1G4TA

Thiamin phosphate synthase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
226
structure length
226
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVSAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords THIAMIN PHOSPHATE SYNTHASE
total genus 80
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4tA00
1OYAA 3M0ZA 1T99A 2X1TA 5C54A 1W3NA 1E51A 3VE9A 2V5BA 3LXCA 3W7DA 3M1ZA 6ALDA 3L5LA 4OV9A 1KFBA 2V8ZA 1I2OA 1OFRA 4A3UA 1ICSA 2OT1A 1NFBA 2WNQA 4OU1A 5EY5A 3N14A 3W7NA 1JRCA 5LHFA 2QAPA 3TW6A 4JS3A 3DFOA 1YPFA 1CX9A 4E2DA 3U6WA 3BK0A 1TJRA 3TAKA 2Z6IA 3C0JA 3HIJA 3P5YA 4N2YA 3LV6A 3NQEA 2Q8LA 2XN2A 2ZBTA 4HNNA 5LHEA 1W1ZA 1JCMP 3TXZA 1OABA 4GUFA 2WNZA 3L0NA 4FEZA 5CPLA 5D09A 2FDSA 4UXDA 1KM0A 1MZHA 1KW1A 2QEZA 3T40A 5DELA 4OGZA 3MHFA 1LRTA 5TIMA 1ME8A 2QCNA 1IF2A 3W1AA 1ML1A 2ZRUA 3MW7A 1Z42A 5CGQA 5AHNA 1I2PA 1OFOA 1MEIA 3UWVA 2A7RA 3C2RA 2J9ZA 3UPWA 1GPWA 5D30A 3ABRA 4X2RA 1XBXA 2YXGA 2NV1A 2YCEA 3C56A 5A5WA 3JRKA 3KRUA 3EXSA 2Y85A 3TXVA 1WOBA 2V0TA 3IIXA 3OBKA 3CIWA 1HO4A 4GC4A 1XI3A 3W83A 5I3HA 2FPVA 1JRBA 5L9FA 1F5ZA 3NDOA 3SECA 3O6YX 5H2ZA 1GVRA 3VE7A 4XWUA 1W3IA 1XDLA 2Q8ZA 3LTSA 4E0CA 3W22A 5G4WA 2FPYA 4WY0F 2X16A 5HUPA 3OVQA 1GYNA 3NPWA 4NJHA 3G0UA 3P82A 2E6FA 2Y7FA 3G0XA 2C18A 4KWWA 3W88A 4AH7A 2B7PA 4JTFA 2FFCA 2OJPA 1P4CA 3ABSA 4GRSA 3P74A 5F2GA 2TYSA 1TTPA 1Q6RA 4UTIA 3W1RA 5BOOA 1KV5A 1QWGA 1D3HA 3O6CA 2VOMA 2WQPA 1TTJA 1ZAIA 2C16A 4EWND 1VZWA 5AC8A 3LOTA 3TQVA 1HUVA 3S8HA 4NUWA 5D05A 2JGYA 4POCA 3C2EA 3HMJG 1QO5A 1IIHA 4ADUA 4WY0B 5KITA 3L21A 2PURA 4XBSA 3CPRA 3G1VA 3EWWA 1F2JA 3SGUA 3LV5A 3A22A 3W6YA 3HF3A 4MY8A 4N4PA 3EKZA 2LLEA 3FA5A 5I3IA 2Y88A 2NUXA 2ZZ7A 4CQ9A 3L68A 2PC4A 3HPXA 1G6CA 3GDKA 4CLMA 3LI1A 1TPWA 4RJEA 3TQKA 3H53A 3STEA 3PUOA 2DZSA 4BK9A 4A2SA 1FWSA 5KZDA 4ADSA 1ZAJA 2FB3A 5KTLA 3LCXA 3G8RA 4FX6M 4IMDA 4CNOA 3FOKA 2CZFA 1H7XA 2YW4A 4P2VA 3W1MA 5K9CA 2TMDA 3BARA 1XBVA 5F4SA 1F05A 3NNTA 4BF9A 4O17A 4UTTC 4ICNA 3GXNA 4K39A 3Q58A 3B4UA 3N2XA 4M6VA 3LHWA 1FY6A 3I68A 3IV3A 1LRQA 2E09A 1LLZA 5AB3A 4L4MA 4UTUA 1XUUA 4HNTA 4QISA 3OA3A 3PBWA 1FWRA 1F76A 1BKSA 3D0CA 3CIXA 3GXTA 2GPTA 2CLHA 2Q3RA 3C2VA 1BTMA 4RXFA 1K7EA 3GKFA 4MYXA 4AVFA 3I65A 2CLLA 4N6FA 2Z0IA 3OEXA 1EA0A 2VELA 4RR4A 2H3DA 3FYPA 5A8GA 5T26A 3IIZA 3VKJA 1C29A 3STGA 4WOQA 4TMCA 5C55A 3EWZA 4IX0A 4PL2A 2A85A 4O57A 1VCGA 3DH7A 1O4UA 3DFPA 1EUNA 3IVTA 4WX2A 3QQ0A 1EEPA 5E93A 2ZDRA 4TIMA 2A2IA 3FIGA 3B0PA 3OG3A 1PCWA 1AL7A 3M41A 1S3HA 2DJXA 5EMUA 4TU1A 3O07A 2R8WA 2NUWA 3KOFA 2HS6A 3NXFA 2WJZA 2NX1A 4KFOA 4UTMA 2CZ5A 4ALDA 5DCDA 3DBPA 4LY8A 1G4SA 1K3UA 1T8XA 2FTPA 2TSYA 1O5KA 3EXTA 5J5RA 1I2RA 1WXJA 4UFIA 3HQ1A 3JR2A 4MOZA 4ZQOA 2HMCA 3NA8A 2ZFAA 1H7WA 1R46A 1SZEA 5DBTA 3W84A 1FDZA 3F4WA 1VYPX 3AJXA 1F74A 3MI3A 2F84A 3M9YA 4GUHA 2QDHA 3NL6A 3SJ3A 2Y7GA 4UFMA 3TK7A 3QH2A 3S0CA 1H62A 1H60A 4J9JA 4UTWA 2JKEA 1TPC1 2DZTA 3S1UA 1T0OA 4YCOA 5HJLA 2FPTA 1EWDA 1DOSA 3KVJA 4JX6A 3M5YA 1OX4A 4QM1A 4O4WA 4UTWC 1F73A 1OFPA 2C15A 2ZRZA 1PL9A 3DHFA 4CQ8A 1H63A 4ZVJA 3W3OA 1W5MA 4TR9A 1KFLA 1H50A 3NQ8A 4P61A 5DY2A 3AO0A 4PFMA 1XUZA 5FF7A 5HNRA 3S5NA 1XBYA 3NVTA 4JIPA 2FLIA 4DQWA 4MYAA 3BG3A 5D32A 2Z1BA 4NU7A 5D33A 2ZA1A 2ZZ6A 3BPWA 3KAOA 1EP1A 4JDBA 5D38A 1LBFA 1YADA 2D73A 3W9ZA 5LNRA 4O13A 1ZHAA 4BI5A 1K7FA 2BZNA 3DXIA 3LHTA 1ZENA 3TFXA 1NSJA 4IQLA 2NWRA 3E9AA 3B05A 2YSWA 3L66A 3GLCA 4G1KA 4NZFA 1QPNA 2GQ9A 3LHZA 1QOPA 1LCOA 2H3BA 3RNDA 5BMXA 3IIOA 2J9YA 4PL1A 4YCPA 4IGHA 3R13A 2J9XA 1VH7A 4X22A 2Y62A 2NX9A 4JTGA 4O54A 3W73A 1JJKA 3I7SA 2HSAA 4M7TA 1W0MA 1OFDA 3DKLA 4AF0B 4FO4A 2QCMA 3T78A 3ANYA 1A50A 5D2YA 2V2CA 3LHYA 4CCDA 4D2JA 4ZQRA 3S42A 5DN1A 1XDMA 3SI9A 1VLIA 5I3KA 1EB3A 3S5YA 2R14A 3QYQA 1EP2A 5KMYA 4RK8A 4Y9AA 2CLKA 3NAVA 5DXXA 2BXVA 1DV7A 1HTIA 2X1UA 2ZRVA 1D9EA 3L65A 1K8XA 1K03A 3BW2A 2NZLA 3DI0A 3A9IA 3LCFA 3PR2A 1H7OA 1J5TA 1Z48A 5EKYA 3QSRA 2GOUA 1F6PA 4Y90A 4JYDA 4N6EA 3PWAA 1Y0EA 2E5CA 1VPXA 1GZGA 1AW1A 5D2XA 1W5QA 1FBAA 2QKFA 1G69A 1KTCA 5CG7A 2G95A 3N2MA 6TIMA 1SZGA 1B3OA 1K8YA 3G1FA 3MBDA 2OT0A 4LVBA 1L6SA 3HG4A 2PRHA 2V5LA 5BMWA 1JQXA 3PVFA 2Z6JA 3EX4A 3INPA 4DPQA 1F7BA 2E77A 1MSSA 2I9EA 1VS1A 4XBKA 1EP3A 5LGZA 3BLEA 4LW7A 2YGYA 3W1TA 4HNUA 4GBUA 4XQ6A 4JTTA 3PAJA 1EPXA 5BNKA 2PRLA 2RDTA 3LRKA 5BW6A 1VYSX 3N9SA 1TYGA 1Z44A 5I3GA 1MXSA 2AAMA 4FNRA 4YWIA 1LORA 3S1XA 1SU5A 4EOUA 2JKPA 1FWNA 3C61A 1CW2A 4AWUA 1VLWA 1W5OA 3WK0A 2ZRYA 3TAOA 4N9DA 1VHCA 4Y8FA 3BW3A 2ZTJA 1MEHA 4DPPA 1I45A 3QC3A 2C0AA 2V30A 3HPSA 2ZA3A 5G2WA 4WOZA 7TIMA 3B0UX 2QUTA 1KM4A 1GG0A 2VEKA 2EPHA 4RZ5A 1DJNA 1RR2A 1OYBA 4U4MA 3DFSA 1T96A 3E02A 5FEXA 3WJWA 5CKSA 1TB3A 5AFDA 1BEUA 2P10A 4MJMA 4CNNA 4XZ9A 1NEYA 3NQAA 3WK2A 1W56A 3GDTA 3R12A 3G3MA 3HO8A 2ZQ0A 4XKYA 3TMLA 1M7PA 3UYCA 5AC7A 2E1DA 1G7VA 1LTDA 2FJKA 3EWBX 3HG3A 1VC4A 4JTKA 1OK6A 4CNPA 3O1NA 3NQ2A 4UNKA 4Z0JA 1KTNA 3P60A 4QIUA 3I7RA 3DFTA 3KXQA 4BR1A 3NPVA 4LS1A 2DZVA 4FXSA 4BI6A 3O06A 4AF0A 3TX9A 1QAPA 3NGJA 3NQVA 5EL1A 4DBEA 2VFIA 1IXQA 3NM3A 3I6RA 3O63A 1I8JA 5F4WA 