1OYCA

Old yellow enzyme at 2 angstroms resolution: overall structure, ligand binding and comparison with related flavoproteins
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OLD YELLOW ENZYME
publication title Old yellow enzyme at 2 A resolution: overall structure, ligand binding, and comparison with related flavoproteins.
pubmed doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase(flavoprotein)
total genus 141
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1oycA00
5DY2A 1RZMA 5HNRA 4N9BA 4MJMA 3W70A 1QDSA 1SO5A 4YXGA 2J9ZA 1KBIA 3NQEA 4OBTA 3M43A 4UFLA 4LS0A 4K8HA 3V75A 2CLOA 4RJEA 1QPOA 1SO3A 1AL7A 1W5MA 3FKRA 4FIRA 2NX9A 1NF0A 3BG3A 4UMAA 1DOSA 1HO4A 3IEBA 4LUIA 2X1TA 1PHWA 3BLFA 2ZRUA 3LHZA 4JTJA 4UTTC 4LU0A 4GJ1A 4N02A 1S3HA 1K02A 3W85A 2G5WA 1R2RA 4JDBA 3W7MA 4H4IA 1MEHA 5D38A 4UXDA 1KLZA 2GVLA 2CWNA 2WNZA 3OVQA 2G95A 2AGKA 3S6DA 3UNDA 3W84A 2HS8A 3BW3A 4CQAA 2EGZA 1F05A 3KRSA 1O60A 3S5NA 1N55A 4MYXA 1VHNA 3KRZA 3NQ8A 4JIPA 2RKXA 4DQWA 2EPHA 4B5NA 5FI8A 5LNWA 1KM1A 4WX2A 2B0MA 1GQNA 1TRIA 2ZZ3A 3NQCA 2OJPA 4NXSA 4EWND 3WFAA 5AYXA 1KFBA 3B8DA 3GX9A 2Y63A 2Y7FA 4N2YA 1GWJA 3PAJA 4NZFA 3WJSA 2Y89A 4FX6M 3EXSA 1TPUA 1EP3A 3IGXA 4DO5A 1XI3A 3TMQA 5H2ZA 5DY3A 3DFPA 4K37A 2W0UA 3W7QA 3DU0A 3NQGA 4FX7A 3GIYA 3W7HA 3SJ3A 1W3IA 3M5VA 2VENA 5CZSA 5LNSA 4O1BA 2PURA 3N34A 3O1NA 1XBZA 3O8AA 1GG1A 4XKYA 3U8GA 4MZYA 2P0OA 4PODA 1GYLA 2NUXA 2CLFA 2JBMA 2ZZ5A 4CCEA 5FF0A 3NPXA 3T4CA 3F4WA 3GB6A 1JULA 1Q6RA 1XDLA 2EKCA 5TQLA 5HJLA 5G4WA 4RCXA 3TCEA 1TQXA 3O07A 3O6YX 3BGGA 3TK7A 3LCIA 2GUUA 4OGZA 3FS2A 2QEZA 3RLUA 2Y6ZA 2A7PA 3TFCA 3P82A 4CNPA 4CCDA 2ZYFA 1KM5A 4RV8A 4JTHA 4UIOA 2FPVA 3OVRA 3SZ8A 5KZDA 2A0NA 3O15A 3PM6A 3C4UA 3I68A 1O4UA 3MJYA 2CZDA 4I7WA 4O0ZA 4EVZA 1UUMA 3FFSA 2YFOA 3W07A 2QDHA 1LOQA 5DBUA 1BWKA 1XBXA 4Z0SA 1OX4B 1F6PA 1I8JA 1QOPA 4M7TA 5F2IA 2V9DA 3M41A 5E1QA 3DBPA 2CFFA 4TIMA 4XZ9A 4UUIA 1KV5A 3YPIA 4FX8A 3STGA 2J9YA 3WK1A 2RH9A 4XWUA 3NPWA 4O8RA 4LC8A 1FX6A 4HSNA 1H62A 3CM4A 4L4MA 2Y88A 5HWMA 5D37A 3W7DA 1SW0A 3LDVA 3GKAA 1F5ZA 5I3KA 2FQIA 3L0KA 5DN1A 1WQ5A 2QCHA 3LCWA 4EOUA 1F76A 3TC7A 1XDMA 1TPB1 3GDLA 4RZ6A 4E2DA 2Q3OA 3CEPA 4JYEA 4GXMA 3MUXA 1H51A 1HTIA 3TJXA 3KOFA 4NX5A 1S5TA 2DZPA 3B04A 4O4WA 4RKAA 3TX9A 2J24A 3ZR4A 3HGRA 3DGRA 4O17A 3P81A 3B03A 3O63A 4O1CA 3S5ZA 3EWWA 4JTTA 4UC5A 1LROA 2CLLA 2R14A 1EP1A 4LT9A 3UWUA 1ADOA 1RR2A 1G6CA 3NQ7A 1AG1O 2E6FA 1OX6A 3L5MA 4PA8A 5D2WA 1WAUA 4S2BA 2ALDA 1HFBA 3PG9A 2ZTJA 3EX2A 2QAPA 4JTLA 3C61A 1NSJA 3C52A 5D09A 1W0MA 1X1ZA 4XQ6A 3MHGA 4X22A 5DCDA 1RD5A 3BLIA 5K9CA 4IOTA 3F4NA 4AB4A 1HO1A 1EUNA 1WBJA 2EHHA 2Y62A 4JTFA 2J6XA 3C2VA 1YYAA 5U4NA 4UTJA 1X6UA 1G4EA 3G22A 4RXGA 2NX3A 1IIHA 3T40A 1EX5A 4UNLA 2PCQA 4AHPA 4DF1A 4NXKA 4HPJA 2A4AA 2NV2A 3W83A 1SPQA 2NXGA 1D3GA 1VC4A 4J9JA 4HNVA 3TH6A 4LVGA 3W1UA 1TV8A 2ZFAA 3DH7A 1G7VA 3M7WA 5DXXA 2JKPA 5G1TA 4WOZA 4C1KA 1LRNA 3ATZA 4O11A 2PE4A 4ZVJA 3G1DA 1F73A 3NQFA 2V81A 1RVGA 3GXPA 3HF3A 5EBUA 1TSIA 3FA5A 3N73A 1EB3A 1JVNA 5FESA 4IXXA 3NYZA 1L6SA 2NWSA 3W71A 3KVJA 5AC7A 1K8YA 3NR0A 5KSWA 2EF9A 4NNAA 1G4SA 4UFMA 1TJPA 1JCYA 2F84A 3A24A 2QUUA 2YR1A 3UQNA 3LGEA 3GDRA 1BTMA 4IPJA 3TAKA 1W3TA 1KM6A 5F4XA 4Q32A 2WSQA 3L65A 3I65A 3QMRA 1OFRA 1KW1A 1UCWA 3MMTA 3DFOA 1VH7A 2E5DA 3LXCA 3CWOX 2ISWA 5BRBA 5H91A 5TIMA 1YDNA 3WK0A 3BW4A 3L68A 3IV3A 4NX0A 2CLMA 1GVOA 4O28A 1Z41A 4YCPA 1YTKA 1KM2A 3W7RA 4K7YA 3W7OA 3TR2A 2C13A 3P74A 5T26A 4NNCA 4ZQMA 3B0PA 3PUEA 4UMCA 3LHWA 3CT7A 2P10A 4LY8A 3M9YA 3LX9A 5F1VA 4O15A 4K6AA 4DXVA 3W2MA 1TPH1 3W75A 3E49A 3T44A 3I7QA 4LUJA 5CPMA 3G8EA 5DCEA 4DBEA 3ZWTA 4M19A 1OG0A 3MP4A 3VNDA 4ONVA 1EWDA 5DELA 3ANYA 2YPIA 2C18A 4TMBA 5D2TA 2A85A 1H60A 3S9YA 3W1QA 3QM3A 2RHGA 3N3MA 2ABBA 1T99A 1Q6LA 3HGSA 1H1ZA 1FDZA 4LW7A 4OT7A 1C8VA 5C55A 1A5BA 3W2LA 2E68A 5I3IA 1YDVA 2ATMA 2GQ8A 5AFDA 3P7YA 2JGQA 3FJLA 2VFEA 5J5DA 2AQWA 2OMAA 3SY5A 4M7SA 5D2VA 3LOTA 4Z1AA 4P61A 4UFHA 2XFWA 1FBAA 1JJKA 7TIMA 2W6RA 1VPXA 3O6DA 3MYOA 5FEZA 3CHVA 2GJLA 3UD6A 4OQVA 5F1UA 4Z1BA 2GVJA 3HJZA 4GUJA 3NQAA 1Q6OA 1P4CA 1I45A 2X16A 1GVFA 2PRLA 3PULA 1KTBA 3O16A 3PB2A 3PBWA 4LRSA 3TUUA 3ABQA 1XUUA 3L21A 3PWAA 4QM1A 3B0VC 2ZZ6A 3Q58A 1FWSA 1PCKA 3JS3A 5K3VA 5CKSA 1SSGA 3G3DA 3L5LA 3F03K 3L0NA 4HNTA 3SIZA 2VFGA 3R13A 5LHEA 1AW2A 3QH2A 1W1ZA 1OYBA 4LVDA 1FY6A 3EWBX 4S2CA 2CLIA 2PC4A 3L67A 4JX6A 5AHFA 3GKFA 6ALDA 2QJIA 4QIUA 2DU2A 4GUFA 3LB0A 3W73A 4BF9A 1DBTA 4I7VA 1JCJA 1VJIA 3LCHA 3QPZA 3G1HA 3JR2A 3DKLA 3CQ0A 2A7NA 4JICA 3PR2A 4IMDA 3TU9A 3NL5A 3C6CA 4NJKA 3SGUA 2TRSA 4Z1CA 3W86A 3Q94A 4MZ1A 3VI2A 3LRKA 3WJYA 3ZWSA 4HHPA 3NQ6A 1WA3A 2Q8ZA 1SQ7A 3U6WA 1RV8A 5G5IA 1KFLA 3Q2DA 3W6YA 1HG3A 4HIBA 1NF7A 3R12A 1YXCA 4FNRA 1SFJA 3W1MA 1OYCA 4KFOA 2E6YA 1AL8A 2OT0A 2YW3A 3IVSA 2JKAA 3N9SA 2FPYA 3HPZA 1DJQA 2A5HA 4JYFA 1GJPA 4MFDA 1GOXA 4BWLA 1IGSA 1LLZA 1K8XA 1TPEA 2ZBTA 1W54A 5AHLA 4C1LA 2QUTA 1OFBA 4P2VA 1QFEA 2JGYA 1W5NA 2B7PA 4PTNA 2P1FA 2ZTKA 3EWZA 2YXGA 1TYGA 4LWWA 3SECA 4WOQA 2Q3RA 3QMTA 4LC6A 4OHQA 4QITA 4BFAA 1ICQA 2H3DA 