5SWUA

Dehydroquinate dehydratase from a. fumigatus arom
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
251
Chain Sequence
DSLGTIKKKQHSFFVSLTLPDVRGADQILEQACVGSDAVELRVDLLEDPDSSNGIPTVDFVADQISYLRSRITLPVIFTIRTKGQGGRFPDDAHAEAMQLYRLAVRSGCEFVDLEIAFPDEMLRAVTEMKGYSKIIASHHDPNGELSWANMSWMKYYNRALEYGDVIKLVGVARNLDDNTALRKFKNWAEEAHDVPLIAINMGGNGQLSRILNGFMTPVSHPALPFRAAPGQLSATDIRKGLSLMGEIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Pentafunctional AROM polypeptide
publication title Dehydroquinate dehydratase from A. fumigatus AroM
rcsb
source organism Neosartorya fumigata (strain cea10 / cbs 144.89 / fgsc a1163)
total genus 85
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5swuA00
3TAOA 1KV5A 3MBFA 4JEQA 1THFD 3JS3A 4FNUA 3T7VA 4ZQOA 2E6AA 3SW6A 1HTIA 3P81A 3CPRA 3HG2A 4ORIA 2YXGA 5F2GA 4MLJA 4FB7A 2HSAA 4RZ4A 3W3OA 3G0XA 1TTQA 2FPTA 3WJWA 1H62A 1KM6A 3M41A 3E12A 1SW0A 4NNBA 3BW4A 2QDHA 4B5NA 3LHVA 4U4MA 3ABQA 2Y7GA 3MHFA 4N9CA 4AMAA 6ALDA 1SO6A 3LERA 5D2XA 4HNUA 1K8XA 1S5VA 3GX9A 2OCZA 4M6VA 1XM3A 1X8FA 1DJQA 3NQFA 3GKAA 2WNQA 3DU0A 4JX5A 3GXTA 1LZOA 3N14A 4AHPA 3S0CA 2NZLA 1SZFA 3A21A 3SECA 2V0TA 2ABBA 3HG4A 3EKZA 2E5BA 3N2XA 4TR9A 4HNNA 1SW7A 4Z1DA 1I2OA 1Z44A 2XFWA 3ABOA 3KRUA 3CWNA 3MJYA 3A23A 1RQEA 4LV9A 3EWXA 5LNSA 4ADSA 3WJZA 3STCA 3C0JA 4LRTA 1FY6A 5C5YA 2WKJA 4A22A 4MIMA 1B4EA 2HS8A 4MZ8A 4NU7A 3OVQA 4JGDA 2R14A 4GUIA 1ICSA 1VHNA 1YXDA 2OT0A 1MXSA 1ME8A 2VFGA 3PY2A 3QSTA 4E2DA 3W1NA 1EUAA 4LT9A 4IMDA 1IXNA 3W7GA 4DPPA 4GNJA 3HOJA 3JRKA 4R33A 3G1HA 5HUOA 3THAA 3EXTA 4IOTA 3G1SA 3S8HA 1NAL1 1KLYA 1I2NA 5DCEA 3EX4A 5KZMA 3W75A 5AHLA 3KRSA 4Q32A 2Y89A 3HG5A 5LGZA 1CW2A 1JQVA 4GFSA 3EWBX 4Y90A 2F7FA 3NZ1A 2E1DA 4FO4A 3LM7A 1VRDA 4LVBA 2CZ5A 4LVGA 5LGXA 2HTMA 2UV8G 1AL7A 1WV2A 1K3UA 2NXHA 1EP3A 3NG3A 5DCDA 3VE9A 3WJYA 4A29A 1SFJA 1TPDA 2H90A 2H6RA 2YZRA 4N6FA 5BOOA 4JYDA 3F4WA 5GVJA 4FNQA 4CCEA 5E1QA 4EF8A 4NNCA 3V75A 5CZTA 4LUJA 1VLIA 3HB9A 3MWAA 4NJHA 4PL1A 3C2VA 3QPYA 1OYAA 3WJXA 4YCPA 3NQAA 1EIXA 6TIMA 3NL6A 1LBMA 3UXDA 4JN6A 3DHDA 3PULA 1TTIA 4MPQA 3TFCA 3B8DA 1AW2A 4LRSA 1TREA 3M1ZA 4M7SA 3TUUA 1L2UA 3PUOA 1ICQA 1PVNA 3QRHA 2GPTA 2ZZ5A 4Z1CA 3S5OA 4PCFA 5LKYA 1T99A 4UTKA 2BWGA 4I9AA 3LX9A 3W7EA 3G8EA 5F1VA 4AXKA 3BLEA 4QJ1A 4DO6A 3DFSA 3QYQA 3LHTA 2Z1BA 5FESA 2C6QA 5FEPA 3TC6A 5C6MA 1YPIA 3GDRA 4WJEA 2ZFAA 2I9EA 3LBCA 4ZZ9A 4UNKA 3GNNA 4XQ6A 3NVTA 5CPOA 4IMGA 2XN2A 4BI6A 2ZRVA 3W1XA 3W88A 2BLEA 1KTCA 3L9CA 3S1UA 2VENA 2V30A 3FEMA 5I3HA 3O06A 3GYEA 3LCIA 2GVGA 2B7NA 4LWWA 1YTDA 4K8HA 1H50A 4GUFA 2GOUA 3DKJA 4UR7A 1PV8A 1JRBA 1QOPA 5L6UA 2Q3RA 1VPXA 1R2SA 3C56A 4HPXA 4IPIA 2JKAA 4ZQMA 3LRMA 5DXXA 1JUKA 4N02A 5D32A 4FXSA 1KFEA 3W2MA 1VYRA 2V2HA 5K4ZA 4KWWA 3HO8A 1T8XA 2WJZA 1OX4A 1SUXA 1RV8A 5K9DA 5D09A 2AQWA 3EX6A 3P84A 1FBAA 4UTHA 1AG1O 4MJZA 2FJKA 2CW6A 1RZMA 1OFRA 3C4UA 1EPXA 2C14A 2TYSA 5DCBA 3MMTA 4N2YA 2A6NA 1JUBA 1TJPA 5BRBA 1YTEA 3UWVA 1GPWA 3LRKA 3W83A 3O07A 4DBDA 3HGRA 3SGZA 3MUXA 2Q3OA 1OX5A 4LUIA 1DBTA 2GVLA 1XKYA 1QR7A 3BPWA 3FA5A 5AHIA 4WX2A 1H7WA 1O5KA 2HS6A 4UTJA 3VKJA 1KM4A 4JDBA 1QOQA 5G5IA 3LGEA 3EWYA 4D2JA 2W0UA 3CHVA 3M5ZA 4OT7A 2RHGA 3EKLA 2QCDB 4YL2A 3VE7A 1ZAIA 3GDMA 2DZXA 2HMCA 4I7VA 4QSHA 1XXXA 4O52A 5CKSA 1QFEA 4OV4A 2ZA1A 3ZWSA 5DY2A 3ATZA 2ISSA 4UTLA 1KFBA 3OG3A 4QIUA 5FF7A 1VZWA 3UZJA 1KM1A 3PS7A 3O8AA 1JULA 3E9AA 3QPZA 4WY0A 1EEPA 4O18A 4UFIA 1N8FA 4FX7A 3C2FA 4OQVA 4OBTA 3LCGA 1F5ZA 3LV6A 3R2GA 1YLVA 2B4GA 3FJLA 3W76A 2H3BA 2BXVA 3QSRA 1XUUA 4A2RA 1TCDA 3CIXA 3E96A 1KA9F 2ZCGA 3O1NA 2YX0A 4K37A 4QISA 4Z1AA 4MZ1A 4FF7A 3TAKA 2ABAA 2FPVA 3IGSA 3BG9A 3FJ6A 3W7NA 1I2PA 4R53A 2B7OA 3LI0A 3YPIA 3C2EA 1DORA 2XN0A 1DQWA 1GTEA 4HSNA 1TQXA 3IIZA 5K7JA 5T26A 2OT1A 4JTIA 3DHFA 5CPNA 1ONRA 1XDLA 3UWYA 4FIRA 5K3VA 3W7PA 4LC6A 3QH2A 2NWRA 2A1YA 3G0UA 4OHQA 4UTTC 2WV8A 3W2KA 3QEZA 5DBUA 2FDSA 2RDTA 5H91A 1R30A 3PC0A 5KZDA 1H7PA 4RKAA 3EXRA 2PC4A 3NQDA 1TPFA 3LXAA 4H4IA 4O16A 3IGUA 1QAPA 3L5LA 4O10A 1LOSA 2V5LA 4HSOA 4Y8FA 5AHEA 3HPXA 1W54A 3E02A 2QR6A 3IV3A 3B03A 1W1ZA 5I3GA 1S5WA 3IRDA 3UPWA 3TCEA 1N55A 2QF7A 4Z0SA 4EVZA 1TYGA 3DAQA 1ZAJA 3P61A 1GQNA 1LOQA 3K30A 3GAYA 3GB6A 1I45A 2E6FA 1QPQA 4OE7A 2GUUA 2JBMA 5DBTA 5CZJA 3TIMA 3B0UX 2TRSA 4ZL1A 4MFEA 1LP6A 3TA6A 2BX7A 5DN1A 3A24A 3I68A 5I3IA 4LS1A 3BG5A 4O14A 3EX2A 5CG7A 3GXNA 1LRNA 1RQHA 2ZYFA 4X2RA 3W2LA 4I7UA 3G1FA 1HUVA 2JKPA 4UTIA 1ZJIA 3STEA 4GUJA 3OBKA 3LCHA 4FX6M 4R7JA 4UMAA 2ZDRA 2YGYA 3SSJA 4ADUA 4DPQA 3SI9A 1ZNNA 3LCLA 4QITA 3O15A 3HGSA 5EMUA 3G22A 3W71A 3HG3A 1VCFA 2WPBA 2A7PA 1QO2A 1UJPA 4UMBA 2JK2A 3TMQA 3UWZA 4AWSA 3KX6A 1A53A 1G4SA 1PE1A 1X1OA 3HPSA 4DF0A 4JY9A 1M7PA 4QM1A 1MEHA 5J5DA 4S2CA 2C16A 3H54A 4M19A 3H55A 4KWVA 3W6YA 1OK4A 2VFEA 1Y0EA 1XUZA 1L6YA 3Q94A 1SQ7A 2VELA 4UFKA 2R8WA 1OFBA 1FQ0A 1DV7A 1F76A 3LTPA 3JR2A 5D04C 3S6DA 4UUIA 3TU9A 5LNUA 3LCXA 4NJKA 4OU1A 5J5RA 2Y7DA 1CI1A 5D03A 4IQLA 1WX0A 3LI1A 3M6YA 4GWEA 2B0MA 3ZFHA 2Z2UA 1VHCA 1OJXA 1SFLA 3N2MA 2H8XA 1X7FA 3TR2A 1YXCA 3UZ5A 2DZVA 3B4UA 4NJIA 1J5TA 2Q8ZA 3CWOX 1JQXA 3GR7A 5DELA 2DJXA 3DBPA 5U4NA 4LOCA 