1H1YA 4O28A 3GXPA 3O15A 3QRHA 1PS9A 1PHQA 3TA6A 3LGEA 2ZZ4A 5CPMA 4K7YA 2CLOA 4MY9A 3CB8A 3PM6A 3W7CA 2V9DA 1TCDA 1X1ZA 5FEZA 4PH6A 4CCEA 5AHLA 2DZXA 4K8EA 2A5HA 3RU6A 1VQTA 3HG5A 1KLZA 1TIMA 3M44A 3W7PA 3R5EA 4AMAA 3NQCA 5KINA 3UY8A 1X8FA 2HS8A 1GOXA 4Z1BA 1A53A 5CPNA 1B57A 3GZ3A 4JXCA 1P1XA 3IIVA 4NJJA 2NXIA 4NXKA 3MMTA 5LNSA 1L9WA 3W7MA 1YDNA 3M5ZA 4UR8A 5AHMA 3TROA 3GK0A 5I3FA 1O5XA 1GVFA 1Q6LA 4LS2A 2PE4A 3TKFA 4K7VA 1GG1A 3PBUA 3HOJA 3ELFA 1FWTA 3FJ6A 3R89A 4FIRA 1NF7A 4ADTA 1L2UA 1X7FA 3F03K 4PTNA 4PODA 5H91A 3GDRA 5C6MA 1VCFA 1XL9A 1LZOA 4NJIA 1VHNA 3LBMA 3M6YA 1SO5A 2BSLA 3W7JA 4IMCA 4UFJA 4O52A 1TRDA 4JTLA 1R2SA 2C13A 2VXNA 2CLFA 2E6DA 4HT3A 3W71A 5ABTA 3FLUA 1LRNA 5D02A 5KZEA 4O0ZA 1JCJA 1KFKA 4RLIA 3L2IA 1JUBA 4RX0A 4E2BA 1OFBA 3TU9A 1X1OA 4HKPA 4O14A 2I1OA 2Y7DA 3TR2A 4A2RA 4C1KA 2CFFA 1SPQA 4NNBA 2KZHA 4PEKA 3LDVA 3OHIA 4N9EA 3LHUA 3G1SA 4OT7A 1KFEA 2QCHA 3IGUA 3OVRA 5AN7A 4FF7A 2GQ8A 2Y7EA 3MJYA 3C2FA 3CM4A 4IMEA 4UR7A 2ATMA 2C6QA 5AC6A 5AYXA 1I4NA 3MI6A 5AOUA 1KM1A 3OIXA 3LCWA 5G1YA 1W54A 4KWVA 2A6NA 1GJPA 5G5IA 2WSQA 3EX6A 4AAJA 4H3DA 2C1HA 3CWNA 4MPQA 3LLFA 3RLUA 1JUKA 3LBCA 2B4GA 4XUGA 3GDLA 5G2IA 5LNWA 3CHVA 4W9TA 1RQEA 3GAKA 4FNTA 3W1LA 3KFTA 4O8RA 3SY5A 2ISWA 4X3ZA 4Y96A 2CWNA 4BFAA 4QAIA 3W1XA 3STFA 3HGSA 2NWSA 1N7KA 4JTHA 4OV4A 4A29A 1W37A 4O1BA 4B5NA 4K38A 3S1VA 3USBA 3STCA 2H6RA 3V75A 4OE7A 3BLFA 1ICPA 5DY3A 1TPB1 4ONVA 3W1NA 1ZCOA 1A5AA 3G1AA 2O7SA 4Z0SA 3W7LA 4ZQMA 3TFCA 4JICA 1H5YA 4BI7A 3L9CA 5EYWA 4ORIA 4LV9A 1O95A 1N55A 3PG9A 5DCEA 2R91A 4JIQA 5F2IA 1YXDA 3U8GA 3TDFA 4AB4A 1TJPA 1C8VA 2JBMA 2YYTA 2ZZ2A 3NZ1A 4JEQA 2H8XA 1GYLA 2NUYA 3Q37A 4O15A 3KVKA 4ZQPA 1LYXA 1GVQA 3P62A 3T55A 3ATZA 1ADOA 1H7PA 5FF3A 3MO7A 2QJGA 1O94A 1SZNA 1G7UA 1SR9A 3O6DA 1H51A 4O19A 3FEMA 3NO5A 3CT7A 3W72A 4DBDA 1LOSA 1RQHA 4JYEA 1W8SA 4Q33A 3LI0A 3A5VA 5G1TA 4O1DA 4BWLA 2YFNA 4JD4A 2NLIA 3HJZA 3QMRA 2TRSA 4NJGA 2ZRWA 4UNLA 2CLEA 1JVNA 1DVJA 1TQXA 1YXCA 2E68A 1FDYA 4GJ1A 5K2ZA 1KM5A 1W31A 4OHQA 3LB0A 1VJIA 1XCFA 2R94A 4IWWA 5FF4A 5FI8A 4R34A 3GAYA 5LSMA 1YPIA 2ATSA 1OJXA 2JKAA 1GVSA 4NVTA 2WSYA 2YZRA 1Q6OA 3BLIA 5E0KA 3DI1A 1SUXA 1YTKA 4MKNA 1TV7A 3CWOX 4MIMA 4U28A 1RVGA 3P61A 1M5WA 4M5PA 3CC1A 1KFJA 3G8EA 3PSVA 1FCVA 3KRSA 1SZFA 1LOQA 1FUYA 4M19A 4GXMA 2PCQA 1OG0A 3G3DA 4HNVA 4DO6A 4K6AA 1PCKA 3UD6A 3UZ5A 4ZL1A 3QSTA 1ZJIA 1AG1O 2W79A 2A7PA 3Q2DA 2WPBA 5I3JA 4RZ6A 1DORA 2EHHA 5AYYA 1OHLA 4JTUA 2EKCA 2GJNA 3QF0A 4MUZA 1IGSA 2TPSA 2Z2UA 1K7XA 2G97A 2F7FA 5LZLA 3HG2A 3THQA 2OCZA 4K36A 3NQMA 4Y6GA 3T7VA 4FNPA 1OX5A 4QJ1A 3O05A 1I2QA 3W75A 1KM3A 2Y61A 5LNVA 1AW5A 5LNUA 4IPIA 1G4EA 1HO1A 4LNYA 1NVMA 3GX9A 4S2CA 4Q4KA 4UFKA 3BW4A 3NQ7A 5KZMA 1RZMA 3B06A 2J6XA 3NL2A 3L0KA 1D3GA 4TX9A 5K3VA 2I14A 4FXRA 3MP4A 1ALDA 1KM2A 1OVDA 3UWZA 3BO9A 2P1FA 3UWWA 4O18A 3A21A 1JCYA 1K8ZA 1QO2A 4WXYA 5K9XA 4Z1CA 4GNJA 4UTKA 2C3ZA 4O0KA 1HFBA 4IOTA 4Z08A 2W0UA 3BV4A 3E96A 2YW3A 2X30A 5HUOA 2VFFA 1S5TA 2HTMA 3LXAA 1TPVA 2VFHA 4C1LA 1FCUA 3P7YA 5G4EA 3VCRA 1IIGA 5F2LA 1EWEA 1WDWA 1XM3A 4AWTA 1OX6A 2AGKA 3DENA 4GWEA 2QJHA 2QCCA 4KKXA 3BGGA 5E1QA 3KVLA 5AHEA 4DF2A 5K7JA 2XN0A 3F1QA 2Y63A 1K02A 1VRDA 4LTSA 1UCWA 4MZYA 2H90A 4RV8A 3PUEA 1W5NA 3UQNA 3PUDA 3YPIA 2OMAA 4NQ1A 3N9RA 1V7YA 4R33A 4N02A 4K37A 2VFDA 1ZY9A 5K4ZA 3C3NA 3FYOA 1SSGA 3W7EA 2C19A 1W3TA 3EX2A 1YDVA 2BTMA 2H8ZA 3NR0A 3H54A 3L0GA 1P0NA 4NX5A 5GVJA 3W07A 3UXDA 3HGOA 3M5VA 4ML9A 3WFAA 3DKJA 4RZ4A 3S5ZA 3CQ0A 4AXKA 1XC4A 4H6KA 3GKAA 3ZWSA 1O60A 4EIVA 3CTLA 4LOCA 3ZFHA 3EWUA 3THAA 1VR6A 1TV8A 2P0OA 4A22A 4UMBA 1QDSA 4QITA 3KX6A 5FEPA 3W7RA 1KM6A 1UB3A 4EF8A 1F6KA 1BWLA 4O1CA 3G1XA 1XKYA 4N9BA 1QR7A 1TPUA 4CQAA 3TQ0A 1JUEA 1SW7A 1SO4A 5CZTA 2DJLA 4QNWA 2EGZA 4UTHA 3C6CA 1H7NA 3FFSA 4YL2A 1J4EA 2B7QA 1ZNNA 3P81A 3PB0A 4WUIA 2QCGA 4AHPA 3EWYA 3QPYA 5D2TA 3W1UA 3CEPA 4LVAA 2XN1A 3IVSA 4JGDA 4JN6A 2PRMA 4HHPA 1A5CA 5LKYA 2ZZ5A 1FDJA 1X6UA 1PV8A 5HR6A 4JY9A 3UPBA 4ZMGA 1UJPA 2Y89A 1A5BA 4JTJA 2EAWA 1KFCA 4M6PA 2GUUA 3E49A 4Z1AA 1GTHA 4JTEA 4YLWA 1KV8A 3LRLA 1DKWA 1TPFA 1A5SA 3KVMA 3NQDA 3WJSA 3W7GA 1C9DA 1SO6A 2QCEA 3NQ6A 1PHWA 4JY8A 5FF0A 3IGSA 2VFGA 4ZZ9A 1P5BA 3QW4B 4R53A 2BX7A 3OVPA 2J88A 4GUJA 4EF9A 1LM1A 4LV4A 1JQVA 2RHGA 4JDYA 3TV8A 1YYAA 3S6DA 4LC6A 4R7JA 3EXRA 3GDMA 1KLYA 5LGXA 3M43A 1M6JA 2ZTKA 3PS7A 2J27A 3W1PA 5MHBA 3W23A 4KFPA 3W2UA 1TQJA 1H1ZA 2DORA 3SGZA 4FNUA 1KBJA 2A1YA 1TPDA 2WO5A 2Y70A 2V81A 1FCBA 3MYOA 4UCGA 2G5WA 3RK8A 4XTDA 5TQLA 5AYZA 3G0SA 5TBOA 2B7NA 2UV8G 3BGJA 1PIIA 1ME9A 3UWQA 2A6LA 3W1QA 1TREA 1ICQA 3B04A 1TPEA 4WD0A 3KRZA 1H7RA 3PG8A 5HULA 3P80A 3S5OA 2ZZ1A 3MI2A 2V2DA 3VFLA 3H55A 3S9YA 4H4IA 5DLCA 4UFLA 1GWJA 1RQBA 4YMZA 2E5BA 3LLDA 1PVNA 3V1PA 2CW6A 4PCFA 3G1YA 4AWSA 3WJZA 5KSWA 3PBVA 3HBLA 4PA8A 1XBZA 4EVZA 1QPRA 4UFHA 3LCLA 4BWLC 1U83A 3UNDA 1VGAA 3DU0A 4MLJA 1FX6A 3CEUA 2CU0A 4O1AA 3DAQA 1PE1A 3RLVA 2GQAA 5IM51 5CSSA 2NV2A 5FEWA 4IPJA 1GVOA 1VYRA 3FKRA 3KHJA 5D04C 2XFWA 4O12A 3W85A 1ZAHA 3ZS4A 4WQ6A 4XTIA 2DZUA 1WBJA 1ONRA 4Q32A 1WA3A 