5G4WA

S. enterica hisa mutant d7n, d10g, dup13-15 (vvr) with substrate profar
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
231
Chain Sequence
MIIPALNLIGGTVVRVQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISAGSNVSLYEEVCAYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
molecule keywords HISA
total genus 80
structure length 231
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g4wA00
3AJXA 2QUTA 3IGXA 1KBIA 5E1QA 4QQ3A 5K7JA 4IXXA 3EXRA 4JIPA 1XBXA 3H53A 2DZWA 4JTSA 3NPXA 1LZOA 4DELA 4MYAA 4Q32A 2VFHA 3PF3A 1QNVA 4XUGA 2WQPA 2EKCA 1DQXA 3OVRA 5FF0A 4HNNA 4MFEA 4X22A 5D33A 3GAKA 1DORA 1XL9A 1PCWA 2RFGA 3GXTA 3HOJA 2X2GA 3DI0A 3O06A 4MIMA 4UFIA 4LVAA 4JTIA 3CU2A 3DAQA 1I8JA 4NZJA 3MP5A 3LLDA 1OFDA 3TFXA 2YXGA 1YDNA 1SFLA 2WO5A 5FEXA 5A5WA 2RDWA 4PFMA 5D2WA 3O6YX 4GWEA 4KFNA 3W88A 3Q58A 4Z1AA 5LZLA 4NNBA 3BLEA 3IGUA 1K02A 3S0CA 3G1XA 4NJGA 1QPQA 3BG9A 2V5BA 5HWNA 3HF3A 5DY2A 5DY3A 5I3JA 1GVQA 4YL2A 1KFKA 4UC5A 3S1UA 3ATYA 2NXHA 1DL3A 2DU2A 5C5YA 3WK1A 5IBXC 3TXVA 4I7VA 4PH6A 3OBKA 4BK9A 3TU9A 3UWZA 4O15A 1EPXA 4A21A 2XN1A 3HO8A 4LVBA 2WKJA 1ADOA 2QDGA 3NL6A 4PTNA 4NX5A 3ANYA 4AF0A 5LGZA 4N6EA 5AHLA 3FEMA 3BW3A 4IX0A 1ICSA 1GVSA 2OT1A 2DJLA 2FB2A 1JCJA 3E96A 5HUOA 2A6LA 3VE7A 4RX0A 5BMXA 1VHNA 1TB3A 3CEUA 4AVFA 1KV8A 2C3ZA 3N2MA 1LLWA 4P61A 2CZEA 2A7PA 4ZQRA 2R91A 3QW4B 2W0UA 3EB2A 1XKYA 3G3MA 1JRBA 4C1KA 3DFNA 1LDCA 3HQ1A 1G69A 3EWBX 5DXXA 3QYQA 1ZCOA 3WK3A 1EWEA 4UTKA 1XI3A 4U4MA 2CLLA 4RJEA 4H3DA 4NX0A 3LB0A 1H63A 1C9DA 1I2NA 1K7EA 1P0KA 2PRLA 3EKLA 1OF6A 5G1TA 5AHEA 2GJLA 1QDSA 4CNOA 2ATMA 3ABOA 2PE4A 2KZHA 4AWUA 2NV2A 3PG8A 3DHDA 1A5CA 3LCIA 3TW6A 2DZVA 3I68A 1MO0A 2R94A 3LXBA 4ZMGA 4IUOA 5J5DA 1UASA 1Q45A 3QPZA 2NWRA 1W3IA 3LCXA 3DGRA 1FQ0A 5EKYA 2E09A 2QF7A 3RFAA 1ALDA 1BWLA 4X2RA 3PC0A 4TO8A 4MZ8A 1SW0A 4UMCA 4IXHA 2EGZA 4OV9A 1E51A 5CSRA 2CLKA 3KVKA 4JTJA 5TBOA 5CPNA 3E12A 3P8IA 2QCGA 4MLRA 5C6MA 3MHFA 1L6YA 2WPBA 4BWLA 4N2YA 3SIZA 4FEZA 3HG2A 3HIJA 4XZ9A 3TR2A 5CKSA 1RVGA 5HR7A 3W9ZA 3W1UA 3N73A 5ABTA 4Y6GA 3UWQA 3W73A 4WZHA 2JKPA 3SR7A 3N19B 3RU6A 4NZFA 2CLIA 3ZS4A 1H62A 3NQGA 3WK0A 3GIYA 4O1DA 4ORMA 3BARA 1W3NA 2DZTA 3DU0A 4OT7A 1RQHA 4HHPA 1O95A 2V30A 3L9CA 2QCNA 1VCFA 2GQ8A 3R2GA 5LNRA 1TV8A 3W76A 3C56A 2A21A 4GJ1A 3UWVA 3CM4A 2Y85A 4FIRA 2BSLA 4LVDA 3W7PA 3WFAA 3BK0A 3IEBA 5AHIA 2UV8G 1LTDA 1KW1A 4BI6A 4WY0A 5HINA 3CIXA 1PS9A 4NXKA 4WXZA 1WOBA 4AB4A 1KTBA 4P2VA 1IXPA 4JICA 3S42A 3NM1A 4UFLA 4M6PA 3GDKA 5J5RA 1JULA 3THAA 3TKFA 3NZRA 1TRDA 3CPRA 3P67A 2WOQA 1GG0A 5CPOA 1KM6A 4HPXA 4DBEA 4O13A 1F73A 4Z08A 2PCQA 4RV8A 1T99A 3TQ0A 4HT3A 1NSJA 2PURA 4ONVA 3P7YA 4O1AA 4X9SA 1TYGA 2VELA 2H90A 3MP3A 4U28A 4MY8A 4AF0B 1ML1A 3HGJA 1M6JA 5EY5A 3M0ZA 3SGZA 3IIZA 3GNNA 2E68A 4O18A 5G2IA 4DXVA 1ICPA 4ZQOA 4LC6A 2TPSA 4FNRA 1KTNA 2V81A 4LS1A 4RK8A 4JTHA 3C6CA 2NX1A 2Y63A 3S5OA 1YDOA 3NL3A 1VJIA 4GUHA 1WOAA 3LTPA 4JYDA 5A8GA 1FCVA 3LLFA 4ZQMA 3LHWA 4O0ZA 2C18A 3FJLA 3TQKA 4XWUA 1IXNA 1XXXA 3VI2A 3UQNA 3WJXA 3Q2DA 1WAUA 2JKAA 2Z6IA 1HO1A 5CSSA 3MMTA 1UCWA 2QCLA 1TPUA 1PCKA 2WSQA 4JYFA 2A7NA 1G7VA 2ZCGA 3R5EA 2XFWA 3GR8A 4EWND 3GX9A 1W5OA 3DFOA 4OV4A 4YMZA 5LNSA 1SUXA 1UBSA 3S1VA 2Y61A 4OHQA 3SFKA 1KA9F 1AW1A 5DCEA 2E1DA 3HGOA 2NUWA 3EWUA 1YTDA 1OABA 2QR6A 1I2QA 1OF8A 4PL1A 1WV2A 4Y9AA 3M5ZA 4JR5A 2AQWA 3PY2A 5HJLA 2TYSA 4LTSA 3BO9A 4LUIA 3G0UA 4L4LA 4YCPA 1K3UA 3O15A 3LERA 1TQXA 3FKKA 1ME7A 4MPQA 1BWKA 1KLZA 4NJIA 3ZFHA 1MXSA 1ZENA 2NXIA 3KRSA 3S1XA 3P81A 1TPC1 5TQLA 1XUUA 3NM3A 2P1FA 1ZAHA 4QM1A 1KFCA 1FY6A 4GXMA 3W2KA 3OG3A 3M6YA 1AW5A 1OHLA 3GXNA 4XKYA 3OA3A 2RH9A 2Y7DA 1OFEA 1FWNA 5FEWA 2B7NA 1VGAA 3KOFA 4AWTA 3NQVA 3HBLA 2A0NA 4DQWA 4JD4A 1XBVA 3TSDA 2VFEA 3NQ6A 3W74A 2V2DA 8TIMA 2E6DA 4NU7A 3PSVA 3W85A 1YTEA 5HULA 1SFJA 2Y89A 3UY8A 5D30A 3S1WA 3UPBA 1K8XA 4ICNA 2Z2UA 4JYEA 1J4EA 3C2VA 1ME9A 3R8RA 3AO0A 1FUYA 3MYPA 3NQ7A 1EX5A 5LNWA 1AL8A 1G67A 3QMTA 2FPTA 1F2JA 1KFJA 4LWWA 2C6QA 1FBAA 2PRMA 4UTTC 1EUAA 4W9TA 3DHFA 2A1YA 1QCWA 1IIGA 3W7GA 4CQAA 5KITA 1OX6A 3TQVA 1JJKA 2E77A 3GDMA 4UUIA 3NQAA 1H1ZA 5T26A 2DZPA 2I14A 4EF9A 2C15A 2CLOA 3I7QA 4TMCA 2EAWA 4B5NA 4N9CA 2OZ0A 4O54A 4PEKA 4O57A 4IPJA 3CLMA 4DF0A 3IVTA 5HMSA 2CLHA 1FCUA 5G4EA 3TW7A 4IMCA 4OU1A 1RR2A 1HUVA 3GB6A 4RZ6A 3I65A 3W07A 2ZBTA 1Z48A 5D32A 3IIOA 4UTWA 1PIIA 2O7QA 3NDOA 2DJXA 4UMBA 1QOPA 4DBDA 5FESA 3HG4A 1HL2A 1L2UA 3N9SA 1G4PA 1TIMA 2DZXA 3FA5A 4IOTA 2VEMA 4JXCA 4ML9A 3LTSA 2J24A 3P5ZA 1H51A 3E0IA 5CZ0A 3CHVA 3NQEA 4JX6A 3TJXA 3S9YA 3SSJA 1MEIA 4EVZA 5IBXA 3CTLA 2VEIA 4K8EA 4QITA 1VC4A 4OGZA 2YCEA 5FF4A 1AK5A 1F74A 2ZRVA 5D05A 4TU1A 3E9AA 1DJQA 5AHMA 3PG9A 1L6WA 3L0KA 4UFKA 4UMAA 4CQ9A 1K8YA 1G4EA 1PE1A 3M16A 4AH7A 3EWXA 3LHTA 3LDVA 4MLJA 4PCFA 4DO6A 2B0MA 2QCDA 2WJZA 4GE8A 4HPJA 1TSIA 3LI0A 1YTKA 3B0PA 1IXQA 1I45A 4ZZ9A 2ZA2A 1T8XA 4JX4A 1QFEA 4O0KA 3W7RA 5DCBA 3JS3A 3TX9A 4BI5A 3LTYA 5AYZA 1TCDA 3SJ3A 3L68A 1B3OA 4JGDA 4Q4KA 3TC6A 3STEA 4IMEA 4A29A 5D38A 2I1OA 1L6SA 4NJKA 3IIXA 3QH2A 4LT9A 4O10A 5F1UA 5KSWA 3DI1A 4O28A 1OX4B 