1G4TA

Thiamin phosphate synthase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
226
structure length
226
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVSAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIAMIN PHOSPHATE SYNTHASE
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 80
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4tA00
1SU5A 3MI2A 1VCVA 3LCWA 3BPWA 4P2VA 1W54A 3LXAA 3FEMA 3S9YA 2VELA 4RJEA 4AWTA 2FTPA 5K9DA 2J24A 2J88A 3B03A 1XKYA 3DZ1A 2LLEA 3ATZA 1HUVA 4JTEA 1V5XA 4ZL1A 4ZQCA 1GTHA 4MLJA 1OYAA 1O5KA 3DXIA 2EF9A 3A5FA 4Z1BA 2HTMA 3NZ1A 4MJZA 6ALDA 4OGZA 4U28A 1I2QA 2ATSA 4AWSA 4RKAA 4LS0A 4IXHA 4NJHA 3C61A 4H6KA 4ORMA 3D0CA 1R2SA 2QDGA 1JR1A 4NX5A 3PSWA 4O11A 2QUTA 2W79A 3TQVA 2BX7A 3NQ2A 1UJPA 1EP2A 5KSWA 1AW5A 5LKYA 2A85A 5D37A 2G97A 1RQHA 1T0OA 2NWRA 4GE8A 3QM3A 3PSVA 5BMXA 4MJMA 4CQAA 4QQ3A 1LROA 1IXQA 4C1KA 1F2JA 2YZRA 3TC7A 3NPVA 3THQA 1FWTA 1IIGA 5HWJA 1MEWA 4FNUA 5CPNA 3W7KA 3RFAA 2GQ9A 1AL7A 3N2MA 3E96A 1JULA 1TPUA 4HNVA 2V0TA 1W5OA 3W84A 1Z44A 1W5MA 4QAIA 2YR1A 1GJPA 3MP3A 3TK7A 2O7SA 4IWWA 1KA9F 2CLEA 3GVGA 3LTYA 3B05A 3GDKA 1EP1A 4FX7A 5I3FA 3LHYA 1THFD 3PB2A 4ZVJA 4MOZA 1TTIA 5I3GA 4HPJA 3LXBA 5DY2A 5HR7A 2WV8A 3W23A 2E6AA 1SO6A 3S5ZA 2V5BA 1G4SA 4PL1A 4QNEA 5AB3A 3GAKA 1XL9A 2QCEA 1OYBA 3A24A 5AYYA 2FPTA 1FUYA 3CT7A 4MY9A 2VXNA 1PCKA 3BG3A 3P7YA 3PVFA 3W1TA 1TQXA 4N9BA 2VFGA 3EXTA 1B57A 5BRBA 4GJ1A 4P61A 4LUJA 1K02A 1I2PA 1K03A 3C2FA 2B0MA 5EKYA 4JDBA 3L67A 4LT9A 2CLFA 1FCUA 4K37A 2V2DA 4NJIA 1OYCA 5LZLA 3NL5A 1H62A 4JTGA 2Y63A 3G24A 5DLCA 4N6EA 5D2WA 1SO4A 5LHEA 4O4WA 3CIWA 4CLMA 5F4XA 2GVJA 2NUYA 4IPJA 5TBOA 4EVZA 1SW0A 2ISSA 4BI7A 3STFA 4NXSA 5AHLA 1H7NA 4NXKA 2GVLA 3C8FA 2V82A 2ZRXA 5C6MA 2RDUA 3G1XA 5CPOA 2EAWA 3WK1A 3HPSA 4R53A 1S5VA 4A22A 5TQLA 3NQ7A 3QSTA 3QW4B 3W6YA 2ZTJA 3KFTA 2CW6A 3CWOX 5D33A 3ZWTA 3NO5A 4MUZA 3HPZA 4GRSA 1OX6A 2Y6ZA 3LBCA 3CHVA 3JRKA 2H90A 4UR7A 3H53A 3G22A 2DZVA 3MUXA 4R34A 3QC3A 3ZS4A 3MYPA 5D2VA 3PULA 2A7RA 3PWAA 4UTTC 3R12A 2QJHA 2W0UA 3S6DA 3T44A 5AFDA 3ABRA 1FWWA 1YTKA 3B8DA 1FBAA 3DKLA 3PR2A 4HKPA 4UCGA 2VEIA 1L6SA 2ZQ0A 3IIPA 3W74A 3BARA 4PEKA 2GQ8A 1TB3A 2Q8ZA 3TSDA 3BG5A 3LTSA 3NL3A 1Y0EA 3OVQA 3IEBA 4XKYB 5DCBA 1CI1A 4N4PA 3STCA 2QJGA 3L5LA 1GZGA 3QEZA 1XCFA 5T26A 3L9CA 3L5AA 4AB4A 1J4EA 4UFJA 1G4PA 5K9XA 3R89A 3W7NA 4JD4A 4DO4A 4PL2A 5C2XA 3CEPA 1EWEA 2OZ0A 3CWNA 3Q2DA 4S2CA 3W1AA 4MZYA 4FXSA 2BXVA 1P0NA 3EX1A 2X1UA 1RPXA 3I7QA 3R2GA 1WOAA 2ZZ4A 3L21A 4O1DA 1VHCA 3G8EA 1NF0A 1KFKA 1JRCA 2XFWA 4N9CA 4POCA 1WAUA 4UTIA 1TV5A 2EKCA 3U8GA 1SZEA 3G0SA 1W56A 1FXQA 3M0ZA 2QUVA 1L2UA 3PUEA 3HO8A 2ZA1A 3L66A 4O54A 1EPXA 4TMCA 1G4TA 1TYGA 4TR9A 3LLFA 4AF0B 3HQ1A 3USBA 1DQWA 1FWNA 5LNUA 3NA8A 2ZFAA 2WSQA 1HO1A 1ICQA 3Q37A 3W83A 3C2EA 3MP5A 2WSRA 2CFFA 2E77A 4FNRA 2B7NA 3SSJA 1P5BA 1ICPA 2A1YA 3E02A 4HHPA 3W2LA 3JS3A 2ABBA 1XUZA 4UTKA 1MEHA 4RXGA 5U7SA 1B4EA 2RFGA 3KOFA 3B0VC 5KZDA 3LHUA 2I9EA 1SSDA 1YXDA 1SZNA 3EWWA 5DBUA 1W1ZA 3BG9A 1XBVA 1QPOA 1XC4A 3NZRA 2NUWA 3BLIA 3B06A 2PRHA 4ORIA 5AHMA 1MEIA 3DI0A 4EWND 1XI3A 1VYRA 3C6CA 1XUUA 4DPPA 2OT1A 4NQ1A 1OFQA 3W1PA 2ZYFA 3DFNA 3GX9A 3LCIA 4A3UA 1PS9A 2JGYA 3QF0A 1C29A 1PHQA 4GUJA 3E49A 1B4KA 1BTMA 3CC1A 4UTMA 3F4WA 3VFLA 3BW2A 3NQ8A 2YDAA 4ZQMA 3DKJA 1GVOA 1RR2A 1HTIA 3CLMA 1TRIA 3P61A 3TJXA 4KWVA 3TIMA 2QF7A 3BLEA 1R2TA 3WJSA 2Y61A 3B0UX 4XBSA 4HSNA 3WK2A 1D3GA 1AW1A 5SWUA 4XKYA 1VC4A 3G1AA 3LDVA 3AJXA 1T8XA 1N55A 3FKKA 3OVPA 1F05A 2Z0IA 4IUOA 2ATMA 4BI5A 1VLWA 3M1ZA 1ME7A 3L5MA 3NQDA 3EWXA 4OQVA 4ZZ9A 3C2RA 4GBUA 4BWLC 1J5TA 4K7YA 4NNBA 4BR1A 2IQTA 5KZEA 1TV8A 5F2GA 2X30A 1H5YA 2BWGA 1IGSA 3HBLA 4LVGA 2FLIA 5H91A 4UTLA 4BF9A 1EEPA 3HF3A 2I14A 4IOTA 4RZ6A 3C56A 5ABTA 4DBDA 1YXCA 3T78A 1TTQA 1BEUA 2C6QA 4O4VA 1OFPA 2WOQA 2BLEA 3JR2A 4XWUA 2CLLA 4AF0A 5FF2A 2JKPA 3IGSA 4QIUA 4YCOA 1T96A 4M6VA 5G1YA 2VEMA 1NEYA 1KFJA 3F4NA 1G69A 1I2RA 1W31A 1DORA 3GDRA 3LCXA 3H55A 4LS1A 3IIVA 4IJBA 1QDSA 1DV7A 3EB2A 4NZJA 4O57A 4WD0A 4Y96A 1LRNA 1TPFA 1OFBA 3TQ0A 4Y6GA 4GUIA 1TMHA 5AYZA 1PE1A 3BV4A 3T40A 1Q6RA 3IIOA 1GT8A 4JDYA 5LNWA 1W0MA 3OEXA 3WJWA 4UMAA 1Q45A 1KM2A 3PC0A 3QH2A 1QAPA 4JTIA 4PH6A 2Y85A 1FY6A 1WBJA 2H3BA 3LCFA 3NPUA 3O6DA 4QM1A 3TXVA 4DO6A 5I3JA 3O07A 4UMCA 1O5XA 3TAOA 3EWYA 1KLYA 4TMBA 3EXSA 1LP6A 2QCDB 2CLMA 3QPZA 2YCEA 1XBXA 4AWUA 3GR7A 4IX2A 1F73A 3H54A 2PRLA 2RHGA 3LHZA 1WOBA 3E0IA 3GNNA 3KVLA 1W37A 3B4UA 1EUNA 1H60A 2YFOA 5CZ0A 4UTUA 2OMAA 4IMDA 1OG0A 2JKAA 4NUWA 2FFCA 3OG3A 5HULA 3BW3A 4N9EA 3LOTA 5KZMA 3OHIA 1R30A 4DQWA 3GXTA 5HJLA 3O6YX 3M7WA 4PA8A 4O1AA 5CGQA 1QNVA 1A53A 4JX4A 1FCBA 1R47A 1SFJA 2WPBA 3W1UA 1K8XA 1I45A 3GB6A 3LTPA 4LV4A 1A5BA 3PF3A 4XTIA 3UPWA 2ZRVA 3N19B 1ZENA 1OFDA 1JJKA 4RCXA 1OJXA 1JCXA 4X3ZA 3QW3A 3ATYA 1TPB1 2TSYA 3CTLA 3TSMA 2ZA3A 4EF8A 4YLWA 4RR4A 3PG8A 5LNRA 1ONRA 2VKZG 1EUAA 4M5PA 1FDYA 1GVFA 2NXHA 5DN1A 5E1QA 2J9XA 2CLHA 2ZRYA 1DJNA 4KFPA 1KTCA 2NX1A 2DZXA 4YMZA 1QPRA 2D73A 2ISWA 5G5IA 4NX0A 3O63A 2V8ZA 3LBMA 1KBJA 1L6WA 5L9FA 3TROA 4HPXA 