4DF2A 4IJBA 4Y96A 4TMCA 3BO9A 3GLCA 3N2MA 2GOUA 3A23A 1LBLA 2NZLA 3QZEA 3C2EA 2Q8LA 4GRSA 1ONRA 2C14A 3TXZA 1H7NA 5BW6A 1R47A 1LBFA 1MZHA 4I9AA 3Q37A 3LTPA 3NAVA 3FJ6A 2X1UA 3NO5A 2BZNA 1OFDA 3C8FA 1O5XA 1KM4A 3NQVA 3W23A 1TPWA 4O12A 4LRTA 1XBYA 4DELA 4LVFA 3W1PA 5EKYA 3EXRA 3HO8A 3P67A 4Y9AA 4WY0F 3I6RA 5AHNA 4JY8A 4BI5A 3BV4A 1VHCA 3HQ1A 3PUOA 1ZHAA 1E51A 3TW7A 4BR1A 1H7RA 5L6UA 1SO4A 1OFOA 4JN6A 3N19B 3GAYA 4JIQA 1UASA 1LLWA 2C19A 3W2JA 1GVRA 1QR7A 4K39A 1WX0A 4JTEA 1N7KA 3HOJA 5LHFA 5EL1A 3LXBA 2KZHA 2YFNA 3PVFA 3BVJA 1B9BA 3DHDA 3KX6A 2FLIA 4AWTA 4N9EA 2E1DA 2CZ5A 3G0UA 5FF3A 1TTPA 1FUYA 5CZ0A 3UWYA 1SZFA 3S1UA 5AC8A 4I7UA 3QJAA 2NUYA 5D03A 5HMSA 1YXYA 5K9DA 3HGOA 3ZFHA 3W88A 4UTTA 3P8IA 3E0IA 4EF8A 1QCWA 2HS6A 4JTKA 4UMBA 4WJEA 4WXYA 4GE8A 3CLMA 2VELA 2GQAA 3EWXA 3WJXA 5MHBA 3G24A 2WKJA 2ZQ0A 3W1TA 3DI0A 5IBXA 5FF2A 3MBDA 4ZMGA 3N2XA 1GTHA 1LBMA 2YYTA 4QQ3A 2H3BA 3QMSA 1THFD 3LHUA 5EPDA 1LP6A 2BWGA 4Y90A 1OX5A 1ICSA 2V82A 4OE7A 3VE7A 4IUOA 1LCOA 2DZTA 1TREA 2NX1A 2OT1A 3P5YA 4H6KA 3MWAA 1UUOA 2TMDA 1KFCA 1P5BA 3LTSA 1SW3A 3LM7A 1B57A 3IVUA 2R8WA 4UR8A 1U5JA 1KFEA 2CZFA 1FXQA 5DXYA 2B4GA 3O6CA 4AF0A 4FNTA 3QQ1A 3W72A 1R2TA 3TKFA 3LBMA 3G3MA 2ABAA 2G97A 3TA6A 1DJNA 1FWWA 3NM3A 1OVDA 1OFPA 1HL2A 3QYQA 2AAMA 3DXIA 2X1RA 3EWUA 3G1YA 1NVMA 4CQ9A 4R53A 3G1VA 4O54A 3MO7A 4YL2A 5I3GA 4QAIA 4POCA 4TO8A 1TPVA 4UTWA 3WJZA 2Y70A 3GR7A 1VS1A 4RK8A 3BW2A 2BSLA 2Y85A 4X3ZA 1XKYA 4MIMA 1TTIA 5AHMA 2V2DA 2QCGA 1EWEA 3THQA 4AHQA 3RNDA 3UWZA 5D2YA 1KV8A 2VKZG 1G67A 1VYRA 3L9CA 1FXPA 2A1YA 3W7LA 2V5BA 1GYNA 4MVAA 2NXHA 3LLFA 1Q6QA 1H7WA 4IPIA 1LM1A 2FFCA 3GYEA 1OFAA 4WUIA 3VE9A 1TPDA 4KFNA 1JUEA 2X30A 3W7PA 4BI6A 1AMKA 1KTCA 4UTLA 2TYSA 1I2RA 3RK8A 3E02A 2OX1A 3G1SA 5KITA 4LOCA 5A5WA 4ZQOA 1SUXA 1TCDA 1SW7A 1VCFA 3CIXA 2ZRYA 1VCGA 3QF0A 2GPTA 1QPNA 2ZZ4A 5LNRA 4WXZA 1O94A 1W3NA 2VC6A 3U2OA 4N9CA 3S42A 2OZ0A 4UFIA 2QCDB 2A6NA 4N4PA 2WPBA 3MHFA 4YLWA 3H55A 3TQVA 1QOQA 3UY8A 5KINA 3PS7A 1EPXA 4N6FA 1Z42A 3THAA 3LTYA 4O57A 1D9EA 1K8ZA 3QW4B 4Z08A 5G2IA 1T0OA 4WD0A 4AXKA 1ME7A 2DZXA 2QJHA 3W1RA 4PEKA 3M5ZA 1JUBA 3PG8A 2I14A 5K9XA 4Z0JA 3LCXA 2WSRA 1GZGA 3L2IA 3DFSA 1OYAA 5F2GA 1QAPA 1LZOA 4XBSA 4DF0A 1VCVA 4JS3A 3BPWA 5EMUA 4RX0A 1SZEA 3TV8A 1H1YA 2ZA2A 1I2QA 2VEKA 3TSDA 1MEIA 1S5VA 3HGJA 2BXVA 4G1KA 1WV2A 2ZCGA 3TE9A 1GT8A 3TIMA 1J4EA 4FNSA 3O05A 1H61A 2VFIA 4OU1A 4XUGA 2QDGA 4AEOA 3BARA 3LCLA 2H90A 2J88A 1S5WA 2VEPA 4IMEA 5FF4A 4PL2A 5F4WA 3QSTA 4JX5A 5FEWA 3G8RA 1FWRA 1T8XA 3CIWA 4XTDA 3NXFA 2J27A 3EX4A 4IMFA 2WNNA 4LV9A 1Y0EA 4LNYA 1K7EA 1XCFA 1L9WA 3QC3A 4O10A 3PSVA 1KM3A 4TU1A 4UTHA 3W2NA 4MY9A 4OV4A 4R7JA 1SZNA 4KWWA 3NZ1A 1DQWA 4AMAA 3PY2A 3S8HA 3W1NA 3MP3A 5HUPA 1ME9A 3LV6A 3MHUA 4JR5A 4IWWA 3STEA 4UCGA 1ZENA 3TSMA 3M5XA 5FF7A 4MJZA 1RQHA 5F4SA 4H3DA 1DORA 1TQJA 5A8GA 1ZAJA 4MUZA 4M6QA 1AK5A 5HR6A 4IX0A 5HQEA 4PH6A 2E77A 1H5YA 3JRKA 1VYSX 1TIMA 3S5YA 5CG7A 4GUIA 1NEYA 4NZJA 4U28A 2QCLA 3GVGA 3NVTA 4O53A 2A21A 1I2NA 2YW4A 1Z44A 3PUDA 3W2UA 5DCBA 3VKJA 3SGZA 2FB2A 3OEXA 1WBHA 4DEFA 3KAOA 1XXXA 4JTGA 5E0KA 4M6PA 1LRTA 3WK2A 4MPQA 1RQBA 4DO6A 1I2OA 4K8EA 1OF8A 4EIVA 3INPA 1OHLA 2E5BA 3GXNA 2TPSA 3EWYA 5DLCA 5D02A 2UV8G 4MYAA 4LS1A 3W22A 2BLEA 2NLIA 1ZCOA 2HSAA 4IMGA 3TDFA 1V7YA 1KFJA 5AHIA 5BMXA 1YPFA 1OFQA 3W9ZA 2NWRA 2WJZA 1YPIA 3GK0A 3EB2A 4ZQCA 1K03A 2JK2A 2QCDA 3ATYA 5HWNA 3NNTA 3I7RA 2O7QA 4K36A 2V2CA 2Y7DA 1FQ0A 3S1XA 2VXNA 4HPXA 3W7IA 2ZA1A 1P1XA 3G1AA 4FB7A 2HMCA 3A9IA 1YTEA 4LS2A 3QQ0A 4DPPA 4TR9A 3FOKA 3FLUA 3SR7A 3G18A 2Z0IA 5KTLA 1FWNA 4QSHA 2QCNA 3EX3A 1SR9A 2Z1BA 3HPSA 3CEUA 4BWLC 1DV7A 3LCGA 2QF7A 3B06A 1WOAA 4HT3A 2LLEA 3LCFA 4NT0A 3NL3A 3R2GA 2BX7A 3HPXA 2X1SA 1Q45A 3BG5A 3HG2A 3ABRA 5AYZA 2ZRXA 3C2FA 3V1PA 3N14A 4KWVA 2WNQA 1VYPX 4RR4A 1FDJA 1Z48A 2QJGA 4ML9A 3UWVA 1W56A 3ABOA 4N6EA 1TTQA 3RF9A 1J5TA 3UWWA 3HB9A 3K30A 1YLVA 3BG9A 4WY0A 4MFEA 4HSOA 4E38A 3IIOA 1ZAHA 1JUKA 4NVTA 3OBKA 3NPUA 1U83A 5SWUA 4ADSA 1H63A 3QPYA 3RLVA 4BI7A 4O16A 3RU6A 3OIXA 3OG3A 1TV7A 2ISVA 3RMJA 3O06A 4BK9A 2FPTA 3NDOA 1JRBA 3IIPA 1PIIA 3UY7A 4AF0B 5IM51 1L6WA 4PCFA 2C1HA 3LHYA 3WK3A 4JD4A 2FDSA 2YZRA 3R8RA 3ZS4A 2JKEA 1J2WA 5TBOA 5AYYA 4CCCA 4JDYA 1IF2A 2QUVA 3CC1A 1MEWA 3IVTA 2VOMA 2E5CA 2Y7EA 4LVAA 4XBKA 5K4ZA 3DHFA 3FKKA 1K3UA 5K4XA 2CZEA 4N4QA 3W7GA 3NOEA 1YXDA 5KMYA 1P0NA 3CB8A 3UPBA 4FHAA 3P84A 1TTJA 2C0AA 1XUZA 3UYCA 3W1XA 4O14A 5I3FA 2FIQA 2DORA 3AO0A 4UTMA 4PFMA 3NL6A 3DKJA 4K7VA 5D04C 1H7OA 1EA0A 3EX1A 4NJIA 3OVPA 1EUAA 2ATSA 5BNKA 4ADTA 4UR7A 5LNVA 3T7VA 4AVFA 3HIJA 3TJLA 2XN0A 5D30A 3EXTA 4CQ8A 1C29A 1Q3NA 2E09A 3G0SA 2B7QA 5CZJA 1ZNNA 4NQ1A 2VEIA 3IIVA 4O1DA 1KLYA 4GUHA 4U4MA 1SSDA 4PC8A 1B4KA 1I4NA 4IXHA 1ML1A 2TSYA 3IIXA 3C56A 5AOUA 3W7EA 1SFLA 3A21A 4GWEA 3P60A 1M6JA 3G1FA 5I3JA 1CI1A 4GBUA 4A2SA 1QWGA 1DL3A 2YCEA 4A21A 5IBXC 2H8XA 1T96A 3MI3A 2ZZ2A 2FTPA 1TV5A 3GXTA 2XN1A 1H7XA 1BKSA 1ZFJA 2A7RA 1MSSA 4QISA 1ZAIA 2PRHA 1DKWA 4A29A 4ORIA 4ZQRA 1X7FA 2CLEA 3LHVA 2DJLA 3I7SA 4ICNA 3HMJG 3OHIA 5E93A 2V30A 1EEPA 3KRUA 5G4EA 3LI1A 