1XUZA 1RQEA 1N7KA 1GYNA 2B7OA 1S5WA 2JGYA 4JTGA 1NAL1 3UZJA 4JDBA 2QCFA 4FNQA 1W3TA 3KFTA 2P10A 4O52A 2VENA 1A5BA 2JGQA 1DVJA 2CZDA 4K39A 4M19A 1M7PA 1Q6RA 1GYLA 1QO2A 2FLIA 3M9YA 3PWAA 1X6UA 1SW7A 5F4XA 4O8RA 1O5KA 4KFPA 2PRHA 4LS2A 1JQVA 2DP3A 3QSTA 3W2JA 4LOCA 2Y6ZA 2CZ5A 2V82A 2Q3RA 3DBPA 3NGJA 2Z1BA 3P8JA 4PC8A 2ZZ5A 3DFQA 4UTUA 1WDWA 4Q33A 4WOQA 3BW2A 1JCNA 5AC7A 3G3DA 2H3BA 4M6VA 2YX0A 3L66A 3KVMA 2VFDA 3NVTA 4ADTA 1R2SA 1FX6A 3F03K 3S5ZA 4GUIA 3PUDA 2VFGA 1ZAIA 3NO5A 4K37A 4O14A 4IGHA 3QF0A 4ZQCA 4O19A 1R30A 1N55A 4GFSA 2YYTA 3G1AA 2JBMA 1QPRA 1OVDA 2E5CA 3LGEA 5KINA 1GOXA 1X7FA 3B05A 4KWWA 1UB3A 1XDLA 3LHVA 1WXJA 5KZDA 1W31A 4X3ZA 1VS1A 3LBMA 2G97A 4ZQNA 3CC1A 1GWJA 3RLVA 1P1XA 4UCGA 1I4NA 3C2RA 4NT0A 4N9DA 1H61A 2WSRA 3L0GA 4K7YA 3W7OA 4UFJA 1SSGA 3TK7A 2VC6A 4CNPA 1JCXA 4R34A 1H7NA 2ZA3A 4DO4A 4DO5A 3L2IA 3B06A 1FWSA 1R2RA 2EHHA 2VEPA 1F7BA 4QIUA 2NXGA 1SO5A 3EX2A 4I7WA 2OMAA 2TSYA 1K7FA 3MP4A 1YDVA 3PVFA 4N9BA 1VLWA 1M7OA 1VLIA 1ME8A 3NQ8A 3LRMA 5CZSA 3U6WA 3HMJG 3QPYA 2C14A 1L9WA 2YR1A 1Z41A 5MHBA 3H54A 1OG0A 1LOQA 4UTWC 1DHPA 1LP6A 1KFLA 3S5NA 5K9CA 5HWJA 1ZFJA 2CZFA 1CX9A 5K4XA 5FF7A 3S5YA 3P62A 3B0UX 2J27A 5BRBA 3W86A 3H55A 4WOZA 3HPSA 1GEQA 3MUXA 1DQWA 3LI1A 1YPIA 1WBJA 2D73A 4GUFA 1H7PA 3KAOA 3QMSA 1W54A 4MFDA 4NVTA 4DF2A 2ZZ6A 3W2NA 1UUOA 5G1YA 1R46A 5HNRA 1A5SA 3W1LA 2A7RA 4FNSA 3W1TA 2CLMA 4JTUA 3IVUA 3JRKA 3PULA 5KTLA 1GTEA 1U5JA 1PHQA 1IIHA 5K9DA 1H7RA 4A3UA 2WV8A 3EXTA 1TJPA 3W3OA 2HMCA 4RR4A 3C4UA 4CCCA 4QISA 3HGRA 3NA8A 5TIMA 3W22A 3W7HA 1KM1A 4XQ6A 3L5LA 3GZ3A 4FF7A 3UPWA 3HPZA 3CIWA 2HS6A 4YXGA 2C16A 4Y90A 4HIBA 1OFQA 1U83A 2RDUA 2B7PA 3NAVA 3T4CA 1Q3NA 3A5VA 1OYCA 2ZQ0A 4UR7A 1ZALA 4LRSA 4LC8A 2ZRZA 1JUBA 3M43A 5C2XA 1IXOA 5AN7A 5EPDA 3F4NA 1FDJA 1KM2A 2ISVA 3MBFA 4E0CA 3STGA 4NJJA 1O94A 4JIQA 2J9ZA 1ZNNA 1VZWA 3NQCA 4N4PA 3WJYA 2FIQA 3EX3A 3G1DA 2FFCA 5G2WA 3OVPA 1OK4A 1ICQA 1V7YA 3QEZA 4FNTA 3TCEA 3CB8A 5D02A 3TH6A 3QRHA 3NQDA 3N14A 3L21A 1QWGA 1W1ZA 4UXDA 3GK0A 1ZY9A 2EPHA 3FYPA 3GXPA 1B9BA 2QCEA 2R14A 5LNUA 1W5NA 1O60A 2ZFAA 4LUJA 3MI3A 1KM5A 1LCOA 3W2LA 3MJYA 5CZTA 2BLEA 2TMDA 2VFIA 4HSOA 5D04C 4UNLA 3TROA 3W6YA 3A21A 1OFBA 3ZWTA 2ISWA 5SWUA 3BPWA 3C2OA 2QCCA 4JS3A 3STCA 4QJ1A 2J9XA 4LNYA 1FXPA 3L67A 1OJXA 4S1FA 3IIPA 2QJIA 1XC4A 4MYXA 1I2RA 3QM3A 3M5VA 1WQ5A 2CU0A 4A2SA 1GTHA 4KKXA 5F2GA 3MI2A 4IJBA 3NQ2A 4FO4A 4LU0A 5LKYA 1KBJA 3V75A 4LY8A 3L5MA 4O4VA 1LRTA 4LV4A 4KWVA 1PL9A 1AG1O 1YLVA 4CCDA 4IMFA 5LGXA 1X1OA 4M6QA 2EF9A 4C1LA 2X16A 1GVRA 3C2FA 4XBKA 1SR9A 3T44A 4FNUA 3G0XA 3MWAA 2GVJA 4IMGA 2ZTJA 2YFNA 3QMRA 4UTJA 1W0MA 2ISSA 3M44A 3RNDA 3W7NA 1FDYA 1FWRA 3A9IA 4UNKA 3C2EA 3G8EA 1LBLA 1DKWA 4IWWA 4JTKA 3UYCA 1FWWA 4JNMA 1M5WA 3DZ1A 4FX6M 5AC8A 2H6RA 2J88A 7TIMA 3QSRA 1QO5A 5C55A 4YWIA 4AWSA 1OX5A 3P82A 3TMQA 1IGSA 5AYXA 1EIXA 3FKRA 2Y70A 4JX5A 4ZVJA 4D2JA 4FXRA 3VE9A 3NL2A 3QFEA 1TPFA 2NX3A 4N6FA 3SI9A 5FEPA 3U8GA 1OFPA 1KM0A 3PR2A 3UWYA 1P5BA 4ADSA 2VEKA 1XDMA 2Y62A 3B4UA 3DKLA 5CG7A 1HTIA 3IV3A 2E5DA 1QOQA 2ABBA 5LHEA 3N3MA 2X1UA 3M7WA 1FCQA 1ZAJA 3RLUA 1BEUA 1FDZA 3NYZA 3R12A 1WYIA 3R89A 3O05A 4FXSA 5BW6A 3ZR4A 3LRLA 2X1TA 1G4SA 4UTIA 3PSWA 4UFMA 3BLIA 2IQTA 3KRZA 4E2DA 5EMUA 1HO4A 5I3IA 1TJRA 3NR0A 2BXVA 3I7SA 1K7XA 5F4WA 5H91A 3EKZA 4MVAA 3YPIA 3VFLA 3R13A 3CWNA 3SY5A 1HG3A 3KRUA 3MBDA 5CPMA 1GQNA 1P0NA 4LW7A 3TA6A 1THFD 4I7UA 5D2VA 2RKXA 4H4IA 2Y7GA 3EWWA 4LV9A 3DFSA 1X8FA 3W1RA 1FWTA 3L5AA 3W2UA 4I9AA 4K6AA 2ZRYA 4JEQA 1RV8A 3EEGA 5LHFA 3G0SA 4WD0A 1PHWA 3MI6A 1V5XA 2B7QA 2GVLA 2C0AA 3DENA 4JY8A 3L0NA 1W37A 5AOUA 3QC3A 3W7KA 1KV5A 3CQ0A 4PODA 3BW4A 3HG3A 3G1YA 2ATSA 3PB0A 3HJZA 1VR6A 3EXSA 2NZLA 1TPB1 1DJNA 1RQBA 3NQMA 2JK2A 4JTEA 5DCDA 1YPFA 3NEVA 1Z44A 2FDSA 2GVGA 2YW4A 2NX9A 3TXZA 4QAIA 3GDRA 1NVMA 1SZFA 1TMHA 3FFSA 3MHUA 4O17A 3TE9A 4O53A 3VCRA 1T0OA 1G7UA 2B4GA 3PUEA 1SZGA 2WNZA 4WX2A 3G1VA 3RF9A 1OFOA 2JKEA 4XTDA 5D09A 1G6CA 4WJEA 3W7EA 4QNEA 3QZEA 1H7XA 2QDHA 5I3GA 1UUMA 3W1XA 1LBMA 4UTHA 1YYAA 2W79A 4FNPA 5D2YA 3LCWA 3NPWA 4IPIA 3GLCA 4E38A 4Z0SA 1AL7A 2YFOA 1Q6OA 2A5HA 4K8HA 3TNOA 3L65A 3LM7A 1VPXA 5KZMA 3PBUA 4O1CA 2GPTA 4FX7A 1GVOA 1W56A 3KVLA 3G8RA 4ZQPA 5I3KA 3WK2A 3W7QA 2QCDB 3M5XA 3LCGA 3T55A 3IIVA 3PUOA 3JR2A 1JCYA 2WNNA 4ZL1A 4PL2A 3W7JA 1DOSA 3VNDA 4OBTA 1H7OA 1OFAA 3NNTA 4QNWA 2YSWA 4UTLA 4GBUA 1RZMA 2E6FA 3TC7A 2ZRUA 5LSMA 3ABRA 1TRIA 2FJKA 5D03A 3ABQA 5LNVA 1LOSA 3FLUA 4ALDA 1SO3A 5GVJA 3HG5A 3TAOA 2E6YA 5IM51 3IGSA 5D2XA 4K7VA 1IF2A 1JQXA 4FB7A 1N8FA 3E49A 3P61A 5EBUA 3P80A 3UXDA 1J2WA 3BVJA 3DH7A 2GQ9A 5K4ZA 4RXGA 3G1FA 4DEFA 4GUGA 2G96A 3G18A 3LBCA 4HN4A 3B04A 1S5TA 3PBVA 1DV7A 2QAFA 1XCFA 3CT7A 5AC6A 3LXAA 1KLYA 4K36A 1C29A 3KVJA 4NQ1A 3W7DA 2ZRWA 4NNCA 3TAKA 3A5FA 1TTQA 2LLEA 4POCA 4A2RA 2RDTA 5I3HA 4MJZA 3NG3A 3TFCA 1YXYA 4FIQA 3O07A 3RK8A 1JR1A 3C0JA 5HQEA 1F5ZA 4AAJA 1B4EA 3U2OA 1S5VA 4Z1CA 1W5PA 2A2IA 3N34A 2ZA1A 1YXDA 3TUUA 1LRNA 4XTIA 1G4TA 3TIMA 4A22A 2CWNA 5F2IA 1GT8A 4RKAA 5U7SA 4TX9A 3T40A 3ABSA 3EX1A 1Q6QA 4LRTA 4IQLA 2R8WA 3Q37A 