1KM0A 1Z42A 4GFSA 4FB7A 3LV6A 2P10A 3Q58A 3N9RA 3GXNA 3CEUA 2GUUA 5IBXA 2E6DA 3VE7A 1VS1A 3LV5A 2X1SA 3TW6A 4TX9A 3W72A 1TCDA 2DJXA 3GKFA 3NAVA 1G67A 2A5HA 5D05A 4XZ9A 1H7OA 1QPNA 2RDWA 1MXSA 4IMEA 5G4EA 3N73A 4JIQA 3LI1A 1SUXA 3MI6A 5HWNA 5D30A 4DEFA 1ZAJA 2QDHA 4GNJA 5CSRA 4JTLA 3S1XA 1GEQA 1OX5A 3DFTA 2Q8LA 2KZHA 1DL3A 5EY5A 2VFEA 1KM1A 4DXVA 2QCDA 2TMDA 4R33A 3YPIA 1FDJA 1RVGA 4JY8A 4X2RA 1RQBA 3VI2A 1SZGA 2YXGA 2E6YA 1W3IA 1NSJA 4JTKA 5C55A 1YPIA 3SGZA 1Q3NA 1H7WA 4NU7A 4YL2A 4Q33A 2C16A 3O8AA 3L0NA 5G4WA 1F7BA 2GJLA 3QMRA 1H51A 4UC5A 3GAYA 1OVDA 2TYSA 4Q4KA 1GQNA 3TMQA 4JR5A 3W3OA 3LRMA 2HMCA 3UWYA 2H8XA 3STEA 4E38A 3O15A 2BZNA 4MYAA 4FX6M 2JK2A 4FHAA 4UIOA 3GXPA 3UY7A 5CZTA 4EOUA 4NT0A 3FJLA 3HG2A 1O60A 1TREA 1JCYA 1H61A 3P81A 1LM1A 3LXCA 1X7FA 2C1HA 5AOUA 1TJRA 2VENA 4LRSA 2FB2A 3NM3A 3HPXA 3HG4A 4JTSA 5TIMA 3M5XA 4JIPA 3UWUA 1I8JA 2X1TA 1QFEA 4PFMA 3PBUA 4AHQA 3UQNA 1QOPA 4L4MA 2NXGA 4KFOA 3NOEA 2HS6A 1EA0A 4LW7A 2Y70A 3UNDA 2J9YA 1PVNA 1TPEA 2VEKA 4O1BA 1QWGA 3LX9A 3G1FA 1PCWA 3I6RA 1TO3A 2QAPA 1LOSA 3FA5A 2ZDRA 3HGOA 4Z1AA 2YPIA 3UWZA 3IRDA 3MW7A 3R8RA 3P82A 1JUBA 4JYDA 2VFHA 4PTNA 4H3DA 4EIVA 3RU6A 5KITA 1ZFJA 1YXYA 1QMLA 2BTMA 3DHDA 2J6XA 4LU0A 1I4NA 1JCMP 3CPRA 2GJNA 3STGA 4O53A 2V2HA 3DHFA 3HG5A 3PM6A 4WZHA 3TQKA 4EF9A 4CQ9A 3G3DA 5J5RA 4MIMA 3DGRA 4CNNA 1TPDA 1YLVA 1TTJA 1VPXA 4NNAA 1WDWA 5F2IA 1GVQA 3LHWA 3W2MA 3QRHA 4K8HA 3PG9A 3W87A 3NQCA 2FB3A 3QSRA 5CG7A 4AHOA 3BVJA 1KM5A 1YADA 4JN6A 1PL9A 3W7QA 5AHNA 3SZ8A 3V75A 3G8RA 1VJIA 2NXIA 4UNKA 1WXJA 3NGJA 3SGUA 7TIMA 5I3IA 3EX3A 3RK8A 3SI9A 4JTHA 5C5YA 4NJGA 4OBTA 2C15A 2A6NA 3LCGA 3BLFA 1ML1A 1N7KA 4MPQA 5G2HA 2ZZ6A 1QO2A 3IVSA 4NJJA 3NL2A 1P1XA 1GOXA 2B7OA 2DZSA 4CQ8A 1BWKA 4UFLA 3LB0A 5BW6A 2FJKA 2JGQA 2WJZA 4ONVA 2E5BA 1AW2A 3G1HA 1IXOA 2GVGA 3NDOA 1SW7A 1WX0A 4K36A 2QUUA 3DFOA 5HQEA 5F1VA 3M44A 3SIZA 4PODA 1LLZA 5FI8A 2QAFA 3GZ3A 3OVRA 1H1ZA 2A0NA 4FNTA 4O50A 1NVMA 5FF3A 4A21A 1KLZA 3TKFA 2VFDA 1PHWA 3M9YA 3VNDA 1HFBA 5H2ZA 1WA3A 4GUHA 4ADTA 3MHUA 3WK0A 4O52A 1JCLA 3S5NA 3MYOA 2DJLA 5FEPA 4ZQPA 3TCEA 3RLVA 2A2IA 2OCZA 4DELA 5D2TA 4NZFA 4BK9A 4LC6A 5CKSA 1WYIA 3SY5A 4K39A 5D2XA 4LC8A 3GR8A 3NR0A 4E0CA 5IM51 2XN0A 1JQVA 3IVTA 4ZMGA 1SPQA 2DZTA 4RK8A 1LCOA 3CIXA 4HNUA 2E5CA 4CNPA 1OF6A 4MFEA 5AHFA 2Z6IA 3UY8A 5FF0A 1FCVA 3NQAA 3WFAA 4UUIA 4M7TA 4RLIA 1KTNA 2GOUA 2PCQA 5FEWA 2C14A 2OT0A 3W2NA 4N02A 3I7RA 3S1WA 4UR8A 1K8YA 3FS2A 3Q94A 5EMUA 3W76A 1HL2A 1WBHA 3DU0A 4AHPA 8TIMA 5LNSA 3DFPA 4GC4A 2CWNA 3HB9A 3SJ3A 3MJYA 3SR7A 2YW3A 2NLIA 3KVJA 1LOLA 2YSWA 2O7QA 5BMWA 4NVTA 3W7CA 3PBYA 1RV8A 5J5DA 5CSSA 4LY8A 2C18A 1G7VA 2NV2A 1B9BA 2F7FA 2PURA 3CQ0A 1IXNA 1JQXA 4ZQNA 2FIQA 4DF2A 5K9CA 3KXQA 3RF9A 4DO5A 3PB0A 1KW1A 1ME9A 4OV4A 1ZAHA 3NQFA 1P0KA 3FYPA 1FWSA 5KINA 2Y89A 3L65A 2CZFA 1DHPA 3LRKA 2P0OA 4QJ1A 3ABOA 4X9SA 5HUOA 4JYEA 1S3HA 4JYFA 1MSSA 3GLCA 1LLWA 5DCEA 4JNMA 2EHHA 1Q6OA 4GUFA 4Y9AA 5AHEA 3AO0A 2VFFA 1I2NA 1M7OA 4B5NA 4ZQOA 1DKWA 1OFRA 4CNOA 1ZCOA 1MO0A 1ADOA 3GK0A 4QISA 3EX6A 1GTEA 5EL1A 1YDVA 1NAL1 4W9TA 1ZHAA 4DF0A 3W7IA 2ZZ3A 4KFNA 3W7MA 1BWLA 3C2OA 2X1RA 3LI0A 3C4UA 2UV8G 4J9JA 3CM4A 3P5ZA 3QPYA 5D38A 5K3VA 3KX6A 3OA3A 4O15A 4AAJA 1Z48A 4JGDA 4UTWC 4CCEA 3NQEA 2YFNA 1H7XA 1M5WA 3NPWA 4K7VA 3M6YA 1SO3A 2ZBTA 1YYAA 5FESA 4HIBA 3GYEA 4RV8A 4LTSA 4NJKA 4Z0JA 4O8RA 1RZMA 2JKEA 1H63A 2ZCGA 1LZOA 2HSAA 2ABAA 1M7PA 3WJZA 1LBLA 1OK6A 2DZPA 4WOZA 1YTDA 3GDMA 4FF7A 4HSOA 5LNVA 3C52A 1F6KA 2C0AA 1CW2A 1VHNA 3VE9A 1H50A 2WKJA 5F1UA 3O06A 4MKNA 2X16A 2ZRZA 1L6YA 5HMSA 4MY8A 4IGHA 1EX5A 2WQPA 3FOKA 3THAA 2H3DA 4KKXA 3DAQA 3WJYA 4WUIA 1WQ5A 4BI6A 3I7SA 3MI3A 3N3MA 2ALDA 3B04A 3QQ0A 3M5YA 1K7FA 5C54A 1OF8A 4N9DA 1I2OA 2DZUA 3KAOA 4FNQA 4MFDA 1GWJA 2R94A 1YDOA 1GPWA 4WX2A 2VOMA 2OX1A 3B0PA 4LVAA 3T7VA 5HR6A 2WNNA 4HN4A 2DU2A 4WY0B 2CLKA 3PUOA 3TFCA 1JCNA 3U2OA 1KFEA 1N8FA 2ZTKA 3W07A 2FPYA 3S5YA 2XN1A 3INPA 1PIIA 1XM3A 2Z1BA 1GYNA 3NVTA 1AG1O 1DBTA 3W7GA 4LUIA 3ZWSA 3TE9A 1OX4B 1C9DA 4IQLA 4E2DA 3EKLA 5DXXA 4LV9A 4H4IA 5A8GA 5AC7A 2WSYA 4O12A 3KHJA 2EPHA 4MYXA 4O0ZA 4PC8A 5MHBA 2QCLA 3QMSA 4O19A 3L68A 4HNNA 4MVAA 4QNWA 1QO5A 1XDMA 2P1FA 3UWQA 1H1YA 3NPXA 3DFSA 3W71A 3NQGA 3UPBA 2QCNA 1OABA 4N2YA 5K2ZA 2QCMA 2VC6A 4O10A 3W1XA 4YCPA 4AMAA 4UXDA 3BO9A 1FCQA 4WJEA 2QCCA 3P74A 2FDSA 3HJZA 4JTUA 5HUPA 5HNRA 3P60A 3NM1A 4UFIA 5I3HA 5CZSA 4DPQA 3S8HA 3R5EA 3GDTA 1KV5A 2G96A 4O16A 2E5DA 1OFEA 3NG3A 4FEZA 2RKXA 4FNSA 4FX8A 3W2KA 3I68A 1TPH1 1ZJIA 4WY0F 3F1QA 3NNTA 3ANYA 3EKZA 1FDZA 3PBWA 2C3ZA 3NQVA 3LGEA 1PV8A 2E1DA 3TXZA 1WV2A 5IBXC 3W1RA 4N6FA 3W88A 5D32A 4XBKA 4ML9A 4UNLA 4CCDA 2CZDA 3A22A 3M5ZA 3FKRA 3MO7A 4OHQA 4O28A 3T4CA 5G1TA 1LRTA 3KRZA 2H6RA 1SR9A 4C1LA 1VGAA 3G3MA 3MHFA 1V7YA 3HGJA 4LVBA 4LOCA 4FXRA 5FEZA 3ABSA 1FX6A 3NQMA 1X6UA 5D09A 2R91A 3GNDA 4AXKA 5L6UA 3W1NA 5GVJA 3C3NA 1DVJA 3TSBA 4A2SA 1OK4A 5F2MA 1UUMA 1QPQA 1VLIA 2YGYA 1IXPA 6TIMA 3GDLA 3FJ6A 3MBFA 3ZFHA 3BK0A 2Y7FA 3IVUA 5A5WA 1KM3A 1SZFA 3W1MA 1TPC1 4WY0A 1EP3A 5LGXA 2VEPA 3ELFA 4D2JA 