1KNWA

Crystal structure of diaminopimelate decarboxylase
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
421
structure length
421
Chain Sequence
PHSLFSTDTDLTAENLLRLPAEFGCPVWVYDAQIIRRQIAALKQFDVVRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYNPQTHPDDIVFTADVIDQATLERVSELQIPVNAGSVDMLDQLGQVSPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQRHHLQLVGIHMHIGSGVDYAHLEQVCGAMVRQVIEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHLGHPVKLEIEPGRFLVAQSGVLITQVRSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEHAPTVETVVAGPLCESGDVFTQQEGGNVETRALPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALELLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diaminopimelate Decarboxylase uses a Versatile Active Site for Stereospecific Decarboxylation
rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Diaminopimelate decarboxylase
total genus 136
structure length 421
sequence length 421
ec nomenclature ec 4.1.1.20: Diaminopimelate decarboxylase.
pdb deposition date 2001-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain
A PF02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 1knwA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 1knwA02
5FAGA 3SY1A 2VD8A 2SFPA 1B54A 3WQFA 2J66A 3B8VA 3B8TA 5GJPA 2ON3A 3E6EA 1BD0A 1TUFA 3CO8A 4A3QA 3WQGA 4XBJA 3N29A 4ILSA 3N2BA 3OO2A 4LUYA 4XG1A 1NIUA 1F3TA 1QU4A 3MT1A 4WR3A 2O0TA 3C5QA 2PLKA 1W8GA 2QGHA 1XQLA 2P3EA 1L6GA 4BF5A 2OO0A 1FTXA 3B8UA 1HKVA 1L6FA 3WQEA 3VABA 3AWOA 3NZPA 4AIBA 4LUTB 4ZGYA 3CPGA 1VFTA 4LUTA 3BTNA 4BHYA 2RJHA 2PLJA 4BEQA 5BWAA 4V15A 3WQCA 3HURA 1D7KA 1KNWA 4KBXA 5FACA 4Y2WA 1SZRA 2VD9A 3WQDA 2TODA 3LLXA 1EPVA 2RJGA 5IRPA 3GWQA 2YXXA 4ECLA 1XQKA 1NJJA 4PB3A 3UW6A 2DY3A 1KO0A 4QHRA 2NVAA 1RCQA 1SFTA 3AWNA 5GJNA 1VFSA 3HA1A 4LUSA 4DZAA 2ODOA 4BEUA 7ODCA 3KW3A 4PB4A 1VFHA 3NZQA 4DYJA 1XFCA 1HKWA 5GJMA 3S46A 3ANVA 3ANUA 4PB5A 2NV9A 3R79A 1TWIA 4LUSB 5FAJA 3E5PA 1CT5A 3B8WA 3N2OA 4FS9A
chains in the Genus database with same CATH superfamily
3WQ6A 1QHZA 2DUZA 1T99A 5A6SA 1VCVA 4AHOA 4ZQMA 1JCXA 4K3ZA 2YDAA 1PX4A 3VOCA 1DL3A 4IPNB 1XIHA 3A13A 1C8XA 2G5WA 3VA8A 1W32A 3RITA 5DMMA 1W9DM 2Y88A 5HBFA 1OX4A 2O92A 4ZQNA 4FX7A 3GR7A 1L6GA 3W02A 3W83A 1EDGA 4RV3A 5C71A 3KOZA 1E15A 2G97A 1JNEA 2NZLA 1J0JA 3MP3A 1ZJAA 3O6CA 5BNKA 1XIJA 3TA6A 1VEOA 1YBQA 3G1AA 5F2GA 3W7QA 2XIOA 1ELSA 4O0ZA 2I5GA 1YQ2A 5IBXC 3GXDA 2PWVA 1QNRA 1EXBA 3TNOA 1F5ZA 3SZ8A 4H19A 3FX4A 4RXFA 1LYXA 3M16A 2PGWA 5HPOA 5FJIA 4Z1BA 2O55A 1Z48A 1VHNA 3N6HA 1XLLA 3KAOA 1X6NA 4H9XA 2OOFA 4LYQA 1NVMA 3WF3A 5IM51 2PDYA 4NIRA 3P62A 1PIIA 1OM0A 3WO8A 3KZSA 3HFYA 3PG8A 2VL4A 4LRSA 3WUBA 4JN7A 1R47A 2NUXA 2PA6A 3AUOA 1XC4A 2WNZA 2W92A 2J66A 2NUWA 1FH9A 4TQTA 2Y61A 4JZ5A 1EC8A 3N18A 3UFYA 1ISXA 3VDAA 4R85A 1Q6RA 6REQA 4O1FA 4CQBA 2YA1A 2X1IA 1F3TA 1NOFA 4CD5A 3PWAA 4W9TA 2VDIA 4Y90A 2QGHA 4AY8A 1XW8A 2XJ7A 3LTPA 1GCYA 4K8HA 5JUVA 5T8GA 1EIXA 1ZAHA 4PUWA 1UASA 3KDOA 1XLJA 1A5LC 2I5QA 3BANA 5HANA 3PNZA 1JAKA 4US6A 2QCDA 5A8MA 2QCHA 5I07A 4N02A 4KERA 5KTLA 2KAUC 3H24A 5FJPA 2CLEA 3S9YA 3B03A 2X2YA 5BU9A 1PUDA 1S2WA 3KFTA 3ZOAA 1OGSA 3IS4A 4L1XA 4C6MA 3AICA 2VDHA 5CC7A 4RE3A 4RZ5A 3NVDA 2PWEA 2V5BA 3O7UA 5CG0A 2GK1B 4GPNA 2CC0A 4EWJA 4ZE4A 4LCSA 5KITA 5BROA 2X1UA 2G0WA 4JDYA 3M5YA 4I5UA 3OGRA 3K4AA 4X2RA 5FEWA 4PRWA 1XCXA 2WNNA 1LG1A 5EU9A 3QFWA 1WXZA 3CEUA 1AH4A 3W0KA 4LYRA 1PKMA 5BRBA 4WDUA 4UQAA 3W1XA 3BSGA 2EPMX 1TZ9A 4HN4A 4Z2JA 2OZTA 2VFIA 4CQCA 3MB9A 2ZDRA 3HV8A 5CPOA 3T0TA 4AWEA 3WBWA 1I2PA 4UTMA 3Q4DA 2HBXA 2QCCA 4AQLA 3AYTA 1I4NA 3KZPA 3AIRA 2O9PA 2GGIA 2XIQA 3G1VA 4LUJA 4LVBA 4ZEPA 1NFPA 4XZNX 3GQYA 2Y89A 3DKJA 1HN1A 4X61A 5HQMA 1TMHA 2EPHA 4JICA 5AHFA 4JIQA 1KRCC 4MF4A 1PO9A 3ORWA 1NP2A 4AWTA 4BEUA 1UOKA 2ZX8A 4KFNA 2ZFAA 4DI8A 1UZ1A 1QHOA 4JQ1A 3D47A 3AXIA 3K46A 1DORA 5I24A 1PHQA 2DJXA 1HX0A 1WA3A 1WDRA 4YTUA 5LZLA 3M0IA 1CXHA 4O16A 4DM2A 3HF3A 4Q22A 5C9WA 1EC7A 3UPWA 3PS7A 1SFJA 4GIRA 2XWDA 2POZA 1XYLA 2A4AA 2V69A 2WMIB 3LLFA 5K7JA 3IUDA 3S83A 3ITXA 1JPKA 4IIDA 4IIHA 1ECQA 1MXSA 1HJSA 3IARA 1CGTA 4WGXA 2NXGA 3QEZA 1F4HA 4LAZA 4UTWC 2J25A 3WQEA 4OOUA 3C6CA 4QM1A 1BTCA 1IEXA 2GOKA 4FXSA 1CLKA 4IICA 3QJAA 4Q6JA 1Q2SA 4F0SA 2WV8A 1HFBA 1BSIA 3BW4A 4LX4A 3PN8A 1AZ1A 2NQZA 2D0GA 1JRCA 3DESA 3QQ0A 2PTDA 4LS2A 3EX3A 3ZXWA 3VUPA 3WLRA 2WBGA 3RX3A 3VOJA 3FA5A 1PV8A 2J7DA 4KH2A 3UERA 3UWZA 2G3MA 3UZJA 4Q33A 3HOJA 2ICSA 1N2VA 4CNNA 4W8BA 3CUFA 3EWYA 1V6TA 1YIXA 2OLHA 4QFUA 1XH2A 2PDFA 3I3EA 4JL2A 3GKAA 2VR4A 2P88A 4C6JA 4R7OA 4C6QA 4CCDA 4OU1A 5C7HA 1E0UA 1QO2A 3VGFA 2JGYA 3TTYA 4HYVA 5LIKX 4WVXA 3F4CA 3AZRA 5I06A 1UD8A 4ZENA 1W8GA 1KFWA 3V16A 2VCAA 3BAWA 4UUIA 3GC2A 1E9LA 4QE1A 4WIWA 1RA0A 4XD6A 2BOFX 1AQFA 1U22A 4GHRA 5DT5A 3LY0A 2WWDA 1D2KA 3PANA 3TQKA 4N6EA 3TFXA 5CPMA 2C1HA 5D04C 5AFDA 3MZ2A 2JF7A 5LSMA 4TVCA 3WNMA 1P4CA 1CPUA 3EWBX 3CZEA 2BX7A 4TX8A 2ZZ1A 2A0NA 3DFOA 1SFTA 4GUJA 4M0XA 1FHLA 3KRUA 3SRKA 1FOBA 4PFHA 1SR9A 1BYBA 2FLIA 3VVGA 4AZGA 1TPDA 2BY3A 1KFBA 3W71A 3RLUA 2EPNA 3OZYA 1C29A 4IGNA 2W67A 4RDVA 1TTQA 2DQXA 3IWPA 4G7EB 3WFZA 3F2CA 3OBAA 4O1CA 1JZ3A 3TP4A 4WSJA 3UJ2A 