5JMUA

The crystal structure of the catalytic domain of peptidoglycan n-acetylglucosamine deacetylase from eubacterium rectale atcc 33656
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
220
structure length
219
Chain Sequence
DPAATADTVNPGNKIIYLTFDDGPGKYTQGLLDVLDKYNVKATFFVTNTHPDYQNMIAEEAKRGHTVAIHSASHKYNQIYTSEQAFFDDLEQMNSIIKAQTGNDASIIRFPGGSSNTVSKDYPGIMTQLVNDVTARGLLYCDWNVSSGDANPKPISTEQVVQNVISGVQSHNVSVVLQHDIKEFSVNAVEQIIQWGQANGYTFLPLTTSSPMSHHRVNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Peptidoglycan N-acetylglucosamine deacetylase
publication title The crystal structure of the catalytic domain of peptidoglycan N-acetylglucosamine deacetylase from Eubacterium rectale ATCC 33656 (CASP target)
rcsb
source organism Agathobacter rectalis (strain atcc 33656 / dsm 3377 / jcm 17463 / kctc 5835 / vp
total genus 79
structure length 219
sequence length 220
ec nomenclature
pdb deposition date 2016-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 5jmuA00
4OUIA 2Y8UA 1W17A 1Z7AA 2CC0A 3WX7A 2W3ZA 2QV5A 4M1BA 2J13A 2DFAA 3S6OA 5JMUA 5BU6A 2IW0A 2C71A 2C79A 1V6TA 4NYUA 4U10A 3QBUA 4NYYA 2VYOA 4HD5A 3RXZA 4F9JA 3CL6A 1W1A1 3CL8A 3HFTA 4NZ5A 2I5IA 2XU2A 4V33A 2C1GA 4F9DA 1XW8A 3VUSA 3CL7A 2C1IA 4L1GA 1W1B1 4NY2A 4LY4A 4NZ3A 2NLYA 2E67A 4WCJA 4NZ1A 1NY1A 4NZ4A
chains in the Genus database with same CATH superfamily
3RUBL 2ZTKA 5KZDA 1WBHA 5G1MA 1Z69A 2YW3A 3T2QA 5M5DA 4U3CA 3N15A 3KL0A 1TVNA 3FXYA 2Y61A 2QXWA 3ES7A 2R8WA 5FACA 2PDFA 2RJHA 4AW7A 1JZ5A 5A6BD 5I3FA 4BQ5A 2X1SA 1O4UA 1PJ9A 3S5NA 4PTWA 1F3XA 3BLFA 3WF3A 1V0LA 4BWLA 1WX0A 2QCEA 3WNMA 1FWWA 5CBIA 3WO8A 3NQEA 4GGBA 3TXVA 1FH7A 3B0PA 3OLIA 3R8RA 3CV2A 3KRZA 2TODA 1BTMA 2VJXA 1CGWA 4TIMA 3VK5A 3AHZA 1N7KA 5FD0A 1EIXA 1Q8AA 2J88A 4LNYA 4G7EA 3N1AA 4H41A 5A95A 4M82A 1U5VA 2GUYA 2ZCGA 3H2AA 5ABHA 3OBEA 1ONRA 4ADUA 1HN1A 4H04A 3FFSA 3S1XA 3ZLFA 1OADA 3PWGA 4HTYA 2NXHA 1YDYA 1JI2A 4JR5A 2OO6A 4L9ZA 4YCPA 3NGJA 4L6DA 1JDAA 4D8LA 1SO3A 2JALA 4NXSA 4JKMA 5LNSA 3P60A 4V2XA 1B3YA 4DJDD 4CD8A 1RLCL 5LA0A 1C91A 1FX6A 2CBIA 3CLWA 1GHSA 2E0PA 4JTEA 3N4FA 4X0NA 3VIPA 3D5HA 4WKHA 4CU7A 2QIWA 1IXOA 5BZAA 3SY1A 3E0FA 1TR1A 2GL5A 1Q6EA 1P43A 4INFA 1GVOA 3B40A 2GDQA 1XL9A 4GISA 4NZ1A 3ZO9A 4C6IA 3BANA 4DWSC 1GVFA 4NX0A 1QWKA 3RYSA 3AS0A 1J0ZA 3JRKA 4JEQA 1W1IE 3PVFA 3WH9A 1TWSA 1RP9A 1J8VA 2FGBA 1WDWA 1BD0A 1HZYA 3WQPA 1IGSA 3VD7A 4O0ZA 1VBRA 3HM7A 2FPYA 1KO0A 1BGGA 3P8IA 1US0A 1ZAIA 5F4WA 4Z1DA 1NARA 2QMKA 3ITCA 4XZIA 1QNRA 1ZJHA 4KGLA 5H2ZA 2P88A 3SCQA 5DMNA 4L1WA 4YTSA 3QW4B 1PV8A 2EPHA 1XG3A 6A3HA 1XX1A 3W7QA 1SMDA 3UT0A 3LCGA 1N82A 2XM2A 3PZVA 2ZVRA 3CM4A 3S2CA 3VNMA 3FHAA 1CXKA 1XKJA 1MNZA 4EF9A 5CSUA 3KZSA 4QJ1A 2AMGA 3OQ8A 5FAGA 2SFPA 1POKA 1LBMA 5HNNA 3LRLA 2WKGA 4TTGA 2Y70A 4PRTA 3UR8A 1TV7A 4DUWA 1OYCA 2XSXA 3FA3A 1BXCA 3VNKA 1K02A 4Y9PA 3NFUA 2P76A 2PPGA 1TX0A 1XC4A 3QZ6A 1AH3A 3GH4A 1IQ8A 2FMOA 2CHNA 4ZENA 1R3YA 1GVEA 5FF7A 2QUUA 1S2WA 1CIUA 2G96A 2QUVA 3T2PA 3ZOAA 4IPJA 4L61A 2NVDA 5IM51 2JKEA 3FNDA 1KFLA 3RFAA 3B8SA 2A3AA 3B8TA 3GNDA 3W81A 2G3IA 4IGNA 2H6RA 2TAAA 2QDDA 4GXPA 4LNCA 3HMCA 1MW3A 3NURA 1UWAA 4ERAA 4AF0B 4D8ZA 2J7BA 4JCLA 1XLCA 1W9UA 1IEXA 4MOZA 4DO5A 2ZUSA 4LF1A 3NDZA 2BXZA 4ZB0A 5EMJA 2X05A 4V28A 2R94A 1EWDA 4JICA 3LK6A 3KUMA 4RX0A 3LI1A 1QOXA 1FDZA 1KTBA 1OX4B 1ZALA 4W9TA 4C6BA 3R13A 1GOXA 4JS3A 4DI9A 2ZRWA 2XFYA 3DFQA 3KOWA 3DGBA 2QGYA 2XSBA 3PZIA 3QH2A 3H26A 4PCSA 1TV3A 4RDWA 4QJ5B 4AH7A 1TJPA 3UGVA 4ZE5A 3OODA 1LWHA 4E3VA 1V03A 3LHZA 2G5WA 4F48A 3OIHA 4EPDC 5BXTA 3AIUA 1PCKA 3OZPA 2JE8A 3FKKA 2J77A 4B3LA 3W24A 1NDYA 3B8VA 3U2OA 1DJGA 1MYRA 3F1QA 4IIHA 2Z2UA 1E0TA 5CQ1A 3RMJA 3DN5A 4AZCB 2B7QA 2XGIA 3WQCA 1H7RA 5I0DA 1RAKA 4GH3A 4B5WA 3I3BA 1X6LA 2DSZA 4NILA 2NQHA 2JEQA 1H49A 2VRQA 3W9ZA 1EJSC 5I3IA 1H1NA 2PAJA 3EMZA 2VRKA 1EQPA 4MB5A 4CNUA 4TX9A 3OG2A 4WK9A 2ACSA 3NUKA 4UFKA 1JCXA 4BQ4A 1I1XA 2VEIA 4FSAA 4LVGA 3BG9A 1DJQA 4V15A 2PDKA 3R0UA 4DJFC 5JU6A 3IRDA 2PC4A 1OCJA 1SFSA 2H9AB 1XJBA 1F4AA 3F4NA 3HG4A 5LNUA 4RR4A 1O66A 5DT7A 2J13A 5E70A 4Z2LA 2X16A 4I5XA 1M41A 4O50A 2XG9A 3OIXA 1P6CA 5A6BA 3WH8A 4AIOA 1RD5A 2A3EA 1RVGA 4NY2A 2PB1A 2E3ZA 1L8PA 1L2QA 4O1EA 1EBGA 1XQKA 3JW7A 3DC8A 4H01A 4DHGA 2E28A 4YPJA 2DZBA 2W91A 1A0EA 3Q58A 1F07A 3BAIA 3QV6A 2ZXAA 1PX4A 4IQEA 3N18A 3ITOA 2W5FA 3GZ3A 3E3HA 4WGXA 4A05A 1YEYA 1Z48A 3OQEA 4IUOA 1NDZA 2VEPA 2WPBA 1ZZMA 3VCNA 5BU9A 2DZUA 5C9ZA 2XJ7A 2JF7A 5E0FA 3W7PA 4CCEA 5C54A 1N2VA 3AWOA 4FS9A 4E38A 2OX4A 3N3MA 5CSRA 4DB7A 3EPMA 5CAKA 4LEQA 1FY6A 4Y9NA 4GH1A 4NAEB 4X61A 1LROA 2XHYA 4XISA 1UR1A 4IMFA 1TV8A 1AFSA 1QOQA 4TTUA 3OEXA 4YIWA 1I2QA 4IPPA 4DJDA 1WPCA 4HNUA 3DECA 2CHRA 3QYSA 4U28A 5F1VA 5A6MA 5FKYA 2ALDA 2EJ1A 4P5UA 3DGRA 1ISZA 4REQA 1VIZA 3KTCA 4JIHA 4PB3A 3WBEA 4F0HA 3C4UA 1DTUA 2FVMA 4YS1A 2V5LA 3W1XA 2Q8XA 1OK4A 1D3GA 4GQBA 3A4WA 3HU7A 3GVRA 1FHLA 3I4KA 1KBJA 2JBMA 4MZ8A 2CLPA 2WSKA 4LYPA 5G1YA 5C8BB 1QATA 4I90A 5D8ZA 1TMLA 4MFEA 2EPNA 3PR2A 2ACRA 2V6AA 2ZTJA 4MKVA 1X1ZA 1Q4WA 5A3HA 1XGDA 2QVNA 5BWAA 2WHKA 1UKQA 4ZOCA 2X1UA 5G4HC 2VX6A 3DHFA 2ZIDA 4ONVA 1QHOA 1FUYA 5DELA 1E1CB 4DM1A 