3UNDA

Substrate-bound crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
283
Chain Sequence
GSMNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDVTHSLQCRDPLGDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRARCDGPSALPLHQLEGLLSQMKAIDDLVKRMPALEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase 2
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 95
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3undA00
5D2XA 4ZQCA 1G7VA 3W1QA 1IF2A 3N2XA 1YYAA 3HOJA 3M0ZA 4OV9A 5K4ZA 2W79A 3DU0A 1FWNA 4X9SA 3TJXA 1W37A 2PRLA 1RV8A 4AF0A 3G1DA 4ZMGA 3HGJA 4DBDA 1K8ZA 1GVQA 4G1KA 1QPRA 2CZ5A 4ORMA 3SZ8A 5EA9A 1EX5A 4LVBA 3TA6A 1GYNA 1XBYA 3BVJA 3QQ1A 3GX9A 2WV8A 4KKXA 5BW6A 1OF6A 2OJPA 3W3OA 3GAYA 4GFSA 5F1VA 3F4WA 3E02A 3PB0A 5FEZA 3TFCA 4AWTA 3CB8A 4AWUA 1DORA 2DJXA 4NNBA 3TXZA 3TW6A 3MP4A 3PUDA 3NQ6A 1TQJA 4RCXA 2WPBA 1ML1A 3O8AA 4RV8A 3CIXA 3W2LA 4BI6A 1FWWA 1OFRA 3TXVA 2EHHA 4HNVA 3SI9A 3VCRA 4CCDA 3HJZA 5AC6A 1A5CA 1OK6A 1LBLA 1AMKA 4O16A 3LRMA 5LHEA 3G3DA 4JTKA 3FJLA 3FFSA 4LVFA 3LBCA 1H51A 3ABOA 4UNKA 3DFPA 4AB4A 3PBWA 3PUEA 2BXVA 3EX6A 4R53A 1TTJA 4GUIA 1RQBA 3EB2A 2WKJA 2VKZG 2DZUA 3BV4A 2I14A 4QNEA 2CLIA 3WK1A 2FLIA 4QSHA 2QJHA 1TSIA 3HGOA 3JR2A 1RVGA 2VFDA 2Q3RA 1KA9F 3TQVA 1JCXA 5AFDA 3W1RA 4DEFA 1HO4A 1FY6A 3PULA 5LZLA 2R14A 4JTTA 3L5MA 2C16A 2O7SA 5I3HA 3C2RA 4LS0A 3A22A 2CLKA 1W3TA 2E09A 3TROA 1RPXA 2VEIA 3GLCA 1AW1A 3B0PA 1QMLA 3UWQA 3NQEA 1X1OA 1KM1A 2JKAA 2ZZ2A 4I7UA 3KVLA 2Y63A 1W5QA 2E77A 1EA0A 2GVJA 3S1VA 3W7RA 2QCEA 5BNKA 2WNNA 4K8EA 1Q6OA 1Z48A 4BFAA 2TMDA 4EVZA 1LRTA 3E0IA 4MOZA 3W1UA 1P1XA 2X16A 3TV8A 4YLWA 1OFOA 1TJRA 3TC6A 4OWGA 1G4TA 3W1NA 4MYXA 3GDKA 3BLEA 4QIUA 3W7MA 2YYTA 3WJYA 1JCYA 3EKLA 5DBUA 1GT8A 3R13A 3IGUA 2CLOA 3LHUA 3KX6A 1I2NA 2QF7A 1K3UA 3DFOA 3S1XA 3BLFA 4S2CA 3LM7A 5EBUA 4DF0A 4XTDA 1K7XA 5HWJA 4TMBA 3HGRA 3UPWA 4ADSA 4NX0A 3W7QA 1W5PA 2C18A 4POCA 5D2TA 1KTNA 3C2OA 1UBSA 3GXNA 4GXMA 4HPJA 4HIBA 2FB2A 1F2JA 4O1AA 4A21A 1W5OA 5D05A 2CFFA 3ABRA 1BWKA 2OCZA 1WDWA 4O13A 2H8XA 1DKWA 4I7WA 1AW2A 3ZR4A 3IGXA 4Z1CA 1H61A 3QMTA 3B8DA 1FBAA 3G1HA 3M7WA 4ADUA 1B9BA 3VFLA 3THQA 5G2HA 1TIMA 1KW1A 3LX9A 3FIGA 3GVGA 1JUEA 1TYGA 3W1MA 2TRSA 3KRSA 1JRCA 5IBXC 4AVFA 5HUPA 3G1SA 2YZRA 4IMGA 4LC8A 1OYAA 1IIHA 2Q8LA 3M1ZA 1O5XA 4UMCA 3PG9A 2ABBA 3LHZA 3SFKA 5AYZA 3CQ0A 2VFGA 4FB7A 4JTFA 2QUTA 3LHTA 2I1OA 3GNNA 1GJPA 3W6YA 3NOEA 3FOKA 3W72A 1SFLA 1YDVA 3L9CA 4E38A 1DQXA 5EL1A 4EIVA 3RLVA 1G7UA 2DZWA 4AHPA 1TB3A 4ZQPA 3QM3A 1XKYA 3Q2DA 1VC4A 4JICA 4L4MA 2NV2A 1KM0A 3I65A 2DORA 3GYEA 3EXTA 3C0JA 2Z2UA 1OJXA 4WQ6A 3LHYA 4UIOA 4AHQA 1GVSA 2A7PA 2Y61A 1DHPA 1UUMA 2Y85A 3OHIA 3UZJA 3HPXA 4KFOA 3S5OA 1H60A 2BSLA 1KV8A 2AGKA 1FCUA 3W7OA 5GVJA 4UR7A 3S42A 3MI6A 1OX5A 4UTKA 3O63A 4IGHA 4B5NA 1TPUA 2B7OA 4GE8A 1ZAHA 3P82A 1TO3A 1R47A 3B4UA 4N9CA 1I2QA 4N9BA 3L0NA 1VYPX 3WFAA 5D03A 1NF7A 4MYAA 5D32A 1EP2A 3QW3A 4NX5A 3USBA 4WY0A 3LCHA 3W1TA 5HUOA 4AF0B 4JTEA 3PVFA 1TTQA 3S9YA 4O8RA 2C19A 5C55A 5ABTA 3S6DA 2YCEA 3CT7A 4ADTA 5CPNA 1VZWA 5C2XA 1GWJA 1K02A 4M6PA 4ZZ9A 1KLZA 1B3OA 4LW7A 2ZTJA 4AXKA 3G0XA 3W1AA 3LDVA 1B4EA 1VH7A 4O11A 5FF0A 1DVJA 3KVKA 3R5EA 4IX0A 1JCNA 3NG3A 4LRSA 2JKEA 2RDUA 1TV8A 1SSDA 4FIRA 3TNOA 4LRTA 1O95A 1TTIA 1KTCA 4QNWA 2ZTKA 3O15A 1R2SA 5D02A 4NJKA 3LCLA 3P7YA 5AN7A 3G1FA 4YXGA 1EWEA 2DJLA 1MEWA 1JUKA 3N9SA 5DXXA 1DQWA 2Y62A 3HPSA 4MFDA 3EX4A 4N02A 1K7EA 3KVJA 3S1WA 2D73A 2Z6IA 5DY3A 1VHCA 4RLIA 1ADOA 4YWIA 5H91A 1TPH1 2XFWA 2HS8A 2TPSA 3U2OA 2HS6A 4K6AA 1RZMA 4N9DA 1ZCOA 2ZCGA 1F6KA 1LLWA 5E0KA 4X2RA 5KITA 2A7RA 1XL9A 5CZJA 4MZ8A 2A21A 3NL3A 1SPQA 4O1DA 2CU0A 2WNQA 3NZRA 3CC1A 4O10A 1GQNA 3C8FA 3L21A 3ZS4A 1SW7A 1TPEA 3C2FA 4TO8A 3JRKA 4FNPA 1GVFA 3EWWA 2X2GA 4HT3A 4QISA 5I3IA 3QMSA 1JQXA 1LOLA 3M5XA 2ALDA 4JS3A 2V9DA 3EX2A 3NM1A 1CW2A 1W3IA 1KM2A 2YFOA 5U7SA 4W9TA 2NXHA 3IRDA 4PFMA 2AAMA 3QEZA 2QAFA 4IQLA 4MKNA 4CCEA 3CIWA 3SR7A 1ME8A 3O6DA 1AL7A 1SSGA 2W6RA 2NX9A 1YDOA 4DELA 4AWSA 4JIPA 4O12A 3DFTA 3N2MA 5AHEA 3IVTA 1LRQA 3NR0A 1X6UA 1SW3A 4FXSA 1XFBA 2B0MA 1KM3A 1BEUA 1VCVA 1X8FA 5FF2A 3BGGA 4RXGA 4C1LA 4GUFA 5LNUA 1PV8A 4MIMA 4R34A 3A24A 3G1YA 5CZ0A 5J5DA 3LRKA 4X3ZA 4UFKA 3M16A 1YLVA 4RJEA 2QCNA 5U4NA 2Y7FA 1LBFA 3C2VA 3C56A 3TSDA 3LV6A 4JTSA 1KM5A 2YSWA 4NNCA 2JGYA 1SQ7A 2ISSA 3FYPA 3H55A 3TMQA 4IPJA 4O1BA 2A6NA 2QR6A 3L0KA 2Y7EA 4ALDA 2QUUA 1GVOA 4O4VA 3S1UA 3W2NA 1M5WA 3LI0A 3PSVA 3TU9A 3TSMA 3G0SA 1K8XA 5D09A 4DF2A 2QAPA 2G5WA 4JX6A 4EOUA 3HG3A 2ZRYA 1KBJA 4P2VA 3EXSA 5D30A 5F4WA 3G3MA 4O1CA 4CNNA 4MJMA 1KFCA 3KVMA 4XZ9A 4GRSA 5HR7A 1QPNA 1I8JA 5DCBA 1NAL1 3BLIA 4ZQOA 3MYOA 2ZRUA 1GEQA 3ABSA 4JN6A 3T55A 1QPQA 3CM4A 3VNDA 1FXPA 3M41A 2WSRA 5LGXA 3SSJA 4UC5A 4Z1DA 2FPVA 2V5LA 4JDYA 5C54A 1UJPA 4OV4A 5A5WA 3L5AA 5L6UA 3P8JA 6ALDA 3BG9A 3EX1A 3I7QA 1G4SA 3MP5A 3MP3A 1O4UA 2Y70A 2QCCA 1H7WA 4MLJA 3LCFA 3FS2A 3L68A 5G4WA 4JNMA 1TPC1 1FCVA 3W84A 3ABQA 5DBTA 4MFEA 2A0NA 4Q33A 3UWUA 3L5LA 2CLEA 2VEPA 4HNTA 5CPLA 1VR6A 5BRBA 2J24A 1T0OA 2V2HA 4PL1A 4JTIA 1QCWA 3LV5A 4WXZA 