4WXZA 5AHFA 1OFQA 3L21A 3SFKA 4OWGA 3B04A 3QQ0A 3FKKA 5CPMA 3NM1A 1FWRA 3DI0A 4K8EA 3L0GA 4O54A 4S2BA 4WY0F 1TSIA 3NL3A 3VFLA 3PM6A 4Q33A 4RR4A 1GVSA 3L0NA 2QCLA 3M5VA 3G1AA 2B7QA 1I4NA 2Q8LA 3SJ3A 2EF9A 1H61A 2J6XA 3FYOA 2VOMA 1VJIA 3QF0A 3GDKA 5DLCA 1WBJA 2CLFA 3L2IA 2EAWA 2VEKA 5D37A 3NYZA 3SGUA 1GYNA 3F03K 3UWUA 1LBFA 4JR5A 5I3KA 1DOSA 1GEQA 2V8ZA 1ZALA 1I8JA 4PL2A 3L68A 2GJNA 3TFXA 4XWUA 4BI7A 2EPHA 2NLIA 3QFEA 5LNVA 1P0KA 3S1WA 2ISVA 2FLIA 3HGOA 1OYBA 4LU0A 4CNPA 3QZEA 1R2TA 2X1RA 1Z48A 4GXMA 1H7OA 3S5ZA 3VCRA 4PTNA 3FIGA 3KRZA 1OK6A 2OZ0A 2G95A 3KOFA 2V81A 3OVPA 1WDWA 5AYZA 1FX6A 3W70A 1DJNA 2X2GA 3A22A 1B4KA 2VFIA 3G24A 4NX0A 3MBDA 3RNDA 1TO3A 3W1LA 5HULA 1WYIA 3W72A 3LOTA 4DBEA 5HMSA 1K02A 3W2UA 5BMXA 4IXXA 4K7YA 4IPJA 3W7KA 4UXDA 1I2RA 5AYXA 3CEPA 3F4NA 3QMSA 1RR2A 4LV4A 4LW7A 2E5CA 1LM1A 1XDMA 2BZNA 1B9BA 3LV5A 4Z0JA 3C8FA 1LRTA 3H53A 4AHQA 5DXYA 2DJLA 3G3MA 4MKNA 2FIQA 1AW1A 1SSGA 3RFAA 3L5MA 4JXCA 4O50A 1OYCA 3NPUA 3W1AA 4XUGA 1EP1A 3EWZA 1G7VA 4M6QA 4CCCA 2G97A 2RH9A 4EWND 1KTNA 1WQ5A 4L4LA 4FXRA 4LVAA 2OX1A 2V2DA 3TV8A 1ZFJA 4WD0A 2Y6ZA 3N34A 4ZQRA 4N4PA 2P10A 2C1HA 5C55A 1KFJA 3GVGA 1G67A 3G18A 3P5ZA 4ICNA 1E51A 1C9DA 4NZFA 4UCGA 3P60A 5AC6A 1VCGA 2JGYA 1ME7A 1VS1A 3E0IA 3O16A 3NPVA 4IMEA 5C2XA 4ZMGA 3G1YA 4XKYB 1BEUA 1LOLA 3TQVA 5FI8A 4BR1A 1B3OA 5G2IA 3AJXA 3G0SA 3U8GA 1JVNA 3GIYA 4O19A 4TMBA 2VC6A 1OVDA 4ADTA 1YPFA 2J9ZA 1I2QA 4RXGA 3D0CA 5EKYA 4CQ8A 2NX1A 3BO9A 3QJAA 5AYYA 3MHGA 3DFPA 5D2YA 2XN1A 4MYAA 3TQ0A 2QKFA 2C19A 4OV9A 4CCDA 3LCFA 5HUPA 3Q58A 1G4TA 3F1QA 1SR9A 3GNDA 4O1DA 3CEUA 4LVFA 1Z41A 5F2MA 3TQKA 4AWTA 1NSJA 3DFTA 3PUEA 4R34A 1JCJA 1C8VA 2AGKA 1PHQA 3DFOA 5F1UA 4RXFA 1P4CA 4A2SA 2F84A 1SU5A 2BTMA 2GJLA 2Y61A 4CLMA 4YLWA 2TMDA 2QJGA 4Y96A 2X30A 4IXHA 3VI2A 3UQNA 3G1DA 4XBSA 3PBVA 2YYUA 1H7XA 1OABA 2ZZ3A 2TPSA 3DH7A 5EY5A 3RLVA 2ZTKA 3S1VA 4LVDA 1LCOA 3W2NA 1D3HA 4ZVJA 5FF4A 1ME9A 3USBA 4KFPA 1G7UA 1P1XA 3MP5A 1FXPA 3DFQA 5BNKA 4UNLA 2FB2A 3I7RA 2VEPA 2JKEA 4TMCA 2NXIA 3A5VA 2R91A 3MO7A 5G4EA 2R94A 1JCXA 3DFNA 1T96A 1R47A 3HIJA 1Z42A 3C2OA 5I3FA 2P0OA 3MI3A 5ABTA 2A21A 2QCCA 2ZZ2A 2CLOA 4JTEA 2J27A 5K9CA 1IF2A 2NV1A 1GVFA 1FCBA 2ATMA 4K36A 4JYEA 4O13A 2X1SA 4NX5A 3CT7A 3NPXA 5D02A 3SY5A 1VGAA 3ABSA 3EX3A 1KTBA 4MUZA 5D33A 8TIMA 3RK8A 1TPEA 1XC4A 1OFAA 4UTTA 2NUWA 2GQ8A 3NQ6A 4Y6GA 1SO3A 1HG3A 3CTLA 4MY9A 4JTJA 3LHWA 1EB3A 3DKLA 1H60A 1VYSX 3W7QA 4LC8A 4XTDA 4AH7A 3EEGA 5TIMA 5KMYA 1TPB1 4O4WA 1NVMA 4DQWA 5H2ZA 1PL9A 3KVJA 5SWUA 3WK0A 3W1UA 1K7EA 1TPUA 4TU1A 3W7RA 1LORA 4RLIA 2RDUA 2DU2A 2YR1A 5D2WA 3OVRA 4JTGA 4NUWA 3NNTA 3BGJA 1WA3A 3ANYA 4JTLA 2A2IA 4QAIA 3S42A 3GDTA 2ZRWA 4G1KA 3W2JA 1WOAA 3O6CA 4HT3A 4DELA 1PCKA 1EP2A 5AC8A 1VCVA 2CWNA 2QDGA 3G1VA 5AHNA 3UWQA 2QCHA 1LROA 1KM3A 1WAUA 3GDLA 3TROA 1ZAHA 1FDYA 4X9SA 4BWLC 3HQ1A 3NXFA 2E09A 3R89A 1WXJA 1UCWA 3FS2A 3WK2A 4U28A 3LLFA 3P5YA 1J4EA 1QO5A 1PS9A 1W5NA 1UB3A 3W7MA 1OF8A 1RQBA 4YXGA 5DY3A 4ALDA 4Y9AA 2RDWA 4W9TA 4RV8A 1LBLA 2X16A 4IX2A 3TJXA 4BI5A 3L5AA 3M5XA 3IIOA 1N7KA 1SZGA 4O0ZA 4O11A 2WNNA 2VKZG 2A0NA 3W1PA 1U5JA 3P67A 5HNRA 1W5OA 3CC1A 3A9IA 3NAVA 3UXAA 2Y70A 3M9YA 3O6DA 7TIMA 4UFMA 3W1MA 3KVLA 4K39A 4DO5A 4PH6A 1KM2A 1XI3A 2PRHA 4ZQCA 5EPDA 5FF3A 1TIMA 1H1ZA 4JY8A 4GBUA 1SSDA 1AW5A 2ZZ1A 3UY8A 1FWNA 2CU0A 4AWUA 2CLKA 3MHUA 4O15A 1PIIA 3HBLA 5G2HA 2J88A 3W7IA 5F4SA 1FCUA 3TE9A 4JTTA 1QPRA 4E38A 1F7BA 2E6YA 4X3ZA 2AAMA 5FEZA 2JGQA 4UIOA 1H1YA 1KV8A 4FX8A 4NXSA 3M47A 4MY1A 2FTPA 3T4CA 4P2VA 4JTSA 3UY7A 4IUOA 4C1LA 3ZWTA 4RJEA 2QCDA 4ORMA 5E0KA 5AFDA 1TRIA 2QUUA 2YFNA 2TSYA 3P8JA 1ZY9A 4MVAA 3T78A 3SIZA 5EBUA 1FXQA 2OJPA 4N4QA 2PRMA 1XCFA 3NQCA 1JUEA 2EGZA 4H6KA 5I3JA 1H51A 3KXQA 3W7OA 5HINA 1YADA 3AO0A 4WZHA 1IIGA 3I6RA 2NUXA 3W7CA 1IGSA 2VXNA 1W3TA 3NQMA 5AHMA 1G69A 1R46A 3BW3A 3NQGA 5G4WA 3IIVA 3IVSA 4HNVA 1YDOA 3A5FA 1W8SA 2Z6IA 3NDOA 4X22A 3PF3A 1NFBA 2Y88A 5K4XA 3M5YA 4HN4A 4RK8A 3Q2DA 3KFTA 1ZCOA 2WSRA 2ZZ4A 5KINA 2VFFA 1D3GA 2CLEA 2ZZ7A 2ISWA 1KM0A 4HIBA 3P82A 3T44A 4CQAA 2DZPA 3PVFA 2C18A 4M7TA 2X1TA 3C52A 5G2WA 1JCLA 3W9ZA 4GE8A 1GG1A 1GVRA 2PRLA 3W1QA 3NO5A 1V5XA 5G1YA 1W3NA 1K7FA 3VNDA 4L4MA 4XTIA 4N9DA 2CLMA 1FWWA 3LXCA 4MOZA 1JCMP 4EF9A 3W74A 4JDYA 2VEIA 1B57A 1NEYA 3THQA 1FWSA 4J9JA 3FOKA 1JR1A 5F4WA 2DP3A 3TH6A 1F05A 2YFOA 4AHOA 4O57A 3N9SA 3FFSA 2WQPA 3BGGA 3UD6A 4EIVA 2CZFA 4O12A 3N9RA 2A85A 1LLZA 5D2VA 5CSSA 3U6WA 5LHEA 3W85A 4LNYA 2ZRYA 2V5BA 4MLRA 4RCXA 5TQLA 1ICPA 3DI1A 2QUTA 2YW4A 4CNNA 3LBMA 5HWJA 4DXVA 5LSMA 4O8RA 3WFAA 1R2RA 4AF0B 1ADOA 2DZUA 3E49A 3C2RA 3N73A 1IXQA 5A8GA 3BLFA 5CGQA 1G6CA 1HO1A 1S3HA 2Z0IA 3NOEA 3HMJG 1Q6OA 1SW3A 4M6PA 1YXYA 1Q3NA 3S5YA 3BW2A 5EL1A 2E5DA 2ATSA 4AEOA 3G3DA 2PE4A 4KKXA 3NZRA 4GUGA 1XBVA 1SPQA 2FQIA 1A50A 1J2WA 1QMLA 3EWUA 5IBXC 3NQ8A 3GKFA 4UTWC 3LHUA 3KHJA 2GQAA 2QJIA 1F74A 4FNTA 1SZNA 5MHBA 1WBHA 3DZ1A 3Q37A 1FDJA 4LS2A 4IWWA 1EUNA 1XL9A 1W5MA 1RPXA 2A6LA 2VFDA 2QJHA 1YDNA 5IM51 2I14A 3B06A 5LNWA 4K7VA 1A5AA 3WK3A 1XBYA 1KW1A 1KBJA 1BKSA 3LRLA 4AVFA 4RZ5A 4QQ3A 3W23A 5HR7A 2KZHA 1H5YA 5A5WA 3GK0A 4QNWA 