5JMUA

The crystal structure of the catalytic domain of peptidoglycan n-acetylglucosamine deacetylase from eubacterium rectale atcc 33656
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
220
structure length
219
Chain Sequence
DPAATADTVNPGNKIIYLTFDDGPGKYTQGLLDVLDKYNVKATFFVTNTHPDYQNMIAEEAKRGHTVAIHSASHKYNQIYTSEQAFFDDLEQMNSIIKAQTGNDASIIRFPGGSSNTVSKDYPGIMTQLVNDVTARGLLYCDWNVSSGDANPKPISTEQVVQNVISGVQSHNVSVVLQHDIKEFSVNAVEQIIQWGQANGYTFLPLTTSSPMSHHRVNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the catalytic domain of peptidoglycan N-acetylglucosamine deacetylase from Eubacterium rectale ATCC 33656 (CASP target)
rcsb
source organism Agathobacter rectalis (strain atcc 33656 / dsm 3377 / jcm 17463 / kctc 5835 / vp
molecule tags Hydrolase
molecule keywords Peptidoglycan N-acetylglucosamine deacetylase
total genus 79
structure length 219
sequence length 220
ec nomenclature
pdb deposition date 2016-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 5jmuA00
2W3ZA 4NYYA 1W17A 1W1B1 4V33A 3VUSA 3RXZA 4OUIA 1W1A1 4L1GA 2C1GA 1NY1A 2Y8UA 2XU2A 3CL6A 4HD5A 4NZ3A 1V6TA 2VYOA 2DFAA 2I5IA 4NY2A 2E67A 4NZ1A 2C71A 2QV5A 4M1BA 2J13A 5BU6A 4U10A 1Z7AA 2C1IA 4NYUA 3CL8A 4F9JA 4NZ5A 4NZ4A 1XW8A 3WX7A 2IW0A 3CL7A 3QBUA 3HFTA 4F9DA 2C79A 4WCJA 2CC0A 4LY4A 5JMUA 2NLYA 3S6OA
chains in the Genus database with same CATH superfamily
3T1GA 3CHCA 4LAUA 2GGHA 2ZVIA 3C2RA 4AZ7A 4DBWA 4KPLA 5C9XA 3QSTA 4B4HA 3SCTA 1IWBA 3HGJA 2BMBA 3GFXA 4GJIA 3FGCB 2AQOA 2HNEA 3ZSSA 4UCGA 4GZ7A 4PMNA 3DKJA 3M6YA 3QV9A 4EOUA 2VEGA 5M5DA 1UBSA 2ZC8A 3L4XA 1JNEA 4J4KA 1QVBA 3DXIA 4TXEA 1GJWA 3QGKC 1J01A 4E2BA 3M0KA 4LV9A 4U10A 4DJEC 3RCNA 3HA1A 4PUJA 1KFWA 1TUFA 1W32A 2G41A 2PDMA 2YX0A 3P81A 1ZQ5A 2NQLA 2A7NA 4RCXA 1W1IE 2ZWYA 3L0NA 4XZLX 4CQCA 4FR6A 1E4MM 3RDKA 4E0CA 4QLLA 1GTEA 4EXQA 2OZ8A 4AD2A 4Q7IA 2QJHA 3PVFA 1FWTA 4ZQNA 2D73A 4H6QA 4RZ6A 5C2CA 3KDNA 4AWSA 3M0ZA 3ARUA 5FF4A 1TV3A 4B5WA 3TZNA 4AAJA 3WJZA 1K6AA 1OFOA 1U1HA 4HHMA 1YLVA 4WY0B 4AIEA 2DSVA 5AOUA 4URIA 4OJYA 1XX1A 4QE1A 2NT0A 1Q2SA 1W9VA 4ZEPA 2CLOA 1E55A 1VR6A 1TRIA 3CV1A 1HTIA 2NT1A 2PWEA 3WEZA 4H9MA 1PB0A 1EYEA 2EG6A 3EWUA 4DN1A 3VZZA 1RK5A 2D0FA 1TPEA 1P1MA 2XIOA 6TIMA 3CO8A 3TCSA 3F2DA 3H2OA 1DQUA 1UW9A 5C54A 2I16A 1K8ZA 3R43A 3LI1A 3P5YA 2EJAA 3GTNA 4TMCA 1DVJA 4XZIA 1W3LA 1YQ2A 4GGBA 3TW6A 3VYLA 1F5ZA 2GJPA 1ZB5A 4JTUA 3NQBA 1KA9F 4OU1A 3U9IA 4MF4A 2VFHA 3CQKA 1BXNA 4HZ6A 4ES4A 3SW6A 2P10A 1W3TA 3D3FA 3MKVA 3BW2A 5TBOA 3FJNA 1V5XA 2QQ6A 1WX0A 1UQYA 1CWYA 1KBKA 3N2MA 1PKYA 1G94A 5D8WA 2NV9A 4Q8OA 4L1WA 3VKJA 2OB3A 3U8GA 3OG3A 3KBVA 1E56A 3W7LA 2GGIA 3ZMRA 2O9OA 4NNAA 2OZ3A 1QPKA 1CT5A 2YW3A 1KM6A 2J62A 4I5UA 3PZVA 2UWFA 3IGUA 3O07A 2UY3A 3PNZA 3AS1A 4HHPA 1SR9A 3L0KA 3SUSA 1F4HA 4KEZA 2CZEA 5CJ5A 4XG1A 4XIMA 3EXTA 1J0ZA 4AEFA 3TTOA 4IIFA 4MWAB 4GGHA 4QX4A 3R0DA 2YA1A 2X1UA 3LB0A 4UFHA 1LOLA 3WQ6A 2QKFA 1TV2A 2HQAA 4FR1A 4HA0A 2W27A 3QTGA 3CWOX 5FJTA 1PSCA 4LVBA 3UZXA 3LS9A 1XCWA 1WZKA 4TVCA 1ICSA 3O3RA 1JZ8A 2RAGA 5A2AA 4G2DA 3M7SA 4QEHA 3M0VA 2QZRA 1XC6A 3BAWA 4AZ6A 1L8NA 4F0KA 1RP8A 4RZ4A 2ZE3A 3WJSA 3TFXA 4NZ4A 3M4HA 3D6NA 3RMJA 3FA3A 1FCVA 1AL7A 4AF0A 3MB9A 1SJBA 4U5KA 2YDAA 5FAGA 4HSNA 4XO6A 3CASA 4OBRA 3BV4A 3RR4A 2HRWA 2ZYFA 1O1ZA 4JTKA 1Q45A 2PWDA 3NOEA 3ELFA 4TV5A 4IXHA 2BS9A 5LA2A 5MF5A 1DJQA 5JBEA 1FWFC 1RVGA 3BQ6A 3H12A 4PUDA 3CXOA 4IOTA 6REQB 1IZCA 1JRBA 1H0IA 2VFEA 2BG5A 3CAKA 3PUEA 3N2CA 1YX1A 3CL7A 5CBJA 3Q94A 3W7CA 3FEMA 2XZ9A 3IIXA 3ABOA 1TX2A 3TTYA 1DYSA 1JPMA 3RYSA 5D04C 3WK3A 2PBOA 4KMQA 3NQFA 2E40A 3UQNA 4D6DA 4PEKA 4YLWA 3GUGA 1J0YA 4F2BA 3B8VA 3K46A 1FWGC 1P7TB 3BPWA 2XIIA 1JR1A 3H2EA 3CPUA 4KWOA 3ITVA 1TWDA 4E6MA 3Q67A 3TWBA 4JHZA 4LCSA 2OVLA 4M0XA 5I00A 4FMVA 1HXJA 1K8CA 4AX7A 1GYLA 3WQ5A 3F1QA 3LENA 3W7HA 3TXZA 1ZBVA 1ZZMA 2AMGA 4C6DA 1W1TA 4H41A 4IQLA 4OZOA 1XIHA 3MI2A 3D47A 4JTFA 1E9YB 3BZJA 2GWGA 3AYVA 3VGDA 4XBKA 1GG1A 3LMZA 2AL2B 2R1PA 2G3JA 3VABA 2EKCA 5RUBA 1U5VA 5CXPA 4XKYA 3P2VA 2C13A 3F4CA 4O57A 4NJJA 1OF6A 4PBEA 2CZDA 1IEVA 1UC5A 1E73M 2Y5EA 4W8BA 5C9RA 3KBMA 2ZX6A 1U22A 3ENLA 1ZS2A 3WLHA 3ABQA 1VCFA 3TYZA 3Q45A 3NM1A 3WFZA 2J7CA 3W7DA 5I78A 4IT1A 3U7BA 2XFRA 4MKVA 1Q65A 2X7VA 3O06A 3UY8A 1KBBA 4Y8FA 1Q4WA 3WD2A 1UR3M 4O4WA 4JQ4A 1REQB 2WHMA 2VFFA 3CU2A 5AHNA 4LTSA 5AHIA 1E3ZA 2RH9A 1TTJA 4B15A 3OG2A 1UZDA 5EMUA 5HA7A 1Q8JA 1VBRA 2GSHA 3WMCA 3JZEA 3OLGA 1TUXA 3IANA 3RAOA 2B7PA 1KB3A 5IXEA 1H11A 2QCNA 2X7WA 4HOXA 4DJDD 3TC3A 1L2UA 2ASHA 3ORWA 1KRCC 2F6UA 4KEVA 1VH7A 5CLTA 2EGZA 3HQ1A 1VBGA 3B8DA 3NYDA 1WXYA 3L68A 3WEMA 2ON3A 4GIYA 4F4RA 3NNTA 3C0QA 2E6FA 1VB9A 4IFKB 5E5CA 4UR7A 5I3JA 3T8LA 4IGMA 5DBUA 2WHLA 2PODA 3WBWA 2V8ZA 5HULA 2BY0A 4YNGA 1D2KA 1NM9A 2NZLA 3SGGA 3G1VA 4QJ3B 1E0VA 3LM7A 1M01A 4PL2A 4WVXA 2V68A 4UTUA 3UPWA 1A5BA 4OIFA 1E72M 4WSHA 1GVEA 4GCAA 3WNMA 3NXLA 1YEYA 4JN8A 2E4TA 1XFBA 4A3HA 4UOQA 3G1DA 4BF7A 1G4EA 3QOMA 1VFLA 2F38A 1GOWA 4JIRA 1A0EA 2ALRA 1F61A 2EG7A 3RCYA 4D9PA 3GR4A 4HA1A 3AZSA 4R7OA 7A3HA 4NT0A 1K7FA 3T44A 1IWPA 1S2VA 1S1RA 4KWSA 1TPC1 4DBSA 3O9NA 3GIPA 1TWSA 2D22A 1US3A 2XPKA 4KFOA 1NQ6A 1OB0A 4HMCA 