2BX7A 2QJGA 1I45A 1GOXA 1PCKA 1SO6A 5IBXA 3NPXA 4JTGA 1WXJA 2NX1A 4GC4A 1R46A 2NWRA 1A5BA 1G4EA 4WY0B 2F84A 3M5VA 3KHJA 4Y8FA 4XQ6A 5E93A 2DZTA 5KSWA 1ZNNA 3NEVA 2WSYA 2GJLA 4O4WA 3TW7A 2OX1A 3E96A 2DP3A 4YL2A 5DELA 2ZDRA 1M7OA 4TU1A 1GZGA 3TH6A 3M43A 5I3FA 3RK8A 5KINA 4JR5A 3MI2A 1H7NA 4Z1BA 5LGZA 1TRIA 1XDLA 2Z0IA 1NEYA 1CI1A 2DZSA 4ICNA 3IVUA 1VYRA 2VFFA 2B4GA 3BW3A 4JTLA 4RX0A 3EEGA 3W22A 1Q6LA 3DENA 3EWBX 2WNZA 2GQ9A 3QFEA 2EKCA 3MMTA 1ZHAA 4LWWA 3W75A 5FF4A 1J5TA 1BWLA 3UD6A 3U8GA 3W2UA 2ZZ5A 4GUJA 4WUIA 5HJLA 1LZOA 1SU5A 2QCLA 4RK8A 5K2ZA 3GKFA 3TCEA 4MVAA 2RFGA 5D04C 3OEXA 2NWSA 1WQ5A 4LNYA 1VLWA 1C29A 4IOTA 3GDRA 3W7EA 1MEIA 1MXSA 4UFMA 3MUXA 3DAQA 3N19B 4LVDA 4MY9A 3FKKA 2CZDA 4KFPA 4FNRA 1LLZA 2C6QA 3INPA 4CNPA 5DN1A 3LLFA 1SZGA 1X1ZA 3QYQA 2QDGA 1ICSA 1G67A 4ZQMA 3CHVA 3IIOA 2X1TA 2YDAA 4M7TA 3W7LA 4AH7A 1OYBA 3BARA 1A50A 4A2SA 3BW4A 3ELFA 4MZYA 1OYCA 4K38A 4OQVA 1L9WA 3LHVA 4UFIA 1QDSA 3TKFA 2FIQA 2OT0A 2QCDA 2ZRXA 1Q6QA 4H4IA 4K7VA 1DV7A 3DGRA 3QSRA 3W86A 3KFTA 2X1SA 1F7BA 1QOPA 1OK4A 3CU2A 4XWUA 1EP1A 3SW6A 3TSBA 4FX6M 3RFAA 4O52A 3NVTA 2FPTA 5FESA 2V8ZA 1XDMA 3EKZA 3LCIA 5DY2A 3T44A 3W23A 4IMDA 4Q4KA 1LROA 2E6FA 2P1FA 2FPYA 3OA3A 3CPRA 3NZ1A 3HQ1A 2Y7GA 3GKAA 2QKFA 4WOQA 3ZFHA 3ATZA 4NJJA 3FKRA 1PCWA 1F5ZA 3P84A 1VHNA 1PVNA 5E1QA 4A2RA 1LRNA 1H1ZA 3NM3A 1DOSA 4FNSA 4UTHA 1W54A 5F1UA 4O57A 1A5SA 3T7VA 4OE7A 3T4CA 2Q3OA 5LHFA 1JCLA 1KFBA 4UTWA 3GDLA 4AEOA 3BW2A 2A85A 5HINA 2C15A 1KM4A 1WBHA 3DBPA 5FEPA 1UB3A 3ZWTA 2NXGA 3FJ6A 4NVTA 3M44A 1W56A 1SO5A 1G6CA 3TR2A 4JTJA 1MO0A 4E2DA 5CPOA 3W7HA 1PL9A 3TFXA 5AHIA 3SGZA 4LV4A 4QQ3A 4CQ8A 1ONRA 4NQ1A 4BWLC 3Q37A 4FXRA 5G1TA 3MHUA 2BLEA 4UMBA 4TX9A 4FX7A 2RH9A 3C4UA 2JGQA 4YMZA 1Z44A 3G22A 1S5VA 2RHGA 3W87A 5F4XA 1K7FA 3PWAA 1R2TA 3P81A 1FDZA 2NX3A 3UNDA 3EWXA 1YADA 2B7PA 4U4MA 5HULA 1NF0A 3NO5A 4O0ZA 1H50A 1H7XA 3UY8A 1C8VA 3NL6A 2YGYA 3LRLA 4NJHA 3BK0A 3W74A 5KMYA 3P5YA 4DBEA 3CEPA 3GZ3A 2VXNA 4TR9A 4CNOA 4QJ1A 4OHQA 4LVGA 1ZAJA 1D3HA 2P10A 3M5ZA 1LTDA 3QZEA 2WQPA 1I2OA 3STFA 3DKLA 3U6WA 3AJXA 1SO3A 1J4EA 3CTLA 3F4NA 3KAOA 3NGJA 1FWSA 4J9JA 3LTSA 4JGDA 2QCFA 1SZNA 4KFNA 2GOUA 1EIXA 1PHQA 2J88A 3UWYA 5AB3A 3TQ0A 2V5BA 1ZALA 3NYZA 1LORA 2JK2A 4FEZA 4FNQA 2YXGA 1MZHA 4CQAA 1JVNA 3G1AA 4JYEA 4UNLA 1SUXA 3TMLA 3DHFA 5HQEA 3FEMA 2WOQA 3NNTA 2V0TA 4FX8A 1ZJIA 2NXIA 1D3GA 1FUYA 3C3NA 4MUZA 1XBZA 2NUXA 5LNVA 1DJQA 3IEBA 5F2LA 3O16A 2WO5A 1QWGA 3KOFA 4UFJA 1H7PA 1VLIA 2ZA1A 5BMXA 3P74A 2VELA 4JYFA 1KM6A 4HN4A 3Q94A 3NPVA 4WX2A 1RR2A 3EX3A 1XBVA 2YX0A 1GG0A 2ATMA 1LOQA 4NZJA 4P61A 3V1PA 4YCPA 2R8WA 4K7YA 3O07A 3P8IA 2A4AA 4DO5A 2KZHA 3C61A 3WJZA 4JIQA 3FA5A 2QUVA 3BO9A 3NQ2A 4RZ6A 1ZENA 3UWVA 2B7QA 4Y9AA 1W5MA 4HHPA 3HPZA 3NQ8A 3TAOA 3DI0A 4K39A 4FNUA 2YYUA 1Z41A 4PCFA 4UCGA 1L6SA 3ZWSA 3LI1A 3AO0A 3E12A 1NFBA 1JRBA 2C13A 3FYOA 3D0CA 4ML9A 3PB2A 2Y6ZA 4E0CA 2E6DA 2E5DA 3GK0A 4IMFA 1R2RA 4IXXA 1TREA 4UTWC 5F2GA 3DH7A 2ZYFA 4M5PA 3W07A 1QPOA 1SW0A 3L66A 2NV1A 1Y0EA 5TBOA 3GDMA 1GVRA 2VENA 3W2MA 2XN2A 2B7NA 1S3HA 3GXPA 5D33A 5KZEA 4RKAA 3I7RA 3NQDA 1R30A 1DL3A 1U5JA 1FX6A 4NUWA 4FNTA 3NL5A 2X1RA 5TQLA 3UWWA 3HG2A 1KV5A 4DXVA 3UXDA 4IJBA 1VQTA 1A5AA 2QJIA 3V75A 3SJ3A 4AHOA 3PAJA 2G97A 3O6YX 1VYSX 4XUGA 2FDSA 1EPXA 2DZVA 3LXCA 4UTJA 3NAVA 2ISVA 3DZ1A 4GUGA 5D2YA 3TE9A 1W8SA 5D37A 1W1ZA 2YPIA 3OG3A 3STEA 2QCDB 3QQ0A 1JULA 3M6YA 3TX9A 1X7FA 2JKPA 4FHAA 1QNVA 3PBVA 2O7QA 8TIMA 4DO4A 4N2YA 1ZFJA 4DF1A 3QRHA 4EF9A 1SO4A 1S5TA 1SZEA 4M7SA 4A22A 2HSAA 2ZZ6A 3I7SA 2E5CA 4TIMA 4WY0F 2ZRWA 3LXAA 3THAA 1QAPA 3P61A 1GG1A 3TIMA 1Q3NA 3S5ZA 4X22A 1ME7A 3PR2A 2WSQA 3A5VA 3TJLA 3WJWA 5CSSA 3LB0A 4Z08A 3W1LA 1SZFA 4LUJA 1E51A 2YW3A 5FEWA 5LNRA 2ZRVA 3JS3A 5EYWA 5G5IA 4PTNA 1XBXA 3T40A 1H62A 3A5FA 1KFKA 1ZY9A 2VC6A 2FJKA 3CWNA 3UXAA 4XKYA 2GPTA 1J2WA 4IWWA 1JQVA 4ZL1A 1TPVA 3IIVA 2G96A 2ZA3A 3B06A 3VI2A 4ZVJA 1P0NA 1OFQA 5C5YA 4HNNA 3OVPA 3PBYA 3P62A 1XM3A 4BF9A 2ABAA 3QPYA 3M9YA 4HSOA 3IVSA 1OABA 1BTMA 5FI8A 4LVAA 3NQVA 3KXQA 3HIJA 3W71A 4NU7A 2X30A 4LC6A 3BPWA 1NVMA 4C1KA 4JY9A 5CZSA 2GVLA 3EWYA 4MY8A 3HB9A 5MHBA 2VFEA 5AOUA 1TRDA 2V2DA 3UWZA 1ICQA 1AK5A 3G0UA 2E5BA 2YW4A 1VCFA 2QDHA 3N9RA 5F2MA 3TK7A 2CZEA 1TPDA 3N73A 2BZNA 1LYXA 1LOSA 4CLMA 2ZBTA 3G8EA 4S1FA 4JX4A 3EWZA 1YPFA 2H3DA 2GVGA 2Y88A 5SWUA 2FQIA 3KRZA 3NQFA 5F2IA 2H90A 2NLIA 3S5YA 1WA3A 1A53A 1W0MA 3B05A 4WOZA 4K36A 2ATSA 5CSRA 4KWVA 2R91A 3GR7A 4N6FA 1SFJA 5AC7A 1EB3A 4O28A 4TMCA 1KBIA 2PRHA 1DJNA 2Y89A 3MBDA 2HTMA 4YCOA 2E6AA 2NZLA 1EUAA 3G1VA 3TUUA 2OZ0A 1TPWA 2ZZ7A 3UZ5A 1TV5A 1H63A 4NJIA 2CLFA 4HKPA 5D2WA 4O18A 1EP3A 1Q6RA 3N3MA 2VEKA 3NQMA 1O5KA 3IIZA 1HO1A 4CCCA 4BWLA 4RXFA 2RKXA 3LBMA 3IIXA 1H7RA 1LDCA 4L4LA 1PS9A 1XUZA 4ZQRA 3DXIA 3L65A 1ALDA 2ZZ3A 1MEHA 2V82A 4UTTC 2Z1BA 1OX4A 2CLMA 1IXQA 3IGSA 2X1UA 4O15A 3B0VC 5C6MA 1YXDA 2G95A 4Z0JA 3B03A 2LLEA 2I9EA 1JCJA 1H7OA 3LCXA 4UTMA 5KTLA 5A8GA 4UTLA 4K37A 1HFBA 4R33A 3OBKA 3LGEA 4XBKA 3I68A 4RR4A 3NQGA 5AC8A 3NXFA 4JXCA 4M6QA 4H3DA 3W7GA 2J9YA 3NDOA 1OFBA 1YTKA 1FCBA 