5G4WA

S. enterica hisa mutant d7n, d10g, dup13-15 (vvr) with substrate profar
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
231
Chain Sequence
MIIPALNLIGGTVVRVQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISAGSNVSLYEEVCAYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords HISA
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
total genus 80
structure length 231
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g4wA00
1KFBA 5BMXA 4O1DA 4RCXA 5EA9A 3PSWA 4NX0A 3LCGA 4L4MA 1BEUA 1OK4A 2Z6IA 3L0GA 4OHQA 3W7QA 1SO5A 1VLIA 5G2HA 3SZ8A 3L21A 2X16A 1KFLA 3KXQA 3EWUA 2VELA 1DQXA 4MYAA 4D2JA 1KFJA 3M43A 3GX9A 1EWDA 5DXXA 4LVDA 3B03A 4XBKA 4IWWA 2E6AA 2ISSA 2BXVA 1XDLA 2V9DA 4ORMA 5BRBA 2CLFA 1W5PA 2C15A 1AW5A 1L6SA 4Z0SA 3KRUA 1HG3A 1R2RA 1ALDA 3AJXA 3G24A 3HPSA 4UTIA 2BSLA 4A3UA 2NUYA 3LRLA 3CT7A 3W23A 4KWWA 3GXTA 3GR7A 1PCKA 2DJLA 1XL9A 5KSWA 1JVNA 4LU0A 1X1OA 3PUOA 4N4QA 1XFBA 2B7QA 3QFEA 3PWAA 4DXVA 4IOTA 3EWXA 1JQXA 2NUWA 2YX0A 1V5XA 3GKAA 5LNWA 4KFPA 4XWUA 3VNDA 4O17A 2VXNA 1O5XA 1N7KA 2ZTKA 2QAPA 4NJIA 1LOLA 3B8DA 3RF9A 1KA9F 2UV8G 1TTJA 1A5CA 4JYFA 5HUOA 1UBSA 3B04A 3NEVA 3W1UA 1VCFA 3C6CA 3S1UA 3CB8A 3NQFA 1H7NA 1AK5A 4ICNA 2BX7A 1H61A 4GXMA 3IV3A 4JTJA 3LCFA 4NQ1A 4GBUA 3W88A 3ABRA 2VFEA 2ZZ1A 2H8XA 4ADSA 3OBKA 3L65A 1VYPX 2HS6A 4KFOA 5AOUA 1G67A 5KITA 1A50A 2ALDA 1OFPA 2VFDA 3GK0A 3DFTA 3QMRA 1AG1O 4MLJA 3PULA 3TDFA 1F73A 1HTIA 2GPTA 1OYBA 4MY8A 3UWUA 3FYPA 1E51A 4K6AA 2JKAA 2DZXA 3R13A 2J24A 5D2YA 1RR2A 1Z44A 3TFXA 2DZSA 5TIMA 4MZ1A 1EPXA 5HR6A 2R94A 1GVQA 3IGSA 4PH6A 5HUPA 1F2JA 5F2LA 1K03A 1G4EA 5AHIA 1SO4A 2YYTA 1JCLA 3TNOA 1W5NA 2TYSA 1YDVA 4JD4A 1L6YA 4JX6A 1GG0A 5SWUA 1SO3A 2HS8A 4JYDA 4JTFA 2YZRA 3TA6A 2JBMA 3LRMA 4DELA 4X22A 4K36A 2V5LA 2R8WA 3NPVA 4RV8A 1YADA 4A22A 4WX2A 1GYLA 5D38A 1KFKA 2E6YA 1UUMA 2EGZA 4W9TA 1SSGA 2YFNA 5BNKA 4FNSA 3W7DA 4FX8A 2PRLA 1VHCA 5DCBA 3TIMA 2BTMA 3MJYA 2CZFA 4LY8A 3W7OA 3L66A 5CZTA 3G3MA 3EX4A 3LCLA 5G2WA 4NJHA 2VFGA 3HG5A 4GUHA 2F84A 3FIGA 4ML9A 3EB2A 4YWIA 3LV6A 3STGA 1TV5A 3PG8A 2PC4A 2VEKA 3W2UA 1F5ZA 1XUZA 2E1DA 5C55A 4ZVJA 1MO0A 4CQAA 5C5YA 1R2TA 3W6YA 4AHOA 1MEIA 1OG0A 3L0KA 1W1ZA 4JTUA 1Q6RA 1Z42A 1PHWA 3MBDA 2ZZ3A 1TCDA 1HO1A 3H53A 4JS3A 1WV2A 2G5WA 3CWOX 3OG3A 2Z1BA 3QF0A 1S5TA 4ZQNA 3L5LA 4BWLC 5HWNA 5LHFA 4H4IA 3VE9A 1S5VA 3BW4A 5D05A 5DBUA 3OA3A 1JQVA 2JK2A 3NPUA 4AVFA 1W0MA 3UD6A 4DPQA 3CC1A 1NSJA 3NPWA 3W7EA 5D33A 3G1SA 4I7UA 4KWVA 2WSRA 1QPNA 4ONVA 5D04C 1VYRA 1X6UA 4NJKA 3WJWA 3G0SA 4UTHA 3EEGA 2A1YA 3THAA 2C1HA 2VENA 2VKZG 3KFTA 1Z48A 1O94A 3LBMA 2P0OA 3BW2A 3I7QA 2W79A 5AN7A 3M7WA 7TIMA 2QAFA 4OWGA 1Q3NA 1N55A 3E0IA 1MSSA 4X9SA 4PTNA 3GDMA 4O1AA 3LV5A 2X1UA 1A5SA 1ZAJA 2DZPA 4IMFA 3C3NA 1C8VA 3LHTA 4OT7A 5CSRA 1SFLA 4GNJA 4JTKA 1Q45A 3H55A 2FPTA 3O16A 3HGRA 1F6PA 4CCCA 3GLCA 2ZCGA 3SIZA 2PE4A 4UTKA 3DFOA 3TW6A 3QH2A 2E09A 1WBJA 3DAQA 2CW6A 5TQLA 3W07A 3P84A 1W5QA 4FNTA 2NX1A 1PIIA 5BOOA 5E0KA 1M7PA 1GT8A 3GYEA 3LB0A 4DO4A 4Z0JA 1F74A 4JX5A 3S1XA 4NXKA 3TC7A 3P61A 3PS7A 4LVAA 3C56A 3S5YA 3PAJA 4JNMA 4UFIA 3WK0A 5F2IA 4WXZA 2YXGA 3IVSA 4NJJA 3DFPA 4I7WA 1KM0A 1LRTA 3S8HA 1L9WA 3MP3A 3W86A 3TSBA 4M7TA 4JTIA 1W31A 2GVLA 1TPDA 4IQLA 1VJIA 2HSAA 1SFJA 5LSMA 2I1OA 1VGAA 4O50A 3RMJA 1QFEA 1R30A 3PC0A 2NX9A 2XN1A 3IIPA 3M9YA 3TU9A 4JN6A 3QYQA 5GVJA 3QM3A 2H8ZA 4M6PA 3T7VA 5LNUA 4QM1A 3I7RA 4N02A 4N2YA 3N19B 3GDRA 4GWEA 4YCPA 5LNSA 1VS1A 1QDSA 3G0UA 1K8XA 4M5PA 4CNOA 1DOSA 4CQ8A 1MXSA 4UFLA 5KZMA 3GXNA 4O52A 3QMTA 3CIWA 3M0ZA 3N9SA 1H63A 6ALDA 5CPLA 4ZQRA 4POCA 1EEPA 1WOAA 2QCGA 2I9EA 1I2PA 4PEKA 1B9BA 1ICQA 2EPHA 4LOCA 3ZWTA 3CEPA 2ZZ5A 2DZUA 4L4LA 1SSDA 3C2RA 3TC6A 4R33A 2Z0IA 3MI6A 3USBA 3EX6A 1J4EA 4E2DA 3DHFA 1R47A 3SW6A 3GAKA 1GVRA 3W3OA 3A24A 3O63A 5I3KA 2VEIA 2V2DA 3W7RA 3NXFA 3LCHA 4YXGA 1O5KA 4QNWA 4S2BA 1PHQA 1KV8A 3W7CA 4ZL1A 4LWWA 4WOZA 1KTNA 1G6CA 3W1AA 1ZALA 4IPJA 2GQAA 4RKAA 3MHUA 4DF2A 1OJXA 4FNPA 1FDYA 4I7VA 3MO7A 3Q2DA 1OABA 5TBOA 3TH6A 2QCNA 3KVKA 1UUOA 4E2BA 4NUWA 3E12A 2ZZ4A 3VE7A 3UWYA 1LBMA 2V81A 4WXYA 4YLWA 5CZJA 1IXOA 1YLVA 2QDHA 2E5BA 1H7RA 3LCXA 1YXDA 2FFCA 1EP1A 3F1QA 4MYXA 1WYIA 5G1TA 2DORA 1TRDA 3F4NA 1DORA 3JRKA 1JRCA 4O57A 3NAVA 4N6FA 4E38A 2WV8A 2Y7EA 3A9IA 4AEOA 4R34A 3W1TA 1WBHA 1Z41A 3LERA 3M16A 3S42A 1YPFA 4JDBA 1OF6A 4BR1A 4MUZA 3CQ0A 3OVQA 4I9AA 5KZEA 3L5AA 3C61A 5H91A 1T99A 4X2RA 4NX5A 1YTDA 4MPQA 4M6QA 5A5WA 2PURA 3OVPA 2VFHA 2PRMA 2ZFAA 1NAL1 2DZVA 3QSTA 1XI3A 4PA8A 4CCDA 5A8GA 4TR9A 1OX4A 2QCMA 2YGYA 1XBYA 3P82A 4IMGA 1D3HA 3MWAA 1QPQA 3TV8A 3TQVA 5D2TA 1J2WA 2FIQA 3NQVA 4JTSA 1F76A 1YTEA 1QWGA 2E5CA 4H3DA 5K4XA 2ATMA 3CWNA 2NXHA 3GDKA 2C3ZA 4MJMA 2QDGA 3A22A 3HB9A 3UNDA 2WOQA 4TMBA 4PC8A 2B4GA 3EWZA 4HPJA 3D0CA 4O18A 3IRDA 3NGJA 3MBFA 4G1KA 3S5ZA 3UWZA 1K8YA 1G4TA 5DY3A 2H6RA 3L0NA 2X30A 1RQBA 3NQGA 2ZQ0A 3IIXA 4DPPA 1D9EA 3QQ0A 3FS2A 2OT1A 4IGHA 4Y96A 3DU0A 1LORA 1EA0A 2E77A 2A4AA 4OGZA 4IUOA 2RDTA 3G1YA 2NLIA 4FEZA 3VCRA 3KRSA 5F2MA 1XCFA 3TFCA 3NQMA 5CPNA 3ELFA 1ZAHA 2A7RA 1A53A 5FF3A 4HSOA 