2B7NA 4HGXA 2B31A 4XBJA 2EHHA 3S1GA 1I45A 4MY9A 3QV8A 3W01A 3C2OA 1CW2A 4JQAA 4CN6A 1ZFJA 1XPGA 3MSYA 3PANA 4RE0A 4Q7IA 3W1NA 4HPNA 3NG3A 4Z1BA 4HK6A 3BARA 3KBJA 3SB0A 3ORWA 1VYRA 3KCOA 4CKQA 5CGMA 2F6XA 4XZLX 3DYMA 1VQTA 3G0SA 1UA7A 4BI5A 1Q5MA 4B9ZA 4U33A 2YA0A 5ABGA 4AY8A 4PBEA 3GR4A 4LCSA 1V79A 4LBUA 1GKRA 4WCJA 3GU1A 1BRLB 4FR1A 4PGLA 3D6NA 2ZXBA 4BEQA 3NXFA 4PTMA 3T1GA 4ADTA 3W7EA 1JGIA 1UWIA 1XH2A 2IKJA 3ABSA 3HFTA 3KWSA 4ERIA 4J7RA 3H70A 3C3NA 4MGGA 1G7UA 3Q37A 4H4IA 4P61A 1ZP4A 2WSQA 4YL2A 3ZWTA 5DMYA 1UC4A 4HNNA 4FZIA 3VKKA 2Y24A 4R7WA 3EWXA 1XLHA 3W88A 3P61A 5K7JA 1RY8A 3N25A 2P10A 2E09A 3T0CA 3HQPA 3N9RA 4JYEA 3VVGA 4IIGA 5HWJA 2Y5EA 3LHVA 4JHMA 1E70M 2PDUA 3H7VA 4YTUA 3T81A 4O1FA 2RDWA 4B5SA 4R9XA 3H2CA 2NX3A 3LHUA 1FWBC 3R6IA 1EC9A 4LAOA 2R1LA 3U3HA 3ZJ6A 2I14A 4MWAC 3KL5A 1XIHA 2QCDA 4EACA 5HQEA 3FEQA 3POCA 3WJYA 2PDMA 1YTEA 2P1FA 3HG3A 3WDJA 4MWAE 2J47A 2ASHA 3ZR6A 1EJUC 3JUGA 3VC6A 5A8NA 3RF9A 3TJLA 1HL9A 3VD3A 5DF0A 5IRPA 1ISYA 4DWSB 3MUY1 3WF4A 3I7QA 4Z42C 4J2MA 1IXPA 1CXEA 1R46A 4B9YA 1XV8A 5FI8A 2PWHA 1UZ1A 2EKGA 1G6CA 2J8TA 3BSHA 4NL1A 4MADA 2G95A 1YE4A 3S6DA 1J6PA 1XSKA 1NF7A 3C0LA 2V68A 4WIWA 3SY5A 4L4OA 1X1OA 5HK4A 3PF3A 1XH1A 3EA2A 2BHUA 1I0DA 4KERA 4BQ2A 1DTNA 2PI6A 4DM2A 2OQYA 4F3HA 3UZ5A 1K8YA 2CWNA 1Q6OA 4PTNA 4PE8A 1TJRA 4IL0A 1PKMA 3UESA 3E6EA 1XD1A 1XBYA 2CEQA 3TTEA 4QTGA 4ZOAA 5TBOA 1UOZA 3P84A 2PWUA 4NZJA 1ADSA 1FKXA 4L7ZA 4KKXA 3RK8A 3FVMA 2VFDA 3B04A 4G1KA 3IJ8A 8TIMA 1EO5A 3BW4A 3ZJ7A 3QY6A 4D1IA 1F6YA 4I9JA 3QYQA 3MPGA 1LLOA 3ZSTA 4X0VA 1LF1A 5IHSA 3BJSA 3QHMA 3QVQA 1O95A 4LJ3A 4IG2A 1X38A 2BVDA 2AL1A 3C61A 5EFFA 4AD2A 4RXFA 2WNZA 3EWCA 3SM0A 5HMFA 3AS2A 4UTHA 1MUWA 3GG0A 4RL3A 1OF8A 2G3JA 4LS1A 5I3DA 3AO0A 1VS1A 4Z2HA 1JRBA 5J8LA 3TN5A 4JFUA 3CWHA 1UIOA 3ZLGA 2FHFA 4DYEA 1W0MA 5CEWA 1NWRA 4WY0A 1UWTA 4P7OA 2REQA 3A9IA 1RR2A 4K6AA 4LTSA 3NQFA 3K4DA 3LY0A 2CZDA 3LNMA 4ZQCA 2C14A 4WDWA 2BOEX 1XBVA 2R14A 4UMBA 3WDHA 3QLLA 1H7XA 3IVTA 2C1IA 1L2UA 1CECA 4B90A 2AGTA 1LUCB 4FIRA 2G37A 4S3GA 1VF8A 1LWJA 1FCVA 3GXPA 2LLEA 3LNPA 3RIKA 1W1A1 1B9ZA 3LTPA 3N2XA 4H9XA 3UJ2A 1DJWA 1O7AA 3KS6A 1O5KA 4Q4QA 4K68A 1DIEA 3KBWA 3SCNA 4N2YA 4WDUA 3WBXA 1AH4A 1TG7A 3CPGA 3USZA 5A6TC 1YIXA 2EXOA 3CIVA 4UMAA 2VMFA 4XAZA 3DC0A 1E4LA 3GFZA 4ZOEA 2EPKX 2CHOA 3S9YA 1JCTA 1WAUA 1D8WA 2HBVA 3KWXA 4G2DA 2YDQA 4QLJA 3OTRA 3P74A 1W54A 4GI8A 2FHBA 4A3UA 4GBDA 4PB4A 4M7TA 5E9XA 2W92A 3EWYA 5L9FA 2Q3RA 3LCXA 3I6EA 4H9MA 4P8XA 1VJZA 1R9YA 1M7OA 1NFBA 4NX5A 2QKFA 3W7CA 4GIRA 3CHVA 3BC9A 1KWGA 1UZDA 3GTFA 2VTFA 3QN3A 1JRCA 3W74A 1GZJA 2PP0A 2QF7A 1E5JA 3GU2A 3PG8A 1UUOA 4DX3A 3A4AA 3WLRA 3WMCA 4BCEA 4TMBA 4AD4A 3UWUA 3ZR4A 3GHUA 4Q8PA 3CV1A 4HMCA 4JX4A 3DOPA 4JL2A 6REQA 2GQ3A 2ZKMX 4GYKA 3EDEA 4MVAA 3GVWA 3WD1A 3EPNA 4ZE4A 1BLIA 3OU8A 3BH4A 4XTIA 1P6WA 2PD5A 7PTDA 1ZTVA 4A6GA 1M53A 3LQGA 4E8GA 4S39A 4UBPC 1S2TA 2XN0A 3MUZ1 2QIIA 4ZODA 3C0QA 1OD0A 3BUVA 4GWEA 1HP5A 2XU2A 2YB4A 3NDYA 3F5JA 4BJHA 1FCQA 3PN8A 3CJPA 3H2OA 1AA1B 2QVHA 3V1PA 3IV3A 4C6MA 3THCA 3EWUA 5C2CA 1A5OC 3H22A 4E6MA 1PTGA 1UROA 3R10A 4KEUA 4HU0A 3VNIA 4UOJA 5HJXA 3BVJA 3CH0A 2PODA 2VO5A 1OFBA 3MB9A 3AMGA 5G2HA 3GTXA 5C6MA 1KM3A 2CYGA 4ZR8A 4KEMA 3V3WA 3COTA 1U2YA 3RPMA 3CQ0A 1EZ2A 4BHYA 1FHUA 2Z2AA 1KA9F 4FF7A 2Z1XA 2DPEA 1U5JA 2NVAA 1B9BA 2Z7GA 4TXEA 5HPCA 2HRWA 2E5BA 3LG3A 4F2BA 3FJLA 4IIDA 3W76A 3D3FA 2V82A 1CDGA 3T9PA 4IP5A 1XLIA 2QJJA 3UZWA 1WCGA 2ZRVA 3C8NA 5C0QA 2FFCA 1QPNA 2YYUA 4J4KA 4XKYB 4DAFA 3WNPA 3UYIA 4DZ5A 2YA1A 3VTRA 3OG3A 4LVDA 5ABFB 1VJIA 4WEVX 1RZMA 3AMKA 5H8UA 4DI8A 2ZX9A 3CL6A 2WBGA 1RD6A 5K4XA 3L21A 3SECA 3M43A 1HXJA 4M29A 4C7GA 1XLFA 1E9IA 4QDMA 4AWTA 5AHFA 1DKWA 1FCBA 2ZC1A 3E12A 3SCUA 2ZFAA 2VC7A 4R88A 1OFAA 5H8PA 2QQ6A 3VNZA 4H7CA 3BMVA 1KC7A 4YXGA 1CGYA 1CXIA 4NNBA 2CBUA 1QNOA 3E2RA 2J8FA 2P0IA 2ZDSA 4LYRA 1JI1A 4W4QA 4WSJA 2DJLA 3VXGA 4MB3A 4HU3A 3GW3A 2NT0A 1EF3A 1TZ7A 4OECA 4RW3A 1H5VA 3LD5A 3KOZA 3OLDA 4M6PA 4LC6A 2OEKA 1EP2A 3LHTA 3JR2A 2HPMA 4ES4A 2IPJA 4Y8EA 3M7WA 3MMWA 3PAOA 4JTUA 3MP3A 2JGYA 1HIZA 3SRKA 1JG9A 4DZIA 4U31A 3E5BA 4YU1A 2PTXA 3ARPA 1PIIA 4Q7BA 3UD6A 4GNKB 1FWRA 3THUA 4J3VA 4UQCA 1A5MC 3VGHA 1OY0A 4TV5A 2V3DA 1XRVA 2HV5A 3KBVA 4M6VA 3RR4A 2WV8A 2I9EA 3Q67A 2WBKA 2GDVA 5CPTA 2VXNA 3LXCA 3TA6A 4MMWA 1NDWA 2PDIA 1LLZA 4GX8A 5FCZA 4GUFA 2E8YA 2OEJA 4EAYA 1S5MA 5CPLA 2O4MA 3B9EA 4Q4KA 4HMNA 1HKIA 5EMKA 3ARQA 1SJAA 1BEUA 1Z41A 4AVOA 3RLUA 3BSGA 1G4SA 1P0KA 4N4QA 5FJRA 3OZOA 4J3UA 5EY5A 2D3NA 4IMAA 3DBNA 4ZQPA 4HOXA 3BSMA 2XYLA 3NZGA 2GK1B 5FF4A 1GWJA 3HPAA 1G0CA 3S5OA 2HS6A 2CC0A 3GB6A 3CPUA 1J5SA 1XRFA 4MWAB 4M56A 3QQ0A 2R9RA 2HPIA 3N29A 2E7FA 4JXCA 2CIPA 3UWQA 1F3EA 3AXHA 3HQOA 1FWFC 3DFYA 4Z1YA 2CKRA 4K1WA 4MUZA 1V6WA 3CHDA 3SJ3A 1I2RA 1CXHA 1AQFA 4F0RA 7ENLA 1AJ0A 4MZYA 2H8ZA 3M0ZA 2BGQA 1FQ0A 5CC5A 2A7RA 3MVIA 4Q6XA 3GXFA 4LVAA 4FX6M 3DH7A 3G1YA 3G2GA 3PAJA 1TA3B 3CTTA 4YN5A 2ODOA 3B0XA 5KITA 5HANA 1IT8A 3SUUA 1OD8A 1F6PA 2J4GA 1YE6A 4XSLA 4AF0A 4HPJA 1G7VA 1OM0A 2A7NA 3MHFA 4IGMA 1E72M 1EC7A 2YCIX 2C7FA 5AYIA 3EEZA 1E0UA 1XYMA 3NPUA 2E77A 3TTQA 2YFOA 4EIVA 1OX4A 1XISA 2PDBA 3LB0A 