2ALDA 4ZQNA 4UC5A 4TX9A 2FPYA 1HL2A 4IGHA 1K8YA 3MYOA 1KFCA 4A21A 1F73A 3B0PA 1TTPA 3BLIA 1XFBA 2QAFA 3CM4A 1QPOA 1G4PA 2YSWA 3ATYA 3TSDA 4CQ9A 4NXKA 1A5BA 1T0OA 4O28A 2WNZA 2YDAA 3LTYA 4JICA 2ZRXA 2QCNA 2V9DA 3UPBA 1QCWA 3IGXA 1MEWA 4S1FA 4AB4A 2QEZA 5LZLA 5F2IA 1MEIA 4Z08A 1OX4B 2IQTA 3P62A 2ZQ0A 3O6YX 4Q4KA 1TMHA 2NX3A 2FB3A 3QQ1A 4LS0A 3NEVA 1BTMA 5TBOA 5G1TA 2YPIA 3NL5A 4IMCA 1SZEA 1TB3A 1TV5A 1DL3A 2O7SA 3W7DA 3L67A 4NQ1A 2QCEA 2V82A 4HKPA 1W5QA 1P0NA 3P74A 3S1XA 5HR6A 3LCWA 1EX5A 1F6PA 2V2CA 4N9EA 3BARA 1TTJA 3QMTA 3TW7A 5CSRA 3W87A 4NZJA 2WOQA 3W7LA 1L6WA 4JX6A 4KFOA 2QCMA 1G4EA 2QCFA 1TJRA 4AF0A 3S9YA 1H7RA 3FLUA 3CB8A 1O5XA 4JTKA 1P5BA 1VR6A 1YYAA 2WSQA 3PSVA 1W5PA 2YYTA 1KFLA 4WOZA 5D05A 3PAJA 1DVJA 2ZRZA 3KVMA 3O05A 4C1KA 3GZ3A 2ZTJA 5KITA 4O1BA 3G1XA 4UR8A 3RMJA 2CLLA 4WY0B 3PUDA 3PBYA 1UUOA 4FNPA 1OFDA 3MW7A 4WQ6A 4HHPA 3EB2A 5KZEA 4BK9A 4AAJA 1VH7A 4EOUA 3ELFA 1GJPA 3HF3A 4XZ9A 3TC7A 3T55A 3CIWA 2G5WA 3LHYA 1EA0A 4JIPA 5EA9A 5FEWA 2CLIA 3NM3A 3TK7A 1HO4A 1F2JA 4MYXA 3FYPA 1XBZA 3W22A 3STGA 3ZS4A 3SR7A 1OG0A 3HJZA 1OFOA 4YWIA 1QNVA 4Z1BA 1AMKA 1IXPA 1GYLA 4E2BA 3I7QA 3OIXA 1QPNA 4PC8A 2C0AA 1ALDA 3W7HA 1H7NA 3T40A 3W7JA 2CZDA 3QW4B 5BMWA 1H63A 4BWLA 3TDFA 2E68A 1BWKA 5FEXA 2A4AA 4I7WA 4MJMA 3N19B 4QNEA 3PB2A 1QWGA 3LB0A 3KVKA 3ZR4A 3IIXA 5HWNA 3TJLA 1TV7A 1SO5A 3NQ7A 1EWDA 2OMAA 2FFCA 4TO8A 4JD4A 3NQVA 2J9XA 3M43A 4O4VA 1TRDA 2LLEA 3R5EA 4JS3A 3EWWA 3TKFA 1JRCA 5D2TA 2EHHA 2QCGA 4MFDA 1SO4A 4CNOA 3NQEA 3NQ2A 1JCYA 4XBKA 4KFNA 4DF1A 1X1ZA 1JJKA 1LTDA 5LHFA 1YTKA 4NNAA 3QW3A 5K2ZA 3WK1A 2J24A 5C54A 2DZSA 5AOUA 3GXPA 3IIPA 3MP3A 4YCOA 1TV8A 2Z6JA 1U83A 3L66A 3NPWA 4WOQA 1LYXA 2A5HA 4O17A 3R8RA 1TPWA 3B0VC 4P61A 1W37A 4WUIA 1VC4A 1AK5A 4GC4A 1M5WA 1L6SA 2P1FA 4XKYA 1JCNA 4ZQPA 2VEMA 2I1OA 1VYPX 2C13A 1MSSA 1GWJA 1LDCA 5K9XA 3C61A 4JTUA 1OX6A 5HJLA 2W6RA 3MI6A 3B05A 1D9EA 5AB3A 2Y62A 2DORA 1AL8A 3HGJA 3UNDA 1KBIA 2X1UA 3DXIA 1LRQA 3C3NA 2RFGA 4ONVA 1XBXA 3MYPA 4E0CA 4UTUA 3IVTA 4H3DA 3TSMA 4WXYA 1ML1A 1FWTA 2H8ZA 2NV2A 3M16A 4NVTA 3QC3A 3NL2A 2CZEA 3V1PA 3LXBA 2PCQA 2J9YA 3M0ZA 1CX9A 1X6UA 2C15A 3L0KA 1NF7A 1KFKA 3L65A 5FF0A 2CLHA 1UASA 3CU2A 3QMRA 2E6DA 1RD5A 4JTFA 1TPC1 2BSLA 3QM3A 3PBWA 2Y63A 3M44A 1PCWA 2EKCA 1K7XA 2PURA 2NWSA 3G8RA 4FNSA 5LNRA 4GRSA 4JNMA 1FCVA 1M6JA 1Q6RA 2ZBTA 1W0MA 1WOBA 4LTSA 3NA8A 4PA8A 2NXGA 4NJGA 3HPZA 4UFLA 3FKRA 4FIQA 1OHLA 4O1CA 4POCA 3LHZA 4O0KA 1TPH1 3P7YA 1O95A 4GUHA 2W79A 4UTMA 3GR8A 4OGZA 1MZHA 3BG3A 1ZENA 1L9WA 3PSWA 3PG9A 3W1TA 2H3DA 3U2OA 5EYWA 4ML9A 1QDSA 3GAKA 3CLMA 3NGJA 3PBUA 1KLZA 3EX1A 2ZZ6A 1GVQA 3INPA 2WSYA 3W07A 4UFJA 1C29A 3UYCA 4NJJA 3R13A 3S5NA 3M7WA 1HFBA 2Y7EA 3NR0A 3W73A 4YMZA 1F6KA 3WJSA 3OA3A 2RKXA 3OEXA 4GJ1A 3W84A 2GQ9A 4UFHA 1FUYA 1GT8A 1GZGA 1GVOA 3DENA 1OFPA 3PWAA 1BWLA 2YCEA 1UUMA 1Q6QA 5E93A 2Y7FA 2A7RA 5FF2A 4O1AA 1OF6A 4HNTA 4IMFA 4BFAA 1EWEA 4N6EA 2VFHA 5AN7A 3OHIA 3KAOA 3P8IA 2CFFA 5D30A 4HPJA 5U7SA 2B7PA 3BK0A 2A7NA 3W86A 4BF9A 1LLWA 3MP4A 5CZSA 5BW6A 4RX0A 1Q45A 1FDZA 5CPLA 3DGRA 5F2LA 1GOXA 3LLDA 4FNRA 3IEBA 4MZYA 4NT0A 5AC7A 1W3IA 2ZA2A 1O60A 1MO0A 2C3ZA 3LDVA 4DF2A 1K8ZA 3I7SA 1OFEA 4N9BA 3RU6A 4K6AA 3STFA 1IXOA 3EXSA 3BVJA 4JIQA 4TIMA 4M5PA 3TSBA 2DZTA 4PODA 4UMCA 5HWMA 3LTSA 4LY8A 4O53A 4PEKA 4JX4A 2NUYA 2G96A 1W31A 1FCQA 2NX9A 2QUVA 5IBXA 4UTWA 4JTHA 4DEFA 1PHWA 3TW6A 4IJBA 1TQJA 1A5SA 2YW3A 2ZRUA 3MI2A 1O94A 5KTLA 1S5TA 5L9FA 4A3UA 1W56A 2QAPA 1IIHA 4FHAA 2ZA3A 1DQXA 2GVJA 2D73A 1GG0A 1DKWA 1UBSA 4K38A 4FEZA 4IX0A 3SZ8A 2Y85A 3CQ0A 3TXZA 4MY8A 1V7YA 1VLWA 1ZHAA 3C6CA 3TMLA 1VQTA 3O63A 5D38A 3TNOA 4DO4A 1M7OA 1YDVA 1K03A 3TX9A 3BV4A 2WO5A 3W1RA 1A5CA 5HQEA 3P80A 3RLUA 3IVUA 1NF0A 1GTHA 3I65A 3GLCA 1O4UA 5CZ0A 3RF9A 2O7QA 4RZ6A 3ABRA 3N3MA 4JYFA 4PFMA 1DHPA 2E77A 3PR2A 2DZWA 3TXVA 3PB0A 5KSWA 1RVGA 3UWWA 1TPVA 3PG8A 3R12A 1Q6LA 1KM5A 5F4XA
chains in the Genus database with same CATH superfamily
4B92A 3TAOA 1XSIA 2W3ZA 4A3RA 3MBFA 9XIAA 4FNUA 1BVNP 3T6CA 3GG0A 2D2GA 3TN3A 5E6ZA 1E1CB 2O4MA 5F2GA 2AGTA 4MLJA 4FB7A 5BWAA 2FPTA 2JE8A 4JKLA 3WJWA 4NF7A 1GZJA 3Q4DA 5FJJA 2PLMA 2QDHA 3LHVA 1V6XA 3AS0A 4Z1YA 1GYMA 3CQIA 2Y7GA 4N9CA 1SJDA 3AS1A 1SO6A 1S5VA 2VCAA 2YOCA 2PDCA 4JX5A 1LZOA 2PA6A 4E4UA 2ABBA 4XBJA 2E5BA 3TTQA 1SW7A 4FOKA 4Z1DA 4S39A 5BU6A 3ABOA 3MJYA 1V6TA 1UKTA 4ADSA 3C0JA 2WKJA 2W5FA 4QG8A 4MIMA 3BLLA 1MXSA 1PAMA 3T42A 3PY2A 3VGFA 4DUWA 2VM8A 4DPPA 2OSYA 3GS6A 4IFRA 4IOTA 3G1SA 3S8HA 1WXZA 3W75A 1XLLA 3K4WA 3KRSA 3LUTA 2Y89A 2Z00A 6A3HA 2FVKA 5LGZA 1NQ6A 3ES7A 4HGXA 2E1DA 4FO4A 1W3HA 2CZ5A 1HJVA 4WJ8A 1XG4A 1NQKA 4E2VA 1K3UA 4J3XA 2NXHA 3BUVA 1US0A 1XLBA 4C6EA 1CZ1A 3WJYA 1SFJA 3M0HA 3NGFA 1BF6A 1UZ1A 3EPMA 4IQEA 2QS8A 3NDYA 4ERAA 3QBUA 3W25A 3BJSA 3ARXA 4XD3A 5GNZA 3MWAA 1BKHA 4YCPA 1EIXA 4JN6A 1C9WA 1XQKA 3B8DA 4XVDA 1TREA 1PVNA 1X7IA 4KGJA 2OEKA 4Z1CA 2BWGA 4I9AA 3A3WA 4DO6A 4QJ1A 3DFSA 2PDKA 3EDJA 3WD3A 5AKQA 1POKA 5C6MA 1PXGA 2C1GA 1Q85A 1UH4A 3VYLA 3GNNA 4XQ6A 3R10A 1GOOA 4IMGA 2W61A 2ZRVA 3W1XA 3W88A 3ZXWA 3TCSA 4E8DA 2NQJA 2XH2A 2BY0A 1KTCA 3S1UA 2VENA 4EAYA 1V6UA 