4MFDA 1H62A 2WSYA 1KW1A 5LHEA 2A21A 2EF9A 3UZJA 1Y0EA 2CU0A 1AL7A 2QUUA 2NWRA 2ATSA 2YDAA 1LROA 2YSWA 3KX6A 4GUFA 4FNQA 3FA5A 2TSYA 3R8RA 2VEPA 4NT0A 5K3VA 2W0UA 1GVFA 3MW7A 2Y6ZA 3HO8A 3QQ1A 2BZNA 1O4UA 3A23A 1W5MA 3CIXA 3GKFA 4LC6A 2YCEA 1OYCA 4ZMGA 4RZ6A 4NNCA 2WNNA 5ABTA 4OBTA 1UB3A 3W9ZA 2Y89A 3IVTA 1T0OA 3EWYA 4LW7A 5J5DA 4S2CA 1D3GA 3C2FA 3W7PA 5KTLA 4U4MA 1G7VA 3TW7A 1FY6A 2WSQA 3ZS4A 3F4WA 4P2VA 3ABOA 2J9YA 2GUUA 3WJXA 1QNVA 4EOUA 3B4UA 5FEXA 3EKZA 5I3IA 3C4UA 3BW3A 2KZHA 4IX2A 3DI0A 3ZR4A 2QF7A 1X7FA 1ME9A 2E5DA 1P0NA 4O53A 1DQWA 3G1VA 5AHLA 4PFMA 1KFCA 2GJLA 4IX0A 1G4PA 1UJPA 3BLEA 3LHWA 1ZHAA 1GJPA 4MY1A 4O0KA 3M1ZA 4O54A 2Y7FA 3FOKA 5AHFA 1F7BA 4LRTA 2OCZA 5CPOA 5DN1A 1SZFA 3S5OA 1ZFJA 3FFSA 3E49A 1VYSX 3JS3A 1MEWA 2CZEA 2Y70A 4N9BA 2QCEA 3O6DA 3NNTA 2C14A 5F1VA 1CW2A 3P67A 4JTGA 1SUXA 1OX4B 5I3JA 5K7JA 4XBSA 2C19A 3M5XA 3PSVA 5EMUA 5IBXA 4C1LA 3WJSA 3NA8A 4N9CA 1M5WA 1VPXA 1U83A 3UY8A 1RV8A 3G18A 1JRBA 1X1ZA 2IQTA 2VEMA 3M6YA 4MLRA 5AHNA 4HPXA 2CLHA 4R7JA 1YDOA 3QC3A 3W2MA 1ME7A 3C52A 1PCWA 3RK8A 3S0CA 3UY7A 4RK8A 1BWKA 3ZFHA 3LM7A 3DBPA 4UR8A 2A7PA 1ZNNA 4KFNA 1X8FA 3G8RA 4YMZA 1H51A 2ABAA 1IIGA 4WZHA 4GE8A 4O1BA 2NX3A 2CLEA 1GOXA 1VCGA 2B7NA 3TCEA 3B0PA 3NG3A 5DELA 2E6FA 3P5ZA 1IIHA 1BWLA 1QO5A 1C29A 2V30A 4DEFA 4WJEA 3P60A 3PUDA 2X1SA 3OEXA 3CLMA 4OV9A 1OYAA 1JCJA 3PUEA 1J5TA 1TPH1 4HNTA 2CLIA 3OHIA 4FIQA 4HIBA 2G97A 3SECA 1OF8A 5DCEA 3LBCA 1DJNA 3TSDA 4X3ZA 4TU1A 4QQ3A 4WY0A 1B4KA 1TO3A 4A2SA 1HUVA 3MHFA 1OK6A 2EKCA 1F05A 1OFOA 3EX2A 4QIUA 5LNRA 2JGQA 2FJKA 3PVFA 2ZRYA 3T40A 3W7MA 2FLIA 4TIMA 1I2NA 5LZLA 3W1MA 1SU5A 4AWUA 3TR2A 2BLEA 2NV1A 3TSMA 2VFIA 2WNZA 3O8AA 1S5WA 2QCFA 3WK3A 3S6DA 4ZZ9A 3NQEA 3W1PA 1H5YA 1QAPA 2NXGA 1NF0A 3LXAA 4C1KA 1DBTA 2WNQA 3H54A 1TYGA 3NOEA 2C0AA 1ML1A 1K3UA 3Q58A 3MYOA 4OQVA 1H7XA 3W85A 3LGEA 4KKXA 4LVGA 4PL2A 4FIRA 3QPYA 4ALDA 1FDJA 1ME8A 2GQ8A 3TQ0A 1LRQA 3LTPA 4WQ6A 3BO9A 1KTCA 2HTMA 1JUKA 3PY2A 1TPEA 5C6MA 1TRIA 4UTJA 2B7PA 1VH7A 4Y90A 1GZGA 1K8ZA 1EUAA 3ATZA 4GUIA 3LI1A 1AL8A 4HKPA 1WDWA 3MHGA 5J5RA 3FJ6A 1VQTA 5CKSA 2ZA3A 3IIVA 3W7LA 1LZOA 3STFA 4M19A 3LHVA 3U2OA 1OFBA 2Z2UA 3M5YA 1OX6A 1K02A 4Z1DA 4Z1AA 3LLDA 5D30A 1TJPA 1BTMA 1EP3A 1SZNA 3W7GA 1TPVA 5AB3A 1YDNA 3G1AA 4JDYA 1VC4A 2WPBA 5KZDA 3W7HA 3L67A 3SGZA 4Y6GA 1U5JA 2F7FA 3P80A 4UIOA 1W56A 2X1TA 1W3NA 3PB2A 4HSNA 4HNUA 2CLLA 3W7JA 4CQ9A 1FWRA 4UMAA 1H1ZA 1JCMP 5F1UA 1Q6QA 3NQ2A 1VR6A 3TMQA 1G69A 1OFRA 3G1FA 3RLVA 1A5BA 1EWEA 2ISWA 2ZTJA 4LVBA 3M41A 3U6WA 3UPWA 1A5AA 3NO5A 3L2IA 3E02A 3M44A 1LLZA 3W2JA 2V8ZA 5F4SA 4Y8FA 3B0UX 3BK0A 3TXVA 1FCVA 1P0KA 2BWGA 3NL2A 3R2GA 3B05A 4RJEA 1KLYA 3IIOA 4NJGA 3QEZA 4M7SA 3S1WA 3SY5A 2FTPA 3BPWA 1WXJA 5KMYA 4AAJA 1M7OA 1PS9A 4O14A 5HINA 4O10A 5D2XA 1P5BA 3HBLA 5HULA 2W6RA 3W7NA 2C6QA 4JYEA 2J9XA 4XKYA 2C18A 2J9ZA 2PRHA 4O11A 1OVDA 3N9RA 3W72A 4JY9A 1SW3A 1AW1A 1IXPA 2ABBA 2CFFA 2H3DA 3NQDA 1T8XA 2OJPA 1EX5A 1XUUA 1KM5A 1IXQA 4UTWA 1I45A 1SZGA 5LGZA 1PE1A 1NFBA 3NQ6A 4A2RA 3TAOA 4WY0B 3TXZA 1TPWA 1WA3A 1TPB1 2Y62A 1K7EA 1I8JA 3JR2A 3C2OA 3O1NA 1QMLA 1K7XA 3STEA 3W1LA 2RDWA 4JX4A 3C2VA 4RXGA 5AC7A 2NZLA 4UTUA 3O6YX 3PBWA 2WQPA 2AGKA 1GTEA 4BI5A 4UFMA 3HGJA 3LRKA 1FX6A 4CNPA 3BV4A 2JKPA 2ZRZA 1KM1A 1P4CA 2YW4A 4UTMA 1N8FA 5D03A 2WO5A 3WFAA 2YYUA 4RZ5A 5FF0A 2OMAA 2V5BA 4FF7A 4LUIA 4GRSA 3PF3A 5KINA 1RVGA 4UUIA 3EWWA 2G95A 1JULA 5EYWA 3TK7A 1TTQA 3W7KA 3GDLA 1F6KA 3GNDA 4H6KA 3INPA 3ATYA 2GVGA 4AF0A 2VFFA 5C2XA 3OVRA 1LYXA 4LS1A 1AW2A 3TJLA 4JTLA 1JUBA 5G2IA 4WD0A 3P5YA 1R46A 4A21A 5HQEA 1PVNA 2ZYFA 2B7OA 3LCIA 2ZZ2A 3SGUA 3NYZA 4XQ6A 4LTSA 4EWND 3PB0A 3G0XA 4DQWA 3O07A 1YTKA 4O15A 2YFOA 4A29A 2CLOA 5EPDA 2GOUA 2P1FA 3W84A 3UWWA 2FB2A 3HQ1A 4LV9A 4RR4A 3DENA 3P7YA 1HL2A 2JGYA 4GUGA 1EP2A 3LI0A 3PR2A 3R12A 1LBFA 3BGJA 1O60A 4MFEA 5G1YA 3UYCA 2Y61A 4NZFA 5C54A 3P8IA 1GYNA 1OX5A 1LP6A 3DFNA 3W76A 4RZ4A 1ICSA 1MZHA 3CU2A 2P10A 1GEQA 5FF2A 3NZRA 1WAUA 5DY2A 1DHPA 1IGSA 2FPVA 3NL6A 3C2EA 1RPXA 1LCOA 1ONRA 4O28A 3K30A 3SI9A 2AQWA 4UFHA 3GR8A 3I68A 3LXBA 1FXQA 2AAMA 1LBLA 3NM3A 4R53A 3TMLA 3P8JA 3FLUA 2QCHA 3TUUA 1SO6A 3CEUA 1FWTA 4LV4A 1CX9A 5D2WA 3DKLA 1RQEA 1H60A 5DBTA 2WKJA 1YXYA 1DVJA 3MI2A 3HOJA 1PL9A 4LUJA 1L6WA 4TO8A 5E93A 2B0MA 4LNYA 3QSRA 4NZJA 1I2RA 3RNDA 3VKJA 1KM4A 3RLUA 4FNRA 1GVSA 3W2NA 4K7VA 3W1RA 2I14A 4XKYB 1IXNA 5I3HA 3IIZA 1QPRA 4JTTA 2R14A 5K9DA 3I6RA 3QRHA 3Q94A 1ZY9A 4UTTA 5MHBA 4B5NA 4IJBA 1SR9A 3LXCA 4NXSA 3TX9A 3E96A 2C13A 5CSSA 1SQ7A 3BG5A 4XTIA 4PCFA 1H1YA 1H7WA 3E9AA 4MY9A 1TV7A 4UTTC 3W71A 1QO2A 3FEMA 3TAKA 3UXDA 3G22A 8TIMA 3SFKA 4O0ZA 3N73A 4UR7A 1XC4A 2GQ9A 1WQ5A 2FDSA 4JY8A 5BW6A 4UFJA 2EHHA 3L9CA 2QEZA 4FX6M 3W70A 3KHJA 3N14A 3W75A 3LX9A 4O4WA 4Z1CA 3EKLA 1JCYA 3CTLA 1TV8A 2CLMA 3PM6A 3V1PA 1FUYA 4CLMA 3MP5A 4EIVA 1R2SA 1OHLA 1P1XA 2FB3A 2A7NA 3SR7A 5G4WA 1EUNA 3W1QA 1KBJA 3LLFA 4UXDA 3EXSA 1O95A 1NVMA 4MKNA 1LOSA 4AF0B 4FB7A 3WK1A 3BARA 3QW4B 5G5IA 5FI8A 4JIQA 3DGRA 4DF0A 1NF7A 4O4VA 3G1HA 3NQAA 4ZQOA 2QCDA 2Y63A 3W2LA 3SSJA 2NV2A 4QNEA 4IPIA 3BG9A 