5K4XA 3O6CA 4MZ1A 5F4SA 3DI1A 2ZZ5A 5AYXA 3P62A 5D04C 1JRBA 3LCHA 1M6JA 1OX4A 1R46A 3OBKA 3NXFA 4UFHA 5E93A 3QQ1A 2NWSA 3O16A 3M41A 1EIXA 3EX4A 3M47A 1K8ZA 4O14A 3QJAA 2YW4A 4M19A 1LOQA 3A21A 3A23A 3A5VA 4Q32A 2G95A 4JY9A 1D9EA 4X22A 4IPIA 4XTDA 1W5QA 3W2JA 2Y62A 3UYCA 2A21A 4JX5A 2PC4A 3W7PA 3N34A 2DORA 3OIXA 5EA9A 1AMKA 5LGZA 1UUOA 3EWBX 1UB3A 2YX0A 5FF7A 2ISVA 5D02A 5BOOA 2Y7EA 1D3HA 3W7JA 5LSMA 2A6LA 4LWWA 1SO5A 1QCWA 2ZRUA 4JTFA 1F6PA 1K7EA 4Y90A 1LRQA 1W3NA 3FIGA 5D2YA 4XQ6A 3WJXA 3EX2A 2ZA2A 4I7UA 1GVSA 5AHIA 3TX9A 4GWEA 3A9IA 4LS2A 2R8WA 1GVRA 4JICA 5HWMA 1AL8A 3P8IA 1GG0A 1EB3A 2V30A 2C13A 3W7EA 3TR2A 4AEOA 4I7WA 1GG1A 4NNCA 4UTTA 4K6AA 2JBMA 3S1UA 2RH9A 1GYLA 1XBZA 1TPWA 3MP4A 1Q6QA 3QYQA 2WO5A 3L0GA 3PBVA 4JTTA 4PCFA 3S0CA 4YXGA 5FEXA 1KM6A 1SW3A 3SW6A 1KFLA 1OFAA 1TIMA 3P5YA 1LBMA 3HGRA 2A7NA 3IIZA 1ME8A 1SQ7A 4Z1CA 1ALDA 5K7JA 4I7VA 3LCLA 5CPMA 3TW7A 5K4ZA 1BKSA 3TA6A 1P4CA 4UFMA 3G1DA 3TJLA 4UFKA 4XUGA 5D03A 3G1VA 5I3KA 4O18A 4FNPA 2QKFA 3LHTA 5DCDA 4R7JA 3SFKA 4LRTA 1HO4A 2VFIA 4IMFA 4ZQRA 5AC6A 2DZWA 4WXZA 3M43A 3RNDA 1UCWA 5AC8A 3W7OA 2BSLA 2NX9A 5F2LA 1LORA 4AVFA 4OE7A 3HIJA 1Z41A 3UXAA 5FF4A 1W5NA 3R13A 3HOJA 4U4MA 4AH7A 4ADSA 2DP3A 4OV9A 4QSHA 4M6QA 1A5CA 1A50A 1X1ZA 3NL6A 3TUUA 4O1CA 2PE4A 1F76A 4WOQA 2I1OA 1X8FA 4I9AA 3S5OA 1X1OA 3W85A 1ZALA 1E51A 1FWRA 3N9SA 5HINA 2NX3A 4RZ4A 3ZR4A 2CLIA 3EWUA 3W9ZA 3C0JA 2YYUA 2NV1A 2CLOA 4O13A 2PRMA 3CB8A 1ICSA 1K7XA 2V9DA 3HGSA 4S2BA 4LNYA 3M16A 4OWGA 2QCFA 1G6CA 1KTBA 3IGXA 3W1LA 5KMYA 3MMTA 4M7SA 4WQ6A 2Q3RA 5EBUA 4TIMA 2B7PA 3MBDA 3UWVA 2FQIA 3CU2A 1ZAIA 1H7PA 2HS8A 3S1VA 2AAMA 1KM4A 2QCGA 3E9AA 3FYOA 3PS7A 3GIYA 1QOQA 4M6PA 3KVMA 3L0KA 3DBPA 3PUDA 1T99A 4QITA 2XN2A 3NYZA 4TO8A 5CZJA 1W8SA 1NFBA 1U5JA 4L4LA 3O1NA 2V81A 2Y7DA 3N14A 4O0KA 4OT7A 1Q6LA 1K3UA 3WK3A 4ADUA 1VR6A 1O95A 4YWIA 1H7RA 1A5AA 2ZRWA 1AK5A 4MY1A 1KBIA 1SFLA 1G4EA 1ZY9A 1YDNA 3P80A 3RLUA 2CU0A 3LERA 1B3OA 3O05A 3IV3A 2E68A 4DF1A 4JX6A 3W7RA 2ZZ7A 3LRLA 1JCJA 3G1SA 4HNTA 2EGZA 2A7PA 1VRDA 3TAKA 1F5ZA 3KVKA 2TRSA 3ABQA 2QCHA 4S1FA 5DXYA 3K30A 3KRUA 2X2GA 1IF2A 5U4NA 3QZEA 4BWLA 1JUKA 1TV7A 3NQ6A 3W73A 3VCRA 2F84A 2ZZ2A 2J9ZA 5G2IA 1A5SA 1O94A 3W22A 5F4WA 4A29A 5BNKA 4BFAA 1TTPA 3IIXA 3BGJA 1SSGA 3UWWA 4LVFA 4ICNA 1UASA 3G0XA 1XBYA 2Z2UA 4Y8FA 1TRDA 2AQWA 1TQJA 5DBTA 4JXCA 1VYSX 3W75A 3G18A 3UZ5A 3UXDA 4TU1A 1NF7A 4E2BA 1W3TA 3UZJA 3MWAA 4FIQA 1KFBA 2V2CA 3HG3A 1S5TA 1DJQA 3BW4A 4UTWA 1XFBA 3P84A 4A2RA 1VH7A 2A4AA 1QR7A 4IMGA 2RDTA 2Y88A 3FLUA 4UTJA 5DELA 3TNOA 4RXFA 3C2VA 4O17A 2NUXA 5E0KA 1LYXA 4UTHA 2Z6JA 1HG3A 1U83A 1YTEA 3FFSA 3EEGA 3IGUA 1C8VA 1ZNNA 1MZHA 3N2XA 1UBSA 1TSIA 1FQ0A 3EXRA 4IX0A 4Z1DA 4JS3A 1FXPA 1XXXA 3DFQA 1CX9A 3QFEA 1L9WA 1LBFA 3W7LA 3L2IA 3PAJA 4FO4A 3GKAA 3NEVA 3BGGA 3W2UA 4Z08A 4Z0SA 3TH6A 1O4UA 3TV8A 3W7DA 3I65A 4IXXA 5EYWA 2B7QA 2ZZ1A 4RX0A 5DY3A 3P67A 3W70A 2Y7GA 4KWWA 4K8EA 2V5LA 1DQXA 4IMCA 4OU1A 5CPLA 2QR6A 3W7HA 4WXYA 1EWDA 2FPVA 3EWZA 4GXMA 3HMJG 2GPTA 1F74A 1RQEA 3S42A 4GUGA 2E09A 4K38A 4FIRA 2W6RA 5LHFA 3M5VA 2WNZA 4G1KA 4MLRA 1XDLA 3QMTA 4UMBA 4HT3A 1TPVA 3G0UA 4LVDA 2QJIA 2G5WA 1JVNA 1LTDA 3VKJA 1TJPA 2AGKA 3TC6A 3DENA 2Q3OA 2NZLA 3P8JA 1VQTA 3RMJA 1LDCA 1JUEA 3TU9A 4MZ8A 1DOSA 4JTJA 3TMLA 1KV8A 3G1YA 2QEZA 3MHGA 3DH7A 2OJPA 3W86A 3KRSA 1KFCA 3SECA 3U6WA 3V1PA 3W1QA 3LHVA 3T55A 1VZWA 2YYTA 1VCGA 2C19A 1W5PA 1J2WA 4N4QA 1R2RA 2J27A 2B4GA 3F03K 3E12A 2R14A 3PY2A 4JEQA 4CCCA 2CZEA 1VCFA 2E6FA 1IIHA 2GQAA 1RD5A 1YPFA 2TPSA 1OHLA 3TDFA 4DBEA 4ALDA 1G7UA 1VYPX 2WNQA 2H8ZA 1S5WA 3LM7A 2CZ5A 5AN7A 5KTLA 1OFOA 3UD6A 5EPDA 4RZ5A 5G2WA 3LLDA 3TFXA
chains in the Genus database with same CATH superfamily
3WNLA 3CZJA 1GCYA 4US6A 4C6QA 1MZRA 1RALA 5I6SA 1JDDA 4RJEA 1CZ1A 4QDPA 2P3ZA 5K9DA 1XKYA 3TLLA 3DZ1A 2VYOA 2J7BA 3SCOA 3AYVA 3T2OA 3ZM8A 3CQHA 3QVQA 3M0KA 3BWWA 1DJXA 1UKTA 1BVZA 4U28A 4AWSA 4RKAA 3DIPA 3KTXA 1TJ1A 1WDRA 5A8OA 3BJTA 5JXQA 2BY1A 1NU5A 3T1GA 2IPGA 3PSWA 4LUSB 7XIMA 4CU6A 2QUTA 1DE6A 3RIKA 3NQ2A 3PP7A 4NG3A 5CC5A 2A85A 5LKYA 1IZJA 4HMCA 1FFRA 1T0OA 4GGHA 4Y9PA 1REQB 3OQEA 2YZRA 3NPVA 3I3BA 3ARWA 3THQA 5CPNA 3ZIZA 4DJFC 2V63A 2GQ9A 3OYZA 6A3HA 1ECQA 4Q7IA 3N2MA 3MQTA 2ZVIA 3R7MA 3ARVA 1W5MA 4MF4A 5FACA 1US2A 2EEXA 3HPAA 4TVUA 3TK7A 1S3TC 3NUKA 2O7SA 4IWWA 1TVLA 3GVGA 3GFYA 3WDQA 1ZB5A 3PZVA 2DSZA 3V3WA 1IT8A 4K68A 5FL0A 1THFD 2CIPA 4LANA 2ALRA 4MOZA 1GOIA 5GQBA 5I07A 4HPJA 3LXBA 2QULA 4AVOA 5M1TA 2WV8A 1W1VA 3G6MA 3OGRA 3WO8A 2V5DA 3KWXA 4QNEA 4HNLA 1Y5VA 4H8UA 3GXIA 3T81A 1R85A 1ZJBA 2WYSA 4WK9A 2VO5A 1H2JA 3PVFA 2VFGA 4Q8UA 4ZSUA 3QHMA 2CLPA 1VF8A 4NZ5A 1K02A 2ANUA 1AA1B 3T09A 3ANVA 3L67A 4H41A 4LT9A 1FCUA 4RDYA 4NJIA 1A80A 2G4JA 2VR5A 2Y63A 5DLCA 3BQ6A 1W6TA 4HHHA 5LHEA 2GUYA 1XSKA 3CIWA 2GVJA 4DM2A 1Q7ZA 2ISSA 1H41A 5GJMA 3W29A 4BI7A 3STFA 5H1WA 4NXKA 4ZFMA 4RE4A 2GVLA 3PPHA 2HBXA 2V82A 4CD6A 5BCAA 3URQA 3ZVIA 1XYZA 1BF2A 3BCDA 4L1GA 3TC3A 4R53A 3RMEA 3T9PA 2YBVA 3KFTA 2CW6A 3AALA 3NO5A 4W8AA 4G7FA 1XH1A 1OX6A 3H6OA 1DQUA 1G0CA 2VR2A 