1OYCA

Old yellow enzyme at 2 angstroms resolution: overall structure, ligand binding and comparison with related flavoproteins
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Old yellow enzyme at 2 A resolution: overall structure, ligand binding, and comparison with related flavoproteins.
pubmed doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase(flavoprotein)
molecule keywords OLD YELLOW ENZYME
total genus 141
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1oycA00
4LVBA 1XUZA 2HMCA 4LVFA 3C2OA 2F7FA 3W88A 5TIMA 3PBWA 4DF2A 4AHQA 1ZJIA 1H7XA 5HR7A 4O14A 5D2VA 3A24A 1KTNA 3TC7A 1ZY9A 4QM1A 3LDVA 3GDMA 1FDZA 2R91A 2NV2A 5CZ0A 2NX1A 2UV8G 1T96A 2VEMA 3HPZA 3P7YA 2WSRA 5G1YA 5H2ZA 3TC6A 1IXOA 5F2MA 4Z0SA 4JYEA 2CLEA 2B0MA 1JUEA 3OG3A 1WBHA 3N34A 4HPXA 3LCIA 3BGGA 2YXGA 2J88A 4UXDA 1G4EA 3A21A 1UJPA 3T7VA 3AJXA 3W7PA 1ZHAA 2VFIA 3BO9A 1JUKA 1H7NA 3OVRA 4ZQRA 3ATZA 1TPEA 4BI5A 3LTPA 4N9CA 2Y62A 3BV4A 2C14A 2CLHA 3S8HA 1GTHA 2X1UA 1R30A 4AMAA 1OHLA 1P0NA 3MI3A 4N4QA 3Q94A 3BLIA 2Y88A 4FNQA 5DY2A 4S2CA 4YLWA 1VS1A 4LTSA 4IX2A 1IXNA 1M5WA 4HNNA 4O0KA 3BARA 2YDAA 2FPTA 4QSHA 4AH7A 1WXJA 2HSAA 4O1BA 4LVGA 3E49A 3PB0A 3NQEA 3PVFA 2YFNA 3U8GA 4OHQA 1KM1A 3KAOA 3L68A 4Y96A 4XUGA 5LNSA 4Z0JA 3GAYA 1GEQA 1DVJA 2Y6ZA 4GJ1A 3W7KA 3L21A 3DKLA 4HN4A 4AHOA 4NJHA 2J9YA 3S1VA 4TMCA 2NXGA 1JULA 2GOUA 1T0OA 1EP3A 5IBXA 2W0UA 1W5QA 4UFHA 1KFCA 4CCDA 3M1ZA 1YPFA 1QDSA 3W7LA 1H1ZA 2DZVA 3NYZA 4X2RA 4IXXA 4LC6A 1DV7A 3CLMA 4O19A 3SJ3A 4LRSA 2Y61A 2ABAA 4ADSA 1SPQA 1OX4B 1L6YA 3BW2A 1JRCA 3UD6A 3DFQA 4DEFA 1QPRA 2FTPA 1TV7A 2FB3A 1LZOA 3BK0A 4Z1BA 2CLKA 3I68A 5EYWA 3DAQA 1LOLA 1SW3A 2E6FA 2R14A 2Q3RA 3T40A 1EX5A 3RLVA 2PRMA 3P5YA 3CEPA 3DFSA 4JXCA 1I2NA 1XBZA 4HNUA 1VYPX 1W3TA 1HL2A 5FESA 1HG3A 4M7TA 1WAUA 3W70A 1AL7A 3O6DA 1DKWA 3N2XA 2E5CA 1UUOA 2E6YA 4DF0A 1R2SA 4X9SA 4WOZA 1UB3A 1OK6A 3LCFA 2H6RA 3PUDA 3TFCA 3GXTA 4POCA 4NZFA 1W5NA 4EF8A 2XFWA 5D03A 1O60A 3G1AA 1TPVA 5G2HA 4W9TA 1W3NA 1JCJA 4DPPA 2GPTA 4NJIA 2Z1BA 3M6YA 5AYYA 3QPZA 1N55A 1VCFA 3GVGA 2A85A 3GX9A 2X2GA 3MMTA 4RLIA 3KOFA 4E38A 4ZL1A 4O11A 4NUWA 5DBTA 2DZTA 3IVTA 4JTKA 1H60A 3GB6A 3TE9A 5LNWA 4O53A 2VEIA 3GDKA 5E93A 4JDYA 1PS9A 5LNUA 2BLEA 1FCBA 3MP4A 3W71A 2VOMA 1O5XA 1F76A 2A0NA 5F2IA 2WNZA 2VEKA 2ZTKA 2J9XA 2QKFA 5CZJA 4DQWA 1FQ0A 1JCYA 4RV8A 3PUOA 3FOKA 2NWRA 3BLFA 1QPOA 1MO0A 4MJMA 2QDHA 3NXFA 1RV8A 4LW7A 3EWXA 3W6YA 3DENA 3E12A 4AXKA 4GXMA 5HUPA 2DZXA 4FO4A 5DLCA 3QEZA 4IQLA 1I4NA 2ZDRA 5T26A 3RNDA 3L2IA 3HJZA 1GG1A 2GQ9A 4QJ1A 1ICSA 3G1HA 3P67A 4NJJA 1LBFA 1DBTA 4M6VA 3DBPA 2QUUA 1R47A 3S5OA 2H90A 3F03K 2J6XA 4FIRA 3LV5A 1VYRA 4I7VA 2RDTA 2ZZ6A 2PCQA 3HG4A 1GVSA 3GKFA 1QOPA 3MUXA 1K8YA 3LHUA 3LHVA 3KHJA 3SECA 3EX4A 4YWIA 3UWYA 2FDSA 4GUHA 5MHBA 3HQ1A 3PUEA 1O95A 3TXVA 3ELFA 2EHHA 2RDUA 4WUIA 2G96A 1YDVA 1DJQA 3HPSA 3LCLA 3HF3A 5K9DA 5F4XA 1SZFA 4JTUA 1IIHA 2QJHA 1GJPA 3DFNA 8TIMA 3NL5A 4L4LA 4NNCA 4UIOA 1S3HA 1RPXA 3DHFA 3MWAA 5CPMA 3B04A 1MZHA 2NWSA 5F1UA 2QCDA 5G1TA 3B4UA 1TPWA 5EBUA 3M44A 2C0AA 5FF2A 4JS3A 3TX9A 3TNOA 1KM5A 1H7WA 4NJGA 3GDTA 3T44A 3W85A 1A5AA 1XDLA 2V0TA 3W7HA 2V5LA 3N19B 1F05A 5AHNA 1FWSA 1VCVA 1W37A 3O6YX 3G1XA 4JX5A 1Q6LA 3SW6A 1D3HA 3W1UA 1LRNA 3PWAA 2H3BA 4JN6A 1IF2A 4NJKA 3UY7A 2WOQA 5FEWA 3P8IA 4LVDA 4FX8A 5C54A 3QSRA 4X3ZA 2VFEA 4IGHA 4O50A 4N6FA 3W1XA 3IIZA 1O4UA 1YYAA 5K9CA 5DELA 3TQKA 4O18A 3CTLA 1RQEA 3M9YA 1HO4A 3LCWA 5H91A 3GIYA 1UCWA 2CZEA 3UQNA 4JYFA 3O15A 4OBTA 4MYXA 2GJLA 1AK5A 1GG0A 1W5PA 4LUIA 2QJIA 4P2VA 3UZ5A 2NZLA 3L66A 4MFEA 5CG7A 3FA5A 5DCDA 1Z48A 4A29A 4M6PA 2NUWA 3G3MA 5I3KA 2B7OA 2FLIA 4R7JA 5HULA 3W1PA 4Z1AA 3VE9A 2C19A 3LOTA 1M7PA 2E77A 2GVJA 1KM4A 2ZCGA 2ZTJA 1DQWA 2VELA 4K6AA 1WA3A 3LCXA 3MYOA 2G97A 1KFJA 3W23A 2ZZ4A 3QMTA 3W7EA 3W1LA 4KFPA 3UPWA 4CLMA 3R89A 3LV6A 3PBVA 5HUOA 1LORA 1Z41A 3EWUA 3L65A 4PL2A 4AF0A 4K7VA 4WQ6A 2AQWA 3H55A 3TKFA 5LHFA 3L0KA 1TRIA 3NQ8A 3NQ6A 5F2GA 1VQTA 1LRQA 2Y85A 4DBDA 2ZA2A 1HUVA 4OV9A 1QNVA 5KZDA 4JX4A 1SUXA 4PTNA 2V82A 3PG8A 1KW1A 3NQCA 1LBMA 1PV8A 5K7JA 4DBEA 6ALDA 4RZ4A 2JKEA 1FCQA 1K8XA 2Z6JA 3FLUA 3DH7A 3R5EA 4P61A 2I1OA 4UTWC 3EX6A 5HWJA 4S2BA 3IIXA 3G1VA 5AC7A 1DQXA 4ALDA 3NPVA 2A4AA 3WJZA 4QAIA 1D9EA 5L6UA 1GPWA 3U2OA 1PE1A 4WY0B 4XBSA 4DELA 3THQA 1H50A 4N02A 3S9YA 1TMHA 4LVAA 1TYGA 5CGQA 4BWLA 1OFRA 3NM3A 1KTBA 3OA3A 1S5VA 5I3FA 2HS8A 2ABBA 3NQFA 4YL2A 1W56A 3LLDA 5D09A 4UMCA 3PS7A 3SGZA 1L6SA 4TX9A 3STCA 3EXTA 3W2MA 1P1XA 4NT0A 1EWEA 1V7YA 3QJAA 3C6CA 5AHFA 5AHEA 1SSGA 2VKZG 1TCDA 2ZZ7A 3G22A 1PHQA 2NUYA 1TQJA 4UTJA 4K39A 3WK2A 4BI7A 4RZ5A 2B4GA 2C18A 3NQAA 1KBIA 2A2IA 4LUJA 2Z6IA 3LBMA 2J24A 3W1MA 3C8FA 4O4VA 2Y70A 1PCKA 2QJGA 4TIMA 1SO6A 1SFLA 2EKCA 1RZMA 2A6NA 2DP3A 3QM3A 5G2IA 3MHGA 1PIIA 4JTSA 3ANYA 1KM6A 2OT0A 5K2ZA 1B4KA 1GVQA 3EWWA 3TROA 1OX6A 2JKPA 2V9DA 2E5BA 5L9FA 1FCVA 2ZZ3A 4N9DA 4UTHA 2YSWA 2X1SA 2QDGA 2YPIA 3I7QA 2YCEA 4MPQA 3W22A 1K02A 3JR2A 1B57A 2EPHA 2ZA3A 3NQ2A 4QNEA 4UCGA 4WXYA 2Y7GA 2WKJA 3KRUA 1OX5A 4X22A 2E68A 1OFAA 3UXAA 3W7QA 2H3DA 2ZRUA 