3UNDA

Substrate-bound crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
283
Chain Sequence
GSMNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDVTHSLQCRDPLGDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRARCDGPSALPLHQLEGLLSQMKAIDDLVKRMPALEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase 2
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 95
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3undA00
1QO2A 4DF0A 4JTHA 3IEBA 4UC5A 3CT7A 2J6XA 1OF6A 1OFEA 1X1OA 3C0JA 2WOQA 1YDNA 1NVMA 4QJ1A 3S1UA 1H7XA 1GYLA 4O1AA 3C2RA 2Y88A 2VEKA 4LC6A 3VNDA 1DQWA 4OV9A 3T44A 2BZNA 1S5VA 1TMHA 5HWJA 2R14A 4N9BA 1OABA 3RNDA 1KM0A 3TW6A 2KZHA 1BTMA 1FDYA 1UUOA 4X9SA 3MI3A 5HUPA 2TYSA 2GQAA 3DENA 1QDSA 3P8IA 4DO5A 3HOJA 2CFFA 3EWXA 4PODA 4UMBA 1LRTA 4Y8FA 1JCNA 2YCEA 4JD4A 3O8AA 1MEWA 2QCDB 3WJSA 5AHIA 2RDTA 1AL7A 3MO7A 1J2WA 4KWWA 1RV8A 4FXRA 2FPYA 3RMJA 3O16A 1NAL1 4OQVA 1VRDA 3JR2A 3NR0A 3EWYA 5G1TA 4LY8A 4I7WA 3GDMA 1TPH1 1KFCA 4IXXA 4ALDA 4Y9AA 3C2EA 3B0UX 3NQ7A 1SZFA 2WNQA 4E38A 3HPXA 1YXCA 1FXPA 3W7IA 3HPSA 1F6PA 4HN4A 1YYAA 4X22A 3DFSA 3G3MA 1FWNA 1UCWA 4FNQA 2Y89A 4I9AA 1WOBA 3O15A 3W1XA 3OVPA 1K7XA 1RQBA 2FB3A 1I4NA 2YGYA 4ZQOA 4FNUA 1I8JA 2ZZ5A 1UJPA 1KFEA 3EWZA 2HS8A 1SW7A 4N4QA 4J9JA 3CC1A 4JTLA 3PULA 4TR9A 1L2UA 3N34A 3IRDA 4RX0A 5D30A 1VLIA 1KLYA 1QR7A 2ATSA 4UFLA 4IUOA 3CB8A 1XBXA 3HO8A 1W3TA 1SZGA 1YXDA 1JCLA 3GXNA 5F4SA 4U4MA 1NF7A 3KVMA 2RKXA 5K4XA 3CLMA 2VFHA 4O0KA 4GUGA 4WUIA 3YPIA 3IGUA 4LW7A 1TIMA 2OZ0A 5G2HA 5D2XA 4JY8A 3BW4A 3NZRA 1U83A 3FFSA 1S5TA 2JGYA 1FDJA 4N02A 5I3GA 3B03A 2WKJA 3R8RA 3L66A 1NFBA 4K7YA 2J9YA 3WJXA 2ISVA 3W7QA 1TREA 1KLZA 2F7FA 4R7JA 1WAUA 3HJZA 4YWIA 1AW1A 4LT9A 3DKLA 2PRHA 1EB3A 1GT8A 2WO5A 3BO9A 2H8ZA 1IXNA 3LXCA 3PM6A 4LUIA 1SSGA 1L6YA 1VCGA 3F1QA 3PSWA 3C56A 3LHZA 5G2WA 4ZVJA 4LU0A 2DZXA 5K9CA 4WY0A 3HG5A 5HNRA 1IGSA 1H5YA 4UFKA 1PV8A 4NU7A 2J9XA 1FXQA 4PEKA 1RR2A 4MYAA 1ME8A 5HJLA 1LBFA 1OHLA 1RZMA 2GVLA 3INPA 5EY5A 2ZA3A 1OX6A 5HWMA 2ISWA 1W5MA 1ZJIA 2G5WA 1A53A 3CEPA 4N6EA 3RF9A 3L9CA 2PURA 1G4TA 1X8FA 4LUJA 4TIMA 3NQVA 3G18A 2NV2A 3O63A 1FCBA 3W74A 4BI5A 3E96A 4L4LA 5EA9A 5H91A 5AHEA 4NNCA 4DF1A 1Z42A 3S42A 1OK6A 4N6FA 1R46A 4HKPA 1H1YA 2DJXA 3THQA 4UTMA 1XUUA 2Z2UA 3TSBA 1QWGA 1I45A 1BWKA 5LGZA 5L9FA 1OYAA 5G4EA 5CSRA 3NQAA 5F2LA 5FEXA 5DXYA 1OFAA 4DPQA 3MUXA 3NQDA 4EF8A 3VE9A 2A85A 4HNVA 4MOZA 1OX4B 3KXQA 3NL6A 1JCXA 4S2CA 3DFTA 1JQXA 1XBZA 4AHQA 4EVZA 3C2VA 4JGDA 4I7VA 3T78A 2QCNA 4Z1CA 3DI1A 4MZ1A 5D37A 2B7PA 1SZNA 1Q6LA 4CQ8A 4E2DA 1YTDA 1CW2A 3GDLA 5CPLA 1GVQA 4NJKA 2TRSA 2EAWA 1NSJA 3IIVA 1Q3NA 2FLIA 4NX0A 1SFLA 1I2RA 1RVGA 4HSOA 3W7EA 3Q94A 3DBPA 3QJAA 3NM1A 4IXHA 3W2JA 3GLCA 3ABQA 5DLCA 1QCWA 2ZZ1A 3L65A 1J5TA 1KBIA 2PRLA 1JJKA 1UUMA 2G97A 4UR8A 1FBAA 3A22A 1H1ZA 3NAVA 1JVNA 4MJMA 4GRSA 2DZVA 5FI8A 4LRSA 2Y7EA 3L5LA 4JIPA 4PA8A 4KKXA 1EP1A 1ZNNA 1WBJA 3K30A 4NJJA 3UPWA 2Y63A 4K6AA 5IBXA 3PF3A 1P5BA 2Y7DA 3N19B 3LXAA 1MXSA 1FUYA 4MY1A 1KTBA 4CNPA 1QOQA 3PSVA 3M41A 3UNDA 2E6AA 2VFGA 3WJWA 1TRIA 3P8JA 1H7OA 4WXZA 5KZMA 3A24A 4RV8A 4HHPA 2J9ZA 3UXAA 1QAPA 1KM4A 3LTYA 3QQ1A 6ALDA 1VYRA 3MMTA 2A7PA 2GOUA 3GKFA 1C29A 3MP4A 4LS0A 4UNKA 1LYXA 3ABRA 5HQEA 3TFXA 4OBTA 3M9YA 3KOFA 2DZUA 4CLMA 2C18A 4OGZA 3LOTA 4K39A 2QAPA 3LM7A 2QJHA 4NX5A 3TAOA 3VKJA 2FB2A 5HMSA 3R89A 3BW3A 3FS2A 2CLLA 1OYBA 4O28A 1MO0A 1KFKA 1TCDA 4XKYA 3THAA 1TPFA 3LCHA 2W0UA 1TPVA 2YW3A 5IBXC 4LV9A 3HG3A 1V5XA 1M7OA 2O7SA 2VEMA 2C6QA 5SWUA 3NQ8A 3LLDA 2CU0A 1YADA 3DFOA 3G0UA 1XBVA 4Q4KA 2A7RA 5H2ZA 3UWUA 3S8HA 2NUXA 2FJKA 1SO3A 5DXXA 5I3HA 4ORMA 5AHMA 3T7VA 1CI1A 3RK8A 3QEZA 5C55A 2QCHA 1L6WA 1SO6A 1OFOA 1W5QA 1WXJA 4M6PA 5EPDA 1FWTA 1L9WA 4IMEA 1IXOA 3TK7A 4M6QA 4TO8A 3NVTA 1L6SA 3PAJA 4YCPA 1GOXA 4IWWA 2D73A 1T0OA 3LTSA 1TTJA 4UNLA 2RDWA 1W1ZA 1IF2A 2EPHA 5G1YA 1N7KA 1R2SA 4HPJA 1DKWA 2Z6IA 4TMCA 3TQVA 2YDAA 4A22A 1OVDA 3LHUA 2GJLA 4WZHA 1G69A 2H8XA 5DCEA 3EKZA 3TMQA 3TJLA 3S1WA 5AHFA 3ABOA 4UMCA 2I9EA 3G0SA 5A5WA 2A6LA 1SU5A 4ADTA 3L0GA 3NQGA 2DORA 3DH7A 1XL9A 3QC3A 4ML9A 5FF4A 3P67A 4NT0A 2YSWA 1WA3A 2EGZA 1SW3A 4IOTA 1YPIA 3FKRA 3EXTA 3M43A 2NWRA 2ZRWA 4AEOA 3MI6A 1T96A 4OT7A 3B8DA 3N9RA 2FPTA 2FTPA 3HIJA 3TC7A 3EWWA 1XKYA 3GDTA 3CIXA 4QIUA 3A9IA 3FKKA 4MZ8A 4O4WA 2E6YA 1ME9A 5ABTA 1G6CA 1KTCA 4WY0B 3UXDA 2Y7FA 1YLVA 4ZQRA 2A2IA 3TSDA 3W7PA 4PH6A 3NA8A 4WX2A 2E5CA 3FYOA 5LNSA 3UYCA 2YXGA 3KRSA 4GFSA 4AWTA 1RQEA 3W86A 3LTPA 3HG4A 1M7PA 2VFEA 4MFDA 3G1AA 3W84A 4GUIA 3TH6A 3DGRA 3L68A 2OJPA 4ZL1A 5G5IA 1PHQA 4N4PA 5U7SA 3C2OA 3E9AA 5DN1A 2B4GA 3NYZA 2W79A 3KFTA 1SR9A 2GPTA 1N55A 5D03A 5AYXA 1QPNA 2YYTA 4Z1BA 4UFMA 1ADOA 5EL1A 4FX6M 1LLZA 2BTMA 4EWND 2GVGA 2XN1A 1KA9F 2V2HA 2ZZ3A 2A5HA 1QFEA 3GXPA 3HGSA 4DBEA 2BSLA 2X30A 2B7OA 4NXSA 4BI7A 1K7FA 3NNTA 3FIGA 2PCQA 2XN0A 1XM3A 1WX0A 1H51A 4ONVA 3T40A 3CPRA 3UD6A 3HGJA 2ZQ0A 3EKLA 4LOCA 3GAKA 4O1CA 1F73A 1P1XA 1W3NA 3I7QA 3W1NA 1LZOA 1XUZA 2H3BA 3PWAA 1A5CA 1H63A 5IM51 1LRQA 1YPFA 5I3JA 1F6KA 2TPSA 2ABBA 1DL3A 3W85A 3LI0A 1H7NA 3W2KA 