1O7AA 1HL9A 3K4AA 3AHZA 3CQIA 4S3FA 2PWHA 1IZJA 3PZMA 3OU8A 4RNJA 2Z27A 1GVSA 2PD5A 4HSHA 2ZUTA 5F4SA 5LA1A 5EBAA 2DT3A 4B4FA 3NQ8A 3SY8A 1DJIA 1PEZA 4JTDA 1KWKA 3UWVA 3DESA 3PZTA 2XZ7A 3L5MA 4ZCWA 1NWRA 3SJ3A 3QKEA 1A0DA 4MDOA 5I3KA 3QBUA 3SCRA 5JIPA 3ZT7A 4WY0F 3FFSA 2JF6A 4D6IA 4C7FA 4REQB 4Q4RA 3NFUA 3E2RA 3WDJA 4PMOA 4ZTYA 3R4IA 4XISA 1T7LA 2A85A 3L2MA 2GUUA 2YL6A 3E2QA 4NXKA 4BEQA 2ACRA 2OLHA 5AHLA 1KFBA 2ATMA 1K9DA 3PPHA 4GXMA 3IIPA 4MLRA 4HSOA 5FF7A 2FZ9A 1IEQA 3CUJA 1WKYA 1JYWA 1MNSA 5HQEA 2G96A 1O6IA 1OINA 4LAMA 2NXHA 3AIQA 4LSBA 4IM4A 1JULA 3PSVA 3DFNA 3E0IA 1AH4A 3VE9A 3VKCA 2BVDA 5JBFA 4FK9A 2MNRA 1DWJM 4KH2A 5LIKX 3GBDA 3LBOA 1OABA 2OO6A 3VUSA 1TFVA 4LT9A 1VFHA 3AALA 1T6MA 3WDHA 1JZ3A 3C3NA 1YADA 2WMFA 1O5KA 2PBGA 2QNEA 3S46A 5A8PA 3C0LA 3D3AA 2DZTA 4GUHA 3VOFA 3IK4A 3UZ5A 1H7WA 2C0AA 3SIZA 2VGIA 1KQZA 2GJRA 2PDHA 4FS9A 1BVNP 5EMJA 1H7PA 3PS7A 1AMYA 3NEVA 1ZL1A 3EX1A 3KLKA 3IIZA 1UCWA 4MNJA 5FL1A 2Y61A 2MANA 2YCLB 4J3SA 2VGBA 2QIIA 4Z2HA 1M03A 4P8VA 4K2SA 1AVAA 3W2UA 1LWHA 4R5EA 2E6AA 5HNUA 3GUWA 3AXXA 4EPBC 1VEPA 4KEUA 3M6DA 4LYPA 3S1GA 2JIWA 4DWDA 1OCNA 2DT1A 5CCZA 4X2PA 1LL7A 3W82A 3U0HA 3RILA 2GQAA 3WCZA 4GUGA 4IQJA 2QPUA 3GXNA 3IVSA 4GX9A 2OSWA 1F8MA 1RCOB 1EPXA 3S0CA 4HA3A 1SZGA 2B0MA 3UWQA 3OYXA 4WKAA 4ML4A 2EJ1A 1X39A 2QCDA 1ZLPA 4NVTA 2VD9A 1KBIA 3EKZA 1JYXA 2VDGA 3DERA 1Z89A 2AMXA 4RE2A 2A21A 2XH4A 1WAUA 4H6RA 1DHKA 4ZO8A 1E6PA 2WSYA 4AY8A 4XZWA 5CGMA 3BANA 1M9HA 5D2YA 1UMLA 3W2KA 3MU7A 5AY7A 2QPSA 5EYWA 2JKEA 1R5YA 3ZYZA 1TWIA 2P0IA 3T55A 2RJGA 5DRIA 3W1NA 1D9EA 3STEA 4JTEA 4LU0A 3LN3A 3NQ2A 3MUCA 2B7QA 3KCLA 3VNKA 3WLJA 3O15A 5LHFA 3QPEA 1US2A 2JKAA 3QC0A 1BD0A 4GXPA 5A8OA 3QR0A 1XH1A 4ADTA 1JZ5A 3ZOAA 2R8WA 5FI8A 1UWIA 1TMLA 1NJJA 5BW6A 2AKMA 2XN0A 3SCNA 4Q3MA 4MFDA 3P84A 4HA4A 1JF6A 4LY8A 1OSEA 4EXAA 1VFOA 4BQ2A 2OZTA 4RDYA 1E5NA 4NNBA 4RXGA 4RL3A 4J3XA 2V3DA 2QJMA 3S2LA 3RPTA 1OCBA 3HF3A 1KFEA 2ZUWA 4IQEA 2WOQA 3EPMA 4JIHA 4IUOA 3GU1A 3GU9A 3PHAA 2Z1XA 2PRMA 2R14A 4FIQA 4GZIA 4HVXA 3GK0A 1J6PA 4G1KA 2Q01A 3V7PA 4DB7A 1OM0A 3P5ZA 4YWSA 4GE8A 3KVMA 2V9DA 4B5SA 4CGTA 3KW3A 3XIMA 4DWSA 1PWLA 1VCVA 1JAKA 1S5VA 3BAXA 2OG9A 1VKFA 3MCOA 4FOUA 2DZAA 4M24A 4C1NB 4JZ5A 1W1ZA 3PK7A 3WH6A 4W5UA 5HWNA 2XFFA 3AIUA 1KWGA 3TN3A 1ZBKA 3AMCA 4Q4KA 3SZ8A 1Q7ZA 5LSMA 1VBHA 1JDAA 1ISVA 3SJNA 1HVQA 1B3XA 1NWUA 4F0RA 3TJXA 2ZX8A 1ZCOA 4HPNA 4F0HA 3TUUA 5EFDA 4QJ1A 4M6PA 3VGBA 2CXEA 3VGGA 3I7QA 2PLKA 4IGSA 2C7FA 4GX8A 3TC6A 3C2FA 1ADOA 4O1CA 2V6AA 1XCFA 3PZIA 1M7JA 1VAHA 4L4MA 4ZXOA 5DT5A 1NTHA 1H7RA 1BAGA 2IMRA 2W92A 5I09A 1OGBA 1FP8A 3VIPA 2QCHA 4XKMA 3MI6A 1Y65A 2QCDB 1W0MA 5HJLA 1LOQA 2R24A 4J3VA 4ADUA 1UR9A 2WWCA 3DGBA 3NIYA 3W73A 2EPKX 1FRBA 1KR1A 3V5FA 3GNOA 4LV4A 1W1PA 3FHQA 1W3NA 3N15A 3PJXA 5I6SA 2A0NA 2H9AA 2AOSA 2Z6IA 4KCTA 3CUIA 3KRZA 1XIFA 3S5YA 4B9ZA 3DIPA 4IG2B 3JVAA 5TF0A 3TN6A 4AWUA 1SFSA 1TVNA 3CZLA 5G2HA 5FKYA 3L4TA 5A8MA 4O15A 5C0QA 1M7OA 1YPFA 4DY1A 3NPXA 4K7YA 1ZTVA 2J4GA 3HJZA 3PTQA 1ZJAA 1KNWA 3PN8A 1HJXA 3WLNA 1JUBA 1N82A 1PPIA 5AHMA 4Q8NA 4GH1A 3V5CA 4XTDA 3IV3A 1QI0A 1UASA 2C1GA 1EGZA 1OG6A 1V6TA 1PKMA 3QY7A 4EXBA 4D8AA 2PC8A 3E5PA 3RX4A 3EOOA 5I0DA 5EBUA 2YL8A 1QI5A 1QNQA 3SUUA 3EDFA 4DX3A 2QUMA 3BLPX 2P76A 1CX9A 5GVJA 3MQTA 1POKA 5U7SA 4FO4A 4P8XA 3D0CA 2X1IA 3SFWA 3W7PA 4DO5A 2HZGA 2NX3A 3NPWA 1IGWA 1GOIA 5D09A 3I65A 3UVIA 5J5DA 1BG9A 3CAVA 4AZCA 4NSBA 1QI4A 4R9OA 1UQZA 2HXTA 3AZRA 3CLWA 1RD5A 4OUEA 2RDTA 3IJLA 3H7UA 3TSMA 2A1YA 4ZBCA 4W86A 4JX5A 3W6MA 3UJRA 1KFJA 3CTTA 2BV9A 3VIHA 2D1ZA 2V38A 1YNQA 3SECA 3M41A 1RJRA 4MUPA 2O55A 3KTXA 4G1NA 4P7OA 2WZHA 3HG2A 4NXSA 4U33A 5CPTA 1YXCA 3TTQA 1UD2A 2QF8A 4A3YA 2Y7FA 3LHZA 3QMRA 1OFEA 2QUUA 4JL2A 1WV2A 1HVXA 3UVAA 4V2XA 3HPFA 3IUHA 1H63A 2FB3A 2WQPA 2DUAA 3T0DA 5E09A 5GNZA 3LK6A 3UA3A 3LNPA 4AZIA 3ZJKA 4QLKA 1I60A 1LBMA 2WBGA 1B4KA 5F2GA 1ONWA 2VX6A 1E6XM 3WELA 2QCLA 1DTUA 5LXEA 1IF2A 4HZ8A 4AZGA 2TRSA 1JL8A 3KHDA 1R3RA 1DWIM 2YPIA 5GQBA 2VR2A 2ZZ3A 5CBIA 2ISFA 2NUYA 3TYUA 3W1AA 3RRAA 3S9IA 3T40A 4ZQRA 2AL2A 4HCHA 5REQB 3EOUA 3ZJ8A 4HNTA 3WH9A 1MMFA 3GG7A 3U57A 1KM4A 2CKSA 1FCBA 2YJQA 1YTDA 1O68A 3QMSA 3FJLA 6XIAA 4GABA 3A4WA 3JR2A 3IAPA 2IQDA 2EPLX 3WL1A 3POHA 4C6QA 1QATA 3W1TA 3V1HA 4HMNA 3HU7A 4K6AA 4QAWA 4CNOA 1C92A 3ECQA 3VKKA 3ARYA 3W86A 2YB1A 3SY1A 2OELA 3E12A 3MUIA 1L6YA 3K13A 2J9ZA 2OGJA 1M41A 3T2PA 2E67A 1CDGA 3V0UA 3NL5A 3IVTA 2QT3A 1ITQA 2QS8A 4YS1A 3TEVA 2AGKA 3PFRA 1DTNA 1FWDC 3UGRA 1EF3A 3VNLA 4AB4A 4D6GA 3OYZA 2P8BA 3IJ8A 5AZ0A 2YR1A 4HK7A 1VEOA 4UQ9A 3TWAA 3OBEA 3MUAA 4Z1BA 3F4DA 1X7FA 1UKOA 2DGAA 5H8PA 4AEOA 5HMSA 4GIRA 2FZ8A 4BEUA 2E1WA 1EHAA 2J6XA 1CI1A 2OQHA 1K9TA 4WOZA 4GJ1A 3UR5A 4BHYA 5J8LA 4HMEA 1R3QA 4HT3A 4ZO9A 4L56A 3LTSA 3IJ7A 1XH0A 4FXJA 4QP0A 3T9PA 3PAJA 3WQPA 3VVGA 1OK4A 1QW7A 3GTHA 1C7SA 2FZMA 1WE5A 4QITA 4WIWA 2QCMA 1O4UA 3QHOA 4LVAA 1H3GA 1HG3A 3RLGA 3BMVA 2QUVA 2P1FA 2WVVB 1KCLA 3G1FA 2W5FA 1S2CA 4GQ0A 4QQ3A 3NL3A 4H7CA 8XIMA 1PIGA 1KRAC 1FFRA 3PPGA 3U2ZA 4ZL1A 1NFBA 4L5ZA 2INZA 5LHEA 1LG1A 4W85A 1SW7A 1NEYA 2XSBA 3VD4A 1F7BA 3HGSA 3C0SA 2FB2A 4UQCA 1MZHA 1WDDA 1KV5A 2H9AB 2A3CA 