3WX7A 5CZSA 4I9AA 2PD9A 3ALGA 3GWQA 3IJLA 1JCNA 4KWOA 3B05A 4IJCA 3W82A 1OX5A 4HVXA 4HSNA 3OVGA 3ZR5A 2F84A 1U22A 4XK2A 2A7PA 4AIBA 5DRIA 4PH6A 5EGRA 1L6YA 3DESA 3WLHA 6TAAA 1XYAA 3C8FA 1KD0A 3S1VA 3LCLA 4PBFA 1BG4A 1E6QM 5HNRA 4S3JA 3VIHA 4AZCA 3C2VA 2XVGA 1YX1A 4IQJA 2YZ5A 1WKDA 3M0MA 4PL1A 3S5ZA 4S2BA 5REQB 3CT7A 1GEQA 3NL3A 3QHOA 3LLDA 2Y62A 2Y85A 2DGAA 1K7XA 1G9HA 4WHBA 5H6HA 1LQ0A 4LCQA 2V30A 3TZFA 1QASA 3WUFA 1TRIA 1F73A 3NEVA 1G4EA 5HWMA 3FY1A 4ATWA 1KM2A 1KFEA 1M6JA 2GJNA 2H9AA 3LCIA 4HA0A 1E6RA 1FP8A 2ESCA 2J6VA 2VC6A 3M0YA 3TW6A 1HT6A 2J9XA 3MCMA 4CN1A 3WFLA 3BDKA 1Q6FA 1XG4A 2HNEA 5CGQA 3GQYA 2NX1A 4PRRA 4JFVA 5JBDA 4PCFA 1W9XA 2ZZ1A 3OB8A 1R85A 1IEIA 4PR4A 4XZWA 1Q7QA 1KV8A 2OR2A 3LGEA 3O15A 4FPSA 4XD5A 1DP0A 4YNGA 2WMJA 4L1GA 4BKNA 3ZT6A 2QUTA 2J78A 4GNJA 4HCLA 1G69A 2BODX 1JVNA 4IIFA 4LV9A 4DBDA 1EJTC 1V3MA 1TELA 5FA5A 4AX6A 1ICQA 5FL0A 2DT3A 2WJZA 4YYCA 1Q66A 3TMLA 1TUFA 1L6WA 3P0WA 4JQ4A 2OZ8A 3VPLA 1ZENA 3WLMA 2CWXA 1J0KA 4ML9A 5CPNA 5FF0A 1G4PA 3OLEA 2G3MA 3TSMA 4TVCA 2VC9A 1Z42A 4PSRA 1QI2A 1V51A 2R1KA 4MNLA 4MB1A 3T4CA 3T0BA 2J27A 2OO0A 3IJQA 1AQMA 3WFZA 1GOOA 4ICCX 3TC3A 4E4PA 2NSOA 3FAXA 1XLLA 4UC5A 1JZ6A 4V27A 4NAEA 2VUNA 4XD6A 1IXQA 3N2OA 3CZJA 2J75A 1W2VA 5LGZA 3QC3A 4TO8A 4RCXA 2P0OA 1ZJAA 2E6DA 1JZ8A 1TMQA 3FSUA 4HCDA 2QDHA 3BW2A 3B06A 4GC3A 1MXDA 1KLZA 4IP4A 5IFTA 2GVLA 1HQTA 1IZCA 4S23A 1CT5A 2PU0A 1N8WA 4JTRA 5EMUA 4QEHA 1VHCA 1XCWA 1M04A 1TQJA 4DYKA 4UR8A 3TYBA 2YCLB 3AMCA 2ZUUA 1UD2A 2F61A 4FHAA 1ONWA 4MJ4A 4NJGA 1E6XM 2GVJA 4UFHA 2VZTA 4QAIA 1B3VA 5JBFA 3SN0A 4E2BA 2WZEA 4H00A 3P67A 2TMDA 4D71A 5I77A 2WCSA 3AIQA 4XD3A 1MFVA 3CU2A 3JZEA 3WF2A 3GNPA 1QMLA 4WF7A 4PMUA 3RCMA 1JNEA 1UKSA 3L4WA 3NWRA 1TPB1 4PEKA 3PJTA 3V5OA 1OFPA 2CBVA 2OTDA 3HV8A 3U2CA 1E1CA 2C8NA 1OC7A 2VX4A 4A2RA 1OCBA 3I3DA 3AHXA 3BO9A 3F2BA 4XSMA 3G1FA 2B4GA 1KM4A 2IW0A 3WNLA 4RPPA 1AG1O 2PUZA 2J62A 4GVIA 5I78A 2A2IA 4J9JA 2PGEA 4IUGA 4PZVA 5E5CA 1M5WA 4C91A 1XLDA 2DH3A 3RLHA 1XP3A 4S3CA 1VFUA 1OINA 3EA1A 1XIFA 4UFLA 2ZZ7A 3CZ8A 1GGOA 1W17A 4R34A 3VYLA 5HUOA 1AVAA 1DWGM 1J10A 2GQ8A 1KXQA 1LRNA 3EZ4A 5T9CE 3FJ4A 2NV1A 3CQKA 3M46A 2R82A 1GVSA 1F5ZA 2ZDRA 2ZXQA 5CC3A 1W9PA 3W1UA 1BRLA 4LY4A 4ZZ9A 3G6MA 3CT2A 2VD8A 2QDEA 3NPXA 1QI4A 4AZHA 4Y2WA 1KXTA 4AEEA 1KBIA 4B5TA 1MNSA 3IK4A 1CXFA 1GJUA 2C16A 5M17A 3PUDA 3D3AA 1W1B1 3MHGA 2O9OA 3TFCA 1MQPA 5E9AA 3L5LA 4GCAA 3BJTA 4MSSA 2HNHA 4N6FA 5CCZA 4W88A 4MF4A 6XIAA 4JTAA 1B4KA 1J18A 2D2GA 1JCJA 4P8WA 2IUZA 1VP5A 3A22A 3C2YA 5CXPA 2OMAA 4O0KA 3ABZA 2EJAA 2WPGA 2FQIA 1RHCA 1C8XA 4FLQA 1GVIA 5HULA 3W1QA 2QS8A 4LXFA 3SURA 2FZDA 2OX1A 1MFUA 1VC4A 4Z2KA 4D6DA 4HHMA 1FFQA 5ECVA 3CAWA 2HVMA 1S46A 3WMSA 4JHZA 1ISVA 4IMCA 2HVNA 3UWZA 3FJ6A 1SFLA 3IIPA 5KEZA 4ROPA 4R9OA 5K3VA 1J2WA 1S3TC 1KRCC 1UPPA 1K8CA 3CC1A 3SSZA 3GDKA 1CENA 1Q7ZA 1SZRA 3NEHA 1SU5A 2GOUA 4DWSA 1TTPA 3VD4A 2BY0A 1LCOA 4AZ5A 2RGMA 2YIHA 3ME3A 5G5IA 2NLYA 4JTJA 4HIBA 3BLOA 1W3LA 5DBUA 2XIJA 3LSCA 3APTA 3QTGA 4NZCA 5BMWA 1JDEA 3WEOA 4BF5A 3VINA 1X8FA 2CZ5A 4G9PA 4BR1A 2Y4SA 4LOCA 3TA9A 1NIUA 6CGTA 2QJIA 3G1HA 1E40A 3W7MA 3FYYA 3AZTA 4F0SA 1C8QA 4RW5A 4WVXA 1V0MA 4JYFA 3DG6A 1FH9A 3JZUA 3HGRA 3II1A 5F7UA 3MDWA 4M6QA 2WKJA 5TF0A 1K1DA 1SSGA 1VH7A 1OG0A 3EMQA 2UV8G 4PCNA 1BXNA 4B4FA 1ISXA 3L2LA 2DVXA 1E9YB 3WF1A 4O19A 5DY2A 2BGNE 4E4FA 3LHWA 3U9IA 3AU6A 1KCLA 2IXUA 2PGWA 5DMMA 1L0PA 3D47A 1W5PA 3PBMA 2BY2A 4XUGA 1RQHA 2UY5A 4ACYA 3MJMA 3WLNA 2JF6A 4J2PA 2R1PA 3L12A 4DZAA 5JBEA 1V3KA 1Z89A 2VZVA 3GTNA 3O9NA 1XIDA 2BY3A 3AYSA 1DJZA 3NPVA 2XINA 1KKOA 1SZGA 3HQ1A 2QEZA 3DDMA 3OGVA 1BPLB 4M7SA 4HYWA 3W1TA 1G94A 5HPOA 4HZMA 1GVYA 2NQLA 3ZWSA 2OLAA 2YW4A 1PXGA 1TV5A 1NH6A 2V8ZA 1W37A 4GPNA 3KVKA 4A8RA 1A5NC 2D73A 3TSDA 1S2AA 4OE7A 1XLKA 2OKTA 3M5XA 3OO2A 2X7VA 3G22A 4O53A 3B97A 1MXSA 3MWCA 1O5XA 2Y88A 2YDAA 4RXGA 3TC7A 1PHWA 1R3QA 4XAFA 2NV2A 3DI1A 5D2WA 5D2XA 3BV7A 4KQNA 1UH2A 4O11A 3TMQA 1ZNNA 2DV0A 4H9ZA 3IGHX 1QR7A 2Z24A 1FXPA 2Q8LA 2WMHA 4MWAD 4PUUA 4LS0A 3VIKA 1SGJA 1LUCA 3IIOA 3EDDA 3NA8A 3A9BA 3PBVA 4JEJA 4DY1A 4EOUA 4HNOA 4PBGA 2WVSA 1HTIA 2DT0A 4GJIA 4LH8A 4OOUA 1UH3A 3PZ9A 3E2SA 4H9YA 3AXKA 1RCOB 5IBXA 4GI4A 2AAMA 1D3CA 2NWSA 1GZ1A 4F0LA 3BICA 4N0RA 1KFBA 3VKDA 5HJYA 4ZB5A 1BQCA 4IM4A 3PG9A 3UW6A 2P50A 1GTEA 3CHCA 1A53A 1QT1A 4CEUC 3HOJA 3TLLA 3GDTA 2XVNA 1A5AA 3N34A 1J93A 2XIMA 1S5VA 2WLZA 4GXWA 4WKFA 5A8PA 3S5YA 4H8VA 2QF8A 4NXKA 2WZHA 4S38A 1JYVA 2Y89A 4ZMGA 2PDWA 5A1AA 1CB2A 3MSRA 2ZUNA 5FAJA 4DNMA 3ANVA 2GPTA 3GNOA 2D69A 4GZ7A 1BF6A 4DJFA 3R8HA 4GVFA 1UR9A 1SZNA 3F2CA 2W9MA 3UWEA 1TREA 1HP4A 1SJBA 4D6JA 4DN1A 2B7PA 3PUOA 2BFGA 4OOZA 2VX7A 3MZNA 3VZYA 4O57A 5GNZA 2AQWA 1MRAA 1NVMA 2BB0A 1R30A 3G5EA 5JIWA 1LJYA 5M2FX 2XH4A 3PP7A 1PTAA 3UU0A 4PMDA 5HXMA 2Q01A 1U83A 1HG3A 5FSEC 1HL8A 4IJBA 1JPDX 4W86A 2HZGA 3BCFA 2JEPA 3B9NA 4F9DA 4Z1CA 4FMVA 3R7MA 2F7FA 2Y7GA 4ENLA 3FV9A 3B9AA 3EKZA 3ITGA 1R7OA 4U5IA 4JX5A 3G1RA 1QBAA 1RJQA 2C71A 3OGRA 2I7GA 3AISA 3L9CA 1RV8A 5BXPA 2CLMA 1I8JA 1T41A 2F2KA 2IQDA 4JL1A 1LL6A 3WN6A 1EB3A 1BYCA 2X40A 3RHGA 3MUIA 4CNNA 1NOWA 2KAUC 2EBNA 3WD4A 1R87A 2VR5A 1LOQA 3V75A 