5SWUA

Dehydroquinate dehydratase from a. fumigatus arom
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
251
Chain Sequence
b'DSLGTIKKKQHSFFVSLTLPDVRGADQILEQACVGSDAVELRVDLLEDPDSSNGIPTVDFVADQISYLRSRITLPVIFTIRTKGQGGRFPDDAHAEAMQLYRLAVRSGCEFVDLEIAFPDEMLRAVTEMKGYSKIIASHHDPNGELSWANMSWMKYYNRALEYGDVIKLVGVARNLDDNTALRKFKNWAEEAHDVPLIAINMGGNGQLSRILNGFMTPVSHPALPFRAAPGQLSATDIRKGLSLMGEIKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pentafunctional AROM polypeptide
publication title Dehydroquinate dehydratase from A. fumigatus AroM
rcsb
source organism Neosartorya fumigata (strain cea10 / cbs 144.89 / fgsc a1163)
molecule tags Hydrolase
total genus 85
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5swuA00
1W5QA 3P81A 3HG4A 4RV8A 4DPPA 2ZRUA 3I7QA 2ZZ3A 1KM2A 4FX7A 3LHZA 1KFLA 5FF3A 1VCFA 3G0XA 1GYNA 4M6PA 3IVTA 4O4VA 2H3BA 2Y62A 1I8JA 3UXAA 2A21A 3TDFA 3IVSA 2XFWA 3C61A 1MEIA 1H7WA 4FHAA 4O17A 2FDSA 1WOBA 3M43A 3TX9A 1DVJA 5D2YA 5C55A 1E51A 4GNJA 4O1CA 3PG8A 1OFBA 4UTTA 1VYPX 2B4GA 3TK7A 1H62A 3GAYA 4CLMA 3NQ7A 1TMHA 1FWNA 5AHEA 4JY8A 2O7QA 3CC1A 3W2LA 3O8AA 2E77A 3HG5A 3P60A 3L5MA 2BSLA 4KWVA 1ZAJA 1FWTA 3PSWA 2ZBTA 4TMCA 1YTKA 3MHGA 2WKJA 4JDYA 1YLVA 4JIPA 5D04C 4NUWA 5EYWA 1LBFA 1VCVA 3LV6A 1FCUA 2J9ZA 1AK5A 3STGA 1MXSA 2FB2A 2R94A 3TSMA 1JCMP 4N9BA 3KVKA 4EF8A 4PEKA 2VFEA 1ME9A 1RV8A 2EPHA 3I6RA 4M5PA 3GDMA 4J9JA 4ZZ9A 3EX6A 1KM6A 5I3JA 1SSGA 3S1UA 4CCCA 3TUUA 3MYPA 4NX0A 4LUJA 2RDUA 4S1FA 3G0SA 5AHLA 5T26A 3MO7A 1OFAA 3FEMA 5DELA 4IPJA 4MFEA 1XL9A 2NXHA 2V8ZA 2JBMA 2ABAA 2W79A 3NPXA 2DJLA 1WBHA 4O57A 4K36A 3UWVA 4FIRA 1W31A 1OFEA 3HOJA 2HMCA 1GPWA 2I14A 4R33A 3RNDA 4JD4A 1Z42A 3SY5A 3KOFA 4UTMA 3KVMA 2WJZA 3IRDA 5TBOA 4UMBA 2QEZA 3AO0A 1QCWA 4U4MA 4DF2A 3IEBA 3NQFA 2OX1A 2JKEA 2C13A 1VC4A 3HPSA 1ME7A 3NNTA 1DQXA 1NSJA 1LM1A 3LCLA 4PL1A 3LXBA 2PRMA 3P62A 5J5RA 4AMAA 2E6YA 2QJHA 1B9BA 5FF0A 1IXQA 4ORIA 5K4XA 1OFQA 3IIXA 2C16A 2CW6A 1BEUA 3B04A 3CTLA 2X1TA 1G6CA 1I2QA 3GX9A 3PUOA 5U4NA 4O1BA 2F7FA 2XN1A 4YL2A 4WZHA 4ADUA 1MEHA 4DPQA 1TYGA 3Q2DA 3FFSA 5K9XA 3UY8A 1F5ZA 2PE4A 3Q37A 3IIZA 2QKFA 4X22A 1O94A 3EB2A 1FDJA 1NFBA 4E2BA 5L6UA 3KRUA 3M9YA 4OE7A 2CFFA 4N6FA 3G1VA 3W07A 3CHVA 3TMLA 2Y89A 3M5XA 5E0KA 3M5YA 4UC5A 5LZLA 1LLZA 3C56A 2FB3A 3RLVA 1FY6A 1Z48A 1WYIA 4CQ8A 2NXGA 4RJEA 3ZFHA 4ADSA 1V5XA 1PIIA 3R2GA 4FNTA 3TKFA 4R7JA 3NA8A 4I7WA 1K8XA 4GE8A 4JX5A 1OG0A 4MVAA 4LVDA 3P84A 2NV2A 5I3IA 3P74A 4HSOA 2AAMA 1RQEA 3W7HA 4MLRA 5LNRA 2QJIA 1OF8A 3F4WA 4IQLA 4RXGA 3W2JA 4BI5A 4AH7A 1TQXA 4HIBA 2DZXA 3UWWA 3RFAA 3LCGA 2H90A 4A2SA 4JX4A 4TO8A 3GXTA 1H63A 2CLFA 1BTMA 1MEWA 4KFOA 2B7QA 2Z1BA 4IMDA 3PF3A 2G95A 3WJXA 4Y6GA 1OHLA 4Z08A 3CIWA 4UXDA 3VCRA 4KWWA 5EPDA 5D2WA 3BGGA 4O15A 5LNSA 2WO5A 3BG5A 4LV4A 4MFDA 5AYYA 3P61A 4YCPA 1QO5A 2X2GA 4JTHA 1GT8A 2X16A 4DXVA 4FX6M 3GK0A 3PS7A 1FWRA 3EXTA 2QUTA 3INPA 4MJZA 2BZNA 1L6WA 4LS0A 3KVJA 2OT0A 5TQLA 3EX1A 1OYAA 4WQ6A 1U83A 2HTMA 3W9ZA 5HUPA 3DAQA 3BLEA 4UFMA 2YZRA 4FNSA 4QIUA 4OGZA 1ADOA 4LWWA 2CLOA 4G1KA 1THFD 4ONVA 1X1ZA 5J5DA 1I4NA 1ME8A 1GOXA 5LHFA 4JTSA 3WJWA 4N9EA 1SO6A 3W22A 1N7KA 1FUYA 4UNKA 3JRKA 3ZS4A 4GWEA 1N55A 3R12A 2GVLA 3G22A 4AEOA 2FTPA 3T40A 1XI3A 4M6QA 3GLCA 3FKRA 3U8GA 6TIMA 3MMTA 3GNDA 2YXGA 1BWKA 1LRNA 3EKLA 5CPOA 1S5WA 4HNNA 1QOQA 4UUIA 4UNLA 4O11A 1P0KA 2J88A 4HN4A 3PM6A 2QAFA 4HSNA 8TIMA 1H7OA 3G3DA 1KV5A 3G8RA 3N73A 1LDCA 1KM1A 2A2IA 4XBSA 2ISSA 1Z41A 3CU2A 3BW4A 2VFGA 3IGXA 2C0AA 4AAJA 2BX7A 4Z1DA 3TC6A 5HJLA 3W75A 2G96A 5AOUA 5F2GA 3KHJA 3T78A 1H7PA 4WUIA 1K7EA 1SO3A 1TB3A 3UYCA 1G4TA 3NQ2A 3JS3A 1EWEA 4A29A 2NUYA 5CGQA 1EIXA 1S5TA 3THQA 2HS6A 5FF2A 1S3HA 3ATZA 3QPZA 4AB4A 4CNNA 3DKLA 2VFIA 4K37A 2ALDA 2ZDRA 4FB7A 5IM51 1LTDA 1QDSA 1W3TA 3A9IA 4LU0A 4GUIA 3LRMA 2VOMA 4FNRA 4YXGA 2NWRA 3WFAA 1WX0A 4MIMA 5D03A 4JS3A 2NUWA 3P82A 3TJXA 4XZ9A 3KXQA 1DL3A 3EWZA 4Y96A 3BVJA 2DZSA 3G24A 1ICPA 2BXVA 1YXYA 3TR2A 3DFPA 5HULA 2CLLA 2EGZA 4O52A 3EWYA 1W3NA 1N8FA 1SW3A 1CI1A 5BW6A 1WDWA 3M41A 1KW1A 3L68A 1Q6RA 1IIHA 1VZWA 3OVPA 1H51A 1FXQA 3PB0A 5DN1A 3O05A 1KFJA 2Y85A 1EX5A 3FJ6A 4MYXA 3PSVA 4X9SA 4OWGA 4O54A 4BFAA 1QR7A 1OJXA 3HQ1A 1RR2A 5F1UA 2JGQA 1W56A 4HNTA 3DHFA 1XUZA 2QUUA 1J5TA 1MO0A 1X1OA 1HFBA 1L6YA 1K3UA 5LNUA 4AXKA 2OJPA 3C3NA 5G2HA 1KBJA 2DZUA 1K7XA 4O53A 1JQXA 1JCXA 4FNUA 2Q8LA 1XDMA 4MPQA 5DY3A 2ZZ6A 3BPWA 3DFNA 1ALDA 5I3KA 3G1HA 2V30A 4ZQPA 4JGDA 4ALDA 5KSWA 2JKPA 3K30A 2QCDB 3C6CA 3TQKA 1I2NA 1YPIA 1KFKA 4JX6A 5CSRA 2A6LA 3R89A 3GB6A 4JTEA 3SR7A 1EA0A 3PBUA 1FDZA 2GQ8A 3OBKA 2TYSA 3IIVA 2NWSA 4IUOA 5EMUA 3PB2A 3NQEA 3RF9A 4IXXA 4NX5A 3QPYA 3NL3A 1SPQA 1YTEA 4M7SA 4NJKA 1WV2A 3GVGA 4GUHA 4CQ9A 5I3GA 1WQ5A 3QZEA 4K39A 1VCGA 3MP3A 5CZ0A 3W2UA 4P2VA 2J9YA 3HGOA 1SO4A 5G1YA 3GNNA 2ZTKA 4DO4A 1R47A 1YDVA 3DGRA 1GVSA 4ZQCA 3QMTA 5D33A 2V2HA 4FNQA 3VFLA 3W7GA 1PCKA 4AF0B 1FXPA 3S5NA 1O5KA 2CLIA 2OT1A 2B7PA 2Z6JA 5LNVA 3W1TA 3DFQA 1QPOA 1G7VA 2W6RA 1ZJIA 4NNAA 4IX2A 1ZY9A 4Y90A 2ABBA 2E5CA 2NXIA 5KZEA 1LLWA 1MZHA 1TV5A 3DZ1A 3PWAA 5AC8A 1P1XA 4MY1A 4UTHA 3FYPA 5AC7A 3UPBA 1GYLA 4E0CA 1KM0A 1IXPA 