4MJZA 3M44A 4JTSA 2O7QA 2V81A 2JKAA 3CTLA 4JXCA 2NUWA 2AQWA 3STGA 2CW6A 1A5BA 4N9DA 4I7UA 4JNMA 4FHAA 3CIWA 2QAFA 4M6VA 2WNZA 2ABAA 4AF0A 3DFNA 1QPQA 4GWEA 1XBYA 3O1NA 5D2VA 1D9EA 3S5OA 4PL1A 2E1DA 5CZTA 5LNWA 3HPZA 5DY2A 3NL2A 2ZRZA 1W5PA 1PVNA 2Q8ZA 2VENA 5AC7A 3B0VC 4O17A 2C13A 1NF0A 1ZENA 4PL2A 2QCEA 3UWZA 1P0NA 5F2GA 3PBYA 1TQJA 3BG3A 2ALDA 3G3DA 4LRTA 3STCA 5LKYA 4HSNA 2EHHA 3LI1A 4XTDA 1U5JA 2Y62A 3TXZA 2ZRYA 5AHLA 1GEQA 5J5DA 3H55A 3ATZA 4IQLA 2CZEA 3R5EA 2FIQA 4JY9A 3M0ZA 2WSRA 3W7OA 3QFEA 1ZAHA 3E12A 3QPYA 4QISA 2Z0IA 4O4VA 3GAYA 5K2ZA 3L0KA 3P82A 4M7SA 3TC6A 2CLEA 3E02A 3PG9A 5F2IA 2F84A 1W5OA 2NX9A 5CZ0A 2J88A 4K8HA 1MEIA 2Y85A 2WQPA 5DCDA 3KRZA 1QPOA 3W7DA 1VGAA 1JCYA 4HT3A 3FOKA 3B06A 1DQXA 3W7LA 3NXFA 1DORA 1G4SA 4W9TA 4XKYB 1LP6A 4C1KA 1KTNA 1F76A 1OG0A 4DPPA 3C61A 4IX2A 1M5WA 4EIVA 3GVGA 3IIPA 4AH7A 1KM2A 3DFQA 4Z0SA 3EX3A 4RXFA 5FF2A 3KAOA 3QH2A 2ZCGA 3L21A 3OBKA 2C1HA 1DVJA 4M7TA 2QCMA 3LCXA 3HB9A 4QITA 3RLVA 3NOEA 2OT1A 4IMFA 1G4PA 1D3HA 5KZEA 1OFDA 3W2UA 4ZQCA 3Q2DA 5BOOA 4HIBA 3STFA 1WBHA 3GKAA 2HMCA 3GDRA 1VH7A 3HGRA 4RZ4A 4R53A 1PIIA 4ZQNA 1LRNA 1TV8A 3G0XA 2Y7GA 3EX4A 4Q33A 1O5XA 3SGUA 2DJLA 3W1LA 4MIMA 1FY6A 1JR1A 3L67A 4O18A 4ZZ9A 3A23A 2H3DA 2ZTKA 1E51A 1WQ5A 5HINA 1TB3A 1LROA 2NXGA 5FEPA 4AAJA 4U28A 4OE7A 4JYFA 1SSDA 4Z1DA 3F4NA 3QF0A 1FCUA 4TX9A 4MPQA 3KVJA 2WPBA 3VE7A 1VHCA 2J27A 4ZMGA 3I65A 4O19A 3W7JA 1F7BA 4LWWA 5CKSA 3HGOA 3RU6A 3QZEA 1OFPA 4UTHA 3F03K 3S5NA 3TA6A 4KWVA 4JTUA 4NXKA 1GJPA 1IIGA 2C19A 1O4UA 3LLFA 4Z08A 4LVFA 4JDYA 2R94A 5F2MA 3IGXA 2GQ9A 3C8FA 3OG3A 1EEPA 3QYQA 4MY9A 4O0ZA 3SSJA 1GYNA 2V5LA 1B4EA 3HQ1A 3IIOA 3FEMA 4L4MA 3TE9A 1IXPA 2Q3RA 3NQMA 3W1UA 5D05A 3DAQA 4WY0F 1W37A 3TMLA 4K7VA 3LHTA 3O06A 2FPVA 2I14A 3SI9A 1FDZA 3WK0A 2C0AA 1ML1A 1LOLA 3G1SA 3LCGA 3OVQA 2QUTA 1FWWA 3W7CA 2P10A 5EMUA 1GG0A 3W2LA 3SFKA 2C3ZA 1PE1A 1ZCOA 5EKYA 2VC6A 2QCLA 2B0MA 4PC8A 2CWNA 2ZZ7A 2A6NA 3QW4B 3DHFA 3SW6A 3EWBX 1TO3A 4P61A 5AOUA 2XFWA 4O11A 4H6KA 5D32A 3DXIA 3IIXA 2C14A 2WJZA 3ABSA 3IGSA 5D2TA 4JDBA 3G8EA 5D33A 4DQWA 1WYIA 3W07A 4O1DA 3C52A 3LHVA 3TQKA 5BW6A 4QSHA 2QCGA 4GC4A 4GUHA 3Q37A 4FO4A 4R33A 5AYZA 1TTPA 4EOUA 5KMYA 4DELA 3R2GA 1TQXA 5BRBA 5DCBA 1WOAA 4O50A 1EUAA 3ZS4A 4N2YA 4C1LA 4XBSA 2ZA1A 3W73A 3BLFA 3NGJA 1AMKA 1GWJA 2DZSA 4CQ9A 2V9DA 1F5ZA 3W1TA 3O05A 3RFAA 3NQ6A 1QO5A 2CLMA 3WK1A 3GR7A 3GXTA 3QPZA 3U2OA 3GK0A 1TTQA 3PUEA 3UZJA 4BR1A 4JX5A 3ATYA 4LNYA 4O14A 5BMXA 2QCCA 1TPB1 3BGGA 2A1YA 1TV7A 1UASA 1TJRA 3OEXA 3T55A 2CZDA 1P4CA 3LRKA 1SPQA 4JN6A 1TRDA 5I3KA 5AN7A 2X1RA 5CZSA 2I1OA 1HG3A 2RHGA 5CG7A 5T26A 5HR6A 2NV1A 1IXQA 4AF0B 3QMTA 1BEUA 3LGEA 3MBDA 5D02A 2OMAA 3LX9A 3G8RA 3M5XA 2QCFA 3BPWA 1Z41A 4MUZA 4X3ZA 3SZ8A 3TFCA 2JBMA 2RH9A 3QM3A 5HULA 1M6JA 4K36A 3DZ1A 3TV8A 1GZGA 3BLEA 2DP3A 3W1RA 2Z6JA 1LDCA 3W7GA 1KFLA 3W71A 3GDKA 4JTTA 1VZWA 3E0IA 2VFIA 4Y6GA 5K9XA 3USBA 1OF8A 1JCMP 3O6YX 3TXVA 1QOPA 1C8VA 3L5AA 1GVOA 3NEVA 4PFMA 2WNNA 3GNNA 4O16A 3R12A 3QSTA 4QM1A 5C2XA 4Y96A 3CEUA 5LNUA 3AJXA 1JCJA 3NPUA 4ADSA 1HO4A 2CZFA 4XZ9A 3CM4A 4BFAA 4GBUA 3DHDA 3NO5A 3P5YA 1LCOA 2YR1A 3STEA 2V0TA 2FDSA 5K4ZA 3N2MA 1BKSA 4FF7A 5FF3A 5KITA 2Z1BA 3IVSA 1S3HA 3TSMA 2TSYA 3TKFA 1LORA 5J5RA 1JQVA 2WSYA 4FIRA 4JS3A 4TMBA 3PBUA 2ZYFA 1YTKA 2NXHA 3DU0A 1SW0A 1I2PA 3W3OA 3W75A 3G1XA 4HPXA 2BXVA 5U4NA 4MY8A 3NM3A 1ZAJA 4CQAA 4JTFA 2CLOA 4GUJA 3MW7A 4Q32A 1VYSX 1B57A 1H62A 4AWUA 1AL8A 2X2GA 3W2MA 4CNOA 3LCWA 5LGXA 1LTDA 3PBWA 1W56A 4QNWA 5D38A 2A7NA 4JR5A 4DEFA 4LVGA 3QSRA 4H3DA 3OVRA 4UTUA 5CSSA 3W2NA 2B7NA 1A50A 3A5VA 4KFOA 4UR7A 3HF3A 4G1KA 5BMWA 2GVJA 3CQ0A 4JICA 5BNKA 1ICQA 2PRMA 3G1HA 3WJZA 4DBDA 3MYPA 2QDGA 3PB2A 1QPRA 1FCVA 2JKEA 3A21A 1MEHA 2C15A 3N73A 4DO4A 1N8FA 1MZHA 1FCQA 1ONRA 2R8WA 3IVUA 2V30A 4O57A 3W7KA 1GTHA 3G22A 3PBVA 4AHPA 1AK5A 2DZPA 4AWSA 3I7SA 2B7QA 4LTSA 2JGQA 1PCKA 1VQTA 3E49A 4AHOA 8TIMA 2C16A 6TIMA 1ME7A 3UWWA 1PCWA 5AC8A 3S9YA 4NZJA 4OWGA 5CGQA 3QW3A 1VPXA 3UQNA 3PUDA 4XBKA 4NNBA 3W83A 2YFNA 5HWNA 3W9ZA 5D09A 4O54A 1KV8A 1ZALA 2YFOA 4QQ3A 2VEPA 4OV4A 3ZFHA 1W3IA 4UXDA 3M1ZA 4FEZA 4IMDA 3NQ2A 1TSIA 5DY3A 4FNPA 1SQ7A 2PC4A 4FB7A 3BGJA 4XTIA 3AO0A 1KW1A 3FJ6A 1YDVA 4WXYA 4FX8A 4UTWA 3W7RA 3NG3A 3PR2A 1KFJA 1XDLA 3HMJG 1RD5A 4XWUA 3W7HA 3UZ5A 3LERA 2Q8LA 3NPVA 3G1FA 4KFPA 3PC0A 1FQ0A 1QMLA 4ZQPA 4YMZA 2ZZ4A 3EWUA 1GQNA 3GIYA 5C54A 3BLIA 4HNTA 5C5YA 5DBTA 3OHIA 4LV4A 3WJYA 2YPIA 2A4AA 3W70A 2ZRVA 1EWEA 3M6YA 3CU2A 4GE8A 4JTEA 2EF9A 5DBUA 4LS2A 4LC8A 4UTTA 3P60A 3VI2A 3M5ZA 3TIMA 1THFD 1XDMA 3TU9A 1VJIA 4YCOA 4WOQA 4YL2A 2GJNA 3MI2A 2AGKA 2GQ8A 2FQIA 3LBCA 3PG8A 5EBUA 1B3OA 5FF7A 4S2BA 4UTWC 1I2NA 4IX0A 1LOQA 4IPIA 3SGZA 2XN2A 3RLUA 3UWYA 2JK2A 2A21A 4TU1A 2CLIA 3V1PA 3PB0A 1WDWA 2VEIA 3TDFA 1RQHA 3S1XA 1I2QA 4AB4A 3BVJA 1GVRA 3GX9A 4O10A 2J24A 4RZ6A 1JUKA 5F4XA 4O53A 2ATMA 2P1FA 1TV5A 4FXSA 1A5AA 1WV2A 2V2DA 2ZRXA 3LV6A 2G96A 1YTEA 1TPWA 1EP3A 1T99A 3PVFA 1FWRA 4UTTC 1XFBA 4LS1A 2TMDA 1H50A 3N3MA 3C2FA 1ICPA 4JYEA 3H54A 4MVAA 2V8ZA 3C6CA 3TQ0A 1ZFJA 1JRCA 1J4EA 