4JTEA 2NUXA 3HBLA 2NXHA 3BG3A 1Q6OA 5D2XA 1FX6A 2ISVA 2E09A 3TH6A 3ATYA 3BGJA 4HIBA 2TRSA 4HT3A 2QCMA 3HGRA 5D2YA 3QW4B 4Y90A 5HR6A 4UNLA 1KTCA 4PCFA 4LS2A 3W87A 4CCCA 2WSYA 3BG9A 3UXDA 4UTLA 3S5ZA 2QCCA 4O54A 2ZRXA 2E6DA 3KVJA 1YTEA 4IWWA 4JTHA 4O52A 3CC1A 1TPFA 3EX2A 2QCFA 4ZQOA 1TTJA 1ZALA 3E0IA 4NZJA 3N3MA 3CU2A 4A2SA 4ONVA 4Q32A 2CZ5A 4MLJA 5I3GA 1K8ZA 4Z08A 3W7JA 3K30A 5K3VA 5BMWA 3CM4A 3C2EA 1UASA 3G0UA 1IIGA 3I6RA 3VFLA 5D30A 2DU2A 1OYAA 1DHPA 1K7FA 1KFKA 1J4EA 3FYOA 5G2WA 4O15A 2WNNA 5A8GA 2GQAA 5HQEA 5HJLA 3W84A 1SSDA 4GC4A 2WPBA 4WZHA 3N9RA 1XCFA 1WQ5A 4TU1A 1KA9F 3JRKA 1FXPA 1A5BA 3ABRA 4IMEA 2B7NA 1R2RA 3HG3A 3C61A 3QQ0A 1FCUA 4JIQA 4MY1A 1TPB1 4IX0A 4XZ9A 3MI2A 1OABA 1ALDA 4O10A 1NAL1 3V75A 3FJLA 3BLEA 4RZ6A 2J27A 4YMZA 1LYXA 2DJXA 2WJZA 1J5TA 1UBSA 4FX7A 2QCLA 3PG9A 4R33A 3ABSA 3C2FA 1B4EA 3TUUA 3W7DA 5BNKA 3TDFA 3IIPA 3CHVA 3F1QA 3LXBA 3TV8A 3BW3A 2C15A 2BZNA 3T4CA 1FWNA 4N2YA 2VENA 1FUYA 1H7RA 4LS1A 3LHYA 4FHAA 1PCWA 1TTPA 5I3JA 1WDWA 2OMAA 3WJWA 4WY0F 4UFKA 1SZEA 1LCOA 1AW2A 1JCMP 3LRLA 4AEOA 1ZAIA 4MLRA 4MKNA 4IXHA 4K7YA 1GYLA 1ME7A 2CLMA 1S5TA 1CX9A 2X30A 3OVQA 2YZRA 3CIWA 5FF0A 2QAFA 3TJLA 5KINA 3CEUA 3S1WA 4NNBA 1Z42A 3W1QA 1JJKA 5IBXC 3W1NA 3N73A 1SO4A 3QSTA 3LTYA 4O4WA 3NZRA 4OWGA 3UWUA 3D0CA 2P10A 1T99A 3ABQA 2H8XA 1IGSA 3MI6A 5CPLA 2E6AA 4JY9A 5K4ZA 4OE7A 2P0OA 3B06A 4O16A 1KLZA 3TSDA 3VNDA 3C2RA 4Y6GA 4PEKA 1FY6A 1N7KA 1FWWA 5LKYA 2FIQA 1AL8A 1TRDA 3O1NA 2X1RA 1VZWA 4XKYB 5AB3A 1TSIA 1KFEA 4AHPA 3H53A 4IMGA 3A5FA 4R34A 3WJXA 4XBKA 1QO2A 1NEYA 3FS2A 5TQLA 5EMUA 2PE4A 3LX9A 4JTLA 1VH7A 3EKZA 4O12A 3WK1A 3GR8A 3UZJA 4PH6A 2ZRVA 4Q4KA 1MEHA 3LTSA 2GJNA 2ZRYA 5CSRA 2EF9A 3G1SA 1MXSA 3SFKA 1EP1A 3I65A 3GLCA 2WSQA 4FEZA 3EX1A 1QO5A 1F7BA 2OCZA 4K38A 1PVNA 4NNAA 3BW4A 2I14A 3HG5A 3W72A 1G69A 1OYCA 1FDYA 3CWOX 1ME8A 3MHFA 1GOXA 1X7FA 4BR1A 1Q6RA 3C56A 3NL3A 3PC0A 2QEZA 3FEMA 4BF9A 5BMXA 4OU1A 3FJ6A 3BG5A 3W2NA 1X8FA 4FX6M 3KXQA 4RX0A 2IQTA 4A2RA 3TU9A 1S5WA 4MYAA 2A1YA 3HOJA 1NF0A 4RR4A 3NR0A 1OFPA 1VLWA 4OQVA 4LV4A 3N9SA 1A50A 2ZBTA 2Z2UA 3W2UA 4DO6A 3EKLA 2PRLA 4JTIA 1TJPA 4JR5A 2I9EA 2EAWA 2PC4A 5AOUA 5LZLA 4L4MA 1VHNA 1WYIA 2DZWA 4JEQA 2VFFA 3GKAA 4JDBA 3NPUA 4BFAA 3EXSA 4K8EA 1YXDA 2QCNA 3N2MA 4QISA 5DBUA 4Y9AA 5G4EA 3S5YA 3P84A 7TIMA 1GZGA 4WX2A 3LCGA 2VFGA 2RHGA 5F4WA 4GWEA 1JQXA 3NQGA 4NXKA 1KFLA 4KWWA 3W2KA 2XN1A 1JR1A 3GXNA 1XC4A 4IMFA 1ZAHA 4LV9A 4JGDA 4UTWA 1VCGA 3B03A 3S1UA 2CLOA 2VEPA 2KZHA 2YR1A 3QQ1A 5DCEA 4C1LA 2CLLA 3HPXA 3PB2A 1W5OA 1ZNNA 2DZSA 1JQVA 1LLZA 4O17A 4O0ZA 4O1AA 1AG1O 5D33A 4ICNA 1LDCA 4MZ8A 4NX0A 2FB2A 3G1YA 1K7EA 5FEPA 1ZENA 3TJXA 3KRSA 1H1YA 3LXAA 4FB7A 3ZS4A 2JKAA 5I3HA 2V5BA 2Y89A 4ADUA 5D2WA 1F74A 2NX9A 3IIOA 5KSWA 3TK7A 1H7OA 1OFOA 3TSBA 4M7SA 1G67A 1ME9A 3LI1A 3CWNA 3CIXA 1SZNA 2JGYA 3P62A 3GR7A 4LC8A 4LNYA 4M19A 4BI6A 4MVAA 1H61A 2PURA 4UMBA 2ZA1A 3B0PA 2ZZ5A 4QQ3A 1DORA 4CQAA 1WOAA 4PODA 4EF9A 3TAKA 1ONRA 2DORA 2VC6A 4UTMA 1I45A 3FKRA 3MBDA 4GUIA 1OK4A 4JTGA 1AW5A 2CLFA 2AGKA 1XDMA 3TW6A 1FXQA 3E02A 3IV3A 4J9JA 4PFMA 1QPNA 5U4NA 4G1KA 3W74A 1TREA 1TB3A 4MFDA 3NQ7A 1QOQA 4HSNA 1OFDA 1KV8A 2E5DA 5HNRA 3L67A 3NL2A 4H6KA 4EOUA 4QITA 3M41A 3TIMA 3NZ1A 3UPBA 3NDOA 5AHIA 2V2CA 5D37A 1KM0A 3L5MA 5J5RA 3W2LA 5EA9A 3CB8A 1TO3A 3QYQA 3KVKA 3KRZA 1Z44A 1G6CA 1RQHA 5DCBA 2B7QA 4GBUA 4JNMA 3TXZA 1M7OA 2OJPA 2OZ0A 4UR7A 3TMQA 1Q3NA 3HMJG 4WXZA 3RFAA 4MZ1A 3RU6A 4GNJA 2Q8ZA 3LM7A 2HTMA 3G1FA 2BXVA 4MJZA 4O13A 3WFAA 3QF0A 4PL1A 4FXRA 2YFOA 1LP6A 3SR7A 4DF1A 3PSWA 2YYUA 1C8VA 1GT8A 3FFSA 4TO8A 1OG0A 1XXXA 4HSOA 5HINA 5C55A 2QUTA 3ZR4A 1NFBA 1TPH1 1ZAJA 1F73A 4K36A 1MSSA 1LLWA 2GQ8A 5K9XA 1F5ZA 2D73A 5C2XA 6TIMA 3A9IA 1YDNA 2ZRZA 1WBJA 3FKKA 4JTTA 1VYSX 3IGXA 3DKJA 5F1VA 4I9AA 3LXCA 1EB3A 4HPJA 1RQBA 2ZRWA 3STFA 2F84A 3IGSA 1B9BA 1IXQA 4YCPA 3TQVA 3W2JA 4O1DA 4N6EA 4GUGA 1RD5A 1DOSA 5BOOA 4M6QA 4GRSA 4WY0A 3TMLA 4N4PA 2CU0A 2YX0A 1OJXA 3CPRA 2RH9A 1UUMA 2C3ZA 3B0VC 3DFPA 2QCDB 1SO5A 1QMLA 2QCGA 3Q2DA 4TMBA 3EB2A 4FNPA 1I2RA 1VR6A 3MBFA 2GVGA 4JD4A 1H51A 2X1TA 3W1AA 3PAJA 4NVTA 2HS6A 1LOSA 3R12A 1OF8A 5LGZA 3GXPA 5E1QA 4YCOA 1OFQA 4E2DA 2Y7EA 3DZ1A 1QR7A 4CNNA 4A21A 4UMAA 5LHEA 2ZZ1A 4GE8A 3UY8A 3GK0A 3C2VA 5KTLA 3TCEA 3LRKA 2YW3A 1SFJA 1H63A 1AMKA 1OFEA 5AC8A 4S1FA 4I7WA 4ADTA 2FFCA 1K7XA 4QIUA 1P4CA 3GAKA 1YTDA 4MY8A 3DI0A 3P8JA 2GVLA 1ZFJA 3GDLA 3G18A 2PRHA 4MUZA 3HB9A 1W1ZA 2ZZ2A 4HNVA 1D3GA 2A21A 1W54A 1J2WA 2ATMA 3RK8A 1IXPA 4H4IA 1TJRA 2YW4A 2QR6A 4JY8A 3L5AA 3P61A 4HKPA 5AYXA 1EIXA 4O57A 3O63A 3ABOA 3TR2A 3OVPA 3W7MA 3WJSA 3OHIA 4AWTA 5C5YA 2A6LA 1SZGA 4IPJA 4AWUA 1LBLA 3HGOA 3PM6A 2V2HA 1OFBA 3NO5A 4O28A 2NV1A 3QC3A 1SW7A 4CCEA 1VGAA 3G8EA 4KFNA 1HO1A 5D38A 3A5VA 1A5CA 4KKXA 4ORMA 3O05A 4RKAA 2P1FA 2V2DA 2RDWA 2X16A 3W7NA 1MEIA 4GUJA 3M5ZA 4IMDA 5TBOA 3IIVA 4UFIA 1W5MA 1TV8A 1I2OA 5LNRA 3ZWTA 2DZPA 4FIQA 3SGUA 4OV4A 4GFSA 3M5YA 3IRDA 5FI8A 1JCNA 5G4WA 3QMSA 1BTMA 4UFLA 3C3NA 1LM1A 3HGSA 4XTDA 1JRBA 3W7OA 4JIPA 3VCRA 4ZQMA 1DL3A 1KBJA 3BVJA 1ML1A 5IM51 2DZUA 3UWWA 1RR2A 5FF3A 