H7ZA 1G0CA 3W86A 2ATSA 3KAOA 3HMJG 3V5CA 4PB4A 4X60A 1O60A 1TTPA 4PMUA 4AZIA 1E4NA 1NAL1 3LNPA 3W27A 3WQ4A 1U1JA 2Z1SA 3W4RA 4F0HA 4O52A 1NY1A 4P7QA 3TTSA 1SZEA 4PCPA 1KXTA 5AYXA 3DHFA 4YXGA 3RM4A 3UCDA 4HCDA 3W88A 1TUXA 3QHNA 1IR1A 3QW4B 1H50A 3S2CA 5BXPA 1ZFJA 4YJ5A 1QI5A 4MPKA 1FOBA 1A47A 4UQAA 5D2XA 3I4EA 4XO7A 2PE4A 4XSLA 3V0SA 4GX9A 3KHDA 3R1ZA 1G69A 4KWOA 4YMZA 1CXHA 2IXUA 3AZTA 1TWWA 3E38A 3O16A 4XAFA 1ME7A 3MJYA 2VEGA 3H2CA 1O4UA 1JZ7A 1H63A 4P8WA 2A3HA 4G2DA 3VIFA 4LUSA 1RQBA 4MGGA 1VBRA 3EDFA 3FKKA 4G1KA 3VD5A 4K6AA 5B7ZA 1FWFC 2A85A 4QX4A 3FFSA 4A8RA 3H6OA 1X6UA 1OFAA 3KOZA 4HPJA 3TNBA 3TU9A 2INEA 4RV8A 3HGOA 1L8NA 3AIUA 4MPQA 4O11A 1NFPA 4GQBA 4A35A 1E40A 1TO3A 2VZSA 3G1VA 1A5NC 5AYZA 3F03K 1DJGA 5CZSA 5D09A 4YWSA 2NQLA 3T0BA 5XIAA 4W88A 3A3XA 4AZBA 2OFJA 2G3JA 1JPDX 1BYBA 4WGHA 3MO7A 3URBA 3EA3A 2WZHA 3B8SA 1N82A 1AMYA 3EMZA 2R6OA 3PNUA 3IVSA 3TTYA 2V3EA 1RBAA 4Q4MA 1E0WA 3GDRA 3U3HA 3KBMA 3FK4A 2REQB 2Z2BA 3MJMA 2IQTA 3OG2A 3M46A 1VIWA 3N2TA 2Z28A 1A5LC 1V3LA 3CQHA 1KRCC 2QCCA 3WL0A 3QGVA 3GXMA 1Q6RA 3E9AA 1FWDC 1KFEA 1AG1O 5M3WA 3AIBA 5AHLA 3FSUA 1S5MA 4DO4A 2B81A 3NQVA 2V82A 2BBFA 3ORWA 2I16A 5JVLA 1W9UA 2DY3A 3LENA 2J9ZA 2GGIA 3MUXA 1CGTA 2RFGA 1QUMA 4WR3A 3KRSA 1YXCA 3UPBA 4L9YA 2WAGA 3C8NA 1U33A 1Y8BA 4E8DA 4TIMA 1BRLA 4Q4SA 5IM51 5KETA 2WHJA 3TQKA 3LYEA 3ABXA 2Y7EA 1A49A 1GYNA 3CUHA 2PU0A 4MY1A 4HJFA 3WQCA 1EWDA 3CAVA 3GDMA 4MADA 1XIFA 3MP3A 3V4BA 2PC8A 2GVEA 1A4MA 1D7FA 3B9EA 1J10A 3MVIA 4RJEA 4ROPA 1HW6A 3IWPA 4LUSB 4GUJA 3RCYA 3RRXA 3FJLA 2OZ3A 2B7PA 2QKFA 2ACSA 1VCGA 4XZHA 3CJPA 5A8MA 1XM3A 5I24A 2TSYA 1OFBA 1K4GA 1Z44A 1FWSA 1E0TA 3FVMA 3ZSTA 3U2CA 1EO5A 4LUTA 5E5CA 1W3NA 7ENLA 3ZMRA 5E0CA 1XGEA 2D3LA 1PB0A 2CWXA 3GAYA 3RILA 1E73M 3L68A 4NJKA 1CW2A 2V63A 1ZCCA 1GKQA 1S2TA 4GXMA 2RDUA 2EG8A 3FJ6A 5TAOA 3AS2A 4AVOA 2QEZA 3ME3A 1JQXA 2AL1A 1H7WA 4B4HA 4WRHA 3OYXA 3B9OA 2C14A 3UU0A 3V7PA 1F3WA 2OO6A 3BJSA 1BKHA 3B9NA 5FAGA 4QBXA 4OWGA 3KLLA 3E0WA 4WSKA 2CHNA 2ODOA 4F8XA 2J4GA 2BY2A 3I7SA 3C56A 1GTEA 1C8XA 5EGRA 3WJZA 2QXWA 3SY5A 3UJSA 3EX6A 3A64A 4XG1A 3RJXA 3UZWA 3AXHA 1RP8A 3W7HA 1P0EA 5KINA 3R89A 4AF0B 3FNDA 1LL4A 4DHGA 4O1AA 3IJDA 1ZENA 3PS7A 1EZWA 1DTUA 3PB2A 1VFOA 1EPXA 3WMSA 1DE6A 3AYTA 2OKOA 4DI9A 1KA9F 1SO4A 1Z89A 1A5CA 4B9ZA 3WQOA 1Y0EA 4HK7A 2E5CA 1PPIA 3R5EA 5CJNA 1CXIA 2YBTA 1RH9A 3WH8A 4W89A 2XN0A 4I9AA 1G67A 4MKNA 