3UNDA

Substrate-bound crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
283
Chain Sequence
GSMNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDVTHSLQCRDPLGDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRARCDGPSALPLHQLEGLLSQMKAIDDLVKRMPALEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase 2
total genus 95
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3undA00
4JX5A 4M5PA 3OIXA 2H90A 1AMKA 2FDSA 3W7DA 5KMYA 1TPH1 3BGJA 2WNZA 3UWUA 5AHMA 1A5SA 2V9DA 3DFOA 3GLCA 3Q2DA 3P8IA 4BI6A 3VE9A 3KAOA 4AXKA 2QCLA 1DJQA 1QO5A 2XN2A 4WY0B 3SJ3A 3CWNA 4DPPA 4O0ZA 1GVFA 1R2RA 4WZHA 5D03A 2V8ZA 3KXQA 2QDHA 3HOJA 3W1QA 2YYTA 3ABQA 4DBEA 4EF8A 3BW4A 1FWTA 3BO9A 1H7WA 5D33A 3NQAA 3GXNA 4UFLA 4AEOA 1UUMA 3DFTA 3THAA 1IIHA 4LVFA 5CPMA 2OT0A 2VFGA 1OFRA 3S1WA 4O8RA 1ZHAA 2Y62A 4JYFA 2WPBA 3R5EA 1GQNA 1KM0A 3PAJA 4GRSA 3LHTA 1EP1A 4LW7A 1JVNA 4AHPA 4AF0B 1W54A 3M5ZA 3MHUA 5AN7A 3H53A 3PF3A 3MI2A 1KFEA 2VENA 5CZ0A 1Q3NA 1GG0A 1OFAA 5DBUA 4UUIA 3VCRA 4UIOA 2HSAA 3C4UA 3HQ1A 3S5ZA 4MFDA 5F2IA 2OCZA 3R12A 4TR9A 3W7OA 2E09A 4M6PA 3G1SA 3W23A 4KWVA 1I2NA 1GTEA 1QPOA 1GVQA 4UTTC 3SI9A 4XTDA 5DXYA 1WDWA 3CU2A 3EX6A 2FPVA 5BMWA 2B7PA 3RF9A 3NM3A 4AWTA 4RZ4A 3BG5A 4H4IA 3TSBA 2VOMA 1PHQA 2X1SA 4JTHA 3IEBA 4FNUA 4XKYA 5I3HA 4E2DA 4MOZA 2O7QA 4H6KA 1OFPA 3GDRA 3MHGA 1KLZA 1O5KA 2R91A 4OE7A 3O6YX 5D37A 5G4WA 5AYZA 1H63A 2NWRA 3QSRA 1LP6A 3VNDA 3KFTA 5F2LA 1FWSA 1OK4A 1SZNA 3C3NA 1F2JA 3LBCA 3EWBX 1H7PA 4Z0JA 1AL8A 2CW6A 3B8DA 1VGAA 3PB2A 4Y8FA 5F1UA 1GEQA 3WJSA 3M7WA 5FF0A 1TRDA 2EKCA 4JTGA 5D2YA 3LHUA 1WV2A 2AQWA 1RZMA 2Q8ZA 3CPRA 1MO0A 3P67A 3TC6A 2R14A 5EKYA 3CB8A 3C2RA 1P0KA 2A0NA 4Y96A 3PB0A 4R33A 5K3VA 3ZS4A 1ML1A 2WOQA 2Q3RA 2XN0A 3FEMA 2VEMA 1JCMP 4XKYB 1ALDA 1K3UA 3TX9A 3RMJA 3L68A 2DZWA 3PBWA 4DBDA 1FCUA 1GOXA 3HGJA 4O16A 1VLWA 1ICPA 1JR1A 3W3OA 2DU2A 2QJHA 2J27A 4GWEA 4BI7A 5F1VA 1ZJIA 1D3HA 3SECA 1QDSA 4IJBA 5G5IA 4IWWA 5D2XA 4NXKA 1CW2A 4MFEA 4N6FA 3BLIA 2EPHA 3TAKA 3TROA 3EXRA 1LOLA 3UWVA 1YXDA 2Z6IA 3LRMA 4JTJA 1YPFA 3QPYA 3KRUA 5D09A 1L9WA 3FFSA 2H3DA 4UC5A 1JULA 4JTFA 3B0UX 3QMRA 1KM6A 2CWNA 1K8ZA 3S0CA 4QIUA 2QCNA 3QEZA 5DN1A 1P0NA 2E5BA 4UR8A 3W70A 2ZTKA 1TPEA 4M19A 2WO5A 1DOSA 3A21A 3FOKA 3H54A 4HSOA 4OGZA 1KV5A 2WSRA 4GJ1A 1VCFA 1E51A 4CQAA 1YTKA 4UTWC 4HHPA 3JR2A 4MIMA 3TA6A 4YCPA 2ZZ3A 3L0NA 1OFEA 4IPIA 2X1UA 3MBFA 4MY8A 2Z6JA 4WOQA 1F74A 1XKYA 4UNLA 3BW3A 1ME9A 3DBPA 3LHYA 3NOEA 1W5QA 3CC1A 3LB0A 2GJNA 3PR2A 3UWWA 4DELA 1HO4A 4JNMA 3ELFA 2FPYA 2YCEA 5LGXA 3QM3A 1SFLA 3M44A 4FIQA 2J9XA 5FEWA 1H7NA 1QPNA 3LCFA 3SFKA 2J24A 1PL9A 4JX4A 1I2PA 1MXSA 4A21A 3GDMA 3N2XA 1KFBA 3P7YA 3W7QA 2W79A 1WBHA 1AK5A 1BWLA 2QEZA 1SUXA 1G4SA 1P1XA 3M5XA 1XDLA 1Y0EA 4O17A 4AMAA 3FS2A 1N8FA 4K36A 3L66A 1GYLA 3IIPA 3DAQA 4PODA 1JQXA 4JX6A 5BRBA 1OX6A 3G0SA 2WSYA 2E5DA 4P2VA 3A22A 1YDOA 1X8FA 4JR5A 3O06A 3EWUA 4IXHA 2I14A 1H1ZA 2F7FA 5DY2A 3S5OA 2C18A 4XZ9A 1TCDA 5DELA 5F2GA 1VLIA 1FCVA 4HNUA 3STCA 3TK7A 1M7PA 4LT9A 3EX4A 1JCLA 1GVSA 1GYNA 1C8VA 1S5TA 5I3KA 1G4EA 1W56A 1I45A 5HR7A 4LC6A 2RKXA 2V0TA 3WJXA 4O53A 3FKRA 4RJEA 5HWJA 1G7VA 5EA9A 1EWDA 4JD4A 3GDLA 2WNNA 4TMBA 4I7UA 2C1HA 4IMEA 1AL7A 8TIMA 1TTJA 1P4CA 3HG2A 3W7GA 3T40A 1JCNA 3TFCA 2YFNA 2HTMA 2J88A 1EP2A 3G8EA 5C5YA 1QMLA 4N4QA 4NX5A 4NXSA 2Y7FA 5KZEA 5F2MA 1SO3A 4YWIA 3RLUA 5FF7A 4UFJA 1XM3A 3V1PA 3A23A 5EY5A 1BEUA 5F4XA 4UMCA 3P74A 1TPDA 1X6UA 1H60A 4EF9A 5CPLA 1KTCA 4RV8A 1JCXA 1GPWA 2C19A 3ABOA 4POCA 4ADUA 1HG3A 3PBVA 4NVTA 1XBYA 6TIMA 1OFBA 5CGQA 4U4MA 2ZZ4A 2A1YA 1R47A 4JIQA 3W87A 1TQXA 2WNQA 1A5BA 3PUEA 3NZ1A 2CLKA 2ZZ7A 4O14A 2FFCA 1KTBA 1SO4A 5AC6A 2Z0IA 1T8XA 2CLIA 3EXTA 4ZQPA 1TREA 2JKEA 3LHZA 1PE1A 2G96A 4CCDA 4NJKA 1HFBA 3E9AA 4AHQA 3LCHA 1TPWA 3EX3A 3NGJA 2NZLA 2CFFA 2QUTA 3W76A 2BTMA 1EB3A 1WXJA 2G95A 2Y63A 4XUGA 5FEZA 1LBLA 1XUUA 2YXGA 3FIGA 3UQNA 3G1YA 1DQWA 1SO6A 1LBMA 3W7CA 2WV8A 4MPQA 4FNPA 1QOQA 1QR7A 5T26A 3LV5A 3HG5A 3TIMA 4A3UA 2WKJA 2A21A 4DXVA 1RQBA 3P62A 5FEPA 5CPNA 1LYXA 2AGKA 3C52A 3NYZA 4FNTA 1XI3A 1K7FA 3NL2A 1TJPA 3W9ZA 4I9AA 1TV8A 4I7WA 4NNCA 4ZQOA 4PL2A 2EF9A 2DJXA 1GTHA 4E2BA 4OWGA 4ZQRA 5C54A 1RV8A 4BF9A 2GVGA 4WY0F 1QOPA 3ABSA 3C2FA 4NNBA 2E6AA 2E68A 1DKWA 1O5XA 4YXGA 4ZL1A 3IGUA 2R94A 3SR7A 2CLEA 2ATSA 1IXNA 1DORA 5D04C 2A7RA 2Y85A 1PS9A 2ISWA 2BXVA 2QUUA 4O19A 4MJMA 3S5YA 1TPFA 2H3BA 2YR1A 3SW6A 5DCBA 2B7NA 3TKFA 3TJLA 2RHGA 1B4EA 3UWQA 1VYSX 1L6SA 5KZMA 3UXAA 3O63A 3W1MA 5KINA 1KM5A 4AH7A 3E0IA 1V5XA 4HNVA 1HO1A 1OF8A 2CZEA 3PUDA 1QPQA 5D05A 2E6DA 3LLDA 3I7RA 2JKAA 2DZSA 3P84A 3LGEA 2V2DA 3HGOA 2HS8A 1X7FA 3GKFA 3NXFA 1OYCA 2FB3A 1VYRA 1VCGA 4GE8A 2YW3A 3KRZA 4JDYA 5TIMA 4CQ8A 3S9YA 1OF6A 2CU0A 1XBZA 4C1LA 1MEIA 3DI1A 2YW4A 5AB3A 3N34A 4MKNA 4FEZA 1OYAA 4NUWA 1HUVA 5LNVA 2QCMA 1R2TA 4X2RA 