1XKYA 4AZ7A 2ZC8A 2NSOA 3PJUA 2XZ7A 1N8WA 4U3AA 3LXAA 5BXPA 1VCFA 4ROQA 2GGGA 4UXDA 1IWBA 4UFMA 3E0IA 2Y7EA 2P8CA 3H2CA 1Q4NX 2OLAA 3GO2A 5BU6A 1G7UA 1NWRA 5HAOA 2YB4A 3VDGA 1Z7AA 1VZWA 1CI1A 1FWAC 1HKJA 1X8FA 4GYPC 5D4YA 4CCCA 3DX5A 4BF5A 1GVFA 4LBUA 4Q8QA 5LGXA 3QZAA 2ZXBA 5LNVA 1Z44A 3GXFA 4IPJA 2C14A 3TFCA 1ICQA 1ZJBA 3BLOA 4H8UA 3SURA 2J62A 5HR6A 3UU0A 2ACRA 2HK0A 3GVGA 4NSBA 3AS0A 1R0MA 2R82A 2ZUWA 4XZWA 2J7HA 1MI3A 2EG8A 2DZVA 3TDFA 3EMZA 3O8AA 2NVCA 4S3KA 4HPXA 1K4HA 3U48A 3HU7A 1Y5WA 2HBVA 4HHPA 4U33A 3RLGA 4PMDA 1G5AA 3C86A 1MDRA 4IGHA 1OFOA 3HM7A 3E0LA 4IGMA 4S3CA 2H3BA 2PWDA 4DO5A 5KZEA 4J2PA 3EXSA 1H3GA 3KRSA 1BWKA 1VQTA 1J2BA 3QLLA 4MFDA 4AYSA 2IPGA 2Z1SA 4GYKA 3B8VA 3QOKA 3M0ZA 1E1FA 2C79A 2BTMA 1LROA 3IGXA 2WKGA 3IGSA 4MNMA 4YYFA 3EDFA 2FGZA 1Y0EA 2VC7A 4A22A 3DU0A 3ITOA 1PBGA 1Q13A 3I3DA 3UY7A 1HJVA 3M7SA 3TSDA 4XAYA 4IJRA 3KBNA 4CNPA 3SIZA 3WF4A 1U5VA 3R10A 2OEMA 2V9DA 4MB3A 3N34A 5LYRA 1DBTA 2GVEA 4AX6A 5CG7A 1TMLA 4DBUA 3MSGA 5HWNA 3OP2A 4AD2A 4MLJA 4ERGA 2OOGA 3TXZA 1TZZA 3SN1A 2YCIX 3MBFA 5TNVA 1U83A 3QQ1A 1JUEA 2J7BA 1DJGA 2E7FA 3TN5A 4MMWA 1BQCA 2CEQA 3V36A 4IGSA 4F2UA 3NA8A 4J3WA 1OQFA 3EOOA 1JD9A 5G5IA 1H61A 4GY0A 5CKSA 1BFNA 5I5RA 3GTIA 3EYPA 4YHEA 2GGEA 1NWTA 1TTJA 2PODA 5M2FX 3MC5A 3DGRA 1OC7A 3T05A 1PSCA 3L5MA 1WDQA 4YTTA 3ARUA 1XG4A 1O66A 4FS9A 5FAGA 3B9EA 3G22A 1C93A 5A6KA 3AXMA 1JUBA 5DCBA 1S5MA 4W86A 3OZPA 2L5HA 4L9YA 4RNHA 1AK5A 2ZUUA 4KF1A 4PN2A 2UY2A 3L9CA 3E1F1 1M04A 1I0BA 1UC4A 3EPMA 1ADDA 3ZVIA 3NQFA 1QNOA 4K6AA 1W17A 3N9RA 3H4XA 4DWSD 2OSWA 3MKVA 1OX4B 2HROA 1EHNA 3LYEA 3UG3A 2AQWA 3JS3A 4UIOA 3N9KA 1TCDA 2QLYA 2P3ZA 4UOZA 1VENA 1TPC1 4CD6A 3W73A 3TZNA 4HOWA 5FJJA 3DXIA 3CMFA 2Y70A 1ZNNA 1HP4A 4NNAA 4Y8FA 4S1FA 3VIJA 2A85A 1RBLA 4PRTA 1CGVA 3ARYA 3W00A 3AWNA 4B91A 3JRKA 3WF0A 1HKMA 1L6YA 2A3BA 2D23A 4U4MA 3L0NA 1EUAA 3PG9A 2D2JA 1E70M 3LBCA 3O2LA 1UD3A 4WXYA 4TIMA 3SCSA 2DZPA 3F4VA 3LRKA 3FEQA 1A5OC 1TE6A 1ONEA 1DWFM 1ZFJA 3M1ZA 3H7RA 3LRMA 3W7HA 1WOBA 3HG2A 3WQVA 1Y7VA 3SECA 4AZ6A 4DM1A 2W91A 4D1IA 2Y5SA 1H0IA 3EXTA 1O6IA 1MEIA 1P1MA 3RU8X 3DYOA 1V79A 3DKLA 5F4XA 1IWPA 1F76A 4M6UA 2VMFA 4ZQRA 1VBHA 3DYMA 3IEBA 1GYLA 3BWWA 3CB3A 2EEXA 3R5EA 2DJLA 3AIBA 4M82A 2BVTA 1ODUA 2VX6A 3M9YA 4XKYA 1TJPA 3RMJA 2OZ8A 4KEVA 3CPUA 1E6XM 2CLLA 3WL0A 1BSLA 4MJZA 3DENA 4P7LA 1UMYA 3DUGA 2PWHA 4ADTA 4XUGA 1G0CA 3MP5A 3NO5A 1R46A 3SCTA 5FSDC 2AQOA 6A3HA 1W31A 3FJNA 3GXTA 3QOMA 4QGCA 3VNYA 3M5XA 4IJBA 3WNKA 3WDIA 3AMKA 4ZO7A 1CLXA 4Q7NA 1AZ2A 1RJQA 5J5RA 3WDJA 3TOYA 4KGJA 3DC0A 4H2CA 2JKPA 3CV7A 1MXDA 2QJGA 1PVNA 2D3LA 1PKNA 4J35A 4DQWA 2WVTA 1KR1A 1J79A 1BYAA 3SB0A 4WQ6A 4BI7A 2RAGA 4CQDA 3A23A 3T55A 1V6YA 3USZA 4J4KA 2VQUA 2H9AA 2ZOXA 1LQ2A 1SW0A 3AU6A 2QJNA 3PZQA 5JIPA 1X8CA 1RV8A 2C8NA 3ID7A 1HUVA 4XBJA 2WZMA 1FWSA 1O12A 1S2UA 5G4EA 1W3KA 3VGHA 5A2AA 5LHFA 1OFEA 4H8NA 3CASA 2A79A 5LIXX 4JY9A 1WB0A 4CU7A 1UG6A 4TV5A 3IIVA 1OZQA 2XUCA 3LBOA 2X42A 4RX0A 2QKFA 2DV0A 2PDNA 2QW5A 5JH1A 1GVRA 2D20A 1U5HA 3DG6A 1QT1A 4LBSA 4HNTA 3WH8A 3ARSA 3FKKA 4K1WA 4EPBC 1RK6A 3VNZA 3RMEA 3NSXA 2OSYA 4RDZA 4CEUC 3T40A 5FACA 3SCNA 1SZRA 1FWJC 3H2AA 1K8ZA 3LN3A 1EOKA 2FTPA 3QTGA 2J9YA 1UZ4A 1MW2A 3PK7A 3VYLA 3R2GA 4NQ1A 3VX0A 3ARQA 4MZ1A 3VM5A 1LT7A 5CQ1A 3S1GA 1ZL1A 3ABRA 1B3OA 1EDQA 4KCVA 4MB4A 3T78A 1OABA 4J5NA 3GVQA 1J01A 3EX1A 3K5XA 2ACSA 1TE1A 4C5YA 4DN1A 3BCJA 3WX7A 3CU2A 3AJXA 3BAXA 3PB0A 3H21A 1UUQA 1PDYA 5XIMA 5E6YA 3BG3A 4AWSA 4MDPA 4PMVA 3LTYA 4UR9A 2PTZA 3C8NA 4P7OA 4NNBA 1EWDA 4C7DA 4EAYA 3S5NA 4KQNA 3WN6A 2YXGA 2E1DA 5FD0A 4BI5A 2KZHA 3SSZA 1IF2A 2VYOA 5JVLA 1GPWA 3PBMA 4RE4A 5H8UA 4Z1CA 4O1BA 4DPPA 4UOQA 1ZALA 2VGBA 3I68A 3UWEA 4G9PA 4DB7A 3GFYA 4GO8A 3WYZA 4WKAA 8CGTA 5I78A 1KRMA 3QHNA 2JEPA 1DQUA 5H8PA 3KX6A 3T2QA 3CO4A 3L2MA 1W9XA 2W9MA 4LUTA 3W7NA 2C3ZA 3L4WA 5HOSA 1PZ0A 2A7PA 3EOUA 4JEQA 3AZTA 1UJQA 5FJUA 4XAGA 4D9PA 2PRHA 2Z7KA 2GQAA 2TSYA 2FMOA 4O17A 3RHGA 2Z29A 1KTCA 2OYKA 1GVYA 4U31A 1ZHAA 1HL2A 1XIGA 2NVAA 2W27A 2GVGA 2FZ8A 3CMGA 3RRXA 1SJCA 2HJPA 4M1BA 1TRDA 1Z3NA 4NP7A 3J7HA 3APGA 3H26A 3GXIA 2ZA2A 4GNKB 1KLYA 1HKWA 1R7OA 3I4KA 4INFA 4A29A 5BRPA 5BMXA 2OX4A 4C6CA 2VWTA 2QVHA 3BG9A 3VOGA 2WXDM 4JIRA 1CX9A 3AXKA 2VURA 2ZICA 3T8QA 1JZ2A 4OECA 4K7VA 4ZQOA 4G2DA 4ERAA 2W66A 1KM6A 1OT1A 2ZADA 1G7VA 2VEGA 3ARZA 1DOSA 5DMNA 2ZC1A 4W84A 1SO3A 2BWGA 1HGYA 1JI1A 4Z17A 3L12A 4MNJA 1JCYA 3GDKA 5AVNA 3BH4A 1FWNA 2WC7A 1R8LA 2QXWA 1PZ2A 3LCWA 3UA4A 3WEZA 2FHBA 4C60A 3KE0A 3WD2A 3GR8A 4Y9NA 3S8HA 1UB3A 3WQCA 1W1YA 4IQLA 1ZENA 5HNRA 4I6KA 2QUTA 4NZ4A 4QRNA 5MHBA 1H2JA 2BXZA 4LEFA 2PDMA 4PMZA 6PTDA 1QNSA 3KL5A 1X39A 1W1B1 1E4NA 2EXOA 2YPIA 4P61A 3TSBA 3UCCA 3PWGA 2ZTKA 2WZHA 3LQLA 3SQMA 2O4QA 3KTXA 1XYMA 2B4GA 3URQA 4EF8A 3H53A 2GDUA 5HUOA 5TBOA 5I03A 3VGEA 1H1YA 5F2IA 4GZIA 3SQLA 2DZBA 2VJXA 1US2A 3BOLA 3WH5A 2NQ5A 2CBVA 4I8YA 3KS6A 2V5DA 4H6RA 3VC5A 7XIMA 4HK6A 1KBBA 4GINA 4CNUA 3DI1A 4JTGA 4PL1A 2PTYA 3M0MA 3AMCA 4CU8A 4C6IA 1JZ7A 3SM0A 5K4XA 3BW3A 4I9MA 3UG4A 1GVIA 1W2VA 3RK8A 3W7PA 4OFCA 1C7SA 5E9XA 1E3XA 3W7IA 1B9BA 5I0DA 4FLRA 4ROPA 2UBPC 1D7KA 2AMXA 5HUPA 3VNIA 3ALFA 1P48A 1KV8A 2HS8A 