5G4WA

S. enterica hisa mutant d7n, d10g, dup13-15 (vvr) with substrate profar
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
231
Chain Sequence
MIIPALNLIGGTVVRVQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISAGSNVSLYEEVCAYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQCWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISA
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 80
structure length 231
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g4wA00
3QSRA 3W76A 2ABBA 1YXYA 4N4QA 1PVNA 3CTLA 4TIMA 1H7WA 1E51A 5LZLA 3PUEA 5LNVA 1LLZA 3UYCA 5CSSA 3HGJA 3M47A 4DF0A 4CNPA 4UTWC 1GYLA 4JN6A 3G3MA 5EBUA 5DCBA 2G95A 5HNRA 4I7UA 5D2TA 4FXSA 4R33A 1PS9A 4K6AA 1ZAIA 2CZEA 3TXZA 2ABAA 4LOCA 4OGZA 3LV5A 3QSTA 1IIGA 4DELA 1I2QA 4QIUA 1KFKA 1R30A 1KTNA 4EOUA 5SWUA 4RXFA 5CZTA 3C56A 1SO6A 1F76A 1FDZA 1LLWA 1SO5A 4X9SA 2QCGA 3IGUA 4JX5A 3S6DA 3QMRA 3NL6A 1SZGA 4Y6GA 1PHQA 3A21A 2HSAA 3EKZA 3BV4A 1TO3A 4WY0F 4LVAA 1UCWA 3C0JA 3ZR4A 3E0IA 2NWRA 3W6YA 1G7VA 4J9JA 2VELA 5F1VA 3NQGA 1TTJA 1ZCOA 4GE8A 4UFLA 3B06A 5CSRA 3M41A 3NL3A 4AWUA 3HJZA 5C54A 1W5QA 1OK6A 3TAKA 4BI6A 1MZHA 4LV4A 3LV6A 3H54A 4M6PA 2H90A 1ALDA 1WYIA 4JGDA 4DPQA 1JQXA 5DCEA 3EXRA 2A7RA 4M5PA 2X1SA 3LBCA 2ZRXA 1LBFA 3LHTA 4BF9A 2VOMA 2QEZA 2YSWA 2A7NA 4WOZA 3A9IA 4XQ6A 4K7YA 3BVJA 3MI3A 3PS7A 3W7HA 3R12A 1SR9A 4X3ZA 4M6VA 4UXDA 2A0NA 5BRBA 3LLDA 2NX1A 3A24A 4LTSA 3GLCA 4FX8A 1TJRA 2RDUA 3PUDA 3CT7A 1NAL1 3DFOA 2V0TA 3P8JA 3S1VA 3G8EA 3Q37A 1YDOA 4QNWA 3NOEA 1TREA 4OQVA 3TJXA 3PF3A 4JR5A 5FEWA 4A3UA 1I45A 2ZA1A 4NJHA 3NM1A 2XN1A 1I2NA 1H50A 2DZXA 3I6RA 3G0XA 1V7YA 5EMUA 3UWUA 1K03A 1JUEA 2XN2A 1OFBA 3TXVA 4JTIA 1H1ZA 3WK3A 4MYXA 4NNCA 1J4EA 1SFJA 2FDSA 1BWKA 2JK2A 2CLLA 1GPWA 4K7VA 3LBMA 3VFLA 2OJPA 2GJNA 1DQXA 1OYAA 1VS1A 4BI5A 3R89A 1PCWA 2Y7FA 2ZZ4A 4NT0A 2CW6A 3FFSA 4YMZA 1XXXA 3U6WA 1XUZA 1Q3NA 3HPZA 4IMGA 2ZZ1A 4IUOA 1ONRA 3LOTA 1NVMA 4JTSA 1TPWA 1TV8A 3LCLA 3OEXA 5I3KA 2A6LA 3EWYA 3Q2DA 3TV8A 4ZVJA 5KZEA 2WSQA 3W86A 4OWGA 4EF8A 2FLIA 3BLEA 1NFBA 3DKJA 3G1VA 3NPVA 3ELFA 4ZQOA 1H61A 1GOXA 4O15A 2AQWA 1DVJA 1B4EA 2QJIA 5FESA 3QW3A 1EP1A 4JICA 3WK2A 1YTEA 1EEPA 3G1SA 5D30A 1L2UA 5LNUA 1M7PA 3KHJA 3IIPA 3NQVA 5KITA 4JTTA 5IBXC 4ADTA 2V82A 4GFSA 1SQ7A 4Z1AA 3QQ0A 2ZYFA 2NZLA 4NX0A 2E09A 1VCVA 3GK0A 3N3MA 2GVGA 3PBVA 2G96A 2WNZA 3IVTA 1DJNA 3QM3A 1KTCA 1VPXA 2YYTA 1W5MA 2G97A 1G4TA 1H7RA 2R94A 4GXMA 5D09A 1Q45A 4YL2A 3BK0A 5LGZA 3C52A 4K8HA 3MP3A 3MP4A 3WJSA 5J5DA 3KVJA 1DQWA 1U5JA 4IMDA 2J9YA 4PL1A 4BR1A 4WXYA 5BMXA 3DAQA 2GUUA 3G1AA 3C3NA 1A5SA 3FOKA 1JR1A 1EUAA 3G8RA 3T4CA 2PURA 2NUYA 4MFEA 2YW3A 1GVOA 3LCXA 1EIXA 4JIQA 1LROA 4I7VA 1KLYA 3VE7A 3O6DA 4LWWA 4NXSA 1GG1A 3ABRA 5C6MA 1LTDA 1WAUA 1FBAA 3B04A 4X22A 4LRSA 3L21A 2BSLA 4KWVA 1PCKA 3OVPA 3FYOA 3M5YA 2A6NA 3W1TA 3M43A 1XCFA 1QMLA 2Y7DA 3CHVA 2FTPA 4O52A 4FNQA 3TSMA 3LCWA 2A4AA 2Y89A 1ZAHA 4MFDA 4JDYA 3GDMA 3DFTA 3HGRA 4E0CA 3UWQA 2W79A 3W23A 3W1UA 4CCCA 5A5WA 2TPSA 3QPZA 3FKKA 3JR2A 4Z1BA 3TMLA 4JD4A 4AXKA 4ONVA 4WX2A 3LLFA 5K4XA 5LHEA 4IMCA 1XUUA 5K9CA 1EP2A 3NQDA 3N9RA 3R13A 1ZJIA 3UWVA 3S1WA 1KM2A 3W3OA 1FWRA 4HSNA 4E2DA 3MI6A 3BLFA 1KM5A 2XFWA 1JRBA 3UXAA 2NV2A 2KZHA 1QPQA 4O4WA 4HNNA 1XBVA 1OX4A 4IX2A 5DLCA 1UUOA 4U4MA 3MBFA 5DXYA 3GDRA 2QJHA 1QAPA 5TQLA 2Z6JA 5K2ZA 4O57A 4UTJA 3CM4A 3DFSA 2WNNA 5C55A 4P2VA 3DI0A 1SW3A 3ZS4A 2J27A 1L6SA 1M5WA 3W7NA 1NF0A 5C2XA 3FJLA 4UMAA 2ISWA 2FFCA 2VC6A 4YCPA 2X1TA 2RDTA 3NL5A 3S1XA 2BWGA 1FQ0A 4TU1A 1TQXA 1HL2A 4O50A 3QF0A 3AO0A 4UCGA 5HUPA 3N2XA 4RJEA 3W75A 2C14A 2QF7A 3B4UA 3TAOA 1DJQA 3WFAA 4CQAA 2QDGA 3DHDA 4Z1DA 2V2DA 3E96A 4ICNA 2CLIA 3PBWA 5AHFA 1A53A 1U83A 1KLZA 3N14A 5TBOA 1B9BA 2VFEA 3P82A 5G5IA 1N8FA 1VRDA 3G22A 3C6CA 4HKPA 3W7RA 2GVJA 5U4NA 3QMTA 4R7JA 4Z0SA 4LV9A 5D2XA 3LHWA 1VYPX 3GB6A 3GZ3A 2YX0A 4RK8A 3OG3A 1LBLA 1TV5A 2CU0A 3IVUA 2QAFA 4EIVA 2X30A 4JTFA 5DELA 2YCEA 1HFBA 2GVLA 2OZ0A 2QCCA 4N4PA 4QQ3A 4O18A 2ZA3A 2NXGA 2Y88A 3UQNA 4GRSA 4OV4A 1RQEA 3EX3A 3SY5A 1LOLA 1W37A 2YZRA 1DOSA 1LRNA 1N55A 1OYBA 2HS8A 1M7OA 3LI0A 3TH6A 3PC0A 5EKYA 1HTIA 1F2JA 1AG1O 4QNEA 2E5CA 1XI3A 4GUIA 3LHVA 2ATMA 3TR2A 1MEWA 4GUJA 3S9YA 4ZQRA 1W5NA 4IMEA 4WZHA 2PCQA 4N9EA 1YDVA 3G3DA 3L0KA 4H3DA 2Q8LA 3ZWSA 2QCMA 1X6UA 5HUOA 3ZFHA 2H3DA 1KFCA 3W2JA 1B3OA 1F73A 4TR9A 2Z1BA 4JYEA 2E68A 1OJXA 1K02A 3HPXA 3WJXA 3DFQA 4C1KA 2CLOA 2QR6A 4UFKA 2ZRZA 3UWZA 2E6YA 2CLKA 4ADUA 3OIXA 2FQIA 1KM6A 1GVSA 6TIMA 1MSSA 3S5ZA 3TDFA 1ZNNA 3R8RA 1XC4A 1OX5A 5EYWA 3QJAA 4TO8A 4GC4A 4DBEA 3NQ2A 1S3HA 2DZPA 3KOFA 4XUGA 5HINA 4ORIA 1YTDA 3QW4B 3RF9A 1SZEA 5FF0A 3G1DA 1QOQA 3L9CA 5F1UA 1S5WA 1OHLA 4KWWA 4TMCA 4FX6M 5TIMA 3STFA 1VHCA 1OX6A 1JCJA 2C16A 1ZFJA 4UTMA 1PIIA 4AHOA 3TU9A 3LX9A 2Y85A 4N6EA 1PE1A 2Y7GA 3DENA 1GQNA 3W7OA 2PRHA 3PBYA 2FB3A 3TE9A 3EX6A 3W7QA 3FA5A 5T26A 1OFEA 3N2MA 4LRTA 4NU7A 2ZTKA 3HIJA 4MKNA 5LHFA 3PSVA 4NJKA 4UTIA 2EF9A 5GVJA 3TQ0A 4YXGA 3W73A 3C2VA 4FNRA 4NJJA 3CPRA 1F74A 2B7NA 5CPOA 2ZRYA 4KFOA 3S42A 3CLMA 4CQ8A 3RFAA 2C1HA 1SFLA 5DN1A 2CFFA 2EHHA 