3SUTA 2FB2A 4PUMA 3BW3A 4Z08A 3QOMA 3L7RA 3AHYA 2WANA 3P7YA 4QRNA 3SGUA 4N4PA 1UR2A 2QCLA 2UBPC 2XH0A 3AIVA 4JQ3A 3UXIA 4Z1AA 1QBBA 4MUPA 4KRUA 5AZ0A 1I6NA 4FR6A 1EPXA 1MI3A 3GXNA 4M24A 3OPSA 2QCMA 2A3CA 1J96A 2VCCA 3VOHA 2OPJA 3URAA 1O1ZA 3XINA 2DY3A 3E0VA 3BQ6A 3WQ5A 4UCFA 4B2DD 2PLJA 3NSMA 3SI9A 4XKYA 3LPFA 2W27A 1HW6A 1YBQB 1YDVA 4QCEA 3HMJG 2Y8KA 1V6UA 3GSMA 2BXVA 2OU4A 3KE0A 5ABFA 4KIEA 1UP3A 1NWUA 1TPFA 4HPHA 2YJQA 3LCFA 1ZP3A 1W8GA 4OFCA 3BAWA 4F66A 1EIBA 4P7RA 1ZLPA 2Y8VA 1S2VA 1F8MA 4EP8C 4HQVA 2PWFA 2DH2A 2X0YA 3L23A 1TJ0A 3FOKA 3F4VA 3TIMA 2I5QA 2V38A 3EOUA 3T2OA 3B8DA 1AK5A 5K9DA 3PUGA 3HPXA 4GY7A 4NRRA 1NOFA 3U4FA 2FKPA 4L80A 4EWJA 4F2UA 2WYSA 4KGJA 2CLKA 1E4NA 4JTKA 1V8EA 1WXJA 2UWFA 3DUGA 4QE5A 2MNRA 4YVVA 5ABTA 3EX1A 2B7OA 1E55A 1T99A 1W5MA 4PN2A 3TTYA 2ZZ2A 4QISA 5D9NA 1ENUA 1GW9A 5C9WA 4J3SA 1JF6A 2PS2A 3KRUA 4FNRA 1OGSA 4CGTA 3UXAA 3CV6A 1W56A 6PTDA 1AMYA 5HUPA 2PLMA 2FZ8A 5D38A 3W70A 3E74A 5HDRA 5I23A 3WQEA 2IKGA 1WQ5A 5KZEA 3LLXA 4JGDA 4AXNA 3T05A 5J5DA 1XYBA 1UBPC 3LM3A 1PYMA 3RRXA 3TR9A 4BA0A 2BS9A 5JMUA 1O1HA 1V6VA 1XIEA 1QRQA 1LG1A 3H55A 5CZ0A 3MMUA 1WOAA 2QHAA 1V3HA 5LXEA 3T78A 1EDGA 5TNVA 1CLVA 4ERGA 3RNDA 3W7OA 1E15A 5D04C 2OWCA 3LV5A 3W00A 4B92A 3M0HA 3WJSA 1J2BA 4YVXA 3ARRA 3VDCA 1RK5A 2IQTA 1RA0A 4PUWA 3C0JA 1FFRA 1KGXA 3U2ZA 4M6UA 2O9TA 3ONBA 1BSIA 2G50A 2RDXA 3RDKA 3QF0A 4GVGA 5ECUA 4MLRA 3GAKA 1HJQA 1ADDA 3E38A 2R6OA 5HMEA 3NQMA 3BXWA 2GK1A 3W22A 1BYDA 3M0KA 4E3TA 3A24A 4POCA 4WZHA 5BOFA 4FLSA 2OELA 5C5YA 4MWAA 4FK9A 3UZXA 3AXXA 5T91A 1TZZA 3ARSA 3WQOA 5I5RA 3CYVA 4O12A 1UQYA 1OT2A 4OBSA 2PTYA 1IHIA 3WK2A 4KBXA 1G01A 1TWIA 1UR3M 3UYCA 3LMZA 3ITVA 3LPGA 2NV9A 2P5NA 3GC5A 1V08A 1VPYA 3QW3A 1TA3A 4RLIA 3UZYA 3PZQA 2JIEA 1QWGA 3W07A 4L9XA 2EO7A 5LGXA 5A8OA 5DO8A 3W2KA 3QJAA 4C5ZA 3LZ3A 3OA3A 4LYKA 4HJWA 1WP6A 2W3ZA 3UR2A 2VD9A 1H7PA 4ZSTA 1T8QA 3T4WA 2VCBA 1TRDA 1YLVA 1F05A 3W87A 3M44A 3CZGA 3WJZA 2J9ZA 3W2JA 4IZGA 4TQTA 3STEA 5AYXA 4S3FA 4I9MA 4EX4A 4Q6JA 3U4AA 4W7WA 4UTMA 2R91A 2YCJA 3R4IA 1UUQA 1BAGA 2DIKA 2I57A 2VFFA 1XBZA 2HJPA 1VEMA 4WDXA 5K4ZA 5EFDA 3BCDA 1P0BA 3DYOA 4O13A 5AHIA 1Q2SA 3F7JA 5E0KA 4W87A 1GORA 2F2HA 3JU2A 3W72A 5BOEA 5BRBA 3ANUA 3IACA 3MWAA 2ZZ6A 4WUIA 3LI0A 4DVOA 3CL7A 5C2GA 4ZL1A 3VDHA 4GJJA 3JS3A 2YSWA 1R8LA 1Q6DA 2Q6ZA 3ARTA 1UP0A 5REQA 1OB0A 4RPQA 2ATMA 3FHQA 3ZM8A 3EKGA 3K8MA 1K8XA 3CL8A 1CNVA 1VIWA 4QE4A 4QHRA 4A3RA 2FIQA 4AIUA 3STFA 2C3ZA 1NP0A 3QGVA 1TJ2A 1XD0A 1YDOA 3KCJA 3UA3A 3LSBA 1DBTA 2PGFA 4XD4A 2ISDA 4E8DA 1JL8A 3VA8A 2FVKA 3QZAA 1EP3A 4NASA 3ISIX 2UY2A 3H54A 1J5TA 1PVNA 3QXBA 1VFSA 3R11A 4Q8UA 1DWAM 3OOQA 3W4RA 4L65A 2HBXA 1K9FA 3UEQA 1SZEA 1GPFA 5FEPA 1NU5A 1A0DA 5CBBA 4TMCA 3NL6A 2X30A 5G2IA 5AHMA 3DHDA 2CCRA 3DG3A 4FEZA 5LKYA 3O07A 3W53A 2Z1BA 3EXSA 4Y6GA 1K7FA 1UKOA 1UH4A 3K4WA 3ZS4A 1R3VA 4B91A 4QDWA 3TVAA 3QPYA 1A5KC 3TR2A 1QNSA 2GSEA 1V4YA 1CI1A 4B4HA 3UWVA 1KRAC 2YOCA 3AIRA 2OZ3A 4JFTA 4Y9AA 3T7VA 4OIFA 4QBXA 2OSXA 1UBSA 3MVTA 3VMPA 2VNCA 1WO2A 3ITLA 1MUMA 3V16A 3GUWA 1MW1A 4B2DA 2D0HA 2A79A 3PHAA 4JFSA 3S4TA 4MY8A 4HSHA 2J25A 3NIYA 4GIEA 1JDCA 5CG7A 4LB3A 3GIYA 1D9EA 4J3ZA 4QSFA 4JKKA 4KCVA 3GE7A 4O0QA 4UB9A 3R79A 4AZBA 3WLJA 1HVXA 3STCA 1BG9A 4W85A 3ARXA 3M6YA 1QU4A 3B9DA 1QUMA 1UZHA 3AHVA 1IT0A 4M0XA 1XF0A 1P6BA 3E0WA 3I10A 2VUYA 3WUBA 4NSBA 3GXTA 1V77A 3NQVA 3ARYA 3UQNA 1EC8A 1RCQA 2G97A 1B90A 3DKJA 3ZQ9A 1SMAA 2AGKA 5A5WA 1H51A 3VKJA 4MKNA 4UCGA 3GR7A 2YCLA 4UTJA 2PDGA 3UR7A 5BMXA 3K1GA 2HCVA 1E43A 2J7FA 5DT5A 2WVVB 3PTQA 3KL3A 4C6NA 4D6CA 1MUCA 4KF1A 1ZCCA 4ZGYA 2FGLA 4GKLA 4EPKA 4MJMA 2XPKA 3QV9A 4MNKA 2OKOA 4QITA 1IE7C 3W1AA 4PUEA 4MAZA 3MCOA 3H6OA 4GX9A 3UNDA 3HF3A 2PF0A 5A6LA 1HKWA 3IJ6A 3CUGA 1D7FA 1ONEA 3SRDA 4JTHA 4LANA 2WZIA 1UIPA 2NQJA 3AICA 2JKAA 4LPCA 3NQ7A 5D8WA 3DU0A 2DU2A 3AWNA 1RUSA 2VDHA 4C6CA 4QM1A 3WMBA 3QSRA 4WSKA 4XO7A 3N11A 4J3TA 4NU7A 3THAA 2ABBA 4GYPC 3PTMA 3MI2A 4W89A 4B5NA 3HJEA 3EEGA 5AVNA 4H8UA 2GVGA 2Y0FA 3HQNA 1T6MA 1BQGA 1XLEA 4OU1A 4MIMA 3QMTA 1JYXA 1PPIA 1JPHA 1J0HA 4S1FA 1K4GA 3CO4A 4DF2A 1FBAA 3FS2A 4HA1A 2XVKA 3CWOX 4TX8A 1DEDA 2J24A 4L4LA 1M7PA 3HPFA 4URIA 3WH7A 4Q8NA 2WWCA 3NYZA 2O9RA 1E1EA 1R3TA 4CQ9A 4KWUA 1GEHA 1OBAA 4K2SA 3QRHA 3KP1A 4IF2A 4E5TA 1QPKA 4DJED 4LU0A 3TYDA 1HVQA 3EXTA 3RU6A 1MQRA 1PBGA 4IGSA 3ZYZA 3ARWA 3A23A 1ML1A 4XV0A 1OYBA 3UPWA 1DIDA 3RU8X 3FEMA 4JX6A 1Q6QA 4OV4A 1VZWA 1GTHA 3AROA 4H19A 1RXOB 3SN4A 2GSJA 2D24A 5D9PA 1DL3A 1RCXB 3A64A 3U7VA 3QHNA 1KM6A 1J4EA 3M0VA 3C52A 4UOQA 5DXYA 5F2MA 3B8WA 3Q45A 2R24A 4AD0A 4DNHA 2YL8A 2PBOA 3E02A 3ABOA 3U7BA 3EX3A 3FA4A 4Q32A 3G3MA 4DQWA 1TR9A 2OB3A 4E0CA 4PEEA 1PDZA 2Z25A 3RJXA 3WKZA 4P7QA 3T55A 3W37A 1R5YA 4JHOA 4QDPA 5AFDA 4JTIA 5LIYX 3E5PA 1IYXA 8XIMA 3H2EA 4OGZA 4Z0JA 3UWYA 4K3ZA 1B0IA 3HA1A 2HXTA 1OEPA 5H91A 1RK6A 2DT2A 3VD9A 3VDGA 3E96A 4YWIA 3UCQA 2V3EA 4LUTB 1BVWA 1WDSA 1IEQA 3WNKA 4M1BA 3O63A 4P7NA 5DX7A 1E6SM 1IWPA 3DHPA 4EXQA 4GUIA 4AC1X 1RPXA 2Q8ZA 3WD3A 3I6TA 3V35A 1X96A 1KM1A 1IZJA 4JIPA 1OFEA 1W3NA 1K6WA 1WE5A 3UJSA 1XLAA 2VC5A 3PPCA 1NWTA 1W8SA 1XSIA 3T0TA 1IEVA 4EVZA 4X3ZA 1DXEA 3IK2A 1GQNA 2PGRA 