4QEEA 4UR7A 1MUCA 2MNRA 2OXNA 4QROA 3MUXA 4QG8A 1B2YA 3PWAA 2A7RA 4YHGA 5CGMA 2QJHA 3S6DA 3T44A 4EANA 1HN1A 1FWWA 3B8DA 4L9XA 3RO8A 2ZQ0A 1P6BA 2BGSA 4R7WA 1BXCA 5DCBA 3NL3A 1UR3M 1Q5MA 3VKCA 1DTNA 3STCA 4MAZA 3QFWA 1FRBA 1R8LA 2BHYA 3RPTA 2WZHA 2BHUA 3MKKA 3L9CA 3PBMA 4H9YA 2NVCA 1KNWA 4UFJA 3R89A 2OZ0A 4S2CA 3H2NA 3BURA 1FWFC 2VR4A 4QFUA 3I7QA 1RPXA 8XIMA 4GQGA 1V0NA 3L21A 2FHBA 1KFKA 4CN1A 1JRCA 2XFWA 3ZJ7A 3O0KA 3U8GA 4W8BA 3OQ8A 5JVLA 3L66A 1EPXA 4TMCA 4CVWA 1H3GA 1TYGA 2O9OA 4GH3A 3FAXA 4GISA 3HQ1A 4AY1A 1EDGA 1XLCA 3GG8A 5LNUA 1OCQA 4L1XA 3L4ZA 4J3UA 3FN9A 3W83A 1E4LA 3C2EA 1BQCA 1FWBC 5GNYA 2E77A 2G50A 4WHBA 1YW1A 2BOGX 2A1YA 2INZA 4M80A 4UTKA 4RXGA 5U7SA 2PU0A 1DXIA 1QHZA 3CUGA 4L7ZA 1SZNA 4BJHA 2FTWA 4PUWA 5XINA 4I5UA 2J7FA 1BAGA 4RDWA 4ORIA 5AHMA 2V68A 4KCTA 1XUUA 4DPPA 4B5VA 2OT1A 3FGCA 4XZWA 3CV6A 5HMFA 1Q2RA 1KXQA 2PDHA 3FVMA 4KCVA 2VC9A 2R82A 4MPKA 3CT2A 2VC5A 5A6AA 1XG4A 3VFLA 3NQ8A 2YDAA 4PRRA 1HTIA 1CPUA 3NEHA 3VZYA 4S3CA 3PZGA 1W1B1 3GIPA 4KWVA 2E7FA 1XF0A 2XHYA 3WJSA 4CEXC 4W87A 4D6CA 3B0UX 4XBSA 3MZ2A 1V6WA 5SWUA 2Z00A 1SJAA 3G1AA 2IPFA 3AJXA 1C91A 1DJWA 3FKKA 3RO6A 1F05A 1G1YA 4JTAA 1FVPA 3WNMA 2FVLA 4Q22A 1JF6A 2REQA 1B3WA 1M04A 2OYKA 1FWAC 3VGHA 1JZ5A 1DYSA 4OQVA 1W1A1 3C2RA 4ZOBA 4BWLC 1V02E 1YIXA 1H0IA 3QGVA 4QR6A 4K7YA 2IQTA 1HJVA 4S3AA 1VD6A 1TR1A 5AVNA 3VZXA 3U4FA 2X30A 4FLOA 1H5YA 2BWGA 2FLIA 4XO7A 3UJSA 4UTLA 4TXEA 2DT2A 1XLLA 2VMFA 1ISZA 5HXMA 5ABTA 4DBDA 4DWSA 1YXCA 3MPGA 4AEFA 4O4VA 5E6ZA 4AD0A 2I5IA 3KEHA 1AQFA 3VILA 4Y7EA 4LNCA 1EDQA 3IGSA 4I8DA 4QIUA 1UZ1A 4PCNA 3AS1A 2XIJA 1VIZA 4P8XA 3F4NA 1I2RA 1U1UA 3H55A 1XLEA 1DV7A 4WD0A 3SURA 2IXVA 4HK5A 1OFBA 3TQ0A 1RK6A 4LUYA 1TMHA 3T40A 2ZXQA 1JZ6A 4S3BA 5FA5A 4ATWA 1GOQA 3OEXA 3QKEA 1PXGA 1O1ZA 3QH2A 1QAPA 4BF7A 2Y85A 2H3BA 1XPYA 5I3JA 4AD4A 3WUFA 3THUA 4TMBA 1BYAA 2HPMA 3IUDA 4DWDA 3LGDA 3N2TA 1BLIA 1E6ZA 1UWSA 2ZADA 5HPOA 3VD9A 1XRSA 1UA7A 2G3MA 3KVLA 1QNPA 3B4UA 4LYQA 1KRAC 1EUNA 1H60A 3WF0A 4UTUA 2OEJA 4G7EA 4IMDA 1OG0A 4NUWA 2FFCA 3BW3A 4QS6A 4QQUA 1ZLPA 3LOTA 1GNXA 4E3TA 3GBDA 4TX8A 5IDZA 1KRMA 5C9ZA 3GXTA 3M7WA 2PLCA 3RYSA 1E1CA 1FCBA 1SFJA 1I45A 4WSHA 3GB6A 1OFDA 1JJKA 5DMMA 4RCXA 1J0KA 3WBYA 3QW3A 2ZX8A 3WH5A 3ATYA 1XV8A 3CTLA 2ZA3A 4J3ZA 4YLWA 5LNRA 3S2CA 3FA3A 4WF7A 1GVFA 4IM4A 2O92A 3TYAA 5DN1A 2EPLX 3P6LA 1K8CA 3U3HA 5E1QA 2ZRYA 3WLRA 3CPUA 4B15A 4AD1A 1KTCA 4I3GA 2ISWA 3ORWA 1TX0A 3LG3A 3EDEA 2PEVA 3LBMA 1A4LA 1X38A 4FB7A 3LV6A 2VVNA 3N17A 2P10A 1V3LA 2QLYA 4RW3A 3N9RA 3GXNA 4PEEA 2E6DA 3QOMA 3LV5A 3W38A 3TW6A 4TX9A 2VX5A 4W89A 2PS2A 1BD0A 3NAVA 5EMMA 1UKSA 1UKQA 1H7OA 1NOUA 2OG9A 3PPGA 1L2QA 2RDWA 4DUWA 3MI6A 4I6VA 3H26A 2QDHA 3BSHA 2JF7A 3MSRA 5ENLA 4DJFA 5CSRA 2GYIA 2GDVA 1CXLA 2G37A 3AFBA 4F0RA 3DFTA 1W3KA 2GSEA 4KIEA 1KM1A 2C79A 3M6DA 1TG7A 4GZ7A 1FDJA 1RVGA 3B9EA 4QDMA 4X2RA 1IR2A 3AYRA 2IPWA 1JG9A 4XB3A 4JTKA 4ZE4A 2IXUA 2BVWA 4R27A 1BG9A 3OLDA 5HMEA 1DJZA 4YL2A 2HE5A 2BXYA 4Q33A 4LH8A 4C6LA 1Y7VA 1YHTA 1RUSA 1GQNA 4UOZA 2C7FA 4CKQA 1GZ1A 3L12A 1XYAA 2H8XA 1E6SM 4E38A 4C6PA 2AL2A 1E72M 2BZNA 1PDZA 3M0YA 4UIOA 5CZTA 1FP9A 4JL2A 3SCUA 4IF2A 3T42A 1Q85A 4QRNA 2OSYA 2FB2A 1E15A 3FYYA 3NM3A 3HPXA 3HG4A 2HEJA 4ZO7A 3OB8A 3NSNA 4PFMA 3GH4A 4ZSTA 3GNOA 4MKVA 3UQNA 4ROQA 2HCVA 3WD2A 3BOLA 4DX3A 4L4MA 4KFOA 1W9XA 3NOEA 3NTYA 1UA3A 3TLQA 4LW7A 2Y70A 1PVNA 1TPEA 8RUCA 4WDWA 3VMOA 5FAJA 1PCWA 2WCAA 3VKBA 3FA5A 3SN1A 3HGOA 1DWJM 3UWZA 3IRDA 3ITVA 3MW7A 4J5NA 4A4AA 3S4TA 3P82A 1RP9A 1QBAA 3TW9A 4H3DA 4EIVA 1P6CA 3I3DA 1JZ8A 3R8GA 1AQMA 1QMLA 3C2YA 2BTMA 2J6XA 3OOQA 4ENLA 4LU0A 4EACA 3DHFA 3PM6A 3IGHX 1HGWA 4CNNA 3QZ6A 3EDKA 1GVQA 3W2MA 1ISXA 1KD0A 5CG7A 4AHOA 4OOUA 1N82A 3B8TA 4JN6A 1CTNA 3W7QA 5JH1A 3TOYA 3LA4A 1TCMA 3F2CA 1WXJA 4LYKA 3NO1A 4J3XA 1V4YA 1F61A 2VC7A 4KIRA 4WR3A 4G8TA 2DIKA 4NJGA 1GORA 2C15A 3LCGA 3SQMA 3LNMA 3BAWA 3R8HA 1W2VA 3IVSA 4NJJA 3VMPA 4AISA 5H8MA 4UTFA 1D7FA 1BWKA 1X8CA 1C8YA 4O1FA 3UG3A 2VGIA 1CGXA 3V0TA 4BQ5A 2FJKA 1L6FA 1UP3A 4MB1A 1FWJC 1IEVA 3NDOA 3WQ6A 1B90A 3WQOA 2POTA 2QUUA 1UC4A 3UFYA 3VXGA 1RHCA 4PODA 4CGTA 1LLZA 4AIUA 2UY2A 3WZ0E 4KEVA 2J6VA 3CH0A 5BWFA 2A0NA 2W27A 3GG7A 1XQKA 1MXGA 2V67A 1RAKA 1KLZA 2PDXA 3UVAA 2VFDA 4GQ0A 3RITA 4GUHA 3MHUA 3S5NA 3MYOA 2OTDA 3SRKA 2DJLA 2NSXA 4QJ4B 1XRVA 1H49A 2QUMA 1HVXA 3VX0A 5D2TA 3N6JA 4NZFA 4AC1X 4K39A 4E0CA 4LC8A 3AROA 3NR0A 5IM51 1VJSA 3MV11 1JQVA 3IVTA 1J79A 2CPUA 1SPQA 4JTQA 5FJTA 1Q7QA 4RK8A 1ADDA 2DPEA 2IKGA 4IUGA 1Q8AA 4H9XA 3OZMA 2E5CA 3QV9A 3UY8A 1E40A 2GWGA 3RJYA 3V0UA 5FEWA 3RG6A 2OT0A 3CGTA 3H7RA 1GEHA 3I7RA 3WDPP 4LB3A 4UR8A 4ZGYA 2OODA 3CAWA 3Q94A 5EMUA 2BXZA 2PLJA 1UPMB 8TIMA 5LNSA 3FVDA 3HB9A 4IPPA 3SR7A 4DAIA 1DIDA 1LOLA 3S6TA 2E8ZA 3PBYA 4HGXA 2C18A 2NV2A 4D6IA 1G01A 1PZ1A 4L64A 3WQ4A 1JQXA 1EEXA 4QG6A 2FIQA 5K9CA 1UQYA 2DZBA 1VFOA 2UZ9A 3RF9A 1Q6GA 3W28A 4KS0A 3W25A 3NQFA 3P2VA 3K8KA 1FWSA 3MUZ1 2Z1XA 4QJ1A 4QP0A 3FY1A 2J8GA 5LIKX 4PTMA 3GLCA 3WQGA 5AHEA 3AO0A 4D1JA 4S38A 4PUJA 1I2NA 3ZZ1A 1MO0A 4E8DA 4QISA 2WLZA 2D0HA 1XDJA 