3ANYA 3SBFA 2DSWA 5KSWA 4IFKB 5REQB 1SW7A 3U57A 2C13A 3UW6A 4HZMA 1QW9A 2QR6A 3OYXA 2Z0IA 4N9BA 1D7FA 1SJAA 3TN4A 4QLKA 3OLEA 1YNYA 1CEOA 4UTJA 3TMLA 4JTUA 3GC4A 3E12A 5U4NA 3VKBA 1Y65A 1BG9A 4DBEA 2CBIA 4N0RA 1SMDA 2C6QA 3IRDA 2BSLA 3FOKA 4I5RA 3P81A 2HS6A 4AHPA 2DUXA 1P43A 1IZJA 1FWHC 1EC9A 2BASA 4GACA 3R58A 1JFHA 4S3BA 3W81A 4CCZA 2YYUA 4O8AA 3DOPA 1YMYA 1BF6A 3U2ZA 3E3HA 3UWYA 4GFIA 4GMEA 5C55A 2XVPA 3QTPA 4DJFC 3G1RA 4JFWA 3QYQA 3LS9A 1UKSA 4LV9A 2HV5A 3D5HA 5EMYA 4O14A 1GOQA 1UR8A 4FPSA 3OLGA 2RHGA 4X0VA 1EOMA 3CGTA 2EQDA 4PBFA 3I65A 2Y2WA 5DN1A 4GUHA 1EZ2A 3LM3A 4QE5A 3LK6A 4AG0A 1K7FA 4XVEA 4IMGA 2GL5A 3IPWA 1VFOA 4ATDA 4YNGA 4HIBA 4QHRA 1SSDA 2TMDA 5K4ZA 4NRRA 2NXIA 3HGSA 4LCRA 3R94A 4HA1A 3W22A 1O4UA 3RJYA 1K7XA 1BVNP 2AL2B 1TA3A 3DBPA 4HT3A 1BGGA 1CXEA 2XIBA 3D3FA 4I7WA 4WSKA 3URBA 5C70A 5L6UA 5F7UA 4I8DA 3BG5A 2Y1HA 3LCIA 2V3FA 3VX1A 4C6FA 2Q8ZA 1RQHA 4QNEA 3BE7A 5BWFA 2RDUA 1E6NA 5DF0A 2GSEA 2Z1BA 3QZEA 4PCTA 3PB2A 3EDKA 3M0HA 2FVLA 4M7SA 2E1WA 3M0VA 4NI3A 1W1VA 2CLPA 5F2LA 4Q8PA 2CLMA 2GQ9A 2REQA 3WBYA 4ZCWA 3RO8A 3NFUA 4IQEA 1EHAA 2RKXA 3K1DA 3RM8A 2PLKA 4B3ZA 1J0KA 5D9PA 2P50A 4NILA 1VS1A 4MWAD 1J93A 3IUHA 4JX5A 2R1KA 5G2HA 1MQRA 3VIIA 3ENLA 1AD4A 3A3XA 4WZHA 3GHUA 3NQ6A 2X09A 1BRLA 4P2VA 4F79A 2JKAA 4TXEA 2VI0A 5CGMA 2ZZ4A 1LF1A 4AC1X 3QKZA 3GIQA 4FMVA 4E38A 2OWXA 3HTWA 1Q6EA 3IJ7A 1JF5A 3LV6A 4J28A 2ZUNA 3S3GA 1XLGA 2I1OA 5A8GA 5JIWA 3HN3A 4GY7A 1V5XA 2Y85A 1VFSA 1GJUA 1SM9A 3PVFA 2DT3A 1GVSA 4PB4A 1TPEA 4J3TA 1TFVA 1Z32X 5KETA 3GDMA 4C7GA 1GYNA 1QR7A 2ZQ0A 5H2ZA 2W0UA 5HPCA 1LBFA 4JS3A 1VFMA 1LL4A 3C61A 2YBVA 1GW1A 1SZGA 2WCAA 3EKZA 5H6HA 4KWOA 1MW1A 1WXYA 1ADOA 3PHAA 2QVNA 3FXYA 4N4QA 4GQQA 4FNTA 2YBUA 1K9FA 1X6UA 3BURA 3DCPA 3CT2A 1GVEA 1KBLA 4PBEA 5H8MA 4D6CA 3L5AA 3N6JA 4D1JA 2GWGA 1FWDC 2F84A 3R89A 2V30A 1CGXA 4CD7A 4L80A 3QV8A 2BOGX 1LZOA 5G4WA 4AD3A 2YXOA 6ALDA 4IMAA 4O1EA 4O57A 4MWAE 4C6LA 2X1TA 3PR2A 1TUXA 4V27A 5GVJA 3R8GA 4V15A 1CGYA 3IV8A 2ZXAA 4IFOA 4HU4A 4Y2WA 3TQVA 4LOCA 1KKOA 2ACQA 3LB0A 1JGMA 3IGHX 5DO8A 1UCWA 4AZCA 2QMKA 1H11A 1IT7A 1ZRQA 3CAKA 4UZSA 4MB1A 2X16A 2DSZA 4JYEA 1ADSA 4W5ZA 4HMCA 1KXVA 2V81A 3GNOA 3NL6A 4HA4A 5HXMA 3BICA 3GYEA 1GJPA 1D3HA 2OYLA 3QY6A 1HJUA 1N8IA 1WKEA 5EBAA 3ZLFA 4A8RA 2OPJA 4AEEA 4CQAA 1JL8A 1C8VA 1KFJA 3I10A 2NX1A 3OVQA 4E6MA 4W8LA 5HMEA 2X30A 1VYPX 3CS2A 4KFOA 4BA0A 3H54A 2ZZ6A 1E6ZA 3B04A 5AC6A 1JUKA 4XQ6A 3TAOA 4QJ3B 2D2GA 4UTKA 1YBQB 3ERPA 1BXNA 4PUMA 1WAWA 5CJ5A 4OWGA 1V3KA 3GB6A 5HQLA 3KLLA 1RPKA 3N2TA 4JQ4A 4MYAA 1EDTA 2J9ZA 3IV3A 5JBFA 1XRSA 4GUGA 3FV9A 4UTTC 4MSSA 2XSAA 3LQGA 1W54A 2A5HA 3VIGA 1VBRA 1GWJA 2XH4A 2V5CA 3AMDA 2Z00A 1W8SA 2OU4A 3C0QA 1ONRA 3G77A 2VRQA 1PYFA 3MTWA 4J3VA 4HD5A 3FSTA 3FYYA 2XVNA 4EPKA 4DVOA 1ZBVA 3BARA 1O68A 2PP3A 3NAVA 1K7EA 4A2RA 4K8GA 3JVAA 5D2YA 3UF9A 1G01A 1G4TA 1TO3A 2CXEA 2D0FA 4QBXA 1MO0A 4EWND 5F4SA 1BVZA 3PWIA 3GRIA 3ABZA 1DYSA 2H8ZA 4D72A 3EDDA 1KXTA 2SFPA 1UA7A 3B8TA 3CL8A 1F9CA 4DNHA 3R12A 2I16A 4G1KA 4Q8UA 1E0WA 2QQ6A 2IQDA 3RRAA 3UR5A 3TYUA 4GG9A 2I7GA 3LHTA 1NDYA 3MDUA 2O7SA 3EWCA 1XGEA 4EVZA 1CDGA 1SR0A 1V0KA 3TC3A 5CAKA 2A3EA 3NIYA 3W7RA 4Y8EA 5C54A 6ENLA 1NWSA 3M0YA 3QR1A 2DORA 3BLKA 3NZPA 5HNNA 1FWCC 1T6MA 5DANA 2WKLA 1ITCA 2B7PA 3C2EA 3F5JA 4O19A 5GNYA 9CGTA 3BLEA 3BUVA 1KBKA 3PUGA 3W01A 2JEQA 5CBJA 1Q4WA 4UB9A 3VZZA 4PFMA 5A6BD 2F61A 5C6MA 4XIAA 1YHTA 4DYEA 5KZ6A 1WZAA 1XBXA 1SUXA 2FH8A 1UWQA 4EIVA 3W28A 1POJA 5A2CA 2Y7GA 1NTHA 2G96A 1QASA 4UTUA 2YCLA 2QV5A 2G3FA 1ONWA 3DFNA 4W8AA 1UWAA 4AEFA 2G3IA 2CWXA 4GI4A 2DU2A 2IW0A 5D2WA 3UZZA 1XDJA 2D2OA 1M7XA 3TVAA 1LWIA 2WB5A 2J75A 3FLUA 5EA9A 4J3XA 1RSCA 2NXHA 1H1NA 1TUFA 1A3XA 1HKIA 3KEHA 2ISWA 4GYJA 4BQ3A 2ZZ2A 3CZKA 4HYWA 4JBRA 1TZ7A 2HPIA 1QTWA 3S1UA 5E0FA 4DWDA 3FXGA 3BZJA 2YDQA 1GKQA 3O63A 4LB4A 1BF2A 1B0IA 1ESWA 4B9ZA 4PCFA 4KCWA 3B3DA 3OBKA 1PS9A 2NX9A 7A3HA 4LANA 1W1A1 3H7UA 3GDLA 2Z4GA 5A6JA 2E6AA 3SIMA 1F6YA 3LHVA 5AHLA 4M29A 2REQB 1R3VA 3II1A 1US3A 1K70A 3W6YA 2CPUA 5LNUA 4QX4A 1NARA 2E0PA 3VNKA 3QC0A 3S6OA 3HA1A 3G8RA 3RAOA 4B90A 1BXBA 3CZ8A 7ODCA 1ALDA 3TTQA 3GNNA 8XIAA 5F4WA 4ZODA 3RGTA 2B81A 1KWKA 1QOQA 1W0MA 3ABQA 2E67A 3LU2A 2PRLA 2P53A 1QNVA 3SCRA 3IJLA 3OGVA 3I3BA 3QZ6A 3WLHA 1SGJA 2EG6A 3O0KA 4CGTA 1VJIA 2C19A 2JK2A 3MHGA 5KMYA 1CXFA 1MSSA 4WD0A 3WDRA 2FTWA 2NV2A 3VDCA 3IJQA 4AD4A 3STGA 1DJXA 3WLJA 4Y6GA 3GK0A 3OVPA 2JE8A 4MY9A 1UR1A 3AROA 3RPDA 3VE9A 4JL1A 3NQAA 1BYDA 4LNCA 2XWEA 3HMJG 3LHYA 1JDFA 1OEPA 1YDYA 3N15A 1DXEA 3WQDA 4OKDA 3WLQA 5LKYA 2FB2A 1O1HA 2GVYA 3M44A 2J24A 3MI3A 3FS2A 2WMGA 2DZTA 2VP8A 2POTA 1PTGA 4AZHA 3NQEA 4IPIA 3IANA 3K2GA 4JNZA 4QDWA 3LGEA 5C0QA 1V7AA 3L2IA 2VC6A 1EIBA 3U5YA 3AXHA 2Z1VA 4CVWA 3GFZA 2BHYA 4ZO8A 4E8DA 4GQ0A 5C9ZA 1P7TA 5CXPA 5EFFA 6TAAA 1TX2A 2XIJA 2DVUA 2FJKA 5CPSA 1TELA 1TV2A 3GY1A 2VO5A 5IDZA 2VGGA 1F8MA 4O18A 3TAKA 3PAOA 1AG1O 3QSRA 4A3HA 1RD5A 4Q8WA 5FJRA 5EMUA 1EYEA 2E77A 1KM5A 1HF6A 4JIIX 1XYZA 3SUTA 4DBDA 1L2UA 2HISA 1C8YA 1P1XA 4X9YA 1JYVA 3CL6A 3IJDA 2WJEA 5IHSA 3DC8A 4P8XA 5C9RA 1OX6A 3P3BA 1XBYA 3OQ8A 1WBJA 4PUEA 1MUWA 2XFYA 2PEVA 1JDEA 3ICJA 3GU9A 2YFOA 4XX6A 4ZVJA 