The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
79
|
sequence length |
220
|
structure length |
219
|
Chain Sequence |
DPAATADTVNPGNKIIYLTFDDGPGKYTQGLLDVLDKYNVKATFFVTNTHPDYQNMIAEEAKRGHTVAIHSASHKYNQIYTSEQAFFDDLEQMNSIIKAQTGNDASIIRFPGGSSNTVSKDYPGIMTQLVNDVTARGLLYCDWNVSSGDANPKPISTEQVVQNVISGVQSHNVSVVLQHDIKEFSVNAVEQIIQWGQANGYTFLPLTTSSPMSHHRVNN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Peptidoglycan N-acetylglucosamine deacetylase
|
publication title |
The crystal structure of the catalytic domain of peptidoglycan N-acetylglucosamine deacetylase from Eubacterium rectale ATCC 33656 (CASP target)
rcsb |
source organism |
Agathobacter rectalis (strain atcc 33656 / dsm 3377 / jcm 17463 / kctc 5835 / vp
|
molecule tags |
Hydrolase
|
total genus |
79
|
structure length |
219
|
sequence length |
220
|
ec nomenclature | |
pdb deposition date | 2016-04-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01522 | Polysacc_deac_1 | Polysaccharide deacetylase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Glycoside hydrolase/deacetylase |