3INPA 1TB3A 2CZFA 3SFKA 1EX5A 3QEZA 4N02A 4HPXA 3NGJA 1RR2A 4O19A 5DXXA 1T8XA 4DO5A 3SGUA 3C2RA 1EA0A 1THFD 3NQ7A 4NXKA 4ZQCA 4WJEA 3HF3A 4N2YA 1WQ5A 1GJPA 1HUVA 3UY7A 2C18A 2VEKA 2A21A 2JKPA 4NJGA 1CW2A 3IRDA 1V5XA 4O54A 4HHPA 2C0AA 5AYXA 3TKFA 4B5NA 4NVTA 4QJ1A 3NPWA 1G6CA 4KFNA 3A5FA 3V75A 1EWEA 3N73A 5C5YA 1K7EA 1FWSA 5KZMA 2WJZA 5G4WA 2ZRVA 4OHQA 3LHZA 4UTLA 3SIZA 1ZY9A 2HTMA 2QCDA 4O12A 1VJIA 2B4GA 3AJXA 5G2IA 2ZRWA 1YYAA 3TMQA 1OF8A 1TPVA 3U2OA 3A5VA 4JXCA 1PL9A 2ZZ2A 4DO4A 1I2RA 4JY9A 1P4CA 4O16A 4KFPA 3OHIA 3PB0A 3QH2A 1SSGA 1W56A 4RZ5A 2F7FA 3STGA 4WY0A 1ZENA 4RXGA 5F4WA 4O17A 1KM4A 1H5YA 3DFNA 2GQ8A 3BO9A 1SZNA 3F03K 2VEPA 1VYSX 1O5KA 1YDNA 5E93A 3W07A 3L67A 4QITA 4OT7A 5AHMA 1BTMA 3NZRA 3NM3A 3SW6A 2QCNA 3W7JA 1VH7A 1NSJA 4MY9A 2Y62A 1LBMA 3ABQA 3TSBA 3W88A 4N9CA 1D9EA 2A2IA 1CI1A 3EWXA 3LCGA 5HWNA 4XTDA 2RKXA 3QMSA 1N7KA 5EA9A 3GKFA 3P80A 3M16A 5BMWA 5LNWA 2OMAA 2LLEA 5F2GA 2CLHA 1MEHA 5D32A 4POCA 3U8GA 4C1LA 3SSJA 3GNDA 3HGOA 3IIOA 4A29A 1R2SA 5CPNA 2A85A 3UXDA 2R8WA 2ZZ3A 2V5LA 4R53A 3VCRA 3W7KA 1QPNA 3EWBX 3M0ZA 3RU6A 3I65A 2NXHA 1KFEA 4UMBA 3G18A 3TJLA 1RQHA 3CWNA 3O6YX 1G7UA 1R2TA 2WPBA 3L66A 3EWUA 1QO2A 3G0UA 4MY8A 1X7FA 3IEBA 4KKXA 4YWIA 1LYXA 4UMCA 4ML9A 4K8EA 3BPWA 1IF2A 4UNLA 3UPWA 4FHAA 1H62A 2E5DA 4WOQA 3QRHA 4EWND 4O14A 5D33A 4NNAA 3CIXA 3CC1A 4CCEA 5I3GA 1YPFA 4O0ZA 4LNYA 3VE9A 5HR6A 2FPVA 2GQAA 3S5NA 3WK0A 3C8FA 3W2UA 3N34A 1JJKA 1QPRA 1SO3A 4ZL1A 4PC8A 3HB9A 3OBKA 4CQ9A 1ICSA 2VEIA 1KV8A 1TPB1 4IGHA 1W3IA 2QCHA 3LI1A 4L4LA 2PC4A 2NX3A 1JVNA 3STCA 1WXJA 3LGEA 1AMKA 2V9DA 2X1UA 1IGSA 5HULA 2YFNA 2V2CA 2R91A 4UR7A 3THAA 5I3HA 2GQ9A 3BG9A 2NLIA 3T78A 2VEMA 4AF0B 3A22A 3L68A 1G67A 1SSDA 1YXCA 1VHNA 3SJ3A 1AL7A 2IQTA 5BNKA 2VFGA 3NDOA 3GAYA 1G4PA 3B0VC 2J24A 2CLMA 3CEPA 2WNQA 3M44A 1AK5A 1F05A 2QJGA 3UWYA 3KFTA 2VXNA 4O28A 4LS2A 4JS3A 2E5BA 2NUWA 3LRKA 2Y7EA 1XL9A 3LRLA 2QCLA 3C61A 1OF6A 3LHUA 2FIQA 2GJLA 4JTEA 4ADSA 1TPH1 3BARA 1X1ZA 1F6KA 4PA8A 3W7MA 3GDKA 3H55A 1KA9F 3FJ6A 1SUXA 4O8RA 3LCHA 2QCEA 3D0CA 3TW7A 3G24A 1TQJA 4PL2A 4ORMA 3PWAA 4MYAA 1JUBA 1YPIA 4UIOA 1W31A 3KRZA 4AVFA 1NF7A 2JBMA 3W71A 1D3GA 8TIMA 1A5CA 3DFPA 3W1MA 4UTUA 4GUGA 3P84A 1VCFA 3L0NA 2A5HA 4I9AA 1LP6A 2CZ5A 3ATZA 2QUTA 2VENA 2B0MA 3W2KA 5D02A 3CIWA 3W84A 4XKYA 2ZZ7A 4LT9A 5F4SA 1MXSA 3M5VA 3B8DA 4FEZA 3W87A 1W5PA 3GR8A 1SW7A 1TTQA 1BKSA 1JCMP 4GWEA 3W83A 4UC5A 1SZFA 4O0KA 1I4NA 2H8XA 1VLIA 2X1RA 4M6QA 1HG3A 3KX6A 1I8JA 3F4WA 1T0OA 3NO5A 2CZDA 3GNNA 3MYOA 1JCXA 1XBZA 1GTEA 3NYZA 3H53A 3RLVA 4WQ6A 3PG9A 1WV2A 1J2WA 1FY6A 4K36A 5FI8A 1LRQA 3PR2A 4QSHA 5EL1A 3G1XA 4S2BA 1Q6LA 4FIQA 1S5TA 5MHBA 4FB7A 7TIMA 1UBSA 1TSIA 3TROA 2ZA2A 5KMYA 4GUHA 1TMHA 2E6FA 1GTHA 1R47A 5K7JA 1IXOA 4UTHA 2E6DA 1W54A 3O05A 3LXBA 2BX7A 3W7PA 2JGQA 1B4KA 4Y90A 4UTTA 2X16A 1KW1A 3QZEA 2FPYA 2YPIA 1O5XA 4XWUA 5G2WA 4DO6A 2C3ZA 3SGZA 4RKAA 3O06A 4IXXA 4ZQPA 2H8ZA 1JCYA 1JRCA 5K9DA 1MO0A 1XBXA 3CWOX 1ML1A 1FDJA 4LU0A 2X2GA 4RCXA 3KVLA 1I2PA 2A7PA 3L5LA 3PM6A 5HR7A 3CU2A 1WA3A 3EWWA 2TSYA 1KBJA 4BI7A 3T44A 5AOUA 3TK7A 3ABOA 1W0MA 4FXRA 3TNOA 3EXTA 3HG3A 3NQFA 3FS2A 3CEUA 3GAKA 5K3VA 3NQCA 3DH7A 5KZDA 4PODA 3NR0A 4P61A 1H7XA 4JIPA 1D3HA 3P62A 5AC7A 5EPDA 2RHGA 4NUWA 1LOQA 3S0CA 1Q6RA 4Y9AA 4CLMA 1CX9A 3UWWA 4MY1A 1JCLA 1X8FA 5CZ0A 3EX2A 1FWNA 1KBIA 4LS1A 2GPTA 2OX1A 5CGQA 3LDVA 2DZUA 1ME7A 4UFIA 1TRDA 3W1RA 2NUXA 4MOZA 1DHPA 3GXPA 4O11A 1O4UA 1QO5A 3M6YA 1FXPA 2C15A 3IGXA 4G1KA 3TFXA 1K7XA 3G1HA 1EP3A 3IV3A 4LVBA 5D38A 1EUNA 5HWJA 3W7GA 4PFMA 3EX4A 4Q33A 5J5RA 2VFDA 5AN7A 4UUIA 3JRKA 1VQTA 4JTUA 1G4EA 1TPC1 4FF7A 5E0KA 1M6JA 4Q32A 4IWWA 1F7BA 2NWSA 5FEXA 3HG4A 1LZOA 3GXTA 3K30A 4FX7A 1J5TA 3KVKA 1DBTA 4LC6A 1GVRA 1W5OA 4NQ1A 2V81A 2Z6IA 2O7SA 4RX0A 3P81A 5I3JA 2YW4A 1XDMA 5CPMA 4LW7A 4MLJA 3BW2A 3C4UA 4JTHA 1DV7A 1MEIA 2BXVA 3LTSA 5G4EA 1JULA 1R2RA 3NVTA 4A2RA 3I7RA 3HMJG 3ZWTA 3VI2A 5DY3A 3EWZA 1GWJA 3OVRA 4PEKA 5FEPA 1ME9A 2ZZ5A 1VR6A 1GT8A 2Y6ZA 4LVGA 2HS6A 3HQ1A 1AL8A 3KVMA 3RMJA 1UUMA 5G2HA 4OE7A 1OFOA 1GG0A 3T7VA 4ZZ9A 1F5ZA 4YCOA 3W74A 2E6AA 3HBLA 4U28A 1H63A 4NNBA 5F4XA 5CZJA 4QAIA 5KTLA 3EEGA 2W6RA 3TX9A 1HO1A 4GUFA 4JTGA 1PHWA 1FUYA 3DKLA 4IXHA 5FF3A 1UJPA 1VCGA 5U7SA 4AHQA 2DZTA 3DGRA 3P60A 3TCEA 2YR1A 1SPQA 4DF2A 3CB8A 4I7WA 4PTNA 4JTKA 1TIMA 1H51A 3G1FA 5D05A 2O7QA 3PAJA 3I68A 3UPBA 5HQEA 1K3UA 2ISSA 1GVFA 2YDAA 3SECA 1OABA 3STEA 2BLEA 3LB0A 1TPEA 3DBPA 5G1YA 4DQWA 4E38A 2J9ZA 2ATSA 2FJKA 3M7WA 1Z44A 2QDHA 1SO4A 3FKRA 1RD5A 2QCDB 1AW5A 5H91A 1O95A 2C6QA 2BZNA 2ZFAA 1EWDA 4LUIA 1ME8A 4XZ9A 4IQLA 1VYRA 3MWAA 2ZZ6A 4JYFA 3LTYA 4EF9A 4JTLA 2PE4A 5L9FA 3NQEA 1XM3A 5F2IA 3MW7A 1Z41A 4IOTA 4WY0B 3FLUA 5LSMA 3P61A 5IM51 3HPSA 4CNNA 3L5AA 4NJIA 3P5YA 3FEMA 1BWLA 1C9DA 1TPUA 3HOJA 3NAVA 3UY8A 1XDLA 3MI2A 2P1FA 1A50A 4HNUA 5ABTA 3TFCA 3VKJA 1O94A 1S5VA 4QM1A 3TQKA 3S5OA 3TW6A 1JUKA 3BG3A 2P0OA 3GX9A 2YGYA 4UR8A 3SR7A 1DKWA 3LERA 3W7EA 3GKAA 1OFQA 3MYPA 1H60A 2DZSA 2JKEA 1PV8A 1L6YA 1XBYA 5D2VA 3W9ZA 1KM3A 3TC6A 2BTMA 1W3NA 2P10A 1IXNA 4UFJA 1FX6A 4RLIA 1KM1A 