1RVGA 5HWMA 5FF4A 3U6WA 4ZMGA 3RMJA 1FWTA 3HIJA 1W3IA 4Q33A 4K8HA 3NNTA 1B3OA 2C1HA 3I7RA 4IOTA 5AHLA 4IJBA 3NGJA 3THAA 3T78A 3QMRA 4HHPA 1GVFA 3N14A 5D2TA 4DO5A 1OVDA 1PHWA 1BEUA 5EL1A 4UNKA 3OBKA 1JCXA 5DXXA 2OT1A 2A5HA 3GNNA 5A5WA 3M5VA 4ZVJA 3W86A 1R46A 2CZFA 1TIMA 3G8RA 1XBXA 4DPQA 3M0ZA 2JK2A 1C29A 3W1TA 4JTJA 1X1OA 3P80A 3HG2A 2CW6A 5G5IA 2JGQA 2BSLA 3UNDA 5CSSA 1EUNA 4MOZA 4I7UA 1W0MA 1LROA 1G4SA 3S5NA 2OX1A 3M47A 3YPIA 3M5XA 3MW7A 1SO3A 1F2JA 1XBYA 3QFEA 1YDOA 1EP2A 1O5KA 2QAPA 3AO0A 5FEXA 4CNOA 4NXSA 4U28A 4A3UA 5F2LA 3MJYA 1XBVA 2VFHA 3W07A 4KFOA 3TFXA 3GNDA 3G3DA 5LNVA 4LT9A 5CZSA 5D05A 2GUUA 1OYBA 3QH2A 1GVRA 1Y0EA 1GTEA 3PY2A 2ISSA 4QNWA 3W76A 1FBAA 4AB4A 2V30A 4OGZA 5AC6A 3PF3A 5D04C 1CW2A 3B8DA 2CWNA 3SZ8A 5EPDA 1YPIA 2H8ZA 1C9DA 2ATSA 5AN7A 1TQXA 3NQVA 3PBYA 2V8ZA 4Z1DA 5DN1A 3C4UA 2WQPA 1EEPA 1GYNA 1KLYA 3QW3A 4UTUA 2G5WA 4NX5A 4A22A 1PL9A 4XKYA 3PULA 5AFDA 1LRTA 3G0SA 5HWNA 2JBMA 1EWDA 4JX6A 4MY9A 4N9BA 1AW1A 1JVNA 3NQMA 3TA6A 3O06A 2DJLA 1DJNA 3A22A 3STEA 3WK0A 2BWGA 1YLVA 2E1DA 2EGZA 3L5LA 3P82A 4AF0B 3GDRA 1YXYA 5U7SA 2J9ZA 3LCHA 3M7WA 3E96A 3EXRA 1OF6A 3KFTA 4UFJA 2Q3OA 2A7NA 1THFD 1P5BA 3MO7A 1YTKA 3M16A 5KZMA 1SW0A 1A53A 2QUVA 3G0XA 4WJEA 1XM3A 3WJYA 1XL9A 1TTIA 1TTQA 5KITA 3W75A 4EWND 4LU0A 4DXVA 2R94A 2WO5A 1XUUA 2FQIA 3UWQA 3NPWA 3EWZA 1XFBA 1ADOA 4N9EA 4Y8FA 3W7RA 4E2BA 3PSVA 3W9ZA 3DU0A 5C6MA 2Y7FA 4BK9A 3PR2A 1TV5A 4PA8A 3W7IA 1H7PA 3O8AA 2TPSA 5EKYA 3C0JA 4JYDA 2YYTA 4AAJA 1A5SA 4DO4A 3Q37A 2C13A 2AAMA 3LRMA 3TSMA 1TPC1 5BW6A 1FWRA 4M5PA 4ZZ9A 3KX6A 3LB0A 3R8RA 4NQ1A 2R8WA 1ICQA 3P5ZA 5ABTA 1I2PA 4OT7A 2TMDA 3HGJA 3NAVA 2FPYA 1O94A 3E9AA 4FNSA 5LSMA 4ML9A 1NSJA 1CI1A 4ZQNA 3NEVA 3B05A 4JICA 3KVLA 2ISWA 2G95A 3I7SA 4FNUA 1G7VA 3MYPA 1GVOA 4CQ9A 2O7QA 1R2TA 3LERA 3L9CA 3MP5A 3O16A 5D32A 3NPXA 1K3UA 3RF9A 1L2UA 1QAPA 2RKXA 3DI1A 3TQ0A 5CZTA 4RXGA 1VLIA 3IEBA 3IGUA 4WD0A 5KZEA 2A7PA 4LRTA 1N8FA 4XTIA 3G1DA 3LHTA 3UYCA 4R53A 3OEXA 3QZEA 1FDJA 4UTTC 4TR9A 3H54A 3NG3A 2ZFAA 2FPVA 3V1PA 1EA0A 3R13A 2NX3A 3NM1A 3LLFA 3DFOA 4GUFA 5D02A 4FNRA 1VC4A 3USBA 1H62A 4ZQPA 1KFBA 1SU5A 4WOQA 4KWVA 4UTKA 4E0CA 1BWKA 3LHWA 1NVMA 1SR9A 2Y63A 5AYZA 1HFBA 4RK8A 1Q45A 4Z1CA 3NOEA 3SSJA 3EWYA 3S1XA 2TSYA 4HNTA 3O07A 4UUIA 3VE7A 5HMSA 4D2JA 3A23A 3OIXA 4JTFA 3SI9A 3W7CA 4EIVA 5F4SA 1JCLA 3GYEA 1E51A 2XN2A 3UWZA 5K4XA 1WV2A 3LBCA 1MEWA 1GWJA 3Q58A 3P60A 1H5YA 4H3DA 4LY8A 3LGEA 5AHMA 2Y7DA 5FF7A 2O7SA 1QFEA 1YADA 3EX3A 5J5DA 1EPXA 1XI3A 4UC5A 5LGXA 4O8RA 3QRHA 2QCHA 4O1CA 3DFTA 3CT7A 1T8XA 5KMYA 1WX0A 3W83A 2ALDA 4UTTA 3NQDA 1BKSA 3W7GA 2RFGA 5I3IA 3B0UX 2CFFA 3DHDA 1F6PA 3INPA 3M43A 1HTIA 1JUBA 3P74A 1LOQA 3S0CA 4PC8A 3ZWSA 3HO8A 3KVMA 4B5NA 3LHZA 3TAOA 2A7RA 1ICPA 3FIGA 2FJKA 4UFMA 5GVJA 2BX7A 4EVZA 1YXCA 3TW7A 4MZYA 5DY3A 1G4TA 3VI2A 3NA8A 2C6QA 1BWLA 3PBUA 3W1RA 4RJEA 1ZCOA 1G7UA 1XKYA 1VRDA 1U83A 5CKSA 5DXYA 1P0KA 4C1KA 1VJIA 2NXIA 5CPNA 1W8SA 4XWUA 4IMCA 2V81A 2WNQA 3O6CA 4FF7A 4NU7A 2LLEA 4FNTA 3IVSA 3P81A 1K03A 4UR8A 2W79A 1G4PA 5EY5A 1KV5A 3SY5A 3L0NA 3STGA 2QF7A 1V5XA 1KM3A 2B7PA 3UWVA 4LS0A 2W6RA 1I2QA 4IPIA 1VHCA 2Z0IA 4XQ6A 2BTMA 1QWGA 5SWUA 1NF7A 4BWLC 4CNPA 4YXGA 3F4WA 3IVUA 1X1ZA 1U5JA 3L0GA 1I8JA 1TPDA 3C52A 5CPOA 3SIZA 3CQ0A 3ZFHA 4IUOA 3JS3A 4K37A 1M6JA 3DXIA 3BPWA 3S6DA 5BRBA 3NVTA 1EUAA 2YGYA 4ZQCA 1Q6QA 3T55A 5FEZA 2CLIA 2WV8A 4AWSA 4LWWA 1GQNA 2QCEA 4LOCA 4AVFA 4RXFA 5E0KA 1OX4A 3F4NA 1F6KA 4FXSA 1X6UA 3FYPA 3EEGA 1L6WA 3LI0A 1WOBA 1QCWA 2ZQ0A 2Q8LA 4MIMA 3MP3A 4RCXA 2ZYFA 4U4MA 2CZDA 3EWBX 1L9WA 3VKJA 4ORIA 2TYSA 3RLUA 1TPUA 3MHUA 3WK3A 2VXNA 3S42A 3G24A 4CQ8A 1VPXA 1QPQA 4UTIA 2C16A 3DGRA 2NLIA 2VFDA 1W31A 3QPYA 1LTDA 3W3OA 3R2GA 3W73A 3GZ3A 1KM2A 2XN0A 1SQ7A 3NL6A
chains in the Genus database with same CATH superfamily
3DC8A 3HN3A 2NSXA 4B9YA 5TIMA 1PKNA 1VENA 2UWFA 4DF2A 4AHQA 4EAYA 1H7XA 3E5BA 1O5RA 5C71A 4O14A 1XIIA 5JBEA 3MMUA 2NV2A 3PFRA 5CZ0A 2NX1A 1CXIA 1Q6EA 1KRCC 3P7YA 4JTRA 5IXEA 5G1YA 1M9HA 4XSMA 3LU2A 4DYJA 1M1BA 3URBA 3VKAA 1R7OA 3LUTA 3LCIA 1IZKA 4UXDA 1M03A 3NDYA 5I78A 4M8UA 4PFHA 4U2ZA 3TYBA 1H7NA 1M65A 4ZQRA 1XFCA 3ATZA 1TPEA 1NDYA 2Z1VA 2C14A 2X1UA 1H11A 1OHLA 3KTCA 3CH0A 4RDYA 2FMOA 1IXNA 1M5WA 2J13A 5DMYA 3AS2A 2D0GA 2HSAA 4O1BA 1RJRA 3E49A 1MNSA 2W4XA 3U2CA 2FZBA 3KAOA 3L68A 4Y96A 4XUGA 3ABZA 5LNSA 4R3UA 3CHDA 4AD5A 1UH2A 4TOQA 4L1XA 4KIEA 4WGHA 2G4FA 3BLKA 4AHOA 2J9YA 1XPGA 5C2CA 1JULA 3ZT7A 3KP1A 2GOUA 3GO2A 2QVNA 6A3HA 2QVHA 4C6CA 5REQA 1CGUA 1RXOB 4ZB2A 5DEZA 3QLDA 1B30A 4G6CA 2AMGA 1UG6A 1B3XA 2HDJA 1BXCA 4O19A 1IE7C 2IXUA 4YVVA 3AXMA 3IS4A 1SM9A 1B0IA 2QUNA 1OX4B 3GBEA 1JRCA 3WQOA 3DFQA 1QNOA 3CMJA 1LZOA 1NU5A 2CLKA 1SW3A 3K1GA 4L4OA 3CO8A 4BS0A 5HPCA 5A8OA 3DFSA 2IW0A 3LA4A 2AKMA 3K4DA 4JXCA 1XBZA 3GSMA 4F48A 3BURA 4HNUA 5FESA 1UD5A 4M7TA 2D23A 4WDUA 1C91A 1DKWA 2E6YA 5C9ZA 1Z9AA 1R2SA 1ZQ5A 3FVMA 3LCFA 3VC6A 1R3VA 1IEIA 4LYQA 4GX8A 1TPVA 3MCOA 5C9WA 4NJIA 2Z1BA 3AYTA 5AYYA 3V18A 2R1LA 1A47A 6PTDA 2JFEX 2BDQA 3KOFA 4O11A 5DANA 3BSHA 1H60A 1Q2RA 4A3YA 4O53A 3N2TA 