2QJGA 3PM6A 3RMJA 3F4WA 3B8DA 2P0OA 3C3NA 1LOLA 3W1QA 2VOMA 3NZ1A 5E93A 1VRDA 5AB3A 1D9EA 1JUEA 2ZZ4A 1LORA 4HNUA 2YDAA 3G24A 1TREA 2V5LA 4L4MA 2ZTKA 4RZ4A 4HNVA 1TPDA 2NUXA 1I2PA 3G1SA 1H7WA 3UY7A 4WQ6A 5K9XA 3N2XA 2F84A 2BX7A 4HNTA 1T96A 3LXCA 3BGGA 3N9RA 5H2ZA 2V2CA 3S6DA 4AHOA 1PV8A 1SO6A 1YADA 3C52A 2Q3OA 1H1YA 4HSNA 4S2BA 1TPWA 3M41A 3LHUA 4O50A 3W75A 1H60A 2Q8LA 1HFBA 3W7LA 3S8HA 1TTJA 1W8SA 1A50A 1SO4A 4G1KA 2X1RA 5K2ZA 3W83A 5KZEA 2ZDRA 5EYWA 4MKNA 5AFDA 4WXYA 4AHPA 5BMWA 5BNKA 3THQA 3PBYA 1RPXA 3WJZA 4NNAA 4YCOA 1KFBA 1KFEA 2Y88A 3A22A 3D0CA 1QR7A 1EWDA 3LX9A 3W87A 3HB9A 6TIMA 2DZUA 3W72A 4R53A 3DFTA 5K3VA 5CGQA 5DN1A 1MEHA 3LRKA 4RZ5A 1UJPA 1NF7A 3BGJA 3CWOX 1BTMA 1P4CA 2OJPA 4Z0JA 4O11A 1LROA 1VYSX 2HTMA 3QQ0A 4AEOA 4UTTA 3TSMA 2WSYA 3O6CA 3IVSA 3C61A 1WX0A 4LS0A 3MO7A 3P84A 3BLFA 3MW7A 4GC4A 2ZRXA 4ADUA 3GVGA 4Z1BA 3BG5A 3LV5A 3Q94A 3A24A 1SU5A 2GQAA 2QEZA 4AXKA 1TTIA 4M7TA 2CLEA 5DBUA 4NJHA 3ZWSA 3PB2A 3ATZA 1TV5A 4Y96A 2BWGA 3QJAA 3UNDA 2X30A 4PA8A 1QMLA 2CFFA 1OYAA 2J6XA 5L9FA 1YXCA 3FOKA 2OX1A 3NPVA 4IX2A 2V9DA 1XFBA 1A53A 1EP1A 2BZNA 3OEXA 2Y7EA 4OQVA 3UD6A 4QSHA 3ELFA 4K38A 1EP3A 4Z1DA 1TQJA 2QUVA 3M5YA 4FHAA 3GNDA 4GRSA 2GUUA 5AYYA 3I6RA 2FPYA 4YLWA 3KXQA 4EF8A 4O12A 1R47A 2QCHA 3FIGA 4WY0B 2C19A 3P60A 4AHQA 2GJNA 1EUNA 2G5WA 1VYRA 2Q8ZA 2VXNA 3TJLA 1WBHA 2C1HA 1WA3A 3DKJA 4N02A 4UFHA 4E2BA 4MJMA 5U4NA 2NWSA 3HPXA 3GYEA 4XKYB 1EEPA 1H5YA 3M47A 4WY0F 3USBA 2FTPA 1LLZA 4LVFA 1R2TA 1VCGA 1EB3A 1JCMP 5G2HA 1KM3A 3EWYA 1FXQA 1XBZA 4O16A 1F6PA 1GVFA 4OWGA 3W7CA 4UR8A 3LCFA 4JTTA 1XM3A 1F05A 1ZHAA 3NOEA 5C54A 3FS2A 4KFOA 3G22A 3O16A 1D3GA 2GOUA 3IRDA 4CQ8A 1VHCA 3UWUA 3B0VC 3NL5A 2AAMA 1B4KA 2NUYA 2Y7FA 1Z42A 3V1PA 4RXFA 3GR7A 1O5XA 3G1HA 3LHZA 5L6UA 2E6AA 2A4AA 1Q6LA 3BG3A 4GNJA 1Y0EA 1KM4A 5F2MA 1J5TA 5CPLA 3SGUA 5FF3A 3W1MA 2NLIA 4BFAA 2HSAA 4UTMA 1LBFA 5HR6A 4XBSA 2VKZG 2G95A 5D2TA 3W2MA 3PS7A 1SW3A 1W5MA 5I3FA 3EX4A 2H8XA 4NUWA 2YYUA 3INPA 2CW6A 1SZNA 1C8VA 1MZHA 3UZ5A 2QAPA 3I7RA 3TDFA 1GJPA 1CI1A 4RCXA 4MOZA 1I2OA 2YW3A 1XBYA 3O6DA 5F1VA 3A23A 5G5IA 2VFFA 1QPNA 2C13A 1VYPX 5AHFA 2ZZ7A 1OFRA 2V8ZA 4N9EA 2F7FA 2QUUA 4H6KA 4Y8FA 4O1BA 1QAPA 5AHNA 4TIMA 2V2HA 2FB3A 2XN0A 3HGSA 2A85A 3K30A 3WJWA 2ALDA 1LYXA 1MSSA 1X1ZA 1CW2A 4DPPA 2O7SA 2OT0A 2PC4A 5DLCA 3T7VA 3GDTA 1NFBA 4CLMA 5KMYA 4JDYA 2DORA 4EIVA 1VCVA 1JUKA 4MY9A 1EA0A 3STFA 4MZYA 1PVNA 3P5YA 2H8ZA 1F6KA 3GKAA 3LCHA 5E0KA 1ZJIA 1QPOA 1LM1A 2I9EA 3W84A 1TO3A 3GDLA 4S2CA 4MY1A 5EA9A 1SZEA 2ZZ1A 3OVQA 4UIOA 6ALDA 4JTLA 1OYBA 1A5AA 5EL1A 1AMKA 4N4QA 1K03A 4M5PA 2WNQA 2H3DA 3KHJA 3OIXA 4DPQA 1O4UA 3FYOA 3PBWA 2RHGA 4BWLC 1TTPA 1F76A 1JCLA 1EP2A 1FCBA 1TPEA 1GPWA 2W6RA 2ZYFA 3WJSA 2V0TA 2CLFA 1W5QA 5G4WA 3W71A 3W70A 4JN6A 4NXSA 3W1NA 1H50A 4AMAA 4CNNA 1B57A 3DFPA 3QQ1A 2TRSA 3BV4A 1BKSA 1KTCA 3W1AA 5DXYA 5FF2A 3VKJA 4ORIA 5F2LA 3T78A 5DBTA 3O1NA 2E5BA 3C8FA 3F1QA 5HWMA 3GAYA 3LOTA 2FPVA 2ABAA 2QKFA 1TV7A 3TSBA 4JTFA 5FEZA 3W23A 1TPVA 1OK6A 3GKFA 3O8AA 4IMDA 3MHGA 3TMLA 5F4SA 3W7IA 4FX8A 3CEPA 1K8ZA 2QJHA 3O63A 1AW2A 3MYOA 5D37A 4TMBA 2HS8A 3KX6A 1DBTA 1VQTA 4CCEA 3UXAA 2ZZ3A 4BR1A 4R7JA 3NQFA 1JVNA 5BOOA 1GZGA 2QCMA 1NEYA 4MUZA 3OHIA 3B03A 1GG1A 3LV6A 2NV1A 1MEWA 3EX6A 1OX4A 3NPUA 2X1SA 4BF9A 4LVGA 4MZ1A 2AGKA 3P74A 3SECA 3UWWA 4WUIA 1RD5A 1S3HA 1VH7A 4JY9A 1NF0A 3W7MA 3EWZA 4R33A 5HUPA 4GUJA 4BI7A 2YZRA 4HKPA 1SQ7A 2ZZ2A 3W1PA 1SSDA 2DZSA 1ONRA 3TV8A 4M7SA 4O4WA 2J9YA 2OCZA 2YGYA 2XN2A 3LHYA 4RLIA 5DELA 3SZ8A 1D3HA 4OE7A 3PAJA 3DXIA 2A6NA 3E02A 4TR9A 3NXFA 3SW6A 3M1ZA 4EOUA 1SPQA 2FQIA 2Z0IA 2BTMA 4J9JA 5CZJA 1TPH1 3QW3A 3FJ6A 5FI8A 4DF1A 1LRQA 2YPIA 3LCLA 1JRCA 2Z6JA
chains in the Genus database with same CATH superfamily
3AJXA 2QUTA 4WJ8A 5E1QA 2AL2B 4H2CA 3DFHA 3H6OA 4J3ZA 1ZRQA 2G41A 4JIPA 4GIEA 4C65A 1DIEA 4J27A 3H53A 2DZWA 4JTSA 5C2CA 3M0XA 3QTGA 2G3IA 4FPSA 4XUGA 2VZSA 2WQPA 4MFEA 1KBKA 4V33A 2X2YA 1XL9A 1YDYA 2RFGA 3GTHA 1W1TA 3ITXA 2X2GA 2I5QA 1RLCL 3HFYA 3IARA 1W8GA 3MP5A 3TFXA 2OZTA 3MMWA 6XIMA 1YDNA 1SFLA 3KCOA 4ZOEA 2RDWA 4PFMA 1T8QA 4XG1A 3W88A 5FAGA 3K4AA 3Q58A 5LZLA 4H9VA 1ZB5A 4MJ2A 3ERPA 4G7FA 3G1XA 3BG9A 5A6BA 3PPCA 3NZPA 2PBGA 4W86A 2YXOA 4YVVA 1M7JA 2PD9A 5CLWA 1MI3A 4L9YA 1DHKA 1P43A 2NXHA 1Q2RA 4KERA 3GR4A 1UWTA 3UWZA 3BWWA 1IYXA 1EPXA 1IV8A 4LVBA 2WKJA 1ADOA 3PTMA 4PTNA 3THCA 3ANYA 2Y4SA 5LGZA 1RJRA 5D9MA 4IZGA 5AHLA 1ICSA 2G37A 2IKJA 2OT1A 4GY0A 2DJLA 4WLCA 2FB2A 4RX0A 3QHMA 2ISDA 1V6UA 3WYZA 4YPJA 4H9ZA 4KETA 1E1FA 1UMLA 4AVFA 3CEUA 2ZX9A 2WMJA 2CZEA 1DJZA 1VENA 4IGSA 4KEMA 2OYKA 4AC1X 4C1KA 1G69A 1CWYA 3EWBX 3AUOA 4W5UA 2Z26A 3WK3A 1EWEA 1NY1A 4G56A 3EOUA 1O12A 4KWOA 2CLLA 1BYBA 4V1XA 1A4MA 5AHEA 4RW5A 3FAXA 2EJ1A 2NV2A 2QPXA 3PG8A 1A5CA 1RA0A 5B7ZA 3TW6A 2BXZA 2DZVA 2WKLA 2R94A 3LXBA 3SADA 1T6MA 5J5DA 2OSXA 1PSCA 4L1GA 3CHDA 4S3DA 3DGRA 2E09A 3V7PA 2R82A 1ALDA 1BWLA 2YL5A 5EFFA 3PC0A 4TO8A 5E70A 2J7GA 4UMCA 2Y24A 4IXHA 3EDFA 4JTJA 3E12A 2HBVA 2QCGA 4MLRA 1DJWA 1L6YA 2BXYA 1UJQA 5KZ6A 4N2YA 1PXGA 3EAUA 1HKWA 2YL9A 4Q8MA 