3GXMA 3DENA 5EBAA 3LXAA 2PSNA 3QR1A 4HCHA 4F4RA 2D22A 2QT3A 1ZRQA 1QHZA 2Q02A 3SY8A 4J40A 3GG8A 4YYFA 1R9ZA 1XPYA 3IVSA 1NQKA 4FB7A 3GFXA 3H4GA 3GIPA 2BASA 1V0NA 1RH9A 2FTPA 3FAWA 4US5A 2PDCA 4FLRA 1PB0A 5C55A 5AHEA 2MUCA 3BMWA 2NW0A 2FJUB 4E4UA 1H0GA 3P81A 3EX2A 5EA9A 1DQUA 3M64A 4BFAA 4GMEA 3O0KA 4DWDA 4I6VA 1EJ7L 3H12A 1U1JA 1H7OA 4TUFA 1EJRC 3ZVIA 5BW6A 5EMYA 4C1LA 2WM0A 1K03A 1LBLA 2YA2A 4CNOA 4TVDA 4XTDA 4LRSA 6ENLA 2CESA 2E5CA 4OWGA 3PNZA 5HBFA 3A12A 3LX9A 1FRBA 5EPDA 2HROA 3LOTA 3IJDA 4U3AA 3WQ8A 1E0VA 2VT0A 4UR9A 4NNCA 3P5ZA 5FIPA 3LDVA 3UVAA 3H7RA 2AL2B 1J0IA 3RMEA 4HBKA 2O7QA 2RAGA 3RO8A 1XIIA 4JIIX 2C13A 2Q09A 2G8ZA 3WJWA 1BFNA 2WVUA 3WDIA 3A5FA 1P0DA 2XUCA 3M7SA 3GC2A 3W0KA 3GNXA 1TTIA 1K9EA 2OZTA 2QGHA 3KBMA 3MSGA 1C92A 2QV5A 5BYWA 1KGUA 1VBJA 4OKDA 4Z2JA 1JNDA 5D9MA 4L64A 1KM0A 1LORA 2I5IA 1FWCC 2KZHA 3BLDA 3CAKA 1JJKA 4FXSA 5CPQA 4BEUA 2CETA 3RM8A 3P80A 1EDTA 4XX6A 4UQ9A 1RALA 3GIQA 5F2IA 4WDTA 3ZVHB 2BSLA 1PEZA 4QGCA 5E09A 3WEZA 1TTJA 2TRSA 1U1HA 4HU8A 3E49A 4QEEA 5BNKA 1MRQA 3L2IA 3STGA 3W2MA 3V0SA 3V5CA 3SGGA 4U2ZA 4DO7A 3RCYA 3MYPA 3W7KA 4EAMA 4JZ5A 5J04A 3GVGA 3FA5A 1E5NA 1F4HA 2Z1WA 3IRSA 5AECA 3CB3A 2WSPA 3BLKA 3LPPA 4GHRA 1KGWA 3SO7A 4P8VA 5HQLA 3NVDA 1EEXA 2CKSA 1TE1A 4FNTA 4ZQMA 1WDDA 3GKFA 2WCAA 1UQZA 3CGTA 2E9LA 1E9ZB 4RKAA 4QG6A 3W86A 4EXBA 1JXJA 4AQLA 2J7DA 3MBFA 2B0MA 3TN4A 3SRFA 1VCGA 3B4YA 2ZBTA 2WCGA 3VOCA 4JNYA 1E6PA 2UY4A 2XFFA 2PTZA 3MCNA 3WL0A 1X8CA 4KIRA 5FJJA 3T09A 2OYKA 4DBWA 3NAVA 3OZMA 5FJTA 1OG6A 2VDIA 3BAJA 4Q8QA 4O54A 2C0AA 2PRMA 4H1ZA 4IX0A 5C9XA 2ZZ5A 3F4DA 3NPWA 4NG3A 5ABEA 4EWND 2ACQA 1ZBVA 4H6QA 3K1DA 1R3SA 2QW5A 5BU6A 2HK0A 3C3UA 4EPEC 4RNIA 3NSXA 1FWIC 1TO3A 2A3HA 3VKAA 1YHTA 3U6WA 3A3HA 3RCNA 3PY2A 2G4FA 1WKEA 3KTXA 4GFSA 4NF7A 3MDUA 9XIAA 1XYFA 1JDDA 1T40A 4DJEA 1J0JA 1UUMA 1DWFM 1POJA 5CC7A 3HN3A 4N9BA 1OYAA 1J79A 4RV8A 4WD0A 2CBJA 1TWZA 4GFIA 1YYAA 5IOBA 2IKIA 2F38A 4XZBA 3PK7A 1CTNA 2GJRA 4JTDA 3M16A 1HGWA 1JULA 5I07A 2J7GA 3QR0A 4PMRA 3RITA 3VDBA 1ESWA 1CB7B 3BQ5A 3UETA 3U0HA 1YBQA 3N12A 3UG5A 2NQ9A 3C2FA 3RJYA 1QNQA 1Q6GA 1S5TA 2OOFA 2VDGA 4DXXA 1GJWA 4I9TA 4XB3A 3S5SA 1DE6A 3FYPA 4HA4A 3VU2A 1XDLA 3URBA 1QAPA 1WDRA 3REQB 2WW5A 3H8AA 4AISA 4IMGA 1JR1A 2H3DA 3GD6A 3W6YA 2FPTA 1R47A 2RH9A 2X7WA 1TV2A 1KRMA 3U48A 2WQPA 8XIAA 1OC6A 4GLEA 3N6HA 4O1DA 4YJ5A 4TX6A 4C90A 4Q8OA 2X1IA 4CQAA 5FOOA 3S42A 4J28A 4UTIA 4O14A 2FMNA 5AC6A 4ORMA 3SZ8A 1OWQA 3M07A 1N8FA 1A5BA 4Y9OA 2F9RA 1C29A 3U2EA 4PUDA 1SPQA 2G3FA 1YPIA 4C7DA 2A6LA 3M0LA 1UJQA 4U5KA 4LF2A 2WC3A 2ZA2A 1UKTA 5A6JA 2UZ9A 2PA6A 3BGGA 2V0TA 3ONCA 2J7HA 1L9WA 1Q8JA 1YMYA 4MYXA 3L4ZA 3V18A 2A3BA 4IGHA 4QS6A 1KCZA 5HQMA 1JCMP 3EXRA 5G1TA 2FYMA 1Q4NX 4LEFA 3OVQA 3B0VC 2PU1A 3S9ZA 1M7JA 3F4WA 2GGGA 3QGAC 3VKBA 2CZVA 4K37A 3TQVA 3MUXA 3TSBA 4CNSA 5GPRA 4LAMA 4KFNA 4PCPA 4JTLA 2C6QA 1Y65A 5KZMA 2QAPA 1DXFA 5GNXA 4Q4OA 2PTWA 2WZMA 3RPDA 3NL2A 5LA2A 2Y7EA 3MKVA 1AW5A 1VFHA 3KBSA 4Q8WA 2XFRA 1SVDA 4CD6A 3SIZA 3E2QA 1ELSA 3L4TA 4WOQA 1XGZA 3T40A 2FGZA 2JQXA 4RNJA 3V0TA 1DXIA 4EXAA 3WBYA 2VGFA 3MI3A 4UQAA 2J66A 3IGUA 4PMYA 4TOQA 5AYBA 2ZUVA 1W1VA 4M3PA 3WUEA 4WX2A 3EBVA 3GHSA 1H0IA 4XAYA 8RUCA 1A80A 2AKZA 5SWUA 2ANUA 2O7SA 2FDMA 2DIJA 5FJPA 4PMZA 3PULA 3TYZA 3CLMA 1M9HA 2QMJA 1PKLA 1H41A 1CX9A 4GOAA 4UWMA 4NNAA 3TYCA 5I00A 3KEHA 4GI9A 5XINA 1A5UA 1AD1A 4HZ7A 2V67A 1WZKA 4GIYA 4XZNX 1B3OA 3EPOA 2D1ZA 4W7UA 5EL1A 1P5BA 5E6ZA 3CEPA 4H9TA 5AVHA 1K9DA 1XHGA 4KCWA 3S8HA 1RBOB 2ZUWA 4GUJA 1PX8A 1ONXA 4HHHA 4R85A 1VRXA 2XDFA 2ISWA 4IIEA 2QV4A 3TV8A 3DFNA 3GLCA 3BPWA 5H1WA 3ALFA 3QQ1A 2PZNA 3KOFA 3BGJA 1VEOA 2AMXA 3SCPA 1M68A 3O6CA 5D30A 3T6CA 2YLAA 1QFEA 3VX0A 5B7ZA 4FXRA 3QBUA 4GG9A 4JIQA 4D6IA 2DJXA 1GOKA 5JUVA 2A5HA 3GNRA 4AAJA 2V3GA 1XINA 2AAAA 5FEZA 1CZ1A 2GDUA 4B3KA 4AXKA 3APYA 5LYRA 1NJJA 2Z1SA 4GUGA 3FGCB 3L0NA 1GCYA 3EMCA 2E5DA 4MJZA 4JN6A 2OOGA 3UP8A 1L6SA 4CD5A 4YHGA 4AZ7A 2V5JA 3B0YA 1YXDA 5LIUX 3GXIA 4F40A 3D0CA 1XUUA 3A3WA 2ZXDA 3CUHA 3W83A 3K13A 4I3GA 2RGLA 3UWWA 1JZ3A 4IFKB 4A2SA 1XXXA 1PYFA 1Z3NA 3RRAA 5GJPA 2OJPA 1FHVA 3OZYA 1JGMA 3CYJA 3ITYA 2CLFA 3MQTA 1UP2A 4JDBA 3N04A 5K9CA 2V5CA 3GDMA 4JBRA 3MMTA 1DJXA 4JTTA 3TZNA 3C0SA 4TV6A 5AC7A 1SR0A 2J8GA 5GVJA 5HJLA 1SM9A 5CZJA 1ZAHA 1T0OA 5CG0A 3DX5A 4PTDA 4C60A 2OT0A 1QOPA 5BCAA 3N2BA 4YTQA 5J5RA 5RUBA 1B1YA 1JQVA 4PMOA 4K38A 2OWXA 4AEFA 3N14A 2OLHA 4AHOA 3WEMA 5D33A 4O18A 3IIXA 2QCNA 4GO9A 1TCMA 1UB3A 5BXRA 1C9DA 4AB4A 5T9BG 2ISSA 2QLYA 1WB0A 3LGGA 4DF0A 3GVVA 2VGIA 4IX2A 3MO7A 1GQIA 2W67A 2Z27A 1FWDC 2OGYA 1S2UA 1RA5A 2BDQA 2QPUA 3N17A 8A3HA 4JQ1A 4ZBCA 2EQDA 5A2AA 1KKRA 1ZBWA 1VJSA 3MYOA 3IV8A 4BI7A 2NXIA 5BOOA 1IIHA 3AIWA 3TTSA 1VCFA 4OTKA 1RQBA 4BF7A 1AJZA 1I2OA 2FB3A 3BAYA 3E1F1 3P8JA 2Z6JA 3A6OA 5A8QA 4DPQA 1T5AA 1F2JA 4ZOBA 5A8GA 2E9BA 2DSVA 1XBXA 5B7YA 1IR2A 1JPMA 4OUIA 1MEHA 4NJKA 3DFOA 3CZKA 3MI6A 3RM9A 3UR5A 3KVLA 1NM9A 2CLLA 4MKSA 3HPSA 1GNXA 4DO4A 1SO6A 4A3YA 4ILSA 4J5NA 1H61A 2GYIA 3WMLA 1DJHA 1VKFA 1AZ2A 3WFAA 2D23A 3QPEA 4PC8A 3IPWA 1O68A 1G4TA 3G1VA 4K7VA 2QULA 3ABRA 3AI0A 4K1GA 1GOMA 4GYFA 2O56A 1US3A 3MJYA 4CCCA 4KS0A 3S2NA 