4MLJA 3U8GA 1Z48A 4LVAA 1W54A 3M47A 3GYEA 5TQLA 5D04C 2QKFA 3R13A 3UPBA 3O6DA 1T8XA 5HUOA 3EX2A 1BWLA 4JYDA 3EX1A 2W6RA 4DO6A 2IQTA 3LDVA 1UB3A 4RXGA 3NDOA 1W5NA 3HG2A 4K8EA 4RZ5A 3MP3A 1X7FA 1I2OA 2QF7A 3I6RA 1VR6A 4RR4A 1TPUA 5HR7A 1OFBA 3G1VA 3OA3A 2CLHA 3CWNA 4FNSA 4ORIA 5AHNA 5F1VA 5LNVA 2CLFA 3P84A 5E1QA 4CCDA 4MZYA 1W31A 3BV4A 3S1VA 4ADUA 1K02A 4GJ1A 3EXRA 2LLEA 5EYWA 1K03A 4Y90A 1P0KA 2Q3OA 4NVTA 4MYXA 4UUIA 1R2TA 1DHPA 4IJBA 3TR2A 1TPC1 3TX9A 4UMAA 5DELA 4B5NA 1EA0A 3TNOA 4FX7A 1QNVA 1SZEA 2OT0A 4JEQA 1YDOA 1TPEA 4UIOA 1W0MA 5FESA 1H61A 5F1UA 4A2RA 1HTIA 4LVBA 1SFJA 4CNNA 4Z0JA 3ZWTA 1LLWA 1TTIA 3TUUA 2Y70A 3G1DA 2ZRUA 3S5ZA 1KBJA 4JTJA 1F05A 5CPNA 1UBSA 3S6DA 3GNDA 3B04A 3WFAA 2HSAA 4ICNA 1LBLA 3N2XA 3A5FA 3PY2A 3Q58A 4ZQMA 3D0CA 3L2IA 2H6RA 3MYOA 3B05A 1XCFA 3FA5A 4DXVA 4FIQA 3LCLA 2GUUA 2ZBTA 3KVLA 4FNRA 4NUWA 3W23A 1Q6RA 4UTJA 2HS6A 3W1PA 1O60A 4FNTA 4UFJA 2VOMA 2ISSA 3LXBA 1ALDA 3BG9A 1KFBA 2QR6A 1H7RA 2BX7A 1Q45A 3M5YA 5LHEA 1W8SA 1FX6A 4RLIA 2QUVA 4A29A 2X1SA 5LZLA 4IMGA 4XQ6A 1GTEA 2DZWA 4N9CA 3VCRA 4D2JA 5F4WA 5KZDA 2QDHA 4WOZA 3EB2A 5KSWA 3FLUA 1KM1A 1SO5A 1H60A 3V75A 4BI6A 3M16A 4O52A 3I7RA 3GB6A 4O13A 2E5DA 1O5KA 2AAMA 3GR8A 2E77A 4O8RA 5CZJA 3S5YA 1KM3A 3W87A 1DOSA 4QAIA 1YXYA 1TYGA 1B9BA 4JX6A 4UCGA 4UFIA 3T4CA 3CWOX 2BWGA 1PL9A 1ICSA 4UTIA 1F74A 3ELFA 5D2WA 3LCIA 3MHFA 4NNAA 4OU1A 5L6UA 4AXKA 4OHQA 3KHJA 1G4EA 1VS1A 2QCDA 3MWAA 1VLWA 2G95A 3SR7A 3KVKA 3EXSA 1OJXA 3W1MA 2V82A 3C4UA 3P81A 4HNNA 3ZR4A 3G24A 1R2RA 4GXMA 1VYPX 4GUFA 1O94A 3PUOA 1K3UA 3LCFA 1OYCA 1DJQA 3MBFA 1AW5A 3IIZA 1HUVA 3W7NA 1MSSA 4A3UA 1JUEA 2NZLA 1A5SA 2H90A 1OX5A 3BW2A 2ZFAA 2NWSA 3QQ0A 3GZ3A 3O07A 3P61A 2NX1A 5KTLA 3L5MA 1HO1A 4MLRA 1DBTA 2OCZA 1K8XA 3CHVA 1KM5A 3QRHA 5FF0A 3NQEA 2VELA 4K37A 3FYPA 2QUUA 4XUGA 4AVFA 2EKCA 2DU2A 2YYUA 3SJ3A 2X16A 1TJPA 1B4KA 4WD0A 4Z1AA 2UV8G 3W6YA 1O95A 1C9DA 3JRKA 5C6MA 2ZTJA 1EX5A 3F4WA 2CLKA 1DJNA 3JS3A 2E5BA 3TJXA 1F2JA 2YX0A 3N9SA 1EUNA 2OX1A 5K7JA 2RDUA 2VKZG 2VFDA 4O12A 3LHWA 2NXIA 4WQ6A 1VCFA 5K3VA 1Z44A 3C3NA 4LVDA 1LBMA 1RPXA 3HBLA 3QMSA 1FWSA 3EX6A 3M5VA 4BWLA 2DZTA 4R34A 2X1TA 3NQCA 4GNJA 3G1YA 1CX9A 3P7YA 4QNEA 1S5WA 2Y61A 5LHFA 3LB0A 3NQFA 5AFDA 5I3FA 1R47A 5LSMA 1KV5A 3I68A 3TAKA 1NEYA 3SY5A 5LNRA 1XC4A 5CPMA 3BARA 2CZ5A 3U6WA 4M5PA 1ZY9A 4BF9A 4S1FA 2QJGA 4AMAA 3LHYA 3LV5A 1JULA 4HNUA 3MHGA 2E6DA 1HL2A 2PE4A 3W72A 5AYYA 2E09A 2NLIA 2V2CA 3S0CA 4MFEA 1EIXA 2Y6ZA 3FJLA 3NL3A 4K38A 4RKAA 3KRUA 3WK3A 3B4UA 4N9EA 4UTKA 1EP2A 4JTIA 4H4IA 3NZ1A 2NUYA 2R91A 4O1BA 1Q6QA 4BWLC 3BK0A 4DF2A 1HFBA 2BLEA 3WK2A 5K9DA 2ZA2A 1G7UA 4O15A 3TROA 3UWVA 5D2YA 3W22A 1SO4A 5AC6A 3DKJA 1ZAIA 4P2VA 1K8YA 2A0NA 1G7VA 3KX6A 1XXXA 1R30A 3IV3A 1GVSA 5CPOA 2YZRA 1H7PA 4NJGA 1X6UA 4IMCA 4UTLA 2VXNA 5FEWA 4M19A 2WSQA 4RCXA 3P80A 4PTNA 4WJEA 4YXGA 1JRBA 1TPDA 1XI3A 5GVJA 1OFRA 3NL5A 4RJEA 4BK9A 1Y0EA 2P0OA 4E0CA 5FEZA 3W76A 5KINA 2ZZ2A 4UFHA 4RK8A 5TBOA 3UY8A 3M7WA 3OIXA 3NPWA 4A21A 5I3IA 5G2IA 3SIZA 1GG1A 1OFQA 4X2RA 2VFFA 4A2SA 1EPXA 4JTKA 3B0PA 1K8ZA 3SECA 1LM1A 1JUBA 2FFCA 2QEZA 3EEGA 3P62A 4YLWA 1X1ZA 3P5ZA 2WV8A 1PS9A 1OX4A 4CCEA 4IGHA 1AG1O 3QMRA 1IIHA 3VFLA 3IVTA 4NJIA 1SUXA 2HTMA 3LRMA 1LOSA 3N14A 1D3GA 2ZDRA 1VCVA 3UWQA 4NJHA 2E6FA 3ANYA 3L0NA 2E68A 3W7MA 5MHBA 3TCEA 3MHUA 3UY7A 7TIMA 3W1AA 2QJIA 3MP5A 1DV7A 2V5BA 3PS7A 1ZHAA 3MJYA 1G67A 1H7WA 3BG5A 3LBMA 2JKPA 2RFGA 4JX4A 4NQ1A 3P74A 5E93A 4CCCA 3DI0A 4JIQA 1EWDA 1GPWA 5TIMA 3O6CA 4MKNA 4PCFA 1GVFA 4POCA 1Q6OA 1VC4A 3W1QA 3ZWSA 5A8GA 2YW4A 4IPJA 3LRLA 4KFNA 1V7YA 3W88A 5E0KA 1OK4A 4E2BA 4JTGA 1PHWA 4EF9A 2X1UA 2ZZ6A 1AW2A 1KM6A 1VHNA 2NX3A 1K7EA 5AB3A 3H53A 5G4WA 3NPXA 4NZFA 3DFPA 3TW7A
chains in the Genus database with same CATH superfamily
5CPSA 4JTHA 3IEBA 3EAUA 3CQJA 2J6XA 3H7UA 4YNGA 4AISA 4TX8A 3C2RA 4LC6A 1DQWA 1ADDA 2BZNA 3VIJA 3FV9A 3Q45A 1OABA 2J8GA 2FMNA 2ZX7A 4C65A 1BTMA 1FDYA 1QHPA 1ODZA 5AECA 1RCXB 1QDSA 3ABZA 3AYVA 5I24A 1U30A 3AUJA 3AXKA 4PODA 1E3ZA 1W1B1 1FWGC 3BSHA 4GO8A 3O8AA 1MEWA 3RRXA 4JKMA 3WJSA 1AL7A 3MO7A 4KWWA 1JDFA 3O16A 3OU8A 4OQVA 1HKIA 4HOXA 4D72A 1TPH1 5DMNA 4W7VA 2XH2A 4ALDA 5TD4A 3NQ7A 1R5YA 3N6HA 5A1AA 2WNQA 1L8PA 1R7OA 4CU7A 2ICSA 2I5QA 1DXIA 1FXPA 3HPSA 1F6PA 3DFSA 2WZMA 4FNQA 4I9AA 4ZR8A 3LK6A 4DB7A 1RQBA 2WWCA 5T9BG 3I10A 1QBAA 1HXJA 4GO9A 1PX4A 1KFEA 2NSXA 2HS8A 3KOZA 3GM8A 3CC1A 3PULA 1JZ8A 3BJSA 3G6LA 2VUNA 4H7CA 4C6BA 4HOWA 4RX0A 7REQA 5D30A 3F5KA 1VLIA 1KLYA 2PDUA 2ATSA 1FWAC 4WDWA 1PKNA 2HQAA 3L2LA 3UETA 3B97A 3TTEA 4I5UA 3KVMA 3CLMA 9XIMA 3KS6A 3KE0A 2GSEA 5FOOA 2OZ0A 1KRCC 1A5UA 4JY8A 3K4WA 1T41A 3BW4A 4GZIA 1CZ1A 1U83A 3FFSA 2OWCA 2FDMA 1S5TA 3PJTA 4N02A 3B03A 4P7LA 1EXBA 4OZOA 3KLLA 3WJXA 4GQBA 1FWEC 2F7FA 4R7JA 1JFXA 1BYAA 5IHRA 1QVBA 2ACQA 3SRHA 1M7JA 1EB3A 3H6OA 2E7FA 4JCLA 1L6GA 1Z89A 4H19A 1GT8A 3I3EA 3B8IA 1IXNA 3LXCA 3TOPA 1EQCA 1F3XA 4QGCA 1W1A1 3PSWA 1C7TA 2J66A 4C6PA 5E6ZA 3C56A 3UCQA 2G3JA 4LU0A 1G9HA 4MWAB 3HG5A 1V3LA 4DIAA 4X60A 1IGSA 4UFKA 4JKLA 4F9DA 1OC6A 1FXQA 1RR2A 3WNLA 1N2VA 