3S5SA 2PCEA 2BLEA 4DX3A 4GKLA 2INEA 3CUXA 4HB7A 1AUSL 2VEKA 2J9XA 1NQ6A 2CIPA 4MWAD 3PTMA 3PK7A 4C6PA 3QZ6A 2O9OA 1QPOA 3PPCA 2QDHA 4RW5A 4WSKA 4AXKA 4FI4A 4GXMA 4QQUA 2ZADA 4AXNA 4WIWA 1JXJA 3QEZA 3TTSA 3ZT5A 4L4PA 2I5QA 1GG1A 3QVQA 4QJ1A 1UQYA 4KWOA 3BICA 3MZNA 1LBFA 4M6VA 2QUUA 2J8TA 2HCVA 2H90A 3ARSA 3K4AA 3PZTA 3RPTA 4Q4MA 1GCYA 1XYFA 1Y8BA 1GVSA 3TW9A 1HGYA 3VKBA 5HDRA 5ENLA 3LHUA 1QHOA 3WEMA 3WLSA 3AZRA 3T05A 2BHZA 2EG6A 5BWAA 3TXVA 1S3TC 2RDUA 4AZBA 1PX4A 3HPSA 1IWAA 3LCLA 3HF3A 1Q4NX 4JTUA 2QJHA 4GC3A 2FTYA 5HMFA 4L4LA 4UIOA 2L5HA 2NWSA 2QCDA 2R1NA 5G1TA 2VMFA 3B4UA 4J2MA 1DJGA 4FALA 3M44A 3TX9A 4URIA 4F9DA 2GSJA 3HFTA 2WC4A 2PAJA 1PAMA 2V0TA 3GS6A 1F05A 5AHNA 1CLKA 5A69A 1VCVA 3EPOA 4XKMA 1Q6LA 1Q4WA 3OB8A 4LUSA 4KS0A 3CIVA 3QYSA 1IF2A 2DIEA 3UY7A 4HCLA 5FEWA 1QNQA 2GJPA 3M0YA 4X3ZA 2D0FA 4W93A 1CCWB 1O4UA 3IIZA 5K9CA 1BRLB 5LA2A 1UBPC 3MUCA 1YEYA 4O18A 3CTLA 3M9YA 1HO4A 3KBJA 1J0JA 4JBRA 2GJLA 4G7EA 1AK5A 4IICA 1GG0A 2XZ7A 2QJIA 1L2QA 4Q7IA 3UZ5A 1PBGA 4NF7A 3N2BA 3PP7A 1AJ0A 1Z48A 4M6PA 5LIUX 3WBWA 5I3KA 3VCNA 3OZOA 3LPGA 3WDIA 1O1ZA 1E6PA 5E0FA 1BYBA 3SCWA 3VE9A 1K8CA 2E77A 2GVJA 4FXFA 4MTVA 3R0UA 4WGXA 4GY7A 2FJUB 2VD9A 5HMEA 5TD4A 3W23A 2XVPA 2ZZ4A 2Q71A 5HATA 1DWIM 3W7EA 1XSIA 1PYMA 4CU6A 3UPWA 2BGQA 3LV6A 1QK0A 4HZ8A 3QV7A 3A13A 3L65A 4WQ6A 4PTDA 3GTHA 3RHGA 2AQWA 3WY1A 1UOZA 3TKFA 2CKRA 2J7HA 3PZQA 4X0NA 2ZA2A 1QNVA 3B8SA 3WDHA 1A0DA 3FXYA 6TAAA 3NQCA 1PV8A 1JCTA 6ALDA 2PDQA 2C1IA 3DH7A 4P61A 3TTYA 3EX6A 2PSNA 2PU1A 4JFWA 3G1VA 5AC7A 3P2VA 4J2PA 5IFTA 4R88A 3GU9A 3K1DA 3F2CA 3B0XA 2MNRA 3RLHA 4WY0B 4UOZA 5I5RA 4DELA 3SCVA 4WCJA 4N02A 1EXBA 3S9YA 1CB7B 2P88A 3I6TA 1XIDA 5CGQA 1OFRA 1EPVA 4A05A 1S5VA 5I3FA 2HS8A 2QPXA 3N18A 1WUFA 3PTDA 3EXTA 1HT6A 3W2MA 2Q02A 4NT0A 1EWEA 1V7YA 3WQWA 5AHFA 5AHEA 1M01A 1E43A 3AS1A 1FH9A 2NUYA 1TQJA 2RGMA 5CPTA 4BI7A 3WQGA 3NQAA 1FTXA 2XM2A 5REQB 2YL8A 1NOWA 2GDVA 4IFKB 2J24A 2NVAA 3C8FA 4GH1A 1SO6A 1EBHA 2A6NA 3QM3A 5C9UA 3EMZA 2CHRA 4JTSA 3ANYA 3ITGA 3H4WA 5FJUA 3EWWA 1QNPA 3TROA 3GVRA 1OX6A 2JKPA 2V9DA 5L9FA 1FCVA 4R85A 3CWHA 4MPQA 2IPFA 1HX0A 1WO2A 1K02A 3GVQA 2ZA3A 4UCGA 2Y7GA 2VDIA 1C90A 4HTYA 1US3A 1OX5A 1HXJA 2R9RA 3VIOA 1EDTA 4C6IA 3ATYA 1XRTA 2OPJA 4M81A 1R6WA 1XCWA 2QCMA 1LJYA 2OLAA 1KTCA 5A6TC 4AZ5A 4J40A 4L6DA 3BG9A 1I0BA 2BXZA 2P8CA 3S5ZA 4ROQA 2ZRXA 1UZDA 2E6DA 3KVJA 1YTEA 4ILSA 4IWWA 3CC1A 3EX2A 3MV01 4NZJA 3N3MA 4H8HA 3CU2A 4ONVA 4B5XA 2CZ5A 4MLJA 1K8ZA 4HVXA 4IQDA 3W7JA 3K30A 1FWIC 5BMWA 1EDQA 1EL3A 3D6NA 4IGMA 3OYZA 3IJLA 2FZ8A 1Y65A 5D30A 4CN1A 2OLHA 1W9BM 4AIBA 1K7FA 3QR3A 3SCPA 1FWBC 1POKA 4QE5A 1VFTA 4O15A 4F2UA 4UQ9A 1V6TA 4HNOA 4BA0A 5A8GA 5HQEA 4DWDA 3OG2A 1HKMA 1T7LA 4GC4A 2WPBA 2ZUNA 1KA9F 5BOEA 1E73M 1A5BA 4JNZA 4IMEA 2B7NA 4H41A 5CGMA 4Q4QA 3UNTA 2VO5A 4JIQA 3SQLA 1C7TA 4XZ9A 4O10A 3B8IA 3V75A 4GI9A 3JZEA 4L9YA 2Y8UA 3WL0A 4CU7A 4TV6A 1LYXA 4LYKA 2WK2A 3ARWA 3QZAA 3PPFA 1J01A 4IF2A 4RE4A 3PG9A 1QHPA 4R33A 1B4EA 4F66A 3KL5A 4HPNA 5CC5A 1PIFA 3VIHA 3F1QA 1OC7A 5DO8A 1FHUA 3VOFA 4LBSA 2C0HA 5EBAA 4ACZA 3PWGA 1H7RA 1H49A 1MMFA 2ZC1A 3LHYA 1CPUA 2FZDA 3WJWA 1DWAM 1CGTA 1Q8AA 4WY0F 1JCMP 3LRLA 3LBOA 1XQLA 1M53A 1ISVA 1ZAIA 1GYLA 2CLMA 1S5TA 1IEWA 1V0KA 2X30A 4HMEA 5BWFA 3TJLA 3CEUA 4NNBA 2F61A 3LTYA 4OWGA 1UWSA 3SUTA 1O5QA 2P10A 4HPGA 2H8XA 2Y2WA 4AY1A 4EACA 1IT7A 5GNYA 5I24A 3CAWA 3VNDA 5BZAA 4ZO6A 4PEKA 1FY6A 1OG6A 1FWWA 3VZZA 1TRDA 3O1NA 4XKYB 1EZ2A 4P7OA 4LYPA 2OQHA 3UW6A 4WDXA 3N6QA 5TQLA 5EMUA 2PE4A 3LX9A 1XQKA 3EKZA 3GR8A 1FP9A 3LTSA 3BZJA 2QS8A 2GJNA 1RCQA 2ZRYA 5CSRA 1QO5A 4Z2KA 4ZOBA 2PLCA 3VIIA 3VNKA 4JZ5A 1DJXA 1G69A 4NAEA 1FDYA 1XG4A 3AQUA 3A3HA 3BAJA 3NOYA 4J7RA 2WANA 3TYUA 3ZR5A 3FEMA 3B9AA 2OB3A 2ACRA 1J0HA 3FJ6A 3BG5A 2E4TA 3RGTA 4MWAA 4FX6M 3DHUA 3KXQA 3MV11 5FCZA 2YL5A 3WQPA 4GNKB 4OBRA 1S5WA 2WHMA 4DJDC 2PDIA 3PZNA 4QROA 3AUOA 1TVPA 1OFPA 1VLWA 4J3ZA 1TR1A 1A50A 2Z2UA 3W2UA 3BQ5A 5CJ5A 4JTIA 3WCZA 2I9EA 5A6SA 1C3FA 1VHNA 3BZGA 4QXIA 4JEQA 1U2YA 1F4AA 4LBUA 2WZEA 1YXDA 3IV8A 1V93A 2A3LA 5DBUA 1E0VA 1K1DA 2RHGA 5F4WA 5I7GA 4NXKA 3MO4A 3W2KA 1JR1A 3BQ6A 4S39A 3CUIA 4H7CA 1VAHA 1XC4A 4LV9A 4KESA 1WDSA 1GHSA 3S1UA 1QW9A 2CLOA 1LL4A 2YR1A 4MB3A 2VRJA 2CPUA 4B9ZA 3HPXA 3PB2A 1ZNNA 3VUPA 2DZSA 2YDSA 3SURA 1LLZA 1YRRA 4CD6A 2XTKA 1CIUA 3LZ5A 4Q8WA 4IP5A 4GQ0A 5C7HA 4IPNB 3KRSA 4GMEA 3AHZA 1I75A 3IIOA 3VIMA 1W1YA 3SM0A 2XUCA 1XISA 3TSBA 1ME9A 4LC8A 4M19A 1H61A 1NY1A 1XYBA 1J10A 3I4KA 4DJDD 1XCXA 3SQSA 4AW7A 2C8NA 2DORA 2VC6A 4UTMA 3L2MA 5FKYA 1EJSC 5A2BA 1OK4A 3HPFA 4PCSA 3AYVA 4JQ2A 3PJTA 1E9IA 2O4MA 3R0DA 1FXQA 5I77A 4PFMA 1XLKA 3VXGA 3ZJ7A 4G1KA 1GVIA 4MFDA 3NQ7A 1UW9A 1OFDA 2NQ9A 1A5KC 2RUSA 3L67A 4EOUA 4IISA 3ITOA 4R7OA 3TIMA 3NZ1A 3MSDA 1JZ4A 3S3GA 4Y9PA 2V2CA 3WEZA 5D37A 5CBJA 3L5MA 4B3KA 5J5RA 3W2LA 5D4YA 1PSCA 1K9TA 2Y1HA 3TZFA 4LCRA 2FGBA 1Z44A 1UWUA 2B7QA 4GXWA 1UWTA 3TMQA 3HMJG 3EA2A 3UG4A 4F0RA 4AX7A 3APTA 3RU6A 4KBXA 3QHOA 3O6AA 4O13A 3NZQA 2G50A 3GNRA 3V4BA 2ACQA 4HBKA 4DXKA 4JIIX 3PZOA 3BAWA 3OYXA 3FFSA 4TO8A 5C55A 3KRBA 2QUTA 