4XZ9A 2XVPA 3IK4A 5HR7A 3W1UA 3ES7A 3VNIA 4IL2A 4MB1A 3UWQA 1I1WA 1J6OA 2JKPA 4DHGA 3WBAA 3U57A 2NVDA 3NQGA 4GHRA 4L1WA 3VVGA 1EQCA 3GHSA 2R24A 4NF7A 3GTIA 4ORMA 2V3FA 3BARA 3BTNA 4OT7A 1US3A 2GSJA 3AHZA 2QDDA 2V30A 3AYVA 3OW1A 2QCNA 1XG4A 2GQ8A 3W76A 2Y0FA 1CXEA 2ZUNA 2A21A 1S46A 4IF2A 2BSLA 2OODA 4LVDA 1Q2SA 2ZUVA 3CK5A 3T1GA 4B9YA 3BURA 1AUSL 1YEYA 4CNSA 2WZIA 4A35A 4GA8A 3ORWA 1WOBA 4AB4A 3PPGA 1IGWA 3NM1A 4UFLA 4GI9A 1JULA 3TKFA 3QV7A 3K2GA 3PANA 5AZ0A 3RR4A 3PZTA 1KM6A 1UKTA 4EPDC 4A05A 4O13A 4BA0A 3BV7A 1T99A 4HT3A 4YTUA 5HQLA 4ONVA 3P7YA 1XDJA 1Q6CA 4PMXA 2VTFA 1TYGA 2MUCA 3RMEA 5JH1A 5JBFA 1GQKA 3A13A 4JN8A 4JL2A 2Y8VA 1ML1A 3WQDA 3HGJA 1M6JA 3SGZA 3P6LA 1I75A 4O18A 5G2IA 2DH3A 1V08A 3WMCA 4FNRA 2XPKA 1Y5VA 4PTVA 2JEQA 3CMGA 3WEOA 4XZBA 2E9BA 2J77A 4GD0A 2Y63A 4ZE4A 1YDOA 4FA3A 5A1AA 4QAWA 2IXUA 4O1EA 1SFSA 5A8GA 1X8CA 4O0ZA 1EOMA 5M03A 4B9ZA 1JAEA 3TQKA 4AD2A 2DEPA 3R4IA 5HPOA 2WBGA 4IIHA 3Q2DA 3N2CA 3BCFA 2Z6IA 3JUGA 3MMTA 4HZ7A 1ESWA 2D2HA 1PCKA 2WSQA 1KBBA 4WR3A 4F3HA 1UC5A 3R5EA 1GKQA 2XFWA 4KRTA 1Z9AA 4DI9A 4M6UA 4AZBA 5JU6A 5BXSA 1UBSA 3S1VA 1QT1A 2Y61A 3B0XA 4X0NA 4YS1A 4RDZA 3T8QA 4QLKA 4TVDA 1UD8A 1D3CA 2NUWA 3ZZ1A 1OABA 2QR6A 4IIFA 3PK7A 4INFA 3R0UA 4B5VA 3EDDA 3M5ZA 2FZ8A 4W87A 3SEPA 2AQWA 3PY2A 2OTDA 2TYSA 4G6CA 5LA0A 1UW9A 3H8AA 3PJTA 4DO7A 3R8GA 4L4LA 1K3UA 3O15A 4JFSA 1RPKA 1TWDA 4LF1A 1TWIA 5CC5A 3MSYA 2HWGA 3AHYA 4BQ4A 1TPC1 1ZJAA 1P6CA 3CL8A 3KEHA 3NM3A 5CLTA 1W1IE 1EJVC 1TE1A 2NSXA 1E5JA 3T05A 1SM9A 1ZP3A 3OG3A 3ZJ7A 4DLMA 4C6BA 2IPGA 5ENLA 1S2VA 2RH9A 2Y7DA 1OFEA 3VDAA 4BHYA 3BSHA 5FJOA 3WQ8A 2VX7A 4DAIA 2A0NA 1CZ1A 4DZAA 3CYVA 1B2YA 2VFEA 3ZT7A 8TIMA 2E6DA 4NU7A 3W85A 3UY8A 1SFJA 3S1WA 2Z2UA 2WMHA 1J4EA 3IJLA 3G2GA 1LQAA 4MMWA 1ME9A 1FUYA 3ARPA 5D8ZA 1JYXA 4LALA 1FBAA 2PRMA 3DHFA 1K4GA 4NZ5A 3AHTA 3BE7A 5KITA 1OX6A 1PX3A 1QNQA 2YCJA 5BCAA 1X1NA 2YZ5A 3NQAA 5FJRA 3OJGA 2WWCA 4PB5A 3I7QA 2EAWA 4B5NA 4N9CA 2OZ0A 1E71M 2CNCA 4PEKA 3AYRA 4B5TA 3SY1A 4DF0A 3UGRA 3WH7A 2WNWA 3UZXA 4OU1A 1RR2A 2HROA 1AZ2A 3ICJA 1VD6A 3VABA 2X8RA 3M0LA 4WVXA 1EH9A 3E74A 2OEMA 2XIQA 1E1CB 2HVOA 3RM8A 1H49A 4UMBA 1QOPA 4DBDA 5C71A 1L2UA 1UD3A 2Z1XA 3FA5A 4IOTA 4QEHA 1LUCB 2R1KA 1D2KA 3LTSA 2J24A 4DWSD 3LPGA 4TV5A 3E0IA 2G3FA 1IZJA 5CZ0A 4R88A 4GKLA 4DJEC 4JNYA 4K8EA 4FXFA 3WDRA 4OGZA 5FF4A 1AK5A 3VGHA 5AHMA 4US5D 1L6WA 4Q7BA 5M5DA 1LQ2A 4CQ9A 3S9ZA 1PE1A 3OZMA 3M16A 2PZNA 1QHOA 1VFTA 3A4WA 2WJZA 4GE8A 4HPJA 3S6OA 1TSIA 3SDOA 3FHAA 1HGYA 2ZA2A 3FXGA 1YPXA 3FDKA 4JX4A 3M7SA 3JS3A 4BI5A 5AYZA 1TCDA 1XIBA 2QUNA 2FTYA 1EJSC 1WKEA 1B3OA 1FHVA 3ECQA 4E3TA 3STEA 4IMEA 3AS0A 4LT9A 4O10A 4O28A 5CSUA 4HMCA 1IWAA 3CZJA 3QC0A 4FALA 3VMPA 1GYNA 1HKKA 4HZ6A 1RVKA 1NAL1 3UZJA 1KGWA 4AY7A 4FNQA 1W3TA 1JPKA 4O52A 2I7GA 3IAQA 5I07A 1M7PA 1KXHA 2AOSA 2FVMA 1YW1A 3AIEA 5I79A 2D0FA 1QXLA 4LS2A 5MKGA 3WF4A 1JQVA 5DT5A 1VBJA 2FH6A 4DUOA 2OOGA 4LOCA 2CZ5A 3MQTA 2E25A 4J5NA 4PC8A 2ZZ5A 3FW6A 4P5UA 3CHFA 3V0TA 3DFYA 1KNWA 4H2HA 5LIXX 1MDRA 1HKMA 2VFDA 4GFIA 3REQB 1VKFA 1V0KA 3PUDA 4A3RA 4K37A 2HNHA 3NO5A 1JPHA 3IS4A 1XWYA 5IDZA 3AICA 4IP7A 1A47A 3UW6A 2E4TA 1EJRC 2PDLA 5KINA 1CXIA 1UB3A 2KAUC 3LHVA 4RW3A 1WXJA 1RCQA 4HK5A 5KZDA 4U31A 2OLSA 1W31A 3OB8A 3LY0A 4ZQNA 3CC1A 1GWJA 1EJXC 1GQLA 4GISA 3C2RA 4RDVA 1XLMA 1NH6A 1XX1A 3AC0A 4C1NB 2WVTA 4UFJA 1SSGA 3CBWA 3V4BA 2XIIA 3H22A 3MJMA 4HPGA 2QPSA 4C91A 3WF1A 4X63A 4S3CA 4H8UA 3G77A 4PR4A 1FWSA 1XLHA 3I3EA 4GIRA 4QIUA 3A3HA 2VHLA 3H2EA 3L7RA 2OMAA 1YDVA 4JTAA 2YXXA 5ABHA 2DSWA 2J7DA 4GBDA 3F4DA 5CZSA 3BZGA 2C14A 2YR1A 4RE0A 5MHBA 1LL7A 4E4PA 2E9MA 1XLKA 4UTWC 2QVHA 1UH3A 1MQRA 3S5NA 5K9CA 4P7LA 1CX9A 5K4XA 5FF7A 3S5YA 4DUXA 1E9YB 1S3TC 2FZNA 1XH2A 3GH5A 3OIHA 2WPGA 4EAMA 5JBEA 1H7PA 1P6WA 3KBNA 1YMYA 2ZUSA 3WLIA 1R86A 3BOLA 4LBUA 4EPEC 3ARWA 4Z2HA 3BMWA 5K9DA 3QY6A 3W3OA 4I3GA 4LCSA 4RR4A 3SCVA 4L4OA 3W22A 5A8NA 3K4DA 3W7HA 4XQ6A 1B9ZA 2WB5A 4FF7A 3H21A 3VIFA 2HS6A 2C16A 4DXXA 4KESA 1UD2A 2BY2A 4MADA 1OFQA 2RDUA 3NAVA 1C9WA 1JZ3A 4PFHA 4XISA 3BSGA 2ZQ0A 4HQVA 3BXWA 1W32A 1ZALA 4D9PA 4LC8A 4J28A 5C2XA 2WHJA 5C9WA 4FF5A 2J8FA 2ISVA 1FWCC 1MVYA 1NIUA 3STGA 1O94A 4JIQA 1ZNNA 1VZWA 3UJRA 3HQPA 1P7TB 4N4PA 3WJYA 3VK5A 3OHMB 2VWSA 3EX3A 3G1DA 4ICCX 3EOSA 3FEQA 2PWVA 2DW6A 3APTA 3P3BA 4QX4A 3TLLA 4EXBA 3ALFA 4AD0A 4GXPA 4LH8A 5H8MA 2OEKA 3B9AA 1KM5A 3MI3A 1TUFA 5BXRA 2EPKX 4MG4A 1UWUA 3ZWTA 1BQGA 3KBMA 2QCCA 4CVWA 2J9XA 4LNYA 4RPQA 3L67A 1M65A 1OJXA 2NQZA 3VILA 3BC9A 5DF0A 5DMNA 2QJIA 3GG1A 4IFKA 1R3TA 4A2SA 5F2GA 3FVMA 4FO4A 4LU0A 1BVNP 3V75A 4LY8A 4HVXA 4U33A 4O4VA 3QZAA 4CCDA 4K8GA 3GG8A 5LGXA 1YRRA 2J6VA 2CITA 3F5LA 2W66A 2X16A 3KWSA 3OA5A 3R79A 4XBKA 1SR9A 4PUKA 4D71A 2V68A 5FJTA 1V3LA 1BFNA 1UC4A 1O1ZA 2ZTJA 4MM1A 1EYWA 1W17A 2ZUUA 4UOJA 3QMRA 4HA0A 1W0MA 1VRXA 4UNKA 2W3ZA 3PTDA 1LBLA 4W8BA 1DKWA 3BLPX 4MWAD 2AQVA 4JNMA 1OGSA 1M5WA 3KS5A 2HV5A 2J88A 7TIMA 2BGSA 1ECEA 2ANUA 1UUQA 1IGSA 2GK1A 5CBIA 4C90A 1FP8A 4M80A 3IJ7A 1ECQA 3LPPA 2I56A 5EMKA 4FXRA 2X7WA 3SCSA 4XO6A 3QFEA 5AKQA 1QATA 1DXFA 