2WZHA 4A8RA 4PULA 2YLLA 1LBFA 1OHLA 2GVLA 2OWWA 3JZEA 1VF8A 5HWMA 5HK4A 1UWQA 1ZL1A 4GINA 3BANA 1SR0A 3UW6A 2YZ5A 3LS9A 1G4TA 4LUJA 1QU4A 2NV2A 2PFHA 1FCBA 1H09A 4ZO6A 3W74A 3QHOA 4IFKB 3A4JA 3CQKA 1VPQA 2G8ZA 2NVAA 4BJHA 1WDSA 3VIFA 4LH8A 3V18A 1DE6A 1E6RA 2YCIX 1E6ZA 1R9XA 2R1LA 3U9IA 4HKPA 3TLQA 1H1YA 4E8CA 4JN7A 1XUUA 2VJXA 3FGCA 1QWGA 1BWKA 1E71M 1AJ0A 1E73M 4QBXA 3GH4A 2CXEA 2PDMA 1QNPA 3HZ3A 5HMEA 4IHCA 3MUXA 3OGVA 2DGAA 1KRMA 1OADA 3CGTA 3S6OA 3A3WA 1Y5XA 3NL6A 3DFTA 4H9UA 2OG9A 4EVZA 1PB0A 5HNNA 2PTXA 4JHOA 5D37A 5E0CA 1B90A 3F2BA 1YTDA 1BG9A 1CW2A 5CPLA 1NSJA 3IIVA 1E4MM 5BOFA 4LAUA 3NM1A 5ABGA 4IXHA 3AUOA 1P0BA 2DSUA 5DLCA 4C7GA 3R11A 1JJKA 4XUYA 4DLFA 1H1ZA 3NAVA 3LBOA 4JIPA 3SRDA 1SJCA 1V0LA 2Z4GA 3QPEA 3CPUA 2W66A 3PF3A 4V2XA 1P5BA 2Y7DA 3EMZA 3N19B 3BCJA 3PN8A 4E3TA 2XYLA 4RW5A 1KTBA 4LYRA 1UD4A 2GJPA 1WDDA 4M56A 1JDAA 2E6AA 4V1YA 3VZZA 3WJWA 5REQA 1H7OA 1I1XA 3PJXA 2V67A 5KZMA 5D9OA 3GSMA 2CERA 1LWIA 2YB1A 2J8TA 1KM4A 3QQ1A 1JZ4A 1MDLA 4GX9A 3MMTA 4E8GA 2GOUA 3MP4A 3DERA 3RITA 3AAMA 3ME3A 3TFXA 4AD5A 1MXGA 1Q6FA 3E5BA 3VIOA 2C18A 3KBSA 3LOTA 3RAOA 3VKJA 2FB2A 2JEPA 4PMQA 4XKYA 3WL1A 5IBXC 4LV9A 2QIIA 1GQJA 3BOLA 1M7OA 4TTUA 2VEMA 2XIIA 4FLOA 3H2MA 1CPUA 4MB1A 3H23A 1IEXA 5D8WA 3QVQA 4AWEA 3T7VA 3NSNA 1ZBCA 1YHTA 3GFYA 2QCHA 3UPMA 1SO6A 4M6PA 1F4AA 1QUMA 4OTKA 1CXKA 4RL3A 3BOFA 4TO8A 3S46A 1EOMA 3NVTA 4YCPA 4IWWA 1TTJA 4GFIA 4DYKA 1AMYA 3VM7A 2ACRA 2YKKA 1DKWA 4TMCA 1TVPA 4FOJA 4CKQA 2RAGA 5I02A 1OVDA 2GJLA 3WG6A 6CGTA 2XWDA 4JFWA 3MQTA 3W0KA 3SCUA 5BCAA 1NH6A 2GSJA 5AVNA 2VEGA 3ABOA 3LLXA 1OT1A 1C91A 2PGWA 4ADTA 2OVLA 3KLKA 3P67A 4PMXA 1BTCA 2YSWA 3EBVA 1VJSA 5A2CA 5TNVA 2OTDA 2I9UA 2XTKA 1Y7VA 3FKRA 4TVCA 2DW6A 3EOUA 4Y9OA 1PZ3A 2ZRWA 4XVDA 4AEOA 3B8DA 3NFUA 5A6BA 2J13A 1XKYA 4J35A 3CIXA 4PB5A 3EWDA 2YOCA 1GUVA 1M03A 5CJMA 2YA2A 1KTCA 4WY0B 3UXDA 4W84A 2Y7FA 1YLVA 1QPKA 4OBRA 3NA8A 4WX2A 4TOQA 1TWIA 1A4MA 2YXGA 1EHAA 5BXPA 1K4GA 3HG4A 1M7PA 2VFEA 1IEWA 3G1AA 5GJMA 3UVIA 3W84A 3L68A 4W7UA 4QROA 4N4PA 5U7SA 5ABHA 1M3UA 3CQIA 1PTGA 1QPNA 4Z1BA 5BXRA 4UFMA 2J62A 1ADOA 5EL1A 3KCLA 1UWUA 2B31A 3FXGA 3U2CA 2QS8A 2P5NA 4EWND 3UJEA 4HK7A 2A5HA 1QFEA 3GXPA 4IIDA 4AZHA 2BVYA 3BMWA 1PDZA 4XO6A 1P6BA 1EH9A 4BI7A 1B0IA 2PDXA 1VP5A 1HQTA 2DFAA 3PTQA 1XM3A 3QV8A 4PRRA 3S5SA 3S83A 2EPLX 4QE5A 3WNMA 2ZQ0A 1XWYA 1HW6A 1P1XA 3W1NA 1XUZA 1H63A 4HHLA 1E4LA 5IM51 2PDHA 1O12A 5C8BB 4D9PA 3M7SA 2VX6A 3RLGA 4Y7EA 3BZGA 3N15A 1ZJBA 4MJZA 2R1KA 2JALA 2PODA 4YTUA 3SO7A 3VOGA 2R24A 3EYPA 3K8LA 4H2CA 4I8YA 5HDRA 2OGJA 4U5IA 3STGA 3IGHX 1J0HA 4YU1A 2EPOA 3WNKA 4FHAA 3PJWA 3CIWA 3A4AA 1LUCB 3KL3A 2VEFA 3S5OA 1D9EA 4F0SA 1NDYA 1IWAA 3HPZA 5DY2A 3WF3A 1ZENA 4PL2A 5HPOA 2QCEA 4WGHA 1P0NA 1BYBA 5F2GA 3IJ9A 2VR5A 4EKJA 1TQJA 3UG8A 3BG3A 1DYSA 3G3DA 2QQ6A 4LRTA 4HYVA 2YL8A 5LKYA 3NVDA 6PTDA 1S5NA 3TTOA 3LI1A 5XINA 4Z2HA 2Y62A 2ZRYA 4IGMA 5AHLA 2DQWA 4GNKB 5FJJA 3H55A 3AU2A 2F2HA 3WFLA 3GU1A 4GXWA 2ZE0A 2Z0IA 3H2AA 3LMYA 4M7SA 2CLEA 3E02A 5EFDA 5F2IA 3THDA 4B92A 4V15A 2XSXA 1W5OA 2NX9A 3KWXA 5M17A 3EA1A 2Y85A 1QI3A 3ITOA 3AMCA 3LZ5A 4HT3A 1JCYA 3G1RA 3DGBA 1DQXA 2WLZA 5JU6A 4GXPA 1DORA 4ZSUA 2VR4A 3KDNA 1OG0A 3C61A 4IX2A 3EPMA 5FJOA 2IMRA 3IIPA 5FF2A 1WKYA 4LF1A 1UKPA 3BC9A 1XSIA 2QGYA 1DVJA 2XGBA 2UBPC 3RLVA 2E4TA 2OT1A 1E1CB 3GO2A 8XIAA 4KERA 5KZEA 3GU9A 1OFDA 4ZQCA 3Q2DA 4NAEB 5BOOA 3UZZA 2BS9A 2DSVA 2QMKA 4Y2WA 4EP8C 5A94A 2FFIA 2Y7GA 2BBFA 5AC5A 3H24A 2DJLA 3W1LA 4MIMA 3BAIA 5B7ZA 1FY6A 1D8CA 4BHYA 3UJ2A 3I4KA 1D7KA 2Y5JA 1WQ5A 5HINA 1XC6A 1XLIA 1TV2A 2NXGA 5FEPA 2XSAA 1HF6A 4U28A 4RDYA 1FWHC 3QF0A 4FI4A 1FCUA 2FGLA 3KVJA 3FDGA 3VE7A 2I5IA 1B1YA 4ERAA 4O19A 4XO7A 3FDKA 5HOSA 3NO3A 2XVKA 3S5NA 1JZ3A 4JTUA 2C19A 1O4UA 4FLRA 4Z08A 2PDPA 4LVFA 3HM7A 4JDYA 1GORA 3C8FA 3SSJA 1JPMA 3WEMA 1XGEA 2ON3A 1XISA 2VHLA 4RDVA 4P8XA 3WBWA 4A8LA 4LAMA 3NQMA 3BLLA 1SJBA 1XSJA 2YDSA 4Q4SA 3FHQA 1BFNA 3AYSA 1J0JA 4WY0F 3SFWA 3WK0A 1U22A 3LCGA 3FSTA 2F61A 1YKWA 3BICA 3OVQA 3VCNA 2NQJA 4GA8A 3OQEA 1KC7A 3L12A 3E2RA 3AU6A 3N2OA 2C3ZA 2W27A 1PE1A 4PTWA 1ADSA 1R3VA 1ZCOA 3H8AA 4JL2A 1NOWA 2BHZA 4PC8A 4C6FA 3LPGA 3DHFA 4Q3MA 2XFYA 5D32A 1IV8A 4L80A 3U4AA 2VD8A 4NRRA 5D2TA 3CS2A 4DJDA 5D33A 1D7FA 1E9YB 1C8QA 1AQ0A 1UZ1A 2NT0A 1XCXA 4QSHA 4G7FA 4NI8A 2QT3A 1PSCA 1E70M 3GR4A 4E4UA 4NP7A 4AY1A 1EKOA 5AYZA 4XZWA 4EOUA 1TQXA 5BRBA 1WOAA 4QHRA 2JE8A 4C1LA 6XIAA 1AH3A 3O9NA 3TJIA 2DZSA 2OGYA 2O92A 3W1TA 4ZENA 1EYWA 1DJWA 4RE0A 2CLMA 3QPZA 3U2OA 1TTQA 3PUEA 3UZJA 4BR1A 2Y8UA 3ZZ1A 4O14A 1RJPA 1OIMA 2R9RA 3QZ6A 1Q2SA 1SPQA 4M29A 6REQA 3M0JA 2RHGA 2PLCA 4DY1A 2FZ8A 4AF0B 3MBDA 3ZJ8A 3LX9A 3G8RA 1Z41A 4X3ZA 2XVGA 4BQ2A 1UROA 1F3EA 3DYMA 1S2CA 2Z6JA 1LDCA 2IKHA 1RY0A 3W71A 4H9XA 3E0IA 3RYSA 1Q6GA 3USBA 2CPUA 1MW3A 3TXVA 4IIGA 5C9UA 1WPCA 1QOPA 3L5AA 1TJ2A 3T09A 5D4YA 2WNNA 4O16A 3R12A 1OGBA 3CEUA 5LNUA 3TYAA 1XLJA 1JCJA 3L4ZA 4ADSA 2BY1A 3CM4A 1EJXC 2INFA 3P5YA 2YR1A 3STEA 1UZDA 2ZXQA 3WKZA 1V02A 5HJYA 1UZ4A 4MG4A 4D6IA 1MRAA 1XFCA 1XLFA 3PPHA 4FF7A 4MF4A 4LX4A 3DG6A 