3S5NA 4GUJA 1S3HA 4EVZA 3C0JA 1H7PA 4IMDA 3DFSA 4GC4A 1HO4A 3Q37A 3N2XA 3M5VA 1KM3A 1RZMA 2V82A 3O05A 4DF1A 4LS0A 1LDCA 1XM3A 3EXTA 3WJYA 4UC5A 1PV8A 3LCWA 2CWNA 1KFEA 5LGXA 3M5ZA 3TKFA 2TRSA 4NNAA 3QZEA 2V2CA 4NU7A 4BF9A 1MEHA 2PCQA 3DI1A 1KBIA 5DLCA 4HNNA 2QJHA 4Z1BA 5I3GA 4K39A 4JXCA 1H7OA 1YYAA 4N4PA 3NZ1A 3FYOA 2DZTA 4HNVA 1XXXA 4XZ9A 5HNRA 1LLWA 1TTPA 5HR7A 3NVTA 1DL3A 4FO4A 4LVFA 5D2VA 4ZQMA 3R5EA 2DU2A 4AHQA 3T55A 5AC6A 2RFGA 4LT9A 3DH7A 2Y85A 4K8HA 1KLZA 3LDVA 5IBXC 3TQKA 4QSHA 2A0NA 4M6VA 1GVOA 5AYYA 1RD5A 3HG4A 4YCOA 1TMHA 3THQA 5F4WA 1Q6OA 4OU1A 2DZWA 5DXYA 5EL1A 1TTIA 5U7SA 3W22A 1W8SA 3KOFA 4BI7A 5AHEA 3LHYA 2ZBTA 2DJXA 4PODA 4QJ1A 1LM1A 4WOQA 3IGXA 3KVMA 1THFD 2OT0A 3LHZA 4O13A 1G4SA 3G3DA 2OX1A 2V0TA 1ZCOA 2ZRUA 3EXRA 4JTHA 4NVTA 3TE9A 4K37A 3NQCA 3U8GA 4MZYA 1W3TA 1W3IA 3HIJA 3GB6A 3HJZA 1QR7A 1I4NA 2QJIA 3HMJG 3HF3A 4JEQA 4Q32A 4MVAA 1SPQA 5D09A 4UMCA 4O1CA 1XDMA 4OE7A 4UCGA 3W73A 1M6JA 1TB3A 2A6NA 3UQNA 3QJAA 5L6UA 3A5FA 1QCWA 4N9DA 3AO0A 1TSIA 3S1VA 5D02A 3DFQA 1W54A 5EKYA 4AB4A 3LTYA 5E1QA 4UMBA 1W37A 3W2KA 1B4EA 1FDZA 2ZRXA 3QMSA 5AFDA 1VZWA 2YPIA 4BWLA 3S9YA 3N2MA 4JR5A 4OV4A 1ICPA 1OFEA 2FPYA 1OFDA 5AC8A 5CGQA 3ABQA 5FEZA 1TIMA 3KRZA 5K9CA 3MUXA 1UASA 2A6LA 4Z08A 1FQ0A 1Q6LA 4MOZA 3EX3A 1GTHA 5CZSA 1GQNA 3BVJA 5HWJA 3GIYA 3HGOA 1GG1A 2YW3A 2OZ0A 2DP3A 3LHUA 2QCDB 5AHMA 2CZDA 3HGSA 2ZA1A 3O15A 3WK2A 4K38A 1SW0A 3W1NA 4IXXA 3HG3A 4MJZA 1L2UA 2VC6A 3UXAA 3STCA 3GNNA 1ADOA 4LRSA 3KVLA 4PL1A 3P62A 2XN0A 2A85A 5F4XA 2QCLA 1KV5A 3NQ8A 2D73A 5H2ZA 1LRNA 2GVJA 3UWVA 4O16A 1T96A 3OIXA 3HPXA 4RLIA 2ZZ6A 3TROA 1G7UA 2C16A 3M47A 4IMCA 3W83A 5FEWA 3T44A 1DV7A 4QISA 1EB3A 5FF4A 3UZ5A 3P74A 1W5OA 4P61A 3UPBA 2H90A 3G8EA 5D37A 3W74A 1FWSA 1QPOA 2J88A 3N3MA 1TPUA 2HMCA 2V2HA 1BKSA 1V7YA 3C8FA 4XUGA 6TIMA 2Y7DA 2Y7GA 4AMAA 1JUEA 1UCWA 3DXIA 4FXSA 3MMTA 5HJLA 3N34A 3R89A 2ZZ7A 1QOQA 1TPFA 5HWMA 4K8EA 3P81A 2O7SA 2CZ5A 4UNLA 2QUTA 3I7SA 2YR1A 4QAIA 3PBYA 3PG9A 1YPIA 3F03K 4WY0F 5K2ZA 1FCBA 1FXPA 4GFSA 3HG2A 4TX9A 4ORIA 1DKWA 3PBUA 1C9DA 2WJZA 2ZRVA 4QITA 4JIPA 3O6CA 5HMSA 3DKJA 3DZ1A 1KM6A 4IMEA 3CHVA 1FBAA 4ADTA 2ISVA 1QOPA 1VHNA 5T26A 4UTLA 2TPSA 3G1XA 3G1DA 3LTSA 2R91A 1CI1A 2QCCA 5K9XA 3A5VA 3GXPA 4FNUA 4HHPA 4J9JA 3WJZA 5FF7A 3L68A 3IEBA 4JTEA 2RHGA 3BLFA 1B3OA 1VCVA 3MI3A 1TQJA 4CCEA 2O7QA 2NXIA 3MP4A 1YXCA 3GAYA 2XN2A 4UFKA 1VRDA 3BGGA 4Q33A 4O19A 4E0CA 1JCXA 4O8RA 3RFAA 1ZAIA 5EBUA 1JR1A 4UTWC 4BFAA 5EY5A 4FXRA 3ZWSA 3T4CA 1H50A 4NNBA 1I2QA 2QUVA 2E6DA 4AWSA 4AHPA 4EF8A 5AYZA 2ZA2A 2E68A 5LNVA 1TREA 1FWWA 3O06A 1B57A 2Q8LA 1TQXA 4WUIA 1EIXA 2NUXA 1VLWA 3YPIA 1WX0A 4FHAA 3CM4A 4ADUA 1ZJIA 4RXFA 4AWTA 1DJQA 2VOMA 4LS2A 1KM2A 2Y88A 4Y9AA 4O12A 1ZENA 4Q4KA 4XTDA 4DBDA 3VI2A 3FKRA 5FESA 5K4ZA 4BK9A 1NEYA 5CG7A 1FCQA 3B06A 1AMKA 4JICA 4CNNA 2X1RA 5AYXA 3LOTA 4U28A 4UNKA 1FWNA 3W7IA 4IXHA 5D32A 3NR0A 3GVGA 2RKXA 4ZQCA 4YL2A 1OFQA 3BLIA 3IGUA 2QR6A 2ZDRA 4ZQPA 1RQHA 4N9EA 1KTBA 2QKFA 4DO6A 2ZRWA 1OFAA 4EF9A 3QW3A 3W1XA 1XKYA 5BMWA 5F2GA 3EX1A 5CPMA 4BI6A 5L9FA 1TJRA 4AH7A 2TMDA 4TMCA 2H3BA 2NWSA 1K7FA 1XBVA 3V75A 4HN4A 2EAWA 3CPRA 3NDOA 3DHDA 3UWQA 2CLKA 3B0VC 2G96A 2Z6JA 1I2OA 4JGDA 3RU6A 5FEPA 5IM51 3KVJA 3VFLA 3NL3A 4GJ1A 1SW7A 3TJXA 5G4EA 1SZEA 3GZ3A 1FCUA 3NQ7A 4MIMA 5I3FA 2RDUA 3W87A 5LKYA 3L5MA 3T78A 4K7YA 2RH9A 1GWJA 2X2GA 3BG3A 2Q3OA 2A2IA 2FQIA 1LOQA 3MYPA 3GDTA 3FJLA 4LC8A 3ANYA 1XBZA 4AXKA 3SJ3A 4S1FA 4MZ8A 3NPXA 3EWBX 3A21A 3I65A 3FKKA 3NM1A 1GPWA 2XFWA 4FX7A 5DCDA 2JKEA 4RX0A 2Q8ZA 1JJKA 2A5HA 1XBXA 2LLEA 2QJGA 2J27A 1IF2A 1WOBA 2J6XA 3PBVA 2Q3RA 1TPC1 5U4NA 3KAOA 5CZ0A 4N6EA 3QPZA 1JCNA 4DO5A 4HT3A 1HFBA 3HPZA 3IVUA 3ABSA 4DBEA 2GJNA 1LTDA 3NL5A
chains in the Genus database with same CATH superfamily
4HCDA 5BXPA 5CAKA 4YNGA 1NTHA 5EA9A 4DWSD 3LCGA 4L4MA 1TJ2A 4H8NA 3L0GA 4WKFA 5G2HA 1VLIA 3L21A 1OT1A 4J40A 3WL0A 4MYAA 4OTKA 3GX9A 3L4WA 5AC5A 2OU4A 2E6AA 2V5KA 1UR4A 3RIKA 3UNTA 1LG1A 2HDJA 4DI8A 1W5PA 1AW5A 4L65A 4Z0SA 2GLKA 2Z1SA 5M1TA 4DO7A 1NQKA 4UTIA 5A95A 1F3TA 3CT7A 4WKHA 5TD4A 3GR7A 2DJLA 2OOFA 1JVNA 4KF1A 4LU0A 5KSWA 1E56A 4AXNA 4UZSA 4LYKA 3LN3A 3PWAA 4DXVA 3OGSA 4DWSC 1E43A 2YX0A 3OYXA 5LNWA 4KFPA 4XWUA 3VNDA 2VXNA 2DUXA 2ZTKA 1XD0A 1XS2A 2GGHA 1K6WA 4Z1YA 5DRIA 3LNPA 1LOLA 4GIEA 3B8DA 2Y8VA 2ZX5A 2UV8G 1TTJA 4XIMA 3LA4A 1SJDA 3UXLA 3KOYA 3PWGA 4ICNA 4PMUA 2BX7A 3AHTA 3AOFA 3IV3A 4GBUA 4G7EB 3OBKA 4KFOA 3SM0A 1JIBA 4QLJA 1OFPA 2V38A 3GK0A 4YTTA 3DFTA 1AG1O 1AFSA 2GPTA 1OYBA 3N04A 1LUCA 3FYPA 3DESA 1B3VA 4GJJA 3XINA 5D2YA 1UR0A 1Z44A 3VK5A 3TFXA 2DZSA 3KCLA 1MUWA 3PUGA 4KBXA 3MZ2A 2QZRA 4XD3A 3IGSA 1KWKA 2OZTA 1CZ1A 1E6QM 5F2LA 5I3DA 3MKCA 1G4EA 1PYFA 2WMGA 3IJIA 5SWUA 2IUZA 4MF4A 2HS8A 2F6XA 3NSNA 1GVIA 4JTFA 3AZSA 2HVNA 4DELA 1YDYA 3H2FA 2ZUSA 4J5NA 4Z2IA 4RV8A 3NPVA 1YADA 4GY0A 4WX2A 5D38A 1NWRA 4W9TA 1S3TC 1UUMA 1SSGA 3VZXA 3W7DA 1FH9A 4FX8A 4C6JA 5DCBA 3TIMA 1DWFM 3MJYA 3TNBA 3SQSA 5FJIA 4LY8A 5T91A 3N25A 3FA3A 2VDIA 5AVHA 1W2PA 4IM4A 3T4WA 3FIGA 3UJEA 5BXTA 3AIUA 1TV5A 1V3HA 2NQZA 3RG6A 