4UXDA 5G2WA 4DPQA 4LU0A 2ZRZA 4M6VA 2DZPA 1XCFA 2VEMA 3C6CA 2BWGA 3W7CA 2Z6JA 4JEQA 4BR1A 3C2EA 5I3KA 3GR8A 2V2CA 3OIXA 1TCDA 2ISWA 3LTYA 1QO2A 4OBTA 1VCGA 4U28A 3DFSA 3QC3A 3N34A 1KFLA 5L9FA 5HWNA 1FQ0A 1AW5A 1B4KA 5AHNA 3R12A 5AYXA 5G1YA 4IUOA 3W76A 5KZMA 1JUBA 2QCMA 5CZTA 1EWDA 3W1XA 1OFEA 3STCA 5FF3A 1EEPA 3PG8A 5CGQA 4QAIA 4UTUA 5BMWA 2C14A 1MSSA 3DFQA 1Q45A 4GBUA 3SY5A 1ZAIA 2C1HA 4MLRA 3WK0A 1HTIA 3VE7A 3NA8A 3W7JA 4UFHA 4N6EA 1OVDA 5I3GA 3NL2A 1YTEA 3CEUA 3S0CA 1JCMP 1TPFA 2ZZ1A 4LV9A 2EGZA 5FF7A 1PIIA 4I7VA 2A1YA 4PA8A 5KZDA 4Y96A 3P60A 3PM6A 1OFPA 4JTUA 4LY8A 4LTSA 2TSYA 3WJSA 1HG3A 5HNRA 5I3JA 4HSNA 1XXXA 2NUYA 3RMJA 1OX6A 3VE9A 1F76A 3NQCA 4PL2A 1TQXA 3W7NA 5CPMA 4WZHA 3K30A 3QMRA 1THFD 2RDWA 4WXYA 1F74A 3QJAA 3GB6A 2DU2A 3WJXA 3PF3A 1YDNA 3W2KA 1UUOA 3UY7A 3TDFA 3F03K 5H2ZA 3MYPA 3HMJG 1XI3A 2NUWA 2E6YA 2GQAA 2GUUA 1GYLA 2A2IA 3L67A 2PE4A 5EPDA 2DZXA 3PC0A 4JY8A 3R89A 2EAWA 3GDTA 1I4NA 5DCEA 2HMCA 1SR9A 3STGA 1WV2A 1IXNA 2Q8ZA 2H3BA 3NQ7A 3UQNA 3QH2A 4AAJA 2FTPA 3W83A 1FXQA 5G2IA 3R8RA 2CZFA 2QEZA 4JDBA 5LNWA 3VKJA 5T26A 5HWMA 5AHLA 1L2UA 1ME9A 2ZFAA 4PH6A 4PC8A 1PE1A 1IXPA 3NPWA 4JTHA 4BI7A 1OG0A 2CW6A 5EY5A 3L2IA 3RF9A 4PODA 5G4EA 1FWTA 1XUUA 3GAKA 3NQAA 4LUIA 3W73A 4D2JA 1KFEA 3W7IA 4FO4A 3B0UX 1QFEA 3R2GA 6TIMA 4JYDA 2W0UA 1FWRA 1JJKA 1KTBA 5F4SA 3OVRA 1VJIA 2C0AA 1FCQA 1AG1O 4KWWA 4UFLA 5CKSA 4ORIA 4XKYB 4I9AA 2XN0A 1WOAA 4FIQA 1K8YA 3BG3A 4UR8A 4MY1A 1HUVA 4EWND 1D9EA 1S5WA 3W7PA 3LCWA 3H53A 5DCDA 1IXOA 1F6PA 5D2VA 3W2JA 2ZQ0A 1B57A 3MBFA 3LERA 3PUOA 4UTIA 3HO8A 4UMAA 4E2BA 1EUNA 4PEKA 3IIPA 1WBJA 3DI1A 1L6YA 3RLUA 3HGSA 3DHDA 3YPIA 1N7KA 1LP6A 4MZ1A 2H8ZA 2PURA 5EMUA 3MHGA 4GJ1A 1VPXA 2E1DA 2GJNA 3LCGA 1HL2A 3CWOX 1C9DA 4AMAA 5HR6A 3EWUA 3GXTA 4IPIA 1P4CA 5DLCA 5K9CA 4IX2A 2A6LA 3BGJA 1T99A 3N14A 5CG7A 3BG5A 5K7JA 2UV8G 1M6JA 1YPIA 2GQ8A 3DFNA 4NZFA 3O6CA 2RDTA 4R7JA 3TQKA 5K9DA 1DBTA 2OMAA 5K3VA 1W3NA 3EXRA 5HMSA 4GUHA 3RNDA 3LXBA 1GPWA 1IGSA 3QSTA 1VRDA 1OF8A 3G24A 4DQWA 4BI5A 2C3ZA 4Q32A 3NPUA 3W7DA 1OFAA 3DKJA 1CX9A 1Z42A 4MJZA 4DO6A 1M7PA 1LM1A 1LBMA 4S2BA 3UYCA 3MI3A 3MJYA 4WD0A 5DXYA 4Y90A 4HNUA 4OGZA 1OFDA 3W88A 3UPBA 4O19A 5LSMA 2FB3A 4N4QA 1AL8A 1WOBA 4NNAA 1UASA 3P80A 4LS1A 1V5XA 4Z0SA 1V7YA 1OX4B 1QR7A 3O1NA 3QPZA 3MW7A 4IMCA 4O0KA 2IQTA 5BOOA 3O05A 1O60A 1P0KA 3PY2A 4O17A 1O94A 2TYSA 1N8FA 4O53A 4O54A 5AYYA 2PCQA 3HG4A 5FEXA 4CQ9A 3P67A 3WK2A 3ATYA 3PSWA 3Q58A 1UCWA 4GNJA 3O06A 3S5NA 1YXYA 3M47A 3P5ZA 3G1XA 2VOMA 1KLYA 2YR1A 1W5NA 4RZ4A 1N55A 3A23A 5K4XA 2VFIA 1RQHA 2J9ZA 1P5BA 1L6WA 2J6XA 3MHFA 1WAUA 3G18A 2V30A 3RU6A 3QW4B 4QITA 1WX0A 1G69A 4LS2A 1OHLA 4LOCA 3SIZA 2H6RA 2ZA2A 4NJGA 1TJPA 1JR1A 2EPHA 3A9IA 3F1QA 4UTTA 1GTHA 3LTPA 2WJZA 4LT9A 1LCOA 7TIMA 5EKYA 1W31A 1H5YA 2BTMA 1TPB1 2PRMA 1QO5A 4N9EA 1I2PA 3T78A 5J5RA 4GWEA 5IM51 4UUIA 2VFHA 4OT7A 4QM1A 4K8HA 3SECA 3W70A 3W7KA 3E49A 3LOTA 4IXHA 1KFJA 4IMEA 2J27A 1RQEA 1VGAA 2QCGA 2V81A 2YFNA 3A21A 3W9ZA 1TTPA 4DPPA 5AHMA 3CLMA 5LNSA 4N4PA 3OVQA 4M19A 3L0GA 1T96A 4A3UA 1YXCA 3FLUA 4O14A 2OT1A 2R94A 3WK3A 4BK9A 4Z1AA 4XTIA 1VS1A 2F7FA 4ZQNA 1IIGA 1FDYA 2CLHA 1ICPA 2EF9A 3GIYA 5LKYA 3M5YA 1TV7A 1WYIA 4EF8A 3ANYA 4MPQA 2J9XA 4NT0A 2A5HA 3IV3A 2Y7DA 3B04A 2A7NA 2AQWA 2FFCA 3PS7A 3GNDA 1YTDA 3TAKA 4WJEA 4XBSA 1BKSA 3G8RA 1F73A 1QOQA 2CWNA 2ZZ4A 3C52A 4HPXA 1F05A 1U83A 4JD4A 4NXKA 3QF0A 3HG5A 4Y6GA 2E68A 5AHFA 5TIMA 3H54A 3I6RA 4O50A 1H1YA 3SGUA 1T8XA 2QCHA 3W85A 1I2RA 3S8HA 1PHWA 4A29A 4H6KA 3MO7A 4OU1A 4JX5A 1GTEA 1G4PA 2XN1A 3TC7A 3E9AA 5K9XA 5D38A 4FF7A 1NSJA 4RZ5A 3LLDA 1TMHA 1FDJA 3MWAA 4ONVA 2PC4A 1XC4A 1RD5A 2JBMA 1K03A 3W1PA 3HF3A 2CLLA 4NXSA 3HBLA 3PBUA 2P0OA 3LHWA 3KRUA
chains in the Genus database with same CATH superfamily
4AU0A 1Y65A 4ZQCA 3GUWA 3N2XA 2A3EA 1YYAA 2BXZA 3M0ZA 3DU0A 3URNA 1XRTA 3CHFA 1GNXA 4FK9A 3HGJA 1F9CA 4HMDA 1GYNA 1XBYA 1FOBA 3BVJA 3QQ1A 3H26A 1OF6A 4XZHA 4F2TA 2OJPA 1T6MA 3GAYA 3B8UA 2XJ7A 5C9WA 1W1VA 4AWUA 1VFFA 3PUDA 1TQJA 4RCXA 4Z17A 2JIEA 1J9YA 1V6XA 3B8TA 4GI8A 4LUTA 4XKMA 4HNVA 4IIEA 1ONWA 3VCRA 1MQRA 2WMIB 2HQAA 3HJZA 4ZO7A 5AC6A 2VCCA 1A5CA 1J6OA 1LBLA 5LHEA 4JTKA 3FJLA 4URIA 3LBCA 3ABOA 1DHKA 2QW5A 1E4NA 2BXVA 4L56A 1J2BA 3GU9A 2VKZG 3EB2A 2WKJA 3VCCA 4JHOA 3A12A 1JPKA 3PJUA 3GG1A 3AHXA 3T42A 2FLIA 1VBJA 3MUCA 2QJHA 4A3HA 3JR2A 4H01A 3A6OA 1RVGA 2DPEA 2VFDA 2NV9A 3SB0A 3OA5A 5AFDA 3MQTA 3AS0A 1WZKA 3ARRA 4US6A 4F8XA 4OJYA 1XLDA 4MJ4A 1EHAA 3WLQA 4D6IA 2XIIA 2C16A 1ZUAX 5IFPA 2Y24A 3TROA 3FYYA 1RPXA 1QMLA 1V79A 4QE4A 4UBPC 1OZQA 2JKAA 4HGXA 3OG2A 2YXXA 2GVJA 5T91A 5BNKA 4K8EA 3GYCA 5EBAA 4EK7A 1LRTA 4YLWA 3WD0A 3N4AA 3NVDA 3O9NA 1UROA 1G4TA 3BLEA 1B54A 1GT8A 3MV11 5TF0A 2CLOA 2J7EA 3KX6A 2YDQA 3R0KA 4H04A 1I2NA 1TVNA 3S1XA 2GK1B 2QJJA 3BAKA 7PTDA 1MNSA 4NY2A 1UG6A 4ADSA 4AIBA 1FWIC 4HNOA 4XBJA 4OIFA 1KTNA 5DQPA 3C2OA 3OHMB 4H83A 4GQBA 1YKWA 2I7GA 4PUUA 1W5OA 1UP2A 1F3XA 3LA4A 1OADA 3RG6A 3ARVA 2AL2B 2BY3A 1Z9AA 3OYZA 1LT8A 3UETA 1AW2A 2IQDA 3IGXA 5HMFA 4Z1CA 3QMTA 4HJFA 1FBAA 5AVHA 4JFSA 3VFLA 