4GI6A 1EXBA 1GONA 1GOMA 3N3MA 4HOXA 1W3LA 1V77A 4O15A 3W72A 5I09A 1CGVA 1J0KA 4LF2A 1KB3A 3PPFA 2ALRA 3QV9A 1MXGA 4UTJA 1V3MA 5A8OA 3OGRA 4NT0A 4KH2A 3CWNA 5H8PA 4JY9A 4R9XA 2ADAA 2ATMA 2EG6A 3T44A 1XF0A 2D2OA 3S2JA 2H9AB 5D37A 4JIEA 3TN6A 4UOZA 1AUSL 2FHFA 4FR6A 3HQNA 1SJCA 1ISVA 1OB0A 3RXZA 1XHGA 3OU8A 4MYAA 3CQIA 1NP0A 1U5JA 3GXTA 5T26A 3VM7A 4XQ6A 3CPUA 3IS4A 3N13A 4UCGA 4N02A 3AHVA 1N2VA 4AHQA 1E9IA 3BK0A 4ICNA 1AJ0A 2VM8A 2WM1A 3DFTA 3VILA 4NL1A 5HNNA 1ZCOA 4UUIA 5I78A 3FW6A 3ZVIA 3QY6A 2YL8A 4W7VA 5JBEA 2VEFA 3V1PA 3FV9A 3TCSA 4B2DD 3BAYA 3IJ9A 1HX0A 5CPQA 1BXCA 3LRMA 2PDKA 3TN3A 4K36A 4JGDA 2PC4A 5DEZA 1JJKA 2P5NA 4EF8A 2P10A 2BG5A 1OCQA 4Q8TA 1XDLA 4B5XA 4GE8A 6REQB 3P3BA 4FHAA 3U5YA 1TREA 2OLSA 1IT0A 2VD8A 3XISA 4O16A 3R11A 4LV9A 5AC8A 4OV9A 4TVDA 1ICPA 2CLKA 4ZQNA 5BXRA 5HK4A 3P60A 3OIHA 4Y7EA 4Y2WA 1VFFA 3MKCA 3ARRA 1R8LA 3ZLGA 1BQGA 4GD0A 2R1NA 5E6YA 4HU3A 3WNMA 2TYSA 1IWAA 2QPUA 2UBPC 1K6AA 3SCUA 4KEUA 1WP6A 3PUOA 1DIDA 1FUYA 4LY8A 3AZRA 1GVFA 4UFJA 1EO7A 1E3XA 3LPFA 4F0LA 4IUOA 3U2EA 3V1HA 3GXFA 1GWJA 1MRQA 3M44A 1M7JA 2HE5A 1Q6QA 2DZTA 3VPLA 3KCJA 2ABAA 1ITXA 4RZ5A 4GQRA 3H7RA 5IHRA 3KUMA 3MV11 1V51A 3C61A 3EOEA 3FVDA 2J27A 1US2A 1LZOA 3QC3A 1MW0A 3GU2A 4GKTA 2FHBA 1M3UA 3WEZA 2ZUMA 2C3ZA 4KEMA 3B9AA 3GFXA 2XGZA 1JCLA 3QY7A 4PTXA 1TPUA 2D20A 4A3YA 3VCNA 4L5ZA 1FHVA 4XVEA 1FXPA 1UR0A 4MWAA 5I0DA 4J1OA 2Z1VA 3JUGA 1CNVA 5G2IA 4V2XA 3SRDA 1TCMA 1F3XA 1RHCA 3IV8A 2A4AA 4Q6XA 1UKPA 3FX4A 4HHPA 3WF3A 2G8ZA 3SUUA 3NSXA 3PG8A 3SGZA 1V0MA 2C7FA 1C91A 2HISA 3L4VA 1DIOA 1CIUA 1KV8A 4Z2KA 1JRCA 1W56A 1H2JA 4FO4A 4WJ8A 3TX9A 1OFPA 1TPC1 2GGGA 1OC7A 3KFTA 1A50A 1E6XM 1IEQA 2RKXA 3H70A 4IICA 1EXPA 5FACA 4IZGA 2CYGA 2AKZA 1M1BA 3GXIA 5FJJA 3MHFA 2WMKA 2ISVA 1HQTA 4AEFA 4C1NB 1JZ4A 3SCWA 3ITXA 4HCHA 4I9JA 4LUJA 4QEHA 4AHOA 4UBPC 4CQAA 4UIOA 2OKTA 2ISFA 1A5BA 2BMBA 5CJ5A 3GYEA 2NQZA 1ZPTA 5AVNA 4UTMA 2E6DA 4YTTA 3URAA 2JGQA 4N4PA 3Q2DA 1NWRA 4NNCA 1R9YA 3LCGA 2FJKA 3WIJA 4HKPA 1UG6A 4H6QA 2J9YA 4WKAA 4C5ZA 3BCJA 1ML1A 2XU2A 3QVQA 4B91A 2QYGA 2FZ8A 1MUCA 4RK8A 3AHZA 1V02E 2FH8A 4IIGA 7XIMA 1VGAA 1RSCA 4XAPA 3ZYZA 3CQJA 2D3NA 3S42A 1KM3A 4JEJA 3WH6A 4IIBA 4MWAC 4YN5A 4M6PA 3JR2A 3WBAA 3RF9A 3EOSA 3KZSA 4UTTA 1MO0A 5DANA 2QV4A 3QLLA 3TYDA 1R9XA 2GZXA 1W37A 2X1UA 2NVDA 1WUFA 3QFWA 3E2VA 1MFUA 2PU1A 2OT1A 3B3DA 3UFYA 4DZIA 3HN3A 1JPHA 4NNAA 1QW9A 1QOPA 3QF0A 