1W1VA 3U8GA 2PLCA 1KM0A 3QOMA 4ADSA 1H11A 2D22A 1XDMA 3UJEA 1HTIA 3IV3A 2E5DA 1QOQA 1A5OC 1ZAJA 3NYZA 3U7BA 2VQUA 3QGAC 5BW6A 3LRLA 1IEWA 4KMQA 5HPCA 2A3LA 4UFMA 1Q63A 3AMGA 2PF8A 1O7AA 2E67A 5H91A 2DV0A 1QVBA 1RP9A 4LBSA 1XLBA 3YPIA 2INFA 4MJ4A 5IFPA 1EEXA 1W9UA 3R13A 5IDIA 1LL4A 1S38A 3PBMA 4QTGA 2EPLX 1P0NA 3TA6A 4KW2A 3M0VA 3G6MA 3P14A 5D2VA 4H4IA 4JFTA 3DFSA 1X8FA 3W1RA 1ODZA 1C7SA 1TE6A 1J79A 3ZLGA 4K6AA 2ZRYA 3RPMA 4JEQA 2B31A 3EEGA 3VD7A 3AYSA 4WD0A 1PHWA 1R85A 2XHYA 3PP7A 3W7KA 3CQ0A 1DWFM 1G5AA 4Q4SA 2NZLA 2E9LA 1DJNA 3W81A 3NQMA 3VYLA 3DUGA 3MPGA 4JTEA 5DCDA 1MQQA 1C8YA 1XSKA 1YPFA 4RE3A 1Z44A 2Y5SA 3GDRA 3OODA 4QSFA 4O17A 3TE9A 1FWDC 3PUEA 2WNZA 4IISA 4C6IA 1OZQA 2VCBA 2OXNA 1CTNA 3DC8A 3AZSA 4IUGA 1LBMA 3FCPA 3LPOA 1C7TA 4KIRA 1YYAA 3TTOA 4FNPA 2XJ7A 2QGHA 3U5UA 4Z0SA 4K8HA 2CCRA 3LM7A 4JCMA 2XISA 1UA7A 4J3TA 2X42A 3F5JA 3PZIA 1T40A 1WDSA 4UQCA 1H41A 3COTA 1W56A 3CYJA 3C0LA 3G8RA 1Q7MA 1US0A 2WWDA 3VIJA 4H19A 2QCDB 4OUEA 3LCGA 1DJGA 1E4NA 1GW9A 1K6WA 1KXTA 1OADA 2Y8KA 4F9JA 4S3JA 3W7JA 4PRRA 1H7OA 3AS3A 1E0XA 1LG2A 1A0CA 5IXEA 1SJCA 4YVPA 3XISA 2JFEX 4EXQA 3BJFA 3FLUA 3HG5A 3TAOA 2VQTA 4XZIA 2GVEA 5I6SA 2E6YA 3VIKA 4K7VA 2PFHA 3IJIA 4FB7A 1AQMA 1N8FA 3LPFA 3P61A 5DFAA 5EBUA 3OGSA 1KQZA 1H09A 3LBCA 3B04A 8CGTA 4C6PA 1XH0A 1DJIA 5AC6A 2EO7A 3KTSA 2CHNA 2GVYA 4CQBA 3W7DA 4NNCA 1VF8A 1TTQA 3NYDA 3R11A 5I3HA 4MJZA 2OPJA 1X6NA 1XLEA 3RK8A 1JR1A 1IEXA 2PU1A 1GKRA 1A3WA 1F5ZA 1B4EA 1RLDA 3U2OA 1S5VA 4Z1CA 1W5PA 3FJNA 1R3WA 2G4FA 1OCJA 3CQJA 4XTIA 5I06A 1GT8A 2DT2A 2D0HA 3NO1A 1EOKA 4TOQA 4LRTA 2QJGA 1HVQA 1EJ7L 3C3NA 4PMJA 3W1QA 2F6KA 1VRDA 1KD0A 2XIMA 1D9EA 3PTKA 4EACA 1DEDA 1LORA 3ITVA 3T8LA 1E6ZA 3G6LA 3N15A 2V5LA 3E5BA 4RZ4A 1VAHA 4GO8A 4H7ZA 1I2PA 3FJ4A 4D8LA 3UY7A 4ATWA 2CXGA 4HNTA 1C92A 1RCOB 3N29A 5H2ZA 4ZO8A 2V2CA 4U10A 4AHOA 1PV8A 3DESA 3VGBA 4HSNA 1ADSA 1EGZA 1TPWA 2OLHA 3SSZA 3E1F1 4XZLX 3W7LA 4WEVX 1ISXA 3SUWA 2XIOA 1W8SA 3TYEA 4KS0A 4G1KA 1JPMA 5KZEA 4OUIA 2ZDRA 3GS6A 4AD4A 2PTDA 5FSEC 3D3FA 1KFBA 4XKMA 2Y88A 1T7LA 2YDQA 1Z3NA 3D0CA 1EWDA 2PDWA 3LX9A 1XLGA 1Q65A 2D1ZA 2PP0A 3RR1A 4QROA 3U0HA 3W72A 4PMYA 1MQPA 3DFTA 1P1MA 8XIMA 3GHTA 2WHMA 3BSMA 4H6QA 1WKYA 4AFYA 1A5LC 1UJPA 2VUYA 1HXJA 4OECA 1K9DA 1BTMA 5C2GA 2OJPA 3SBFA 3WLQA 1W1PA 1CT5A 5A94A 4IICA 3H7UA 4U2ZA 5I77A 4XD3A 4R85A 2WSYA 3MO7A 3B4YA 3P84A 3BLFA 5G1MA 3AZRA 3BG5A 3GW3A 4YVXA 1QNRA 1SU5A 2HISA 1HL8A 1WZMA 4QHRA 3SUVA 1X98A 2ODOA 4NJHA 2J25A 3BAYA 3PB2A 1JF6A 5I03A 1ITXA 4Y96A 3UNDA 4Q8NA 4ACZA 3EOLA 4US6A 3WQEA 1JPIA 4HOZA 1LWHA 3OEXA 2PLJA 3ELFA 4K38A 2VX6A 4FHAA 4GRSA 3M0JA 4PE8A 3AIRA 4LUYA 3KXQA 4O12A 4DB7A 1GHRA 3CUJA 4EANA 1W91A 3FIGA 2VD8A 3P60A 4QRNA 4AHQA 4PSPA 3WDHA 1EUNA 3GW0A 1DWIM 4ASTA 5C9XA 3LG3A 1RY8A 4MJMA 4H9XA 3EPOA 3HPXA 1KWGA 1BXBA 3USBA 4WY0F 4RE4A 1LLZA 4LVFA 4ECLA 3AIUA 7TAAA 1VCGA 4ZO6A 3CNYA 1W9XA 2QGYA 3QR0A 1GPFA 4IIBA 4IM4A 3LCFA 4WDTA 1ZHAA 3C86A 3GH4A 3FS2A 4KFOA 3V3WA 4H00A 3B9OA 1JI1A 3W6MA 3O16A 2JF7A 1HX0A 1NJJA 3ITGA 1D3GA 3WUGA 3N2BA 1E6PA 1RXOB 3LU2A 4E8GA 3GR7A 1O5XA 3TOYA 3G1HA 2EG7A 5CSYA 3WFZA 4GNJA 3BG3A 1KM4A 3T0TA 1PZ1A 1LBFA 5HR6A 4RZBA 1PAMA 3T81A 1SW3A 1W5MA 1OEPA 4C6KA 2H8XA 4PYSA 3BQ6A 1CIUA 1VFFA 3UZ5A 1ODUA 1JDFA 1GJPA 2W67A 3RIKA 2CHOA 2V69A 2VC9A 1M7XA 1XBYA 3O6DA 4BF7A 5I5RA 1GJUA 2XIJA 2VFFA 4NAFA 2FVKA 4MB3A 4XX6A 2ZZ7A 2F7FA 2J47A 2QUUA 4H6KA 1V6YA 1J11A 2V2HA 5XINA 2XN0A 4Z2IA 5BYWA 4FOKA 5EMJA 1DTNA 2GYIA 4MHBA 4DPPA 2OT0A 2PC4A 3LEPA 1NFBA 4JQ2A 2BDQA 1DXEA 4XBJA 4IIGA 3LGDA 4QG9A 1SJBA 3H2AA 1EO5A 3P5YA 1F6KA 2E40A 4FK9A 2F6UA 1LM1A 2HRWA 3STPA 1O68A 4S2CA 2ZZ1A 3OVQA 1MW2A 6ALDA 1UWRA 3W02A 3OIXA 4DPQA 1QK0A 2RHGA 3NFUA 4IG2B 4E2VA 3CUXA 3RCYA 2V0TA 4J2PA 4GQQA 4MNLA 3W70A 3W1NA 1Z89A 2CETA 4TVCA 4NKCA 1B57A 1YBQA 3BV4A 4N7QA 3H2MA 5DMYA 4A3YA 1ZL1A 3T78A 4NI8A 3O1NA 3WG6A 1BF2A 3C8FA 4QS5A 4YN5A 4B15A 2NQJA 1F4AA 1TV7A 3GVRA 4GQBA 3TSBA 5FEZA 1BXCA 4XD4A 2EG8A 2XSXA 3CZLA 2EXOA 2AKZA 4HMNA 3MB9A 3VDHA 1FWBC 2QJHA 1AW2A 3MYOA 5D37A 1V93A 3KX6A 4ROPA 5EFDA 4CCEA 4HGXA 1JVNA 2D2OA 2QCMA 5JQ9A 4MUZA 1MEWA 1QK2A 2EG6A 1OX4A 1R8LA 2FMNA 3RCNA 2X1SA 4FI4A 3O6AA 4LVGA 3UWWA 9XIAA 4B2DD 1VH7A 4HHHA 1SMDA 3TN5A 1QNSA 5HUPA 2YZRA 4PUJA 1SQ7A 2ZZ2A 1HQTA 1W6TA 3NEHA 4O4WA 4AIEA 2YGYA 3A6OA 5DELA 1D3HA 4JPGA 3PAJA 1UH2A 2VRKA 4AY8A 1SPQA 2FQIA 4XAFA 1TPH1 3MV11 4WCJA 2X09A 4DF1A 3TZNA 3BOXA 2Z6JA 3IGXA 4DN1A 1KBIA 4QQ3A 4IQDA 4IXXA 3EXRA 1V02E 3VUSA 1AJ0A 4MYAA 1FKWA 3PF3A 2PDUA 3WD4A 1DQXA 3OVRA 5FF0A 2DUAA 1E72M 4HNNA 4R3UA 4X22A 4Z2JA 1DORA 3UG4A 4Q8UA 4IPLA 5E6YA 3DI0A 2X1IA 4JTIA 2DZBA 3CU2A 4NZJA 2BBFA 2QV5A 3QGKC 3UF9A 3LLDA 3Q4DA 4Q4MA 1ONWA 4OBRA 2VZVA 2XVKA 5FEXA 5D2WA 1NQKA 4AD3A 2Q8XA 4Z1AA 4NNBA 5I24A 3EGJA 3IGUA 3RDKA 1K02A 2JQXA 4AZIA 1E6SM 4NJGA 4DLFA 4B4FA 5A8QA 5DY2A 5DY3A 1GVQA 4PBGA 4ZOAA 7CGTA 4KEVA 3SUUA 4AVNA 5C5YA 3WK1A 5IBXC 4BK9A 4Y9NA 4C7GA 3TU9A 4O15A 1PPIA 1KFWA 1YE4A 2XN1A 4IJCA 4AF0A 3P2VA 2JIEA 2BHYA 4PEEA 1B3ZA 5RUBA 3GH7A 1JCJA 3MANA 2G50A 3TYDA 4GLEA 