5DT7A 2XVPA 1F3WA 2OQYA 4FXFA 5EB8A 2X1RA 3LI0A 2QDEA 4ZEPA 2UV8G 1DJIA 4GA8A 1IR1A 1RD6A 3P5ZA 3QPYA 3EZ4A 3EMQA 4O15A 3IACA 4AAJA 4NRSA 4CCEA 3NQEA 4ZFCA 1YYAA 3U2EA 4G5DA 2FH6A 5FJUA 2EQDA 1TVNA 4C6JA 1SJDA 3LPPA 1LBLA 3C0LA 1XIFA 1WDQA 4WOZA 5T9CE 3CUJA 3BAJA 3VU2A 5C70A 4EPKA 2ADAA 4RDVA 1ZS2A 4MKNA 1TFVA 1SJCA 2W62A 4IGHA 1P43A 3W6MA 3FOKA 1OB0A 1DWGM 4KKXA 3WJYA 4Q4SA 1WQ5A 4JIHA 4WUIA 4BI6A 2WKGA 3MI3A 3IV8A 3N3MA 3U7VA 5C2GA 2ALDA 3B04A 2VI0A 5HJXA 1TWZA 4XIAA 2GLKA 2R94A 4NRRA 4WX2A 2W9MA 2VOMA 4UOJA 3T7VA 1QI3A 4M1RA 3LPGA 4WY0B 1J12A 1JCNA 3NZGA 5GJPA 3U2OA 1KFEA 1IQ8A 2NQZA 2NT0A 3W07A 2XN1A 1XM3A 2Z1BA 3NVTA 4FF5A 1XRFA 3W7GA 4LUIA 2P8BA 5CH9A 1TX2A 4IQLA 4FMVA 1JF5A 4LV9A 3KHJA 3H4WA 1E5JA 5MHBA 2WHJA 1VEMA 4Q8NA 1J9YA 4MVAA 3B8SA 1QO5A 5TD4A 1UHVA 3CBWA 2GJXA 3U2CA 1HKIA 4YCPA 3AIUA 1AQ0A 3BO9A 1FCQA 4WJEA 3P74A 4B5TA 4HZ8A 4NYYA 5HNRA 3P60A 1P48A 2OWCA 1JZ3A 2GQ3A 4PUNA 2FZNA 3PANA 3CUHA 4B9ZA 1KV5A 3HTWA 1Y5WA 2E5DA 3APYA 1AJ2A 1WP6A 4FEZA 4RNFA 4IMAA 5M3WA 2PCEA 3UG8A 3UPMA 1Q6DA 4H6EA 1SGJA 4WY0F 3NXLA 3ANYA 3EKZA 1FDZA 1PV8A 3CB3A 3WQDA 2E1DA 3L7RA 4E8CA 1JPHA 3RM4A 4CCDA 4E4UA 3A22A 3V1HA 3FKRA 4OHQA 5G1TA 3UZXA 2H6RA 1CT5A 5JUVA 3G3MA 3MHFA 3AZTA 2PDNA 3G5EA 5FEZA 2WMIA 1XIIA 1ZSXA 3NQMA 5D09A 3ZLGA 3B8WA 2CBVA 3GNDA 4QHRA 5L6UA 5GVJA 3C3NA 1DVJA 3TSBA 4A2SA 5EMYA 3KL3A 3BE7A 5IHRA 3LPFA 1UH2A 4RNHA 5F7UA 3GXFA 1IE7C 2FGBA 5A5WA 3ZYZA 1V0MA 4Q4QA 1ODZA 5M17A 5C9UA 1SZFA 3W1MA 1EP3A 5LGXA 1U2YA 1D7KA 5IFPA 3ELFA 4D2JA 3O6CA 1EHNA 2ZZ5A 5D04C 5DT5A 1TWDA 2PDIA 3E3HA 3UJ2A 3KBNA 5AECA 2NWSA 5CC3A 3QV8A 4MGGA 1EYEA 1UJQA 1K8ZA 3T0TA 2WKLA 4OOZA 3LSBA 1ZBVA 3A23A 4AIOA 3A5VA 4X22A 4DM1A 1S39A 1E0TA 1RY0A 3UYCA 2PC4A 4XBJA 1OINA 2QF8A 1UB3A 2YX0A 5FF7A 3QHOA 5BOOA 4S3EA 3ARQA 4LWWA 1QCWA 4IGMA 3F5KA 4M56A 4JTFA 3WDRA 1K7EA 4Y90A 1MUMA 5D2YA 4XQ6A 1ZP3A 2ZA2A 3TTOA 5AHIA 4IP4A 3P0XA 1GVRA 4JICA 2OFJA 1PWMA 1AL8A 2D3LA 3P8IA 1P0BA 3L4TA 3W7EA 4HMNA 4KWSA 1QXLA 4AEOA 5HATA 1GG1A 4S3JA 2ZIDA 1WCGA 2JBMA 4DXXA 3S1UA 2RH9A 2BNJA 3RLHA 1SR0A 2ONEA 3L0GA 1LQAA 2XDFA 4X0NA 1P6WA 3SADA 5FEXA 1KM6A 1KFLA 2AKMA 4UQBA 5I5RA 2EJAA 1MW2A 5DMYA 1HKJA 4YTQA 1CXEA 1ALDA 1R6WA 4P7QA 4I7VA 2PDKA 2KX9A 2TAAA 1V03A 1ITXA 4LFYA 4UFKA 4D6GA 5I3KA 7REQA 1QI4A 4FNPA 3ISIX 4MDOA 3SFKA 2VFIA 2X8RA 1TKKA 2XVLA 4DO7A 4H9VA 1TVPA 4QDWA 4WRHA 3S3GA 3W7OA 6TAAA 2JEQA 4AVFA 3HIJA 3BAIA 4FP1A 3IK2A 4A3HA 3U7BA 5TNVA 1UH3A 4AH7A 4FSAA 2VNCA 1I60A 2DP3A 3VD4A 1W9UA 4Z1YA 3IWPA 1W1TA 4JQ1A 1XLDA 1F76A 3OPSA 4MSSA 1X8FA 1W9PA 2BP1A 1ZALA 3ITXA 3N9SA 3HV8A 3K13A 5ABFA 2OX4A 3GC4A 4DBUA 2CLIA 4C90A 4DZIA 1EH9A 2CLOA 2PRMA 2Y8UA 2VCBA 1K70A 4OWGA 4K1WA 2QCFA 6PTDA 5KMYA 2GSJA 1T7LA 3MMTA 4B9YA 4M7SA 3ES8A 3S5SA 3DOPA 2HWGA 3A64A 4HOXA 1ZAIA 4P7NA 2HS8A 1Z89A 4EAYA 3SUTA 4PMUA 3TYCA 2F61A 2QCGA 5C7VA 3PN8A 1XLBA 9XIMA 1QOQA 4WKFA 4ASTA 3L0KA 2HRWA 5ABEA 4HP5A 4QITA 1XFCA 1GQKA 4RPQA 4UZUA 1DJYA 3OHMB 1VFLA 2FTYA 4O0QA 1U5JA 3UXLA 2PA6A 4J2PA 1IWBA 2ZOXA 2YKKA 3GG0A 2O9TA 1EA9C 2ZRWA 4MY1A 3S2JA 1G4EA 3LERA 4H6QA 1PX4A 3WDJA 3GU9A 5FJRA 4DF1A 4JX6A 4TVDA 3W7RA 3F5JA 1KCLA 2E25A 3GHRA 1R3YA 3QYSA 1RJRA 5A6KA 5T8GA 3T4WA 1S2AA 4S1FA 2G41A 5DANA 4IFKB 2CKSA 1FWIC 1TV7A 3NQ6A 1WKFA 3WCZA 1A5SA 2VGFA 2RGLA 3W22A 1TMLA 3LMYA 4YNGA 1TTPA 3OBAA 1B3VA 1HJXA 3BGJA 3QR0A 3KBSA 1CXHA 4LVFA 2XVGA 4GNKB 2Z2UA 3ABXA 4GY1A 1B3ZA 4WSKA 5CJMA 1VYSX 3SAZA 1LT8A 2PC8A 3UXDA 2OWWA 1U30A 1JFHA 4H9ZA 3MWAA 4FIQA 1S5TA 4KWUA 1DJQA 5FSEC 3BW4A 4ATLA 2A4AA 2WZMA 2BB0A 4QGCA 4UTJA 1WAWA 3C2VA 3RX3A 3WELA 1NP2A 3EEGA 3FFSA 3IGUA 2J79A 4GACA 3EXRA 3IJIA 4Z1DA 1FH8A 1FXPA 4GINA 1XXXA 2PWEA 3DFQA 1CX9A 1L9WA 4YTUA 3W2UA 5PTDA 4Z08A 1RH9A 4F0LA 4D9PA 1O4UA 3I65A 5EYWA 2V5LA 1XS2A 5CPLA 3UA3A 2QR6A 1LUCA 2FPVA 3EWZA 4GXMA 1M1BA 3HMJG 1F3TA 4A8RA 4GUGA 4FIRA 1M41A 5LHFA 2WNZA 4G1KA 4GXWA 1XDLA 3QMTA 4UMBA 3DC0A 2YIHA 4JN8A 1JVNA 1LTDA 2JQXA 3RMJA 1JUEA 3EOSA 3ID7A 4FLSA 1KV8A 3UXIA 3G1YA 4WGHA 5DRCA 1QK2A 4Q3MA 2W66A 1F3XA 1VZWA 2YYTA 3OA5A 1ZRQA 2C19A 1W5PA 1J2WA 2J27A 3E12A 3Q4DA 4HA0A 3PY2A 3MUIA 1PKYA 1RY8A 2CZEA 2NVAA 4JCMA 4I6KA 1GQIA 1YPFA 4GPNA 4UQDA 4ACZA 1OHLA 3VD7A 4ALDA 1KKRA 1VYPX 3BUVA 3TYDA 2H8ZA 3VM7A 1S5WA 4CU8A 3LM7A 5MKGA 2YL5A 5EPDA 7ODCA 3AZSA 4RZ5A 4H83A 5G2WA 4EK7A 1X6LA 1U5VA 3TFXA 2A3BA 1SU5A 3MI2A 3GVQA 3PZMA 1AFSA 2XGBA 1W54A 3SCQA 1HJUA 2NQ9A 5E09A 3BC9A 2J88A 3ZSTA 2QMJA 4JTEA 4ZL1A 1Z7AA 3MKCA 4ZQCA 1O5KA 3DXIA 3A5FA 2XIBA 4GBDA 2IPJA 2X05A 2OKOA 1GKPA 1A47A 2ATSA 2YCIX 3SUSA 4IXHA 3A6OA 1EGMA 4AG0A 3C61A 3S2MA 3E6EA 4YTTA 4ORMA 2BASA 3M0LA 1R2SA 4HYRA 1OD0A 1WDSA 4O11A 3EYPA 2XIQA 1EP2A 1TE1A 3TP4A 5KSWA 3OODA 1AW5A 3KP0A 1UQZA 2E9BA 2NWRA 3PSVA 5BMXA 1QJWA 3IK4A 4MJMA 4CQAA 4XD5A 4DXKA 4OKDA 3O3RA 1FFQA 4HU4A 1MEWA 4FNUA 1MVYA 4NZCA 3VKAA 1AL7A 4PMVA 3DYOA 1ZBWA 5C9RA 3E96A 4LF1A 1JULA 1TPUA 3DFHA 1KXVA 1W5OA 1Z44A 2VDIA 1UD8A 1DIKA 1GJPA 3PHAA 3OIHA 4ZO8A 1MRAA 4KQNA 4C91A 3LTYA 1R3RA 3ZJ6A 1DIOA 3RX4A 3PB2A 3AXIA 5DY2A 4CQCA 3L4VA 