1GHRA 4RW3A 3N6HA 1D8WA 4NI3A 5EU9A 3GUGA 3QHMA 1R3YA 2JF7A 2WWCA 4G5DA 5LA1A 4LVAA 4XZLX 2RH9A 4O0QA 3OOQA 3GG0A 3DESA 4HK6A 7REQB 2VFGA 3RHGA 3BL3A 4PODA 1V6TA 3ZLFA 1XFBA 5F2LA 1HFBA 2VOMA 1D3CA 3F4VA 4FIQA 3WLHA 5AHNA 3LG3A 2F8QA 2VRKA 4P7RA 3VC5A 1MNZA 2PA6A 3EDKA 4IIDA 1TJRA 1FWTA 4UNKA 1BGAA 1LUCB 4OTKA 4S3DA 1UPMB 3O6DA 1XGDA 2PDWA 1F7BA 4FNSA 3E12A 4QS5A 4LS1A 1GT8A 3WQGA 1M41A 4BQ5A 2CC0A 1XINA 2F38A 1Z69A 4WHBA 2I9EA 4O1CA 4C6PA 4NAEA 1Q6EA 3DFNA 1W5PA 4KCUA 2XH4A 4ZA0A 3TK7A 4UCFA 1V3KA 3VNIA 3E02A 3RFAA 1ZJBA 4MZ1A 3P74A 3C0JA 4H6KA 4IUGA 4D1IA 3W26A 3GS6A 3OP2A 3M0HA 4H7VA 4UTTC 1ZLPA 1JD7A 3K13A 4URIA 1TRDA 1P48A 1JAEA 1JDDA 1EYWA 3V75A 3MQTA 3RNDA 3A22A 3K5XA 1XRVA 5JUVA 2WBGA 3NPWA 4WZHA 3RG6A 4BQ4A 3M4HA 3AIRA 4K1WA 3K1GA 3EPOA 5DRCA 4QR6A 2WNZA 2XVGA 1KFJA 1OFRA 1AJ2A 3HA1A 3M7WA 2QGHA 1TZ9A 1TQXA 3L2IA 1UA7A 7ODCA 1DP0A 5F2MA 3U6WA 1N7KA 3BOFA 4GNVA 4X2RA 2O55A 1AQFA 4XD6A 5REQB 4RZBA 1VEPA 1B0IA 1Z41A 3FA5A 2WMGA 4IIFA 1CGYA 5M1TA 3S2MA 4EPEC 4HYWA 2C18A 3NWRA 1ZHAA 1UZ1A 1GEQA 2BDQA 2YYTA 1GVQA 2WHLA 3A4JA 4HHHA 3SUWA 2Z7GA 1TV2A 4PUMA 1O5QA 4JL1A 4N0RA 2VJXA 3W7DA 4LC8A 1EPVA 4FNQA 5AECA 7TIMA 3RJYA 3N2CA 4I7UA 1YDOA 4J3WA 4XTIA 3MZNA 3UZXA 2Q8LA 3EGJA 1PDYA 1QNOA 1X6NA 2BODX 2TRSA 3EWDA 2G4FA 1OK6A 3U8GA 3A21A 4GABA 2OQYA 4DO5A 5C9RA 5BZAA 3DENA 5CGMA 5A6LA 2ZRWA 3N2XA 4HSOA 2GSHA 1OCNA 1KCLA 2GFTA 4YNGA 3OZMA 3L66A 3L2MA 2E09A 3SSZA 3UETA 4INFA 3G6LA 4O1EA 4R7JA 3GYCA 2YCLA 4J3XA 1UCWA 3BAIA 3HV8A 1REQB 4MFDA 3S9YA 4Z1DA 4ZGYA 3W2UA 1O12A 3BSHA 1AL8A 2QCMA 2F2HA 5C5YA 4WGXA 1TA3B 1Q6CA 2R1KA 1E70M 3WLMA 3B8IA 1SR0A 3EZ4A 3AOFA 2WW5A 1XLMA 1V0NA 3F4CA 1PZ0A 3NSNA 2OSYA 3SSJA 4DJED 1F8MA 3ZWTA 4DPPA 3W02A 2WJDA 4GI4A 4L65A 4NASA 2E9BA 1QPQA 2QLYA 3LM3A 4JS3A 1QPOA 3FHAA 4AZ7A 3H53A 2ZWZA 1UWAA 1MFVA 1VB9A 2EJAA 5LNSA 2Z29A 2D73A 2Y24A 5I23A 3G8RA 3K8KA 1FWCC 4FX7A 1KLYA 4ONVA 3PBUA 3N1AA 4FALA 1RAKA 3QTGA 2Q3RA 4CEUC 4IFKA 5ABEA 1UIOA 4W7UA 1A5OC 2IPWA 5DN1A 2NW0A 2QCLA 4HNLA 1J93A 4OHQA 3W1NA 4GIAA 5K9DA 4K8HA 4M7TA 1JCTA 1YDYA 1K70A 1UC4A 1GHSA 4Y9AA 4IISA 3TAKA 2HQAA 5BNKA 1XDMA 2J78A 3EEGA 1UWIA 1JZ5A 3GKFA 3B0VC 5EFDA 4ROQA 3KOFA 3DBPA 3YPIA 5I7GA 2DIKA 1QHZA 1AZ2A 4K7YA 3LHWA 4JNZA 1ISXA 1QNRA 4DYKA 4IPLA 3AU2A 4JICA 4ZL1A 4MVAA 4QDMA 3IRSA 4H9ZA 1QTWA 3NPXA 4MTVA 4UOJA 1V02A 2Q01A 1LLOA 3LSBA 3OJGA 5DMLA 1QXLA 2XIJA 4M5PA 