3UNDA

Substrate-bound crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
283
Chain Sequence
GSMNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDVTHSLQCRDPLGDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRARCDGPSALPLHQLEGLLSQMKAIDDLVKRMPALEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase 2
total genus 95
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3undA00
4S2CA 1TJPA 2X16A 4LS0A 3UZ5A 2DP3A 1VR6A 3LHZA 2EGZA 5D32A 3VFLA 1IXOA 2GOUA 5G2HA 2YYUA 3ANYA 4AH7A 3NL5A 2DU2A 2ZRWA 1TRIA 1A5CA 2V2HA 1A50A 4UFMA 3DFSA 5D2VA 2DZPA 1WV2A 3TW6A 3CLMA 3G0SA 1H62A 1KTCA 3SFKA 5G2IA 4HNUA 1K8XA 3H54A 3KVJA 3PB2A 3BGGA 4O11A 3DI1A 1HG3A 5DELA 2ZA1A 1SZEA 3BG9A 4Q32A 4UNLA 1OFQA 4FB7A 4Y8FA 2X1SA 3W23A 2EF9A 1LCOA 1EX5A 3W7PA 5D04C 3PBVA 4TR9A 1TPWA 4A22A 5F4SA 3TAOA 3EWZA 4WY0A 3Q2DA 3H53A 4A3UA 4S2BA 4IUOA 4NXKA 1KBJA 2QJHA 4TX9A 2ZYFA 3O6DA 4G1KA 2WV8A 3GXNA 2Y61A 4A2SA 4EF9A 1C8VA 4O18A 5AOUA 2KZHA 3S1VA 3B0UX 3C0JA 3TMQA 2OT1A 3INPA 3MP3A 3P81A 4JX6A 1X7FA 3UWQA 3P7YA 1ICPA 4MIMA 3GAKA 4CQ8A 1H63A 3NQ2A 3GDRA 1EIXA 3W2JA 5LNRA 2E6YA 2ZTKA 1VCVA 3SY5A 2Y85A 1H7WA 3UXDA 3B03A 1I2OA 4M7TA 1TSIA 1PS9A 3G0UA 5K9DA 2FIQA 3NYZA 3L68A 4U4MA 2WNQA 7TIMA 1GT8A 2V81A 1GEQA 1VGAA 3TK7A 3W1NA 4TO8A 2GPTA 2XN2A 4LUJA 3M5ZA 3PVFA 4AF0A 1AW2A 1UBSA 4AEOA 4RJEA 3M47A 1BWKA 1YLVA 3NQ8A 5FF0A 1F05A 4ICNA 4O13A 5DCEA 1SO5A 2WJZA 1GVOA 2XN0A 3UWVA 4OU1A 5K4ZA 1GVRA 2HMCA 3HO8A 3M44A 3ABOA 1TPC1 1KFLA 5LGXA 1GG0A 5KITA 4LV9A 3FS2A 4DBEA 3PF3A 4NT0A 3PG9A 4Z08A 4YCPA 1O60A 2OX1A 2FB2A 3UD6A 5AFDA 2BTMA 1W54A 3SJ3A 5IBXA 1D3GA 1LDCA 3U6WA 1VQTA 3G1HA 4O50A 5TQLA 1T0OA 3R2GA 4JGDA 1GVSA 3GB6A 5CKSA 1K8ZA 3YPIA 3PB0A 1OFBA 1KLYA 3QZEA 1NSJA 4AXKA 1W1ZA 1LM1A 2W0UA 5J5DA 1ZCOA 2DZVA 3LOTA 3CPRA 1QWGA 1QCWA 4N9BA 1PV8A 1FCUA 1ONRA 1KFEA 5I3GA 3KFTA 3O07A 4Y96A 3RK8A 4YLWA 1H1ZA 2R14A 3CM4A 1VZWA 1VYRA 1XC4A 5EL1A 4IMFA 4JX5A 2QF7A 1LBMA 4LRSA 2J24A 4DO4A 3P61A 1TCDA 2Y7DA 4HPJA 3TC6A 3LXCA 4N02A 1JCNA 1B4KA 3MW7A 4HNVA 4YMZA 1H7XA 2BX7A 3G1YA 3LCXA 2QUUA 3ZS4A 1WAUA 3A22A 1NF7A 3SGUA 1GYNA 3W1LA 4RZ5A 5HR6A 3I7SA 4NXSA 4Q33A 3UWUA 5I3KA 4QNEA 3HG2A 1X6UA 1KFBA 3W7LA 3G1AA 4MZYA 2CU0A 4WOZA 3WFAA 3F03K 1JCXA 1DOSA 3NO5A 4JYFA 3N9RA 2J6XA 4KWWA 1HL2A 1W31A 3L5AA 2RDWA 2GQ9A 2LLEA 2JK2A 3PS7A 3QYQA 3MBDA 1QAPA 2G97A 3BLFA 2FDSA 2QDHA 4R34A 3SZ8A 3DFTA 2A0NA 4UC5A 4UXDA 1MZHA 1THFD 3W7HA 1S5VA 4QJ1A 4EIVA 5CPNA 4UMBA 3PULA 1KV5A 3O63A 2FLIA 3LCFA 3NEVA 4RXGA 2CLKA 3W1MA 2FQIA 3NPVA 4K36A 4E2BA 3MYPA 3EXTA 3B04A 4I7VA 4MLRA 4BWLC 4AMAA 1L6WA 2CLOA 3G3MA 3W7KA 1VC4A 4NJGA 3STFA 1WX0A 3G22A 4ML9A 2NV2A 4GE8A 3GR7A 5FEZA 1JRBA 1ME9A 8TIMA 3MHUA 2HS8A 4MY1A 4N9CA 2RKXA 3WJSA 1AMKA 3W2MA 2YCEA 2A5HA 3MHFA 2Q8LA 5G5IA 1GVFA 1TTJA 2Y6ZA 3DKJA 4FO4A 2VENA 2VFIA 1KTNA 2A4AA 5CGQA 3W7EA 5BOOA 3LCWA 3E9AA 1OF6A 1YXDA 3NQVA 3G1FA 4BR1A 1LTDA 4NNBA 4NJJA 3CEUA 3G8EA 3S9YA 1J2WA 1EWDA 3CEPA 3IGSA 3W84A 3S8HA 3EWXA 2VEKA 4KFNA 4FNTA 3W1RA 1F73A 4QSHA 3DKLA 3VCRA 4WY0F 3P62A 4MFEA 4DQWA 2BXVA 3UPBA 2ZFAA 1JCJA 4O4WA 1XDLA 3EX2A 4DF0A 4M6VA 3L5MA 5G1YA 4JICA 1YXCA 4BFAA 2OMAA 2BWGA 3W3OA 3D0CA 1R47A 1QO5A 4I9AA 3G3DA 1G7VA 5F2GA 2ISWA 4O52A 1SQ7A 3F1QA 2DJXA 3A5FA 1JQXA 5I3HA 1Q6LA 2CZDA 4GNJA 1RR2A 2GQ8A 3ABRA 3KX6A 4CNPA 2W6RA 4EWND 3HG3A 3LRMA 1DBTA 3I68A 1G6CA 1MEIA 4KFPA 3CU2A 3UYCA 1WXJA 4CCEA 1F2JA 1SZNA 1TO3A 3HG5A 3NQAA 2VEIA 3O1NA 4HHPA 3NNTA 2O7QA 1F6PA 1WA3A 1W3TA 1MEHA 4DF2A 4GXMA 4IOTA 2Y88A 3GDKA 4O57A 1CX9A 4N4QA 3KXQA 2CLLA 3O06A 3M41A 1LLZA 4EOUA 5CSSA 5TBOA 1NFBA 3S5NA 2R91A 4K7VA 3ATZA 3UWWA 1DJNA 5HULA 1K7XA 1OFEA 1SFLA 4AHQA 3W2KA 1TTQA 1JJKA 4GUJA 3NGJA 5IM51 3GDLA 1JUKA 3TSBA 1H60A 1TPFA 3W9ZA 1H7NA 2PRHA 2A7PA 5DCBA 3GVGA 2E09A 4NUWA 1NF0A 4UTMA 2NX3A 4S1FA 4RZ6A 5HQEA 4O10A 2ZCGA 1KM1A 5C6MA 2YDAA 1JUBA 1RQHA 2QCCA 4RR4A 1Z41A 1VPXA 4WQ6A 3W88A 1UASA 1KM6A 3L0GA 4UTWA 1LLWA 1N55A 2Y62A 3ZR4A 2V82A 3QJAA 2YYTA 3AO0A 1QFEA 3PAJA 3NZRA 5BMWA 1V5XA 2JGYA 3IIXA 2ZZ4A 3MBFA 4DELA 3WJZA 3GIYA 1R2TA 1ADOA 2NV1A 4FF7A 1R46A 5FEXA 5LKYA 3T4CA 4OE7A 3G18A 1JQVA 3QQ0A 4JEQA 3TJLA 1XBXA 4CLMA 4HNTA 4XKYB 2P10A 2X1TA 1AW5A 1JCYA 3LBMA 5C54A 1PHWA 2J27A 3MWAA 3NQEA 2C14A 1G69A 1I45A 4TIMA 1VCFA 4LY8A 4WJEA 1S5TA 4JD4A 3QW4B 3QH2A 2V2CA 2TYSA 5C5YA 1DKWA 2OJPA 3LTYA 4CCCA 2WOQA 4UFJA 2VFEA 3W22A 1JVNA 3TQVA 2ISSA 4XQ6A 4JTEA 1O5XA 2EKCA 4ZQCA 3A21A 2PC4A 1VYSX 3NPUA 5FEWA 4FX6M 4E38A 1D9EA 2ISVA 3B05A 1K03A 3EEGA 4NJHA 5CPLA 3W7JA 2NWRA 1FCQA 3DXIA 3NL6A 4GUHA 2E5DA 2XN1A 3MYOA 4GUGA 1JUEA 4JDBA 2QJIA 3LBCA 1B9BA 1W56A 2E6FA 4JTHA 3QMSA 2GVJA 3LHTA 4OBTA 1F6KA 2NLIA 3IIZA 3VNDA 2E5CA 1OX6A 3LDVA 3TH6A 1LRTA 1D3HA 2QUVA 1GJPA 5CZTA 1KFKA 4PEKA 4R7JA 4HT3A 4FIQA 2F84A 3B06A 3DFNA 3O05A 3CTLA 1J4EA 5AHEA 5D2TA 3L67A 4O53A 4CQAA 4HSNA 3FKRA 1R2RA 3A24A 4JNMA 3E96A 4K8EA 3SI9A 1T96A 4XZ9A 3DH7A 3L9CA 3HQ1A 1H7PA 4P2VA 5E1QA 2YW3A 3LTPA 3TROA 1O5KA 1DQWA 4RLIA 3TUUA 1JULA 4XBSA 1GOXA 3N14A 3NL2A 3FFSA 3L2IA 4HPXA 4CCDA 3IVSA 2J9ZA 