5L6UA 3MO7A 4NX5A 3TSDA 3THQA 1ICQA 2WSRA 2I9EA 2G5WA 5AYYA 3LCIA 3GR7A 3P74A 5FF7A 2RH9A 3OVQA 4OV9A 3KRUA 4NZFA 2CWNA 5F2LA 3W2LA 3LM7A 1H7PA 1RVGA 2Q3OA 3E02A 3W2MA 3W1PA 3NPUA 2J88A 4MUZA 4WD0A 1VZWA 3MBDA 4R34A 4BWLA 3C2OA 3NEVA 3MHGA 1YLVA 4XBSA 4YLWA 3W22A 5D37A 4JNMA 4O53A 3UNDA 1O60A 2PRMA 1ICPA 3HG2A 1HO4A 2UV8G 3GXNA 4FO4A 1DORA 2EAWA 3L0GA 4K37A 1KFBA 3OA3A 4Z08A 4Y8FA 1WOBA 2V30A 3DZ1A 4S1FA 4HSOA 4L4MA 3WJWA 1KTBA 4AH7A 3G1YA 2TMDA 3KRSA 4MZ8A 4MIMA 4FNSA 3SZ8A 4DXVA 1L9WA 2CLFA 3MMTA 1TYGA 1LOSA 4ZMGA 5HJLA 3B0UX 4AWSA 1NEYA 1P5BA 1FCVA 2DJLA 4PCFA 3LTPA 4Z1CA 5CG7A 1LORA 2ZRUA 4N6FA 1T99A 2OCZA 3KAOA 1YADA 5D04C 1I2OA 4UTWA 2HMCA 1RPXA 3TIMA 1P1XA 4X2RA 4FNTA 4D2JA 2DZWA 1QPOA 4UNKA 5KINA 4TX9A 3BGJA 1FCQA 3Q58A 3WJYA 2C13A 4RZ6A 3FIGA 4A22A 4K39A 4O13A 5A8GA 5LNRA 1KFLA 2B7PA 3PVFA 2VFHA 4PH6A 3UD6A 3L5MA 2I14A 1H7NA 2ALDA 4LVDA 3EKLA 4BK9A 2YFOA 1H1YA 1K8ZA 3NXFA 4O1CA 4GNJA 3IIXA 3LHYA 3PUOA 3QYQA 4DEFA 1WBJA 2E1DA 1L6WA 4NZJA 1FWTA 5BOOA 3A23A 3E12A 1VLWA 3LCFA 2WOQA 1OVDA 4H6KA 2JKAA 1R46A 3PULA 3PY2A 2QUUA 5AHIA 4AWTA 1UASA 3W7DA 5AHNA 4AAJA 5LKYA 4AEOA 4CCDA 3IVSA 2B7QA 1XFBA 1OFDA 1QFEA 5H2ZA 1FCBA 1LCOA 3IIVA 3GDLA 3W70A 3BGGA 4LY8A 5CKSA 4XTIA 2Q8ZA 4MLRA 5CZSA 2Y61A 2ZTJA 3P7YA 4N9DA 4Q4KA 5D2YA 5F2MA 1OFRA 3NNTA 4WUIA 4AB4A 4HNVA 3EXSA 1VGAA 5BW6A 3W7LA 4OBTA 2ZDRA 1WX0A 2FB2A 3C2EA 4MZYA 4LC8A 5CPLA 2OT0A 4UTTC 3YPIA 1EPXA 3W72A 1OK4A 4ZQNA 4XKYB 1X1OA 1FDYA 1FXQA 3ABSA 4O1AA 4MJMA 4GBUA 2J9XA 3P67A 2Z2UA 3S1UA 1SW0A 2R14A 3ATYA 3QQ1A 1GYNA 2QKFA 4DBDA 1TPFA 3HO8A 4Z0JA 4HN4A 4JY8A 1TV7A 1LDCA 5DBTA 3O07A 4AF0A 4H4IA 3GIYA 3R5EA 3NPXA 2ZCGA 5AB3A 1QCWA 4O1DA 1AW2A 1RQBA 3DXIA 2VFIA 4DF1A 4JX4A 3WJZA 4UTKA 3O63A 4ZQMA 1TTPA 3TQVA 5D03A 4E2BA 4MVAA 1VC4A 4JEQA 4O1BA 4DPPA 3M5ZA 2EKCA 1OX4B 4MJZA 1DL3A 2H3BA 1RV8A 3UZJA 3P5ZA 2FPTA 3B05A 3GVGA 4HPJA 5FEZA 4CNOA 2YYUA 3BLIA 3PSWA 2TRSA 3GDTA 3VNDA 4M19A 5AC8A 3MHFA 1WBHA 3W1LA 1Q6OA 4A21A 1JCNA 3N19B 4IPIA 1RZMA 3DHFA 3JS3A 3NG3A 1KV5A 4OU1A 3MHUA 4BFAA 5HMSA 3BW4A 3S8HA 4XBKA 4LS0A 3NL2A 3W1AA 1ZAJA 3G0SA 3GYEA 3L2IA 4AMAA 2RDWA 3E9AA 3F1QA 2H6RA 1LM1A 3L65A 3W1XA 1OYCA 2B7OA 2NXIA 4WXZA 2Z0IA 2J6XA 3LXAA 3EB2A 2DP3A 5AFDA 4M7SA 3F4NA 1T96A 2A1YA 1UB3A 2GOUA 1IIHA 1BEUA 3SI9A 5IBXA 1ADOA 1ZALA 4UFMA 3FYPA 1QNVA 3M1ZA 4GJ1A 1K8XA 3NZ1A 1FCUA 1JQVA 4MZ1A 4M7TA 1C29A 2ZBTA 3O8AA 3IIZA 3P8IA 1W1ZA 1YXDA 4FNUA 1KM0A 4HNTA 3W2NA 3EX1A 5D2WA 1GEQA 1QR7A 5LGXA 2ISVA 3W7CA 2RFGA 2W0UA 4QISA 2JGYA 3B03A 3NA8A 1SU5A 2D73A 3NQMA 3QFEA 4JX6A 3BG5A 3TA6A 1GZGA 3MP5A 1K8YA 4EVZA 3Q94A 1TTIA 3T40A 1TCDA 4HT3A 2Y63A 3RK8A 3TUUA 4A2SA 3NQ6A 4N9BA 2AGKA 3M9YA 3USBA 1G4SA 5DBUA 1IXPA 3R2GA 3T55A 3N9SA 1FWWA 2DORA 3LXCA 5G1TA 2QCFA 2WO5A 1TRIA 3W1NA 1B57A 4K38A 3PG8A 4JTJA 1EB3A 4W9TA 1G69A 3S5YA 5KSWA 3UZ5A 4O4VA 2CLEA 3B0PA 3LRMA 2EGZA 5I3FA 1AW1A 5FF4A 2V2HA 1QWGA 3MJYA 1K7FA 2DZVA 3KXQA 2VKZG 2DU2A 4S2CA 2NX9A 4LVFA 3RNDA 3TC7A 2V8ZA 3O6CA 1OFAA 2E77A 2WSYA 5DCDA 3PB2A 3W1QA 4IPJA 3QC3A 1W3TA 2V5BA 2ZQ0A 4HIBA 4FIRA 1OFPA 3ANYA 3NQAA 3W7IA 2OT1A 3W85A 4RV8A 1QOPA 3E49A 1OG0A 2Q3RA 3HG5A 1WOAA 4IMFA 5AYZA 3BW3A 5DY2A 5AC6A 4RZ4A 2VFFA 2PRLA 1TJPA 1GVQA 6ALDA 1P0NA 4O10A 5HWMA 1WDWA 3O15A 2WV8A 3IGSA 2QUVA 4RR4A 2I1OA 1W8SA 5AHLA 1YTKA 2EPHA 4MPQA 2C19A 3WK1A 3V1PA 3I7QA 1ZHAA 1QDSA 2AAMA 5K9XA 2NV1A 2QAPA 4TMBA 1F6PA 3M5XA 1KFJA 1TPDA 2XN0A 3NQ8A 5I3IA 3PBUA 3O1NA 3DU0A 2F84A 4LUJA 4UFHA 5K4ZA 5LNSA 4BWLC 1Q6QA 3CQ0A 1Y0EA 4FNPA 3RLUA 1A5AA 5EY5A 2TYSA 1Z48A 2Y70A 1XKYA 3DI1A 3I7SA 1A5BA 5FF2A 3O16A 1H7OA 4IJBA 2WKJA 3HGSA 1C8VA 3C2FA 1IXQA 4IX0A 4JDBA 1P0KA 4ALDA 4Y96A 2WQPA 2YXGA 4JYDA 5AHEA 4AHPA 2DJXA 3MUXA 5E1QA 3QPYA 1LRTA 1Z42A
chains in the Genus database with same CATH superfamily
3QSRA 5HNTA 2ABBA 3CUIA 4N4QA 1CXKA 2VR4A 4IG2B 5M03A 1MFUA 1H7WA 1UC5A 5LZLA 3BLLA 3PUEA 1LLZA 3UYCA 3V0SA 5CSSA 3HGJA 1HKMA 5D9OA 3TZFA 4JN6A 1FOBA 2BMBA 4R33A 1YBQA 1ZAIA 1AH3A 4UB9A 4CCZA 3C2YA 1D3CA 1I2QA 1KFKA 1R30A 4FR6A 4WSHA 4PBEA 4EOUA 1HVXA 1F76A 1FDZA 1LLWA 1SO5A 4JX5A 2E25A 4XZMX 3S6DA 2FZMA 4Y6GA 1ZZMA 2HSAA 3S1GA 1J9YA 3DHUA 2YXXA 4WY0F 1FWBC 1V03A 5IFTA 1UCWA 1UMYA 2HPIA 2NWRA 3U3HA 4TQTA 2VELA 1AJ0A 2EXOA 1TTJA 1OB0A 1BGGA 4AWUA 4MAZA 3MV01 4ATLA 3LSBA 5A6JA 1EZWA 4BI6A 4LV4A 3LV6A 3H54A 4M6PA 2FH8A 3W29A 1U30A 4DPQA 2A7RA 4WDUA 2ZRXA 4YN5A 2VOMA 1P6BA 3WY1A 1JZ3A 3VD5A 3A9IA 4XQ6A 1B3XA 3ZSSA 4JL1A 2GGEA 1MW2A 2XVLA 1UKQA 5BRBA 4PE8A 1P7TA 4FX8A 1IT7A 2Y24A 3CT7A 2WC7A 1XH1A 3G8EA 1XRTA 3Q37A 4B5UA 3NOEA 2PODA 2XIBA 4XZNX 1TREA 2VYOA 4ROQA 1WAWA 3D3AA 3LUTA 4OTKA 1TZ9A 2FFIA 4IQJA 1JPIA 4PMNA 2WSKA 4EPKA 2EG6A 1K03A 1JUEA 4C90A 2CZVA 3R10A 1KKOA 4MYXA 3SADA 5TF0A 1M01A 1SFJA 1D2KA 3V7PA 3IWPA 4KEUA 1ELSA 3H8AA 1BWKA 2CLLA 1GPWA 2A3EA 4LUSA 2X0YA 2OJPA 4BI5A 5CG0A 2WMJA 2CW6A 1CGWA 4WSKA 3U6WA 3SM0A 4P7NA 1MDLA 3IARA 2Q6ZA 3LCLA 3OEXA 3UWEA 3Q2DA 4ZVJA 1FWHC 1E70M 2HV5A 5BU9A 1X97A 4ZFMA 1V3LA 2FLIA 3BLEA 1WNOA 4U10A 2QDEA 1H61A 3WNPA 2AQWA 2QJIA 3UR8A 4JICA 2QV5A 