1F8MA 4H7CA 3ZM8A 1MO0A 1R2TA 4BJHA 1PEZA 4F2BA 3S9IA 3WZ0E 1Q6RA 1PHWA 1UR1A 3M0VA 3FGCB 7REQB 4JS3A 2VC5A 4XG1A 2G5WA 3ORWA 1LT7A 1W1IE 4W93A 2VURA 1V08A 1QBAA 2PWEA 2HK0A 5HWNA 4IH3A 4PTDA 5LHFA 1TA3B 4AVFA 4QR6A 4WHBA 3UFYA 5DEZA 3AXIA 4QG8A 4G9PA 4ZTYA 1ESWA 4I7UA 1M68A 4C5YA 2WSRA 1IEXA 4ONVA 4DAFA 4ACZB 1J10A 1AJZA 1J6OA 1W1YA 2DV0A 3THAA 3RILA 2VKZG 3W00A 1O94A 1NP0A 3BW2A 4FR1A 4IGNA 4P8XA 7TIMA 4OWGA 4DZ5A 3TN4A 1N55A 3SUTA 4QEEA 2PDNA 4GYFA 4EPDC 3C0SA 1BG4A 3CZLA 4IFOA 1N8IA 5CSRA 4XVEA 3O16A 2YBTA 1V0NA 3BAJA 1ISYA 1TZ9A 4IICA 3DAQA 2CW6A 3WDIA 1W5QA 4FNTA 1QATA 4US5D 3G2GA 4EXBA 3FCPA 1M7PA 1GT8A 3B3DA 3LB0A 1J0KA 1F74A 3CJPA 3BH4A 2EBNA 4NXKA 3WEZA 3FJNA 1KCZA 1AQMA 3C56A 3TWBA 1XQKA 4LAMA 3IVSA 3DFPA 2VZTA 1HJWA 1VFSA 1LRTA 1W9UA 4NRRA 2WSPA 1OZQA 3MP3A 4Q4OA 3PHAA 2XINA 4JTIA 1US0A 2I1OA 4XZHA 4O50A 3RMJA 1QFEA 3PC0A 1SFTA 4I5RA 3TU9A 5GVJA 2QPSA 5IOBA 3GDRA 4YCPA 2CBUA 4RE3A 3BOLA 3ZJ7A 3ITLA 3GG8A 1DOSA 4CQ8A 1EGVA 2FZ8A 3H2NA 2YCLB 3PTQA 2ADAA 4IF2A 4W7WA 5D8WA 5CPLA 4A8LA 5JH1A 5BOFA 1K77A 4UNIA 1B9BA 1ICQA 2EPHA 3UCDA 4L4LA 3GXDA 4GVFA 3R58A 4QGCA 4E2DA 3EX6A 4ZOAA 3GG7A 4PGLA 1V51A 1TIWA 3BAWA 2Q8XA 4HD5A 1DJYA 1S2VA 2YLAA 3TWAA 1TZ7A 1J93A 3W4RA 2DGAA 1NU5A 1PHQA 3R8GA 4GYPC 3EZ4A 3MCNA 4ZO6A 1EPVA 4S23A 1ZBWA 3HFYA 2POTA 1ZJHA 4YTQA 2XM1A 3W1AA 3KBSA 3M4HA 4IPJA 1E6NA 4RKAA 1OJXA 4FNPA 3TW9A 1M1BA 3B9AA 1CYGA 1AH3A 4S3CA 1OADA 4ASTA 4NUWA 3E12A 2ZZ4A 3FHAA 1LBMA 3BAKA 2J78A 5CZJA 1IXOA 2BVYA 2WVTA 2VX6A 4J3UA 3IJ6A 1RA5A 4XZIA 1I60A 3EB4A 1TVNA 1RPKA 1UWQA 1H7RA 3LCXA 2FFCA 1EP1A 3F1QA 3K8MA 4MYXA 5I07A 3VVGA 3U7BA 1TRDA 2QPUA 5J04A 1DORA 3JRKA 1TWZA 4NRSA 3QV6A 1V7AA 4N6FA 2MNRA 1ZRQA 2XIIA 3A9IA 3TA9A 1ZJBA 1ENUA 3W1TA 3LERA 1E70M 4BQ4A 3S42A 2V5DA 4BY3A 3FAWA 1WE5A 3AS1A 4JQAA 3OVQA 2YDSA 3OLEA 2BV9A 4MPQA 5LIXX 5A5WA 4D9PA 1NAL1 1BRLB 2J79A 4HOZA 1G0CA 4ICCX 2F9RA 1GKRA 5HK4A 3WY1A 3A9BA 2OEKA 4NSBA 3T0CA 3W0KA 1U5VA 3F4DA 5CSUA 3GDKA 4B90A 3VM7A 4E2OA 3A22A 3S46A 3UNDA 4PC8A 1KBBA 2B4GA 2FVLA 4PMZA 2CWXA 4HPJA 4O18A 3IRDA 1DWAM 3ABZA 3S5ZA 1K8YA 4L80A 5XIMA 2X30A 3LPFA 1RQBA 3KZPA 1KKOA 4RE2A 1KFWA 4WIWA 3TYAA 3AHVA 3QQ0A 2OT1A 1VJZA 1LORA 1EA0A 2HCVA 2XZ7A 2A4AA 3A3XA 5I09A 4MHBA 1XIGA 3G1YA 3H4WA 1B90A 1OG6A 4MUPA 2NLIA 4FEZA 2ZUTA 2HVOA 5F2MA 1W8GA 3TFCA 4OUEA 1B31A 4H19A 5LHEA 3UZJA 1EL3A 4UR9A 4FAMA 1BLIA 2CU0A 1E0TA 2ATSA 1LROA 2YSWA 3KX6A 1H0GA 3FA5A 5GNZA 2QDDA 5IDZA 1VENA 1XYAA 4C65A 2W0UA 1PAMA 3IJ9A 4J28A 3QQ1A 4V1XA 1ITUA 2BZNA 3CIXA 4LC6A 2YCEA 3WBYA 3PJUA 1OYCA 1Y5VA 4GQBA 2WNNA 1C7TA 1C8XA 3CPGA 4CGTA 5I0DA 3IVTA 5J5DA 1S2CA 3W7PA 5KTLA 4U4MA 3ZS4A 4LYPA 4HYWA 3WJXA 3TTEA 1Q6GA 3VINA 3EKZA 2VX5A 5I3IA 1BF6A 3BW3A 4E4FA 4UQEA 3ZR4A 2QF7A 2HBVA 4J35A 4P8VA 1X7FA 4J4KA 3CPUA 4QG9A 4PMNA 1UWTA 4RUBA 3QV7A 8A3HA 3R0UA 1FH8A 1UJPA 3AROA 4TVDA 4O0KA 3LM3A 1Q85A 4W84A 1A3HA 4B2DA 3W29A 4E8GA 5DN1A 4KS0A 1ZFJA 3SCUA 1MEWA 2Y70A 4CD5A 2J7EA 3O6DA 4J3TA 5F1VA 4FLQA 1X8CA 2OGYA 2DQWA 1HXJA 1SUXA 1OX4B 3L2MA 5I3JA 5K7JA 2C19A 4NI8A 4N9CA 1VPXA 2G3JA 1RV8A 4ECLA 3T81A 1NWTA 2DH3A 3CMGA 2IQTA 3L4TA 1PWMA 1JZ7A 3M6YA 5AHNA 1O1ZA 4IIDA 5CC7A 2BY2A 3ZFHA 3U48A 4D6IA 1A47A 2A7PA 1X8FA 3SUUA 2GDUA 1WDDA 1IIGA 2R6OA 4WZHA 1QK0A 3N4FA 4LF1A 4LJ3A 5HAOA 2W63A 1EXPA 5D9NA 1X96A 4AEEA 3P5ZA 4QAWA 4GLEA 3ARPA 2V30A 4DEFA 2V3FA 5GJMA 2YLLA 2QT3A 2IPWA 5BXRA 2Z24A 3OEXA 6ENLA 3QTGA 1YEYA 1TR9A 1MYRA 1J5TA 3NFUA 5C0QA 2CLIA 3OHIA 1KGUA 3WCZA 5E9XA 4HIBA 3SECA 5DCEA 1DJNA 2P8CA 1I0BA 2PLJA 3MVIA 4AD5A 2GOKA 4PTWA 3WD2A 1QNRA 1B4KA 3W6MA 1HUVA 4A3YA 4I90A 1NJJA 1V3LA 1WDSA 3KS6A 3SGGA 1GK8A 3ONCA 3GBEA 4W8AA 1UZDA 3UA4A 4W89A 4OZOA 4GK8A 2Z7KA 1VJSA 4W85A 3U7VA 3TSMA 2CHNA 2Z26A 3WK3A 3GHTA 2FGZA 2QF8A 1DBTA 3H54A 2GK1A 2H9AB 3CASA 3WUBA 3MYOA 4KEMA 4L9ZA 3LGEA 4PL2A 4KKXA 4LVGA 1DWGM 3QPYA 1S46A 3LLXA 2L5HA 2Z2AA 4WQ6A 1KTCA 4KT2A 1IEQA 3TTYA 2HTMA 3CV2A 2D24A 2R1LA 4Q8QA 4ZXLA 1TPEA 5HBFA 3SDOA 2YJQA 4UTJA 1VH7A 4GX9A 1GZGA 5REQB 3LI1A 1AL8A 1PIFA 4MSSA 3V5FA 5H8MA 4DRSA 5J5RA 3FJ6A 1FHDA 3GTXA 5A6SA 1HJQA 1UUQA 1ZSXA 4XO6A 2Z2UA 3F5KA 3DBNA 4X61A 3VIJA 4Z1AA 1BTMA 5A6LA 3EYPA 1YDNA 1U2YA 3WF1A 3EOSA 1NWSA 2WPBA 2X40A 1IWBA 3LZ3A 2F7FA 4TXEA 2VRJA 4W88A 4YU1A 2CLLA 4GH3A 3W7JA 3A13A 1JCMP 3M0YA 4HP5A 3NQ2A 4JIHA 3RLVA 3UPWA 6PTDA 3L2IA 3E02A 2V5CA 1LLZA 1GQJA 5HDRA 3R94A 2DSWA 1E73M 3NZQA 2J75A 1Y7VA 4GI4A 2PZ0A 4Y8FA 3B0UX 3BK0A 2EPMX 3AJ7A 3R2GA 4RJEA 4JTDA 3WIJA 3G6LA 3R10A 3N3TA 1KLYA 3S6TA 3AI0A 2OSYA 2QGYA 4GQQA 3ARQA 1DIDA 3BPWA 3MMDA 1WXJA 3BC9A 3GH7A 4IP4A 3G5EA 5D2XA 1P5BA 3W6LA 2C6QA 3SEPA 4DX3A 3TTQA 3MC5A 4JY9A 1SW3A 1AW1A 1IXPA 3NQDA 2E8ZA 1T8XA 1EX5A 1XUUA 2J7CA 3ID7A 4PB5A 1JZ2A 3NQ6A 3TAOA 4WY0B 1W3HA 1UZ4A 3E0FA 2W67A 9CGTA 4PSPA 4LUSA 3W24A 1WA3A 4ZTXA 1RUSA 3JR2A 3STEA 3W1LA 1EGZA 2RDWA 2W61A 2PWDA 3WO8A 1ISZA 2YCJA 4RXGA 5EBAA 2WMIB 1QVBA 2CXEA 2XVKA 3V35A 3CZEA 4H9YA 2PTXA 4Q7NA 4JCLA 5D03A 4LYRA 1E3XA 4OECA 2PFHA 2V5BA 4W87A 1JDAA 4GRSA 5KINA 3MJMA 5B7YA 5EYWA 3W7KA 4CU6A 2VRKA 