3ID7A 3QPZA 3EB2A 3RK8A 3W0KA 4LCRA 1MYRA 2J6VA 2Y4SA 3R79A 3K2GA 2Z0IA 3B0UX 3S5YA 5G1TA 1KBIA 1YNQA 3UZJA 3SUVA 3W38A 4BR1A 3IPWA 4YS1A 2G4JA 4M7SA 1JVNA 2DW6A 3I3DA 3BLLA 2G97A 9CGTA 1KD0A 3OZPA 4ZB0A 1Z3NA 2OODA 2XWEA 4D6IA 2P1FA 2Q3OA 3WDIA 2EQDA 3S1UA 1EX5A 3W2LA 3LERA 2FGBA 1H11A 3GR7A 4D6JA 1U5HA 1R3WA 2E6FA 3NQFA 3V35A 3UEQA 2A79A 5GJPA 2FHCA 2Q02A 3EB3A 1TVNA 3C0LA 4JTLA 1BTMA 4TVCA 2VZTA 1E4LA 2QCNA 3VZZA 3EWWA 5IFTA 5T9BG 4NSBA 5TIMA 4BJHA 1A5MC 4XVDA 2ZX5A 3UQNA 4NRSA 1DHKA 1NDZA 3W82A 2OYLA 1W3KA 2GGJA 4IFKB 3W7GA 4LUYA 2WSYA 1VEOA 4HQVA 4C6IA 5D9OA 3CT7A 4QDWA 2H8ZA 2GVGA 3PAJA 3CIVA 1G4PA 4N2YA 1S46A 1YPIA 3ANVA 1L6YA 4PMRA 3IRDA 3MMWA 4AD5A 5BWFA 2PDBA 3EMCA 2QUTA 4WDWA 1RLDA 3FGCB 3PUDA 4DIAA 2OU4A 1HUVA 1DIKA 2J79A 4OVXA 2AAMA 3WLOA 3CZGA 3W7MA 3QKZA 1FWWA 1P0NA 1FFRA 3FEMA 2E28A 2JIEA 4GIYA 3RPMA 3PBVA 1OABA 2O9PA 3DX5A 3G3DA 4ZE5A 1GPWA 2ZUNA 3IUIA 2GDUA 4C7GA 3QW3A 4RZ6A 2GSEA 2H6RA 2HSAA 1WE5A 3II1A 1F6YA 4IP4A 3J7HA 1LWIA 1AMKA 3MZ2A 4ML9A 3CT2A 1T96A 4GNKB 2Q6ZA 1MDRA 2QCDB 1PYFA 5LIYX 1HXJA 2JGYA 3UW6A 5CGQA 1PE1A 1IHIA 2VYOA 3CWHA 1IEVA 4TX9A 4AC1X 4EP8C 1UD6A 3O6YX 4UNLA 2WZIA 5K2ZA 1VPYA 2ZCGA 3EDEA 3SCTA 4U2YA 4DUWA 1BWLA 2P0OA 2Z6IA 4K38A 4D2JA 1KFKA 4M6VA 5GVJA 1TWZA 1S2WA 3W76A 2Q8ZA 2CBVA 2PP1A 1ENUA 4CEXC 1TJPA 3QMTA 1E72M 5FF3A 3I7QA 4Z1YA 3WFAA 4DBDA 3IK4A 3TR2A 4QNEA 3BO9A 2FLIA 1V3JA 2F2KA 3EPMA 1XXXA 5HPOA 4NZ4A 4IH3A 4IJBA 5FJIA 3B0PA 3CPGA 2BXVA 1XWYA 4B5VA 3KEHA 5XINA 5A6SA 5C54A 1W1IE 3TXVA 3N6QA 3CZLA 1VZWA 4FPSA 5CSSA 5AFDA 1F2JA 3MSRA 3QSRA 4M6UA 1R3VA 3KE0A 4P8UA 4M19A 4X0NA 3CUFA 2P3ZA 3QH2A 1GOXA 4LY4A 2WO5A 1W1B1 2NUYA 1U1HA 1QI4A 3GDKA 1WKFA 2NT0A 4E6MA 3LHUA 5H91A 2WJZA 3TC7A 1QK0A 4UQCA 1HG3A 3DKJA 3N73A 4LVFA 1VS1A 3VK5A 3WL1A 1ZJHA 3RCNA 4UR7A 2QS8A 1E6QM 1GORA 1KM5A 3C5QA 3HZ3A 1HKWA 4LV4A 5IFPA 2QW5A 4GRSA 1FHLA 2W67A 4OJYA 2A7PA 1RVGA 3A9IA 1GQKA 4MAVA 3T7VA 1W3HA 4LYPA 3LEPA 1EUAA 5FKYA 5GJMA 4IIEA 1CI1A 1XX1A 3PN8A 4AIEA 5EA9A 3TLQA 1UR8A 3S46A 5LHFA 1UB3A 4LBSA 3GU1A 4CQDA 1BAGA 3NYDA 3UG3A 1HP5A 1LG1A 4KWWA 4DLMA 3GIQA 4D6EA 3MSYA 2PZ0A 3KVLA 3WNPA 1EJSC 3TUUA 3MYOA 4QE5A 9XIAA 4FMVA 1W8GA 3NXFA 4IXHA 3DHDA 3ZZ1A 2WHMA 1Z32X 2OXNA 2XIMA 1HVQA 3VZYA 1YXYA 3S2LA 1XUUA 3GXPA 1B90A 3WMLA 3VX1A 3WBEA 1E6RA 1UR4A 1A5SA 4YYCA 5TQLA 4O54A 4W5ZA 5D9MA 4EWJA 2ZKMX 3WQ5A 2FZMA 4IX0A 2PWUA 1WBJA 1YLVA 