1IXNA 2V0TA 1KW1A 2VFGA 1LOQA 1G4EA 1K3UA 1YADA 4JTFA 3TXZA 1VH7A 3QQ1A 4GUIA 1TPEA 4UMCA 1TYGA 4Y6GA 4WY0B 5F2LA 5AHNA 2X2GA 2AQWA 3V1PA 3IIPA 3MHGA 4W9TA 1Q6OA 1S3HA 5AC7A 5FF7A 1GVQA 1SO3A 4MLJA 3WJYA 3LGEA 2NZLA 1SR9A 4LS2A 3SIZA 5DBTA 2A7RA 1LOLA 2QUTA 2GJLA 5G2WA 4Z1DA 3TXVA 1FUYA 3L21A 5C55A 3HIJA 1LORA 3CQ0A 3G0XA 3NQFA 1UB3A 3KRZA 3ABSA 1H7OA 3QFEA 5DY2A 1B57A 1Y0EA 3S5YA 4RZ4A 3DHFA 4TU1A 4PFMA 1SW3A 3A9IA 4H3DA 2C3ZA 3QMRA 5LNSA 4GUFA 2WKJA 4OHQA 1H1YA 5AYZA 2QDGA 4O0ZA 2I9EA 1TTPA 3TSMA 4DPPA 4GC4A 3W7CA 3TA6A 2C1HA 4H6KA 1BTMA 3N9SA 2B7PA 3C2EA 3W7QA 2E6AA 2YFOA 3HGRA 3P67A 4M6PA 4IMEA 2NUYA 4FXSA 3W6YA 1KM2A 5A8GA 3GDTA 4UTUA 2WPBA 3CB8A 4UFHA 2X1RA 1J5TA 1FWSA 2AGKA 1OYCA 3PUOA 5AYXA 3T44A 3K30A 1TV5A 3LRLA 2VFDA 4LWWA 3UPWA 1K7EA 1DJQA 3B4UA 4ZL1A 4YCOA 2D73A 1SPQA 1IXQA 1OK6A 2ABAA 3LCGA 3P60A 1HTIA 2CZ5A 2J9YA 2IQTA 1PIIA 5LNUA 5D38A 4KFOA 4FX7A 5K3VA 3WJXA 2QCHA 2ZQ0A 5AHMA 4RX0A 2Q3OA 2UV8G 4NNAA 4C1KA 2ABBA 3LI0A 3W7RA 2YXGA 3TQKA 1KM4A 5J5RA 3NXFA 3KOFA 4MZ1A 1MXSA 4M7SA 4AHOA 2B7NA 2ZA3A 3MI2A 5IBXC 5DY3A 3W1PA 3OVPA 1OX4B 4K39A 3OVRA 5H91A 4ZMGA 1AK5A 1QR7A 1RD5A 5KZEA 3DFPA 4UFLA 2RHGA 5U4NA 1LRNA 1WOBA 3Q94A 3IV3A 2Q3RA 1A5BA 3W7GA 3O6YX 2VELA 3LM7A 3NZ1A 4DPQA 4LVBA 1I2NA 5D2WA 2OCZA 4UTIA 2E1DA 2GQAA 3EKZA 3MI3A 2RDUA 5BRBA 3BPWA 4POCA 3NOEA 4ADTA 1VLIA 1UCWA 1CW2A 2ZZ5A 1W3NA 3EX3A 5D2XA 3RU6A 1ALDA 4MFDA 4E2DA 3W2NA 3W1TA 2WSQA 2NX1A 1DL3A 1NAL1 3OEXA 3ELFA 6ALDA 1AL7A 3P8JA 1LRQA 1Z42A 3R8RA 2JKEA 2CW6A 2QCMA 5H2ZA 2QR6A 4NJKA 1WYIA 4BWLA 3FJLA 3T78A 1QMLA 3C8FA 4MZ8A 4ALDA 3QC3A 4DXVA 4LS1A 1P4CA 4LT9A 3G1XA 3W83A 5LHEA 3TNOA 3S1XA 3HBLA 2GUUA 1R2SA 4HNNA 1I2PA 3M5YA 3GZ3A 2YFNA 2I1OA 3LXAA 4Z0SA 1T99A 2A21A 3W1UA 1SUXA 5CSRA 1MSSA 3W7MA 4IX0A 5HUOA 1BEUA 3HB9A 4O1CA 4MVAA 5FF2A 3W07A 1FWNA 3G1SA 4OT7A 5K9XA 1FCBA 3PUEA 4ORIA 4Y9AA 3CT7A 3G1VA 1GZGA 3UY8A 1Q45A 3KAOA 5LNWA 3NDOA 1QPRA 3M6YA 5LHFA 3W71A 1ICQA 5AN7A 1WBHA 1IF2A 2VEPA 5HINA 4HKPA 3HJZA 4LC6A 3LCLA 3W70A 4DO6A 3BO9A 1YDVA 3HF3A 4M5PA 3C2OA 3M0ZA 5I3IA 2FTPA 2WQPA 4HSOA 3QEZA 5L6UA 3O15A 1OYAA 3EX4A 5AYYA 2FPYA 5TIMA 4JTJA 1FY6A 3N3MA 4JX4A 1AG1O 4WX2A 3CIWA 3C4UA 3GYEA 2QAFA 2H8XA 4MPQA 2E77A 1EA0A 2TRSA 4TMCA 3L66A 1VS1A 1RZMA 1OFAA 1VLWA 2WSYA 3F4WA 1TPB1 3ZFHA 3N19B 3EX1A 2H3BA 3QM3A 1F76A 3R5EA 5CPOA 1G4SA 1TPH1 2FB3A 1HUVA 3STCA 4JY9A 5D33A 3EB2A 2PRMA 1TREA 1FWWA 2ZZ2A 4LTSA 3I65A 3W87A 1KM3A 4FEZA 3TCEA 1OF8A 5LNVA 1V7YA 3PSVA 3TJXA 4LOCA 1ZAIA 4A21A 3A23A 2NXHA 4R33A 5FESA 2E5BA 3PSWA 2BSLA 1MO0A 3KRUA 1W5QA 4BI5A 1LYXA 1YDOA 1YTKA 4QM1A 4O17A 4K37A 3UQNA 1ZJIA 4QITA 1W0MA 3QPZA 4N2YA 1WOAA 5BW6A 3BLIA 5F1UA 1ZFJA 3GK0A 1QOQA 2A85A 4FX8A 1W37A 4X9SA 1H50A 4MUZA 1I4NA 3ATYA 5SWUA 2EHHA 1ZNNA 3NQDA 3LCHA 1TJRA 3M5XA 4K8HA 4RXFA 2ZRZA 3KRSA 5D30A 4ORMA 3GR8A 4HIBA 3W7OA 1ICSA 1XBVA 3NG3A 4GWEA 1KV8A 1YYAA 5EKYA 4ZQNA 4QIUA 4O16A 2G95A 4MYXA 5D2YA 1TIMA 2DJLA 1EP3A 5CZ0A 4NNCA 4ZVJA 1DORA 5CPMA 2QCGA 1RPXA 4K38A 4LVAA 1GTEA 3OHIA 4TMBA 1KBIA 5G4EA 1C9DA 3LCIA 3V75A 1NVMA 3LV6A 3HGSA 5EPDA 1BWLA 3O8AA 2NUWA 4IGHA 4Z1AA 1XL9A 2CLHA 2Y7EA 5F2MA 1M7OA 1VRDA 1XDMA 1EUNA 3PWAA 4LV4A 3BW3A 5G4WA 3W7DA 2ZZ1A 3B0PA 3PR2A 1OX5A 4JTUA 2J88A 5D09A 2WNNA 2FFCA 2NXGA 1JRCA 4LNYA 1KLZA 3GX9A 2VOMA 3KVLA 4ZQRA 4C1LA 2A1YA 1N8FA 4FNPA 4OWGA 3DHDA 3MP4A 4UUIA 1IIGA 4UTJA 5DCDA 5DLCA 1JCMP 1LBFA 2QCDA 4UMAA 4UTKA 5EMUA 3U2OA 1U83A 1XCFA 1OABA 3LERA 4UFKA 1I2QA 3O16A 1R30A 1GG1A 3PBWA 4JTIA 3BV4A 3HMJG 4NX5A 3JS3A 3DZ1A 5AC6A 1FDJA 3FA5A 3TSDA 3BLEA 2E6DA 2WSRA 3N73A 2DZUA 4J9JA 3S5ZA 4B5NA 2VXNA 3BGJA 1Q6RA 2Y70A 5ABTA 1AL8A 3M9YA 3UZJA 2CFFA 2QJGA 4NZFA 3W76A 1Q3NA 1U5JA 3JR2A 1ZENA 5KTLA 3M5VA 3UNDA 1FXPA 4PH6A 3P80A 1H5YA 1UUOA 3RNDA 1W5OA 1TV8A 1PHQA 5BNKA 5HJLA 1O94A 3EWBX 4ZZ9A 1P1XA 3TC7A 4JDYA 5AHIA 3W1XA 1IGSA 1EP2A 3HOJA 3LHYA 4PC8A 3TDFA 1PL9A 4IXXA 1I8JA 1XUZA 3BW2A 2OZ0A 3TW7A 3W2LA 1F5ZA 2H8ZA 5DBUA 5E93A 3W72A 2TMDA 4WOQA 1OJXA 2J9XA 1IIHA 2JGQA 4IX2A 3IVTA 4X22A 5A5WA 3E12A 3O6CA 4AWUA 4FIRA 3U8GA 4QNWA 1PCWA 3LTSA 3STEA 1Z44A 1SZFA 5I3JA 1DHPA 2CZEA 3L65A 2ZA2A 1UJPA 1NEYA 5FI8A 3EKLA 3NPWA 4BI6A 2PE4A 3E49A 3STGA 3KVMA 2Z2UA 4PL1A 4QQ3A 3C61A 4XWUA 3LXBA 1TTIA 2B7QA 4H4IA 5EA9A 1GTHA 2CWNA 3W1QA 3E02A 2RH9A 1B4EA 5F4WA 3DENA 1EUAA 4AVFA 1KM0A 3BVJA 4UCGA 4N6FA 3QPYA 2EPHA 3GAYA 4A29A 3W74A 5CZJA 4L4LA 3ABQA 3C2RA 2V8ZA 4EVZA 4IMGA 1EPXA 3PY2A 3R89A 3NQGA 1WBJA 1QNVA 3TE9A 1XBZA 4LW7A 5FF4A 5K9CA 2ATSA 3DFQA 3TFXA 1L6YA 5D03A 1OFOA 4NU7A 2RDTA 2F7FA 2ZZ3A 4UTWC 3FJ6A 3ZWTA 1FDYA 2X1UA 4AAJA 4UTTA 3FIGA 4IQLA 1I2RA 2V9DA 4RKAA 1WDWA 3M16A 1DV7A 3TAKA 3C2VA 3MJYA 1RQEA 4ADUA 3TQ0A 1ZY9A 2NUXA 2AAMA 3CHVA 1YTDA 1JCLA 2YGYA 4XUGA 2TPSA 3LX9A 4DF1A 1AW1A 3EXSA 2V30A 3S0CA 6TIMA 4GBUA 1M6JA 2QEZA 3RLVA 2PCQA 3C56A 3L0KA 1LZOA 4OQVA 5HNRA 2FPVA 3L5LA 1VHCA 3PBYA 4O8RA 4O1AA 1L9WA 4NJIA 3LB0A 2C6QA 4JTSA 2Z6JA 1OG0A 2R8WA 4YXGA 2ZRVA 2WO5A 1N7KA 3G24A 1FXQA 3NL3A 2QAPA 1GYLA 1H51A 3OBKA 4UTHA 3QSRA 3LLDA 4ZQOA 3TFCA 