5E9AA 3B40A 1VHNA 2IW0A 4AW7A 3QZ6A 3N2MA 4JZ5A 3BZJA 3GUWA 4ZQRA 1XKYA 1KO0A 3CH0A 3HQ1A 1MRAA 3HN3A 3QYQA 3ARRA 3E0FA 3CHEA 1XI3A 4PMUA 3OGVA 2YCIX 1N8IA 1RJPA 3EWCA 4H3DA 4PMOA 3LB0A 1H63A 1I2NA 1P0KA 2PRLA 3VKAA 2GJLA 4CNOA 1POJA 1PYMA 2PE4A 2VGGA 1PX8A 4AWUA 2GQ3A 3DHDA 3OLEA 3TTQA 3WQCA 3V35A 1OGGA 4HA4A 4HK6A 5GJMA 4IUOA 1VBGA 3N2TA 3LCXA 2GJRA 1FQ0A 3DOPA 3GXDA 1UWSA 2QF7A 1QU4A 1XIIA 1ZGDA 1SW0A 4OV9A 3UZYA 2YBTA 4I6VA 5CPNA 2Z1WA 4GYPA 3FA4A 4GGHA 3K46A 3MCNA 3HG2A 4YNGA 4JAWA 2P8CA 5GJNA 3PFMA 5FL0A 1CGYA 4J3VA 3WLRA 1BHGA 4Y6GA 3A4XA 2BVWA 3RU6A 3VKKA 1QI3A 4O1DA 3W53A 3LUTA 3GFZA 4HOWA 3BAWA 4DZHA 3OYXA 4TVUA 3FAWA 4X9YA 1VCFA 2GLKA 2NT0A 3VNZA 3Q67A 1TV8A 3UWVA 4GZ7A 1UQZA 4MB5A 4FIRA 1YQ2A 1LTDA 4AISA 4FS9A 3T2OA 4WY0A 4ROQA 3CIXA 3QTPA 1XFCA 4FLSA 2JE8A 3OLDA 1WZLA 4JICA 1XYAA 4M6PA 5HANA 2Z25A 3GDKA 3VMNA 4A8LA 2PTZA 5J5RA 3NZRA 2PA6A 3VO0A 2AMGA 5CPOA 1XLJA 4HPXA 1AZ1A 4DBEA 4AXNA 3DERA 4IFOA 4KH2A 4C6QA 1GYMA 1EJTC 4YHGA 1IHIA 1NSJA 2PURA 1OC5A 4L56A 2IKGA 3WD3A 2VELA 4DZIA 2EJAA 2H90A 1PX4A 2ZE0A 3M0ZA 3A9BA 3IIZA 6XIAA 3GNNA 2E68A 1R5YA 2WLYA 4LC6A 2TPSA 2QIWA 2J7HA 3L12A 4Q4OA 1NU5A 3O9NA 4JIRA 3S5OA 7ENLA 4GUHA 4AIUA 4IFRA 1WOAA 2Q71A 3ZR5A 1FCVA 4UNIA 4ZQMA 3UQNA 2GZXA 1HT6A 1UCWA 4K3ZA 1G7VA 3TLQA 3PBGA 1VFSA 3GR8A 1GHSA 3GX9A 3UJFA 5B80A 3WMLA 2QF8A 3SN1A 5LNSA 2J79A 2VEGA 5H8PA 3I3BA 2PDIA 2WC7A 3ME3A 4S38A 3SFKA 3TN3A 3ZVHA 2E1DA 2WCGA 2ZX7A 4AZ5A 3HGOA 1YTDA 1Q6EA 4C6FA 1WV2A 4Y9AA 2GGIA 4ZSUA 3BO9A 3L4XA 3AMKA 3G0UA 4KCVA 4NZ4A 3LERA 5T8GA 1LWJA 1RY0A 1ME7A 3FKKA 3WBEA 3ZFHA 1ZENA 2PP3A 5AC4A 2X0YA 3KRSA 2ICSA 3AWNA 3NTYA 5A6BD 3MUAA 4QM1A 1JFHA 3N1AA 1KFCA 3TCSA 3N6JA 3SB0A 3SGGA 5LXXA 4GXMA 5DO8A 2MANA 5FJJA 1AW5A 3GXNA 4XKYA 1CNVA 3ARQA 3VC5A 3U48A 3HU7A 1H3GA 5JUVA 4AWTA 3MMDA 1F8MA 1XBVA 3NQ6A 2PDPA 2XH2A 4Y9PA 3K5XA 3U2EA 3WNOA 3UPBA 3NSMA 3W4RA 2PDQA 1BSLA 1XR2A 3KUMA 3C2VA 3WZ0E 3R8RA 1EA9C 3AO0A 4L7ZA 3VM7A 1EX5A 5LNWA 3AUJA 1G67A 4CN6A 1MWOA 3O0FA 4IFKB 1OB0A 2C6QA 4UTTC 4W9TA 3ZT5A 2A1YA 2PWUA 3KL5A 3OQ8A 1HW6A 4GZIA 1QNOA 4D72A 4RL3A 3ITOA 4UUIA 4BY3A 4WDXA 3KBVA 2DZPA 2I14A 3IPWA 2C15A 5CC7A 3JVAA 3WLPA 3TJ4A 2KX9A 4O54A 4O57A 3IVTA 1PJ9A 1EDGA 4Q7NA 3H4GA 4IMCA 4L6DA 5JBDA 2BG5A 4BZYA 1D7FA 3W07A 2ZBTA 4LAOA 3S1GA 5B7YA 1E5NA 1PIIA 1YKWA 1UR3M 2OB3A 2DJXA 1V3IA 2VVNA 1TIMA 2VEMA 4EXAA 4ML9A 3K8LA 1NDZA 3S9YA 3NQEA 1ZBCA 3SSJA 3EYPA 1MEIA 4EVZA 5TAOA 1M3UA 3IANA 4QITA 5A6TC 4DBSA 1VC4A 3TWAA 5T9CE 2YCEA 8A3HA 3CLWA 3THDA 3OVGA 3E9AA 1DJQA 1SFTA 4UFKA 4YTTA 1K8YA 1G4EA 3SQSA 1QW8A 1OD0A 1EHNA 4PCFA 4PCSA 4CQCA 2QCDA 3URBA 3B0PA 1EYEA 2RUSA 5C9UA 3E0LA 2VL4A 4HNLA 3WLTA 2VZTA 3SURA 1D7KA 3C3UA 3ONCA 3L68A 1KBLA 3T08A 3WNPA 1WAWA 1K9TA 2I1OA 4DJDA 4PTDA 3DI1A 4AG0A 3MS8A 1FWGC 1AH3A 4TQTA 5CAHA 2B7OA 4EPKA 4JTGA 3M4HA 4JDBA 5E0FA 4HTBA 3EA2A 4K39A 4M19A 1Q6RA 2JIWA 4EPBC 1X6UA 2PRHA 2OSWA 1Q5MA 3QSTA 4V27A 3PFRA 2J7CA 2Y6ZA 4DAFA 4AUBA 3MKKA 3BW2A 2DY3A 4M6VA 3HURA 4E8CA 2YX0A 4U3CA 1R2SA 2GSEA 2VFGA 4IGHA 2PAJA 1R30A 1RBLA 1IWPA 2YYTA 4S3GA 3IUHA 2E5CA 2GWNA 2DSKA 2QV4A 3T0AA 2XGIA 1KQYA 1E40A 1UKSA 1JGIA 3RLVA 1QNPA 1YHTA 1YNQA 2DT1A 1H61A 5I78A 4IGMA 3L0GA 1J93A 1IT8A 4HCLA 2JALA 1V03A 3ZSTA 3TK7A 1XYMA 5AZ1A 4L64A 4AIOA 2X0HA 2PP1A 1GORA 4H04A 4WK9A 1H7NA 2ZA3A 4L5ZA 4W89A 3UR2A 2EHHA 2C8NA 2XZ9A 1SO5A 3EX2A 3N13A 4DX3A 4ENLA 4BEUA 1K7FA 4M51A 3MP4A 3D6NA 3PVFA 4DJFC 1VLWA 5CH9A 1WDRA 1ME8A 3NQ8A 3UXKA 4Q6JA 1K70A 5DX7A 2Y2WA 3EOEA 3QPYA 1Z41A 2Z1KA 4ACZB 3S4TA 5DEZA 1OG0A 1LOQA 3CV6A 1DHPA 1LP6A 4HMDA 4N42A 1KFLA 5HWJA 3T2QA 4PUEA 4L80A 2J27A 5BRBA 3WQWA 3W86A 3H55A 4WOZA 3A4JA 3TYZA 3MUXA 2XGBA 1XRVA 3W01A 1TELA 3KAOA 3QMSA 4DF2A 1ADDA 1QJWA 3W6LA 1R46A 4S3EA 3W1LA 4FNSA 1UD4A 1VIZA 3POHA 4MSSA 5H8UA 4JTUA 1GTEA 1XHGA 1U5JA 2W62A 4P8UA 4DJFD 1IIHA 4DM2A 5EB8A 3TJIA 4E2OA 3HA1A 3GG7A 1FHUA 5TIMA 3GYCA 3L5LA 1OIMA 1UOKA 3GZ3A 3RAOA 3WIJA 3HPZA 3CIWA 4DNMA 4YXGA 3T4WA 3ZYZA 1CGXA 3T4CA 1XS2A 4HTYA 2Z7GA 3A5VA 3F4CA 1OYCA 3DG7A 3VOJA 1XIFA 3VIHA 2VRQA 2PU0A 4JTRA 2V5DA 3AFBA 1WZKA 4M24A 1FDJA 3MBFA 4S39A 4D6GA 1CECA 3PZVA 1P48A 4QLJA 1NFGA 1Q85A 2RGLA 4LJ3A 3OVPA 1ICQA 2G3MA 1H5VA 1AJZA 2QXWA 3NSXA 3CB8A 3NQDA 1QWGA 2O55A 5C9RA 4X61A 1KKRA 1W1ZA 2BOEX 4FMVA 1ZY9A 3L4UA 3AMCA 1VB9A 1E1CA 2VX5A 4BS0A 3CWHA 2ZIDA 1EFZA 4P8WA 5CZTA 5D04C 3ITTA 3LQLA 4UNLA 1A3XA 1XINA 1OFBA 5CBBA 3QV9A 4MNKA 1FH7A 1TCMA 3C2OA 1E6XM 4JS3A 3STCA 1C8QA 1MW0A 1OCBA 4MF4A 3AQUA 4JHOA 1QOXA 3M5VA 5D8WA 4KWSA 3DEQA 5A6AA 1GTHA 3MI2A 3NQ2A 4GXWA 4ERAA 4J3SA 1K77A 3AXIA 3A47A 2ADAA 4JHZA 3M6DA 3FYYA 3L5MA 3N2OA 3WF2A 4AIBA 4KWVA 4U5KA 3ZQ9A 1YLVA 3GFXA 3KBWA 4I9TA 5G4HC 4NI3A 4GH3A 1X1OA 1W9VA 1NP2A 4B5SA 2EF9A 4C1LA 2XZ7A 4J3UA 1U1UA 3C2FA 1MW1A 3BLOA 4FNUA 4DVOA 1NM9A 1C91A 1K8CA 5KEZA 2Q09A 1BGAA 1DP0A 2VRJA 3M44A 3A9IA 2R1MA 1M53A 1XGDA 3UYCA 4QE1A 3F2CA 3QSRA 2XFYA 1CCWB 3BMXA 4B5XA 2O4QA 1EL3A 5C55A 3FXYA 3P82A 3TMQA 1W3JA 1FOBA 1EIXA 1FRBA 2Y70A 3FKRA 4D2JA 3NL2A 4HHLA 2NX3A 1OIFA 1BSIA 4AU0A 