1F5ZA 3M41A 4I7VA 4JXCA 1RQEA 2CLMA 4AWUA 2TSYA 1F73A 5LZLA 1SW7A 1FQ0A 4NX0A 1D9EA 3NPVA 5LNUA 1ZY9A 4ZQCA 2C13A 3BW2A 2VEPA 2QCHA 3L5LA 3LCXA 2CLHA 3DENA 1F6KA 1W31A 4ALDA 1TTPA 4QQ3A 5LNWA 4DF1A 3O05A 5J5DA 3W2MA 5J5RA 3G3MA 3LCIA 4B5NA 3LERA 1IIGA 2XFWA 4ORMA 2NUXA 1QAPA 3FLUA 2VEKA 5DLCA 3RNDA 3CLMA 3TMQA 3KVKA 3OHIA 3QMSA 2FB2A 3C2VA 4PTNA 4TMCA 2NXGA 1ICQA 2ZZ5A 3E49A 1JQVA 2P1FA 4NT0A 3DKLA 4BWLA 3NQ8A 1U83A 4LU0A 3NQCA 3BVJA 3CQ0A 5E1QA 4JIPA 4O52A 3DFSA 3QPZA 2D73A 3W7JA 3M16A 4G1KA 3AO0A 1XBXA 3C56A 1WX0A 4N6EA 2BZNA 2ATMA 1XXXA 4JTEA 3W7LA 4BK9A 3W86A 1B57A 3DZ1A 1VCVA 4IMGA 5E93A 4X22A 3ZWSA 4N2YA 3MUXA 1ZNNA 4KWWA 5AOUA 2RH9A 3QZEA 3TQVA 5D30A 3LTYA 1H62A 2QCFA 1LZOA 4AAJA 1GVRA 3I7SA 3IIZA 4MJZA 3E12A 4Y6GA 5DCEA 1W37A 1J4EA 2DP3A 1LCOA 4O0KA 1YADA 1EUNA 3L21A 4ZMGA 4JTSA 3UPWA 2C0AA 3B06A 3V75A 4Y9AA 4X9SA 4RZ5A 4LUIA 2PRMA 1GG1A 4UR7A 5FF2A 4O13A 3QFEA 4YMZA 3C2OA 4MY1A 1TV7A 1B3OA 1X1OA 1FDYA 1GT8A 1THFD 1QCWA 4Q32A 1H5YA 3U6WA 3W71A 1R46A 3WFAA 2FJKA 2ZBTA 5G2HA 5K9XA 2FPTA 1IGSA 3N9SA 4IMCA 5SWUA 3LXBA 2YZRA 1WAUA 3NO5A 4O12A 5HULA 5D32A 2JBMA 4YL2A 3T7VA 4UTTA 3EKLA 3BLFA 3QRHA 2YDAA 1LORA 2R8WA 3PG9A 2XN1A 5HMSA 4MYAA 2BWGA 1XCFA 1OABA 2QDGA 3MP3A 4JEQA 3MYOA 2JGYA 1FWWA 1KM3A 4GUIA 2VKZG 2QR6A 4JTUA 3S1VA 4NJHA 4ZQMA 1XFBA 3HBLA 2GOUA 3TC7A 4K7VA 3G0UA 1ZALA 1SW0A 2F84A 3S1UA 1YTEA 3QW4B 1PHWA 1CI1A 1SQ7A 2ZA1A 1AW2A 3SGZA 3Q58A 3WK2A 4O4WA 3HGRA 4OV4A 1TB3A 3PC0A 1EA0A 1Q6OA 4AWSA 5LHFA 1JRCA 3N9RA 1NF7A 4CNNA 4DO4A 5H2ZA 3OVPA 3NQ6A 5AYXA 3QYQA 2X30A 7TIMA 1K03A 1V7YA 4IX2A 4JYEA 1LDCA 3LM7A 1T96A 2TRSA 2GPTA 3W2JA 2ZYFA 3LCWA 4IXXA 4FHAA 3LBMA 1QFEA 2DZPA 1FY6A 1FCBA 1PV8A 3L5MA 4NQ1A 3W22A 4KFPA 1FBAA 4PH6A 3RLVA 4XTIA 3IVUA 3W7PA 1VC4A 3JS3A 4AB4A 2JKPA 1TTQA 4EOUA 3BG3A 1U5JA 1R2SA 1KBIA 1TYGA 3NQGA 3FA5A 4Z1CA 3NAVA 1UB3A 1FX6A 4NNAA 4RLIA 2QCDA 4KKXA 3MBDA 4OV9A 2I1OA 1LLWA 3HB9A 3I6RA 4CCCA 3P82A 3S6DA 2YYUA 2ZRWA 3CWOX 5KZDA 4DF2A 2C16A 1TMHA 5G2IA 2CLLA 4LV9A 1LLZA 3HPXA 3TXZA 2ALDA 5AYYA 3O07A 4LS1A 3OVQA 4JDBA 5DXXA 1TPB1 3B04A 3G8RA 4K39A 1PVNA 3NM1A 5G1TA 1NEYA 1A50A 1A5CA 2ZRZA 2P10A 3LCLA 4DEFA 2YFOA 4N9CA 4QAIA 2Y61A 3UXDA 3M9YA 3TDFA 1D3GA 5CG7A 1FUYA 3BARA 4OBTA 2CLFA 3R2GA 4KFOA 5CZSA 1ME8A 1DL3A 2NV1A 4C1KA 1L6WA 1CX9A 1YYAA 1H1YA 3P60A 3P80A 3QQ1A 3FJLA 4NZJA 3LV6A 4IQLA 4FIRA 4WD0A 3I68A 5LNRA 1IXPA 3AJXA 4Y90A 4UTLA 1EUAA 3G18A 3GNDA 4ADSA 1KLYA 1LROA 2PC4A 1OFOA 3EWZA 1ZFJA 2V5BA 1ONRA 5K7JA 1M6JA 4UMBA 2Y7DA 2X1TA 4TO8A 2I9EA 2NX9A 5D02A 3MYPA 3L2IA 2NV2A 2YGYA 1W5MA 1O4UA 1ZAHA 3HO8A 5C2XA 1X1ZA 1YXYA 3D0CA 4LUJA 4UTIA 1YPIA 3NL3A 4FNQA 5LHEA 3W75A 1F7BA 3P81A 1H61A 3T4CA 4QM1A 4Z08A 2FIQA 2C3ZA 1S3HA 3KX6A 1J2WA 1KM1A 4QSHA 1KBJA 1YXCA 4L4MA 4WXYA 5AHLA 3KVMA 1OX5A 3UWYA 4RZ6A 3N19B 3F03K 4GC4A 1EX5A 4NZFA 3QF0A 4JTTA 4JYDA 5F4SA 1SFJA 3NZRA 2VELA 2O7SA 1VJIA 3DHFA 2C15A 1B4KA 3UY7A 4O10A 4LTSA 4PCFA 1XBVA 3FJ6A 4JS3A 3NA8A 4FXSA 1K8YA 4AVFA 1AW5A 3G1FA 2QAFA 1VH7A 4O4VA 2QUVA 1F76A 1PCKA 1K02A 3PY2A 2A85A 2HMCA 3UD6A 2H6RA 4HIBA 5CZTA 5E0KA 2TYSA 3PSWA 4QJ1A 4LVDA 3G1XA 2JK2A 1EIXA 1BWKA 1TIMA 2ZRYA 1P5BA 1EP3A 1LRTA 2GUUA 4O50A 3S1XA 4FNRA 1H7XA 3MP5A 1ICSA 3A9IA 3W1XA 4GNJA 2V81A 4KFNA 4J9JA 1SO5A 4OQVA 3OG3A 2VFHA 5FI8A 3B0PA 3BV4A 4Q33A 5EMUA 3W1LA 5FEXA 3W2UA 1SSDA 4PL1A 4FO4A 4HT3A 4GUJA 4LRTA 3CEUA 3LTPA 4BI5A 4MZ8A 4HPXA 4UFIA 1FWRA 4O57A 4ADTA 3DI0A 4M6VA 4BWLC 3P5ZA 2ZFAA 1MEWA 3N14A 3SGUA 2G5WA 3LI1A 1G67A 5BW6A 2ZQ0A 3W85A 3WJYA 5KSWA 4RR4A 3G3DA 2PRHA 4P61A 4A29A 5FF3A 1W1ZA 2ABAA 2Z2UA 1L6YA 2CZ5A 3GB6A 3O6CA 3U2OA 3W1UA 2P0OA 3W84A 3P5YA 4TX9A 3FYPA 3QH2A 3O15A 4N02A 4O15A 3LLFA 3LX9A 4MLJA 5I3IA 4GUGA 1LM1A 2BX7A 3EKZA 3G24A 3W7KA 4K37A 4JY8A 3W7IA 1TSIA 3GYEA 3BPWA 1W8SA 4ML9A 4S2CA 4LNYA 3B0VC 2ZTJA 4LVBA 2YSWA 3L5AA 1BKSA 4RXFA 3R8RA 2PRLA 3UZ5A 3EXSA 4XBKA 4XBSA 5MHBA 2BLEA 4UMAA 4JY9A 4GUFA 1Z48A 4MZ1A 4MY9A 4PEKA 2FLIA 3GDTA 2V2HA 2DORA 5CPOA 4L4LA 3TAOA 1I4NA 1TPUA 5BNKA 2A7PA 3MP4A 1W5OA 1FXPA 1NAL1 5HJLA 4EIVA 3S8HA 1SW3A 1DHPA 1VRDA 2W0UA 2QJGA 4WXZA 3NL5A 5IBXC 1TRIA 3ZFHA 2VEIA 2QCEA 4JTLA 1RVGA 2RFGA 1I2QA 4JGDA 1KW1A 1IXQA 4M7SA 1HTIA 2Y6ZA 3IIVA 2NUYA 3TR2A 1ME7A 1ADOA 4DQWA 1MSSA 1PIIA 1JUEA 1QWGA 3PBYA 4BFAA 3LTSA 1LRQA 2H8XA 3NQFA 4CQ9A 3HMJG 4PC8A 4IUOA 3QW3A 4GUHA 1JUKA 3NQ2A 1DVJA 3GX9A 2FTPA 1NF0A 5I3GA 4ORIA 4LS2A 2DZUA 3NG3A 1LRNA 2ZA3A 3NQDA 3S5NA 4IOTA 2OJPA 1WOBA 1IXOA 3CM4A 3NL6A 2OX1A 4LOCA 4UFMA 2VFEA 1SU5A 3C8FA 4YCOA 3M0ZA 3UY8A 1FCQA 2ZRXA 2B7OA 3W74A 3VFLA 5H91A 5CKSA 4GXMA 4WJEA 1LTDA 4S1FA 1L2UA 2PCQA 2Y7GA 1O60A 1WYIA 2X16A 4FF7A 4WX2A 1O94A 1UASA 5AC7A 1VS1A 3KOFA 3NNTA 3A24A 3NQ7A 5KITA 1AW1A 5ABTA 3PBUA 1UJPA 3MHFA 3NQVA 2NWSA 2ZZ2A 3TFXA 1Q6LA 3IVTA 1OJXA 3WK1A 3PULA 4A22A 