2V30A 1H1NA 3WQVA 3LCIA 3E5BA 5AZ1A 2ZE3A 2B7NA 2A3BA 4GUFA 2GOUA 3DKJA 1PV8A 1QOPA 3L12A 1VPXA 4IPIA 1XW8A 3CO8A 3LRMA 5A69A 3G1RA 2GSHA 4N02A 4GI8A 3AIRA 1VYRA 2V2HA 3A9BA 5BOEA 1AUSL 1EZWA 1OCQA 1CWYA 1T6MA 2NVAA 3PZOA 2W67A 3AC0A 4KWWA 1VB9A 3QR0A 2WJZA 1OX4A 1H11A 3HM7A 5K9DA 2AQWA 3ZJ8A 1OGBA 4IT1A 2FFIA 3P84A 1FBAA 1QNRA 1F4AA 3QY7A 3C4UA 2XGBA 3VA8A 5AVNA 2C14A 5DCBA 3WNOA 1JUBA 3L4WA 1VPQA 5BRBA 5A6BD 5E5CA 3O2LA 4DJEA 3H2FA 3O07A 3HGRA 4MWAB 5E70A 1OX5A 4LUIA 3FA5A 4WX2A 1H7WA 1O5KA 4UTJA 4LNCA 3A3HA 5G5IA 1TZ7A 3CNYA 4XISA 3EWYA 1DYSA 2W0UA 3VILA 3M5ZA 2RHGA 2QCDB 1OSEA 1JDFA 4QSHA 1XXXA 3NSNA 3UA4A 3FHQA 3FJNA 1V77A 4E2OA 2HV5A 3ZWSA 1KFBA 5FF7A 3UZJA 3O8AA 2PTXA 4RNHA 3E9AA 4JTCA 4PRWA 4WY0A 2WZMA 1RP8A 3C2FA 2G3JA 4S3EA 3PZVA 3U4AA 1RBOB 4G7EA 3DBNA 1YLVA 2XFRA 1XLDA 1FWCC 3E96A 2E9BA 2P76A 2VUNA 1NDWA 3OQEA 4K37A 2CBJA 4QISA 4PB5A 2ABAA 4R88A 2GJXA 2IQDA 1DE5A 1I2PA 4QTGA 2OWWA 1DORA 4GABA 1V3JA 1EA9C 3ES8A 4ROQA 1XQLA 3WEOA 5CPNA 3GHSA 2Y5EA 3UWYA 1J79A 2V5KA 4LC6A 3QH2A 2NWRA 3G0UA 4OHQA 4LGXA 1KFWA 2QPSA 1LT8A 4Y2WA 2RDTA 4AC7C 3PC0A 1BYBA 4AY1A 1S1PA 2BHUA 1UP2A 3OQ8A 4JTDA 1QAPA 3WDJA 2R1PA 2V5LA 1ISWA 5T9CE 5AHEA 4LF2A 4MM1A 3HPXA 3KCLA 2HWGA 4AZIA 1S5WA 3UPWA 3TCEA 5ABGA 3DFYA 2QF7A 2NV9A 4EVZA 5D4YA 1ZAJA 4FZIA 1JDCA 3GB6A 4IGMA 2QQ6A 1QPQA 2OSWA 4OE7A 2JBMA 1H3GA 4GCAA 1L0PA 1TUXA 3GC5A 4Q4SA 3GNOA 4H8VA 3TIMA 3UF9A 2BFGA 3B0UX 1GVEA 4D6CA 1R3WA 1LP6A 2IKJA 1MDLA 5DO8A 4JIRA 4LS1A 1XLAA 3MUCA 3DX5A 3VIMA 1VKFA 2Y4SA 1RQHA 2BV9A 4Q8OA 4UTIA 2BOGX 4FX6M 3DECA 4R7JA 3OO2A 2YGYA 3ZLFA 4RL3A 1TX2A 2HK0A 4J40A 4YN5A 3WL0A 1JI2A 5HK4A 3SSJA 4ADUA 3SQMA 4JQ4A 2VX7A 4AZ6A 5EMUA 3ME3A 4QDMA 3G22A 3WNPA 3EEZA 1KXQA 2A7PA 1QO2A 4UMBA 2JK2A 3UWZA 1FWJC 4DF0A 4DHGA 1X1NA 2XPKA 3PNUA 1QUMA 2BVTA 2W91A 4D72A 1Y0EA 2BY1A 1L6YA 1QJWA 1SQ7A 1Q4NX 4NZ1A 5CG0A 1F76A 2VEGA 3LTPA 1W9UA 4PCNA 5CLTA 4UUIA 3TU9A 7CGTA 5LNUA 3TYCA 3LCXA 3RO8A 1CI1A 3BCJA 3TTOA 4GVIA 5BROA 3M07A 4IFKA 5I00A 1X7FA 3MUY1 4UQDA 3UZ5A 2CETA 5FJPA 3B4UA 3L4XA 2CHNA 4NJIA 4GZIA 3VTRA 1EBGA 3T2OA 1FRBA 3IJLA 4LOCA 5AHFA 3CH0A 3L21A 1XLMA 3PZMA 2OO6A 3BWWA 3HU7A 3IWPA 4E6MA 1I0BA 2X09A 3JVAA 3R7MA 5EFFA 1KRAC 3LPOA 1K4GA 4WY0F 3NL3A 2YCKX 3KS5A 1GVSA 2B7QA 1UUQA 3H7VA 4AMCA 1GOMA 1W9XA 4KQNA 1QU4A 1VJIA 4WDWA 1KBLA 5ECVA 5DLCA 1XCXA 5IHRA 4AQLA 1QATA 4JQAA 9CGTA 4HU0A 3WDPP 3NYZA 3SCTA 4DXKA 4HZ8A 4HA4A 1GEQA 4WVXA 4PL2A 3L68A 2GJNA 3PTDA 2PWFA 4KEMA 5D8ZA 2VRJA 4XWUA 1TMLA 4P8XA 5A95A 1V4YA 2EPHA 5A6MA 2VDIA 2ISVA 2PDFA 1VFFA 3CV7A 3LM3A 2DVXA 4UOQA 1H7OA 2G4FA 3SCRA 1OK6A 3L2MA 2V5JA 5I06A 4LUTB 1WDWA 1FX6A 2X2GA 1GOIA 1B4KA 3NUKA 3RNDA 4JQ2A 1JFXA 1V03A 3RO6A 1DWHM 5HULA 3W72A 3KM8A 3W2UA 3ISIX 4IXXA 1XKJA 3W7KA 3CAKA 4G56A 5AYXA 4W4QA 1DIEA 1RHCA 3VGBA 1UG6A 1RR2A 4MUPA 1QHZA 2YCLA 4YIWA 1LM1A 4U3AA 2CC0A 3C8FA 5JUVA 3G3MA 3OLDA 5JQ9A 5AVHA 3G5EA 3ONCA 5FD0A 1SSGA 2Z1SA 1CLXA 3L5MA 4O50A 1NDZA 3NPUA 1VEPA 1EF2A 4D6HA 2FYMA 1G7VA 3WBYA 1Y65A 1GCYA 3Q45A 1WQ5A 2W9MA 4LEQA 3SSZA 3APTA 2OX1A 4X61A 3TV8A 1ZBWA 2Y6ZA 5KEZA 4WKFA 1G67A 3G18A 3P5ZA 4OOZA 4C5ZA 1E51A 4PMOA 2JGYA 1VS1A 3EOOA 1C3FA 4IMEA 1JL8A 4ZMGA 1FH9A 3TQVA 5I23A 4AEFA 1FWIC 3WMBA 4DJFC 4ML4A 3PN8A 1R0MA 4IF2A 3G0SA 3AJ7A 3U8GA 3GIYA 3DHUA 4MB3A 1WCGA 1E3XA 3T05A 3B0YA 1OVDA 1YPFA 4H9VA 1A5OC 2NQ9A 2NX1A 3N9KA 4MWAE 3QJAA 4HYWA 5D2YA 3C86A 1E3ZA 3DFPA 1C7SA 4J7RA 3LCFA 2ZUNA 2BS9A 3Q58A 3AMKA 2PDXA 4LVFA 1Z41A 1P0BA 3TQKA 3PUEA 1JCJA 2AGKA 1ECEA 3BMXA 5F1UA 2GGEA 4A2SA 3GQYA 1T7LA 4A6GA 1SU5A 2BTMA 4CLMA 4YLWA 1MW3A 2QUMA 3BANA 5D9OA 3G1DA 4L56A 4ZBCA 1BPLB 3S6OA 1IT8A 1J93A 1D3HA 4KWOA 3D3AA 5FF4A 3TQPA 4RNFA 2HJPA 3VMPA 4UR9A 2FB2A 3I7RA 3LEPA 8A3HA 1IEVA 3MO7A 4EPBC 5G4EA 1FHDA 5TNVA 1Z42A 4HK5A 2PDMA 2PDGA 3AFBA 4S38A 2WJEA 4JTEA 5K9CA 4FXFA 2NV1A 3H23A 1KKRA 2PDWA 3P3BA 3TN4A 3PBGA 3AMCA 1HGYA 2X1SA 4NX5A 4RE3A 2ZUTA 3SN1A 2WM1A 1DWGM 3FA3A 3O0FA 3CT7A 3SY5A 4H7CA 3EOSA 1KTBA 3QFWA 4H19A 4HA0A 5A6LA 3BLPX 1TPEA 4HSHA 1XC4A 3WH9A 1OGSA 2NUWA 3NQ6A 4CGTA 2QIIA 3LHWA 1XYLA 2FZMA 2PDIA 1H60A 1EGMA 4XTDA 3EEGA 3GTNA 1TPB1 4FI4A 1PL9A 3KVJA 2XWDA 3WK0A 1K7EA 4WGHA 3W7RA 4WSJA 3VK5A 2XSBA 5CBJA 2FKPA 1UH3A 3SGGA 1DXFA 1MMFA 1MRAA 1TE1A 3O6CA 4HT3A 1E4IA 3F5JA 1HP5A 1BTCA 1KM3A 2D24A 1W2PA 3RX4A 1WXJA 1UCWA 3FS2A 4HK6A 3P5YA 1AJZA 1QO5A 1UR4A 1W5NA 1M7JA 4AD1A 3W7MA 1OF8A 4G8TA 2VQUA 3C8NA 3WDHA 1EQCA 2F61A 5DRIA 1SJAA 2X16A 3K4AA 4PTMA 4JN8A 4PUWA 3UR7A 1O1HA 4CD8A 1AJ2A 3IUHA 3C0SA 4PBFA 2V3DA 1U5JA 4URIA 1XIBA 3O6DA 7TIMA 1UA7A 4LPCA 4UFMA 4LAOA 4PH6A 4MAVA 5LIUX 5M3WA 3O6AA 2VX4A 1TIMA 4IIEA 3RJYA 2XIQA 5I24A 3MC5A 4W7UA 1H1ZA 4C6NA 2CERA 3MZNA 1AW5A 1HP4A 5XINA 1NP2A 2P88A 2JF6A 3MSYA 3WFZA 3HBLA 4B16A 2BNJA 4XAZA 3ITTA 2CBIA 4JTTA 4E38A 2AAMA 3UGVA 3M0MA 3UJSA 1ISYA 3KTXA 3AOFA 3E3HA 3GY1A 3ONBA 1PSCA 2OWCA 4NXSA 3VKBA 1A4LA 4AD3A 3F5LA 4EPEC 3UY7A 3KDNA 1ZY9A 3M0VA 1FWGC 5BXTA 1QNOA 1MUWA 2A79A 2BGSA 3SIZA 1ISZA 2OJPA 3B9OA 4INFA 3NQCA 2RGLA 4KIEA 1L6GA 3HQNA 4ZO9A 1E71M 2WLZA 3KXQA 3W7OA 3ZVHA 1JG9A 1CLVA 2PP3A 1RBAA 