2FTPA 1S5VA 3K30A 4NILA 3AJXA 2FDSA 3TCEA 3WUFA 1QW7A 1PS9A 1XW8A 1VR6A 2G37A 4AYSA 3LPPA 3T1GA 1ECQA 1XI3A 3NA8A 2YYUA 2FPYA 5FCZA 3G6MA 5CBJA 3ARQA 2ZXQA 3CLWA 1M5WA 5AZ0A 3KVKA 1E6ZA 1FH9A 3VKJA 3G1AA 3WK3A 3VKAA 2NV2A 2OEJA 2CLFA 3TWBA 4P61A 5FIPA 2OWXA 3IJQA 4OBTA 2WMJA 1YADA 1C3FA 3W81A 2C1IA 4Y9OA 1DBTA 1OADA 2WK2A 1NOFA 4LSBA 1CEOA 3QR0A 3AROA 3NYZA 1JI2A 3NVTA 4P7NA 1HJSA 1J0JA 1ONWA 4FNRA 3W1LA 2W9MA 1F76A 2CBUA 3V36A 2YZ5A 1IYXA 5JBDA 4JD4A 4LEFA 2WKLA 4R88A 3MP5A 4JPGA 1QRQA 3LBMA 2X0HA 3L0GA 3LZ5A 3MUZ1 2QJIA 5C0QA 1A3HA 2VFFA 5BYWA 2ZADA 1F3TA 1WPCA 4X22A 1XS2A 3VE9A 1W1YA 1GQNA 3UVAA 1UR3M 3GXDA 4D6CA 1BF6A 3ITLA 4QLLA 3WQ8A 3M5ZA 4B2DA 3T2OA 5TBOA 1TV3A 3SFKA 1MZRA 1V6UA 4FLOA 2ZZ4A 1UBSA 2ZZ1A 1KM6A 1ODUA 3BUVA 2HCVA 4UTWA 1BXNA 1MEWA 3C2FA 1M01A 1SFTA 1N8WA 3NM3A 4H04A 4Q33A 3LMZA 3W7RA 3CZEA 1TELA 2VX5A 3H12A 1NELA 2VGIA 1QNPA 4M8UA 4LXFA 4NI8A 2H90A 1P43A 4GY0A 2PLMA 4AZ5A 3PC0A 3ONBA 1G4TA 3NNTA 2GJXA 1CGUA 4CCDA 5TF0A 2NQHA 5D9PA 3S5ZA 4AEEA 1NDWA 1DXEA 4B5SA 3WZ0E 5HULA 4ZOCA 5JH2A 3I6RA 3TYBA 4A22A 2RDWA 3UG5A 4IPPA 1NWSA 2DZAA 3WDJA 4ZSUA 3GK0A 4PMXA 3ANYA 1KWKA 5DT7A 2AGTA 4JQ4A 2PFHA 1TMLA 1TE6A 2P76A 3SY8A 3DFOA 3UXDA 1UP3A 2V0TA 3OLDA 1OM0A 2XG9A 4JTIA 5DT5A 1CB2A 1UH3A 3ECQA 3O07A 2J9XA 4MDPA 5M2FX 4DZ5A 3PF3A 2YXOA 3W25A 4GFSA 5DQPA 2X2YA 1J96A 2Y0FA 2MANA 4WY0B 1UA3A 4W8AA 1FXQA 2F6KA 2ZRUA 4L6HA 3DU0A 3VM5A 1IF2A 3GTIA 1IZKA 4RXGA 1K1DA 3NO1A 3G3MA 5BU9A 5HA7A 3LOTA 5BXSA 3DG7A 4H41A 4XIMA 4M56A 1JEZA 2BXYA 3KOWA 8A3HA 2AQVA 1LT7A 4HN4A 4UTWC 4U28A 1LRNA 5CPNA 2PGWA 2VFHA 4GLEA 5FESA 1OZMA 5C2XA 4ZENA 5I06A 1PHQA 3QOMA 3APYA 1RVKA 5CC6A 1FQ0A 4KS0A 1F61A 2DVXA 4LBRA 3ZM8A 4H9YA 2Z27A 3BWWA 4HPGA 4HNVA 2PDIA 3VNYA 4I6VA 1JZ3A 3M0JA 2GWNA 3GNNA 3OO2A 1QWKA 2ZX7A 4TUFA 3PZGA 3KBSA 1ALDA 1F6PA 3RLVA 1PIIA 2DSKA 2FFIA 3SFWA 3DI0A 4IGSA 3SI9A 5LA2A 4NKCA 5D03A 2V6AA 1AVAA 3IVTA 1KTCA 1NF0A 3ABRA 4WOQA 4JYFA 1ZTVA 1XH0A 2WPBA 4GX8A 5CGTA 2QV5A 4MLJA 1TR1A 4MNJA 3W28A 4PRTA 4BF7A 1C8QA 1K02A 3V5OA 1GKRA 2YXXA 1AQ0A 1B3VA 4PCFA 2YCIX 1XCXA 4XAYA 3VAVA 4F9JA 3TFCA 2OJPA 1KNWA 3APTA 2DQXA 3AMLA 3O6AA 2GJXB 4AXKA 1VYSX 3ZT6A 1RZMA 2XSBA 7PTDA 1QBBA 3MCNA 1EP3A 3AS1A 2I5GA 4DYEA 4KWSA 3WLQA 4U5IA 1HJWA 1EB3A 1FDJA 1A3XA 1MWOA 4N9BA 2QVNA 3U4AA 1XISA 5KZ6A 1JCMP 3SCRA 3WF1A 3UG8A 3DAQA 4ACYA 3LRLA 2EG7A 2POTA 3RGTA 4F0MA 4AZCA 5KMYA 