2YXOA 1TIMA 5LIWX 9XIAA 1UWTA 3S1GA 4ZE5A 1E55A 3VGGA 3W1MA 1QI5A 2WJEA 3R0UA 2VX6A 2VOTA 2VZSA 4W4QA 3WLHA 4ZFCA 4EXQA 5HUPA 3W27A 2YZRA 4S3KA 2Q8LA 1HKKA 4JKKA 2KX9A 1G01A 3W02A 2ABBA 5I03A 2E9LA 3LHZA 4M3PA 3WQOA 5AYZA 1B3VA 4ZOEA 3R58A 2ZUSA 3W6YA 1YDVA 1JXJA 5JBDA 2OFJA 3QM3A 1QRQA 1CXEA 4JICA 3TOYA 2NV2A 1V3IA 3I65A 4H9UA 2WVVA 4WQ6A 3LHYA 2TODA 3M0KA 2HCVA 2FZMA 1C8YA 5IFTA 3S3GA 3UZJA 2QIWA 5AY7A 4MAVA 1UWIA 3SFWA 1YPXA 1H60A 2AGKA 2PLMA 4DJFD 1KB3A 1KKRA 4UR7A 1OX5A 4REQB 2OX4A 2WZEA 1W1A1 7XIMA 4JQ1A 4CD8A 3CUZA 3LU2A 5IXEA 1ZAHA 1TO3A 3THCA 4AEEA 2X42A 5D32A 3E38A 3QW3A 3USBA 2E3ZA 3T8QA 3HV8A 3CHEA 1JPIA 1TUXA 1FP9A 5FIPA 3S9YA 2C19A 4V2XA 5C55A 2P0IA 1SJDA 3NSMA 2PDIA 2G37A 4WF7A 4GY7A 1K02A 2XHYA 3WH5A 4V15A 3W1AA 1JGIA 3N1AA 2VVSA 1VH7A 4O11A 2J7FA 3RPTA 3DYPA 3R5EA 1JCNA 2VJXA 4JN8A 4XB3A 1TV8A 1SSDA 4LRTA 1BLIA 4GZEA 3VINA 4DBWA 3UNTA 4LUTB 3O15A 1XQKA 2PGWA 3P7YA 3NZPA 5AN7A 1ELSA 2FZBA 3UJ2A 2C91A 4YXGA 2DJLA 2HVMA 1YQ2A 3BOXA 1DP0A 2R1LA 4I90A 4MFDA 1CTNA 2AGTA 3EX4A 3KVJA 3GM8A 2C7FA 2Z6IA 3TN5A 5DY3A 1IZJA 1ECEA 4MNJA 1R3RA 1LQAA 2XFWA 4PUEA 1NY1A 2HS8A 4AISA 2CNCA 2HS6A 2PDNA 4BQ3A 2ON3A 5EFFA 4YTTA 4L9YA 1ADDA 4XZWA 1CZ1A 1F6KA 2IMRA 5KITA 4ZEPA 4DLMA 1UMYA 3N9KA 2VZOA 4O1DA 2YJQA 1GQNA 2E67A 3KE0A 4FNPA 1GVFA 2X2GA 4AIUA 2YA0A 4QJ5B 3VIPA 4QISA 4LF2A 1LOLA 2ALDA 2BASA 3EBVA 5U7SA 3GVWA 4QJ3B 2I5GA 3DERA 3B40A 5T9BG 2NXHA 2AAMA 2PGRA 4IQLA 4WIWA 1ME8A 3WZ0E 1MUWA 1UUQA 5I00A 3QOMA 2NX9A 1OCBA 2PWFA 3LPGA 4JIPA 1QBAA 2B0MA 1BEUA 3L2LA 3E0VA 2PTXA 3SCUA 1BFNA 2VDIA 4RXGA 4FOKA 3CAVA 4C1LA 4FSAA 2OLHA 3G1YA 1X8CA 5J5DA 3LRKA 1OB0A 1YIXA 5BOEA 3LV6A 2INZA 4NNCA 4CUCA 3BLOA 3TMQA 1AA1B 2YZ5A 4B2DA 2A6NA 4OBRA 2YLLA 2QUUA 4NYYA 4O4VA 5FAGA 3S1UA 4W8BA 4H9VA 4WSJA 1M5WA 3LI0A 3PSVA 1PDZA 3G0SA 2QVHA 3DN5A 2G5WA 3EPNA 4MWAC 2ZRYA 2V5DA 3I4EA 4EPDC 4PFHA 5D30A 3WUBA 3GXFA 2FKPA 1WZLA 4GRSA 3MKCA 5DCBA 1NAL1 1RJPA 3BLIA 1VEMA 3VMOA 3L4VA 2IPGA 4HCHA 2ZRUA 1GOQA 3ABSA 2BOEX 3PZOA 3UZZA 1FXPA 1RHCA 5LGXA 2BG5A 1MW2A 1ISZA 3OQ8A 3ES7A 4Z1DA 2FPVA 1IV8A 1UR2A 5C54A 2CETA 1JZ4A 1UJPA 4R9OA 3MTWA 4F2BA 3BG9A 1J12A 3EX1A 1G4SA 2DH3A 2WVVB 1O4UA 3AYRA 4CKQA 1H7WA 4IICA 3A3HA 4MLJA 3VMNA 2C71A 3FS2A 4PBFA 3PJWA 2PGEA 1KC7A 1V08A 4PMVA 1XYCA 3CHDA 4ATLA 5DBTA 2A0NA 1UPPA 1UR9A 2VEPA 4HNTA 1VR6A 5ENLA 5F7UA 4ZODA 1HJQA 1A80A 3TJ4A 1QCWA 4WXZA 2DW7A 3ANVA 2BX7A 2QJGA 1GOXA 1PCKA 5A69A 1PX8A 4ZO9A 3NPXA 4ASTA 4J3UA 4GC4A 3WBAA 1IWBA 5JMUA 4J2MA 1VFSA 2PAJA 1A5BA 1G4EA 2A3AA 2O9RA 5LXEA 1ZB5A 3NFUA 4XQ6A 2YB1A 3CYVA 2F2HA 1DXIA 4ICMA 4O4WA 3TW7A 3E96A 2DP3A 3GW3A 4XVEA 1JL8A 1FWJC 1R0MA 3SADA 1M7OA 3KOYA 1EXBA 3RX3A 2R9RA 4YIWA 3GY1A 3FHAA 2JQXA 1TRIA 3QVQA 1AVAA 1XDLA 4RX0A 5KETA 1E43A 2PDGA 3CNYA 5DMNA 4Z2HA 2I9UA 4JNZA 1UKQA 4HOXA 3QFEA 4LWWA 3W75A 3T2QA 4RK8A 2QZRA 4LNYA 1WQ5A 3RO8A 4GVHA 2QYGA 2AQOA 2CPUA 3MUXA 1YMYA 4LVDA 4MY9A 3G5EA 3OB8A 2XU2A 3MKKA 2WMJA 2QDGA 1CEOA 3CHVA 3KDNA 2XWEA 1UW9A 1HJXA 2W92A 3MCMA 4D6CA 3BARA 1A50A 2ZWYA 3BW4A 1JEZA 2OODA 1A5KC 2Y1HA 4WR3A 3LHVA 1PZ1A 1O66A 2FMNA 1E5NA 3TKFA 2QCDA 2OT0A 2ZRXA 1Q6QA 1DV7A 3EYPA 3DGRA 2X1SA 1F7BA 1OEPA 1EP1A 3W25A 1MUMA 4E2OA 2V5CA 4ZE4A 4CD7A 3GHRA 4AFYA 1BPLB 3NVTA 4B90A 1XDMA 2GGHA 1QI4A 4D1IA 4IMDA 4HMNA 3MS8A 2P1FA 1PYFA 2FPYA 3K1DA 3T2OA 3WH6A 5EGRA 3NZ1A 3VIMA 4P8XA 3QFWA 4LBRA 1VHNA 1OQFA 1T5AA 1PVNA 5E1QA 1WKDA 4A2RA 3NM3A 5B7ZA 1V6WA 1JGMA 4OE7A 3VNKA 3UJFA 4QAWA 1JCLA 4YYCA 4M6UA 3V5FA 4IPNB 1NELA 2C15A 4H41A 4H8NA 5FEPA 2OQYA 3UESA 1UB3A 3FJ6A 5FA5A 4P7QA 5E0CA 2PZNA 3WELA 4I5UA 5CPOA 4E2DA 3E2RA 1PL9A 5C7HA 3TFXA 5AHIA 2VD8A 4RE4A 1NDWA 3ARUA 3Q37A 1Q66A 1QW9A 3MHUA 2BLEA 3VIHA 3BWWA 2CIPA 4TX9A 3SUTA 3VM7A 1DYSA 4ZB0A 3PPCA 2JGQA 4GKLA 1B3XA 3GG0A 3W37A 2RHGA 2X0YA 1K7FA 3CPGA 4U4MA 1H7XA 3GXIA 2VX5A 4Y9OA 3NL6A 2YGYA 2XIJA 1T41A 2YA2A 1HIZA 5TD4A 3CEPA 3K2GA 4QJ1A 1TG7A 2A3BA 5CPQA 3SCQA 1ZAJA 3LPPA 1OIFA 1C90A 2VRKA 3KW3A 2GGJA 4JCMA 4PMXA 4CVWA 3QZEA 2WQPA 2PB1A 2YB4A 1TMLA 1EFZA 2IW0A 3F4NA 3KAOA 3L4WA 3IRSA 4ZXOA 5AB3A 4XD3A 4CEUC 4E3VA 4ZB2A 4X9YA 1ZALA 1TKKA 1BAGA 1PX4A 4FEZA 3TQPA 1MZHA 3G1AA 2Z1VA 3BC9A 3TMLA 3FEMA 1O1ZA 3A4AA 1SMAA 1JI2A 4FX8A 3LZ5A 3MSYA 1E3ZA 4NG3A 1ITXA 3C3NA 4J7RA 2BHZA 4P8UA 5LNVA 1JNEA 3IEBA 2V5KA 4IJRA 3RX2A 2WJDA 5B7YA 3WL0A 1VLIA 4JYFA 4D6DA 3NPVA 4UQEA 2XZ9A 2YX0A 1SJCA 1X6LA 1VFOA 1FWDC 3V1PA 4CU8A 4DO5A 3WJZA 1Q7MA 3LUTA 4QFUA 3S2CA 4YNGA 4L4PA 4HHPA 2XFYA 3LSBA 1BYDA 4UCGA 1XW8A 2WM1A 3LI1A 3AO0A 4S3JA 2DQXA 4PMZA 3E12A 1NFBA 4ML9A 1P6CA 3VVGA 3WBXA 2WAGA 4E0CA 3BSMA 1ODUA 1NWTA 4K1WA 2PP3A 4UTWC 2DVTA 3W07A 4JEJA 3A13A 1EYEA 3UJSA 3L66A 3MB9A 2XN2A 2B7NA 3F4VA 5EMKA 3QTGA 1ZS2A 5HK4A 3T0AA 3DUGA 4CQBA 3I7RA 3NQDA 4MAZA 3W81A 1R30A 1DL3A 1AQFA 4M56A 5GNZA 1ECQA 3SRFA 3RJXA 3E5PA 3B4YA 1W3HA 4DXVA 3ZQ9A 3MC5A 3ARQA 1XS2A 1A5AA 3UG3A 2QJIA 4HZ6A 3UZYA 4NP7A 3PAJA 2G97A 4W93A 4D72A 4XUGA 2IQ0A 1U2YA 3SSZA 2ISVA 1IZCA 4F79A 1UHVA 3AS1A 4ZR8A 3DZ1A 5D2YA 3D3AA 2QGYA 3STEA 2QCDB 1WZAA 3CH0A 1ZU8A 