1OFPA 4FOUA 3UWYA 5I23A 2VEKA 3RM9A 3ZSSA 5CG7A 1E4IA 2AQOA 3M0IA 2GWGA 2X1UA 3RLUA 3R12A 4DUVA 3R89A 1V8EA 3S2MA 3ZR4A 2QULA 1G4SA 1DTUA 3NQBA 2IQTA 1XICA 2QZRA 1L8PA 1HJSA 1HO4A 3NR0A 1ISYA 3OTRA 1PTAA 1V0NA 4MVAA 3NO3A 2WXDM 3GIPA 1A5NC 1ELSA 1D8WA 4HYWA 3KRUA 3MBDA 5CPMA 3FGCB 3OZOA 4LW7A 1NDYA 1I60A 1POKA 2RKXA 4XVEA 1FWTA 3W2UA 2XUCA 5CZKA 2WQDA 3WNNA 1RV8A 1ZTVA 5LHFA 4G2DA 2B7QA 2GVLA 2PDHA 5BZAA 3DENA 4JY8A 3L0NA 2PWGA 3QC3A 2AAAA 5LYRA 3BW4A 3HG3A 5D9PA 1IWBA 3G1YA 3L4TA 2ATSA 1X7IA 1SZRA 3PB0A 3HJZA 6REQB 3S2JA 3CASA 3S46A 1XLLA 3PN8A 3NEVA 2FDSA 2FYMA 1R38A 3CUHA 2GVGA 3LENA 3O3RA 4QAIA 1E9LA 1SZFA 2PD5A 3N6QA 3E3HA 3AIVA 4WX2A 3ZLHA 2JKEA 4RNIA 4XZNX 1G6CA 4WJEA 3W7EA 4UCFA 1Q4WA 4R27A 2W63A 3QZEA 1H7XA 1UUMA 2YB1A 3GD6A 5D2YA 4P7NA 4GG9A 3VFCA 4DRSA 3LCWA 3NPWA 1AD4A 4E38A 2IQDA 1QI0A 4F2UA 2PB1A 4KRZA 3U5YA 2PWEA 3L65A 2BASA 3N18A 1UH4A 4U3AA 5BOFA 3PBUA 4O1CA 3R7MA 1GVOA 4ZQPA 5HOSA 5I3KA 3M0KA 4LCQA 1R0MA 3UA4A 1VPQA 3T55A 1W2VA 3VNYA 1O6IA 1GW1A 1BVWA 1J0IA 3QKEA 3VU2A 4EKJA 3JR2A 4BJHA 3B8VA 2RJGA 1DOSA 4OBTA 1A5MC 4GBUA 2ZRUA 5TD4A 2REQB 4JQ3A 3L4VA 3MUY1 2G3JA 5JIPA 4E6MA 5LNVA 5GVJA 1JYVA 3HFTA 4Y8EA 5D2XA 2Z1SA 3SCRA 1JQXA 3WELA 4M29A 4PCNA 3P80A 2GQ9A 2OEJA 4IIEA 4ERGA 3G1FA 5E9XA 3G18A 1S5TA 1DV7A 2QAFA 3SY8A 3KLKA 4JIEA 4FOJA 3PZOA 3LXAA 4K36A 4NQ1A 2NW0A 7PTDA 9CGTA 1Q6DA 2RDTA 5HMFA 3OP2A 4UZUA 3TFCA 4FIQA 2WLZA 3W82A 1PKMA 1Y8BA 1E0TA 5HQEA 4ES4A 4KEZA 1V6XA 3MV01 4AAJA 4HNCA 3V36A 4G1NA 3TUUA 1LRNA 3TIMA 3W00A 3N11A 1V6VA 3OZYA 4RKAA 3H2CA 3CO4A 4TX9A 3ABSA 3F7JA 1DWAM 5JVLA 4ZB0A 3WDIA 3ZJ6A 2OO6A 2WZTA 3RMJA 3B8DA 5HQMA 4XAZA 2FDMA 3DBNA 4QXIA 1VJZA 4I90A 1WUEA 3DGBA 2ZZ4A 4HNUA 2HK1A 1TV3A 3DYOA 5A8MA 4GO9A 2ZTKA 4F40A 2NUXA 4US5A 1K9EA 4WQ6A 1O66A 5K9XA 2F84A 1T96A 3ZT6A 3SRFA 3FDGA 3CUFA 4UQAA 1SO6A 5GNYA 2Q3OA 1XLAA 5BWAA 1H1YA 3E6EA 4B91A 3LHUA 1ONXA 1GKPA 2VURA 1ISVA 3AROA 2DH2A 1TTJA 3SCTA 1EBHA 2WM0A 5K2ZA 4PCTA 2D2JA 2FGLA 4CD6A 3I10A 5EYWA 4MKNA 5BMWA 2OKTA 3OZPA 5BNKA 3R0DA 3THQA 5CG0A 3WJZA 4CD5A 1KFEA 1I9CB 4HZMA 1HJQA 3VNKA 3GC2A 1SR0A 3A22A 3VDBA 1V3JA 1QR7A 5CPSA 7REQB 4EAYA 3UZZA 6TIMA 5K3VA 1V6WA 3LBOA 2D3NA 5CGQA 5DN1A 1XD0A 1MDLA 3LRKA 4AEEA 3BGJA 5BU9A 3CWOX 4LANA 4JBRA 3WLLA 3LN3A 3KWXA 2WVUA 4Z0JA 1U2YA 1OZMA 4AEOA 1EXPA 4ZENA 1S2WA 3U3HA 3C61A 1CLKA 3MW7A 2ZRXA 4ADUA 1JXJA 4NILA 3LV5A 3A24A 3UBPC 2D20A 1IR2A 3AIBA 5LIWX 1J8VA 5BOEA 7ODCA 5DBUA 1B3WA 1GOMA 1TV5A 4LCRA 1GK8A 2BVTA 2BWGA 4KGJA 1QMLA 3QHOA 2CFFA 1WDQA 2P3ZA 1YXCA 2PGWA 1KXVA 3NPVA 1W1B1 2PODA 4QCFA 1EP1A 4AEFA 2INEA 2Y7EA 3UD6A 2IS7A 2OWCA 4OKDA 3N17A 4HHMA 2WVVA 5FIPA 4MB4A 4YLWA 4EF8A 2ZADA 1R47A 1S2CA 2C19A 4WIWA 1H0IA 4AZ6A 3MO4A 2G5WA 1X6LA 4W7WA 5DT7A 3TA9A 3EWDA 1L6GA 1WBHA 2CC0A 2OGYA 4Y2WA 1BYCA 1G0CA 4JKMA 1JAKA 2NWSA 3VTRA 3F4VA 3UYIA 3QHNA 1PIFA 1EB3A 5G2HA 1KM3A 3EWYA 4CN1A 1FXQA 4C6NA 1GVFA 3WUBA 3V1HA 1ZQ5A 3AXHA 3OQEA 3IGHX 1CDGA 4UR8A 4UZSA 1F05A 3NOEA 4M1RA 4RDWA 5A2CA 2XTKA 3PZNA 4LFYA 1P7TA 3H2OA 4I6KA 5XIAA 3E0WA 3S2NA 1CGWA 2ZVIA 4CD7A 3T42A 3NL5A 2AAMA 4E4FA 2Y7FA 1W3HA 1CXLA 1BRLA 3UG8A 4NSBA 3CZEA 1B0IA 5CQ1A 5JXQA 1YIXA 5CC3A 4Q8QA 1CPUA 2E6AA 5C7VA 3GNRA 2A4AA 4LUTB 1Y0EA 5F2MA 3SGUA 2JF6A 4UTMA 3MZNA 2G95A 3HJEA 4WGHA 2Z29A 2EPOA 1FWEC 1Z8AA 1E3XA 3NUKA 8RUCA 1C8VA 1MZHA 1WP6A 3I7RA 4LPCA 3TDFA 4RCXA 4MOZA 1I2OA 2PGRA 5F1VA 3A23A 2ZICA 1EF2A 2FFIA 1OFRA 4Q8WA 2V8ZA 1W1YA 1QAPA 5AHNA 4AX6A 1KRBC 3WJWA 4X0VA 2ALDA 3RO8A 3VXGA 1M01A 1MSSA 1X1ZA 4REQA 2CKSA 3GQYA 4J3XA 2XH0A 5DLCA 4CN4A 1HF6A 1EC9A 4CLMA 2VT0A 3W37A 1VCVA 1EA0A 1TVNA 2FGBA 4MZYA 3STFA 2PDMA 1LJYA 1PVNA 2YLLA 3QVQA 4GIYA 2GGJA 5ABGA 2EEXA 1HJUA 3HQOA 5E0KA 2I9EA 1HP4A 3NSNA 4Z2KA 1KKOA 3GDLA 2YIHA 3C5QA 1OYBA 5A6SA 1DJXA 1AMKA 4HZ8A 2OOFA 3WQOA 1TR9A 1U1HA 3PBWA 1O4UA 3FYOA 1TTPA 1ONEA 2UY3A 3WJSA 2QPUA 4YHEA 1U1JA 1BPLB 4ZR8A 5A6JA 3AHXA 3GTNA 4DJDD 3NOYA 4NXSA 1R87A 1EC7A 4AMAA 3LM3A 3WNLA 4CNNA 3GO2A 3POCA 4CEUC 3QQ1A 3FA3A 2WCSA 3WF0A 3SRKA 4XAGA 3MDWA 3I6TA 5FF2A 3VKJA 3WH9A 4PSRA 1LWIA 3ISIX 5HWMA 1US2A 3LOTA 4M1BA 1XLDA 1H1NA 3GZAA 4P8VA 1NWUA 3UZWA 3O8AA 4KCUA 1E43A 3OLIA 3FK4A 1S5NA 2EQDA 2C71A 1DBTA 4BEQA 2DSUA 1XIDA 4R7JA 3VPLA 1XQKA 3H26A 3CMJA 1NEYA 1SJAA 4BF5A 1PKLA 3OHIA 3SCNA 2PWDA 1GG1A 4NZCA 3LV6A 4HBKA 1JYWA 3K13A 3NPUA 3KOZA 4B90A 4QJ5B 2VZOA 4MZ1A 3P74A 3O2LA 4RDYA 2XVGA 1A3HA 1NF0A 3M0YA 1UPPA 5F7UA 2WMFA 1SSDA 1VFUA 3KOYA 2TAAA 4M7SA 3N6HA 3EOOA 2J9YA 2Y1HA 4HNOA 2XN2A 3SZ8A 4RLIA 4CGTA 2J8TA 3MCMA 4GY7A 3DXIA 2A6NA 3NXFA 2OQHA 3W24A 4EOUA 2J7EA 2P5NA 3GY1A 5CZJA 4J9JA 3QW3A 3FJ6A 4NIRA 3FSUA 1LRQA 2YPIA 5HATA 3LCLA 3TVAA 4FXJA 1KGXA 3PNUA 3EMZA 5K7JA 2VZUA 3I4KA 3TW9A 1CENA 1XBXA 4WRHA 3VIPA 2AL2A 3NPXA 1H2JA 3AXXA 3NIYA 4Q32A 1KCLA 3F2DA 1TJ1A 2VFHA 2XWEA 3GTXA 2GGEA 4D1JA 2CLPA 4D6CA 3GAKA 5EMYA 2CYGA 2PDGA 3GXTA 3HOJA 1BLIA 4UFIA 3UNTA 2X7VA 2YKKA 1OFDA 4RUBA 2WO5A 4GC3A 3ZOAA 4REQB 1N8WA 5A5WA 5HDRA 3RITA 3O6YX 4GWEA 4KFNA 4H6RA 3WQPA 3CS2A 5I3DA 1TWZA 3BLEA 4UQEA 3FY1A 3IK2A 