3LTSA 5D09A 3LXAA 3T55A 3M16A 4OQVA 2CLKA 3A21A 2A0NA 4N6EA 2ZCGA 3NZ1A 2DZTA 5C2XA 3M47A 4O8RA 4A3UA 2ZQ0A 1JUBA 1SW0A 4UFJA 1R30A 4LOCA 2C15A 5ABTA 3TXZA 3BW3A 4HKPA 4FO4A 3BK0A 2UV8G 4LVBA 5A8GA 2E6FA 1W5MA 5BOOA 3G1YA 3MI3A 2R14A 3PBVA 3W7DA 3HG3A 4LVAA 3DI1A 5K4ZA 3SIZA 4NNBA 3L0NA 2WV8A 4WY0F 4N2YA 5G1TA 6ALDA 3NDOA 4OU1A 4NZJA 1KFCA 4GJ1A 2AQWA 3KAOA 4BR1A 2QCGA 2GQ9A 5HQEA 5FEPA 2GVGA 3H53A 4N9CA 2Z6IA 4AWUA 3W71A 3W7LA 4LTSA 3B06A 2QR6A 3B0VC 3SZ8A 2NLIA 1J4EA 2CZDA 3S1VA 3LCIA 3O16A 1W0MA 2NZLA 3NVTA 1HO4A 3M6YA 4QNWA 3LXCA 3PR2A 2V5BA 5CPLA 4P61A 3WK0A 1HTIA 2ZRYA 1WAUA 3EX4A 4AWSA 1NF7A 1SZFA 3B4UA 1HO1A 1O5XA 2V5LA 1D3GA 3CT7A 1NVMA 1OFDA 3W1XA 3SGZA 2DP3A 3DH7A 4QNEA 3EKZA 3OA3A 1EUAA 3GYEA 3NQ8A 3W2MA 1KFEA 4Y8FA 4CNPA 5D38A 2C6QA 2RH9A 1Q3NA 1OX5A 1M6JA 4Q4KA 3ABSA 3L65A 5K9DA 1TTIA 1YDOA 3R8RA 4UTIA 3HB9A 1SQ7A 4IWWA 4NZFA 4ZQNA 3Q94A 3CEUA 4PL2A 5DCBA 2ZZ5A 1TPFA 3LBCA 3NL5A 7TIMA 3RU6A 3TAOA 1AW2A 4CCEA 1JCJA 4DO5A 3W7RA 1TO3A 4IXHA 3SSJA 3I65A 2FJKA 3N19B 2EF9A 1GVRA 3BW2A 3FYOA 1R46A 2E5BA 1W5OA 4MZ1A 4TX9A 1T0OA 1LCOA 3GR7A 3QMSA 3LTPA 3WK3A 4UR8A 2ZA2A 4UTUA 4O14A 2ZRWA 4NNCA 1FWSA 3G18A 3TQVA 1UJPA 3CIXA 1UCWA 2TPSA 4GC4A 4PA8A 3W7IA 3W88A 3O15A 1GQNA 2YCEA 1L9WA 5KTLA 2RKXA 2ZA1A 1ZHAA 5HINA 1OX4B 3T44A 1A5CA 2VFDA 3BV4A 3STEA 1OABA 1TTJA 3M5VA 1R2TA 1OFOA 3C4UA 3RMJA 3O06A 3N2XA 2CWNA 3DI0A 4TU1A 5C54A 4ZL1A 3JR2A 3GKFA 1TPEA 2QDGA 4HNUA 4FX8A 3RLUA 3HMJG 5AHMA 4UFIA 2QUVA 3G1FA 3IV3A 4HPJA 3TROA 5U7SA 1XBYA 3THAA 4MKNA 2TSYA 3N9SA 1Q45A 1F7BA 1DV7A 2ZFAA 4ZQOA 3SI9A 2ZZ7A 1XM3A 1QWGA 5AHFA 3B8DA 4FNPA 5H2ZA 4O19A 5LGXA 2QF7A 4UTLA 2V2CA 3L2IA 1GVFA 5HWJA 5FF4A 1A5BA 1WOAA 4LNYA 2Y63A 1DQWA 1LOSA 3DHDA 3S5YA 2QDHA 1OYCA 1YXCA 4Z0SA 2FPTA 1XBXA 1XUUA 4Z1CA 4MYAA 3H54A 3NXFA 2A85A 1VR6A 1ONRA 4Z0JA 2OZ0A 3SECA 1AG1O 3V75A 3UWZA 3S5ZA 4WD0A 4MOZA 3L21A 4IGHA 2E1DA 4O16A 3IGUA 2Q8ZA 1BKSA 1Y0EA 4LS2A 2HS8A 5LSMA 3MBFA 5CPMA 3WK2A 3I7SA 4A21A 4BWLC 3GDLA 3KX6A 1IGSA 1QPNA 1SU5A 1B3OA 2PRHA 1L2UA 1O60A 5AHNA 3WK1A 2Y7FA 2YPIA 2RFGA 2ZZ4A 4K8EA 3W7MA 3P8IA 4H3DA 3LLFA 3HBLA 4DO6A 2CZEA 2I9EA 4WXZA 4R53A 2DZPA 3S1WA 3TNOA 3V1PA 2NX9A 1ML1A 1UASA 3TXVA 3E12A 3NQCA 4LUIA 1AL8A 4JTIA 1K8ZA 4LRTA 3LCFA 1FDYA 3FOKA 4EVZA 4ICNA 1VRDA 3R5EA 3BLIA 1KM4A 2XN2A 3M44A 2KZHA 3NM3A 2NX3A 5MHBA 4M19A 3W2KA 1GG0A 1KTCA 4Q32A 2A7PA 1SW7A 2X1SA 3ANYA 4FXSA 1SFJA 1YTDA 4S2BA 3BG3A 4UFHA 3W86A 1I2PA 2WNZA 1JRBA 1R2RA 4E2DA 3NQGA 3O6CA 2R91A 3DKJA 3MI6A 2WNNA 1GEQA 1G69A 1Q6OA 1FCQA 1Q6QA 1VH7A 3PAJA 5DCEA 5DXXA 3ABOA 5IBXC 3NAVA 2EHHA 1QFEA 2Q3RA 4AHPA 3LDVA 4QM1A 3T4CA 2V0TA 1G4SA 3HG2A 3WJZA 3GDRA 1A53A 4KKXA 3EXRA 4XUGA 2YSWA 4O4WA 3W70A 5KINA 4WOZA 3UZJA 3G1DA 2QCEA 4RCXA 1B57A 3VE9A 3ABQA 1M5WA 1XCFA 2QJGA 1ZAHA 4DBDA 1KLZA 4JICA 1W8SA 2A7NA 1K8YA 5AYZA 3MJYA 5DY2A 2J9XA 5CZSA 4A2RA 2VENA 5F4SA 1TPWA 5HWNA 3A5FA 4NJHA 4JXCA 3ZWTA 3PUDA 3OG3A 1W5NA 3W87A 1KA9F 4HNVA 1HG3A 1IF2A 1O95A 4Y9AA 4JTJA 5FI8A 3DENA 4NT0A 3PULA 4ZVJA 4CNOA 1PHQA 5AB3A 3E02A 2QCNA 3F4NA 4LC6A 1LOQA 1A50A 3LRLA 3BG9A 4HHPA 1KM3A 1F76A 3PBYA 1FX6A 2D73A 3W1RA 5LKYA 3UWYA 3HGJA 3SJ3A 1H7NA 3LLDA 3PBWA 1VGAA 4O1DA 4KFNA 2A1YA 2J27A 3STCA 2G5WA 3LCHA 3OVRA 4BWLA 1HUVA 2C18A 3NR0A 1P4CA 2PRLA 3E49A 1UUOA 1X8FA 1IXOA 1XXXA 3S9YA 4QITA 3CPRA 5DCDA 2W0UA 4LY8A 1DORA 2YGYA 2RDTA 2DU2A 1IIGA 1FWWA 2P1FA 1XC4A 3QH2A 1TV8A 1GWJA 1G67A 4HT3A 2B7NA 2ZRXA 5CKSA 3UNDA 1C8VA 5LHEA 2IQTA 3W23A 1PE1A 4M7TA 2RHGA 1OFPA 3W1PA 2VFHA 3NEVA 4U28A 3MBDA 4XKYB 1FCVA 1OVDA 4JDBA 4FIQA 2VKZG 5AHIA 3VI2A 1YDNA 2E5DA 3FS2A 3TIMA 3M1ZA 4NJIA 1YXDA 1EUNA 5D2XA 3G1AA 2DZWA 4FF7A 4PC8A 2P10A 3HJZA 4I7VA 2ZZ2A 1FBAA 2QAPA 5LGZA 1WA3A 4D2JA 4ZMGA 3C2RA 5KZMA 1JUKA 4K7YA 3I68A 5I3HA 4OT7A 2E68A 3E0IA 3CB8A 3MP4A 1VYSX 3U6WA 5IBXA 2YW3A 3CWOX 3TQ0A 1F6KA 2JK2A 1F73A 3TV8A 1D9EA 1C9DA 2GOUA 2Y70A 4WJEA 3FA5A 1GVOA 2E09A 5KZDA 1VS1A 4OBTA 4NXKA 4LVGA 1UBSA 2YYTA 3W7PA 5CG7A 3UY7A 4YCOA 1RPXA 1W3IA 3W72A 5HR6A 4WY0A 3LI1A 4JNMA 5AFDA 2E6DA 1ICSA 3DFTA 4OHQA 3FIGA 3S42A 1SFLA 2O7SA 3B03A 1I2OA 2Y6ZA 2Z2UA 3TCEA 1KLYA 1EB3A 1W1ZA 2DZVA 3S5OA 3A22A 4RKAA 4C1LA 2DORA 3LM7A 2C1HA 1TTQA 3LERA 4JTLA 3LTYA 3P5YA 4GUFA 4RK8A 1PL9A 2ATMA 1FQ0A 2Y61A 4UMAA 4BF9A 1LP6A 5F2LA 5HMSA 4JYEA 2GVJA 4EF9A 5FEXA 3TW6A 1OK6A 3M7WA 1H5YA 5C5YA 4MZ8A 5CPNA 3KFTA 3LHYA 2YDAA 1VHNA 5EKYA 2TMDA 2ZRVA 1JULA 1PVNA 4PH6A 3PY2A 3G1XA 4TMBA 4UR7A 3W1UA 2H3DA 1WBJA 3S0CA 3IGSA 4JYFA 3SW6A 1S5VA 3HPZA 3M5ZA 5AN7A 1TSIA 5EL1A 3W83A 1J2WA 3QW3A 4PFMA 4X3ZA 2WSRA 5FESA 4AF0A 3VE7A 2YX0A 1LORA 1VQTA 1TREA 2RDWA 2VC6A 4DF1A 3LRKA 4MLJA 5FEWA 3BARA 3N9RA 1ICQA 2FPYA 2FFCA 1ZAIA 1VYRA 4DEFA 3W1MA 2BTMA 3TAKA 3LBMA 1JCLA 4LC8A 1H50A 2ISVA 5EY5A 4NVTA 4DELA 4WOQA 3G0UA 1TCDA 4RXFA 1EP1A 4GUGA 3FJLA 4QSHA 1B4KA 1RVGA 4LRSA 3TSBA 4EWND 1W37A 3WJYA 3W7NA 3LB0A 4LT9A 5F2IA 1JQVA 4JTFA 5L9FA 2BWGA 4JTUA 2WNQA 3L0GA 3MYOA 2OMAA 2WOQA 1YADA 3CLMA 3PVFA 1H7XA 3LCXA 1JR1A 4UIOA 2VEMA 1AW5A 3QQ1A 4BI6A 2WPBA 3NO5A 2ZTJA 1Z44A 4H6KA 4RR4A 1EEPA 5FF7A 5G5IA 4JIQA 4K8HA 5K9CA 