3NQ2A 1F2JA 1PV8A 3ABSA 3A5FA 4UFJA 1WXJA 3E9AA 3GDKA 5HUOA 4JX4A 3PBVA 3C2RA 1LTDA 3TFXA 2DP3A 1LOLA 2WOQA 1N8FA 2ZRZA 3KVLA 4AWSA 3L66A 3STFA 4RZ4A 2WQPA 2E6DA 3DFQA 4HKPA 4TX9A 2V5LA 5CGQA 3PBUA 2HTMA 3NA8A 1KTNA 1FCBA 3NEVA 5CPNA 5CPLA 2I1OA 4HNUA 3EKZA 4UTWC 1G4PA 3QEZA 5LZLA 5G1YA 4S1FA 3TC6A 4CNNA 1YDOA 3IIZA 3R5EA 1KA9F 3CPRA 1KBJA 5C54A 4ZL1A 3EKLA 1LORA 3M16A 5AC6A 1H50A 3E96A 4ALDA 2RDTA 1TPC1 1QMLA 4ADUA 4MLRA 1CX9A 4ORMA 1DQXA 3M1ZA 4JY9A 4KFPA 3PB0A 3M47A 3LLDA 2ZRVA 3TQ0A 3L0GA 5ABTA 1BWLA 4QNEA 3UXDA 3SI9A 3UZJA 2V8ZA 3MBFA 6TIMA 1LYXA 4LV4A 1OK4A 3NZRA 4WZHA 1EP2A 1OJXA 3FEMA 1TRDA 4FEZA 3W7KA 4CNOA 1TB3A 2YX0A 4QNWA 3H54A 1A50A 2VFHA 4O0KA 3NQMA 3S1WA 1G4TA 1VQTA 3GR8A 3W7JA 1JQXA 1ICPA 3KHJA 4NU7A 5HULA 2DZSA 3BLEA 1QNVA 1PL9A 4NJJA 3S1VA 3OA3A 3DI1A 1OF6A 3W3OA 4O52A 4FNPA 4QJ1A 2ISSA 4YCOA 2GQ9A 1TO3A 1XL9A 2W79A 1L2UA 1VGAA 4D2JA 2FB3A 1W37A 3MW7A 1SO6A 1R30A 2YYUA 1AW1A 3FIGA 5BOOA 3W74A 1FCVA 4JTIA 1A5SA 2Z2UA 4MOZA 5K7JA 3QRHA 4AHOA 2QAFA 4GNJA 3C2OA 4GC4A 3EEGA 3QFEA 4NJHA 4O1AA 3DFNA 1SU5A 1WDWA 1W5PA 2VFFA 3TAOA 5KZEA 1K7XA 3W7NA 1NAL1 4UTUA 1C9DA 5LGZA 4GUGA 2DJXA 3P5ZA 3PF3A 3USBA 2CU0A 1RPXA 2Z6JA 4FXRA 3NG3A 4WQ6A 5CZTA 1K7FA 4Z1DA 4M5PA 4AWUA 5LNUA 1H7PA 4X9SA 1UBSA 3VFLA 5FEPA 2GJNA 1W5QA 4UNKA 3W76A 3C0JA 1ME8A 1LRQA 1GVQA 3A22A 2QCMA 2YSWA 2E6AA 1W8SA 3HG5A 1CW2A 4GFSA 1YTDA 1VRDA 4FNQA 5C5YA 4Q33A 5C2XA 2BTMA 1JR1A 3B0UX 3L5AA 5I3HA 3PBYA 2XN2A 1JCNA 3SSJA 5L9FA 1FCQA 2QKFA 2YGYA 2FJKA 2CLHA 3TROA 1ZALA 3WJWA 3FYOA 1XBVA 1NFBA 4LTSA 3TNOA 1IXQA 4RLIA 2J9XA 2PRMA 2VFDA 3IRDA 3VCRA 3QW3A 4MZ8A 3W1LA 1JCMP 3QSRA 1AW5A 3S0CA 1M5WA 3HG3A 1PS9A 3IGSA 5D05A 1M7PA 4UTKA 1W31A 4JGDA 3NGJA 2OCZA 3KVMA 4WY0B 5EY5A 4R34A 2ZZ7A 5LGXA 4HNNA 3TMLA 1FCUA 2H8ZA 1A5CA 3HG4A 4NNBA 3MI2A 4X2RA 3T55A 1VR6A 2A6LA 4JTSA 4ZQPA 3UWQA 2G96A 1TPFA 4IMCA 5KZMA 5AB3A 2X2GA 3STCA 4O18A 3CU2A 3LRMA 4JNMA 3LBCA 3NM1A 1QO2A 5G2HA 2DZUA 3W2KA 4OV9A 4L4LA 2GVGA 3GNNA 5J5RA 4O13A 4AH7A 3AJXA 3W1AA 4JEQA 4IX2A 5HR7A 3UXAA 4XTIA 2O7SA 1BEUA 3GAKA 1IIGA 1DVJA 1MO0A 4M6VA 1PHQA 1G7UA 5D2XA 3EX6A 2ZDRA 1OX4A 4NJGA 2C15A 3TSBA 2H6RA 3S5OA 3B05A 1IXPA 2D73A 1R46A 3P61A 3DFTA 1D3HA 1I2PA 3A5VA 2Z6IA 4JTUA 5CSRA 5G2WA 3LRLA 1EIXA 5HWJA 8TIMA 2RDUA 2NXIA 1QPRA 3GDMA 1JQVA 2NV1A 2C6QA 2I9EA 4FO4A 4PL1A 4IGHA 1QPQA 5LKYA 1TMHA 3TW6A 1XC4A 3DAQA 3PSWA 1V5XA 1OFEA 1G69A 2NUWA 1ALDA 1VLIA 4UFKA 3TXVA 2RFGA 5FEXA 3CTLA 3W7CA 2QCFA 3MI6A 1SZGA 1XM3A 5F2MA 1B4EA 4ZQNA 1F6KA 4W9TA 1L6YA 1UJPA 1WOBA 2VEMA 5LSMA 1OK6A 4K38A 1ZJIA 5D32A 2A2IA 4MLJA 1GPWA 4JYDA 2YDAA 3KFTA 3N9RA 1A5AA 2ZZ1A 3P8JA 1HUVA 1MXSA 3G1XA 4NUWA 3FYPA 3D0CA 1FWTA 2V2HA 1OABA 2ZA3A 3CWNA 2DZWA 4FXSA 5AN7A 5EA9A 2R94A 4UTIA 5HINA 1PCWA 3GDTA 3M0ZA 1RQEA 4HN4A 4O50A 4A22A 3UPWA 1KM0A 1P0KA 2RDWA 4Q4KA 1X8FA 3B4UA 4O4VA 1R2SA 4Y6GA 1JCLA 4JXCA 3G0XA 5AHEA 1GVSA 3DENA 1F7BA 2F7FA 3P62A 5F2LA 2WO5A 2QCCA 3SW6A 4ZZ9A 2B7NA 2EAWA 5EYWA 1GEQA 1IXNA 2B7OA 4A3UA 1A53A 3DZ1A 3C3NA 1JCXA 4DPQA 2R91A 4OWGA 2QCEA 4IQLA 2WV8A 4MY8A 3IGUA 3LXAA 1WYIA 4RZ5A 3NPVA 3PC0A 3H53A 3BGJA 3T78A 1F74A 5GVJA 1FDYA 4KKXA 4O19A 3MYPA 1O5KA 3R89A 1JRCA 1GTEA 4XKYB 2DZVA 3W87A 2Y7GA 1YADA 1LDCA 2CLKA 1ZY9A 3KXQA 4MKNA 4E2BA 2IQTA 1M7OA 3LV5A 3LI0A 4MY1A 5CPOA 5D33A 1IXOA 2WSYA 2Y61A 1O95A 4FF7A 3GNDA 5CSSA 3RFAA 4A2RA 4AAJA 3M5YA 3GZ3A 1XFBA 1KFKA 4N9DA 4YMZA 1GG0A 4R33A 1B3OA 4FIQA 2ZRWA 4YWIA 4EF9A 3M6YA 5K2ZA 5DBTA 3NL2A 4FNUA 3HBLA 3E12A 3NQDA 5U7SA 4RXFA 1PVNA 4CLMA 3M44A 3F1QA 4DO4A 1LOSA 1VZWA 2C16A 3KVKA 1TJRA 5C6MA 3BK0A 3P80A 5BMWA 4Y8FA 1PE1A 3UZ5A 1DHPA 2C3ZA 1X1OA 2CW6A 3TQKA 4DBDA 3LHTA 2QR6A 1W5OA 4E0CA 1VLWA 3LERA 3ELFA 1QO5A 3SFKA 2V0TA 4LVBA 1UB3A 3MP5A
chains in the Genus database with same CATH superfamily
1RZMA 4LAZA 4MJMA 2E1WA 4HOXA 1AD1A 1GOQA 5HXMA 1EDTA 2FZDA 1KBIA 2DIEA 3M43A 3AMGA 3MMWA 4K8HA 3GTXA 2CLOA 4RJEA 3NO3A 1AL7A 3N4EA 4FIRA 5CLTA 2NX9A 4Z2GA 1NF0A 4GI6A 2O9TA 3RRAA 2ZRUA 2HV5A 4JTJA 4TOQA 3WQ8A 4LU0A 1K02A 1QI0A 1ISYA 2XH2A 1T40A 3W85A 1FA2A 4L61A 2G5WA 5RUBA 4H7CA 2XWDA 3CBWA 4M3PA 1FOBA 2VC5A 4H9VA 3SRHA 1JI2A 2WNZA 4GZJA 3W84A 4CQAA 3CXOA 2EGZA 1F05A 4CU8A 2IPFA 4MYXA 1VHNA 3NQ8A 1XFCA 2NLYA 5FI8A 1KM1A 4J3TA 1TRIA 3QZAA 2ZZ3A 3MV01 3WFAA 1XSIA 1KFBA 5AYXA 1OCQA 1XD0A 1SJAA 4PZVA 3TYUA 1X6LA 1R8LA 2BY2A 2O55A 3LK6A 3EDKA 1OGBA 1BVWA 4PUKA 1UZ4A 3TOYA 1EP3A 2WMHA 4DYEA 3BL3A 3IGXA 3AZRA 2ZKMX 1XI3A 1Q6EA 2OEMA 3DFPA 4K37A 3QVQA 1I9CB 3T0AA 1UWAA 3DU0A 2WM0A 4D6CA 1N8IA 3HQOA 4CNSA 4UCFA 3O1NA 3N18A 4ZE4A 1CGYA 2JF7A 1GYLA 2CLFA 3QN3A 4DM2A 1IT0A 2WKLA 4GGHA 2WSPA 4XAZA 2EKCA 2GK1A 5CSUA 5BOEA 5G4WA 2CBIA 4RCXA 1PYMA 3M7SA 1FWBC 2AL2B 1TQXA 3TK7A 3LCIA 2GUUA 1EBHA 4Q8UA 3VILA 2QULA 3FS2A 4XD4A 2OOGA 2QEZA 1WZMA 3W6LA 1P48A 1HJSA 3TFCA 2ADAA 4RV8A 2DW7A 3CAWA 4UQCA 4QAWA 1R3YA 3S9ZA 5E9AA 4HZ6A 3O15A 3PM6A 4JNYA 4MJ4A 3I68A 3MJYA 3E0FA 4I7WA 1XIFA 1GZ1A 3EPNA 1UUMA 3WEMA 2YFOA 4HA1A 3GNOA 4OTKA 5CAHA 2WYSA 1XLEA 1OX4B 1F6PA 4WEVX 3KBWA 5C9ZA 1QOPA 4M7TA 4PCSA 