1MEWA 1QXLA 4WDUA 3U7VA 1P0EA 4GI6A 4GUFA 4HMDA 1JI2A 1VYSX 3SCQA 1E6QM 3UJ2A 5DQPA 2G3MA 4PBGA 3LRKA 4WJEA 3W83A 5FCZA 1HKIA 3I6EA 3U2OA 4PUUA 3AI0A 3N9SA 3H2NA 4WRHA 2R9RA 3QH2A 5ECUA 1GHSA 3CHVA 3GHSA 1G69A 2G8ZA 1GWJA 4XZBA 4POCA 1TPVA 2YA0A 3S1XA 1J5TA 1RQBA 2QVHA 1KRMA 4H3DA 4B3LA 4J3ZA 4IUGA 1IHIA 5M03A 5CAKA 3EB4A 2GPTA 4P8UA 1MFUA 1TKKA 1N8WA 3UPMA 3LOTA 3LM3A 2FIQA 3LCHA 3W7OA 5D37A 1R38A 4LCRA 3WFLA 1W54A 2VQUA 1CGUA 2YGYA 7ODCA 1QCWA 3N1AA 3BOXA 3TC7A 5CSRA 1K8YA 2GYIA 1K4HA 3QFEA 1NWSA 2JIEA 5TAOA 1IQ8A 1F6YA 1SZRA 1QHPA 4QS5A 5D2VA 4JQ1A 5FJIA 5C9WA 1H5YA 4IL0A 1BFNA 4D1JA 2HDJA 1E6RA 3EXSA 1G1YA 3LYEA 1I4NA 2SFPA 1OFQA 3LQGA 2D2GA 1TWWA 1E3XA 4PCFA 2QXWA 2PF0A 3LA4A 4L1GA 1RALA 4J40A 3R2GA 4X60A 2PAJA 1G7VA 3KDOA 3TA6A 1GZGA 3QZAA 4Z2JA 2XVPA 5JH1A 5CBBA 2B81A 5CJNA 1TYGA 2VQTA 3TTSA 1OHLA 2QAPA 4BCEA 1W1A1 3QQWA 1O12A 3VM7A 1Y5WA 3M46A 1MQRA 4ERAA 2I56A 3C4UA 3ITTA 5AC8A 3W7NA 4PMVA 3GDTA 4JTJA 5AC5A 1UD3A 4HN4A 3VXGA 2VL4A 1CLXA 3OZYA 3SN4A 2Y5JA 3VIGA 3WQ4A 4ZE4A 4JTLA 3QR1A 3ABZA 1DORA 3T42A 1UC4A 3NQ6A 1IIGA 3GTIA 1GONA 1E51A 3AYSA 1KFCA 1XISA 1KXVA 1QW8A 4YYCA 3BXWA 1A5MC 3S4TA 2QR6A 3SR7A 3UNDA 3DFSA 5EKYA 3VGEA 4V28A 4LX4A 2WNZA 4M80A 3BLIA 3P8IA 2BHUA 4Z2LA 2E9LA 3B4UA 3PULA 4EVZA 3VGHA 1UYQA 2XSAA 4F3HA 2OWXA 3LTYA 3UY7A 4O0ZA 5FJOA 5JBDA 4UQEA 2CC0A 3MWAA 2AAAA 3TV8A 1W2VA 3TQKA 1IEXA 5JU6A 2BXZA 2YDQA 4EANA 2VNCA 4A3UA 4GBDA 4UXDA 2YCEA 2YCKX 1F6PA 3VI2A 3T8QA 2J6VA 3VKAA 1ESWA 2KX9A 3WBXA 1DXFA 4MYAA 3QPZA 5LIYX 1LLOA 4H2CA 5XINA 1EIXA 4AYGA 1V77A 5DX7A 3W07A 1AQHA 1IV8A 2WSKA 1ALDA 4HJFA 4NZ1A 3THAA 1YTEA 3FYYA 2DZWA 4NHVA 8XIAA 1WDRA 1XQLA 3USZA 5ABTA 3CB3A 1UD4A 3BVJA 4GVGA 3UWEA 3QHNA 2WW5A 4QJ5B 1ONRA 1TV5A 2Q09A 1JD9A 4JY9A 1LUCA 2I5GA 4IPIA 3GYEA 4QSHA 1BQCA 4W88A 1A53A 1AL8A 1MW2A 1DJWA 3H4WA 4HYWA 2BLEA 1EA0A 2HJPA 3OVGA 4E4PA 3DFTA 4NZ5A 2WSRA 1JAEA 1E1EA 1SJDA 4C7DA 1MW1A 4NZFA 2IPJA 4DO4A 4OVXA 4Q8UA 1X6LA 1XYZA 1PX8A 4GZJA 4IIHA 3A4AA 3W26A 4J7RA 4IIDA 4U5IA 1XLHA 3HG5A 3ZZ1A 4LRTA 3KOZA 4BQ4A 2W62A 1UP0A 3N2OA 5MHBA 3O2LA 5H8MA 3UG4A 5BXTA 1TV7A 2PDLA 3UZWA 4IICA 1J2WA 4PZVA 2E6YA 1NFGA 1TVPA 3PBMA 3VNDA 4NI8A 2YDRA 5K9XA 3SRFA 4HCDA 1EWEA 2O4MA 5AHEA 4O19A 1MVYA 2R1NA 3T81A 2CITA 4Q8TA 1PUDA 2PPGA 1HW6A 5G1YA 5LKYA 3MANA 3P14A 4EKJA 3NXFA 2Z24A 4DIAA 1WAWA 1B1YA 4OOUA 4NP7A 2WO5A 2VTFA 1XPGA 3IIVA 5E6YA 1A5KC 1W3HA 2RFGA 4HTYA 1VRXA 4Y9PA 3UXIA 3VE7A 1HJSA 1I45A 3WFAA 2PTYA 5BWFA 1Z32X 5LNRA 1SZFA 3E0VA 3VIFA 4DYJA 4NX5A 4KCVA 3C56A 4DAIA 4MJ4A 3VDHA 3KCOA 3USBA 2YBVA 3OHIA 3IACA 5DCDA 1J10A 5BROA 4DPQA 3I7RA 3TYDA 3C0JA 3DU0A 3AROA 2Y1HA 1QWKA 1QW9A 1Q6CA 1LTDA 4XZMX 2Y4SA 3B04A 1UR4A 2E1DA 4GVFA 3UZZA 4R34A 3NG3A 2VP8A 2Y0FA 4GZEA 1EQPA 3TFCA 1PTDA 3APGA 3NM3A 4S23A 2EO7A 1GQNA 1DJNA 4RR4A 1FP9A 5I79A 3ZT6A 1EP2A 3BZGA 3KVLA 2VZVA 1E1CB 1SZEA 4K7VA 2BOFX 4F9JA 4LAZA 3M0XA 2ZKMX 1R47A 1TREA 1OT2A 4JDBA 4R27A 1VGAA 2BHZA 2E09A 3GH4A 3GXFA 4N02A 4C6PA 3MVIA 1R30A 4H04A 1OCQA 2GK1A 5KINA 1H1NA 4UTIA 1TQXA 4HNVA 4HPJA 4AY1A 2CLFA 4AWEA 3O6CA 1XICA 1IWAA 4GA8A 4XD5A 3PC0A 3CZGA 3LBMA 4HBKA 3QR3A 2X1TA 1BXCA 1K03A 1LJYA 2OX1A 2E6DA 2OSYA 3AIRA 3VU2A 4UNKA 3KP0A 5BOEA 2C16A 3PSWA 3DGRA 5FEZA 1O5QA 1ICPA 3KWSA 3VKBA 5I03A 4MKSA 3H7VA 1CLKA 4US6A 4WUIA 5U4NA 1C8YA 4QG8A 5MKGB 4FA3A 4PUMA 3N18A 1F05A 2BVYA 4HNUA 1EC7A 1VJSA 3AHVA 3TCEA 3M5XA 1XS2A 4PC8A 1TWZA 3M0LA 4NZJA 4IGNA 4DHGA 5HMDA 2WMJA 3LERA 1AQ0A 4YVXA 4F0LA 3OJGA 3OHMB 4KBXA 4B90A 2ZC1A 1OT1A 2EEXA 4KIRA 1RK6A 5CZKA 2A3AA 2QMKA 1GVRA 4C6EA 3WNNA 2J7HA 3GIQA 5ABGA 3UXLA 3AMKA 1WP6A 1H4PA 2CU0A 3NVTA 1C90A 2NQZA 3BCJA 3WG6A 1MNZA 1PZ2A 5EFFA 1JG9A 2YBTA 1WBJA 2B31A 2HMCA 2VWSA 3SCWA 4YU1A 4RNHA 5XIAA 1EP3A 4QG6A 3UZJA 3LDVA 2ONEA 4YTQA 4JKLA 1E70M 2Q3OA 1C9WA 5HXMA 1QWGA 4RE0A 3MSGA 3F2CA 4JN6A 2E68A 1WB0A 3TTEA 3G1AA 2D2OA 1E5JA 1MSSA 2OOGA 1Q6LA 3AO0A 3EPOA 3TSDA 3TZFA 3NSXA 5CZJA 1WPCA 3XISA 1BYBA 4QS6A 1VPXA 3WD3A 3A6OA 1CGVA 1TJ1A 4ZOEA 3G1RA 2OT0A 1GW1A 4MWAC 2DU2A 4XUGA 4Z0SA 3WD1A 3N11A 4MB1A 2Z2BA 4XZNX 1ECEA 2XM2A 1E0UA 3M16A 2WQDA 3VM5A 3I3EA 3TX9A 4GPNA 4LALA 1FWNA 5BRBA 3WH5A 2CBVA 3GXPA 3SCOA 1DJYA 2XH0A 3CUXA 3ITLA 2J74A 3W1RA 4F8XA 1S2AA 2CBIA 1XW8A 3WX7A 5K9CA 3DG3A 1V0MA 5M3WA 4PUKA 3AMGA 4H9YA 4PFHA 1XDMA 4IH3A 3WJWA 3GM8A 5GPRA 1MI3A 5HR7A 1CXEA 3GO2A 1GOQA 2I5IA 1QO2A 3BC9A 1KTBA 4E5TA 2DJLA 2CETA 3QW3A 1YXYA 2FQIA 3ZR4A 1TPH1 3GHTA 4WF7A 1OY0A 1VENA 4W84A 4FX7A 1X6UA 5C2GA 4HCLA 4LBSA 1LOSA 1ZJHA 2J27A 3CUZA 2OCZA 1NVMA 4AHPA 1X96A 3DYOA 2G4JA 1DOSA 2C15A 3MWCA 5I5RA 5A6SA 1CXFA 2DW6A 4S3CA 4TO8A 2A2IA 2Z4GA 3V16A 4QJ4B 2P88A 1LZOA 1KBLA 2OYKA 1EA9C 4LUTA 3EKGA 4KW2A 3NZQA 5F1UA 3OGSA 1W37A 1S5MA 2BDQA 4H6KA 5A6AA 4M8UA 3V18A 3VDBA 2YZRA 4JBRA 1D8WA 3SQLA 5G1MA 4O8AA 3VX0A 2DIEA 4FP1A 2CZ5A 4OV9A 4QE5A 4QFUA 2VC9A 4YCOA 3TJIA 1XLEA 1KGWA 1RZMA 3K8LA 4IP4A 3RLVA 2QV5A 1Y5XA 5IHRA 3N6QA 4QG9A 4L80A 3WNOA 3KBWA 3WN6A 1DWAM 3VMOA 3TR9A 2ZRXA 1ZGDA 4LBUA 4Q8MA 2UZ9A 4QAIA 4CCZA 4H1ZA 4UC5A 3EDDA 4HZMA 3GNRA 4CNTA 4ZENA 4AX6A 6ALDA 1TO3A 2VWTA 2W67A 1JGIA 1V93A 3F4VA 3GG8A 2VCBA 4E8DA 