1ZBKA 2WVVA 4DLFA 1EX5A 3RR1A 4MAVA 3TN6A 2R1NA 1HGYA 1B5TA 1AH0A 1A5CA 1NAL1 5MF5A 2WJEA 2VZOA 3SFKA 2E40A 1OSEA 3CIWA 3NM1A 1ECEA 4A8IA 3PPFA 4NUWA 3M5YA 3HPZA 1FWNA 4N9CA 5LZLA 4W5ZA 3W29A 3P3BA 2JK2A 3IJ7A 3GKAA 1JXKA 1BWVA 3G8EA 4J3WA 1NELA 2WHMA 5I3HA 1IWBA 4F9JA 2DORA 4QNEA 3O05A 2HISA 1NFPA 2NSXA 3ELFA 5EBUA 4KFOA 3AYTA 3KLKA 3UPBA 3WK1A 1DYSA 1E56A 3S0CA 1XM3A 3HFYA 4DZHA 3KAOA 2DUAA 2XIQA 1WDQA 2BNJA 4KFPA 1GOWA 4IQLA 5D4YA 2Z4GA 5FJIA 3W6MA 4NJJA 1TZ9A 1YXCA 4N02A 2PBGA 4MZ1A 5CLWA 3GVQA 3UNTA 3YPIA 1HKVA 2C0HA 5FEWA 3CZLA 3BG5A 3HGOA 4WSHA 4A8NA 3TEVA 1Q13A 1TQXA 2ZRXA 4PMJA 3SEPA 5HOSA 4HNLA 1WZMA 3ID7A 4LAUA 1H7WA 3SIMA 2JFEX 4PB5A 2OGJA 1U5HA 1GKQA 3VKCA 3ICJA 2FVLA 1VHNA 1FXQA 1W1ZA 3L4YA 2GUBA 4RE4A 1NQ6A 2QJGA 2VGGA 1Y5XA 3S2LA 9CGTA 3QR3A 3GFYA 1IXNA 5F1UA 1WKFA 1G5AA 2ZX7A 3P82A 5A94A 4CU6A 4HB7A 2D3LA 3EB3A 3L0GA 3I7RA 1FP9A 4R7JA 1PUDA 4AC7C 2GVYA 1Z7AA 1C8VA 3DI0A 2ZE3A 2GFTA 1N8IA 1ITQA 1NSJA 1R7AA 1U1UA 2YXGA 4U4MA 1LWIA 1D2KA 4GABA 4J27A 3ECQA 4H7ZA 5CGTA 4LAZA 3LTSA 3WD2A 4FNSA 1ZU8A 3ENLA 5GJNA 3UFYA 3CK5A 3HJZA 1VYSX 2L5HA 5HMSA 2GJXB 4HSOA 3L5MA 1HKJA 4HN4A 1K9TA 3ZIZA 1MW2A 3HG5A 4R33A 1IF2A 4IH3A 2CERA 3EOOA 4LUTA 3PBGA 4GRSA 3SDOA 3W7DA 5JH1A 3CO8A 1W1PA 3CMJA 1ECQA 2J7EA 4MFDA 1F3WA 3G8RA 3XISA 4XUYA 1Q3NA 2POZA 4ZQNA 4W8AA 4DLMA 2DW7A 1UD3A 4AMAA 4D72A 3NYDA 1V7AA 4ZTXA 1ICPA 2O92A 3QC0A 1YDNA 1CCWB 2DUZA 3OW1A 4HNCA 3VM5A 4C7FA 1C3FA 1V6TA 5D03A 3ZT5A 2GJLA 4H6EA 2BGSA 5C7HA 1I2NA 3DFPA 1AW2A 2O55A 1TPVA 2VHLA 2HK1A 1K6AA 1C9WA 1EF2A 7REQB 4B5VA 2YDRA 4O16A 1FWTA 1R38A 5C9RA 1KFCA 2CNCA 1LG2A 2ZOXA 4V1YA 1PS9A 5LA1A 2P3EA 3IIZA 4QJ3B 1C7SA 1LTDA 4QROA 1EHNA 5M03A 5A8MA 4J35A 2VENA 1OIMA 2PDLA 3PC0A 1ZHAA 2PP3A 3R5EA 5CSYA 3DBPA 4ICMA 4US6A 3LBOA 1B4EA 4NZ4A 2XM1A 5M1TA 3WY1A 2W4XA 5AYYA 4Q8MA 1E1FA 2DZXA 4JNZA 1IT7A 2EAWA 3PZNA 4MPQA 7TIMA 3EA3A 4HD5A 3U5YA 3I4EA 2O9PA 3AOFA 3FLUA 1UR4A 1XC6A 3KVJA 3PZMA 5A6KA 4WXZA 4GC4A 2AL2A 3PPGA 4L9YA 1TSIA 3OHIA 3OVPA 1SJDA 4GJ1A 3TYUA 2E6AA 2RDTA 3CXOA 4UTTC 2X0HA 5F4SA 2Z0IA 4UZUA 1LM1A 3EX6A 2PWEA 3W2NA 3TXZA 3O6YX 1QI0A 7A3HA 3FDKA 3W23A 1HKMA 2XH2A 2CZFA 3VIFA 1FTXA 2Q71A 3NQ2A 3WYZA 3CUJA 3CUXA 1Z6KA 3MO4A 4H6RA 1K4HA 3BV4A 1XRTA 2D0FA 3RN6A 3T08A 3RAOA 3GBEA 4GZIA 3ZVHA 1LP6A 2ZE0A 4XIMA 5FSDC 4QG8A 2RHGA 3W73A 1JYNA 4IXXA 3WQFA 1NOUA 2X09A 3AYVA 2VQUA 4JAWA 2D2JA 3AS3A 3VM7A 4K8EA 2DZTA 5TIMA 5GNYA 3HURA 1OF6A 5AOUA 4ZA0A 2XSAA 2E67A 1T7LA 1LQAA 4FO4A 2Y63A 4E2VA 3GM8A 3GU9A 4QIUA 3VUPA 3PTKA 1H4PA 4MG4A 1V3JA 2ZA3A 2AQOA 3UXDA 4A3QA 3A47A 1BKSA 1TIMA 5G2WA 4FP1A 2NT1A 3R2GA 2O4QA 4DWSD 2PDXA 4GY1A 4LW7A 2ZZ4A 1W32A 4UFMA 4IHCA 3JVAA 2F6KA 3QSTA 3G1XA 3N9KA 1XCXA 3KFTA 4BS0A 4O8RA 5C71A 2Y7FA 2JIWA 2XVLA 2FHCA 3MU7A 2XVPA 3CQIA 3AQUA 3GZAA 5CSSA 2G41A 2Y2WA 2W62A 3ZMRA 1M65A 2WSYA 1EZWA 2VKZG 3WCZA 3P93A 2X8RA 4YMZA 4AIEA 4GQQA 1KFJA 1P0NA 2EG7A 1X6UA 1YQ2A 1WA3A 2OODA 3QPZA 1EH9A 1KW1A 3STPA 5IBXC 1H1ZA 5L6UA 4I6KA 2DW6A 5CJ5A 2H8XA 3LBCA 4V33A 4L5ZA 3GHRA 1LQ2A 4FLOA 3L5AA 4UZSA 3UJFA 3WSUA 4PODA 3WQWA 2R1MA 3SN1A 5B80A 2VCAA 4JIEA 2QUNA 2VM8A 2PLCA 3RGTA 4YTTA 1W9VA 2CZEA 4KWVA 3S83A 3R58A 2BXYA 4H6KA 4NP7A 4Q33A 3DZ1A 1YXYA 3KHDA 3NQ6A 4Y9MA 2DVUA 3OGSA 3PB0A 4GCXA 3TUUA 1L8NA 3PJWA 4OHQA 2CITA 3SUSA 5G4EA 3G0UA 1DWIM 1S39A 3KCLA 3GDBA 4G8TA 3N2MA 5E0CA 3MANA 1UMLA 4LUSB 3TROA 2VEMA 2P3ZA 1P7TB 4GQGA 4JN8A 4B5UA 1EQCA 4HU4A 4JFWA 4N7QA 1BF2A 3O6AA 2ZICA 4RZBA 4QLLA 5D37A 3K4AA 1H63A 1UHVA 3VGBA 3PS7A 4S3EA 3NQBA 1KCKA 1FDYA 4KWWA 1JUBA 2HQAA 2PDHA 3BL3A 2GGHA 1NWSA 2BMBA 4LS2A 5FESA 1AW1A 1F76A 4GYJA 3B03A 1QI5A 3B3DA 5AYZA 5DCBA 4E2DA 1E51A 3CQHA 3HBLA 1YTDA 4PA8A 1DIKA 4G6CA 1PZ2A 4Y90A 5KSWA 2PDPA 3REQA 3S2MA 1O5RA 1RJRA 3MBDA 1O5QA 3WUGA 1KXVA 1EJXC 1A3HA 4R3UA 4KWSA 5DANA 2HWGA 4AY7A 3RO6A 3UBPC 3FIGA 3IWPA 4AHPA 4AWUA 5G4WA 1BVNP 3VGGA 1EA0A 1Y8BA 3VOFA 3ABXA 5AHLA 4GYPA 2YZRA 1R2RA 4IT1A 2W0UA 4V1XA 1MZRA 3DKLA 3W7LA 3I65A 1BSLA 2RJGA 4BY3A 2XZ7A 1MWOA 3VAVA 2OG9A 4QS5A 4NJHA 1KWKA 4JKLA 3LERA 4ATLA 4DBEA 2BLEA 4FF5A 1HJVA 4W7VA 1NTHA 2PURA 3NCOA 5BWFA 1KR0A 1EGZA 2FZBA 3QTPA 3KX6A 4M1RA 2CXGA 4DJFD 4ATDA 3QV7A 1DIOA 2D2OA 4LX4A 2PDNA 3LBMA 5U4NA 1GUVA 3E0IA 5IHRA 3CASA 2OQLA 4LALA 3K5XA 3GG7A 4R5EA 1OFDA 3AMLA 1PZ0A 1W9DM 3H23A 3KDNA 5CH9A 4A21A 1UD8A 2WB5A 2C15A 4H9UA 4CNPA 1GONA 2PCQA 4I5UA 4QAWA 3BWWA 3GUGA 4ROQA 1SQ7A 3W26A 1B54A 1P1XA 4Z2IA 1QTWA 1E71M 1F7BA 3UG4A 1FWSA 1WZLA 3RLGA 2PDQA 5A2BA 3APGA 4AVFA 2DZSA 1QPQA 3BJFA 1CGVA 2QPXA 4HHPA 2FH8A 3S1WA 2FZ9A 3LM7A 4IWWA 4W8LA 3QLDA 3LCHA 4LUJA 2QCFA 3TP4A 3WZ0E 4O10A 3MHUA 3VC5A 1QDSA 5D2YA 4UFJA 1OFQA 2D20A 3BAKA 2HS8A 3FDGA 3W7HA 2P8BA 3VIOA 4HP5A 1WNOA 2WMIB 1R86A 1UR0A 5HNTA 4MNMA 2OYLA 1OK6A 1OVDA 3ITTA 5CBJA 1VENA 1X7IA 3TOPA 2CLIA 2ZQ0A 4X22A 5I24A 2PDJA 4I7WA 3QKZA 5LNRA 1EPVA 2VL4A 2FPVA 1BVZA 5XIAA 3HTWA 3XIMA 1R0MA 5FF3A 3AIEA 3GH5A 4OZOA 1UR8A 3L66A 1KFKA 3W7JA 1UOKA 5PTDA 1CXLA 4QE1A 4UTWC 3BOFA 1XIMA 4IPLA 1GHRA 3VIIA 2GJPA 3PFRA 1ITXA 3WLIA 3PNUA 3BTNA 1XDJA 3RXZA 4R27A 3W71A 1J11A 2PEVA 2ISFA 1TCDA 2I16A 3MUCA 4QQ3A 4I8DA 4FX7A 