2NUXA 3GH7A 1UIPA 2HE5A 4QS5A 4J27A 5M17A 3A5FA 4X22A 3PF3A 5K4XA 5CBBA 4RK8A 2Z2BA 5KINA 1JEZA 2ISWA 1EYEA 1KM0A 4HIBA 3T44A 2DZPA 3V3WA 4M7TA 1JCLA 2HEJA 5M1TA 3RDKA 1MNZA 1ZLPA 2JF7A 2PRLA 3S9ZA 5G1YA 1W3NA 3H7RA 4UQEA 3XISA 1B57A 3RLGA 3CYJA 3THQA 1R3YA 4HNLA 3UVAA 5F4WA 4AHOA 1ZUAX 3BGGA 2HXTA 1YQ2A 2A85A 4BQ3A 1VFSA 3WL1A 4RDVA 3W85A 4LNYA 2WMJA 2HISA 2J62A 2ZRYA 4RCXA 1HL9A 1X96A 1PIGA 2YW4A 4CNNA 5LSMA 4MF4A 1RBLA 4FR1A 1ADOA 2DZUA 3E49A 1Q7MA 3FX4A 3N73A 2A3AA 5A8GA 2POZA 2E67A 1HO1A 5FIPA 4C6QA 4KIRA 2QUNA 4UBPC 2IPFA 1SW3A 4M6PA 1UR3M 2VVSA 3F4CA 3LGGA 5EL1A 4L9XA 3HJEA 4C60A 2J6VA 2ANUA 1ZP3A 3SN4A 4NSBA 2RDXA 3WCZA 5EU9A 1PWLA 2E9LA 3EWUA 3VNKA 5IBXC 1E0VA 5E09A 3GKFA 3N4FA 3OG2A 3PZUA 5G4HC 4TUFA 3T07A 2X7WA 4FNTA 5I0DA 4ZCWA 1WBHA 3Q37A 3PWGA 1HT6A 2DFAA 2A6LA 2JEPA 4WGXA 3QN3A 5C9RA 1KW1A 4D6IA 1BKSA 3VZYA 1XG3A 4B5VA 1HKMA 2VZVA 4TX9A 2FPYA 2DQXA 4HJFA 3QOMA 3MYOA 4Q6JA 1F73A 4FA3A 1IZJA 1B3XA 5A6TC 3QHMA 2YSWA 3ATYA 4C6BA 1DJHA 1VFUA 2X1IA 4GI6A 4JICA 3AIEA 5DANA 3IGXA 1MEWA 4AB4A 1MEIA 3H2OA 3OLGA 4QAWA 1C8YA 2IKHA 1OX4B 3N25A 3P62A 4JIHA 2ZQ0A 3DOPA 5JH1A 4LS0A 3CHDA 2VHLA 2OVLA 4BQ4A 3N6QA 5A6SA 3NL5A 3M0LA 1B31A 1TB3A 4ATDA 3F7JA 3U2EA 3POHA 1K9DA 4NQ1A 3I6EA 2OFJA 1P0NA 3P74A 1F9CA 3QGVA 3LCWA 1FWFC 3OZOA 1NDYA 4ECLA 1VBRA 1HL8A 1JZ5A 3W87A 4U5IA 2QCMA 4B15A 3S9YA 4JTKA 1YYAA 3N04A 1XIEA 2ZX8A 4B5XA 1HKJA 4HCHA 4Q4RA 1NIUA 3G1XA 4WY0B 4FOJA 3PUDA 3SRFA 4FNPA 1OFDA 4GCXA 1GNXA 3EB2A 4BK9A 4EOUA 1Z7AA 5DMNA 3ZT6A 2WCGA 1JPDX 3CIWA 4JL2A 4HU3A 1UKOA 5FEWA 2CLIA 1HO4A 1UKQA 4AX6A 3DG6A 4CN4A 5XIAA 4MYXA 1R9ZA 3W22A 1HKKA 3BTNA 1QNVA 1IV8A 4DNMA 3BJTA 7TAAA 2CKSA 1RJPA 2HK1A 4PC8A 1AD1A 1ALDA 3WLLA 1OCJA 4DN1A 2ALRA 3IJ9A 3PZTA 5HQMA 3TDFA 4BQ2A 1KRCC 5DX7A 2E68A 3R25A 2FVMA 2A4AA 3CPUA 3AU2A 3BSHA 3LB0A 3MV11 3KVKA 3IIXA 5EFDA 1BWVA 1WXYA 5DMMA 3TJLA 4H9TA 2X42A 4JIEA 2OMAA 2FFCA 2FMNA 4U31A 2QIWA 2PLJA 1JGIA 1TRDA 3XINA 1Y5WA 2EHHA 1CIUA 4I90A 3SCSA 3P93A 1W9PA 1E4MM 1EC8A 4V1YA 4XBKA 2WC7A 2OQYA 5FA5A 1YTKA 1HJWA 3ITOA 3PP7A 3KP1A 3WK1A 2WZEA 3IIPA 2Z6JA 3BDKA 4DJDD 1LYXA 3II1A 4C6FA 1KXVA 3RLHA 1KB3A 1W37A 1QW7A 5E0FA 3B9DA 3PPHA 1PKMA 3ALGA 4GC4A 2P1FA 3E74A 3EOLA 1VYPX 2C13A 4ZFCA 2REQA 2PP1A 1AA1B 3IS4A 1XRVA 4X9YA 2A3CA 3LQGA 2W6RA 3MI6A 2A3LA 1PX4A 2QJMA 3B05A 3R58A 3ZR6A 1D9EA 5AB3A 2DORA 4ACYA 5I78A 5I09A 2IS7A 2X1UA 1LRQA 4S3JA 3CZGA 3WBEA 3C3NA 3FVMA 4ONVA 4Q4PA 4E0CA 2D22A 2ACSA 3BAXA 1ML1A 1VF8A 1QPKA 2NV2A 5D9MA 1SVDA 3NL2A 2QJJA 1LL4A 1CX9A 3BXWA 2F9RA 3ZSTA 3N4AA 2FZBA 3UJRA 3H70A 3R94A 1BF2A 1X6UA 3L0KA 1EOMA 1NF7A 3MPGA 1NTHA 1KFKA 1D7FA 5FF0A 2CLHA 4C1NA 4LAMA 3CU2A 3MKVA 1TPC1 1N8WA 4M3PA 3QM3A 2Y63A 2O56A 5FJIA 1UWIA 4DYJA 3MUZ1 2WBGA 4FNSA 1O6IA 1M6JA 4DAFA 4KW2A 2BMBA 1EJWC 1EF3A 4NJGA 4UFLA 3SUUA 5GQBA 3WF2A 3PHAA 4IL0A 1WB0A 4FIQA 4POCA 3WLHA 1TPH1 3BOLA 1X97A 2OZ8A 1JZ7A 4UTMA 3GR8A 1MZHA 1S2WA 4B5SA 4DYEA 2IMRA 3PSWA 5J8LA 2PODA 4M56A 2AKMA 4A8RA 3GXFA 5EYWA 3CLMA 2YIHA 3NGJA 2WJFA 3PBUA 3EX1A 3INPA 3UYIA 3P2VA 4HTYA 2WMHA 4I6KA 4NJJA 3ZR5A 3TR9A 5HANA 3W00A 1HFBA 2Y7EA 3NR0A 1OG6A 3P0XA 4GJ1A 2GQ9A 4UFHA 3VO0A 4XZHA 1H0IA 1FUYA 1IE7C 1GZGA 4CN1A 3PWAA 5DT7A 1KXHA 2Y7FA 4DBUA 2G50A 1BG9A 2VGGA 1MZRA 3CYVA 3BQ5A 4HNTA 1EPVA 4DJDC 3OHIA 2OLHA 2QYGA 1TFVA 5U7SA 4WLCA 3VNIA 1R86A 4PMVA 2NLYA 3U2CA 2I7GA 5D9PA 1V3LA 5CPLA 5F2LA 1R3TA 4RDZA 4FNRA 1PKLA 4BCEA 4IGSA 1O60A 2PU1A 3HFYA 1MO0A 1QNPA 4L9YA 3V18A 3BL3A 3WQ8A 1K8ZA 3I7SA 4JIQA 5TF0A 4AD0A 2V3FA 4D1JA 3HV9A 3OZYA 4O53A 4LY8A 3HN3A 2EQDA 1O5RA 1PHWA 3E0WA 4F2UA 1K4HA 3AZTA 7REQA 2YCLB 2YW3A 3N29A 5KTLA 3E1F1 1P7TA 2E3ZA 4UTFA 1MVYA 3TJ4A 2Z29A 2XM1A 4KS0A 4FHAA 3VM5A 1DQXA 2GVJA 4XX6A 1DKWA 3NJ3A 2XVLA 3H8AA 4FEZA 4IX0A 2Y85A 3TXZA 1OB0A 4NHVA 2HPIA 1V6YA 5JU6A 3ARTA 5D38A 1M7OA 4FAMA 1K03A 4LFYA 1US2A 2UY2A 2OSXA 4LCRA 2WO5A 5HQEA 3IVUA 5A6JA 1GTHA 3EPOA 3I65A 1RXOB 3S4TA 1YE6A 5CZ0A 4J3WA 2WSKA 3PJUA 3T8QA 3ZM8A 1XIDA 2WZHA 1TJ1A 2YL6A 2DZWA 3TXVA 3QKEA 1S5MA 3UWWA 1TPVA 3R12A 4W89A 3USZA 1TG7A 7ENLA 4N0RA 1BSIA 4B3LA 1THFD 3GH4A 1KKOA 4E4FA 1YNPA 3HG2A 2DW6A 2YXGA 3WX7A 1PYMA 1EGZA 2QDEA 3CL6A 4RZ4A 3W3OA 2DUAA 3AU6A 3AXKA 4Z2HA 1SW0A 1UD5A 4NNBA 4B5NA 1UMLA 2VR5A 3ABQA 1L8PA 1UW9A 1W1B1 4IQJA 1K8XA 4KGLA 1QVBA 6XIMA 3GX9A 1CNVA 1D8WA 1WDRA 5CEWA 3DU0A 4H2HA 3GXTA 1QRQA 1U33A 3UU0A 3S0CA 4GQ0A 1SZFA 2GGGA 2V0TA 6REQA 3MCNA 3EKZA 2YLLA 4DX3A 2WHMA 3L4VA 1C8QA 1MXGA 3PBMA 3A23A 4LV9A 3WJZA 3AWOA 1FY6A 5C5YA 1YHTA 4IQDA 1U1JA 4NU7A 3OVQA 4JGDA 2OT0A 4C6LA 1ME8A 5A6KA 3W1NA 5BRPA 4IMDA 5H8UA 1IXNA 1KCXA 3HOJA 1XYBA 1QI0A 3THAA 3EXTA 1NAL1 4WDUA 3WQFA 1ZU8A 4Y8EA 1WNOA 5KZMA 1EDTA 4AZBA 2WWDA 5AHLA 1A0CA 2NSOA 5LXXA 4B5TA 3HG5A 4GFSA 3EWBX 3OOQA 2GL5A 2F7FA 4LVGA 4XUYA 2PTWA 3H24A 2UV8G 2CEQA 3UESA 3GTHA 4M24A 1EP3A 1NARA 3CL7A 2PD5A 1U2YA 4N6FA 3IGHX 2WLYA 3AQUA 3UJ2A 3RIKA 4KRTA 5CZTA 3RM8A 3C2VA 3QPYA 1OYAA 4FMVA 1O1ZA 3NL6A 1A0DA 3UXDA 3WLOA 3CZEA 3T4WA 1TTIA 3QV6A 4LRSA 2FHFA 3M1ZA 1VIZA 3UNTA 5FKYA 3PUOA 3QRHA 3PZIA 4WK9A 2J78A 3S5OA 2Q02A 4PCFA 5LKYA 