1GTHA 2PURA 1T99A 3OHIA 3SGUA 2VEIA 1SZGA 1QPQA 5DXYA 2P0OA 3W1NA 2R8WA 1AMKA 2VELA 2VXNA 3L0KA 2FLIA 3EEGA 2OCZA 3QW4B 5D32A 3MHUA 5H91A 3NQAA 1A5AA 3TJLA 1TPB1 5A5WA 5F2MA 4OV9A 5BRBA 3NPUA 2DJXA 3EX3A 3TC7A 1TIMA 4RX0A 3QRHA 2JGYA 3EWWA 4FXRA 4UTWA 3W7JA 3TH6A 3G1SA 2Y88A 3A5VA 3H55A 3O63A 1F74A 4UFKA 5LNWA 4UCGA 3IVUA 3F03K 5EA9A 1SSDA 3O6YX 1QPRA 1ZENA 1F6PA 4JN6A 3W2NA 1X7FA 3Q58A 4ML9A 1VLWA 1T8XA 4KFPA 3W7CA 2EKCA 4AWTA 2H8XA 4LS1A 1DHPA 4JY9A 3T7VA 1GZGA 3QEZA 2Y7GA 4ADTA 1JUEA 1LRQA 2ZYFA 2GPTA 3P5ZA 3NQDA 1TTPA 3QJAA 3LHTA 2QCHA 2WSYA 2NX1A 4XTIA 1VPXA 1BWLA 4UFLA 4NU7A 1IXNA 3TA6A 1UB3A 2V2DA 2V82A 3L66A 2GUUA 4LW7A 1OK4A 3ZWSA 1F2JA 2A5HA 1TPUA 1TRIA 4L4MA 3W85A 5FEZA 3MI2A 4NJJA 4JR5A 4LV9A 3DXIA 4I9AA 3ATYA 2X1UA 4I7UA 2ATSA 2E6AA 4W9TA 4O0KA 2HSAA 1EPXA 1LOLA 3O1NA 1KV8A 2EAWA 1QOPA 3E96A 4QAIA 1M7OA 3QMRA 3C2OA 2B0MA 5D02A 4QQ3A 3PG9A 1SZNA 1XFBA 5BMWA 1EWDA 3P8JA 1X6UA 5HWMA 3NQMA 2YFOA 3NM1A 1TRDA 3TW7A 3C8FA 5G2IA 5C6MA 1XKYA 1GVQA 3UD6A 3O6DA 1MSSA 3HGSA 3QQ0A 2NV1A 3IIOA 4MJMA 5CZTA 2V9DA 5AYXA 1H7RA 1ZNNA 3QF0A 4UTKA 1SZEA 1QNVA 4PCFA 4S2CA 4E38A 4JYDA 1OX4A 3VNDA 1DOSA 5EBUA 2YW4A 5SWUA 3QC3A 3O07A 1TQJA 4YWIA 1DBTA 1Q6LA 3YPIA 2QCFA 1K02A 3D0CA 4XQ6A 5G4WA 1LYXA 2CZ5A 4YMZA 3GDTA 4N9DA 1TPH1 3LI0A 1XBZA 1PS9A 3GZ3A 1TJPA 4O12A 4DF0A 3UZ5A 3KRZA 4LVFA 2ISWA 3PC0A 1I45A 2BLEA 4CCDA 3STFA 5CZJA 2QCLA 5HNRA 2C19A 3C2EA 1B4EA 1ZCOA 5TIMA 3EXSA 5KMYA 3USBA 3NGJA 3C2VA 4IPIA 4TR9A 1FCBA 2Y7DA 4Z1BA 2QCCA 1O4UA 1RQBA 1A5SA 3MUXA 3A24A 1ZALA 2X1RA 3LHVA 4NQ1A 1EP3A 2YFNA 1RD5A 1JJKA 4NXSA 2X30A 3GIYA 3HPXA 3BO9A 3OIXA 1LBMA 4QISA 3ZR4A 3N34A 2C14A 3W84A 4EIVA 4MUZA 3PUEA 4MZYA 1NEYA 3TU9A 4L4LA 3W1QA 3L67A 4UTJA 5G2WA 4IMEA 1T96A 1I2RA 2FQIA 1GG1A 3B0UX 1C29A 3GR8A 1SR9A 3W1AA 1RZMA 3UWUA 2F84A 1PHWA 3ABRA 1H1ZA 3MW7A 3NZRA 2Q3OA 1UUMA 3EX2A 3W7EA 3B0PA 5AC6A 3DFSA 5F4WA 4GFSA 2FPVA 3NQVA 3LX9A 4XTDA 1DJQA 4O10A 5DBUA 3TE9A 1R2SA 3N2MA 4RLIA 3QM3A 2AGKA 3DU0A 2C3ZA 4MY8A 3DBPA 1RQHA 3KVLA 4O0ZA 5K3VA 2J24A 3W3OA 3W7QA 1XBVA 1H1YA 3KRSA 4POCA 4FEZA 1H60A 1CX9A 3A23A 4JEQA 3UQNA 4PODA 4IMFA 3LV5A 1CW2A 4IOTA 4X2RA 4C1KA 3OVQA 4DBEA 4RZ5A 1LZOA 4B5NA 2NUXA 3W6YA 3LCWA 3P67A 1OYBA 3NQ6A 3W1LA 1KFBA 2Y7EA 3TFCA 2A6NA 3W7KA 1VHCA 3TMQA 5CSSA 3S8HA 1JRCA 2GQAA 4QJ1A 1TV7A 2H8ZA 5BNKA 2J6XA 1DKWA 3L5AA 2WSQA 2V81A 4IX0A 5GVJA 1P0NA 1OF6A 3MHFA 2LLEA 1YPFA 4CQAA 3QYQA 3P7YA 3M0ZA 4O28A 1EP2A 3UWQA 3CEPA 3U2OA 3CM4A 3NL6A 3BLFA 2B7OA 4O18A 2YYUA 1GTEA 2TRSA 5K7JA 1G7UA 5HUOA 3GAKA 2VEPA 5DLCA 1GJPA 1OX6A 3I7RA 1K7FA 4AHQA 3N14A 4HPXA 4GRSA 1NF0A 2GJLA 4K6AA 3GKAA 2CLEA 3CQ0A 3QSRA 4XWUA 3LOTA 1KM5A 2CU0A 2GJNA 4JTGA 1JCYA 3NG3A 4M6VA 5BMXA 1H61A 2XN0A 1LBLA 2PCQA 3N3MA 1QMLA 3HIJA 3HGRA 3GXPA 2VEKA 3C52A 4RZ4A 4AVFA 3EWXA 5I3FA 2YR1A 4ZQRA 3CWNA 3E9AA 4UTTC 5G4EA 4WX2A 2I1OA 3HO8A 1NAL1 2JKAA 3NYZA 4O50A 4WY0B 3LHUA 1G4PA 2WQPA 4TIMA 1U5JA 3BGJA 4AHOA 3L5LA 3QSTA 4ZQMA 3UPWA 1K03A 1QAPA 3R13A 4UMCA 2G97A 3OEXA 3NL2A 3LGEA 3HF3A 2CLMA 2PC4A 2CLHA 4A22A 4Q33A 3ELFA 1PCWA 3MWAA 3TFXA 3FKKA 3G3MA 4NJGA 4JTKA 3C0JA 1TPDA 1TPC1 1F05A 2ZRZA 1VJIA 2FIQA 4Z1AA 4MY9A 3S1XA 3NPVA 5E93A 4UTWC 1PV8A 3W7OA 1TPVA 4H4IA 3GXNA 3EWUA 2A4AA 3SFKA 4N4PA 4O13A 1SUXA 3W74A 1LROA 3GDKA 5D2VA 4OV4A 4N4QA 3TSDA 4WXYA 3W76A 1ZFJA 4N02A 3L9CA 5D30A 4K38A 3VKJA 5DBTA 1AL7A 2A7RA 3C2FA 1D3HA 4JTTA 2ZA3A 4IMGA 4IJBA 4RZ6A 1WXJA 5D05A 2QCDA 5KITA 3EWBX 1JCNA 3W73A 4DQWA 5D37A 1OFRA 1XDLA 2QCMA 4GUJA 3NPWA 4XKYA 4O1AA 3FLUA 1JVNA 3QFEA 3WJSA 1M7PA 5HR7A 3AJXA 4BK9A 4PTNA 1QO2A 3P80A 3MP5A 1AW1A 1P5BA 3B05A 1HL2A 2Z0IA 1LRTA 3NOEA 4K7VA 4YLWA 1KTBA 1TJRA 4GBUA 1VLIA 1W5PA 1KTNA 4IMCA 1W54A 5D2TA 4GXMA 3G8EA 1SO5A 5F1VA 2CZFA 3RK8A 3F1QA 5F4XA 4XBKA 3LHWA 3IIPA 3DFOA 2H6RA 1KBIA 4R34A 4BI7A 1V7YA 2ZZ1A 3S6DA 1DJNA 5E1QA 5K2ZA 1L6SA 1G4EA 1YYAA 4ORMA 3UXDA 2VFFA 4EOUA
chains in the Genus database with same CATH superfamily
1HJUA 3HG4A 5C9RA 4RV8A 4YTTA 3GXFA 3KOZA 3N4EA 1QOXA 3CH9A 4PEEA 4M6PA 3FEQA 4O4VA 5DX7A 1XQKA 1XYMA 4Z2GA 4HYRA 3IVSA 3C61A 4C6JA 1MEIA 1H7WA 3KL3A 4O17A 1CXFA 5JMUA 4HU4A 3EDEA 4GABA 5JIWA 3RCNA 3U2EA 3GIQA 4AY8A 2EBNA 3LPFA 2DVXA 3GAYA 3GYCA 2VDIA 4CLMA 4Z2LA 3VAVA 1E40A 5AHEA 1E9LA 1EO7A 3PZNA 3CC1A 3W2LA 3WL1A 4ZEPA 2E77A 3HG5A 1Q6EA 3ZJ6A 2Q01A 1YDYA 2BSLA 5E09A 2W91A 3DOPA 3PSWA 3H7RA 2ZBTA 1YTKA 1UBPC 4XAGA 3EAUA 5D04C 1NWTA 1LBFA 2VO5A 1FCUA 3N25A 2VRJA 4Z17A 2XFRA 3STGA 4UQ9A 1XIDA 3SCQA 2PDXA 3KVKA 1A3HA 1BD0A 2VFEA 2R6OA 5XIMA 4IGNA 4ZZ9A 4J9JA 3WLHA 4LB3A 3KBMA 5I3JA 4MPKA 4MFEA 3CV7A 3OGSA 2ICSA 2OTDA 4L9ZA 2BODX 4HA3A 2HMCA 2I14A 1UP3A 4JD4A 3IRDA 3CL6A 1FTXA 3CAVA 5AZ0A 3R4IA 2EPMX 1ITXA 4JCMA 3SIMA 1J0KA 4DF2A 2V38A 4GQGA 3NQFA 4Z2JA 2HK0A 5CC6A 4D6CA 2C13A 2QDEA 1VC4A 3HPSA 3S46A 1DQXA 1WP6A 5J5RA 4AMAA 5K4XA 4ORIA 4GX8A 1OFQA 1BEUA 1D3CA 1RXOB 2J77A 3B04A 3CTLA 2X1TA 3MMUA 4KWOA 5U4NA 1OB0A 3VNYA 1JAEA 2A3LA 1L2QA 3LZ5A 3R8HA 1TYGA 2OQHA 3AIRA 3UY8A 4B90A 4X22A 3EB2A 1FDJA 1F3XA 2WHJA 5CJNA 4HZ8A 4H8NA 3W07A 2CLPA 1TVNA 3PBMA 3V1HA 4QEHA 1CEOA 1UR1A 