2IKGA 1VBUA 2QDDA 3MZNA 1EPVA 2XVKA 3UJFA 2HE8A 3TONA 3PSWA 3UVAA 4QS6A 4L6HA 1CBGA 3WK0A 1AJZA 4P7RA 4MJ4A 1M7PA 4YYCA 1SO4A 3RJXA 2HK1A 1NOWA 5CJNA 1EFZA 1EO5A 4D6FA 2QAPA 4RCXA 4UTHA 1YW1A 4GQRA 3EX6A 5CGQA 5A8OA 5DCDA 2VX4A 3ZM8A 2IPJA 4AW7A 2RFGA 2XSXA 3NNTA 1T0OA 1V93A 1ZSXA 4C65A 3NXFA 3FA4A 4ACZB 3BAYA 1PEZA 3QPEA 1E1CA 1DXIA 2YJQA 3VOHA 3VOFA 2XN2A 1QI0A 4AZ5A 2A3HA 3GXPA 3B0PA 5C9UA 3P14A 4G7EA 3OQEA 3PBUA 3ZT6A 1Z8AA 4F4RA 1R2RA 5CPTA 3CZLA 4F3HA 1S2VA 4GY1A 1VPYA 3MWCA 3VD4A 1RQEA 4AD0A 1JXKA 1XLDA 1EP2A 2GVLA 5L9FA 4F48A 1S3TC 4XSLA 3BXWA 3NPWA 1UWIA 1R85A 3PZ9A 4A3UA 1GPFA 3AMGA 3TKFA 3VCNA 4BQ4A 1AQ0A 2XU2A 4O8RA 1JYWA 3A24A 2UZ9A 4QROA 4O0QA 3MVTA 4MKVA 1GW9A 3E02A 1AD1A 3BJSA 4GE8A 2J7GA 1UROA 4MTVA 1CB2A 1EWEA 1U1UA 4IUGA 1ME8A 3AHYA 1EX1A 4RL3A 3FHQA 4IP4A 1VRXA 1WUFA 4AMAA 5DELA 4US5D 2OKOA 2ZXQA 3H2NA 1E0TA 1GQNA 1TVLA 4AX7A 3ZVHA 1JI2A 2IXUA 3M6DA 3WQGA 4ZL1A 3NL5A 4OE7A 2O9TA 5JXQA 4RPQA 5LIUX 4GQGA 1W1TA 3XINA 1VLIA 4D8ZA 1DPMA 3QPYA 2CBJA 2B0MA 3UETA 2AGKA 1V03A 4IF2A 3CMJA 3T81A 2PWUA 3G1XA 3CNYA 2H6RA 3PTDA 2DUAA 1R3RA 4HHMA 2HE5A 1EP3A 3SRDA 2HWGA 1MW0A 1CWYA 3ATYA 1E4IA 2ADAA 3P5ZA 1RR2A 4DEFA 4LS0A 3MI2A 3DERA 1B30A 4YTQA 1XS2A 1C7TA 4TX9A 4BWLC 2CHRA 4LH8A 2FDMA 6XIAA 4C6OA 1YKWA 1X1ZA 3GG8A 1PB0A 1BPLB 5BOOA 5D32A 5C7VA 3QGAC 2QUVA 3M7WA 3HPSA 1EB3A 4AH7A 1P7TB 3KBVA 2OWWA 2XFFA 4HNLA 3R0DA 2H8XA 2C15A 4N9CA 4W7UA 3BQ6A 2ATSA 4DYJA 2PGRA 3I7SA 5E5CA 2BS9A 3AISA 2GGHA 1FWTA 2VFHA 3ZJ6A 2G37A 2Z6JA 4LV4A 3T07A 1E73M 5LHEA 1W3IA 1FKXA 4GZEA 4AY7A 4XBKA 3AO0A 3P93A 3PJWA 4RDWA 3PJTA 3PC0A 4JTIA 1PAMA 3Q45A 3WBXA 2V0TA 4CU6A 2WCSA 1U30A 4GJ1A 4LF2A 4HK7A 4LPCA 3AS2A 2R24A 3GYCA 2VCCA 3WL1A 3IJ6A 4OT7A 3VZXA 4YTSA 2V3EA 2ABBA 4YL2A 2W4XA 3MCNA 4XUYA 4RE0A 2DEPA 5CGTA 3UWWA 2WMIA 1I1WA 1QMLA 3QR0A 1ME9A 1JYXA 4HMDA 3TROA 1MFUA 4W7VA 5AZ1A 4E2BA 3GM8A 4XB3A 1A5AA 1TPVA 1ODZA 1QXLA 1UP3A 4O11A 5KZDA 4MHBA 3OVRA 2CZEA 1B3WA 3BK0A 1B9ZA 4L7ZA 1WV2A 3M64A 4LQ1A 5AY7A 2PDPA 3NL3A 3EKLA 5HA7A 2Y5JA 3WJZA 3W53A 3NURA 1Q6DA 2BLEA 2AAMA 3S6DA 2XTKA 4JR5A 1VFHA 1I60A 1P0EA 3FGCB 3L21A 4HJWA 4GO9A 2G4FA 1PDZA 2VGIA 1JZ4A 4X2PA 4P8UA 2R94A 3SGGA 5J8LA 3DGBA 2EF9A 5MF5A 1VR6A 1OX5A 3VMOA 2PF8A 1RBOB 1W5NA 3IVUA 3M5VA 1V02A 1D8CA 1R38A 4XD3A 1B54A 2C1IA 1ZPTA 1QNQA 3IGUA 1EQPA 4FIQA 4IMCA 4JKMA 4X9SA 1SZEA 4Z42C 5FA5A 3A4JA 1WDDA 4HHHA 2BG5A 4NNCA 2XN0A 1KBJA 3GH5A 3IK2A 1D9EA 3UYIA 3BAKA 3KLKA 2GJRA 2VENA 2W3ZA 2OEJA 4JHMA 3ABSA 1GOWA 4IZGA 3OIHA 1DJZA 4WLCA 1BG4A 1I1XA 3WBAA 1R3QA 1VP5A 4OUEA 1Q3NA 1O7AA 1R3SA 2V8ZA 4C1NB 4UMAA 4Z2GA 3A22A 9XIAA 2AGTA 1UUOA 2OQHA 4H6EA 2IUZA 2IMRA 1IIGA 2ZVRA 3WDQA 1OADA 1QOXA 3UT0A 4JCMA 3OEXA 3SFKA 2QGYA 3LPFA 3TYBA 4JN6A 1R9XA 3VIKA 1F73A 3L0GA 3IIZA 2KX9A 1IEWA 3B0YA 1XR2A 5DXYA 3U8GA 2PTWA 2Y63A 3MMTA 3KW3A 4LJ3A 4MOZA 3NQ7A 1CB7B 2XDFA 1OB0A 4S39A 3Q2DA 4UFJA 4ACZA 4YCOA 1RHCA 1V51A 1JCLA 4DX3A 5AYXA 3DN5A 4P5UA 4JTAA 3DZ1A 3GH7A 5BRQA 1CYGA 2WHLA 4R53A 3U4FA 3IJIA 3FAWA 1VBJA 5XIAA 2PDIA 2ASHA 4E2VA 1K6WA 2VEMA 5AYBA 1M65A 5K9XA 4UR7A 4S2CA 1A5MC 1UWSA 3LZ5A 1ECEA 1MNZA 5CAHA 3V0UA 2WMKA 1NIUA 4LWWA 3CUGA 1UC5A 2CU0A 3GIYA 5D38A 5D9NA 2DIJA 4MUPA 4DUVA 2ZRYA 1M3UA 4PMQA 2VR5A 3MO4A 4LTSA 3S5OA 2QYGA 3MHFA 4WJ8A 1Z6KA 3MKCA 3TJLA 2OR2A 3E38A 3SADA 5B80A 2V5JA 3VXGA 3NOEA 4ZE5A 4D8AA 3DHPA 2ZCGA 3C52A 4LC8A 2VM8A 2RDTA 2NVDA 1W91A 2QCFA 4RPPA 2P0OA 3L4TA 4M51A 1WXJA 5CSSA 2EJAA 4HHLA 1E3ZA 1AVAA 4IP5A 5A6BA 1DIEA 3IRSA 1A4MA 1B4EA 3B06A 2VOMA 1NJJA 1KO0A 1XYAA 1QPKA 1X1NA 2QJJA 3VIHA 1EJRC 2NV1A 4K68A 3GH4A 1O5QA 1KM0A 3HB9A 1OF6A 4YMZA 2YW4A 3LX9A 1YE4A 4KCTA 2NV9A 2QIIA 3UBPC 4HPGA 3UPBA 2YDSA 4OBRA 3LUTA 5ABTA 3WDHA 5CZSA 1D3GA 3GW0A 3IUIA 2P8BA 2PFHA 3EB2A 1EEXA 4NASA 1T41A 3BQ5A 1KCXA 2Y7FA 4V1YA 3I6RA 4KIEA 3LSCA 4WY0F 3HG4A 2V68A 1I2RA 2ZVIA 4CQ8A 5KINA 1NF7A 1RJPA 4MZYA 3W4RA 3ZO9A 4TMBA 4GI6A 4K1GA 1EGVA 4DUXA 1XSJA 4I90A 4UTFA 5A1AA 3IVSA 4EE9A 3POCA 2P10A 3OTRA 3SCUA 4JIHA 3TYAA 3HURA 3E2QA 1W1IE 3WCZA 3VKDA 2PC8A 4LUIA 3WQ8A 3VIFA 2ESCA 3OYZA 2G3JA 2PP1A 1EO7A 1DHKA 4NXSA 3LI0A 5A8NA 3ZWSA 1LBMA 1E43A 1WZKA 2VEKA 4R33A 1AA1B 3CB8A 4LF1A 1KXQA 1GOOA 3DYPA 1R3WA 2ODOA 4N9DA 3T1GA 1EUNA 4BKNA 3OG3A 4HP5A 1P0DA 4F9JA 3NZQA 3PBWA 1UOZA 2LLEA 3CK5A 1ME7A 1LORA 2Y8UA 3QQWA 3NZGA 1V3JA 3BLDA 4DUWA 3C8FA 4H8VA 1P0NA 4Q8TA 2G50A 2VX7A 2EHHA 3GBEA 1S1RA 4GGBA 2ON3A 3OOQA 2ZRXA 1KM2A 3NUKA 3THQA 4IWWA 4XG1A 4YTRA 4IQJA 3QV6A 3V35A 4I9AA 4Q4MA 3W7EA 3GNRA 3CBWA 3TLLA 2FYMA 1LLWA 2YIHA 2CHOA 2V3GA 1E71M 1EA0A 3W2LA 4IG2A 3KL3A 1VFTA 3PZMA 3ARRA 2A2IA 1SYTA 3P0WA 5DBUA 4CNTA 1KKRA 1JVNA 4PL2A 4H41A 4JD4A 2YX0A 4LFYA 2O9RA 4XO6A 3WD1A 2YL5A 2GSJA 4WY0A 3APYA 2J47A 4GNVA 1HG3A 1V6WA 3B9OA 4WEVX 5SWUA 3MUXA 5BMWA 1FHDA 2FVMA 2GJXA 2QF7A 4D71A 1VPXA 3V1HA 3QY7A 3CWHA 1WPCA 2NLYA 3UQNA 3NDYA 3TC6A 1MUCA 3Q65A 1RH9A 4UQBA 1D3CA 1OJXA 1W5QA 3MSYA 3W26A 1XIMA 1KR0A 1UJPA 1VYSX 4GX8A 1IHIA 1L8PA 4GYFA 3S0CA 1XYCA 2PBOA 3F2DA 4IG2B 3NJ3A 5HWJA 3GU2A 4AEOA 3NXLA 4H9YA 3OGSA 2A7RA 1ISYA 1GQJA 4FF5A 3C5QA 2GDVA 3NQCA 3EPOA 4MWAA 3RR4A 5F1VA 3VABA 1JQXA 1YTEA 3M6YA 