1G4TA

Thiamin phosphate synthase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
226
structure length
226
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVSAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THIAMIN PHOSPHATE SYNTHASE
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 80
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4tA00
4O11A 4IX2A 2QCLA 3S1UA 4JTIA 5EYWA 1TB3A 2ZRUA 3IRDA 4N4PA 3P5YA 3W72A 2CLFA 2X1SA 4JDYA 3FKRA 2DU2A 1JCNA 3F03K 3U8GA 5F2MA 3EWYA 3IVSA 5D30A 3LV6A 3HGRA 2AQWA 1X8FA 2E1DA 4ZQMA 3W1TA 2X1RA 5DBUA 2PRMA 2XN1A 5E0KA 3UWYA 3C2EA 1X1ZA 4WZHA 2R94A 3MI6A 2VFGA 2VFHA 1FWRA 1PE1A 1H7XA 4N2YA 5D33A 1VHNA 3F4WA 1W5PA 1F7BA 3BGGA 4JXCA 3SY5A 3THAA 4UTUA 1ZENA 4ML9A 2Z6IA 1UCWA 3FFSA 3LHVA 3DAQA 3LXCA 3UY8A 1S5TA 3NO5A 1RQEA 1A5CA 2VENA 1F76A 4XTIA 2EAWA 4KWWA 2HTMA 2WNZA 1WQ5A 1HFBA 4BWLC 2ZRWA 4S1FA 5AC8A 3UPWA 3TSBA 4O1BA 4G1KA 3S1XA 4BWLA 4WXZA 3DFSA 3GIYA 1DQXA 1OABA 4R7JA 1M6JA 3R89A 3LV5A 3A5VA 4N6EA 3G0XA 1SQ7A 1JULA 1CW2A 3NXFA 4X3ZA 2V0TA 3O8AA 3B4UA 2Y62A 1TV5A 2B7NA 2YFNA 3O05A 6ALDA 2YXGA 1LBMA 3P8IA 4RR4A 3MP4A 3PR2A 5LNSA 5DCBA 4A29A 1PCKA 3LI1A 3MUXA 1PIIA 1O94A 1TJPA 1TO3A 2QJHA 2QDGA 3W86A 4E2BA 3PSVA 4JYDA 1Q45A 1UJPA 3VE9A 2O7QA 3TXZA 6TIMA 3MBFA 1TCDA 2CU0A 1ADOA 1K3UA 4FIRA 5C54A 3KXQA 2J27A 4LUJA 1QAPA 3SZ8A 4O4VA 1LBFA 4FF7A 2CLEA 2ZDRA 4XKYB 4N6FA 4ZQCA 3W2MA 3NR0A 4XZ9A 4Z08A 4YCOA 2Y88A 4HNVA 2OJPA 3AJXA 2G95A 1A5AA 3LB0A 3NQDA 3W1UA 4AWTA 5F2GA 2VC6A 1TPDA 4A21A 2A4AA 4AXKA 3NQ2A 1KM6A 3DFOA 2J9YA 3TW7A 3UD6A 5TQLA 4O4WA 2W0UA 3I7SA 4D2JA 3L67A 3VKJA 3LHWA 5I3JA 5HR6A 3EXTA 1FDJA 5AHNA 2J24A 1KFEA 4LVAA 2ZA3A 4LOCA 2ZBTA 4MY9A 5F2IA 4MY1A 3EX1A 4O14A 1I2OA 2J6XA 3E02A 3A21A 4XBKA 4MZ8A 4RCXA 2NXHA 3BW2A 4KWVA 3L21A 3E96A 4UR7A 1FX6A 2X1UA 2BSLA 1H7WA 2CLKA 1TJRA 4RZ6A 1SO3A 5DXXA 4JTUA 3B0UX 3IGXA 4W9TA 2Y63A 3TFCA 2WPBA 1VPXA 3TV8A 1J2WA 5F4WA 2FFCA 1EP1A 1ICQA 4MZ1A 3TKFA 1JVNA 3VE7A 3SGUA 2CZ5A 4FNPA 3S8HA 2NUYA 4LWWA 3TFXA 4JD4A 1SFLA 1DQWA 2JGYA 2R14A 3GAYA 4HSOA 1N8FA 3EKLA 3L5MA 4LC8A 2Y7FA 4EOUA 1OVDA 1RVGA 4NNCA 5HULA 1PL9A 2ISVA 3R8RA 1W5NA 3NL3A 3P5ZA 1XDLA 3VFLA 4QM1A 4XQ6A 4M6VA 4EF8A 1O5XA 2CLIA 3QJAA 1Q6OA 3GR7A 1K8YA 5I3KA 4B5NA 4A2RA 5LGXA 3CEUA 3BO9A 2GVJA 4UCGA 3W2UA 1SO5A 4IGHA 1H7RA 4O15A 2A6LA 1EWEA 3LHYA 1LRNA 1TSIA 1VC4A 5KZMA 4WQ6A 2ZZ2A 1G4SA 2CLOA 3M5YA 2VEMA 3NPXA 3M7WA 5HMSA 1W5QA 1JCYA 2V82A 1DBTA 1XBYA 1L6SA 4E38A 3EEGA 1XUUA 2E5BA 3ABOA 4PCFA 4JIPA 2Z2UA 2WSQA 1PV8A 4UXDA 3O63A 4TIMA 3LCGA 1K8XA 3DFPA 3AO0A 2E09A 3NQVA 1WXJA 2FTPA 3P61A 3Q2DA 4HHPA 3MWAA 1W54A 1VHCA 4K8EA 1CI1A 4DXVA 1R2TA 1L6WA 1VS1A 3LCHA 4GUGA 1R2SA 3TMLA 2DORA 5CSRA 3G3DA 3HGOA 3OVQA 4NJGA 3S42A 4X9SA 3PG9A 4FX7A 3PWAA 1AL7A 4IMCA 4MZYA 4ORIA 3S9YA 1NF0A 2AAMA 3W3OA 5DY2A 1QNVA 2V2DA 3G0SA 3HQ1A 3FS2A 4JR5A 4I7VA 5I3IA 1JCMP 2GQAA 2G96A 2Y70A 3LBMA 4IX0A 4O52A 4UIOA 4LRTA 1PS9A 3GKFA 5FEXA 4O13A 1VQTA 5U7SA 1KTBA 2VEIA 5H91A 3MO7A 1BTMA 3B0VC 3CM4A 2A0NA 3NEVA 3ZR4A 4NQ1A 3WK2A 2H6RA 1H50A 4MJZA 1VR6A 1UASA 3DFQA 3EKZA 1IIHA 1NVMA 3L9CA 1KFKA 4I9AA 3KX6A 3UY7A 3O06A 4RV8A 3ATZA 4JX6A 2VEPA 3NYZA 1GVSA 4Z0SA 4NT0A 3W7KA 4LW7A 3KAOA 3I65A 3HOJA 3PF3A 4LY8A 4HPJA 2QCFA 5K3VA 3KHJA 3W7QA 5FF4A 3NDOA 3G1YA 3G1SA 3HGJA 4WX2A 3KFTA 1KV5A 1GVOA 4DO4A 5FEWA 4FX8A 3TDFA 4C1LA 2FB3A 3TSMA 2NZLA 1AW2A 4GWEA 3MP3A 4IPIA 3HG2A 1TPVA 3C52A 2C19A 5DY3A 4QIUA 2ZCGA 3P7YA 4BI7A 4O12A 3GAKA 1P1XA 1TYGA 1LORA 1OX4B 4ZMGA 3NG3A 3FA5A 3RF9A 1Z41A 3DFTA 3PS7A 3W7LA 1U5JA 1T8XA 3QC3A 4Z1DA 1G7UA 3LBCA 3IVUA 3LRKA 1FUYA 4OE7A 1VYPX 3BPWA 5HWMA 1DVJA 2DZUA 4QAIA 4RZ4A 3RNDA 3U6WA 5K9DA 3KVLA 2RH9A 5DBTA 1X6UA 3M5ZA 1H63A 5LKYA 2QJGA 3TJLA 4N9EA 3USBA 4AB4A 1B9BA 2FDSA 1G4TA 1RR2A 3W7GA 4RLIA 2V5BA 3N2MA 4PL1A 1KM5A 1MEHA 4MKNA 1W56A 1WDWA 1MO0A 3GVGA 3CC1A 2WOQA 4CNNA 1LDCA 3W2NA 1LYXA 3V1PA 3PUDA 1IXOA 3M47A 4UFJA 3SFKA 4OT7A 4A2SA 2A5HA 4S2BA 4WY0F 3C2OA 3NM1A 1KFBA 5F1UA 1MZHA 7TIMA 1QPRA 1VGAA 3QMTA 3QYQA 3C8FA 1PHQA 2QCNA 3T4CA 2Q8LA 3NGJA 3SGZA 1F6KA 4FX6M 1LOQA 1I45A 3QMRA 1QPQA 3W07A 3BW3A 3TA6A 4FNSA 4IXXA 4XUGA 3G18A 4H4IA 1MSSA 2PE4A 3S5NA 3PM6A 4FXRA 1ME9A 3S6DA 1RV8A 1JCJA 2ZZ7A 2IQTA 3UYCA 1EPXA 2VELA 4MUZA 2YDAA 3JS3A 3NNTA 3WJSA 4AH7A 3DKLA 4JN6A 2X1TA 1FDZA 2ATSA 3O6DA 1QO2A 1D9EA 4IWWA 1IXPA 4AHQA 4JTTA 2E5DA 1TQJA 4O50A 3OVRA 2E68A 1O5KA 1YPIA 1TQXA 3QRHA 4N9DA 2C15A 3QSTA 2A2IA 4UFIA 5LHFA 3V75A 3W1PA 1ZAJA 1DORA 2PRHA 3DHFA 3E0IA 1FCQA 4M7TA 3W7RA 1OFRA 4LNYA 5J5DA 5AHIA 2E6DA 4NJIA 4GJ1A 3W7CA 2Q3OA 3KVJA 2QUTA 5FF0A 3PVFA 4FNTA 2QUUA 4NVTA 3W2LA 1TPUA 2JKEA 2ATMA 5LGZA 1ZAIA 2J9XA 3PULA 3P81A 4DPPA 1YADA 4JYFA 4NNAA 3W1MA 1OYAA 5K9CA 2GUUA 3GZ3A 1OYCA 1S3HA 4QNWA 1QFEA 5BW6A 2NUWA 1H60A 2OCZA 1IGSA 2RFGA 3WJXA 5HNRA 2DZWA 5LHEA 2Y61A 3GK0A 2B0MA 3VI2A 3GXPA 3LXAA 4JEQA 1NAL1 3A5FA 2GQ9A 2V30A 3NQMA 2DZTA 2ZQ0A 3DGRA 4YWIA 1RPXA 1AW5A 5EY5A 2JBMA 1T99A 3M1ZA 4K7VA 5E1QA 5FF3A 1OYBA 3WJYA 4O28A 4MVAA 3UXAA 4PH6A 1ONRA 3CHVA 1ZALA 