3S5ZA 3SEPA 4CD7A 2WB5A 1DHKA 3KBWA 5AB3A 1XLIA 3A24A 1FUYA 4GH1A 3AWNA 1XLGA 1TQXA 2EG6A 2IKJA 3EXTA 1CWYA 3AYSA 1CENA 4D6EA 4P61A 4LUJA 1MFVA 2WSPA 4ZB2A 1VENA 2B0MA 3C2FA 3SRFA 6REQA 4K37A 1OYCA 4CCZA 4KESA 3NL5A 4JTGA 1JAKA 1JFXA 1TELA 3LNPA 1SO4A 2Y1HA 1E9YB 2E8YA 1H5VA 5F4XA 2NUYA 1E4IA 3ZMRA 4EVZA 1IWAA 2Z1VA 5AHLA 4RUBA 3ZSSA 1TWWA 5BOFA 3SCPA 1FTXA 3EOLA 3FGCB 2PSNA 5CPOA 3R0KA 2EAWA 2ACSA 3WK1A 3NQ7A 3ZQ9A 3QSTA 3QW4B 1A0DA 2ZTJA 4DJED 1HKKA 3NZPA 3ZWTA 4MUZA 3F4VA 4XVDA 1XX1A 1HP4A 4IIBA 4H1ZA 3G22A 3QC3A 3MYPA 3R12A 4ZCWA 3VM5A 5AFDA 2ZUUA 1MW0A 3ABRA 4LGXA 4DUXA 1YTKA 4HKPA 3EGJA 2VEIA 1MDRA 4PUKA 3IIPA 1R38A 2Q8ZA 3O2LA 3IEBA 1WE5A 5HJYA 1V77A 1CI1A 2QJGA 3KRBA 5ABGA 4KCWA 3VUPA 3ZR6A 3N25A 2REQB 3N4EA 3L5AA 1C8QA 4AZBA 1J4EA 1S46A 5K9XA 1G4PA 2I7GA 4DO4A 1K6WA 3UZZA 2BBFA 3WDIA 3W1AA 1BYBA 1Q6CA 2BXVA 3EX1A 2R1PA 3WEMA 1QVBA 3R2GA 1VJZA 4F9DA 1F9CA 2ACRA 2ZZ4A 3VOCA 4O1DA 3S9ZA 2XYLA 3DDMA 1EYWA 4N9CA 4POCA 4NI3A 2I56A 4IIFA 4CN4A 4DWSB 4ATDA 1L2UA 3CZLA 3VIKA 1FKXA 3AISA 4O54A 1G4TA 3LLFA 4NI8A 3URAA 2GK1B 1LG1A 3GH5A 3NYDA 2PWHA 1JPIA 3IUHA 2WSQA 3H24A 3Q37A 4CNUA 2Z25A 4QE1A 2CFFA 4IPNB 4FNRA 2OR2A 4E2OA 4UQAA 1ICPA 1A5NC 4HHPA 3W2LA 4UNIA 3JS3A 3KOFA 3B0VC 2I9EA 4R5EA 1YXDA 5DBUA 1EX1A 1XBVA 1XC4A 4B2DA 3NZRA 2NUWA 3B06A 4XX6A 1Y5XA 3WMLA 2CHNA 3EPNA 4XZLX 3W1PA 2ZYFA 3GX9A 2D2JA 2JGYA 3QF0A 1C29A 3GU1A 3OW1A 4GUJA 1LLOA 1KGWA 1VBGA 1BTMA 3DN5A 3CC1A 4Y9OA 5HQMA 4G7EB 1OWQA 3F4WA 3PZQA 4MAVA 4B5SA 4W5UA 2OLSA 4K1GA 4ZQMA 1GVOA 3CLMA 1TRIA 3TJXA 1KCXA 5EFFA 1NTHA 3WYZA 3AUOA 1E1CB 2QJJA 3BV7A 3URBA 3REQA 3IS4A 4XKYA 1AD1A 3FW6A 1T8XA 1N55A 4AW7A 3CK5A 4HCDA 3ZLHA 2Z0IA 4N7QA 2ATMA 3MMWA 2EPOA 2WBGA 4BI5A 1VBHA 1ME7A 3EWXA 1ADSA 4GBUA 5I0DA 3GZAA 1RLCL 4BR1A 3ARYA 3WBWA 1TV8A 1TA3A 3PZTA 4DJEC 5JQ9A 4K3ZA 2PZ0A 1IGSA 4GMEA 5RUBA 4J1OA 1EEPA 2I14A 3CASA 4IOTA 4LBUA 1UZ4A 5E5CA 4O8AA 2BVYA 3BLDA 1POKA 3E0LA 1WUEA 1TTQA 1BEUA 4JIRA 2C6QA 2WOQA 2CLLA 1TV2A 5FF2A 2JKPA 4ROPA 1UWRA 3VINA 4M51A 4M6VA 5G1YA 2GGHA 1W31A 1DORA 3RCNA 3LCXA 3EAUA 1QDSA 4IJBA 3EB2A 5CG0A 3UERA 4Y96A 3EA1A 1TPFA 1B31A 1R9XA 2ISDA 4U33A 4Y6GA 3GIQA 1OGSA 4GUIA 4PYSA 1XQLA 5I09A 1PB0A 4PZVA 3FDGA 2WSKA 1JD9A 1QI2A 1Q7MA 3IIOA 2WVSA 3L4XA 3WJWA 4UMAA 1Q45A 1KM2A 4D6FA 4PH6A 1FY6A 1T5AA 1WBJA 3NPUA 3CQJA 4RE3A 2WC4A 4UMCA 3AIWA 4NL1A 3TAOA 1UWAA 2ZUNA 2PU1A 3AWOA 2YDRA 1LP6A 5HA7A 1DWIM 2E28A 2WVVA 1XBXA 1ESWA 1XCWA 1XIDA 3GR7A 1QTWA 5CPQA 3LHZA 3E0IA 3UJRA 3T8LA 1NDWA 2WMKA 3WQ8A 3A13A 1ITUA 1C92A 2BDQA 2Y8VA 5HULA 3AUJA 4N9EA 3CXOA 1T40A 3OHIA 1R30A 3A4WA 4PMOA 1PTDA 5HJLA 4WDXA 4O1AA 2A3CA 4HCHA 1QNVA 1A53A 3EA2A 2FZBA 5EU9A 1Z32X 2WPBA 1K8XA 2IMRA 3LTPA 1E4NA 1MDLA 3BCFA 3PF3A 4XTIA 1Q2SA 2AL2B 3HQNA 3UPWA 3L4YA 4U31A 1OJXA 1JCXA 5BYWA 3WD3A 1XGDA 4PBEA 2TSYA 2DW6A 4L9YA 4ZOEA 1E1FA 4EF8A 3KCLA 4HTBA 4L9ZA 3PG8A 1UD2A 1A5LC 3URNA 1WXYA 1EUAA 3ITTA 3V35A 3HFYA 1AJ0A 2FH8A 3UZYA 1NDVA 1O12A 1DJNA 1XP3A 2OQHA 2D73A 4IGNA 5G5IA 1IZKA 1W9VA 1I1WA 3UU0A 2CBUA 2V8ZA 2PDJA 1J2BA 1L6WA 1R86A 1Z42A 1UR0A 4GFSA 2PI6A 1HW6A 1XIJA 3V5CA 2V5JA 3Q58A 5G1MA 4ZR8A 4AZGA 1K6AA 2W92A 4AWEA 2CCRA 2HXUA 1OADA 5IBXA 1XIMA 3VE7A 3OP2A 5AC4A 3MUCA 5C7HA 1MXDA 2DJXA 5HMDA 2NQLA 3GKFA 3D46A 4XZ9A 2RUSA 1QPNA 1JXJA 2AOSA 4CNTA 1MXSA 4IMEA 4IIHA 5G4EA 3N73A 3LI1A 5HWNA 5D30A 4I5RA 1ZAJA 4GNJA 4CNSA 1W1PA 1A0CA 3GY1A 1NDYA 2ZICA 3WLTA 1E9LA 1VFTA 3U48A 5EY5A 4R33A 3DESA 5E0FA 4H9MA 4B3ZA 3H7VA 3YPIA 1E43A 4GYKA 3PZOA 3PZUA 1YBQA 2VURA 3MCOA 4JY8A 2FVMA 2EG8A 5I78A 5EMJA 5A3HA 3K8LA 1W3IA 1GZJA 4AU0A 1Q3NA 1H7WA 5D9PA 1FOBA 3WQVA 5BROA 1J8VA 1EXPA 2C16A 1SFSA 5G4WA 3WBAA 1F7BA 5HDRA 2GJLA 3A12A 5XIAA 4X2PA 3VDGA 1H51A 3T2PA 4UC5A 3ONCA 2AAAA 2TYSA 3VIGA 1J0JA 3ICJA 3TMQA 3DFYA 3TTYA 1W1YA 2HVOA 2VX7A 4RNJA 4YHEA 1JCTA 4R7OA 4UQEA 4EOUA 1ZL1A 4NT0A 4HHLA 1O60A 1WDDA 3P81A 4Z42C 1LM1A 2PUZA 5AOUA 2PGWA 4PSPA 1ITCA 5TIMA 1RSCA 1XKJA 2F6KA 2ZWYA 5ECVA 3ABZA 3THCA 3UWUA 2X1TA 1J10A 1ZU8A 2CXGA 1A5UA 1UWQA 1QOPA 4XAGA 1KQYA 4AZIA 4H7ZA 2JEPA 3CHFA 2OOGA 2J9YA 1Q4NX 4HA1A 3LX9A 3V5OA 3I6RA 4GOAA 4RE0A 4KEMA 4RPPA 4Z1AA 1R3SA 3R8RA 1I75A 4JYDA 2Y5JA 3UNTA 2VFHA 1M68A 2ODOA 1QATA 3TYUA 4IG2A 4PUMA 5KITA 1ZFJA 1YXYA 3CUFA 4QSFA 3UCDA 5CBIA 1JCMP 3CPRA 4I90A 2PBGA 4MTVA 2V2HA 4MIMA 3DGRA 1YLVA 3H4XA 1CEOA 1VPXA 5F2IA 3LHWA 3QRHA 4I8YA 3PG9A 4DYJA 2IS7A 3WL0A 4IQJA 3QSRA 1KM5A 1YADA 3S9IA 4V28A 4QTGA 3V75A 1XINA 2DH3A 1K9TA 2NXIA 4W84A 3FV9A 3IPWA 3WH8A 3SGUA 7TIMA 5I3IA 1YNPA 1CLKA 3EX3A 1OG6A 3SI9A 4C6NA 3ALGA 3S2LA 3BMWA 5AZ1A 1SZRA 3SCVA 4LCSA 1ML1A 1YDYA 1HL9A 2ZWZA 1QO2A 2BGNE 2VTFA 3NL2A 4EXQA 3IJQA 3VOJA 2OGJA 2B7OA 3R10A 1ISYA 2D1ZA 1KGXA 4KRTA 4XK2A 4ONVA 4JN7A 4HOZA 2ICSA 1AW2A 4H9TA 1IXOA 1NP0A 3P0WA 4PSRA 5HQEA 5F1VA 5CJ5A 3SIZA 1ELSA 3TCSA 5FI8A 2QAFA 4X61A 2PAJA 4D1IA 3GXMA 5CSUA 1XJBA 4FNTA 2HE8A 3GVVA 1EC9A 2C71A 4ICMA 5AY7A 4DVOA 1PHWA 3M9YA 4ADTA 1GVEA 1NARA 1LL4A 2DT1A 4O52A 3U2ZA 3AZRA 4QJ3B 3N15A 3CZGA 5FEPA 3TCEA 2A2IA 1KWKA 1U1JA 2OCZA 