4LVDA 1H09A 2OO6A 3CPGA 2PF0A 3TN3A 1B3ZA 2J7CA 2PDLA 4M7TA 4JTDA 1I9CB 4KRTA 2GYIA 2W61A 3MA8A 2Z24A 2X05A 1XHGA 3QV7A 3TU9A 3V0TA 4ZOCA 3MWAA 1VC4A 3QBUA 1E72M 3GVRA 3VIOA 4JYDA 1LWHA 3UJEA 4D8LA 2I56A 1XRVA 4S3DA 2DSKA 3GG0A 5AB3A 5DEZA 1I0DA 2ZX5A 1JJKA 4GOAA 2IS7A 1DQXA 3DG7A 1FCUA 3LNPA 2HCVA 4XO7A 2WYSA 3P74A 3H2OA 1F6PA 1CW2A 4Z2HA 1Q7MA 4DJFD 1HXJA 4R3UA 2OQLA 4OVXA 4KMQA 4PTXA 3PBYA 2VC9A 5C2CA 1C90A 1DWIM 4ZOEA 3W7JA 3MI6A 1XISA 4MUZA 1U5JA 1MYRA 3W74A 1QU4A 1Q66A 1VEPA 3CIVA 4DIAA 4FLOA 4UCFA 3B9AA 4IMDA 4YWSA 1FTXA 3LPOA 3N14A 3SDOA 3T0BA 4JXCA 1T8QA 1QRQA 1PTAA 3HJZA 3WLPA 4A2SA 1P6BA 4EXAA 4QCFA 4PC8A 1BVWA 1JCTA 1OBAA 1WOAA 3W37A 3NQVA 3UXDA 5M1TA 4E8GA 1ZCCA 4JTJA 3JZUA 2F8QA 5FJTA 5DBTA 1XYBA 1VH7A 2V82A 4A8IA 3LLDA 5I2UA 3PULA 3UEQA 3GKFA 4UC5A 5IXEA 1O5RA 2XYLA 1RCQA 3UR7A 1B3YA 2DFAA 1TQXA 4BY3A 3RO6A 3JU2A 5I00A 1SFSA 4JGDA 3S5YA 5I7GA 2E3ZA 1UKQA 2FDSA 1HP5A 5G1TA 3SUUA 1EGMA 2WHJA 3L5LA 4E3TA 1HZYA 3QHMA 3GSMA 4PUJA 1YXDA 2BNJA 4NJKA 5CPNA 3OODA 4RE2A 1E9IA 1QI4A 3M4HA 3WFAA 2WBKA 1WX0A 4DWSB 1WKDA 3G1FA 3CXOA 1UWUA 3SUSA 3AAMA 2OJPA 2X1RA 1EH9A 3PJXA 2XH7A 2CBUA 1YLVA 3UR2A 3CWOX 1Q6FA 1JZ5A 4HU8A 4W7WA 2F2HA 5D05A 3VFCA 3V4BA 3DFHA 5I3IA 5BOEA 3A12A 3CLWA 2J88A 3V5FA 4RUBA 2OFJA 3LCHA 4ZGYA 4NG3A 2QCDB 2RJHA 4HJFA 4FXFA 4DXKA 1A80A 3KTCA 5K2ZA 3TIMA 1SMAA 3GIPA 1V7YA 4FHAA 4MY1A 1G94A 1W5PA 1H51A 1I2OA 3S5ZA 4ZQCA 5M3WA 1NELA 3TC7A 1FA2A 1A5BA 2DY3A 3LM7A 4PR4A 4M5PA 4K37A 1VAHA 3R0UA 3R25A 2X0YA 3BAIA 1TPFA 2YGYA 2CETA 4IXHA 1LLZA 4BI6A 3OZOA 2GJLA 3FCPA 5A95A 3W1MA 3KCOA 2WC3A 3K8LA 4L6OA 1ZB5A 3DFPA 1YE6A 3EEGA 1MFVA 4HK5A 2CCRA 1NH6A 4DF2A 1J0ZA 2YLAA 3KL0A 4IOTA 5DRCA 1X96A 1OCNA 5FKYA 3VIPA 3M41A 4I9JA 3B40A 4XSMA 1WCGA 4MAZA 4O4VA 2E6YA 1VCGA 1DV7A 2WJZA 4Q4QA 4FNUA 1FXQA 3FJLA 4H00A 3TW7A 3WEOA 4D6IA 3O6DA 4RR4A 1UBSA 2PDHA 4HYRA 3C2OA 2VFEA 2E68A 1PIGA 3OLIA 3W6MA 1CENA 4H8HA 4H9TA 4JEJA 1KFCA 2ZWYA 2PE4A 5AC7A 3DFYA 4KS0A 1S2TA 1F74A 4JY8A 1GKPA 4MDOA 3V75A 3LD5A 3ALGA 4QITA 2PSNA 1Y5VA 1L2QA 2XINA 3T44A 3E0VA 3ZSTA 3NYDA 1R5YA 1T96A 1IYXA 2A6LA 4WRHA 2Z26A 1OCJA 1TQJA 4D6HA 3ZQ9A 4AAJA 4ZXLA 4I7UA 1DJHA 5LA1A 1ZJHA 3PFRA 2B7NA 3E9AA 1NSJA 3ZR4A 2QCLA 3RILA 1JPIA 5EKYA 1PX3A 3BMWA 3F5LA 2HVMA 2D3NA 5A6MA 3WLKX 4AFYA 4L4OA 1UUMA 1CT5A 1O5KA 4S3FA 3CWNA 2W5FA 2A6NA 4JQ3A 4GA8A 2OVLA 1US0A 4KPLA 2FVKA 1R30A 3MCOA 3RN6A 3OO2A 5B7YA 3WLLA 4FAMA 4QG9A 2A1YA 4LVAA 4XISA 4UR8A 1BLIA 4LS1A 1XG3A 4LC6A 2FKPA 3RDKA 4CNSA 4AMCA 1XQLA 2DPEA 2PLCA 2AAAA 3UWVA 2W79A 2QJHA 3REQA 4ZR8A 3GW3A 3GTHA 3E2RA 3B4YA 2FTYA 2BXVA 3R13A 1RQBA 5CSYA 1ITQA 2QDEA 1K9DA 2V5LA 4ICMA 2QNEA 2ZKMX 1I2QA 4PMYA 3EMCA 2ATMA 1BHGA 1UMLA 3FDGA 1FFQA 5HMSA 1XQKA 4K38A 1OYCA 2Q8LA 1DJYA 4WSHA 3MUCA 1FY6A 2C1GA 1UPMB 5E93A 3TWAA 3W38A 1A50A 4ZQPA 2CZDA 2PDBA 1U1JA 1MUMA 2INFA 3BJFA 4PULA 5HMFA 4GZJA 1ZAJA 1XRTA 2ZA3A 2Z1KA 1OD8A 4A8NA 2OKTA 1DIOA 5DY3A 1S2CA 4J2MA 3IAPA 3CV1A 1PYMA 3NTYA 2VNCA 4EKJA 5I09A 3EB3A 1XPYA 1FDZA 2FB3A 3FSUA 3MDWA 1TCMA 2Y4SA 2Y7DA 3IK4A 4KW2A 3U9IA 3SAZA 1TG7A 4DJFA 2ZUTA 1EJSC 3HIJA 2H9AB 3NO1A 4QISA 1I45A 2E4TA 4ICNA 3WD4A 4Z1YA 4HSNA 3SR7A 2WLYA 4W88A 3W2MA 2DIKA 3BLLA 1UPPA 1JIBA 2PMQA 3MO7A 4QSHA 3ISIX 3E96A 3WNNA 3B05A 1KGWA 4O0KA 1KGUA 4I6VA 1LL7A 4HZ8A 4XZBA 4WJXA 4DHGA 2PRMA 5LXEA 2CERA 5H91A 1NF0A 2ISSA 1Q7QA 4HQVA 3C4UA 2WSRA 3CV2A 3BTNA 4I3GA 1OC6A 2BXYA 1MVYA 3LMYA 4S3JA 1EGZA 4MAVA 2VD9A 2YSWA 2QS8A 1F8IA 3WLTA 1TIWA 4OJYA 2I14A 2YOCA 2DDXA 3SJ3A 3C3NA 2EGZA 1JQVA 2NWRA 4NAEB 3SFWA 4C91A 1HJQA 3W85A 3DFTA 4S3GA 1JAEA 1XIEA 2Z25A 4C6PA 1E1EA 4GBDA 2R6OA 3KS5A 1QW7A 3TYCA 8RUCA 3EWXA 2WZEA 5JH2A 1O1ZA 3O05A 2ZX7A 5E0CA 5EB8A 3WLIA 2ZA1A 5JMUA 1IGSA 1IIHA 4F0HA 5AYIA 3AZSA 3LHZA 3PZTA 4LXFA 1B2YA 3GS6A 1RLCL 2HRWA 2OWCA 1TWWA 4E4PA 4RV8A 3HJEA 4GBUA 1F3XA 1YYAA 4FNQA 3T0AA 5C2XA 3LPGA 4HMNA 5AHEA 3PZVA 3ZWTA 3O6YX 4R7JA 4WUIA 4M19A 4FOKA 4LAOA 1PZ3A 3N29A 4PTNA 3W7CA 1RY0A 2BB0A 1IT0A 1FWEC 3GHRA 2XN1A 2ZZ7A 4K2SA 2B7QA 3GVWA 3XIMA 4UQCA 3PY2A 4JFSA 3AI0A 2FQIA 3LV5A 4IHCA 2BBFA 1S39A 3FIGA 1BXCA 3UXAA 1KWGA 3NR0A 3C0LA 1AH3A 1DJQA 2Q01A 1CLVA 2CITA 2MUCA 1IEIA 1QDSA 1PZ1A 1M41A 4AHQA 1GQIA 5G1MA 4RDYA 1B5TA 1J6OA 3A21A 1FVPA 3WENA 4S3AA 3ARWA 4BS0A 1K3UA 4C1KA 1QFEA 3PPFA 4IIBA 1DIKA 1G4EA 4Q4SA 1DWAM 1M5WA 3E5BA 3HG5A 3B0UX 3N17A 3E2SA 1XSIA 4HNVA 4XZ9A 1IWAA 3PUOA 3B0XA 2X7VA 3W29A 2ABAA 3RCMA 2F6KA 2INZA 2Z28A 5D8WA 5J5DA 4DY1A 1UH3A 1EA9C 2E25A 1BQGA 2ZTJA 2V38A 4LUSB 4S23A 4KEMA 1S3HA 4MM1A 4GUIA 1W3TA 3HZ3A 3KHJA 3GNDA 4Q4OA 1YDNA 4Q32A 1UKPA 4Q8MA 1OCQA 3E6EA 2O4MA 3AC0A 4REQA 3OHMB 4C5ZA 4O28A 2VX5A 4ILSA 1TVNA 1VD6A 4CNOA 1GZJA 2BHUA 5A94A 2XVLA 3KBSA 1WAUA 3NQMA 3QPZA 2IKHA 4PMOA 1YPIA 5D37A 3WBEA 2XM2A 4PUDA 1MDLA 3FJ4A 4BQ5A 1RA5A 1BAGA 4XD4A 4QJ5B 2HXUA 1XDMA 5D8ZA 1B57A 1K4GA 4GIYA 3AWOA 3V3WA 1BGAA 1GOKA 1RBAA 2BFGA 1X7FA 2Q09A 1XIDA 3WMBA 5IHRA 2Z1XA 1XYFA 4BEQA 1A5SA 3KBJA 3KVKA 2Z7GA 4XD5A 4BR1A 4NU7A 5CLTA 3O9NA 5D03A 5D2TA 4UNIA 4CN4A 3I4EA 1PXGA 4WGHA 4V28A 3WQWA 3T08A 1KC7A 1Z41A 1DJWA 2JBMA 2PGFA 3OJGA 4GI9A 1J11A 4UTIA 3W2NA 1V0MA 4Y9PA 1T5AA 5FF4A 