1BEUA 3CIWA 5G5IA 1G69A 4RKAA 5BMWA 2QF7A 2NX9A 5K2ZA 1W0MA 2QUVA 3UZ5A 2EPHA 3MBDA 4ZQNA 1THFD 1H7NA 1HO1A 5KTLA 3CEPA 2BTMA 4MYXA 4A22A 5C5YA 3TW6A 1SZNA 1UB3A 1XCFA 1ME7A 3IIVA 5CKSA 4P61A 5E93A 3HG5A 1EEPA 2O7SA 4ICNA 2A6NA 3MI3A 3S5YA 1YTDA 1JJKA 3E49A 4WUIA 2GQ8A 4L4LA 4M6QA 4X22A 1FXPA 1KM3A 1KBIA 3W7PA 5DELA 1OK6A 2ZZ5A 3EWXA 3HG3A 1L9WA 3UXDA 3W1LA 3FLUA 3UWWA 3S1VA 5KZEA 4RX0A 2JK2A 1OF6A 3N9RA 4YCPA 4NJJA 4GUJA 1XXXA 1ML1A 2I1OA 4JIQA 3IEBA 3LI0A 3CIXA 4RJEA 3NVTA 5G2HA 1SW3A 1ZHAA 3TC7A 2YGYA 2P10A 3M6YA 1D3GA 1ICPA 3WK1A 4FIQA 2J88A 4MLRA 1I2RA 4NNBA 1LLZA 2NLIA 3G8EA 1K7XA 3CLMA 4TMBA 4TO8A 2QCDA 1O4UA 2YW3A 1I2NA 4BFAA 4K37A 2NV2A 5C6MA 1LRQA 1TRDA 1TV8A 2E5CA 2TSYA 4IPJA 1DKWA 1GVFA 1C9DA 2E6YA 1OFDA 3FYOA 1WX0A 3EX2A 2QKFA 3T78A 4UR8A 1YDNA 4K6AA 1LP6A 1W3NA 3A23A 3G1AA 1W31A 2LLEA 1TREA 3B8DA 1EX5A 3MHUA 1HG3A 2GOUA 4JYEA 2NXGA 3NQGA 3CWNA 8TIMA 3JRKA 1FWWA 3TE9A 4BF9A 1EWDA 1YXYA 3TQ0A 3W7NA 3G1DA 1F5ZA 3LCLA 1OK4A 1EB3A 3CPRA 1F73A 3PUOA 4O54A 4Z1AA 4JTFA 4Q4KA 5D03A 3SIZA 3HGSA 4JTLA 4ZQOA 3LCIA 3W1XA 4E0CA 1O60A 4FO4A 2WNNA 1ZCOA 4K8HA 1VRDA 3R5EA 4BK9A 5IBXA 4JICA 4OHQA 2ZTJA 3BG5A 3Q94A 1FWNA 2C14A 3G8RA 2B4GA 3MYPA 4JNMA 4O17A 5D38A 3QH2A 1FWSA 4ZVJA 3K30A 4NX0A 2NWSA 3ABQA 4LS1A 5AYXA 1TRIA 3O07A 1EP3A 1XFBA 1JR1A 2DZXA 3Q58A 4RK8A 2XFWA 1YXDA 5CPMA 1WA3A 3N3MA 3W6YA 3PBVA 4N02A 3LLFA 3ANYA 4UTKA 2WQPA 2FPYA 1DHPA 3UNDA 5BMXA 1XBZA 2WNQA 3LDVA 1SR9A 4FB7A 1M7OA 4UTHA 5DLCA 1SW7A 1RQBA 3MP5A 3NQ6A 3W1NA 2V2HA 3LX9A 1WYIA 3MI2A 4JTSA 4WY0A 3TROA 3LTPA 3UWQA 5ABTA 4U28A 3N19B 4MOZA 3DI0A 3PB0A 1U83A 5LZLA 2G97A 3W84A 3A22A 5AYZA 4WD0A 5K4XA 4DF0A 3LHUA 3EXRA 1SW0A 2C16A 3N34A 1JRBA 5EKYA 4AAJA 3FEMA 2R91A 1VH7A 3MHFA 1QWGA 4NJHA 4UTTA 3EWZA 1GQNA 1OX6A 3C61A 3WJWA 4IUOA 3LHZA 3T40A 3OHIA 3EWWA 3UWZA 1LROA 1E51A 4LTSA 3SR7A 4JTJA 3GLCA 3GX9A 4QNEA 1ALDA 3IIPA 4YXGA 1SZGA 2QCMA 4XTDA 3RFAA 5SWUA 1TPFA 5HWNA 4Z0JA 2NX1A 3HBLA 1SSGA 4TMCA 1JUKA 2NX3A 1GYNA 3QW3A 3SSJA 3QFEA 3C2FA 1KBJA 4LU0A 1KM2A 3W7MA 3O1NA 5I3GA 2H3BA 1PHWA 2ZRVA 1OFEA 3O6CA 4UUIA 3EB2A 4AF0A 4DF1A 4CQ8A 2HS8A 3W7DA 1JQXA 3RK8A 2X30A 4JDBA 4ORMA 4PC8A 2Y7DA 3N14A 4KFOA 1KM1A 4UTIA 5CSSA 2EF9A 3PG8A 5G2IA 3F1QA 5EPDA 3UWUA 1TV7A 1SSDA 1GEQA 2ALDA 3W70A 1OFOA 4R34A 5CPOA 3A24A 5AN7A 1VLIA 3FJLA 5AFDA 1A5SA 3N2XA 1R47A 1GJPA 1VCVA 3W7EA 1JRCA 4TX9A 3PC0A 1VYSX 3M44A 4UMBA 3W7OA 2BX7A 4M19A 4RXGA 1OFBA 2C1HA 1ZJIA 2CWNA 4JY8A 2YYTA 3TU9A 1J5TA 2EHHA 1XL9A 2WSRA 3W7JA 5FI8A 4OV4A 3EXSA 2Y7EA 4JGDA 3ZS4A 1SO4A 1HO4A 3BLIA 2KZHA 4HIBA 3ZWSA 1LCOA 1X1OA 5K7JA 1QOPA 1AK5A 3JR2A 2RHGA 4WOQA 1O95A 4Y96A 5CG7A 1GTHA 1KM0A 3M5XA 4CQAA 4OWGA 3I7QA 3GNNA 1KTCA 4ADTA 1HTIA 4ZQRA 3W23A 3NM3A 4ADUA 4CQ9A 3LHTA 5LNRA 3QQ0A 3TMQA 3DH7A 1V7YA 4J9JA 1PCWA 3O16A 4DPQA 5FEPA 1GG1A 4N9CA 2B7QA 5D37A 4JTKA 5IM51 1H1YA 3FIGA 3STGA 3W7HA 2NXIA 1UUOA 5FF7A 3TIMA 1FCUA 1GTEA 3H53A 1FY6A 4AWUA 3RLVA 2HS6A 3FJ6A 2GJLA 4K7YA 2C3ZA 1F05A 2Z1BA 4KFPA 1C8VA 4FNUA 2FLIA 5F2LA 4GNJA 3WFAA 5D2VA 4ZZ9A 2CFFA 4CCCA 3IIXA 3B0PA 3DI1A 2PRLA 2V5LA 1GZGA 5EA9A 2F84A 1LBLA 1AL8A 1FBAA 1Q6LA 3BK0A 2AGKA 3QW4B 3ZWTA 4CNOA 4LC6A 3NQEA 3TAOA 1FDYA 2W79A 2Z6JA 1H51A 2Q8ZA 1QOQA 2C6QA 4DEFA 2VFEA 2Y7GA 1TTPA 4LVDA 1YYAA 1IXQA 3GR8A 2CZFA 3G0UA 4UTJA 4JS3A 3E9AA 1XM3A 3P60A 3OA3A 4XKYA 4XWUA 1P5BA 5AHFA 2QCEA 1W3TA 2BXVA 1S5VA 3NL5A 4ZL1A 2QAFA 5HUPA 1TTIA 2I14A 1YDVA 4HPXA 1NFBA 1GVRA 4AEOA 1F6PA 2V9DA 3BG3A 3B04A 2CLHA 3G24A 1VYRA 3L0NA 3LTYA 1TTJA 2DZVA 3GDRA 4GUHA 3L66A 3STCA 3THQA 3BG9A 1YTEA 1KTNA 4GXMA 3GYEA 1XI3A 1T96A 1OF8A 3C3NA 1B57A 1XBVA 3NQCA 2A7PA 3W74A 3W1RA 1QR7A 2ZZ1A 3BV4A 4JY9A 1FXQA 2GPTA 3NOEA 3OVPA 4DBEA 2VFDA 2FIQA 3R12A 4YL2A 3I6RA 2C0AA 3KRSA 1SU5A 4O18A 4R53A 1QMLA 5C55A 1UUMA 2RDUA 4M7SA 3T44A 4AVFA 1H7OA 1TTQA 3VNDA 4LVBA 3DZ1A 3FKKA 3L0GA 1GYLA 2A85A 2A21A 3TCEA 2VFIA 4Z1BA 3GDKA 2GVGA 1DOSA 5AHEA 3BW4A 3SI9A 1R2RA 3EX4A 3PSWA 4EIVA 5MHBA 5CZTA 5KITA 4JX5A 3F4NA 3M16A 2F7FA 4NUWA 1NSJA 3C2RA 4AHOA 5G1YA 3BLEA 2ABBA 1GT8A 2YFOA 4EF9A 3L65A 4MPQA 3YPIA 3U2OA 2ISWA 4UTWC 1VZWA 4OQVA 1YTKA 3NZRA 3PBWA 3TR2A 1LZOA 1ICSA 5I3FA 4UTWA 1OJXA 2PC4A 2CW6A 1L6YA 5D04C 1W3IA 3GDMA 1KFLA 2Y6ZA 2PURA 3NL2A 3BARA 3PB2A 3VCRA 3IGSA 5HINA 1BWKA 2H8XA 4KFNA 3GXNA 2NWRA 3GB6A 1HL2A 1KV8A 3S5OA 1G67A 1NF7A 4N9BA 4MY8A 3S5ZA 1WOBA 5GVJA 1SO6A 4LRSA 4M6PA 5L9FA 4HNUA 4RZ5A 1Q3NA 1EA0A 4EWND 3CB8A 3L5AA 2W6RA 2YW4A 4H6KA 3UZJA 1F74A 1G6CA 1DL3A 3KRUA 3Q37A 5KSWA 5TIMA 4TR9A 3CU2A 4HKPA 4PFMA 3LM7A 3GKAA 4C1KA 3KVMA 3QEZA 2A1YA 3RLUA 4AWSA 3DXIA 1KLZA 3SJ3A 3B06A 5D2XA 3S0CA 1Q6RA 4QISA 1KLYA 2Y89A 4ZQPA 2QDHA 4CNPA 3W88A 2ZZ3A 3PBYA 3PUEA 3W76A 4NX5A 1ME8A 3HB9A 4O0KA 4UFMA 3DENA 4BR1A 1NEYA 3P62A 2ZZ6A 1XC4A 4OV9A 1HUVA 2G5WA 5DCDA 4UNLA 4MFEA 5AHLA 1RZMA 2JKAA 3G22A 4H3DA 2V2CA 2J9ZA 1EP2A 3LERA 1VLWA 1SUXA 4BI5A 2R8WA 3E12A 1KFJA 2ISSA 2YSWA 4YMZA 2WV8A 3NZ1A 3QSRA 5D2TA 1W5MA 4NXKA 4I7WA 3W2KA 1MEWA 3KRZA 3CTLA 4IJBA 5H2ZA 5U4NA 4MJMA 2WKJA 1OFPA 3O15A 1B4EA 