5H8UA 4PRWA 1WUFA 1R8LA 3LLFA 3MO7A 1T99A 1E9LA 5H2ZA 5CQ1A 3I4KA 3ITGA 1Q7MA 2X8RA 2HS8A 3CV2A 4J3WA 3W22A 2VC7A 4GQRA 1Z41A 3B40A 5T91A 4MNLA 3BJFA 3H2FA 3YPIA 2KZHA 4CU8A 3E96A 4GY0A 2DPEA 3G0XA 2PUZA 4GJJA 2FZDA 1UJQA 3VCRA 3GDRA 2YXXA 4FX6M 4MDPA 1GHRA 1NF0A 1XPYA 1GNXA 1R3WA 4XWUA 4DUWA 1OBAA 3QV7A 1JCLA 3IAQA 2OKTA 2QCFA 1Q6FA 3MA8A 5REQA 1FWWA 4PGLA 2RKXA 5HATA 3G6LA 5T9BG 4W5ZA 4A22A 1ITCA 2D2JA 2BODX 1SQ7A 4CU7A 4WSJA 4A8RA 4WJ8A 2CIPA 2VCCA 1VYPX 4KF1A 3FXGA 3KS6A 4O1DA 4Q7BA 2DORA 4DI8A 5C2XA 1YIXA 4EX4A 3SQSA 2VX7A 3EGJA 1F2JA 1UD5A 3UFYA 2PDIA 4C1NA 1GJPA 4PL1A 1Z9AA 2WBKA 3LGDA 1NAL1 3SDOA 4KWUA 3IJDA 1DHPA 3VDGA 2E5CA 3E38A 2NX1A 3SEPA 4PFMA 1V6XA 4DZHA 4WY0A 2PF8A 2ZQ0A 4D8ZA 1OD0A 3WQOA 3L7RA 1OZMA 2XGBA 3V5OA 3FYPA 1WKDA 3P67A 4MKNA 1VRDA 3UU0A 3N3TA 3MP3A 5JXQA 1B9ZA 3CZ8A 3RN6A 2X16A 1V7YA 1LT8A 2B7NA 4QLJA 1XRSA 4O50A 4C5ZA 1GTHA 4XSLA 4P8WA 1RHCA 4ZE5A 1P0DA 3PPFA 4NAEA 3VPLA 4KRUA 2DDXA 3MMTA 4BS0A 2NX9A 1UUQA 1ZP4A 4QCFA 2X41A 1EJSC 2CYGA 1YBQA 2IXVA 4HHHA 4ILSA 4Q8PA 4ZQCA 4NUWA 4WEVX 2Y5SA 3VNZA 1PAMA 1XLCA 5M17A 4US5A 3PBYA 3CIWA 1FDYA 1P6BA 1VHCA 3GAYA 1TZ9A 4CCEA 4KFNA 1UPMB 3FXYA 5EMYA 2PCQA 2HVOA 3W53A 1SFTA 3VX1A 2F9RA 3UG3A 1PWMA 2VDIA 1JZ6A 1AW2A 1GW9A 2ZXAA 3FJ6A 1LP6A 1XYAA 2Q8XA 4C5YA 3CIVA 1PVNA 1XYMA 3DKLA 4TMBA 5BNKA 2C14A 2Z26A 1M1BA 3APTA 5LNWA 5FL0A 4C6KA 4DAFA 5J04A 4Z1YA 1OG0A 3WUGA 2R91A 1XD0A 4U3CA 3K30A 3BMWA 3UP8A 4O12A 3CWNA 3RIKA 3G1XA 4IISA 1LLZA 3AJ7A 3OTRA 2PCEA 3DDMA 1JCMP 4UTTA 8CGTA 3M7WA 4GNVA 3LEPA 2OQLA 1KTNA 2I9EA 4J5NA 1QMLA 5LIWX 2VZUA 3H4XA 3ABXA 3LSCA 1Q66A 5EGRA 2ZRYA 3HGRA 1BRLA 1JI1A 4I9AA 4NRSA 5A2CA 4U28A 1EYWA 1XQKA 2OZ0A 4PH6A 2QF7A 4O17A 2PDFA 3LPGA 4RW3A 3G0UA 3BSHA 1JCYA 4S3DA 5BZAA 1XR2A 1YNYA 2D20A 3UXKA 2WVUA 2PLCA 2HE5A 3ARWA 4JOMA 5IHSA 1M68A 2OPJA 3BQ5A 5HUPA 3OZOA 2WANA 7XIMA 4YTUA 1OIMA 1NOWA 1YE4A 3G8RA 3CQJA 3S5SA 5C9ZA 4KRZA 3H6OA 4W87A 2GJXB 1K77A 4XD3A 2NVCA 3CZEA 3GSMA 4B91A 3UCDA 3VC6A 2FGZA 3WQ8A 3ONBA 3LPPA 1FXPA 2GDVA 1ZBCA 3FV9A 3IWPA 4PCNA 3MSYA 1ICQA 4UCFA 3V36A 4M6VA 3VNYA 3LHUA 4YWIA 3RHGA 1LT7A 1JRCA 1UKQA 4O18A 1JUEA 1QJWA 3DZ1A 4EP8C 1AG1O 1PBGA 4DBUA 3B97A 3MP4A 1MO0A 1LCOA 1QPNA 3QRHA 3P0WA 1KKRA 5H91A 2VC5A 4ZOCA 4JTAA 3B8TA 2WZEA 3BWWA 4FNRA 1PX3A 1L6GA 4Q8WA 1SO6A 1IXOA 4HK6A 4M1RA 1I2RA 1V7AA 2J25A 4H8HA 2ZIDA 1E0XA 4DWSD 1QI2A 2IUZA 4RXFA 3MCMA 2RDXA 3HBLA 1AZ2A 3Q65A 7REQB 3QZEA 4UTHA 4GVIA 1B3ZA 2VUYA 1GPFA 4UZSA 3OB8A 2F6XA 2ZTJA 4UTMA 1SMDA 3RCMA 3GC5A 1Q6RA 4N9EA 1OC5A 3I10A 4PEEA 5CJMA 3HZ3A 1S2WA 1I1XA 4C6OA 1EEXA 4XX6A 3G77A 1WXZA 1XIGA 7CGTA 3PF3A 4US5D 4ZQMA 4O10A 3T6CA 3W6LA 4HU8A 4WJXA 2HSAA 3QXBA 2VJXA 3B06A 2J8TA 3TH6A 2NQHA 4RPPA 1ZY9A 5IOBA 2DH3A 1XKYA 3TKFA 1XIIA 3PNUA 2PWVA 1DJHA 2WC4A 2FGBA 3B4YA 3KHJA 2YYTA 3MT1A 3FEQA 3CHEA 2JQXA 3J7HA 4X63A 1CCWB 1R7AA 4I7UA 3PG8A 1EH9A 4J35A 1M5WA 2YSWA 3GH7A 4CNNA 5FSEC 1XSKA 3MSDA 5E0CA 4KETA 6PTDA 2PDYA 5HAOA 1CXLA 3AHTA 2X0SA 2GVJA 3WLQA 1UWTA 2WNQA 4ERGA 2OYLA 4JHOA 1JPKA 2UY4A 3CIXA 1SW0A 1ZAHA 2PDBA 1IXNA 4JICA 3GDBA 5EPDA 1XIDA 1E9ZB 1EKOA 2WVVA 3PUDA 4JCLA 1ISZA 2DQXA 4IMGA 1EWDA 1A47A 1UPPA 1FOBA 4M7TA 4HK5A 1UP3A 2ACUA 2TPSA 4QIUA 1CPUA 2Y8VA 5BU9A 4J3UA 3QFWA 4F2UA 3GHRA 5C6MA 4JEQA 4QBXA 3GKFA 1WKEA 3GZAA 1VFUA 2EF9A 3TJ4A 2ZRUA 1SR0A 5JUVA 2WLYA 3WQWA 2EQDA 2QVNA 1UA3A 1GQLA 3LSBA 2I17A 2ZFAA 3EMZA 5HMEA 1V02A 1MRAA 2JALA 3ZLGA 3KRBA 3AXKA 3ZWTA 2CLPA 2YFNA 3LCXA 3CUFA 3NJ3A 1QDSA 1GPWA 3DC8A 2V3EA 3TQ0A 5FJUA 1TCMA 3SCUA 4A3RA 3BMXA 3HV8A 3W1LA 1E4IA 4KWWA 2Y6ZA 3REQA 5DXYA 4PUNA 3GWQA 5XIMA 2VVNA 4JFWA 4MHBA 3NWRA 2ISSA 4HGXA 3HTWA 3W7QA 1G67A 2DV0A 2PWUA 1QOPA 4HN8A 5IDIA 3B9EA 3AYTA 2YL5A 4Y9NA 3JW7A 1XP3A 1PHQA 3GE7A 4H01A 4A2SA 1TPDA 2VGGA 3OBKA 2QIWA 3R8HA 4JAWA 3QM3A 1EF2A 2BB0A 4RLIA 3H26A 4V15A 4E3TA 4INFA 3VOJA 1K70A 1TCDA 1H1ZA 3SRDA 1NDYA 1MFVA 2AKZA 1TX0A 4IJBA 1BPLB 2Y7DA 1PE1A 1PL9A 1B57A 4NKCA 3SI9A 1D3GA 3UF9A 4LAOA 2O0TA 4NJKA 3Q58A 1S46A 3S1VA 1R2RA 2VRQA 3UD6A 1DP0A 5CC3A 3S5ZA 2GDQA 2WB5A 1KLZA 3SFKA 4MJMA 1EX1A 1NP2A 5JIWA 2XVGA 2HE8A 1RR2A 3M64A 1QO5A 3UERA 2YZ5A 3KEHA 4UOJA 1SM9A 1RY8A 2WMIA 3AS2A 3RU6A 1Q7QA 1GT8A 3RX3A 4QEEA 3B9OA 1GUVA 2ZRWA 3PZUA 2X1RA 3HFYA 3M5VA 4G7EA 1RCXB 4WDXA 3FVDA 2CHOA 5AC7A 4A21A 3B05A 3GC2A 1J18A 3MHGA 1BYDA 3KTSA 3AYRA 4ONVA 3UJSA 3EYPA 3QLDA 1BGGA 2ZZ2A 3WQVA 1UD6A 4MWAE 4QM1A 4XBSA 2REQA 3ZFHA 4QRNA 3TOPA 4IFRA 4GYPA 1V3LA 4TQTA 1ADSA 1JPHA 1FQ0A 3MY9A 1XIJA 1EIBA 3V75A 3PZOA 3W1QA 5D8ZA 2PRLA 2W91A 5LIXX 2PDJA 4MB4A 2F7FA 4MADA 1S3HA 2G95A 3NOYA 4LF2A 4IJCA 2RJHA 1HUVA 2NQ5A 4MB5A 3NQGA 1QNOA 4ZQPA 4AMAA 1I2QA 5EMLA 2A3BA 2PTZA 1K8XA 4DZ5A 3NQ7A 5CPMA 3U48A 3L67A 4LNCA 5E1QA 2DT0A 2ABAA 2V81A 1LWIA 1B5TA 1VZWA 2FGLA 4QNWA 4E4FA 2YCLA 3RRXA 2O4QA 2BGQA 4JX6A 3F5JA 1VJIA 5FA5A 4M7SA 1V0NA 3O0KA 3CLMA 2GVEA 2WC3A 1I9CB 3A3XA 3W7MA 2YL9A 1ZALA 1NP0A 3ABSA 2ZDRA 4GIAA 4RZBA 3LRMA 3N2TA 4JTCA 2E8YA 3MC5A 4GISA 4H8NA 3MVTA 1WCGA 1I0BA 2NWSA 3ARZA 5FEXA 7PTDA 1KM5A 3G1HA 4ZVJA 3C86A 3SURA 4O54A 4JFTA 3DAQA 4J2PA 4PB5A 4PN2A 3MYPA 6TAAA 4DWSC 4LXFA 4CCCA 3I6TA 4I8YA 