3W2LA 3G1HA 1HG3A 5L6UA 3ABOA 3C4UA 1Q6QA 3RMJA 4NT0A 3C2OA 2RDUA 3GNNA 1QFEA 1OX4B 2A0NA 2G96A 4ZQNA 4UTTA 3M5XA 1RV8A 4IXHA 1EUAA 3NOEA 2O7QA 1YTEA 2RFGA 1R2RA 3B8DA 3SR7A 3LCHA 1TTQA 3ZR4A 3LHVA 3BVJA 4GUGA 2EF9A 3TJXA 4LT9A 1WOAA 1DBTA 2IQTA 2DZWA 3G18A 4UTLA 3K30A 5D2WA 3NG3A 5J5DA 3W87A 3UZJA 4TO8A 4OQVA 5F4XA 1DJQA 1M7OA 3L67A 4HSNA 4IMGA 3N3MA 4RCXA 1QPQA 4HN4A 3NPUA 3SFKA 3CLMA 1FWWA 1QOQA 2FB2A 1QCWA 1LBMA 3B0VC 1WQ5A 4I7UA 4WJEA 5AHFA 3EWXA 3EKLA 3TCEA 1Z41A 4O50A 1ME7A 1P0KA 5D03A 1IXNA 1S5VA 1WYIA 1GQNA 3C52A 3W7QA 3MHGA 5K9DA 3QMSA 2ABAA 2BWGA 2CLMA 1GEQA 2NX3A 4L4LA 1EX5A 3LERA 4UMCA 1AMKA 2QAFA 3QEZA 1LP6A 5FF2A 1WX0A 1SFLA 4AHQA 3MHUA 4DEFA 2FQIA 3W2KA 3IIPA 2QR6A 2NXGA 3SIZA 2A21A 2VEMA 3A23A 3TSBA 3QQ1A 4LVDA 5CSRA 3MP5A 3ABQA 1GTEA 4I7VA 4AHOA 1MO0A 1XFBA 3TJLA 4JR5A 4MY1A 3U2OA 4TMBA 3DGRA 2YPIA 3P8IA 1IXOA 3M7WA 4NNCA 2X2GA 3TC7A 1OF6A 4LUIA 4MFEA 1LDCA 4IJBA 4OBTA 5HMSA 1L6YA 2OX1A 1TTIA 1H61A 3L5AA 2QDGA 5F2MA 1R30A 5U4NA 1AL8A 1JCNA 3PC0A 1LROA 1DQWA 4FX7A 4LVGA 2ZCGA 2WKJA 3N19B 4IXXA 3SSJA 5U7SA 4FNSA 4O11A 1R47A 4QQ3A 5IBXA 3NM1A 1SQ7A 3EX1A 2VC6A 1TPH1 3QZEA 4N9CA 2B7OA 1KBIA 3C8FA 1WBHA 3G1DA 3QPZA 3UWYA 1LBLA 2CLIA 2ISSA 2WNNA 2ZRXA 3QW3A 1JCXA 4NX0A 4AEOA 1FQ0A 3TUUA 2V82A 4JX5A 3QMTA 3IEBA 3L5MA 4PC8A 5CPOA 2QUUA 3O8AA 1NF0A 2BLEA 1YLVA 2RKXA 4O53A 1R2TA 3MWAA 3UY7A 3VI2A 4NNAA 3W74A 4LVFA 5DCBA 1WV2A 3TMQA 5DBUA 1QNVA 1N8FA 3EB2A 3FJLA 4MJZA 1THFD 2W6RA 4WY0A 3TSMA 1DL3A 1OFAA 2QCDA 5CZJA 3LRMA 3GVGA 2WOQA 5CZSA 3N73A 4UIOA 2ZZ3A 5D37A 2Q3OA 3E0IA 3RF9A 2GJLA 4MZ1A 5D2VA 5IBXC 3UXAA 1XXXA 2YYUA 2VKZG 3MUXA 4IX2A 2VENA 3WJXA 4MVAA 2QJIA 2Y6ZA 4LS0A 4HSOA 2WSRA 5HWMA 1ZFJA 3W2NA 5FESA 1S5WA 1TRIA 1IXPA 4O4VA 2ZYFA 3M16A 3W2JA 3LCIA 4O16A 3FS2A 2FIQA 4LU0A 3GR8A 2QCDB 3NEVA 3GYEA 3HGRA 4DO5A 3P84A 2GVLA 2E6YA 1I2NA 3UWUA 3PULA 1MEWA 2VEPA 1W5PA 5AHIA 3JS3A 4X9SA 3PF3A 4NZJA 5BRBA 1OYCA 4MZ8A 1KTBA 1JCLA 3NPXA 3EEGA 3LM7A 3NZRA 3SZ8A 3NL5A 4IMFA 1UASA 3MBFA 1ZALA 1FCQA 4DF1A 1UBSA 1B4KA 4XKYB 1NAL1 1SW3A 5EBUA 1OFQA 1TSIA 2WV8A 3DFNA 4OWGA 4S1FA 3DZ1A 2ISVA 1B9BA 1KA9F 1RPXA 2OZ0A 3TE9A 2VFEA 2YFOA 4JYFA 2X1RA 1SW0A 2B0MA 4FIQA 5HR7A 3WK1A 2QUVA 2CZEA 5EA9A 3WK3A 3T4CA 3NQFA 4QSHA 3E12A 4NXSA 1G4TA 4HPXA 3NQGA 4QNEA 3P67A 3NL3A 3QFEA 3O16A 4JTIA 4MLRA 4MFDA 4LRTA 5CZ0A 1UUOA 1EIXA 5HWJA 1JULA 2ZA2A 2QF7A 4ORMA 3PSWA 3HGJA 1YDOA 3W76A 1B4EA 4LWWA 3W2MA 3MYPA 3CU2A 4NJKA 5DXYA 8TIMA 4Z1DA 5F1VA 3LTPA 2NXHA 2A4AA 2JGQA 1L6WA 2C14A 3RFAA 3TIMA 4CCCA 5C5YA 4GE8A 1CI1A 3A5FA 5HQEA 3TSDA 3P5ZA 4M7SA 2ABBA 3MP3A 4N4QA 2QCLA 3R2GA 3N34A 4DF0A 3T44A 3VNDA 3BG5A 3WJYA 3W7KA 2YX0A 1OFEA 4FB7A 3M47A 3W7IA 3LX9A 4LRSA 3R8RA 3LTYA 2AQWA 4DXVA 5SWUA 1AW2A 3W86A 4FHAA 2E5DA 4LC8A 3IRDA 3QJAA 4UC5A 2DZPA 1AK5A 4JNMA 4DELA 3TNOA 4GUIA 3LXBA 1GT8A 1TMHA 3DHDA 3PB2A 2J24A 1TO3A 1JR1A 4UUIA 5EPDA 1FXQA 1YTDA 1YXYA 1VCVA 1DQXA 4S2BA 1OK4A 1RD5A 1SO3A 4I7WA 4WZHA 3SW6A 2YDAA 2JK2A 3I7QA 2DU2A 3Q94A 4YXGA 2RH9A 3W7OA 4UMAA 3BG9A 4JTSA 1DHPA 3GB6A 3S1WA 2V2HA 3TW7A 1TV5A 4WXZA 5F1UA 3W70A 1UUMA 3G24A 3A24A 2ALDA 3GR7A 5K4XA 3TH6A 2DP3A 3GNDA 3HPZA 1LOLA 1OF8A 1Q45A 3DFQA 1HL2A 3IGXA 4DO4A 1FXPA 1WAUA 2GVGA 3ATYA 4FNQA 4GFSA 2VEIA 4HIBA 3G22A 4FX8A 3F4NA 2QCFA 3B03A 3P8JA 2GVJA 1J2WA 1U5JA 1G4PA 2E6AA 5C2XA 1QMLA 4HPJA 4A21A 3ZWTA 3TC6A 4O10A 3PBYA 4LUJA 1BWKA 2CZDA 4E38A 1G67A 1SSDA 1Q3NA 3PY2A 3W7HA 2YR1A 4K8HA 4ZQCA 3FKKA 4IUOA 3EX3A 3IVUA 4RXGA 5G2HA 1LLWA 3NYZA 3QM3A 2X1SA 5HINA 4I9AA 1SFJA 4JX4A 4M6QA 2A7NA 1QPOA 4KFNA 3HB9A 4UTJA 1V5XA 2RDWA 3LCGA 5HWNA 4RKAA 3GIYA
chains in the Genus database with same CATH superfamily
1OYAA 2ZIDA 4AX7A 4A3RA 3N4FA 2V5BA 1HJSA 3OZYA 3WKZA 2CPUA 4C6DA 4HZMA 2BOGX 4E8DA 1KFBA 3GNPA 1GKRA 4OU1A 5LHFA 1JRCA 2QAPA 1V93A 4JS3A 3DFOA 1YPFA 4M80A 3OOQA 1TELA 1TUFA 4XSLA 1PDZA 1TJRA 1J5SA 4L80A 3P5YA 1SMAA 2F38A 5T8GA 2Q8LA 4HYRA 2XN2A 4XD6A 4HNNA 5LHEA 3TXZA 2BVTA 3MUZ1 5LXEA 2V5DA 2F6UA 4DJFC 2QEZA 3VKAA 1YNYA 2PLKA 5DELA 4EANA 1ADSA 1EQCA 5TIMA 2QCNA 3BSGA 1US2A 2NT0A 3BICA 1IF2A 3W1AA 2ZRUA 3BC9A 3PBMA 4IHCA 1QI2A 4L5ZA 5CGQA 5AHNA 2PDWA 1DJGA 1S39A 2QUMA 2XZ7A 4OUEA 4S3CA 2Y8UA 2UY3A 3F2BA 1XYLA 4Q6JA 4TXEA 2JF7A 1JZ4A 4HJFA 3FDKA 4HD5A 1DXEA 4UZSA 6XIAA 2WHMA 2QYGA 1XSJA 3SB0A 4Y9MA 3KRUA 3EXSA 3QGAC 1OY0A 3PPFA 2Y85A 1B2YA 4KERA 3TXVA 4RE0A 4AZCB 3CUZA 4GX9A 3KTCA 2ZUMA 1BYDA 3RX2A 1HP5A 3AYSA 3NDOA 3NXLA 3O6YX 1XDLA 3LTSA 3TTOA 5G4WA 3GO2A 4WY0F 2YCKX 5HUPA 3DECA 3G0UA 4C7FA 2E6FA 3G0XA 1BYCA 1GNXA 2RJHA 3LMZA 2FFCA 2CESA 4OBRA 4LUTB 3ABSA 5F2GA 2TYSA 1TTPA 4GNVA 1Q6RA 3K4DA 4TTGA 1KV5A 2VZSA 1D3HA 5CLTA 4FXFA 1TTJA 2VGGA 1RLCL 2C16A 2W27A 4MB3A 3LOTA 4X0VA 1PUDA 3QTGA 3S8HA 3B9EA 3UA3A 1QO5A 1IIHA 2YDRA 3G1VA 3E38A 3A22A 2PWFA 4JFUA 5CC6A 2OGJA 1HN1A 3EKZA 1E72M 2FHCA 2Y88A 2ZZ7A 1ZSXA 3NOYA 2RJGA 3HPXA 1G6CA 4CLMA 2IQ0A 3GR4A 1GOMA 4FOUA 3PUOA 4BK9A 4A2SA 1FWSA 3B4YA 5KZDA 4ADSA 2FB3A 3KM8A 4AZBA 3LCXA 4URIA 1E0WA 3CV2A 1S3TC 3CT2A 4B2DD 1H7XA 3VIGA 1OIFA 