3TX9A 1KFCA 3H54A 1AMKA 3M43A 2NUXA 1B3OA 1LRTA 2B7PA 4O19A 4UTMA 4NU7A 3GDTA 4OU1A 1QPOA 4M5PA 1OFQA 3W1AA 1YLVA 1Z44A 5F1VA 4NXSA 4OGZA 5A8GA 2BWGA 3I7RA 2ZTKA 4S2CA 3IVTA 3LOTA 1H5YA 3B03A 4XBSA 5CPLA 4E2DA 2QAPA 3M0ZA 2E77A 3P67A 3P82A 2P0OA 1TPH1 3SECA 3G1HA 4POCA 1R46A 4YLWA 1WV2A 3LGEA 1A50A 3R13A 5HWJA 5IBXC 4Y6GA 3W85A 1TPC1 1ZAHA 1UBSA 1OG0A 3OEXA 4CCEA 3M41A 1B4KA 5AOUA 3N73A 4TU1A 5F4SA 1OX4A 1Z48A 4WXYA 5D09A 3BGJA 5G2WA 2NV1A 1G4EA 2ZRYA 3L68A 4HSNA 4IOTA 4CCDA 4N4QA 1GG0A 5D02A 1LM1A 2PCQA 3C6CA 2YPIA 4NZFA 2P1FA 4UFLA 3TUUA 1IIGA 4DO5A 4JTEA 5CZJA 2BLEA 4JTHA 4A3UA 2ABAA 4CLMA 1QPNA 2OT1A 2VEKA 3P8JA 3NPWA 5F4XA 3ABSA 3LTSA 2C18A 1OX5A 1FCBA 4UTLA 2YX0A 3UQNA 3INPA 3D0CA 3NQ8A 3W2JA 5K4ZA 5AYYA 1XKYA 3L5LA 2CZEA 4EVZA 1IXNA 4UNKA 3HPSA 1FWTA 1V5XA 3P84A 1JCLA 5TBOA 3RU6A 3DFNA 1AG1O 4ONVA 4UMAA 3HMJG 3P74A 3G1VA 4LVGA 1QCWA 5G1TA 4BI6A 3EWBX 4FNRA 2OMAA 2D73A 3H55A 1I4NA 1TPB1 4ALDA 5LSMA 5KMYA 4Y9AA 3CT7A 5AHMA 3OIXA 3NQFA 3SW6A 1A5BA 3IGUA 4U4MA 3W1QA 4DF2A 3S1WA 1LOSA 2GJNA 3NL6A 1W5OA 2QCCA 5CZSA 1DJNA 4UTTC 4AHPA 3MMTA 2OX1A 4LS2A 1C29A 3DBPA 4LVFA 3TSDA 1M7PA 4FXSA 5BNKA 1K03A 1BWLA 1H1ZA 4O16A 5AC7A 1YPFA 2YYUA 4IMDA 3EX3A 2C13A 3OBKA 4Q32A 4PTNA 4ADSA 1WOAA 4WOZA 1P0KA 3DHDA 5EMUA 1SPQA 1FCVA 4DO6A 1XBXA 3R2GA 3IIOA 2FPVA 5D05A 2JGQA 1K8ZA 5J5RA 3KVKA 1G7VA 3NPVA 2TMDA 3TXVA 4QITA 1RQHA 3HJZA 2EGZA 3QQ1A 5T26A 1T0OA 5DCEA 5G4WA 3M5VA 1VCGA 4GBUA 2BZNA 4MFDA 5CZ0A 2RDWA 3GNDA 3TK7A 3LRMA 3HPZA 4HT3A 2QEZA 3GDLA 5DXYA 5KZDA 3O6YX 2VOMA 3L0KA 1MXSA 4IQLA 2V8ZA 1WAUA 2ZA1A 1H62A 2DZPA 4DELA 1GWJA 1XDMA 1DV7A 3W75A 2E6FA 3TJXA 4MLJA 2OT0A 3QF0A 1A53A 4R33A 4K36A 3HO8A 3T7VA 1ZNNA 4AMAA 2QCDB 5D2YA 4PA8A 4HN4A 4LT9A 4Y8FA 1TPEA 3STEA 3OG3A 2Q3RA 4UC5A 5KINA 1EUNA 5EL1A 5HUOA 5DN1A 4HNTA 1JCXA 5K9XA 1YDOA 5BRBA 1W1ZA 3ATYA 1ZFJA 2VKZG 4NJKA 4Z1CA 4L4MA 3LXBA 1JUBA 4QQ3A 4PEKA 1MEIA 4FEZA 4Y90A 1H61A 1BKSA 1W8SA 4JTGA 3MJYA 2RDTA 3QPYA 1G4PA 3WJZA 4O1AA 3C56A 2RKXA 3G1FA 4JX4A 1TPWA 2ZRXA 3A9IA 2TRSA 4GC4A 1M5WA 2Y85A 5FESA 1TMHA 5D32A 1GOXA 1XUZA 2DZSA 3HIJA 3PAJA 4IMFA 5LNWA 1LLWA 1W37A 2V81A 2QCHA 3STFA 2YCEA 3IV3A 3RMJA 3IIZA 5HJLA 2QCGA 1I8JA 3DKJA 2QJIA 3LCXA 5BOOA 1YXCA 1L2UA 2QR6A 4DBDA 4LV9A 2GVLA 2TPSA 5HR7A 5FF2A 3HF3A 1K7EA 3NQ7A 1X7FA 1P4CA 5G4EA 4LS0A 2CZDA 2ZA2A 3B05A 4GFSA 3TH6A 4GUFA 4DQWA 1JUEA 2H3DA 4IMEA 3L2IA 1R30A 1QDSA 3W71A 2HSAA 2XN0A 2ZRZA 2Z0IA 3TC6A 3W87A 5LNVA 1SZEA 2ZFAA 2H8ZA 4UMCA 1P0NA 1QO5A 1FQ0A 1DJQA 3EWUA 1PVNA 1OFAA 1D3HA 2EKCA 3QM3A 3FOKA 2WSYA 4O57A 3C4UA 1EIXA 4NZJA 3W73A 1KM4A 2DP3A 3C2VA 3WK0A 3WK3A 3W83A 2VFFA 2B7OA 3EX6A 4WY0B 1CX9A 1IF2A 2XN2A 4O10A 2E6AA 5AB3A 1N7KA 1K02A 3CWOX 3M9YA 3QMSA 1I2QA 1JQVA 5D2WA 5L6UA 2ZZ4A 4X2RA 3QPZA 4Q33A 2FPTA 4QSHA 3LCFA 3BLFA 3NQAA 4IXHA 2A7RA 1OHLA 1F2JA 5I3HA 3UWVA 3HPXA 3MW7A 5CPNA 3C0JA 1J4EA 2WJZA 3LCWA 3W22A 1KW1A 3PY2A 3ZFHA 3TQVA 5EBUA 4IMGA 2ZYFA 5C2XA 4FHAA 3G1XA 4UFHA 1Z42A 2CLMA 2DJLA 3ELFA 3TQKA 4O1CA 3NPUA 3HG4A 3LLDA 1EUAA 1TIMA 3I68A 4O0ZA 2TYSA 3FYPA 3NA8A 1Y0EA 1GPWA 1ZY9A 2VXNA 4GRSA 1AW1A 3W7IA 4K38A 3TAKA 3W9ZA 3UPBA 3GXTA 2DJXA 3QZEA 1GVQA 1RD5A 2WO5A 2FB2A 4AF0B 5CGQA 4FNQA 1LTDA 4PL2A 2A7NA 1I2PA 4PODA 4K39A 2X2GA 2UV8G 2OZ0A 4GE8A 3KOFA 4RXFA 1N55A 1K7FA 1H7PA 5FEZA 3MHGA 4HNNA 4LV4A 3BVJA 4LUIA 4O53A 3P80A 2FQIA 2I9EA 1KA9F 4O8RA 5AC6A 3N9SA 2HMCA 3LRLA 3TNOA 2X16A 1S5WA 1VCFA 3G3MA 1WBHA 1SZFA 1WBJA 4P2VA 2JKPA 4MYAA 3MYOA 2H90A 2YR1A 4MIMA 5HQEA 3CQ0A 4QJ1A 2YZRA 1LOLA 4GUIA 2CLLA 1Q6QA 3DU0A 3T55A 4UFKA 5A5WA 3PBUA 5LNUA 1SFJA 4KKXA 3ABRA 4I7UA 3NAVA 2FJKA 1VJIA 4WJEA 4O1DA 4OBTA
chains in the Genus database with same CATH superfamily
4RE4A 4K2SA 3AYSA 2P3ZA 4YHGA 4U2YA 1PX4A 2WM0A 5F2MA 3EWYA 3AICA 3I3BA 1Q8AA 1XIGA 3HGRA 2GQ3A 2XN1A 1K77A 1X1ZA 1F4HA 1JPDX 2PGEA 3DX5A 2P76A 2R94A 2FFIA 5ABGA 5M5DA 2CC0A 2EG8A 3I4EA 5C9ZA 3MY9A 2AMGA 3OA5A 4N2YA 3GTFA 4HSHA 3DHPA 1IR1A 4UTUA 4HU4A 4IM4A 1ZENA 4ML9A 1UCWA 4BQ3A 1GOMA 3LHVA 2PTYA 2PDNA 2WMFA 4ENLA 3LXCA 3NO5A 2WANA 5ENLA 3SAZA 1E3ZA 2HTMA 1HT6A 2ZIDA 2DZAA 1WQ5A 2D0FA 5LIKX 2ZE3A 3S1XA 1WKYA 1UIPA 3R89A 1C7SA 3A5VA 1UKSA 3CBWA 3V5CA 3UCDA 3NXFA 4X3ZA 3B4UA 2VDIA 2B7NA 5A6LA 6ALDA 1KQZA 2YXGA 1V03A 1VFMA 3KS6A 5EMKA 2OO0A 4RR4A 4D9PA 3VZZA 4MDPA 2WMIA 4B2DD 3N04A 1Q6GA 3M7SA 1EYEA 3VA8A 1PIIA 1O94A 1QHPA 5DFAA 3W86A 3PSVA 1TR9A 4JYDA 4H9MA 3SIMA 2REQA 4JQAA 3TXZA 2FHFA 3MBFA 4G5DA 5AY7A 3UXLA 4MNJA 3FA3A 5BWFA 4JFUA 2J27A 2PLMA 3REQB 1B2YA 1V0KA 3PNUA 4S23A 3RM4A 1LBFA 3AYTA 2CLEA 1TZ9A 3BSHA 2NSXA 1U1HA 4PMYA 4N6FA 4RDYA 3NR0A 4XZ9A 3SCWA 3F5KA 4HNVA 1F3TA 3LB0A 1V79A 3U2ZA 5F2GA 2VC6A 4A21A 3VZYA 4AXKA 2J9YA 3UD6A 1FTXA 2W0UA 1W3JA 3BV7A 5AHNA 3U7VA 2PWDA 1EDGA 3QR3A 1OG6A 2YCLB 4BQ2A 3JW7A 1JD7A 2PDGA 3QV9A 2ZBTA 4MY9A 3EX1A 1XINA 2TAAA 3WFLA 3T8QA 1G01A 3LN3A 3FY1A 5IRPA 4RCXA 2Q01A 4PB4A 2NXHA 3WF3A 3VZXA 2RGLA 4UR7A 1LL7A 4QXIA 2HVNA 2YXXA 1H7WA 2V5DA 1OT1A 1TJRA 4S39A 2WJDA 2KAUC 3B0UX 2Y63A 1QI4A 1VPXA 1YE6A 3U5YA 3TV8A 1J2WA 