1Q7ZA 1WYIA 1RP9A 4J3WA 3ZFHA 2VEFA 3SN1A 1PIIA 2FVKA 4KIRA 1PZ0A 1MW2A 3SCVA 3SURA 4CQBA 1OG0A 1JPKA 4QQUA 1VAHA 3WLNA 2NV2A 3P74A 2C91A 4NASA 1QK2A 4MLRA 4HHLA 1OF8A 3H2AA 3F4WA 4QJ4B 4GVIA 4XIAA 3WDRA 1E1CB 2DZXA 3LCGA 3WIJA 4JX4A 1A3WA 4GK8A 2G4FA 3BGAA 3DG3A 5DQPA 2CLFA 4KFOA 1XYFA 3PF3A 3ARSA 2XH7A 4NILA 4Q8TA 3WJXA 4TV5A 4UXDA 3G6MA 4ZTXA 5EPDA 4O15A 4LV4A 1WKYA 3FVDA 5AYYA 3H7VA 1M53A 4P7QA 1S2UA 1GT8A 3WFZA 4I90A 4XD4A 1FWRA 1WXYA 2QUTA 1R3WA 3GXMA 3LSCA 1EH9A 3FX4A 1W17A 3WBEA 2OT0A 1WKEA 1JG9A 2INEA 3QYSA 3AZTA 4IP7A 1R38A 2J8GA 2O9RA 3DAQA 3TTSA 2YA0A 3VMPA 4LWWA 4MDPA 1MZRA 1THFD 1EJTC 1ME8A 1SO6A 1N7KA 1FUYA 4UNKA 3JRKA 3ZS4A 3R12A 3SAZA 1BG4A 4AEOA 2FTPA 3T40A 1XI3A 4M6QA 3ZT6A 3FKRA 3U8GA 6TIMA 4ERGA 5CPOA 4HNNA 2VDGA 4DWSD 4O11A 3GM8A 3AMLA 3ITLA 4ENLA 2DUXA 2QAFA 5DMNA 1KM1A 2YBUA 4AQLA 3VKAA 2PMQA 5A6SA 2ISSA 1HKMA 5IFPA 2G4JA 3BW4A 1ZPTA 3VILA 1QI4A 2G96A 4DNHA 1F9CA 1H7PA 1W9BM 5EMLA 2FTYA 5AVHA 3UYCA 3JS3A 4A29A 2D2OA 1ODUA 3GVVA 4B5XA 1S5TA 1VP5A 5G1MA 3GZAA 3PAOA 4GX9A 3QPZA 2VFIA 2ZDRA 3BCJA 1LTDA 1OCBA 1VF8A 1Z9AA 4LU0A 4HOWA 3VOIA 2Z25A 4FNRA 4YXGA 1F4AA 4D9PA 1WX0A 4MIMA 5D03A 1VENA 1JDAA 4JS3A 5LXXA 4PMRA 1V0LA 1DE6A 1O5QA 2J62A 5FJUA 4LCRA 1BXBA 3BAYA 3EWZA 2BNJA 1IR2A 1YXYA 5HULA 3CZ8A 1CGUA 4O52A 2ZUNA 3EWYA 1T6MA 1JXKA 2OEKA 3L68A 1ITQA 1Q6RA 3V35A 3PB0A 3WNLA 1GEHA 2NW0A 3M0MA 4E6MA 1JXJA 3OQ8A 4AEFA 4RL3A 4NRRA 1QR7A 5HANA 1UWAA 4BEQA 5CAKA 1W56A 4HNTA 2QUUA 2P53A 1K3UA 2OX4A 5LNUA 2OJPA 1JQXA 4Q8MA 4YN5A 4K1WA 3BPWA 2XSBA 3CO4A 3G1HA 2V30A 4V33A 5KSWA 3SO7A 3W6LA 4LAUA 3C6CA 1OZMA 3JZUA 1KFKA 1UWUA 2VMFA 3GB6A 1EA0A 2GQ8A 3OBKA 3WL0A 1MYRA 2TYSA 4HNOA 1JZ5A 3RF9A 3OA5A 4IJRA 3QPYA 4HHHA 3L4XA 1SPQA 1YTEA 2VVNA 3QZEA 4MNMA 5T8GA 1VCGA 3MP3A 5CZ0A 3GG7A 3VIFA 6CGTA 2ZTKA 5BOEA 4M29A 4AD3A 1R3VA 1GVSA 2J66A 1CYGA 4UWMA 4OECA 3UR2A 2VGGA 4BZYA 2OEMA 4JQ3A 4P7NA 4GGHA 4G7EB 3W1TA 4RE0A 3F4VA 1BKHA 1G7VA 2W6RA 3EDKA 4NNAA 4MKSA 2PDJA 2POZA 4HMEA 4C90A 4QGCA 1H0IA 2NXIA 3WD3A 1LLWA 1RCOB 1MZHA 3PWAA 1DXEA 3AISA 1MQQA 3FYPA 5AC7A 3TEVA 4XISA 1Y5XA 1B3XA 1R3YA 1XR2A 4RW5A 1KRBC 3LXAA 3M16A 4UR9A 3V5CA 2DZAA 3OBEA 2A0NA 4JKLA 4N6EA 4H04A 5C2XA 5FJTA 1J93A 3ABXA 4A3UA 4CD8A 2F8QA 3LEPA 4GVHA 1R30A 4FO4A 4KCTA 5A8GA 5XINA 3G1YA 3AUOA 1CGTA 2DIKA 3HG3A 4L9XA 3DI1A 5K4ZA 4BEUA 4N2YA 3NDOA 4NZJA 4BR1A 3AXMA 4HK7A 4AZIA 1RUSA 3GFZA 1DYSA 5HQEA 4NSBA 2GVGA 4N9CA 2MANA 3MSYA 2UY4A 5DEZA 3VOGA 3WQFA 1Q7QA 1ZQ5A 2XIBA 3LCIA 1W0MA 2Y8VA 1X6LA 1IWAA 1HO4A 3NVTA 4QP0A 3UXLA 4WSJA 1O1ZA 4FSAA 4U10A 2HEJA 2ZUVA 1WAWA 4ZB0A 3CHFA 2PDFA 1HTIA 1WAUA 2O4QA 1GKPA 4AWSA 1V6VA 4QE5A 3B4UA 2V5LA 3GXIA 2XTKA 4FR1A 3EKZA 3RR1A 2WKGA 1EUAA 4JFVA 3GYEA 8RUCA 3NZGA 2V63A 2RH9A 1R9ZA 1NH6A 4PSPA 1YDOA 3R8RA 1SQ7A 4IWWA 3A47A 4NZFA 2BS9A 3CEUA 2VRKA 5FOOA 3SUTA 2VZTA 3UESA 3NL5A 3RU6A 1W1A1 4KWUA 2J74A 7TAAA 1JCJA 4DO5A 2XH2A 3W7RA 5BCAA 2OU4A 1R46A 2E5BA 3MPGA 3MZNA 3RO8A 1BVNP 4TX9A 1T0OA 1LCOA 3GR7A 3WK3A 3P2VA 1W9UA 2YL5A 4LSBA 3IJ7A 4XZLX 4O0QA 1AH4A 1GORA 3NQBA 3O15A 2YCEA 3WQGA 3PZUA 1R5YA 4YHEA 5DT7A 4GJJA 1A5CA 1DXFA 1ZJBA 2VFDA 3AS1A 2ISDA 3VZYA 1OFOA 4W88A 2DT3A 3O06A 4HHMA 3H2OA 5T91A 4C6PA 1ISWA 3VGDA 4V28A 5I09A 1YW1A 2QDGA 2ZADA 2XZ7A 2HQAA 3I4EA 1XBYA 2EEXA 1UHVA 1J0YA 1Q45A 3EPMA 4IGSA 1DV7A 3BMVA 3SI9A 5FSDC 2WBKA 2Z7GA 1QWGA 2PDIA 5AHFA 4GZIA 4FNPA 2QF7A 2GJXA 2V2CA 4CD7A 3L4YA 3S5YA 4GVGA 1XH2A 5H1WA 4U33A 2ZWZA 3CLWA 1KXVA 3KW3A 1W3JA 1T8QA 1VR6A 1IT7A 5E9AA 1AG1O 2WMIB 4WD0A 1CXLA 2VUYA 4EPDC 2YJQA 2Z2AA 1VFMA 3OGVA 4O16A 3IGUA 4JTRA 4HBKA 3MBFA 1J79A 1XIEA 3MUCA 4A21A 2XFFA 2AL2A 1IGSA 1QPNA 1SU5A 1B3OA 4RDWA 3W7MA 4H3DA 3MMDA 3UPMA 4JFSA 4H00A 2WYSA 3MUAA 2ZUWA 4XG1A 1XRFA 4W7UA 4HPNA 2F9RA 3TXVA 3NJ3A 3NQCA 3SCOA 5LIXX 1Y65A 1MW3A 3LCFA 4EVZA 4V2XA 1VRDA 1BQGA 5HMEA 2G50A 3OB8A 2KZHA 3NM3A 3S2LA 4M19A 4LPCA 3W2KA 3ITTA 2OSXA 1HJXA 2X1SA 3ANYA 2VGIA 4D72A 4UQEA 3QV9A 1DIOA 1YTDA 5I00A 4GBDA 4C6BA 3R0DA 1I2PA 6XIAA 2WNZA 2QF8A 1SGJA 3NQGA 3O6CA 2PU1A 4FK9A 1GZJA 4LYPA 4PZVA 1Q6OA 1FCQA 2PCEA 1QUMA 4H6RA 5IBXC 3TOYA 4OZOA 5CPSA 4JBRA 1E4IA 4ASTA 4CD5A 1J6PA 1BVWA 1CB7B 2V0TA 3CZEA 3GDRA 4OJYA 1TV3A 2YSWA 3TTOA 4JN7A 4WOZA 1E1FA 1EOMA 3O7UA 2O55A 1Z3NA 9XIMA 2R24A 4RCXA 1BF2A 3VZZA 5EFDA 1KLZA 3KBNA 2YCLA 1W8SA 4L80A 3GTNA 3MJYA 3OZPA 4WIWA 3I6TA 4A2RA 2P50A 3MWCA 3CQJA 3AIWA 4GYFA 2V3GA 5C9UA 3H4WA 2ZUUA 1W5NA 3W37A 3T2PA 3BUVA 1PKLA 3BJFA 2VC9A 2D0GA 1UQZA 2WVVA 5FI8A 3DENA 2FVMA 3O9NA 5ECVA 1PDYA 1YBQB 4PCNA 2GLKA 3BCDA 4PUMA 2ZXQA 2QCNA 5LIYX 3F4NA 2HROA 4HHPA 3IJDA 1F76A 3U2CA 3GE7A 5BWAA 3H7UA 4IIHA 3HGJA 3VIIA 1U5VA 1UZDA 1CBGA 3PBWA 5CZKA 4AISA 2NQJA 2DQWA 4LF2A 2J27A 3STCA 4F2TA 2G5WA 4HGXA 3LCHA 4WSHA 4BWLA 4WSKA 1UUOA 4L5ZA 3S9YA 3MV11 2XIQA 2ACQA 5DCDA 3WMSA 1Z7AA 4MNLA 4LY8A 2YGYA 2HVOA 4ZOBA 3N4AA 2P1FA 3ABZA 1XC4A 1EJ7L 1FOBA 3R10A 3QH2A 4G8TA 3AXXA 5CKSA 3UNDA 5CAHA 2OWWA 1PE1A 4WLCA 1ADDA 3W1PA 1EHNA 4C5ZA 3SCSA 5HQMA 5E9XA 2WMFA 2QPUA 3N2TA 3NEVA 4R9XA 1FCVA 4XKYB 4DY1A 3V16A 3CHEA 5D2XA 4B3ZA 4UZSA 2ON3A 3FJNA 1KKRA 3HJZA 