2IMRA 4DM1A 3YPIA 1JPHA 1J0IA 3WK1A 2RH9A 4BEQA 4D8AA 4L4MA 3GU2A 2EQDA 4HK5A 1WQ5A 3S3GA 3UP8A 3LCWA 1TPB1 4RZ6A 1W1YA 2XIMA 4D6DA 1H51A 4W5ZA 4HMEA 3O0FA 4YIWA 4NX5A 3QY6A 4O4WA 3TX9A 3IK4A 3ZR4A 2ZX6A 4IQJA 2V5KA 3HGRA 1EEXA 3H2CA 3EWWA 4JTTA 4UC5A 3W27A 4Q8PA 4KEUA 3K4WA 3KDNA 1EP1A 5EMJA 1R7AA 2EPNA 1ADOA 2GDVA 1XYZA 1G6CA 3NQ7A 3WNNA 1NJJA 3K8KA 4PMVA 2FMNA 4S2BA 1TMQA 3PG9A 3BCJA 2ZTJA 4G2DA 2QAPA 3C61A 2I9UA 3C52A 3BLLA 5DCDA 2OR2A 2PCEA 3GXIA 3WZ0E 2OELA 4IOTA 1HO1A 1WBJA 4AU0A 4JTFA 2G0WA 3C2VA 4JFWA 4YTUA 5U4NA 1X6UA 1G4EA 3OZMA 2GJXA 1IIHA 1F07A 1EX5A 2A4AA 1SPQA 2NXGA 4PBEA 1TA3B 1D3GA 4J9JA 1X96A 3W1UA 1TV8A 3M7WA 5DXXA 1G7VA 5IRPA 2HVOA 4C1KA 1OC5A 3WBWA 5LXEA 5B7YA 3G1DA 1F73A 1GQLA 1RVKA 3QYSA 4MB3A 3NVDA 3GU1A 5D8ZA 4Y9PA 3HF3A 9CGTA 1JZ6A 1NTHA 3BMXA 4Q7BA 4WDTA 3KVJA 1XIIA 3A24A 2PSNA 3LGEA 1W3TA 5F4XA 3BCFA 1L6FA 3MMTA 2E5DA 3GVQA 5GJPA 4PRTA 3GXDA 4HPHA 1EF3A 4D8ZA 4MAZA 3L68A 4F4RA 5GJMA 1HVXA 4AX6A 2YA0A 1M04A 4ZE5A 5A2CA 4OOZA 4K7YA 3PHAA 3EB3A 4GKTA 3W7OA 3B0PA 3WNMA 4UMCA 2HNHA 3LX9A 4DXVA 3RCMA 3EDDA 1UH4A 3W75A 3T44A 3KLLA 2XISA 4DBEA 1OG0A 3PPCA 2WCSA 2G50A 2YPIA 4DO7A 1AQFA 5LA0A 4M56A 4LYPA 4TMBA 1H60A 3S9YA 3CGTA 4QP0A 3N3MA 2ABBA 4JHZA 1V02A 1WP6A 2DIKA 4LW7A 1C8VA 3PNUA 4Q8MA 3WD2A 5A8PA 4R27A 3H7UA 3GRIA 1YDVA 5FIPA 4GACA 2VFEA 1VB9A 1UWQA 2AQWA 4M7SA 4Z1AA 5J04A 4UFHA 1PX8A 2NVDA 2W6RA 1NWSA 3TW9A 3O6DA 3MYOA 2Y1HA 3MB9A 3CHVA 3KE0A 3UD6A 4H2CA 4H6RA 4DZ5A 2GDUA 1C8YA 3G1RA 1Q6OA 3ZXWA 4GI4A 1P4CA 3PZVA 1I45A 4ZENA 5CG0A 2PRLA 1KR0A 4NILA 1KTBA 3VIPA 5HQLA 2QIWA 1BTCA 2GGGA 2YL8A 3BV7A 3PB2A 1IZJA 3SCVA 4EPBC 2X42A 1XUUA 3CQHA 3RYSA 1J8VA 5AKQA 3TYBA 1W9UA 3Q58A 2XGBA 4GZIA 2VC7A 1JF5A 5CKSA 3L0NA 3XINA 2GGHA 1DWHM 1TA3A 2FVLA 1K70A 3QH2A 4LVDA 1Q8JA 3MVIA 3A3WA 2JALA 4S2CA 2CLIA 3L67A 1D7FA 4JX6A 3GKFA 4IP4A 2QJIA 4QIUA 1TZ7A 2ZUUA 1VJIA 3CIVA 3JR2A 5GNYA 3PR2A 4IMDA 3NL5A 4F0HA 4YTTA 3W86A 1EC8A 3MUZ1 2ZUNA 1EO5A 4QS6A 4FLQA 2NVAA 3U6WA 5G5IA 1KFLA 3W6YA 2J8GA 1SFJA 4JTQA 1R38A 2OT0A 2BP1A 1U1JA 4X61A 3L4UA 3WO8A 3EYPA 3HPZA 3JZEA 4Y8EA 3H2FA 1TG7A 3VDBA 1E40A 4QFUA 1XQLA 1RCXB 1YEYA 1TPEA 1I60A 2ZBTA 3OLIA 3AYTA 4C1LA 2QUTA 4AVOA 2OYLA 2JGYA 1JYWA 4PTNA 1BXNA 1NDVA 3SECA 3QMTA 1XJBA 2H3DA 1H4PA 5BWAA 2OODA 4IJBA 2IXUA 2FZNA 4LPCA 2GOUA 2PDLA 4PUUA 1LBLA 2NZLA 3QZEA 3C2EA 3ZR6A 1ONRA 1UD5A 1XLAA 5BW6A 1LBFA 2WZMA 3RXZA 1MZHA 1BF2A 3REQB 5FJJA 2X1UA 3NO5A 4I8DA 2BZNA 2IKJA 3FDGA 4DELA 3W1PA 4QS5A 2G3NA 3P67A 4BY3A 4AY1A 1XIBA 2WC7A 1JDAA 1RSCA 1VHCA 3HQ1A 1EJSC 3O0KA 2VRKA 2XPKA 1UASA 4U3AA 1WX0A 1N7KA 3ERPA 1YE4A 3H24A 2KZHA 2YFNA 1ADSA 2X0YA 1UR1A 1R3RA 2FHFA 3KX6A 5TAOA 2W92A 2FLIA 3CTTA 3GTFA 2F6XA 1SJCA 3G0UA 5FF3A 4RUBA 2VHLA 3UWYA 3S1UA 2A3AA 6REQB 3FSTA 4NKCA 5DF0A 4KPLA 3VGHA 5HMSA 1GVYA 3W88A 5XINA 3RR4A 3ITVA 3P8IA 4J28A 3TN6A 3BLKA 3E0IA 4EF8A 2HS6A 2ZXDA 1AODA 3R0DA 2GQAA 3EWXA 5MHBA 4CNTA 3GBEA 2P8CA 2PD5A 3WLPA 3H7VA 4PCTA 1GOWA 3NEHA 2XVNA 3AMCA 3U5YA 1LBMA 2WBGA 2JFEX 2H3BA 5FOOA 1JZ7A 2OLAA 4FZIA 4M1RA 8XIMA 1CXHA 4DJEC 1ICSA 3VE7A 1LCOA 2NX1A 4Z2KA 2PWDA 4H6KA 1UUOA 1EOMA 3LTSA 2O56A 4ATLA 1U5JA 1Q85A 3BAKA 1OZMA 4FNTA 1NWUA 3QQ1A 2IPGA 4J7RA 3TKFA 4GLEA 2ABAA 5I78A 4TX6A 4PUEA 1OVDA 1OG6A 2EKGA 2FVMA 3UA4A 2PODA 1GQJA 2FFIA 3UGVA 3DXIA 2X1RA 4P8XA 3ALFA 5FJRA 3HURA 4R53A 3N13A 4LUSB 4LUTA 3MO7A 4QAIA 4TO8A 3WBAA 3ANUA 3ZSTA 3E2QA 3WJZA 1VS1A 3K5XA 2Y85A 1XKYA 4KWSA 3BQ6A 4MIMA 1TTIA 2V2DA 2WMJA 4XZBA 5E0FA 4AHQA 1XD1A 3KCOA 2PWHA 3UWZA 3RHGA 1G67A 2A1YA 4Q8TA 2PGRA 1GYNA 2WJDA 1MXDA 1LM1A 3REQA 3VDCA 4WUIA 1QJWA 4KFNA 4X2PA 4GY1A 5BU6A 1AMKA 3MWCA 4K2SA 2TYSA 3BAIA 1ISXA 3AIBA 4HN8A 3G1SA 2XVGA 4M81A 5XIMA 4LOCA 5E5CA 1TCDA 1SW7A 3CIXA 5IHRA 1VCGA 2GPTA 1QPNA 2ZZ4A 5JQ9A 5LNRA 3WDJA 4WXZA 4MJ2A 2OZ0A 4QCEA 3TC3A 2J6VA 1PZ0A 4GQQA 2QNEA 4F9DA 1PKNA 5C71A 1QOQA 2DSWA 5KINA 4N6FA 4Z2JA 4IMAA 1Z42A 3OHMB 3THAA 3LTYA 3KZSA 7REQB 4FLRA 4LJ3A 2QDEA 3ISIX 3U7VA 4WD0A 4GO8A 4AXKA 1MQQA 1OD0A 1IEWA 4ACZB 3TA9A 3M5ZA 5K9XA 3S9IA 5I09A 2XM1A 1OYAA 3KCLA 2ICSA 1VCVA 4F0KA 5EMUA 4M29A 4RX0A 3RMEA 1SZEA 3RG6A 3TV8A 2ZA2A 3DCPA 4NY2A 4J3UA 1E9YB 1I2QA 2VEKA 4MDOA 4IPLA 3TSDA 5DMLA 1WV2A 5REQA 1ONXA 3PZQA 4WKAA 3V7PA 3O05A 4XUGA 3LCLA 2H90A 2J88A 2R1NA 2PBOA 4JX5A 5FEWA 3JVAA 1VPQA 1XH0A 2GFTA 3CIWA 3FNDA 4XTDA 2I5IA 3GBDA 2J27A 4ZTYA 4C90A 4EAMA 2D0GA 2V3EA 3KHDA 3EX4A 4EK7A 3QC3A 4O10A 1UHVA 3DC0A 4TU1A 4QROA 1LQ2A 5FAGA 1GOKA 2RGMA 4ZO9A 3PY2A 1E6PA 1KXVA 3LV6A 1H0GA 3GC4A 2VVSA 4QJ3B 1ZENA 1TE1A 4R3UA 1V08A 3N6QA 1ZBWA 4AG0A 1DORA 4HYWA 1V3MA 1AK5A 4OFCA 4AD4A 1GGOA 4PH6A 5E70A 1ZP3A 4Q4PA 3JRKA 3GIPA 2O0TA 2Q09A 1YX1A 5JXQA 2WHMA 3GVGA 3NVTA 1E5NA 1I2NA 1Z44A 1XQKA 5DCBA 3ZJ7A 5TF0A 3KOZA 3OEXA 4DEFA 4JTGA 4M6PA 4PRWA 1RQBA 4NSBA 3KOYA 1OF8A 4YTRA 3UBPC 2HK1A 2TPSA 3M64A 3OLDA 3EWYA 4K1GA 5D02A 4MYAA 4RNJA 3A4XA 3RN6A 2OKOA 5BMXA 1YPFA 2FGBA 3W9ZA 1UD8A 2NWRA 1POKA 3AMDA 2JK2A 5HWNA 1K77A 3MSYA 3S1XA 8CGTA 1R85A 1HP5A 3WMSA 4XAYA 3ABXA 1V6XA 4HPXA 5JBFA 1P1XA 1V8EA 3OPSA 1JXKA 