3BAWA 4IISA 4E2OA 2UY4A 3NZQA 3BJTA 3TYBA 3TNBA 3NQVA 3WLRA 3ZYZA 5IBXC 3OBEA 4GFSA 5A94A 2DIEA 3QQ0A 3QTGA 2NZLA 1HGYA 3WQPA 3GK0A 3PBVA 2WNZA 1RY0A 1V79A 3GVRA 2YYTA 1R8LA 2AL1A 4C6QA 4F2UA 2BB0A 2R94A 4GXMA 1CENA 4Z42C 3DYMA 3SQLA 2W92A 3ANUA 3F4VA 2FZBA 4GH3A 4IJCA 1J0YA 4K8HA 3MP3A 1P6WA 4IMDA 3S9IA 4PL1A 3JZEA 1ESWA 3O2LA 1A5SA 3ZLFA 3GQYA 4DJDD 1JR1A 2PURA 3PPCA 2YW3A 3RYSA 4HBKA 3N2CA 1E3XA 1BTCA 5D4YA 4M6UA 4NXSA 5GNXA 2JQXA 1SJDA 1WAUA 1DJYA 2F2HA 4GIAA 3ZR6A 1PCKA 3M5YA 2A6NA 4Q8NA 3ZVHA 3W1TA 3M43A 1P0DA 3TR9A 1LT7A 4ZOBA 3TSMA 4QTGA 4KS0A 4MFDA 4JDYA 1CECA 3AZRA 3EPOA 4ZXOA 4H19A 2UY3A 2TPSA 3JR2A 4ONVA 3S47A 4WX2A 1IEXA 1EH9A 4AMCA 3WYZA 4HN8A 5LHEA 4R5EA 5FJOA 3N9RA 3R13A 4GJIA 3UWVA 1WUFA 2W3ZA 3W3OA 1H1NA 1US3A 4NILA 4HSNA 4AX6A 2NV2A 4U33A 4PUMA 1NY1A 4HNNA 2J8GA 4H8HA 4GX9A 2J6VA 3LU2A 3COTA 3GW3A 4QLKA 3H4WA 2QJHA 1YRRA 4RPQA 3AS1A 5K2ZA 3CM4A 4QCEA 2WNNA 3RM9A 1SW3A 4LQ1A 4NZ4A 7CGTA 3TZNA 2DFAA 2IW0A 4YYFA 2VZUA 1S2UA 3KDOA 2OO0A 1O1HA 3WDPP 1HL2A 3CHEA 3AO0A 2WVVB 3TAOA 1OZQA 1GOIA 4ACZA 2V5KA 3BSGA 1SJCA 2X0HA 2WAGA 2V2DA 2IPWA 5AHFA 1U83A 4CQDA 1H3GA 1VRDA 3G22A 1ZJBA 4G8TA 3REQB 1MQQA 1W6TA 1R9ZA 4FSAA 4Z0SA 3BCDA 3LHWA 3GB6A 3LA4A 3W24A 1MNSA 4E3VA 2YX0A 2XINA 5E5CA 4RK8A 4JTFA 3DOPA 5TD4A 3UQNA 5DMMA 4JAWA 1HJVA 4L80A 2Y8VA 4A3YA 1DOSA 1LRNA 1OYBA 2FGLA 2G41A 4WSJA 2HWGA 3TH6A 2OZTA 1DIKA 2QIIA 4QNEA 1AG1O 4GUIA 4ECLA 4UQBA 4GUJA 1W5NA 1UWUA 2PCQA 1XGZA 3G3DA 2XHYA 4NAEA 1Q2SA 4W8BA 1X6UA 5HUOA 3GU9A 3ZFHA 2YOCA 4DYKA 2G4JA 4H04A 2E68A 3MSYA 1OJXA 4ERIA 2YLLA 3DFQA 4Z2GA 3QR1A 1BRLB 1A5UA 2FQIA 1DXEA 6TIMA 2PU0A 1MSSA 3S5ZA 1XC4A 4TTGA 5EYWA 3GVVA 2C1GA 3NQ2A 3VNIA 4BQ4A 4S3EA 3H6OA 4GI8A 1S2AA 4DX3A 2D22A 3OODA 3RF9A 1SZEA 5FF0A 3G1DA 4DXXA 2OLSA 4AXNA 2IS7A 2PZ0A 1S5WA 5J04A 4CN6A 1KKRA 2CIPA 1BF6A 1E6ZA 1JCJA 2ICSA 2C16A 1TCMA 4G9PA 4MUPA 4YTRA 4LALA 3BMXA 4AHOA 2XVGA 2Y7GA 3DENA 4PZVA 1FKXA 1GQNA 3W7OA 4LJ3A 3EX6A 3W7QA 4MG4A 3FA5A 5T26A 4QDWA 1OFEA 4TX6A 4AIBA 1HP5A 4NU7A 4MKNA 2DSWA 3PSVA 3KBMA 4NJKA 5FD0A 1VIWA 2EF9A 5GVJA 3TQ0A 4GKTA 4YXGA 5C7VA 3CPRA 3C0LA 3L4ZA 4NZ5A 1W32A 1CXFA 3VNYA 1DHKA 3CLMA 1SFLA 3ID7A 5DN1A 4GBDA 2CFFA 5FAJA 1E6SM 2EPLX 1VIZA 2PD9A 3INPA 1DJGA 3PP7A 2C8NA 2ZUSA 6XIAA 3NGJA 5DXXA 4I9JA 4D6FA 3TJ4A 4D6IA 3WLLA 4C6MA 4MADA 3VYLA 4B91A 4ZQCA 1NH6A 2KAUC 3URAA 1WQ5A 4ILSA 4WVXA 2WC4A 1E3ZA 2C18A 2JKPA 4K8GA 4RNFA 3IRDA 1M68A 4AZIA 2ZE3A 3NPWA 5JBEA 2AGTA 5EFDA 5I00A 5ABEA 3ITXA 4PMZA 1K7EA 1FWSA 2WJZA 1HKIA 2G0WA 3UT0A 3RR4A 3NYDA 3FEQA 4G7EA 5EMMA 3SIZA 4Z2IA 1VJIA 1B3WA 4KRTA 5BRPA 4QG8A 3ZZ1A 2XYLA 4MPKA 3RCYA 3HMCA 1JL8A 1I2RA 3ZVIA 3SCOA 4JY9A 2O4QA 4KFPA 1R3TA 1W56A 4RZ5A 2F7FA 2WMGA 3IACA 3PZMA 4YHGA 3WLMA 3WO8A 1YDNA 3LPGA 3KL5A 4ZXLA 3R7MA 3NM3A 4WKHA 3CZ8A 3WH7A 1F3XA 3LMZA 4US6A 4HMNA 1CXHA 2Y62A 1LWIA 3E5BA 1WP6A 3VOFA 3W88A 4N9CA 1J2BA 1D9EA 1XRSA 4IP5A 1V0LA 4L4PA 1A5LC 4D72A 1W1B1 4BY3A 5EA9A 3WQEA 3M16A 3USZA 8RUCA 4AYGA 3VMNA 2OMAA 1GNXA 3U7BA 3GRIA 3GNDA 2A85A 3GNOA 2R8WA 2OSWA 4GKLA 4MWAA 1MZRA 1TV2A 2NXHA 1V93A 4J28A 3T0DA 3NGFA 4B5TA 1RQHA 3O6YX 2G50A 6CGTA 2WPBA 4I5XA 2X1IA 3EOEA 1IV8A 2ALRA 1X7FA 1X39A 2XSBA 3GXFA 4HZ8A 4UMCA 1EDTA 3BPWA 1GVIA 3UPWA 4FHAA 1H62A 2E5DA 3JZUA 4S3JA 1UMLA 4O0ZA 3TTQA 3IJ6A 4C91A 4PTWA 1TR1A 3HZ3A 2NV9A 3N34A 1QPRA 4ZL1A 3AICA 3I4EA 5HNUA 4GYKA 2O9OA 5DRCA 4FLRA 4US5D 1E4MM 4FLOA 4KEVA 5C9RA 4L4LA 3WNKA 1KBKA 2PC4A 1I0BA 1JVNA 1KD0A 3OJGA 5HULA 2V2CA 3PZUA 3BG9A 1EQCA 3GG1A 4RNJA 4HK5A 1FWAC 4C6IA 1VHNA 4AQLA 1W1YA 3MKCA 1XIFA 5JIWA 2DSUA 2PDLA 2ZVIA 3CB3A 3HU7A 1LQAA 5BYWA 3UPMA 1AK5A 1F05A 1RJQA 2CBIA 3RPMA 2VXNA 4O28A 4Q7BA 5ABGA 3HQNA 2E0PA 2E5BA 3CPUA 2PDGA 4RDVA 3UETA 5A69A 1G01A 2D0FA 3LHUA 2FIQA 4P8VA 2E4TA 1KA9F 3N2OA 3FJ6A 5GQBA 5E0CA 3GG0A 2D0GA 3TW7A 4OJYA 3DFYA 1EDQA 4ORMA 4WK9A 4HD5A 2IMRA 3PWAA 2WCSA 2X05A 1YPIA 4UIOA 4GZJA 2E3ZA 2QDDA 2XVNA 1X6NA 3WQGA 1NF7A 4JPGA 5CQ1A 4HNCA 2PWFA 5BROA 4O8AA 4I5RA 1A5CA 3DFPA 1JCTA 4QE1A 1A3WA 4GUGA 2R1MA 2A5HA 4B2DA 1LP6A 4LCRA 3BLDA 4XKYA 3WFZA 3KP0A 3VGEA 2X09A 4HPNA 5F4SA 3UJRA 3N12A 3M5VA 3GR4A 3VXGA 3IGHX 4IPNB 3ARUA 3BMWA 3UJSA 1QI0A 2IKHA 3ITLA 3UJFA 4U31A 1QNPA 3ORWA 2W27A 4NP7A 4M6QA 1Y7VA 1HG3A 5KZ6A 2VQUA 1LG1A 4XVDA 1J0JA 1T0OA 4P7QA 4RPPA 3GNNA 3BJFA 2PLMA 2PSNA 1UKOA 3FW6A 1U5HA 3H53A 3VGBA 4A8NA 4EWJA 3CS2A 4WGXA 3GVWA 1XISA 1FH7A 4R9OA 1YX1A 1UBSA 1R86A 1C8QA 1TSIA 1TWDA 3TROA 3U4FA 4GUHA 4GZ7A 1TMHA 4XO7A 2VD9A 2E6FA 1GTHA 1QI4A 1HKVA 3VX1A 1DQUA 1MRQA 1IXOA 1GUVA 2BVDA 5DMNA 4DI9A 5B7ZA 3LXBA 4MNLA 4B9YA 1MXDA 4DBWA 3W7PA 5MKGB 3TYUA 1XYCA 2VVSA 2XDFA 3QZEA 1ZBVA 2YPIA 4XWUA 1NDWA 2CHRA 4DO6A 3IANA 1JRCA 4QGCA 3VINA 2G4FA 1GJUA 1XBXA 1EPVA 3KHDA 5DMLA 1I2PA 3EB3A 3HFTA 1WA3A 2TSYA 2WZEA 4BI7A 3B8VA 3T44A 5AOUA 4PTXA 3TNOA 1ISZA 2FDMA 1KXTA 2AQVA 3GAKA 4Q4PA 5G4HC 4P61A 3AHZA 4W8LA 1ECQA 3DUGA 2PWEA 2HJPA 1CX9A 1JCLA 2EPOA 2PP1A 3B8IA 3EX2A 3L2LA 1XLCA 4BF5A 3WF2A 1KBIA 4B3ZA 3C86A 2CNCA 4F4RA 4HGXA 3PTMA 1ME7A 4J2MA 4TVCA 1UR9A 1BPLB 1QO5A 3ZLGA 