3TE9A 4LY8A 4YLWA 4RCXA 1W0MA 1GJPA 4HNNA 1KTNA 5DY3A 1FWNA 1ZAIA 4MUZA 4FX7A 1UBSA 2RDTA 3L65A 1SZEA 3C0JA 2X2GA 3CIWA 3NDOA 3DKJA 2WJZA 1N55A 2NXIA 2DZTA 2VXNA 3LXAA 4UTHA 3W7EA 5I3FA 3KHJA 3L0GA 3W1AA 1TQJA 2E1DA 1W5NA 1T0OA 4IX0A 1W3IA 4FNSA 3R13A 4K38A 1RPXA 3LOTA 3RK8A 3HPSA 4E38A 3TSMA 2GQ8A 3IGXA 2C6QA 5K4ZA 3DU0A 4OHQA 4RKAA 1T99A 5AHEA 4DPQA 1KV8A 5L6UA 1G4PA 4NU7A 2GQAA 3W7HA 1XL9A 4DF0A 5L9FA 3O8AA 1LOQA 4HN4A 1TPVA 3G1VA 3SY5A 3UYCA 3GR7A 4OT7A 2YPIA 3JRKA 1FDZA 1VYPX 5BOOA 3BGGA 1YTDA 3EB2A 4LVAA 4LC8A 3T55A 4WY0A 2AAMA 4FX8A 1NVMA 2VFIA 3TMLA 4X3ZA 3TQ0A 2A4AA 3TV8A 3ATZA 3KVJA 3E96A 4K7YA 4HNTA 3TUUA 1W3NA 5IM51 5C55A 3LRKA 1Q6RA 3BLEA 3KRSA 5C6MA 2NUWA 5F4WA 3GNNA 3G22A 5IBXA 1DJNA 1XC4A 2HS6A 1RR2A 4QNEA 2J6XA 2BSLA 5G2WA 4IGHA 2ABBA 4Q4KA 3PSVA 5LKYA 4O1CA 3MW7A 1GWJA 4JTIA 4UTUA 3HIJA 4UTWA 1KM4A 3W7RA 3WK3A 1K7XA 3TH6A 2KZHA 3NEVA 3PS7A 2PE4A 3BK0A 1W3TA 2EGZA 5K2ZA 3Q94A 4TU1A 2WSQA 2GVJA 2Y70A 1S5WA 1HL2A 4BR1A 2ISSA 3MO7A 3W1NA 1YDNA 3HGSA 4R7JA 3UWZA 3UNDA 4LVGA 2VFFA 3W1PA 3DH7A 3GDKA 1M5WA 4S2BA 5HR6A 1OFDA 3TXVA 2QAPA 3EWXA 4GBUA 4A2SA 3M1ZA 4CNOA 1WOAA 1I2RA 3W2LA 1F6PA 3WK0A 2QCGA 1SPQA 2WQPA 1ZCOA 3TU9A 5EBUA 3OBKA 3MMTA 1DBTA 3LHWA 2QKFA 2PURA 4WUIA 3L67A 1XUZA 2NLIA 5HUPA 2JGQA 3NVTA 5HUOA 4LV4A 4Z0SA 2EHHA 1OX4B 4JTKA 3A5FA 4N9DA 1RQHA 4O11A 1A5AA 5DBTA 1I8JA 1M7OA 4ZZ9A 3W2NA 2B0MA 5AHFA 3HPZA 2J9YA 1G69A 3BG9A 4LWWA 3VE7A 3EX2A 1FXQA 4MZYA 3L0KA 4NJJA 1AG1O 2TMDA 5U4NA 3T44A 3MWAA 3PWAA 1G4TA 4UXDA 2A7NA 1DQXA 3PM6A 4O54A 2DJLA 4MVAA 2OT1A 3DXIA 4W9TA 3G0XA 3WJWA 2QCDB 1B9BA 2VC6A 2ZZ6A 4R34A 3G1DA 3SIZA 3OA3A 4UNKA 3F4WA 1OG0A 1S5VA 5DCDA 3HJZA 4NJIA 4ZVJA 2VFDA 3C6CA 3EX1A 4WQ6A 3STEA 1JCJA 4UFHA 1KFCA 5TBOA 4GFSA 1XDMA 1LOSA 1I2OA 1MEHA 1ZAJA 5A5WA 4O1BA 4M7TA 5D2VA 1JUBA 2ZA2A 3W2KA 5CZJA 5EL1A 5LGZA 1SZFA 2Q8LA 3O1NA 4TIMA 1UCWA 4ZQNA 2G97A 3GZ3A 1H7RA 3O6DA 4LS0A 1SZGA 3DGRA 3LI0A 4O1DA 3IIXA 1TTIA 5HWNA 1LBFA 1KA9F 3NQEA 5K9CA 3LDVA 2V82A 5EYWA 3R89A 4FXRA 3M43A 5K9DA 1H7OA 3OVRA 3W73A 3CHVA 1EEPA 2V30A 1H50A 1K8XA 3RFAA 4RK8A 4HSNA 4DO5A 3KVLA 1EPXA 5D2TA 2A2IA 3TNOA 1Q45A 1WQ5A 2RDUA 2H8ZA 2B7QA 3TW7A 1IF2A 2IQTA 6ALDA 5LNSA 4Z1DA 3ZWTA 1VZWA 1NFBA 2QF7A 2QJIA 3USBA 4PA8A 5KTLA 3OEXA 3STFA 4UTMA 3U8GA 1VHNA 1C29A 5BMXA 2J9ZA 1VR6A 4K6AA 5EPDA 3W6YA 5D38A 1KFKA 3NR0A 2E6YA 3IRDA 3GAKA 5CSSA 1K7EA 1VHCA 3IIOA 4D2JA 5HWMA 3GXTA 4FX6M 1Z42A 4AF0A 2W6RA 3TW6A 3DFNA 3MI3A 3F1QA 4N9EA 1MZHA 2Z1BA 5AHNA 5GVJA 3UZJA 3W88A 4UTKA 3QC3A 4QNWA 3WJZA 2CZFA 4XWUA 1KFLA 3H55A 2UV8G 1TO3A 1O95A 3GAYA 3HG4A 3PVFA 1KFJA 3EEGA 1QPRA 5AC8A 3SSJA 1OVDA 1OYBA 1R30A 3M6YA 4IMFA 5FESA 2ZRUA 3ANYA 1UUOA 2GQ9A 3HG3A 4UTJA 4K8HA 1TV5A 1FDJA 3GVGA 2Y7EA 5TQLA 1OHLA 4PFMA 3MJYA 3VKJA 4ONVA 2V5LA 1ZENA 3FYOA 3GKAA 2ISVA 3DFPA 4LRSA 2YX0A 4O18A 4CLMA 2E6FA 2LLEA 3UPBA 5G1YA 3P61A 1Z44A 4IPJA 3B05A 4Z1AA 3LHVA 4M6QA 2GJLA 4CCEA 1NSJA 3ZR4A 2B4GA 4E0CA 4MYXA 3NPUA 3CEPA 4EVZA 1OK6A 2OZ0A 2V2CA 3GR8A 3CTLA 2GVLA 3N73A 3K30A 3W7NA 1JCYA 3G1AA 3NQMA 4QITA 5AHIA 1Z41A 3B03A 2FQIA 1C9DA 1QNVA 3EWYA 2ZDRA 2A6LA 2DZVA 1YDVA 4N4PA 3QSTA 3TQKA 3W83A 3IVSA 4H3DA 5I3JA 3S42A 1Q6QA 4RXGA 4N9BA 4CNPA 3A5VA 3M5VA 3O16A 4XQ6A 4DO6A 1N7KA 3N2MA 4ICNA 3W1TA 3NPWA 4U28A 5U7SA 3ABRA 1GZGA 3NPXA 2DZXA 1DV7A 4NJGA 1KM2A 1W5PA 5G4EA 4HPJA 5K4XA 2E5CA 3P8JA 1PCWA 4AHOA 3PG8A 5CSRA 3QQ0A 1G7UA 3F4NA 1BTMA 5HNRA 4JN6A 3B4UA 2E77A 1JJKA 3GIYA 4QISA 3GK0A 3MI6A 3TCEA 4RX0A 1VQTA 3FKKA 1GVOA 4MLRA 2A5HA 3IGSA 2NX1A 3IV3A 1WA3A 1OX4A 3L9CA 4A2RA 4HKPA 3LRLA 5D2WA 4FB7A 3W07A 2TPSA 3RU6A 3C61A 3HF3A 3W7MA 3M47A 5HINA 3M5YA 5FF4A 1SSGA 4EWND 1G6CA 3T78A 3LXCA 4Z1BA 3G1HA 1WBJA 3STGA 2X1RA 3QMTA 1RD5A 5AFDA 2CZDA 4OU1A 4UCGA 1YLVA 2ZRVA 3LCGA 2A6NA 4UFKA 1SR9A 3TSDA 3W72A 3VI2A 3THQA 2Y88A 4WOZA 1JRBA 5A8GA 3INPA 2RDWA 3I65A 2OMAA 5HQEA 1QO2A 2NXHA 3CIXA 1J5TA 3QJAA 3I7QA 3Q37A 3DFQA 1VPXA 4R53A 3C2EA 4O28A 1H51A 1EWEA 2ZCGA 2Q3OA 3PUOA 1TJRA 2CLOA 3N3MA 3SZ8A 1F05A 4O1AA 2ZZ1A 4K8EA 2EAWA 4JICA 3W1RA 5LSMA 3ATYA 3DHDA 1A53A 2Y89A 3GXPA 1TPC1 2QCCA 3CT7A 2NX3A 1OFQA 3EWWA 3YPIA 2C14A 3E02A 3TJXA 4IMDA
chains in the Genus database with same CATH superfamily