3LPOA 1UIOA 2PWUA 1QHZA 3QQ0A 3PAOA 1DJZA 1FWNA 4IFRA 4KETA 4QSHA 4B9YA 2WHLA 2Z1BA 4U5KA 2OLHA 4ASTA 3LCGA 3KWXA 4AZ7A 3AU6A 3SB0A 4J4KA 4NT0A 2XFYA 2BX7A 3UT0A 1Q45A 1NWTA 2B81A 5CZKA 4GIRA 5AYZA 3C2FA 4KWVA 2VVNA 1VYPX 4RR4A 1Z48A 2QJGA 3K8MA 1RCQA 4LCQA 1J5TA 1MI3A 3WG6A 3PBMA 2GUYA 4HSOA 3AAMA 2PFHA 2VRQA 3VZXA 4WDWA 1JD7A 3U9IA 3NPUA 3HV8A 1RA0A 4ADSA 1N2VA 1V6TA 4IL2A 2VUYA 4KRTA 3OIXA 1TV7A 2DFAA 1VEOA 3BH4A 5C9WA 1M03A 3ANVA 4AF0B 1PAMA 1IT8A 5IM51 1Q4WA 3LHYA 2D2GA 3R8RA 3ZS4A 3A13A 5AYYA 1QW9A 4AYSA 1M01A 4MF4A 2Z1KA 3ZIZA 2GJPA 2VTFA 2ZVRA 1P0NA 2XIBA 4FHAA 5FJIA 5CH9A 1TTJA 3QGAC 3WELA 3UYCA 4O14A 3OQEA 3PWGA 3NWRA 1KGUA 1MUWA 4K7VA 2CERA 5D04C 1HGWA 4RDYA 1CPUA 1EUAA 5LNVA 1NQKA 3B4YA 3H2NA 4AVFA 4I9TA 5D30A 2E09A 2B7QA 4GVFA 3OG2A 3WMCA 3T05A 3WDIA 4H7VA 5AYBA 2WPGA 3WFLA 1XGDA 1HKWA 4PSPA 3AROA 2G8ZA 1OIMA 2O92A 3AZTA 2J7DA 1ML1A 2NT1A 4FP1A 3G1FA 1UOKA 3L2MA 4B5UA 5I3JA 1H1NA 4CUCA 2EPOA 2PP3A 2ZZ2A 1M3UA 2FTPA 3CV7A 2VZUA 4EPEC 3QTPA 3TZFA 4I5XA 4AZHA 1UWUA 4HZ7A 1XIJA 1J11A 1ZAIA 3CS2A 3LBOA 2P5NA 4ICNA 3HMJG 3OHIA 2W67A 4HD5A 3TZNA 3ABSA 1WXJA 5AVNA 5HUOA 2J66A 5FA5A 3TQPA 3PBVA 1LTDA 2DDXA 2WOQA 1N8FA 4AWSA 5A95A 3STFA 6XIAA 2Q6ZA 4RZ4A 2YL5A 3HM7A 3S2MA 5C9RA 5CPNA 1UOZA 1DWGM 5CPLA 1ITQA 4HNUA 3M0VA 3PUGA 3QEZA 3TC6A 3WNOA 3MJMA 1YDOA 3POCA 3SCSA 3AXMA 1V6YA 2YLAA 3ITOA 1KA9F 1CGUA 2O9RA 4XZWA 3PPGA 2C0HA 2NV9A 3E96A 5CBIA 4ALDA 4D6IA 1TPC1 5KEZA 4JY9A 3PB0A 1MDLA 3LLDA 4Q8WA 2ZRVA 4ML4A 1BWLA 4QNEA 1EJUC 3IJ9A 2VDHA 3MBFA 5DANA 6TIMA 4R85A 1FFRA 1MNSA 2DSZA 4QXIA 3I4KA 1EP2A 4ZO6A 4QJ5B 1P6BA 4FEZA 1TB3A 2PB1A 1R3SA 4XZHA 4FF5A 3H54A 1A50A 3R0KA 4O0KA 3NQMA 3S47A 1VQTA 2J8FA 3K46A 4ROQA 5DRIA 4H9UA 4IG2A 4HJWA 1ICPA 3PZNA 2DZSA 5I79A 1UKOA 4NJJA 2W27A 3UCQA 4M0XA 4F9JA 1OF6A 4BQ2A 3WQ4A 2A3LA 3NSNA 4D2JA 1GHRA 1SGJA 4JQ3A 3LA4A 3WQVA 3GIQA 1R30A 4PMQA 1LT7A 1AW1A 2WJFA 3B97A 5BOOA 3I3EA 3WD0A 4AHOA 2QAFA 3K2GA 3VIHA 2QV5A 4GC4A 4XISA 3EEGA 1WDWA 1W5PA 3TAOA 1A4LA 5KZEA 2FH8A 1DJYA 4CNUA 3LLXA 4US5A 2V3DA 3B9OA 1TELA 1AVAA 3PF3A 5D8WA 1WDSA 3K8LA 4V15A 5CZTA 1H7PA 4AMCA 1MYRA 3FA3A 3EWCA 3APGA 3V1HA 1U33A 1XYAA 2QPSA 4UNKA 3RGTA 3VKCA 4TUFA 2QCMA 2E28A 1OINA 4F2UA 1W8GA 5CAKA 4GFSA 2UZ9A 3LZ5A 3KEHA 5CGMA 4D9PA 2BGNE 3PBYA 4MAVA 4NAFB 5L9FA 3SSJA 1BKHA 1FCQA 2YGYA 2EPKX 2VCBA 4TX8A 2FJKA 5EFFA 3PJUA 2E67A 4RZBA 3FYOA 4MNJA 1Q66A 3LEPA 4GD0A 1IZCA 2VFDA 3UG8A 3BJSA 1M5WA 1RJQA 1Q7ZA 1E5JA 1P7TB 4R5EA 4JGDA 1K9DA 3E5PA 2OCZA 3R4IA 4WY0B 3VCCA 2GGEA 2VX5A 5FJUA 4MUPA 5LGXA 1WDRA 2XGZA 3TMLA 1Y5VA 1FCUA 1A5CA 3MI2A 4X2RA 4M51A 3WQGA 1C3FA 2QJJA 4GZEA 4TTGA 3IS4A 3WN6A 5ECVA 2EEXA 4JQ4A 3VABA 5D4YA 2NT0A 3RM4A 4C65A 3ITYA 3SSZA 4ZA0A 4AUBA 1FKXA 3LBCA 2GWNA 3LYEA 3W2KA 4OV9A 2GVGA 1MW2A 1W1TA 3UGRA 1RJRA 4Q4MA 2W63A 3W1AA 4IX2A 1V0KA 2HDJA 4XTIA 4LCSA 4J3WA 3VINA 4K68A 3Q4DA 3E0VA 1OSEA 2V3FA 2QT3A 5D2XA 2ZDRA 4NJGA 1E43A 2WK2A 4LF2A 2H6RA 2Z00A 1CWYA 3SN0A 3DFTA 4WKHA 1I2PA 2RUSA 4JTUA 4JQ1A 3WLQA 5G1MA 4NG3A 2PPGA 2NXIA 2VR4A 1TUFA 3WH7A 2NV1A 2BGSA 3EDFA 5DT7A 2RJHA 5AC5A 1KRBC 1TMHA 4HCHA 3TW6A 1EDGA 4BEUA 2OQYA 3ZOAA 2NUWA 1ALDA 2RFGA 5FEXA 3CTLA 2VEFA 1SZGA 1OCBA 1B4EA 1F6KA 3RPDA 2HEJA 1WOBA 1ELSA 4L6OA 2PZNA 4K38A 2VQUA 2A2IA 3APYA 1L8NA 4QSFA 3A47A 3FYPA 4QG8A 1OABA 5AN7A 4FXSA 3LM3A 3K1GA 4QG9A 4UQBA 4DJFD 1PCWA 4DIAA 3R1ZA 3M0ZA 1RQEA 4HN4A 1DWJM 5XIAA 4AZBA 2VRJA 4P7OA 3SY8A 3VUPA 3UPWA 2WWDA 4JKKA 3I10A 3QXBA 1OT2A 2RDWA 3H2EA 3URAA 4D1IA 1W9PA 4REQB 2O4QA 3DENA 4L1GA 1F7BA 1BRLA 4BCEA 2A3CA 4F0SA 4E8DA 2EAWA 2YDRA 2V5DA 3XISA 4F8XA 3GVRA 1JCXA 2CBVA 2QLYA 2R91A 4IQLA 2WXDM 4RZ5A 3NPVA 3PC0A 1RK6A 2XGIA 4DRSA 2TODA 5EU9A 3AHZA 3H8AA 3V36A 3W87A 5HJXA 1ZY9A 3KXQA 3VC6A 4H9TA 4OECA 3V5OA 3QHMA 1GNXA 1XRTA 5CPOA 4W87A 4AAJA 4FF7A 1XFBA 1I1WA 1ZSXA 1GG0A 4R33A 1B3OA 3UVAA 2ZRWA 4TVCA 4O1FA 3FK4A 4CVUA 5DBTA 3WQ6A 2HCVA 4KEZA 1VBUA 2NQ9A 3NZQA 4KCUA 3NQDA 1WXYA 4HHLA 4HCLA 2OU4A 1PVNA 2V67A 3C5QA 4CLMA 6CGTA 4DO4A 1LOSA 2R82A 3KVKA 1HXJA 3P80A 4DI8A 4Y8FA 1PE1A 3WBXA 3SRDA 4D72A 1I0BA 5I24A 2CW6A 4HMCA 4DBUA 3NGFA 1YDYA 4E0CA 2PEVA 3LERA 3VYLA 3ELFA 3L23A 3OGVA 1QO5A 3SFKA 4KGJA 2NSXA 1UB3A 4L80A 1HF6A 2WMIB 2YXXA 1QDSA 4YXGA 4PTWA 2DY3A 4UFLA 4LS0A 4V1XA 2DSVA 1GZJA 4PEEA 1SO3A 1W5MA 2F8QA 3FKRA 4ZB0A 1DOSA 1HO4A 4F48A 3CMGA 3BSGA 5FSEC 3OLEA 3BLFA 3LHZA 1VFLA 4Q7IA 1X39A 4LEQA 1GKPA 3G77A 1QRQA 3NOYA 1F8IA 4IH3A 4XKMA 2E40A 3W7MA 4H4IA 1YKWA 2WZTA 3PZOA 1PIGA 3H22A 2GVLA 3SQLA 3BSMA 2G95A 4GQRA 3S6DA 2HS8A 3BTNA 4HOZA 3PPHA 1R86A 1N55A 3T0CA 1RUSA 1DP0A 3NTYA 4DQWA 2EPHA 1VAHA 3L4ZA 5JIWA 4B5NA 2J75A 2B0MA 3CK5A 1RHCA 1GQNA 1PUDA 4GOAA 5DX7A 3NQCA 3GTNA 1Z32X 3FHQA 3C2YA 4OUIA 5C7HA 1YMYA 2OSXA 4REQA 4J5NA 4I6KA 1JYVA 3WH5A 3GHTA 4L64A 3FJ4A 2DSUA 1TPUA 2QIIA 2PLJA 3F7JA 3NFUA 1P0EA 3WUFA 3LNMA 5DY3A 3DG7A 3W7QA 3NQGA 3WIJA 2AQVA 2R9RA 2BVTA 4MM1A 3M0LA 2OPJA 3W7HA 2NQJA 3SJ3A 1W3IA 3VOFA 1TVPA 4O1BA 4DUWA 1XBZA 4ZOBA 1P6CA 1VIZA 3N2CA 4JQ2A 2P0OA 4RE2A 4PODA 3WDHA 2Z2AA 2NUXA 3VIIA 2ZZ5A 4S3AA 