3M46A 4UTKA 4R7OA 3WQDA 3LX9A 4H8HA 3W7EA 2YA0A 3BLEA 5FESA 3NOYA 4BEUA 3S5SA 2R1LA 4AVOA 5FEPA 3D3FA 1YPIA 2GGIA 3GDRA 4WJEA 4UNKA 1WDSA 1UWRA 3NVTA 1GK8A 2XN2A 2Y1HA 4GYPA 2WC4A 4DJED 3L9CA 3FEMA 4Q8WA 5I3HA 4M80A 3G6LA 4P7OA 2ZUSA 3AUOA 3H4XA 3GYEA 1DP0A 3VOIA 3AYTA 5JXQA 4JHOA 3TTSA 4MB4A 2CESA 3K13A 2XUCA 2Q3RA 2QGHA 1MQQA 5CH9A 1R2SA 2JKAA 2P8BA 5D32A 1VFTA 3MCOA 3HO8A 2D2JA 3T1GA 4GO9A 3HMCA 4XK2A 1NWUA 4ZENA 2X8RA 3RJXA 4UTHA 3OBAA 4A05A 1AG1O 3ZO9A 3VGGA 1XIFA 2VZTA 2PWDA 2CW6A 3CV2A 4BF7A 2XH7A 1E6ZA 1B1YA 1B30A 2A6NA 2DSWA 4V28A 3W83A 3G6MA 3DGBA 5FJTA 4DBDA 1XCWA 3SGZA 1XSJA 2Q3OA 1DBTA 3UVIA 2GVLA 1YNQA 1QHOA 3MTWA 3BPWA 5AHIA 3VKJA 1RJRA 3T08A 4CNSA 3UXLA 2I17A 3BAIA 4LSBA 2PZNA 3N12A 1ZJHA 3IJDA 2EJ1A 1WZKA 5DMLA 5CSUA 3N1AA 4OT7A 3EKLA 3A13A 2ADAA 3GDMA 2DZXA 1W1IE 2HMCA 4I7VA 3SN0A 3CIVA 2PDLA 5CKSA 1QFEA 2CLPA 3WH6A 1YPXA 4UTLA 1XS2A 5I77A 3PS7A 5MKGA 1LQAA 3ZVHB 1N8FA 3WDRA 4KT2A 1CCWB 1R9XA 3R2GA 3AI0A 1FWBC 4LB4A 4ZO8A 3FJLA 2E7FA 4US5A 1MUCA 4A2RA 3A4WA 1PTDA 4ZO6A 3CIXA 4KERA 1A49A 4GKTA 4ERGA 4FF7A 4HHHA 3BG9A 4WSKA 1PZ2A 4ZXLA 5GNYA 3V4BA 2PEVA 3YPIA 2XN0A 1GTEA 4HSNA 3IIZA 6XIAA 2OT1A 4XO7A 1NOUA 1XDLA 3C0LA 5BXRA 3B4YA 1XLJA 3NSMA 4B3ZA 4IGNA 4O8AA 2WV8A 1OC5A 3QEZA 5DQPA 3NEHA 2FDSA 1CXIA 4PCPA 4A8IA 4GNKB 4B2DD 5H91A 1SMDA 1R30A 4RKAA 3VIOA 3EXRA 4C91A 5HPOA 2HNHA 4ZA0A 4C7GA 3LXAA 4H4IA 3L5LA 3MKKA 4H2CA 4HSOA 4GQBA 4YTQA 2OYMA 4H7VA 4CQBA 1UZ4A 3DYOA 1OWQA 4Z2KA 1TYGA 3GTIA 1KRMA 5EMYA 2HZGA 4XSLA 1OD8A 1LOQA 3GAYA 2C91A 1I45A 1S38A 4MWAA 4E4PA 3NURA 1F3WA 2V6AA 2TRSA 4MNLA 4ZL1A 5H6HA 5I79A 1DE6A 2PWUA 4MFEA 2DV0A 2BX7A 3WQOA 3BQ6A 4XIAA 3R43A 4O14A 3K46A 3GYCA 3GXNA 4NZCA 4PB3A 3BJFA 3OBKA 4XSMA 4ZGYA 2I9UA 3SBFA 1GUVA 3BICA 3CS2A 4DPQA 5A8PA 4QITA 3HGSA 4F2TA 2OQLA 4ZO7A 4DWSC 4Q7NA 3VKDA 1VCFA 4FLQA 1X1OA 2E25A 1TR1A 3W24A 3HPSA 1CGVA 3SM0A 4I8YA 4L4PA 4JCLA 1A0EA 2G3IA 1EO5A 5J5DA 2C16A 4KWVA 1J6PA 1D2KA 3CQJA 1HKWA 2VELA 4S23A 3VGHA 2J8GA 4UFKA 2R8WA 3B97A 1FQ0A 4BEQA 5D04C 2AOSA 3S6DA 3WLPA 4OU1A 3ALFA 5D8WA 4Q4MA 1VAHA 3F2DA 1FH8A 3M6YA 3E0VA 4GWEA 2J25A 1OJXA 3UEQA 1SFLA 2WVSA 3N2MA 4BF5A 3VDHA 1YXCA 5HOSA 5XIMA 1E43A 1M9HA 4W93A 3GR7A 4R7WA 3JW7A 3MO4A 1EJXC 4LUYA 3ARZA 1IT0A 2PWGA 2OX4A 3ARYA 1OFQA 4OWGA 3BCDA 3FKKA 3OJGA 3FVDA 2OR2A 2IUZA 2A3HA 4CD6A 4K8EA 3IV8A 3VFLA 4S2BA 3U3HA 2VT0A 4YWSA 3G1AA 1WO2A 1JI1A 3SJ3A 3KE0A 2YZ5A 1S5NA 3QF0A 4UWMA 3PTMA 4YHEA 1WBJA 2CLFA 3CQHA 5C2CA 3VIHA 4KCUA 2EAWA 5D37A 5I3DA 1X6NA 3KL3A 1Z8AA 4GISA 3F03K 1B5TA 3UWUA 1KWKA 1HJXA 2V8ZA 2YBVA 5LYRA 1ZALA 3OP2A 1TJ2A 2NLIA 3TW9A 3AHYA 2FLIA 3HGOA 3DG7A 4CNPA 1P1MA 1T41A 4GXMA 3S5ZA 2FZ9A 1GHRA 1DJYA 2XTKA 3KOFA 3W70A 1DJNA 3FN9A 4HN8A 4DZAA 3AALA 1W1YA 3A22A 3MBDA 2Q8XA 1TO3A 4QP0A 1WYIA 3F2CA 1XC6A 4DBEA 1K02A 1SFTA 3ZMRA 1I2RA 3CEPA 3F4NA 3QMSA 2AKZA 1UZHA 5CC6A 1NDVA 3A12A 4LW7A 3AXIA 3RRAA 3ICJA 1C93A 1B9BA 3LV5A 4Z0JA 3H53A 4AHQA 5DXYA 2DJLA 4MKNA 5AYIA 3GRIA 3VDCA 1CXFA 1KBBA 2DY3A 3QYSA 3RFAA 4JXCA 4EP8C 3RX2A 1QW8A 3MSDA 3VNLA 2QPXA 1JPMA 1B90A 3RGTA 2FTWA 1W1TA 4EWND 5LA0A 3N2OA 3GSMA 2OKTA 2OELA 2PDUA 2V5CA 3SURA 4KBXA 3LN3A 4JCMA 1ZFJA 4WD0A 4Z2JA 3N34A 2QHAA 2UY3A 4N4PA 2C1HA 3GO2A 3PWIA 3VUSA 4NZFA 3ERPA 3P60A 2IKGA 4M81A 5I03A 4HCLA 3O16A 2P50A 5C2XA 4EK7A 1BEUA 4WDTA 4IPLA 3VMNA 1NH6A 2REQB 1ITUA 4HTBA 4AIBA 5G2IA 1EC9A 3V0SA 2QW5A 1UD8A 4GJIA 1W3LA 3LBOA 2J7EA 1ODUA 4D6JA 4ADTA 2J9ZA 1I2QA 4NP7A 2BB0A 3A64A 3TQ0A 3MHGA 3WH8A 1SM9A 2P3ZA 4ZFMA 3RYSA 4K3ZA 5HUPA 2RUSA 3GNDA 4P7RA 3AMGA 4O1DA 4RDWA 3CEUA 2PC8A 4GBDA 4AWTA 3AMDA 4CNUA 1PHQA 2YXOA 2GJLA 4L1GA 4IPNB 4C1NB 2QJGA 4Y9NA 4U2YA 4OBRA 5BXPA 4DZIA 5C8BB 1OABA 2ZZ3A 2FDMA 3FJ4A 1JPIA 2TPSA 1J6OA 3CUGA 1O12A 1EOKA 1V3MA 2VYOA 2WM0A 4ZVJA 1ME9A 3USBA 4L7ZA 1G7UA 4MADA 2ZUWA 1XD1A 3MP5A 3DFQA 1CXEA 4PCSA 1UA3A 4IP7A 4TMCA 2NXIA 2QLYA 2G41A 3UZYA 1R47A 3HIJA 1NWRA 1U1UA 1M53A 3UCCA 1XLEA 4AD2A 2QCCA 2ZZ2A 2CLOA 5BWFA 2J27A 2XFYA 2HE8A 1IF2A 2JQXA 4LXFA 2ATMA 1UR1A 3ABXA 4JYEA 4HZMA 2R1MA 4B5UA 3QY8A 3CUHA 1Q13A 2TODA 1PZ0A 4DI9A 2UZ9A 3EX3A 4HNCA 3VINA 1NOFA 8TIMA 4H9UA 4LAUA 1OFAA 4Y6GA 4JTJA 1TZZA 1E9LA 4R3UA 1VYSX 2BOFX 4ZOEA 3M0KA 1W6TA 5HNUA 5TIMA 1V02E 5KMYA 4EPDC 4O4WA 1R3VA 5SWUA 1Y7VA 1ONWA 1TPUA 4TU1A 1J96A 4J3UA 3BC9A 2RDUA 2YR1A 3U2ZA 4AU0A 3V36A 3OVRA 4JTGA 1ZPTA 4GVGA 3DEQA 1UYQA 4GY0A 1WA3A 4GK8A 2EO7A 2BASA 3EPNA 3ARWA 3W2JA 1EP2A 4QR6A 3GVVA 2IPWA 3SQLA 3G1VA 2J66A 4XVEA 1LROA 1X8CA 1F3TA 1WAUA 1QW9A 1ISVA 4W7WA 3ZYZA 3NXFA 4LF1A 2PMQA 1PS9A 1UB3A 1GVIA 5DY3A 3W01A 3WQPA 4AG0A 1KQYA 4PMYA 4AC1X 3CJPA 1E5NA 3K8KA 2DIEA 1S2CA 1JAEA 4XV0A 4OZOA 3RM4A 7REQB 3N13A 5I7GA 3LMZA 3L5AA 1N7KA 1SZGA 3MQTA 3PPGA 2WNNA 5IHSA 1P7TB 4V15A 3W1PA 4GQQA 3P67A 3UXKA 3NXLA 5HPCA 1W5OA 3CC1A 4JFWA 1Q63A 3UXAA 2PP0A 4IHCA 4N42A 2Y70A 1IEXA 1BQGA 3M9YA 2OEJA 4DXXA 1BHGA 3KVLA 3FGCA 3B3DA 4MMWA 4ZQCA 5EPDA 3T2QA 4W86A 2D3NA 4OFCA 3WLQA 2VZOA 3EDDA 4LYQA 3BAKA 4HB7A 3UY8A 3T0CA 3KTSA 1DIOA 2CU0A 4I3GA 4AWUA 2XWEA 4O15A 1V51A 3AIUA 4Z17A 3GXIA 4HJWA 3W7IA 3WYZA 1PBGA 4CNTA 2E1WA 