1B3YA 3M7SA 3M6YA 1IWPA 1AQHA 3LD5A 1FXPA 3F5KA 4JEJA 4GOAA 1BYCA 3G1HA 1EP3A 1EUNA 2E8ZA 1MUMA 3WD0A 3SCRA 4ZA0A 5J5RA 4UUIA 2FMOA 3CV2A 4XZWA 3TLLA 1A0DA 1MYRA 3DG6A 5E0KA 1M6JA 2J8TA 3QKEA 2NWSA 2A3AA 3HG4A 4QEEA 5LA2A 3V0TA 3UCDA 3A4JA 5DANA 4LC6A 3W02A 3UG8A 4B3KA 1UR1A 1W91A 3M4HA 2WJEA 4F0MA 2E9MA 1DEDA 3W27A 1XLBA 4G5DA 3BW2A 3AMDA 4JTHA 2PS2A 3A6OA 3SUUA 1VJSA 1MEIA 3NVTA 3S2CA 3I7RA 3THDA 4HCLA 4PEKA 4UTFA 2EPNA 1ME9A 4GQGA 4QE5A 2E9BA 1NWTA 4L6OA 1KQZA 4OE7A 3T7VA 1F5ZA 4M8UA 3VMOA 2P0IA 2CC0A 1H63A 4M51A 4NNBA 4YHEA 5CZJA 3W26A 1XLFA 2J74A 1PEZA 4MB4A 5JQ9A 3AIQA 2DT2A 2XZ9A 1VFOA 3DKLA 1IR1A 1YKWA 1TUXA 5FF3A 1UJPA 1V0MA 1VCGA 5U7SA 5T91A 3OP2A 1NQ6A 1UPPA 3KOWA 3UZXA 3G2GA 4PTNA 3MS8A 4JTKA 5D05A 2D2JA 1IZJA 2GJRA 2O7QA 3I68A 4L1WA 4NZ3A 1UC4A 4WDWA 3FVDA 4UQDA 4OBSA 3WLJA 4UZUA 2YDAA 1ZPTA 2VQTA 4DQWA 2YL5A 2J9ZA 2QZRA 3N4EA 2ATSA 1Z44A 2Y0FA 4C1NB 2QCDB 3QKZA 5H91A 3MUAA 2ZFAA 3GFYA 4U3AA 1UZ4A 4IQLA 4CVUA 4JYFA 3LTYA 5CBJA 1X1NA 4MHBA 5F2IA 1XM3A 1Z41A 4IOTA 5FSEC 5HANA 2XH2A 3L5AA 4A3QA 3UR2A 3FEMA 5A6BA 4IT1A 3WD4A 3K8LA 1TPUA 3NAVA 3MI2A 3UR5A 3VKJA 1O94A 3TQKA 3S5OA 3TW6A 1KWGA 2Z2BA 1H09A 2FGBA 3KLLA 1UWQA 3LERA 1OFQA 3VM7A 3MYPA 1KNWA 2QPUA 1H60A 1L6YA 1XBYA 3UFYA 1TZZA 4IG2A 1W3NA 3FSUA 3D3FA 1XLDA 3T0BA 3THQA 4ZO8A 2X41A 5FF7A 2RH9A 4RW3A 2ACQA 4OV9A 4XAYA 4AZHA 3FJNA 3L12A 3W2LA 2Q3OA 3E02A 3W2MA 1NDZA 3NPUA 1HJUA 1JZ4A 3MBDA 3MA8A 3NEVA 4XBSA 1JYWA 1J93A 4JNMA 2XGZA 1ICPA 3WEMA 3H4XA 1F8IA 4KGJA 4M1BA 4S3CA 2V30A 3FGCA 4S1FA 4HSOA 3WJWA 3BJSA 1CLKA 3F2BA 4X61A 4RE3A 3NWRA 1JF6A 4ASTA 3G1YA 2CXGA 4MIMA 4FNSA 4DXVA 3MMTA 2DVXA 1TYGA 3VC5A 4AWSA 1NEYA 5J8LA 2XU2A 2QGYA 4XD3A 5CG7A 2ZRUA 2PLJA 1M41A 4KRZA 4DWDA 1TX0A 2OG9A 4X2RA 4H83A 3VUSA 4D2JA 2DZWA 3IUHA 4TX9A 3BGJA 1V3IA 4DNHA 5AC4A 3FIGA 4O13A 2OO6A 3NZGA 4H9VA 1FWJC 1QXLA 3L5MA 2I14A 2NQZA 1PKLA 3WQOA 3IJ9A 3BLPX 4O1CA 4GNJA 3IIXA 3UCCA 3QFWA 1MW1A 4NZJA 3B9DA 1OGSA 3WD1A 2VJXA 2XSXA 1C92A 2JKAA 1R46A 4RDYA 3QQWA 5FSDC 3BSHA 4C6BA 2BP1A 2P3EA 3W7DA 1HP4A 4AAJA 5LKYA 1MMFA 1OFDA 5H2ZA 4H9ZA 4XTIA 2E40A 5CZSA 2ZTJA 5DT7A 2YBTA 4Q4KA 1XLKA 4AB4A 3HJEA 4RZBA 1UR0A 1Z89A 2ZDRA 1J0ZA 4MTVA 3C2EA 4ZCWA 4DAFA 1QTWA 3OOQA 4LC8A 5CPLA 4UTTC 1NARA 3H2NA 1EBGA 4CVWA 2EQDA 1DP0A 1OK4A 3SBFA 1X1OA 2I9UA 1VEPA 4O1AA 2TAAA 2V68A 4W88A 2Z2UA 1UOZA 3S1UA 3ZM8A 2R14A 3VOIA 2QKFA 1IQ8A 2DDXA 1BD0A 3O07A 4AD2A 2FKPA 2Y5SA 3BCFA 1KGXA 3PUGA 3NPXA 1QCWA 3RX3A 2VGIA 3GTHA 2VFIA 3BE7A 4RNIA 4UTKA 1AQFA 1B9ZA 4ZQMA 1FH9A 3QHMA 3TQVA 1GEHA 3NQBA 3I3DA 4HMEA 2ZICA 4K3ZA 1FP9A 4MVAA 4B16A 1VC4A 3VDAA 2WHMA 3M5ZA 4RUBA 5H1WA 3VIJA 3IJQA 3VD7A 1RV8A 5A8QA 3UZJA 2IKIA 3O6AA 3B05A 4K2SA 2GGIA 4HPJA 3EDDA 4BF7A 3N3TA 5EMLA 4JBRA 3GDTA 3W1LA 4DBUA 3W6LA 3N19B 3V1HA 1DJXA 3D5HA 1KV5A 3O9NA 2FVKA 1W1PA 3ARRA 5HDRA 1TWWA 4XV0A 4C60A 1N8IA 3GYEA 2BXZA 3L2IA 2RDWA 2QGHA 5C9UA 1XHGA 2H6RA 3VGHA 3NOYA 3L65A 1GQKA 3T0TA 4JTDA 3QN3A 1O66A 3L23A 2NXIA 2WZIA 3RX4A 2P5NA 4DIAA 4BJHA 4J27A 4BQ5A 1DIDA 4DJEC 2D1ZA 4AWEA 2A1YA 2QW5A 2C71A 3QBUA 5RUBA 4GCXA 2GOUA 4PCNA 5LYRA 1ADOA 4E8GA 4NSBA 3NZ1A 1JQVA 1NM9A 1HN1A 4MZ1A 4QE4A 3UESA 4M7TA 4Y8EA 4F9JA 4GVGA 3WBYA 3O8AA 3IIZA 3P8IA 4FNUA 2RJHA 1WXYA 3BQ5A 4HNTA 5D2WA 4V33A 1AUSL 3ITYA 3W7CA 1ZCCA 2W0UA 3AALA 3UA4A 3MP5A 2XVPA 1D8WA 4EVZA 3AYSA 3QTPA 1TTIA 3GC2A 4H6RA 2Y63A 1A5KC 4NASA 4A2SA 1EHAA 2AGKA 4DJDA 1J6PA 3R2GA 3N9SA 1FWWA 3CAWA 2DORA 5CAHA 2QCFA 2WO5A 3VGGA 3V5FA 3BQ6A 2WVVA 1E5JA 1RCXB 3S5YA 4J5NA 1FTXA 3UERA 4P7OA 2ONEA 5I3FA 1PKYA 1NIUA 3REQA 1HT6A 2OOGA 2J4GA 1XD1A 2VKZG 4HTYA 4S2CA 3WUFA 1BQGA 2BODX 1J12A 3O6CA 5DCDA 2J7DA 2XWEA 3W1QA 1PX3A 4IPJA 3SRKA 4FOUA 2ZX7A 2V5BA 1EA9C 2HDJA 3KOZA 3I3EA 2I5QA 1QOPA 1OG0A 3EOSA 3RM4A 1UP0A 3P0WA 3BW3A 5DY2A 3CGTA 4GH1A 4RZ4A 3M0XA 2GSHA 2VFFA 3G77A 2RGLA 1GVQA 4L1GA 2W5FA 4LNCA 1WDWA 2WV8A 1IE7C 2WYSA 2ZE0A 4ROPA 5JVLA 3CIVA 2REQA 2PLKA 4Q8OA 2J7CA 3FJ4A 1UH2A 3I7QA 3XISA 4F3HA 1GOQA 1JAEA 1F6PA 3TJIA 1BRLA 2XN0A 5I3IA 4V2XA 2D3LA 1FH8A 3DU0A 4Y9OA 1ITXA 4MNKA 4LUJA 1W3HA 1JG9A 1JXKA 1Q6QA 3CQ0A 3ZJKA 5EY5A 2PTDA 1GZJA 1A5BA 3RN6A 3O16A 1DE6A 4AX7A 2WM1A 3HGSA 4QDMA 1GGOA 1JZ6A 4H2CA 3H21A 1OGGA 2R24A 2BHZA 1XIIA 4TXEA 1OIFA 5E1QA 4HJFA 3AHVA 4LX4A 2FZDA 4D6GA 4PN2A 3DG3A 2HNEA 2HK1A 3NEHA 3W37A 3GIQA 4BQ2A 4I8DA 1EEXA 2WMIA 1LJYA 4DF0A 1C7TA 1GYLA 3G3MA 2DZBA 2WANA 5D2TA 4DAIA 3TXZA 2ABAA 3FXGA 3KRBA 1XG4A 2CHOA 4OGZA 4R85A 4HZMA 3QSTA 4JL2A 3QGKC 3AROA 3EPNA 5CZTA 3E6EA 3GC5A 4WF7A 4X9SA 5CC5A 1XYFA 4PMQA 2QCGA 3T42A 3VA8A 1NOUA 1C8XA 3QMRA 1SZGA 3A21A 4GXWA 1TO3A 1B90A 2Q09A 2DT0A 1V02A 3VIFA 4DZIA 1HQTA 3C0JA 2ISFA 3ZR4A 1XPGA 2NSOA 1XSJA 3KWSA 2DPEA 2WBKA 3H7RA 3B06A 3NL3A 1VFTA 2QNEA 1WUEA 4FLSA 1OK6A 1LQ2A 4IFOA 1MZHA 1XIEA 4WLCA 4E4PA 3NDZA 3GG8A 1XRFA 2OQLA 3EXRA 1AFSA 2WHLA 1LBFA 1YEYA 4BF9A 3A12A 3VX0A 4U2YA 4D6JA 4F0LA 1E6QM 4XVEA 3LK6A 3MI3A 2YDRA 5IXEA 3OB8A 1ZGDA 2F6KA 1XSKA 2NX1A 1ZLPA 3PUDA 4WR3A 2X8RA 3DFOA 4XZBA 3SCPA 3P8JA 1Q6DA 2AL2A 3PZGA 4Q22A 1D7KA 3OLEA 1FP8A 4KF1A 