2FFCA 2WZHA 3K1GA 1ICQA 1R3RA 2D1ZA 2D22A 2VMFA 5ABFA 1OB0A 3W26A 3TKFA 3GW3A 3IK4A 4HMNA 3SGUA 3ZJ6A 4M1RA 1LG1A 3R25A 2NVDA 9XIMA 2Z26A 1SFLA 3CHCA 3CPUA 3GAYA 5FA5A 2FZBA 2ZE0A 5TNVA 3SCSA 4I5XA 2D0GA 5HULA 1B3YA 3AS1A 5JH2A 4QM1A 3WBAA 1O5XA 3VNJA 3QJAA 3GR7A 3O2LA 4YWSA 4B5NA 3CEUA 4ZODA 4E4UA 4KBXA 1JDFA 3BLLA 5BROA 4V2XA 1RBOB 3OZPA 4WK9A 2G3NA 2VR4A 2WHKA 4O15A 3R43A 3LHYA 2AGTA 3WF4A 2I5IA 1EFZA 1P6BA 2PDJA 4KEUA 5BYWA 3ITGA 2Y5SA 4E38A 3KBNA 3T2QA 3MUAA 1NDWA 1N8IA 3WDRA 4PCFA 3ARSA 1PV8A 3O63A 1AH4A 1XLJA 4TIMA 1DTNA 3DFPA 3KLLA 3AO0A 2ANUA 3OYXA 1PZ0A 3VO0A 2A3LA 3QHMA 3DYMA 1L6WA 3SN0A 3LCHA 2BHZA 4G7EA 3U2CA 4NJGA 5CJ5A 4X9SA 3PG9A 1AL7A 4XAPA 2Y4SA 1BHGA 4IMCA 1RP8A 3BJTA 3W3OA 1W1TA 1UD3A 1TZZA 3FS2A 2ZUUA 3GNOA 4I5UA 1ZP4A 2Y70A 4CEXC 4OZOA 5EB8A 1PS9A 4ASTA 4O13A 1KR0A 1VQTA 3KE0A 4WSJA 3B0VC 3AXKA 5C8BB 2VNCA 4IIHA 1H50A 2P0IA 1FKXA 4TVUA 1X97A 1UZHA 1XGEA 3QGVA 4NP7A 4B5VA 1MYRA 3L9CA 1KFKA 2C8NA 1NOUA 2ICSA 1A47A 3ATZA 2QJNA 5HDRA 1GVSA 4Z0SA 2PS2A 3DC8A 3KAOA 3I65A 1XG3A 3KP1A 4HPJA 4F2BA 2R1PA 3NDOA 4QLKA 3G1SA 3KFTA 3ZT6A 4MGGA 3TDFA 3C0LA 2FB3A 2NZLA 1Q5MA 3KOYA 1AW2A 3ABZA 3T05A 3T2PA 3P6LA 4A05A 4I9JA 5DQPA 2C19A 4F3HA 2DVUA 4JFWA 3KL3A 1Z69A 2BGNE 1LORA 3DC0A 3WQOA 1UWIA 3NG3A 4XAGA 3WUBA 3PS7A 4LBSA 2CBVA 1G7UA 1FUYA 1V4YA 3VOJA 3CAWA 2FMOA 3RNDA 5MKGA 4P7QA 2R82A 1DJYA 3TJLA 4JQ1A 1H11A 5J04A 4PL1A 1PIFA 3GVGA 1LYXA 3AROA 3KCJA 2GGHA 1IXOA 2ON3A 3V3WA 4OT7A 7REQB 2WZEA 5FJRA 3TC3A 4WY0F 3C2OA 4Z2KA 3WQ6A 4X63A 1MW3A 1CPUA 3LS9A 1CLKA 1PUDA 5C9UA 2XVNA 4AY7A 4J7RA 1VFOA 1K4HA 1VFSA 4UQ9A 2Q8LA 3VKCA 4IP7A 3N6HA 4QS5A 4WDXA 1JGMA 5AVNA 2QGYA 1S38A 3W07A 3BLPX 4D8AA 1UPPA 1SFTA 3TA6A 4XUGA 1MSSA 2PE4A 3PM6A 1EJUC 3UFYA 1FH8A 4JQ4A 4L6HA 1XS2A 3UYCA 3GBEA 1VEOA 4MUZA 1XRTA 4AH7A 3WJSA 3MVIA 3DKLA 1FDZA 3V35A 5FIPA 2ATSA 1XW8A 4IWWA 4MWAE 3DERA 3CMFA 4FMVA 1Z32X 1ISVA 1YNQA 2A2IA 3NGFA 4RNIA 4UFIA 3RLGA 1WP6A 3W1PA 4Q8OA 3OQ8A 4DUVA 1DORA 1QOXA 4HZ7A 1UHVA 3GM8A 3GIPA 1XRVA 3W7RA 1OFRA 4LNYA 4KGJA 4MMWA 5XIMA 3GTIA 2WXDM 1B3VA 3RHGA 1BYDA 3CYJA 2Z7KA 2QUTA 4FNTA 1IZCA 3W2LA 5A8QA 2VTFA 4AZGA 1XLAA 1GYMA 4PMVA 3P81A 4DPPA 1YADA 5I0DA 3FJNA 4Q6XA 1OYAA 1OYCA 1O12A 4DJFD 1S3HA 2PGRA 4B4FA 3KL0A 4QE4A 1V02E 2OCZA 1IGSA 4EE9A 5HNRA 3WL0A 4PRWA 3B4YA 5I02A 5M03A 2B0MA 2XGBA 3N6QA 3GXPA 1CGXA 3ZOAA 4W93A 8A3HA 1QT1A 1TA3A 5EY5A 3B97A 3CQKA 1T99A 3M1ZA 5FOOA 3AUJA 4AZ5A 3ARVA 4MVAA 3UXAA 3E0LA 1G0CA 4B3KA 3CHVA 1OGGA 4S38A 1CXFA 1K9DA 1BEUA 5LA0A 4GGHA 4XD3A 4RKAA 1DIEA 4LB3A 3NVDA 4DLFA 3UZ5A 3JZEA 1A49A 4EPDC 5A8OA 1AQHA 5CAKA 3T09A 3B8SA 4ZQNA 1THFD 2VZUA 2XIJA 4GH3A 4LF2A 1B54A 4Y9PA 4JNZA 3GG7A 3CV6A 5KTLA 4MYXA 5A3HA 1SZNA 4XISA 5CKSA 4P61A 5E93A 3HG5A 3TTEA 3G77A 3MI3A 3UG4A 4DBWA 5TAOA 3S5YA 5BRPA 1BD0A 1JJKA 4AWEA 4LBRA 3WDIA 3FX4A 3WH5A 3LY0A 3EA2A 1FXPA 3MA8A 4IP4A 4MTVA 3AU2A 1QJWA 2QVHA 5I7GA 3APGA 2XIOA 1CXLA 1EZ2A 2GL5A 3WUEA 1PYMA 3O0KA 5DANA 3S1VA 5CH9A 4RX0A 4GUJA 1ML1A 3MMUA 3IEBA 4OUIA 3TZFA 4UBPC 2WBGA 4ML4A 1SW3A 3TC7A 1KGUA 2P10A 2WZIA 1ICPA 2WKLA 1I2RA 2R1NA 4XD6A 5C71A 4LCRA 3QZAA 2NLIA 3CLMA 1JDAA 3FK4A 4EKJA 3UR2A 5GJNA 2WC3A 2YW3A 4ZENA 1I2NA 3BANA 2NV2A 1B3WA 1LRQA 1TRDA 4KS0A 2D0HA 1OFDA 1XLDA 3ALFA 1L0PA 1WX0A 3LPPA 3CO4A 1XRFA 2J7EA 3T78A 4Z2HA 4KERA 1YDNA 1O66A 1SM9A 1ISYA 4DWSB 1EX5A 1IGWA 3NSXA 4H83A 3JRKA 1FWWA 4BF9A 1E9ZB 1YXYA 3ONCA 1F5ZA 3BAXA 4DM2A 2B31A 2V3FA 1EL3A 2YIHA 3WQ5A 5D03A 4Q4KA 1S3TC 3HGSA 3NDYA 4E0CA 2ZUWA 3E5PA 1O60A 6XIMA 1ZCOA 4TVDA 2ZWYA 2QLYA 3BG5A 4XUYA 4XV0A 1XD0A 4O17A 1X8CA 1MXDA 3QH2A 5FSDC 1FWSA 3H26A 4L9XA 3K30A 4FK9A 4N0RA 4X60A 2NWSA 2P3EA 5M1TA 1EP3A 2DZXA 3KBSA 2CITA 3N3MA 3W6YA 2MUCA 2NQ5A 4DZAA 2UY4A 3GVWA 1SR9A 4XIAA 4FB7A 1M7OA 3E2RA 3KTCA 3URQA 3TYCA 3WLJA 3W1NA 2ISDA 3MI2A 4WY0A 4H2HA 2FGBA 5ABTA 1EJ7L 5LZLA 2G97A 5HQLA 3ZJ7A 5E6YA 3CMGA 3EXRA 1SW0A 1UBPC 1D7KA 1JRBA 1XPGA 4AAJA 1VH7A 5D9MA 1JI2A 4I8YA 1US2A 4UTTA 5CCZA 2IPGA 4AD2A 4RV3A 3N2CA 2XFFA 4JIIX 1VFFA 1FRBA 3CAVA 3T40A 3OHIA 1E51A 4F40A 4CQCA 3NO3A 3IIPA 4ZFCA 3VD4A 4Q8NA 2WVTA 2Z1KA 3HBLA 2BP1A 2GOKA 4TMCA 4NG3A 2X41A 4MUPA 3SSJA 3AIWA 4NYUA 2P8BA 2REQB 5I3GA 3EMQA 2C79A 2ZRVA 3CPGA 3VGDA 3USZA 2CKRA 1NFGA 1F3EA 2HS8A 2YKKA 2Y8VA 3H7VA 3TTQA 2X30A 3F2CA 1AVAA 1PEZA 1XLIA 4ORMA 1KM1A 4GY7A 5G2IA 4QSFA 1PDYA 4R7WA 1Q6FA 4S3KA 4H6QA 4HTYA 4RPPA 4US6A 3CHEA 5GQBA 4NAEA 5BZAA 2PWUA 4P8VA 5CPOA 1XYFA 1JAKA 2GUYA 1KRBC 4D6HA 3WD2A 3N2XA 1VCVA 4ZO6A 2DSUA 2ZVIA 2V3EA 1VYSX 3M44A 5IFTA 4M19A 3SCQA 1ZJIA 2CWNA 3JZUA 1YHTA 2WSRA 3W7JA 3EXSA 2Y7EA 5HATA 4MJ4A 3TOPA 1BF6A 1HJSA 1H41A 3WZ0E 4HIBA 3T08A 3TYAA 3UT0A 4IFKA 4A8NA 3UG8A 4WOQA 3WF1A 5ABFB 1X1NA 1O95A 1KM0A 2E0PA 3M5XA 1XSIA 4CQAA 1KTCA 4ADTA 5EBAA 3W23A 2G37A 5AECA 5LNRA 5I2UA 3CJPA 3DH7A 4GKLA 3U2EA 4C6IA 3ZR5A 4AD4A 1O1HA 1H1YA 2OZ8A 3W4RA 1AFSA 3FSTA 2MANA 5LXEA 3W7HA 3CV1A 2C7FA 3RITA 2IKJA 4AWUA 2HS6A 4D6IA 4K7YA 2Z1BA 1DXIA 2ZOXA 1ZQ5A 1C8VA 1ZUAX 4H7ZA 4CD6A 1OADA 5AZ0A 2FLIA 4GNJA 2YDRA 1O6IA 3OLDA 