1SFSA 1ZRQA 3WQEA 1MVYA 4CCEA 5FF0A 3NPXA 3GFXA 4WK9A 4EPKA 4L1WA 2D24A 1JULA 4DLFA 1Q6RA 1XDLA 1O12A 4GZ7A 3FA4A 1G5AA 4C91A 5TQLA 3TCEA 3O07A 3BGGA 2CITA 1MNZA 5BCAA 2XM2A 2A7PA 3ZMRA 5CSYA 1KM5A 4JTHA 3Q67A 2SFPA 2FPVA 1EXBA 4C1NB 3SZ8A 1FWDC 4JN7A 2A0NA 3HPFA 2DQXA 2Z27A 3C4UA 3IJ8A 4RNHA 3FFSA 2QDHA 4X0VA 1NDZA 4JOMA 1BWKA 1XBXA 3PWIA 1UZ1A 2JE8A 2V9DA 3M41A 1WUFA 3ITLA 1RY0A 4ZTXA 3FGCA 4ROPA 1FX6A 1GHSA 4HSNA 1H62A 3CM4A 5HWMA 2Y88A 4A8LA 5TD4A 4DAIA 4ACYA 3LDVA 1EC7A 2MUCA 4KESA 1F5ZA 5I3KA 3L0KA 3TTQA 2QCHA 4EOUA 3UR5A 4IIDA 4LBSA 2YBTA 4E2DA 4JIHA 4JYEA 2V63A 4GXMA 4GYKA 4E4FA 2DZPA 2PWGA 4W88A 4RKAA 1QPKA 1EA9C 1TWZA 4AZCB 2QUMA 2RJGA 3SCTA 1H09A 4O17A 3B03A 3ONBA 4O1CA 4IIEA 2Z7GA 1C92A 4NZ1A 4JTDA 3WEZA 4LGXA 2R14A 4RW3A 4C5ZA 3GC2A 1UR8A 3UWUA 3S46A 3WD3A 3B9DA 1M1BA 3L4XA 5JUVA 4DWSD 2BVWA 1WAUA 1CTNA 1BYCA 3UJSA 1HFBA 1UQYA 4KH2A 4JTLA 3NYDA 5FD0A 1VRXA 1E9ZB 1IT7A 4XQ6A 3EOOA 4MWAA 3KS6A 3BLIA 1C8QA 2XIOA 2G3IA 2IKHA 2A3BA 2XIIA 3M4HA 3LQGA 2EHHA 2AQOA 4UTJA 3G22A 3PTQA 4KEVA 1SFTA 3HFTA 3ZR5A 2PCQA 4DF1A 4NXKA 3W83A 2NV2A 4C6QA 3N11A 4HNVA 4LVGA 2ZFAA 3DH7A 5E09A 5H8UA 2PE4A 3CPGA 4ZVJA 5CPSA 3VGGA 5E6YA 3SM0A 3NQFA 2V81A 4FLOA 1RVGA 1ODUA 3CZEA 3GXPA 3MZ2A 2ANUA 1TSIA 3FA5A 1EB3A 1JVNA 4HU8A 1HJXA 4GKLA 2FMOA 4IXXA 1VP5A 4HHHA 1YNQA 3NR0A 3VX0A 5HOSA 2EF9A 2VCCA 1G4SA 1CIUA 5BROA 2F84A 3R7MA 5FAJA 1UR4A 2BOFX 1BTMA 2J4GA 3MKCA 1KM6A 1RBAA 4R88A 1X6NA 3SDOA 2GYIA 2HE5A 1EJTC 1UCWA 5D9MA 1YBQA 4C1NA 4AIOA 3CUZA 3DHUA 5TIMA 4NX0A 3WLKX 1UC5A 4O28A 4YCPA 4D71A 2HWGA 3TR2A 1CXEA 3E6EA 1BWVA 4NNCA 1JYXA 3QBUA 3M9YA 5F1VA 4ENLA 4K6AA 2ZWYA 3E49A 4QE5A 5HANA 5CPMA 3G8EA 5DCEA 1VBGA 3G5EA 3A9BA 3ARPA 2F6UA 4QCFA 1EWDA 3MSGA 3ANYA 5T9BG 2C18A 5D2TA 1IV8A 2W3ZA 4A3HA 2Y5EA 1I1XA 2Z4GA 3ORWA 3RO6A 1T99A 4L4PA 1Q6LA 3HGSA 1H1ZA 5EFDA 4W8LA 3GC5A 3WLTA 1D8WA 1ZJAA 2J7FA 2BBFA 2E68A 5GJNA 2PI6A 4FSAA 4U5IA 2VD9A 3UR2A 3LQLA 2BOEX 2JGQA 3FJLA 5J5DA 3URNA 2OMAA 3CAKA 3SY5A 3LOTA 1E15A 1E6QM 4P61A 2C1GA 2GWGA 3PTKA 5HAOA 1MFVA 4AEFA 3V35A 1UC4A 3QV8A 1HVQA 3WQPA 1VF8A 4PMRA 4CQDA 4H00A 2GJLA 2ZUSA 5F1UA 2FJUB 1JDFA 3N6JA 3GUWA 1NOWA 2ZX9A 4J2PA 1GVFA 5AZ0A 1XP3A 3O16A 1DJIA 1JDCA 1K9EA 3PBWA 3TUUA 3WQDA 3T42A 3L21A 3EWDA 1FWSA 3AMLA 2JEPA 4JIRA 3JS3A 5K3VA 3G3DA 3L5LA 1KC7A 1JD9A 2D20A 5FJOA 2J79A 4HNTA 3SIZA 3R13A 5LHEA 2WKGA 3U48A 3H12A 2FZMA 3UEQA 3GXMA 3EWBX 4S3CA 4HYRA 4X63A 2V3GA 2NQLA 3TYAA 4GUFA 3WMBA 3W73A 4YPJA 4BF9A 3OBEA 1JCJA 3LCHA 3QPZA 3OIHA 3ICJA 2A7NA 4JICA 4OBSA 2VGFA 3WQCA 4PMYA 4JHOA 1MW3A 3ZWSA 4B4FA 1RV8A 3Q2DA 1HG3A 4JIEA 1NF7A 4GABA 3RR1A 4FNRA 5KETA 1VBRA 2E6YA 3IVSA 2JKAA 4BA0A 2FPYA 2W61A 4ZB5A 3UNTA 4MB5A 1HKJA 3S2LA 4G1NA 4H01A 3PZGA 3KTSA 1UKSA 1E0UA 1K8XA 3CYVA 2FKPA 3B8IA 3AHXA 1OFBA 3MU7A 4P2VA 1B3WA 4EX4A 1QFEA 1GVIA 2P1FA 1U1HA 3CJPA 3FV9A 4HU0A 4OHQA 5A6AA 4BFAA 3G6LA 4C6MA 4DF2A 4Y96A 1UKPA 1UZDA 3L2LA 4IJRA 1MFUA 1GUVA 3MMDA 1V0NA 3K4DA 2C14A 1H7NA 4UBPC 1ADDA 4ZGYA 5I77A 1WXZA 4W5UA 3Q37A 3LTPA 1OFDA 3C8FA 1KFWA 3P6LA 1TPWA 1SMAA 4PB5A 4LVFA 1RAKA 5EKYA 3W4RA 4Y9AA 3I6RA 1HL9A 3OO2A 4WF7A 1S38A 1ZHAA 4BR1A 5BXRA 5L6UA 1OFOA 4JN6A 5IXEA 4P7RA 1LLWA 3GSMA 5C7VA 1GVRA 1QR7A 4JTEA 1CT5A 2G41A 3LZ3A 3OTRA 4S23A 5LHFA 1FHUA 3BOLA 3LXBA 4DYJA 3PVFA 4JTRA 4LB4A 1IGWA 1B9BA 4EE9A 1GPFA 2QMJA 2E1DA 1HKMA 2CZ5A 1TTPA 1FUYA 1QWKA 1W1PA 3FX4A 3ZFHA 3IANA 3BCDA 4AD1A 2REQA 3WUBA 4FR6A 4WJEA 3L7RA 4WXYA 1JI1A 2OZTA 1KB3A 2PTDA 2JIEA 1AA1B 3WJXA 1HJQA 5AY7A 1Q4NX 3MBDA 4GGBA 2TAAA 3N2XA 3F2DA 5J8LA 1GTHA 4QLJA 4EP8C 3ARXA 1XCXA 1W1B1 4AZIA 4NP7A 4HYVA 2BWGA 4Y90A 5C9UA 2GVEA 2I56A 3ZM8A 4OE7A 3CHEA 4IUOA 1TREA 1J0YA 4QQUA 4DVOA 2KAUC 4WGHA 1B57A 1OWQA 2R8WA 4IICA 1KFEA 1Z7AA 5DXYA 2B4GA 3O6CA 1T8QA 4N0RA 3RJYA 3NUKA 4A05A 1N8WA 4S3KA 3KBVA 1IWAA 1FWWA 4TQTA 3AXKA 3UERA 1OFPA 4AX7A 4S3DA 3EWUA 3G1YA 1NVMA 3IUDA 3B3DA 4GISA 3TCSA 5I3GA 4NAEB 1BPLB 4XAFA 3C0QA 1TPVA 4UTWA 4KWOA 4RK8A 3BW2A 2BSLA 4F0LA 5HDRA 2PS2A 4O0QA 3DYOA 5AHMA 3AWNA 1EWEA 3LMZA 3RNDA 5D2YA 3W7LA 3E2VA 4B2DD 2D0HA 2NXHA 1Q6QA 1FKWA 2FFCA 3GYEA 3VPLA 1XLMA 1JUEA 1CZ1A 3GD6A 4BI6A 1KTCA 4UTLA 4IGSA 4YTSA 1EC9A 3H2AA 5KITA 3W0KA 5A5WA 4HA0A 4ZQOA 3VU2A 3RJXA 4B16A 3A12A 3SRFA 1WDQA 2C8NA 4H9ZA 1V6VA 1LUCB 4L65A 3GNPA 2AL1A 2WPBA 4AZ5A 3MHFA 4U31A 1KR1A 2PDFA 4CD4A 1WNOA 4YLWA 1VFOA 2X8RA 4ICMA 2YB1A 1JZ8A 3ZVHA 1ITUA 1TX2A 1JGMA 1T41A 3VVGA 4JL1A 3OQ8A 3FEQA 1K8ZA 4Z08A 5G2IA 1A5NC 5A6SA 4ZSUA 3W1RA 7A3HA 3PG8A 4PR4A 2OKTA 3WQ5A 4IT1A 1B3VA 2YBVA 4DF0A 3T9PA 3BPWA 4FOUA 4OOUA 4PGLA 3V0SA 3F4VA 1AUSL 4B3LA 1E1CB 4MNMA 4DUOA 1KBLA 2I5GA 3HGJA 1Q63A 3VNIA 1PTAA 3RU8X 1J0KA 5CEWA 1GT8A 1VFTA 3AIWA 5BRQA 1H61A 2VFIA 1U22A 4OU1A 4AEOA 3BARA 3CAQA 1S5WA 2WLYA 3J7HA 2VEPA 4IMEA 3SCOA 2E25A 3QSTA 4DYKA 3NXFA 4PTXA 1EH9A 1NQ6A 2WNNA 4LV9A 1XCFA 1C90A 1B3YA 3BLDA 1W9BM 1US3A 3W37A 4OV4A 8A3HA 4PUDA 4FR1A 3NZ1A 3S8HA 2XIQA 3VZZA 3W1NA 3MP3A 5HUPA 2ZUMA 4JR5A 1OT1A 3QY8A 1UH3A 3TSMA 2W91A 2IKIA 3TYEA 2VURA 5F4SA 4NAEA 4H3DA 3IV8A 1XYMA 4MUZA 