1P5BA 3P84A 1PCKA 1QPOA 2G5WA 5DXXA 5U7SA 4MY8A 3LI1A 2WNZA 1BKSA 4JTGA 4FNUA 1EP1A 3CC1A 1W5MA 3P5ZA 1TV7A 3VKJA 1PVNA 2H6RA 2QCNA 1KA9F 3QSTA 3LRKA 4KWVA 4Y90A 5AB3A 2A2IA 2P0OA 4JXCA 2C15A 1A53A 2YZRA 1IXPA 3Q37A 1TQJA 5FF3A 4Z1BA 3THAA 3PC0A 4I7WA 3M7WA 4YL2A 5HMSA 1SZGA 2Z0IA 3F4NA 2CZFA 3N2XA 2ATMA 1L2UA 5L9FA 1TRDA 5MHBA 1KM5A 3FOKA 3EWWA 1XFBA 5EYWA 3T55A 2YSWA 4UIOA 3E0IA 3CIXA 1W8SA 5FEPA 1OFDA 3A5VA 1Z48A 3I7RA 3TX9A 3DAQA 4MOZA 1M7PA 3BARA 1H61A 2X30A 4MJMA 3GXPA 1FWRA 3SR7A 1B3OA 3QMTA 2Y63A 3FEMA 3MI6A 3HPZA 2W79A 4FNSA 2I14A 3C52A 2GJNA 3THQA 3NVTA 1HO4A 3WK1A 1TPDA 3OVQA 1TPUA 5D02A 1SFJA 4JTKA 3RMJA 2Z1BA 5HUPA 1QOPA 1K8YA 2V5LA 3LHVA 5F1VA 3RLUA 3FYPA 1MEWA 3C3NA 2FPTA 3KHJA 2B4GA 3RF9A 3BK0A 1CI1A 3NQCA 5KMYA 2YW4A 4JTTA 3S1UA 1TQXA 2ALDA 3NAVA 5LZLA 3AJXA 4NZJA 2RFGA 3TR2A 1UUMA 1X8FA 2Y7GA 1HFBA 3NQ7A 5AHFA 3TU9A 4R53A 3FKKA 1XBYA 2ZZ7A 4PTNA 3DFOA 3JRKA 1P0KA 1O4UA 2H3DA 5GVJA 3SSJA 2CLIA 4IPIA 3IEBA 3CWOX 4WD0A 1EEPA 3G8RA 4UTTC 4UFIA 3W75A 3NQ6A 2B7OA 3T40A 1ZHAA 4DBDA 3IVUA 3NPXA 3NA8A 5HWMA 1G4TA 3OIXA 1VHNA 2NXIA 3GXTA 4XKYA 4WXYA 1C29A 4LU0A 3H55A 4IMDA 5EY5A 4PL2A 3TV8A 1RVGA 4O1BA 4AB4A 1SW7A 3W7NA 5KZMA 1OYBA 4JTLA 2DZXA 4JR5A 4UNKA 3SECA 5DN1A 4PCFA 3G1DA 2YX0A 3GNDA 1SO4A 3W86A 3SGZA 4A2RA 3GKFA 4ONVA 4NQ1A 4LUIA 5BMXA 3W85A 1K02A 1F74A 3HGJA 4N6EA 3PUDA 4NVTA 3W7IA 3HPXA 2HS6A 3IIOA 3FLUA 2HTMA 4O4VA 1XKYA 1TPVA 3QRHA 4L4MA 4JS3A 1M5WA 3PBUA 3S42A 3CWNA 2BLEA 3OG3A 1SW0A 4MY9A 4CNOA 1S5WA 3MO7A 1K7FA 5LGZA 3IRDA 4DEFA 1OFPA 3P8IA 4LVGA 1LP6A 4BK9A 3EWUA 3BG3A 4QISA 1HO1A 2E68A 3WK0A 3GDMA 2OT0A 4PODA 5HWNA 1DQXA 2VKZG 3VE7A 4U28A 2Z6IA 1GQNA 2QCFA 3N34A 4EF8A 5F4XA 4IMCA 3WK3A 2G96A 2H90A 1X1ZA 3C6CA 3L0NA 2QCEA 1SSGA 5K2ZA 4IWWA 2HSAA 3LHWA 3ZWSA 1FQ0A 3NQMA 3W73A 3IIVA 3P82A 4GFSA 4WZHA 4N9DA 4GRSA 3M1ZA 3DU0A 1XM3A 4O28A 4JN6A 2VFFA 3UXAA 4LVDA 3GLCA 3RFAA 5C2XA 3BW4A 3KVKA 1SO6A 4WUIA 2ZRXA 2JKAA 2ZBTA 4UTLA 1YPIA 2DZTA 4BI7A 1RQBA 1YPFA 1W5NA 2ZRUA 4HN4A 2C19A 3OA3A 1OFRA 1XUUA 3P74A 1YXYA 2DORA 2ZDRA 1ZAHA 4AF0B 2VC6A 1TMHA 4ZQPA 5D05A 4JIPA 1F7BA 1VCGA 3NR0A 4XTDA 1E51A 3M43A 1G7UA 4X2RA 4CNNA 1XXXA 4DO5A 2Y89A 2NWSA 2CLFA 1PE1A 4GJ1A 3QF0A 4XTIA 1A5AA 4FNQA 4LVFA 1FX6A 1QPQA 4Z0JA 1XI3A 4X3ZA 2A7NA 4FNRA 5G1TA 1RV8A 3UY7A 1QPNA 2O7SA 4O54A 4JYEA 1G67A 3UWYA 1FDZA 4QAIA 5F2IA 3PM6A 1FBAA 2XFWA 4N9EA 2C18A 2ZRYA 3B8DA 4IPJA 1EWEA 3I7QA 4IXHA 3B0VC 1G4PA 1OK4A 5CZSA 3USBA 1DVJA 2GVGA 4UR8A 4ADSA 5K4XA 3S5OA 4MYAA 3VI2A 1OVDA 4RK8A 3W1AA 3GKAA 4WXZA 4M6QA 1FWTA 1OX4A 3P5YA 2VFHA 2R94A 1TB3A 5I3FA 3TMLA 1KFJA 4OV4A 2EAWA 2JBMA 4RV8A 4AWTA 4XBKA 5K7JA 2QCDB 3DGRA 4O12A 2NX9A 3MP5A 2TSYA 3MMTA 2FJKA 4RCXA 3VE9A 5E0KA 2DZSA 1W3IA 1A5SA 3SW6A 4NX0A 1YTEA 3WJWA 3IGXA 1GPWA 5KINA 2YR1A 3HGOA 1OHLA 4O0KA 1L6SA 2P1FA 2C0AA 4LRTA 2Q8ZA 3S1WA 3DI0A 5T26A 4Q4KA 3I6RA 4FHAA 4N4PA 1KFCA 1GWJA 2A6NA 4K6AA 3IGUA 2JKPA 4Z1CA 2A6LA 3QW3A 5HR7A 1QDSA 4M19A 5EBUA 1WQ5A 3T7VA 1JR1A 4LC8A 2ZZ6A 2V2DA 4OV9A 3FYOA 5AHLA 3R12A 4BF9A 3TIMA 2QCLA 2V5BA 2CLMA 4D2JA 1SSDA 4I7UA 4O19A 1ME7A 1ME8A 2CLEA 2BZNA 4FXRA 3EWYA 3BG5A 4AWSA 1W5PA 2DZWA 5HWJA 1X1OA 3HPSA 4YWIA 4MKNA 3NM3A 3LV5A 3NM1A 3EX6A 3PG8A 3EXRA 5KSWA 1H7RA 4ZQMA 3DBPA 1EB3A 4O15A 5KZDA 1QO2A 2PURA 4CQ9A 1FCVA 4E0CA 5LSMA 1YDNA 1ML1A 2C16A 3R13A 1ZALA 2B0MA 4JIQA 4IJBA 2C13A 4OGZA 4MJZA 1ZAJA 3S6DA 2Y7FA 1SU5A 1LBLA 4JY8A 4UR7A 4KKXA 1VYPX 4P61A 3N2MA 3C2FA 1VJIA 2ZTJA 2VEMA 1LOSA 5D37A 2PRLA 4O14A 3W2UA 3WK2A 2YPIA 4PA8A 1P0NA 3Q58A 1KTBA 4JYDA 1LROA 3LLFA 3GNNA 1Q6QA 5DXYA 1O95A 1T8XA 3MUXA 4AHPA 5CG7A 2GVLA 5AC8A 3HG4A 4O1DA 3LHUA 3TKFA 2QKFA 4K7YA 3UWZA
chains in the Genus database with same CATH superfamily
1P0EA 4S2CA 1TJPA 4G7EA 1HXJA 4FR1A 2IPFA 2EGZA 5LA2A 1MVYA 3GBDA 5D32A 3VFLA 2GGIA 1FWIC 2WVTA 5G2HA 2IW0A 2NSXA 2DU2A 3CHDA 4XISA 3GW3A 1A5CA 3FGCB 3LU2A 4J3XA 3CUZA 1RP9A 4XIMA 1KTCA 1QRQA 4BQ3A 3WIJA 5IDZA 2PI6A 3BG9A 3V0UA 1RY0A 4B9YA 7A3HA 1KGWA 3BOXA 1LCOA 1CGWA 1V3IA 1LWJA 1TPWA 3TAOA 3EWZA 4UOJA 2XTKA 2PF0A 2CHNA 3Q65A 1E0VA 1EQPA 1KBJA 2QJHA 4NIRA 5D8WA 3AIBA 4UOZA 2ZYFA 4AX7A 3O6DA 4HYWA 4CU8A 4ACZA 1C8VA 2G0WA 5AOUA 2KZHA 3B0UX 2CETA 1XIBA 2OT1A 1UD6A 4PUUA 3P7YA 3NQ2A 1VFFA 3XISA 4XAZA 3W2JA 5LNRA 2WZMA 4FOJA 4DUXA 1AFSA 1E5NA 1H7WA 1I2OA 3DG7A 2PU1A 3G77A 4NSBA 1QNQA 3HA1A 1BGAA 3L68A 1HVQA 4Q8PA 4MMWA 3SSZA 4XZIA 4W4QA 1GT8A 1KXQA 4JFWA 3BAWA 5I78A 3V36A 1BFNA 3CMFA 3WDHA 2XN2A 1CBGA 4LUJA 3M5ZA 2R24A 3QV6A 1UBSA 3QKZA 4RJEA 3QLDA 4AVOA 4FR6A 2V5JA 5D4YA 4ICNA 3RHGA 4A8IA 1GVOA 4JN7A 2WHLA 2XN0A 3UWVA 1X6NA 3PZMA 5CC3A 2EO7A 1TPC1 1C92A 5KITA 4LV9A 3FS2A 4CVWA 4LAZA 3B8UA 4N7QA 3BSGA 2V3GA 4AY7A 1JPMA 5AFDA 5A8OA 1P0BA 1W54A 1E4NA 5IBXA 1BKHA 4I3GA 4C6LA 2GDVA 1V6VA 2XGBA 5TQLA 1T0OA 1PZ1A 1K8ZA 3DESA 2CERA 1KBKA 1OFBA 3QZEA 4AXKA 3CH0A 2W0UA 3ARXA 3M07A 4GY1A 4XV0A 3CPRA 4N9BA 1GKRA 1UPMB 2DVUA 1DPMA 4DM2A 1EZ2A 4Q8WA 1DQUA 2HXUA 1H1ZA 1LQ0A 2R14A 2C1IA 2WJFA 2BS9A 2C1GA 4HD5A 3FW6A 1V4YA 5EL1A 1LBMA 3UERA 2PTYA 2VCAA 