4F2UA 3IWPA 3OVRA 2DW7A 3TJLA 4JTLA 1JUBA 4WD0A 1AUSL 2GSJA 4H8UA 3MWCA 4A21A 4MWAD 1VBHA 2B7OA 1E4IA 1YX1A 4XQ6A 5HANA 3V16A 3PB0A 3BURA 3WH5A 1YTKA 2CYGA 3PJWA 4A29A 1SYTA 1IGWA 4WDXA 3W84A 3WELA 2F8QA 3N17A 7PTDA 4LUTA 3TLQA 2VL4A 4LV9A 1HL2A 3MUIA 3OBAA 4KCTA 1ZBVA 3MV11 3CV7A 4IP7A 3AMLA 1O60A 3QYSA 2VUYA 3P8IA 1OX5A 1Z3NA 3H2OA 3W76A 3BSGA 3GNPA 3T08A 3CU2A 3RCMA 3K4WA 1GEQA 4DUWA 4KPLA 2DT3A 4YS1A 1BVWA 4MWAC 1DHPA 2ZICA 3NL6A 5D9MA 1RPXA 2VP8A 4O28A 4KIEA 3SI9A 1IWAA 3ITGA 1QXLA 3TMLA 3HPAA 3F2DA 1XH0A 2NT1A 5E0FA 3TUUA 1UA3A 1C91A 1UC4A 1Y65A 5A8PA 2X0SA 1TVLA 5DBTA 1YXYA 1DVJA 8XIMA 3MI2A 4XAFA 6TAAA 3WQWA 2B0MA 4D6EA 1I2RA 1KM4A 5LA1A 3QOKA 4JN7A 5A6KA 2UWFA 1JAEA 1MW1A 3T1GA 3OVGA 2CKRA 1QPRA 3S3GA 2PC8A 4JPGA 3I6RA 4IJBA 1PJ9A 2YA0A 4NXSA 5CJMA 3E96A 3S2JA 3AU2A 1WUEA 1P43A 3RM4A 4MM1A 1B3XA 3E9AA 1NWUA 1TV7A 1QO2A 3G22A 4O0ZA 1AD4A 3QFWA 5ABEA 1WQ5A 3UBPC 4UFJA 2RGLA 3N14A 3W75A 1I0DA 2PLCA 1EJSC 1TMQA 2ACUA 3LX9A 5A1AA 1A0CA 1OZMA 2FHCA 5HNTA 5H8PA 1FUYA 2WW5A 1R2SA 2FB3A 2BXZA 2WB5A 4DWSA 3LLFA 4LCRA 2DQXA 4P7LA 3RHGA 2BASA 4IUGA 3DFYA 1RSCA 3BARA 1Z9AA 3DGRA 3CUGA 3UF9A 2PD5A 1OGSA 4HGXA 4IPIA 3RGTA 5T9CE 1CPUA 4GUJA 1S3HA 3EPNA 2IPFA 3WG6A 4NYUA 3M5VA 1E3ZA 1KM3A 3ARRA 1E1EA 1UOKA 1VD6A 2CETA 1QNOA 4JKMA 1QW7A 3ISIX 4UC5A 3LGDA 2IXUA 3UETA 4D6FA 2BOGX 5CZKA 4DJEA 1KFEA 5LGXA 3M5ZA 1JFXA 2Y8UA 3N29A 1TWWA 2SFPA 5JBDA 2C79A 3UERA 1E55A 1KBIA 4HNNA 4ZBCA 1E0UA 4NZ5A 3AMKA 1OC7A 3FYOA 2PGFA 4XZ9A 1ZLPA 2BNJA 3PNZA 3TN5A 4ENLA 9XIMA 2ACSA 2DU2A 3T55A 4FXFA 4QJ4B 2RFGA 3DH7A 5IXEA 2GSHA 3L4XA 4M6VA 1CXFA 1DYSA 3HG4A 4M51A 1Q6OA 3I4EA 4OU1A 2DZWA 2ZX6A 3K5XA 5DXYA 4G56A 3KOFA 3VDHA 4PUJA 5EB8A 1QI3A 1CLXA 4XB3A 2QPXA 3NIYA 1THFD 4LAKA 2OT0A 5AZ0A 3ZSSA 1SR0A 3G3DA 2C1IA 3PZGA 2DZAA 2ZRUA 3JVAA 3EXRA 2QJNA 4NVTA 4K37A 1RVKA 4HMCA 3HIJA 5EMYA 3HJZA 3ITVA 2QJIA 3HMJG 3FW6A 4OFCA 1RHCA 3K46A 3ME3A 3FSUA 3W73A 2A6NA 4PULA 4YTUA 1GOKA 1RD6A 4Q8UA 1ZQ5A 1QCWA 3A5FA 1WCGA 3GR4A 1TSIA 2OXNA 2V6AA 4OIFA 3PZNA 3PFRA 5E1QA 1C7SA 1MZRA 4U3CA 4QE4A 3CZ8A 4DB7A 1NDWA 4BQ3A 2NLYA 4ZO8A 3OZYA 3QLDA 1VZWA 3S9YA 3MSDA 1HVQA 3GNXA 4OV4A 1ICPA 5LA2A 2FPYA 2P3ZA 5CGQA 3DG6A 5K9CA 3UJ2A 3MUXA 4FZIA 2NV9A 4Z08A 1GOIA 4KIRA 4JIIX 4G1NA 3WUEA 5HWJA 2GYIA 3TVAA 3CYVA 1K4HA 3CZGA 2NVDA 3GFXA 2PGWA 4M1BA 1WXYA 2QCDB 1GEHA 3O15A 1VKFA 1XCXA 2OFJA 3QLLA 3HG3A 4HPNA 3UXAA 1T8QA 3DUGA 4X2PA 1EC9A 3WQ6A 4LRSA 3B8SA 1CEOA 3KVLA 3RR4A 1KRBC 1EC8A 4HMDA 2QULA 1LRNA 1M3UA 1V6VA 3CXOA 1T96A 3B4YA 4OKDA 4OVXA 3WQEA 3HPXA 3DHUA 2XVGA 3TROA 3IUIA 3M47A 4IMCA 3W83A 1U30A 4QISA 4ATWA 1XISA 2OG9A 4P61A 1J12A 2IKHA 4PMYA 2J88A 3CMJA 2V2HA 1V7YA 3S5SA 2Y7DA 2ICSA 4AMAA 1JUEA 1IT8A 4IPNB 4M81A 3ZVHB 4EPKA 2DSVA 3N34A 2QV4A 4P8WA 3NZGA 2WMFA 4UNLA 2IKGA 4DUOA 4F79A 4I8YA 3I7SA 3RRAA 2WLYA 1OCNA 2GJXA 1ELSA 1R3SA 1RA0A 4H9XA 3F03K 3ZT5A 1Q6FA 2BS9A 1NP2A 4ORIA 2WC3A 2ZRVA 2PSNA 3EA1A 4JIPA 4H8VA 4IMEA 2WZMA 1E15A 4US5A 3DYOA 3KP0A 1QOPA 5A8OA 4NAEB 3S4TA 1T6MA 1CI1A 4J9JA 5CXPA 2CKSA 1B3YA 2UY3A 3MI3A 2FZMA 1UKPA 1FP8A 5FACA 2NXIA 3H4XA 1VRDA 5FKYA 1T41A 3GH4A 4O19A 4C6KA 4E0CA 4O8RA 1J0YA 3H6OA 4LNCA 1JR1A 4UTWC 2BODX 5EY5A 1MWOA 3T4CA 1XYFA 2INZA 4EF8A 1SVDA 2E68A 4GYPA 1SMAA 4KGJA 5ABGA 2Q8LA 5AYBA 2ZX8A 1EIXA 4X0VA 2D2OA 1VLWA 1WX0A 2OKTA 1DJQA 3WMBA 1VIWA 3A4WA 4Y9AA 1B2YA 1F3WA 2WM1A 1I1XA 1XKJA 1HJSA 4QROA 1EJVC 5RUBA 1NEYA 5CG7A 4DNHA 1FCQA 3FXGA 2DY3A 1AMKA 3EKGA 1TWIA 1REQB 3HV9A 4CN1A 2WBKA 4DZIA 1MRQA 5D32A 3AYSA 2OYKA 3CO8A 2Z00A 4R27A 4A8NA 1OFQA 2FMNA 4S3KA 1ISVA 2QR6A 2WAGA 1RK5A 1MDRA 1CGUA 2QKFA 5HA7A 4QBXA 1JPMA 1UZ1A 3K1GA 1GQIA 2YL9A 2OELA 3CQIA 2OQHA 1BFNA 4GO9A 4WK9A 4PUKA 1VF8A 1DIKA 2XZ9A 4C6IA 2G41A 4HU3A 4F0LA 4Y9NA 4HB7A 2Z6JA 3RU6A 5FEPA 4B15A 4WJ8A 1SW7A 5G4EA 1SZEA 3NQ7A 1FCUA 2RDUA 4FSAA 1I9CB 4K7YA 2NQ5A 4QS5A 3VUSA 2Y5SA 4LAUA 2A2IA 2FQIA 4U31A 3SN0A 1CB2A 3URAA 1EC7A 1LG2A 3MYPA 3LD5A 3L23A 3GDTA 1AA1B 4KMQA 4LC8A 3UZYA 1RP8A 1NDVA 3TP4A 3EEZA 3VGBA 3FDGA 3NYDA 3GC2A 2XFWA 2WQDA 3AIQA 4RX0A 2A3AA 3E3HA 1PYMA 3FY1A 3JZUA 2P0IA 3CUZA 1XBXA 2LLEA 1OCBA 2TODA 1PBGA 2J27A 3VIOA 1IF2A 1WOBA 2J6XA 2OSXA 2X42A 3CAQA 1QBBA 1H11A 4JTCA 5IHRA 3QPZA 4ZXOA 4E2VA 1JCNA 3SO7A 2J7GA 4AW7A 2OOGA 4GIRA 4WRHA 2F6KA 1LTDA 2E6DA 1R9ZA 2AL2B 3F7JA 4LUSB 5BMXA 3LK6A 4RNHA 3BMXA 4GNKB 4MPKA 3HQOA 4NX0A 3GZAA 4LALA 3W7QA 3UG4A 3MSGA 1MMFA 4PTVA 1GORA 3PN8A 4EPEC 3TONA 2OODA 3KXQA 2JEPA 3EWUA 2VELA 1KFJA 4A8IA 4AG0A 3URBA 1EDTA 2RJHA 3MY9A 4LBUA 4IWWA 3WBEA 2PCEA 4G8TA 2BXVA 3CLWA 3QY8A 5BZAA 1EQCA 3LGGA 2C15A 1W1B1 2IXVA 3M0KA 1ALDA 3MTWA 2ZUMA 3AJXA 1MQPA 1M65A 1PPIA 1OIMA 3HPSA 4DHGA 4WDTA 3LRLA 2ZADA 4K1GA 3SB0A 3AISA 1PCKA 1X1OA 3PUOA 4P8UA 2B7QA 1PDZA 4B4HA 1AJ2A 4IOTA 3O2LA 1JQXA 4WGXA 4R88A 3HA1A 1W1A1 2FVKA 1B3WA 2CPUA 2VO5A 2VQUA 1PKYA 3TOPA 3NEVA 3W1UA 1VCFA 2PDHA 3TCSA 4WVXA 4MMWA 3IS4A 1H7NA 3E5BA 3T8QA 1RLCL 2J8FA 1EBGA 4GXMA 2J13A 2FZDA 3KHDA 3W88A 3ABRA 4ZO9A 1UKSA 2VFEA 1PB0A 2H8XA 2GSEA 4ADSA 2HS6A 2X2YA 1A50A 3SCNA 3VC5A 1WZLA 