1ZY9A 5G1YA 3ITVA 3LBMA 1Z89A 1J18A 2VTFA 2G3NA 3S46A 3ZT5A 1FHVA 3P6LA 4Q3MA 4TU1A 4RKAA 1EP1A 4C6KA 3CTTA 4KIRA 3PZUA 1KA9F 4JCLA 3R4IA 3WZ0E 4LBRA 3LEPA 9XIMA 1L8NA 2NQLA 1NDZA 4MZ8A 5I79A 3CO8A 1KD0A 1ZCOA 3P67A 3IJ8A 1ONXA 5D33A 3G24A 1OK4A 3P84A 1JZ8A 2QHAA 3WFLA 4NXKA 4QIUA 4Y96A 2ONEA 1GUVA 1F05A 4E3VA 1RVKA 3D3AA 2E6FA 5D2VA 2E40A 1GYMA 4Z2KA 4U5IA 1JDCA 2J6XA 3N4AA 2DW7A 3L65A 3OVGA 3V5CA 5HWMA 4MPKA 5FF3A 1VHCA 5G2WA 3V18A 4TTGA 1UIPA 3SCQA 4O10A 4R27A 1K1DA 4A4AA 4CUCA 4B4FA 3G1DA 4FX6M 3EBVA 3NO3A 2GLKA 1EF3A 5CZKA 3W84A 1Q6OA 3F5KA 2E09A 2FJUB 2CXGA 3HO8A 4C7FA 4YWIA 3CH9A 4DUOA 2J77A 2C7FA 4TVDA 1DE6A 1KW1A 5HJLA 1ICSA 3EX4A 4NX0A 2WPBA 4YLWA 1HL8A 4B4HA 2FFIA 4J40A 1XCFA 4B5NA 1SO6A 3AOFA 1OC5A 1M9HA 3GG1A 3ZS4A 3BGGA 1X38A 1UP0A 3ZMRA 3EDEA 4M6QA 5CSUA 1XM3A 1DHPA 5EGRA 3A64A 4QG6A 1WKFA 1WDWA 2YL8A 4GQBA 2YA2A 3C3UA 3EPNA 5T91A 1G69A 3VI2A 2VC5A 3MUY1 1OIMA 3LTSA 4PUUA 3R7MA 1NFBA 3L7RA 4ES4A 5K9DA 2WHMA 2WMJA 5A3HA 3NWRA 3LHUA 1FKWA 3T8LA 5FJOA 2GUBA 1QPQA 4DAFA 2OT1A 1H7XA 2IXVA 1FH7A 1XUZA 1ZS2A 2AL2A 5KZMA 4LGXA 3ARXA 3I7QA 4UFHA 2VZSA 3W7OA 2HZGA 4RW3A 4IL0A 1WO2A 4XKYB 3ZT7A 4NZ3A 3F2BA 4L5ZA 3UXKA 5BXTA 1GTHA 1B4KA 3EXRA 4GVHA 1K9TA 4QLLA 2ISFA 1POKA 4NHVA 2UY3A 2W63A 3KM8A 1DVJA 1EEPA 5CBBA 2QEZA 3ZJKA 1G9HA 1HIZA 2E5DA 3PZOA 1KRBC 1U1HA 1OYAA 4DF0A 2C18A 3VD5A 1GEHA 4B15A 4Q6XA 3NPVA 3A3HA 3P5YA 4A05A 3W70A 1GTEA 4LNYA 5GNXA 2E9LA 4L61A 4YCPA 3QR3A 4ZTXA 3G5EA 4YJ5A 1REQB 3U3HA 1Q6GA 3THDA 4B9YA 4P7NA 3R1ZA 3VGDA 1XLEA 3FVDA 2TRSA 4MKNA 4IFKA 5REQA 1AW1A 3L4VA 2H3DA 3GHSA 2OZ3A 4H9MA 1VYRA 4AB4A 1K8YA 1WE5A 3HGOA 5HDRA 1QBBA 4ZXOA 1W3NA 2YLLA 4ZFMA 1DP0A 3K13A 4X0NA 2ISVA 2YL9A 4JOMA 2Y62A 1CTNA 2YFNA 1R3YA 3O06A 3SUWA 1X98A 5C9XA 3VD3A 3QW4B 2DVTA 3WH6A 3BCFA 2EO7A 2CZFA 2BGQA 4NYUA 3UR8A 1UKOA 4GRSA 4CCEA 1OFPA 3AIVA 3Q67A 4R9OA 3RM9A 1ZQ5A 1XIBA 3AHXA 4MPQA 3HQOA 3R0KA 2E9MA 3L4UA 1REQA 2WM1A 5FEPA 3CYJA 2PDWA 2W62A 2J78A 4L9XA 4TX6A 3W7KA 4G56A 3RX4A 4AIUA 2CNCA 1NDVA 4O53A 2VUYA 4HSOA 3K4WA 4WKHA 4CD8A 1LOSA 3W23A 3QMTA 1XICA 1TV4A 3U5UA 5IFTA 4UMBA 1E9YB 1MRAA 1UZDA 4D6EA 3OIXA 3Q94A 3FYOA 1KM1A 4AXNA 4IIFA 5LIYX 1JGIA 4O13A 3N2OA 2PU1A 3LOTA 2WVUA 2PD5A 5XINA 3P8IA 3CPRA 3UG5A 4LU0A 3H70A 3IACA 3NVTA 2F6UA 1W37A 1X6LA 3GDBA 3GTXA 1ISVA 1TR9A 5CEWA 2PD9A 3REQB 1DXFA 2ZRVA 1E6PA 4E4FA 1EPXA 1GG0A 4PEKA 4GFSA 1S5WA 1UHVA 3SY8A 2JF6A 3G1HA 2VDGA 1M7OA 4BWLA 1XFBA 3NOYA 4WDTA 3LXBA 2BY1A 4OV4A 3TXVA 1O60A 1UBPC 4O1AA 2CHNA 4H1ZA 2TAAA 1FX6A 1XX1A 4PTDA 5I3HA 1I2NA 4DJED 1MQQA 3CEPA 3OZMA 4HZ6A 3VD7A 1UKTA 4H9UA 2PDQA 4LSBA 3LCXA 4K36A 1H60A 5J04A 1OYBA 2DSVA 3GE7A 5AHIA 1JULA 1JXJA 1ISWA 3L4XA 4NY2A 3WMCA 2J8GA 3GU1A 3PM6A 1AMYA 4KKXA 3QM3A 3CQIA 4E5TA 3KVMA 1TV3A 2OSXA 3A3WA 5CZTA 4MVAA 3RUBL 2VR2A 3UA3A 4L56A 3UG8A 3EEZA 2QCEA 3QV9A 3U2OA 1QJWA 4GVFA 4CKQA 3W1LA 2Y5EA 4R7WA 3EZ4A 5ENLA 4DZIA 3KVJA 1JR1A 1LRTA 3M0LA 1XLKA 2ALDA 1VJSA 3ZFHA 1E0XA 1H49A 3SQSA 2VD8A 2OMAA 5BXSA 4N7QA 4ML4A 2I9EA 4AIOA 3IIOA 1QBAA 4EXQA 5G4HC 4MGGA 1AMKA 5BW6A 4Q4RA 1BWVA 3ITGA 1AODA 2ACUA 3M5ZA 4MIMA 3N11A 4CD4A 8XIMA 4X60A 3M46A 1NOUA 1QPOA 1IQ8A 2XIMA 4UNLA 1IZKA 1V0NA 1RK5A 3QVQA 3HBLA 3B9DA 4FIRA 2PBGA 1XLIA 2V2CA 1F2JA 2G95A 3B9NA 3G6LA 4A21A 1V3IA 3V5OA 4LAKA 2V63A 2VZUA 2IKJA 2B7OA 2XGZA 2TODA 3NG3A 4B2DD 1TV7A 1VBGA 2WSQA 1VF8A 3M47A 1H7NA 1HW6A 3QW3A 1CXLA 1W1PA 4RXGA 4BF7A 1E9ZB 7TIMA 1BWLA 1DWHM 5I3JA 3JUGA 3MHUA 1JF6A 3Q58A 4Z1DA 1QCWA 5C5YA 4AY1A 3W27A 3D0CA 4O12A 2G8ZA 1QATA 2J9XA 4NZCA 3KRBA 1M68A 2WC4A 1G6CA 2Z2BA 3DDMA 4Y7EA 1XL9A 4I7VA 2P0IA 4JFUA 1YADA 2VHLA 1SU5A 1P6WA 4PMUA 2IPWA 3L4ZA 2CW6A 2GJNA 3EWDA 4DXXA 2WSPA 3EX2A 1WZMA 1ISZA 4NUWA 3A47A 4A3QA 1W3HA 2A3AA 4H7VA 3ZJ7A 5AVHA 2XFRA 4ZSTA 3W6LA 4XAPA 3QMRA 3P80A 2PDXA 3L23A 3F4NA 3TYZA 5JU6A 1W1ZA 4WKFA 3KOFA 3NDOA 2E5CA 3H2FA 5KEZA 1W5MA 1ML1A 1SZFA 4HA0A 5HULA 3N1AA 4ASTA 2GDQA 4BZYA 3LDVA 1A5UA 3AIUA 2Y24A 1XF0A 5AYZA 3ZZ1A 1CNVA 1M03A 4GKLA 4R88A 2AKZA 4PODA 3GUGA 4QSFA 2EG7A 3F4DA 1VLWA 3AS3A 1TWSA 1PHWA 4ADUA 4NAEA 1H41A 1O5XA 1J9YA 2IQTA 3WQ4A 1DJIA 3USBA 4GNJA 1JNDA 1PKLA 4PA8A 3W72A 3CAWA 3ARVA 1U33A 3WK1A 4O54A 1XBVA 3ZJ8A 1TR1A 2EKGA 1XWYA 2WANA 4AZBA 4AZIA 4M24A 4JTLA 3STEA 4PB5A 1GZGA 4PMNA 2WZIA 4GXWA 1TA3B 1NU5A 1A47A 3AYRA 3EA1A 4JYFA 4NAFB 3TYEA 4KETA 1RUSA 3PFMA 2FZ9A 5F1UA 2ZRZA 4JAWA 1W56A 1L6WA 4TUFA 2D0HA 3A9IA 2PWGA 3EA3A 1Q45A 4J3ZA 3L68A 3QFEA 2GGJA 4DZ5A 1T8XA 4PH6A 4WHBA 1OGGA 3B8IA 1B1YA 1KFLA 2VRKA 3VFLA 1R7AA 4YVPA 2BVDA 3BMVA 5AHNA 2CZ5A 2YCLB 3W1QA 3T0DA 3QH2A 3L66A 4JFTA 2EPOA 4J27A 4YVVA 2OG9A 5T26A 3DH7A 2R8WA 2ZUMA 4PUNA 5EMMA 1HNYA 3M0JA 4FSAA 3FVMA 2DH3A 2XISA 4XZLX 3HQPA 4KT2A 5A69A 1JD7A 5D30A 4LW7A 1AJ0A 1MEHA 4AXKA 5DCEA 5EYWA 4M3PA 3LZ3A 4AVNA 4IIGA 2C0AA 3U7BA 4GGHA 1G67A 2A3LA 3PTQA 2GQ3A 3NYZA 3C56A 1J96A 4DZAA 5EPDA 3LXCA 1W2PA 3KCJA 5EMLA 4FXRA 3CZJA 3NEVA 4IH3A 3TW6A 4G5DA 1YTDA 4JTEA 3GAYA 5I77A 4PRRA 3N6QA 3NQBA 3C2RA 2PLMA 3ABXA 3U4AA 4PTMA 3FFSA 3DHFA 3URAA 2YL6A 4NL1A 3SY1A 1TJ0A 1E6SM 3STCA 2R14A 2V2HA 3BZGA 3TW9A 4D6DA 3H4WA 5FF2A 3PPGA 3L67A 1TJ1A 2TPSA 4NZJA 1F3WA 