2EXOA 5D2XA 4ZXLA 3EB4A 5C0QA 3W02A 1DPMA 3FEQA 1DWHM 3ME3A 2NQHA 3CIXA 3WUGA 3L23A 2QPSA 5JIWA 4GVGA 5FF0A 1FCVA 3MB9A 3NQAA 1YQ2A 3WFAA 3C0QA 2VRQA 4Q6JA 4H8NA 2PCQA 1X97A 2XU2A 3W76A 1WBHA 4IJCA 2XZ9A 4HQVA 3DFPA 1AZ1A 4GC4A 3MC5A 3FCPA 4HHMA 2YSWA 2O7QA 1RV8A 4KW2A 1B9BA 2F7FA 3CQ0A 3AIEA 1JAEA 4XG1A 4ZQNA 4HNOA 3CHDA 4WCJA 2R1LA 3SCTA 3PB0A 4JOMA 2IKHA 2VZTA 1RBOB 1LF1A 3FYPA 2PDPA 2J7HA 1DHPA 2RAGA 1IYXA 4TVCA 4AZCA 2XFRA 1S3HA 4TQTA 2V3EA 1MSSA 3AAMA 4TX6A 4LAZA 1XIGA 2GJXB 3CS2A 4GUFA 4Y9AA 1M9HA 3I10A 1DKWA 4CNOA 4J7RA 1QASA 2ZUSA 4KERA 1GTEA 1EBHA 2VQTA 4W9TA 3UA4A 3M7SA 2ZKMX 4DF0A 3B9DA 4C6KA 2ZZ3A 3GTHA 4MADA 3W7MA 4GKTA 4H2HA 1OIMA 1GW1A 1US0A 2BVTA 2OLHA 3DHPA 1WZAA 2XVKA 1MWOA 3KX6A 3OA3A 2PODA 3TN6A 1GOWA 1Z48A 4JGDA 4UTWC 2JALA 2YFNA 4OVXA 3B9OA 3AIVA 3M6YA 3AMGA 3H8AA 2ZBTA 2O56A 5HNUA 2BS9A 1UYQA 4LTSA 1PKLA 1RZMA 2JKEA 4ZE5A 4DLFA 1M7PA 3QTPA 1OK6A 2DZPA 1P7TA 3GDMA 2QMKA 4HSOA 3WFZA 3KBVA 4HYWA 4W4QA 1BG4A 1H50A 2WKJA 5F1UA 4F66A 4KF1A 1GOKA 2ZRZA 4JIIX 5HMSA 2WMIB 4MY8A 4S3DA 2YA0A 1BGGA 1DP0A 2H3DA 2C0HA 3KP1A 4GYFA 3RILA 1EO5A 3R1ZA 2WXDM 4JBRA 1ZPTA 1K7FA 4PB3A 2DZUA 4B3LA 4LVAA 2OX1A 3B0PA 3SUWA 4GYJA 4MWAA 3AHTA 4HN4A 2DU2A 2YDQA 1KO0A 3TFCA 3LEPA 1N8FA 4EX4A 1ZJHA 3N13A 2AMXA 3T0AA 3CTTA 1XPGA 3S5YA 5FSDC 1S5NA 1DBTA 5D9MA 3PK7A 3VOHA 3MS8A 3ZWSA 3S6OA 5AC7A 3UR2A 4E4FA 4ZENA 2CESA 4PC8A 2QCLA 4RL3A 3A4AA 4O19A 4HNNA 3IANA 2A3LA 4QNWA 1XDMA 1H1YA 3NPXA 4Q7BA 3W71A 3AXKA 3NQGA 3LM3A 3DGBA 3UPBA 3COTA 2QCNA 1QHPA 3P93A 3TYBA 4L1WA 3W1XA 3QR1A 1E3XA 4F0KA 3UG5A 1QU4A 4UCFA 1C8XA 3N04A 1LWJA 2CBIA 3IJ6A 5LYRA 4L4PA 5I3HA 2O4MA 8XIAA 4DPQA 1PZ2A 3S8HA 4GFIA 4O16A 1S1PA 4Z2LA 3NG3A 2OSWA 4NAEB 3VMNA 2XTKA 3PNUA 3W2KA 2JFEX 1UR1A 1YE6A 1PEZA 3GRIA 4LY4A 3MVTA 4HMDA 3GH7A 3LGEA 2QIWA 1WV2A 4N6FA 1L8NA 3HFTA 1SVDA 2ZUVA 2GFTA 4UNLA 2ZX5A 1QNOA 4BEQA 3MO7A 3WQFA 1PX3A 1VBUA 3IAPA 1SR9A 1VGAA 1PIGA 3EMZA 3HGJA 3TYEA 2BMBA 4LVBA 4LOCA 4FXRA 3KZPA 3ABSA 1UP2A 2R91A 4I9TA 3QY8A 7REQB 1HIZA 1P0DA 3CV2A 5F2MA 3MWCA 1UUMA 3QKZA 1QPQA 1OCNA 3WFLA 3AJ7A 3UGVA 6TIMA 3FJ6A 1K9EA 3BK0A 2Y7FA 3CAQA 4C60A 1KM3A 5A2AA 1V3IA 4XZMX 2GJRA 1GVYA 3OVGA 4LAUA 4JZ5A 1TPC1 3K1GA 4OZOA 3VGBA 2Q01A 2VEPA 2FHCA 1QRQA 5F4SA 3UVIA 1JRBA 3T0BA 4ZXOA 1TR9A 3OBKA 3L2MA 1R9ZA 4PMJA 4UFHA 1PUDA 1T8QA 3JU2A 5AVHA 2D24A 3USZA 4LXFA 3M41A 2QJMA 4M19A 1FHVA 3KCJA 5ABFB 2PDGA 4JY9A 4C5YA 1D9EA 2ZX9A 4XTDA 2Y62A 2A21A 3OGVA 3N34A 1PTGA 3M07A 3E2VA 1EF3A 1A5KC 1D3HA 2WW5A 5LSMA 1YMYA 1SO5A 2ZRUA 1GOMA 3FIGA 3UJEA 3W0KA 3F2DA 3R79A 1CYGA 1E71M 1V3KA 3KHDA 2R8WA 2PWUA 1CXIA 3U5YA 3TEVA 2R1MA 4MM1A 1XCXA 2XWDA 2WJDA 4YWSA 4UTTA 3VIMA 4KMQA 3F4DA 2R6OA 1GYLA 1TPWA 1EBGA 5FL1A 3MP4A 1F8MA 1U33A 1WPCA 1Q63A 1QW7A 2WO5A 3PBVA 4PCFA 3TYZA 3S0CA 5A6TC 4X0VA 4M8UA 2AQOA 3HGRA 2VVSA 1Q65A 2W91A 3MU7A 3VIIA 2VUNA 3D3AA 4TOQA 3GDBA 3NOYA 4S23A 1BSIA 4UFMA 4E4PA 3G1DA 4DB7A 2HISA 2YXOA 1GJUA 4V33A 2J8TA 5D03A 3G1VA 1NQKA 3DBNA 4HJWA 1Q6EA 4GC3A 4E2VA 2QKFA 5DCDA 3PPFA 1W9BM 1E6NA 3NDZA 3CQIA 2Y24A 4WXZA 3M43A 1UCWA 3WUBA 5LXEA 2PLKA 2BSLA 2J13A 1EKOA 1Z9AA 4OE7A 4HB7A 3RN6A 2ZE3A 5FF4A 3KE0A 4KRUA 5B7ZA 2E4TA 4OV9A 4H9UA 4M6QA 2VEGA 3BAXA 1XG3A 3O0FA 1A50A 4U5KA 1IEWA 1NWUA 2I1OA 4I9AA 5I79A 1QNQA 1FWRA 5HINA 1UKPA 2NX3A 4RZ4A 4KEZA 3AS2A 2XM1A 4IP7A 2VCAA 4ILSA 1ICSA 1K7XA 2V9DA 4S2BA 4LNYA 2R1KA 3A47A 4FS9A 1W8GA 3M0HA 3IGXA 9XIAA 1ISVA 3FHQA 3CH9A 5EBUA 3FXGA 1ITQA 3ZO9A 2GGIA 2GSHA 4A3QA 3GE7A 1H7PA 4C6CA 2BY3A 1EJSC 1LUCB 2EO7A 2AAMA 3AMKA 1KM4A 3WLKX 2QV4A 3LGGA 4HZ7A 1AH0A 3PS7A 3GIYA 3C0SA 4PTVA 4MKSA 2Q71A 2HBVA 3E5BA 4PUDA 5HOSA 3LMZA 1PTAA 3SSZA 4PB4A 2DDXA 1M03A 4TO8A 4IH3A 4HVXA 2V81A 3NO3A 3NJ3A 3WK3A 2AMGA 3NSMA 1VR6A 2JE8A 1AD4A 1H7RA 4F2TA 1A5AA 1AK5A 3BICA 1YDNA 3P80A 3OZOA 3RLUA 3UW6A 3WQPA 1B3OA 3O05A 4TTUA 1OM0A 2D2GA 2E68A 3M64A 3WNNA 4DUVA 4U2ZA 3G1SA 4HNTA 2OWXA 2EGZA 4RNIA 2A7PA 3B0YA 3TAKA 1F5ZA 3KVKA 2DW7A 1HZYA 2Z27A 1WO2A 1LL7A 4ACZB 3QZEA 4GLEA 3K4DA 2DFAA 1V6YA 3VCRA 2F84A 1O94A 5MKGB 4A29A 3ITGA 2DVXA 1VBJA 1DTUA 2ZUMA 2WVTA 3AIRA 4JL1A 2D0FA 1OT2A 1QT1A 2WK2A 3LLXA 4GIYA 4FAMA 3EOEA 2OZ3A 4R85A 4U5IA 1TRDA 4XZHA 2X7VA 1S2VA 1TQJA 5DBTA 4JXCA 2AGTA 5BXTA 4GZJA 1WXZA 3UZ5A 1SYTA 1W3TA 4A3RA 4N42A 4UTWA 3P84A 4A2RA 1VH7A 1XLKA 4L6DA 2Y88A 1HF6A 4J2MA 2XINA 1LYXA 5GJNA 1V7AA 2Z6JA 1U83A 1YTEA 1J0IA 1C8VA 3HU7A 1NFPA 4DI9A 3UR7A 4WJXA 1TSIA 5ECUA 1OY0A 5E9XA 4IX0A 4M81A 3K1DA 3PFRA 3VKKA 1UWUA 4FO4A 1XLFA 3NEVA 3AS0A 4IIGA 5CZKA 2PLMA 5BWAA 2Y7GA 2PD9A 2CZVA 4AMCA 3BAYA 2VUYA 2FYMA 1F74A 3BJSA 1RQEA 3S42A 2E09A 1W1IE 1E9IA 3GYCA 5DF0A 3M5VA 4UBPC 5I77A 4M1BA 1EZWA 2RJHA 2FZ9A 1OD8A 3DENA 4EAMA 3P8JA 1VQTA 3IRSA 3WQEA 3M0JA 4D72A 1JGMA 4KH2A 1EC7A 2QEZA 3MHGA 3RHGA 3DH7A 1O1HA 3W86A 4BF5A 3U6WA 4J3SA 3AU6A 3U4AA 2QS8A 3E74A 4YVVA 3KWSA 3GXDA 1VCGA 4G6CA 2PDYA 1R2RA 2OELA 4QJ5B 3F03K 3MV01 1KCKA 3RRXA 5AZ0A 1EJ7L 4LEQA 4A3YA 5I23A 4AYGA 4H01A 3GS6A 4BHYA 2WNQA 2ZC1A 4FOJA 3FK4A 2CZ5A 5AN7A 2KAUC 1J11A 3RDKA 6REQB 