3KP1A 5HQLA 2VFDA 4LAZA 3DDMA 3OGVA 3S2NA 3TDFA 1LWIA 2XIJA 3S6OA 4MY8A 1E51A 3L2LA 2JKAA 2DZXA 3URNA 2J24A 4LCQA 5FSEC 4NZ3A 3R6IA 4H9TA 3A4JA 1XYMA 4MZ1A 5HR6A 2V68A 1GVQA 3D5HA 1F2JA 1K03A 1IR2A 5AHIA 1SO4A 2WC7A 4P7NA 3MO4A 4JD4A 1GG0A 1M53A 1SO3A 1YNYA 2AGTA 3WDPP 3IACA 2V3DA 2YZRA 1KQZA 2JBMA 4F4RA 2REQA 3MDWA 4K36A 4E4PA 2V5LA 4FOKA 1TVPA 2ZE3A 2R8WA 4R9XA 3MV01 1ADDA 2EGZA 4U5KA 3T42A 5BNKA 1TELA 1SJCA 2BTMA 2IS7A 3DIPA 4FOJA 3WLRA 1V8EA 3LCLA 3EX4A 4JHMA 1P48A 4QRNA 1TE1A 4EPBC 1U33A 3T2PA 2F84A 4D1IA 4YWIA 2VR5A 3W2UA 3BJFA 3J7HA 5ECVA 4UWMA 2E1DA 3WMCA 1UBPC 3R43A 3W6YA 4AC7C 1TV4A 1OG0A 4PRTA 4IIBA 1VFOA 4JTUA 3QBUA 3MBDA 2ZZ3A 1TCDA 4IIHA 4HHLA 4W86A 3H53A 1WV2A 3CWOX 4MNLA 3ZJKA 4OBSA 1S5TA 1XIFA 1WDQA 3VE9A 3VO0A 1S5VA 2DEPA 2VC9A 4IHCA 2P50A 3OA3A 4RPQA 5CCZA 2JK2A 3NPUA 1W0MA 3WLPA 4DPQA 5CSYA 1XIMA 2A3EA 4KWVA 2E4TA 3Q67A 5D04C 3PPCA 3EB3A 5I6SA 1W17A 3CV6A 5I77A 1E0WA 1WPCA 4PCNA 4NZCA 4XZWA 4JZ5A 1DJZA 4L6DA 3I7QA 5AN7A 5E70A 1DJHA 2A3HA 3E0IA 4X9SA 4PTNA 1R6WA 4MGGA 1FWIC 2X1UA 4H2HA 1A5SA 1ZAJA 2DZPA 4IMFA 1GW1A 3H8AA 3WH8A 2OO0A 3KBVA 1SFLA 4GNJA 2PGRA 4JTKA 3CUXA 4V15A 2FPTA 3HGRA 1J6PA 1UD2A 2YIHA 3DFOA 3TW6A 4IIGA 3W37A 3UJFA 1PZ1A 1JI2A 2D22A 1BVNP 3WLMA 5E0KA 1C8YA 4MDOA 3GYEA 3EDDA 2P76A 4YVXA 1B5TA 5HJXA 3TC7A 3CO4A 1IZKA 3GDBA 1D8CA 4LVAA 3AYVA 5F2IA 4WXZA 2ACRA 5C7VA 1KM0A 2YCIX 2WC4A 3TSBA 3LBOA 1T5AA 1XGDA 2GVLA 3L4UA 3BJSA 3LPPA 8RUCA 3VOIA 2EJAA 2NX9A 2VCBA 2XN1A 3M9YA 4B5VA 1F3EA 2H8ZA 4M6PA 4QM1A 5IHSA 3U9IA 3FNDA 3RO6A 1J2BA 4GWEA 1FHLA 1VS1A 1QDSA 2F6UA 3G0UA 4IIEA 1NIUA 1J0IA 1MXSA 2IMRA 4UFLA 5KZMA 4O52A 3WNKA 3CIWA 3M0ZA 1H63A 3THDA 2Q6ZA 4HQVA 4ZQRA 5AY7A 1J5SA 3MUAA 4AD2A 2CEQA 4LGXA 2D69A 1WKDA 4LOCA 3SCSA 3ZWTA 3CEPA 2DZUA 2INEA 3C2RA 4TVUA 3TC6A 2VYOA 4R33A 1D3CA 4W7VA 2Z0IA 3MI6A 3USBA 1J4EA 1JYXA 3SW6A 1K1DA 3B9DA 3GAKA 3KRBA 3KBWA 3DYMA 1WDRA 2OQLA 2YDRA 3O63A 1IYXA 3LG3A 2V2DA 4UQAA 3W7RA 3NXFA 4R3UA 3LCHA 4YXGA 3VOHA 1XF0A 4JQ3A 1KV8A 2PODA 4JNYA 4DXKA 3MA8A 4CD6A 3EOEA 4WOZA 1KTNA 1G6CA 4DM2A 1KCKA 4HU0A 4AX7A 3MHUA 1FDYA 4MDPA 1BXNA 1EQPA 3Q2DA 2QCNA 3KVKA 2QVNA 1MNZA 3VE7A 2I56A 1O5RA 4XD5A 5A94A 2V81A 4Y9MA 2ODOA 1VEOA 1H4PA 5AKQA 2QDHA 2E5BA 4JKLA 2VUNA 3LUTA 4XD4A 3AMCA 1UWSA 5G1TA 1K8CA 2DORA 2PTYA 1JRCA 3NAVA 3QR0A 3WLIA 4Q8MA 3GQYA 3DX5A 4S3DA 1YPFA 4BR1A 5TF0A 4JFVA 4RV3A 4I9AA 5KZEA 3KDOA 1JNDA 1EA9C 1V0LA 4MWAA 3W27A 4GGHA 2ZFAA 2CBIA 3GYCA 3QSTA 4PA8A 1F4HA 1U1UA 3KTXA 3WMLA 4TVCA 1EH9A 2YGYA 3P82A 1O68A 1QPQA 3TV8A 5D2TA 5CBIA 1VRXA 4PRRA 3M64A 3CHEA 3CWNA 1C8QA 2C3ZA 2C1GA 1EJXC 2DIEA 4MJMA 4AZCA 3HB9A 1UW9A 3NZPA 3E0VA 3EWZA 3R8HA 1P6CA 4G1KA 3WNOA 2NT0A 4DUVA 3NQGA 2XVPA 1E1CB 4CVWA 4IGHA 2YL5A 2BGNE 4Y96A 3KBJA 3WYZA 2JF6A 4C6DA 3ZT6A 4IUOA 3MZNA 4QDWA 3U2EA 4AZIA 4AUBA 1KKRA 2YOCA 1DTUA 2BVDA 2XH0A 2EG8A 3KRSA 1YMYA 3AYRA 3ELFA 1ZAHA 4B91A 1EYEA 3VD9A 3F2BA 1B3ZA 2A7RA 4DLMA 4I9TA 1KW1A 1FWAC 2PD9A 1BYDA 3GVWA 2NWRA 3DHPA 4IL2A 1GONA 1PWLA 4FNQA 2HJPA 1BXCA 3R8RA 2OZ3A 4CN4A 4NT0A 1IT0A 1GQLA 1O4UA 1W5MA 5MKGB 1TUFA 2ZUVA 4ZMGA 4HA0A 4NNCA 5ABTA 3BCDA 3ITOA 4HU4A 2Y89A 3WLHA 1T0OA 4LW7A 1D3GA 1B1YA 1OD0A 1G7VA 1FY6A 4B2DD 2WSQA 3F4WA 1Z6KA 4TOQA 2YXXA 2GUUA 1QNVA 1JNEA 4EOUA 2VVSA 4I9JA 4A4AA 3BMWA 2QJJA 1PX3A 4HN8A 4M0XA 2KZHA 4IX2A 3DI0A 4MJ2A 2HE5A 4AZGA 1DQWA 4PFMA 3BZGA 3W01A 1KFCA 3UP8A 2Z27A 3LHWA 1BVZA 1GJPA 5C2GA 2ZWZA 5BCAA 3KE0A 4O54A 3U0HA 3WH7A 1U1JA 2ASHA 3PZUA 3KOXA 4LRTA 5DANA 1SZFA 3SUSA 3NSMA 3E6EA 1HL8A 1FA2A 3LYEA 1O66A 3VGHA 1VYSX 2XWEA 4M1RA 2CZEA 4OOUA 1X1NA 2QCEA 1PZ2A 3NNTA 2FTYA 2C14A 2FKPA 4JTGA 3WH6A 2VI0A 2OX4A 4XBSA 3PBMA 2PDLA 3TZFA 2HZGA 3WJSA 3NA8A 1ZU8A 4HPGA 3W26A 3WD0A 3G18A 1JRBA 1IHIA 4MB5A 1ME7A 3GU1A 4RK8A 4K8GA 3LM7A 1DP0A 1LT8A 4J7RA 3UR8A 2GZXA 4TV6A 3S2LA 2WMHA 4YMZA 1H51A 5CG0A 4KEZA 2NX3A 2CLEA 1GOXA 2B7NA 3TCEA 3NG3A 5DELA 5I2UA 4A05A 1IIHA 1BWLA 1RJQA 3P60A 5C9UA 4IT1A 3CLMA 4OV9A 4Y9PA 1TPH1 3AXKA 1MI3A 3KWXA 1C93A 2CLPA 4FIQA 2G97A 2BY1A 2QYGA 2GGGA 3KW3A 1RBAA 2DW6A 3ZSTA 4X3ZA 4TU1A 9XIAA 4KWSA 1ECEA 1TO3A 3I6EA 2YA2A 2EKCA 2WCSA 5LNRA 4GMEA 2JGQA 2FJKA 2FMOA 1RJRA 2AAAA 3NJ3A 3W7MA 2J77A 4HTBA 2WLZA 1I2NA 3CAWA 4EWJA 3KCJA 1QI0A 2VFIA 2WNZA 2QCFA 3POCA 5ABFB 5JIWA 4NI3A 1E40A 4ZZ9A 3KL5A 2PPGA 3W1PA 4MTVA 1E5NA 3VMNA 1NF0A 2HE8A 4C1KA 1R86A 2FHBA 1TYGA 1ML1A 1K3UA 4OQVA 4I6VA 3W85A 1ITXA 3VMPA 2VDHA 4FIRA 4ALDA 2OLAA 2P8BA 1FDJA 2G37A 1ME8A 2GQ8A 3I10A 4GQGA 2BGSA 2PB1A 1FVPA 7ENLA 4ICMA 1EUAA 4L6HA 2WYSA 4KGLA 1BXBA 3MHGA 3M0JA 5CKSA 1HX0A 3STFA 3OP2A 3EPMA 4OUIA 3SQLA 3M5YA 3FAXA 4HMNA 3W7GA 1TPVA 1KWGA 1Q13A 2XGZA 2ISDA 1G5AA 4JDYA 3RM9A 4LPCA 3L67A 4Y6GA 5ABHA 1U5JA 1JDDA 6REQA 5FJRA 4HZ8A 3PZTA 3PB2A 4CQ9A 9RUBA 5F1UA 1EOKA 2HBXA 1HN1A 3TTSA 4S3BA 2REQB 3TN3A 3M44A 2HROA 5DT7A 2CHOA 3TXVA 2FZNA 3ITXA 2O4MA 3NL2A 4QQUA 4Q7IA 2PP3A 4GFIA 4NJGA 3OHMB 4F0KA 3MSYA 4M7SA 3A4XA 3AU6A 1UWAA 3GVRA 2ZWYA 1PS9A 2NW0A 3WQ4A 3FHQA 4TX8A 3HBLA 2W6RA 3W7NA 1JYVA 2J9ZA 3GW0A 2PRHA 3M0LA 2X09A 1DJXA 2OJPA 