4FXFA 1NDVA 1SMAA 1BWVA 1B3XA 1B31A 4HOXA 3HMCA 1E6QM 3A64A 5GNYA 3UYIA 1EO7A 3KWSA 2CYGA 4DJEC 1FBAA 1E9YB 1RK5A 3ZWTA 2OWXA 4LC6A 4BJHA 4DJEA 5C2GA 2W79A 4ICCX 4B90A 4HD5A 3BURA 3PJWA 2ASHA 4A8RA 5FJUA 1XM3A 1P5BA 4OTKA 4AD3A 2W3ZA 4G7EB 2Z2AA 3LLXA 3R0UA 3R4IA 2O55A 2Z27A 3ALGA 3C5QA 3LTYA 3NQBA 1FH9A 1MUMA 3AMLA 3STCA 2JE8A 1YTEA 4MF4A 3H4WA 4GXMA 4YIWA 2F38A 1DYSA 1T96A 1OF8A 2VUNA 3NQCA 1LQ0A 3W1RA 1JYNA 1QR7A 4LJ3A 4JY9A 4O8AA 3K8LA 4HU0A 3NOEA 3QR0A 4L6OA 2FIQA 4YL2A 4O18A 3WQ8A 1QMLA 4LBUA 5C55A 4M7SA 3ITXA 4LXFA 1ZBKA 3SUVA 2OG9A 1GYLA 3QVQA 3FHAA 4Z1BA 3T42A 2GVGA 1DOSA 3U57A 1R2RA 4GG9A 3WNLA 1HVXA 2DDXA 5HOSA 1HXJA 4E8DA 3RIKA 4HN8A 4M81A 4EF9A 1GT8A 2YFOA 3L65A 4MPQA 4P7RA 4KWUA 3U2OA 4W7VA 4PRRA 1YTKA 2QVNA 3NZRA 2XYLA 4KCTA 5I3FA 2CERA 3RILA 3MSRA 3A13A 1EBGA 3PHAA 2RDXA 3NL2A 3BARA 3QZ6A 4B91A 3LQGA 5HINA 3W0KA 1JZ7A 3KOZA 4HMCA 4N9BA 3AWNA 5JUVA 4K68A 1WOBA 1SO6A 1YRRA 4HNUA 1UWSA 1EGMA 4P7OA 5MKGB 3PPGA 4LUYA 1K6AA 4UZSA 4RL3A 3MQTA 4DJED 5E70A 2W5FA 3HQNA 1UG6A 5KSWA 4HHMA 4WGHA 3GKAA 4HA0A 4C1KA 1HKMA 1QNPA 2CHNA 4LAZA 4AWSA 2PP0A 4HPGA 3BZGA 3DXIA 4C6JA 3SJ3A 3VD9A 5CPQA 4HNLA 4QISA 5E09A 4GIEA 3BSMA 2X40A 2QDHA 2Z28A 3M0KA 4JBRA 3PUEA 2WHMA 1XG4A 4CGTA 3HB9A 3HPAA 3TONA 1NEYA 3P62A 3T07A 3KBMA 2HQAA 2PMQA 1V3MA 4OV9A 2G5WA 3RDKA 2NT0A 2GSEA 5H6HA 3ZMRA 1VLWA 1SUXA 1TG7A 4BI5A 1KFJA 1XIHA 3NWRA 2WV8A 3T8LA 1V6YA 3NZ1A 3QSRA 3L12A 2HVOA 1PPIA 3KRZA 1GJUA 2BDQA 3CTLA 5C2CA 4IJBA 5U4NA 3N12A 4MJMA 2WKJA 4A8LA 2WYSA 3BMWA 1PO9A 1FH7A 2OU4A 1OFPA 3TX9A 1XYAA 4IGMA 1OEPA 2NUXA 3S2CA 3AS2A 2O4QA 3GDTA 4M5PA 3BOLA 1OFQA 2HPIA 2VR2A 3K4WA 4J40A 3B8VA 1J0IA 4S2CA 3IVTA 2CKSA 4AIEA 4ATDA 2J62A 2XHYA 2DT1A 4J3UA 4XBSA 3B8UA 4E2DA 1CDGA 1ODZA 1RJRA 4GXWA 3P67A 2GDVA 1XR2A 3SECA 4POCA 4C7DA 1DQUA 1XIMA 1Q4NX 1HJUA 6A3HA 1OG0A 3OEXA 3TCSA 3RU8X 4W87A 1NARA 3BGJA 2XVKA 4AQLA 3DCPA 4IH3A 4N4QA 1GG0A 2YPIA 4NZFA 4C6FA 1CBGA 5CPSA 1GK8A 3DIPA 3PJXA 1V3HA 1M04A 3PBMA 3LTSA 2O9TA 4RW3A 3RO6A 3UZXA 1N82A 1IHIA 1XKYA 4PCTA 5IHSA 1IXNA 3HPSA 1TA3B 3KM8A 1X38A 3II1A 1JCLA 3P84A 4NKCA 5TBOA 3RU6A 2RUSA 3P74A 3G1VA 4HK7A 1QCWA 4LVGA 4FNRA 5LSMA 4ALDA 1OGBA 3CT7A 3OIXA 3CL7A 4WLCA 1A3HA 4FLOA 3IGUA 3VMNA 2GJNA 3NL6A 4UQDA 2HNEA 1GVEA 4C7FA 4B3LA 3MMTA 2OX1A 4K3ZA 1C29A 1JXKA 4K8GA 1DWGM 4FXSA 1BGGA 4PMNA 3VIMA 1K03A 1QRQA 1YPFA 1GJWA 4IMDA 3EX3A 2C13A 1QBBA 4DYKA 4Q32A 3MUZ1 2XM1A 4PTNA 3R8HA 1LQAA 2D2HA 1R3YA 3AQUA 1DXFA 4DO6A 2F61A 1XBXA 1X6LA 3CQJA 2JGQA 5J5RA 4KMQA 1EX1A 2HDJA 4QITA 1RQHA 4IJRA 1V08A 2EGZA 5G4WA 4JN7A 4HHHA 2PTXA 3O9NA 4GBUA 2BZNA 1SFSA 3GNDA 4OUEA 4AZBA 1R38A 3I6EA 3PZUA 2E25A 2VDGA 3BJSA 3L4VA 2ZA1A 3GTHA 2JQXA 3R1ZA 4AY8A 1XDMA 1ZGDA 1WKDA 2E6FA 3TJXA 4MLJA 5E0FA 2J79A 1XX1A 3HO8A 1ZNNA 2F8QA 2J8FA 4Y8FA 1TPEA 1J79A 1R85A 4C6CA 5HUOA 3CH9A 3G6MA 5BRBA 3ATYA 4NJKA 1IWAA 2ZX8A 4M8UA 1HKWA 3RG6A 5JIWA 4IL0A 1V0LA 4FEZA 2NQHA 5JVLA 4NIRA 1BKSA 1W8SA 4Z2JA 1XYMA 2WCAA 2FTWA 5IHRA 1G4PA 3TZNA 3VIHA 2OX4A 4XD5A 2Z1SA 1HJQA 4XZHA 3A9IA 1I0DA 4GC4A 1M5WA 2Y85A 3BZJA 4EXAA 3HURA 1XUZA 3LPOA 3OGSA 1JCTA 3PAJA 2EPMX 2V81A 4F0LA 2YCEA 3IV3A 4A3RA 5HJLA 5LIYX 1I8JA 3GZAA 1YXCA 1XD1A 5T9CE 4XZMX 1H3GA 2FTYA 3GIQA 3HF3A 3DG6A 2VX7A 2GVEA 1K6WA 2CZDA 2QNEA 4GFSA 4E2VA 3RRAA 4DQWA 2DVTA 4LALA 2OKTA 3RPTA 2H3DA 1FVPA 2ZKMX 3L2IA 1R30A 3W71A 4WGXA 3SB0A 1P0NA 1QO5A 4AX6A 1E15A 1EC8A 2EKCA 3QM3A 3E2QA 3NSMA 1VFUA 3NFUA 2DP3A 3C2VA 3WK0A 3WK3A 1OD0A 2ZVRA 4WY0B 3THDA 3WUGA 2HRWA 1UD5A 2ZICA 4O10A 2AOSA 3RJXA 5D2WA 1DWAM 3NQAA 1T5AA 1YW1A 2A7RA 1BG4A 1F2JA 3W82A 3OW1A 5I3HA 5CPNA 1YBQA 2WJZA 4IG2A 3LCWA 2Z2BA 4EPEC 4J1OA 4AZHA 1UUQA 2YCIX 5C2XA 4FHAA 4UFHA 5A2BA 4NASA 4AD5A 2Y5JA 2OQYA 3NJ3A 3GY1A 1GQIA 1EUAA 4Q8PA 3I68A 4O0ZA 3PN8A 1Y0EA 3QKEA 1D8CA 3SY8A 5C7HA 4NY2A 1W9VA 4IF2A 3WMLA 3OGRA 3GXTA 1WAWA 3QZEA 4Z2IA 2FB2A 1CLVA 3BAWA 1J8VA 1RH9A 1XICA 2RJHA 1LTDA 2E7FA 4K1WA 2X2GA 2UV8G 4PULA 1HVQA 1N55A 3E0FA 3MHGA 4LV4A 3B9NA 1KA9F 2OYMA 3H8AA 3LGGA 5C9RA 2WHLA 1FKWA 3T2OA 3TNOA 4GBDA 4YTRA 3G3MA 4HK5A 1T6MA 1LUCA 1J18A 5CC6A 1GVIA 1LOLA 1Z3NA 1UWRA 4FXJA 4NAEB 3MUY1 4GUIA 1MFUA 2CLLA 1RLDA 1V51A 3T6CA 3N18A 2V69A 3CTTA 2PDWA 1XH2A 3NAVA 2PF8A 4WJEA 4O1DA 2Y24A 3TLQA 4IX2A 4JTIA 1TB3A 1P6WA 2ZRUA 2PU0A 3P5YA 4JDYA 4CD5A 1JCNA 5T91A 3PZGA 2E1DA 3GHTA 3W1TA 4C5ZA 2X1RA 3LG3A 1EJTC 4A35A 3SCRA 4WVXA 1DWFM 3ICJA 1L8NA 3WH8A 1TX2A 2VFHA 5D33A 4IFKB 3FCPA 1VHNA 3MSDA 1F7BA 2J6VA 3NZQA 3UGVA 4HMEA 3TNBA 3GU1A 2ZXQA 3QV6A 4H9ZA 1S5TA 4Q4SA 3S83A 1RQEA 4XTIA 3C0QA 4KWWA 2WNZA 3UG3A 1HFBA 4O1EA 3FVDA 2CNCA 2ZRWA 1JAEA 7ENLA 3GTXA 3KBJA 3U48A 3DFSA 3GIYA 1E55A 4R7JA 3SBFA 1M6JA 3LV5A 1TVPA 3BDKA 3ID7A 1JULA 3MCNA 2GGJA 3O8AA 4G2DA 3QLDA 4BCEA 3O05A 1GOQA 5LNSA 1XKJA 1MQRA 5DCBA 4LFYA 4F4RA 4A29A 4FAMA 3ME3A 1PCKA 2QF8A 1UKOA 2QGHA 1U2YA 2IXVA 3A9BA 1PX8A 4H8UA 3VE9A 2QJMA 2HK0A 4YTTA 3CV2A 1TCDA 2O56A 4FIRA 1XCWA 2ZUTA 4LUJA 1UC5A 3OBEA 3SZ8A 1VIWA 4FF7A 4Z17A 1ZJHA 1IWPA 3RX2A 2OJPA 2G95A 1AQ0A 3LQLA 4DNMA 1TPDA 3BOFA 