1PKMA 3OBAA 1TPH1 4W87A 2DQWA 1MSSA 4L9ZA 6TIMA 2ZRZA 4KCTA 1VYSX 4DAFA 3IGXA 3UCCA 3TN4A 1WDRA 1XGEA 4I9AA 1EB3A 4HPJA 2F84A 1IXQA 1BF6A 3PFMA 1KXTA 4N42A 4O1DA 2WC3A 3AIEA 1XLEA 4D1JA 1N8WA 5BOOA 1DOSA 4GRSA 2EPMX 4D8AA 4N4PA 4GVGA 2R1MA 4W8LA 1AA1B 3Q2DA 3D3AA 1YBQA 4XV0A 4FNPA 3OZPA 3V5OA 4D8LA 1QK2A 4W4QA 1KWKA 1GVEA 2EPLX 4ZO9A 3UPMA 1X97A 4QGCA 2PZ0A 3I3EA 5LGZA 2J7GA 3GXPA 1CWYA 4E2DA 4GVIA 3VD7A 4CNNA 2YB4A 4UMAA 3GK0A 1SFJA 2H9AB 1OFEA 2PDLA 5AC8A 4S1FA 1YNQA 2WKGA 5G1MA 3A4AA 2PPGA 1K7XA 4QIUA 2FH8A 2CBUA 4ML4A 3DI0A 3MKKA 4V1YA 4L65A 2PRHA 4M1RA 5IHRA 1ISYA 1W1ZA 1KKOA 3N2CA 4HNVA 1DYSA 1Z8AA 5FAGA 3RK8A 4Q4PA 1U30A 4JTDA 1UH4A 3W00A 2HK1A 2RGLA 4O57A 4G2DA 3TR2A 2DEPA 3ZVIA 4AWTA 4FSAA 4M51A 2YA2A 3NZGA 4JQ1A 2V2HA 3B0YA 3ORWA 4EXAA 3RIKA 4QLJA 4OOUA 1SW7A 4KFNA 1HO1A 3A5VA 4REQB 4Q8PA 4US6A 3SN0A 3QY7A 4JFUA 2SFPA 2X16A 2ACUA 1MEIA 3SCRA 5TBOA 4FOUA 1B31A 1TV8A 4FIQA 1DP0A 2VGBA 3RM4A 2HVNA 3CQKA 3IRDA 1JCNA 1BTMA 4I9MA 4XTDA 2HNHA 1TMQA 2CETA 3QR1A 4AZ6A 1DL3A 1KBJA 3P93A 4AD4A 1ML1A 1UIOA 4EXBA 2WVSA 2PWHA 5HWMA 3EMQA 5FF4A 3HIJA 2ZUMA 4K8HA 1BYAA 3NNTA 5AHLA 2VVNA 2F38A 2J79A 3THAA 3IUHA 2WWDA 4DUXA 1OVDA 1PHWA 1GZ1A 4RNIA 3ZSSA 1OD0A 5EL1A 3AHXA 3B8UA 2C91A 1HJSA 1UH3A 2A5HA 3GTIA 5A5WA 4DLFA 1XLJA 4QJ4B 1R46A 3E0WA 4DJFD 4HOZA 2PWUA 4L61A 1VEMA 4AMCA 2BGSA 4YIWA 1QNRA 3ARVA 3P80A 3HG2A 4IUGA 2ANUA 2BVWA 4I7UA 5PTDA 1LROA 1RJQA 3VDGA 4HYWA 3QPEA 3MW7A 5E5CA 4F3HA 3HU7A 3MUIA 2GGGA 1O5KA 3LK6A 1XBVA 2VFHA 2UY5A 3TFXA 1Q65A 5LNVA 1W6TA 1D2KA 1AD4A 5D05A 3W28A 1FKXA 2XWEA 3MDUA 1Y0EA 1GTEA 3GW0A 4B15A 2ISSA 3W76A 5JH2A 2G41A 2OXNA 4OGZA 5AC6A 5B7ZA 5BCAA 4HNLA 2RJHA 5BXPA 4KEUA 5EPDA 5HNUA 1LQAA 3TVAA 2VCBA 1F8IA 2V8ZA 3BAYA 5DN1A 1MW2A 4AD3A 3B9NA 4GIRA 5E9AA 5H8UA 4H83A 3G0SA 4PMYA 3VM7A 4MY9A 4PMVA 3CUZA 3NQMA 2QW5A 3O0KA 1FOBA 1XYMA 3STEA 3BE7A 1YLVA 2E1DA 2EGZA 4AF0B 3GDRA 1YXYA 1PDZA 5U7SA 3SSZA 2J9ZA 3E96A 3IUIA 1OF6A 2PEVA 1PUDA 2CBJA 3KFTA 1XLIA 2QV4A 4UFJA 1LT8A 1M04A 3MO7A 5IRPA 3M16A 1OB0A 3QKZA 4DYEA 3NWRA 1H09A 4H7ZA 5A1AA 1NQKA 1XL9A 1ZBKA 2DVUA 4C65A 4EWND 3T0DA 2NQLA 4Y8EA 2ZX9A 3WELA 3UWQA 2DDXA 1ADOA 2UY4A 2WLYA 2CCRA 4E2BA 3VOHA 2CESA 1W17A 3W9ZA 3VTRA 2Y7FA 2OYMA 3U7VA 4C6NA 5C9XA 3SAZA 1RHCA 4J27A 1RA0A 3KCJA 1A5SA 1XYCA 2O9RA 2AAMA 3R79A 3TSMA 2ESCA 2NV9A 2D22A 4J4KA 4CVUA 3REQB 1ZGDA 2YIHA 3KX6A 3R8RA 1BGGA 4NQ1A 2R8WA 4A8RA 3WX7A 2AL1A 2GLKA 1ISWA 2VCAA 2R1KA 4JQ3A 1K6WA 2E8ZA 5GPRA 4OT7A 1UZ1A 1NSJA 1CI1A 1R87A 6REQB 2PDPA 1EJTC 2HNEA 1A0EA 2G95A 2HE8A 2DSZA 3N9KA 3KP0A 1R2TA 4ENLA 2E9LA 1K3UA 4KCWA 4ZTXA 4JFTA 3DI1A 1JD9A 4D6GA 1W9UA 4NAEB 1N8FA 5DMLA 3LHTA 3L4YA 3UR7A 2PP1A 4UTTC 1L8PA 3UG3A 4TR9A 4B2DD 3H54A 3UGRA 5M5DA 2OKOA 3R13A 2NX3A 4ZE5A 3LLFA 2GDQA 2QMKA 1Q7QA 1DHKA 3A3XA 3N29A 4E0CA 3PAOA 1NARA 3KOWA 1QATA 3LHWA 1HFBA 3E6EA 3N13A 4GBDA 3EDJA 1HP5A 2WZHA 3KM8A 2VUYA 4GO8A 1X38A 2WM1A 3CQHA 1XYLA 3S83A 5I79A 3SI9A 1ZUAX 4EIVA 2XIOA 3V0TA 3GD6A 1KXHA 3MVIA 2P3ZA 1E51A 1JDDA 1TX0A 2XN2A 1WV2A 2NQ5A 4BQ5A 4NI3A 3Q58A 4PMDA 3ZQ9A 1H5YA 3LGEA 2Y7DA 2O7SA 1VBGA 2GK1A 4O8RA 3MKCA 4B3LA 1RY8A 2QCHA 1WX0A 5BRQA 4F0MA 3A4XA 4B3ZA 3W7GA 3GIPA 2CFFA 2DIKA 1F6PA 4V2XA 3INPA 2AOSA 3N6JA 3M43A 5JMUA 1ONXA 4AEEA 3S0CA 4LH8A 3QXBA 3LHZA 1C7SA 4QLLA 1AZ2A 1HGWA 1S5NA 2FJKA 4UFMA 2BX7A 3MPGA 4MZYA 3DERA 4XB3A 3WLRA 1OGGA 1ECEA 1VD6A 1BWLA 3PBUA 2Q09A 2XSAA 3CGTA 1XKYA 1U83A 5DXYA 4BKNA 1VJIA 4GQQA 4XWUA 2JALA 3WL1A 5HQLA 1GQIA 6XIMA 2I17A 4FF7A 1OADA 2W66A 3IJQA 4TTUA 1KV5A 4GYPC 3L0NA 2JEPA 2QF7A 1V5XA 3T2PA 1UD2A 4IPIA 4NAFB 1WDQA 4US5A 1GYMA 1JFXA 4BWLC 2XFYA 1DJHA 4LGXA 4CEXC 3IVUA 1E5JA 3WLKX 4IUOA 5AZ0A 3SB0A 3VIPA 4QX4A 2X41A 3S6DA 3NVTA 1X6LA 4A3QA 1AZ1A 2YGYA 2QCEA 2XH2A 3L4UA 1OX4A 1F6KA 3N17A 3AXXA 4EP8C 4UB9A 1K6AA 2Z1WA 2ZQ0A 1LWIA 4RCXA 4UBPC 4HHMA 1L9WA 3BAIA 3R94A 3VKJA 3OLIA 1VJSA 3CNYA 2B31A 1TPUA 2Y5EA 1LLOA 3WK3A 4B16A 1QPQA 3DGRA 1YDYA 2NLIA 3W3OA 4NAFA 4LUTB 3DG6A 5KEZA 3NL6A 2HMCA 4LVFA 3T0TA 1TWWA 4TX8A 3W88A 1TVLA 5HR7A 5D2VA 1KTNA 5FJTA 1ZY9A 2GVEA 1HZYA 3LDVA 4QM1A 3VKKA 3W02A 4DYKA 3L7RA 3KDOA 3E2QA 4E8CA 4KCVA 5J04A 2UV8G 2J62A 3HPZA 1UWQA 1W9PA 2DSUA 5H2ZA 4JYEA 2CHOA 1TZ9A 3ES7A 3N34A 4WRHA 4AIOA 1VIWA 2QHAA 1W3LA 4W8BA 1UJPA 1V0NA 3T7VA 1E1EA 4F9JA 3BO9A 3OGVA 1JUKA 3URAA 2VX6A 3OVRA 4N9CA 2VX5A 3VO0A 4ZFMA 2Y62A 2CLHA 3IK2A 3S8HA 1R30A 3CBWA 2X40A 1P0NA 4N4QA 3Q94A 5HK4A 4HU3A 3GG1A 1VS1A 4LTSA 1OINA 2D2GA 3LPOA 3DHPA 4GHRA 3SRFA 5GJPA 3BARA 5C70A 1EJUC 1WXJA 2EQDA 4LVGA 2BFGA 3CZEA 4Z42C 3NQEA 1GGOA 2YFNA 2D3NA 2YA1A 2HK0A 1UPPA 1UWRA 4Z0JA 4TXEA 1DWFM 4DJFC 3VNJA 4CEUC 4FF5A 3WN6A 3W7KA 3GXMA 3MCMA 3WLHA 1EGMA 2WQDA 4HN4A 2FFIA 1JDCA 2NXGA 5I0DA 1T0OA 2HPMA 5IBXA 2W0UA 4LEQA 2PDKA 2Z00A 1YPFA 4KEZA 4NRSA 3SUWA 1H1ZA 1V3IA 2PDGA 1PKLA 3OPSA 4EPEC 1Q85A 5DRCA 4NASA 4X2RA 3AIVA 1JXKA 4LC6A 4AC7C 1EKOA 3SJ3A 4PRWA 3WQ5A 1MQRA 3RPMA 2ABAA 3TLLA 4Z2JA 4QJ3B 2E40A 1DEDA 1SPQA 3BW2A 1XGDA 5A8NA 4DEFA 1QPRA 4IP4A 3T07A 4E4UA 1MWOA 2EG7A 2X0YA 2G4JA 4TVUA 1MW1A 3NEHA 