2YDQA 1QPRA 3KWSA 4YTSA 4X3ZA 1PIFA 3GXMA 4ERIA 4JBRA 3PZ9A 3UCQA 2XSAA 1ZJAA 4AIUA 1UWSA 4FX8A 2ZXQA 4UQCA 3M47A 2CXEA 4P2VA 4JTSA 2CHOA 1M04A 2CNCA 4C1LA 3ZWTA 4GZEA 2EPOA 4IH3A 5JBDA 4MNJA 1ZCCA 4I5UA 4ORMA 5AFDA 3S47A 1GW9A 1LWHA 2DW7A 2J8FA 5FOOA 4GLEA 2PRMA 1OD0A 3M7SA 1XCFA 5FAJA 1BAGA 3CMFA 5A2AA 3QZAA 3E2SA 1M41A 5HINA 2NSXA 1E9ZB 2VX5A 3WNLA 3NDZA 5AHMA 1UPPA 6REQB 1R46A 3UG4A 3NQGA 2ZUMA 2Z6IA 3NDOA 4PRTA 2DIJA 4L1XA 2ZXBA 3M5YA 3IRSA 4G5DA 1M7XA 2WSRA 4W8LA 4CQAA 3GC2A 2C18A 3W81A 2X1TA 4KCVA 3C52A 3FV9A 4MNMA 4MJ2A 2O55A 1GVRA 3V7PA 4HMEA 1J5SA 3EDEA 1V5XA 4RUBA 3M0JA 1UR0A 1F61A 4L4MA 4EACA 4MOZA 2C8NA 3WDIA 3I3EA 4ZOCA 3TH6A 1F05A 3GZAA 4O57A 4ZOBA 3FFSA 3T0AA 3VIGA 3N9RA 3MS8A 2XIBA 3FCPA 5M2FX 3S46A 3HQPA 3U6WA 3ZT7A 1GOWA 1GQIA 3ZQ9A 1HXJA 2OXNA 3ARRA 3DI1A 4M82A 2QUTA 4LEFA 2J8TA 1CT5A 4AF0B 4K1GA 1FWAC 1CXKA 3C2RA 4FLOA 3SRKA 1IXQA 1UZDA 3BLFA 1SMAA 4PMUA 2Z0IA 3HMJG 1ITXA 1Q6OA 1K8CA 1CDGA 4YTTA 3BURA 1YXYA 1Q3NA 2E5DA 3H2MA 4Q7IA 3G3DA 4KKXA 4IIHA 4OBSA 1E4LA 4GUGA 3CB3A 3AIWA 2FQIA 3TP4A 5FL0A 1CXHA 3NQ8A 5CPQA 3ITXA 4W8AA 1F74A 9RUBA 2SFPA 1SZNA 1GVYA 1Z6KA 1FDJA 4IWWA 3R0KA 1RPXA 2VFDA 2QJHA 1YDNA 2I14A 4H6EA 5LNWA 1CYGA 3MV01 1XRFA 1J0ZA 3AYVA 1LJYA 4DJFA 4AVFA 4QQ3A 1AD4A 2KZHA 1H5YA 4GYJA 3TONA 3LA4A 3UGRA 2Z7GA 3B0PA 4DUOA 4W5ZA 5FACA 1XFBA 3K4DA 3WD2A 1G4PA 4CQ9A 4NXKA 1A5BA 1NFPA 1T0OA 2WNZA 3WLJA 2YDAA 3WFLA 3ZJ7A 5B7ZA 1TV2A 1R3QA 5LZLA 4GVFA 4MDOA 4CU6A 4ES4A 4PULA 3H2CA 1TR9A 5C9ZA 3NSXA 5I5RA 3C5QA 2VRQA 1H4PA 2NX3A 3QQ1A 1UD3A 3NEVA 1BTMA 5G1TA 3A4JA 2BHYA 2ZVRA 1Q8JA 3H2AA 1EIBA 4J1OA 4DWDA 4YPJA 2V82A 5HA7A 3BGAA 1W5QA 1A80A 3PAOA 4F79A 5HR6A 5I6SA 2ZKMX 3WQ4A 4N9EA 2V2CA 2AMXA 3TW7A 1F4HA 7PTDA 5DF0A 1J0HA 2WOQA 1AMYA 3UFYA 3W7LA 3WH5A 1Q2RA 1L6WA 4KFOA 4TVUA 1K77A 3K1DA 4QX4A 2J79A 4M6UA 3MDUA 1H7RA 3UG5A 4YYFA 3KUMA 3FLUA 1O5XA 4IG2A 1P5BA 1W5PA 1KFLA 2VGIA 5D05A 2Z2AA 1CXLA 1IEWA 2ZRZA 3O05A 4C1KA 1JZ4A 3GZ3A 5MKGB 4DY1A 4UR8A 1UJQA 1UUOA 2Q71A 3MW7A 4WQ6A 3U7BA 5KZEA 4XZ9A 1F3EA 3WH7A 1UR2A 3NQBA 4XB3A 3LHYA 4MG4A 4D6DA 1BD0A 4PUMA 5EA9A 3NM3A 1XYCA 4S3CA 1F2JA 3FYPA 1XBZA 1BYDA 3ZS4A 3WUGA 3SR7A 1OG0A 2QV5A 3PZQA 4O1FA 1OFOA 3W26A 4YWIA 4EXBA 3G2GA 1AMKA 5LIXX 1AH3A 1CEOA 1GYLA 3LPFA 4MHBA 1QPNA 3RILA 2WMIA 3WUEA 3GNRA 1H7NA 4AX7A 3T40A 3W7JA 2BODX 2HNEA 2GUYA 3GNXA 4RW5A 5BMWA 1H63A 1XYMA 3KRBA 4GX8A 4MJMA 3T8LA 3H4WA 1QWGA 1BVZA 3ZR4A 3BE7A 1PB0A 3THCA 1TV7A 3NQ7A 1BG4A 4QG6A 1EWDA 2E9MA 4TO8A 1NJJA 2PDPA 3H26A 3NQVA 2J9XA 4CD7A 2LLEA 3SCPA 4JS3A 3EWWA 2CZVA 3TKFA 3ARPA 1IR1A 1SO4A 4CNOA 1YKWA 4W5UA 3NQ2A 3QXBA 4KFNA 2O92A 3BSGA 1X1ZA 3SCQA 4DF1A 3LZ3A 2EPKX 4NNAA 3SY8A 1Q7QA 2EG8A 5C54A 1DXIA 3MU7A 3GXPA 2YB1A 1TV8A 1U83A 4OUIA 3MUAA 3N15A 3R8RA 3B0VC 3SRDA 4WUIA 1VC4A 1AK5A 1V3HA 1M5WA 1L6SA 3KCJA 3WQ5A 4XKYA 1JCNA 2AQOA 2I1OA 3C0QA 3N11A 4PYSA 4JTUA 1OX6A 5HJLA 4D6EA 3FNDA 4CD5A 2ZC1A 1E6QM 2HVNA 3M0IA 2G3NA 1VFOA 4F0LA 1IWBA 1E6NA 2J47A 3ANVA 4V2XA 3GD6A 3LD5A 4KRZA 3CZKA 3V0UA 3Q65A 1Q8AA 3MYPA 4Z42C 1E0WA 3IVTA 3BMVA 3MMWA 4H3DA 4ZOAA 1O66A 4GNVA 3M16A 2OZ3A 1TWWA 1E5JA 4YVVA 4TQTA 3QC3A 3SEPA 1GW1A 3LXBA 3AIVA 3M0ZA 1X6LA 5HNNA 3VOCA 4KF1A 3UXIA 4FLRA 3WQGA 4JTQA 3L65A 2OO0A 3TTEA 1TKKA 4F8XA 3BMWA 3V16A 4XG1A 1YEYA 1EJTC 1KR1A 4QCFA 1FP9A 2Y24A 2E4TA 5LNRA 3SADA 2NWSA 3G8RA 3E2QA 4JNMA 2BGQA 1FCVA 1G0CA 4GXPA 1Q6RA 3APGA 1W0MA 3NA8A 1UR9A 4PA8A 4OVXA 2OYLA 3TOPA 4O1CA 4O0KA 5LXEA 2VCBA 3DC0A 1O95A 2INEA 3THDA 4GUHA 2W79A 5JH2A 4MSSA 2WVTA 3BG3A 1ZENA 1L9WA 3PG9A 2H3DA 2OYKA 4AIEA 4PTXA 2D1ZA 2ZZ6A 1FHUA 2CXGA 4IJRA 2OU4A 3SCVA 2GVYA 1C29A 3UYCA 4QEEA 4IP4A 1YDYA 3S5NA 1ZSXA 1VBGA 3NZGA 3WF1A 4YMZA 2GYIA 3MMDA 3APYA 3VDBA 4PMQA 1GT8A 1EJUC 1JYXA 1GVOA 4U33A 4ASTA 1EH9A 2YCEA 1QOXA 5JBFA 5IDZA 5E93A 3VIIA 1Q5MA 2A7RA 1K70A 3HTWA 3TC3A 4IMFA 4BFAA 3B8VA 3TZNA 1XH2A 1CGWA 5D30A 2CFFA 5ABFA 2Y0FA 2A7NA 3W86A 4BF9A 3MP4A 5CZSA 4PN2A 4ZE4A 3U48A 5BW6A 4UZSA 3VOGA 4YNGA 1Q45A 1TX0A 3WELA 5DFAA 8CGTA 1GOXA 1ISXA 3RCMA 4MZYA 1Q6CA 1W3IA 1LL6A 2PGWA 2QMKA 1MFUA 2EPNA 1C91A 2C3ZA 3LDVA 4QFUA 1FHLA 3K5XA 3UCDA 4N9BA 6ENLA 1MW1A 4K6AA 4LCSA 4DLFA 2F8QA 1Y8BA 3VNJA 3EXSA 2QNEA 3BVJA 3KBNA 2BGNE 1M01A 4M5PA 4H01A 1JPHA 2DZTA 2J7HA 4UMCA 5IFTA 2JIEA 1I75A 3VU2A 1JDAA 4QJ5B 4QGCA 1A3XA 2NX9A 5IBXA 9XIMA 4JTHA 2FTYA 1OCNA 3TW6A 1M1BA 3PZGA 1BYAA 1FA2A 1PTGA 2VC9A 2R1KA 5E6YA 1A5UA 2ZRUA 2QVNA 1S5TA 2WCAA 3N2TA 3AS3A 4A3UA 4KETA 1W56A 2FMOA 2QAPA 1SR0A 3AHVA 1GG0A 1EX1A 1K1DA 4F0KA 2NQHA 4MY8A 1V7YA 2GSJA 1ZHAA 3HPAA 1EEXA 3C6CA 2J77A 1VQTA 3O63A 4C5YA 2DDXA 4L6OA 2VC7A 3N2CA 2DIKA 2BBFA 3P80A 3RLUA 4YHGA 4F0RA 4LYRA 1TV3A 3O9NA 3GLCA 1O4UA 4FF5A 3RF9A 2O7QA 4RZ6A 3B9NA 4GH1A 1UP3A 4GA8A 1PDZA 4BY3A 2ZWYA 2E77A 1E56A 1XYAA 1EZ2A 2RGMA 3SUWA 3PB0A 3UJEA 4C6PA 5KSWA 1RVGA 1JDDA 1HX0A 2QMJA 1UD6A 1KV5A 4I5RA 2DSZA 1NY1A 3FXGA 1J12A 1TE6A 3JS3A 3GUGA 4ZQOA 1HTIA 4DZHA 1DTNA 2HSAA 4AFYA 3GHUA 1W91A 1YBQB 3G0XA 4ZB2A 1TTQA 1MNSA 2P8CA 3O7UA 3UW6A 2FH6A 1KM6A 3L4UA 1GQLA 3FYYA 3M41A 3THUA 3E12A 3CBWA 3BW4A 2IXUA 4LBUA 5C9UA 3MHFA 