1AFSA 2IKGA 1PIGA 3WLMA 1EHNA 1WP6A 4AZBA 3G1XA 2AL2A 3EPOA 3M0VA 4GNVA 3NM3A 2CLOA 4UQCA 1VYSX 5LA1A 1B57A 3H12A 2EEXA 3DG3A 3J7HA 3W2MA 2INEA 4HBKA 3LCWA 5LGXA 1HL8A 5D38A 1E6NA 4JR5A 4LVGA 4DAFA 3A5VA 4L1XA 4UR7A 3BXWA 2X09A 5HXMA 3HF3A 4L7ZA 4JICA 1ICQA 1UD6A 3WJZA 4ZEPA 3MYPA 3U2ZA 1KCLA 4PBFA 4H6RA 3PB2A 2PLKA 3A21A 3USZA 4DO4A 1FCQA 1ONRA 3MPGA 3WQCA 2V30A 3TONA 1IGWA 5FJPA 2XIQA 4AHPA 3TYUA 2DZPA 4CVWA 4GYPC 1HIZA 4LTSA 4LCQA 2D23A 2WMIB 6TIMA 1ME7A 3NTYA 3S9YA 1VB9A 2REQA 3S47A 1NOFA 3PUDA 2Y5SA 4KRZA 3WDIA 2DDXA 3W25A 4Z2JA 2CBUA 1JZ5A 1XH1A 3W83A 1TE1A 4WDUA 2BOFX 5FJUA 3W9ZA 2WZIA 1YNPA 2Q6ZA 3PFMA 2QUMA 3KP1A 4NZ3A 3OZYA 1RBOB 2Z1WA 5JBFA 3TWBA 3NQ2A 5DY3A 1SQ7A 5JH1A 3CIVA 1U1JA 3SUSA 3AO0A 3FJ6A 4FX8A 3ZJKA 2PI6A 4AG0A 2AOSA 4F0HA 4IUGA 3VVGA 3VDBA 3EA3A 4K68A 2GUBA 1XLAA 1WDPA 2BV9A 3CAWA 3NPVA 3WNNA 1UOKA 1BVWA 1ZBKA 5C5YA 3A3XA 2TODA 3JZUA 4IGNA 2CHNA 3EZ4A 4LS2A 3W6MA 1VBGA 4UTTA 5BROA 4A8IA 2Z1SA 4ZTXA 3DDMA 3FNDA 5C2GA 3HV8A 1HX0A 1KQZA 2HBVA 5EBUA 5FF7A 1E6PA 2PLMA 4UTWC 4DZAA 5I6SA 2OQHA 1LOQA 1UKQA 3QGAC 2XN2A 3E1F1 1J6OA 1PEZA 1UWSA 1LT8A 4DXXA 1RA0A 2JK2A 1XIEA 2CLIA 3VIPA 3V1PA 2DQXA 4ROPA 1NQ6A 2J24A 1JUKA 2QXWA 2OB3A 3XIMA 4OBSA 3POHA 2W5FA 1YTEA 2AQVA 2WLYA 1V6TA 1XFBA 3ANVA 2TMDA 4WCJA 4YVXA 3C2FA 5DMLA 3TQ0A 2R6OA 3AHYA 4MLJA 4WVXA 3U8GA 1Z48A 3R79A 2BOEX 2WYSA 3CT2A 3L4VA 2QKFA 3BLPX 2X2YA 3DN5A 3GHUA 3UPBA 1TE6A 4ZOBA 1GOQA 3EX2A 4AFYA 3ARWA 1BWLA 3WUFA 4DO6A 4U3AA 3UG3A 3NZQA 3NDOA 1Z32X 2QF7A 3QY7A 4KEMA 4RR4A 2VC9A 1LT7A 1TV4A 2W67A 3A4WA 3AS1A 1OFBA 2PWGA 3P84A 4R88A 5E9AA 4ICCX 1V7AA 3VM5A 3VNJA 3IJIA 1W31A 4GI4A 3S1VA 3PJUA 4AYSA 4DZ5A 4Y8EA 2ZX5A 2CHRA 3EXRA 4G56A 3CO8A 5AYIA 2UWFA 1R2TA 4GGHA 1MZRA 3OBEA 5ABFA 2Z1XA 2NT1A 2ZICA 1BYCA 5FCZA 3TR2A 3TTQA 3TX9A 1P7TB 4UMAA 5DELA 3CHEA 4AC7C 1FWFC 1P0EA 4XD3A 3UESA 3AALA 1WDQA 5FESA 1TWWA 3JW7A 2XH7A 3GNXA 5A95A 3HJEA 1ZP4A 2XVPA 4Q8UA 1TTIA 2WMIA 4TXEA 2Y70A 4JTJA 1F05A 3A4XA 1LBLA 3BAJA 5BWFA 3N2XA 4ERGA 1W1PA 1JYNA 3WQGA 3MYOA 3B05A 3OW1A 3GG1A 4DXVA 4FIQA 4EXBA 4IG2A 4OOUA 2GUUA 3KVLA 4FNRA 4JAWA 4GIAA 3V0SA 4ZB2A 3VD7A 2Z25A 1Q6RA 2Z24A 3PUGA 3W1PA 1O60A 1XPGA 4UFJA 4W8AA 3LXBA 1ALDA 4JPGA 3AIVA 3BG9A 1GPFA 1EJWC 4D6FA 4GCXA 4QCEA 1ZBVA 3ZSTA 2X1SA 5LIUX 4XQ6A 4ATDA 2DZWA 1GQLA 2QDHA 5KSWA 4S3FA 1SO5A 4CD6A 4BI6A 4O52A 4E2OA 1FOBA 2OKOA 4U33A 2BODX 4XVEA 4CEUC 2I16A 3KZSA 2AAMA 3GR8A 4HHMA 4QE1A 3AS2A 4DUWA 1TYGA 4KH2A 4JX6A 3T0DA 1ICSA 3H2OA 2VVSA 4AD2A 3C8NA 1RJRA 4TX6A 1M04A 3RX4A 1REQB 3C5QA 4NNAA 4AXKA 4OHQA 2Z00A 4W7WA 4CQDA 1A5OC 3MWAA 1VLWA 3EXSA 1DXFA 2DV0A 2JF6A 4DUXA 5DQPA 3ID7A 1XIIA 3WEOA 4GGBA 4MNKA 4GXMA 3QFWA 5DRIA 3HTWA 3UXLA 4E4FA 1VFUA 5KEZA 1OYCA 1DJQA 2G0WA 3IIZA 4M80A 3VDHA 1JUEA 2BASA 2ALRA 3AWOA 4DNMA 4HA0A 1A5SA 3H7VA 3VILA 2CETA 3O07A 1K8XA 3CHVA 3QRHA 5FF0A 1LG2A 3NQEA 4B3KA 2PDNA 3AIBA 4J3VA 3ZVHB 1PO9A 3CV1A 2OKTA 2X16A 3HMCA 3BAKA 3GNRA 1CIUA 4FR1A 1UQZA 4WD0A 3W6YA 1C8YA 1DQUA 5FIPA 1U2YA 1B3XA 2DIEA 2J7FA 1YE4A 3ITLA 4ZBCA 3JS3A 3AZRA 3MZ2A 4BQ5A 2VNCA 1MFVA 4EWJA 2OFJA 4QJ3B 1CGXA 2G37A 5ECVA 1QK2A 3LNMA 4D8LA 3EX6A 4BWLA 5GNYA 4LBRA 2DZTA 4R34A 2X1TA 4B3ZA 4J3UA 2PU0A 4QDPA 4GNJA 2YA1A 4DJFD 3M0HA 3N4FA 3LB0A 5LSMA 4GBDA 2CHOA 1OBAA 2OR2A 4JEJA 1XS2A 1EJUC 3QGKC 4BF5A 3PZVA 4S1FA 4CD5A 3LV5A 2PDGA 3LZ3A 3VOJA 3MHGA 3WL0A 5ABEA 3OZOA 3JUGA 3WN6A 5AYYA 1A5LC 5GQBA 1NWRA 1XP3A 3JVAA 4ZO8A 1HKMA 4M81A 2ZUWA 4IQJA 3GY1A 2GWGA 2NUYA 1Q5MA 2R91A 3APYA 5EMLA 4O1BA 1Q6QA 4M24A 2HEJA 2OZ3A 1ZP3A 3HURA 1E1EA 3W22A 3R94A 1EDGA 4FZIA 3DUGA 4B2DA 1XXXA 4I90A 5CPOA 1V03A 1M65A 5C7HA 2BP1A 4JTCA 3FSUA 4M19A 4WJEA 2V5KA 1C9WA 2KAUC 4RJEA 2DUXA 5FEZA 3W76A 5KINA 2ZZ2A 4KESA 4ZXOA 5TBOA 4DHGA 5I3IA 4A21A 5G2IA 3SQMA 3LEPA 4LGXA 4A2SA 4ZO9A 2RDXA 4M6UA 1LM1A 3EEGA 3P62A 1BXNA 1TA3A 4IGHA 4KEVA 4GIYA 4AIBA 1G94A 1D2KA 2WK2A 3UG4A 3VX0A 1HP5A 3LRMA 3SCOA 2ZDRA 3UWQA 1CBGA 1UR2A 3ANYA 4NL1A 3W7MA 2EO7A 3MHUA 7TIMA 4AX7A 2VD9A 3W28A 3MDWA 3MJYA 1W3HA 2IXUA 4NQ1A 3BG5A 2JKPA 3MSRA 2V3EA 3P74A 5JVLA 5C2CA 4CCCA 3ZLHA 2FHCA 1EFZA 3UYIA 4MKNA 2VZUA 1VC4A 4JFSA 4IPJA 4CQBA 1PAMA 1SYTA 1QW8A 3N9KA 1UR1A 5E0KA 3GFZA 4E2BA 3EDFA 4JTGA 4HPGA 4NILA 1S2WA 2GWNA 1IZJA 4EF9A 1QW9A 1AW2A 3IS4A 2BVTA 4Q8QA 1U1HA 1KM6A 1VHNA 2NX3A 4RZBA 5AB3A 3H53A 4PUNA 3NPXA 2I7GA 4NZFA 4B5VA 7XIMA 4NIRA 2V6AA 3CAKA 2FZ9A 4YYFA 3CT7A 2Z1KA 1KBBA 2WC4A 1OF6A 3HFTA 2WOQA 4F4RA 1NVMA 3EDJA 4V28A 3S1UA 1GYLA 2QYGA 2VP8A 3HN3A 3Q4DA 3T44A 1FH7A 1FA2A 3GW0A 4PMRA 2R14A 1KM0A 1VPYA 3CUJA 4F0RA 4X63A 4YTQA 3V16A 3KS5A 2W9MA 4DYJA 1T40A 5CAKA 3GNPA 1JDEA 3GQYA 2EPMX 3EWXA 3KDOA 4UMBA 3WH9A 3PZOA 2YCEA 4JD4A 4L6DA 1XRVA 3AZSA 1J2BA 2FPYA 2FZDA 3LQLA 3JR2A 3UCDA 1OC7A 2DSWA 1V02E 2PC8A 1XGZA 4E38A 3HPXA 5C7VA 1YW1A 3W7IA 3E0VA 4X22A 4XD6A 3G3MA 3WX7A 1K6AA 1WOBA 1K7XA 4IFRA 2FB3A 1I4NA 1W9DM 2IW0A 1S1PA 4ERIA 1UJPA 3GUGA 4N4QA 3OGSA 2GFTA 1A5KC 1L2UA 3ARYA 3COTA 2WB5A 4X0NA 1A5NC 1W9VA 2DT0A 1XD1A 2XM1A 1RPKA 4HGXA 1QR7A 4G7EB 1X96A 1GQIA 3IK4A 3MY9A 4IUOA 