4M6QA 5HR6A 2E77A 1H5YA 3TVAA 5MKGA 2NW0A 1CLKA 3S5YA 1FP9A 1NEYA 4NZJA 2PGFA 2AKMA 2YCIX 5HATA 3I6TA 2YW4A 5CC5A 2VT0A 3W2UA 1JEZA 3VNZA 2D2HA 4HHMA 4C6KA 3KAOA 1MWOA 2YCJA 4ZOEA 3CZJA 3EMQA 5C9XA 4EXAA 3INPA 2E5BA 3SRKA 2WLZA 1BF6A 3KDOA 1BYBA 3I3BA 4PB3A 1AFSA 3WLNA 2HSAA 3GG0A 2VGGA 3TDFA 1V7YA 1KFJA 1OFQA 3GK0A 6XIMA 3UW6A 1OEPA 2EG6A 3NNTA 4C6DA 2Y7DA 2PDKA 4UOJA 3IJIA 3WQOA 3KWSA 3WFZA 1TVNA 2UY2A 2VXNA 3FY1A 2D0FA 3A9IA 2PGWA 3ZT7A 1WUEA 3THCA 4TR9A 1F61A 3CB3A 3FLUA 3SR7A 3G18A 2Z0IA 4RL3A 5ABHA 1PB0A 3EX3A 1SR9A 5IHSA 3HPSA 4I6VA 3CEUA 2INEA 1LQAA 1NP0A 4HK6A 2QF7A 3B06A 4HT3A 1F3XA 3LCFA 2ACUA 4LUYA 1RP8A 4GBDA 3V5CA 2X1SA 1JPMA 3BAYA 3H7RA 3BG5A 4XK2A 3ABRA 4LQ1A 3QZ6A 3UG5A 3DEQA 3URBA 3WDPP 4LFYA 1ZL1A 4N6EA 1DJHA 3EKGA 2XU2A 3K30A 1YLVA 3BG9A 2FGLA 1WKYA 2BXZA 2GVYA 1JUKA 4NVTA 1AH3A 4CU6A 2I16A 4OKDA 4LANA 6PTDA 1H63A 3RLVA 3OG3A 3IUHA 3RMJA 3O06A 1DQUA 4RDZA 5LIUX 2C91A 4V27A 3NDOA 4LYQA 1JRBA 1L6WA 2AGTA 2C1HA 5LXXA 1XIHA 4QDWA 2FDSA 2D2OA 5A2AA 1JAEA 2XVPA 1J2WA 1UWIA 4GYFA 4E8CA 4L9XA 3LPPA 3UU0A 2QUVA 3CC1A 1MEWA 3APTA 1NOUA 1JNEA 3DHFA 5K4XA 3AIVA 5JMUA 3W7GA 1UQZA 1YXDA 3UPBA 3P84A 3VIJA 4Q8VA 2VX6A 1P6WA 4GO9A 3D46A 2R6OA 3W1XA 2DORA 1V6UA 4ZODA 1T7LA 4UTMA 4D6JA 3M0MA 2POZA 1HJVA 2YDSA 3OVPA 4X9YA 2ATSA 4ADTA 3TN4A 3T7VA 4HNCA 2GJRA 3TJLA 2J47A 3EXTA 4CQ8A 3ARWA 1Q3NA 1UUQA 3R25A 3WH6A 1WDPA 5CZJA 1XYLA 3GHSA 3IIVA 1KLYA 1SSDA 1PWLA 2BHZA 4I5UA 4A3YA 4YNGA 1O66A 4YWSA 3TNBA 4Z1YA 2TSYA 4Z2LA 3AS0A 3NJ3A 3W7EA 1SFLA 3A21A 4GWEA 3P60A 3PPFA 4OZOA 4BHYA 2HZGA 1GW9A 2ZDSA 3VGDA 3VNMA 1QWGA 1OCJA 1EBGA 4B90A 4A21A 2VO5A 2H8XA 1EKOA 3GXTA 5CJNA 1BKSA 2A7RA 1MSSA 1AQMA 2PRHA 4A29A 4C6FA 4X60A 1EIBA 2XVLA 2AOSA 4GJIA 3MDWA 3QQWA 3DBNA 1UWRA 1TWWA 3R10A 4AZ6A 1FWGC 3KRUA 5G4EA 4JN8A 3VD5A 3N15A 2UWFA 4HCDA 3A5FA 3CH0A 3GDKA 4JX4A 2PDPA 3C2RA 5LYRA 4C60A 2DP3A 5CC7A 2VWSA 4XVDA 2ZRZA 3EOEA 2XHYA 4MGGA 1Z8AA 2V5LA 2Z26A 1T6MA 3SY1A 3GQYA 2HTMA 2A3HA 1ONWA 2VCAA 4UTWC 4S1FA 3ARQA 3IIZA 3KP1A 5A8OA 3LPGA 4J3VA 1KBJA 1Q65A 4C7FA 3EKLA 2NQZA 4PUJA 2Z24A 4LAMA 3M16A 4B91A 2DZAA 2L5HA 1U1UA 3S2NA 1CLXA 1A5LC 1UD2A 4MLRA 4PN2A 4HA3A 1CX9A 4KFPA 5CBBA 4WKFA 4S3EA 3TQ0A 3WSUA 3PJTA 5ABTA 1S1RA 3UXDA 3TR9A 2CETA 3V18A 4J35A 8RUCA 3GUGA 4LV4A 2V5CA 1DWAM 1G0CA 4PMJA 1IEVA 3NZRA 2G3JA 2ZXBA 4WZHA 1B0IA 4MADA 1XKJA 4GYPA 1CNVA 3W7KA 4DI9A 2CZVA 3OVGA 3P14A 1G4TA 4GCXA 1JQXA 3ARSA 3KHJA 1ECEA 2OG9A 1PL9A 2Z25A 2WVTA 3N9KA 1FWAC 3W3OA 4ZXOA 4O52A 4FNPA 2ISSA 4C6OA 1LJYA 2CESA 1B30A 3W24A 1XL9A 2W79A 1UW9A 1L2UA 2WZIA 4Q6JA 3VUSA 2CHNA 1W37A 4C7GA 1EZWA 1ZPTA 2ACSA 1EHNA 3GY1A 2PDCA 3BOXA 1FCVA 4G56A 3CNYA 4JTIA 4DJEA 3QRHA 1TUXA 1PZ3A 1E4MM 3DFNA 1KO0A 1UD6A 1EDQA 2CPUA 4WIWA 4YS1A 1B5TA 3ABZA 2PU0A 3W7NA 1NAL1 4UTUA 1Y7VA 1A5UA 2DJXA 3P5ZA 3L4YA 2DPEA 3USBA 2CU0A 3F5KA 1IHIA 3ID7A 1E1FA 2F38A 4M5PA 1Z89A 4Z1DA 5T8GA 4J27A 3VFLA 1B31A 1B90A 1UYQA 3CUGA 2BMBA 3N2BA 4UZUA 1REQB 1GVQA 2E6AA 1W8SA 3FN9A 3BLOA 1X97A 1YTDA 5C5YA 4Q33A 1JR1A 3L5AA 4A8IA 3BOFA 5BXTA 2CLHA 4IL0A 1QK2A 4MHBA 2I5QA 4C6CA 3TNOA 2HXTA 1IXQA 4C6BA 3NSMA 2ONEA 3VCRA 2D69A 4MZ8A 3UXLA 1JCMP 2PLMA 1W3LA 3S0CA 3HG3A 3GG7A 1ZU8A 1AQ0A 2VEGA 4XIMA 3B0YA 2XH0A 3P0XA 1EGZA 3KVMA 1RBOB 1RP9A 1V02E 2CNCA 4NF7A 1XRFA 2PF8A 4NNBA 3UZWA 3T55A 2YL6A 4JTSA 2PU1A 1J6OA 4MPKA 3PZIA 4I5RA 1QI2A 5LA1A 3HJEA 1PZ2A 3VO0A 2AL2A 2IS7A 2Z1SA 3KBNA 3LRMA 4JNMA 2ISFA 1QO2A 3MANA 5G2HA 2DZUA 5IOBA 4L4LA 5CXPA 1OBAA 3OU8A 4AEEA 3N4AA 5C8BB 4O13A 4IFOA 3EOSA 3EBVA 3AJXA 3S6OA 4JEQA 4J2MA 4IISA 4N42A 1JZ4A 3UXAA 3M0HA 2O7SA 1PDYA 3SUSA 1QNRA 3GWQA 1UPMB 1BEUA 2GDQA 3BANA 1IIGA 1EL3A 1Q8AA 1BFNA 2P3ZA 3EX6A 3KBMA 1OX4A 2C15A 2CBUA 2Z28A 1IXPA 2D73A 4FS9A 1R46A 2Y24A 1O5QA 2F6KA 5CSRA 1E0WA 1ZJBA 1F6YA 2RDUA 1QPRA 3GDMA 3SADA 4FO4A 4IGHA 3G2GA 1XC4A 1M9HA 3VCNA 3PSWA 3T09A 3K4AA 4UFKA 1XV8A 4K3ZA 1UMYA 1UR3M 1PWMA 4AVNA 4AD0A 3PZ9A 4PMDA 5JIPA 4F0RA 2IXVA 1ZJIA 5D32A 1GPWA 4JYDA 1H0IA 1LF1A 2ZZ1A 3P8JA 1B1YA 1TCMA 4NUWA 4DJDD 5A6BD 3D0CA 2V2HA 2ZICA 2DZWA 3P93A 4AD3A 3BJTA 3GDTA 4PBGA 5ECUA 1ONEA 4A22A 1W17A 4F79A 4H83A 4HMNA 4GK8A 4E3TA 3M07A 1JXJA 1UKTA 1X8FA 1R2SA 4Y6GA 4JXCA 1ISVA 1WDDA 2BDQA 2F7FA 2AMXA 2DT2A 1E9LA 3P62A 3QGKC 2CHRA 1PKYA 2WO5A 3E74A 4QE4A 1OIFA 4ZZ9A 1KXQA 5EYWA 4YYFA 1PZ1A 2B7OA 3DZ1A 3C3NA 7XIMA 4DPQA 4HP5A 2O9OA 1AJZA 3IGUA 4DJFA 3LXAA 1NY1A 2PA6A 1OQFA 4E8GA 4QE1A 3BGJA 2JF6A 2Y2WA 4JBRA 4KKXA 1ZLPA 4O19A 2HVNA 3A4WA 3T08A 2P88A 3V0UA 2KX9A 3B8SA 1TJ0A 4URIA 2DZVA 1YADA 1LDCA 3ZJ6A 1K9FA 1HIZA 3MDUA 2XZ9A 3LSCA 3AXIA 4RNIA 3LV5A 1GOIA 1UR9A 3O7UA 3C0LA 4W7UA 1XG4A 1E6XM 1V79A 3TN5A 3RFAA 4A2RA 2W66A 3GNDA 3F4DA 3GZ3A 4N9DA 4BS0A 1A5MC 4GY7A 2FTYA 2ZUWA 2F2HA 4CU7A 3VDHA 5U7SA 4EXBA 5EMKA 4KCTA 2PC8A 1TJRA 3NDZA 2C7FA 3USZA 3RUBL 2PDGA 1X1OA 4AW7A 3FW6A 4DBDA 3E3HA 3LHTA 1J01A 3WLOA 1NOFA 1VLWA 3RPTA 2ZX8A 1UJQA 2OLSA 3ENLA 5F7UA 1J9YA 3HTWA 5CG7A 3MP5A 3IPWA 2H9AB 1XLFA 5B7ZA 1O1HA 5DY2A 5HNRA 4N9BA 3W70A 4I3GA 2J9ZA 3RM8A 4OBTA 1V03A 1ZJHA 1UBPC 3DN5A 3L4TA 