1KM6A 3DFOA 5FJTA 4WDUA 3AHTA 4DUOA 5TQLA 4O4WA 3I7SA 3LHWA 1YE4A 3EXTA 4ZB2A 5I06A 2EKGA 1KFEA 4LVAA 4TTUA 4EX4A 1VEMA 1WZMA 3VD5A 5FL1A 1TFVA 5DMYA 5LIXX 5F2IA 4MY1A 1KBKA 4MZ8A 2Q02A 4KWVA 2EJ1A 3E96A 4Q8VA 2YLAA 1W9UA 2X1UA 4L65A 1CB2A 2FZNA 2PD5A 3BAJA 5CBIA 1B0IA 2UY5A 3VPLA 9RUBA 1ZU8A 3MB9A 3A3HA 3V4BA 3TFCA 2QV5A 2V3DA 2BV9A 3SJNA 3AUOA 3BUVA 5DMLA 4OIFA 4MZ1A 1IEIA 1N2VA 3MC5A 1LT8A 3VE7A 1AZ2A 4KQNA 3ZIZA 1EA9C 3S8HA 1VFTA 4LWWA 3TFXA 1JZ6A 3CUJA 3T1GA 4V1YA 4NZCA 4PBGA 1WDDA 3EKLA 3L5MA 4LEQA 2Y7FA 4M6UA 1XH1A 1W5NA 3BXWA 4CUCA 3VFLA 2FGLA 3SCPA 4CD7A 5HMFA 3D6NA 2CLIA 4JKKA 3VDBA 1BKHA 3QQWA 3AIBA 2WVVA 2OQLA 1QU4A 1SO5A 2WC7A 2A6LA 1EWEA 3MDWA 1VC4A 2POZA 4WQ6A 4B5UA 3QXBA 3K46A 2VEMA 3NPXA 5HMSA 1W5QA 3OTRA 1DWJM 3TW9A 3BSGA 1L6SA 2NQLA 3EEGA 1NP0A 4A3QA 4MNLA 2Z2UA 4U10A 5FAJA 3KZSA 1U30A 4UXDA 1K8XA 2OLHA 2FTPA 5EU9A 2W4XA 1C8QA 1VHCA 2G41A 3NTYA 2CWXA 4GUGA 3ENLA 3CZJA 1KCKA 1XRSA 3PZVA 4US5D 3B8IA 3TA9A 2PDIA 3S42A 4C6MA 4FX7A 1KCXA 3PWAA 4ORIA 1NF0A 1F4AA 5HANA 5DY2A 4W88A 4PE8A 3G0SA 5I3IA 4JR5A 5I3DA 3WDJA 3KCOA 1CB7B 2CLPA 3KL5A 2FYMA 2G96A 2IMRA 2IXUA 3LBMA 4HCHA 1F8MA 1YQ2A 4LRTA 3GKFA 5FEXA 1WNOA 2BBFA 5U7SA 2VEIA 3GSMA 5H91A 3N2OA 3ZSTA 3CYVA 2A0NA 4C91A 5I6SA 2I56A 1VR6A 3EKZA 4P8XA 2Y2WA 3RM9A 4C6BA 1Q65A 3T0AA 1REQA 3EB4A 4YYCA 2VEPA 2XFYA 3BCDA 3U9IA 4NT0A 3W24A 3W7KA 3GS6A 3HOJA 1JZ4A 3PF3A 4NZ3A 3W7QA 3VKBA 3HGJA 4WX2A 5D4YA 4GPNA 3WMBA 1BGAA 1BRLA 4DO4A 3APTA 3CL8A 2NSOA 1Q2SA 3IJ6A 4G7FA 4GWEA 1XIFA 3C52A 3AHXA 2D24A 3GC2A 2ZCGA 3P7YA 4CQBA 4BI7A 2GYIA 3GAKA 1P1XA 3N11A 1GZJA 1Z41A 4GO8A 3W7LA 1E1CB 1U5JA 2Y8UA 1T8XA 4LGXA 3QC3A 4Z1DA 4DBUA 3LBCA 3I3EA 3WLTA 1P6CA 1HL9A 1VYPX 2CHOA 3BPWA 3MU7A 3AIVA 1QNRA 2DZUA 4QAIA 2VWSA 3U6WA 4RNJA 5K9DA 3KVLA 2RH9A 4KEZA 1X6UA 5LKYA 4RDZA 1G9HA 4N9EA 5A6AA 4AB4A 4V15A 1B9BA 1A5KC 2FDSA 1RR2A 2WSPA 3W7GA 4PBEA 3N13A 1MEHA 4MKNA 1W56A 1WDWA 4CNNA 2ODOA 3BH4A 3MMDA 4QE1A 4KIRA 3W2NA 4HK6A 3BE7A 2J75A 4UFJA 2A5HA 3N4EA 1R5YA 1KFBA 5F1UA 7TIMA 1QPRA 1TCMA 1VGAA 2XJ7A 4CVUA 2QDEA 5GJMA 1BYAA 3LPFA 3VC5A 1EJSC 4NL1A 1TV3A 1UP3A 5BOEA 5I78A 3NGJA 3ZVHA 1F6KA 4H6RA 1GCYA 2NQZA 3UG5A 2DW6A 3CHDA 4P5UA 1J0JA 4FOJA 4FXRA 1JCJA 2V3GA 3PZTA 4M51A 3RGTA 1EPXA 2YDAA 3JS3A 5EFDA 3NO1A 3N25A 4I6VA 3B9EA 4GCXA 3C3UA 1E0VA 4JTTA 3ZXWA 4J27A 1XSKA 4O50A 3WEOA 1O5KA 3QRHA 2DQWA 4J2MA 1ISZA 4DJDC 1Z6KA 2QT3A 1KGWA 2O0TA 3W6MA 2PRHA 3XIMA 3AU6A 4DJDA 1AMYA 1XYLA 5AHIA 4HHLA 2DIJA 4NJIA 4OBSA 3MANA 3W7CA 5FF0A 4AX7A 3HU7A 1Z89A 1Y5VA 3WLIA 1SYTA 4R85A 5HK4A 2ZC8A 3ABXA 1XIEA 4N42A 2PDQA 3PULA 4NNAA 4LEFA 3W1MA 3FA4A 5CC5A 4YVXA 3WD4A 4PTDA 1X39A 3DOPA 3K2GA 3WJXA 2RFGA 5LHEA 2DZWA 1OZMA 4FOKA 4INFA 4F66A 3GU9A 4JEQA 2OWCA 2WW5A 1PZ3A 5A6JA 1PJ9A 1M03A 2DZTA 1V6WA 1XLGA 3DGRA 3E1F1 1RPXA 4GIAA 4J28A 2OSWA 2PTDA 4QJ4B 1T8QA 3WEZA 1S2TA 4ROQA 1M1BA 3U4FA 2A3HA 4PH6A 3GUGA 4Z42C 8XIMA 3UJEA 3MV01 2VCAA 1Q2RA 3CIWA 1W9PA 3UR7A 1E9IA 1V6UA 1UKTA 2NX9A 3ANUA 4NF7A 3WQWA 2D20A 3MBDA 3D46A 4CVWA 4L80A 1H7NA 4LAKA 1HO1A 3V0TA 1OWQA 5CG0A 3VC6A 2GK1A 1NU5A 1HZYA 2A6NA 4HYRA 3E49A 5HPOA 1DIKA 4L4LA 3JUGA 1KBIA 4DRSA 4ES4A 5DELA 1Q6DA 4NZ5A 4RNFA 3EWXA 4JTQA 4AUBA 3GC4A 3UWWA 6TAAA 3L2MA 1EZWA 3HFTA 4NJJA 1XXXA 4HGXA 4GD0A 2YL9A 3W37A 1YBQB 3GC5A 4IG2B 2KX9A 1W1B1 4RJEA 3NVTA 1C3FA 3PJUA 1K4GA 4S3AA 5HNNA 3VNMA 3WK1A 3T0TA 4URIA 4DAFA 4MLRA 1ZBWA 3ARTA 3RPMA 4S3JA 1K7XA 4HP5A 3TN4A 4E3TA 5LIWX 3SM0A 4TMBA 4TO8A 5ABEA 5AC4A 1IYXA 1VPQA 1XCXA 4LAUA 4BFAA 1J0KA 2E5CA 2TSYA 2VR5A 1GVFA 1C9DA 4IPLA 2QKFA 1E73M 3LSBA 4UR8A 1JI1A 1SJBA 4MDOA 3TLLA 4M1BA 3WLPA 4W8AA 5A6TC 2ZX6A 1RAKA 2NXGA 8TIMA 5B7YA 3E38A 2OR2A 3TQ0A 1LUCB 3QGKC 3LCLA 3GVVA 1N8WA 1OK4A 1F73A 4KH2A 4Z1AA 1R3WA 4ZQOA 1S39A 4PCNA 3LZ5A 3TTYA 5XINA 1VRDA 1QI3A 3MSYA 1NTHA 4BK9A 4TOQA 3IARA 2DY3A 3H7UA 3S5SA 4M3PA 1TWWA 2V38A 4GISA 2B4GA 1UW9A 3RUBL 5CAHA 4H9VA 5JMUA 5D38A 4HOWA 1OQFA 1QHZA 2HCVA 3SO7A 1S2AA 4W8BA 3CK5A 3O07A 2F2KA 6XIAA 4LYPA 2NW0A 1HP5A 2PEVA 2VO5A 1GHRA 2WQPA 2FPYA 4QCEA 3UNDA 2WNQA 3LDVA 1E4NA 4QRNA 5DLCA 1KBBA 1SW7A 4HCDA 3MSGA 1H49A 3P93A 3S9IA 2J7GA 3BQ5A 3H23A 1J96A 1WDPA 3V0SA 4W86A 3P14A 3TWAA 3W84A 5AYZA 1E6PA 1OCNA 2BOGX 2ZDSA 2IW0A 1XYZA 4L6DA 4MAZA 3B9AA 4AYGA 3MHFA 4NJHA 1JL8A 1GQNA 1OX6A 2V5JA 2VM8A 3WJWA 2OPJA 3LHZA 1Z8AA 3EWWA 1XDJA 3UWZA 4I8DA 4LTSA 4Q6JA 4H41A 4JTJA 3GLCA 4B5TA 1UZDA 1ALDA 2VC7A 1SZGA 4XTDA 5HWNA 2NX1A 3QHNA 2XSAA 3N9KA 3QW3A 3M0HA 4QDMA 1KCLA 1KBJA 4LU0A 1JYWA 1R3SA 3O1NA 1PKMA 3CZ8A 1OINA 4MWAC 3QOMA 3VUSA 4GYFA 3W7DA 1JQXA 4MWAA 3RK8A 4JDBA 3LPGA 1Q7ZA 2YLLA 1JDEA 3V5FA 5CSSA 3VABA 3F1QA 4HU3A 5EPDA 3UWUA 4JCMA 2X0SA 3W70A 2F6XA 1FWAC 2BNJA 3H2CA 5MF5A 3A24A 7A3HA 2WZMA 3CZLA 3FJLA 5A8PA 4Z2LA 1GJPA 3VTRA 1JRCA 3GDBA 4TX9A 3NYDA 3R0KA 4JL1A 1FHUA 2BX7A 3G6LA 4Y9NA 4QDPA 3SCTA 4C65A 4JY8A 2YYTA 3TU9A 1ZTVA 1ITUA 1J5TA 1V02A 2ZADA 1RA5A 4S3GA 1QASA 3UW6A 3ZWSA 1LCOA 5K7JA 3JR2A 2PTZA 3WNPA 1GTHA 1QK2A 4OWGA 2ADAA 1HTIA 4D6JA 2DFAA 3TMQA 2DGAA 3ITVA 5KZ6A 4J9JA 