1Q2RA 7TAAA 2CNCA 3ANVA 2INFA 4LY4A 1K9DA 4UTWA 1XYZA 3DECA 3PZOA 3TQPA 1KXQA 1NFBA 2EO7A 3SUWA 4AMCA 1TPWA 1W1TA 1Z7AA 1I8JA 3C2OA 1IT7A 3O1NA 4DYEA 3C2VA 2AOSA 5AC7A 1VBRA 3O6YX 1BSLA 1SFSA 3PBWA 4XD6A 4BI5A 1WDPA 4GQ0A 3HGJA 3LRKA 1FX6A 3VIKA 3KBMA 2JKPA 3UXIA 1KM1A 7ODCA 4UTMA 1N8FA 3WFAA 3E2QA 4RZ5A 4H6RA 1NOWA 3PF3A 4IZGA 7A3HA 4IQJA 1RVGA 4UUIA 1JL8A 2G95A 2XU2A 5LIYX 3T0AA 3GDLA 4AD1A 1W9BM 2OZ8A 2O9OA 3INPA 3LQLA 4AF0A 1CGYA 6XIMA 4JQ4A 4H04A 5G2IA 3T2QA 2QVHA 1JXKA 1R46A 2E28A 1W9DM 5HQEA 1HIZA 2FVMA 1PTGA 5KEZA 3ARWA 4PMQA 3ITYA 3UZXA 4G6CA 4L6OA 4DQWA 3V5OA 2HVMA 1JZ8A 4DJDD 4L61A 3VDCA 2CLOA 5EPDA 2Y24A 2P1FA 1BYBA 4S3GA 3W82A 3W02A 3DENA 3P7YA 2JGYA 4QCFA 3PR2A 2Q09A 3NQBA 5IFPA 5JQ9A 1XG4A 2CERA 2V69A 1LP6A 4ATLA 3DFNA 3SUVA 1ICSA 3CZKA 4ROPA 4US6A 5HPCA 4B5WA 4WJXA 4NKCA 1QHPA 4D6JA 1DWIM 5DY2A 1FH7A 1IGSA 3QKEA 1DXIA 3LQGA 3C2EA 1W6TA 1RJPA 1MDLA 1ONRA 4PTXA 3K30A 2AQWA 3B9OA 4UFHA 4DJDC 3I68A 1ONXA 2AAMA 3NM3A 4R53A 1RP9A 3CYJA 2WVVA 2X0YA 1FWTA 5ENLA 4ZOCA 1A5MC 4LV4A 3IV8A 5G4HC 2WKJA 1L8NA 1AODA 1KXTA 4CQCA 1PL9A 3RRXA 4LUJA 4PUDA 5E93A 2I5GA 4LNYA 3WF3A 2XIOA 4NZJA 3RNDA 2NVCA 4FNRA 1E6PA 4K7VA 2I14A 4HK7A 2PP0A 4HTYA 4XKYB 3GG1A 5I3HA 2JALA 5H6HA 4HNCA 4JTTA 2R14A 3STPA 3QRHA 3E38A 5MHBA 4K68A 2J74A 1W32A 3CL6A 1IWPA 1SQ7A 2X05A 3L4ZA 4XTIA 1H7WA 4GVHA 1UP3A 1CT5A 2BVTA 3FEMA 4FLRA 4EK7A 1H41A 4UR7A 2PLMA 4WLCA 4EANA 1GZJA 1XC4A 1VPQA 3KL3A 4DYJA 5B7ZA 1TG7A 2XSXA 1XSIA 4XK2A 2XJ7A 4DLFA 2EPOA 2POZA 1RY8A 4JY8A 3RO8A 3KLLA 1MQQA 4FX6M 3KHJA 4G2DA 4XZMX 3ZMRA 4O4WA 2GWGA 5JU6A 2PP1A 1SGJA 2CLMA 2VR4A 3PM6A 5E6YA 4CLMA 4FR6A 3MP5A 3MU7A 1OGBA 2A7NA 1POKA 5FL1A 4UXDA 1NVMA 4JL1A 4MKNA 1LOSA 3UVAA 4C7FA 3PBGA 4DJED 4FB7A 4B4FA 3RX4A 1RY0A 4AU0A 3EA2A 2J6VA 3C8NA 3SSJA 4UB9A 1LF1A 3BG9A 3JU2A 2VD8A 4IP5A 3BWWA 4IFRA 3C0JA 4IMDA 4DZAA 3EBVA 4BA0A 4GC4A 5CGTA 3O05A 1RZMA 3VAVA 1XIBA 1CXKA 1GOOA 1LDCA 4BHYA 2RGMA 1GW9A 3WJYA 3H2EA 4O1FA 2TRSA 2F2HA 4DWDA 3N4EA 4NNAA 3U4AA 2V2CA 2Z2BA 3VYLA 4BF9A 1K4GA 2PWGA 4Q8PA 4DJEC 4K39A 4JXCA 1H7OA 3CWHA 2E67A 4RNIA 3PZQA 4HNVA 2WHMA 3H70A 1LLWA 1W9XA 2JIWA 3OYZA 3NVTA 4LVFA 3R5EA 1RCXB 4QCEA 4AHQA 1AZ1A 3OG2A 5AC6A 2HXTA 3GFYA 2OWWA 3W28A 4K8HA 4HOWA 3LDVA 3NGFA 4LFYA 3VZZA 2ZE0A 4QSHA 4E3VA 1GVOA 5E6ZA 1Z69A 4YCOA 1CTNA 3PK7A 5F4WA 1WO2A 1QHOA 1TTIA 4OJYA 5AECA 2PZNA 4BI7A 5AHEA 2DJXA 3H7UA 3VOGA 1LM1A 4WOQA 3VUPA 3OOQA 4D8ZA 1G4SA 4Q8OA 4S3EA 1ITCA 2ZC8A 3TE9A 4K2SA 3NQCA 1LQ0A 4WDWA 4ZCWA 3GB6A 1I4NA 1R9XA 2Z1WA 1WUFA 3HF3A 1HT6A 3KEHA 4Q32A 2XH2A 5EFDA 4MVAA 4UMCA 4O1CA 4L64A 4UCGA 3QJAA 1UWRA 4LUYA 3RMEA 3AO0A 3DFQA 1EZWA 3E1F1 4UMBA 3RDKA 1W37A 3W2KA 1B4EA 2WANA 1PZ0A 4BZYA 4PUWA 3N2MA 1WB0A 4JR5A 4WF7A 2Z1VA 4H41A 1OFDA 1EGMA 1E4LA 2Q71A 1E1FA 1DPMA 3ZOAA 2A6LA 1FQ0A 1Q6LA 4IFKB 3D47A 3VNIA 1OIFA 1F8IA 5CZSA 1GVEA 5HXMA 3HGOA 2BP1A 2YW3A 3V1HA 2NVAA 4REQA 4A8RA 3UJRA 1CBGA 4A3QA 2OR2A 1SW0A 3PZIA 3W1NA 4GHRA 3G6MA 1XLHA 3PJTA 3WNMA 1L2UA 3UG3A 2OB3A 3GNNA 2NQJA 4FXJA 4BEUA 5KZ6A 3P62A 2PDUA 1H3GA 1TX0A 3AALA 5A2CA 3UWVA 1PXGA 1I6NA 1WKFA 3IJDA 3FEQA 2VDGA 2C16A 1J0ZA 1BHGA 4JFTA 1PO9A 2PDJA 2PBGA 1Q63A 5FF4A 2C8NA 3TC3A 2BHYA 3N9KA 3WF0A 4H00A 1V3IA 1NFPA 1K6AA 3G8EA 3VGFA 3W74A 1QPOA 3AXHA 2EXOA 4TUFA 2HMCA 1BKSA 4C6PA 4Z2JA 2Y7GA 5FAGA 4TTUA 2XVNA 4IPLA 4FXSA 5TAOA 3MMTA 3URQA 2I5QA 3O9NA 3VKKA 5CBJA 5HWMA 3P81A 4H83A 1WXZA 2QUTA 4D6GA 3WBAA 3NSXA 3T9PA 4LBRA 3S1GA 1E6ZA 4QAIA 3PG9A 3UJSA 4WY0F 5K2ZA 1A5UA 4TX9A 4U33A 1A80A 1DKWA 4ZO7A 4QJ5B 5LIWX 1EHNA 2ALRA 4UTFA 5HMSA 3DZ1A 3VNJA 5JBEA 2TPSA 3G1XA 3G1DA 1ZPTA 3LTSA 4IG2B 2QCCA 3M0HA 1PKNA 1FWGC 3N2TA 1C9WA 3MCOA 1Q4NX 3IPWA 3UEQA 3PZMA 3BLFA 3FVDA 1VCVA 3NO3A 1V79A 2XISA 2PDQA 3UR7A 2XN2A 4F66A 5AZ1A 3BGGA 3QGVA 1JF5A 4P7RA 4Q6JA 4DVOA 1QNSA 4WSHA 5EBUA 1UQYA 2FZBA 2Z1KA 4FXRA 3ZWSA 1H50A 4NNBA 2QUVA 4AWSA 4DI9A 3ES8A 5LNVA 1TREA 4PMJA 3LNMA 1SZRA 4M29A 4MJ4A 2YBUA 4LAOA 2R1KA 2DUZA 4W8BA 4FHAA 3CM4A 3CQKA 4ADUA 4Z2KA 3MKVA 2BVWA 4GXPA 4MKVA 1CLVA 4RE4A 3WEMA 3Q4DA 5A8QA 5LIUX 4DBDA 1ZBCA 3SCPA 4C6FA 4CNNA 3LOTA 4U28A 4PR4A 3W7IA 3CL7A 2IPJA 5D8ZA 3GVGA 3TYUA 2RKXA 1HZYA 2IKJA 3BLIA 2D0HA 2VCAA 4J3VA 3QXBA 4J2PA 1XV8A 4ZQPA 1RQHA 5EMJA 3RLHA 1MW0A 3OZOA 2RUSA 1KTBA 1HQTA 3VOCA 1OFAA 3W1XA 1XKYA 5CEWA 5F2GA 3RUBL 1X39A 5L9FA 3MT1A 3WD3A 4L5ZA 2NWSA 5FA5A 1KRCC 2ACQA 4I9MA 3WKZA 2Z25A 1W3KA 1V93A 3NDOA 4G7EA 3QQWA 2QIWA 1UC5A 4B3ZA 3UWQA 1HKWA 2CLKA 1XIHA 1J8VA 3B0VC 1JDFA 5IM51 3KVJA 4FK9A 4O1EA 3PZ9A 1Q6EA 3FX4A 5LKYA 3L5MA 3ZJ8A 2RH9A 1BD0A 1FOBA 2QMJA 3QR1A 2PEVA 3BG3A 2I9UA 2Q3OA 2V3GA 3CUIA 4IL0A 2XFYA 1A5OC 4R5EA 1XBZA 1XRTA 1JCTA 3NPXA 3FKKA 3VDBA 3NM1A 3APTA 4PCSA 2XVLA 1M03A 4FX7A 4YWSA 4JEJA 3WDHA 3CH9A 1XPGA 4QLKA 1HKIA 2QJGA 1FWEC 3PBVA 2Q3RA 3UU0A 1J79A 4Q8VA 1VFMA 2PF8A 4WKAA 1DWJM 5FL0A 1P7TB 2G50A 2EEXA 4HT3A 3HPZA 3VNLA 2RJGA 4HYRA 3LSCA 2GUYA 4GJIA 4L9YA 4RDVA 2E1WA 3PAOA 4GISA 4O1DA 5FJTA 1PSCA 3H2AA 1OK4A 2Z6IA 4OHQA 2X1IA 3SZ8A 2X16A 1KBKA 4DZHA 4KWUA 1KFLA 3OQ8A 2PA6A 4D2JA 3A6OA 4HMEA 