4H01A 3VKJA 1XLAA 5I23A 3STFA 1MWOA 3S1WA 3BDKA 1OG6A 3RNDA 3ZYZA 3UWUA 4WR3A 1FRBA 1GOXA 1X97A 3UZ5A 3HPZA 5ABFA 3QLDA 5CBIA 2VZOA 2YW3A 3W88A 3S9ZA 2QT3A 3CAQA 1J0IA 3CQJA 5IBXA 3FN9A 1V02E 4FOUA 1HO1A 3MYOA 4RZ6A 1VGAA 2OEKA 3I6EA 4ZO6A 2PCEA 2F9RA 1CIUA 4TMCA 2VXNA 4FX8A 2WZTA 2V5KA 1PKYA 4N9EA 1XI3A 4Q8VA 1C8QA 3L2LA 1R86A 4F0MA 1N7KA 3G6MA 3F7JA 3UGVA 4AF0A 4OBSA 1TRIA 4OIFA 1GOIA 4HNNA 1U2YA 5DLCA 5GPRA 3DI0A 1EJVC 4GH3A 5AYYA 3JR2A 4L4PA 4LYPA 3LCLA 3ATZA 4AWUA 4LT9A 3ZLGA 2P5NA 4QP0A 3R8RA 3WMSA 2WW5A 3N4EA 4IL2A 5AZ0A 3KCLA 1YXYA 3M43A 1DWJM 2X2GA 4P8WA 4ENLA 1TVPA 3RX2A 1A49A 2X40A 3GTFA 5FF7A 2OYMA 1H7OA 4N4PA 2NLIA 2VFGA 3LI1A 5CZJA 5CSRA 2QJIA 1EQCA 1KCLA 1NWUA 4LVGA 3PPCA 4FNPA 1J5SA 4EK7A 1VIZA 4HPHA 5I3DA 1CXKA 3GNPA 1OFQA 1XH0A 4ONVA 1YXCA 2PDUA 3WG6A 1A0DA 1AH0A 3O15A 1UYQA 2NQHA 4DI9A 3O16A 3W75A 5FEZA 4HCLA 1PX8A 5MKGB 4QTGA 2FHCA 2ZX6A 3MS8A 4FNSA 3E0WA 3LRLA 2VZTA 1FHUA 1EJTC 2X41A 4EOUA 5TD4A 1OK6A 5FF0A 1RPXA 1W9VA 1UR0A 1YPXA 4ECLA 5HNUA 2VGFA 5I3KA 3N13A 4H04A 3KBWA 4MLRA 4S3EA 2P1FA 5BYWA 2OGYA 4HPJA 4B92A 3RIKA 1KGXA 4ZMGA 2OELA 2BDQA 2VKZG 3A5FA 3M07A 1TTIA 3APTA 4XKMA 4B3LA 3FKRA 1ZU8A 3ANVA 2PB1A 3T9PA 4YVXA 2HNEA 3CUIA 3NPUA 5LNRA 1FWRA 2YA0A 3ARTA 2F6XA 1UR2A 2VFDA 2VZVA 4ZFCA 3U0HA 4TVUA 2GFTA 3CJPA 3S2LA 4MJ2A 3GDTA 3DIPA 3CHEA 1IEQA 1HL9A 6REQB 2PC4A 3W1TA 1MXGA 3CYVA 4HTBA 3EMQA 4ZB0A 3GVVA 4FZIA 1V6UA 3G2GA 1V08A 2VWSA 4DJEA 2C91A 1G4SA 4EP8C 3UYCA 1J10A 1RY8A 2VCBA 1XINA 1Q6LA 3C2VA 4L4LA 1OZMA 2WQDA 3FHAA 3GLCA 3P60A 4Z2LA 3WH7A 4JTRA 5CPQA 3AU2A 4TTUA 4WJEA 5LGZA 4RNJA 4DNMA 1O95A 1GKRA 4U2YA 4L9ZA 4N6FA 4E4UA 2XM1A 3NCOA 4H6KA 4RK8A 3CL7A 1GVOA 2WM0A 4QS5A 1YNQA 2OX1A 3A4XA 2BVYA 4YIWA 4D2JA 3UNTA 2V3DA 6CGTA 1FWGC 2O9OA 2QUMA 2WQPA 1QPRA 4XV0A 4IX2A 1QVBA 1QWGA 4C90A 4E0CA 3S2CA 5D2XA 3W86A 3TUUA 3MP4A 4JQAA 4GXMA 5IFPA 1G4PA 4ATWA 1KLZA 3NQDA 4WDXA 4U2ZA 4A3RA 1GNXA 3PZGA 2GJPA 4AZCB 3B0VC 3VGBA 1E51A 2DP3A 4YXGA 4KWSA 4KESA 3NQGA 1HTIA 1A5CA 4H2HA 2RGLA 1NEYA 4QJ4B 1XP3A 1B31A 1Q2RA 4GJIA 3WNPA 3NEHA 4RW5A 1ZP4A 1ICPA 2DT1A 3BMXA 2BV9A 5ABGA 1UH4A 3VUSA 1LOLA 2PURA 5AHMA 2CWNA 5HJYA 2J7FA 4B2DA 3H7VA 2P76A 4JTHA 5DMLA 3VIMA 5I02A 3JW7A 3CAVA 1Q8JA 2JIWA 3F4WA 3H8AA 1RALA 4KFPA 4HPNA 4PSPA 3VD9A 1D8WA 1JYNA 4V1XA 4D6JA 4PGLA 1ZBKA 4MJMA 3LGGA 3LCFA 1Y8BA 4IM4A 4DJDC 1OWQA 3GTNA 1OVDA 5A2BA 4C1LA 4LAUA 4DO7A 3FA3A 3QYSA 3W1NA 1OD0A 1W5OA 3UCDA 1E6RA 4NI8A 2Q71A 1KQYA 5CPLA 2WJDA 4LY8A 3FW6A 4F2BA 1B3XA 2PDGA 2E8YA 1XD1A 2WAGA 5FAJA 4P7QA 4ZB2A 4XWUA 1SW3A 2PWFA 1AQMA 2FIQA 2QDGA 1TX0A 3AIWA 1UD2A 5JBDA 3FK4A 5K9CA 1VPQA 2I57A 1O94A 1Q8AA 1XSKA 4GC4A 3ME3A 3BO9A 3WJXA 1GHSA 5EBUA 3W1RA 1LUCA 2QULA 4TV6A 2QPSA 4QAWA 1OFDA 2CKRA 3DHUA 4HSHA 4XAFA 4BJHA 5TIMA 3THUA 3VDBA 5TF0A 1SO5A 2IKIA 1TKKA 3BV4A 3LENA 2WCGA 3VNLA 4EF9A 4ZOBA 1IXOA 3R11A 3T4CA 4PYSA 2VVNA 2E5BA 1PIFA 3A6OA 2XSBA 4YN5A 1GG1A 1IR1A 4WY0B 3H22A 3COTA 3MYPA 1A5KC 1GOMA 1H7WA 1TV5A 3FGCA 1K02A 4I5XA 4TO8A 3DBNA 1RCOB 2R9RA 1KBIA 1XLMA 3RR1A 1CECA 3F03K 3K4DA 1E4MM 4O4WA 1B3VA 1J8VA 4M81A 3TTOA 1XGZA 2ZWZA 3BGJA 1FWBC 4KWVA 3ZLHA 4RJEA 2OB3A 2YYTA 3AUJA 3L4YA 4AD1A 1V6VA 1LQ0A 1IR2A 4DBSA 1AUSL 1PE1A 1XH1A 2BZNA 2HPMA 4XVDA 2FZBA 1LM1A 2UV8G 4DJDA 1BD0A 4MWAC 2BHZA 4HMEA 1FBAA 3UCQA 3S42A 1JG9A 4LUYA 4HNCA 2RUSA 3N04A 1GZ1A 3WK2A 1LOQA 2DH2A 2O7QA 1C9DA 2OQYA 2BODX 2BP1A 2DZWA 4HNOA 2PDCA 5DT7A 4DWSC 2EKCA 1FWFC 3BOXA 1XGDA 3CTLA 2YZRA 4ZBCA 5AC8A 3GHTA 3QMSA 3T6CA 1R3TA 1QI5A 3VKCA 1FFRA 5EFDA 4WX2A 4ADSA 3VKKA 1HKKA 5A6AA 3O07A 4QE4A 4FK9A 3EOEA 3A4AA 5EMJA 2EBNA 5EMKA 2YXXA 1WQ5A 5M17A 1ZTVA 1KRAC 4N2YA 3VPLA 4KWUA 1W9PA 4L1GA 3LA4A 3QSTA 1UD6A 4NAFA 3MV01 3TOPA 2HVNA 4AD5A 4V33A 3SCPA 2X8RA 1EL3A 3R8HA 2WSYA 4W89A 3CM4A 3SN4A 3PP7A 1XKJA 1FP9A 2R1LA 1V8EA 1Y5XA 2IPFA 3QRHA 4QJ1A 3W82A 1GQKA 3B97A 4B5VA 2QAFA 1OFRA 4OUIA 3MCMA 1NY1A 5FI8A 4O15A 2ZRUA 4JTCA 2VT0A 1XRFA 4IXXA 1ZLPA 4Z0SA 3U2EA 2OODA 3S2JA 4OTKA 4HNUA 2RDXA 1N8FA 5BXRA 4PSRA 1FCBA 3P8JA 3S2NA 2NUYA 4NX5A 2G41A 1AFSA 1S5VA 2Q6ZA 2PCQA 1IV8A 1NM9A 3PF3A 3YPIA 2AOSA 1PPIA 3HQNA 2R91A 1LUCB 5BWAA 2FPYA 2Z27A 3VU2A 1AW2A 3I6TA 4GXPA 3FNDA 4K7YA 4NVTA 3ABOA 3S1XA 2DZUA 2BGNE 3AFBA 3DECA 4JHZA 2YCEA 2OT0A 4KWWA 1QW8A 1TPH1 3TTEA 5HJXA 1FDYA 3VGGA 4HTYA 3VTRA 5AN7A 3TEVA 3BAJA 4Y9OA 3G0UA 7CGTA 1SJDA 4W4QA 5FL1A 4URIA 3MSDA 2PGEA 4H3DA 4CN6A 5ABHA 4PMJA 1K03A 3TK7A 2OTDA 1J2WA 5EL1A 2FZMA 3SGZA 4F66A 1I6NA 1MRQA 4NJHA 1LWJA 4OGZA 1UH2A 2V67A 3ECQA 4TR9A 3UZYA 4JX6A 4HOZA 3E5PA 3DG3A 1LTDA 3UZWA 1OT2A 3FDKA 4WOQA 3UNDA 5FCZA 1BYCA 4DJEC 4ZTYA 2PP0A 4A8LA 3M0KA 3UJRA 4FP1A 2AQVA 3MU7A 2R1PA 3WUEA 3K30A 2WMHA 3FEMA 4FLSA 1YNPA 3IJ9A 2XPKA 3BJTA 4G1NA 3VM7A 4NZ1A 5B7ZA 4PMRA 4ORIA 3EGJA 1C3FA 1KCKA 1F7BA 5DRIA 1L6FA 1A5NC 2PTXA 3TJXA 4NZ5A 3GDRA 3K1GA 1BTMA 4LUTB 2W6RA 4XK2A 5I6SA 3EAUA 5F2MA 1K6AA 3W7DA 1CGUA 3QKEA 4JHOA 1WP6A 3V7PA 3W07A 4ZB5A 2YBTA 1Q6QA 2PDKA 3RFAA 1H5VA 3WF1A 4N42A 2D22A 1DE5A 3GZ3A 4JKLA 4NYYA 3PUDA 3EOLA 2QUUA 3CQHA 3MY9A 3N73A 3HGRA 1IXPA 3RLVA 1LT8A 3W7GA 5FSEC 1R9ZA 4M1RA 3AIEA 4S2BA 4JX4A 1TB3A 3TMQA 3G8EA 3MUZ1 