3OIXA 2H90A 1AMKA 2AL1A 2FDSA 1E1EA 4AXNA 3W26A 5AHMA 2GJXB 3Q2DA 3OJGA 3T0AA 4BI6A 3T8QA 3KAOA 3VE9A 4AXKA 1DJQA 1LT7A 1A3HA 3SY8A 3VX1A 1QO5A 2XN2A 3CWNA 4JTRA 1MXGA 3OYZA 1E3XA 1GJWA 4O0ZA 1V6YA 2WMKA 3DX5A 5JIWA 2YYTA 3ABQA 3ES8A 4UQDA 3THUA 5JVLA 4QROA 2PSNA 1FWTA 3BO9A 4BQ2A 3JU2A 4UFLA 3NUKA 1E15A 1IIHA 1QNSA 1CZ1A 3E2QA 3S1WA 1AQFA 1ZHAA 2Y62A 4H9YA 2WPBA 3WH7A 3PAJA 4LW7A 3AS3A 3W02A 1E5NA 1S1PA 4XZLX 3WD3A 3BOLA 4LBRA 3MHUA 1E1CA 3ZSTA 2PDIA 4KQNA 2ZXQA 3MI2A 5CZ0A 1GG0A 4PB4A 3PTKA 3LPPA 3AC0A 3CO8A 1CB7B 3GO2A 1DPMA 4TR9A 2X1IA 4M6PA 2KAUC 1QPOA 4H9ZA 1NM9A 3SI9A 4IIDA 1UKOA 5DXYA 3ARSA 3NM3A 4IP4A 2VOMA 2X1SA 3IEBA 2YIHA 4XKYA 4MOZA 3V16A 4H6KA 1OFPA 3MHGA 3IJLA 4ZFCA 3CHFA 2BOEX 4YNGA 5D37A 5G4WA 3VNDA 3KFTA 5F2LA 2G3IA 2VR5A 3U57A 1E4MM 3M7WA 3SBFA 5D2YA 1I0DA 3FVDA 4KF1A 3L4XA 5EKYA 2HZGA 4R33A 5K3VA 2ACQA 3E0FA 4Q4OA 5PTDA 5CQ1A 2XN0A 4NRSA 1UWQA 1IZCA 3ITGA 2V3FA 1ALDA 1C93A 3L68A 4AC1X 3I4EA 1GOXA 4O16A 3OLGA 4FOUA 4E6MA 5HBFA 4A4AA 3C3UA 2A3LA 2J27A 1TZ7A 2PUZA 4BI7A 4HYWA 4W85A 1XC6A 3DECA 4F2TA 3BMWA 4IJBA 4DRSA 1TWWA 1Q7ZA 2OEJA 1A5NC 5DEZA 3BLIA 1BXNA 1NOFA 1NWRA 2W66A 3N6HA 4M0XA 4S39A 3GC5A 5C8BB 1K1DA 1ITXA 3KRUA 3V1HA 5D09A 2CERA 2BHZA 1WZMA 4FP1A 1JULA 3KL0A 4JTFA 1XD1A 4QJ5B 2HBVA 1UBPC 2XJ7A 1P0NA 5DN1A 5HQLA 4EACA 2ISFA 1NDWA 2WO5A 4M19A 3H12A 1KCKA 2PDWA 4QX4A 2ZX6A 4OGZA 1KV5A 4Z17A 2WSRA 5FA5A 2ZOXA 1E51A 2W4XA 1R7OA 3F4VA 2PPGA 3JR2A 1G1YA 3AIVA 3TA6A 4YCPA 2PGFA 4IPIA 4JCLA 2Z6JA 4MY8A 4GY0A 3UCQA 3UBPC 1XKYA 3DBPA 2Y5SA 3F7JA 4KRUA 2DY3A 3ELFA 1H0GA 1XIFA 3SCOA 2WZTA 2HK0A 3M44A 4DB7A 3QPEA 5KZ6A 1H7NA 1QPNA 3SFKA 1PL9A 1I2PA 3GDMA 3ZXWA 4MWAB 2WLZA 3VCNA 2FTWA 1AK5A 2ODOA 5LIXX 3GFZA 1BWLA 3BOXA 2BY2A 3CMFA 1ISXA 1PX8A 3CGTA 3EPMA 1Y0EA 2PZ0A 3FS2A 1GJUA 1PEZA 1EIBA 1AA1B 1GYLA 3DAQA 1JQXA 3AWOA 1OX6A 1XF0A 1NWUA 3AAMA 1U33A 1YDOA 2C1GA 4NASA 1GOMA 1H1ZA 1UOZA 4XAYA 4BJHA 4FZIA 5AY7A 1JIBA 5F2GA 2W62A 3ARRA 4XIAA 3H2NA 3WY1A 3EAUA 4LC6A 3DBNA 2P8CA 3K5XA 3MQTA 3MMUA 3LPOA 3WMCA 3GRIA 4O53A 5JBEA 5EA9A 4L80A 3WDIA 2C1HA 4RZBA 3V35A 1Y65A 1JCNA 4PMXA 4WKHA 3TFCA 1J12A 5I03A 4W7WA 4NXSA 2PGRA 2Y7FA 3NZGA 5F2MA 5FF7A 4UFJA 3S2CA 1BEUA 3FSUA 1TUXA 2WJFA 1EZWA 3OO2A 4UMCA 1OC6A 1X6UA 1YKWA 3RMEA 2IS7A 1VBRA 5CPLA 5J8LA 1KTCA 4RV8A 3UGVA 4M24A 4IPLA 2VMFA 4GHRA 2F9RA 4POCA 1HG3A 4S3FA 1A47A 2HROA 2A1YA 1R47A 3PTMA 4KERA 2OQYA 4O14A 1DJZA 1SO4A 5AC6A 3N6JA 1EGVA 3CV7A 4CQDA 3K13A 1TREA 4YVVA 2P0IA 3RR1A 1S2VA 4AHQA 2ZICA 3LCHA 1SYTA 1A49A 3EX3A 2A3AA 5HDRA 3A4AA 1W1TA 4B5VA 4URIA 3KZSA 1JZ4A 2XPKA 4W89A 4OZOA 3W00A 3DGBA 3UQNA 3G1YA 3LS9A 4NP7A 1SO6A 4WJXA 5I0DA 5CPQA 4MPQA 3T0TA 4HZ7A 3SGGA 3MCOA 2G37A 3HG5A 2ZUSA 3TIMA 3PZQA 3UG3A 3VIFA 4YYFA 2A21A 3Q45A 3EA3A 3P62A 3ABXA 4REQA 3NYZA 3C52A 3BOFA 3T8LA 1L8PA 1K7FA 1X8CA 2JF6A 3AUJA 4GXPA 1TJPA 1J0KA 3W9ZA 4MKVA 1TV8A 4I7WA 4NNCA 4PL2A 2EF9A 2DIJA 2WVTA 4ZOAA 4GYFA 4E2BA 2B31A 2PLCA 2PP3A 1TCMA 2MUCA 1DKWA 1O5XA 4YXGA 2R94A 3SR7A 1X39A 2CLEA 1IXNA 1DORA 3LEPA 1LQAA 3ZLGA 2A7RA 3GFYA 2ISWA 2QUUA 1XLFA 1TPFA 2H3BA 3WDHA 1ECQA 3TKFA 3D6NA 3DCPA 2OKTA 4HNVA 1HO1A 3T2QA 1OF8A 2CZEA 3N4EA 1U30A 3I7RA 2QJJA 4L9YA 2DZSA 3MC5A 1T7LA 2IPFA 5D9OA 3NXFA 5BRQA 2XZ7A 4GYPC 2FB3A 3ZT5A 3IJIA 2PTXA 2WZHA 4GE8A 5EB8A 5TIMA 5H8MA 2GGJA 2VGBA 3GBDA 3U2ZA 2PTZA 1MZRA 1UD2A 5HPCA 3ZMRA 4JTAA 4MKNA 4D6JA 3LSBA 4FEZA 4GZJA 5A3HA 1OYAA 1V0LA 4XZBA 5LNVA 3BLOA 3L2LA 4KCVA 2GUYA 2W27A 2ZKMX 5HAOA 1XICA 4JXCA 1RQEA 3GUGA 3O3RA 1GOOA 4F79A 1D9EA 4CD6A 1XIDA 1ZY9A 4ACYA 4XKMA 2GSHA 2FHBA 1VPYA 1MI3A 2VEPA 1F6YA 2VUNA 3U9IA 4I9TA 2OPJA 3OPSA 3UZYA 5HOSA 1V6XA 1UH3A 3ITLA 1XPYA 2VX6A 1O68A 3GG1A 4XVDA 1QI2A 5JBDA 2WLYA 4AY8A 3KP1A 4GZIA 4B5NA 2FTYA 3SDOA 1QAPA 1E3ZA 4J3TA 3FLUA 4WSJA 5CXPA 2VR4A 3KVKA 3QMSA 2FB2A 3C2VA 4PTNA 4XK2A 1C7TA 4NSBA 1QWKA 3MVIA 4RDYA 2EPNA 3VXGA 4DWDA 4EK7A 4Q8PA 5E1QA 1V6UA 5FJJA 3DFSA 2D73A 3W7JA 3VIJA 2O9TA 3WH5A 3BAXA 1QK0A 5C0QA 4PMNA 1V0KA 1NDVA 3DZ1A 1VCVA 1QTWA 2I5GA 3K46A 4GCXA 4PCNA 1YBQB 3ZWSA 2DZBA 3TQVA 3E0LA 1XLLA 3KCLA 1EF3A 1GVRA 3I7SA 3FY1A 5DCEA 3PZNA 1PO9A 4Q7IA 4QDPA 2DSUA 3TTEA 3WG6A 1TMQA 2PU0A 2E8ZA 3R58A 4TVUA 4X9SA 3P2VA 4RZ5A 3I4KA 3H2OA 4XZNX 2ONEA 3T09A 1U1HA 2XFFA 3VZYA 1DJWA 4MY1A 1X1OA 1FDYA 2WXDM 5FJTA 3U6WA 1H5YA 3WUEA 3WFAA 1RSCA 3UJSA 5K9XA 5REQB 1PKYA 2AMXA 3VA8A 3LXBA 3NO5A 4NZ3A 3V5OA 4NILA 5D32A 2JBMA 3PFMA 4X60A 1UUQA 3BLFA 1K8CA 1CECA 2E4TA 2R8WA 2BGNE 5HMSA 2BWGA 1HJXA 1XCFA 3EZ4A 3MYOA 3S83A 3UFYA 1CXKA 4Y7EA 4MB5A 1J0IA 3CMGA 3RG6A 2R1KA 5HK4A 4JHZA 3AYSA 5HNNA 5BU9A 4NJHA 4B3ZA 4TXEA 4F9DA 3QQWA 1XFBA 3TVAA 2GOUA 3DC8A 2PP0A 1BD0A 1TE1A 1WNOA 1PHWA 3SGZA 3WK2A 3BLKA 1CXIA 4O4WA 4ZA0A 1B3WA 4OV4A 1TB3A 1FKWA 1EA0A 4C7GA 2FJUB 4AWSA 1OY0A 1JRCA 3ZLHA 2V38A 1QRQA 3OVPA 3NQ6A 5CZKA 1JZ5A 4H00A 3G6MA 1V7YA 4EPBC 4IX2A 3LM7A 2GYIA 1V7AA 1F8MA 2PTWA 4IXXA 2YXOA 3LBMA 1M68A 2DZPA 1FCBA 3L5MA 4NQ1A 4UOZA 2CLPA 3WO8A 3AXKA 5TNVA 4AB4A 5D8WA 4QR6A 3QR1A 3VNZA 2OTDA 2YOCA 4QEEA 1TYGA 2VR2A 2HPIA 5B7YA 2NT0A 5T9CE 4Q7NA 3GH5A 4F2UA 1JPMA 2QCDA 4F48A 4ZFMA 4OV9A 2G3NA 4FAMA 4E3TA 3AHXA 4CCCA 4DF2A 2YYUA 3CWOX 5KZDA 3OLIA 2ALDA 4LS1A 4XV0A 3RR4A 1TJ0A 4KT2A 4MB1A 3AUOA 4KCUA 3G8RA 1PVNA 3UNTA 1KCZA 3NM1A 1NEYA 2P10A 3BSMA 1AZ1A 4DEFA 3CUZA 4P7QA 3L4TA 3TDFA 2J8TA 3BL3A 5I24A 1ZB5A 1BF6A 1O5RA 4OBTA 3R2GA 4CCZA 