3M43A 1UR9A 5C9RA 4Q22A 2EPLX 4LVDA 3B03A 4XBKA 1OEPA 2QXWA 3FGCA 2V9DA 7REQA 2CLFA 3GU2A 3WX7A 1TCMA 2GDVA 3KRUA 1HG3A 1UD6A 4NF7A 1R2RA 3EDEA 3PFMA 1U22A 3BL3A 4A3UA 2NUYA 4ROQA 1VBJA 4KWWA 3GXTA 4AY7A 2ZUNA 2QLYA 1QTWA 1TA3A 3O0KA 4N4QA 1XFBA 3QFEA 3U4FA 1ZZMA 3WFLA 3EWXA 2NUWA 2GVEA 3GKAA 3K4AA 4WSJA 3M46A 4QHRA 1N7KA 4D8AA 3WNLA 1XLKA 3QN3A 1KA9F 2FH8A 1L6GA 1A5CA 1XYBA 4JYFA 1O5QA 5HUOA 4C1NB 3VOJA 3C6CA 3S1UA 2QS8A 3NQFA 4LSBA 1AK5A 1QT1A 3KZSA 1XLDA 4CD4A 1Q66A 4RDZA 1VBGA 3LCFA 4NQ1A 2ESCA 1X6NA 4KETA 3L65A 5LYRA 4QG6A 2DT2A 1YQ2A 2UY5A 4E4UA 2QNEA 3APYA 1X98A 3QMRA 2OKOA 5CQ1A 4K6AA 4LBSA 4AYGA 2VHLA 4KRUA 1V77A 2O92A 4CKQA 2WCGA 2G0WA 2Y4SA 3UGVA 3I4KA 3SN4A 3SAZA 1P0DA 4PH6A 5HUPA 1EHAA 4MWAE 3VKAA 4AYSA 3TNOA 1W5NA 1L6YA 4JX6A 2GGIA 3GXIA 3KOWA 1XIDA 5FIPA 4JYDA 1OCJA 1XD1A 4QTGA 3TA6A 1A49A 3HQNA 1E4MM 1GOQA 1HP4A 1KCLA 4YHEA 4GVGA 4WGHA 2Y2WA 4A22A 1XIEA 1GYLA 5I02A 1KFKA 2E6YA 2C0HA 4FNSA 1XLAA 2PRLA 3V36A 1VHCA 2CZFA 4XZLX 5D9PA 2YB1A 4I8DA 3W7OA 3L66A 3B8IA 3G3MA 4IJRA 1XGEA 5E09A 2VFGA 4GUHA 4AEFA 2YCLA 3EB2A 1OD8A 3AIWA 3STGA 4KWOA 3PG8A 2PC4A 2VEKA 1UHVA 4QP0A 1XUZA 1XIIA 4S3JA 4CQAA 1GPFA 4YHGA 4DM1A 4HPHA 1KB3A 1MXDA 1W1ZA 3LMYA 2Z1XA 5GPRA 3VNZA 1MUMA 3IAPA 3WEOA 4M80A 3RM8A 3QF0A 2PBOA 2DPEA 3CL8A 1EJWC 3ZYZA 4H4IA 4PMOA 6A3HA 1K70A 3BW4A 4FMVA 5D05A 1JQVA 1XLJA 4IMAA 3B9EA 1NSJA 3CC1A 3XIMA 4BQ2A 1Q7MA 4Y9OA 3GY1A 5D33A 2EQDA 1QPNA 3BMVA 1X6UA 4NJKA 1FTXA 1MQRA 3WJWA 3G0SA 4UTHA 3EEGA 2A1YA 2XSBA 2C1HA 2VENA 3EDFA 3BAYA 3V3WA 3M7WA 1Q3NA 1MSSA 1K9TA 2VJXA 3GDMA 3W53A 2PDBA 3LV5A 3N18A 1ZJAA 3C3NA 1XRVA 1C8VA 1PUDA 3LHTA 4OT7A 1F6PA 4CCCA 1W1VA 3O7UA 3BANA 3R0KA 2ZCGA 4PCPA 1LUCB 1XLIA 3QH2A 3IRSA 3WDJA 2E09A 3LY0A 5M3WA 1ZUAX 1XINA 4CUCA 1GGOA 4H9ZA 1S38A 1ODUA 1TV3A 5BROA 3WQCA 5C71A 1BRLA 3KL0A 2BHUA 3P61A 3PS7A 2RDXA 3IAQA 4JFUA 3V18A 1DWHM 1DIEA 3P2VA 4I7WA 3EGJA 4G5DA 4M7TA 4MNJA 1W31A 4YYFA 1TPDA 2HSAA 1SFJA 5LSMA 2AQVA 2BFGA 1VGAA 3B9NA 1R30A 2Z29A 3IIPA 3K13A 4UOZA 4GNVA 4JN6A 3QYQA 3T7VA 2D2HA 2G3MA 3I7RA 3N19B 2HXUA 1X6LA 2PI6A 5LNSA 3HQPA 3WQGA 1OGGA 4M5PA 4CNOA 1GCYA 4KRTA 3GXNA 4XAGA 3N9SA 3DFHA 1E0VA 3LPGA 1WOAA 2QCGA 2I9EA 3I6TA 1G01A 4FS9A 3CNYA 4JIEA 3NEHA 4HA4A 2ZZ5A 1EXBA 1Y5WA 4UQBA 3DHFA 4U5IA 2HPMA 2Y5EA 3W3OA 4AZ6A 5I3KA 3RN6A 4RZBA 2VZUA 5AC4A 1O5KA 1JPHA 4ES4A 4ZR8A 2AKZA 4ZL1A 4LWWA 1KO0A 1ZALA 5FJUA 4REQB 2BG5A 4I7VA 3QZAA 3KUMA 1OABA 4E2BA 1W9VA 3I3DA 4R9OA 3UW6A 1UIOA 4EACA 2GDQA 4YLWA 5E5CA 4PFHA 3ZR5A 1VEPA 1YLVA 5LXEA 2PU1A 1YXDA 4GO8A 5TNVA 1WYIA 5AVNA 3TTOA 1NELA 3DG3A 3A64A 4O57A 2Z4GA 1UA7A 3N4AA 4E38A 2WV8A 3AWOA 2Y7EA 4AEOA 1ZBKA 1JPDX 1WBHA 1Z41A 1XYLA 3OBEA 1JFHA 1FHVA 2ZX7A 1DJGA 5H91A 2XPKA 2PDGA 3HURA 2HWGA 4MB4A 4CEXC 2FH6A 4ZSUA 1DJWA 4M6QA 4XX6A 2VFHA 2PRMA 4B16A 3COTA 1GNXA 5CJ5A 4CCDA 3VIHA 3MCMA 4DJDA 2D0FA 5A8GA 4C6EA 4TR9A 1OX4A 2QCMA 1XBYA 3APGA 3ARVA 1D3HA 3MPGA 2Y8KA 2CITA 2FIQA 3VMOA 1M7JA 5DRCA 1YTEA 1QWGA 2E5CA 1EEXA 2CESA 2ATMA 2NXHA 1CECA 4DJFD 2FFIA 1ODZA 4TMBA 2XGIA 1UOZA 2YB4A 1DEDA 1PKLA 4GCXA 2BOFX 3D0CA 1A5LC 1XYCA 2X7WA 4KH2A 1G4TA 5DY3A 3CAVA 3JZEA 5BXSA 1TKKA 1D9EA 1N82A 3FS2A 1A0DA 3DU0A 5C9WA 1M7XA 2E77A 2PDYA 1CNVA 3KCOA 1UH3A 4TQTA 3UXKA 1LQAA 3N11A 4ZSTA 1B54A 3SRKA 2E9LA 2E8YA 3WLKX 1LLOA 1XCFA 1Y8BA 2C71A 1O12A 3DERA 4HVXA 4NZ1A 1JDEA 2VNCA 4HSOA 1H62A 1OY0A 4DJFC 4ZEPA 4ZFMA 2AKMA 2QUUA 1AL7A 3CIVA 2C7FA 3MQTA 2YDAA 4GUFA 2VGIA 3NO1A 4QX4A 2VEPA 2HPIA 4GKLA 4GI9A 5K3VA 1GVFA 1L0PA 1MRAA 3MW7A 2VGBA 4Z2LA 3GKFA 3N15A 4L4OA 3AFBA 3ANUA 5DMLA 1MW3A 1QK2A 3OLIA 4YYCA 4XO7A 4PUMA 5LIKX 5M17A 4JTQA 1UR2A 4PCTA 2OYMA 2PUZA 2H9AA 2W62A 3TW7A 1CGVA 3GRIA 4P2VA 3ABOA 1G94A 3B4UA 3NUKA 4AIUA 1V02E 2O9RA 2XYLA 3C4UA 1TWDA 3AAMA 3MB9A 1V6TA 4TV5A 5DFAA 3OZPA 2E5DA 3VM5A 5REQA 2YL6A 5AHLA 3VGGA 2GJLA 4XVDA 3PTKA 1G4PA 4P7QA 4XV0A 3BLEA 3F4VA 1ZHAA 4MY1A 3M1ZA 3FOKA 5AHFA 1F7BA 4XAZA 5CPOA 4GZJA 2WM0A 3FFSA 3E49A 1OINA 3OA5A 1XLLA 1Q5MA 5CBBA 3VOFA 2FJUB 4D1JA 3TEVA 1YRRA 3REQA 3P67A 4GY7A 3M5XA 2D23A 2PU0A 3OTRA 1U83A 1VAHA 1W1PA 1X1ZA 2J66A 2VEMA 1YPXA 2CLHA 4R7JA 1YDOA 3QC3A 3RK8A 4KRZA 2O0TA 4UR8A 5C2CA 3T6CA 2W66A 1ZNNA 4INFA 4KFNA 5HJYA 3G8RA 1IEIA 4C60A 2YXOA 4GE8A 1GHRA 4O1BA 1VCGA 2W4XA 1HF6A 3B0PA 2ZKMX 3LMZA 4IGMA 3H2CA 1QO5A 1C29A 2PDWA 4ERGA 5I23A 1QNQA 3PUDA 3UGRA 2UZ9A 1JYNA 1J18A 4R7OA 3V4BA 1JPIA 2XWDA 3R4IA 1OYAA 1R3VA 3B40A 3PUEA 4HNTA 1T40A 1RCQA 1CXEA 2VD9A 1BGGA 2BDQA 2FHFA 3TSDA 4QQ3A 5CC5A 4WY0A 4A2SA 3OLGA 3ITTA 5CGMA 3CB3A 2G3NA 2YCKX 3EX2A 4QIUA 2WMIA 4HZ6A 2ONEA 1US3A 3PVFA 3T40A 4C7GA 4EE9A 3H21A 1CXHA 4B92A 1TX2A 2FLIA 2Y5JA 4TIMA 1HKKA 4CNTA 5LZLA 4NP7A 2WPGA 1SU5A 2BLEA 5A6BD 2NV1A 1S5WA 4AIOA 4BQ5A 3CBWA 2VGGA 4BCEA 4KEUA 1RBOB 3MSRA 1H5YA 5C9XA 1YNQA 1UWIA 3GHSA 3U5YA 3C0QA 3ZLFA 1IQ8A 3RAOA 3WLOA 1QPKA 4PYSA 2GVYA 4HK5A 1EF2A 3ZLHA 3TQ0A 3KLKA 4B9ZA 5LXXA 1XH1A 3UZZA 3PY2A 5C6MA 3DYPA 4Y90A 4DXXA 3ENLA 1K8ZA 3ATZA 3II1A 3T09A 4HKPA 7XIMA 2OLSA 3GC5A 5I5RA 4PMDA 1O7AA 3IIVA 4M19A 3U2OA 3CUHA 1OX6A