4UMAA 2XZ7A 3IEBA 2Q8XA 4LUIA 1PHWA 4W85A 3EDEA 3AHVA 4UTTC 1EGVA 2ZXAA 4GJ1A 5I07A 3SJNA 1LL7A 3FXYA 4B5TA 1FRBA 3GHRA 4A6GA 1NELA 3HQPA 1CXLA 4JDBA 1XYCA 4XB3A 1IR1A 1TWSA 1QTWA 3TWBA 1QOXA 1V93A 3UNDA 3ES7A 3BW3A 1UKQA 3KRSA 4NI3A 3KRZA 4JIPA 1YHTA 2RKXA 2G4FA 2HROA 4GI9A 4WX2A 2BY3A 4NXSA 3RM9A 2G4JA 1J79A 3GX9A 3MUCA 1ZBVA 4N2YA 1W9DM 4ZOCA 4NZFA 3AXXA 3WJSA 4YHGA 3CV6A 2Y89A 2ZE0A 1W3HA 3MPGA 3EXSA 3WLJA 4MG4A 3L4VA 4DO5A 5ENLA 3NXLA 1A4MA 4GYPC 2VX7A 3UCCA 2D1ZA 1A5KC 4HPGA 3AS2A 4DWSB 3M5VA 4B3KA 5LNSA 1J0JA 4IQDA 3O8AA 1IEQA 3U8GA 4MZYA 3WL1A 1B2YA 2JBMA 5CJ5A 3T4CA 2WANA 3F4WA 3GB6A 3QV7A 4Q6XA 3RX2A 2VR2A 3C8NA 5CC3A 1S5NA 4RE0A 1NIUA 1V51A 3NZPA 1V3LA 3N3TA 3V3WA 4OGZA 2P50A 5I0DA 2Y6ZA 2QGYA 3P82A 1XINA 4UIOA 1V0LA 3OVRA 5KZDA 4GVGA 3N2TA 2YCKX 2FGZA 3B8UA 2WVVB 2CZDA 4O0ZA 4EVZA 2PDHA 3W07A 1HL8A 3UZXA 1LOQA 3AS1A 3GR4A 2YBUA 5DBUA 3CZGA 2AMGA 4ERGA 4DXKA 2PWVA 5E1QA 2PAJA 3F2CA 4NASA 3DBPA 4US5D 3STGA 2J9YA 3PBGA 3NPWA 4O8RA 1L8PA 3V5FA 3W26A 4JEJA 3GVVA 1TZZA 3U5UA 3W7DA 1SW0A 1BLIA 4PUWA 1BAGA 1O5RA 3SAZA 5DN1A 3CLWA 3AHYA 3TC7A 1XDMA 3GDLA 3S5SA 4WJ8A 2Q3OA 8XIAA 2PLCA 4JPGA 3MUXA 2WC4A 1FHDA 4QDMA 9XIAA 3KOFA 3B04A 5EBAA 2DVXA 2ESCA 3QKEA 1YRRA 3K13A 4GH3A 1EO7A 1GQIA 3DGRA 4XO7A 2XSBA 1RPKA 3P81A 4ATDA 1VD6A 3HPAA 4HNOA 2RDXA 3WBYA 1LROA 2CLLA 3ITTA 4OBRA 5EMYA 2X09A 2CIPA 1RR2A 4DZAA 2E6FA 3DG6A 3L5MA 5D2WA 1ECQA 2YB4A 5BZAA 2PTXA 1NWRA 3EX2A 2V38A 3BDKA 1S2WA 1W0MA 5PTDA 3MHGA 1JZ2A 3OA5A 1ZGDA 1EQPA 5K9CA 1Z69A 3R6IA 1H5VA 4IUGA 3TLLA 4HZMA 4F2BA 1BG4A 3P3BA 2J6XA 5HPCA 2QYGA 3T40A 4LH8A 1HKKA 2ODOA 4AHPA 6REQA 3MCNA 4IGMA 2YCLB 3B8TA 4HPJA 3UWEA 3V4BA 4L6HA 3TH6A 3B8VA 2V68A 2ZE3A 5G1TA 1E3XA 1FWCC 3MMUA 4IIFA 1LRNA 3ATZA 4RPQA 3ALGA 4DNMA 2BY1A 2PF0A 3I4EA 4GNKB 3K1DA 3NYZA 1L6SA 2NWSA 2OWXA 5AC7A 1E4NA 5KSWA 1QI4A 2BOGX 1XSKA 1CCWB 1TJPA 3UZZA 3IWPA 2FDMA 1VJZA 4IPJA 3TAKA 1EQCA 2Z29A 4BJHA 4Q32A 2WSQA 1TJ2A 3L65A 3I65A 3P2VA 3UESA 3QMRA 2NSOA 1OFRA 1KW1A 3LXCA 1EFZA 1TWIA 2W4XA 5BRBA 4B9ZA 3FVMA 5H91A 1YDNA 3WK0A 3BW4A 3IV3A 3WQWA 1GVOA 3VIGA 2XIJA 1KM2A 3W7RA 4V33A 1C91A 3H4XA 3P74A 3KZPA 1MRAA 4GQ0A 3VMOA 3LHWA 1AD4A 4LY8A 4LUSA 4O15A 1TPH1 2IKGA 2DUXA 4KERA 3I7QA 3HA1A 4B5XA 3GTHA 4H8UA 1K6AA 3MP4A 2OQHA 5AZ1A 4B92A 5DELA 2DEPA 1KGXA 1KKRA 1KWKA 2HVMA 1VEMA 3JU2A 3W1QA 3QM3A 3FSUA 2RHGA 3QKZA 2BG5A 3QR1A 3PZUA 1XIEA 1UA7A 1EZ2A 2VOTA 4DZIA 5LIWX 3UA3A 2W9MA 1FDZA 5C55A 2FYMA 3F4CA 4DJFC 3ZLFA 4EPDC 1CBGA 2YDQA 5I3IA 3FAWA 2GQ3A 1E70M 1CGTA 2ATMA 2GQ8A 5AFDA 3P7YA 2J7EA 3ARTA 4D6EA 5D2VA 1IEXA 1FBAA 1JJKA 1E3ZA 1JFHA 3TLQA 1VPXA 4KCWA 3GNXA 4Z1BA 3BAJA 3TONA 4GUJA 3N25A 3T2QA 1XLCA 2X16A 1A3XA 4HMDA 3EAUA 3PULA 3F5LA 2WMFA 4WRHA 7REQA 3ABQA 1KQYA 4DN1A 4QM1A 2ZZ6A 4UQ9A 1PCKA 1P0BA 2VYOA 3W81A 3WF0A 4ACZA 4TTUA 3T81A 1D3CA 1DTNA 2VFGA 3JZUA 2FTWA 1AW2A 1W1ZA 1OYBA 3NURA 3WLHA 6ALDA 1GQKA 3LN3A 4DBWA 3CV2A 2FVKA 1H3GA 3ONCA 3G1HA 5A8MA 3CZLA 2GK1B 3DKLA 3WLLA 3CQ0A 3TU9A 4LB3A 1VPYA 2TRSA 4Z1CA 4HK7A 3WUGA 4MZ1A 3STPA 3VI2A 1XLBA 1W1IE 1G9HA 4HHPA 3NQ6A 3UXKA 1WA3A 2Q8ZA 1SQ7A 4FLSA 5EB8A 5I02A 3WLIA 3VD7A 4HIBA 5M17A 2DZBA 4NI8A 3AUJA 2YW3A 3EOLA 2XYLA 1DJQA 3MTWA 2EPLX 1GJPA 4MFDA 1S2CA 2ZX5A 4C7DA 2J7HA 3C3UA 3BJFA 2YZ5A 4C6NA 3KW3A 1BVNP 4NYUA 4LCRA 1RK5A 4DLMA 5AHLA 4IQEA 1ZBCA 5T91A 1FP8A 1B3ZA 4A3QA 3SCNA 2B7PA 3EWZA 2YXGA 1TYGA 4LWWA 4PSRA 2Q3RA 2G3FA 4LC6A 2EO7A 4QITA 4B5SA 4CEUC 3CV1A 4L9ZA 1ICQA 4HGXA 4V2XA 3LENA 2IPWA 1BXCA 3GLCA 1XPYA 4LYKA 3A23A 3ES8A 4KT2A 2Q8LA 4LY4A 3TXZA 4A35A 3RILA 1R47A 2DW6A 1KKOA 3TYCA 3NAVA 3ZQ9A 3FJ6A 1I6NA 1KM4A 3NQVA 2GSJA 3W23A 4O12A 4WJXA 4BQ3A 1XBYA 3COTA 3HO8A 1R0MA 3XIMA 1IEIA 4JY8A 4E4PA 4BI5A 5I06A 3BV4A 3VC5A 1JPIA 1E51A 1CXFA 4JIQA 3W2JA 3AJ7A 4K39A 1DIKA 4GINA 4AYGA 1SYTA 5I3DA 4U2ZA 1M65A 3DHDA 2QPUA 2E9MA 3GE7A 3VD9A 1HKVA 3HFYA 1S2VA 1FH9A 3IJQA 2GJXB 5CZ0A 1UR0A 5M5DA 4HNLA 4WSJA 5K9DA 1DWFM 5C0QA 3HGOA 1R3QA 1A47A 1P0DA 3WDQA 3UF9A 2QPXA 1XR2A 4P7QA 3EPOA 4GE8A 2VELA 2GZXA 4XSMA 1DWIM 5GNXA 4CD6A 1L2QA 3W1TA 1VKFA 1GW1A 3LY0A 3D5HA 2UY3A 4GX9A 4NL1A 1OM0A 4QQ3A 3QMSA 1POJA 1M68A 3LHUA 3KTCA 1LQ0A 1OX5A 3A6OA 2XFFA 2VC9A 2GL5A 2OT1A 4UQEA 4FOJA 4IM4A 2BVYA 5I2UA 1P5BA 4GA8A 1SW3A 2PTYA 3IVUA 3R11A 4UR8A 2D3LA 2CZFA 2QZRA 4JQAA 1FXQA 3TEVA 1AZ2A 1ENUA 4AF0A 4KMQA 2FH6A 4XD3A 3W72A 1R2TA 4V28A 4DB7A 3ARZA 1DJNA 3NM3A 4NRSA 4HU4A 4H9MA 1HL2A 4U3CA 2G3MA 4HSHA 4KIEA 4PCPA 1NM9A 3G1VA 4YL2A 3BGAA 3WD4A 3ARYA 1O1ZA 3BZGA 1AQHA 4JFSA 4X3ZA 1ESWA 2HQAA 2QCGA 4KF1A 3AICA 1YPXA 3BURA 2VKZG 4LNCA 3L9CA 4GJJA 1FXPA 4MVAA 3CL6A 1H7WA 4CD7A 1JCTA 4Q8QA 2C71A 4NZ5A 1OFAA 1UZHA 4ZXLA 3VE9A 1TPDA 5JH2A 3LU2A 2X30A 3ME3A 4MWAD 4AISA 3W7PA 1HNYA 4DWSC 1JAKA 2VX4A 1M41A 4IP7A 1V3JA 4FI4A 3VIFA 1VCFA 1ZTVA 2ZC1A 1QW8A 4CGTA 5I00A 1S2UA 1O94A 3S4TA 2VJXA 1W3NA 4B2DA 1K1DA 3S42A 1FTXA 1GKQA 3IARA 3RRXA 3H55A 3TQVA 3FVDA 1SJDA 1DXEA 4O57A 3QW4B 2J62A 2QMKA 1CB7B 2J7BA 1QHPA 1VFUA 4QG6A 2O9PA 1EHAA 1ZS2A 4G9PA 1FH8A 1UG6A 1JUBA 4K1WA 2I14A 4D1JA 4TV6A 4Z0JA 3WCZA