1V3LA 2YFNA 4CNTA 3T0AA 1A3XA 4DBUA 3HG2A 1S5WA 2XN2A 4FOUA 3SGZA 3W7IA 1ME7A 3TDFA 2WVTA 2QYGA 4Q4SA 6XIMA 4UUIA 3URQA 1I2PA 3MV01 3TU9A 1ODUA 3FGCA 4D2JA 2PC8A 1S1PA 3NJ3A 3U57A 4BZYA 1KNWA 1XLJA 3SBFA 4UNKA 2WLYA 2V2HA 4WRHA 2A1YA 3EAUA 4I5RA 1OCQA 4ORIA 4LGXA 5AHNA 3K46A 2F6UA 5A6SA 1UA3A 1XW8A 4MPKA 1NFGA 2VQTA 1B31A 4IFKA 3K8KA 1LRTA 1HO4A 2GZXA 4XQ6A 1KBKA 3TC6A 7CGTA 4JIRA 2GWGA 4IICA 1R3RA 1EJVC 3MUAA 1XIJA 5D2VA 1BKHA 3AALA 2VVNA 1RVKA 3LMYA 3GYEA 1VBGA 1E6NA 4NI3A 5DLCA 1S3HA 2X1RA 5FF2A 3C2RA 4LBRA 4R7OA 4H2HA 4H83A 4HMDA 1TPH1 1GYLA 3QGKC 3WG6A 1JDFA 2DVTA 1H62A 2ZRZA 3IUHA 1SYTA 5TD4A 1XIGA 4NAFB 3VE7A 3IVUA 5LHFA 1CPUA 1CGXA 3T42A 2CXEA 8CGTA 3USBA 2CPUA 3O16A 1A5SA 1DWJM 4QG9A 1HO1A 5D2TA 1A5LC 4RV3A 3UXKA 5AC8A 4S3BA 1S2CA 9RUBA 3WNNA 4D8AA 4C6EA 1D7KA 2BV9A 5AY7A 1ZSXA 3M1ZA 4AFYA 4KCUA 2YR1A 3WL1A 1EGVA 4PMXA 1PDYA 1ZY9A 2Z00A 5DRCA 1V02E 5KTLA 4J3XA 4XG1A 4OJYA 2Z2BA 1Z9AA 2ISVA 1L6FA 5HR7A 1LDCA 2IQ0A 4ECLA 3F5LA 4C65A 4AZGA 3NO3A 4O8AA 1A50A 1W3JA 2CLHA 4UNLA 3GRIA 4O4WA 1ZBCA 4UTFA 4Y8FA 3LENA 1ME9A 1W9BM 2NUYA 2PDYA 1FVPA 4O52A 4ZCWA 4D6GA 1C90A 1KTNA 4KRTA 5EMMA 3R12A 3AHTA 2RKXA 4X2RA 1I0BA 4JY8A 3WLPA 4Q4PA 1BWLA 4B15A 3HGJA 1BYBA 1OJXA 1Q65A 1QO5A 2INZA 4BF9A 2XWDA 4AD3A 1WXYA 2YCKX 1OHLA 3CH9A 1VAHA 4WLCA 1TE6A 3NQAA 2HEJA 1KB3A 2E25A 1T96A 4MY1A 3U8GA 3WLSA 3VFCA 2CLOA 1SSDA 2CU0A 3AUOA 3VOJA 3LUTA 3OBAA 2VGBA 4EKJA 4L56A 4LUYA 3NOYA 1F8IA 4H2CA 3BLIA 3BZGA 4AYGA 1K8ZA 2PWDA 1UKPA 4AG0A 1TV4A 3RLVA 3WDRA 2C19A 2Z1VA 3W25A 1W3KA 3ZLHA 4ZB2A 1LT7A 2J6XA 2YLLA 4AU0A 3GK0A 4ZQOA 4GZEA 1FHDA 1UG6A 4L1XA 4YLWA 2WMFA 4WXYA 3FK4A 4IISA 2QNEA 3KHJA 3M4HA 2OSYA 1ISWA 3QMRA 5CPOA 2DSKA 5HWNA 4IIBA 4QSHA 2DSWA 4P7LA 1VCVA 2XIBA 3BOLA 1MZHA 2DZVA 2DFAA 2YBTA 3BGAA 4YVPA 3ZJ8A 3BG3A 4K39A 1RBLA 2V81A 3KRSA 1MXGA 1W1TA 2FZNA 3TJIA 2RUSA 1JPIA 3WDQA 4LVFA 4CQ8A 4IFRA 4HKPA 1KFWA 4AX7A 1VLWA 1VPXA 4DXVA 3CMFA 2GQ9A 5C70A 5I09A 3E2VA 3TQPA 3L65A 2V2CA 3UF9A 1HX0A 1OT1A 1GK8A 4LV4A 1KBLA 4M51A 2DSUA 1AODA 3DFSA 3KVMA 3EDFA 5I3KA 5I3GA 3VMNA 3W2LA 4YTRA 1UD4A 1PL9A 3CV7A 4HPGA 3U5UA 1QNPA 3VNJA 1JPKA 4Q8VA 1J9YA 2O0TA 2XTKA 4ZO6A 3M5ZA 4XBKA 2HTMA 3LRKA 4RZ5A 4RNFA 1E4IA 1HL2A 3FN9A 2FTWA 4JN7A 1HJWA 3UERA 3IANA 4E8CA 5FL1A 4IXHA 3N13A 1KXHA 1GG0A 4QX4A 3C5QA 4LWWA 5I3JA 3P0XA 5D09A 1JZ7A 4KW2A 3VNLA 2X42A 3NGFA 3F2DA 5KMYA 3UA4A 2DT1A 3A4XA 4IP7A 2OZ0A 3HB9A 4AHQA 3LZ5A 1UD5A 5DBTA 1US2A 1Y5VA 2X0SA 2Y6ZA 3ZSSA 1UW9A 4NIRA 3NQDA 4UIOA 4DRSA 2QCHA 1GG1A 4DUVA 2IS7A 4ZVJA 3M5VA 3GDLA 6ALDA 4E2OA 1ZJIA 3AS1A 2CLEA 3RX2A 4FNUA 3IGXA 3ATZA 5HATA 4KETA 1XWYA 2X41A 4OV9A 3SCVA 2EPOA 2OQHA 2GJXA 3TONA 3O2LA 5MKGB 4XZ9A 1DVJA 1EOKA 3G1SA 2FDSA 4HHLA 1FWAC 2VFHA 4R53A 4AD1A 4JOMA 1VFMA 2OVLA 2FFIA 2W61A 4D1JA 3CUZA 4AWEA 4FX8A 2PZ0A 5D02A 2C79A 2FLIA 2V5BA 4C6PA 3FJNA 4MHBA 1R2TA 4PFMA 3RG6A 2IPFA 2VVSA 1T8XA 2YBVA 3B8UA 3GX9A 1W2PA 4BWLC 1HUVA 4PL2A 3OYZA 5AC4A 3WQDA 5FJUA 1QI3A 2EEXA 1XGEA 4Z17A 4B3ZA 4N42A 1ZQ5A 1I60A 3PTDA 4FOKA 3S46A 3BLPX 4QNWA 4DEFA 2QPSA 7REQA 3LTYA 3DEQA 1H50A 3DXIA 3KTSA 4G5DA 3RM4A 5C9UA 3THDA 5DCDA 4RE2A 1FOBA 4PUJA 1CGTA 2Z7KA 4LC8A 3UJRA 3S6TA 1TJ1A 5AKQA 3ERPA 4NZ3A 2ZVIA 1E0WA 3GYCA 3GC4A 2I5GA 3TLQA 3PZUA 4CLMA 4XZHA 3MKKA 2XZ9A 4GQRA 5F2LA 3FSTA 2ZX8A 3SQMA 1Y0EA 2GGJA 3VUSA 2WOQA 4LYQA 1X7FA 2ZRUA 1DE5A 1LOLA 1YPXA 2WNNA 3KOXA 4ZXOA 1YKWA 3SW6A 1MO0A 1AQ0A 1JQXA 5BXSA 3SJNA 4K36A 3TAKA 3VIMA 1QPRA 3PSVA 3CIXA 4HK7A 4RNHA 1BTCA 3G6LA 1EBHA 3VMOA 1UWSA 2X1TA 3FX4A 2NX9A 1TMHA 5ENLA 5HR6A 3OYXA 5EYWA 3PJXA 3PBUA 1J0YA 3R94A 1TPC1 1UD6A 1MEWA 1TB3A 4BI6A 1LBFA 2XIOA 4WJXA 5D32A 2POTA 2EG8A 2PLKA 4ZEPA 4FOJA 3NOEA 4F8XA 3OHMB 1I9CB 2IXVA 1KQZA 2WNQA 4CD7A 3WQ6A 4PSPA 3OP2A 3WH6A 2BX7A 2C91A 4UTLA 5C2XA 1OZMA 1QNVA 3VGFA 4AEOA 4GD0A 2ALRA 3V7PA 2BVYA 5BRQA 1J12A 3RILA 2GGEA 1KM5A 1W1YA 3W1PA 4UQDA 3EWBX 3PZGA 1P1MA 1DOSA 2B81A 2CFFA 4NZ5A 1QPOA 3QMSA 1PIGA 4FNQA 4LAKA 2DIEA 4Y96A 4PULA 5A69A 1EHAA 3BLLA 3GY1A 4QLKA 3MS8A 2WXDM 1BXBA 3T8QA 3SADA 1GQKA 3A21A 1RLDA 3KXQA 3NZRA 1IGWA 3WLTA 4X9SA 3UG3A 1X98A 4DBSA 4MB4A 4ML4A 1C8YA 5DEZA 3TAOA 3CTLA 5KZ6A 2C18A 3TK7A 1DWHM 2DZAA 2JGQA 1TWDA 3WLKX 4EPBC 2OT1A 1QXLA 1PTDA 4WY0F 3LPOA 1MSSA 3GW0A 4JYDA 5HINA 3RX3A 1B2YA 3DIPA 4XZMX 1SW7A 5K2ZA 1ADOA 1MEIA 3KP0A 4HOZA 1WBJA 4KCTA 4LY8A 3VNYA 5EU9A 3I7SA 1LOSA 4EANA 4D9PA 3OJGA 4IPIA 4HK5A 3AJXA 3SUVA 4O4VA 2EGZA 1QHPA 4P2VA 1X6NA 4A29A 4C1NB 4DUOA 1QW8A 1UJPA 2QJMA 3HIJA 2WWDA 3I6RA 2XN1A 1PKYA 4F0KA 3NZ1A 3QFWA 3L67A 3UJEA 3VI2A 3O1NA 4I8YA 4LVBA 2EPLX 3AIBA 4NI8A 3MV11 1M01A 3OVRA 1LT8A 3MY9A 3CAQA 3FKRA 2TSYA 2OFJA 3CHEA 1SFTA 3R89A 1XH0A 3I3EA 4O1CA 4US5D 1FKWA 5DCEA 3GXDA 3UVIA 3H21A 2OWWA 3S1UA 1SUXA 1TFVA 1I4NA 1AQHA 3K2GA 2VYOA 3ATYA 3M41A 3KW3A 4OVXA 2GLKA 1H1YA 3R43A 1L6GA 3WIJA 4WGHA 3FCPA 3UGRA 4LUSA 2WQDA 1MW0A 4O15A 4UR7A 4JPGA 4MM1A 5DN1A 3ZT7A 4UMCA 1P7TA 1F3TA 2QDGA 1XICA 1JIBA 3DG7A 3EDKA 3N9SA 3AXMA 3MA8A 1EL3A 2C1GA 2ICSA 1FDJA 2VX5A 1SJCA 1TKKA 4Z0SA 2V5DA 1LZOA 1A0CA 4KESA 5CJMA 1UPMB 1TWWA 1JAEA 1KTCA 1RSCA 1UASA 3VDAA 1ZCOA 3HGSA 2D0GA 1LRQA 3WQGA 4ZO9A 