5FEPA 2WJEA 4N9CA 2XSBA 2B7QA 5IM51 3EEZA 3FIGA 2DH2A 2QW5A 3PFMA 3UBPC 2J13A 4GZIA 4FR6A 3IJ7A 4QE5A 1FCUA 3H53A 2X05A 1FY6A 3RLVA 3H70A 3WD3A 2GJLA 3G2GA 1W17A 2W63A 1UC4A 1F05A 2VEGA 5FKYA 4EXBA 4FNUA 2WVVB 5A95A 3MJMA 1CXKA 3H2AA 5D2VA 2BASA 1XSJA 1QBAA 3KDOA 1CYGA 3WMCA 4QG8A 4F9DA 2V5LA 4F0KA 2VGGA 3ZR6A 2AGKA 4DB7A 3TAOA 1QATA 2Z6JA 1K9FA 2Y7GA 1ODUA 3GR8A 1TWSA 3PWGA 2CZFA 3G0UA 4UTJA 1X96A 3PPFA 1EYWA 4TX8A 3E9AA 3P60A 4XKYA 4XWUA 5AHFA 3GH5A 3K8MA 4ZGYA 1SR0A 3HQOA 2W91A 4QJ3B 2BXVA 5DO8A 3H2EA 1S5VA 3K5XA 4B3ZA 4PMQA 1TTIA 1UMYA 3WQFA 4F0HA 4R5EA 4CCZA 2BOFX 3KHDA 3UF9A 1VYRA 4B2DA 3L0NA 1WUFA 1TTJA 1OC5A 2DZVA 3GDRA 4GUHA 1HL8A 3BG9A 1KTNA 3GYEA 3V18A 3BTNA 2PUZA 4RW5A 3W53A 3C3NA 4RNHA 3SDOA 2ZZ1A 4GI9A 5DT5A 1HKKA 2JFEX 1O5RA 3OVPA 4Q3MA 2VFDA 4PB5A 1JZ2A 4KGLA 1SU5A 2W9MA 3V1HA 5CJMA 4AVFA 1TTQA 4LVBA 1DPMA 3DZ1A 3FKKA 2D69A 2EG7A 4GYPC 2QUNA 3OVGA 4P8WA 4HZ8A 1BVZA 1REQB 4GZ7A 1I6NA 4GYPA 3TCEA 1WDSA 3GDKA 1IEWA 5AHEA 1JF6A 2HBVA 4MAVA 3EX4A 4PMOA 1NIUA 1JD9A 1A3XA 4HVXA 3MZ2A 4LF1A 4ZBCA 3F4NA 4DIAA 2F7FA 4TTGA 1UH3A 3C2RA 1BRLB 5FL0A 4C6EA 4YYFA 2GUBA 2QPSA 1XLLA 3BLEA 1O7AA 5M17A 3ES8A 3T9PA 1EGVA 4GCAA 1KC7A 4HCLA 2ISWA 4TQTA 4H7VA 2PDKA 5HXMA 3PBWA 1LZOA 1ICSA 3LK6A 4GFIA 4JQ3A 4Q8TA 3ARZA 3KBVA 5D04C 1L6YA 5KETA 5HAOA 1JEZA 2J4GA 1KFLA 3RR1A 3N3TA 3WELA 1I60A 3VILA 2QPXA 3VCRA 5A6KA 2WWDA 2NWRA 1HL2A 3S5OA 1EIBA 1G67A 4FLSA 4MY8A 3S5ZA 3URNA 3V5OA 3GW0A 1BAGA 5GVJA 3WFZA 2WCSA 1Q3NA 3EMZA 4UB9A 3VFCA 4X9YA 1CZ1A 1PZ2A 8XIAA 1DJXA 3Q37A 3L4YA 4F8XA 5TIMA 3CU2A 3C0SA 3WD1A 3KVMA 1VEPA 5CQ1A 1V6VA 1US3A 1KGXA 3U3HA 5D2XA 3WNOA 1NM9A 1KLYA 2VC5A 4ZQPA 1MMFA 3VINA 4D8ZA 4H04A 1MUCA 1RCQA 4NX5A 2Y5EA 3QY8A 3D3AA 3ZVHB 4IGNA 2ZZ6A 1HUVA 1OCBA 5DCDA 5AHLA 1EF2A 1RZMA 3G22A 4H3DA 4V33A 2XZ7A 4JPGA 1RY0A 2D23A 2V63A 4PTVA 1UKPA 2R8WA 4U33A 2ISSA 4UOZA 2OTDA 4NXKA 4OFCA 2ALRA 3O15A 2I5QA 1B4EA 3H54A 4Q7NA 4O0QA 1LRTA 4UTMA 1DHKA 3WBWA 1QPOA 3W1AA 3MZNA 5F1VA 1J9YA 3WNMA 1ZBCA 3PPCA 4J5NA 2VJXA 2BWGA 1I1WA 1OZQA 2R9RA 2ZTKA 3LOTA 4ZO8A 2XU2A 3BJFA 2JF7A 1MXGA 4XO7A 3M0ZA 4R9XA 4NILA 1KWGA 1R87A 3M0MA 4ACYA 1R46A 4YLWA 1A50A 5HWJA 5IBXC 3W85A 1S5NA 1DJHA 1ZAHA 1UBSA 4CCEA 3A3XA 3M41A 5H8UA 5AOUA 3N73A 1R0MA 1VJZA 4Q8WA 5F4SA 1CTNA 2VX4A 2YL8A 2NV1A 4HSNA 5D8WA 2GSHA 4C6QA 4CCDA 1JYXA 1EQPA 4D1IA 1LM1A 2BOEX 2PCQA 1WKEA 3C6CA 2P1FA 1BYBA 1IIGA 1S46A 4JTEA 2BLEA 4JTHA 2ABAA 3RO8A 2BXZA 4UOQA 3CMJA 4UTLA 2YX0A 3WDHA 4TUFA 3UQNA 3FXGA 1UMLA 3D0CA 1YX1A 1EJWC 2OSXA 5AYYA 3VUPA 4QEEA 2OEKA 1FWTA 2XVGA 1GKRA 2YB1A 4BS0A 3EOSA 2ACQA 4NI8A 3M4HA 2OMAA 2D73A 4GHRA 3ARWA 4KW2A 2HE8A 3CUFA 3NQFA 1Q8JA 2C1IA 3S46A 5I77A 1AJ2A 3SSZA 4GQBA 1NWTA 3L4WA 1DJNA 4AFYA 2C91A 1TIWA 1TKKA 3OODA 4H9XA 3V7PA 1GKPA 1T40A 3TSDA 4CN4A 4HZMA 5IDZA 5AC7A 1AJZA 1RY8A 2ACUA 2GK1B 3WENA 4WOZA 3DHDA 3KRBA 2Z25A 4W7WA 2VWTA 1LWHA 3R2GA 3IIOA 5D05A 5C0QA 1F8IA 2FVLA 1G7VA 4PUMA 3DYOA 3QQ1A 1T0OA 4F2TA 3HTWA 3AIRA 1KB3A 4NHVA 4AZCA 2XWDA 2QQ6A 1U1UA 4HT3A 1P48A 2V68A 2E28A 3WNKA 4AYSA 2V8ZA 1WAUA 3TYUA 2QULA 1E43A 1IR2A 1H62A 2P50A 4PMRA 1DV7A 3PNZA 1Q85A 1GKQA 1UZ4A 4K36A 3T7VA 5CLTA 2P88A 3FJ4A 2Z1XA 4LT9A 3WH9A 4PMUA 4IFRA 2EPOA 4UC5A 5KINA 3VDHA 2WJFA 5DN1A 1IWBA 1FWEC 1W1ZA 4HQVA 4Z1CA 4BKNA 3WY1A 4PEKA 1MEIA 4AEEA 5D9OA 1MW2A 2WQDA 4RE0A 4RE3A 4JTGA 5H8MA 3QPYA 4GACA 2I7GA 3WJZA 3WLKX 4O1AA 1IT8A 4GC3A 1TX0A 1ZCCA 2VUYA 3G1FA 3AISA 2PODA 4JX4A 1Q63A 3LD5A 1EXBA 4KRUA 2TRSA 3R8GA 1XJBA 2E9MA 4M24A 4GQGA 1BLIA 1LLWA 1W37A 2AL2A 2QCHA 1W9DM 4B9YA 3GFYA 4CU7A 1NOWA 2QIWA 4J4KA 1EPVA 2OGJA 1IEXA 4BF7A 5B7ZA 4H6EA 4W4QA 4DJFC 1L2UA 2YA1A 2QR6A 4DBDA 3VIGA 4LV9A 3B8WA 2PLJA 5HR7A 4DJFA 1K7EA 5C7VA 4LS0A 2O92A 2ZA2A 3SRKA 3ARYA 1W1VA 1DJGA 3B05A 2I16A 1QDSA 2EPNA 2HSAA 3W87A 5LNVA 2ZFAA 3ITCA 3SEPA 1FQ0A 2P5NA 2QYGA 1XIBA 2I5GA 2J74A 4O57A 4G9PA 3MKVA 3SUWA 1KM4A 2B7OA 1UR3M 4LPCA 2YDSA 4GNKB 1EOKA 1K8CA 2QMJA 1K02A 1N7KA 4J3VA 3SQLA 1I2QA 1OC6A 1TZ7A 1TWDA 5JQ9A 1OHLA 3HPXA 1WXYA 3A3WA 3W25A 3B9OA 3W22A 1KW1A 5EBUA 4IMGA 5I24A 4MB1A 2XSXA 3G1XA 2QZRA 3ELFA 1D8WA 1ZZMA 3MT1A 1UPMB 3QGAC 3EMCA 3TQKA 1ZLPA 2TODA 3PUGA 4E4FA 2OFJA 1TIMA 3HQPA 3Q65A 1GPWA 2VXNA 3UWEA 1NWUA 3PTKA 1JDDA 1RXOB 3J7HA 4LCQA 2VCBA 5A94A 2PBGA 2VL4A 4PUUA 1GVQA 2V5CA 4E5TA 2OVLA 1JPMA 2VD8A 1UD2A 4MWAB 3GWQA 4PODA 2J66A 2OZ0A 3EA3A 1MDRA 4RXFA 4HNNA 4G1NA 4O53A 2FQIA 5CZKA 3N9SA 2X16A 2AL1A 1WBHA 3CWHA 3TOYA 2JKPA 4MYAA 1RP9A 1A5NC 2YR1A 4MIMA 1C90A 2AKZA 1Q6QA 1UR0A 3V0UA 2PA6A 3MMWA 1TV4A 1BVNP 1KR1A 2E4TA 4W85A 4OJYA 4UNIA 2Z00A 4IQEA 4KKXA 2ZXBA 3ABRA 1IT0A 1VJIA 3VOFA 4OBTA 1L6FA 4HPHA 3VGHA 4O11A 4ZOAA 3AJ7A 3S1UA 3GHUA 5EYWA 5FSEC 3IRDA 4N4PA 2XGIA 2CLFA 4I9MA 1J6PA 1H2JA 3FKRA 2DU2A 1GW9A 4DWDA 1XIIA 3U8GA 1UH4A 1X8FA 4ZQMA 2C0HA 4LSBA 5DBUA 4HA4A 4Y7EA 3C2EA 3UR8A 3MI6A 4L1WA 2VFGA 3AS0A 4WSHA 4PMDA 1FWRA 5CC7A 1PE1A 2GWNA 1H7XA 1P0DA 1W5PA 3SY5A 3THAA 1UKQA 2Z6IA 3KWXA 4YVVA 3FFSA 3DAQA 4YPJA 3AHYA 1H4PA 2YBTA 1A5CA 2VENA 1F76A 2EAWA 4FF5A 5JBFA 4MSSA 