1JF6A 2O92A 1X7FA 4FHAA 3RCMA 1QNVA 2O7QA 4TX8A 3IJIA 4AVOA 3GBEA 4N2YA 1E6PA 3QRHA 1KCLA 3V18A 1SZEA 4AUBA 2O56A 4JKLA 4M7SA 4A22A 3QN3A 3I7SA 1XLGA 4LUYA 4TIMA 4WY0F 2ZRWA 3LXAA 2IKIA 1UKSA 1ZBKA 2VTFA 2FVMA 4PRTA 2HWGA 2FJUB 3WJWA 2OB3A 3ZR6A 2HJPA 3B9DA 1SZFA 4KERA 2GGIA 1E51A 5BZAA 5LNRA 5G5IA 3T40A 1XBXA 4IPLA 3A5FA 1KFKA 1ZY9A 3CWNA 2GPTA 5IOBA 2BB0A 2PEVA 4JIRA 4MADA 2PF0A 1P0NA 3OVPA 3MANA 3ZSTA 5GPRA 1XM3A 2OWWA 2VX4A 4LF1A 2CESA 3G2GA 3M9YA 1MDRA 4H9MA 1BTMA 3RN6A 1ZBVA 5FI8A 3R43A 4E8DA 3NQVA 3HIJA 1D8CA 4LC6A 3CV2A 1NVMA 5CZSA 4S38A 3ZLGA 1QNRA 2WCSA 4MY8A 5JH1A 2VFEA 1NQKA 1TRDA 3N6QA 4JFUA 4JOMA 3UWZA 1AK5A 1GZJA 3K4AA 4F0HA 1VCFA 3N73A 2YBTA 1LOSA 3ITXA 3G8EA 2Y5SA 3NQFA 3UPMA 4ZSUA 1WA3A 1W0MA 3B05A 1EYWA 4BY3A 2ATSA 5CSRA 2FMOA 1SFJA 1B30A 5AC7A 1EB3A 4LXFA 4O28A 2HTMA 1XLHA 2NZLA 2X7VA 5JQ9A 3CMJA 3TUUA 1H63A 3T0TA 2CLFA 4HKPA 2VEKA 3NQMA 4TTGA 1O5KA 3IIZA 1E0VA 3GH4A 4F66A 2RKXA 1LDCA 4L4LA 1XUZA 4UQ9A 1MZRA 4P7RA 4ZQRA 4BCEA 2V82A 4UTTC 4WGHA 5IHSA 2CLMA 1EDGA 1UWRA 1BRLA 3AICA 4O15A 4QCEA 1NP0A 1WP6A 3B03A 2LLEA 3WDHA 1J93A 1H7OA 3KCOA 4UTLA 4L4OA 4L65A 4R33A 1XWYA 3OBKA 5HOSA 2HXTA 2BY2A 3E0FA 5AC8A 2Z00A 1XLAA 4MTVA 2J7GA 4M6QA 2J9YA 3SM0A 1MW3A 1WDRA 2DZPA 3ZYZA 1XCFA 2BWGA 4QLJA 4JEQA 4BR1A 5I3KA 3GR8A 1EC7A 1N8IA 3RHGA 5HNTA 4OBTA 1VCGA 4U28A 3WLLA 1KFLA 4NI8A 1W9VA 5L9FA 1AW5A 5ABHA 5JIPA 5KZMA 4LUSB 1JUBA 3VD9A 4PRWA 3STCA 1XIGA 2D24A 4EPBC 1EXPA 2C14A 1A5LC 1MSSA 4I6KA 2R1PA 3FW6A 3CZJA 5A95A 3NA8A 3W7JA 2RGLA 1OVDA 1IEQA 3RU8X 2W3ZA 3WLNA 3S0CA 3AXIA 1VBHA 2TAAA 1PIIA 3VGDA 3WJSA 3TTEA 4HSNA 4DYJA 4LCQA 2NUYA 3RMJA 1OX6A 3GUGA 3IK2A 4ML4A 5CPMA 4WZHA 2XIQA 1WCGA 3N11A 2RDWA 1F74A 1BQCA 4IGSA 1W6TA 3PF3A 4GIYA 3S6OA 3W2KA 4M82A 3HMJG 3F03K 3MYPA 1XI3A 4AY8A 4ZA0A 1GYLA 3R89A 3PC0A 1O68A 2EAWA 3GNRA 3VX0A 2HMCA 1UKOA 1I1WA 1WV2A 5A6LA 2ZX7A 1E1CA 3UQNA 2VUYA 4GINA 1FXQA 1C8QA 3W83A 2XSXA 3AC0A 4DUOA 5A2CA 3N04A 1ME9A 4PC8A 1IXPA 4PUMA 5KEZA 2YL9A 2Y2WA 3C3UA 4Q7BA 4Y9PA 3GVRA 3RIKA 3UBPC 4D71A 4LUIA 2BBFA 1XLKA 1CGXA 4FO4A 1VAHA 2WYSA 1YHTA 1FWRA 2WXDM 4CN4A 1KTBA 3OVRA 1US0A 2C0AA 3C8NA 3VDBA 2FHFA 3VOGA 5FOOA 2PDMA 2BDQA 4X63A 3BG3A 3GC4A 2Z29A 1D9EA 1S5WA 3ARZA 4GFIA 3CZ8A 4HSHA 1VB9A 1F6PA 3LD5A 5JBEA 3AFBA 3VO0A 4YVXA 2V67A 4UMAA 4L1XA 3DI1A 1L6YA 4GABA 3DHDA 3TCSA 1N7KA 1QNPA 2PURA 3GNOA 4GJ1A 1VPXA 2E1DA 4JTDA 3WKZA 1C9DA 2ACUA 3WCZA 1QW8A 1P4CA 4KRUA 3EAUA 5DLCA 1LWIA 1WZMA 3AOFA 3AU6A 2J8TA 2WW5A 3DEQA 2G41A 3PJTA 5K9DA 2ISDA 3UXLA 4GUHA 1XGDA 1XQLA 1JZ8A 6CGTA 4F3HA 1UWSA 3NPUA 3ID7A 1CX9A 1XH2A 4DZ5A 4IP4A 1JPMA 4C90A 4MJZA 4DO6A 1M7PA 4XAFA 4B2DD 4BKNA 3MJYA 2INEA 4HNUA 3W88A 3UPBA 5LSMA 3CZLA 1A3XA 5G4HC 3P80A 1S1RA 4NAFA 2PTDA 1ITUA 4LYPA 2WLZA 2WHKA 1BRLB 3VZZA 3O1NA 4CVUA 3EA1A 4IIDA 3QPZA 2OEMA 4S39A 5BOOA 3O05A 3QR0A 5A94A 4IP5A 4O53A 1V3KA 1MW1A 6PTDA 4OUEA 2V69A 1MQQA 4GNJA 3J7HA 3SRKA 3S5NA 3P5ZA 1XHGA 4B9YA 5HA7A 4RNHA 5K4XA 2VFIA 1GUVA 1NWUA 2J9ZA 2IPFA 2J6XA 2V30A 3ITTA 1FVPA 3AIQA 3QW4B 3HQPA 1GK8A 3L2MA 2UY4A 1UR0A 4LS2A 3CXOA 3GQYA 3SIZA 1TUFA 4XZBA 1JR1A 1VRXA 3F5KA 4R7OA 5C71A 4ZFMA 4JZ5A 2DDXA 2PDFA 4GQGA 1QU4A 4IQJA 4LAMA 4HCLA 4GA8A 2BTMA 3JZUA 3B8SA 3KP1A 1QO5A 5J5RA 1J5SA 4KRZA 1TE1A 4IIGA 4Q8OA 2QV5A 3RCYA 3SECA 3EA3A 5GNXA 4MWAE 3IV8A 3LOTA 4IMEA 7ENLA 4GZ7A 2QCGA 3JVAA 1KD0A 1GONA 2YKKA 4KCUA 3OVQA 1R9XA 3L0GA 2PLJA 1YXCA 2FZNA 2CKRA 4O14A 2G3FA 2R94A 3WK3A 4Z1AA 2EPKX 5E6ZA 2FHCA 2WVUA 2F7FA 4ZQNA 2D2OA 1IIGA 1XDJA 2CLHA 4PMQA 2J7HA 1TV7A 3M5YA 1WYIA 2IKHA 2XVNA 2J9XA 3L4YA 4WKAA 4LAUA 1S2CA 1E1CB 5CG0A 3IV3A 3NYDA 1A5UA 3WQVA 3WNKA 2A7NA 4PMDA 3GNDA 3PBGA 3CGTA 1TZ7A 4QROA 3G8RA 5CEWA 4RUBA 5HPCA 2ZUNA 4XD5A 1QOQA 1F05A 1OGSA 1E15A 1XLEA 3FDKA 4NXKA 3LY0A 3QF0A 3WQWA 1H1YA 3SGUA 5H8UA 4MDOA 4WSHA 1I2RA 3S8HA 3AIRA 3EOUA 3TC7A 4DYEA 1I9CB 1WUFA 1TMHA 1FDJA 3LLDA 4ONVA 1P0EA 2PC4A 1Q8JA 3HF3A 1GVYA 2O9OA 3MZ2A 4NXSA 3AMCA 1RVKA 5LA0A 3LHWA 1K4GA 4QR6A 3TN6A 3U2EA 4Q4QA 5D2XA 4Z1YA 4Z42C 4IM4A 4P8VA 5K4ZA 3MO4A 1NFPA 1J0IA 1FWNA 3U5UA 1NH6A 3O2LA 3RAOA 1EC8A 4FA3A 3EDDA 3TJXA 1Z89A 1W37A 2PRLA 2IXVA 3V5OA 4R7WA 4ZMGA 4TV6A 3QBUA 3WDQA 2VRJA 4G1KA 3SZ8A 5EA9A 1F3TA 3B9EA 3W29A 3QV9A 1DWIM 3BZJA 5BW6A 2BHYA 4AZIA 3W3OA 1CGYA 2QS8A 5D9OA 2FZ9A 3F4WA 6REQA 1EO5A 1KRMA 3UA4A 4NNBA 3TXZA 3MP4A 1BVNP 3NQ6A 3EWDA 1I75A 4Q6JA 4TUFA 2J25A 2WPBA 4RV8A 1ZJAA 3AIVA 3CIXA 6XIAA 4H8UA 1PUDA 3TXVA 3KL5A 1TJ2A 2PDUA 3AMDA 2OELA 4AY7A 3B97A 2O9TA 1CWYA 4PTWA 1XSKA 4C6FA 3G3DA 3FFSA 5FAJA 4UNKA 1GJUA 4Z2IA 3EX6A 1M3UA 3WLSA 5C7VA 3BV4A 3UCDA 2I14A 1SFTA 1PZ2A 4QNEA 1W1IE 4Q8NA 1KGWA 4NAFB 2REQA 3XINA 3TWBA 3HGOA 5C0QA 1N2VA 1QASA 1KA9F 3IJ6A 3M0HA 3W1RA 3N18A 1P6WA 1HO4A 1FY6A 3VUPA 2X05A 3H7UA 2J62A 3L5MA 5I3HA 4WCJA 3TYUA 3KTXA 3A4JA 4YPJA 4MB4A 5A6SA 1KGXA 1B3YA 5DRIA 2WC4A 3GLCA 3B0PA 5TAOA 2ZZ2A 1HKIA 4I7UA 4GD0A 2B81A 3M0XA 3STPA 5C9UA 3K13A 1RBOB 2GSHA 2QCEA 1FWGC 1WUEA 3VOCA 1EF3A 2JEQA 4AD2A 1Q6OA 1QT1A 1Z48A 2PDYA 3CMGA 4MOZA 4UQAA 2X16A 3VCNA 3TC6A 1F61A 4LANA 