1VCVA 3BPWA 4FALA 4Y2WA 4P2VA 3NURA 3LXAA 4JFTA 3S9YA 4C6BA 2VELA 1J0HA 1G94A 2J24A 3B03A 5CJNA 3ATZA 4JFSA 1KXHA 1GTHA 4MLJA 4L61A 1OYAA 2XIMA 2EF9A 4Z1BA 2HTMA 4QS5A 4MJZA 3VYLA 1XIBA 3WL1A 2F2KA 4OGZA 1BVNP 4EWJA 4WEVX 2VZVA 3LZ3A 4LS0A 4NJHA 4H6KA 4Q4MA 4B91A 3D0CA 3AICA 1JR1A 2P76A 5HBFA 3TQVA 2BX7A 1UJPA 4H6RA 1TIWA 4F0HA 3B8UA 4AEEA 1M3UA 3TJ4A 2QXWA 2QNEA 3BJFA 2ASHA 1DXFA 4GE8A 1EFZA 3QM3A 2XUCA 4QQ3A 1YRRA 1LROA 4C1KA 3TC7A 4FI4A 1FWTA 1IIGA 5HWJA 4QLLA 2WANA 3W7KA 3H2AA 2YL6A 2WC7A 2Y0FA 3TWAA 3MCNA 2NLYA 3OLEA 2MANA 1TUXA 3C5QA 3KTSA 5JBFA 1NJJA 4QAIA 1VPYA 1F3EA 4JIEA 3M0IA 1H11A 4DHGA 1KA9F 4HA4A 4ZA0A 2CLEA 1J0YA 3B05A 3BLPX 1EP1A 1EJTC 4FX7A 3UJFA 4IIEA 5I3FA 4YTSA 6XIMA 3SY1A 5A8NA 4ZVJA 3TOPA 3QBUA 2VOTA 5I3GA 5TAOA 4AD2A 1JYXA 1UD5A 3W23A 2YCKX 1SO6A 5IRPA 1G4SA 4PL1A 2VX6A 2GWNA 3GAKA 3LN3A 2QCEA 3DHUA 4YS1A 4IGSA 4IP5A 4J4KA 2FPTA 1PCKA 3BG3A 3FJ4A 3W1TA 3GW3A 4N9BA 3NQBA 2V69A 3GR4A 4GJ1A 4AD3A 2V6AA 2O9PA 5A6BA 1WUFA 1I2PA 4LX4A 2PTYA 1Z69A 5EKYA 2RDXA 4JDBA 4D8AA 3H23A 2GVEA 4DJDA 4B92A 4N6EA 4O4WA 2AQVA 4IPJA 4C6EA 4DRSA 1YNYA 5TBOA 1SW0A 3DERA 1W3HA 3LYEA 1H7NA 2PDLA 4GHRA 1QNSA 2F6UA 3M0MA 3RGTA 3C8FA 1PO9A 2ZRXA 1KGUA 2RDUA 1POJA 1EJVC 4MJ4A 4A22A 5TQLA 4M6UA 4TV5A 3UT0A 4B4FA 3QGAC 3CWOX 3WLNA 1XLMA 1VBRA 3PZ9A 4GRSA 1UR4A 2Y6ZA 3LBCA 1UZHA 3ARUA 3H53A 2DZVA 3ZS4A 3W01A 3CYVA 5D2VA 3PULA 4RE2A 4PCPA 3WMBA 2Y4SA 1NFGA 1FBAA 1F8IA 1MQQA 3PR2A 3WBXA 2QVNA 3W74A 4JTCA 3BARA 1EQCA 1TB3A 2GQ8A 3REQB 5T91A 4L5ZA 3BG5A 3LTSA 3OVQA 1Y0EA 4XKYB 2OSXA 2Z1WA 3AHZA 2DUXA 2ESCA 3ITOA 3KCOA 1XCFA 5T26A 4IIDA 4NAFA 1OC5A 3WLJA 2DEPA 4L65A 4JD4A 3T07A 3CEPA 5D9OA 1EWEA 4DLMA 1DWAM 1TA3B 4MZYA 3WH9A 4HOWA 4H19A 1P0NA 1W91A 2WWDA 1WOAA 1JD7A 3G8EA 3I6TA 4EXAA 2E9MA 3E5PA 1WAUA 4UTIA 2EKCA 3G0SA 1EJWC 1W56A 2A3HA 1D8WA 3M0ZA 4XD4A 2QUVA 2ZA1A 4PRWA 3BL3A 3LU2A 2QZRA 1UR8A 7ENLA 3USBA 1DQWA 4V1YA 3NA8A 2DY3A 1UH4A 5CQ1A 1BRLA 1ICQA 3WH6A 2DSUA 4J40A 5H6HA 3E0WA 4GYPA 2DSKA 3UZWA 4GIRA 5LA1A 3ZJ8A 2ZE0A 1XUZA 4C65A 5D4YA 1B4EA 3KZSA 2RFGA 5KZDA 3LHUA 1SSDA 3EWWA 4WLCA 1W1ZA 3RPDA 4GI4A 1GOOA 2WJEA 2PPGA 1VKFA 3BLIA 2CHOA 3DI0A 4EWND 1XI3A 1VYRA 3NSXA 2Z29A 3VX1A 2XSBA 4NQ1A 1OFQA 3LCIA 3WY1A 4A3UA 1PS9A 2WVVB 1S2UA 1PHQA 1A0EA 1H09A 3LK6A 3UG4A 2DUAA 1TJ0A 2ISFA 1B4KA 1E0UA 3VOGA 3E2RA 1VRXA 1JNEA 4UTMA 3VO0A 3HZ3A 3DKJA 3P61A 1HVQA 2H9AA 1M01A 1EHAA 3BLEA 5GNZA 1R2TA 1EF2A 3BANA 4R9XA 2CERA 4E5TA 1D3GA 1AW1A 4UR9A 4PTXA 2O0TA 4REQA 3CZ8A 2FMOA 1P0EA 2WHLA 3VAVA 3UP8A 4LPCA 1VLWA 1KFWA 3L5MA 3NQDA 2NSOA 3VNKA 2W3ZA 1VEOA 2XISA 1M7JA 3PFMA 4NNBA 5KZEA 1UD6A 4EPEC 3RUBL 2PWFA 4LVGA 4PCTA 1HL8A 4YIWA 5FJPA 1CECA 1MQPA 3HF3A 2J25A 3C56A 2I57A 3VVGA 1KXTA 1J93A 2VZSA 2WAGA 3T78A 4AIEA 3J7HA 2EPKX 1GK8A 1OFPA 2GDQA 3VDBA 1W9DM 4XWUA 2B81A 2WHKA 4AF0A 2ZXAA 3ZXWA 5HPCA 1S2TA 2VEMA 3SFWA 1E4MM 1KFJA 1I9CB 3FJNA 4GIEA 4DY1A 3VDCA 3GDRA 2W5FA 3WD1A 3IIVA 5DX7A 3UEQA 1LRNA 3MMDA 2V3FA 1J96A 2F9RA 5CPTA 3QZAA 5AYZA 1PE1A 4J28A 4JDYA 1A3XA 7CGTA 1W0MA 1IHIA 3OBEA 3AI0A 3TXVA 4V27A 2PDUA 1IEXA 1O5XA 4JFVA 4GX9A 1KLYA 3EXSA 4H8VA 3SUUA 1R3QA 1VB9A 1BFNA 2YCEA 1YBQB 1UWTA 4IX2A 2PTWA 1F73A 3H54A 2PRLA 3D3FA 4JHZA 1W37A 3BAKA 3W27A 4C7FA 2FFIA 5CZ0A 4Q8TA 3E2QA 4AFYA 6ENLA 2JKAA 3OG3A 4G9PA 1A49A 2X40A 3R25A 4Z2IA 1BF6A 3V5FA 2D20A 3WF2A 1PYMA 4HN8A 4GCXA 4RV3A 3VIJA 2PDFA 1ZTVA 4PA8A 4F8XA 2QQ6A 5CGQA 3WQ5A 4KT2A 4NHVA 2OO0A 1RCQA 3W1UA 1RA0A 4LV4A 1A5BA 2ZRVA 3N19B 4ZOCA 1ZENA 2QPXA 4US5A 3BSGA 1ODUA 1EXBA 2J77A 3VK5A 1S5MA 2VCCA 4RR4A 2DIEA 3DECA 1ONRA 4M5PA 4OIFA 4F2UA 1FDYA 2VGGA 1V3MA 3TZNA 1NM9A 2GOKA 2XVNA 5T9BG 2I5GA 1B54A 1R87A 3O6AA 2CLHA 4PMNA 2QPUA 3OZYA 2J7GA 2DZXA 2P50A 5FKYA 2J7EA 4MMWA 4XZNX 4LQ1A 1MFUA 4GQBA 1O6IA 1KBJA 5L9FA 4CQBA 3TROA 1AH3A 1M53A 4LB4A 3M4HA 4C7DA 4UOQA 2J47A 4C6DA 3L4WA 2GJPA 2Z24A 5FIPA 3U5UA 1E6QM 3PTMA 4IG2B 3GTXA 1VS1A 5EMKA 1EQPA 3W72A 4G2DA 1TCDA 2FKPA 1V6XA 2A5HA 4AY7A 3RR4A 3WLQA 4WKHA 4JTRA 3OJGA 4GJJA 3F7JA 4JIQA 4GVHA 1SUXA 2GGEA 2P88A 3CLWA 2IUZA 2XH0A 1R3VA 3BZGA 4JTLA 3S1XA 1Z3NA 4ICCX 4FPSA 5DRIA 1E0VA 2KZHA 3R6IA 1CB2A 1UIOA 1DL3A 2VFEA 4DXVA 2QCDA 3BGAA 4HTYA 3EEZA 3CL6A 1RQBA 4K8GA 4Q8PA 3VI2A 2YXGA 2E6YA 5DMNA 4IFRA 1NSJA 2Z4GA 3MSGA 1OC6A 1YPIA 2WWCA 3SGZA 1U5HA 3A4XA 1CIUA 4NU7A 3VIHA 1E56A 3QY6A 3L0NA 4HMEA 4OTKA 3T8QA 3QMRA 1ZGDA 3MDWA 4W88A 4YYFA 2PB1A 4PMRA 3GAYA 1JPDX 4TTGA 1JPMA 2P8CA 4B2DD 2XIOA 2VHLA 3LRMA 2HMCA 3UWYA 1TWIA 1OEPA 2OOFA 4FX6M 5A8PA 3GXPA 3UY7A 2X0SA 2HXTA 4S3FA 1TREA 1JCYA 3EB3A 2PTDA 2C1HA 1TJRA 2VENA 1FKWA 4JTSA 2VJXA 4JNZA 2PP0A 1I8JA 4E6MA 1QFEA 3PBUA 4AHQA 1AH4A 3B9AA 2XIIA 2NXGA 4TUFA 1EA0A 1UKOA 3UNDA 1X96A 3GNRA 4GIAA 1V0KA 1AODA 2QVHA 1IT7A 1E0WA 4AZ7A 1FH9A 4AXNA 2YPIA 2WVUA 2JIEA 3LBOA 4OECA 1JUBA 3F5LA 2PGRA 5DO8A 2GJNA 4O53A 3N2BA 4WZHA 3TQKA 4CQ9A 5J5RA 1J6PA 2HV5A 2JIWA 1TTJA 3SQLA 3KL0A 2QHAA 3D6NA 1C9WA 3W87A 3NQCA 2FB3A 3B40A 4HK7A 2OZTA 3BMXA 4HSHA 4S39A 4CQDA 1JI2A 1YPXA 5AHNA 3SZ8A 3G8RA 1VJIA 2ZXDA 2QGYA 3PWGA