2EO7A 1UR9A 4OOZA 4S1FA 5AC8A 4IL2A 3UPWA 5DMMA 1VD6A 4O1BA 4PTMA 5HJXA 1LG2A 1DQXA 1OABA 4HA3A 1CLXA 4U3CA 4PGLA 1DP0A 4LYRA 2PDUA 4NRSA 2OYLA 3EAUA 5BU9A 3JVAA 2GVYA 3P8IA 3MP4A 3RXZA 3MUXA 1TJPA 3GXDA 1TO3A 2QDGA 3I3DA 1UJPA 4PSRA 2O7QA 5A8MA 2CU0A 1ADOA 1MDLA 2G3FA 2CXEA 5J8LA 3KXQA 5C54A 1C8XA 1DJZA 4Q8QA 1QAPA 1NP2A 3N4FA 4XKYB 2MNRA 2CBIA 3BL3A 3F2BA 4Z08A 4YCOA 4ICMA 4YTQA 3NQDA 4AWTA 3VNIA 3IAPA 3S3GA 4ATWA 5LYRA 4D2JA 4REQA 2VZSA 1ZS2A 2F6UA 5HR6A 1FDJA 4PRTA 3F7JA 1E6NA 2J24A 2ZUSA 4QHRA 3BQ6A 3WQEA 4FA3A 4MB3A 1PKYA 1TV2A 3LMZA 4GIYA 4C7GA 1ZPTA 3EPNA 3BW2A 4IZGA 2BSLA 3ZSSA 3AMGA 2CLKA 4LB4A 2FZ9A 3VOHA 4JTUA 3W81A 1SZRA 3IGXA 4W9TA 3VIFA 2XIBA 2G3JA 2WPBA 3VAVA 4YNGA 4ECLA 4EPBC 2CIPA 3GRIA 1EP1A 1ITCA 4XZLX 2CCRA 4W84A 3KOXA 3N2TA 4XAFA 1DJWA 3MO4A 2NUYA 1Q6CA 2VGFA 3P0XA 1DQWA 1OD8A 2JGYA 4HSOA 1N8FA 3CZGA 2G4JA 2WLZA 4IT1A 5E6ZA 3OHMB 3WL1A 4EOUA 7PTDA 5TF0A 1OVDA 1RVGA 4NNCA 5CXPA 5GJPA 3P5ZA 3NL3A 1XDLA 3ZLHA 5B80A 3S9ZA 1Q6OA 1K8YA 1TVNA 5I3KA 5LGXA 4A2RA 1J0ZA 3PPHA 2GVJA 4HNOA 4ZOEA 5CGMA 2XINA 2G50A 2XZ9A 4IGHA 1H7RA 4BEQA 2XIQA 2FJUB 3TQPA 1XGDA 3STPA 1LRNA 1TSIA 4HMDA 4XZWA 4A6GA 3CUZA 5KZMA 2ZZ2A 2RJGA 2CLOA 1RBAA 1CWYA 1PWMA 3M7WA 2UZ9A 1JCYA 2QPUA 2V82A 2CBJA 1DBTA 3P0WA 5LA2A 4QBXA 2OELA 3ABOA 1HX0A 1DJIA 2YL5A 4U3AA 1V3JA 3Q2DA 1JNDA 3GH7A 4L4PA 1CI1A 3COTA 2RGMA 1TJ1A 3LM3A 3TMLA 4MB4A 3HGOA 2WMIB 1M41A 1XC6A 2PLKA 3S9YA 2HVMA 1VJSA 4AD1A 4PYSA 3VGBA 1CECA 2Y0FA 2GJXA 4PBFA 1YEYA 4GLEA 1QNVA 5G1MA 1UD4A 3NZGA 4I7VA 2GQAA 1J01A 4UIOA 3JU2A 4PCSA 4ROPA 5TD4A 1EEXA 1KTBA 2WAGA 3MO7A 1BTMA 3CM4A 4E4PA 4JIRA 1W2VA 3NEVA 3GBDA 4NQ1A 2H6RA 3M0YA 4U5IA 1UASA 3FAXA 3NOYA 1DE6A 1NVMA 3LGDA 1NH6A 3O06A 1V93A 3PZQA 1JPIA 3MDUA 4DHGA 4FALA 2A79A 4LW7A 3HJEA 3M07A 4PB3A 4LY8A 1BYCA 3EGJA 5K3VA 4ZB0A 4V28A 4DZHA 1KV5A 2YL6A 5IXEA 5FEWA 1VIZA 1U5HA 4O1FA 2Q6ZA 1C8YA 1ZSXA 3MP3A 2WLYA 1B9ZA 1KO0A 2XWEA 1TPVA 4PUJA 2OWWA 5DY3A 1QW9A 4QIUA 3OZOA 2YXOA 1QNOA 3AFBA 3OJGA 3VGGA 1PX3A 4ZMGA 5FAGA 3FA5A 3RF9A 2VEFA 3C2YA 1WE5A 2PC8A 5FACA 3TP4A 1QNQA 3UCQA 3IVUA 3LRKA 3QV7A 2VT0A 3N4AA 4BEUA 3POHA 4RZ4A 1NDYA 4JL2A 2CZVA 3CUHA 5DBTA 4IQJA 3M5ZA 3SUTA 3USBA 3M0IA 5HA7A 2L5HA 2V5BA 3UJFA 5AKQA 3VVGA 1MO0A 3CC1A 2WOQA 1LDCA 1RLCL 4ZFMA 1JPHA 3PUDA 1E5JA 3GXMA 5I07A 3GR4A 3Q45A 3IJ8A 1AUSL 3T0DA 3RRXA 1UZ1A 3U7BA 1EH9A 4UR9A 4GVIA 3QYQA 2EJAA 1V3KA 4E8GA 3C8FA 3I10A 4NRRA 3SGZA 4RE2A 4FX6M 1LOQA 3L7RA 4B5XA 2G4FA 3MV11 2EBNA 4RPQA 1QPQA 3BW3A 3KS5A 3WBEA 4IPNB 1WZLA 4IXXA 1J5SA 3G18A 3S5NA 1MRQA 1F61A 1ME9A 4J3ZA 1RV8A 2IPJA 3HN3A 1QI0A 2IQTA 2VELA 3AXXA 4JN6A 3CUXA 2WMGA 4PZVA 4M0XA 4F0RA 2E9BA 1OC7A 3O6DA 4LANA 3PTMA 1QXLA 1IXPA 4QQUA 4DWSC 4DI9A 3L23A 2E5DA 3C8NA 1TQJA 3RX4A 4W89A 1Q6EA 1BFNA 3OVRA 1QI2A 2PTWA 2E68A 1M53A 1YPIA 1TQXA 2A3BA 3QV8A 3QOKA 2C15A 1A5MC 2VURA 4FZIA 3IACA 1PTGA 3V75A 2BG5A 3E0IA 3DFYA 2HXUA 1FCQA 4M7TA 4JCLA 3O0FA 2Y1HA 4GJ1A 1UQYA 4MHBA 4QLLA 3KVJA 1A5LC 4GI6A 1E9LA 3TEVA 3PVFA 2QUUA 4NVTA 1J2BA 1NOFA 3UJRA 1ZB5A 4CNSA 3UP8A 2J9XA 1XGZA 2CESA 4JYFA 4S3CA 6REQA 1JDCA 1J10A 2GUUA 3GZ3A 4QNWA 3A47A 1QVBA 3S6TA 1QFEA 5BW6A 4PR4A 5A6SA 4X2PA 1H60A 4PUKA 3LA4A 4XAYA 4EWJA 4ZCWA 2Y61A 3GK0A 4P7NA 3VNKA 3LXAA 2X0HA 4JHZA 1NAL1 3VX0A 3BOXA 2GQ9A 3NQMA 4CN6A 3QKZA 2ZQ0A 4XSMA 4YWIA 1AW5A 3ITOA 2AL2B 2JBMA 4LAOA 1K9EA 3PAOA 5E1QA 1CENA 5FF3A 1OYBA 2I9UA 2FMNA 3H6OA 5FCZA 1XFCA 4R88A 3NXLA 3MS8A 4IQDA 3SY1A 1ZALA 1MNZA 3MTWA 4D6CA 5G5IA 1E0XA 3IJ9A 4J3TA 5BMWA 2A3CA 2QF7A 1W0MA 2GGGA 2I57A 5EGRA 2EPHA 1AJ0A 4QP0A 1IQ8A 4GQQA 4PEEA 2BTMA 3W02A 1VBRA 1XCFA 1ECQA 1ME7A 3GYCA 1W1YA 4CEUC 1DWHM 2O7SA 4GXPA 1IZKA 4ICNA 2CEQA 3KLKA 4WUIA 4M6QA 2BHYA 4QTGA 3VOGA 1KM3A 1XLKA 4DI8A 3VMPA 1WPCA 1A80A 3WLOA 2PDLA 3UXDA 3W1LA 2VOTA 4DXXA 3KTSA 5KZEA 4KWOA 1OF6A 2FH6A 3T0BA 4YCPA 4DWSD 2I1OA 2INEA 1PTDA 3D47A 4H01A 1GEHA 4AC1X 3CIXA 2XG9A 4L9ZA 4MM1A 1UD6A 1D3GA 3A6OA 1W1IE 3EKGA 4FIQA 2J88A 4GY0A 4ZXLA 2WK2A 8RUCA 1HF6A 4GJIA 3VMOA 1LLZA 2WCGA 1TELA 3VU2A 1O4UA 1MWOA 3WKZA 1M7XA 1TV8A 1DKWA 1WZAA 3FYOA 3IUHA 3AIUA 5AYIA 3WLMA 1E0TA 2XH2A 3K4DA 1ZL1A 4U2ZA 3B8DA 3MHUA 4EAMA 1HG3A 1FFRA 2GOUA 2BVTA 4JYEA 1TJ2A 3LNMA 3CWNA 3TE9A 2GFTA 1EXPA 1EWDA 4GABA 1UR1A 5GNXA 2J7BA 1VENA 4LQ1A 3A4AA 5HNUA 3DG3A 3CPRA 1A0CA 4JTFA 1WUEA 3DEQA 3NDZA 3QC0A 4GVFA 1HJWA 2WNNA 4FO4A 3DDMA 4K8HA 1QHOA 4F79A 1GOIA 4JICA 3Q94A 1FWNA 2C14A 3MYPA 1W1PA 4JNMA 4LY4A 2FZDA 2WPGA 4NX0A 1UIOA 2FHBA 2J78A 4HNCA 2PDHA 3ABQA 4OECA 1PZ1A 5AYXA 1WKFA 1RJQA 3NCOA 1XFBA 1JR1A 3ARPA 4XZBA 1L8PA 2PB1A 2XFWA 1YXDA 5CPMA 4DAIA 3VD3A 4N02A 2A3EA 3LLFA 1H1NA 2E40A 3OU8A 1W8GA 4FLQA 2Q71A 3KW3A 1XBZA 1J6OA 1MNSA 2PDBA 3NQ6A 1Q7QA 3ITYA 1WYIA 4JTSA 3QPEA 3TROA 3LTPA 3UWQA 1VF8A 5CLWA 3N19B 4MOZA 1RA0A 3DI0A 3PB0A 3A22A 4WD0A 5K4XA 3LHUA 3WLLA 2C16A 5EKYA 4HOZA 2V5KA 4J2PA 2R91A 3IRSA 3FV9A 3EWZA 3H7RA 2J7DA 1OIMA 3A4JA 3CT2A 3IWPA 4NYYA 3AALA 2NLYA 4OOUA 3QTPA 1JGIA 2F2HA 4YXGA 3TJIA 5SWUA 4M82A 3DHUA 4Z0JA 3ANVA 1MUWA 2HWGA 3GXFA 2NX3A 1HW6A