4OWGA 4Q8MA 2PS2A 3W1NA 2VZTA 1Y8BA 4BF5A 3GDKA 1DIOA 2E8ZA 4C65A 3EKLA 5J8LA 1TCMA 3QY6A 1V3JA 3BLFA 4S2CA 3LM7A 4DF0A 1CNVA 3HGRA 3UPWA 1VFMA 1W5PA 4L1WA 5D2TA 4YWSA 3ZXWA 1UBPC 3QKZA 1UBSA 3DGBA 3GXNA 2FB2A 3OGVA 3GD6A 1F2JA 4O1AA 4D1JA 5EB8A 3G1RA 3CZKA 3O0KA 4ZXLA 1TELA 1HF6A 4O13A 2H8XA 4GH1A 3DDMA 3UR8A 1UPMB 1DKWA 4I7WA 4JL1A 1Q6GA 1H61A 4B15A 2XH0A 4AZBA 1U33A 2X7WA 3M7WA 5FJOA 1KW1A 3W82A 1RY0A 1TYGA 2UWFA 3V0UA 1VBUA 2TRSA 1RLDA 3KRSA 4A8LA 2F61A 4DUWA 3ALFA 2WSKA 4IMGA 2Y8UA 3M1ZA 4Z2KA 1W1YA 3PG9A 7A3HA 3UCCA 4PCTA 4JQ3A 2ONEA 2WC3A 4UZUA 5XIMA 2YCLA 3CQ0A 2VFGA 4FB7A 1CGTA 3S4TA 4F40A 3LHTA 2I1OA 3FN9A 1GJPA 3NOEA 4U33A 3L9CA 3TONA 4E38A 4EIVA 2ZVRA 1G7UA 3C0SA 4C6JA 4MF4A 4TV5A 4ZQPA 4WDUA 3T07A 3CQHA 2VRQA 5I6SA 3GYEA 2V38A 2Z2UA 1OJXA 3OJGA 1GVSA 2W66A 3N6JA 1ZL1A 3RILA 2Y85A 5C8BB 3JU2A 5D8ZA 3S5OA 3S2NA 2BSLA 4TVDA 5E9XA 2XM2A 1LLOA 5XIAA 1F4AA 3GRIA 2EG8A 4UTKA 3WEZA 1P0DA 1DEDA 4B5NA 4HPHA 3P82A 4DO7A 1R47A 3RR1A 4N9CA 3L0NA 1VYPX 4S3CA 3OQEA 3WFAA 3BL3A 3SCSA 1O6IA 1TZZA 3WF4A 3WF1A 3ZJ7A 1S2WA 2R6OA 3HZ3A 4XD4A 2EKGA 1RBAA 2GWGA 4DZHA 3WLJA 3PVFA 1BKHA 5XINA 2G3NA 2PDCA 3MKVA 1TR9A 4DIAA 3TJIA 2A79A 1HVQA 4PB3A 2ZXQA 3S6DA 5CPNA 1WDQA 2Z7GA 3LS9A 3NZQA 4M6PA 4FP1A 2PDHA 4MWAA 1MXDA 1KLZA 1YX1A 4AXKA 3F2BA 2ESCA 1B4EA 1KCZA 6REQB 5FF0A 1J0YA 4PCPA 4U31A 5GNYA 2RDUA 3TNOA 4Q4PA 3W6MA 3AZTA 4WJ8A 1W9BM 1R2SA 5D02A 3UG4A 1M65A 4TQTA 3G1FA 3WBWA 3U9IA 3L4XA 1JYVA 1LJYA 1W3LA 3AISA 3HPSA 3ABZA 4HU3A 3H2MA 1UH4A 4BQ5A 1ITCA 3SIMA 1ADOA 5H91A 1TPH1 1DTUA 3M07A 1JFHA 1RCQA 3DBNA 4YTQA 3H7RA 1RZMA 3M0MA 2Z27A 4XAZA 1QTWA 2PP1A 4GKTA 1ISYA 1LLWA 2DT3A 1XL9A 2BY1A 2J8GA 4UQCA 2P76A 4GYJA 2GDQA 5CZJA 3GTXA 4FAMA 2PDJA 1SPQA 3NZRA 4AD4A 3I6TA 3CC1A 4O10A 3L21A 4QHRA 2QDDA 3B9AA 3JRKA 2O4MA 2HK1A 5I3IA 3WLIA 1JQXA 4C1NA 4JS3A 2X0HA 2V9DA 3W4RA 3WH8A 3EX2A 5EMLA 2J7BA 2QAFA 3SR7A 3WF3A 3KP0A 4DELA 4ZO8A 4B5XA 3N2MA 5A6TC 5AHEA 4UB9A 5DMLA 3NR0A 1SW3A 4FXSA 3NO1A 5HQMA 1S2UA 1G9HA 1VCVA 4QXIA 2ZX9A 2XZ7A 3BGGA 3GTIA 2WCAA 4KCTA 4YVVA 5LNUA 3E2QA 1PV8A 2DV0A 1ZTVA 5CZ0A 4RJEA 2QCNA 5U4NA 3UWEA 3TSDA 4DYKA 2AAAA 3SJNA 2YSWA 4GLEA 4PULA 3VIGA 2QR6A 3AYSA 2XWDA 2BP1A 5GJPA 4GK8A 4CD4A 3TSMA 4GHRA 2DH2A 4DRSA 2QAPA 3IUHA 3UP8A 4EOUA 3H12A 1PAMA 2Q02A 1V0NA 1DXFA 5F4WA 5FSEC 4A3YA 4C7GA 1K9EA 2Q8XA 4ATWA 1KFCA 4ROQA 3UXKA 1I8JA 1EJUC 1MXGA 2Q01A 1XG3A 3UJRA 3MYOA 8XIMA 1GEQA 2YCLB 1QPQA 2BOFX 1GKQA 3CM4A 1GORA 1EKOA 3IJLA 5BXSA 2ODOA 1V0MA 3WDRA 3BE7A 1OC7A 3M4HA 3WBYA 5HJYA 2FTWA 2AKMA 4R5EA 3WYZA 1Q4NX 4OV4A 5EMYA 3L5AA 2OLSA 3P8JA 2GFTA 1O5RA 3PNZA 3ARWA 4C6CA 3D47A 1OCQA 2ZUWA 2CLPA 4B5TA 5CJNA 4F9JA 1KRAC 1X7IA 3EDEA 2WVSA 3AXHA 1TPC1 3W84A 3ABQA 1XIEA 3UWUA 2CLEA 1TV3A 4PCNA 9CGTA 3RRAA 2D69A 5I24A 2XGZA 2GGGA 3LV5A 1KKOA 5IBXA 1S46A 3V16A 4Q8TA 2DUAA 3HFYA 1U1JA 1RAKA 1DJYA 2FZ8A 2NWRA 4KMQA 2F84A 3M5VA 5CAKA 3PTQA 4Y8FA 1YNYA 2DZTA 3OTRA 3AU2A 4IPPA 2WSYA 2GJLA 1QBBA 4RNIA 2WMKA 4XIMA 2IS7A 2OX1A 3JUGA 1DJZA 3AWNA 4YL2A 2HROA 3H8AA 3A9BA 3SN1A 5CJ5A 3OGSA 1KR0A 3PN8A 4I8DA 2OG9A 2XH4A 4MWAB 3MI2A 4Z1BA 2I56A 2Z0IA 1NEYA 1CI1A 4C6OA 2EO7A 2DZSA 3VGFA 1VYRA 1QHZA 1R9ZA 3W22A 1Q6LA 3AXKA 3EWBX 1KBKA 2EKCA 1NOFA 1BWLA 3U8GA 3W2UA 4GXPA 1FH8A 5K2ZA 3EDJA 4A6GA 1AD1A 4HNLA 4MVAA 2RFGA 3W7EA 1VLWA 1O7AA 3GDRA 4H1ZA 4PN2A 1PX3A 1MXSA 4JKMA 2VYOA 1VBRA 1E0WA 4IIFA 3FKKA 2AL1A 4C7DA 1VJZA 4DY1A 1BG9A 3WD3A 4K1GA 3QYQA 2FHBA 3WG6A 2X1TA 2P50A 1XIBA 4H8VA 4M7TA 4AH7A 1OYBA 1RLCL 2ZC1A 1OYCA 1GQLA 2CWXA 1TFVA 3RJYA 1E0UA 4LNCA 1L9WA 4UFIA 3EZ4A 2PDXA 1EC9A 5A6MA 4H4IA 4F0SA 3PFMA 4Q7NA 3VDCA 1QOPA 1OK4A 1JYNA 4XWUA 1W3JA 1J96A 4D6HA 5HATA 2FPTA 5FESA 5DY2A 4C1NB 4Q4KA 2E6FA 3OA3A 1TX2A 4GCXA 1DIEA 2Y7GA 1A4MA 4S3EA 3ATZA 3BLPX 1JPDX 4NJJA 3O6AA 1PCWA 1LRNA 1Z3NA 1H1ZA 4GG9A 3BCJA 4UTHA 1W54A 3APYA 5F1UA 3VNIA 3QR1A 1DQUA 3LBOA 4GX9A 1A5SA 4IFRA 2ZX8A 3T7VA 2Q3OA 4HP5A 5LHFA 5TNVA 4UTWA 3GDLA 4AEOA 3AIWA 1TWSA 2P53A 3DBPA 1B5TA 2G50A 4NVTA 4H6EA 3M44A 5FL0A 4D6GA 1SO5A 3TR2A 3GW0A 1E0XA 4GQ0A 2YL8A 2AMGA 2YCIX 2IKJA 5HDRA 1XR2A 4LV4A 1OINA 1ONRA 4L9XA 4CQ8A 2Z4GA 4NQ1A 3VOHA 4D6FA 5G1TA 3FJ4A 5I23A 4UMBA 3UGRA 4RDZA 3G22A 3PZMA 2CEQA 4ZOAA 3WQPA 3W6LA 4TTUA 2QT3A 1FDZA 2NX3A 3EWXA 4UQDA 3ZMRA 2HISA 2Q6ZA 3CO4A 2BGQA 2ASHA 3QHMA 3NO5A 3ABXA 1KWGA 4DUXA 1C8VA 4LBSA 3D3FA 3LRLA 3BK0A 5KMYA 3P5YA 3GZ3A 3WF0A 3B9NA 5CSUA 2EEXA 3M5ZA 2P10A 1KRBC 1X6NA 4WLCA 2ZXDA 3STFA 3DKLA 3H22A 5AZ1A 3U6WA 3AJXA 1SO3A 1J4EA 1W9DM 2CZVA 3N2CA 1IT0A 2DVXA 3USZA 2E8YA 2QCFA 1HGYA 2GOUA 2J88A 3UWYA 3ZO9A 1F6YA 1A5NC 2DY3A 3CZEA 3KM8A 4KBXA 3T1GA 5CBIA 4BF7A 3SBFA 4NILA 3N29A 3R1ZA 3RLGA 3V1HA 1VIWA 4LQ1A 3V3WA 4KEMA 2YXGA 4CQAA 1ZZMA 4JYEA 3R79A 2QMKA 5I5RA 3PWIA 3DHFA 1GCYA 3HPAA 1D8WA 4O8AA 2WOQA 4WDWA 3NNTA 4JQ4A 1OY0A 1D3GA 3QGAC 5JUVA 4MUZA 1EJXC 2I5IA 4TVCA 5DEZA 4FLSA 4FOJA 1XBZA 2PD9A 2FVLA 5F2LA 3KWXA 2O0TA 2VUNA 3KOFA 4G9PA 1Q4WA 3P74A 2VELA 4FPSA 4H9YA 1S2AA 1RR2A 3EX3A 2ATMA 1LOQA 4NZJA 1MVYA 4YCPA 4K7YA 3O07A 2KZHA 3WN6A 1V7AA 