5H8UA 5FEWA 4OUEA 1KBBA 2ZA1A 4NJHA 3NM1A 1I2NA 4HK7A 3WQ8A 3CZJA 1V7YA 2DV0A 4AIEA 1OFBA 3OVGA 5I23A 5I79A 1UWTA 3LS9A 5I3DA 2FDSA 2WQDA 2D20A 2JK2A 2NT0A 4ZSTA 2ODOA 3LBMA 2R6OA 1GORA 1GVYA 3WCZA 4D6HA 2NVCA 1PCWA 2PEVA 3FFSA 3PZQA 1G9HA 4YMZA 3TTEA 2INFA 4RW5A 1Q3NA 4AVOA 2ZZ1A 4JTSA 1TPWA 1TV8A 5IFPA 3VVGA 1EOKA 2OZ8A 1IEQA 1NU5A 1ISXA 1NWUA 4OWGA 1QWKA 1NFBA 3J7HA 4ZQOA 1MQRA 4NAFA 2O92A 1DVJA 4PEEA 1EP1A 1IEIA 2VVNA 1YTEA 4H2HA 2DEPA 2XIOA 3ARPA 3G1SA 3TN4A 5I2UA 3KS5A 2FTWA 2GDQA 1M7PA 3KHJA 5A6TC 4ADTA 3E3HA 1PXGA 1QI5A 2E09A 3N3MA 5FJIA 2GVGA 2G96A 4JNYA 1DJNA 3KTSA 1KTCA 1H7RA 3T8QA 1XYBA 4P8WA 3BK0A 2BY1A 4XBJA 3TYDA 1W9PA 1DQWA 3KZSA 2J9YA 5AZ1A 4WXYA 1EXPA 4K1GA 3H2MA 3FOKA 3SCUA 9XIMA 3N18A 2ZX9A 3T4CA 2NUYA 4C6KA 4CD7A 4MFEA 1GVOA 3QV8A 1OD0A 4GQ0A 1GK8A 1A3HA 1LROA 2HE5A 2ZUMA 4GINA 4K1WA 3RRAA 1RCQA 1GG1A 3TYAA 5C6MA 1LTDA 1YQ2A 4X22A 4LRSA 4KWVA 4ZOCA 1QMLA 3CHVA 4WDTA 4O52A 1UQYA 4I8YA 4FNQA 4TVDA 2A4AA 3I3BA 3IK4A 1ZAHA 4HA0A 4Y9PA 4GFIA 4EPDC 3DFTA 1OADA 4EX4A 1Y5XA 3UWQA 2W79A 1R9XA 3FKKA 2BY2A 2DUXA 3GXIA 5FOOA 1GW9A 4ZO9A 1XUUA 3AAMA 4O1FA 1ITCA 5DFAA 4DZAA 1FWRA 3M0HA 4HA4A 1PJ9A 3MI6A 2XFWA 1JRBA 1EF2A 4UQCA 4US5A 3POHA 2KZHA 1QPQA 3FYYA 2IUZA 4LANA 3ENLA 3ZT5A 4PB3A 1XBVA 4QHRA 4IF2A 5CJ5A 1OX4A 4IX2A 1JYXA 2G3NA 3RG6A 2O0TA 4X2PA 2F6UA 3CAKA 3F7JA 5T9CE 1NFGA 2Z6JA 3BGAA 4O57A 2WMFA 1XYLA 4JOMA 4P2VA 3ZS4A 3WG6A 2YLAA 3W7NA 2GK1B 3FJLA 4NRSA 4HOWA 2G37A 2RDTA 1K4GA 1XPYA 1TQXA 3RMEA 4JHMA 6ENLA 4JFTA 3U57A 4UCGA 2C14A 3A3WA 4Y9NA 4CQAA 4HMDA 1M03A 4WHBA 5BXSA 3PBWA 2QVNA 5TBOA 4HKPA 3C6CA 3B3DA 3MSRA 5MKGA 4JN8A 3UVIA 4LV9A 5D2XA 1VYPX 4CQBA 1TV5A 2CU0A 2QAFA 1A4MA 1Q63A 2YCEA 3T9PA 3EB4A 2J7GA 4CGTA 4F48A 1G5AA 3M0VA 3W01A 1LOLA 1W37A 2YZRA 1A80A 3CPGA 3TOPA 3LI0A 1EO7A 1F2JA 7ODCA 3R6IA 1LT8A 3ABXA 4ZQRA 4N9EA 1YDVA 5G1MA 2QCMA 4A8LA 2H3DA 5KEZA 2Z24A 5HBFA 3W2JA 1B3OA 1F73A 1QW9A 1UUQA 3HPXA 3WJXA 1KCZA 3P0XA 1EHNA 1E0VA 2QR6A 4UFKA 3THCA 4LYPA 4B5WA 2CLKA 4AD3A 3F2DA 3OIXA 4KIEA 1F3EA 5B80A 1HW6A 1ZNNA 3R8RA 2R9RA 1TMLA 1S3HA 3ARQA 4ORIA 1YTDA 5DF0A 1GOKA 3PPGA 2O4MA 3L9CA 3SQSA 1OHLA 4AZGA 4F0HA 3CZLA 5I6SA 3A4XA 3KL0A 5TIMA 3STFA 4MNMA 5CAKA 1PIIA 4JIHA 1MDRA 1PE1A 4XUYA 4QCFA 1UR4A 4GNKB 4LBSA 1E9YB 4XAGA 4L9YA 1RJPA 1WZAA 2QT3A 3MZNA 5FJPA 4LRTA 2ZTKA 2MANA 5LHFA 2ZXAA 3W73A 1S2VA 3C2VA 4FNRA 5BOFA 1DPMA 1JYNA 4AZCB 5HA7A 3N25A 1N2VA 3RFAA 4MWAD 4QLLA 3SFKA 1EX5A 3QEZA 2YXOA 3OQEA 2YJQA 4O19A 1EJUC 1T8XA 3IJDA 1K9TA 1WKYA 4W89A 1THFD 2CLPA 1DIEA 4WJEA 1GJPA 7REQB 2ANUA 4GYPA 1F4AA 1C90A 2WZTA 3TKFA 4HHPA 5AYXA 2OGYA 4B5NA 4NVTA 5HJYA 2VDHA 3M0KA 2F6XA 1G6CA 4YJ5A 3GTXA 7ENLA 3A5FA 3V75A 4ZB2A 3N73A 4QG6A 1DTUA 4M81A 1QVBA 4F66A 4OHQA 5I5RA 1V6WA 4ZBCA 4C1NA 1E0XA 2QCDA 2YBVA 2PA6A 2B4GA 5G2IA 1TE1A 2R82A 3GHUA 3WFLA 1QASA 2ZZ2A 1IHIA 1GQJA 1V8EA 2F61A 1P4CA 4O16A 5E6ZA 3OHIA 3QH2A 4FXJA 5C9XA 1UP2A 3STGA 2WPGA 1ZENA 1BQCA 2V5JA 4PBFA 2VEPA 4D6DA 5E93A 1QHPA 4OT7A 2OYKA 3NZRA 5JBFA 3W7JA 3DFHA 4DUWA 1NSJA 4A3HA 3S9ZA 1LBMA 2PMQA 1H49A 2NQ5A 3WL0A 3WF3A 3CK5A 2Z27A 1CI1A 3H2CA 3K4WA 3QMSA 1N7KA 4E5TA 3II1A 3GKFA 4GD0A 4Q8PA 2ZC8A 5F2GA 3M0IA 1MEHA 5D32A 4C1LA 2AMXA 3SSJA 2XWDA 3DN5A 3WQCA 1MNZA 2X7WA 4A29A 1HKWA 2ZZ3A 1E1CB 3TN3A 1QPNA 3EWBX 4NL1A 3I65A 2PLCA 3VABA 3G18A 3VKDA 3TJLA 1D7FA 4M3PA 3CWNA 3B0YA 1EXBA 1QNOA 3EWUA 4Q6JA 5C2CA 1E5NA 3CL6A 4R27A 3TLQA 2BGQA 3SRFA 3IEBA 4YWIA 1W9DM 3TEVA 1E15A 3FN9A 4K8EA 4QDPA 1AQ0A 1CGYA 3PBMA 4UNLA 4EWND 3CIXA 4WIWA 1NJJA 1FHVA 4LNYA 4L1XA 4YTUA 4YVPA 3KS6A 2J62A 4GC3A 3HB9A 2XPKA 4JQ1A 1ICSA 1DE5A 3VIKA 1TPB1 1DWGM 3DYPA 3LI1A 4M0XA 4LEFA 1EFZA 3LGEA 3JUGA 2V9DA 1XYZA 1UW9A 1B3VA 4BS0A 2R91A 5I3HA 2GQ9A 4XZLX 4FAMA 3T78A 3MWCA 4GVHA 3VNMA 3BOFA 3CQJA 4C65A 1G67A 4JQ2A 1HZYA 3VILA 3T2PA 1YXCA 3VCCA 2R1LA 3SJ3A 3CUGA 4GJJA 4IFKB 2VFGA 3NDOA 1VB9A 2PDKA 3WKZA 3HN3A 3SCQA 4QAWA 1KCKA 2XGBA 3KTCA 1PO9A 1XL9A 2QCLA 3SQMA 4ADSA 3BARA 3GDKA 3H55A 3VNZA 4PMRA 1XWYA 3ONCA 4GZIA 3LCHA 4Q8WA 2VX5A 2Y5JA 3OGRA 3G24A 4PL2A 3E0LA 3AMCA 3O0KA 4MYAA 3GS6A 3WD3A 3KRZA 5CJMA 4YIWA 2V69A 1NTHA 1UWIA 1XYMA 1TMQA 8TIMA 4ZB0A 3AJ7A 2W4XA 2POZA 1UQZA 5AYIA 1XG3A 2CZ5A 1Q6FA 1CGXA 2DVUA 4EACA 1FWEC 4HCDA 2BOGX 3GH7A 5ABFB 3B8DA 4FEZA 2BHYA 4IIDA 5IDZA 3GR8A 3LENA 3VZYA 1SW7A 4GWEA 1BKSA 1JCMP 3BAXA 4H01A 4O0KA 2H8XA 3IS4A 1VLIA 1J6OA 4D9PA 3F4WA 4YTSA 1K77A 3NO5A 2CZDA 1JCXA 1XBZA 1MFVA 3SCVA 1GTEA 3RLVA 4WQ6A 3VGDA 3AIUA 3PG9A 1PTDA 1J2WA 1FY6A 4KIRA 1LRQA 4DJFD 1U2YA 4QSHA 3EMZA 4FIQA 5H8PA 7TIMA 1OG6A 5KMYA 3WLKX 1VBGA 2FJUB 4REQB 1R47A 1W9XA 1W54A 4CD6A 3O05A 3OBAA 1E56A 6TAAA 2WLYA 1MUCA 2GSJA 1KW1A 2Q8XA 5G2WA 1ZS2A 1CXIA 5EMYA 4RKAA 3SGZA 2IKJA 1V51A 2CWXA 1JCYA 1E9ZB 4GA8A 4JNZA 5K9DA 1MO0A 2H9AB 3CWOX 3UZWA 1SJBA 2IQ0A 9RUBA 2OELA 2X2GA 3QY8A 4RCXA 5DX7A 1AH0A 4ICCX 2A7PA 3L5LA 4C6LA 3CU2A 3MUCA 2XG9A 3TK7A 3EXTA 3NQFA 4A4AA 4HA1A 2YCKX 5K3VA 3DH7A 3NR0A 2VZSA 2XGIA 3P62A 5HK4A 2OSYA 2RHGA 1LOQA 1WO2A 1P48A 3AS0A 1Q6RA 3UWWA 1RBLA 5CZ0A 3HPAA 3BAYA 2OX1A 2OKOA 