4WKHA 2ZZ2A 3AC0A 2GWGA 3N6QA 1B2YA 3CMFA 1US3A 3CPUA 3I68A 1XRVA 5I3HA 3RX3A 3OOQA 1VYSX 3U6WA 2YW3A 1F6KA 1D9EA 5KZDA 3WQ5A 1VS1A 4OBTA 5HATA 2ODOA 3SRKA 4LVGA 4D6FA 3VNMA 4V15A 3PZQA 3EOLA 4YCOA 1G94A 3S47A 1RPXA 5HR6A 1D8WA 4WY0A 5AFDA 5EBAA 1V3IA 2Z4GA 4OHQA 1XH0A 2WC3A 3TYCA 2FVLA 2O7SA 2YLAA 1C93A 1JFHA 2CEQA 3EBVA 3SSZA 1XSIA 3U5YA 4JL1A 3EOEA 4GH3A 4RKAA 4C1LA 1QI3A 3LERA 4GUFA 4RZBA 3IJ8A 5CLTA 5F2LA 1VEPA 2IKIA 4DUOA 1WZKA 1XSJA 4EF9A 2WM0A 5FJIA 5I03A 2OB3A 2V68A 4Q4QA 4WDXA 4DZ5A 1NQKA 1F3TA 3G1XA 4AZ5A 3UCQA 1GKRA 4FS9A 2OLSA 4X3ZA 4IPNB 5FESA 1YNQA 3VE7A 2YX0A 3E0VA 4DZIA 4DF1A 4LAMA 3N9RA 3UF9A 1VYRA 4DEFA 3TAKA 3E74A 3LBMA 4L61A 1QNRA 1JCLA 4LC8A 2UBPC 2VR5A 1DJXA 4NVTA 4WOQA 3ES8A 4RXFA 1EP1A 3MT1A 1W37A 3WJYA 2PLKA 3B8TA 4NYUA 3F2DA 4PBEA 3T07A 4JNYA 2ZUSA 3MYOA 2V3DA 5GQBA 2OMAA 2WOQA 1YADA 3ONBA 1H5VA 2GL5A 3S2NA 2VEMA 4BI6A 4AZ7A 5E0CA 2RJHA 1X96A 2INZA 1IWPA 4RR4A 4B5UA 3SQMA 5FF7A 2CESA 1I0DA 5K9CA 2DIJA 2H9AA 2PURA 3SGUA 4MWAC 4WGHA 1MRQA 2P0OA 3RILA 4ZOAA 4BQ3A 1ZBVA 1BGAA 4LALA 5D32A 4S3KA 4X61A 1Q66A 3TJLA 1TPB1 1WZMA 4CCZA 5HOSA 5BRBA 3IK2A 3NPUA 1C92A 3EX3A 1EPVA 3WLJA 4B4HA 1I60A 3EWWA 3USZA 3LNMA 1CGXA 3H55A 1F74A 4B5VA 5HBFA 1OZQA 3N2BA 4I6VA 1QPRA 3AAMA 2OR2A 4JN6A 3L4WA 3Q58A 1J5SA 2D3LA 4DI8A 2Z2BA 5ABGA 2PDQA 4P8XA 1K1DA 4JQ1A 4TVCA 2DT1A 2Y7GA 1GOMA 1JUEA 2ZYFA 2GPTA 1UOKA 3BXWA 4DB7A 3L4UA 3LHTA 2FJUB 1TA3B 1V6UA 1BWLA 4CU6A 4XVEA 4B2DA 4OKDA 2V2DA 4LW7A 4QS6A 4D8AA 1F2JA 2R1LA 2D24A 1TRIA 3W85A 5FEZA 1CLKA 4LV9A 2BV9A 4EE9A 3DXIA 4I9AA 1E1EA 3VYLA 2ZE3A 4LYKA 4I7UA 1RBOB 4HA1A 4LY4A 4W9TA 3RLGA 2PODA 3QR0A 1W1PA 1LOLA 5LA1A 1KV8A 1LJYA 1HVXA 3C2OA 3WF0A 4ZODA 1TMLA 4Q6JA 1XKYA 5A6LA 3UD6A 1MSSA 1MWOA 2NSOA 5CZTA 2V9DA 5AYXA 2GZXA 4CEXC 4UTKA 1SZEA 4PCFA 4XZIA 3UU0A 1AFSA 4C91A 1OC7A 4E38A 2ALRA 4JYDA 1OX4A 3VOHA 5SWUA 1HKKA 3OHMB 3O07A 5JBFA 2OELA 4LB4A 3YPIA 4CKQA 2WPGA 1K02A 1MI3A 5G4WA 4YMZA 3WH5A 3R6IA 4N9DA 2PC8A 3M4HA 3GZ3A 3VMOA 1X8CA 1QPKA 1VJZA 3VOJA 4PFHA 2ACUA 1UZ1A 1PWMA 4GQQA 3PC0A 4LUTA 4J28A 3C2EA 4IMAA 1B4EA 2HCVA 2NVAA 1QHOA 2PGWA 1RA5A 4C7DA 4YVPA 3EXSA 5A94A 2V3FA 3NGJA 4W8BA 4TR9A 1BF6A 2IUZA 1FCBA 1JPHA 4PUDA 4GIYA 4WF7A 2QCCA 3A24A 3ES7A 1RD5A 1JJKA 4IP5A 4JTAA 3HPXA 1D2KA 5D9OA 2OSWA 2VR2A 1PB0A 5AKQA 3CV2A 3W84A 2HE8A 4MUZA 4ZXOA 2G3IA 1VFLA 4L4LA 1GQLA 4JTQA 1CXEA 5G2WA 3QY6A 4QHRA 3AIUA 1M7XA 3W1AA 3WQWA 3CV1A 1C91A 3BE7A 4JHOA 3AZRA 3VDHA 3B8VA 2BOGX 1H1ZA 4GYPA 3NZRA 3E2RA 1XPGA 4N42A 1UUMA 1RK5A 2MUCA 2C0HA 4QLKA 5GJMA 4GFSA 5FJRA 4JEJA 2GUYA 3LX9A 1DJQA 5DBUA 3M0VA 1TR1A 2PGFA 3QM3A 2RAGA 2C3ZA 1T40A 4RDVA 5A69A 3KVLA 4AG0A 3TJIA 3FY1A 3SCTA 4FEZA 1W1VA 3A23A 2PFHA 5ECUA 4PODA 4X2RA 3ZMRA 4IOTA 4C1KA 2VQTA 1NWUA 1E6SM 1LZOA 1IYXA 4KCWA 1C3FA 4AYGA 3WDPP 4AY7A 3E2VA 3VXGA 2A6NA 1VHCA 4I9MA 5FJPA 5F7UA 1CDGA 3S8HA 4GCXA 1TV7A 4CNTA 1CNVA 1MUMA 4FF5A 3IACA 1PPIA 4HJFA 1O66A 1XLDA 4Q22A 3HQNA 2QGHA 5GVJA 3QGKC 4NAFB 1XYBA 1P0NA 1J0ZA 1OF6A 1EBGA 3E1F1 1WDDA 4DZHA 3WO8A 3M0ZA 4O28A 3CEPA 3U2OA 3CM4A 3TTQA 5EMKA 2TRSA 3VOCA 4GI6A 5FIPA 5A95A 3CV6A 1PKMA 5ABEA 1G7UA 1RALA 5C7VA 3PZ9A 1DIKA 4AHQA 4KF1A 3SJNA 4GRSA 4K6AA 3APGA 3CQ0A 4XWUA 1LT7A 3Q65A 4PCTA 3AXKA 3PN8A 1UA3A 2IPFA 2R82A 3VIGA 1JCYA 5CGMA 1ITUA 1LWHA 3WNMA 1XKJA 4GIRA 4DBUA 3WLTA 5M1TA 5LIUX 3AMDA 3S9ZA 4MJ2A 4RZ4A 2VX7A 3MDUA 3T42A 3VCCA 1J9YA 3B8SA 3V0TA 3NDYA 4WX2A 2I1OA 2JKAA 3LHUA 1G4PA 4YNGA 4IP4A 1V0NA 1A5MC 3L5LA 4S3BA 2FGBA 1IZCA 1EF2A 3ARYA 3PTKA 4HMNA 4E3TA 4UMCA 1NDYA 3LGEA 2IKJA 4LX4A 1UR2A 1T7LA 2CLHA 4Q33A 3F4DA 4OOUA 4NAEA 1KD0A 4CNUA 3CGTA 4MY9A 3LPPA 3S1XA 2J13A 1UUQA 4UB9A 1ZBWA 3VMNA 3SFKA 2R1MA 1LROA 3PTQA 4TTUA 3TSDA 4WXYA 3W76A 1EF3A 1PO9A 2HE5A 2WJDA 2A7RA 2WVSA 4IMGA 1WXJA 2QCDA 3VDAA 3BC9A 2CBVA 3W73A 4FOUA 3UJ2A 3UXIA 3NPWA 2VZSA 5CC7A 4DWDA 3MO4A 1FWHC 3HN3A 3AJXA 3GRIA 5T9BG 1QO2A 2A3HA 5GNYA 4DM2A 2Z0IA 4K7VA 3GHSA 5A2AA 4F0KA 9RUBA 4IFKA 4IMCA 1W54A 2PBGA 1DTUA 3GW3A 4F9DA 2HBVA 5F1VA 1WXZA 3RK8A 1H11A 5F4XA 3PZIA 1BYBA 3LHWA 3K5XA 4R34A 3ZSTA 4JQAA 3S6DA 1DJNA 5E1QA 1L6SA 3N29A 2FMNA 4I9JA 4W84A 5FSEC 4ORMA 1BYDA 2VFFA 4PCSA 4J2PA 2NVCA 4KT2A 3P81A 4UQCA 2QHAA 1F8IA 2BHYA 2PDUA 2G3JA 4ATWA 3RM4A 1AQFA 4HCHA 4ATLA 3LHZA 4F0SA 1QW9A 3CZGA 4PMXA 1VCFA 1G5AA 4G56A 2WJFA 1XG3A 4RE3A 4YPJA 3VDBA 4FHAA 4B92A 4Q3MA 1WOBA 3CO8A 3E2QA 1EQCA 5D2YA 5C55A 3ZLHA 4PBFA 1OFBA 4UTTA 1VYPX 3E3HA 3TK7A 1V3LA 4HTYA 1KCKA 1TMHA 5HNTA 5B80A 3B9OA 4C6DA 4C6EA 3ENLA 3P60A 4M0XA 1E6RA 2VQUA 2WKJA 4NUWA 1VCVA 1T41A 3MS8A 2BXYA 3G1RA 1AK5A 3G6LA 3GNXA 2GGEA 5C2CA 1UPPA 1JCMP 2G3NA 4HJWA 1QJWA 3R1ZA 3WH7A 1VFOA 1J11A 3S5SA 1C7TA 3LS9A 1KM6A 3B40A 4H83A 4CCCA 1A0EA 3FA4A 4LUJA 2NQ5A 4YTQA 5DELA 4IPJA 4QG8A 2W79A 3VC5A 2DJLA 4K36A 2BMBA 3AIEA 1YPXA 4R5EA 3UETA 3HOJA 1KKOA 4DJEA 2OQYA 4R33A 1UYQA 3OZMA 1Q85A 1Z42A 3VM7A 4UTMA 3KOFA 1W2PA 3KVMA 5B7YA 3CAWA 3CWHA 1SMDA 3KBWA 5CH9A 4UMBA 4JOMA 1PX8A 4MNKA 1U5HA 1M41A 3AO0A 1OGGA 4E4FA 4ZBCA 3T0DA 1UWIA 1UC5A 1NFGA 4IFRA 1ME7A 1LM1A 3LCLA 3LXBA 2PRMA 1H1NA 2VNCA 4XZWA 4PGLA 1P48A 1IXQA 4A8RA 