3FA5A 3BLLA 2QUVA 3OBAA 1ZENA 1QWKA 1SYTA 4Y9AA 1QI2A 3VYLA 4K39A 3ZM8A 2YYUA 4DJDC 1L6SA 1LL4A 2PODA 1Z7AA 2XH7A 1CGWA 1UD6A 3H24A 1EDQA 2C13A 3D0CA 3VIIA 1DJGA 1MW0A 5H6HA 2E6DA 2E5DA 3GK0A 2WCGA 2JF7A 5F2GA 4KCWA 1K77A 1WKYA 2PDPA 5ABFB 2NV1A 1IGWA 3GDMA 1GVRA 3W2MA 2D0FA 2L5HA 3GXPA 4HOZA 5DMMA 5D33A 5KZEA 1OC5A 1GOIA 1IHIA 3T81A 1FX6A 2PUZA 3D6NA 4NUWA 4FNTA 4Y2WA 3II1A 2X1RA 1RSCA 1RCOB 3IJ7A 4ZTXA 3BLKA 5A6AA 3KDOA 3PNUA 1H49A 4IJBA 3EB3A 3GHUA 1M04A 5AVNA 3EA2A 3B8VA 3S2MA 1VYSX 3T6CA 3OBEA 3H2CA 4IMAA 1Q6EA 3LM3A 3EOSA 4GUGA 3NOYA 4XZNX 1HQTA 4KH2A 1W1ZA 3OG3A 1DJIA 2P5NA 3TX9A 4TX6A 3U57A 3TLQA 2JKPA 3B0YA 2O4QA 3C2YA 4PCSA 3WLMA 3TWAA 3PBVA 8TIMA 4DO4A 3LSCA 3GTNA 1UD4A 1O1HA 4ACZA 1BHGA 2ZUMA 1QI0A 2EXOA 1Q6CA 2HSAA 2E5CA 1TZ9A 1DIDA 4G7FA 5HAOA 2W9MA 1GG1A 1POKA 2Z1SA 1ME7A 3PR2A 3DG7A 2WSQA 1NARA 3LB0A 1Q85A 4Q8VA 2ZRVA 3JS3A 3WQ8A 1V8EA 4PTNA 1TIWA 1JG9A 1H62A 4DM1A 3H2OA 2VC6A 3OZYA 1BF2A 3MDUA 2PDKA 1OC6A 1TPVA 3S6TA 4PTDA 3BMWA 4K3ZA 3SQLA 2W63A 4HNNA 3T0DA 2PWDA 4BF9A 2ABAA 3QPYA 4HSOA 1UOZA 2HE8A 4N7QA 4LVAA 3W71A 4NU7A 3PZ9A 4HZ8A 2OQHA 5A2BA 2XH2A 5I09A 5AOUA 2V2DA 4M81A 3WMBA 1ICQA 3G0UA 1B2YA 4OECA 1AH4A 2YW4A 1E1EA 4U5IA 4PB5A 3MA8A 2BZNA 2RDXA 4LYQA 2ZBTA 4PSRA 4JX4A 2Z1KA 2Y88A 1Y5VA 3KRZA 5A6KA 5ECUA 2NLIA 1Q7QA 4AZ5A 3VNMA 2Y8KA 5A1AA 4B4HA 2WK2A 2ZKMX 3XISA 4FI4A 1KBIA 2PRHA 2WQDA 1T40A 1AJ0A 2V63A 2G3IA 5A6BA 4LCRA 5E9AA 1QPKA 2ZZ7A 3UZ5A 4NJIA 1NDZA 3FHQA 4PMRA 1CGVA 3N3MA 5CJMA 1HO1A 4CCCA 2CITA 2HEJA 4NZ1A 3ZLHA 4N42A 1VPYA 5EMMA 4GX8A 4U5KA 3DXIA 1MEHA 3WQFA 6A3HA 3RXZA 2I5QA 3B0VC 4AVNA 1AFSA 2G95A 4Z0JA 4PRRA 3N3TA 5KTLA 2PC8A 5A8PA 1HFBA 1F3EA 4CQDA 3K4WA 1XISA 2B31A 3I68A 4WGXA 4XAGA 4ROPA 4F0LA 1EOKA 4E4PA 1HNYA 3OLGA 4H3DA 3W7GA 1YTKA 1FCBA 4V27A 4LU0A 2NQZA 2F6UA 2G3JA 4MNKA 3S9ZA 4KPLA 2Z6JA 4X0NA 1GQKA 3UEQA 2GJXA 4V28A 1E3XA 3CHCA 3R7MA 3TNBA 4E8GA 2V6AA 1H3GA 4UQBA 3VUSA 1J0HA 1QK2A 1GZ1A 1US3A 1FQ0A 1BWVA 4Z2LA 4PMUA 3R12A 1M53A 1OT1A 4JIHA 1DJHA 2QCMA 5CZTA 1EWDA 4MDPA 3W1XA 1OFEA 1V77A 5I02A 4QE1A 1GW9A 2BOGX 4H8HA 4QAIA 2UY2A 4FR1A 3DFQA 1EIBA 1Q45A 4GBUA 1U5HA 3URQA 4W84A 4EWJA 1AZ1A 1YTEA 3CEUA 5M3WA 3GFXA 2ZZ1A 1QHPA 5DX7A 3HURA 3WL1A 2VI0A 1YNPA 3CO8A 3H70A 1BGGA 1XPGA 3PM6A 1OFPA 2J47A 4JTUA 2VD9A 2TSYA 2ZX5A 4DBSA 1HG3A 4EAMA 4H00A 2HVNA 4AZ7A 2PWGA 4PL2A 3APGA 4A8IA 4QDMA 4GYPC 3QMRA 4MWAD 1XIFA 4IISA 3QJAA 3TR9A 2EBNA 2OEKA 1XLBA 1YDNA 4L80A 3PAOA 3GU2A 1LG1A 2GUUA 5AC4A 2FYMA 2A2IA 2PE4A 2DZXA 2NQ5A 1XCXA 3GDTA 1I4NA 5DCEA 1BXNA 3U48A 1V02A 2DGAA 3NQ7A 2HRWA 3VGBA 3VKJA 4HA3A 5AHLA 4HB7A 2OPJA 2WHMA 3W01A 1UQYA 3NPWA 4FLRA 3ANUA 4U2YA 4L9ZA 3OU8A 4JTHA 4BA0A 3F7JA 1KR1A 1OG0A 1FWTA 4ZBCA 3PHAA 3V36A 3GAKA 3WMSA 2PF8A 4DAFA 3W7IA 3B0UX 5E5CA 3FDGA 3ENLA 1XH0A 2EG7A 1PIGA 2OVLA 1A0DA 1VJIA 1UZDA 4GY0A 4ORIA 5ABGA 2IKGA 3QV7A 1LWHA 4I9AA 1ZCCA 4MKSA 1IT8A 4MY1A 3QV8A 4WDXA 1HUVA 4RL3A 1RK6A 3LCWA 2CC0A 3H53A 5DCDA 3MDWA 1W1B1 4FXFA 1EJRC 1QJWA 3LERA 1UZ1A 3JZEA 3HO8A 1WBJA 1PIFA 2JE8A 3AIBA 3M6DA 3HGSA 3RLUA 1NM9A 2XG9A 1XINA 1ENUA 1LP6A 5M03A 4QRNA 3MHGA 4J3XA 3CAKA 2GJNA 3LCGA 3RCNA 2WPGA 4AMAA 3EWUA 1J10A 1WB0A 4IPIA 4WEVX 1A49A 2IUZA 1F07A 1WAWA 5DMYA 5CG7A 2D0HA 3BG5A 1PKLA 4W5UA 2UV8G 4GOAA 2GQ8A 4IG2A 1J8VA 4R7JA 1LUCA 1EBGA 1DBTA 2OMAA 5K3VA 3EXRA 3RNDA 1MQPA 1OF8A 4JTQA 3UT0A 3G24A 2C3ZA 4Q32A 2P8CA 1Q13A 1Z42A 1UR4A 4S2BA 4J28A 2VEFA 4UTFA 4B92A 3MI3A 4GI9A 1UD3A 3AUOA 2YBVA 1TR1A 4H6RA 1PWLA 1RALA 1UA3A 2FB3A 2IPWA 2OZ8A 2HPMA 3DG3A 1QR7A 1CCWB 4I8YA 5DF0A 1CXLA 2SFPA 2PCEA 1O60A 3ERPA 1DPMA 3VIOA 4O17A 1O94A 2TYSA 1ZQ5A 4HA0A 4H9TA 4O54A 3VU2A 2E28A 3F5JA 3RM8A 5T9CE 3WK2A 3ATYA 4C91A 2XVGA 4M51A 3TC3A 1YNQA 2VOMA 2WMGA 1N55A 3A23A 4AZCA 4WVXA 3HMCA 2GJXB 9RUBA 3MHFA 2X8RA 1VF8A 3CUFA 3RU6A 1FP8A 1VPQA 2OKTA 3P3BA 4PSPA 1G69A 1OHLA 3AS2A 4LOCA 3FAXA 3V0SA 3AROA 1UC4A 2ZA2A 4NJGA 2EPHA 2E7FA 3NDYA 1M41A 3A9IA 1S39A 1UR1A 1GTHA 3LTPA 5D4YA 1RP9A 1GKPA 4LCSA 3ARYA 3PK7A 4DJFA 2QUMA 1TPB1 2HBVA 3T78A 2R1MA 5A2AA 4HNCA 3GO2A 5IM51 2OGJA 4UUIA 1R7AA 4XVDA 3R25A 4QM1A 3Q45A 3A4WA 1YDYA 3MVTA 4S3BA 4D6EA 3SY1A 3UR2A 2PD5A 3NDZA 4F0KA 4H2HA 1RQEA 1I0BA 1VGAA 2YFNA 4FLOA 4KF1A 1OGBA 3ZIZA 3W9ZA 4DVOA 3HJEA 3KCJA 4Q7IA 4OTKA 5MF5A 1V03A 3E0WA 4N4PA 3VZXA 1RD6A 4A3UA 2VT0A 3F4CA 1CPUA 4BK9A 3I3EA 4Q4RA 4S3GA 2ZXBA 4HA4A 1ICPA 2ZICA 3GIYA 5J04A 1JZ3A 4EF8A 3B9OA 1UA7A 1FRBA 1ISWA 3KWSA 8XIAA 1V6YA 2AQWA 3TAKA 3R94A 2H9AA 2J79A 1AJ2A 1F73A 2W27A 3RO6A 1E6XM 4US5D 2V3EA 1QNOA 2ZZ4A 3C52A 2ISFA 5AC5A 3SQMA 4JD4A 4JQAA 2E68A 1W1PA 3I6RA 4IFOA 2NW0A 3SCNA 4PMOA 1PHWA 4A29A 3MO7A 5DT7A 1G4PA 4PTXA 1EGZA 4J3SA 1XLMA 3MWAA 2R82A 1A3WA 1REQA 4CNSA 3ME3A 2OWCA 1KBLA 1UWAA 3PBUA 4G7EA 1CGUA 3OP2A 3KRUA 3OZOA 5CQ1A 2V68A 5MKGA 5LA1A 1G7VA 3W1QA 3HOJA 4OV9A 8A3HA 4JFWA 4RPQA 3SDOA 1ZRQA 3GH7A 3LPOA 2MNRA 4ZOCA 3N6HA 4RPPA 2PDQA 5FJIA 3BAIA 1HT6A 1SGJA 3G1DA 2DZBA 2CCRA 3VKCA 4DBDA 1K8ZA 3H6OA 2YDRA 4ORMA 2C1IA 1EX5A 2GQ3A 1KBBA 4G5DA 4LVBA 3TA6A 5C2CA 4Q4OA 2Z1XA 3GFZA 