4GQRA 1J9YA 3NYDA 2PBGA 1F05A 5IHSA 5CSYA 2XSBA 3NNTA 1A0CA 2P5NA 4DO7A 4LYPA 1D8CA 2VI0A 5CBJA 3VIPA 1ECQA 1O6IA 2VGBA 3N2XA 4GI6A 3VGFA 1LLZA 1SM9A 1M53A 1XUUA 3S47A 1X97A 3VKKA 3PBWA 1F76A 1BKSA 3II1A 3GW0A 3ARUA 2YBUA 3DBNA 1NDVA 3C2VA 3LMYA 3UG8A 4I5UA 3GKFA 1RP8A 1XG3A 1RHCA 1EA0A 4N6FA 3FYPA 5A8GA 6REQB 3OO2A 2QDEA 5T26A 4BQ4A 3IIZA 3S46A 2XDFA 4HNOA 4MM1A 1AA1B 3WDRA 5C55A 3ZO9A 5BCAA 2E25A 4PL2A 3U57A 3PBGA 3DH7A 3IVTA 1EUNA 2FYMA 5E93A 3JVAA 2VDGA 3RM4A 2A2IA 4LUTA 7ENLA 2HBVA 1AL7A 1DYSA 4C6IA 1GHRA 3BL3A 4XKMA 2NUWA 3KOFA 2NX1A 4PN2A 5FJJA 3UR7A 3B8VA 5H8UA 1ZU8A 1MW1A 2H9AA 4LY8A 2X7WA 2AL2B 1T8XA 1KXVA 4Q7NA 5J5RA 3H2NA 2WMKA 3JR2A 4ZQOA 2HMCA 3NA8A 2PB1A 1H7WA 1SZEA 2ZFAA 1WPCA 3WG6A 1H4PA 1VYPX 1IT7A 5EFFA 4GUHA 3QV8A 2QDHA 1Q6CA 3SJ3A 4TUFA 1H60A 3MKCA 2JKEA 1TPC1 1FWEC 4XG1A 4H8HA 3KVJA 1OX4A 3WD0A 1OFPA 4JQ1A 2I5IA 3DHFA 3CV6A 3FV9A 4ZVJA 4ACZB 3W3OA 2VRKA 3OLDA 2XHYA 4TR9A 3AO0A 4PFMA 3TN4A 4JIPA 4E4FA 3LPOA 5D32A 4ZB0A 2P8BA 5D33A 2G0WA 3U0HA 3KAOA 2DV0A 4F48A 3W9ZA 4KCUA 1TV2A 5LNRA 4HCLA 2BZNA 3LHTA 1SFTA 3TLLA 1ZENA 3S5SA 4PUMA 4Q22A 1BRLA 3ZXWA 3L66A 4NZFA 1QPNA 5FSDC 1HKVA 1LCOA 2H3BA 1AH3A 3RNDA 3IIOA 4PL1A 5BZAA 4WSJA 5CZKA 1EJSC 3KOZA 3R13A 2J9XA 1M9HA 1ZQ5A 3VX0A 4LUSB 1CXHA 3VNLA 5LIWX 4NIRA 4YVPA 4M7TA 3WQ5A 1W0MA 2YOCA 3DIPA 4AF0B 3DDMA 2GGIA 3ANYA 5D2YA 3ALGA 3LHYA 4CCDA 4HK5A 1XDMA 3SI9A 3KDNA 3K5XA 2W5FA 2FDMA 4OVXA 4PMNA 5DXXA 1QW7A 1PO9A 2BXVA 4CEXC 2O0TA 2WWCA 3WD3A 1XLIA 5ABGA 4LFYA 3BW2A 3DI0A 3SO7A 1EEXA 2VCCA 3C8NA 3LCFA 4E8CA 4Q8VA 3AALA 4Y90A 5HNTA 3AZTA 3GWQA 2Z26A 3U48A 2IKGA 4IFRA 4AW7A 1FBAA 4FA3A 5CAKA 5CG7A 4W7WA 3GW3A 3LPGA 3N2MA 2GDVA 1JPHA 2BVDA 1K8YA 1OSEA 3PZUA 2OT0A 3BMVA 2UY4A 3HG4A 3PVFA 4JQ4A 3O6AA 5IHRA 3QYSA 3D6NA 4A3QA 2E77A 2BHUA 4IQDA 1IE7C 1O7AA 4CN6A 5ABFB 1EP3A 4Q6XA 3BLEA 4LW7A 2HV5A 4HNUA 4GGBA 5LIKX 1V3LA 4J3SA 5BNKA 3LRKA 4J2PA 2CITA 3M64A 3N9SA 1TYGA 1VPYA 1MXSA 2ZUTA 3S1XA 3I4KA 3TWAA 4EOUA 1G9HA 3HA1A 3BMWA 3R7MA 2P50A 3FCPA 2DT1A 4D6GA 4N9DA 4YNGA 4H6QA 1W1B1 3F2DA 1QU4A 3BW3A 2VP8A 1I45A 3EPMA 2V30A 2ZA3A 4WOZA 3WH7A 1EO7A 1QWKA 3LGDA 1KM4A 1GG0A 4UOJA 2XVGA 4WGXA 4ZCWA 3E02A 3CZLA 1BEUA 4JTRA 1AODA 3IJ7A 4XZ9A 3LY0A 4ZTYA 3WK2A 4L61A 3BSHA 3P6LA 2ZQ0A 4GA8A 1VFHA 5AC7A 4HMEA 5DMLA 1LTDA 3N2OA 1EC7A 2RDXA 3EWBX 4TOQA 4CNPA 3O1NA 4FK9A 1KTNA 4QIUA 3I7RA 4LB3A 4IIHA 3HV9A 2DZVA 5CPSA 4HN8A 5XIAA 1Y65A 4AF0A 1PKNA 1QAPA 1XH1A 3UVAA 4IGSA 9RUBA 1R86A 1LT7A 2HK0A 4WJ8A 1MQRA 3HZ3A 5CPMA 1KXQA 4E2VA 2CLOA 1CB2A 1SJAA 4MY9A 1E5JA 1TCDA 3UVIA 4PH6A 4K8EA 2A5HA 3AS2A 1EJRC 1KGUA 3DEQA 5EBAA 1MUMA 2GFTA 4AMAA 1GEHA 3NFUA 2OKOA 4JL1A 5CPNA 2E0PA 1OWQA 4NXKA 2NXIA 2GUYA 3VA8A 1NTHA 4JCLA 3U7BA 2J74A 4BQ5A 1BXCA 3T09A 1EDQA 1LWIA 1D7FA 3A12A 1VFMA 1V03A 5AHMA 3TROA 1JXJA 1CIUA 3KDOA 4ERIA 4F0LA 2NVCA 4LS2A 3TKFA 4K7VA 1GZ1A 1GG1A 3MS8A 5RUBA 1FWTA 1BD0A 4HOWA 3VKBA 4KEVA 4ADTA 4PTNA 5C6MA 1VCFA 3N1AA 2R6OA 4HYWA 3ES8A 1REQA 3OW1A 4C1NB 4JFSA 5CC7A 3V18A 2E8ZA 2G4JA 4P8UA 1V0LA 3KBNA 1OCNA 5ABTA 2HNHA 4AY7A 1PB0A 3L2IA 1JUBA 2QMJA 1F3EA 2UBPC 1OFBA 4HKPA 2I1OA 3UETA 4ZXOA 3HM7A 1C7TA 4C1KA 3D3FA 2CFFA 3PAOA 2KZHA 3KCOA 4LJ3A 2GYIA 1XRSA 4FSAA 4N9EA 1FWDC 2P53A 1KFEA 4MJ4A 4FF7A 1NFGA 2Y7EA 5A8OA 3E2SA 1L0PA 2I57A 2XVNA 1KGXA 2C6QA 3GU9A 1E15A 5AOUA 5IDZA 1GJPA 3OJGA 2DT2A 4AAJA 3CWNA 4XAPA 3E3HA 1KR1A 1OC7A 4CVUA 5LNWA 3CHVA 2FZ9A 2PD9A 3GAKA 3URAA 4S39A 1GOIA 3M0YA 4Y96A 4D8AA 1PAMA 2CWNA 4YPJA 2HJPA 4JHOA 1KXHA 3AI0A 2NV9A 3L4YA 3STFA 3HGSA 4A29A 1W37A 4O1BA 3EB3A 2X41A 3S1VA 1W17A 3LUTA 3STCA 3GHUA 3AICA 2D2JA 3V75A 1CB7B 3SGGA 1BYAA 3LZ3A 1ICPA 2XGBA 4YTUA 2ZICA 3LK6A 1EJXC 1NU5A 4JICA 4BI7A 1EC8A 5EYWA 4H9YA 4ORIA 5PTDA 4AZ5A 5DCEA 3NGFA 3N6QA 1YXDA 4AB4A 1C8VA 2JBMA 2ZZ2A 2O9RA 4K1GA 1GYLA 4O15A 1JIBA 4IICA 1HJUA 4HYVA 3KOXA 3ATZA 1ADOA 1H7PA 1HVQA 3MO7A 2QJGA 1X38A 1SZNA 1G7UA 3O6DA 3WX7A 4TV6A 3CT7A 1NOUA 3EKGA 5I00A 2WSKA 1RQHA 1UR2A 1W8SA 1BG4A 3VKCA 3HJZA 2XH4A 3VAVA 3QMRA 2BXZA 3WF0A 1DVJA 1YXCA 2CETA 2IQDA 1FFRA 1FDYA 3OLIA 1W31A 1RA0A 1XCFA 2R94A 4HMCA 3VK5A 3GAYA 1S2TA 3B9NA 4NVTA 5DANA 1N8IA 2WMJA 2OQLA 4DI8A 4H83A 4MIMA 3CWOX 3WQ6A 3VOIA 4DAIA 3EWCA 3GSMA 3G8EA 3VVGA 4G2DA 1IV8A 2VC5A 1FCVA 2PTYA 2XSXA 4X0NA 4M6UA 4JKKA 3DC0A 3ANVA 4ZO7A 4M19A 2Y0FA 4GXMA 1E0UA 2PCQA 2C91A 1YIXA 4NAFA 3PNZA 4DO6A 1OM0A 1PSCA 4R7OA 1JZ8A 4ZL1A 5E5CA 2W79A 3H2AA 1DORA 4NZ4A 2EHHA 2EKCA 3TYAA 3T07A 2GJNA 4MUZA 2OWWA 1IGSA 1K7XA 3FXYA 4I3GA 1FKXA 1QNSA 4ERAA 2F7FA 3QV6A 1CNVA 2PLMA 2OCZA 3AOFA 1EJTC 4Y6GA 4FNPA 3UGRA 1FHDA 1YDYA 5J8LA 3RM9A 1G94A 2P8CA 1HO1A 2YKKA 2FHBA 3CH9A 3GX9A 4S2CA 4Z2HA 4L1GA 4UFKA 3NQ7A 3VNMA 3IJ9A 3B06A 4FPSA 4CU7A 2WKGA 5K3VA 1R3YA 3URNA 3UWZA 3F5JA 4RL3A 3VCCA 3UWWA 3A21A 2NT1A 2QJJA 1DHKA 5K9XA 4C6PA 4Z1CA 1NY1A 1GQKA 3LD5A 2OODA 2NQZA 2PDXA 1VEOA 1PWMA 1QNRA 3UWEA 3H26A 4Z08A 1WKFA 3BV4A 3WBAA 1I0BA 2X30A 5CBBA 5FJUA 1S5TA 3MQTA 3W29A 2DZBA 3EPOA 3KWXA 3R1ZA 3GD6A 3U4FA 1V3MA 2QJHA 3BGGA 5K7JA 2XN0A 1TE6A 2W91A 