3F2DA 3PP7A 4YS1A 1YXDA 1M41A 1XLBA 1F8MA 9CGTA 4G1NA 5K4XA 4GUGA 4NYUA 3VD3A 1K8CA 4LW7A 3N2TA 1MRQA 5I3GA 2KX9A 3R8RA 3L66A 1NFBA 3UP8A 2ISVA 1TREA 1OZMA 3B8UA 2VL4A 4RPPA 2V3FA 3E2QA 4PSPA 1EIBA 2CXGA 5FJRA 2FZNA 1AW1A 4YWIA 3DKLA 3QY8A 3WY1A 1H2JA 4RE4A 1GZ1A 2VI0A 2GGHA 3KCOA 4LALA 3BO9A 2HE8A 4KW2A 1SSGA 1L6YA 2Y2WA 4QLLA 4QAWA 5LA2A 4I9MA 3MJMA 3V4BA 3LHZA 2DZXA 2PS2A 3PWGA 2OLAA 2NW0A 1H5YA 4AMCA 1PV8A 2FH6A 1Q66A 4Z2GA 2J9XA 4PEKA 4MYAA 4LUSB 4QDMA 1O1ZA 1DWAM 4C5YA 1B54A 2BHYA 1W6TA 2ISWA 4HNLA 1US2A 3VGFA 1R3RA 1UYQA 3P0WA 3L9CA 3VKBA 1B2YA 4TIMA 4P7NA 3NQVA 4BI5A 3E96A 5GPRA 5A8OA 4UOQA 5AHEA 1UIOA 1DIKA 3D6NA 4DJEA 3AZTA 1OK6A 4N6FA 4QG8A 3S2NA 3IUIA 2HWGA 2WVVB 4UTMA 3T2OA 4J3ZA 1FP9A 1GOWA 3TSBA 5JQ9A 1I45A 2DY3A 5LGZA 1GW9A 4K8GA 4FP1A 5CSRA 3NQAA 2XFRA 1XLGA 4EK7A 5F2LA 1ZS2A 3K8KA 3N04A 5E9XA 5DXYA 4K1WA 4JIHA 3NQDA 4GK8A 1CEOA 3WLNA 1VBJA 4EF8A 1U5VA 2Z7GA 4HNVA 3CHFA 4MM1A 4MOZA 1NIUA 1OX4B 2PZ0A 4CNSA 2ISFA 3KXQA 4A05A 1XLLA 1JQXA 2P53A 1XBZA 4AHQA 3C2VA 2D0HA 1UR3M 3WLLA 4HB7A 2QCNA 3T78A 2YCLA 3RMEA 4F0LA 2B7PA 1SZNA 3ZXWA 5FL0A 1TX2A 2V5JA 4NJKA 3T1GA 2FLIA 4NX0A 1I2RA 3DBPA 1ZJAA 4BQ3A 3AIRA 3GLCA 3UG5A 5EU9A 1V51A 1UZHA 1UUMA 1JVNA 4MJMA 5FI8A 2Y7EA 4DZHA 1NDVA 2VWSA 1ZNNA 3NCOA 1W17A 1XINA 2Y63A 2G3IA 2W62A 4PGLA 2J75A 2V68A 1W1VA 1VIZA 1TZ7A 3AXMA 1MXSA 4KBXA 4W87A 3PZMA 2OODA 1QOQA 1RCOB 3S6TA 3PSVA 3D3FA 5LIWX 3UVAA 4ECLA 3CNYA 3EOSA 4H7ZA 3TYDA 3EDDA 2FYMA 3WDQA 3MA8A 4HHPA 2HISA 6ALDA 5CCZA 1KQYA 3VZXA 2Q71A 1CYGA 3HPAA 4LS0A 2GL5A 3IPWA 5CBIA 3G6MA 4HA4A 2D69A 1JL8A 5E70A 4GVFA 5I77A 2W63A 3M9YA 4MTVA 4CLMA 3OVGA 3CMGA 2QAPA 2J4GA 3TAOA 3ZQ9A 3MS8A 3VDAA 3BW3A 3WQ4A 1EX1A 3RX2A 1V3JA 1GVIA 1WB0A 1OYBA 4O28A 4WK9A 1TCDA 3THAA 1NM9A 1MQPA 1TPVA 2YW3A 4Q7BA 2C6QA 5SWUA 3NQ8A 4HP5A 5MKGA 2A7RA 3O7UA 4MDOA 1SO3A 5DXXA 4JZ5A 4DI9A 1QI2A 4DM1A 3RK8A 1GONA 3AROA 1W5QA 1WXJA 3DX5A 1L9WA 4LBUA 1IXOA 2VTFA 4M6QA 1C8XA 2WC7A 2V3DA 3VD5A 3I6EA 3WQ8A 3P6LA 3R58A 4JQ1A 3F5LA 3LTSA 1NOUA 4UNLA 1W1ZA 1IF2A 2PDIA 1N7KA 1R2SA 4HPJA 2Z6IA 3HA1A 1T5AA 1HNYA 4A22A 1YEYA 1G69A 2H8XA 5DCEA 3UJRA 3UBPC 3EKZA 3TMQA 1Y5WA 1P6WA 4I8DA 1W1IE 4PMZA 1KKRA 4UMCA 2I9EA 5HNUA 3W01A 3ITGA 5A5WA 3RIKA 1SU5A 4URIA 3L0GA 1EC9A 2EBNA 3NQGA 5DX7A 3DH7A 4HZ6A 5FF4A 3A64A 3WUGA 4IOTA 1EZWA 3N18A 4ACYA 3M43A 2NWRA 1RK6A 1T96A 1E55A 4AQLA 1EJ7L 2XVLA 3AS0A 2E67A 3EWWA 2YL9A 1VEPA 4J1OA 2RGMA 4QIUA 3ALFA 4J5NA 4MZ8A 1ME9A 5ABTA 1NU5A 3WBXA 3SN0A 4ZQRA 2A2IA 3W7PA 2VZOA 3W81A 4WDXA 3UFYA 3UYCA 4AWTA 3W86A 3LTPA 1V4YA 3WLKX 2J7CA 5JH2A 2E9MA 5G5IA 4H6EA 1G01A 3C2OA 1E9IA 3W00A 3TA9A 4XV0A 2VZSA 1QHOA 1R7AA 5AYXA 2PDWA 3PTDA 3F4CA 4Z2KA 4DZIA 4FX6M 4FALA 3KTCA 6TAAA 3F7JA 2WKGA 4HQVA 3HGSA 1VBRA 4AU0A 4UNIA 1AA1B 2B7OA 4NXSA 1K7FA 2JQXA 3NNTA 3URNA 3AQUA 5CH9A 5H8PA 1JAEA 3GUWA 4MNMA 1R38A 3TN6A 1WX0A 3LSCA 4DUVA 1H51A 1FVPA 2AL1A 2QVHA 3T40A 1QNSA 3VGEA 3EKLA 2YCJA 1ZCCA 2QIWA 3LPPA 2WMKA 2WANA 4Z42C 2XM2A 1X97A 4AD0A 3R0KA 1POJA 1YPFA 2GK1A 3T0CA 2FZBA 1F6KA 4V1XA 1M9HA 3VGHA 1DL3A 1US0A 3V1HA 5EBAA 3LI0A 3T42A 3GTHA 4JTSA 2PTDA 5LIYX 4P5UA 3GE7A 4ZO7A 4HTYA 1RK5A 7ODCA 3P2VA 4D6HA 4PSRA 1HKKA 4UQAA 2D24A 3GHSA 1AH4A 3HQOA 2FTWA 4M6VA 2WNZA 4W93A 4LSBA 4CN1A 1HVQA 3W26A 4PL1A 1LF1A 2DZAA 3OOQA 1JD7A 1W5PA 5CPQA 2VENA 3B8VA 2XPKA 3B0VC 2C13A 1NF0A 3UWZA 1XV8A 4ZE4A 2W3ZA 4M8UA 2P76A 1E72M 3STCA 2A3HA 4HSNA 5T9CE 2EHHA 3ARXA 2YBVA 3URAA 1GEQA 5J5DA 4ZE5A 3R0UA 1RBLA 1M7XA 2CZEA 1ZAHA 4QG6A 1PXGA 1N8WA 5K2ZA 3E38A 3L0KA 3RXZA 2X1IA 3PG9A 3MZNA 2PGFA 4RUBA 3R0DA 1BQGA 5DCDA 2VCAA 1I60A 3FOKA 3B06A 3POCA 1BGGA 1JZ2A 4V27A 5C9XA 3NXFA 2PB1A 4GG9A 4W9TA 1G4SA 3VMPA 4C1KA 4DPPA 1TG7A 4EIVA 3GVGA 1KM2A 4JTQA 3EX3A 2VC7A 5IHSA 4X0VA 4XIAA 2C1HA 4DWSA 1BWVA 3TNBA 3HB9A 4U10A 3NOEA 2VUYA 4GI6A 2DZBA 4R27A 1GYMA 1C7SA 1MW2A 4AZIA 4KIEA 4Y9MA 1EDQA 4R53A 4AC1X 2HDJA 1LRNA 3PZGA 3KOXA 2HRWA 4J28A 4Q33A 3KOWA 3XINA 2WBKA 2CC0A 4AXNA 3KUMA 4O18A 4Q8OA 2WM0A 3A23A 2ZTKA 1E51A 1GOIA 2QGHA 2CEQA 4P7OA 2DIJA 2QJNA 4Z1DA 4JKKA 4MPQA 2VDIA 2WPBA 4DX3A 2YDRA 4ZMGA 1Y5VA 4LWWA 4UQEA 3RU6A 1ISXA 3WF2A 3OGRA 3QTGA 3CHDA 3F03K 1DIDA 4KEZA 1GJPA 3CWHA 3ZT7A 3LLFA 5IFPA 2R94A 5F2MA 3WQFA 1O5RA 1EEPA 2CYGA 1IT7A 1DWIM 2V5LA 4W8LA 5I79A 3HQ1A 4ZSTA 3FEMA 3NZPA 4HZ7A 4L4MA 3TE9A 3TEVA 2ZIDA 2HJPA 3G5EA 4GJJA 1W37A 3TMLA 3C0SA 4FSAA 3LHTA 3O06A 3OJGA 2FPVA 3ARQA 4GPNA 1O6IA 2WJFA 1LOLA 4Q7NA 3REQA 2ACUA 1FWWA 3I3BA 4IF2A 2XU2A 3W2LA 1IWBA 3SFKA 4QQUA 4HK6A 2OQLA 2IS7A 3DEQA 1GVYA 3WO8A 4R7OA 2QCLA 5HQLA 2CWNA 2A6NA 5BRPA 5DF0A 5FKYA 3EWBX 1TO3A 2F2KA 2XFWA 3IIXA 2C14A 2NSOA 4KCTA 4KWSA 3WNOA 2XISA 3TQKA 2ZVRA 3UNTA 5BW6A 4NI3A 4GC4A 4L61A 4GUHA 3CV2A 3Q37A 3NUKA 4NY2A 1TTPA 4LBSA 2Y4SA 1Q13A 4HD5A 5DCBA 4O50A 1IE7C 4N2YA 4BCEA 2ZA1A 3BUVA 1P6CA 3NGJA 5AC4A 2X8RA 3WBEA 3BLOA 3QOMA 2QDEA 3EKGA 3OLEA 4J3TA 2PTWA 1BXCA 3PBMA 3VX1A 3W6LA 4JQ3A 3WLRA 4O1EA 3S2MA 3GR7A 3GXTA 4LNYA 3NQBA 3VPLA 3BGGA 4PZVA 5BWAA 5BXSA 5C9RA 3T55A 2CZDA 2DVXA 3T81A 3MT1A 3AICA 4JN6A 