1UWAA 2Y7DA 4HPJA 3BAYA 3LXCA 4N02A 4DJFC 1JCNA 1DJXA 3MW7A 1EJTC 5M1TA 3OG2A 1AQHA 3W6LA 3ZS4A 2F6UA 1WAUA 3G6MA 5JXQA 1VFSA 3W1LA 3I7SA 4Y9MA 3UWUA 2D2HA 3HG2A 1ODZA 2A3EA 4Q22A 5A6BD 4R3UA 1KFBA 1AH3A 5ENLA 3GE7A 5LIWX 4MZYA 4OJYA 3F03K 3LPOA 1GOKA 2H9AA 1DOSA 2FZ9A 5CPQA 1V02E 4KWWA 4O1FA 1W31A 3L5AA 3I3EA 4LAMA 2DIKA 5JU6A 1QHZA 2DSVA 3FX4A 1VPQA 3MBDA 3GNRA 2FZMA 4GX8A 3BLFA 1B90A 2QDHA 4AC7C 3UR5A 3LEPA 2A0NA 3TA9A 1THFD 1S5VA 4EIVA 4LUSB 5REQA 3PULA 4JHMA 1EO5A 4RXGA 2CLKA 2WWCA 4ZXOA 2VWSA 2J7GA 3UW6A 3MYPA 4ZB2A 3OIHA 2P8CA 2ZXAA 4NRRA 1F8MA 1L6WA 2CLOA 1EL3A 4KCUA 3G3MA 3G22A 3M6DA 4ML9A 1EKOA 3AS2A 2ISDA 3DHUA 1T8QA 5FEZA 4LEQA 1D7FA 4G56A 1JRBA 3MHUA 1TV2A 3SRFA 1FWJC 3MUY1 2A5HA 3MHFA 3ENLA 5A6MA 2VENA 2A4AA 4ZO9A 1PZ0A 1OF6A 2GQ3A 1IEXA 4BR1A 4NJJA 2P76A 2NQJA 1RA0A 3GVVA 2WLYA 3TYCA 2OB3A 3S9YA 2WMJA 5EB8A 3EWXA 4JQ1A 4KFNA 4QSHA 2VL4A 3QY6A 3ERPA 1BVWA 5FJJA 3GTHA 4BQ2A 1JCJA 4JZ5A 4DF0A 4M6VA 4JICA 1YXCA 1L8NA 3WNKA 1ECQA 3D0CA 3G3DA 4GABA 3QQWA 1GGOA 3PNZA 1RR2A 3CNYA 2GQ8A 3KX6A 3EGJA 4EWND 4JFUA 1MEIA 5MKGB 1SMDA 4CCEA 1WXJA 1TO3A 3CO4A 2UY2A 5E5CA 3HN3A 4HHPA 1W3TA 4UWMA 4IOTA 3WDJA 1CX9A 4N4QA 3KXQA 3O6AA 3CV6A 2X2YA 4IGSA 3OYXA 2R91A 4K7VA 3UWWA 1K7XA 1OFEA 1SFLA 1WDPA 4GUJA 5JUVA 3NGJA 5IM51 1WP6A 4HHHA 1ZU8A 1JUKA 1TPFA 3EDJA 1JAKA 3GVGA 4J28A 1H5VA 2VO5A 1L8PA 1NF0A 3WMCA 2UY5A 4DBUA 5C0QA 4O10A 1XYMA 2YDAA 2QCCA 4RR4A 3LPGA 1R0MA 4ZE4A 4HN8A 2W4XA 3ZR4A 3AO0A 1QFEA 3PAJA 1EOKA 1WKFA 3QLLA 2ZZ4A 3OYZA 4EANA 4DELA 3WJZA 2CESA 3WH7A 1ADOA 1W3KA 2NV1A 1R46A 3AS1A 1TV4A 2I9UA 3GVWA 1AQFA 1UWUA 5LKYA 4C91A 4KRUA 3V18A 1W1YA 4PUDA 4JEQA 2QGHA 3TJLA 2OSYA 3NDZA 4ROQA 1RHCA 3B8VA 1B1YA 4OUEA 1PHWA 3FVDA 2TAAA 1I45A 4REQB 4CQBA 3QYSA 3AJ7A 4JD4A 1F3EA 3QH2A 5C5YA 3RLHA 1DKWA 1J18A 3GXFA 1PDYA 1X38A 1R85A 3A3HA 4NZCA 3TYBA 1E1CA 4UFJA 5A6SA 1DWHM 1C91A 2JEQA 3WQGA 3TQVA 1HJUA 4Y9NA 3ARWA 1O5XA 2YZ5A 4ZQCA 3CAKA 2PC4A 3UG5A 3NSMA 2D1ZA 3B05A 3W7JA 2NWRA 4F8XA 3NL6A 3GDBA 4GUHA 3ITLA 1V6UA 1IT0A 2QJIA 1W56A 2E6FA 3LHTA 1F6KA 2NLIA 3IIZA 1U5HA 2E5CA 4ERAA 4OBRA 1LRTA 1KNWA 2WNWA 4QX4A 4OBSA 3RO8A 3TR9A 3ZXWA 4RUBA 4V33A 1H1NA 4FIQA 2F84A 4PEEA 5EMMA 4H7ZA 3LD5A 4MNJA 3FKRA 1R2RA 3A24A 4JNMA 3SI9A 1ITUA 3L9CA 1H7PA 2OSXA 1OG6A 4AD2A 2YW3A 2IKJA 3BZJA 2WVVA 1ESWA 3RITA 4ES4A 4IT1A 1X6LA 2O9RA 5FL0A 5JBEA 3TZFA 4CCDA 4MPKA 1IXNA 2V0TA 3IANA 1AQMA 2HK1A 1YADA 3TXZA 4HCDA 4GUIA 1TPEA 4A3HA 3F2BA 4UMCA 4Y6GA 1XYAA 1E3ZA 2PTDA 2AQWA 4R9OA 4DWSD 2CNCA 4YTTA 1B5TA 3V0SA 3LGEA 5BXRA 2ANUA 1PTDA 4LS2A 3SIZA 1LOLA 3EWDA 2GJLA 5G2WA 4Z1DA 2R1KA 5B7ZA 3CMGA 4IFRA 3SCOA 4PCSA 1Q7QA 3T05A 3S2LA 1KGUA 3G0XA 3NQFA 4HHMA 3QFEA 1KB3A 3BOLA 4U2YA 1GVEA 1AD1A 3DHFA 2F8QA 4PFMA 4TU1A 3QMRA 4GUFA 3JW7A 1XP3A 3LG3A 4XZWA 3PUGA 4OHQA 1Z8AA 4O0ZA 1J10A 2I9EA 1NTHA 1TTPA 3WNMA 3VUPA 4ACZB 3TA6A 3PZGA 4H6KA 3N9SA 2B7PA 2XZ7A 1H09A 3CTTA 1A47A 2D24A 5A8GA 4A8LA 2GJPA 4P7LA 1QHOA 4HNCA 2IMRA 1FWFC 3T81A 4FLSA 3BICA 3NXLA 3KBWA 1PEZA 3PHAA 3LMZA 3PUOA 3ALFA 5AYXA 3LRLA 3VIHA 4LCRA 4MWAA 4ZL1A 5JIPA 2D73A 2INFA 3LCGA 3P60A 1HTIA 1LWIA 1DWJM 2PUZA 5LNUA 4W8AA 2E8YA 3L4TA 3POHA 4KFOA 5K3VA 2ZQ0A 3K8KA 5AHMA 1OGGA 3LI0A 3W7RA 3WH6A 4M8UA 4UZSA 4TVUA 1J6PA 1Q6FA 1UD8A 1QBBA 2RJGA 1DHKA 5IBXC 5DY3A 3OVRA 4GQBA 3KTXA 2QNEA 1QR7A 4GYFA 3SN0A 4L80A 2RHGA 2WCSA 3KLKA 3H2FA 3SRDA 5EFDA 3Q94A 5HBFA 2Q3RA 1A5BA 3O6YX 4C65A 3MY9A 4LVBA 2QPXA 5A8MA 3URAA 4GIEA 2OLSA 1I2NA 4UTIA 3PZUA 4W7VA 3F5JA 2OO6A 2WJDA 1E73M 3THCA 2BVYA 3OZYA 4TOQA 4GVFA 3J7HA 5D2XA 4NP7A 4MFDA 2W62A 3AWNA 3VGEA 1MW3A 4GH3A 4V1YA 4MWAD 3AIRA 2PD9A 2DUZA 4NJKA 1WPCA 3FJLA 3PAOA 3T78A 4NAEB 4ALDA 2DW6A 1GOOA 4LS1A 1TE6A 3NUKA 5D9NA 2GJXB 2DT0A 3G1XA 2QT3A 1OADA 2W91A 3GNOA 1R2SA 2D0HA 4MKVA 1RLDA 2YFNA 3M0HA 2I1OA 2D2JA 1W9BM 2YL9A 3W1UA 2VUYA 1XLHA 4MVAA 3TWBA 5A2BA 5I2UA 4OT7A 5K9XA 1I6NA 1FCBA 3A3WA 1OC7A 3CT7A 1CZ1A 1H41A 5T91A 2V63A 5LNWA 4KS0A 1AODA 4LAUA 3W71A 1ICQA 4F9JA 2C8NA 5HINA 3LCLA 3W70A 3OZPA 4AY8A 4H8HA 4HNLA 3M0ZA 1DTUA 5L6UA 2XH0A 3MMUA 3O15A 4NZ1A 5AYYA 2FPYA 5TIMA 1EA9C 1AG1O 4WX2A 3QHMA 2H8XA 2E77A 1PBGA 1VS1A 1OFAA 1DJZA 2WSYA 2J7HA 1M53A 3E0FA 3F4WA 4YN5A 4O0QA 7ENLA 3N19B 2ZICA 3CV2A 3MUIA 1JPIA 4S3CA 3RM9A 1F76A 1G4SA 2PDUA 5E6ZA 3H22A 4HU3A 4JY9A 3MCNA 3VOIA 2ZZ2A 5AC5A 4P8UA 2YCJA 5C70A 2BV9A 4XD6A 3TCEA 5I23A 1GOWA 3TJXA 4DJFA 4A21A 2HPMA 2E5BA 3PSWA 5HMFA 1MO0A 2HK0A 4Q8MA 1W5QA 4BI5A 3V5CA 1LYXA 1YDOA 1YTKA 2DGAA 4CEXC 4HK6A 3SY8A 4EWJA 4N2YA 3GK0A 5AZ0A 2A85A 4X9SA 1I4NA 3TN6A 5SWUA 1Q2RA 1I0DA 1BQCA 1GKPA 3NQDA 1TJRA 4IPNB 3M5XA 1Q6EA 4ML4A 2GZXA 3M0MA 5D30A 2W27A 4GINA 1XBVA 1VFMA 2I5IA 3RJXA 4QIUA 4LBRA 5D9OA 2G95A 3GTNA 4MYXA 3GC4A 2Z1SA 4XBJA 3AIQA 4S3EA 3MKVA 2DJLA 4L65A 4NNCA 1V3KA 4ZVJA 3RO6A 1IT8A 2V68A 5CPMA 4TMBA 1KBIA 2XH7A 1O5QA 1UKOA 1W1IE 4J3SA 1BWLA 4FF5A 5J04A 4CD8A 3C0LA 1XX1A 3GH7A 4Z1AA 4DHGA 5ECVA 2VP8A 5A8PA 4YS1A 5G4WA 5C71A 1LLOA 4JTUA 2WNNA 3AWOA 2FFCA 4GPNA 1XD0A 2VUNA 2BVTA 1CGTA 4Z2IA 2VOMA 2VRJA 2YDQA 3IAQA 