2DDXA 3BMXA 3DFTA 2ZYFA 1PHQA 4KT2A 2IPGA 3G18A 1TX2A 4C5YA 2H3BA 4KEVA 2P8CA 4PUNA 5JVLA 3V4BA 1YPFA 3TOYA 3BAXA 1XR2A 4JCMA 2W63A 1GOIA 4TR9A 4XKMA 1V6XA 4PMNA 5DXXA 3E0LA 1G1YA 4GE8A 1EEPA 2DZPA 4ZO8A 3VABA 1XDMA 2BZNA 1X39A 1EUAA 1PE1A 4GZJA 3VOIA 3V0UA 2EF9A 4XVEA 1YRRA 4HYVA 4RE3A 4L6HA 4DJEC 2PFHA 5CLTA 2GOKA 3KZPA 3PWIA 2DQXA 2V2DA 4HA3A 3W1RA 2OXNA 4ACZB 4XVDA 5E1QA 1VFLA 3BOXA 2HE8A 3C6CA 1B3ZA 2XISA 3SCWA 3W85A 3H24A 5A6AA 2INFA 1PZ3A 3N4AA 2OLSA 4CD4A 3EX4A 5JQ9A 3B4UA 3L68A 3Q4DA 3L0KA 4FA3A 1FH8A 4LUIA 1S38A 4A35A 3N73A 3M6DA 3UCCA 1FWGC 3CHFA 4CQCA 2I56A 1VRDA 4HPXA 2ZC8A 1QW9A 3W84A 1LL4A 2VZUA 5EKYA 4JTCA 1BWKA 2NXGA 1UZ4A 3RPTA 4A22A 2WKLA 4HN8A 4H8HA 4UTKA 3G77A 4RDVA 3W7GA 1AD4A 3URNA 3NL5A 2HE5A 1H5YA 2ADAA 3SR7A 4I7UA 3ZZ1A 4Q7NA 3CMGA 1IR1A 3ES8A 3TX9A 2A3LA 2D2HA 4DO6A 3GR8A 1IEWA 3L4UA 2XGZA 3LS9A 4NKCA 5TQLA 3M9YA 4QP0A 2PCEA 1EKOA 3CPRA 4DJDC 4AUBA 1C7TA 2Y1HA 1V7YA 1Q7MA 4RUBA 1REQB 1XS2A 4WOZA 2ZUMA 4QR6A 1W5NA 1Z8AA 3MMDA 3PFMA 3BE7A 3R8GA 2J9YA 1HFBA 1NEYA 2V5KA 2J74A 3MC5A 2E8ZA 4UNIA 5JIPA 3MZ2A 4M8UA 2H90A 2VELA 3LRMA 2UY3A 4A4AA 5I2UA 1JAKA 3RX4A 2WMIA 2HSAA 4LCRA 1V0KA 3T07A 5LNVA 1JUKA 2YKKA 3K30A 3VZXA 3N3TA 4O17A 5LSMA 6TIMA 4WKAA 3TCSA 1FWEC 3IUIA 4C6LA 4UQEA 2BP1A 2BVTA 3GDRA 4PFHA 4ADSA 3MKCA 2Q3OA 1SO4A 2Y7DA 3GBDA 1B3WA 1J6OA 1CLKA 1OFRA 7TAAA 2E68A 1ZS2A 3V5FA 4FI4A 1EYWA 2BTMA 2XGBA 4GACA 5DMLA 3LV6A 4NVTA 2W79A 4G1NA 2DZWA 3IGSA 4ICNA 1GYNA 3R0DA 1H7NA 1Q63A 2GWNA 3PPHA 3G3DA 3KRBA 3F03K 1VGAA 1UWUA 2ZX5A 3VCRA 3T8LA 3SQSA 2Z26A 3OA5A 4GNVA 3W1MA 1UYQA 3BCJA 1XLBA 4OBTA 3CS2A 1F61A 3CB8A 3DYPA 4A3HA 4C6KA 2QR6A 3WBWA 1PWMA 1TYGA 1ICSA 4HT3A 4YCOA 1QCWA 1XYLA 4CEXC 1XRSA 3ARUA 1FWJC 5XIMA 3Q94A 4F79A 3TE9A 3QQWA 1EGMA 4GUHA 4GY0A 4ALDA 3Q65A 4GQ0A 2QZRA 4G7EB 2BY1A 1MDLA 1OGBA 4K8GA 4I7VA 4CU8A 5C7VA 1DHKA 2WNWA 4M19A 2VOMA 1QK0A 1KRBC 1QVBA 1VEPA 3VOGA 2OCZA 5CJNA 3ZXWA 1CEOA 1ZL1A 4NQ1A 4AZIA 5I02A 2OSWA 4UFIA 5HA7A 1EXBA 1ZPTA 3H7UA 2WC7A 1DPMA 3QFEA 1PSCA 3AC0A 3IUDA 1EO7A 1P0EA 1PIFA 1XQLA 4NZFA 1EA9C 1IWAA 1I75A 3NQCA 2ZRYA 3MP4A 1JD9A 2YL6A 4DIAA 3SAZA 3IAQA 4DAIA 3C56A 2G0WA 3IJ9A 4X9YA 3M0JA 3WD0A 1E9LA 1ZAJA 3VNDA 4NYUA 2PTDA 1A49A 3CEUA 3UXLA 2IPWA 2E9MA 3S3GA 4UTTA 1M3UA 3DHUA 1WAWA 1A4MA 2FH6A 4NAFA 5E6YA 4IJRA 2NLIA 3R25A 2WMKA 3KLLA 4ZXLA 2WMGA 5K9XA 1RPKA 3GS6A 3IARA 4OQVA 2BOGX 2NQZA 4CUCA 7ODCA 1XFBA 2E6FA 3LA4A 4B5XA 5EMLA 4UXDA 1KBBA 4RDZA 4K8HA 1AMKA 1GVRA 2A0NA 5IXEA 1YNYA 5JH2A 1RQEA 3G0XA 1WDPA 4LFYA 3QZEA 3DAQA 2ZUTA 4C6QA 4GO8A 1E0XA 1CYGA 2WJDA 4JTQA 3LEPA 4G7FA 5CC6A 1RBAA 3PSWA 3H2NA 4GVHA 3EDJA 3PBYA 4AZ6A 1LLWA 1RJPA 4IMDA 2HDJA 4ZQRA 2W66A 2IKHA 2I1OA 4IOTA 2RDUA 3VILA 4RDYA 2QJNA 2EG6A 2VFIA 3L4XA 3H2MA 4C6FA 3IEBA 3PJUA 4Q4MA 1IZKA 1SR9A 4L4MA 4IFOA 4RJEA 4GI6A 4H9VA 1DORA 4HJFA 2ATSA 1TPUA 1IV8A 3W75A 3SCTA 4TU1A 1A3WA 5FJOA 3WK3A 5DQPA 1WYIA 4KRZA 2TPSA 1R2SA 2WJFA 3S47A 3WQVA 2ZX6A 5AC5A 2Z1KA 3TNBA 1JFXA 3AMDA 3IAPA 3HZ3A 3SUWA 3AZSA 1TVPA 1VPQA 2EPMX 1NP2A 2P53A 5GJMA 3V36A 3NR0A 1PAMA 3POHA 2OYMA 3NQGA 3A5VA 3G1DA 4EF8A 3NZQA 2WHJA 3WLLA 1XKYA 3NO1A 2VRJA 5F4XA 1K3UA 3W7RA 5KETA 3TH6A 3B8IA 1G67A 3TFXA 5LXXA 3KBNA 3AJ7A 3NDOA 4HMEA 3B0UX 3EB2A 1GVQA 1Z44A 1GT8A 1Q6LA 4WR3A 4W84A 3SCRA 3UG8A 2AKMA 4HNVA 3W1LA 1WOBA 3CWNA 1JCLA 3NM3A 2BVWA 1GW1A 3WLQA 3QKEA 2VFEA 1WKYA 1KQYA 2VEGA 3VIGA 4H7VA 2Y5SA 4JY9A 3WJXA 1YW1A 4PUKA 1Q2RA 3IJIA 2J79A 3TWBA 4WJEA 3P2VA 2PRLA 2ONEA 1DQXA 3SCOA 1QK2A 1ZGDA 2DP3A 2VZSA 5HNUA 1ITUA 4CN4A 4KPLA 3T0DA 4DXKA 2GVEA 3HO8A 3HV9A 1E6ZA 3NVTA 4IL2A 1VYPX 3W02A 1SW0A 5HMDA 1DHPA 4AD5A 4C6OA 3W3OA 4HYRA 4QJ4B 2FZMA 3UY7A 3C2EA 3QM3A 5IDIA 4HZ8A 2FTYA 4G56A 5IFPA 1VR6A 1W3TA 4GGHA 3E9AA 3CUFA 1YNPA 5BRPA 1F6KA 4D6FA 5KINA 3M0IA 1EXPA 1O12A 3P14A 2XH7A 3IS4A 5T26A 3PZOA 3W6LA 3DFHA 3A4JA 2I9UA 3UZZA 3O3RA 2BHZA 2ZZ3A 3CNYA 4TVUA 1Q6RA 4CVUA 1VFFA 1SZFA 1SO5A 1ZUAX 3MP5A 1A4LA 4F0MA 9XIMA 1GJPA 2YXOA 3QY8A 1JD7A 5I06A 3PZTA 4FNPA 3EWWA 3S2JA 1KV5A 4GK8A 4D6HA 1O60A 1GPWA 3CQJA 4JTSA 1XYCA 2NZLA 2WHLA 4EK7A 2E6YA 3WNOA 3LQLA 5MKGA 1FWHC 2E1DA 2NQ5A 5CAHA 2WK2A 2JKPA 4M5PA 1YADA 1R6WA 1S5NA 2G4JA 1D8CA 4W8BA 3VX1A 2ZADA 3TWAA 3TQ0A 4KEZA 1HJUA 3PB2A 1Q85A 3WDPP 5CZKA 4GKTA 3EWDA 4XBSA 2VI0A 1H60A 4GBUA 5I7GA 2NUXA 3TW9A 4PMQA 3O8AA 4AVNA 2PP1A 1TTQA 3N6JA 2DEPA 1YNQA 4AWSA 1JZ4A 5I6SA 2AQVA 4JDYA 4N9DA 3SRHA 3TN3A 2VEFA 3PUEA 4CQDA 4S3DA 4U2YA 2YDSA 1PO9A 5H8MA 1BGAA 1PWLA 2RFGA 3LU2A 3VD5A 4QQUA 5AZ1A 1GKPA 3FYOA 1VFOA 1W31A 1ALDA 3ANYA 5HAOA 1SW3A 3UPMA 1Y7VA 3WH5A 1B30A 4DPPA 4REQB 3R0KA 4ZTYA 3H53A 3PM6A 3K8LA 3FXGA 3NTYA 1X1NA 4JNMA 2ZWZA 4DYJA 1GQLA 2VOTA 3L2MA 4XAGA 4GXMA 4Q22A 1DJIA 1OABA 3W7NA 4UOZA 2HVOA 5CPMA 4PTVA 2G3NA 1W5OA 3TJ4A 4Z2GA 3CUIA 1VBHA 4X60A 2QJHA 4GA8A 3H2FA 1W91A 2VEKA 5LNWA 3TKFA 3V1HA 1SFJA 3NSNA 5CKSA 4FXFA 3VIJA 3S6OA 1CWYA 3WENA 1TPWA 4D6EA 2YYTA 4F2TA 4ASTA 1DV7A 1XYZA 4MJ2A 2ABAA 4H8NA 1ZB5A 2OEMA 3BZJA 4FALA 3O7UA 1QW7A 2V69A 2HMCA 3R1ZA 2W6RA 2PE4A 2X2YA 3D46A 4UTWA 3IIVA 2V63A 1H11A 1WV2A 2C1HA 3F5KA 1K7EA 3A3XA 2QCCA 2Z6IA 2V3FA 1JF5A 1S1RA 3ITXA 3H4XA