5AN7A 1JDCA 1HG3A 1HKJA 3VINA 4A3QA 3ARUA 1TKKA 1ZLPA 2NV1A 1NARA 1EL3A 5D02A 2WVTA 3BPWA 1LQAA 4JNYA 4NAFB 4WRHA 2C0HA 2RH9A 1A3WA 4H8HA 1M6JA 1WXZA 9XIAA 1YQ2A 3TV8A 1GZGA 3BLEA 4X9YA 1GHRA 3EDKA 3WMSA 3GDKA 4JTTA 4W4QA 1SJAA 3QY6A 5K9XA 1JCMP 3M0XA 4QDWA 3O6YX 4JOMA 4D8AA 1WUFA 1UR9A 4M82A 2C79A 1C8VA 2HXUA 4AZCA 4YHEA 3GNNA 2XJ7A 1B3YA 1BRLA 3DHPA 3QSTA 4Y96A 1XLCA 3QKEA 1A0EA 2CZFA 1VFFA 5FAGA 1I75A 1YE6A 3VMNA 4GBUA 3GS6A 3VO0A 4ENLA 1UJQA 1LCOA 3QTPA 2FDSA 2OOGA 4WJ8A 3VIIA 4DAIA 3PFRA 4IQEA 4G5DA 5KITA 4PUDA 4IICA 3KOYA 3TSMA 3AHXA 1DWFM 3TKFA 4TMBA 3PBUA 2ZYFA 2C1IA 3DU0A 3AYRA 5JBDA 1K9EA 4ZXLA 2G4JA 3TVAA 2OSYA 3K13A 4LQ1A 3PNUA 3WMCA 5A2BA 3WCZA 5U4NA 4MY8A 4CQAA 2QPSA 5A6BD 4LPCA 4GUJA 2ZOXA 4EANA 4QP0A 1H62A 1RD6A 3TYZA 1UH4A 3B9DA 4O1FA 1RJQA 3SGGA 1LTDA 1W56A 4XKMA 4QNWA 4DJFC 3QSRA 3OVRA 4UTUA 3UZXA 5CSSA 3T0TA 1CB2A 5DRCA 1OZQA 2B7NA 2V38A 4KFOA 2P8BA 3ARVA 3SURA 2PRMA 3E2SA 5GNZA 2VGGA 1QPRA 1RVKA 3H2NA 5JIPA 2VQUA 5I78A 1BF2A 2B7QA 5AVHA 1UIPA 3CAQA 2OZ8A 2C16A 1PCWA 4CQCA 3D46A 1MI3A 4NZJA 4XBJA 1UG6A 2XGIA 1VPXA 3TN5A 1I0DA 4F79A 1OINA 3MTWA 2QULA 3WQ5A 3RJXA 1ZALA 3WDJA 4PUWA 2YFOA 1FWIC 5I5RA 4MDPA 2UZ9A 1TWZA 3ZFHA 3M1ZA 4FEZA 5G1MA 4XTIA 1LWJA 2X42A 4WXYA 3V3WA 5KZ6A 3W7RA 3PR2A 1XDLA 3WZ0E 2H9AA 3LUTA 3VD4A 3QBUA 4XWUA 4Q6JA 3UZ5A 2Q8LA 1KXHA 3G1FA 2O56A 3AWNA 4YMZA 4NZ1A 3F4VA 2JF7A 2DSZA 3B4YA 3OHIA 4PUEA 3WJYA 2XH0A 1OB0A 2G50A 5E6YA 3W70A 2ZRVA 1EWEA 2O0TA 4ZA0A 3M6YA 4AZ7A 4GE8A 1TWSA 2EF9A 1MNSA 1MNZA 3P60A 4NZ4A 5MF5A 3M5ZA 3M0MA 2YL6A 4L1GA 4WOQA 3VTRA 3BAXA 3KM8A 4MB4A 1FRBA 2BVDA 2GJNA 3MI2A 1YBQB 4CEXC 4IZGA 1ZBWA 1B3OA 4QE4A 3KWSA 3BQ6A 1I2NA 4RNIA 4R85A 2D0GA 1KFWA 2GJXB 3TYEA 3AC0A 4TU1A 1T6MA 4U31A 2VEIA 2XGZA 3WUEA 3ALGA 3S1XA 1I2QA 4AB4A 5DT5A 2PU1A 4O53A 2ATMA 3FJNA 3RM8A 3AJ7A 4FXSA 1WV2A 4Q4QA 1EA9C 1H0GA 4AY7A 1EP3A 3PVFA 2BVWA 3WENA 3C86A 1RHCA 4MNLA 4LS1A 1H50A 3BTNA 3H54A 2V8ZA 4ACZB 1ZFJA 1C3FA 1J4EA 5E0FA 4LVAA 4FMVA 4NZ5A 5D04C 4PUJA 3R13A 4LYQA 3SUWA 3O6DA 4E6MA 4RNFA 4S3CA 5GJNA 1A3HA 3EX1A 3QR0A 3UJSA 1R8LA 4RXGA 1W5NA 1TUFA 3MP3A 1X7FA 1I2OA 5M1TA 2E9LA 2OLHA 5D9NA 3G1VA 4MB3A 4CCDA 2ZC8A 2WW5A 1K02A 3PTMA 4GJ1A 3QHNA 4H83A 2Q3OA 4MKSA 1QOXA 1A0DA 4B5NA 1O1HA 2R1NA 1B31A 1EA0A 3AHTA 4FX7A 3TNOA 2OT0A 3AMLA 3LGGA 2J74A 1TPEA 1V6VA 3EMCA 5F1UA 1EOKA 1SFJA 5B7YA 2VRQA 3BDKA 4Z0JA 4H8NA 2IPWA 3ZWTA 1LLWA 4AIEA 3TUUA 2OEMA 3SY1A 5TF0A 3PK7A 2ZRUA 1KBJA 1UBSA 4KCUA 3S6DA 1A3XA 3GNDA 5CLWA 3H2CA 1EDTA 2AGTA 4PCNA 4GI9A 5CJ5A 3D0CA 3L2IA 1E6QM 2ZBTA 4CN6A 4NUWA 1R3QA 2CIPA 4FNTA 2FMOA 3B9NA 4XSLA 2OYKA 5JXQA 1FWDC 2BX7A 1Q45A 3T2QA 4ROQA 4US5D 1FX6A 4RLIA 1UC4A 4A29A 2P8CA 1VFHA 1E40A 1NWSA 5F4WA 3O6AA 1UMYA 3FLUA 3CASA 4C1NB 1KM1A 3G77A 3B8SA 4F2TA 1AJ2A 3A6OA 4O13A 4PMNA 5CXPA 1JPIA 1O5KA 4DJDD 1IEQA 2J77A 4O8RA 1UQYA 2GDQA 2QHAA 1XIBA 3T4CA 3APGA 5DFAA 1UR0A 1NELA 3B0YA 5D2WA 2FVKA 4UQ9A 2Z2AA 5DMYA 3DG7A 1K4HA 1O7AA 4XZLX 2X7WA 4CD4A 1G4EA 3MUCA 1A80A 1BSIA 2EKGA 4GQ0A 2G95A 3DYPA 2X0SA 3KVKA 1XSKA 1O5QA 4AZGA 3W1MA 2V82A 3VDGA 2NQLA 3VGGA 3VC5A 3LCFA 5A6AA 5AY7A 4JFVA 4ZFCA 4PTXA 1AW5A 3U4FA 1HUVA 4YN5A 1Q8AA 4HU3A 1MSSA 2ZWZA 1EC8A 1VRXA 4MJ4A 4GKTA 5BZAA 5CC5A 3KBWA 4WDTA 1EXPA 3RX3A 4HA3A 3GZ3A 2NX1A 5KTLA 1HO1A 4MLRA 1DBTA 5DANA 1KM5A 1TFVA 1KNWA 3CH0A 1SGJA 4ZB5A 1Z3NA 4PTDA 4A3RA 1ZPTA 2QUUA 4XUGA 2DU2A 1FFQA 3N17A 3SJ3A 1EJVC 3AYTA 5I03A 3E2VA 2UV8G 5D9MA 2EJ1A 1UH2A 3MCNA 4EAYA 1C9DA 5C6MA 2ZTJA 1E6SM 3WQOA 2CLKA 1DJNA 3VD9A 2E5BA 2YX0A 1J93A 1E9LA 3ARZA 5GNXA 2QVNA 2BMBA 1EUNA 1K70A 5K7JA 4M1BA 3FYYA 1OSEA 2VKZG 2F6XA 2OLSA 3U5YA 3M0KA 4WQ6A 4PRWA 3C3NA 3OG2A 1LBMA 1RPXA 1PJ9A 3M5VA 2Y5EA 2NQZA 5DT7A 3P7YA 3CUHA 3L4YA 1GHSA 2Y24A 3MU7A 4X2PA 3NQFA 4UCFA 3WDHA 1KV5A 2WHJA 3I68A 4ML4A 5A8PA 1TX0A 3SY5A 5CPMA 4IM4A 3W4RA 2CZ5A 4I6KA 3R8GA 3U6WA 3WFZA 3T8QA 3EMQA 2DUZA 1JF6A 4XAYA 1D8WA 1HL2A 3VOHA 1JYXA 4MWAA 2E09A 1WNOA 2FH8A 2D22A 2BDQA 3S0CA 1EIXA 3FJLA 4S3DA 3FXYA 3NL3A 4K38A 1DTUA 1GJWA 3HPFA 3KRUA 3B4UA 3WQVA 4UTKA 4N42A 1H5VA 4Z17A 3GVWA 3AI0A 3H22A 3A13A 4LEQA 1ISYA 1G7UA 4O15A 3UWVA 4C6IA 3IUHA 3Q67A 3RUBL 4PEEA 2D2HA 1U1UA 1SO4A 4IFKA 3DKJA 2EG8A 1ZAIA 2I17A 2A0NA 4YVPA 3APTA 2YZRA 1X6UA 2VXNA 2WSQA 4XG1A 4PTNA 3M0YA 1G0CA 1UOZA 3V0UA 5RUBA 4BK9A 2P0OA 2Y1HA 3QYSA 4C6DA 4UFHA 4RK8A 2D3NA 3NPWA 1K8ZA 2FGBA 1JUBA 1RP9A 4YLWA 2G41A 4M0XA 4GY0A 2WV8A 3WD4A 2UY2A 4U2YA 5A8NA 2GOKA 5CEWA 1S1RA 5CC6A 2BOGX 5EB8A 3VFLA 5M2FX 2NVDA 1LOSA 1D3GA 3W82A 1E56A 2E6FA 2J7DA 3GVQA 3TCEA 3UY7A 4GC3A 3N4AA 4P7QA 1J11A 2PGEA 1H1NA 1Z6KA 1G67A 3DI0A 3CV6A 4AEEA 3WEZA 3OLGA 4PCFA 3W1QA 1BLIA 5FJTA 4RNJA 3LRLA 1IZKA 1QTWA 1TMLA 1XR2A 1C93A 3W88A 4FOUA 4RDWA 1US3A 1HN1A 2X1UA 1B9ZA 4R3UA 1K7EA 4W85A 3H4WA 3IRSA 3MWCA 3TW7A 1FH9A 4DF0A 4CUCA 1E0UA 2PDQA 1OFEA 1X1OA 1W9BM 2UY5A 1YDNA 1KBLA 4QJ1A 1Q6EA 3C0LA 4O1AA 3S9ZA 2Y88A 1QW7A 2VEKA 2PGRA 3VNDA 4OV9A 1RA5A 3CZKA 1TMHA 3TW6A 1KWKA 4PTVA 3MI3A 1EGVA 4CD7A 2NLYA 3K46A 3GRIA 4O8AA 2TYSA 3DENA 4DO5A 4W89A 2OWXA 3ZT6A 