3C0LA 3DG6A 4C1KA 3M0YA 3K4AA 1S38A 4NZJA 4PTWA 1K6AA 1MNSA 2IMRA 1EUAA 2J75A 3CUJA 1OZMA 1ZFJA 4F0KA 2PWFA 4AZCA 4EX4A 4IQDA 2X1TA 4OBRA 4BCEA 3EDFA 2FGZA 6ENLA 3H24A 1W5MA 2A3EA 3DYMA 3QV8A 1IGWA 3D0CA 1MWOA 1YPIA 3SRHA 2XIOA 5LHEA 1V6TA 5GQBA 3W75A 2XIJA 1UD4A 5CCZA 1H61A 2XFYA 3EYPA 2C3ZA 4A8RA 1UR2A 1KBJA 1YXCA 4MWAA 4RZ6A 4GC4A 3P0WA 1SFJA 4Q7BA 1XYZA 3R0DA 3SCQA 1UR9A 3R6IA 2OWWA 3AFBA 3RDKA 4XZHA 2C15A 3AIBA 1WO2A 4QAWA 1RA5A 3GNRA 5C2CA 3KCJA 3NA8A 3AXHA 1GNXA 3G1FA 4O1EA 3BAYA 1F76A 1K02A 2A85A 1W3JA 3N29A 1KWKA 1N8WA 3PSWA 4PMJA 1A0DA 2YCLB 5DT7A 4QJ1A 1KXVA 3FDGA 2JQXA 3C0SA 2XYLA 3HURA 5CAKA 4LVDA 3G1XA 2OGYA 4MJ4A 1XYFA 3PZ9A 1P5BA 4O50A 1E6SM 3WLPA 4FNRA 3W1XA 2CCRA 3DYOA 2CXGA 4KFNA 5I09A 2YBVA 3RO8A 2YBUA 3D3AA 4Q33A 3B9OA 4RL3A 1LWIA 5FEXA 1SSDA 4FO4A 3IK4A 4HT3A 2WJDA 4GUJA 4W5UA 3CEUA 3CASA 4MMWA 4HPXA 4RE2A 1O66A 1FWRA 4O57A 2CITA 3DI0A 2P8BA 4M6VA 4BWLC 3P5ZA 1MEWA 4ZENA 3LI1A 3WJYA 7REQB 3WF3A 1OZQA 5KSWA 3EMCA 4DHGA 2DIKA 2PRHA 5FF3A 4AY1A 1L6YA 1HF6A 1EQCA 3CH9A 4DZHA 1LL7A 1TVLA 3GVQA 2VURA 3O15A 1XCXA 1PWMA 4MLJA 5I3IA 3SCPA 2DIEA 1LM1A 3O9NA 3G24A 3E5PA 1IEIA 3E3HA 3L12A 5E6ZA 1VBJA 4PUUA 4GK8A 2OODA 5BXSA 3A4JA 2YL9A 3B0VC 4LVBA 4RXFA 4HP5A 2ZE3A 3LU2A 1E0TA 4WRHA 4F0MA 3QOKA 4GUFA 1Z48A 2Q09A 5CPOA 1LL6A 3POHA 3TAOA 1I4NA 2DH3A 3AU2A 1TPUA 5BNKA 4YTSA 1FXPA 1Z3NA 1H5VA 4EIVA 1SW3A 3U4AA 2QJGA 3NL5A 4R7OA 5IBXC 1TRIA 3ZFHA 3PTQA 3K8MA 4XSMA 4B9YA 2WC3A 3MV11 1IXQA 4M7SA 2WBGA 3OLEA 2NUYA 1ME7A 1ADOA 4Y9OA 4JBRA 2F61A 5C9RA 2I56A 2DT3A 2HK1A 2YLAA 2OZTA 3WDRA 3QW3A 4GUHA 4JTDA 1JUKA 3NQ2A 3GX9A 3OQ8A 1NF0A 1TJ1A 4ORIA 3QHOA 5BRPA 2ZA3A 2OJPA 1IXOA 3ALGA 5ECUA 3A13A 1H1NA 1UC4A 3RILA 3VGDA 4UFMA 1SU5A 4S38A 4YCOA 1C8YA 3GC4A 2B7OA 3W74A 3VFLA 5CKSA 4FOJA 1W1B1 1Q6EA 4S1FA 5DT5A 1CWYA 5T8GA 4XD5A 1L2UA 1O60A 4IL0A 1UZ1A 3AICA 2FH6A 5AC7A 1VS1A 3NNTA 4IIHA 3A24A 2WWCA 5KITA 3P3BA 1AW1A 3N17A 1YMYA 1Q6CA 2V3GA 1FH8A 3PBUA 3NQVA 2ZZ2A 4J3ZA 4WKAA 1OGSA 5H8PA 4A22A 3ZVIA 1SMDA 4LY8A 4R85A 7REQA 1BYDA 4PMOA 1UROA 4HNNA 1DWAM 4YHEA 1FWNA 1ZAIA 4H7ZA 1HGYA 1RLCL 1UBSA 2RDTA 4QP0A 1TFVA 4Y8EA 4AD3A 2D2HA 1ITUA 2GWNA 3BAKA 1N55A 2DZTA 2J62A 2VXNA 3LXAA 3M4HA 5I3FA 4KW2A 4J5NA 3KHJA 5C9ZA 2E1DA 1POKA 1W3IA 1KCXA 3RJYA 3R13A 2QPXA 1H41A 3WF4A 4K38A 5BXTA 3HPSA 4OHQA 1T99A 5AHEA 1GVIA 3KBSA 4E8GA 4Q6XA 3HZ3A 1A5LC 5L9FA 1LOQA 4HN4A 3G1VA 3UYCA 2YPIA 2INEA 1UJQA 1VYPX 5BOOA 1X38A 3IANA 2XSXA 3R43A 4CNTA 1QU4A 1JI2A 3LSCA 3GTFA 2IPWA 4K7YA 3TUUA 1HKKA 2NV9A 1W3NA 5I2UA 5A2CA 3WBAA 4LEQA 3GSMA 1K77A 4PCSA 4JTQA 1JAEA 1ZU8A 4C6DA 2HS6A 1XPGA 4RV3A 2BSLA 4Q4KA 2BY0A 4NI8A 2CC0A 3EMZA 3L4YA 5H1WA 4UTWA 1KM4A 3W7RA 1TX2A 4A8NA 3TH6A 3GU9A 1D7FA 2DUZA 2DW7A 5I06A 2QDEA 1WB0A 5K2ZA 3Q94A 2Y70A 4OJYA 3EB4A 1Z32X 5A6LA 4CN6A 1JXJA 1B0IA 2J7DA 1YDNA 4NL1A 1DJHA 3UNDA 2HE8A 2QGHA 5J04A 2WVVA 1VB9A 1XH1A 2ZADA 4ZTYA 4S2BA 4H6EA 1F9CA 3O2LA 3WBEA 4KWSA 2YDRA 3EWXA 4GBUA 4FMVA 3FGCA 4D6EA 2GJRA 4C1NA 2OO6A 3TU9A 2VO5A 3NO1A 1JYXA 2PWDA 4GYPA 4IIBA 4AZBA 4I6KA 5DFAA 2NLIA 1WZKA 3NVTA 1A4LA 4HNCA 1TIWA 4Z0SA 1OX4B 3DOPA 4DYJA 3ZLFA 5B80A 4NIRA 1S2AA 3OGRA 2F2KA 4LYPA 1VFSA 3HPZA 3BG9A 3GY1A 4LWWA 2QF8A 4HVXA 1J0HA 2J7BA 2WSPA 3L0KA 1QHZA 3WKZA 3MWAA 3ENLA 3PWAA 1V03A 3PM6A 4MVAA 5A95A 1DJYA 3M7SA 2DEPA 1UD5A 4HGXA 2V68A 2QCDB 3KTCA 4CD7A 2ZZ6A 3G1DA 1FVPA 1JPKA 1OG0A 3VGFA 2ASHA 1JCJA 5EFDA 1KFCA 5TBOA 4GFSA 4O1BA 4M7TA 4ILSA 1Z7AA 2B81A 3QY8A 2BS9A 5CZJA 1JZ3A 1KRCC 4LF1A 3GNXA 1NIUA 4PCTA 3KUMA 2QHAA 3I3BA 3RUBL 3MT1A 2G97A 1QNRA 1QW9A 1KGXA 2P53A 3O6DA 4LS0A 3V3WA 1XYMA 4PZVA 3LI0A 3IIXA 2HJPA 5HWNA 4UWMA 1UC5A 1Y5XA 3VNMA 3RN6A 3LDVA 2V82A 1DTNA 5EYWA 3H6OA 2XM2A 3R89A 4FXRA 3M0MA 3KWSA 1REQA 8XIAA 4PRWA 4DIAA 4DLMA 2Y4SA 1VFMA 3CHCA 1XGEA 3VD3A 1Q13A 4IFKB 1ZRQA 4K8GA 1EPXA 2A2IA 4GACA 4ZO8A 3S46A 1SMAA 2SFPA 2HQAA 1VAHA 3TW7A 5LNSA 1JYVA 2VGFA 1IZJA 4GI9A 4IT1A 1BG4A 3LMYA 4TVDA 3C86A 5KTLA 4K3ZA 1VFFA 1XV8A 3K8KA 5BMXA 2HWGA 1CXHA 3GAKA 3FSTA 2J7FA 3TTYA 2PDMA 1Z42A 4LANA 1CIUA 2W6RA 4KIRA 3WLLA 4BQ3A 3LGGA 2Z1BA 1J11A 1TO3A 1O95A 2UV8G 1VENA 2FVMA 3BH4A 3DFYA 4IMFA 1HP4A 4UTJA 3U7BA 2WWDA 3IJ6A 2OYKA 1OHLA 1VEOA 3MJYA 2ISVA 3TOYA 2EPLX 4WJ8A 2E6FA 4QTGA 3P61A 4HOWA 2Z1XA 4IPJA 1XRFA 4DUOA 4Z1AA 4AD0A 2IKJA 4HJFA 4M6QA 2CWXA 4CCEA 1NSJA 4E0CA 3WENA 4I90A 3CEPA 5ENLA 2OZ0A 2V2CA 3IUDA 4RDZA 3WLRA 3B03A 2FQIA 4DWSD 4US6A 1Q6GA 3UVAA 3CO4A 4KS0A 1OIFA 3QY7A 3REQA 2E9MA 4N9BA 3VIOA 2ICSA 5B7ZA 3MS8A 1N7KA 1FFQA 3SY1A 3NPWA 1KXTA 4UR9A 4U28A 5U7SA 2EJAA 4UTFA 1UHVA 2D0GA 5I7GA 1V02E 3L7RA 4LX4A 4AFYA 4NJGA 1QBBA 1W5PA 5K4XA 1GKQA 1BHGA 2GK1B 4ZGYA 2RDXA 3PPFA 2J74A 3F4NA 2E67A 1BTMA 2NQLA 4JN6A 1V93A 3JUGA 3SUVA 3AS1A 4Q3MA 4G7EA 2XVNA 1F61A 1GVOA 2A5HA 1JD9A 2NX1A 1UPPA 1WA3A 1RCXB 