4GGHA 4GFSA 2CBIA 3PZVA 1DWJM 3CUIA 3L4ZA 2CERA 3PB0A 2XPKA 4L64A 4IG2B 3A64A 1EOMA 3LQLA 3O8AA 2GSEA 2OKOA 1LUCB 4J4KA 3SCWA 3W2LA 4BI6A 5A8OA 1FWWA 1OFRA 4E8CA 2EHHA 1XGEA 1TA3A 2D0GA 3MV01 2X40A 3WIJA 1AMKA 1AQ0A 2HV5A 1SVDA 1F8MA 3DFPA 3PBWA 4R53A 4PBEA 3ZT6A 4GUIA 1JD9A 1RQBA 1KXQA 2DZUA 2NQLA 3WO8A 3CK5A 3ZJ8A 4WDTA 3H2FA 2CLIA 2CKSA 1ONXA 3W24A 1IWPA 3KTSA 1TSIA 3G6MA 4TOQA 3FNDA 1QK0A 3R10A 1JCXA 3OODA 3MT1A 2YBUA 4QG9A 5LZLA 3BJSA 5DRCA 1YE4A 3REQA 4XO7A 4I5RA 4C6NA 3IJQA 3OGRA 3CQJA 2O7SA 3C2RA 4LS0A 1U1UA 4ECLA 3A22A 2CLKA 1W3TA 1W9XA 3WD4A 2VEIA 4FF5A 1JXKA 1IE7C 3UG8A 1KM1A 2OXNA 3DG6A 4TXEA 3AS3A 1RUSA 3I3DA 2XSBA 4AZCB 2E77A 1EA0A 3S1VA 4IQDA 3W7RA 3UXIA 2Z24A 2WNNA 1KWKA 3QHOA 3KL0A 3S47A 4BFAA 1FFRA 2TMDA 1V51A 5CBJA 2G4FA 3W1UA 3TZNA 1NP2A 3UVAA 5LA2A 1IEXA 2DFAA 3TV8A 1OFOA 1JDCA 7TAAA 3N2OA 1BSLA 3WQ6A 3AIUA 3AALA 3AXXA 4QIUA 5DBUA 1NTHA 3R13A 3IGUA 1S3TC 2OYMA 2PWVA 2QF7A 3DFOA 4WK9A 4UR9A 1JDEA 1HP5A 5G1MA 4CN6A 4NX0A 3W7QA 4YTRA 2BVDA 4POCA 4E3TA 1L6FA 4GXMA 4HPJA 4Y9NA 4PUKA 3SCVA 4A21A 1W91A 3P0XA 1XH1A 2DVUA 2MUCA 1BG4A 3ABRA 1BWKA 1XPYA 3T05A 3VOFA 1WDWA 1OIMA 2XYLA 1G5AA 3BXWA 3DYMA 1H5VA 5A8NA 2C79A 5CC6A 2ZUTA 3G1HA 4ADUA 2C1GA 1B9BA 5G2HA 3WD2A 3FIGA 1ZP4A 1XKJA 1JUEA 4MM1A 3TVAA 3T9PA 1U22A 5IBXC 3R4IA 4AVFA 1BSIA 3G1SA 2DZAA 3WEMA 1IIHA 1V93A 1O5XA 4GJJA 4E4FA 3CLWA 1KRCC 1JDDA 1J11A 2NSOA 2H9AB 3GNNA 1D7FA 3KUMA 4E6MA 3FOKA 3W72A 3WF2A 4KEVA 4KCVA 1IYXA 1DQXA 5EL1A 3C86A 3CWHA 4JHMA 4I6VA 3BDKA 4L4MA 2GL5A 3NSNA 2WHLA 3S46A 3EXTA 4HBKA 3APTA 2F38A 1BD0A 1TWDA 4CEXC 4GVIA 4IP7A 1XIMA 4AHQA 3HQNA 4A8NA 2YDSA 1DHPA 1YEYA 1CLXA 1UUMA 3OLIA 2PP0A 4GIAA 3HPXA 1REQB 2BVTA 1KV8A 3SN4A 4WHBA 3W7OA 4AY1A 3S42A 1ZBCA 1GOWA 4AC1X 3O63A 4IGHA 1TPUA 2B7OA 1FWEC 3FV9A 5MKGB 3HU7A 1GHRA 1VEPA 3CAWA 4EKJA 4B3KA 4W5ZA 3SY8A 4PMYA 4WY0A 4Q22A 4GO9A 2PTZA 1EA9C 4XISA 3W1TA 2WMIA 4JTEA 5M1TA 1TTQA 2VURA 4O8RA 1IQ8A 2VGGA 4J3ZA 1VZWA 4ZZ9A 3VGHA 4LW7A 3G0XA 3PPHA 4S3FA 4HA1A 1DVJA 4GISA 3KVKA 2ZX6A 6TAAA 2JKEA 1KCXA 4FIRA 1L8NA 3PANA 3SUSA 3FGCA 3UJEA 2NQ9A 4GVFA 3VILA 1KTCA 4QNWA 2EPOA 4NJKA 3LCLA 1TA3B 2YLAA 3L12A 1UD2A 3BQ6A 2QQ6A 1TVPA 5CZKA 2NVAA 4FMVA 5FSDC 1HN1A 1MEWA 1JUKA 1L0PA 4AYGA 1DQWA 4XG1A 2QF8A 1K7EA 3S1WA 2D73A 3ZJ6A 1RP8A 2D2JA 3DHUA 5LYRA 3ZLFA 3GXMA 4DJEC 1EDTA 4XO6A 2TPSA 3VNJA 3U2OA 2EPNA 4K6AA 1J01A 3AHVA 2X41A 2GOKA 1ZCOA 4RE0A 3GNPA 2ADAA 2ZCGA 4QG6A 5E0KA 4X2RA 2DT2A 4NZ5A 4RE3A 3REQB 4MZ8A 3TW9A 2A21A 1B90A 5CC7A 3NL3A 1UR3M 2WNQA 2OOFA 5A6BD 1Q8AA 1SW7A 1J6PA 4TO8A 1G0CA 1DWAM 1GOOA 3EWWA 4GZJA 4HT3A 1XFCA 5AYIA 2OR2A 3VPLA 3NM1A 1CW2A 1W3IA 1W2PA 3CIVA 3EDFA 5GJMA 2VZUA 3QGVA 4PFMA 1TJ0A 3QEZA 4MKNA 2R1KA 4CCEA 2AL2A 3DC8A 1ZJHA 3O6DA 1SSGA 3DECA 4C5ZA 5E0FA 4AWSA 2RUSA 3DFTA 1DTNA 1LRQA 1X6UA 4AZHA 1XFBA 2HDJA 4J1OA 2CXEA 1GOMA 2GLKA 3GFYA 2HNHA 3OPSA 4GUFA 1K70A 4PUDA 4MIMA 4KEUA 4X3ZA 1WKFA 2Y7FA 3TA9A 1W9UA 4JTSA 4YHGA 1UC5A 2JGYA 2ISSA 1AQMA 2CBUA 4IPJA 3AYTA 3E0LA 3RGTA 1DWHM 4ALDA 1GVOA 1GJWA 3W2NA 3TU9A 3WQEA 3TN4A 5D09A 4PUNA 4DF2A 1TE6A 3BOFA 3HG3A 4I5XA 3NQBA 4P2VA 2VL4A 3G3MA 3BAYA 3PTKA 4CNNA 4MJMA 4OZOA 5HR7A 3WQGA 1DWFM 1JZ5A 3UFYA 4XSLA 1V6VA 4OBSA 2F9RA 1RA0A 5DANA 3VNDA 2F8QA 1R3WA 2WSRA 3M0VA 1FHUA 4UC5A 4JFTA 2V5LA 1E4IA 4JDYA 1C8XA 2ACQA 3BV7A 5A5WA 1TWZA 5L6UA 6ALDA 1MUCA 2Y70A 2QCCA 3IJDA 2QDEA 2YOCA 1PZ3A 3GIQA 4JNMA 2PZ0A 2D2GA 2AKZA 1FCVA 4MFEA 4Q33A 2QHAA 3L5LA 1RK5A 1XYFA 5HPOA 3AIEA 5CPLA 3VNYA 3WQDA 5BRBA 5LIKX 2J24A 3CAQA 2GZXA 2XGBA 2P3ZA 5CXPA 8CGTA 2VP8A 4JTIA 4I9MA 1IR2A 1I45A 4MHBA 3VK5A 3T0BA 4C6KA 3LMYA 4EACA 1A4LA 4JTGA 4NZ3A 4CGTA 1WXJA 1VEOA 1XYMA 1R46A 1S2TA 3DYOA 3FVMA 3MJMA 4WY0B 5E70A 1XIJA 3C0LA 2FGZA 2VMFA 4UOZA 5KSWA 3BH4A 2E40A 2VWTA 2BVYA 1ZNNA 2WSPA 3NEVA 3GVVA 3ZT5A 2XFFA 4QTGA 5DELA 1NDVA 3KZPA 2ZDRA 4TU1A 1GZGA 2VEGA 5M17A 1KQYA 3TH6A 3M43A 5I3FA 3RK8A 2PMQA 4JR5A 1H7NA 1B0IA 3QXBA 1E6ZA 4ICNA 4ICCX 2VFFA 5HMEA 3FSUA 4YVPA 3BQ5A 1EJWC 2WNZA 1ONEA 3FGCB 2GQ9A 3MMTA 1ZHAA 1J5TA 4QSFA 3CS2A 4HHHA 3VC6A 2ZZ5A 4GUJA 1W3KA 3IANA 5HJLA 1LZOA 1SU5A 3QHNA 2QCLA 1MFUA 1UIOA 3CUXA 3GKFA 3T0CA 2Z28A 4I9TA 4IOTA 1C29A 2EJ1A 1MEIA 1WDPA 1C9WA 2WMHA 1PWMA 1GGOA 3N19B 3VD3A 2EPMX 3GC5A 2CZDA 2ZUUA 2VO5A 1LLZA 1XLIA 1CXKA 3MUAA 2C6QA 5DN1A 2Z7KA 1YRRA 1X1ZA 1PO9A 4C6QA 1MRAA 4HHLA 5BXRA 1LG2A 5H1WA 1ICSA 1G67A 4ZQMA 2BHUA 2WZMA 1DE5A 2FZDA 3ELFA 4MZYA 4AWEA 3ITLA 4JBRA 1FFQA 3RX4A 1V3HA 4OQVA 1EL3A 2WKLA 4DNMA 3QSRA 3KFTA 4KESA 3VDHA 3CU2A 3PP7A 4QG8A 4KS0A 3VTRA 3OIHA 3TSBA 3L4UA 3RFAA 4RNFA 2VVNA 3N4FA 5HNUA 3KBNA 5A8MA 1X98A 3VDAA 2V8ZA 3EKZA 3W23A 1KXTA 3T44A 3WNOA 1UZHA 3GKAA 2QKFA 3ZFHA 1JPHA 1FWFC 3XIMA 3BJFA 3FKRA 3HN3A 1F5ZA 3P84A 4MMWA 4DJDA 4FNSA 2ICSA 3T4CA 1CBGA 3IAPA 4EPEC 3IACA 4OOUA 3BW2A 4LAKA 4DZIA 2A85A 4R88A 4R27A 3MMUA 1K1DA 4QS6A 4ENLA 5HINA 1KM4A 1WBHA 3E2VA 4Q8WA 3ZWTA 4QDPA 5CCZA 2NXGA 1VBGA 3FEQA 2DQWA 4JTJA 1MO0A 4KIRA 3WBEA 1RJQA 2CBJA 4KGJA 4FXRA 3H7VA 1B9ZA 2Z26A 4FX7A 1Z44A 3QY7A 3RRXA 1ZP3A 1S5VA 2DW6A 3WLTA