2O7QA 4RKAA 4RV8A 3A4XA 1XYLA 1GKPA 5A2BA 3VA8A 3AJXA 1L6WA 1M7PA 1OX4A 3CZKA 1H41A 3FHAA 4B9YA 4WXZA 1TA3A 4V1XA 2XSXA 2V3GA 2J7GA 3M0HA 5I3DA 3H7RA 1GYNA 4AZCB 3DBNA 3MDUA 2PURA 3LPFA 3WNKA 1PCWA 3KZPA 2X40A 4CNUA 1E43A 4F79A 3IJIA 3GNDA 4IIBA 1XI3A 3WK0A 4IHCA 4GY7A 5BXSA 4P5UA 4F0SA 1F76A 2QULA 1JFHA 3N19B 3IRDA 2VEIA 3IEBA 1QNVA 3G22A 3UGVA 2FZBA 1BVZA 1DWHM 4IMAA 1EO5A 4CD4A 1D3CA 4W9TA 5AYBA 2G50A 1SFLA 4GFSA 1UKSA 3W6YA 3EA3A 2VOTA 4A2RA 4B2DD 4LUSB 1JPIA 2F61A 2PS2A 4MIMA 4Q6XA 1WBHA 3S2CA 4D8LA 4FX8A 1WDSA 4FOKA 2J7DA 1SJAA 1UWAA 3LHTA 3QY8A 2FVMA 4LUTB 3WF1A 1DV7A 5HQMA 4A3QA 3WQFA 3LBCA 3L4VA 2C1IA 4LUIA 2VC6A 5LGZA 3W7JA 3CV7A 4GK8A 2XFYA 4O28A 1HNYA 3Q4DA 3FA4A 2V3FA 1V8EA 5CGQA 3BG3A 4LPCA 2VFIA 4L1XA 5BMXA 1JPDX 2CLMA 3STFA 3S83A 2XWEA 2NQ9A 1M6JA 1A80A 2JGYA 2ODOA 3L12A 2V2CA 3LMYA 2X2YA 1C8QA 2FPVA 3N4EA 2VENA 3P6LA 3UZYA 1CGWA 4PODA 4Q4PA 2CHNA 2OEJA 2NQJA 3WLOA 3SN1A 4BI7A 4UMBA 4X2RA 4BZYA 4FZIA 1NDVA 3W75A 4EWND 4K68A 5K2ZA 1ITUA 1W9UA 2IKHA 3EWYA 2J75A 1A5AA 1VJZA 5D9OA 4G9PA 1MDRA 4LJ3A 2V5CA 5TD4A 1OGSA 4GRSA 2INEA 2Q3RA 4M1BA 1KR0A 1RH9A 4LWWA 7REQA 2XIQA 4HPXA 1U2YA 2WCGA 6XIMA 1RQHA 5FD0A 4C6CA 1Q6DA 3JZUA 4PCTA 4XQ6A 4ERIA 3VUPA 3GKAA 3WNPA 4C6JA 1CECA 2CPUA 2OQYA 2DZXA 3F7JA 1O5RA 1V6UA 2PGRA 4A4AA 1WZAA 4HIBA 3EBVA 2ZXDA 4O11A 4ECLA 3EWCA 1XLAA 2HS6A 1LBFA 3RM4A 1WNOA 4V1YA 5KZDA 1V0KA 4GNKB 3AIWA 2R1LA 4OWGA 5DMMA 2VRKA 4PMRA 1GG0A 1Z3NA 3BAIA 4XAPA 1UWQA 4L4OA 4PTNA 3VNIA 4UUIA 4H00A 2GQ8A 1EHNA 3CBWA 1XYBA 1TG7A 1C9DA 1ZFJA 3UPBA 4JPGA 1U83A 1XYFA 5CZSA 3W01A 2AQWA 3KZSA 3C2OA 2ZA3A 2FVLA 3BARA 2E5DA 1P5BA 2WZMA 4R85A 3CPGA 1YDNA 5BU6A 3E0LA 4E8GA 4XV0A 1FX6A 2PP1A 1G4TA 1BTCA 5HPOA 1FXQA 4Y9OA 4AZ5A 3CB8A 4GINA 3URNA 2NV2A 3ITOA 1J11A 3CT2A 3H55A 4MSSA 5HJXA 1AQFA 1VD6A 3M07A 1UA7A 3CMFA 4JNYA 1LQAA 1KTCA 2QUNA 4GLEA 3ZJ6A 1K9EA 4RZ5A 4BKNA 3GR7A 3GVQA 4CQAA 1I6NA 3ONCA 1AH0A 2IW0A 4K1GA 4YL2A 4NAFB 4RJEA 3LTPA 5FACA 3TVAA 4UMCA 3QV6A 3CO4A 3EWZA 3LCFA 3RXZA 1KW1A 2F2KA 2DSZA 4IG2A 4ENLA 2WKGA 3OOQA 4P61A 3W76A 4TR9A 1SGJA 5HUOA 4F40A 3TONA 4RDWA 3O16A 1N8FA 4L6DA 5A6LA 4M5PA 5C7HA 3KBSA 2GOKA 1WZLA 3SADA 4YTSA 2XGIA 4H9TA 3THCA 4AC7C 2BVWA 3K8KA 1V51A 2H6RA 1IT8A 1GZ1A 3CZJA 3F4WA 2RDUA 3T4WA 4L9YA 5SWUA 1EJVC 5B7YA 1NH6A 1HIZA 3L4UA 3DHFA 3E74A 1LQ2A 3L5LA 4JKMA 5ABEA 1KCKA 1TRDA 2O9TA 4NL1A 3PANA 4J3TA 4K36A 2DQWA 3N13A 4NIRA 4DLFA 5D38A 4MMWA 5IBXC 1V02E 3HGOA 4AISA 3D5HA 2PD9A 5BWAA 3FS2A 3WLRA 3T7VA 2WZTA 2QHAA 3L5AA 5FSDC 3MDWA 3COTA 3EMCA 3AAMA 2JGQA 3GX9A 2OSXA 1N55A 1DXEA 3POCA 1KCZA 5CPLA 4WSKA 4GC3A 3LY0A 1X6NA 5A6JA 3FGCA 1JUKA 4MUZA 1XIBA 3GRIA 1HL2A 3RU8X 1EJTC 4Y6GA 4XD6A 2QW5A 1XLDA 5HNRA 1KXHA 3MMUA 1PZ0A 1OVDA 1PJ9A 2ZZ7A 4DXVA 5F7UA 2HK0A 5ABFB 1F74A 4HPHA 4KFPA 3HPSA 3L66A 4I7WA 4UTFA 3PFMA 2ZUSA 1XGZA 1WDWA 3NSNA 4OBSA 4XZHA 4E3VA 3BURA 1TPWA 2Y63A 4DO6A 1L6SA 1DWFM 2G3IA 1X1NA 3L23A 3N17A 4IQDA 5CG7A 4PCPA 3VD3A 4X9YA 3VNJA 4FXRA 1IT0A 4YXGA 4J9JA 4N7QA 3BG5A 2ZA2A 1JJKA 3WH7A 1W9BM 1KQYA 4H2HA 2E3ZA 1D3HA 1B90A 1XRTA 2PU0A 1L8PA 3G3DA 2YXGA 1JZ2A 2BXVA 3RPDA 3AWOA 5LIUX 3DEQA 2VZSA 1F3XA 1TQJA 4O4VA 1OC6A 4OTKA 4DJEA 3MS8A 2G37A 4H9XA 1RSCA 4WHBA 2WJFA 3NQEA 4FNPA 1E4NA 4C90A 2P5NA 3E0FA 3V1PA 2X30A 3GIYA 4Y2WA 2WNWA 2HBXA 5EU9A 1Z69A 5DCEA 1LWJA 5GJNA 2P3EA 5CC5A 3NO5A 5A3HA 4KQNA 1F3TA 2ADAA 2E8ZA 1H2JA 2O9RA 5I7GA 1DQWA 4JIPA 3P0XA 3AXMA 2E7FA 3APYA 5CSYA 3R10A 5D2TA 1R46A 3KOXA 4FLQA 4NZCA 4LCQA 4LVDA 3W1UA 2UV8G 3DHUA 2QDEA 3NZ1A 3LG3A 2ZWZA 4QCEA 1CB2A 3PY2A 4NF7A 2DIJA 3CL8A 3PZNA 3UJEA 1GQIA 1VIWA 4O53A 1S2TA 4LUYA 1ZSXA 3V0TA 3QYQA 5HMFA 4BF5A 1I1WA 2I14A 2NW0A 2ZUMA 3HB9A 4FLRA 1J2BA 3G1SA 4S1FA 1RJPA 3EDEA 3LZ5A 3OEXA 3IK2A 4I9MA 4L4LA 2ZRZA 3GDLA 2EKGA 3WUEA 5G2WA 2CBJA 4AHOA 3OQ8A 3SBFA 1DPMA 5B7ZA 1IE7C 1TSIA 3FDGA 1KFKA 2J88A 2Y7GA 4AH7A 4DF0A 2IS7A 5C55A 3UG5A 3B3DA 4JTTA 9CGTA 3FSTA 3LCWA 4DUOA 2C79A 4EAYA 3SSZA 3E3HA 4AWTA 1W9XA 4E4UA 1JCNA 2HWGA 1ECQA 4V33A 3OGRA 3BLDA 4ZA0A 2VX5A 4MWAD 1TV4A 2BFGA 4UFJA 3TXVA 3PBGA 1UROA 4AIBA 2V5DA 3O05A 4Z42C 1GKRA 2IQ0A 3ANYA 3HMJG 4IX2A 1G4SA 4XSMA 4NX0A 3RNDA 5CKSA 3GY1A 1S2UA 4QNEA 5A8NA 3W7IA 4FHAA 1W5PA 3MJYA 3S6TA 9XIAA 1GVYA 4MAZA 8A3HA 4NAEB 3GTFA 3VOCA 2C8NA 4LS0A 2UY5A 2EXOA 5G4HC 3WUBA 2C6QA 1AQMA 3VD7A 4O16A 1C29A 4BI6A 2PE4A 4UR9A 2W6RA 3PUOA 1OYAA 2WMHA 5DRCA 1KXTA 3RGTA 1YDOA 3NQVA 3VOGA 3NL6A 4GXWA 4PMDA 2NXGA 1ZJBA 4IWWA 1Q63A 3A5VA 1TR9A 1EFZA 3U2CA 1CENA 2PDWA 3FLUA 4PRTA 3GTXA 4QR6A 1EGMA 3OPSA 2X42A 2VHLA 2W9MA 3M47A 4LAKA 3MUY1 4CQDA 1C3FA 2GUBA 1I2OA 1BSIA 2CZVA 4LYQA 5AYZA 3TYEA 3NCOA 3LLXA 2YXOA 1UZHA 3XINA 2DEPA 3NQAA 4RE4A 3W7GA 2RGMA 2I57A 5E0FA 3EX2A 2Y70A 3WQDA 2G0WA 4AD0A 3O8AA 1QPRA 2PLJA 2ZOXA 3LV6A 4NILA 5DY2A 1A5UA 3FNDA 1JYNA 3GVRA 3BG9A 4QHRA 4XD4A 3BL3A 2EBNA 3VIIA 4GUJA 4LFYA 1RQEA 2DZVA 4L6OA 3VFCA 3EMQA 4S3EA 1JCXA 3CL6A 4B2DA 4FAMA 4G6CA 3RX2A 3TNOA 4GWEA 3C8NA 3UR7A 1SZNA 3BE7A 3L4YA 3R1ZA 4O8RA 4LW7A 3TYCA 4OKDA 5LXXA 3RG6A 2RGLA 2V63A 1ONEA 4CUCA 1MW3A 3OVRA 4ORIA 3TN4A 3AUOA 5AYXA 2V69A 3OBAA 3KWXA 4S3KA 4CQBA 4IL2A 1G5AA 1QFEA 2OKOA 