3LRLA 4AU0A 1CLVA 2GSJA 3PPHA 1W8GA 3STPA 2TPSA 3QV9A 3C61A 3HF3A 3GHRA 5JQ9A 5FF4A 4XX6A 2O92A 1G6CA 3CAVA 3T78A 4PULA 1WBJA 3BLDA 1HVXA 1RD5A 2CZDA 4I9JA 2VRKA 1YLVA 4HMCA 3VI2A 2Y88A 4PTMA 3GWQA 1KR0A 3FEQA 3R7MA 2VCCA 2OMAA 1R3QA 3B40A 1E56A 1JGIA 3NYDA 3AOFA 3U7VA 4O28A 1H51A 2VEGA 3ZM8A 1WKEA 2Q3OA 3QKEA 3GH7A 1EL3A 4EXBA 1TJRA 1UZDA 4A3QA 1Q8JA 2CLOA 3N3MA 1K6WA 1DEDA 3CUHA 2HVOA 3ATYA 3DHDA 4XIMA 3N18A 4OOZA 2PTDA 4MAZA 2E7FA 2G0WA 2QCCA 3B8UA 3VDBA 3YPIA 3E02A 1VRXA 3WLOA 2QMJA 3CUFA 3W7DA 5KMYA 4PMRA 2AQOA 5HPOA 2WNZA 3AIRA 3UR7A 3UWUA 2XH0A 3W38A 4TTGA 2DVXA 2OELA 2E3ZA 4HQVA 3R1ZA 2ZUMA 4PUJA 3SJ3A 1XQKA 3PWIA 1GVFA 3BJFA 2V8ZA 3IUHA 3WQCA 4EF8A 1DYSA 3URAA 1B5TA 3BW4A 4K2SA 1H7WA 3NQAA 2WMIB 4BHYA 1W1PA 3GXNA 1UUMA 2WSKA 1OFRA 4INFA 1PJ9A 4O8RA 2FVLA 4KCTA 2RJGA 3VOGA 4IP5A 1UMYA 3E2VA 1EP1A 2ZX7A 1JVNA 3RRAA 4FR1A 2CZVA 5CH9A 3VFCA 3M5ZA 3VUSA 4ENLA 3H53A 4NZCA 3PF3A 4LYRA 2J13A 1OCQA 3JVAA 3IJ9A 1KFEA 1Q3NA 4EPKA 2HSAA 4ERGA 4MFDA 5F2IA 4PSPA 2E09A 2G4JA 2TODA 3G1SA 1GTEA 1GVQA 2CEQA 2VOTA 1W1IE 1WDWA 3EX6A 3RF9A 3G77A 1NU5A 3TSBA 1PHQA 4GMEA 4OTKA 2GWGA 4FNUA 4E2DA 2ZE0A 2O7QA 3ARUA 1RAKA 2XSAA 1BKHA 1KLZA 2P3ZA 3G5EA 2R91A 3EKGA 4LAMA 3O6YX 1HKVA 2NWRA 3RPTA 3QSRA 5IFPA 3VINA 1FWSA 2EPOA 4MDOA 1F2JA 4Z0JA 1BAGA 3B8DA 3BAWA 3PB2A 1IT8A 4Y8FA 4AD2A 5FF0A 4IG2B 4DX3A 2YBTA 1WV2A 3W27A 3KOXA 3FJ4A 1A5KC 3CPRA 4UBPC 1PKNA 3CB8A 1KKRA 1PIFA 3J7HA 1B3ZA 4Y96A 3RPDA 1HL9A 3ZS4A 1RHCA 4JFVA 2WOQA 1RPKA 4JEJA 1MMFA 2VEMA 4XKYB 1F4HA 2EG6A 3PBWA 4DBDA 1P1MA 4GX9A 3HGJA 1ICPA 1JR1A 4IG2A 3F2CA 3PJUA 1YX1A 1IEXA 1ZJIA 5IDIA 3VMOA 2BXZA 1R6WA 3ZVHB 1D3HA 1JZ7A 1Q2RA 3QN3A 4IWWA 3B9EA 2JF7A 5D2XA 4NXKA 4YN5A 4MFEA 1HKMA 2OYMA 3TAKA 4DAIA 3ARTA 1A4MA 1LOLA 3GS6A 2Z6IA 4P7OA 3H22A 4P8XA 1GORA 1KM6A 3R4IA 4H1ZA 4AZIA 4NI3A 1Q6FA 3SUWA 2PDGA 4QIUA 2QCNA 3QEZA 5GNZA 1Q85A 4ZO6A 3ERPA 2X0HA 3W70A 1TPEA 4R9OA 1GW1A 2R1MA 1DOSA 4AMCA 3CV2A 3FOKA 1JZ6A 3IARA 4GJ1A 1US2A 3AMCA 4CQAA 2REQA 4GQ0A 1PTGA 5ABFA 4R9XA 1EJWC 1KXQA 4EAMA 2WK2A 1ZSXA 1PAMA 1ZP4A 2C7FA 5CJ5A 2GJPA 1P43A 2ADAA 4UNLA 1ENUA 3AQUA 3LHYA 3WQ6A 3CC1A 4ML4A 4ZR8A 3WQFA 2GJNA 4IHCA 1S46A 2X8RA 3UWWA 4JNMA 1TWDA 2EBNA 3BV7A 3NDZA 2FPYA 4GC3A 4BS0A 3QM3A 4DVOA 2ZC1A 4ES4A 4L9XA 4FIQA 4B2DD 3ITOA 2J24A 1EXBA 4GVGA 1E1FA 3VX0A 4PTVA 4AX7A 2Z00A 3F4CA 4A21A 3AALA 2G3JA 1KFBA 3P7YA 3W7QA 1V3MA 3PK7A 4V1XA 4RUBA 3BANA 4GD0A 2VVNA 1SUXA 4NG3A 3CIVA 2Z26A 5D8ZA 4O17A 1E6RA 4AY7A 1J79A 3IIPA 1TA3A 4PODA 1IQ8A 1R87A 5BRBA 1XYLA 3BXWA 1PKLA 3G0SA 5LIYX 5A6MA 2QVNA 1X8FA 4JR5A 5FJPA 3OYXA 3SN0A 3VDAA 3TLLA 2IKHA 1TCDA 3CZGA 1VLIA 4QS6A 3A47A 1FCVA 5LYRA 4HNUA 2P50A 5CBIA 3STCA 2QIWA 3TK7A 1FRBA 3GW0A 2Z2BA 3I3EA 1GVSA 1C8VA 5I3KA 7CGTA 1L6FA 3ZJKA 1W56A 2X7VA 4U3CA 2RKXA 2WHLA 1G9HA 3FV9A 1UP0A 1G7VA 5A2BA 5E0CA 2VDIA 2WNNA 3U5YA 2JIWA 3W7GA 3T40A 4PUKA 1HKWA 1ISVA 4B4HA 1RUSA 1QMLA 4WR3A 5KZEA 3SCUA 3BAJA 4MWAC 1SO3A 4HPNA 3RLHA 4C7FA 2E8YA 4YTQA 3KL3A 3D47A 1H60A 2QV4A 1CXEA 1LL4A 3TYCA 1P48A 1GPWA 1NFGA 2PLMA 4NVTA 4F66A 4GBDA 3BMVA 6TIMA 5I3DA 5CGQA 1GKPA 4JNYA 3UW6A 2VWSA 4JIQA 1TQXA 3PUEA 2CLKA 1SJDA 1EFZA 1T8XA 2CLIA 4GYKA 3EXTA 1K9FA 4IFRA 2JKEA 1J10A 3LHZA 2WZMA 3E9AA 1ZJBA 3EOLA 2XH2A 1W1VA 2EPMX 3NGJA 2PBOA 3KBVA 2BTMA 4PCPA 1OGBA 1ZJHA 4Q8QA 5FEZA 1LBLA 2QV5A 1XUUA 2W92A 1DQWA 3GNOA 3UPMA 1F3XA 4FNPA 5T26A 3LV5A 4A3UA 1CDGA 1CNVA 4BKNA 5BZAA 1RQBA 3N2CA 3UG8A 3M0XA 4CU7A 4RPQA 1LYXA 1DJGA 1G94A 3VGBA 3S9ZA 4R7WA 3URNA 4M82A 3GM8A 2VTFA 3GIPA 1MQQA 4NF7A 4I9AA 4V28A 3NCOA 2G3FA 3TN4A 4M8UA 2PD9A 2DJXA 3VKDA 4A6GA 4JNZA 1BGAA 2Y1HA 3CAKA 4YJ5A 4ZQRA 4WY0F 5CGMA 4AYGA 2WCGA 2E68A 3WELA 4AX6A 3SRDA 4UQEA 4J2PA 3S5YA 2YR1A 3TTQA 2WYSA 3SW6A 1XIHA 2DT1A 2PDFA 5CJMA 5KZMA 3UXAA 5KINA 1W17A 4AH7A 3E0IA 1L0PA 3M64A 1QPQA 4AIOA 2V5KA 1RH9A 3P84A 1HJWA 3LGEA 2G50A 3HGOA 1WDSA 3PPGA 1TV4A 1VYRA 4NZ1A 1VCGA 2YW3A 1JGMA 4CQ8A 2XIBA 1KC7A 3S9YA 4KIEA 4HZ8A 1R8LA 1XBZA 4C1LA 2GGIA 1MEIA 3DI1A 2X40A 4S3DA 2YW4A 5EMLA 4L9ZA 2J47A 4NUWA 2QCMA 2AKMA 2GDQA 3SQMA 1TJ2A 3M41A 3N04A 2Y8UA 4XVEA 3WQWA 3VMPA 1BSLA 2FGLA 1JYNA 2CLMA 5A6BD 2TSYA 2Y0FA 3ARVA 1FKXA 2BODX 4H01A 1XLDA 3DDMA 4ZQCA 3NURA 4KCWA 2ACSA 3L5LA 4RE4A 2CLHA 3ID7A 1F6KA 1W31A 3N13A 3QGAC 2YXXA 4PUWA 3SCRA 3TYBA 5J5DA 2C79A 3W2MA 4WK9A 5J5RA 1S2WA 3AS2A 4H83A 3VZXA 1R7AA 3EPNA 4ORMA 1R85A 2WVSA 2VEKA 3CLMA 1UZ4A 2PDYA 4XD3A 1OSEA 2R1LA 3E49A 1FWFC 1RBLA 2P1FA 3DKLA 2BOGX 3CUXA 1U83A 4LU0A 2PODA 3QPZA 3EDJA 2JFEX 3WD0A 1QHOA 5GJMA 1VJSA 4G1KA 1B3XA 1YBQA 3C56A 3RPMA 1WX0A 4N6EA 2OLAA 2ATMA 1OD0A 3W7LA 1EHAA 3BGAA 4BK9A 4L1XA 4ZSUA 1RJQA 4XAGA 5E93A 3UETA 3URQA 3U5UA 3QOMA 2RH9A 3QZEA 4IL2A 1EPVA 2PWEA 1LZOA 4AAJA 2ZXDA 3BTNA 1J0YA 4MJZA 3E12A 1TZZA 1W37A 2OFJA 5BOFA 1YADA 2O56A 1EUNA 