2TAAA 4DRSA 4ADUA 2AKMA 1PZ1A 3VDGA 4AZHA 5E9XA 3CYJA 3UF9A 2DSUA 2Y2WA 3P62A 1EC7A 3R6IA 4G6CA 3OYZA 3KXQA 5CJMA 3KBNA 3EA1A 2XFFA 3MI6A 4JIQA 4JHOA 1LDCA 2QIIA 2QUNA 5AHFA 2CHRA 4M29A 1EOMA 1LG2A 5FSDC 1AODA 2Z24A 1B3YA 2XIBA 1XLCA 1RV8A 3SO7A 4DWSB 4ENLA 1F9CA 2WSKA 4US6A 3VFLA 1KXQA 3NQGA 4F0KA 1ICQA 2G5WA 3KDOA 5D32A 3STFA 1D3HA 2C91A 3SUTA 3KS6A 3MANA 4KCTA 1TPWA 1F5ZA 4GQQA 1AD4A 1Z9AA 3RMJA 2I57A 5CG0A 3M5VA 4Z0SA 4GGHA 3NR0A 2E8ZA 3LLDA 3N2MA 4BHYA 1AD1A 1XQKA 4PH6A 2AGKA 3H8AA 1KCZA 4POCA 1W1ZA 5LHEA 5MHBA 4REQA 4BA0A 5C2GA 3L4WA 3PZNA 5DMNA 5HR6A 2B7NA 3V5FA 1SO6A 3TAOA 1KCXA 2BGQA 3BLEA 4E0CA 3UZZA 4GOAA 1AZ1A 3I68A 2YKKA 1XSKA 1RPKA 2BY3A 4HNOA 4KGLA 3LGEA 1EGVA 4B92A 4AISA 1R2TA 3UPWA 5BOFA 3UWVA 1FWGC 3S6TA 1X39A 2BY1A 3WQPA 4Q7NA 1J6OA 3WUGA 3M0XA 3MUCA 3QN3A 1XGZA 3F1QA 2ZTJA 3N3TA 4A3UA 1CXEA 5JMUA 6PTDA 3ZJ6A 4ILSA 2OYKA 4JTKA 1WZKA 2BLEA 2IPFA 2DSWA 4FNPA 1E6PA 4W93A 3ENLA 1GNXA 4JTRA 1IE7C 3NSMA 5A8GA 4YHEA 4FS9A 3VNJA 3CHFA 4LVDA 2W4XA 5C55A 2Z00A 3E0LA 4LAZA 4OOZA 1TX2A 3GXNA 2QJNA 4QS6A 3P84A 3TTQA 3LB0A 3M6YA 1AW5A 2OLHA 3GZ3A 1GOQA 4GG9A 1D2KA 4HTBA 1OG0A 4DUVA 2HDJA 2VFDA 4ALDA 2ZA1A 1V3IA 2R91A 3QYQA 3D0CA 2FPVA 2JKEA 3H2AA 3VNMA 4ICCX 3W1XA 4P8VA 2EPHA 3BCFA 1RP9A 1W54A 1LT8A 4ZVJA 2ACRA 4JIRA 1ZALA 3TXZA 4NXKA 3GVVA 3UGVA 2BTMA 2YL9A 1TV4A 5M17A 1KQZA 2YLAA 3VTRA 4O4WA 3IAPA 1NOWA 1DKWA 3PTMA 1R30A 1JL8A 1Q85A 2ASHA 5LNWA 3VKKA 3PPCA 2NV1A 3VDAA 1S38A 4A6GA 4DNHA 4AQLA 3BLFA 4WSJA 3VXGA 4I90A 4JFUA 3NIYA 3TYZA 5DY2A 1VRXA 1TWIA 3E49A 1B30A 3VMNA 2VD9A 2BWGA 4UFKA 3H23A 2BHYA 4O50A 1FWJC 5D2VA 3L12A 4GA8A 4GYKA 2CZVA 1JQVA 2V3FA 3V3WA 3LY0A 5EYWA 3GY1A 4HBKA 1UUOA 4IHCA 2G3IA 3D47A 3B8UA 3WN6A 4FF5A 4GVIA 1VFTA 1XLDA 4JY8A 1FA2A 3HQOA 1DV7A 1YW1A 3ZWSA 3S6OA 4CUCA 2X1IA 1M9HA 3NQCA 4DXKA 1F74A 1E51A 3EWCA 4DJEA 1UBPC 2WM0A 4NNBA 1GTHA 3L9CA 2V3DA 2ANUA 4J27A 4C6DA 3T0AA 2R1MA 1P0DA 1NDYA 3SJNA 2VNCA 3CUXA 1E5JA 1KRAC 4AXNA 1A0DA 3C2YA 1BG4A 1OD8A 5F4XA 1SUXA 1JPIA 2C6QA 2YSWA 2O4QA 5JXQA 4AWEA 2HVOA 1SW7A 4J35A 3BMWA 4QDPA 3T4WA 3QV6A 4YU1A 5GNYA 3BJTA 1KKOA 3D3FA 1P7TB 3HB9A 2G3NA 4JX6A 4TV6A 2WHKA 3LV6A 1OFDA 4H00A 1J5SA 4Z2HA 4UOQA 2DW7A 3SECA 5ENLA 1TZZA 1W5MA 3VGBA 3CO8A 4RDWA 1DPMA 1KFLA 5CXPA 3WQEA 3ARUA 5K9XA 4JTHA 4L61A 4AY1A 2UY5A 4A8NA 4JTSA 1XYZA 1CXFA 3BH4A 4RPQA 3PFMA 3O2LA 4MB3A 2BNJA 1K7EA 4QROA 5T91A 2OZ0A 