4I9JA 2XUCA 3TNBA 1N8FA 4FNPA 5PTDA 2PDJA 3MP4A 3G5EA 5IRPA 2QCDA 4S3FA 4UTKA 5EMUA 4A8NA 3NWRA 3IJLA 1WXYA 3LERA 4UFKA 2WVSA 6XIMA 5HA7A 1IWAA 4PZVA 4XZBA 3JS3A 3DZ1A 5AC6A 3TSDA 2EBNA 1PDZA 2DZUA 1AZ2A 2XIJA 3LGGA 2VXNA 1Q6RA 2E8ZA 3DEQA 1Q3NA 1QXLA 4GYPC 3JR2A 1ZENA 3D3FA 3M5VA 4L64A 4HJFA 3NCOA 1W5OA 4J1OA 1O94A 5HJLA 4XVEA 3AU6A 1P1XA 4JDYA 1CGXA 1EP2A 3OTRA 2FZNA 3HOJA 4PC8A 3T42A 3TDFA 2O9TA 2INZA 1XUZA 3BW2A 2OZ0A 3WLPA 3CPUA 1K9DA 2TMDA 1FTXA 4GI4A 1B3VA 2J7CA 3OBEA 1W1VA 4WOQA 3ZO9A 1IIHA 1ZBKA 1Q7MA 4X22A 3K4WA 3U8GA 4Q8QA 4AWEA 1Q65A 3LTSA 4W84A 1Z44A 4NAFB 1ONEA 1UOKA 5FI8A 3VNYA 4BI6A 4I9MA 2PE4A 2WMHA 3GQYA 3KVMA 3ZOAA 2FGZA 4PL1A 3VD7A 1KRMA 5CAKA 3U3HA 5A6AA 3ONCA 5EA9A 1GTHA 3TYAA 1RK5A 3GD6A 1EUAA 3ZT5A 3L23A 3K46A 1EHNA 2Y5SA 3CL6A 1VBRA 4YWSA 4AZ6A 3R25A 3QPYA 1X39A 4XO7A 5CZJA 4WSHA 3R8GA 2XPKA 3B8SA 1PKNA 4WGHA 1XH0A 4WKHA 4L6DA 1XCXA 2J66A 3TE9A 3H70A 4LW7A 5FF4A 2E9LA 2G3MA 3ZVHA 1YNPA 2RDTA 2ZZ3A 4UTWC 2X09A 3VNMA 4B92A 4IQLA 4AG0A 2OKOA 4H19A 3TAKA 3C2VA 4AIUA 3S6OA 1ZY9A 3CHVA 1YTDA 3ICJA 2OQLA 4XUGA 2EG7A 3PZVA 3AMLA 4OOZA 4KCWA 3EXSA 2V30A 2CZVA 3T2QA 6TIMA 2BY3A 1M6JA 4L4PA 1NDYA 3KS6A 3L0KA 1TWSA 4OQVA 5HNRA 1E72M 4FXFA 2FPVA 4HK5A 3C0QA 1XW8A 1IZCA 4GK8A 4F0RA 2OFJA 4IP5A 4UQ9A 4WSJA 2WO5A 3G24A 4YU1A 1BLIA 4C6JA 4ZFMA 3WBAA 4UTHA 3TFCA 4W86A 3GG8A 4J4KA 2G5WA 1EO7A 2WNZA 4QCFA 1BKSA 3VKJA 1T5AA 1BG4A 3VNZA 3SN1A 1FKWA 2QCNA 3LRKA 2ZDSA 4OIFA 4WDWA 4DUWA 3PNUA 5AYIA 5FJOA 3TP4A 1O1ZA 3ZJ6A 2YZRA 3M7WA 3CUXA 5HMSA 2J77A 1S1RA 4KPLA 1TRDA 4BA0A 3WD3A 4IH3A 3ITOA 1VEMA 2PBOA 3WQCA 3EWWA 1VRXA 1W17A 3SQMA 3T55A 3D3AA 4PTWA 5LIKX 1OFDA 2FYMA 1XSJA 3VDBA 2DFAA 3U48A 1SFTA 1FWRA 4RE2A 1NOWA 3FEMA 4JFSA 4FNSA 2I14A 3THQA 3NVTA 1HO4A 1Q85A 3E0LA 4AFYA 3FAWA 1TPUA 4JHOA 2Z1BA 5F1VA 3LHVA 1XYCA 2VRQA 3C3NA 2FPTA 3KHJA 3KOWA 3BK0A 1UIPA 1KR1A 1ISXA 5KMYA 4X0NA 2YW4A 4LGXA 4EPKA 2X0SA 1C9WA 3R0UA 5LZLA 3AJXA 4NZJA 1US3A 1UUMA 1TV3A 1W1PA 3FKKA 4DNMA 2QHAA 2F6KA 2ZZ7A 1D2KA 3KW3A 1Z89A 2H3DA 2Y5EA 4F3HA 3WMBA 2YA0A 3IEBA 1U2YA 3CWOX 3QN3A 4PRTA 3G8RA 3WH9A 3ARTA 4AZCA 3NQ6A 5I6SA 2ZUTA 4C60A 2H9AB 4PTVA 4MB4A 3OIXA 1FHUA 1S2UA 1ISYA 2QJMA 4WXYA 4HZMA 2XM1A 3WF3A 4PL2A 5JIWA 5HQMA 3W53A 3VZYA 2RAGA 3B0YA 1SW7A 2X05A 3W7NA 4AB4A 4JTLA 2DZXA 5A6LA 4M3PA 5DN1A 5A6JA 2PGEA 4PCFA 3GNDA 2YX0A 5C7VA 1S2AA 5E0CA 3OO2A 4A2RA 3GKFA 1AH0A 4LAKA 1E0UA 3RX4A 1PTGA 5IFTA 4BF7A 1TE1A 2C7FA 2GUYA 3H4WA 2E3ZA 2OLAA 4NVTA 4IL2A 1P6WA 4YHEA 3FLUA 2HTMA 3VD5A 1XKYA 5MF5A 3ISIX 1RBAA 1PTAA 4GQ0A 4UQCA 1IEQA 4RPQA 3VC5A 1AD4A 3W37A 2BLEA 5DX7A 2WMIA 1SW0A 4MY9A 4CNOA 4P8XA 1CXKA 4ERIA 3IRDA 3AHZA 1LP6A 3H23A 3EWUA 3AOFA 1V3MA 3BG3A 4MUPA 4MNKA 2OT0A 1EJRC 4PODA 3SDOA 4BKNA 3LUTA 3VE7A 3VO0A 4UQAA 2QCFA 3U0HA 4F0LA 4IMCA 3OW1A 3V1HA 4HOWA 1X1ZA 2QCEA 2YXXA 4L7ZA 3FDKA 4IWWA 4F2BA 2DSWA 3P93A 3ZWSA 1FQ0A 4LXFA 3SJNA 4WZHA 3B4YA 1NJJA 4GRSA 1SJBA 5C2CA 4O28A 4HOXA 3EDDA 4JN6A 5ABEA 3H4XA 3DYPA 4ZSUA 1RBOB 1C3FA 3D6NA 4IIHA 2OWCA 4I5RA 1FA2A 1SO6A 2FVLA 2ZBTA 4UTLA 1YPIA 4H8VA 1EYEA 4KERA 2PDGA 3P74A 2DORA 2G3IA 2ZDRA 3N2OA 3EKGA 1Q66A 2J7DA 5D05A 4JIPA 4QE5A 4XTDA 6REQA 2PP3A 1XXXA 1Y5WA 1OCNA 2CLFA 4U33A 4GZJA 2YOCA 1ZJBA 3WH5A 3E2VA 1FX6A 2CBJA 3H2MA 4X3ZA 5G1TA 5DEZA 1RV8A 3UY7A 3RPTA 1WZAA 4QAIA 5F2IA 1QASA 2WHKA 3U7VA 5BXTA 3K5XA 1US0A 2PDQA 3F4DA 1EWEA 2VDHA 3SIMA 1AJ2A 1OK4A 3USBA 1JEZA 1UQZA 4XD5A 3WEMA 2W5FA 4ADSA 3S5OA 1UZDA 3VI2A 1ZCCA 4WXZA 4M6QA 4KETA 1FWTA 3P5YA 2VFHA 2R94A 3SCQA 2PB1A 4PB4A 1EJUC 4IQDA 3WUGA 1E6SM 2PDMA 1CENA 4AWTA 3RM4A 5K7JA 2QQ6A 4O12A 1I60A 2NX9A 2TSYA 2AMXA 3HURA 4RCXA 3KP1A 2J8GA 4LQ1A 3IGXA 1GPWA 1ZUAX 4MGGA 4LY4A 4QLKA 5TD4A 2KX9A 2WKGA 5XIAA 3T0DA 3ITYA 2Q8ZA 1Q6CA 1V02A 4J3UA 3I6RA 2BY1A 2JIEA 1IT7A 4R85A 2UBPC 1XIFA 2ZX7A 4HP5A 1EGVA 2A6NA 1K9EA 2FTYA 4MADA 3IGUA 4C6DA 5EBUA 3F7JA 3FHAA 2BGNE 3GSMA 4FS9A 1YRRA 4LC8A 1Q7ZA 3BAIA 4EAYA 2HBXA 3FYOA 4I6KA 4Z2HA 1UKTA 1DEDA 4QFUA 2CLMA 4D2JA 5A2CA 4ILSA 2PLMA 1ME7A 3E5BA 4GI6A 1BYBA 3S2MA 1UC5A 3BG5A 1XIGA 4PSRA 4DBWA 1XGEA 1W5PA 4MWAE 4PCPA 1SMAA 3OLEA 4MKNA 2XVNA 1BQGA 1IE7C 4RDYA 4IQJA 1JD7A 3B8IA 3NM1A 4PBFA 4OZOA 3PG8A 1BTCA 3RRAA 4NAFA 5CLTA 4E8CA 4Q4MA 4D6CA 1HKKA 1UP3A 4BHYA 1W2VA 3CL7A 4ZENA 4B3LA 5LSMA 1QI2A 1SVDA 3FJNA 3WBXA 2B0MA 4JIQA 1MUWA 3BANA 3TJIA 4GISA 1KGXA 3S6DA 3WF4A 4D1IA 2ZWYA 3RXZA 4PFHA 4JY8A 2VDGA 2WC4A 3MUAA 2EPKX 3WLRA 3VMNA 3U2CA 4TTGA 1KFWA 1VJIA 5CJ5A 3AYRA 1YPXA 3VTRA 5D37A 3WK2A 4PA8A 1GUVA 4XUYA 3VMOA 4UNIA 1KTBA 4NYUA 4JTRA 3H4GA 4I5UA 4TQTA 4CNTA 4AHPA 5AZ1A 2OZTA 4HVXA 3O2LA 3WQ4A 2ZUWA 3H2NA 2X16A 4ACYA 2DP3A 4JKLA 1VR6A 4GVGA 1ZLPA 3B9EA 2GOUA 1LL4A 2OR2A 3EMQA 4Y8EA 3ANYA 4S3KA 4LF1A 2ZRWA 5EMLA 1A50A 4HA0A 2DZPA 3G0SA 2OG9A 4HNUA 5FAJA 3PB2A 1HG3A 3CLWA 4L61A 4HCHA 1XLLA 1K6AA 1DE6A 3TWAA 2V5KA 4Q32A 1FFRA 4UNLA 1JGIA 3W23A 4PMUA 1UW9A 3LK6A 4XK2A 2QUMA 1W1TA 2O9OA 4RW5A 5F4SA 4WY0A 1PJ9A 3Q2DA 3RYSA 3M0VA 3QR3A 4A3UA 4AZBA 1A3WA 1X96A 4NXKA 3U7BA 1UP0A 2QW5A 2YJQA 4A2SA 1ZB5A 7REQA 