3IIXA 1LUCB 1LQAA 2OSYA 4L4OA 4Y2WA 3EMCA 4F0RA 4DUWA 4FLSA 4QCEA 4Q8OA 1G6CA 1I2QA 4I8YA 3PUOA 2XN1A 3CZKA 4WZHA 4MWAB 3EB3A 2EG7A 4G5DA 4Y9NA 4DPQA 2AL2B 3N3TA 5K9XA 1F5ZA 3AXIA 3S6OA 2QKFA 1IZKA 2XVPA 3CQHA 1NFBA 2NQHA 3QHOA 4E2BA 3QY8A 2BHZA 1WZAA 3M9YA 3IGHX 4OE7A 3G1VA 1G9HA 2Y89A 1DE5A 3M5YA 2PLJA 1JNEA 2FB3A 1FY6A 5CCZA 1Z48A 3DYOA 3ICJA 2NXGA 1NDVA 1XIMA 1Q2RA 1V5XA 1O6IA 4FNTA 2B81A 4R7JA 1SFSA 4I7WA 2D69A 3HFTA 2PDNA 3AMCA 4LVDA 5I3IA 4HK5A 4NIRA 3GVQA 1BYAA 4QX4A 3HM7A 1XIJA 1ZU8A 4IQLA 4AH7A 3I6EA 2NLYA 4ZA0A 1P6WA 2QVNA 4A2SA 1H63A 3BJTA 4M6UA 1LQ0A 5HAOA 2B7QA 3P14A 1IT8A 3CIWA 1IV8A 3W4RA 3VCRA 3KTCA 1J10A 2Z00A 3WLQA 1JAKA 2ZC8A 2WO5A 5JBEA 4QFUA 3P61A 2PLCA 4YCPA 1QO5A 2X2GA 1D7FA 2X16A 4GH1A 4DXVA 2PSNA 4FX6M 3EXTA 3VKBA 4C6NA 1L6WA 4K2SA 3KVJA 5TQLA 1PZ3A 3EX1A 1MFUA 2YCLB 1OYAA 3M46A 3TYZA 1U83A 5HK4A 1RJQA 1EGVA 1KO0A 1E6XM 3BLEA 4NZ1A 1U33A 4FNSA 3WELA 1U1UA 1ADOA 4IG2B 2CLOA 4G1KA 5J5DA 1I4NA 1GW9A 3PUGA 4LAOA 4JTSA 3W22A 1TZ7A 4GWEA 1N55A 2GVLA 1TCMA 5I78A 3UP8A 1XIBA 3HQPA 3EKLA 3AMGA 3SQLA 4QJ3B 1QOQA 2YCJA 1MDLA 3PM6A 3V0SA 4Z1YA 2R9RA 8TIMA 3RPDA 2O4MA 3GC2A 1V93A 1AJ2A 1M03A 2VFGA 4AAJA 2C0AA 2BX7A 4Z1DA 1UD3A 3W75A 1PIGA 3T78A 1LL7A 1K7EA 1XHGA 4L4PA 2NUYA 2OO6A 2C79A 4EPKA 2HS6A 4DWSA 3ATZA 4AB4A 1VPYA 2XM2A 2ALDA 1QDSA 1G01A 2D0FA 1JGMA 1M04A 4HA4A 2VOMA 3N17A 2NWRA 3N2CA 3PNUA 1F3EA 2NUWA 3VIHA 4ZO6A 3P82A 3QKEA 2WMJA 3TJXA 1UQYA 3VGBA 1ICPA 3T81A 2Z7KA 2PDCA 1J0JA 3AFBA 4JFWA 4MHBA 4B5TA 3MSGA 1W3NA 4LXFA 1N8FA 1SW3A 4WK9A 4CD4A 5BW6A 2PGRA 4U3CA 2ESCA 3K8KA 1ESWA 3OVPA 1GOWA 2WANA 3FK4A 1KFJA 1HJSA 5LIKX 3PSVA 3RG6A 4X9SA 4O54A 3W29A 4BFAA 1TVLA 3HQ1A 3WF2A 1RR2A 2WWDA 3NEHA 2QZRA 1OCQA 1IT0A 3VA8A 1XUZA 4KETA 1J5TA 1MO0A 4UOZA 1X1OA 1L6YA 4Q6XA 4AXKA 4RDYA 4C1NA 2WZEA 1AJZA 2DZUA 1K7XA 3CL8A 4QG9A 4O53A 3SN0A 1XDMA 4MPQA 4D71A 3DFNA 1ALDA 5D9NA 2BFGA 4ZB2A 1VKFA 3AICA 4ALDA 3UZXA 3C8NA 1FRBA 2Y8UA 3K30A 3TQKA 3N13A 1A0CA 2BVTA 3PPGA 4JX6A 4GA8A 4DM1A 1F6YA 3CYJA 5HJYA 2CPUA 3NSNA 3IIVA 1R87A 1DQUA 3P3BA 1VBJA 4M7SA 4NJKA 1OCJA 4CQ9A 4NI3A 4H2CA 1WQ5A 1RVKA 2A79A 4JTCA 3LY0A 5A1AA 5A6BA 1JZ4A 1FWIC 2XJ7A 3SN4A 3V5OA 4XIMA 4P2VA 4XD3A 3IUHA 1W3KA 3GNNA 1S1RA 2J8FA 1R47A 1YDVA 4GI9A 1FP9A 3QMTA 1E0UA 1PCKA 3TR9A 2PDPA 2CLIA 5JBDA 2B7PA 2Z6JA 3D3FA 3CYVA 5LNVA 4NYYA 3VX1A 4GXPA 4L6HA 2JE8A 2V5DA 2G3FA 1RAKA 1GYMA 4Y90A 2E5CA 3A9BA 3RR4A 3GNRA 4WRHA 4GJIA 4IPLA 2E8ZA 4MM1A 2Z24A 1GYLA 4E0CA 3LTSA 1KFWA 4HPHA 4GYKA 3OLGA 3KCOA 2QV5A 3WD4A 1DIDA 2X40A 3A21A 2YIHA 4LBSA 1TX2A 3NZ1A 2DZTA 4O8RA 3M47A 1YMYA 3OVGA 2WMKA 4IPPA 2H9AB 2QDDA 3TXZA 3BW3A 2PWGA 4TX6A 4PB5A 3FAXA 3C3UA 1W5MA 5BOOA 1OC6A 4QBXA 3PBVA 3W7DA 3TC3A 4MMWA 1S2TA 1GZ1A 2F38A 3RCYA 2JIWA 1AVAA 3AYRA 2WV8A 2FGLA 4F2BA 3NSXA 5G1TA 4OU1A 4R88A 4EK7A 1KFCA 2ZUMA 1XLIA 5C0QA 2WCGA 5E6ZA 3ZJ8A 3EMZA 1DJHA 3H53A 4Q8NA 2Z6IA 4AWUA 4B5WA 4MKVA 3WQDA 5GNZA 4O8AA 1Y8BA 2PU0A 2DPEA 2DIEA 1OC5A 2NLIA 1J4EA 3S1VA 1N82A 3O16A 4HTBA 1UWTA 2JIEA 5M5DA 4RV3A 4QG6A 1POJA 1E6NA 1HQTA 5CPLA 3W38A 4N0RA 3WLRA 5AECA 2AAAA 2ZRYA 2X09A 1EZWA 3CS2A 3VIKA 1EYEA 2YL9A 1NVMA 1OFDA 5ENLA 4MAVA 3SGZA 3DH7A 4QNEA 1E73M 3OA3A 2AMXA 1MW1A 3PBGA 3POHA 3W2MA 3LYEA 3GH7A 2C6QA 2ZICA 3CH0A 4WGXA 3ABSA 5K9DA 2V6AA 3M07A 3CHDA 4ZQNA 2KX9A 4F3HA 2A3BA 5DO8A 5A2BA 3LBCA 4ACZB 3W01A 2OYMA 2ZX9A 1TO3A 4A8IA 3I65A 2FJKA 3N19B 1GVRA 5DT5A 4DIAA 3FYOA 4MZ1A 2C8NA 3LTPA 4B2DD 4H2HA 3VGFA 3TYEA 1MNZA 4H8VA 4FLRA 3OLIA 1W1YA 2GVEA 1UCWA 1OQFA 2NT1A 1GQNA 2RKXA 1GW1A 2OLHA 2EKGA 2GWNA 1OX4B 3STEA 3M5VA 1E3XA 3N2XA 2CWNA 3DI0A 3H2MA 3UJRA 5C54A 2QUNA 3GKFA 4M1BA 3DEQA 4EPEC 3RLUA 1IWBA 1GCYA 3THAA 1I1WA 4LUTB 4A8NA 4ZQOA 3ARZA 4BQ5A 3RM9A 5CSYA 2ZZ7A 3ARXA 2J25A 2PWUA 3B8DA 3SCPA 3K13A 5H2ZA 2Y8KA 4J7RA 5LGXA 4C6OA 4UTLA 1E5JA 5HWJA 1A5BA 1WOAA 2Y4SA 2Y63A 5I0DA 3WH9A 2EG8A 1UH4A 3N6JA 1YXCA 4Z0SA 1L6FA 1EEXA 1K8CA 3CIVA 1JL8A 4PTWA 4HD5A 3H54A 4ES4A 4GY7A 2D0HA 4AIBA 2A85A 3HURA 4IFOA 4Z0JA 3EB4A 3UBPC 2NT0A 3CUJA 2DH3A 5D9PA 1ZP3A 4P8UA 4IGHA 2Q8ZA 3N1AA 2E9LA 3P0WA 3ITYA 1O68A 3GFYA 5EMYA 2A3EA 3GDLA 3KX6A 2VCAA 2W67A 2PRHA 4GMEA 1XD1A 1O60A 2ZVRA 1ZBKA 2FH8A 2Y7FA 3WK1A 2YPIA 4K8EA 3HBLA 2CZEA 2I9EA 4RE4A 4OUEA 4R53A 4DJFA 1PKNA 1QI5A 5IDZA 1LL6A 3S1WA 3V1PA 1ML1A 2FH6A 1W3LA 2XWEA 3UJEA 4JTIA 1K8ZA 1JPDX 3KL0A 3FOKA 1Q8AA 1Z89A 1UD2A 3M0YA 2OWXA 1PEZA 4U2YA 1W6TA 2XN2A 4S3GA 1QHPA 4KGJA 2V69A 1B54A 2NX3A 2O92A 1GPFA 1GG0A 1XGEA 4REQB 2VOTA 3V4BA 4Q32A 1SW7A 4JAWA 5A6JA 4PMDA 3BG3A 4LGXA 4UFHA 3W86A 1KWGA 4HQVA 1CZ1A 1UWQA 1R2RA 4E2DA 1Z32X 1EDTA 1V3MA 5M3WA 3HPAA 3KTSA 1BSIA 4PYSA 2WNNA 2G8ZA 1G69A 1BYCA 1Q6QA 1VH7A 3PAJA 5DCEA 4YVXA 3ABOA 5EGRA 1PX4A 3NAVA 2Q3RA 1XV8A 1E9IA 2IPJA 3T09A 3T4CA 1KGUA 1I6NA 1G4SA 4G2DA 4OTKA 1S38A 1S3TC 1A53A 3ZIZA 4H01A 2CBIA 3A4XA 1ECEA 1OCNA 3B8UA 4INFA 2QGYA 2VVSA 1K70A 3OZOA 3VDGA 2QCEA 1JDFA 3VE9A 3BANA 1MUWA 1M5WA 1XCFA 2Y2WA 2NQLA 1DJWA 1K8YA 5AYZA 5DY2A 3SADA 1TPWA 3TLQA 5HWNA 3A5FA 4IL2A 4JXCA 3ZWTA 2OKTA 3JZEA 4ZOEA 3ITOA 1KA9F 5CSUA 1IZJA 3TYDA 4NT0A 1POKA 4FA3A 3APYA 