4PMYA 1GEHA 4XTIA 3U3HA 1XLFA 3WYZA 3IPWA 3RLHA 3PWGA 2VDHA 5LGXA 3A3WA 5K4XA 2ACQA 2WJEA 3AXIA 1M04A 1DXIA 3SUWA 5TNVA 1LG2A 3LPOA 5GNXA 2R82A 3PB2A 4ATWA 4BFAA 2Z2UA 2PWFA 4CU6A 4U31A 2V5LA 2D3NA 3ITXA 2O56A 2V5BA 1GVFA 3FSUA 5PTDA 1SSGA 3AHYA 2W61A 1W3KA 3NZPA 3S2MA 3P60A 3HV9A 4X22A 4PTDA 1SMAA 4WD0A 1NWTA 3S8HA 4N4PA 4LUJA 2NUWA 1UOZA 4F66A 1R2SA 5IDZA 1J9YA 3WDRA 4NJGA 1B3VA 1DJGA 1PKLA 5IFTA 4UQDA 3V4BA 4DJDA 3RJXA 2WVTA 1WYIA 1ISXA 2QJIA 3FCPA 3KRSA 2VGFA 4AFYA 3WK1A 4OUIA 3HG3A 1R0MA 3BK0A 5E9AA 4GYJA 4ROPA 1J12A 1AH3A 3MP5A 1QR7A 3MCNA 2BOEX 3WLLA 2Y8KA 2BSLA 3M0IA 4LBRA 1JDFA 1Q6GA 1RA5A 2BVTA 4MAVA 2PEVA 4B5UA 1R3YA 4FNTA 3N73A 2YYUA 1LLWA 1MUWA 4M81A 1EP1A 4JQ2A 3IGHX 4GYFA 4UFKA 3WY1A 1Q85A 3W81A 2XYLA 3VK5A 3WLKX 1Y5VA 4WCJA 2DJXA 2GLKA 1UP2A 3PJWA 3GVVA 2TMDA 2A6NA 2HXUA 2W63A 4I90A 1SO4A 1Z48A 4B3ZA 1X1OA 3AS0A 1KM2A 4HD5A 1UWUA 5FEWA 4QSFA 1CIUA 1Y7VA 2DT2A 2DZPA 2X2GA 3SAZA 2OO0A 5EB8A 1QT1A 1QNRA 2DSWA 1CBGA 3SRHA 4MZYA 1LL4A 5A1AA 1DIKA 2O92A 3OLDA 4IX0A 3NQDA 3URQA 4LB3A 2XWDA 4AEEA 5LYRA 2I9UA 4QQUA 1UOKA 3G8EA 4FXFA 3DCPA 4PRRA 3SO7A 4D6HA 4KGJA 4JHMA 1CTNA 2F6KA 1QHZA 1EEPA 3Q2DA 1MQPA 1J0KA 1OX6A 1PDZA 1H7XA 2XU2A 2WMKA 2XDFA 1GYMA 2OU4A 1M3UA 1JCTA 2G97A 5A6MA 4IMEA 2XIJA 1R3TA 1YYAA 1GVIA 4GI8A 4ICMA 1GOXA 4S3JA 3FDKA 1LROA 4ATDA 3ZS4A 3QV8A 1BWLA 5JMUA 3DI1A 5HNTA 1L9WA 1O1HA 1Q6OA 1QK2A 1N2VA 2DZSA 1BHGA 2VEFA 5GJPA 1TJ0A 1KFLA 3WH8A 1EJXC 1RJQA 5DELA 3SCSA 2WJZA 3BLOA 5BRQA 4PCSA 3NURA 4IPPA 4JNZA 1DEDA 4UNLA 1Z42A 1UR0A 2H8ZA 1V6WA 6REQA 2PRHA 2P53A 3LX9A 2C18A 1XUUA 2TSYA 2PFHA 1XIMA 2D69A 1A3HA 5DMYA 1YMYA 4QROA 3AICA 4IGHA 1TZ7A 2DW7A 3FYOA 4MB3A 3U4AA 3PM6A 2RUSA 1J4EA 1TZZA 1HX0A 1SU5A 5KETA 4UZUA 3KRUA 2IXUA 2WKLA 5A6BD 3A22A 3N4AA 5E0KA 1HFBA 1R6WA 3DN5A 1CXIA 1OYBA 2PGWA 4WGXA 2L5HA 5IM51 4DQWA 2ZDSA 1XDJA 2AL1A 2WMGA 4GOAA 1A5SA 1GVQA 1PS9A 2ZADA 2ZZ1A 1QNSA 3QSRA 1JNDA 5A6BA 3UR2A 4H7ZA 1SPQA 4XVEA 3HFTA 2H90A 4GI4A 2EAWA 3BOLA 4K39A 1DE6A 4Z08A 4LQ1A 4Q4QA 3M44A 5AHFA 1JQVA 1Z6KA 1Q13A 4RPQA 1IYXA 5I3HA 2BP1A 3OIXA 1AZ1A 2VR4A 3THDA 4AF0B 4H83A 4W8AA 3HG4A 1DIEA 1NDZA 1A0CA 3N14A 4AVFA 3GYCA 3A9BA 4FALA 2CHRA 4ZFMA 3KFTA 1R9XA 2QPXA 3ALGA 3NDZA 3URAA 4A05A 3EEZA 3T07A 5CPOA 4BK9A 1KCXA 1REQA 3RO6A 2CLKA 4FF5A 2WM1A 2OODA 4AYSA 9XIMA 3PZGA 3MTWA 4JTIA 1NQKA 3BOFA 1UWRA 4N4QA 4H8UA 3TA9A 1DKWA 3S3GA 3N9KA 1ZAJA 3S2JA 1CNVA 3LNMA 4Z1CA 3PBVA 2FPTA 2PDQA 1G0CA 4OBTA 2FHCA 5M2FX 4LF1A 4Z1DA 4G8TA 3NQMA 3GLCA 2CESA 3CHFA 4RK8A 4JFVA 5C7VA 5F2IA 2GOUA 1E6SM 4LS2A 1A3XA 1NIUA 4JTGA 5AC6A 7TIMA 4P7QA 3I3DA 3CH9A 1UZ4A 4JNMA 3UCCA 1EXPA 3R6IA 4DNHA 2F84A 3I7SA 4YTTA 3MUXA 3EZ4A 3A13A 1YPIA 1W6TA 3PPCA 5K9DA 1EJ7L 2ABBA 3NGFA 1DIDA 4PMJA 1MEIA 3TMLA 3RMEA 5HANA 1VYRA 1VBJA 2VZOA 3M43A 3WIJA 4JYFA 2VEPA 1DIOA 1FDZA 2ZICA 4ZB5A 3W1XA 1XFCA 1V0LA 2ZUNA 3K4WA 1TTPA 1XRFA 3CT7A 2DVXA 3N25A 3W7RA 3AOFA 4Q7NA 5I23A 1G7UA 6A3HA 1K02A 1C8VA 1QU4A 4AIOA 5CC6A 3K1DA 2QDDA 1H50A 2A3EA 3H2CA 4N2YA 2DZBA 4FF7A 2HPIA 4H19A 1WZMA 3SUVA 3W74A 2GJXA 4FB7A 2W0UA 3BV7A 4HYVA 2DUZA 3S6DA 1VFMA 4X9SA 3N9RA 3UWZA 3EB2A 1OX4B 3VIMA 4CD5A 2DFAA 5CPQA 1JQXA 3ZJ7A 2C71A 3H4GA 4UWMA 1OFRA 3G5EA 4ROQA 5DXXA 1NARA 5HINA 1A5OC 3AZTA 1SO5A 2QMJA 4XKYB 2A6LA 1TIMA 4HJWA 2VFGA 2PDPA 1HT6A 4O13A 4ZTXA 2QJNA 3VTRA 5KTLA 2FMNA 3R13A 4DLMA 2JKPA 4KKXA 3N2XA 4YPJA 3CV6A 3WQEA 3BO9A 4JL1A 1R85A 2YCIX 3G2GA 3BJTA 4RV3A 2Z1BA 4P7LA 2VKZG 3P82A 4GYPC 1RBAA 4ATLA 5FJJA 4E8CA 2CCRA 2C91A 3MZNA 3SGUA 2CW6A 1C93A 3VGFA 2ICSA 3TLLA 1GOOA 2BASA 3JU2A 5EL1A 1QASA 3VAVA 2BX7A 2P8CA 3DFPA 1XF0A 5BXRA 2D0GA 1YDVA 3W4RA 1H61A 4W7WA 3UT0A 2RHGA 1XLBA 1I75A 3GR8A 1H09A 2C3ZA 1U33A 2DZUA 4AMCA 2X09A 4H8VA 5HBFA 1EC9A 2QYGA 4DJDC 4A29A 1F6KA 1MDLA 2HVMA 3R11A 1QOXA 3IJ6A 4OOZA 2VM8A 1KKOA 1B3OA 4IMFA 3T09A 3WK2A 1RPKA 3IGXA 1F9CA 4BF9A 3MV01 5A69A 2ZZ5A 4KCUA 4RDVA 1UKPA 2J7BA 3WLIA 3I68A 5DMNA 1GGOA 3VILA 3HPXA 3AUJA 4IMDA 4AC1X 4BR1A 2VT0A 1JXJA 1FCQA 2NLIA 5FF0A 1HKKA 3L2IA 3E9AA 4FNUA 1W5NA 4PMZA 3A4JA 4AZHA 1K1DA 4ZFCA 2F2HA 4O52A 3PJTA 1P0NA 4RNIA 2Y24A 3OVPA 4L65A 1FHVA 2HROA 2VI0A 3R79A 3R89A 2PSNA 1LBLA 4K8EA 3W87A 1PYMA 1NF7A 1JDDA 3G1YA 1V3MA 2VFDA 1CLVA 1YHTA 1KV8A 2WSPA 3PP7A 4GYKA 2PB1A 4PUWA 1Y0EA 3HMCA 1QTWA 3WLSA 3DYMA 1BF2A 4LANA 4LYKA 3U4FA 2WHJA 3TROA 3GW3A 3CWHA 4ZOBA 2ANUA 3B0PA 2XN2A 3QMTA 1E6ZA 1FHDA 1QPOA 3UXAA 1QBAA 1AUSL 1ME8A 1FWAC 2OTDA 1EBHA 4P7RA 4HPGA 3K5XA 3ERPA 3P7YA 3NUKA 5CPNA 3GFYA 4YVVA 3SM0A 3H2MA 4U4MA 2FFCA 2GZXA 1D7KA 7TAAA 2ZUUA 4H4IA 1U1JA 3W29A 4DM1A 1UG6A 5HQLA 3P3BA 1HGWA 3H23A 3OLIA 2PLMA 4C6LA 1G4PA 3INPA 1HJUA 4ZZ9A 3FOKA 2OEKA 1UMYA 1ZNNA 1TPFA 3T0AA 3IRSA 1W1B1 3R8RA 2B4GA 1VPQA 4F0MA 3C3UA 3ES8A 1XG4A 3ITCA 3AIVA 1AMKA 1OX5A 4BI5A 5F2LA 3WNLA 2QJJA 1AA1B 1UR2A 4I9TA 1ZRQA 1HO1A 3VMNA 4PE8A 3FJ4A 4ORMA 1RAKA 3KOWA 3ANUA 1XLGA 2CLLA 1IXQA 1E6NA 1XBVA 1A4MA 3A3HA 4S3AA 1UD8A 3MBDA 1XV8A 3ITYA 3IS4A 4Z1AA 4L61A 4CQ8A 3NVDA 5G5IA 3A24A 5J5RA 4CVWA 4C6NA 3G24A 5L9FA 1DL3A 1W2PA 1B31A 1DQXA 1UZ1A 3EOSA 4WDWA 2Z00A 1FH9A 3BGAA 4Z2KA 5D05A 3KAOA 4R33A 2GGGA 2XH7A 3B8WA 1R2TA 1YKWA 