1Q4NX 2DIJA 3WELA 3AUOA 4RV8A 3COTA 3FVMA 1K9FA 3BURA 1S5MA 3JUGA 2YA2A 4R33A 4N02A 4ZOAA 4GVGA 4LB4A 1MI3A 4XSMA 2C19A 3EX2A 2ZXAA 3H22A 2H8ZA 3ZOAA 2QJMA 3PHAA 3H54A 3A3HA 5GVJA 1DJWA 3UXDA 3HGOA 3S5ZA 1BGGA 1XC4A 4EIVA 2ZKMX 3N9KA 1IHIA 2EKGA 1G1YA 1FH9A 4GCXA 4TX8A 3S9IA 3AXMA 3GTIA 4HHLA 3OG2A 3M07A 3WQCA 9XIMA 1Q7ZA 3PN8A 1FWFC 1FA2A 4UMBA 5HNNA 4QITA 2CCRA 3RYSA 1IWPA 1F6KA 1BWLA 3TQ0A 1JUEA 4H7VA 1SO4A 4LXFA 4L9XA 1E73M 3IUHA 2C79A 4L1XA 1HZYA 1W1PA 3MDWA 2B7QA 3P81A 4WUIA 3W1UA 5A1AA 2XN1A 3M0HA 4JGDA 3RM8A 5JBDA 4PSPA 4QHRA 3RG6A 1PV8A 1VFTA 2OEKA 3UPBA 1U30A 3NIYA 1UJPA 1T8QA 1ZBKA 2EAWA 5HAOA 3DESA 5CBIA 2BGNE 3WH8A 4GK8A 3LRLA 1A5SA 3KVMA 3NQDA 4PCPA 1A0DA 1ITCA 3O0FA 5FF0A 4GZEA 1F8MA 3QW4B 3OLGA 4IIFA 2WVSA 2I5QA 7CGTA 3V3WA 4GUJA 3D5HA 4C6QA 4CNSA 4D72A 1WZLA 3HQPA 4HPGA 4LC6A 1UROA 4R7JA 3EXRA 4DRSA 2DUXA 1XSKA 3EZ4A 3NZPA 5LGXA 4AEEA 4JQ3A 3KHDA 2ZTKA 4RW5A 1KR0A 1MFUA 2WM1A 5MHBA 3T4WA 5IDIA 4PUUA 1B30A 1C93A 1EJUC 1TPDA 2Y70A 3MYOA 1GZJA 3SDOA 3PFMA 3H2FA 2A6LA 4WD0A 4P7NA 5B7YA 3R8HA 3GY1A 5KEZA 1R8LA 3MI2A 4UQ9A 3Q4DA 1QXLA 4Q8UA 4ZE4A 2W9MA 4CKQA 5D4YA 2PEVA 1E6ZA 3ZYZA 3VIHA 3LLDA 3V1PA 3WF4A 3MT1A 3ARXA 1MZRA 5KSWA 3KW3A 3UJEA 3TJIA 1SVDA 2ZOXA 2BG5A 4UFHA 1NH6A 3RHGA 1IZCA 3UNDA 4IIDA 1AQFA 2W62A 2ISFA 4UOQA 8XIMA 1JDFA 1ZGDA 2BY1A 4G7EB 5IM51 7ODCA 4PB3A 5FEWA 5HPOA 4IPJA 2GGHA 1JAEA 3ZS4A 1J01A 1D3CA 5L6UA 1HG3A 3ABOA 4RDZA 1PWLA 1W2PA 1I0DA 2QDDA 3AZSA 4Q8MA 3BMXA 3CXOA 4S3DA 4ATDA 1H49A 1OX4B 2A0NA 3SCUA 2G96A 1W1VA 5E09A 5TF0A 3WMSA 2PP1A 1KRBC 2IPGA 1E71M 3B8DA 2OO0A 4US6A 4AU0A 1VIWA 2HEJA 3VOHA 1TTQA 3QR0A 3N18A 3C0SA 3N11A 4MAVA 3LHVA 3BVJA 4PUWA 4XIAA 2PAJA 3SCSA 4GUGA 2O9TA 1JDCA 2IQTA 4UTLA 6TAAA 2PU0A 4AIBA 1HKKA 2OXNA 5HJYA 1MYRA 3K1GA 3BLPX 2FHFA 3NG3A 2Y24A 1PX3A 1OEPA 3W87A 4TO8A 5F4XA 4OQVA 4PZVA 1DJQA 3L67A 3CQIA 4HSNA 1NARA 3H24A 1VFLA 4G7FA 2DZAA 2ZE0A 1TUXA 3NDYA 1QPQA 2PPGA 4L9ZA 3H12A 4B16A 1B31A 1QCWA 1LBMA 3RX4A 1WQ5A 1M68A 1Z41A 4O50A 1ME7A 2GSHA 1IXNA 4NSBA 1GQNA 2QIWA 3PWGA 5M03A 2QS8A 3GDBA 3HFYA 1UP0A 2BWGA 4LSBA 1AMKA 5FF2A 4HQVA 2V67A 3GU1A 2C1GA 4AHQA 1E55A 5DMMA 3IIPA 2QR6A 3SIZA 4LVDA 5CSRA 3ABQA 1GTEA 1SFSA 1XGEA 4JR5A 1TWWA 4BCEA 4NNCA 4XO7A 2X2GA 2WZHA 3IK2A 4A8RA 1LDCA 4IJBA 3SQLA 1L6YA 3R0DA 2OX1A 2OEJA 3ITYA 3ORWA 3WNPA 3R0KA 3L5AA 2QDGA 5F2MA 2J66A 1R30A 1OC5A 1GJWA 1JCNA 3GS6A 1LROA 2JIWA 4FX7A 3ZLHA 5U7SA 2VX4A 2ZUUA 4AZIA 2INEA 2DSKA 4ZOEA 1IYXA 4MTVA 4DZAA 3C8FA 3G1DA 3CZEA 3UWYA 5I24A 1JCXA 4NX0A 2OB3A 3IWPA 2PD5A 1DIOA 2FJUB 3TUUA 2V82A 4KIRA 3QMTA 2WC4A 4R3UA 4U33A 5CPOA 4W93A 2QUUA 1POJA 1NF0A 5C71A 3PZOA 3OYXA 3W27A 3W74A 1DWJM 4DNHA 4JPGA 2PDLA 2YL6A 2GDUA 3C5QA 3RR1A 3K2GA 3TMQA 2BXYA 1N8FA 3EB2A 3FJLA 1THFD 3A4JA 3T9PA 2OZTA 3BOXA 1DTUA 3TSMA 1BVZA 4LCQA 4N7QA 5CZJA 2QCDA 1CECA 1K4GA 1LQ0A 1TX2A 3DYMA 1A5NC 3N73A 3UCDA 2ZZ3A 4QR6A 2Q3OA 1LWHA 3OGSA 3RF9A 3BLKA 3GHRA 5IBXC 3AS1A 2VKZG 3O9NA 1M1BA 2R24A 2FH6A 4LS0A 4LAOA 2WSRA 4MWAB 3TYDA 3RO8A 1TRIA 4O4VA 2XM2A 3M16A 3EMZA 2XGZA 3W2JA 4AUBA 1EDGA 4O16A 1RVKA 4V27A 3ZVIA 1CGVA 1VRXA 3GYEA 5A6TC 5A6LA 2XVLA 3L4VA 1I2NA 4C91A 3PULA 3HN3A 5AHIA 2PGRA 4UTFA 4AZ6A 4NZJA 1JCLA 1XRVA 2WZTA 1U1HA 2XIIA 5EMYA 2DSVA 2ESCA 3W00A 1CXLA 1FCQA 4DF1A 4XKYB 2HISA 1SW3A 5EBUA 2G8ZA 3DFNA 3SQMA 3DZ1A 3GXMA 4ZB5A 5I02A 1B3VA 4JYFA 4FIQA 2CZEA 2OU4A 3VYLA 1DJHA 3T4CA 3P2VA 1R3TA 4NXSA 3EDFA 1U2YA 1AJZA 4BHYA 4QNEA 1H3GA 3NL3A 3QFEA 4MFDA 4LRTA 5A6MA 5C70A 1LF1A 3ANUA 1EIXA 5HWJA 1JULA 1L6GA 4ORMA 3W76A 1E6RA 2GGGA 3I4EA 3WD1A 2QGYA 4Z1DA 2DSUA 3LTPA 1R3VA 1L6WA 2C14A 3ZJKA 4IQEA 3TIMA 1PKMA 1CI1A 1UWSA 4LX4A 3JU2A 1EXBA 4XZNX 3A6OA 2GJPA 3W26A 2Z29A 3A5FA 2FMOA 2W67A 3ZQ9A 3P5ZA 2PI6A 5HMFA 1WP6A 2QCLA 1J0HA 2HWGA 3SY1A 4TVUA 3ZVHB 4PCTA 1AQMA 5JQ9A 3WJYA 2YX0A 3GIQA 1OFEA 3W7IA 3BJTA 2G3JA 1YRRA 4AISA 3A13A 4FHAA 1HL8A 2E5DA 1M7JA 3IRDA 3LNMA 2BHYA 1E56A 4TV5A 3N12A 4IG2A 1FWIC 4JNMA 4DELA 3LXBA 3GTFA 1D8WA 3ARWA 1QHOA 4GY1A 2XH7A 1TO3A 1HGWA 5LA0A 2PC8A 1YXYA 6XIMA 4NZ1A 4PMDA 1RD5A 2Y2WA 1G01A 4LCSA 2JK2A 4GX8A 3T0BA 1XF0A 2DU2A 1XW8A 1AUSL 2RH9A 4UMAA 4JTSA 3GB6A 4LNCA 3IJLA 5F1UA 3G24A 4P7LA 2ALDA 4PUJA 3HPZA 4JN8A 1LOLA 3MZNA 3F5KA 3AIVA 2O9OA 5A6KA 1FXPA 2W3ZA 4GFSA 3OBEA 4Q4PA 4UQDA 1HKJA 5GJNA 5I7GA 3B03A 3V0TA 2GVJA 3WMBA 1J2WA 1O66A 3H4GA 1K77A 4HZ7A 1G67A 1SSDA 5EMLA 3PY2A 4W85A 3W7HA 2YR1A 4K8HA 1JZ6A 2ODOA 3FKKA 1SJCA 4P7RA 4IUOA 1YKWA 3N25A 4HMNA 4B5WA 1LLWA 3NYZA 1AQ0A 2HZGA 1CGXA 3QM3A 3WLRA 1SFJA 3M0VA 4JX4A 2A7NA 1DXIA 3UNTA 2HK1A 4PTMA 4KMQA 3LCGA 3J7HA 2VCAA 1DWIM 5HWNA 3VOGA 2A3AA 4XD3A 1MUWA 3M0ZA 1Q7QA 3M1ZA 4MB1A 6ALDA 4OV9A 4IIGA 4A3UA 1ICSA 5REQB 2WNQA 3N14A 3W7NA 3TW6A 3AHTA 4E2DA 3ARVA 3EYPA 1XIFA 1V6YA 2DH3A 3BAXA 1LG1A 1O1HA 4N2YA 1CGYA 3NQEA 1V4YA 1IEXA 1ISZA 2FVLA 2VWTA 1W1ZA 2ZBTA 4GABA 5GQBA 3GG0A 5CPLA 4QTGA 5D09A 1VPQA 2FDSA 1JPMA 1UWAA 4OBSA 3CHFA 3T40A 4OGZA 3MHFA 3WQEA 3VDBA 4RDVA 1ML1A 3MW7A 4J40A 2YLAA 2PDFA 3L4WA 3O3RA 3DYOA 2Z28A 2J8TA 2QQ6A 3BAYA 