3S1VA 1ECEA 2I7GA 1X7FA 2PSNA 4CD7A 1DIDA 1WDRA 2NV9A 2XDFA 2EKGA 4NHVA 4RNFA 4CQ8A 2Q01A 2DH3A 1Q5MA 3FSTA 2HROA 1Y65A 3SY5A 1S2VA 1ITQA 2PDPA 3MC5A 1NDZA 1RBLA 3AC0A 1KCLA 3BLPX 3CAQA 5K9DA 3NYZA 3CB3A 1ZZMA 2HE8A 1C8XA 1JGMA 4TX6A 1G0CA 4FOUA 3QFWA 2V81A 3TK7A 4TO8A 4R27A 4IPPA 5BWAA 2AQOA 1UD3A 4PUKA 1HW6A 5CBIA 3GVRA 3IJQA 1G9HA 4X9YA 3QVQA 2UY4A 1K77A 4O13A 1NQKA 1DWAM 1LWHA 1NARA 2WJZA 4Q6JA 3LYEA 3WBWA 5K4ZA 2ESCA 4PMYA 4QJ4B 5LGXA 3JU2A 3PG9A 1SGJA 1E6NA 3ZLFA 3BDKA 3SJ3A 4M1BA 1D3GA 3WF1A 1QW9A 1VQTA 5EU9A 4HTBA 4E2OA 2VT0A 5A6KA 4ZEPA 4V2XA 3LZ3A 1XQLA 1JYVA 2W9MA 1KCKA 3SCPA 1W1ZA 2PTXA 3BAJA 4RNJA 1LM1A 5J5DA 4U5IA 3DERA 1ZCOA 2DZVA 3Q67A 1JFHA 1QWGA 4XAPA 1JYWA 1FCUA 1ONRA 3K8MA 3O07A 4Y96A 2OKTA 1JPHA 3UZWA 2ZXQA 4YLWA 5MKGA 3BAKA 4Y7EA 1UWIA 3K4DA 1VZWA 1VYRA 3M46A 1ITCA 3P61A 5KZ6A 4G5DA 5I3DA 3KP0A 2FVKA 3EMCA 3AHYA 2YBTA 1B4KA 3SUVA 4HNVA 4QE4A 1JDAA 3T1GA 2J8FA 3WNLA 1IR1A 3L4XA 3WDQA 4Q33A 2Y4SA 2UZ9A 1XKJA 1KR0A 1M7XA 3FEQA 3UJRA 1J0KA 4WOZA 4QAWA 3MVIA 1JCXA 2QS8A 1E3XA 4U10A 2RDWA 3EA1A 3QYQA 1QAPA 3ORWA 2HDJA 4QS6A 3S5SA 2FDSA 2IXUA 3LA4A 3SZ8A 4UC5A 1CECA 2GGGA 4KQNA 4UXDA 3W7HA 4EAMA 5TF0A 5CPNA 1DE5A 3ZSTA 4IIDA 3NEVA 4H83A 1VD6A 4GO8A 4H7VA 4UQEA 4E2BA 1C7SA 2YCLA 4I7VA 4MLRA 2D0FA 3VPLA 5BOFA 3STFA 3VGBA 4GKLA 3TONA 4GE8A 3GR7A 3P0WA 3EPOA 2VDIA 5A2AA 1J11A 1TKKA 3BC9A 4MY1A 4N9CA 1AMKA 2YCEA 1UUQA 3UZYA 4AQLA 4CU7A 3QV8A 3DKJA 4FO4A 3W7EA 3LCWA 3E9AA 1YXDA 3QGVA 3G1FA 1LTDA 3H2OA 2FZDA 2DT2A 3G8EA 1JAEA 4Q7BA 1J2WA 4RNIA 3CEPA 4WCJA 3QY7A 1F73A 3VGDA 1QHPA 2MNRA 3BJTA 3UPBA 2ZFAA 2OOFA 1XDLA 3EX2A 4MNLA 1QK0A 3ANVA 1UWSA 4BFAA 2BWGA 1PWLA 1R47A 3WF2A 4PRRA 5F2GA 3PJXA 3T07A 1W1A1 2WMGA 3F1QA 2DJXA 3A5FA 1JQXA 3WLKX 3ABRA 4H9XA 2BODX 1G6CA 3E38A 1FKXA 3UYCA 1SZNA 2F38A 1EH9A 3NQAA 3VIKA 4AD5A 4TTUA 3HFTA 4D6IA 4RPPA 2VX5A 3MSGA 1MEHA 3MANA 1A5NC 3RJYA 4YNGA 4O57A 2CLLA 2PZ0A 4CVUA 3UZXA 4GJIA 4EOUA 5TBOA 1IYXA 3S5NA 3SAZA 2G41A 1YBQA 4AHQA 2PWFA 3O0KA 1JJKA 4LUSA 4F0HA 4S3JA 3L12A 3W9ZA 2ISFA 2A7PA 5DCBA 2HQAA 2Z4GA 2ZUMA 3VGGA 4S1FA 3UESA 4RZ6A 1EJXC 2ZCGA 1KM1A 2PWUA 1RQHA 1Z41A 4WQ6A 4HK7A 3WNOA 1UWTA 2IKGA 2OTDA 3NZRA 4NI8A 2PDKA 4QTGA 3IIXA 3V16A 3MBFA 3M64A 1GZJA 1R2TA 3TOPA 2Z7GA 3N13A 3V5FA 4ZODA 5FEXA 3PJUA 4D6HA 1EXBA 1JQVA 3VGHA 3D5HA 4HYRA 4XKYB 1J9YA 1OQFA 1R86A 1P0DA 5C54A 4Q8VA 3KCOA 2J27A 1GVIA 4DYKA 2C14A 4TIMA 1VCFA 4YYCA 1S5TA 2YDSA 1Q63A 1W9XA 2OJPA 3LTYA 1OD0A 3XIMA 2ZUNA 2DIJA 1V08A 2AL2B 4JEJA 4XQ6A 1Q4WA 4JTEA 3W6MA 2EKCA 1TMQA 3A21A 3TC3A 1VYSX 2OU4A 5I03A 5FEWA 4FX6M 5BU6A 2ISVA 4XZMX 2QJNA 3E2RA 4NJHA 3WFLA 5AC4A 2WMIB 2E5DA 3MYOA 4GUGA 1JUEA 4JDBA 2A3AA 3EOSA 2A3CA 4JTHA 3NJ3A 3U2ZA 4JNYA 3VUSA 3CQIA 3LDVA 3VAVA 1D3HA 4OKDA 2V67A 3DC8A 2NQ5A 3BWWA 1KFKA 1RLCL 1K9FA 1N2VA 4R7JA 2XWDA 1BSLA 2PZNA 3B06A 3DFNA 4A35A 4GZIA 3O05A 5AHEA 2DY3A 5ABFA 3L67A 2Z24A 3T0CA 4J2PA 4HSNA 4K8EA 3E96A 3N15A 3DH7A 3O9NA 1CXEA 4P2VA 1KWKA 3UP8A 3U4AA 4ZSTA 1JZ4A 4D72A 3TROA 2A3HA 1O5KA 1W32A 5CJMA 1FWBC 3TEVA 4DB7A 4C90A 3LZ5A 4J2MA 4HA4A 3ARSA 2GVEA 3GZAA 3GH5A 1BD0A 1KWGA 1CPUA 1O1HA 2RJHA 4C1NA 4Q7IA 4JTFA 2G50A 4H7CA 2X1IA 3PPCA 2WWDA 3QQ1A 1A5MC 2D0GA 5CAHA 3E1F1 2X2GA 4AD4A 3MHGA 1ZPTA 3BLDA 1L0PA 1A5LC 5FF7A 4MLJA 3QGKC 1NH6A 1RAKA 4D6GA 4L1WA 5DBTA 1BWVA 5FIPA 1FWHC 3MU7A 2QUTA 4HPNA 3EDFA 4KWSA 1FWCC 3TXVA 3AZSA 1FUYA 3P14A 3AHXA 4LAOA 1EBHA 3AI0A 3H7RA 2GK1B 3VABA 1ZQ5A 3U2EA 1Y7VA 3UPMA 1I1XA 5E09A 1FRBA 3S5YA 3CAWA 4RZ4A 4DJDA 2C3ZA 4GHRA 5LNSA 2DT1A 1Q13A 2OYLA 3N6QA 1K9TA 5HNNA 2GDQA 3HPFA 4DPPA 2OPJA 3EYPA 3IUDA 3A4WA 1BTMA 3C2EA 3AXKA 4C6KA 3UA3A 2E6AA 4GD0A 3HTWA 3H26A 2I56A 4UTUA 4UFHA 2X1RA 2DPEA 2RGMA 4U31A 1J5TA 3VM7A 2AGKA 3UYIA 2PEVA 2QDEA 2VFDA 4LWWA 1ZBCA 4DZ5A 5JBFA 1RJQA 3B4UA 3SUSA 3OB8A 4YCOA 2WM1A 4GG9A 2EPLX 3ZMRA 2CCRA 4GX9A 2NQHA 1TWDA 4CNUA 2P3EA 1OCJA 4J3WA 3I3DA 1OGBA 3WJXA 2UV8G 1MXGA 4C1KA 2HWGA 2YXGA 1H2JA 1KM4A 2J8TA 4J40A 4MZ1A 3AS3A 2REQB 1E4MM 2ZA3A 3MI2A 4WJ8A 3KRBA 2ZADA 3CYVA 4EXBA 2D3NA 1P48A 4K39A 3URNA 2X42A 4ZMGA 1AK5A 4UFLA 3MZ2A 1LRNA 4H9VA 4MWAB 4GACA 3IV3A 3W7GA 1RD6A 2QV5A 1XRFA 1J0JA 3CMJA 3GXDA 1YHTA 2E1DA 2GQAA 4ZTYA 1EYWA 5HJXA 4IP4A 2BVDA 3BPWA 3CT2A 4POCA 1VLIA 2Q09A 5DANA 1CW2A 1DXFA 1BRLB 3RU6A 1EHAA 1KCXA 1T41A 2NX1A 1DL3A 3TYZA 6ALDA 1AL7A 3GY1A 2VMFA 2CW6A 1M65A 1VJSA 4JQ2A 3RX3A 1KQZA 4BWLA 3P6LA 3WENA 1MDLA 3WLMA 1IZKA 1JNDA 3QC3A 2AOSA 1P4CA 4LT9A 5IDIA 1XD1A 4FP1A 3HBLA 2GUUA 1I2PA 3M5YA 3GZ3A 4U5KA 3KOYA 4B90A 4H9MA 2A21A 4GXWA 5CSRA 2VGGA 1RJPA 3FGCA 1BEUA 1JXJA 3DECA 4O1CA 3VDAA 3W07A 2EQDA 4B2DA 4ORIA 1AJZA 3WLIA 1WUEA 1GZGA 1QUMA 3KAOA 1V3HA 1QPRA 3M6YA 1JZ7A 5BXPA 1M1BA 5LHFA 3KWXA 1SFSA 1EDGA 5CC5A 2F2HA 4NILA 4LC6A 3NSNA 4PE8A 1RPKA 2DZBA 4DO6A 3HF3A 2DDXA 3A64A 2WZTA 4PMDA 1TUXA 2FTPA 4HSOA 1QVBA 3UA4A 1OYAA 2WAGA 3EX4A 1EF3A 1MFUA 3IARA 5DRCA 3CIWA 3GYEA 4MPQA 2TRSA 4TMCA 1OY0A 3L66A 1VLWA 3QHNA 4QSFA 4US5D 1GZ1A 3KCLA 1TPB1 1MW2A 1DIEA 2YBUA 1HGWA 3QM3A 2ZXBA 1UZ1A 3R5EA 5CPOA 1TPH1 2FB3A 4H9TA 