5BU9A 4MB5A 4I3GA 1DWIM 5AB3A 3E02A 4LC6A 4E2VA 4KWSA 3BG9A 4HVXA 1KM3A 1RJPA 3PBYA 1ZZMA 2HBXA 3AU2A 3N11A 1A0DA 1YQ2A 3SJ3A 2EQDA 3LN3A 1VGAA 3IANA 2CYGA 4O1DA 2A1YA 3LD5A 3H2NA 2WM1A 1QW8A 4PUEA 1UR3M 2PWVA 7CGTA 2C18A 2Z1WA 3E49A 4FALA 4X0NA 1IXOA 1XXXA 2YDQA 1W3HA 4NAEB 2HPMA 4DXKA 4IISA 1PTGA 2GDVA 4W86A 3CPRA 3HTWA 2W0UA 2BGNE 1QK0A 1UMLA 4RPPA 1TV4A 1PTDA 3DX5A 2DU2A 2EPNA 4HPGA 1IIGA 3KBJA 3H24A 4C7FA 3RU8X 4XO6A 6A3HA 4LAZA 2V5KA 4WJXA 5FCZA 2IQTA 3W23A 1KCZA 1UH2A 1ZCCA 1UR8A 1FFRA 4MADA 2RHGA 4H9YA 2E1WA 1PIFA 4PMJA 1OVDA 1V02E 1Q4WA 5FL1A 4EPBC 2VKZG 3VI2A 3COTA 4PC8A 5JH1A 1FBAA 2W9MA 2QAPA 5LGZA 4KBXA 4ZMGA 2REQA 5KZMA 1ISXA 5C7HA 5H8PA 2E68A 3PJXA 4QLLA 3TQ0A 4UBPC 1F73A 5AC5A 1XPYA 2Y70A 2E09A 1AODA 4Z2HA 2J8TA 7REQA 4NXKA 2J78A 3W7PA 5I79A 4UQAA 2W3ZA 4GVFA 1W3IA 3FA3A 1O7AA 4JNMA 1CIUA 4J3XA 3TZNA 1PDZA 1U1JA 1SFLA 3B03A 2Y6ZA 5H8UA 1KLYA 4PTDA 3S5OA 1R3TA 3LM7A 1TTQA 1W9XA 1DJGA 5CQ1A 4RK8A 1PL9A 4JKKA 4UMAA 1FQ0A 4GNVA 5HMSA 1EGZA 5A8MA 2P88A 1TZZA 4JYEA 3D46A 1OK6A 2PDBA 1H5YA 5CPNA 3KFTA 3R0KA 3TWAA 3KOYA 1D7KA 2VZUA 4PH6A 3AQUA 3W53A 2JFEX 3W1UA 2H3DA 3IGSA 3SW6A 1I1XA 1AD1A 3M5ZA 3DG7A 5AN7A 2X41A 1R7OA 1TSIA 5FKYA 1W1TA 4PFMA 2WSRA 2GDQA 4AF0A 1IEIA 1LORA 1VQTA 2RDWA 2RJGA 3NWRA 4ZE4A 1GQJA 1MXGA 2CXGA 2GFTA 1M1BA 5CGTA 1RHCA 4HYWA 1TE1A 4YYFA 2FHFA 5HJXA 3PWIA 4XB3A 4DELA 4FR6A 1LWJA 4GUGA 3VUPA 1H41A 4Q8PA 4QSHA 4LRSA 3TSBA 1EIBA 3LB0A 1V3JA 3A3XA 4LT9A 5F2IA 1KCXA 2BWGA 3LU2A 2WNQA 3VC6A 2CNCA 1WUFA 3LCXA 3PZGA 2WPBA 2ZTJA 4H6KA 4KGLA 3SBFA 1M9HA 1EJSC 4KEVA 4C6IA 2ZX8A 3NOYA 2WC4A 3RN6A 3VIJA 4K8HA 1RY0A 1T99A 1AZ1A 4FPSA 3HZ3A 2W27A 3W1NA 3L0KA 2FLIA 4A3RA 3POCA 3FW6A 1HKJA 1JDCA 5FD0A 5H91A 3NQAA 1A5AA 1JYWA 3VIOA 3WQCA 3SUVA 5F2MA 5T9CE 1SJBA 1BQCA 1I0BA 4QRNA 3U9IA 3TC7A 4GY0A 3NDZA 3WKZA 3W7JA 3EDJA 4DJED 3NO3A 2Y88A 3A5VA 2JEQA 2XIJA 4UFKA 5LNWA 3HU7A 3PFRA 2GSHA 2BBFA 3O6YX 3KS5A 3QV8A 1ZENA 4F8XA 3H21A 4HU0A 3PP7A 1RBLA 1B3WA 2EKCA 3RYSA 4AWTA 3LGGA 4OVXA 3DDMA 3T0AA 1J18A 1VFHA 1HKIA 2QXWA 1HW6A 3T7VA 3UZYA 3EPNA 1GZGA 1TWWA 3L2MA 4OBRA 4TTGA 2NV9A 1TTPA 1DEDA 3QJAA 3GDBA 2QCHA 4Q7NA 4XTIA 5CEWA 4NU7A 3V18A 3TA6A 2Q71A 1CXKA 2V82A 3L66A 4DBSA 1TPUA 2WW5A 3URNA 4UOQA 3H8AA 1VPQA 2WLYA 4W85A 2YKKA 2CERA 2UY3A 3MSRA 3E96A 4S3EA 1PBGA 2Y24A 1SZNA 1XFBA 1NDWA 1EWDA 3VNJA 3A13A 1MW0A 3WDIA 3NQMA 5A6KA 2PDWA 3AXHA 3MKKA 5G2IA 5C6MA 4MB1A 2JQXA 3QQ0A 2Z26A 2NV1A 1QTWA 1XP3A 3IIOA 3WUBA 1V0KA 1JF5A 4D6DA 3TVAA 1QNVA 2E3ZA 4S2CA 2PBOA 3AROA 4S3DA 2YW4A 1UWSA 4LUSA 2VJXA 2QCFA 1TWZA 3NURA 1IEVA 4QCFA 2CZ5A 1AQMA 3GDTA 4YTUA 2GGJA 1TPH1 3LI0A 2GYIA 3PHAA 3UZ5A 3EDDA 4TUFA 4LVFA 2ISWA 3K4WA 1I45A 4D6HA 4WVXA 5CZJA 2PWFA 3A12A 5HNRA 5TIMA 3VNIA 3NXLA 5KMYA 3USBA 4S3JA 4IPIA 1FH7A 1ZBCA 5IOBA 2X0YA 1X7IA 1ZALA 2X1RA 4NQ1A 2WVUA 1OT2A 2X30A 3GIYA 3BO9A 3OIXA 3URAA 4PN2A 1XLGA 3M0HA 3FV9A 3ZR4A 2BGQA 3PUEA 1NEYA 4Y9OA 7ENLA 3KDNA 3TU9A 4KW2A 3M7SA 3TP4A 1C29A 3A3HA 2AQOA 1RZMA 4F0LA 4DWSB 2F84A 4E8GA 1IEXA 1PHWA 3ZJ7A 1TVPA 3D6NA 4X60A 3K46A 2XUCA 4BS0A 1FWDC 1XQLA 1HN1A 4XTDA 1V7AA 1R2SA 3N2MA 4RLIA 2AGKA 1E5NA 4ZB5A 4R7OA 4MY8A 4EWJA 4O0ZA 3GO2A 4I9TA 1E56A 1PKYA 4KRUA 1XBVA 1H1YA 4O1FA 1EXBA 3QBUA 6REQA 4IMFA 4J2MA 2C7FA 1VFTA 1QU4A 4RZ5A 1QNQA 2VTFA 2DVUA 2XGIA 3LCWA 4QS5A 1RCXB 3NQ6A 4P7LA 1KFBA 3MSDA 4CVUA 1BSLA 1FP8A 1S5NA 5HPOA 2H8ZA 2NSXA 3WQ8A 4P7OA 1DTNA 4KPLA 2V81A 3OU8A 3DCPA 3WQPA 5HA7A 4C1NB 2LLEA 3GVWA 3WBYA 3QYQA 3JUGA 2VURA 4GCAA 3TZFA 3UXKA 2B7OA 4PMOA 2HZGA 1PYMA 1P0DA 1M01A 3KOWA 2CC0A 3GAKA 3MJMA 4AZCA 2VEPA 5DLCA 1GJPA 5KZ6A 3I7RA 1E71M 1DP0A 1K7FA 4GKLA 3N14A 2TAAA 2GJLA 2D3NA 2QIWA 3KUMA 2CLEA 3G77A 3WENA 4S39A 2X0HA 3LOTA 1PX3A 4PUUA 1U2YA 3NG3A 4M6VA 2YLLA 3C0SA 4E5TA 3A64A 2I17A 3CPGA 7XIMA 3CWNA 5A2CA 1F61A 3UNTA 4PBGA 2OPJA 1DIEA 3O2LA 1NAL1 3K8MA 4O50A 4TXEA 5LXEA 2WQPA 3UJSA 4AHOA 4FXFA 4LBRA 5I6SA 5A6BD 3SB0A 3C2YA 1K03A 1QAPA 2GJPA 3S3GA 3UW6A 3ITXA 1V02A 4HZMA 5TD4A 3HF3A 1A80A 2CLMA 3PPFA 5A6AA 4B91A 3AIQA 3G3MA 2Z1SA 4JTKA 3C0JA 1TPDA 3ANVA 3E0WA 1NU5A 1NQ6A 3EGJA 5M2FX 3ZLFA 4O13A 3ECQA 2QT3A 3GDKA 1XRSA 4QDWA 4EXBA 1XCXA 4N4QA 3I3EA 4N02A 3VVGA 3WQVA 5D30A 4K38A 1D3HA 5CLWA 5D05A 3RCMA 5KITA 4QSFA 1XINA 1OFRA 3H2CA 2QCMA 2C71A 2VWSA 3FLUA 1CWYA 2QPSA 3N15A 2CZVA 3M64A 3QFEA 2OO0A 3WJSA 1M7PA 3FCPA 4TVDA 3TJ4A 1PZ1A 3CTTA 3QXBA 3WQ4A 1P5BA 3B05A 4LEFA 4D1JA 1HL2A 1LRTA 4HB7A 1ENUA 5DMMA 5BYWA 1TJRA 1VLIA 1W5PA 4ZSTA 2QV4A 3GWQA 5D2TA 3UT0A 4GXMA 3G8EA 1AZ2A 1A4MA 4AC1X 4PTXA 3VGHA 3KCLA 3W28A 5A8PA 3TLLA 4XBKA 3P0XA 5E6YA 1BPLB 1VFSA 6XIMA 4W5ZA 3OZYA 1XYCA 4R85A 1HZYA 1Q65A 1V7YA 1L0PA 4G7EA 3MVTA 1SMAA 1G4EA 1W2VA 1UJQA 3F5KA 3E38A 1RLCL 3GG1A 4DRSA 3L4TA 2CHRA 2PD9A 1DJZA 4IL0A 1VRXA 1KM2A 4FX7A 3A4JA 1KFLA 4IIGA 1GQKA 4IJCA 1N2VA 1GYNA 3G0XA 4F4RA 3LQLA 4E4UA 4I5RA 2Y62A 1I8JA 1JPMA 2A21A 2DSUA 3TDFA 2O0TA 3AALA 4LCQA 3HQOA 4L65A 4RNHA 2YL8A 2FDSA 3M43A 3I4KA 3TX9A 2DDXA 2ZXAA 4GNJA 3GH4A 4O1CA 3WLSA 3KWSA 2WZHA 1VD6A 4NG3A 1H62A 4J3VA 3NQ7A 4JY8A 3BLDA 5FAGA 3DG6A 3L5MA 4KWVA 1UD8A 1WKDA 4JNZA 