1MEIA 2NVDA 2A7RA 3C2RA 3UPWA 1GPWA 1DIEA 3V5OA 3T0TA 3ABRA 4BQ3A 3JRKA 2X1IA 2OLSA 5HBFA 1X7IA 3VGBA 2PZ0A 1BLIA 4PR4A 1FP8A 2POZA 1N8WA 2I9UA 3SRDA 3WQGA 2BODX 4DBSA 1J0ZA 3CIWA 1HO4A 2PDYA 3N04A 1V08A 1QW8A 1J10A 1F5ZA 4MWAC 1GVRA 1J2BA 2FMNA 2QJNA 4KRTA 2Q8ZA 2VD9A 4QE1A 3W22A 1E43A 2GLKA 2X16A 4LAMA 5A6JA 3IAQA 4AZ7A 3KBWA 2Y7FA 3PJXA 1H1NA 4PTVA 2C18A 2DUAA 4KWWA 3JZEA 3W88A 1ISXA 2JE8A 4WEVX 2YJQA 4H2HA 1P6WA 4HP5A 3SFWA 5BOOA 4ZO9A 2D0FA 2WQPA 4XZHA 4AYSA 4F8XA 3DGBA 3VZYA 3VKDA 2W63A 2JGYA 4POCA 4IL2A 3C2EA 5DMNA 3SUSA 3UP8A 3CPUA 3CPRA 3KZPA 3LV5A 5LIXX 3U5YA 2XIQA 3UZYA 4QFUA 4BEUA 5I3IA 1Q6FA 4W88A 2NUXA 1RUSA 3L68A 3WDHA 3D47A 4W86A 3MKKA 1TPWA 3KBSA 3U9IA 2AQVA 1W32A 1M04A 2DZSA 2OELA 3G8RA 2EPOA 4DZIA 2CZFA 3WF1A 2YW4A 4P2VA 3AIEA 1GK8A 3W1MA 4DJFD 1MW3A 3BARA 3WENA 4MWAD 1C9WA 4UTTC 2WXDM 3GXNA 4Z2JA 2ZX5A 3E1F1 4IISA 1JFHA 3MZ2A 4M6VA 4AY8A 1FY6A 5I77A 5EMJA 3I68A 3IV3A 1LRQA 1J93A 2E09A 3MUAA 3BANA 1OCBA 4LAKA 2XIMA 1XRTA 1Q85A 2UY5A 1UYQA 1FWRA 3IACA 5ECUA 2V3DA 2OFJA 5E9XA 2XYLA 3C0QA 3F2CA 1JYXA 1WXZA 2VELA 3PZQA 2EXOA 1RLDA 3R43A 5EGRA 4BEQA 1C29A 4F40A 1ZTVA 2VR5A 1RPKA 3V1HA 3RN6A 3DFPA 4PMRA 4B4HA 3WQVA 4TIMA 3FIGA 1JPKA 2DJXA 2NQHA 5CAHA 3IUDA 2CLPA 4UR9A 1KGWA 3AXHA 1OCQA 3GZAA 4CQDA 5CCZA 4UTMA 4IUGA 3I6TA 2NQJA 3MANA 1TWDA 2I56A 3DBPA 4WKAA 1K3UA 3QV7A 2FTPA 2TSYA 4GBDA 1O5KA 4UFIA 4X60A 2WLYA 2J7GA 2WW5A 3URBA 3NJ3A 4DJDD 1R46A 3VZZA 5DBTA 3C86A 3BAJA 1F74A 3RAOA 3MKVA 3M0IA 4UFMA 3QH2A 4GIAA 2VD8A 3S0CA 1H62A 3WQDA 3M5YA 4O4WA 4DZ5A 4UTWC 4CQBA 1X39A 4Q3MA 1FWHC 3BOLA 1Q65A 2WQDA 3O0KA 1H50A 4P61A 3VIMA 4GHRA 3WNKA 1K4HA 4B9ZA 5FF7A 5HNRA 3S5NA 1AZ1A 1XBYA 3NVTA 1GOOA 4L7ZA 4MYAA 2Z1BA 3KL0A 2AL2A 1ZP4A 1AQHA 4MSSA 1RJPA 3I6EA 4B3KA 1TJ0A 4W89A 4O13A 4BI5A 4C6NA 3DXIA 3OHMB 3TYCA 3N4EA 4PMYA 1WO2A 3TFXA 4IQLA 2NWRA 3E9AA 3B05A 1XIHA 3W37A 3GU2A 3CGTA 1BKHA 3SEPA 2GQ9A 3LHZA 2JF6A 2WM0A 5BMXA 2J9YA 2FZBA 3N6JA 4YCPA 4OTKA 3WLNA 1OD0A 4X22A 2P3EA 2NX9A 4L1WA 2XINA 3I7SA 1RCOB 4TX6A 1DJIA 3T78A 1A50A 3JZUA 3QR1A 2XIOA 4ZQRA 1Q63A 5DN1A 4I5XA 4DJDC 5I3KA 3H70A 3WLHA 1E1CA 3WZ0E 1EP2A 1NOWA 4RK8A 4Y9AA 3NAVA 1KWGA 2D3LA 1DV7A 1HTIA 3L65A 3WDIA 2C7FA 1K03A 2NZLA 3H23A 1Z48A 4H6RA 2FZDA 1NJJA 1JXKA 5CGMA 4JYDA 3OIHA 4QG9A 5JIPA 3WUGA 4ZODA 4MKSA 1UPPA 3E6EA 2G95A 3FNDA 3EDDA 4LQ1A 3MBDA 2Y4SA 2V5LA 3OZMA 3LEPA 3QY6A 3VDGA 1MSSA 1BTCA 5LGZA 4QDPA 2J79A 3N13A 3WNMA 4JTTA 4I9MA 4WLCA 2FGLA 5D9MA 5BW6A 4H8VA 1VYSX 1Z44A 2V3FA 2AAMA 3K4WA 4FNRA 1UQYA 4QQUA 4YWIA 4AXNA 2GK1A 3C61A 1W5OA 3WK0A 4A8NA 1I9CB 3LNPA 2ZTJA 1MEHA 4DPPA 4HA4A 2YB4A 3ZLFA 2QW5A 1WAWA 3HPSA 5C7HA 3P93A 3QKEA 1R85A 4U5IA 4RZ5A 4U4MA 5FEXA 1FWAC 3IANA 4CNNA 3NQAA 2VR2A 4H7CA 1W56A 1LUCA 4E3TA 5AZ0A 3HO8A 3BWWA 1S1PA 1UKTA 3W4RA 4M1BA 4PTXA 2FJKA 3STPA 4CU6A 3WUFA 1TX0A 1E4IA 4BF7A 2PWGA 4WDWA 4H41A 2HPIA 3TR9A 1TV4A 1DJZA 4UNKA 3S2NA 3P60A 3VD3A 3DC8A 4US5D 3DFTA 3VDCA 3NPVA 4NRSA 3VGDA 4LS1A 4FXSA 4FR1A 3PTMA 2PUZA 2W61A 3O06A 1TCMA 1EXPA 4HCDA 5EL1A 3NGJA 4HTBA 4A3YA 4DBEA 4YVVA 1XP3A 3NM3A 1X98A 1I8JA 3GXPA 1PS9A 1TVPA 3TA6A 1IZJA 1XHGA 1UH4A 5LA2A 3W7CA 2V9DA 4GACA 5C9WA 4A3HA 2PLJA 1C8QA 5H8PA 3R10A 1VQTA 3HG5A 1TIMA 3SCRA 2RGMA 3M44A 3R5EA 3RPDA 5J04A 3H7RA 4CEUC 3AU6A 1UG6A 5EU9A 2HS8A 1GOXA 4WR3A 1B57A 6PTDA 3E0VA 3DERA 4HGXA 3MMTA 3CL6A 4B5XA 3MCOA 3CV7A 5FL1A 2CXGA 1AD1A 3M5ZA 2WHKA 3GK0A 1O5XA 1R5YA 3NSMA 3ECQA 4DYEA 3DYPA 4H7ZA 4Z2IA 1CBGA 3AHYA 1OGGA 3AHVA 4LUSA 3HOJA 4GJJA 3R89A 3QKZA 1X7FA 1Q6EA 1XL9A 1LZOA 4NJIA 2BV9A 1WZAA 3LBMA 1SO5A 4QG8A 4XISA 4UFJA 2INZA 4O52A 2ZWZA 2VXNA 2BOEX 5I79A 4US5A 3FLUA 1VFOA 1JCJA 1W9VA 3WQWA 4AD2A 1OG6A 2A3LA 2Y7DA 4PEKA 3LDVA 1FOBA 3BZJA 3PZMA 3ITCA 1GVYA 3G1SA 2PDBA 2QCHA 3OVRA 1M01A 1Q2SA 3WIJA 3CM4A 1RALA 4QS6A 4FZIA 5AC6A 5AYXA 2X8RA 3MI6A 4A05A 1KM1A 2E9BA 3LCWA 1GCYA 2C1HA 3RLUA 1IWBA 3LLFA 1DXFA 4ASTA 1H09A 5M3WA 3ONCA 4KEMA 4KESA 1R3WA 4O8RA 3H4XA 1R3SA 4D6EA 1TR9A 4QAIA 3HFTA 1B90A 3ZJ7A 3VOFA 3AXXA 3W1XA 1N7KA 3MTWA 3BJSA 4OV4A 1WDPA 3ZZ1A 1ZBWA 5M2FX 2PMQA 3USBA 4MDOA 2H6RA 2IKHA 4QDWA 3BLFA 3APTA 3ENLA 4FLSA 3W1NA 1ZCOA 1A5AA 3UA4A 4QX4A 3TFCA 2Q8XA 1YX1A 2ZX7A 1N55A 4JTQA 3TCSA 1KRMA 3PG9A 3QN3A 3FSUA 2R91A 2VVSA 4OUIA 4B5SA 4XZBA 2YYTA 1BHGA 3VNZA 3SN1A 4GLEA 1FWBC 3KVKA 3FGCA 4IFOA 2QULA 1GVQA 3P62A 6REQA 2POTA 1XLJA 2BOFX 1SR9A 4DN1A 4WF7A 4QP0A 1LOSA 4JYEA 3ID7A 3T2OA 2YFNA 3ZR6A 4D1IA 2TRSA 4L4OA 4NJGA 4UNLA 5A3HA 1JVNA 5CLWA 5FJIA 4GJ1A 5K2ZA 1KM5A 3AAMA 3QGKC 2WVUA 3SM0A 5FI8A 3QOMA 5LSMA 4IG2B 3MA8A 1GVSA 2WSYA 2YZRA 3BLIA 3AMLA 4MKNA 1TV7A 1RVGA 3P61A 4M5PA 1KFJA 2GUBA 3PSVA 3WL0A 2XPKA 1SZFA 3OODA 1JI1A 3WLSA 3CAVA 4YTTA 3UZ5A 1ZJIA 1Z9AA 2PTDA 4RZ6A 3OPSA 4ZFCA 3P14A 1ZS2A 3QF0A 4C6CA 4F2UA 2G97A 3ZJ6A 4JOMA 3HG2A 3ITLA 1AD4A 3THQA 3TTQA 1RBAA 3T7VA 2J78A 2QVNA 4QJ1A 1I2QA 2FZMA 1DP0A 3QY7A 1KM3A 1K1DA 4XX6A 4GFIA 5LNUA 1XWYA 4LF2A 4F3HA 5JU6A 1R38A 1A47A 1NVMA 3HPAA 1MXDA 4MF4A 1UR9A 3QR3A 1S2VA 2J6XA 2JEPA 4XAYA 1LQAA 3MP4A 3K8LA 1OVDA 