1HQTA 1BRLB 2NQJA 1DKWA 1QUMA 1OCBA 3MPGA 4HGXA 3AALA 3LPPA 1DJNA 2PAJA 1I75A 3VE7A 1AJ2A 3EDJA 5CC5A 3TA9A 2FH6A 3A4WA 2BGSA 2J79A 3ONCA 3KOWA 3OA3A 3U7VA 1H63A 4MFEA 2F7FA 1UIOA 2J8TA 1QK0A 5K3VA 4FOJA 3MVIA 2EJ1A 2E8ZA 1TWZA 4JFVA 4XIMA 3WSUA 3T42A 4M6PA 5TAOA 1H1ZA 4DELA 3ES8A 3W2JA 3UPMA 3SSJA 1J4EA 1R87A 2OGJA 3W2KA 3NZRA 1HJXA 1RJRA 5TQLA 2ZRWA 3TH6A 1FWIC 3KOYA 3ZR5A 5T9BG 2AKMA 7REQA 4PTVA 1JPDX 5M03A 4M8UA 4JIEA 4X22A 3EWWA 2WK2A 3GAKA 3TQ0A 4UFKA 5FEXA 4UWMA 4HBKA 3EWZA 3HG3A 6XIMA 1TJ2A 3BGAA 2ZDSA 4IT1A 8A3HA 3W7MA 3GFXA 1PWLA 2GVJA 4X3ZA 3IIXA 1DTNA 4U3CA 1I8JA 2VEIA 4PMXA 1AQHA 4B16A 3WQFA 3VILA 4MG4A 3H2MA 2XHYA 3ONBA 3GUWA 1NAL1 4GCXA 3ITLA 1M53A 1IXNA 1F3EA 4CEXC 1NP0A 1A0CA 1OSEA 4H83A 3L0KA 4F0RA 4UTWA 4FALA 2TYSA 2FFCA 4AF0B 2WVVB 3KP0A 4EACA 2OO0A 1GGOA 4UZUA 1TPB1 1HGWA 3CH0A 3WEMA 3THCA 4ACYA 4HVXA 4UCGA 4V2XA 1H4PA 2WNQA 2D24A 1XIIA 3W9ZA 3MSRA 1JCJA 5A5WA 3CV6A 3HFTA 2RJGA 5HR7A 2QCGA 3DHDA 2J27A 4PB3A 2XVGA 4J7RA 3PZIA 4HZ7A 3ITTA 3WY1A 2VEPA 2WPGA 3QGVA 1Q7ZA 2DQWA 3I7RA 2HSAA 1FDJA 3W3OA 5C2GA 3UY8A 5LIWX 4JPGA 3PBVA 4PTWA 2VUNA 1KB3A 1QWKA 3LNMA 2X1SA 3CZGA 1XXXA 2WKJA 2GJXB 4EANA 1S5TA 1H62A 2EPLX 4LY4A 4CN1A 3EOSA 2E28A 1PCKA 4DZHA 4WXZA 3RLHA 1KFEA 3WLOA 1XV8A 2FHFA 1EYWA 3N2MA 4DYKA 4FEZA 1XLHA 4FLQA 3PUEA 2XZ9A 3MT1A 1WDPA 1GJWA 4J3UA 3PNUA 4QLJA 2QPXA 2XGIA 1Q65A 3P82A 3BLPX 1YDVA 3G1YA 3AHZA 3F1QA 2A21A 4Q4PA 2JQXA 4WCJA 5HMDA 3SCWA 3VNDA 1HO4A 1EKOA 1XPGA 3VNMA 1FQ0A 3BLFA 1PJ9A 3W7LA 2D73A 4WK9A 3EWUA 4FR6A 2PUZA 4DPQA 4CLMA 2XFWA 2HVOA 3E74A 5JBEA 1ZJIA 5D02A 4UOJA 3WQOA 2QCNA 2D1ZA 1T7LA 5BZAA 2ZZ5A 3FYPA 2WNWA 4P8VA 5H1WA 2FGBA 1SVDA 1B90A 2OZ0A 4W5UA 3P7YA 1ITXA 3O6AA 4PEEA 1P0BA 4Y9AA 4RZ4A 1GEQA 1C91A 1VRDA 2JKEA 1AW5A 1M7JA 2GSHA 3MMWA 4XZMX 3TNBA 3VKAA 3K8KA 4L65A 4GIAA 3CHCA 1KM3A 3W1UA 3BPWA 1XC6A 2QV4A 4M56A 3U2CA 1DWGM 4R5EA 1WBHA 3E2VA 4YHGA 3AJ7A 4ZO9A 3BVJA 3WQ5A 2E9BA 2I9UA 3NPXA 4F0LA 3ITYA 1IXQA 2INEA 4E2OA 1UA3A 3U6WA 1HVQA 1V0LA 3BLIA 2Q3RA 4U28A 4HCDA 2YKKA 4REQB 4G6CA 3ZVHB 4GVIA 4HU3A 2QPUA 4QEHA 3RYSA 1EXPA 1RCXB 3POHA 2FPVA 1CCWB 4JQ2A 1KM4A 1F4AA 3GNXA 1S38A 3QN3A 2MANA 1E4LA 4ATLA 5EY5A 3H23A 3VOIA 1QO5A 3O3RA 1EX5A 1PL9A 2QDHA 2I17A 3D6NA 4XZHA 2YDRA 1C92A 3VNJA 4O50A 4FA3A 4IUOA 3OG2A 1L6SA 3LMZA 4Z2IA 3SRFA 3R6IA 3OBEA 4ICCX 4PCNA 1V77A 3AXXA 2A7NA 3CUXA 3HPAA 3GC5A 1WKYA 3T7VA 4DWSA 1C9WA 3TQPA 4MYXA 2J7EA 2XH0A 4LAMA 3QF0A 4GX9A 4LEQA 3LLXA 4GJJA 3XISA 2YR1A 3IIPA 3P61A 3SEPA 2EAWA 4KEZA 3SY5A 4LALA 3W25A 3TTSA 4RNIA 3GG7A 4QNWA 2ALRA 2VRJA 1ZZMA 4ML9A 1OGBA 3T4WA 1QI3A 4H9ZA 5CH9A 5DX7A 3WD3A 1YDOA 3E49A 4MADA 2DVXA 1J0YA 3CLMA 2I5IA 3AHTA 4QEEA 3OPSA 5AOUA 3H2EA 3TCEA 1A4LA 4Z1AA 2WJFA 3B8WA 1VFFA 1J5TA 1PTDA 4YPJA 3WMLA 3OU8A 3TLQA 1IGWA 3A9BA 3HGJA 2QZRA 4FI4A 2RDWA 3N4FA 4GC3A 4QQUA 3GBDA 4B5WA 1E55A 1TV8A 4PE8A 3MUIA 2AMGA 2HNHA 2UY4A 2J8FA 3RPTA 4GH1A 4H6QA 2QIWA 3WQPA 3ARPA 4KRUA 3GD6A 5E0KA 5ABEA 1HKVA 1UZHA 4LCQA 1X1OA 2Y6ZA 3KTSA 1GVQA 4UNKA 1GHRA 3KXQA 2X0SA 3OA5A 4C6NA 1CGWA 5M5DA 3QXBA 4FR1A 3O1NA 4U10A 1JDDA 1YX1A 4X63A 2WLZA 4JKKA 3IVTA 3VK5A 4AYGA 3TN6A 4LUSA 2FPTA 8TIMA 4US5A 4HKPA 2HQAA 1LCOA 4L64A 1E1CB 5FIPA 2Q8XA 3CIWA 4MY8A 3HQ1A 2F2KA 4C6BA 3WLSA 4ZA0A 4AC7C 5GQBA 2JFEX 4NJIA 2CESA 4MNLA 1KTNA 3AIQA 4QCEA 2VFFA 3OW1A 3H55A 3CHVA 1F61A 2E6DA 1OG0A 1V3HA 1IEVA 2YZ5A 3A5VA 4JTKA 4Q8NA 3W24A 3MJMA 1OFBA 1XD0A 3ZIZA 1S1PA 3GXNA 3MMUA 4HA3A 1LDCA 2PS2A 1IT8A 4MWAB 5FESA 5LA2A 4G7FA 3H6OA 4GZ7A 2V6AA 4PCPA 4O52A 1BKSA 1SFLA 5A8PA 3ITCA 3BV7A 2Z1WA 2XG9A 2ZX9A 1TIMA 4S38A 1S2AA 4MKSA 3C2FA 3AHVA 4L4MA 3MANA 1UD4A 1FH8A 3VC6A 4OQVA 1TSIA 3N12A 4TOQA 1UW9A 2V2DA 2ZUVA 3KVLA 2C16A 1TYGA 4F8XA 2QCMA 3WLNA 2GZXA 5ECVA 4OV9A 5U7SA 3LCGA 4U5KA 3SCVA 1RVGA 4IX0A 2Y8KA 4DJDD 1BKHA 1V3LA 4IFRA 1QHPA 3WJSA 3SJNA 2XH2A 3SN0A 1W9BM 5D9MA 3TV8A 3UD6A 1JZ6A 1MW3A 2A3CA 1XFCA 1JFXA 4M80A 1RAKA 3GX9A 5CLWA 4IQDA 1N82A 1PCWA 4ORMA 4AU0A 2Z2UA 1VIWA 2HMCA 4QXIA 1LJYA 1GK8A 4C1NA 4IP7A 4GD0A 1OF8A 4DF1A 3WNOA 4XBSA 1R6WA 3BC9A 5CZ0A 1A53A 4J9JA 4GABA 3G0XA 1KTBA 2RGMA 1TWDA 1NQ6A 2C0HA 5E70A 1ZBWA 3NDZA 1QOPA 4BF9A 5E1QA 1E0VA 3CQKA 2H90A 3TSMA 1KV5A 3WF2A 2YCJA 3V1PA 1CXIA 3TX9A 1IE7C 2NX3A 2D69A 1H7PA 2GOUA 4EAMA 5AKQA 3CQ0A 3N25A 1XLBA 3TYDA 1OFAA 5D9OA 1EJWC 1OINA 3UJSA 1CZ1A 2Q02A 3GXMA 3KRZA 3LG3A 5E9AA 2BVWA 1L0PA 3VCCA 2PPGA 2HEJA 2QMJA 3MBDA 1TMQA 4YS1A 3MW7A 1R2SA 3D46A 3FY1A 3VAVA 3S47A 3WLMA 3NQ8A 3B8DA 3CC1A 1WUEA 1E6QM 5PTDA 4NT0A 1NDWA 3MKKA 2JALA 1EF2A 2F38A 1UP2A 3G3DA 3AYSA 4UQEA 3M0XA 3W76A 4UQ9A 5GJMA 4AISA 3W87A 4HN8A 1KFKA 4JTTA 3MMDA 4NF7A 1QAPA 1WDSA 1JCMP 3RXZA 1F6KA 5DXXA 4RNFA 5HATA 2X0HA 3C0SA 3RG6A 1Z69A 3S9IA 1JPHA 3MV11 3WUGA 1RZMA 3KWSA 2XIIA 5GJPA 1OHLA 4NKCA 1Z9AA 4OBTA 3BW2A 4F40A 5AC5A 2ZBTA 3UXIA 4QQ3A 1LQAA 4GVGA 4MB5A 1LG2A 2ZE0A 3T2OA 2NW0A 4WDWA 4OOZA 3TR9A 1XLCA 4NJGA 1JDAA 1EJ7L 1JRBA 4CQ9A 1EBGA 3NGFA 3UGRA 1K77A 3BCDA 3WUFA 3G1SA 2YB1A 1K9EA 1M1BA 2PDJA 4H9VA 1H50A 3S1VA 4LYKA 1RP8A 2GK1A 4FB7A 1UWRA 4EX4A 3NL2A 2ANUA 1DIDA 1W6TA 2GUYA 2QJMA 1W3LA 2WO5A 1SZNA 3S4TA 5BCAA 3S6TA 2VVSA 4UBPC 2ZXDA