1ZTVA 2QVHA 4JIPA 5I3DA 3UR7A 1P0BA 3LV6A 2X2YA 2CKRA 3LNPA 2FB2A 5EFFA 3TSMA 4N9BA 5C9ZA 3E0LA 4J3ZA 1EKOA 3M0XA 4PEKA 1ME9A 3V36A 2EPHA 1P7TA 1XLBA 3I6RA 4AMCA 3SY1A 4M5PA 3GDMA 1DWGM 3EX6A 1SSGA 3TN6A 3MYPA 2RDUA 1XLMA 2IQ0A 5AHLA 1R8LA 3MO7A 4A8LA 4OIFA 3FEMA 1FWCC 1XL9A 4XKMA 4B15A 3IAQA 2ABAA 1V8EA 3QHMA 3MCOA 2ZE0A 1WBHA 4O57A 4HNCA 3UWVA 1NDZA 1JI1A 1OFEA 2IKGA 4NRSA 3R11A 2WJZA 3VKDA 2PLMA 3LMZA 1FWJC 2OZ3A 3QHNA 1QCWA 2WJEA 3IEBA 4CEUC 2OX1A 1P43A 3T0TA 3FNDA 4OBSA 1Z69A 2JKEA 5BRPA 3RITA 1NSJA 1NWSA 5DRIA 4AZGA 4JQ4A 3GQYA 4PL1A 4KCVA 2E6YA 3B4YA 2QJHA 3EOOA 1B9BA 2XVGA 4FP1A 1FWBC 2CW6A 4C5YA 4S3CA 3TTYA 4L64A 4F0MA 3NIYA 4O1BA 5HNNA 4YL2A 4V1XA 3GD6A 4ZO8A 4ADUA 3XINA 2AKZA 3SUUA 1EDQA 3Q2DA 3QY7A 3FFSA 2WKLA 4AW7A 2PE4A 4A4AA 1O94A 2VX4A 2ANUA 5L6UA 3KRUA 2CFFA 4N6FA 1MMFA 3CHVA 3VK5A 2HJPA 5E0KA 1LL4A 1QASA 4UC5A 4Q4OA 5LZLA 2VD8A 5EB8A 4DAFA 2YXXA 3GTFA 1ZSXA 3KEHA 2PTYA 1C7SA 2YCKX 4AVOA 4Q8QA 4QTGA 4AZ6A 4J1OA 4DYEA 2EG6A 3SDOA 4XVDA 4WR3A 4F66A 4GE8A 4NZ4A 3SRHA 2XIOA 4FLOA 4MVAA 2OYLA 4HSOA 4DJFD 1RQEA 3W7HA 4RXGA 4BI5A 2Q09A 1AQHA 2BVWA 3UWWA 3RFAA 2H90A 2F6XA 3WD2A 2Z29A 4CGTA 1MEWA 2Z1BA 4IMDA 2XVLA 3N04A 1LT8A 3R43A 4Y6GA 4US5A 5I23A 3ARVA 1H3GA 5LNSA 3WSUA 3BG5A 4MFDA 3IUIA 5GJPA 5I77A 1OADA 4JTHA 4MDOA 2JALA 3DFYA 2HVMA 3PS7A 1J2BA 2GSJA 2BY3A 7A3HA 4MJZA 1XFCA 4I6KA 2AMGA 3SRDA 3O6AA 2GGIA 3IJ6A 3W9ZA 3BICA 4XO7A 3IJIA 2YZRA 4QIUA 3VX0A 4OGZA 4UNIA 1X1ZA 1GOXA 1GHRA 1V3KA 2F2KA 2J7EA 1Q6DA 5IXEA 1V3HA 4H1ZA 2L5HA 4HCLA 3HJEA 3GNDA 2YXGA 3VTRA 1BWKA 1LRNA 1S5WA 2CHOA 1EQPA 4IGMA 1P0KA 1HGYA 4KERA 4HN4A 4HSNA 4DX3A 5FL0A 1H7OA 1KV5A 1LDCA 4GO8A 2OXNA 1BXNA 1NIUA 3QN3A 4XBSA 1Z41A 2BHUA 3CU2A 3MUY1 1R0MA 4XAZA 2ZC1A 2FHCA 3K1DA 3TC6A 4D6JA 5F2GA 1QVBA 1V4YA 2P76A 1SO3A 2V67A 1TB3A 1X97A 4PULA 3AIBA 3THQA 1EIXA 5FF2A 1S3HA 4CNNA 5A6TC 3DKLA 5IFTA 4K37A 5IM51 1W3TA 3A9IA 2FZNA 3LRMA 1XIGA 3SY8A 4W93A 3RAOA 3NGFA 3STPA 3AU6A 3XIMA 4AYSA 3WQEA 1UD4A 1HX0A 1DL3A 4KQNA 1SJDA 1WDQA 1QNSA 1OBAA 4Y96A 2DZSA 4FI4A 3TR2A 2I16A 3ARPA 1YNPA 2IKHA 1UR4A 2EGZA 1GQIA 1B5TA 5CBJA 4JN8A 4C65A 1CI1A 1WDWA 2YDRA 3CUZA 1KW1A 1OY0A 1IIHA 3PWGA 1H51A 2E9BA 1XJBA 1C8XA 4GNKB 3N4FA 5BROA 3IWPA 1JNDA 2DUZA 2Y85A 1EX5A 3FJ6A 4MYXA 4Q7BA 1VBHA 3KLKA 4OWGA 1OJXA 2CKSA 2GK1B 5F1UA 4FXJA 1GOOA 3RPTA 3L7RA 3DHFA 2WXDM 1HFBA 3KL5A 7REQB 3FGCA 2XVKA 4HK6A 3C3NA 1MQPA 6PTDA 1E72M 1AUSL 2Q8LA 5DY3A 1UKQA 5I3KA 4QEEA 4ZQPA 3LPOA 3WQ6A 1XLAA 1I2NA 1YPIA 5CSRA 3R89A 3SCNA 4JTEA 3SR7A 3PBUA 4W8AA 1FDZA 2NWSA 5EMUA 1IGWA 3WUEA 4IXXA 4NX5A 4J35A 2OODA 3U57A 3NL3A 4XD6A 3EMQA 5BXPA 1WV2A 3GVGA 4GUHA 5I3GA 1M3UA 4GQ0A 4K39A 3MANA 3W2UA 1SO4A 1XDJA 3CUFA 4DO4A 3OW1A 4J3TA 2E9MA 3T8LA 2BOEX 3GBDA 4ZENA 3ZVHB 2P3EA 4TVUA 4WKAA 3VFLA 3N6HA 5FJJA 3W7GA 1GKQA 4JZ5A 4AF0B 4J3UA 3DESA 2GJRA 3QOMA 1JPIA 3V0UA 1E0VA 3TONA 3DFQA 2JF6A 1BAGA 4I5UA 3RX2A 4EP8C 1VFUA 1H09A 3CUHA 1IHIA 4ZE5A 5TF0A 4W8LA 3PZOA 3DZ1A 3C0LA 1P1XA 4MY1A 4D6IA 4UTHA 2B31A 4PMUA 1PJ9A 3UPBA 2UZ9A 1EXPA 1IXPA 2YL6A 1KCLA 1YE4A 3K4DA 5D09A 1OGSA 4XZNX 3T55A 4OQVA 3TTEA 1M7JA 4GYJA 2ZCGA 1XLEA 4GACA 3IJQA 2ZQ0A 3N12A 1SW0A 4UFJA 3VNZA 4LOCA 4D6EA 5ABTA 3KBVA 3W26A 1KXHA 2UV8G 4PUWA 3GC5A 2E6FA 4GQBA 3PFMA 5CC5A 1JYXA 3SIZA 4NNBA 3L0NA 4WY0F 1XLHA 1FWEC 1UD6A 1HIZA 2VC5A 6ALDA 2IPWA 3KAOA 3EPOA 4HZ6A 2GQ9A 3E6EA 1VBUA 1JZ2A 5CJMA 1KRMA 4O1EA 1V77A 3W7LA 4LTSA 3VO0A 3WH6A 3B06A 3H26A 2EO7A 3QVQA 1ZRQA 3B0VC 2O56A 1VJSA 3M6YA 4YIWA 3LXCA 3ONCA 3OYZA 1R86A 2V5BA 1DJYA 4P61A 3UVAA 3MA8A 2YCIX 1HP4A 4YJ5A 1NF7A 1SZFA 3G5EA 3CT7A 1Q6FA 3W1XA 4K8GA 2FZ8A 3LSBA 1QI0A 1ECQA 1QRQA 3NQ8A 1LG2A 1KFEA 4Y8FA 5D38A 3TN5A 1OWQA 3FAWA 4JKMA 1OX5A 3L65A 1E55A 1TTIA 3HB9A 3WBWA 1SR0A 3A4WA 1WE5A 4PMVA 5DCBA 2PF0A 3RIKA 7TIMA 4PE8A 3MVIA 4JL2A 4CCEA 1RK6A 2VM8A 3CMJA 2HRWA 1QBAA 3SSJA 2WQDA 7PTDA 3JW7A 1B9ZA 1W5OA 3QMSA 1KWKA 4Q8VA 2ZXDA 3UG4A 3ZR6A 4ERIA 1UJPA 4MGGA 1R9XA 5AYIA 4PA8A 4GC4A 3W7IA 3W88A 2I57A 5KTLA 2ZA1A 1FHDA 2EJ1A 5HINA 3SFWA 1A5UA 1ODZA 5JVLA 3RDKA 4C60A 4LUSB 4CQCA 1R2TA 3F5JA 3F4CA 3RMJA 4UTFA 4A3HA 4L6DA 5E70A 4ZL1A 3JR2A 1CXIA 4FX8A 4URIA 2QUVA 4HPJA 2I56A 3TROA 4XBJA 1JI2A 3HPFA 4MKNA 2TSYA 3PZMA 3WDHA 3J7HA 1IEQA 4Q4MA 2ZFAA 3I10A 1YE6A 1P6CA 3R79A 4O19A 4CN6A 4E2OA 1TA3A 4IQDA 1ZGDA 5FF4A 1JZ8A 4LNYA 4TX8A 1DQWA 3DHDA 4Q4PA 2W4XA 4PR4A 3PJTA 1V51A 3AYVA 2JEPA 1XUUA 1H49A 3R0UA 3XISA 4RPQA 4QE4A 4W7VA 1EC9A 4A05A 1XIFA 3SECA 4MWAE 2HPIA 3UWZA 3S5ZA 4MOZA 3IAPA 2FFIA 1Z6KA 4NZCA 2E1DA 4GD0A 1Y0EA 2XIMA 3AUJA 3FYYA 1AH3A 4HMCA 2HS8A 5LSMA 3CK5A 2XH4A 3I7SA 4BWLC 2PS2A 1J01A 3L12A 4AFYA 5AHNA 4DYJA 3P8IA 3GW0A 3LLFA 4DO6A 1Q6GA 5ABHA 3TQPA 3TNOA 4A3QA 1RH9A 4KMQA 1UASA 3B9DA 2YA2A 4AC7C 3R5EA 3BLIA 2YB1A 3LPGA 3FXGA 2BP1A 1B30A 1KM4A 3UGVA 5I24A 2DGAA 4ZXLA 2Q6ZA 3M44A 1Y5WA 1UKSA 3DUGA 1FHLA 2YOCA 3GR4A 6REQB 3VABA 5HXMA 1KTCA 4HMDA 3DC8A 1TKKA 5AYBA 1SFJA 2HDJA 2JF7A 4R9OA 3LUTA 2PP3A 4A6GA 4J4KA 4DUXA 3KS6A 1JRBA 2R91A 3ZQ9A 4LANA 4AX6A 3ARWA 2EHHA 1QFEA 3CXOA 4CN1A 3TN3A 4KESA 1XGDA 4QROA 4CUCA 1CGYA 2PTZA 3WJZA 3SRFA