3R8HA 4GVFA 1ITUA 2QUNA 1TRDA 3JW7A 4MSSA 4O11A 2PDBA 1VF8A 4ATWA 5JBDA 1K7XA 3IV3A 3H2EA 3W7GA 3WDHA 5AY7A 1OZMA 3EX4A 4Q33A 4QRNA 4WCJA 5AN7A 1HJWA 3WQVA 1VQTA 2PWGA 1E0TA 3GNRA 4IH3A 4Q32A 2VI0A 3W25A 2QPSA 2GDVA 1F7BA 4IWWA 3RXZA 3K30A 2Q01A 1LLOA 3W28A 3KVKA 1EF3A 1GVRA 1W5OA 1P0EA 4RX0A 3PPFA 2DSKA 2YW4A 1F8MA 4PFHA 1I6NA 3SUVA 3GDBA 2P8CA 1DV7A 4MB1A 3STPA 1QBBA 3VKAA 2W67A 2FYMA 3S6OA 3BWWA 3ONBA 4DHGA 1UOKA 2QS8A 4IL0A 3VCNA 1RJRA 3OVRA 2CBUA 2ZZ5A 1VR6A 3VDHA 1VEMA 3K8MA 3URNA 1TJ2A 5G2HA 3UGRA 1GG0A 2FMNA 3FAXA 1RLDA 1IWBA 2E6AA 5F4XA 1JDEA 5DEZA 5KTLA 4ES4A 1PHWA 3DIPA 2VCBA 4IXHA 1UA3A 3O0FA 4A8IA 4AHQA 3PK7A 2RUSA 4OBRA 4IFRA 1YBQB 4GGBA 4KPLA 4JIIX 4UNIA 1SPQA 2V3GA 1HXJA 2W63A 1WB0A 3CB8A 4I7WA 2PWHA 2HXTA 1H51A 3G1FA 1JDCA 4JIEA 2YCLA 4L4OA 3UPBA 5HQEA 1K3UA 2VP8A 1GVFA 1OABA 4BA0A 1PKMA 5G1YA 4ZE5A 2FJKA 2QDHA 2R1NA 1SO4A 4FF5A 4B9ZA 1AW5A 2IPJA 1U1UA 2XIIA 2Z26A 4MWAC 4Z2JA 3MWAA 4IGSA 3H23A 2BASA 1UD5A 4JTLA 4Q8MA 2A3LA 1RAKA 3MW7A 4WY0B 5D8WA 1E1EA 2FZ8A 3KE0A 5CPQA 2P88A 4QBXA 1EGZA 4CNNA 2EPKX 3WH6A 2Q02A 3KOXA 1KWKA 1AZ2A 1DWAM 1XLGA 3N17A 4ICMA 3VOGA 3HOJA 1XDLA 2QJJA 1ISYA 2P1FA 4HNUA 4LBUA 4E8CA 3BG3A 5CH9A 3GX9A 4LYRA 3APTA 4PBGA 2VR2A 2BV9A 4UR8A 4K68A 4U5IA 3W7EA 3GKAA 1SMAA 3CWHA 1PV8A 4GX8A 3D47A 3TA9A 2BTMA 2A3BA 2JIWA 2WJDA 3GIPA 2XFRA 3SAZA 2HVOA 1KM1A 5L6UA 1US2A 2OSXA 2WMKA 1GJWA 4KWUA 5CPTA 3TSDA 4F2BA 3MQTA 5C0QA 1ICQA 2VR5A 2IXVA 3I6TA 4IGMA 2G5WA 1EJXC 3CTTA 1TVPA 3KRUA 5I02A 4AZ6A 2CWNA 5F2LA 3LM7A 1RVGA 2C79A 3IV8A 3FV9A 3BLOA 4D71A 5BXRA 3M6DA 1GKRA 1CTNA 3WSUA 4MUZA 3TP4A 4BWLA 5HMDA 3C2OA 1VPQA 2I5GA 4YLWA 3S2JA 4PRRA 2PPGA 1B54A 2PRMA 3HG2A 2HBVA 1JZ8A 1DORA 1NP2A 2PGFA 4K37A 1KFBA 3OA3A 1UA7A 4Y8FA 1WOBA 3DZ1A 1QUMA 1KTBA 1ITQA 1TE6A 3WL1A 4PUNA 5A8PA 1O5RA 5AC5A 1KR0A 3SZ8A 2YDQA 4RV3A 3QZAA 3BZJA 5HJLA 5CLTA 1UJQA 8A3HA 2DJLA 1UWSA 2Z7KA 4Z1CA 4DN1A 5FJTA 2OEMA 4J3UA 4UTWA 1PSCA 1KRMA 1V3KA 1B30A 5KINA 1BG9A 3B97A 1FCQA 1W3LA 4A22A 4K39A 2PP3A 5LXXA 3PVFA 3WLNA 4PH6A 3EOUA 4U5KA 4D6EA 1OCBA 1KXQA 4A05A 3AC0A 2ALDA 2VC7A 2YB1A 3EKLA 2J77A 4BK9A 7A3HA 5FAGA 3PUOA 3M46A 3QYQA 3IAQA 1WBJA 1CXEA 3LCFA 3QZ6A 3N04A 4I6VA 2WOQA 1OVDA 3MMWA 2CITA 3PULA 1FHLA 1UG6A 3CAQA 4H8NA 4CUCA 5XIMA 1DJHA 5AHNA 2VT0A 1LCOA 5A3HA 1TJ0A 1V6XA 2Y4SA 4XISA 4AEEA 3NO1A 4HNOA 3KBVA 4E4UA 2XH4A 4FMVA 2J78A 1E71M 5F2MA 1AQMA 3W7LA 4OBTA 1UZHA 2FB2A 4DBSA 5IHRA 4MZYA 3RX2A 4IICA 4PSRA 3PWGA 4DB7A 2WCGA 2XISA 3GU2A 3VOHA 2OT0A 3W72A 4QJ5B 3TONA 4ZQNA 3ZVHB 4CKQA 3N2TA 1HJSA 3BANA 2J47A 1ZBWA 4GBUA 3VNLA 3URQA 2G3JA 1GQLA 3ATYA 2FGZA 5REQB 3QQ1A 4DBDA 1TPFA 3KLKA 4HN4A 2FVMA 4JY8A 3Q4DA 1LDCA 2OLAA 1F9CA 4AF0A 4H4IA 1HJQA 1RP8A 1RSCA 3ZT7A 2IKGA 2CBVA 2FZNA 3GO2A 1AW2A 2Z1SA 4YYCA 4DF1A 1KRAC 3MB9A 4RE4A 4CEXC 3SCWA 3QV6A 5D03A 9CGTA 4IJRA 3AQUA 4E2BA 3MMDA 2Z2AA 1OEPA 1PBGA 4DPPA 2EKCA 4MJZA 2H3BA 4HOXA 4TTUA 1KGWA 1R3WA 3P5ZA 3IUIA 5FL0A 4P8UA 5FEZA 4CNOA 2YYUA 1BWVA 2EBNA 4JQ4A 1CLVA 3BLIA 5AC8A 2DSZA 2E8YA 3TOYA 1Q6OA 4A21A 3NG3A 3P93A 4GZEA 4BFAA 5HMSA 1QPKA 1WKFA 4H6QA 4C6EA 3V35A 4XBKA 1V7AA 3NL2A 1ZAJA 3G0SA 4AMAA 5LIUX 3VKCA 3U5UA 2WK2A 3SCNA 1RD6A 3WMSA 3TW9A 3W1XA 3F5LA 1RY8A 5TNVA 3ARTA 2E7FA 2B7OA 4RDWA 2XZ7A 2Z0IA 3GNPA 3LXAA 4J40A 4ZB5A 3CO8A 2XSAA 1T96A 3F4NA 2EEXA 3KW3A 1EJTC 4GVIA 4JHOA 2PTXA 1SFSA 3QYSA 3KCLA 2Y8KA 1EC7A 3QR3A 4CD5A 5HMEA 1R9YA 1C29A 2ZBTA 3FDKA 3OHMB 1W1ZA 3OPSA 3ZQ9A 1YXDA 4YWSA 4FR1A 4LB3A 3EX1A 4DWSD 3W82A 1GEQA 5LGXA 1XV8A 4L56A 4AW7A 3EDEA 1V0NA 1V6UA 3B03A 1SU5A 2OX4A 1FVPA 1TWZA 3BG5A 4KGLA 4Q4QA 4AYSA 4H9UA 4NAEB 1IYXA 4QS6A 5IRPA 3QGVA 3VNJA 1PTAA 4S3AA 3MO4A 3BOXA 5ECUA 3UVAA 5FACA 4ZSUA 2DIKA 3K4DA 3BH4A 3USBA 1Z6KA 3LXCA 3DGBA 1TRIA 4UQ9A 3V5CA 1EGVA 4BKNA 4C6DA 1Q8AA 2DQWA 1PX4A 4JTJA 4EANA 1EB3A 3AU6A 3HA1A 2ACRA 4O4VA 4IPPA 2O56A 3B0PA 3WLPA 2EGZA 1TZ7A 1QI2A 2J7BA 1AW1A 4PYSA 2V2HA 1QWGA 4EAMA 1DWFM 4LCQA 4AY1A 3MV11 3ES8A 1ZSXA 5I7GA 3WQ5A 1GQIA 3AUJA 2E77A 4R3UA 2JF7A 2NQLA 4DYEA 3PB2A 3AMKA 1AVAA 4HIBA 4FIRA 1SMDA 3NQAA 1OCJA 4Q6XA 1DYSA 3W7IA 3W85A 4MM1A 4GY0A 3B4YA 3GFXA 3E49A 3KTXA 5C9WA 3C5QA 4DWSB 4B90A 2Q3RA 3HG5A 3LPFA 5AYZA 2J66A 1LL4A 1E1FA 1QW7A 2PRLA 3VIHA 1HKKA 1P0NA 3O15A 1Q65A 1FA2A 1BHGA 3SUWA 3RJXA 2FHCA 5D9PA 2I1OA 1BXBA 3KCOA 5AHLA 5E9XA 1K4HA 2Z28A 4CN4A 1ZB5A 3SFWA 4MPQA 1Y5WA 5K9XA 2AAMA 1GOWA 3Q45A 1TPDA 3NQ8A 1XDJA 1RPKA 3PBUA 5F7UA 1X8CA 4UFHA 4ZO6A 3S5SA 3WNNA 5LNSA 3WMBA 1VP5A 2WXDM 2VUYA 3RLUA 1V6VA 2Y70A 1OY0A 1XKYA 5FF2A 4HK6A 4PMUA 2EO7A 1C8VA 3C2FA 1IXQA 2OWWA 1LUCB 1P0KA 2WQPA 2YXGA 4JYDA 6PTDA 1U5VA 2B31A 2J13A 3BUVA 3WLOA 1DJWA 1REQB 2VZTA 1QJWA 4AD4A 3CTLA 1E51A 1VJZA 1DXIA 3NUKA 5LNVA 4Q8QA 3M47A 1O5QA 3POCA 5EBUA 4DRSA 4AZCA 4FXSA 3VK5A 1J10A 1WZLA 4LOCA 3LV5A 1EJWC 3VO0A 4QIUA 2FZ9A 4RXFA 4ZODA 3KOYA 4LY4A 2ACUA 2X42A 4PUJA 3NL6A 1PHQA 3FY1A 3EKZA 3BCJA 7REQA 1KGUA 1IT8A 3E0IA 1EO5A 1XIMA 1G7VA 4J9JA 5F1VA 1H0IA 3NCOA 5M3WA 2BXYA 4GE8A 5BWFA 1Z9AA 5CSRA 4KH2A 2PWDA 1UR8A 3TTOA 3HPFA 5C54A 1W5QA 2Z29A 5I09A 1I9CB 