3L21A 3V75A 3UEQA 4LUIA 2PRMA 4UR7A 1GG1A 1MW3A 1GOKA 4I8YA 3OVGA 4YMZA 3RRXA 3CYVA 1QCWA 3W71A 4B91A 2FPTA 3PP7A 2BVDA 4IMCA 3GNPA 1UMLA 4JQ4A 5SWUA 4IQJA 3POCA 4OOUA 2VD8A 5IDZA 5FD0A 3NIYA 4LCSA 1ADDA 1FWEC 3VAVA 4UTTA 3TZFA 1XP3A 2YDAA 1LORA 2WC4A 4WGHA 1NQ6A 1OABA 1O7AA 4JEQA 1V3JA 2PLJA 2Z4GA 4MUPA 4MB3A 2QR6A 2WMJA 4JFWA 3F4DA 2OKOA 4ZQMA 2VCAA 3TC7A 4HOXA 4K7VA 4P8VA 3ITVA 1QHPA 2F84A 4MNKA 2ZDSA 4S3AA 1CEOA 3QW4B 4AZ5A 1J96A 1SQ7A 3BQ6A 2PDUA 1JNDA 3HGRA 1Q6OA 3N9RA 3QYQA 3CQHA 2XGBA 1W9BM 4HSHA 1X97A 2VHLA 4JYEA 1LDCA 2TRSA 4RW5A 1MW0A 4FHAA 2WM0A 1FY6A 3WD2A 1QJWA 3W22A 4KFPA 1FBAA 3RLVA 3IVUA 1HQTA 4EOUA 3BG3A 1RK6A 1U5JA 2F6KA 1XYAA 5AVNA 1EBGA 1ESWA 3TJ4A 1UB3A 3A3HA 2ALRA 3HN3A 2VX7A 2I1OA 5ABFB 5KETA 1LLWA 1VF8A 3WMSA 3I6RA 3S6DA 5CLTA 3WLKX 4LV9A 3JZUA 4H6QA 1D2KA 3PJTA 1QNOA 3G6LA 3B04A 4KGLA 4AIEA 1O12A 4A3HA 4JL2A 1J2BA 4Q4SA 3UZXA 2NQ9A 1R0MA 4ZODA 2ZRZA 4JIIX 4MNMA 2Y61A 3UXDA 1D3GA 2CESA 4ATWA 1MW2A 3V5FA 3SURA 4TOQA 4DM2A 3DUGA 3W25A 3G1RA 1DL3A 1L6WA 1CX9A 1YYAA 4HZMA 3QQ1A 1AMYA 3FJLA 1Q63A 4DYEA 3LV6A 1YE4A 4OVXA 2J7EA 1E9LA 3TYZA 5FL1A 5LNRA 2VVSA 2WM1A 1E0UA 4HYRA 4J3WA 4UTLA 2VP8A 4ADSA 1KLYA 3EWZA 1NELA 1F8IA 2ZC8A 4CD8A 1ONRA 1OM0A 1M6JA 2BASA 1VEMA 1P6CA 3W37A 2NX9A 3L2IA 5C2XA 1V02A 3HO8A 4AZHA 1JDDA 3LENA 4C6OA 1ZBKA 2XDFA 3NL3A 4FNQA 4X2PA 4C6MA 3P81A 4KBXA 1NDYA 4BA0A 1Q4WA 2PWUA 4Z08A 5MKGB 1UKSA 2FIQA 3OZPA 5CBJA 1EC9A 3H23A 1S3HA 2E28A 2WNWA 4RE3A 3BJTA 3N19B 3CQJA 4NZFA 3QF0A 4JTTA 4JYDA 3VNIA 1VJIA 3VDHA 3DHFA 3T2OA 4PTDA 3W6LA 1B4KA 3UY7A 4O10A 1Q8AA 1XBVA 3FJ6A 4JS3A 5DMNA 3FXGA 4FXSA 4AVFA 5IXEA 2PAJA 2QAFA 1VH7A 4DJDC 2QUVA 1PCKA 3PY2A 3UD6A 5CZTA 1QPKA 1PYFA 2IKIA 2PGEA 2VC5A 1ONXA 3UXLA 4DI9A 1R9XA 4MWAD 1X6LA 8CGTA 3HQNA 2CHOA 1JYWA 2EEXA 1UH2A 1TIMA 1F3EA 2GUUA 3S1XA 1E0WA 1R3RA 3KDOA 3NSXA 1TV2A 1QBAA 2W67A 4OQVA 4ACZB 3OG3A 5JUVA 2QGYA 4H9MA 5FI8A 1DXIA 2YL6A 4XAFA 1VD6A 3W1LA 1IHIA 1GQIA 4HMEA 4O1FA 2WMIA 4LRTA 4GA8A 5E09A 4MZ8A 2FMOA 2QXWA 1R3YA 2G5WA 5BW6A 2ZQ0A 3W85A 5LA0A 1FWBC 4P61A 1H2JA 1W1ZA 2CZ5A 2YB1A 4PBFA 4LAOA 4TX9A 3VNLA 4W7VA 3QH2A 4ZCWA 4N02A 1ISYA 2FZ8A 2VGIA 5HA7A 1GCYA 3DHUA 2GVYA 1UD3A 3IUIA 4K37A 2A3CA 3R94A 1A5UA 2G41A 4WF7A 4W86A 1W9XA 3GYEA 4EANA 1KKOA 3UA4A 1UH4A 4Q4RA 2Q02A 3KCOA 1PYMA 1BLIA 4NHVA 2ZTJA 1FA2A 3L5AA 1BKSA 3O7UA 4P8WA 4XO7A 6TAAA 3V4BA 5MF5A 3EXSA 2PDJA 3HMCA 1WP6A 3TYDA 4BF7A 4PEEA 2VRJA 3F5KA 1M7JA 4L6OA 2V2HA 4L4LA 4X63A 4ASTA 3MSDA 1W5OA 4I8DA 1NAL1 4XG1A 3V18A 1EZ2A 1DHPA 1VRDA 1E72M 2GVEA 2VEIA 3NOYA 1RVGA 3KLLA 3M46A 1I2QA 3VGHA 4JGDA 3V0TA 1ZPTA 3AYVA 5BYWA 1X96A 3AMGA 1HTIA 1RP9A 2Y6ZA 4I5XA 3TR2A 4DQWA 1MSSA 5EFFA 1Q6DA 2H8XA 4CQ9A 3VTRA 6REQA 1W9VA 4TQTA 3NGFA 2PC8A 1UWRA 2Y2WA 4LS2A 2DZUA 3NG3A 2VRQA 1F3WA 3NQDA 2Z25A 3CM4A 5IRPA 3R8HA 3VABA 2QNEA 4PFHA 4L64A 4QSFA 2DH2A 5C9UA 1YW1A 2D2JA 1IR1A 1ZP3A 3N9KA 1GOQA 5CC5A 1LTDA 1HT6A 1HIZA 4RPPA 2Y7GA 4GKTA 4UZUA 4H8UA 3RCMA 1X7IA 4WX2A 1O94A 1UASA 3KOFA 3WEZA 5HATA 3CNYA 3VU2A 2V3EA 5GNYA 4JFUA 1SVDA 1YNYA 2PDHA 2HVMA 1W2PA 1UJPA 3TFXA 1XWYA 2D2OA 1VIZA 4C5ZA 3UERA 4YYCA 1GW9A 1GJPA 4M1BA 1KTNA 5DY3A 1A3WA 5I00A 1E6ZA 4MUZA 1HVQA 4HK5A 3L65A 3FHQA 1QVBA 2PGWA 2D20A 3CAWA 5JIPA 2NXIA 3TTSA 4UTHA 1JNEA 4MAVA 1TQJA 3ONBA 5HXMA 1W5NA 1T0OA 1GQLA 1J5SA 2Z1WA 3RK8A 2BVWA 3IGXA 5K4ZA 3DU0A 4RKAA 4LBSA 3SM0A 3LLXA 1UP3A 4NU7A 1AH4A 1EKOA 1XL9A 4DF0A 3H8AA 3WSUA 4JHOA 4LNCA 1R3VA 4PUEA 3GR7A 5CEWA 1CTNA 4FOKA 3CZEA 1YTDA 3IACA 3GW3A 3T55A 4WY0A 3WD4A 1NVMA 3TMLA 3TQ0A 2EG8A 3ATZA 4QXIA 1H49A 4B5WA 1ZTVA 4BQ4A 4HNTA 3BSHA 5EMKA 4EXQA 5IM51 1ADSA 1GGOA 4PMZA 3BLEA 4CEUC 1W32A 4QE1A 2INZA 2PWHA 3K8LA 2EG7A 4MPKA 4QNEA 1RR2A 2J6XA 3TTOA 2ABBA 1E6XM 3AHZA 5LKYA 1GWJA 1QK2A 4QCEA 2R6OA 4U5KA 5CPSA 4DBSA 3BK0A 4Q22A 2GVJA 1S5WA 3B9NA 3AMKA 1EO7A 1E43A 5AVHA 3RCNA 3MTWA 1MNZA 4U31A 2D22A 4MDPA 4HHLA 1VBHA 1XS2A 4A35A 2P3EA 3VUPA 1ODZA 5HR6A 3VYLA 2V6AA 1OFDA 3H7RA 3G2GA 4MWAE 4IFKA 3UR8A 1BYAA 3IJQA 1FOBA 3LNMA 3H26A 4GJIA 3WLSA 5XIAA 1E71M 3PBMA 2YA2A 3W2LA 3WK0A 4GGHA 3VD7A 1EJSC 3LHWA 1GPFA 2C0HA 5HUPA 4LV4A 1RCQA 5C2GA 4JTKA 2X09A 4N9DA 5D9NA 1RQHA 1A5AA 1EYWA 3TP4A 3ITTA 5DBTA 1M7OA 4ZZ9A 2OO0A 5AC4A 2J9YA 2J7GA 1FXQA 4C6NA 4AIBA 1AG1O 1HN1A 1DQXA 3EMQA 4O54A 2DJLA 3QTPA 3CV6A 4HJWA 2BMBA 4I9MA 5LIWX 3DXIA 4XD6A 1Y8BA 1KGWA 4EP8C 3GVVA 4R34A 4C6IA 3SIZA 3F4WA 2EKGA 4NJIA 4WQ6A 3STEA 3EBVA 4MG4A 2JEPA 5A5WA 1ZAJA 4TX8A 1GZJA 1M04A 3DFHA 1OT2A 3SCTA 1TVNA 2VJXA 1ZL1A 2C71A 3LK6A 3WBYA 1UCWA 4V33A 5FJRA 4DWSB 4R5EA 1OEPA 2O55A 4E4PA 4CVUA 5JU6A 3DGRA 4O1DA 1TTIA 1LBFA 3SIMA 3NQEA 5K9CA 3SRFA 8RUCA 2ZUVA 1H7OA 2TAAA 5FACA 3CHVA 3BCFA 1EEPA 2V30A 1K8XA 2DPEA 4QLKA 1WQ5A 4CQBA 2WMGA 1HJVA 1EGZA 4KH2A 4QG9A 3FVMA 3UR5A 3TYEA 4FXJA 3ZWTA 1VZWA 