3IIOA 4Y8FA 3UZ5A 3TZFA 4XBKA 3FIGA 1ZY9A 1FWEC 1HO1A 1QFEA 1PTGA 1UMYA 3WH7A 2FZDA 4GJJA 4AWUA 2BFGA 5CPLA 5JU6A 3CO4A 3TROA 3RUBL 1KWGA 3OZOA 2D0HA 3R0DA 5G4WA 3RAOA 3SW6A 4GCAA 4KESA 4DJEC 1US0A 4XKYB 2ABBA 3DI1A 4OV4A 3UP8A 4KIRA 4S39A 5AHMA 1FDZA 4ACZB 1X97A 4J3TA 1PZ2A 3WO8A 4GXWA 4GZ7A 3AWOA 1XLJA 2J66A 5DX7A 3TTOA 3ZT7A 5ABHA 4B5NA 4M1RA 3VGGA 3FEQA 3UXLA 3EWUA 3GTNA 1VRDA 3A6OA 4GC4A 1QVBA 4U2ZA 1F3EA 3KL5A 3G1RA 1XLBA 1V7AA 1FRBA 3N6JA 4Z17A 3WLRA 4AD4A 4IP5A 3PPHA 3M0VA 4XKMA 4OE7A 2ZDSA 3M0MA 4QJ3B 5A8NA 4S2CA 4Q7BA 4CNNA 1AA1B 5LNRA 3EB4A 2RUSA 4J3VA 1GKPA 2TMDA 3BE7A 4JTCA 3WMBA 1IIGA 2Y5JA 1W2PA 4DF0A 4PULA 3BCDA 4C6EA 1POKA 2ZZ3A 3CK5A 5BRQA 4C91A 4HD5A 3F4NA 3ZXWA 5AZ1A 3T9PA 1UJPA 3OGSA 1KM1A 3FYOA 1WNOA 2O9OA 1SFLA 3LPOA 3SCOA 1ESWA 1O95A 4GQ0A 3L65A 4O4VA 3NQAA 3PHAA 8RUCA 3NZQA 3L2LA 4N6FA 4XBSA 2JQXA 4UR8A 5BMWA 4PN2A 4H7CA 3DFYA 5HJYA 1SZRA 2A3AA 3C3NA 3EX3A 4YVVA 2IKGA 1JDCA 1EBGA 2BX7A 2Z1WA 1MQRA 3BICA 4QNWA 5AHIA 4XV0A 1T7LA 4MDOA 1HJQA 3QV7A 2VC5A 3IIXA 5C9WA 5AYBA 1UASA 1UROA 1UUQA 1XUZA 3ZVHB 3VMOA 4BI5A 4EPKA 1UHVA 3E2SA 1OK4A 4KMQA 1HIZA 1Q7MA 1D9EA 5XIMA 4H9TA 3CTTA 4PMYA 4FOUA 1QDSA 6ALDA 2IQ0A 1XLKA 3SR7A 1TFVA 1Y5VA 3QQWA 3SN0A 3TJXA 4R7WA 1G4EA 3TWAA 4EAYA 2ZE0A 2Y8VA 5A94A 3SCNA 4Y90A 1KKRA 2P8CA 4LAMA 5HMDA 4B4FA 3UWYA 1R3SA 3K4AA 4EACA 4O18A 5IBXA 3T2QA 5FOOA 3HV9A 2R82A 3UR2A 2VEIA 1YNPA 2QVHA 2DVUA 2C19A 3MCOA 5BRBA 1UD2A 3L0NA 4LOCA 3BGAA 1HO4A 3CGTA 2EJ1A 1C29A 4DZAA 2DUZA 1YBQB 1ADSA 4OQVA 3T07A 5LNUA 4CCEA 1U1UA 3VDCA 4AZ6A 1W1TA 3ERPA 1XYBA 3R58A 3G1XA 4H9MA 5HQMA 4GI9A 3A47A 2OOGA 1BYCA 1TJ1A 2ZA2A 2V30A 4Z0JA 1J18A 1EJXC 2YDQA 1Q2RA 3RO6A 4K68A 1DJQA 1NWTA 1A0CA 4PC8A 2IMRA 1H60A 3T6CA 4WDTA 4JTEA 1WX0A 3CZKA 5A6BD 4H4IA 1NU5A 4HYVA 3OHMB 3PTDA 1QNVA 1SMDA 2VDHA 4IMEA 1RK5A 5K4ZA 4E38A 3HPAA 1FTXA 4F4RA 3S0CA 2EKCA 3UWEA 3NZRA 5F4SA 1NEYA 2W61A 4GUGA 1RD6A 2V5CA 5D2YA 1R7OA 4C6FA 2GOKA 1HL2A 4RR4A 1P1MA 2VOTA 1RBOB 2A6LA 5E93A 4FX6M 3I7RA 5FA5A 3OHIA 3S1XA 3PSWA 1J0YA 2GUUA 5U7SA 1RUSA 2IUZA 2Y5EA 4GACA 4I8YA 3PTQA 3HGRA 4S3GA 1K8YA 3N4EA 1BSIA 4XZBA 1OZQA 2PDHA 1WA3A 3M47A 3GZAA 4U33A 1Y7VA 3VZXA 2XH2A 2YCJA 4H6RA 6XIAA 2PMQA 5IBXC 1NSJA 3POCA 4C6QA 3H54A 3M0YA 4EWND 1CZ1A 4Z1BA 4C6CA 1TSIA 4IG2B 1XCFA 3AS0A 2CESA 2VHLA 3VE7A 2GJPA 2AQWA 4E4PA 1KCKA 4AWTA 2WBKA 1JFHA 2VVNA 4JTUA 3V0TA 3UD6A 1TVPA 2P3EA 