3WDJA 4MKSA 3WDPP 3I68A 1CBGA 2YA0A 3CYVA 2ZX6A 3VD5A 2QDEA 4Z2HA 3RLVA 1EZWA 1BRLA 2OGJA 3P5YA 2BV9A 3H7RA 1I2NA 5FOOA 3S2JA 3ZJKA 2V69A 2W63A 1HL2A 2DW6A 3N1AA 1WAUA 4DUOA 3A3WA 3K2GA 3W70A 1AL7A 8XIMA 4JKKA 1E3ZA 2GDUA 1RP8A 1UUOA 4U10A 2V6AA 1AQHA 4X9SA 2A3BA 1VFFA 2H6RA 3QV6A 4KGLA 1Q2SA 1W5NA 4EXQA 1VPQA 1O60A 1E70M 3G1AA 1S5MA 4H7VA 4DPPA 3LG3A 2GGHA 1S2TA 5LXXA 3QPZA 3TN6A 3GVGA 2FHCA 2X2GA 4BEQA 4GYPA 1DIOA 1XYAA 3BLOA 3M0IA 3IVTA 1FA2A 5LNWA 5JBDA 1TA3A 2O0TA 4FAMA 3GDKA 4JDYA 1GW1A 1PS9A 3E0LA 2VX7A 5LNUA 2OOFA 3W71A 3ARPA 1F76A 2A0NA 2WNZA 1GOKA 4OZOA 2Z1KA 3TCSA 3UJSA 2X8RA 5CZJA 4RV8A 1PZ3A 5AVHA 3F7JA 4IFKA 5DMMA 4AYSA 1E72M 3G5EA 3EWXA 3HQPA 3F4DA 3AMDA 4MWAB 1NWSA 5HUPA 4DWSB 2VZVA 3UERA 4FMVA 4CQBA 3H2AA 2VYOA 1OM0A 3RNDA 3GQYA 2GQ9A 1ICSA 3BUVA 1AMYA 4YTUA 3NQBA 3ALGA 1R47A 2J6XA 4ZXLA 3LV5A 1VYRA 4I7VA 4WLCA 4MNLA 1VFHA 4LCQA 3S6OA 5CC6A 3HG4A 1TE6A 3L12A 2BHUA 4FXJA 3KHJA 3WMCA 4B5TA 3MMWA 3UWYA 2DZAA 4GUHA 1KXQA 1O95A 3ELFA 3WD3A 3GE7A 2G96A 4Y2WA 4AIEA 3P3BA 4H9TA 1W1VA 1YDVA 3RX2A 1JPKA 1R5YA 5F4XA 1UD4A 1SZFA 1IIHA 1W3JA 3D3FA 4W88A 1HIZA 4ZGYA 8TIMA 4NNCA 1RPXA 3MWAA 2PD5A 1JIBA 3B04A 3CUGA 4HU4A 3C8NA 2OU4A 5EBUA 3TLQA 3BJTA 3TOPA 3TNOA 1KM5A 1H7WA 4NJGA 3GDTA 2J77A 3N3TA 3W85A 1HJVA 4PUNA 3U2EA 1A5AA 3W7HA 4ZE4A 1CXHA 1AH4A 2KAUC 2D3LA 3SCUA 1DWHM 3OP2A 3G1XA 4JX5A 4PUMA 5XIAA 1D3HA 1OIMA 1XYZA 3W1UA 3MA8A 4JN6A 4NJKA 3U0HA 2CBVA 2E0PA 3P8IA 4FX8A 4O50A 4W7WA 4F8XA 3TQKA 3N4EA 4NRRA 1E1CA 1UCWA 2CZEA 3UQNA 4JYFA 2VR5A 1GQLA 3DCPA 2XVGA 1XH1A 4P2VA 2PP0A 5CG7A 3FA5A 5DCDA 4XD5A 1EYWA 1J5SA 3VOJA 2NUWA 1ZBCA 3RILA 2HBXA 3DN5A 3W1PA 2C19A 1JYWA 3LOTA 1M7PA 1GOMA 1KM4A 2ZCGA 2VELA 4GNVA 3MYOA 5C8BB 2G97A 1KFJA 4JPGA 1GOQA 3FV9A 3QMTA 3UCDA 4KFPA 4CLMA 3R89A 3PBVA 1E4MM 4RZBA 1LORA 1SJDA 3DFYA 2WJFA 4MB4A 3H55A 1GNXA 1TRIA 2GYIA 4H1ZA 4O0QA 3TYAA 3NYDA 4NKCA 3PZVA 5F2GA 3F5KA 1VQTA 2C79A 1HUVA 5KZDA 5CEWA 3LQGA 2FDMA 2V82A 3V36A 3PG8A 4HU0A 1KW1A 3H2CA 1E3XA 5K7JA 3HJEA 4PBGA 2JKEA 1K8XA 3S2CA 2Z6JA 4IIHA 3R5EA 1HKJA 5M03A 4J3VA 4UTWC 1UR0A 4EPKA 3IIXA 3ZVHB 4ALDA 4LALA 3NPVA 1E6SM 3S46A 3WJZA 3DEQA 3KOZA 4DAIA 1D9EA 5L6UA 1GPWA 1ODZA 3U7BA 5A8MA 3VUSA 1PE1A 1V6XA 2V5KA 5HQMA 3A47A 4ERIA 1H50A 4PUWA 1LWHA 1VBRA 2CYGA 5TF0A 1PZ1A 2HE5A 4PEEA 4YL2A 1W56A 4H2CA 5D09A 4JHMA 3PS7A 3DFHA 1E4NA 3KCLA 1P1XA 1SFTA 3TYDA 3C6CA 4TX6A 1SSGA 3IANA 3UVIA 1HW6A 3NSXA 3ICJA 3G22A 1PHQA 4RE3A 4MG4A 1KRMA 3WK2A 4YNGA 3SRDA 2C18A 5FIPA 3AXIA 4JHOA 1KBIA 4JQAA 1OGBA 4BHYA 2Z6IA 4UQEA 3W1MA 2IQDA 1PCKA 2QJGA 4TIMA 2EKCA 3PBMA 3TYCA 2HJPA 4Y7EA 3HQNA 3BLDA 3E2SA 3WF2A 5K2ZA 4HQVA 1B4KA 1PKYA 2E5BA 2ZZ3A 4UTHA 1HP4A 2QDGA 2X0SA 3W22A 1UR3M 1B57A 2EPHA 3NQ2A 4QNEA 1VB9A 3KRUA 2QQ6A 5LYRA 1ELSA 2E68A 3W7QA 3HM7A 2NUXA 4ZSTA 4MJ2A 3BG3A 3EMCA 1Q6OA 5D2XA 4ZXOA 1M41A 4FZIA 2ISVA 1J2BA 3TH6A 2VRQA 2TRSA 3CUJA 1L6FA 5HR6A 3EAUA 4UNLA 1IZJA 4CCCA 4XD4A 3B8TA 2WSYA 2ZE3A 1EOMA 4O54A 1CEOA 1ZP3A 1Y5VA 2DUAA 2A3AA 4TVCA 2FHBA 1TPFA 4NZ5A 1FHDA 3C3UA 1TTJA 4GLEA 1HL9A 2NW0A 4A2SA 3XINA 1WDPA 4XZHA 2Y8VA 1ONWA 4GXPA 3G0UA 3G77A 4ZBCA 4E4PA 3VFLA 4Y9OA 4GGHA 1G9HA 3A4JA 2DU2A 1KFKA 3FYOA 1LUCB 3AS0A 1V51A 2XDFA 5G2WA 3RAOA 4UCFA 2CXGA 1A3XA 1UOKA 4WZHA 4LEFA 1WQ5A 4UQDA 4TU1A 1H0IA 2VT0A 5A6JA 3AMKA 3S9IA 3HG3A 4MY1A 1TPB1 3DBNA 4HA0A 8XIAA 2J27A 3WFLA 4YMZA 2WJZA 1UBSA 2QCLA 3UYIA 3ABSA 3FEQA 3C2FA 1XS2A 1D7FA 2XH7A 2YZ5A 5A6BD 2OEMA 4JL1A 4LBRA 1JF5A 3LXBA 3CHVA 1KGUA 3MMDA 3U4AA 3VILA 3EEZA 3T4CA 2TAAA 4N2YA 4X2PA 3SEPA 3KTSA 3APYA 4HA3A 5ECUA 1MQQA 1TTPA 2OMAA 1NM9A 2DT1A 1SZEA 1LCOA 3TEVA 3PZGA 4MLRA 2D1ZA 4I6VA 2FYMA 1ME7A 3R10A 2BMBA 1UPMB 3OVQA 4QS6A 4XD3A 3MS8A 1XRVA 5EMMA 3W25A 3CIWA 1US2A 3GHUA 1CDGA 3AROA 5J8LA 3H7UA 1RALA 1MRAA 4EPBC 1D3CA 4D71A 4UOQA 3EOEA 1G1YA 3N73A 4O4WA 3FDKA 4OUIA 1V3JA 1BVWA 3ABQA 4JY9A 5K4ZA 4LF2A 3ISIX 4OE7A 4LQ1A 2VX4A 4O16A 5HJYA 5I00A 2HBVA 2EBNA 4Q6JA 2HV5A 1N7KA 2XU2A 2X1RA 1VZWA 2J8GA 4IJCA 3QHMA 1KFEA 3R25A 3BLLA 4IMGA 5E0CA 3GG8A 1W1IE 4R34A 3WJXA 2FKPA 1DIEA 4DHGA 1DJYA 3FNDA 2PLKA 3H2MA 3WK1A 4O12A 3WLTA 3UZJA 1A3HA 1BFNA 4PH6A 1N2VA 4HA4A 2XSXA 4Q4KA 2J7CA 4YYFA 1TJ0A 4P7NA 4QFUA 2EF9A 1MXSA 3SFKA 3WMBA 3I65A 2VZSA 3GLCA 3ARZA 4DJEC 3UJRA 4W86A 5AKQA 1JDFA 4K38A 1UZHA 1PVNA 3W27A 3W72A 1FH8A 2AAAA 1KFWA 4BR1A 1X7FA 3WENA 1Q6RA 1BYDA 3NL3A 2FGZA 2ZUUA 3UA4A 1XIEA 3WLJA 5I6SA 1F8MA 2IMRA 4I5XA 4RX0A 4GFIA 3CZGA 5A6AA 4DJEA 2I57A 1VBUA 4DUVA 3U57A 4A2RA 3TU9A 1XINA 4XZBA 1GOOA 1QW8A 3NR0A 3SQMA 2BVTA 3N9SA 2ZBTA 1XV8A 2VL4A 3S47A 3CK5A 5AOUA 4HZ7A 7CGTA 4C1NB 2VFFA 4N7QA 3ZSTA 4JDBA 2ADAA 4BFAA 4W7UA 2OSYA 1VBHA 3GHSA 3TNBA 2QCNA 4ROPA 3N2MA 1JPHA 4QISA 1ZRQA 4H6RA 3P84A 1GZGA 2PLJA 4GWEA 2DV0A 1JQXA 1F9CA 1KFLA 4MWAE 2XN1A 2E9BA 1VIZA 2YCKX 1EDGA 4UTWA 3KBSA 3B03A 5TNVA 4AZIA 1S2CA 4OOZA 4O0ZA 4O1AA 3TP4A 1AG1O 5D33A 1BSIA 1D7KA 2REQB 2G37A 2OZ8A 5CCZA 1K7EA 3TJXA 4MJ4A 1H1YA 1WKDA 3LXAA 5JXQA 3ZS4A 2VGGA 4C7GA 3UR2A 2Y89A 5D2WA 1F74A 2JE8A 1ZJAA 2NX9A 4CD8A 5KSWA 5AY7A 3TK7A 1H7OA 