3WF0A 2VO5A 1V03A 2IPGA 2J24A 4CN1A 2H3DA 3C2YA 3UR8A 4QDWA 2J77A 3CH0A 4EK7A 4ZB0A 4HKPA 2PI6A 1A3WA 3HPAA 4HU4A 1JZ7A 2R1MA 3MKKA 4UNIA 1E1CA 4J27A 3PTDA 3N3MA 2FLIA 3TJLA 4UQBA 3NPVA 4A8IA 4L6HA 1H62A 2ZBTA 3S47A 2O9PA 2E77A 4W7UA 4Q32A 1XC4A 5GJMA 4M29A 1EDQA 1FTXA 1XJBA 2V5KA 3K8MA 1KGUA 1ML1A 3CPRA 2FH8A 3E5BA 4EF8A 1V79A 2WMIB 5BOOA 4RNFA 3CUGA 3PTKA 2Q8LA 3LD5A 4PYSA 3A23A 3KVJA 4HNOA 2BWGA 4K8HA 4G7EB 1N8IA 1OK6A 2XGZA 1E71M 4Q22A 4JR5A 2DH2A 1ITXA 3BGJA 3AXHA 4O1FA 1AJ2A 2DIKA 4UMAA 2ZXQA 4CNPA 1JYVA 1TPB1 3VINA 3EAUA 4HYRA 4IIEA 3HJEA 1LORA 1IGSA 2QLYA 5HWJA 5CG0A 4CD8A 3EDKA 3PTMA 2ZX5A 2WPBA 2X1SA 3VZYA 4D6EA 1T5AA 4DI9A 2DVUA 3GXMA 3WF3A 3WMBA 3OQEA 2POTA 1W9PA 4J1OA 3O7UA 4GD0A 1SJCA 4JD4A 1E15A 1YRRA 1FWIC 2XVLA 4P7NA 1B9BA 2P50A 4KCWA 1V4YA 1B0IA 5AN7A 1MXSA 4AW7A 1R9YA 3LCLA 2TODA 1XDLA 2VX4A 4FXSA 2OX4A 1YE6A 1HJQA 1P4CA 4BWLC 4HNNA 1XKJA 3BLKA 5LNSA 5LNVA 1QOQA 4PB4A 1B3WA 4P2VA 3S5NA 1M7XA 1GOKA 2ZE0A 1PXGA 3CYJA 5B80A 3DG6A 5K7JA 4H9UA 3R25A 2XH2A 3KBNA 4D2JA 3DYPA 3SCPA 5CAHA 1XWYA 4U2ZA 1NELA 4NASA 3LRLA 3S5OA 2J13A 2V2HA 2O7SA 4M19A 2WWDA 1L2QA 1P48A 5BRPA 2OFJA 3N2BA 3TQVA 2CLEA 3RLUA 3TE9A 2OGYA 2Z25A 3KE0A 3CTLA 2HISA 3IGSA 1ME9A 4H9ZA 4YJ5A 4W89A 1CZ1A 2IKJA 1W5QA 1GQJA 1PDYA 1QPQA 3O0FA 3P8JA 1FKXA 2GWNA 3NQCA 1V3HA 2HK1A 1SFJA 3LLDA 5I3IA 4AXKA 1JIBA 3R5EA 1X1ZA 2PGEA 5E93A 1BG4A 3NPUA 3ABRA 2QUTA 3MBFA 5DCBA 1X38A 1PIIA 4B92A 4GQGA 2GJLA 3HQOA 3E1F1 4ICCX 2BGSA 1UBPC 2QCEA 3F5LA 2Q71A 4AD4A 3N6HA 2GSEA 1H1YA 4K37A 3LZ3A 4ACZA 1B4EA 1OEPA 1LRTA 4JTSA 1ELSA 3SCVA 1Z7AA 3M5YA 2WM0A 3PB0A 4D71A 3L0GA 3ZWSA 3RF9A 4DO7A 1F3WA 3KCJA 3URBA 4GO8A 3WSUA 1HJWA 2FTYA 5DBTA 1KO0A 1HN1A 2D23A 4W8LA 1ENUA 3FVMA 3EX6A 2Z6JA 3W70A 1WUEA 3L4WA 2PDUA 1JGMA 2FDMA 1LL6A 1K9FA 4IF2A 4G7FA 3P62A 3WEOA 4F48A 2H8XA 1VF8A 5DT7A 5DANA 1TELA 5LNUA 2PDGA 3OO2A 2C0HA 3L9CA 2HEJA 4NNCA 3LHYA 1FH8A 1GQKA 4JQAA 4WOQA 2E25A 3EWWA 3N29A 1QRQA 4I9JA 4F9DA 2ZX9A 1SSDA 1CGYA 2VCAA 3OIHA 3BSMA 4KT2A 3GFZA 3K2GA 3RPMA 2CBUA 5DY3A 1KM1A 1UH3A 4KGLA 1XLMA 5F2MA 1DJZA 1E4LA 2WNNA 3L65A 1F3EA 4M6UA 4MNKA 2Z2AA 1PHWA 5DLCA 3GXDA 4KEMA 5G1TA 3SB0A 1EZ2A 2JBMA 2J47A 1OC7A 4C6BA 3FN9A 3TU9A 4UTWC 5KEZA 2G3FA 3DECA 3ARPA 3IJQA 3QOKA 4BWLA 2OYMA 5L6UA 2WYSA 3LCGA 3UEQA 1C8XA 5K4ZA 1IXPA 4Q4MA 3B8IA 1J6OA 2Z7GA 3TNBA 4MG4A 4JTRA 5BXPA 2I1OA 1NY1A 1JDEA 2CKRA 2PC4A 1FWSA 4TUFA 3WBAA 3GNNA 3B0VC 4AQLA 1W1VA 3HIJA 2E5BA 3L4ZA 4LUSA 2V82A 1HKMA 4NRRA 1J0IA 2V5JA 4R88A 5HR6A 1HP5A 4YHEA 1RA0A 1W91A 1WOAA 1WQ5A 1RLCL 1WDPA 2ZZ6A 3GHUA 1TPUA 1CGTA 4MY1A 2ZZ4A 4IP7A 1H0GA 1T8XA 4DZIA 3QZ6A 4PTXA 3LCIA 4CD6A 1J0JA 3CAQA 3W27A 1BWKA 3Q37A 2INFA 2V2DA 4GO9A 2OOFA 3CUHA 4H7VA 2IPWA 3OLEA 4N9BA 4R3UA 1I8JA 4I8DA 2BHYA 2FTPA 3L21A 1EDTA 3H21A 2CLIA 1FHUA 4EIVA 3T05A 2Z7KA 3BJSA 1YW1A 1OWQA 4K1WA 1FWHC 3KS5A 4MOZA 4C91A 3TW9A 3QTPA 4HTBA 1J5SA 5CEWA 5I24A 1KGXA 2NSXA 4G56A 2GUYA 3KL5A 3I3BA 1Q2RA 1P6WA 5FESA 1DWGM 2J9YA 2ZX7A 4BQ5A 1OFPA 3CMGA 1ZP3A 4PTVA 1RLDA 3CEUA 1I0DA 5KZ6A 2FMOA 2QDGA 4J28A 1XM3A 3LGEA 4MPKA 1SYTA 3EOLA 2E0PA 2OJPA 5HPCA 4ZODA 4ZQOA 3ES7A 4OECA 1U5JA 2WAGA 1BXBA 3HQPA 4JYEA 3LV5A 2WHKA 1FFQA 3HOJA 1GZJA 3T0TA 3EX4A 3TR2A 1OF8A 5BMWA 4IPNB 4REQA 1ZCCA 5D9NA 1S5NA 4ZOAA 3T08A 3GDMA 3BGGA 2GVLA 2ACSA 2GK1B 2WXDM 4ADSA 2XG9A 4Q33A 5HOSA 4KERA 2DVTA 3MHUA 2J8GA 3VCCA 1P43A 1RVKA 3FIGA 4DJFD 3PWIA 4L9XA 3FKKA 3W00A 2CFFA 3EPNA 3O63A 1UH2A 3AU6A 1YTKA 5I3FA 2I7GA 3HPZA 3OW1A 1K7XA 2C19A 4LB4A 2JF7A 3MO4A 3WJYA 3GAKA 1LQ0A 1XCXA 3IIOA 5A95A 4PR4A 3ARVA 3FY1A 3IUIA 1WOBA 4C6IA 2D2HA 1TIWA 4AD3A 2WLZA 3FAXA 1GOMA 3GD6A 4BY3A 4C60A 5FOOA 3GVWA 3UWUA 3E02A 1OIFA 2IKGA 3QLLA 4IJRA 3N4FA 3DFHA 3S1UA 1VFSA 4I7VA 3BLLA 4D6FA 4ICNA 3W9ZA 3UG8A 1EZWA 1YNPA 3VO0A 3G6MA 2YW4A 3NL2A 4V27A 3FW6A 2PZ0A 4WR3A 4FLOA 3AFBA 4HZ7A 1ZJIA 4GH3A 1J8VA 1P0BA 3IJ9A 4FNSA 5EY5A 5HDRA 5FAJA 4MVAA 3EA2A 3EWXA 4PULA 1ZPTA 3MMDA 4OQVA 4TOQA 3WUFA 2CNCA 5AYYA 1AODA 4B5NA 2V30A 1EJUC 1HF6A 3O6YX 5FJRA 1CXKA 3H70A 4YTRA 3W88A 3DX5A 4QE4A 1T96A 3H53A 2G5WA 4LC8A 5CGTA 4M6QA 1VFFA 3GNPA 1E40A 1LYXA 4Y9AA 2Y2WA 3DOPA 3KLLA 2OR2A 1WXJA 1ODZA 1FUYA 3BW3A 2DP3A 3GH5A 1VPYA 4UTJA 3STCA 1KBJA 1EX5A 4UB9A 4HU3A 1B3YA 1KRBC 3PUGA 5F1VA 4WX2A 4I5XA 4JDYA 5FIPA 4UTWA 2WSQA 3DI0A 1SUXA 4MTVA 1MXGA 4XAYA 3C5QA 5AB3A 2FH6A 3OZMA 4MZ8A 4PA8A 4YIWA 1TE6A 2Y62A 3F4NA 3RITA 1GCYA 4AU0A 3WMSA 3B8SA 4WGHA 3UJFA 3W24A 3NR0A 4GACA 5G4WA 1XINA 2LLEA 2HPMA 4XAGA 4DJED 1HO4A 1XLJA 5FJPA 6ENLA 3SN0A 4UTLA 3ZSTA 4B5VA 3B0UX 3KL0A 3VD5A 3C2VA 4D1IA 1W3JA 4IMCA 5EMKA 4CD7A 4IPLA 1XL9A 2ZXBA 4UFLA 4TX6A 2VR5A 3MYOA 2X0HA 3PR2A 1VC4A 2AAMA 3PZQA 5AECA 3VIKA 2DSKA 1FKWA 3R7MA 3QJAA 2ALDA 3A12A 1XUZA 5C71A 3VCNA 1G01A 4Q6JA 4MM1A 5BYWA 4DF2A 3LHVA 3P61A 4ZSUA 4PB3A 3W3OA 1EXBA 1V3KA 4GKLA 4KS0A 1XRVA 1CW2A 5D2XA 4LS1A 3ZR5A 3M1ZA 2BBFA 5DF0A 3EB3A 3SIMA 2Z1WA 4E2OA 1VBUA 2E9MA 2WV8A 2XUCA 3SY5A 2X0YA 3PWAA 3EOEA 3C8FA 1LUCB 1C7TA 1UR8A 3AIEA 1I2PA 1EB3A 1MUCA 4CCDA 1HP4A 1MQQA 1IT7A 2P3ZA 3ZQ9A 3VMPA 5CSSA 3HO8A 2VXNA 4H9VA 2PTXA 1EOMA 1FWEC 2X05A 4NU7A 3FK4A 3ARSA 1JXKA 4E38A 