3EB2A 2PRMA 3C0SA 1FWWA 3QGAC 4U3AA 2R1MA 1A80A 1KM3A 2ZOXA 2XVKA 2Z00A 4JFTA 1UMLA 1X1NA 1V7YA 4XSMA 4KEUA 3WLSA 6TAAA 3A4AA 2J74A 2NXHA 4LYKA 5FESA 2BSLA 1UR8A 2O4QA 1W3JA 4HZ8A 5XIMA 4G8TA 2VX4A 4K37A 1QJWA 3CK5A 4D1JA 5BW6A 2FFIA 5F1UA 1ZFJA 1QOQA 1W37A 2ZX8A 1H50A 2J47A 2BY2A 3WLTA 1S38A 1ZNNA 2VCCA 1HJVA 2ZRZA 1JF6A 4D8ZA 1V0LA 1R3QA 4ORMA 1E1FA 3GR8A 1HVXA 1ICSA 4Z2JA 4GWEA 1KV8A 2VR5A 1YYAA 1QNPA 5EKYA 4ZQNA 3S46A 4GQQA 3KE0A 2HNHA 7TAAA 3FK4A 2QPSA 5D2YA 3WDRA 3ABXA 3OJGA 4YVVA 1RPXA 2BGSA 1A3HA 1F8IA 1GTEA 3R10A 2POZA 1JYXA 3N25A 1EQCA 4KRZA 5JVLA 1NVMA 5JH1A 5EPDA 1A49A 1GEHA 3ITGA 3RGTA 2NUWA 5C7HA 1B2YA 4WGXA 2Y7EA 1M7OA 1VRDA 3BW3A 5HDRA 1OX5A 1REQA 2J88A 5D09A 5KETA 2NXGA 4YTSA 3CQHA 2FH8A 3KLLA 5I00A 2ZKMX 1UIOA 1UBPC 3EOUA 3BH4A 3KVLA 1P7TA 3EDKA 4OWGA 3AICA 1JCMP 1LBFA 1J5SA 9XIMA 2DVXA 3ZLHA 1PYFA 1HJXA 2D20A 3U2OA 4DUVA 2NVCA 4V28A 1ENUA 2Z2AA 3BLLA 1HP4A 3SN4A 3N6HA 3O16A 4AVNA 4HGXA 2R82A 3NZQA 3PBWA 4JTIA 3ITTA 3AZTA 4XSLA 3HMJG 2ZUVA 3SO7A 4BEQA 3BLEA 3MSDA 2WSRA 3UR2A 4ATLA 5CXPA 5C9ZA 4HNOA 3M0KA 1W9DM 1OIMA 1VFHA 1R7AA 2J7BA 3UNDA 3FAXA 1FXPA 1GCYA 1T40A 2DSZA 3BXWA 2PP0A 3P80A 1UUOA 5BNKA 2BG5A 3EWBX 4FOKA 1DJGA 3R43A 4C6EA 3UJSA 2CC0A 3UBPC 3T8QA 3KOXA 3UJEA 3LHYA 1I8JA 3CQKA 1IHIA 5DBUA 4R7OA 5E93A 1MW0A 1HJSA 3AXHA 2BHZA 3JUGA 2XVLA 5A5WA 1BYCA 3O6CA 2Q8XA 4QNWA 3STEA 2OEKA 2WVVB 1SZFA 5I3JA 4MTVA 2J75A 1NEYA 5BOEA 3LS9A 1PUDA 1FVPA 3E49A 1UD2A 1DWIM 3STGA 3HZ3A 5E9XA 3OGSA 4CQDA 1H0GA 1TTIA 3R0KA 1XGDA 4MJ2A 1F3XA 5LIUX 1J0YA 5F4WA 4A6GA 1TJ0A 3WQ6A 1KM0A 3II1A 1M01A 3LQGA 3M0LA 4QHRA 1VFUA 2EPHA 4QEHA 3W74A 1SJDA 1XIDA 4RL3A 1V6XA 5K9CA 3ITVA 3WX7A 3DFQA 2ACSA 1OFOA 2WZIA 3UT0A 2GSJA 2F7FA 3FJ6A 3KBVA 4P7NA 3WLLA 1WDWA 3M16A 1QNSA 1AA1B 1ZBVA 1RQEA 1OM0A 3TQ0A 2NUXA 2C79A 2TPSA 5GNZA 3IACA 1P6CA 1UZ4A 3K8LA 3TTSA 2Q6ZA 4JOMA 3S0CA 1EJVC 1TX0A 3WQFA 2QEZA 2CBIA 4ZCWA 4K2SA 2PCQA 3OPSA 1QNRA 4D9PA 1VHCA 4O8RA 2XVPA 4O1AA 2Z6JA 1OG0A 2R8WA 3S4TA 1FXQA 3H8AA 3UXIA 2WW5A 1W9PA 1TZ9A 2PF8A 1PCKA 3UGVA 4MY8A 3DOPA 3I6EA 1G5AA 1R5YA 3A47A 4FNUA 1WKEA 3P5ZA 1PVNA 4WK9A 2H6RA 1KA9F 3QSTA 4KWVA 4IFOA 5AB3A 2A2IA 2C15A 2I16A 3Q37A 1TQJA 4Z1BA 3THAA 4ZGYA 4YL2A 2Z0IA 4Z2KA 3LSCA 5L9FA 3CV1A 1UR1A 3IJ9A 3WQWA 3UR7A 1T7LA 1HKMA 5EYWA 2BGQA 2YSWA 3E0IA 2BOGX 4LUTB 3A5VA 1Z48A 2NT1A 3I7RA 4GNVA 4XAYA 3DAQA 4F0KA 3ZT6A 3HPAA 1FFQA 2X30A 1EPVA 2PLKA 1EEXA 4CGTA 3VOGA 4PMJA 3SR7A 2B31A 4B5UA 3HPZA 1Q4NX 5TAOA 3FHQA 1H11A 1QTWA 3OVQA 1HKVA 1D3CA 1K8YA 4QG8A 4W93A 1U1JA 2B4GA 3RF9A 1CI1A 3S1UA 2ALDA 1YDYA 2P8BA 5CJNA 1X8FA 1CXFA 3NQ7A 3IV8A 2WKLA 3S6TA 3VDHA 3ARYA 3JRKA 1P0KA 3USZA 3SSJA 2CLIA 4IPIA 3NQBA 3NOYA 1R9YA 2XM2A 3W75A 1E6ZA 1K70A 5A95A 2YL8A 2PTZA 4AD1A 1ZHAA 4DBDA 1U5VA 4FLOA 2OWWA 1YE6A 3V7PA 3QC0A 1VHNA 1O66A 4ZFCA 3GXTA 4I5XA 4XKYA 4KRTA 3TYUA 4FAMA 3K2GA 5EY5A 4IMDA 4IJRA 1RVGA 1Z9AA 3TJ4A 1XH2A 1SR0A 4JR5A 3SECA 4YTUA 3G1DA 3W86A 1IEIA 4ONVA 1NM9A 3EZ4A 5BMXA 1K02A 1F74A 3TOYA 4Q6XA 3PUDA 1GOQA 5M3WA 3W7IA 1GHRA 1FHDA 3IIOA 3ARRA 3WD2A 3VKBA 3QRHA 4JS3A 5IOBA 4CCZA 1MWOA 5LXXA 2VZSA 5J8LA 2V6AA 1WUFA 5LGZA 5FKYA 1DIKA 3HQNA 4TV6A 4BK9A 4DX3A 3H2EA 4QISA 1HO1A 4F2UA 3GDMA 2R6OA 5HWNA 3JZUA 5EBAA 3ECQA 1DTNA 3GTIA 4W88A 1BHGA 4Q4OA 3VU2A 1QBAA 1GQNA 3B3DA 3N34A 4DJEA 3L4YA 5F4XA 3T4WA 3DFHA 4M1RA 3L0NA 3WDIA 3SB0A 2C0HA 3AAMA 1KBBA 3SBFA 3P82A 1F61A 2W3ZA 2GSEA 3DU0A 1UR3M 4PTMA 3QV7A 2OEJA 1IWBA 4WUIA 2ZRXA 2JKAA 4O8AA 1YPFA 1R38A 3OA3A 1OFRA 1GW1A 1ZAHA 1UD4A 3CV7A 3EPMA 3OA5A 3KL3A 3WQ8A 4ZQPA 1TMHA 1E9IA 1TWIA 3M43A 1G7UA 3BZGA 3FA4A 4Q4SA 4X2RA 2FH6A 3W81A 2Y89A 1VBHA 2NWSA 1CB2A 4G6CA 3AIUA 4KCVA 3QF0A 5F7UA 4XTIA 4W7UA 1JI2A 1QPQA 4WKFA 4TX8A 1LT7A 2NW0A 3H21A 1GJUA 3VGFA 4ZB0A 1NDWA 2CXGA 2O7SA 4F4RA 3PPFA 4GIYA 3UWYA 1TZ7A 2XFWA 3VNJA 3O7UA 4IXHA 3FDGA 2J78A 3ARVA 3A9BA 1OIFA 2GVGA 3VZZA 4UR8A 4XG1A 3ZJ8A 2YCLB 1OVDA 1QPKA 3W1AA 3GKAA 4E8DA 4DI8A 5C9UA 3EWCA 4L1GA 3AYTA 2PDBA 1KFJA 2CHRA 4K1WA 2EAWA 1VENA 3RR4A 4XBKA 1OINA 3GVQA 1RXOB 3DGRA 4HJWA 4NASA 1MYRA 2VD8A 4NX0A 3WJWA 2QVNA 3WMSA 2XIBA 3KOZA 4C5YA 3VMPA 2QPUA 1L6SA 1R3WA 1CDGA 2E25A 4LRTA 1NIUA 4FHAA 4N4PA 3HU7A 1KFCA 2XZ9A 1GWJA 2VHLA 1QW8A 3OP2A 4Z1CA 5HR7A 3REQA 1E4IA 4M51A 4IIEA 3RIKA 3T7VA 4C6OA 1W6TA 2CIPA 3R12A 1XWYA 1OGSA 5I77A 4JAWA 5LYRA 1ME8A 3TTOA 2BB0A 3BL3A 4Z2LA 4YWIA 2PMQA 4GYJA 3NM3A 3LV5A 4XZLX 1RA5A 3JVAA 3RPDA 4S23A 2VURA 4PUNA 1UYQA 3DBPA 4WDXA 4O15A 3RDKA 2PURA 4CQ9A 4NF7A 4E0CA 2DH2A 1YDNA 3AMCA 1ML1A 3TTQA 2G3FA 4OGZA 1HKJA 3QOKA 2Y7FA 1SU5A 4UR7A 3ZQ9A 1VYPX 3OLGA 1HN1A 4WKAA 1TA3B 1CYGA 3C2FA 2VEMA 2A3LA 2WLZA 4C6PA 2WZHA 5DQPA 3NTYA 2PDLA 4GI9A 4KESA 1A0CA 4HZ6A 2IQDA 2YB1A 2VQUA 2J25A 1T8XA 2GVLA 2YB4A 3LHUA 3BSHA 3TKFA 1DWFM 2QKFA 1KBLA 3OGVA 1NY1A 9CGTA 5BU9A 3LHZA 4JCMA 4X61A 1MUCA 9RUBA 2HE5A 2YYUA 4KWOA 4AH7A 1JYNA 2WXDM 1TA3A 1TRIA 2BY0A 2INEA 1C90A 5D2VA 3G2GA 3CLMA 2PGRA 1H62A 3S2JA 1G1YA 4IGMA 2PWVA 5FD0A 4F0SA 3BCFA 1OFQA 4FB7A 3UZZA 4G2DA 2EF9A 3RCYA 3CZKA 4YPJA 1UR4A 1EX5A 