2G3FA 2PLMA 4M7SA 1G67A 3CWNA 2OWXA 3CIXA 4GVHA 4FP1A 4BI6A 4MVAA 2ZA1A 4INFA 2G3MA 1Q7MA 5M2FX 4DIAA 4X60A 4AIUA 3VIFA 2DH2A 1E5NA 3COTA 4MF4A 2WMKA 2VP8A 3D5HA 4Q7NA 1I45A 2RAGA 4U2YA 3LYEA 1QI5A 3MBDA 3TTEA 2ONEA 3R1ZA 1AW5A 1QHZA 2CLFA 2PD9A 3E02A 4R9OA 1X1NA 1BTCA 4QCEA 3STPA 3B97A 1PTDA 2QZRA 3PTQA 1ITXA 1CGYA 1RUSA 4M29A 2OWWA 3I3BA 1QOQA 4QEHA 4V33A 1JPIA 2E5DA 3FSTA 4H6KA 1E6NA 4QITA 1ZJHA 3NDOA 3SCTA 5JBFA 1J96A 1HQTA 2OZTA 1TO3A 1G6CA 1FWGC 4JNMA 3IWPA 1W1PA 2OVLA 4WXZA 4C6BA 3B9DA 2Q8ZA 3LM7A 1R3RA 2BXVA 4MJZA 2ODOA 4XG1A 1EQCA 4PL1A 5BROA 1CZ1A 2YL9A 4I5UA 3PSWA 2UY2A 2YYUA 1GT8A 1OG0A 4Z17A 4HSOA 5B7YA 1ECQA 3NO1A 4D6JA 3NSNA 4X9YA 3E5PA 1U33A 3OBEA 3TN5A 1LLWA 3BLPX 4YHGA 1R9ZA 5K9XA 3VX0A 5C2XA 1YDNA 1JPMA 3M0JA 4DNMA 4DBUA 4TTGA 2F6UA 4ES4A 4CKQA 3DKJA 5JIPA 1UWAA 3UETA 5F1VA 3HURA 1XLBA 1V6YA 3H7VA 1QASA 4D6EA 5M17A 3W2JA 1TFVA 2WHJA 4PSPA 4PB5A 3KE0A 1UWIA 2YX0A 1OJXA 1UUMA 2PGRA 1BPLB 1QMLA 4TMBA 3EB2A 3HMCA 2GVGA 9RUBA 1I9CB 1H51A 3W1AA 4KRZA 1ADSA 3WDQA 4U3AA 3SRHA 4F79A 3PAJA 3WD2A 3G6MA 1UP3A 1OFQA 3ERPA 2WMIA 3Q65A 5GJMA 2ZUTA 1WXZA 2W92A 1QR7A 1EGZA 4MAZA 1ZS2A 4A21A 7TAAA 3UY8A 3BMVA 3TQPA 4WDWA 3GC2A 2PDXA 1H63A 2WZIA 3CT2A 4AWEA 4GIYA 5CXPA 1OQFA 2R82A 3U4FA 1P4CA 3GAKA 4MY8A 2O9TA 1EX1A 1HNYA 4G7EB 2NT0A 3KBNA 2ZZ2A 1H5VA 2BASA 4N0RA 1IXPA 1I0DA 1IEQA 1TJRA 2YW4A 3P61A 4L80A 3B8WA 5AYXA 3IRSA 3GDBA 1OWQA 3IJ8A 3C0QA 1XIJA 1R3WA 5C5YA 4B5VA 1SZGA 4IPJA 4AWUA 1QJWA 1US0A 2PFHA 1UJQA 3VDBA 1PB0A 1OFBA 3NO5A 3DYMA 2IKHA 4Y9NA 5C9RA 1BKHA 2F9RA 1A5CA 3O05A 4PRTA 1Z69A 3KBVA 1EXPA 2P1FA 1P6CA 2V2DA 2BODX 1R3QA 3M5ZA 3VNIA 1GW9A 3B4YA 4UFIA 5CJMA 1W5MA 3UP8A 3WSUA 3ZWTA 2DZPA 3CB3A 3SGUA 2J4GA 4OV4A 1UA7A 5A6MA 1MRQA 3CL6A 3QMSA 4O1FA 1TUXA 3QR0A 4Q8MA 4UFLA 3C3NA 2ZUSA 3PN8A 1JRBA 4Q3MA 3W7OA 4E2OA 2PGFA 4LB4A 4JIPA 3ZLHA 4AG0A 2V68A 3BVJA 5E6YA 3UWWA 3LD5A 4ZMGA 3RMJA 1FWTA 4Q33A 1W3IA 5HXMA 2WW5A 1KNWA 1B3OA 3PTKA 4IOTA 3NGJA 1R9XA 3QMRA 1GVFA 2DSVA 5D2TA 4DO5A 2GUYA 1V3LA 3OBKA 4GABA 3ZJ6A 1JCXA 5DXXA 1KO0A 1P7TB 3BOXA 3ANUA 1TZ7A 1QI0A 2CNCA 3M5VA 2BY0A 2OELA 2Z24A 2WLZA 3G8RA 3REQA 3M0ZA 4ASTA 3W1TA 3WH5A 4JTJA 1X1OA 1BF2A 1XLGA 4KW2A 5G5IA 2CW6A 2VHLA 1KQZA 2OX1A 3AISA 3M47A 3YPIA 3EB4A 1F2JA 4EE9A 1XBYA 2GGJA 3QFEA 2PTYA 1EP2A 1GKQA 3KOXA 4CNOA 5IFPA 4NXSA 3LPFA 4U28A 1NFPA 4F2BA 2WKLA 3GNDA 5CZSA 1HJXA 4HCHA 2J66A 1OYBA 4A8LA 3QH2A 2YCJA 3PY2A 4H9YA 2FZMA 5D04C 1CW2A 3UXKA 2CWNA 4TVDA 3W82A 3SZ8A 3P0WA 1TQXA 4XZIA 3PBYA 1E55A 3OQEA 5TAOA 4Q8OA 4Z1DA 1PTAA 4L7ZA 2QDDA 2WQPA 4UTUA 3LY0A 5JQ9A 3PULA 3ES8A 3KLKA 3AXKA 2XGBA 1EWDA 5A3HA 1CGWA 5CG0A 1JVNA 2QULA 2DJLA 3A22A 1TCMA 2QUMA 3VNZA 1Y7VA 5HANA 1H41A 3BL3A 1SFSA 4MB1A 3T81A 2ZC8A 3FSUA 1P5BA 5KZMA 1SW0A 4DBSA 3AU2A 3B9EA 4WJEA 4DBWA 1XM3A 2PP3A 3RUBL 1TTQA 5KITA 4H9VA 2R6OA 1VKFA 2WO5A 2XFRA 3EWZA 3NPWA 1XFBA 2ZX8A 2ZKMX 3QV9A 2GJXB 1BYCA 1KWGA 4KETA 4BK9A 4PA8A 3H22A 4CVWA 3EOLA 5C2GA 3GW3A 4JYDA 2YYTA 3OJGA 1V77A 2DPEA 2EKGA 3Q37A 4BEUA 1B3YA 1TPC1 3LEPA 4DZAA 1NH6A 1FWRA 2I7GA 4M5PA 4ZZ9A 1JNEA 4DRSA 3VDCA 3LB0A 3CV1A 2BG5A 4LSBA 4KEMA 7REQB 1ESWA 1I2PA 4QE4A 4IP7A 4FNSA 4MB5A 2X7VA 4GX9A 1CXLA 3GFZA 2BOEX 4QP0A 4K3ZA 5CBBA 3I7SA 1B3VA 1TWSA 4FNUA 3AHVA 3MYPA 1O12A 4GGBA 1GVOA 2FGLA 3QY6A 1LG1A 1UIPA 2BS9A 2V5CA 3SN4A 5D32A 3NPXA 3IGHX 1OBAA 1UC5A 2X05A 5T9CE 2DY3A 4RXGA 1VLIA 3K8MA 1WUEA 4HA1A 4WD0A 3LGGA 4QBXA 4GINA 4R53A 5FJOA 3QZEA 4F2TA 5CPSA 1RJPA 4KH2A 3NG3A 5CC7A 1SZRA 2ZFAA 4XAYA 2FTWA 4GUFA 4L6HA 5D02A 4FNRA 3WQ8A 4RPPA 3USBA 4ZQPA 1ZTVA 3F4CA 2DT2A 4WOQA 3N11A 4KWVA 2HVOA 3WH8A 4UTKA 1BWKA 4UZUA 1SR9A 2Y63A 3FAXA 3CMFA 1Q45A 3F5JA 4GH3A 4Z1CA 1JNDA 3EWYA 1Z89A 1BVNP 3A12A 4G9PA 1XLFA 3TR9A 4QHRA 3H4GA 4NY2A 5T8GA 3A23A 1EF3A 1RPKA 4L9XA 2G8ZA 3GYEA 5EFFA 3UWZA 3AALA 4LNCA 3PJUA 1GWJA 3OW1A 3WMSA 4PMXA 5AHMA 3QFWA 3BOFA 1EPXA 4H04A 5LGXA 3WLLA 4RUBA 4O1CA 3RO8A 3CT7A 1T8XA 5KMYA 2QNEA 4AY8A 1NJJA 2ALDA 3W83A 1U1HA 2RFGA 5I3IA 4S3KA 4XAFA 4PR4A 4P5UA 4BZYA 1X96A 1JEZA 3HO8A 1Y5XA 4QLKA 3ME3A 1QPKA 4U5KA 4DJFA 1MXGA 5GVJA 4LYRA 3VD9A 1XPYA 3NA8A 3M0VA 1EHNA 1J0ZA 3W1RA 5DMNA 1G7UA 4QRNA 1VRDA 5CKSA 1P0KA 2NXIA 3H2OA 3UFYA 4IMCA 3NO3A 1S39A 2V81A 3KL3A 4OFCA 3IVSA 4UR8A 2W79A 1G4PA 2DQXA 3OLEA 3SY5A 3BCJA 4FK9A 4PULA 2B7PA 3UWVA 1B54A 4BF7A 4PSRA 1VJZA 1I2QA 4YJ5A 2Z0IA 3SGGA 5SWUA 2BTMA 1XIGA 3N04A 4H9UA 4JKLA 3L0GA 1ENUA 5CPOA 4MSSA 2YCLA 3POCA 1HJWA 3CZKA 3CQ0A 3KOYA 1NP0A 3UGVA 3V7PA 4B4HA 2JIWA 3DXIA 4S3FA 4A35A 2Z2BA 3POHA 4BQ2A 3MSGA 1UD3A 3A4WA 3IACA 4LAZA 1JAKA 3DIPA 3T55A 5FEZA 4MWAC 3WD1A 1GQNA 3JU2A 1R8LA 4GZJA 2DVXA 5E0KA 4F0KA 3FYPA 3EEGA 1E6ZA 3QQWA 2Q8LA 4MIMA 2WSPA 4U4MA 2GWNA 2OKTA 2CZDA 2PZNA 1AH0A 1DJZA 3VYLA 1O68A 4C1NA 2AGTA 3MHUA 2Z7KA 4CQ8A 1JZ6A 2WMGA 3JVAA 3KBMA 1VP5A 1KM2A 1I6NA 2XN0A 3VZYA 3ZOAA 4LVBA 1XUZA 3C2OA 5A2AA 2V38A 2PA6A 4S3JA 3GU2A 3PBWA 3OGRA 4B4FA 1DIDA 3VAVA 3A24A 1JYXA 3VDHA 3GDMA 5AVNA 1FDZA 4MKVA 3OTRA 2Q6ZA 3VK5A 1T96A 4IIDA 2VEMA 3K5XA 1QI3A 1IEVA 5F2MA 2CLEA 5ABGA 3OG3A 2YXXA 2VC7A 