2DT1A 5D2XA 1HKIA 2EXOA 2OCZA 4M6VA 4P8WA 2D0FA 2WNQA 3CH9A 1PTAA 2WHLA 1OM0A 3N14A 4AHPA 4HVXA 3NIYA 4L61A 3A21A 4GQGA 3SECA 1Q65A 3N2XA 3VNYA 4W88A 2GJRA 4JZ5A 1Z44A 2XFWA 3KRUA 3CWNA 3OZMA 3WUFA 1RQEA 2FZDA 5LNSA 2ONEA 3V5FA 1WE5A 2GK1B 4LRTA 4GY7A 1HJSA 4A22A 4A4AA 1P6BA 1B4EA 4DM2A 4MZ8A 4YU1A 2BVWA 1Z9AA 3MMUA 2DSVA 1ICSA 4EWJA 1VHNA 1YXDA 2VFGA 4XD4A 4E2DA 3BAJA 4LT9A 3RG6A 2XIMA 3W7GA 2HVOA 4RNIA 3JRKA 4J35A 4R33A 3S83A 3VIPA 1XPYA 1DWAM 3U9IA 1KLYA 3EOUA 1EHAA 3SDOA 3WQEA 1EDQA 1OIMA 2F38A 3ENLA 2PDNA 4RE0A 1IZCA 4Q32A 1JQVA 3ECQA 5M03A 4Y90A 3HFTA 5JBEA 1REQB 3NZ1A 1VRDA 3IUIA 4LVBA 5LGXA 3FHAA 4GIYA 1AL7A 1WV2A 2EBNA 1QHPA 5HMEA 1ITQA 3BH4A 1SYTA 4PB4A 1JDEA 4QDWA 3SUSA 3OGRA 3NG3A 5ECUA 5DCDA 4G7FA 3VE9A 4A29A 4QSFA 4CEXC 1TPDA 2YZRA 5BOOA 1PKNA 4JYDA 2WQDA 1HQTA 3S2MA 4CCEA 1IHIA 5E1QA 4EF8A 2EJAA 1VLIA 3HB9A 5CC5A 2XZ9A 4NASA 4OTKA 3WJXA 2VVNA 4DRSA 3NQAA 6TIMA 2HPMA 1LBMA 4DBSA 1UWAA 2VL4A 3GC4A 3CASA 4MPQA 3ITVA 1AW2A 3MVIA 3TUUA 3A4AA 1L2UA 4L6DA 3E2RA 2GPTA 5J04A 2ZZ5A 3FDGA 3WLTA 1FH7A 3AHTA 4BHYA 1T99A 2OLAA 2Q09A 3G8EA 5F1VA 2XH4A 4AXKA 4M51A 1U22A 1W1A1 2DSUA 4N7QA 3PJXA 3TC6A 4HPNA 5A3HA 2YXXA 3LBCA 4NIRA 3NCOA 5BYWA 2OPJA 4GH3A 4V33A 5CPOA 4P7QA 4BI6A 4JHZA 2BLEA 4O0QA 1H49A 5CBIA 1AZ2A 1MYRA 1F07A 3O06A 1WKFA 4HHMA 4HU8A 3N4EA 2GVGA 3R8GA 4LWWA 1YTDA 3W27A 1H50A 3B9AA 1E0XA 3OZPA 4UR7A 1JRBA 5L6UA 3P14A 4ZSUA 3CL8A 4KEVA 4HPXA 4ZQMA 5DXXA 2OB3A 3FGCB 1JUKA 2BOEX 3WNNA 1KFEA 1HVXA 3IPWA 3GBDA 4PBGA 3V35A 1BXCA 3B8IA 5D09A 2ZX5A 1NP0A 3AZSA 2YBTA 4IISA 3A6OA 2DZBA 2FJKA 5CJNA 3R11A 5C71A 1RZMA 3URNA 2XG9A 4HZ6A 1QASA 3MMTA 1W1VA 4N2YA 1TJPA 2VMFA 1YTEA 4US5D 1PPIA 1RP9A 4IJCA 3WLRA 1XKYA 2PF8A 4GD0A 3IJ8A 4PTDA 3TYUA 2KX9A 3E38A 3AMLA 2WNWA 1R5YA 4GINA 4KH2A 3CAQA 3GFYA 1KGXA 4P5UA 4YL2A 4J3TA 4H83A 1ZAIA 4J3VA 4PUDA 4L4OA 2VGBA 5KETA 3CZJA 5IFPA 3GR4A 5DY2A 3ATZA 4NZ5A 3OG3A 4QIUA 3B8WA 3VX0A 4TOQA 4D8AA 1VZWA 1KM1A 1JULA 3QPZA 1JZ6A 3QPEA 4O18A 4UFIA 1A5MC 4FX7A 3AROA 4OBTA 3EDKA 1F5ZA 4W87A 4QE4A 3W76A 2H3BA 4UB9A 1DIDA 2BXVA 1XLIA 4QEHA 3QSRA 2ZE0A 3ORWA 1TCDA 4DJDA 1EJVC 1OT2A 1MXDA 5JVLA 2FHCA 3WENA 1NM9A 1I0DA 2ZCGA 3O1NA 4AZGA 4Z1AA 2FPVA 3IGSA 3GE7A 5IDIA 4EAMA 3HA1A 2B7OA 3LI0A 4WKHA 3C2EA 3OA5A 4EXQA 4FK9A 3HURA 4UNIA 4PSPA 1TQXA 3L7RA 4MWAD 1OY0A 1UWTA 3PK7A 4MDPA 3DHFA 3CUZA 5G1MA 1ONRA 4FIRA 5K3VA 1BLIA 4MPKA 3KTCA 1V0LA 1ZZMA 4PBEA 1UROA 2WVVA 4FR6A 2BVDA 4Z2GA 2CCRA 4UTTC 1UR8A 1RA0A 3W2KA 1OZQA 5DBUA 3EMCA 3WD0A 1E6RA 4LJ3A 3GIQA 3I3BA 4H9ZA 5KZDA 1H7PA 3ARUA 3SRHA 1ECQA 2PC4A 3IGUA 3CO4A 4O10A 4E8GA 1LOSA 4GX9A 2EPLX 1UC4A 1W54A 3OIHA 3E02A 3IV3A 3B03A 3UZZA 6PTDA 3QVQA 1E55A 4E3VA 5ENLA 4W85A 1N55A 1TWDA 4Z0SA 2DSKA 1GQNA 3K30A 5BU9A 1W8GA 2E6FA 2GUUA 2TAAA 5DBTA 2NQ5A 4HD5A 5CZJA 3B9EA 5LIKX 1FWDC 3ANUA 2OG9A 1L8NA 1IEQA 1C90A 5RUBA 1I6NA 5DN1A 4XAFA 3I68A 2PAJA 3L23A 5HXMA 4GHRA 2YCIX 1OCBA 5CAHA 1BXNA 3EX2A 5CG7A 2P0IA 1LRNA 3W2LA 4I7UA 3G1FA 3AHXA 2JKPA 1ZJIA 1UKSA 3RM9A 1ONXA 4GUJA 3STEA 3R8HA 2ISFA 3KOZA 2ZDRA 3WSUA 3LCLA 3O15A 1JGMA 3HG3A 3T81A 3TMQA 3DERA 2B81A 3W0KA 1G4SA 4QM1A 1JD9A 4JY9A 4Q8MA 1Z32X 5ABEA 1MEHA 3H54A 4M19A 3SCNA 3W6YA 2GWNA 2WCSA 1XRSA 1OK4A 2XIOA 1XUZA 1XP3A 2YL5A 4GI9A 4PMXA 4HOWA 1GPFA 4CQCA 1DV7A 2R82A 3WBAA 3JR2A 2V69A 2IQ0A 3IJ6A 4GKLA 3DIPA 3OTRA 4C7FA 3EA3A 5I2UA 4NJKA 4NI3A 3LNPA 2Y7DA 5D03A 1WX0A 3LI1A 4RNJA 2NT1A 4ATWA 2H8XA 2DT0A 2PB1A 3TR2A 3V1HA 2DZVA 1VEMA 2ZUVA 5E0CA 1R3SA 4B3KA 1V02A 5DELA 4TV5A 1ZQ5A 4IIBA 4WXZA 1ONEA 4NILA 4OOUA 2ACRA 3SFKA 1O7AA 2YCJA 1US3A 5CPMA 4JOMA 3CTTA 1B9ZA 5FSDC 1FWRA 1TMQA 1ZP4A 3DI0A 2CBUA 3KZPA 1TSIA 3PM6A 2IKIA 4Q33A 4RR4A 3M5VA 4IG2B 1I4NA 2EF9A 2J6XA 3GDKA 5T9BG 1DWJM 4ATLA 5LIYX 1XIJA 3VVGA 3OB8A 4H8NA 3VIJA 3HZ3A 2J7BA 1PEZA 3GG8A 2VEKA 3SGUA 1GYNA 4KEUA 4W84A 1I9CB 3W28A 1I8JA 3TFXA 4IZGA 3QFEA 5LNVA 1P0KA 3EAUA 2G37A 1OYBA 1WDQA 1GJUA 1R2TA 4LAKA 1Z48A 3W6LA 3H6OA 4LALA 1G5AA 3VCRA 1AVAA 4PTNA 2OZ0A 2G95A 2V81A 2ZWZA 5AYZA 5T91A 4NX0A 2WMIB 3W1LA 3WQCA 2WMFA 3LOTA 3VDAA 5B80A 4K7YA 3M64A 2WMGA 4FOUA 2CITA 2X40A 4A3YA 4DZ5A 2GWGA 2E5CA 1XDMA 1OZMA 3OGVA 1LRTA 3WNKA 2XVGA 3PJTA 3LK6A 4PR4A 1H5VA 4A3QA 3MZ2A 2O0TA 3XIMA 1CECA 1OYCA 4YTUA 3W1AA 4XUGA 1EP1A 3EWZA 1XIIA 2VR4A 7XIMA 2VEFA 4Q8PA 3FSTA 2G97A 1JPKA 3OLIA 4JEJA 3PANA 5T8GA 4LVAA 5CJMA 3PNZA 1JZ8A 1GKQA 4GJJA 3PFMA 2V2DA 4ICCX 4A8LA 4HBKA 4XZNX 5C55A 3EBVA 4ICNA 2FVLA 2PFHA 1C9DA 3QKZA 1UBPC 5FJOA 4XKYB 2V38A 1LOLA 3RU8X 5FI8A 2QVHA 4AW7A 4KMQA 3LYEA 3VIKA 2D2HA 3ARVA 3KEHA 3RR1A 5C2GA 4JAWA 1PZ1A 4MKVA 1TELA 3W4RA 2XGIA 1AQMA 4ILSA 3C2YA 3NWRA 2ASHA 2VC6A 2PBGA 4LUSA 4PMJA 4RXGA 2RJGA 4CQ8A 2YJQA 5AYYA 2XN1A 1LG1A 3KBSA 3RPTA 4OV9A 2HCVA 3OYXA 4CCDA 4FP1A 1TWZA 3PFRA 4GMEA 1EBHA 4UQAA 4LQ1A 3BSMA 1EGVA 1K6AA 4OKDA 1U5VA 1TVNA 1NSJA 3DFTA 2XZ7A 3DFOA 4RXFA 3RITA 2Y61A 1UH2A 1S3TC 4IXHA 3VI2A 1GHSA 3V5CA 5H1WA 5CPTA 4V1XA 5EY5A 3RLVA 2V68A 3S9IA 4IIDA 1LCOA 3W2NA 4PCTA 1CGTA 2C71A 1MQRA 2VGFA 2JIWA 2W62A 1P1XA 4FLSA 1J8VA 3ABZA 1XH1A 4WEVX 3A5VA 2GDVA 2R94A 2QV4A 4W7VA 1JCXA 3DFNA