1SGJA 2V5BA 1JDDA 3AU2A 3HF3A 3JZEA 4MWAA 3KW3A 4YL2A 1KFKA 4UC5A 3ATYA 3PJXA 5DRIA 1NWSA 1DL3A 3PJUA 4I7VA 3OBKA 2HZGA 2DVUA 4L9ZA 1JCTA 4A21A 3HO8A 2QDGA 4N6EA 4F0RA 3FEMA 2PDFA 3BW3A 4IX0A 1GVSA 4JTDA 3MWCA 5HUOA 2A6LA 3VE7A 3VD3A 5BMXA 1CLXA 1JIBA 3REQA 3VKDA 1ISZA 1TB3A 4PB4A 1FFRA 1KV8A 1XIJA 1JZ8A 2C3ZA 4JKKA 1MFUA 4P61A 3UP8A 3HMCA 4W93A 3PNZA 3QW4B 1FVPA 3G3MA 2VR5A 3VKCA 1JRBA 4NZ3A 3DFNA 5DXXA 3GTFA 4Q4PA 4UTKA 2ACRA 4U4MA 4Z2LA 1UR9A 2YCLA 4I9MA 4NX0A 2VVSA 1C9DA 5EGRA 5J8LA 1K7EA 3PPHA 3KRBA 4EE9A 5IHRA 1OF6A 5G1TA 2IXVA 1J12A 2ATMA 1V79A 2QQ6A 2KZHA 1FP9A 3WBWA 3WEZA 4MWAB 1CLVA 2PLKA 3LCIA 1NARA 3M0MA 3USZA 3I68A 1J18A 3ES8A 4MWAC 3KBJA 5XIMA 4ZMGA 1J6PA 4GZJA 2NQ9A 4G5DA 3QPZA 2OQLA 2QS8A 1HN1A 3VX1A 5EKYA 1VFOA 3RFAA 4X2RA 1FH8A 3HV8A 4I5XA 4I8DA 4J2MA 1B3YA 2CLKA 1OBAA 1T5AA 1IQ8A 3P8IA 1S2AA 2WPBA 3VNLA 4ZE5A 4BWLA 3T0DA 2QIIA 4FEZA 3GC4A 3UXIA 4F0HA 3HIJA 2PPGA 4LQ1A 3CUGA 1RVGA 1WZAA 1XLFA 3KP0A 5ABTA 1RCXB 2VI0A 5GNZA 1JZ5A 3W73A 3U4AA 3SR7A 3CPUA 4NZFA 3ZS4A 3WQGA 1H62A 3WK0A 2WMIB 3GU2A 2CZVA 2XM1A 3RX2A 1O95A 3L9CA 5CBJA 3FSTA 3UVAA 2VP8A 3R2GA 4ML4A 3C56A 1UPMB 3RLGA 4ZA0A 4OOUA 1NDWA 1I1XA 3WFAA 3IEBA 5AHIA 1AVAA 2Z27A 4F48A 3N4EA 4BI6A 5HINA 4PBEA 4NXKA 4WXZA 3NZQA 3S42A 4BKNA 2CEQA 3THAA 2WOQA 2D3LA 3OG2A 1F73A 3NVDA 4Z08A 2PCQA 4RV8A 3H2FA 1NWRA 4IHCA 3TQ0A 2YJQA 2FHFA 3ITLA 1TA3A 3IV8A 4NRSA 4O1AA 3CZ8A 4LUSB 3NCOA 3MA8A 1S2UA 5FAJA 4BCEA 1TA3B 2FGZA 3MP3A 4U28A 1Q6GA 4AF0B 1CXHA 1ICPA 4ZQOA 4D6HA 2V63A 3WN6A 3SRHA 1KTNA 5ABEA 2V81A 3R43A 3ZIZA 5A8PA 3C6CA 1GVYA 1KCZA 3BQ5A 3B97A 3KHDA 3S47A 1W3KA 1S39A 3NL3A 6ENLA 3QFWA 4XZMX 4NAEB 4HA1A 4JYDA 3LLFA 3LHWA 2L5HA 2PDJA 2C18A 1W2PA 1GVEA 4HMEA 3FJLA 1XXXA 5D4YA 5AY7A 3WJXA 1UZHA 2JKAA 4RNJA 5FOOA 3VIOA 2YDRA 2WC3A 1TPUA 4JYFA 1J0JA 2A7NA 3N4FA 2E7FA 2ZCGA 1GZJA 1P6BA 4EWND 3EEZA 3DFOA 4OV4A 4YMZA 1SUXA 3M64A 2CIPA 4OHQA 1ZU8A 2EKGA 1KCXA 5DCEA 1FWAC 3EWUA 2BMBA 2QMJA 4JR5A 3AAMA 4LTSA 3V18A 4H83A 4V1YA 4LUIA 4ZB2A 5M17A 2HJPA 4H7VA 1BYDA 3GFYA 3N3TA 1O5RA 4DWSB 4MPQA 1FFQA 1BWKA 1MXSA 3GHRA 5EMLA 2NXIA 4Z1YA 1UR2A 3RHGA 3S1XA 3P81A 2P1FA 4Z2GA 4LAMA 3EA1A 3CUIA 3B3DA 3CH9A 3OA3A 3UR7A 4JTCA 4TTUA 1UP3A 1VGAA 1VBRA 3HBLA 4URIA 4JD4A 2E1WA 1B90A 1PDYA 1QW9A 3TSDA 2V2DA 3ZJ8A 1YTEA 3SCPA 5D30A 4C6JA 3CL7A 3SFWA 4PULA 3V5FA 1JDCA 4FAMA 1AQ0A 2V5JA 3VOGA 1V0LA 2GDUA 3NQ7A 1AL8A 2UWFA 3DN5A 1F2JA 1KFJA 2WC4A 4LWWA 3VM5A 3AXMA 1EUAA 1WO2A 1IIGA 5A2BA 2R1LA 3BJTA 1T41A 1MW3A 3NGFA 3AALA 3B0YA 5HJYA 1H1ZA 5T26A 3ITYA 2O92A 3KOXA 2CLOA 4U2YA 1GOQA 4MGGA 1OY0A 4M3PA 3CLMA 4H7CA 2BHUA 5HMSA 4H8VA 4CEXC 3W29A 5A6MA 3M0HA 3GB6A 2XU2A 4RZ6A 2W91A 4HA3A 1ISWA 3IIOA 1ZBWA 2FZBA 4UTWA 1K1DA 2O7QA 3NDOA 3F5KA 4R5EA 3E2QA 4TXEA 3XIMA 3HG4A 4DBWA 1HL2A 1GQIA 3H7RA 3TR9A 3S9IA 4JXCA 1A4LA 4I5RA 1ZBKA 2NV9A 4KF1A 1QPKA 3I3DA 4JX6A 2W5FA 1XIGA 5IBXA 1R7AA 3CTLA 2VEIA 2CBUA 4F9DA 4PUUA 4F8XA 3AJ7A 1GOKA 2ZRVA 1DE6A 2NQLA 3PG9A 3VGDA 3L0KA 4HCDA 3PTQA 3LK6A 4A8RA 4UMAA 4HYVA 2O9RA 3LHTA 3DHPA 3LDVA 4MLJA 3WLNA 2B0MA 2D23A 3LI0A 5DMMA 1Z6KA 1AJ2A 4ZZ9A 1OC6A 5E0CA 4D6DA 2F6XA 2I16A 4L6OA 3KP1A 3PUGA 4ICMA 1QFEA 4O0KA 3LYEA 3W7RA 3LTYA 4MTVA 1REQA 3CL6A 4JGDA 4Q4KA 3TC6A 3HPFA 5D38A 2BHZA 1H4PA 3IIXA 3QH2A 5F1UA 4F2BA 1OX4B 1XUZA 1N7KA 4H1ZA 3OOQA 2HVNA 1XP3A 1ZBVA 2QCFA 3KFTA 2P10A 3MSDA 3TNBA 1A5BA 1DVJA 2VGBA 2CZDA 4GNKB 2VEFA 2GDVA 3M9YA 4R9OA 4QFUA 1L8NA 5F4XA 3MKVA 4KFPA 3LLXA 4G7EB 2RGMA 3EZ4A 3DBPA 2Z1BA 3P8JA 5CC6A 3DFQA 2CBJA 4WOQA 3G3DA 2H3BA 1TFVA 4ADTA 3EPMA 4Q8OA 1G01A 1X38A 1FX6A 3URQA 1HKVA 3S5ZA 3WBXA 1S2TA 5FJPA 4A6GA 4ZQCA 2BB0A 4QQUA 4O19A 1N55A 3N9KA 4C5YA 3G1AA 2JBMA 3ZM8A 2UY4A 3VD5A 3P0XA 2CHRA 1X7FA 3WLMA 4KWWA 4YYCA 4S3KA 1B31A 4X3ZA 2GK1B 1VS1A 2VMFA 3LBMA 2XINA 5DANA 1SJDA 2F2KA 4UCGA 1XV8A 4WSHA 4W7VA 4K7YA 2WVSA 3W7OA 5C0QA 4ZEPA 1CGTA 4P7OA 4LGXA 4QDPA 3BLKA 3BLDA 4PGLA 3T0CA 4HPHA 2VC6A 3AHVA 5EU9A 4QDWA 4IQJA 3L2IA 1R2RA 4XAYA 2BODX 5JH2A 2VEPA 3URAA 2NXGA 4BQ2A 1Q8AA 1J0HA 2O56A 5I2UA 2TSYA 4CU7A 2F61A 2XFFA 3UEQA 4MAVA 4N9BA 4TX8A 2IQ0A 3GVQA 4GABA 1M7OA 1QRQA 1VLIA 4C7DA 3WH6A 1R9XA 3CZGA 2ZKMX 3K8KA 3HMJG 2PSNA 3MUCA 2J13A 1L9WA 3AS1A 3H54A 1AMYA 2REQA 2PC8A 4AVOA 1JNEA 2J7FA 4R7OA 2I17A 1DXIA 2DPEA 4C60A 1GEQA 3RRXA 3UJSA 3HM7A 2P3EA 1WBJA 4NAFB 4GUFA 1FWIC 1W54A 4MFDA 4UBPC 5G1YA 5C70A 5HNRA 2GJXB 4C6MA 1RP8A 2W9MA 2AGTA 1UR0A 3RILA 3K1GA 3W1TA 2CLMA 3GRIA 1RSCA 3BAKA 3PULA 2ZX6A 1WUFA 2QHAA 3BOFA 1VEMA 1F3TA 4A3UA 4C1NA 2HMCA 1ZCCA 3UERA 1OSEA 1UD5A 4QISA 1DIDA 3HGRA 4HB7A 1KRAC 2VCAA 3QLDA 4JN7A 4JCLA 2WZHA 2P76A 4NASA 1N82A 1WE5A 4HIBA 3UGVA 1U83A 1Q3NA 4ZODA 1W9DM 4YTRA 4QE4A 4UR7A 3QBUA 2ZRZA 1JUBA 3M43A 3DIPA 3FV9A 3MSRA 1REQB 3GE7A 5AN7A 1XD1A 1UZ4A 5EPDA 3WENA 3UXLA 4E0CA 4NJJA 1AA1B 2PDXA 3N04A 2ZE3A 3V0UA 4L6HA 1R3YA 1QTWA 2C1IA 3VUPA 4CU8A 4HU0A 5D02A 3QRHA 2SFPA 2XGZA 4W88A 3MZ2A 4MPKA 3GK0A 4ZO7A 3W27A 5ECVA 3FYPA 3GXPA 1B9BA 2O9PA 1L2QA 2R6OA 3E2SA 4A3HA 5FJIA 4ATLA 4ZO9A 5LNUA 4GQGA 3TYCA 1O60A 2ZFAA 4E4UA 4LUJA