4JL2A 3BGGA 2YXGA 2J88A 3DC0A 2G3NA 4R9XA 1G4EA 3TJIA 3A21A 2V5DA 2XVNA 3AJXA 1KR1A 3KS5A 3N4FA 5BOFA 4BI5A 3TWAA 1RCOB 3PPGA 1G5AA 4AMAA 3GG7A 3Q45A 3GH4A 4PCNA 3MI3A 4FNQA 1R38A 4YLWA 2PDYA 3WNKA 4RE2A 4O0KA 3AIUA 3QHNA 2FPTA 4QSHA 4AH7A 3UR5A 3ONCA 4Q4SA 2P50A 3PVFA 2EPNA 3U8GA 5I09A 4OHQA 1KM1A 3HPAA 3U2ZA 1F07A 5FA5A 2OSWA 3GAYA 1GEQA 1DVJA 2Y6ZA 2W3ZA 4AC1X 1W1B1 3L21A 3DKLA 3GY1A 2ZVIA 2D24A 4XAZA 4NJHA 4PMZA 3S1VA 4P8WA 3CUHA 2ON3A 1EP3A 3AHYA 4WSJA 1A5MC 3IAQA 4GI6A 3SCOA 3KBWA 4UFHA 4E2VA 3GTXA 5D9NA 4LUYA 3C2YA 5H6HA 1L0PA 1R9YA 2WCSA 4HN8A 4JOMA 1XSJA 2DZVA 1R3TA 4IXXA 1DV7A 3CLMA 1DWGM 4MAVA 2AMXA 4MPKA 2Y61A 3W26A 4ADSA 3S1GA 3GTNA 5G4HC 3MANA 3TOYA 2FB3A 3BK0A 4JQ4A 3ITYA 3S2LA 3CL8A 4Q8VA 2R14A 5I23A 2A3HA 1QNSA 2XVLA 3T40A 3V0SA 1EX5A 5CAKA 2PRMA 3PPHA 4HU8A 2R1PA 1VYPX 4GCXA 3NSMA 3R8GA 3AICA 3C0SA 4PB4A 2FHFA 3O6DA 1OCNA 1FWJC 2E5CA 3F2BA 4FR6A 4PZVA 4C6FA 4C7DA 4WOZA 3WNMA 1OK6A 3BCDA 3PUDA 1ISXA 1OC5A 1REQB 4CU8A 3M0LA 5ABHA 4EF8A 4AZCA 2XFWA 4LXFA 4UQAA 4W9TA 1JCJA 2ICSA 4Q8QA 2GPTA 3ONBA 1KR0A 3TYEA 3FGCA 3EDDA 4NI8A 1N55A 2A85A 3SCSA 4X0VA 2Y5SA 3MMTA 3H24A 4RLIA 4AYGA 2PTDA 3WD0A 3BC9A 4ZL1A 3NFUA 4PMJA 1P0DA 2DZTA 4KWUA 1PYFA 3TE9A 5D9PA 4JNYA 1XLAA 2WM0A 1FCBA 3MP4A 5LA0A 5ABFA 5BU6A 4G56A 4QR6A 1B1YA 4QS5A 5LIYX 1O5XA 3AU6A 2WHKA 3ZVHA 2QKFA 2XWDA 2VGIA 4GCAA 4BCEA 2NWRA 2OEKA 3BDKA 3BLFA 2POTA 1MO0A 4BJHA 4MJMA 1Q66A 1QW7A 3NXFA 1RV8A 3WYZA 3W6YA 1K9FA 3TTOA 2PWFA 8A3HA 2DZXA 1H3GA 4FO4A 2J47A 1JYVA 5KZ6A 4C6LA 3UZZA 4GKTA 4IQLA 4FLQA 1I4NA 2VOTA 2ZDRA 5T26A 1XG3A 4I9TA 2DIJA 2ZIDA 2E7FA 4NJJA 4QDWA 1DBTA 1F3TA 5GQBA 5A2CA 3DBPA 2OQLA 3S5OA 3VGHA 2OX4A 2WVUA 4FIRA 5FSEC 2ZZ6A 1GPFA 2PCQA 1CECA 5HBFA 4W84A 4XVEA 1CLVA 3RN6A 2BY1A 3WD4A 1K8YA 3UZYA 2Z26A 2O4QA 2F2HA 1CENA 3EX4A 2FDSA 3FJ4A 3VMOA 3M07A 3HQ1A 1NFGA 1EC8A 2EHHA 2PWEA 4WUIA 3ZR6A 3OLGA 3T08A 1HF6A 4GZIA 5K9DA 1T5AA 3MCNA 1ZBWA 5EMLA 2OGYA 5MF5A 3M64A 1GJPA 3DFNA 2OEJA 5LIWX 3NL5A 4RE0A 2I5GA 2ZVRA 4UQBA 3LNMA 1GOWA 3U5UA 5F1UA 1MVYA 2P8BA 3CZJA 3NTYA 1TPWA 2C0AA 1Q6GA 3T44A 1DJWA 3ALFA 3PZMA 4XD6A 3BXWA 2ZX7A 4ERGA 1U1UA 5LIXX 4P7LA 4YYCA 4D6FA 2E8YA 4HMCA 3WLIA 3ZLFA 3O6YX 2C7FA 4YPJA 3QOKA 1GZJA 4HMNA 1LRNA 1JDAA 3WKZA 4LCSA 2WOQA 3NURA 4US5D 5C54A 4LAOA 3WQDA 3FHQA 2VFEA 1V6VA 4N6FA 2VWTA 4BQ3A 3WNLA 2ZICA 5XINA 2W5FA 1J9YA 3WF0A 3LCWA 2D20A 5H91A 4FA3A 3WH6A 3O15A 4OBTA 1LQ2A 3UEQA 4K1WA 2NZLA 3L66A 4MFEA 3TA9A 1EEXA 2VQUA 3WNPA 3EKGA 1POJA 4A29A 4EX4A 2IS7A 2B7OA 2FLIA 2G3JA 2W9MA 3WNNA 4GZEA 4Z1AA 1XD0A 4D6HA 2AL2B 2ASHA 2PGEA 4K6AA 1WA3A 1FKWA 2WXDM 2YLAA 1E9ZB 2VEFA 2A3CA 3W1LA 4ATLA 3WIJA 1YW1A 5HUOA 4K2SA 5DRIA 1Z41A 1BAGA 1BXNA 1WKYA 3AOFA 1ZU8A 1ITUA 4GI4A 3BSMA 2P3EA 3IJIA 5LHFA 3NQ8A 3WEOA 1R85A 4HJWA 1YPXA 4GPNA 3A6OA 4DBDA 1UP0A 2V63A 3E38A 3NUKA 4OV9A 1I60A 4JX4A 4MGGA 1SUXA 4PTNA 1ISZA 1W3KA 3UJEA 3LS9A 3OIHA 4AD2A 1FCQA 3FLUA 1YNYA 3URQA 5HWJA 3FAWA 4M80A 2PWDA 1Q7ZA 2BP1A 4D1IA 3VMPA 1DQXA 2V3GA 1WAWA 5D8ZA 2A4AA 2GWGA 4PB3A 4QAIA 3OO2A 4C6DA 1GQKA 1XLHA 4NSBA 3U2OA 5FJJA 1JYNA 5C7VA 3VINA 2WB5A 1TYGA 4BWLA 1KTBA 3OA3A 4IT1A 4DM2A 2HWGA 1K77A 3APGA 4DZHA 3H12A 4R7WA 4TUFA 2ABBA 2BVYA 5H1WA 1LL6A 3GVVA 1X8CA 2QXWA 4BF5A 1Q8JA 1V0LA 3STCA 4CN4A 1WZMA 4XO7A 3QJAA 2VKZG 3PJWA 2YJQA 1CB2A 3PZUA 1BG4A 4UTJA 7ODCA 3WBYA 3GZAA 1BHGA 4RV3A 4LUJA 1IYXA 3J7HA 1UZ4A 3LBMA 4XAGA 2GSHA 3H8AA 2Y70A 2WVVB 1SFLA 2DP3A 5G2IA 3GFXA 1OC6A 2BNJA 1EYEA 4N9DA 2X1SA 4IG2A 1R3YA 2X7WA 2OOGA 3HTWA 1JF6A 5H8MA 1NDWA 4IH3A 4WXYA 4YHEA 3RU8X 4LB3A 1T6MA 2YBTA 1CNVA 2Z7GA 4NL1A 2WKJA 4HK5A 4OJYA 4DUWA 2VI0A 1OFAA 3LENA 3UXAA 4JTEA 3HBLA 1Q6CA 2NXHA 3AJ7A 4EPDC 4ATWA 4L6OA 1K9EA 4RNFA 4HIBA 1BSLA 1EHAA 4HT3A 1U5VA 2VWSA 3TTQA 3UXIA 3QW4B 4Y90A 3ITXA 4FPSA 3W87A 1I1WA 2Z1SA 1JZ2A 3VX1A 4UTLA 2QCCA 1KC7A 4WVXA 3F4VA 1IZCA 1VRXA 3QN3A 4ZQOA 1ZALA 3VABA 4PMNA 3E0IA 1ZP4A 3VGDA 3SRKA 3CV2A 5I3GA 3UR8A 4NHVA 4XZLX 5MKGB 3C2EA 4GOAA 4KT2A 1NELA 5D9OA 3T0BA 3R58A 5JU6A 1FVPA 3A64A 4JEJA 1S2VA 4OKDA 3LM3A 4CNSA 3CV6A 3QV8A 2NQJA 3CPGA 3EWDA 4NYUA 3W84A 1SSDA 3GNPA 4ZO8A 4BY3A 2YCIX 4L1GA 4AQLA 1FXPA 3ABRA 3C61A 3NDZA 1FCUA 4AZGA 3IJ7A 4IX0A 2PDNA 3MI2A 1OABA 3ITCA 3H4XA 3KZPA 3FJLA 2DJXA 2ZDSA 1BLIA 4IM4A 4QG9A 3TONA 5BXTA 4AD1A 3EA1A 2QLYA 3KEHA 2CWXA 2VGFA 3CQIA 3L4ZA 4DVOA 3W7DA 1A5UA 2W91A 3TDFA 3BW3A 2FZNA 2BZNA 4Q4RA 1FWNA 1B3WA 4R5EA 4LS1A 2WVTA 4FHAA 1PCWA 3T42A 1H1NA 5I3JA 4GI8A 1WDWA 2P0IA 4J3TA 2W27A 1AW2A 4X61A 1EF2A 4MKNA 2BOGX 1FH7A 4IXHA 4K7YA 4JFSA 1UMLA 1CX9A 1E6RA 1Z7AA 3VGBA 1YIXA 5FF0A 1KCZA 4AEFA 5KINA 3W1QA 1JJKA 2CKSA 4S3CA 3PNUA 1J0YA 4IHCA 3QSTA 3NZRA 3UWUA 1HKKA 1EO7A 3LN3A 1IWBA 2YCLB 3MI6A 2C1GA 2P0OA 1LQ0A 4ZCWA 1KLZA 3DX5A 3T4WA 3TSDA 3C2RA 4Y6GA 2V3FA 5LKYA 2FIQA 1AL8A 3IK4A 4EAMA 5AB3A 1J6PA 3DG7A 1TSIA 1F4HA 4XBKA 5EU9A 4AFYA 1W32A 1NEYA 3MUZ1 1XW8A 3FY1A 1VH7A 1UMYA 1UR1A 2VD8A 1WZAA 2ZRVA 3VGFA 1PX3A 4GISA 3MWCA 1MQPA 4G8TA 1ZBVA 1EP1A 4ZOAA 1IGWA 4WSHA 2WSQA 1V3MA 2RJGA 1MUWA 4FEZA 2OTDA 3T1GA 3FK4A 4NNAA 2IKJA 3BW4A