4MFEA 3WBYA 3WO8A 1NOFA 2PZNA 3RM8A 3BTNA 4PTMA 2B7OA 1BRLB 1SO3A 2Q02A 3TIMA 3IUDA 4U3AA 3V35A 4JXCA 1H7NA 4TU1A 3WMLA 4LNYA 1Z8AA 1XBXA 4WZHA 3LXAA 2Z29A 5D9PA 4HB7A 2OEMA 3BICA 1F73A 4Y8EA 1FWCC 4NQ1A 1OCJA 4HNLA 4HOWA 3B9DA 3CNYA 4DF1A 4CN4A 1HQTA 4DBDA 3FKRA 2RDWA 4XUYA 3UWYA 4PUEA 1NSJA 4FIRA 2CZFA 2ISVA 3NDYA 4HOZA 5I2UA 1ZU8A 3QY6A 3AHXA 3WKZA 3K1GA 2VZTA 4NI3A 4GQQA 1RXOB 3NSMA 4RE3A 1XIEA 2J8FA 4OV4A 3LU2A 1X7IA 3BW4A 2WJDA 1PO9A 1MYRA 3WL0A 4K8GA 2EPMX 3NZRA 4LOCA 1FHLA 1BQGA 3IV8A 1WO2A 1XLIA 2P0OA 2QEZA 1NU5A 3ZVHB 4Z2IA 1XHGA 2ZA1A 3E2VA 3UCQA 3AMDA 2PDCA 4RW5A 3VIJA 3VDCA 1TE1A 1U5HA 1A49A 1ME7A 1OZQA 4Q4OA 1NOUA 4AG0A 4TTGA 5G4EA 2FKPA 3B8UA 4CLMA 1YDYA 4FOJA 3RO8A 2E9BA 2FTWA 1OGGA 3P93A 1Q3NA 1VHNA 4JCMA 1LRNA 5BCAA 1IR1A 1HKJA 3SRKA 4GVHA 1TVLA 2FYMA 1S3TC 3B03A 3ZXWA 2ZVRA 2WKJA 2Q8ZA 3F2BA 4QTGA 3W02A 1A5NC 3SUTA 3UA4A 1BF6A 4TVUA 3R58A 2J7EA 4X0NA 4AHQA 4DVOA 3ATYA 4GBUA 1T0OA 4Q8QA 1PZ1A 1DBTA 2Z1VA 5KMYA 1EJWC 1N7KA 4GUIA 3IVUA 5E6ZA 4ML9A 4QXIA 3LHWA 3ID7A 5IRPA 2Z0IA 3QPYA 1B2YA 1T41A 3WZ0E 4CQ9A 1O95A 2QDHA 3BLFA 2F8QA 4JTQA 2VEKA 2R6OA 4JFUA 1UUOA 2VMFA 3RK8A 4OT7A 3NZGA 1W31A 2Z28A 3M0MA 4DYKA 4DEFA 4IXXA 2CWNA 2YIHA 4N6EA 1E9IA 1FDJA 2BXYA 4IFOA 3DHPA 6CGTA 3AISA 1IR2A 1FH7A 4K38A 3STGA 1DE5A 4NAFA 1GKQA 3EDJA 3VOIA 3ARXA 3UWWA 3PZ9A 4OFCA 1W9DM 2EG8A 3OODA 1BTMA 3T0CA 1A50A 2V67A 4UFIA 2XJ7A 4M56A 3AQUA 4UBPC 3DG7A 4C1LA 2D0HA 4JGDA 3W25A 2OXNA 2FHBA 2YA2A 1XLKA 1LM1A 4O14A 1B54A 2J79A 4X0VA 4ASTA 3LXCA 3LXBA 5D03A 1VP5A 4C6FA 1H7OA 3DENA 5EMMA 1G6CA 3ANVA 4LY4A 2Z1KA 1KC7A 3KVKA 4S3GA 1LF1A 1PTAA 3TYBA 3CS2A 2BGNE 2NWRA 2WPGA 1GJUA 3HM7A 3KOFA 3AWNA 3QC3A 3JRKA 3I4EA 5AVHA 2QAFA 4XK2A 5T8GA 3W1MA 4XBJA 3B9NA 3R8GA 3DUGA 2G4FA 4A8LA 3WENA 3TLQA 2G3NA 4GQBA 4JKKA 1V3IA 1D7FA 3CAWA 4S38A 3W2JA 3BH4A 5AVNA 1V08A 1Q8AA 2WZIA 2PTWA 3M0JA 4A35A 4A6GA 4JIEA 4YHGA 1PCKA 3PJUA 5K3VA 3N34A 5HNNA 4AY7A 1TMQA 3CHDA 3NEHA 5H1WA 2JFEX 2OT1A 2HNHA 3LQLA 3OP2A 3WDPP 2FHFA 1BVWA 5CLWA 1M65A 5M1TA 1XYCA 1KXQA 4UOZA 3W2MA 4WKHA 2GQ3A 2VEMA 2JE8A 1A4LA 3WLTA 5KSWA 3THQA 4ZO6A 2E28A 3DC0A 4HQVA 5A8QA 2FJUB 4Z0JA 3GDKA 3QEZA 4UTKA 2CEQA 1MW0A 4IP5A 3UYCA 1FA2A 3AIBA 5EA9A 3H54A 4PSRA 4EE9A 3N6JA 2YKKA 2ZUVA 3ARRA 4L9ZA 3E6EA 3G0SA 3CK5A 1RUSA 2I5QA 4YCPA 4AIUA 2HBVA 4PBFA 1S38A 4LRSA 1VLWA 3W85A 1TJ2A 5KZMA 4JX4A 4MYXA 3GXIA 1VFTA 4WK9A 1EPVA 3TYAA 4EACA 3NDOA 3CQHA 2PWGA 4CNSA 2GFTA 1W3IA 3ZT5A 4DPPA 5CH9A 3C52A 4O1BA 2UY2A 3W0KA 3K4DA 3DBPA 1RY0A 2Y88A 1E1FA 4YYFA 4HNCA 3G18A 3BLEA 2VURA 3S42A 2V0TA 1R87A 2QV4A 1W8GA 3TQPA 1BKSA 5IBXA 3MW7A 2Q6ZA 4LYRA 3E2SA 3RFAA 3ICJA 4JEJA 4DXXA 3TAOA 1XGEA 2AGTA 1EGVA 5MKGA 4M82A 2XN1A 1G9HA 4ZGYA 4I6VA 2JK2A 3EA1A 3R12A 1KM0A 3BSGA 4D6JA 1Y8BA 2NV1A 4O0QA 5LZLA 3WLPA 1PV8A 2J9XA 3M0YA 3BCDA 2R1KA 3ZLFA 3B9AA 1ISWA 4I3GA 2Y85A 2BY1A 2A7PA 1ISYA 2TAAA 2R94A 1BKHA 1TTQA 1BYAA 3II1A 2ZTKA 1W8SA 5HJYA 3M5ZA 3T2QA 2NXIA 4ZO7A 1POJA 4OGZA 1ONXA 3V3WA 2XIMA 3W2LA 1UIOA 2IKIA 4N9CA 2HV5A 3P80A 4XO7A 4B3KA 4MY8A 4S39A 2HVNA 5F4WA 2Y89A 1P7TA 4UR8A 3H8AA 3WDQA 4UTTC 4W93A 1QK0A 3WLMA 4TX8A 3CC1A 2DUXA 3QKZA 2VYOA 2BNJA 1TA3B 2XTKA 1UR1A 2A7RA 2QCCA 5G2IA 5C70A 1IEWA 2UBPC 4XVDA 4AUBA 1T40A 2VRJA 5D4YA 1TR1A 4GHRA 4EAMA 3VZXA 3TP4A 1R86A 1W5OA 3UNTA 2A3HA 2EHHA 3N04A 4XB3A 2OLSA 1E0TA 5AKQA 1V6YA 4K3ZA 3WF2A 3T0BA 3TSBA 2YOCA 5F4XA 2PP3A 1S39A 3NTYA 1AFSA 1VS1A 1FBAA 3ZIZA 3O6DA 1RBOB 4ACYA 2CERA 1U1UA 2CXGA 1S5TA 4WKFA 1L6FA 1WKFA 1L0PA 5D02A 3NA8A 4E2DA 3KL3A 9RUBA 3A9IA 3BCFA 3G3MA 5DO8A 3CQ0A 1ZENA 1HGYA 3W23A 4GFIA 1YXDA 4DUVA 1MEHA 5E9XA 2FFIA 2GQ9A 1DJXA 4GKTA 4WDTA 2D3LA 2XFWA 4QISA 3ATZA 2GDUA 4GCXA 3BUVA 4FEZA 5HWMA 1OJXA 1J93A 3OA5A 3GXTA 3UBPC 3GG0A 4X61A 4GG9A 4YN5A 4JFSA 3PBUA 3QGAC 1ADDA 2OWCA 3WQGA 1TJPA 2YFOA 1U30A 4CKQA 1THFD 5ABHA 1OD8A 3W7EA 4N42A 2A5HA 4ZXLA 2YCJA 5GNYA 2CLHA 2GSJA 4L4PA 4Y7EA 4I5RA 2XHYA 1O66A 3R94A 3MMWA 1QBBA 1CXHA 2GGEA 3KBJA 5D30A 3M9YA 4WLCA 1RBLA 3UETA 5DN1A 5I77A 3ZR6A 3A64A 1LDCA 4W4QA 5D32A 4CEXC 1Q6QA 5HK4A 4HU0A 4NJHA 2WCAA 3ARTA 4IFKA 4DWSB 5I02A 1IZKA 3KTCA 2BTMA 4MPQA 2BY2A 1HKWA 4UIOA 4UFMA 1SVDA 4OE7A 1QI3A 4DXKA 3R0UA 1EC8A 1T8QA 2GL5A 4ACZB 5FF2A 2EPNA 1JD7A 3TDFA 4Z2GA 4AVOA 3SGZA 4DUXA 4XAFA 1W17A 2Y7EA 2BY3A 2A79A 2NUXA 1EJRC 3DFOA 2QGHA 1RCQA 2D24A 2NSOA 5E70A 1D8CA 5T9CE 5A8GA 1FWRA 4Y96A 3WDIA 1J0HA 4PTWA 2WVSA 1W56A 5FF3A 3E49A 4ZB2A 4JTHA 4NYYA 4A8NA 4LH8A 3W84A 1O94A 3GVGA 4AXNA 1QAPA 1PKNA 1XBYA 3PG9A 2W4XA 3GBEA 3AC0A 1UUMA 2PTDA 3VNMA 1XSIA 2W79A 4JY8A 1JZ4A 2XM1A 2OWWA 2PA6A 3C61A 4TX9A 4HHLA 5BOFA 2VVSA 1MZRA 3CYVA 3TAKA 1ZBWA 5JQ9A 1OYCA 3EEGA 3E0WA 2HCVA 4KESA 4AVNA 3TN5A 4MY9A 3MZ2A 1CYGA 3W72A 3PAOA 4MNMA 4DZAA 1LRQA 3F03K 2WCSA 2POZA 1FWBC 2NLYA 3TW7A 3VD9A 4JIQA 5DEZA 1JFXA 1BGAA 1P6CA 3A5FA 4R7WA 1EUAA 8TIMA 5C8BB 4Z17A 2JEQA 4XZ9A 5KZEA 2VUNA 1X8FA 1AD4A 3WD0A 1AW5A 1K7EA 3NYZA 4JYDA 4WXYA 3VOHA 2REQB 4FLSA 3A47A 3RR1A 4GMEA 3QYSA 1XLLA 5C9UA 3A21A 3BAKA 1Q6EA 1JDCA 3AU2A 2VOMA 4UQAA 1A5LC 1H5VA 2GGJA 2YB4A 2KAUC 4PSPA 3JS3A 4GI9A 3S1WA 1JEZA 1PYFA 4CVUA 2QGYA 3WQCA 5I3GA 4NZ3A