5CJ5A 4NAFB 4O18A 3SY8A 1JCYA 1K8ZA 4QEEA 4R9OA 2D1ZA 5HOSA 5MF5A 2WANA 2IXVA 1HFBA 3CHDA 4IOTA 3T6CA 3M0JA 4D1JA 1R3QA 3LXAA 1EO5A 4C1LA 2FH8A 1FCUA 1IIGA 2X0SA 5F2LA 1EWEA 2WNWA 1XM3A 3CB3A 2DPEA 3E0FA 3DENA 4GWEA 4YTQA 1OT1A 2QCCA 1NP2A 3F1QA 4G9PA 4LTSA 4PTDA 1GGOA 4MNKA 3UXKA 1DWAM 4K3ZA 1VD6A 3DFHA 4KETA 2WMHA 2OMAA 4NQ1A 4K37A 4UNIA 3C3NA 3DX5A 3VMNA 3FYOA 3MMUA 2XU2A 2HVMA 3W7EA 5A94A 2GQ3A 2VURA 2BTMA 3R79A 1K9TA 4F0SA 1R6WA 4EAMA 8XIAA 3W07A 3WFAA 4ML9A 2WWDA 1PZ2A 1R9ZA 3AS0A 4H6KA 4H2CA 1Y5WA 3SADA 4LOCA 3ZFHA 2HPMA 1PZ1A 4PCSA 2PDGA 4ZBCA 3GFZA 2J7FA 3THAA 2WMFA 1VR6A 1TV8A 4QXIA 2IMRA 1H11A 3AYTA 2Q6ZA 3VDAA 1QDSA 1XR2A 1O68A 4FAMA 3KX6A 1UWTA 3W7RA 7A3HA 1UB3A 1XKYA 4N9BA 2XZ9A 3B40A 2V38A 2GZXA 3UR2A 5CZTA 1FHLA 2DJLA 4QNWA 4ATLA 2EGZA 4UTHA 3C6CA 1ELSA 5FJPA 3FFSA 4JTDA 1YW1A 4AHPA 2J7HA 2DQWA 5D2TA 2QPXA 4QE4A 3CUJA 3S2LA 3IVSA 4RZBA 2D69A 1UH3A 2PRMA 4IJCA 5LKYA 5AVNA 1FDJA 4FS9A 4C6JA 4B91A 4LUYA 4QSFA 1KRAC 4JTJA 3TYEA 1KFCA 3B8SA 3M6DA 4Z1AA 4JTEA 3TTEA 1I75A 2OSWA 2YA1A 3RJXA 3D3AA 3W7GA 5DT7A 5FJTA 2VRQA 4LEQA 3ZM8A 1TKKA 3NQ6A 1XV8A 4JY8A 4GYPA 4QEHA 2VFGA 4XK2A 2J62A 4BJHA 1SMDA 2BX7A 4HU3A 3OVPA 4UQBA 2J88A 4EF9A 2PGFA 3ZR5A 3TV8A 1TWSA 3GDMA 3SSZA 4MAZA 4EXQA 3LSCA 3CZJA 1S5NA 3GNOA 4H9TA 1HJQA 1M6JA 3PS7A 2OSYA 3AROA 1TV3A 2PDCA 4BF5A 4Q4SA 4UZUA 2DORA 3SGZA 4C6EA 3KOYA 1KBJA 4EX4A 1ITQA 2XFFA 2WO5A 1Z6KA 2V81A 1FCBA 2G5WA 3CYJA 3RK8A 3CL8A 5AYZA 2BHZA 1PX8A 2PWUA 2B7NA 2UV8G 4RDWA 3GUGA 4C6KA 1T40A 1PIIA 1BQGA 3UWQA 4IQJA 3EA3A 1TREA 1TPEA 1XLBA 1XH0A 4HA3A 4GPNA 2ZZ1A 3SUTA 3GM8A 1HKIA 2DIEA 3VFLA 2HE5A 1RQBA 2E5BA 2WZMA 2CW6A 4PCFA 3KBMA 4JIEA 2ZUVA 4YJ5A 4CNTA 4PA8A 1KB3A 3DN5A 4EVZA 1QPRA 2VX7A 3LCLA 4J3VA 4BWLC 1GOQA 3DU0A 4MLJA 3DG7A 2DH2A 3CEUA 4R27A 2CU0A 9CGTA 1F3TA 5CSSA 3FAXA 3W53A 2J47A 3FKRA 2X42A 5C2CA 1SJBA 4O12A 3W85A 4E5TA 3KE0A 3WFLA 3QOKA 1WBJA 2INFA 3AZRA 3TYZA 2B31A 3G1HA 4K8GA 3PTKA 5C2GA 5HANA 3A9BA 1Q6QA 2MNRA 4IIBA 4NT0A 5HMEA 3C2OA 4GJIA 2RDUA 3GNNA 2VWSA 1UUQA 3NVDA 4AVOA 5C9ZA 3U2EA 1EUAA 3AXIA 3UG5A 3QV9A 1YTEA 1QHZA 2Z7KA 1HW6A 2VHLA 2D2HA 1EYWA 5FJOA 3QZAA 2ZUWA 1CLKA 4C90A 3RRAA 3WLPA 3F7JA 1ZP3A 1R7OA 3TJXA 1A5UA 2EF9A 1JD9A 3FEQA 1WOAA 1DBTA 2DZWA 3O7UA 1SJDA 1QBBA 2OWCA 5CH9A 5D2WA 5HNUA 1U5VA 3CO4A 5GNYA 1VJZA 1Q8JA 4GZ7A 3VMPA 1QT1A 4UQAA 1GJUA 2ACUA 4RCXA 1TJ1A 3MMDA 4G1NA 3AJ7A 1R7AA 3SFKA 3CLMA 2ASHA 4LH8A 3RDKA 1FVPA 4I7UA 4Q8QA 4G56A 5JBFA 1ISWA 1J0IA 4K1WA 3BOFA 2YA0A 1OC6A 5A95A 4XD4A 2VMFA 3W7QA 3MHGA 1BQCA 2ICSA 1WCGA 2ABAA 1PKYA 2CLMA 1GEQA 4L4LA 1EX5A 3LERA 1WX0A 2PWEA 3N2BA 4DEFA 1WZMA 2ZDSA 3QLDA 2X09A 4ZTXA 2WJDA 2Z2AA 2VEMA 3TSBA 4J3TA 3TN5A 4JEJA 4BKNA 1XFBA 4MY1A 1MWOA 3P8IA 3ZJ8A 1Z3NA 1VFFA 3BAIA 1ONEA 4MFEA 4B3LA 1S2UA 1EBHA 1Q4WA 5HMSA 4LBUA 1MXGA 3VOCA 4I9TA 1AL8A 1DE5A 3UXIA 4PMUA 3PC0A 2QPUA 2ZCGA 2WKJA 3MV11 4P5UA 3WMLA 4O11A 4NP7A 1SQ7A 3EX1A 2VC6A 1TPH1 3QZEA 4N9CA 2B7OA 3BSMA 2PSNA 1KBIA 2VRJA 1WBHA 2ISSA 1V02A 2WNNA 3QW3A 3GVWA 4AEOA 2ISDA 4GY7A 1DWHM 4PC8A 3UU0A 2D2GA 5I0DA 1W1IE 1JGIA 3O8AA 4DM1A 2Z1WA 2DDXA 4PUNA 3RPMA 1V02E 4KS0A 2RKXA 4J1OA 4R7WA 4M29A 4IFKA 3CMJA 3HV8A 1BRLB 1ONWA 5F7UA 3H6OA 2Z1VA 1CENA 5DCBA 3ALFA 4D8ZA 1E40A 4KW2A 2XVPA 1LLOA 1W1TA 4J3WA 4PE8A 3AU2A 1V3IA 4MJZA 2W6RA 2WHJA 5FACA 1FHVA 1F4HA 1GKPA 2ZE3A 3S2JA 3ISIX 3RJYA 2WLZA 3WQFA 4C7DA 4WRHA 5D37A 3RLHA 3E0IA 2GJLA 4RNFA 5D2VA 4NRRA 2QVHA 3VILA 4MVAA 2QJIA 1GW9A 1MW2A 4HHHA 3PWIA 4MG4A 5FESA 2ZYFA 2CERA 3POHA 2EPNA 4DX3A 3LCIA 1VEMA 4QAWA 3FS2A 4M1RA 1VAHA 2QCDB 4ES4A 1TMQA 1K6WA 2W66A 3VIOA 4HA0A 5BWAA 1MEWA 1E4LA 5H1WA 2VEPA 1W5PA 3ARSA 4GQBA 5BRBA 2AQOA 2BFGA 3LM7A 3BV7A 2ZX6A 3SZ8A 4ERGA 3AHZA 2BY2A 1UASA 1ZALA 4PTWA 5CJMA 5IFTA 2G37A 4MPKA 2VZVA 4WDUA 1BYBA 3KL3A 1YE4A 2HE8A 1P7TB 1B9BA 1CLVA 1KA9F 2VFEA 3CUGA 3UZZA 2YFOA 1SW0A 3WK1A 3PTQA 5EA9A 4IPLA 5T9BG 3CAQA 1MVYA 3CUHA 1XLDA 4HPXA 2R1LA 4KCTA 3UJRA 1QNQA 2WBKA 4Z17A 3O16A 4MLRA 2IXUA 1ZBVA 5CZ0A 3SCOA 2ZA2A 1AZ2A 3OZOA 4LWWA 3EOSA 3Q45A 4LBRA 3MYPA 4YVXA 1TWZA 1QK0A 1L8PA 1KFWA 2NXHA 1B3XA 1SZRA 2WCGA 3RFAA 3USZA 4CCCA 5C5YA 3EDEA 2D24A 5HQEA 2P76A 4DXKA 1Q13A 2ABBA 3MP3A 2EQDA 3VABA 1HL9A 2DVTA 4DF0A 2PDUA 3SCNA 1TR1A 4KQNA 2IPFA 4FB7A 1QI3A 1MNSA 3ERPA 4LRSA 2Q71A 2AQWA 1L6FA 1J8VA 1AW2A 2WJFA 3ZT5A 3HU7A 3K13A 3W86A 1XSIA 3TP4A 4LC8A 1JG9A 1F61A 4JL2A 4UC5A 3ARPA 3B8UA 2YXOA 1XGDA 3TNOA 2AKMA 2A3BA 4GUIA 3C2YA 1EZWA 1HVXA 4GOAA 1K9EA 2GWNA 4DXXA 1JR1A 4XVDA 2J7BA 4GVFA 3BQ6A 1YTDA 4WDXA 3BCFA 4XB3A 1US0A 2HRWA 2OQYA 1SO3A 2VX5A 5HATA 5I03A 1EJWC 3I7QA 4YXGA 3W7OA 1MQQA 2A3EA 4H04A 4DBUA 2V2HA 1XFCA 4V28A 4WXZA 2VCBA 1OT2A 1HKWA 2GJXA 3TH6A 2DP3A 5H6HA 1U1JA 1OF8A 1Q45A 1P0BA 4NKCA 4F2BA 3AWNA 4CU8A 1ADDA 1JYNA 3MWCA 2VEIA 4HIBA 4FX8A 1EF3A 3F4NA 1XIBA 2Y5SA 3V5CA 3HPFA 5B7ZA 1U5JA 3IUIA 1CTNA 2ZUNA 4PMZA 4A21A 3ZWTA 3TC6A 4O10A 4KH2A 2CZDA 2YBVA 1EX1A 4L6DA 3T08A 3VD4A 1FWCC 2CZVA 3AIUA 1JD7A 3EX3A 3IVUA 5GNZA 1UZ4A 4XZMX 2HVNA 2ZX9A 3I3EA 2BMBA 3ZSSA 4GIEA 5BOEA 2X1SA 