3W7EA 2UY4A 4D71A 3GTFA 4H8VA 4QE1A 4K37A 3CUJA 1G9HA 3RPDA 3GNDA 2V2DA 2DIJA 3VD7A 4DPQA 3L4ZA 1UKTA 1M03A 3VOFA 2V5BA 2ZUWA 3L7RA 2VDIA 4L64A 4A8IA 1TV8A 1LQ2A 2D22A 3HG3A 3LQGA 3HJEA 3V0UA 1J5TA 4JTDA 4PMDA 5A95A 4UR9A 4HA4A 4EANA 1UWQA 1DJIA 4UMAA 1V03A 4E3TA 4O0KA 3N9KA 3URQA 2Y8KA 4F40A 3C52A 1ISYA 1TTIA 1E71M 4XUYA 4AIOA 1IT8A 3RX2A 1A80A 2ZXDA 2CLOA 8TIMA 2PCEA 3A23A 4ZOEA 1E1EA 4A3QA 1NJJA 2DT2A 3MC5A 1YX1A 1EEXA 2INZA 2PTXA 3AICA 4K8EA 5D4YA 4E3VA 3WELA 4GMEA 1EWEA 3UBPC 2JK2A 1PHWA 1U83A 3W1MA 3ZS4A 4IMCA 4DYJA 2EEXA 3B0XA 1LTDA 2GQ9A 3U2ZA 3VOJA 1H1NA 5PTDA 4UMCA 4Q22A 3TZNA 4WEVX 3P6LA 4GI8A 1XFCA 1XIBA 2GGEA 4G1NA 3SRFA 2VRQA 2EPOA 1Q6GA 4ERAA 3H24A 3AYRA 4MYXA 1RJQA 2EPLX 2WVVB 4QGCA 2Z1BA 4BY3A 1IWPA 4B90A 3NTYA 3TQPA 1C90A 3SB0A 3M41A 3GVWA 4A2SA 4AAJA 2HNHA 2F6UA 1EGMA 4HP5A 2PBGA 1KM0A 3GG8A 5I79A 2O9RA 4ZQCA 2ALDA 3QQ1A 4MKVA 1NARA 1DHPA 2NLIA 3NQDA 1BYDA 5HUPA 3LUTA 2A5HA 4NG3A 4HSHA 3PB0A 5HANA 5H6HA 3RU6A 1UWSA 1ZJIA 3B9DA 2B7OA 1H7RA 4HVXA 4JQ1A 3VNKA 3KVJA 2CU0A 1M68A 1Y5WA 1S2AA 2PF8A 3MO4A 2PAJA 3L4XA 3F2CA 4KKXA 5HWJA 1OFOA 3NAVA 4H3DA 1WV2A 2J7BA 2GK1A 4LRSA 2W62A 4PRWA 1SM9A 2A7NA 5AC6A 4PUNA 1E15A 2PDMA 1DQXA 2FZ9A 4PBFA 3LHVA 5HMFA 4ZO9A 3DG3A 1SSDA 4UTUA 2Y89A 3NEHA 4DF2A 3F2DA 5JBFA 1SSGA 1TCDA 4N9EA 1CCWB 1XYMA 2ONEA 5G2HA 2F6XA 3GHRA 3WD1A 3MVTA 4PFHA 1UUMA 2GWGA 1SJDA 4MNKA 3ICJA 3GAKA 3W84A 4CNPA 4LS2A 7A3HA 1I9CB 3T0TA 1YTEA 2XVPA 4TO8A 3AHYA 5HNRA 1H7PA 1J12A 3IV3A 3VD3A 2VP8A 5DY3A 2E40A 1ICSA 3RRAA 4IGNA 4PUWA 3WJYA 3MA8A 4I8DA 2DJXA 3KRZA 1C7SA 4EOUA 3WYZA 4CNSA 4WX2A 2DPEA 2OQHA 2DT3A 5IOBA 2X0YA 4KRUA 1BKSA 3WG6A 2DZXA 2XYLA 2ZBTA 1LYXA 4NP7A 5LGZA 6A3HA 4EKJA 1LLZA 1R3QA 5DCBA 1JF5A 3K8MA 3QZ6A 1GVEA 3A24A 1ITCA 1WB0A 3VYLA 3GH7A 3UYCA 3BOXA 1SGJA 3MHGA 1NF7A 4FOJA 1TPFA 4PB3A 4WSHA 1PX8A 3CYVA 1NOUA 1PKMA 4QQ3A 2CPUA 3REQB 1EGZA 2ESCA 5AYIA 3TYEA 4GBUA 4XB3A 2ZWYA 2VC7A 2Q09A 3KRBA 1AFSA 4R9OA 1X1ZA 2XJ7A 1U22A 4E4FA 2YA2A 1HKMA 4NX0A 1GG1A 1G01A 2BVWA 5H2ZA 3GKAA 4QFUA 1QCWA 1YE4A 3I65A 4CD5A 2JEPA 2EO7A 4LNYA 4JFWA 3LQLA 4NQ1A 1GJWA 1UD4A 4BF9A 2FFCA 2PGEA 4QLJA 3FYYA 4NAFB 1P6BA 1TMHA 3PWGA 2QF8A 3PWIA 3Q67A 1H1ZA 3W75A 3NPUA 3EXRA 2PF0A 4DJFA 4BWLA 1TUFA 2J6XA 2C0HA 3W73A 4CCZA 4S3CA 5CZKA 2DZVA 3CWOX 4XAZA 1S2VA 4H6EA 9RUBA 5CC3A 4DJDD 4Z2LA 2PDXA 4PYSA 2QT3A 3BQ5A 4GBDA 3RLUA 3CMJA 3DDMA 4O8AA 4CNOA