2DH3A 3KBMA 5J04A 1LRTA 4Y8FA 1JCNA 2P3EA 3SADA 3IUDA 2QCDB 4GZJA 1J2WA 4Q8WA 1RV8A 4FXRA 3RMJA 4X61A 1GW1A 1ITUA 1NAL1 5JIWA 4GI8A 1VRDA 3NR0A 3EWYA 1HKVA 3EDEA 4I7WA 3GDMA 1JD9A 4INFA 3C2EA 1SZFA 4QTGA 1RBAA 3CUZA 4S3JA 4UQBA 1J01A 1W91A 2UY3A 1YXCA 1PTAA 1CLVA 4GH1A 4OKDA 5CG0A 1FWNA 3O15A 3UA4A 1GZJA 3OVPA 4IIHA 5A6MA 3BCDA 1DIOA 3ZLFA 4ZQOA 1K1DA 4UWMA 4FNUA 2ZZ5A 1DP0A 1SW7A 4CNTA 4J9JA 4B91A 4JTLA 4ZOAA 3N34A 3IRDA 1L8NA 4AD3A 1HP4A 1VFMA 4UFLA 3CB8A 3HO8A 1W3TA 3S2LA 2GYIA 3EOLA 1BHGA 4H9VA 1JCLA 2V3GA 2D2OA 3GXNA 3GTNA 4U4MA 2WZTA 3MKKA 2ONEA 4WUIA 1MXDA 3YPIA 2PP1A 5G2HA 5D2XA 1Z7AA 1XIHA 1RCQA 2VCBA 2JGYA 1FDJA 2WKJA 3H4XA 2J9YA 3WNPA 3W7QA 1PKMA 1ITXA 1KLZA 3WLQA 1WAUA 3HJZA 1E9ZB 2PWDA 5H1WA 4LT9A 3T05A 2PRHA 2BG5A 2HVMA 2Z28A 3GTIA 2RUSA 2R82A 3PPCA 2WO5A 4S39A 2HK1A 4TVDA 3PM6A 3R10A 3IJDA 1EZ2A 2VQTA 4LNCA 3OIHA 3SCPA 4MB5A 5G2WA 4ZVJA 3ES8A 4WY0A 1XYBA 4NU7A 1KCXA 1NY1A 4UBPC 3VUPA 4BZYA 1RZMA 1KXTA 1FKWA 3INPA 2ZA3A 1OX6A 3KCJA 4B5SA 1W5MA 3RF9A 2WSKA 1JEZA 4NHVA 1Y8BA 2VDGA 3LMZA 5H91A 1TR9A 4E8DA 1ZSXA 1E1FA 4PFHA 4WR3A 2DT2A 4DF1A 3KP0A 4C6QA 3S42A 2ACSA 1PDYA 4GACA 4HCDA 4EPEC 4GY7A 4YTTA 1XYAA 8CGTA 2XWEA 5JUVA 3GG0A 2Z2UA 3N2CA 2D0FA 1F61A 5DEZA 4GLEA 4RNHA 1OYAA 1R3YA 5G4EA 1H49A 4RE3A 3WDPP 5FEXA 5IDIA 4JHZA 1OFAA 4DPQA 1DJGA 2ZUNA 2A85A 1R86A 3DCPA 3FW6A 3THUA 1XPYA 4S2CA 1DE5A 2VRKA 4US5A 4JGDA 3R6IA 4TQTA 4C6LA 4Z1CA 4MZ1A 4ZTYA 1Q6LA 4CQ8A 2PUZA 4E2DA 5BYWA 3WYZA 3UF9A 3GDLA 1GVQA 2PSNA 4G2DA 3T08A 1UD5A 1XLHA 1SFLA 4HSOA 3V35A 3Q94A 3TLLA 3IAPA 3OTRA 1QNRA 3RO8A 3NOYA 1QCWA 3S1GA 1NQKA 1LUCA 2CITA 3W27A 2PRLA 1KD0A 3WH5A 1EGMA 2G97A 1FBAA 3QV6A 2DZVA 5CLTA 4PA8A 4KKXA 1EP1A 1DWHM 3LENA 4ZODA 5F7UA 5E09A 3N6JA 1PUDA 2GVYA 4K6AA 5IBXA 3BZJA 4FXFA 2F8QA 1R87A 1FUYA 5A6TC 4CNPA 2HBXA 3M41A 3UNDA 1TRIA 1Q2RA 3CMFA 3VA8A 2VC5A 1R6WA 2PWHA 3ZR6A 3A24A 3MCMA 5A6KA 3SN1A 4EPBC 1XYFA 2J9ZA 3UXAA 1QAPA 3IK2A 3LTYA 1VYRA 2A7PA 3TYBA 2VGBA 3GKFA 1LYXA 3ABRA 3F5JA 2DZUA 1OT2A 4OGZA 3LM7A 2QJHA 4K1GA 1XG3A 2AMXA 2E9BA 5HMSA 5HATA 3R89A 3EOEA 5DO8A 1MO0A 1KFKA 3WF0A 1TPFA 4EACA 1S38A 3CAVA 4EPDC 4MPKA 1V5XA 3CMJA 1TV3A 2O7SA 1AUSL 4GIEA 3LLDA 5FA5A 3G0UA 1XBVA 3WLOA 4Q4KA 5CC7A 1V6WA 2WCSA 5H2ZA 5A3HA 1UWTA 3UWUA 3U57A 2NUXA 2FJKA 1E1CA 3AIEA 2QLYA 1CI1A 5C55A 4KT2A 3UT0A 4NAEA 4MAVA 1L6WA 5EPDA 1FWTA 4J3WA 4C5ZA 1UWRA 2FVLA 6ENLA 2ODOA 4D6EA 3CYJA 1LQ2A 4BEUA 7REQB 1T0OA 1R3WA 2EPHA 4A4AA 1MDRA 1NFPA 1J0KA 4I9JA 3GFXA 3TQVA 3UR5A 2YDAA 3ZM8A 2PAJA 3LHUA 4WZHA 1ONXA 3KEHA 5FJIA 4HVXA 3N3TA 3TJLA 2IPJA 5AHFA 1HVXA 4Q8NA 4B2DD 2QJJA 1XIDA 3BSGA 1BYDA 2DORA 3QC3A 2IKIA 2XUCA 3B3DA 3CH9A 2EGZA 3TZNA 2Z29A 3EXTA 2PEVA 1NP0A 5HJXA 1WDRA 3ARSA 4OT7A 2EG7A 5CSUA 1TWDA 2FPTA 3HIJA 8XIMA 3TTSA 3ZO9A 1X7IA 1B5TA 3GDTA 1V77A 1OD8A 2D2JA 3A9IA 3BCFA 4O4WA 3EEZA 1G6CA 1R3TA 4S3BA 4B15A 1VFOA 1HL9A 4IIEA 4YWSA 1GQKA 3ITYA 1R9ZA 4PH6A 3BGAA 3LD5A 3ZOAA 1J79A 3BMVA 5LNSA 3KRSA 1K77A 1RQEA 4Z1YA 1V0KA 4OECA 4YHGA 4MFDA 3WQPA 3LG3A 4GUIA 3FK4A 2B4GA 3KFTA 2GPTA 3GHTA 1HKWA 5D03A 1KRAC 3SEPA 3QV9A 3NXLA 1LLZA 3VGDA 3RN6A 1RY8A 3FHAA 2V2HA 2EQDA 4J3XA 4XB3A 4GYKA 1DPMA 4P8UA 4DBEA 4XD5A 2X30A 4XISA 3FGCB 2OO6A 1YPXA 4CNUA 2YL5A 3CTTA 3FIGA 2PCQA 4XZNX 5I00A 3CUIA 4ONVA 3L7RA 3RGTA 4LOCA 1FH8A 3GAKA 4IPLA 2WHLA 1BXBA 1PWMA 1LZOA 2H3BA 3PWAA 1A5CA 3K1GA 5I3JA 2WJDA 2TPSA 3GD6A 2ABBA 3W85A 1TJ0A 1PX3A 1BD0A 3VOIA 3CTLA 3U2EA 3V5FA 1XYCA 4JXCA 3KL5A 2NUWA 2AQWA 4LF2A 2CW6A 1PX8A 1IEIA 1A5BA 4N9DA 4I7UA 3R4IA 1KKOA 3ZVIA 4OFCA 4AF0A 3DFNA 5EMKA 4GWEA 3O1NA 5D2VA 3VMOA 4XD4A 2W4XA 2E1DA 5LNWA 2ZRZA 1PVNA 1MYRA 5AC7A 2FHFA 4QSFA 4O17A 4MWAE 2PBGA 4I5XA 3CB3A 5M3WA 4PMDA 3TP4A 1AH0A 1QJWA 2ALDA 4GCAA 3ES7A 4N7QA 3FVMA 3ZLGA 4QLKA 4F0MA 4XTDA 1U5JA 3TXZA 5REQB 2C1GA 1SJDA 3GTXA 8RUCA 3M64A 2FIQA 3R5EA 2WSRA 3QFEA 3QPYA 4KEUA 4O4VA 4GQGA 3GAYA 3TC6A 1ITCA 5A8QA 2F84A 1HJSA 4CD8A 3CL8A 5CZ0A 1VBUA 1YIXA 5TAOA 2Z1VA 1EGZA 2WQPA 3KRZA 3WMBA 3K2GA 1QPOA 3GIPA 1VGAA 1W3LA 3E3HA 1E3XA 1GOMA 3CQHA 3DC0A 4XKYB 1LP6A 4B4FA 3WLHA 1ISZA 1NDWA 1Q4WA 3LA4A 3OHMB 1EEXA 4Z0SA 4RXFA 3QH2A 2HK0A 3OBKA 3VYLA 4M7TA 3VAVA 2QCMA 4LY4A 2RGLA 4QITA 1R85A 4IMFA 1D3HA 4HCLA 3SIMA 3K4DA 1LQ0A 3W2UA 2QMJA 4F9JA 3L4TA 4HIBA 3STFA 1Q8JA 3GKAA 2HMCA 3GDRA 1PYMA 1PIIA 4ZQNA 5IOBA 4RV3A 3BLDA 3SGUA 1JR1A 3L67A 2OO0A 4ZZ9A 2ESCA 3MVIA 3ORWA 2E8ZA 2H3DA 4L56A 2OEJA 3UU0A 3EOOA 3GXDA 4PE8A 3ARRA 4BS0A 2BY2A 4JQ2A 4OE7A 1SSDA 4GVHA 3F4NA 4KRUA 3M0LA 5BXTA 3KL0A 4DN1A 1GKQA 3O0KA 4HJFA 1VHCA 2PDFA 3I65A 1F7BA 5CKSA 1ONWA 3OA5A 3QZEA 3LY0A 1XX1A 2ZXAA 4DJED 2NQHA 3TA6A 4KWVA 5C9ZA 2P3ZA 4UZSA 4YPJA 1CECA 2X05A 2XSBA 3IGXA 3QYQA 3OG3A 4MY9A 1FFRA 4O0ZA 1GYNA 1M68A 4R9OA 1GVEA 1W2PA 1GCYA 1TUXA 2ZX9A 2MANA 4GD0A 1IXPA 4M3PA 4UOJA 4GHRA 3W1UA 1ECEA 1WKEA 3CK5A 3DAQA 3RCMA 1DJXA 1UP3A 2I14A 3SI9A 1ISWA 3B8TA 2QUTA 1BG4A 4HYRA 3MKCA 1EJRC 1TIWA 5EMUA 3N1AA 1V3KA 4B3LA 3A9BA 1VEOA 1EF3A 5EKYA 3IACA 2VC6A 2VRJA 1Z8AA 2ZZ7A 3SW6A 4ZGYA 4W5ZA 3SM0A 4O11A 3MSYA 3WLSA 3DXIA 3GXIA