1XIIA 3AMKA 3FA3A 4PMQA 3HB9A 4UTJA 5AKQA 2RDWA 1DQUA 2OLHA 4RKAA 3GIYA 1B54A 1XDJA 1WUEA 2I5GA 1E51A 3LXCA 3L5LA 4TVCA 1LL6A 1XLMA 2OT1A 1NFBA 8CGTA 4R85A 3QQWA 1CX9A 5CPTA 3WH5A 4JIHA 4M56A 3QFWA 2Z6IA 3C0JA 4JFVA 3HIJA 4EXAA 1E70M 3LV6A 1FH7A 2ZADA 1TMLA 1JCMP 1SGJA 2AOSA 2D2OA 3WLQA 1OABA 4GUFA 4DZHA 4FEZA 1BFNA 5EMMA 3IS4A 4UXDA 1HJVA 3GFYA 1KM0A 1KW1A 1DTNA 2CEQA 3UR5A 1A5LC 4LGXA 1IT0A 3BAWA 1OIMA 1W2VA 1Z42A 2WYSA 2ANUA 6A3HA 1GORA 3GBEA 1I2PA 3TYBA 3AYRA 3HURA 4AEFA 1KD0A 2E40A 5D30A 1WB0A 4X2RA 3TOYA 2NV1A 4EE9A 3C56A 5A5WA 4ROPA 1KNWA 3NEHA 3WO8A 3ICJA 5BYWA 2E28A 3W01A 1WOBA 1ZJBA 3S4TA 3IIXA 4X9YA 3WD4A 1LQ2A 4ZSUA 4BY3A 3W83A 1EA9C 5I3HA 3CASA 2FPVA 1JRBA 5L9FA 1OADA 3VE7A 1T5AA 2O92A 1W3IA 3WF2A 4J3XA 4E0CA 1QBAA 3CQKA 5GNXA 2WK2A 1UC4A 3NPWA 4JQAA 3P82A 1XICA 4QE5A 4AH7A 3GNRA 2OJPA 1M41A 3L4XA 1EKOA 1N82A 1P4CA 4PRRA 4GRSA 3A4AA 3W1RA 4I6VA 4ZB2A 3E2VA 3ITTA 4TTUA 3O6CA 2PWDA 5BROA 1ESWA 4ICCX 3TQVA 1HUVA 3WQPA 5D05A 1K70A 3GHTA 3HMJG 2YL9A 5MKGB 4WY0B 4MHBA 5KITA 2PURA 1MFVA 3P0XA 3EWWA 1F2JA 3NDZA 2XSAA 1B0IA 2AAAA 2A3CA 1TZ7A 2CHNA 4MY8A 3A4WA 4KCWA 2DVUA 4MADA 4NASA 4FI4A 3P0WA 3CUIA 3GDKA 3UZWA 3CL7A 1XLCA 4IPPA 1JDEA 2OSXA 2GVEA 1UP2A 1ZAJA 5KTLA 1E3ZA 3TN6A 4F0HA 2QZRA 3FDGA 3NO3A 4YYCA 1XBVA 1S2AA 2VC7A 3KS5A 1UMYA 4ICNA 4K39A 3Q58A 5A8MA 4GVIA 4AFYA 4UTUA 4FXJA 4KPLA 4HNTA 3OA3A 3R6IA 4U10A 4P8XA 2XUCA 4GYKA 2J77A 3O2LA 4GH3A 1B3WA 3GXTA 2GPTA 3CNYA 1KO0A 3ITGA 2VZOA 4RXFA 3WNNA 2J8FA 3K8KA 4H9ZA 3I65A 2CLLA 2WZEA 2Z0IA 2H3DA 2C0HA 4UWMA 3U2ZA 4QCFA 1F07A 2OKTA 1W3HA 3S83A 1JF5A 3STGA 4WOQA 2Z00A 3NWRA 3MSYA 4IMAA 1O5RA 3VCNA 1ECEA 4HBKA 2BGQA 1VCGA 4K2SA 1O4UA 3OTRA 3QQ0A 5CJNA 3KCJA 1UZHA 3OG3A 3FK4A 5EMUA 1HP4A 2R8WA 4RE3A 2IW0A 2PTZA 6CGTA 3EPNA 4XO6A 2RGLA 3BAKA 3NXFA 4ML4A 2YLLA 4KFOA 3GFXA 4ALDA 3WCZA 3N2TA 5MKGA 1XLHA 3PZIA 3EXTA 1WXJA 4MOZA 1X96A 1E0XA 4LAUA 2OOFA 1FDZA 3F4WA 1EHNA 4UB9A 5A8QA 3TC3A 3AJXA 4PSRA 3T0DA 3M9YA 4DHGA 1NP0A 3NL6A 2X2YA 2Y7GA 5BXSA 3T2QA 2AL1A 3VGHA 1E6XM 2DZTA 4YCOA 2FPTA 1EWDA 1DOSA 4QM1A 1NDWA 4RE2A 1F73A 2BB0A 2DSWA 1IEVA 2ZRZA 4CQ8A 1XLGA 1H63A 2QNEA 2R82A 1KFLA 1EDTA 1XQKA 4LAZA 4NL1A 4DQWA 3BG3A 3RRXA 3S6TA 3I3DA 3BPWA 5D9NA 5D38A 3L4ZA 3WQ4A 1LBFA 2D73A 4M81A 4XAFA 5IRPA 1ZHAA 1K7FA 1RY0A 2E3ZA 5IOBA 3GLCA 3CZKA 4J35A 1UKSA 4Y9NA 1F3WA 4C6BA 1V7AA 1I60A 1QASA 1VH7A 4DJEC 3GC5A 4NYUA 1GW1A 4JTGA 3W73A 1JJKA 1QOXA 2HSAA 1OFDA 2GGEA 5GJMA 3DKLA 4FO4A 2QCMA 2VNCA 2V2CA 1TVLA 2AMXA 3S42A 4DI9A 4S3AA 1VLIA 3BDKA 3S5YA 2O4QA 2R14A 3AUJA 3CMGA 4GVHA 5KMYA 2VJXA 3G6MA 5A6BD 2C8NA 1P6CA 1E9YB 1EOMA 4ZEPA 4XZIA 5FL0A 1DE6A 5A8PA 2ZXDA 2PFHA 4LYKA 4MNJA 1K8XA 4WHBA 5FD0A 3N6HA 1XPGA 3PR2A 7TAAA 3VIIA 1E9ZB 4DWSA 1F6PA 2Z7GA 3RCNA 4N6EA 1XLAA 1UA3A 7XIMA 4DAFA 1G69A 1KTCA 2F8QA 4ZSTA 4C6MA 6TIMA 2FGBA 5DQPA 1SZGA 1L6SA 3SCWA 3V5FA 5BMWA 2PRHA 2Z6JA 3EX4A 3INPA 1F7BA 2Q02A 2I9EA 2XVKA 3RCMA 4XBKA 4RPPA 3MPGA 2YGYA 3W1TA 1ISYA 4GBUA 4XQ6A 1XS2A 4DWSB 1ZL1A 3PAJA 4Y7EA 3EDJA 3F4DA 2PRLA 2RDTA 1UD8A 3EMQA 3FX4A 3KOWA 1SYTA 1LORA 1Y5VA 1FWNA 1JCTA 1VLWA 3TJ4A 3TAOA 2MUCA 1YBQA 2PDIA 4Y8FA 1JZ7A 3CZ8A 5EMKA 4AD0A 8RUCA 1BF6A 3LQLA 3WLJA 1ZRQA 1C7SA 3OGRA 4HU0A 3B0UX 1D2KA 2PF0A 4RNIA 1DJNA 1RR2A 1V6TA 3CK5A 3DFSA 4JZ5A 3WJWA 3N29A 5CKSA 1TB3A 2YIHA 5C7VA 2ZC1A 1C91A 3FHAA 2A3HA 2XG9A 4F79A 2ACRA 1LL4A 3GDTA 5E6ZA 3R12A 2BNJA 3TMLA 5IXEA 3UYCA 4MNMA 4JHZA 4U5KA 1LL7A 3HG3A 1VC4A 2X40A 4JTKA 1UPMB 2GGJA 4MGGA 4J2MA 4AMCA 1TFVA 1VBJA 2EJ1A 1WE5A 3DHPA 3WLOA 1V6UA 4HCHA 3NQVA 1ZPTA 2VFIA 4FOJA 2CKRA 1H1YA 4O28A 5F4WA 4DNMA 4RNHA 3W38A 1UA7A 3HTWA 2YXXA 4DLMA 2QLYA 1PHQA 3MY9A 1CGTA 4D6DA 3LGEA 4IM4A 4K7YA 3UPMA 3PM6A 4KT2A 5I6SA 3PZGA 1X1ZA 4AD4A 1J0YA 4ATWA 2B81A 2FZ8A 4F0KA 3RU6A 1MDRA 1JFXA 4MUPA 2PP0A 5KINA 4GQQA 4OKDA 5HDRA 3UY8A 1CPUA 1X8FA 3BLOA 3QBUA 1A53A 3VINA 1KC7A 3GZ3A 4JXCA 3IIVA 4NJJA 1TE1A 1RCXB 4HNLA 3W7MA 1YDNA 4UR8A 5I3FA 3R58A 3L4UA 4EAYA 3BUVA 4DBWA 3MB9A 3ELFA 2PLCA 1NF7A 5H91A 4PODA 3EAUA 1VHNA 4Q8TA 1WZKA 4BS0A 3BE7A 2BSLA 3V36A 4JTLA 4ZR8A 2IKIA 2C13A 1EL3A 2CLFA 2E6DA 4HT3A 2QHAA 3W71A 1JYVA 1LRNA 1N2VA 5D02A 5KZEA 4O0ZA 5DMYA 1JL8A 1J18A 1VEPA 4GYJA 3TR2A 4A2RA 1SPQA 4QRNA 3GYCA 4AC7C 1P43A 3UG4A 1XIMA 3LHUA 3WL1A 5AN7A 3V35A 3RUBL 4ECLA 2GQ8A 3MJYA 1KBBA 3VM5A 4H9VA 4IMEA 4GI8A 2PWVA 4YWSA 5GJPA 3OIXA 4KWVA 1O1ZA 2A6NA 5G5IA 3EX6A 3K46A 4XAGA 2CBUA 4H3DA 2V68A 1JUKA 2B4GA 3GDLA 5G2IA 3EWDA 4E2OA 2VOTA 2YCIX 1RQEA 1TVNA 3W1LA 3SY5A 1XGZA 3LA4A 2PDKA 4X3ZA 2EBNA 3FGCB 1CGUA 2WMGA 3V16A 4A8IA 1GKQA 1ISVA 5A2CA 4LYQA 4CD7A 5AECA 3TTSA 4JTHA 1W9DM 1V6VA 4B5NA 2IUZA 2OO6A 3OBAA 4OE7A 4OECA 2DW6A 3IJIA 1NOFA 2YCLB 4ONVA 3G1AA 2V69A 3QHMA 4ZQMA 1H5YA 2PS2A 4LV9A 2PGEA 1KRCC 1ITXA 4HOZA 4O1FA 4JIQA 5F2IA 7PTDA 2O55A 3U8GA 1W1A1 3TDFA 1XYZA 3N3TA 1PTDA 5AC5A 1EBGA 5EB8A 3NZ1A 5GPRA 4JEQA 4JFWA 3Q37A 1E6QM 5CG0A 4BA0A 4PUEA 1JNEA 1RXOB 3AIRA 2QV4A 1KBLA 5FF3A 1X8CA 1H51A 3MMWA 4O19A 4CD5A 1HNYA 1YNPA 4DM2A 4HPNA 3W72A 1RK5A 3IJQA 2JEQA