5JMUA 2VRJA 4KCWA 2H90A 4JGDA 5E0FA 1JQXA 1V4YA 1ZTVA 3GY1A 3OZPA 5DCEA 5GJMA 4GO9A 1P0BA 3G6LA 3LHTA 2PGWA 4HSHA 1VRXA 2DUAA 3OGVA 1ODZA 2F9RA 4MWAE 2ON3A 2Y1HA 4QQUA 2BHUA 1K1DA 3L7RA 4F79A 3PS7A 4X3ZA 4R9XA 6REQB 5I03A 5DMYA 3QV7A 3LLDA 1Q2RA 4S23A 4KT2A 1YNQA 2C0HA 2V0TA 2VNCA 3S1VA 4UR9A 5ECVA 1YDOA 4QNWA 4IHCA 3M0LA 4LYQA 3CUHA 2QHAA 3PF3A 4JR5A 1VFSA 4BEQA 2XM1A 2XN1A 4Z17A 1H50A 1KXHA 3I6RA 1Q4NX 5CEWA 3G0XA 3UWUA 1X38A 2XH7A 4N7QA 3CMGA 3B8UA 3WK3A 2QF8A 1QU4A 1T5AA 4DNMA 3MANA 3AYTA 1EOMA 5CC6A 2V3EA 1IZKA 3WF4A 1RALA 3VFLA 1E1CA 1DQXA 3CT2A 1OYAA 1VS1A 1I75A 2V38A 2Y7FA 2ISDA 2GUYA 2QJNA 3DC0A 1XUZA 3IK2A 4IMGA 1NVMA 2A6LA 3EWYA 2J8FA 1M53A 3W86A 3GFZA 3K1DA 1BSIA 2WCAA 3DKJA 3G1VA 3NPVA 1CDGA 3ELFA 4JQ3A 1CZ1A 4O15A 4GIYA 3CAVA 1B4EA 5FESA 3QW3A 1CWYA 4U2ZA 4KCUA 2OKTA 5D30A 4Q4MA 3ITGA 5LNUA 3IIPA 5KITA 4JTTA 5H8MA 2V82A 2PUZA 4Z1AA 2ZYFA 4NX0A 4J35A 1VCVA 2ZUVA 1MVYA 3QM3A 1E6PA 4B3LA 2ZC1A 1HL8A 2G97A 3T07A 5D09A 4PTMA 1Q45A 3WDRA 1JPDX 4YL2A 2AKZA 5LGZA 2ZX6A 3C52A 2GJPA 1YIXA 3MP4A 5J5DA 3WJSA 1Q7ZA 4ZR8A 4IFKA 4BR1A 4X9YA 3DAQA 4W4QA 3CV1A 4GYJA 1EUAA 3G8RA 1XW8A 3MUZ1 4B4HA 3LCXA 4F0SA 3AU2A 3R94A 5C9ZA 4MDOA 1KLYA 1OCNA 2WVSA 3AYRA 1A47A 1H2JA 3GC4A 3I6EA 3B04A 1Q85A 3L21A 5FJJA 5CLWA 1M3UA 3S4TA 3WF0A 2WLZA 3WLIA 4DJDC 5CBIA 3MUY1 1XCFA 2Y7DA 1A5NC 1V77A 2FTPA 4XD4A 3LCWA 3NSNA 5CC7A 2E1WA 4PGLA 3GDMA 3HGRA 2P8BA 1UYQA 3MPGA 3W23A 1SYTA 2JALA 4L9ZA 4W7WA 5A5WA 3QPZA 4Z1BA 9XIAA 4HVXA 4AXKA 2JF6A 4JFWA 4C5YA 5K4XA 1YDYA 1EP2A 4MB5A 2J7HA 4KERA 1XGEA 1ZJIA 4D1IA 3EWCA 3S1WA 1KM2A 3KDNA 2QXWA 2YB4A 4E2DA 4AZ5A 3BLFA 1KM5A 5C2GA 1ZU8A 4S38A 5CXPA 1NFPA 4LUTB 1V08A 3KP1A 3LY0A 4FA3A 2AAAA 4WEVX 5DLCA 2POTA 1JDAA 2PDHA 3MBFA 3GDRA 4B92A 3B8WA 1DWHM 3R43A 3S46A 4GQQA 3WQ6A 1QAPA 2GJXB 2NSXA 3WUBA 1K8CA 4FLQA 2WKGA 1G1YA 1JI2A 2HVNA 5C55A 3DI0A 2IXUA 4P7RA 3U2EA 1NF0A 3FVMA 2ISWA 3LSCA 2PBGA 4YCPA 5EU9A 2BWGA 1FQ0A 4O50A 4TV6A 4XKMA 3N2XA 2YL9A 3R8GA 4S39A 1ONWA 3WFAA 3DHDA 5C71A 1CYGA 4REQA 1GVEA 2CLIA 2VX6A 1LL6A 1B9BA 2VFEA 3P82A 5G5IA 2B81A 2VDGA 4MNJA 2GVJA 5U4NA 4J3TA 4I90A 1CXLA 4CQCA 1VD6A 3VOCA 3DDMA 3GZ3A 1ZRQA 4JKKA 3OG3A 2Z1WA 4Q4SA 1UP3A 3CHDA 2GVEA 1S2CA 3GW0A 2H9AA 4KEMA 2VDIA 2QCCA 3PZ9A 4QQ3A 5EMKA 2NXGA 2Y88A 3B8TA 2BOEX 4GRSA 4KWSA 2EG7A 1RQEA 5BZAA 3EX3A 3FCPA 2BS9A 1F61A 3CNYA 5CJNA 3W00A 3UG3A 1JF5A 3ZOAA 3PC0A 4INFA 3WEZA 5EKYA 4PRTA 1HTIA 4ZO7A 4YTTA 1YMYA 3PTQA 2E5CA 4RDZA 2YL8A 1Q13A 2ATMA 1MEWA 1A0EA 1H5VA 3BOLA 3S9YA 2DW6A 3L0KA 1NWRA 3ZWSA 1KFCA 1C3FA 4TR9A 4JYEA 3DC8A 4C1KA 2CLOA 2YA0A 2ZRZA 4DJFA 3E0WA 4EAYA 2V3DA 3N13A 4URIA 4M24A 3APYA 4AIUA 1B3ZA 1ONEA 3TDFA 4IP4A 1OX5A 2I5IA 4GC4A 3U2CA 3HTWA 1SVDA 5HINA 1UD3A 3GTNA 3F5JA 1XLHA 2D24A 1VBRA 3QVQA 5F1UA 3U4AA 5A2CA 1WDDA 1K9FA 2OXNA 4XZHA 4JFSA 4KWWA 1XLMA 5GNYA 1WXZA 4LPCA 1BFNA 1O68A 4IZGA 1QHOA 4UTMA 3LX9A 5BXPA 4N6EA 2TODA 2OOFA 1GHRA 2FB3A 3TE9A 1Y8BA 1KC7A 3N2MA 3E2SA 1EJRC 1XR2A 3HIJA 1PIFA 3OZYA 4UQEA 1QNQA 1E4NA 3AIWA 4NJJA 4PMYA 3U9IA 3QOMA 1TWIA 5CPOA 2ZRYA 2OR2A 1P6CA 3R0UA 5HAOA 4LEQA 4CQ8A 3QPEA 1V6YA 3WIJA 3V5OA 2PU1A 1DTNA 2EHHA 3MSDA 2CPUA 1FFQA 3CASA 4N02A 1TA3B 3PPHA 3SGUA 2UZ9A 2WNWA 3NQ7A 4NXKA 3LMYA 4N2YA 1WKEA 1R3RA 2EG8A 3AHTA 3R4IA 4XD5A 4ZOEA 3S3GA 1HUVA 2VEKA 4NJGA 1CW2A 4HP5A 1O12A 4O54A 4GQRA 2PTYA 4QJ1A 1UH3A 3WNOA 3RPDA 2V5DA 4KFNA 4I3GA 3A64A 4PCPA 1PZ1A 1RHCA 5C5YA 2GL5A 5G4WA 3TCSA 3U48A 3LHZA 2J7EA 4UTLA 1ZY9A 3PJUA 4GO8A 3EWDA 3AJXA 3WN6A 5DRIA 1VFFA 2ZRWA 1YYAA 2EJAA 3U2OA 1TPVA 5LIYX 3A5VA 3FGCB 4LAUA 4DO4A 2HEJA 3VIMA 3W53A 3C0SA 1GZ1A 4WY0A 1E4LA 4RXGA 5F4WA 4X60A 1S5MA 4O17A 1CB2A 2OLHA 3DFNA 2GQ8A 1SZNA 3UXLA 1VYSX 1O5KA 3L67A 2PWUA 5AHMA 4IIHA 4Q4OA 1BTMA 1KFWA 3GBEA 3SW6A 2QCNA 4HHHA 3UXIA 4J3SA 3L4VA 4MY9A 4PUDA 3WBAA 2DH3A 3H4GA 3ABQA 1UR3M 1YNPA 1EC8A 1DWJM 3N9KA 3VC6A 5AYBA 1JIBA 5T8GA 4XTDA 2RKXA 5FA5A 4GY1A 3KZPA 5BMWA 1S39A 1XP3A 3HGOA 1R2SA 5CPNA 3UA3A 5A6SA 3GXDA 3ZIZA 2WMHA 5T9BG 4R53A 5JU6A 4KBXA 3E38A 3M0ZA 1X6LA 4UMBA 3VIOA 1TVNA 4JKMA 3AI0A 3PFMA 1E6RA 1TR9A 1R2TA 1DXFA 1QO2A 1R7AA 4XIAA 1E72M 2OEKA 4MY8A 4KKXA 4I5UA 3E2RA 4A8RA 2D69A 1IF2A 1CB7B 4WOQA 3QRHA 4NNAA 1ZP4A 3CC1A 4CCEA 5I3GA 4L9XA 3T8LA 2DGAA 1YPFA 2PTZA 3VE9A 1K9EA 2GQAA 1L6FA 4JFVA 2VURA 4MAVA 1HNYA 1SO3A 4DLMA 2ZXBA 3A47A 4WKFA 4XSLA 3OBKA 4CQ9A 4UOJA 1KV8A 2G3FA 2QCHA 2VGFA 4Q7NA 3STCA 1WXJA 3T0CA 1JGMA 1AMKA 2X1UA 3H2OA 1FKWA 3MCOA 2YFNA 4UR7A 4TX8A 3EDFA 2PBOA 3L2MA 3UG4A 1Z32X 2D3NA 1W1VA 5TAOA 2BFGA 2HPMA 4J4KA 2WC3A 3ITTA 2IQTA 5BNKA 2BDQA 3GAYA 3H24A 2RJGA 2J24A 3P3BA 3CEPA 2WNQA 3M44A 1EGMA 3BMVA 4HYWA 1PDZA 2QJGA 3B9AA 3CV6A 5FL1A 3KFTA 4M82A 4LS2A 4JS3A 2NUWA 1EKOA 2Y7EA 3C61A 3V36A 2GJLA 3R0DA 3UR7A 1C8YA 1H41A 1X1ZA 1F6KA 4PA8A 4GMEA 4CNTA 3W7MA 1A5MC 5PTDA 4PTVA 1SUXA 4O8RA 2JFEX 3D0CA 3DBNA 4KW2A 3ARWA 4XZIA 2BY3A 1WKDA 1SFTA 1YE6A 4J3ZA 1R3YA 3W81A 1JUBA 4IIBA 2A3CA 1QK2A 4BQ3A 1W31A 4G6CA 4HTBA 1VFHA 4AVFA 1L8NA 4J1OA 3IRSA 2D0HA 3W1MA 5GJPA 4I9AA 3L0NA 3UCQA 4LAKA 2B0MA 4PMXA 5EMJA 4QS5A