2NLYA 3GU9A 1PZ3A 4A22A 3S9IA 4TV5A 3H53A 1NOFA 1RP8A 1WDQA 1JI1A 4TX9A 1OEPA 4G1KA 2WV8A 3L7RA 3GXNA 5I07A 4EF9A 3KDNA 4O18A 3PZTA 3C0JA 4H6EA 4NL1A 3P81A 4JX6A 2J7EA 3UWQA 2JEPA 1K1DA 4WR3A 1ICPA 2RDXA 4MIMA 4AMCA 1EIXA 2ZTKA 3UXDA 3B03A 1XCWA 4HBKA 2BNJA 3S2CA 3FXYA 4U4MA 4C7DA 2F6XA 8A3HA 7TIMA 2XSBA 3KBMA 1GEQA 1MI3A 1VGAA 4S3DA 4KEVA 2GPTA 4B5VA 3PVFA 4AEOA 3ZZ1A 5CQ1A 4W5UA 1YLVA 5FF0A 1F05A 4H9YA 2UWFA 2JQXA 5E6YA 1SO5A 2QMJA 4OU1A 3M44A 2FGBA 1KFLA 4IIGA 1GG0A 4GY7A 3PF3A 2C91A 1O60A 5CC6A 1GW9A 4IICA 1EC7A 3U6WA 3G1HA 4O50A 2E9MA 4JGDA 3R2GA 1DJIA 2QULA 2A79A 3IGHX 1GVSA 3GB6A 5CKSA 4M82A 1MQPA 3PB0A 1KLYA 3BLKA 3MT1A 4EACA 2VC7A 4US5A 3LOTA 5CGMA 5FSDC 1PX4A 3QTGA 3VZXA 4J3TA 1KFEA 5I3GA 1POKA 4JTCA 3EB4A 1PX8A 1HQTA 2WM0A 5CCZA 3DYMA 4IMFA 3HQOA 4JX5A 2QF7A 2Y8VA 4H9ZA 1MZRA 4ZE5A 2R9RA 4DO4A 1AUSL 3TC6A 5E70A 4HPHA 4PUEA 1O7AA 1H7XA 2BX7A 4KGJA 1OC6A 1MDRA 1GYNA 1XS2A 1NP2A 3KL0A 3GS6A 4NXSA 2GYIA 5I3KA 2JF7A 2OGJA 1VIZA 4A3YA 1X6UA 1BXCA 1FHLA 1KQYA 3KBNA 3G1AA 2CU0A 3WFAA 5HXMA 3GR4A 1S1PA 2PDCA 1GPFA 4FLQA 2GFTA 4FPSA 5EGRA 2JK2A 2W61A 4YTRA 3OVGA 3S83A 1K4GA 2G97A 2OZ8A 1RSCA 3LMYA 2DUXA 3EDEA 1PPIA 2FHBA 1QNOA 1MZHA 2PA6A 4QJ1A 2XIQA 3VNIA 2J7FA 3QV9A 4UMBA 3OLIA 1KV5A 1XLEA 2FLIA 3O63A 4DAIA 3W1MA 3VILA 2FQIA 4B15A 2P0IA 3RLGA 3SURA 1GQIA 1Y8BA 3B04A 4AMAA 4PYSA 3W7KA 4E6MA 2NV2A 1W9UA 3PZQA 3VIPA 3WNPA 1ME9A 2HS8A 2RKXA 2VX6A 3WJSA 1LQAA 4LF2A 3W2MA 4DYEA 7XIMA 3VOFA 3PZOA 2Y6ZA 2A3BA 4HMCA 3WUFA 4QGCA 4GO9A 2VFIA 1KTNA 3PWGA 1VF8A 1V51A 4Q8NA 4NNBA 4RW3A 3CEUA 3FVMA 4RDWA 4L4OA 3L4ZA 2VGBA 1C93A 1EWDA 3IGSA 3WYZA 3W84A 3WQEA 4PSPA 3S8HA 1BF2A 4IZGA 3TZNA 3L2LA 2F9RA 4FNTA 3DKLA 3VCRA 4WY0F 1V77A 4MFEA 4UR9A 3B97A 2BXVA 4FXJA 3D46A 3B9NA 4O4WA 3M0IA 3TVAA 4DY1A 2L5HA 2IPJA 4CUCA 3L5MA 3MVTA 2OMAA 3W3OA 4I9AA 1G7VA 4UB9A 1E56A 2ISWA 4O52A 1NELA 1OCQA 2QDDA 1SQ7A 4C7GA 1E43A 3PWIA 1JPKA 1Q6LA 2CZDA 4GNJA 4ZO7A 3KHDA 3WMLA 4GYKA 4L9ZA 4CNPA 1D8CA 2W6RA 4HPGA 3HG3A 3LRMA 1DBTA 3I68A 1P1MA 4KFPA 3CU2A 5B7YA 1WKYA 1F6PA 1WA3A 5CPTA 1UWQA 3VD3A 1ZSXA 2ZUSA 4C6BA 4A8RA 4ASTA 1A0EA 4GLEA 2ZX9A 4HMEA 3O06A 3M41A 1LLZA 5CSSA 1FWEC 1NFBA 2OSWA 2OQHA 1GQLA 1US2A 1TG7A 3WDPP 1X8CA 1RJRA 4AIEA 4I90A 4WJXA 3TSBA 1H7NA 3MCMA 2GOKA 2V69A 1EC8A 4AEEA 4NUWA 1RCXB 5C6MA 1VPXA 3W88A 1KM6A 4UTWA 1N55A 2Y62A 1E6XM 2V82A 1CNVA 3QJAA 1CEOA 4PMZA 5HANA 5BMWA 4AD0A 1V5XA 3E3HA 4JL1A 5IXEA 4IMAA 2VVSA 2ZVRA 4OOUA 3T4CA 2X40A 2ZE3A 3QQ0A 2V38A 1XBXA 4CLMA 1U1HA 2X1TA 4FMVA 1JCYA 3LBMA 2HJPA 3IUIA 1E6PA 1TJ2A 3BMVA 4PBGA 3MWAA 1G69A 1HX0A 4LY8A 4QS5A 2V2CA 3PZ9A 2TYSA 3VD4A 4G9PA 4XB3A 4CCCA 3GU2A 4LH8A 5I79A 3W22A 4HCLA 1XLFA 1JVNA 5H6HA 2G37A 4H2CA 4LB4A 2ISSA 1HIZA 3RR1A 4MB3A 1XLGA 1EJWC 3R58A 1QI3A 3HQPA 4GIAA 1FOBA 1GJWA 1KO0A 3QZAA 3NPUA 4QROA 4E38A 1K03A 5CPLA 1FCQA 4MWAC 4GBDA 5FA5A 2XN1A 3TN5A 5HK4A 4IISA 2GVJA 4PTDA 1X7IA 2PD5A 4JFVA 1XYBA 5C9WA 5CZTA 7ODCA 4PEKA 4IGNA 5BZAA 1CGVA 3AMDA 3CTLA 5D2TA 3WEOA 2PWGA 2VVNA 4CN1A 1BXBA 3ZSSA 1T96A 2G4JA 1UPPA 3HQ1A 2IPGA 3WLJA 3LTPA 1DQWA 1H4PA 1HZYA 3TUUA 4I6VA 5M5DA 5ECUA 3NEHA 4XBSA 2ADAA 1GOXA 2WC7A 4NRSA 3L2IA 3ONBA 1EDQA 1B3YA 3IVSA 2VGFA 1LOQA 1KD0A 1K3UA 1XLDA 4B16A 3QBUA 1VH7A 1BRLA 1TYGA 4WY0B 4E4UA 4LUTA 5F2LA 5AHNA 1JF5A 3V1PA 3IIPA 1XINA 4ECLA 4P7QA 1GVQA 3WJYA 3F5KA 1XLCA 4XX6A 1NFGA 2FZBA 2WHJA 4G1NA 5HOSA 3BSMA 1FWAC 2B81A 4ZXLA 3NIYA 1XPYA 1KXVA 3VKDA 5C55A 5HAOA 3HIJA 3CQ0A 2DT3A 4ATWA 3ABSA 4W5ZA 4S3BA 1B57A 3IJ8A 3TLLA 2IUZA 4PBEA 3PBMA 3E0VA 2YXOA 1SW3A 1TCMA 2E4TA 3A9IA 3N4FA 4XAFA 2WKJA 3BTNA 5AYZA 1UWRA 3MQTA 3H7VA 2CKRA 1IR2A 2ACRA 4GC4A 3RMEA 2HZGA 3W7QA 4Q8TA 4AX6A 1TIWA 3WEZA 2P50A 4EK7A 8XIAA 3HGRA 3P67A 3PJWA 3N4AA 4M6PA 4R9XA 4IMEA 2W67A 1V3JA 2REQA 3CB8A 3SEPA 2YA1A 4O1EA 1KKRA 1FWSA 1PWMA 1R3SA 3PP7A 3VXGA 4XD3A 3N6JA 1TV5A 3ID7A 3NURA 2GWNA 1AH4A 1KRBC 1SPQA 1IXQA 1OK6A 4B91A 4RE0A 2CZ5A 2J9YA 2ZVIA 4Q4PA 2Y2WA 2GJXA 2AL1A 3B9OA 1M3UA 1M03A 2VC9A 2ABBA 2XINA 3TQKA 3IK2A 4Y9OA 2WHMA 3NXFA 4MM1A 4H41A 2CWXA 4M6UA 3MS8A 4M7SA 4AHOA 1XLJA 2B7NA 4KCTA 3DHPA 3FXGA 3W1PA 4JIIX 1N8WA 1MRQA 4L6OA 5H91A 2VYOA 3UGRA 6CGTA 3VD9A 3DFPA 3THUA 5HJYA 4NY2A 3UG4A 1WOBA 2I5QA 4XVDA 1W8GA 2YCIX 2VELA 4H00A 3R1ZA 3LM7A 4DPQA 1U33A 1CT5A 2OCZA 4QJ5B 3IS4A 1CTNA 2HEJA 3TTYA 2RDUA 5BRBA 2O4MA 3CH9A 3AALA 4TXEA 4K3ZA 1XC6A 4LYQA 2PU0A 1Z6KA 4E2DA 3W2NA 3W1TA 2WSQA 3N9KA 1D8WA 3ELFA 1S39A 3P8JA 1LRQA 1Z42A 3R8RA 3UR8A 3E0WA 3SY1A 1V3LA 3AZRA 1JIBA 5H2ZA 5JH2A 1ONXA 1JDEA 4HU0A 4MZ8A 3DFYA 2GSHA 4DXVA 2ZC8A 4F9DA 3ES8A 4F0MA 4G7EB 2ASHA 9XIAA 1E55A 5LHEA 1W3LA 3S1XA 4HNNA 4E3TA 2VZTA 3WCZA 3UCDA 1XYLA 1OCBA 1SUXA 3W7MA 1HJQA 1VBJA 4LNCA 4XZNX 5HUOA 1ODUA 6REQB 1FWNA 1BF6A 3G1SA 4HA3A 4PCNA 2OXNA 3PUEA 2G3NA 3UCQA 1CXLA 4BQ4A 1AMYA 1Q45A 4MNMA 4M56A 5DO8A 4DAFA 5AN7A 5EFFA 3ARPA 2VEPA 2YKKA 2ACQA 1R3YA 3BO9A 3E6EA 1YDVA 4JIHA 1A5KC 4HZ7A 2HCVA 5FL1A 5A3HA 2WZEA 3CUFA 4V1XA 4AZ5A 3QEZA 3M0XA 4RV3A 5HNTA 3BCDA 4JTJA 4PCTA 1FY6A 4JX4A 1FP9A 5AY7A 3C2YA 1ZRQA 3NDYA