4H8VA 2GZXA 3USBA 1UA7A 5I5RA 4PA8A 1I6NA 1SZRA 1B30A 3U8GA 2G8ZA 4DYKA 2J9ZA 5AKQA 1VR6A 1LJYA 5EPDA 1E4IA 5D38A 1KFKA 4PRTA 4E4UA 3RO6A 1VHCA 1DE5A 5HWMA 5A6BA 4WDUA 2XVLA 4AF0A 4IJCA 1EX1A 1TE6A 4C65A 3H55A 3GAYA 2I17A 1KFJA 1QPRA 3SSJA 1OYBA 1O6IA 3AYTA 1FFRA 1XRTA 3W29A 2ZRUA 3VD5A 3ANYA 1JD7A 1X1NA 1UUOA 2GQ9A 3MVTA 4NZ4A 3UU0A 3ZJ8A 4G2DA 2Y7EA 5TQLA 2E40A 3VKJA 4M29A 4J4KA 3FYOA 4ZOCA 2Q8XA 4F0HA 3GKAA 5ABHA 1FHVA 2IXVA 3UPBA 3UYIA 1KBBA 3EA2A 4GVFA 3LHVA 1EJRC 2GJLA 5E5CA 3ZR4A 1PX4A 3KEHA 2B4GA 4AUBA 3NPUA 2ZX9A 2YCIX 2QUMA 4JZ5A 3CTLA 4C90A 4W4QA 3N73A 3W7NA 3UA3A 3G1AA 1T6MA 3NQMA 4QITA 5AECA 4CKQA 2YKKA 2RAGA 1QNVA 2ZDRA 2PF0A 4WDWA 3OGSA 1UIPA 2Z1VA 3I6EA 3TQKA 4HTYA 3W83A 3IVSA 3NQBA 3UJFA 4H3DA 3VIPA 3AXIA 4CNPA 3QTGA 4GIYA 3O16A 4DO6A 3MZNA 2XUCA 2E0PA 1GZGA 1DV7A 3NZQA 2E5CA 1ISZA 3RU8X 4AHOA 4TVCA 3QQ0A 4BQ5A 2E77A 4LB3A 4TUFA 4C6KA 3GK0A 3MI6A 2WHKA 4ZB0A 1AH3A 3PZVA 4XZIA 4MLRA 3IV3A 3WQEA 4GQQA 4HB7A 2A3BA 3ZYZA 5D2WA 3U48A 3RU6A 3GHTA 3M47A 1JF5A 3M5YA 3OODA 4EWND 3AJ7A 3LXCA 4DJDD 4DI8A 4D8AA 4D8LA 1DIEA 1I60A 5AFDA 2ZRVA 1PBGA 2A6NA 1NP0A 4UFKA 2O9OA 4WOZA 2I57A 3INPA 3BICA 3I65A 5HQEA 3CIXA 2WQDA 1J5TA 3WNLA 4WDXA 3QJAA 3A4XA 4CN1A 3OIHA 1GYMA 1EYEA 1VPXA 3C2EA 1EWEA 1N8IA 3QGKC 3PUOA 2QW5A 3B97A 2JIEA 1F05A 2ZZ1A 1VFTA 3WUFA 4DLFA 4HCHA 1VBGA 1Y7VA 4C1NB 4AW7A 1DWJM 3TLQA 2NT1A 3BC9A 3GXPA 1W9UA 3EB3A 1TPC1 5LA2A 2NX3A 2DSZA 2YDQA 4PBEA 3KBWA 1OFQA 3TJXA 1S2CA 4M5PA 4GYJA 1EDGA 5FJIA 3DFOA 3GLCA 4HPGA 1KWGA 3P8IA 3XINA 3CPGA 4DN1A 3NSNA 2QCLA 5E9AA 1Y5WA 3CT2A 2NVCA 1DE6A 4FLRA 3QHNA 4X9YA 3S2JA 1R2RA 4WZHA 4MHBA 3KXQA 1OBAA 2QDHA 3W1QA 1FP8A 4QE5A 3LPGA 4NY2A 4DY1A 1CENA 1DP0A 1CGTA 4GG9A 3FCPA 3DFTA 1JDFA 4GQRA 3WUGA 1A3XA 2OT0A 3RLGA 4JYFA 4DJDA 3IAPA 3R5EA 1GQNA 1XH0A 1KM0A 1RD6A 1QOXA 3RHGA 3LHTA 5ECVA 4CN4A 4AHPA 5EU9A 5LIUX 3E1F1 3H4XA 2GLKA 3FA3A 3PUGA 1XDJA 6CGTA 3THCA 4CNUA 3MUIA 3OW1A 2BGQA 4UUIA 2XIMA 3VCRA 4QHRA 4UIOA 1R5YA 1AFSA 4P5UA 3S5ZA 4FXFA 2ZWZA 3WH8A 2OCZA 1ONWA 3R12A 4KWVA 4Q4MA 3VNKA 1KRBC 3UXKA 2FPVA 3VM5A 4RZ4A 4H4IA 3JW7A 1MFUA 4K68A 3C0QA 1YEYA 3GDRA 3Q67A 2J79A 3E38A 3A4WA 1H09A 1NJJA 1EO5A 1XLCA 1UD6A 1LP6A 1OK4A 3ZVHA 3LBCA 3EWBX 2CW6A 1VGAA 5IHRA 3S1GA 5F1UA 1A5MC 2VZUA 1GEQA 3WJSA 6XIAA 3UJRA 4JTGA 3P6LA 2OQHA 4DZIA 4H7CA 3LHUA 2X0SA 3VGEA 5DRIA 1UWIA 3P67A 2R14A 4WGXA 5HMEA 2Q6ZA 2Q3RA 3B0XA 4UQBA 3DYPA 2R1NA 1CPUA 3FEMA 1QUMA 4MSSA 1V3LA 1J93A 2DSVA 2KX9A 4M6UA 3RMJA 4P7NA 2DZWA 4M51A 1VLWA 4ROPA 3W3OA 1ISWA 2QJHA 1PWLA 1UQYA 3NWRA 2PDXA 4GWEA 5F1VA 3GTHA 3KE0A 1VP5A 1V8EA 1ZZMA 3WL1A 4UQAA 4N6FA 1BRLA 4LAUA 1J6PA 3UWVA 1XIGA 1YXDA 4JTJA 3FFSA 4TV5A 4UC5A 1TWZA 3QMRA 2CWNA 1K8ZA 3CQKA 4UR8A 2ZTKA 2GDUA 1EJ7L 1XYCA 1W6TA 4GKLA 4C6PA 3A21A 3AWNA 2ZXAA 4HSOA 4DBWA 4S3JA 4LEFA 4US5D 1XLMA 3V0SA 1YTKA 4HHPA 5D9PA 4IMAA 4MIMA 2ZZ3A 1OB0A 3PNUA 5CLWA 1OFEA 4HMNA 1C91A 2QS8A 2X1UA 3LPFA 3MBFA 2J8FA 5I78A 3MUZ1 4Z2KA 1F74A 1BVNP 5CC6A 1V3IA 3NOEA 4PMYA 1W5QA 3N4FA 2W9MA 3LB0A 1HO4A 5A6TC 3MCNA 3BZJA 2Y5EA 2J4GA 1UZHA 2VNCA 1SFLA 4J28A 4JIEA 1IWAA 1NY1A 3EOOA 4BZYA 4PE8A 3N2OA 3CAQA 4JX4A 3E2RA 3E74A 1P7TB 4GQBA 3K4WA 5A2AA 4V1YA 2W79A 5HJYA 3QV6A 1WBHA 2WHJA 9CGTA 1GOIA 1UKQA 1JF6A 1G4SA 1P1XA 3M5XA 2UZ9A 3H2EA 5EMMA 5JMUA 4AMAA 4C91A 3N25A 3I10A 3EEZA 4W93A 1BVWA 2WSYA 2E5DA 3HM7A 4K1GA 3V36A 3FAXA 4IXHA 2I14A 3OZMA 4DJFD 2FKPA 4LB4A 3JZEA 3EOUA 2BY1A 5DELA 2QIIA 4CU6A 4KGJA 1XLAA 1M7PA 4LT9A 1JCLA 1JG9A 1GYNA 2V3DA 5FJUA 3LBOA 2G4FA 3MANA 1NOUA 3WJXA 1FH9A 3FKRA 5HWJA 2VX4A 4UQCA 1EWDA 1A80A 1C9WA 3GDLA 2AGTA 1UQZA 4TMBA 2AL2A 4I7UA 1AL7A 1TTJA 1P4CA 3HG2A 5A8QA 2WZIA 1RALA 3QKZA 2VWTA 3AI0A 1YRRA 3M0JA 2YFNA 4B3LA 2HTMA 3NVDA 3G8EA 2X41A 4JQ1A 4Y9PA 4GNKB 1FWDC 4ZE4A 3RLUA 1XM3A 3V1PA 2HNEA 3LNPA 1O1HA 1FWGC 5E6YA 5F4XA 4B2DA 3CL7A 1TPDA 1OCNA 3TC3A 2OEMA 4EF9A 2BBFA 1UYQA 4C6BA 1VJZA 1XISA 2C19A 4ADUA 3PBVA 1UPMB 1M03A 1OFBA 3GE7A 1DIKA 2ZZ4A 3W87A 1B9ZA 1E9IA 1A5BA 2YDSA 1H0IA 3TQPA 2VL4A 3NZ1A 4AEFA 1KTBA 2OOGA 3ONCA 4JKKA 4ZQPA 3ARQA 2G96A 4NJKA 1HFBA 2X0YA 1QATA 4HK7A 4AVOA 1LWHA 4QG6A 4S3KA 2Z7GA 3S9IA 1EB3A 3VILA 1TR9A 2Y63A 4XUGA 4AIUA 3FIGA 2A3HA 1V79A 3PZMA 2CBJA 1LBMA 1VFLA 2W3ZA 4R88A 4DWSC 4CGTA 2WV8A 1QOQA 2WZEA 4D71A 3HQPA 4I5UA 4DXVA 4NRRA 5FEPA 5CPNA 4W88A 3UJEA 2AGKA 3IWPA 4X0NA 4FNTA 3B8WA 4HU8A 5CSYA 2XSBA 2QYGA 3D46A 4E8DA 3UESA 4ZQOA 5A6JA 1MW1A 1GTHA 5TAOA 4OWGA 1OCBA 3L23A 3VC6A 5C54A 3H2FA 2GVGA 4FF5A 1P0BA 3ABSA 4IZGA 2BV9A 4F9JA 4IISA 4ZL1A 5E70A 2QQ6A 1AODA 1XH2A 4DUVA 1E6NA 4G5DA 2ATSA 2CIPA 5D04C 3HFYA 1ZQ5A 1XYBA 3AS0A 5DCBA 2B7NA 2PBGA 1L6SA 5A94A 3O63A 3ARPA 3FK4A 1KM5A 4GISA 4V27A 1V5XA 3OBAA 4PGLA 4GJJA 4PUMA 3PUDA 3LLDA 2MNRA 1OWQA 2VC7A 3CQIA 2JKAA 2EXOA 5C7HA 5I23A 2V2DA 4DJFC 2HS8A 1X7FA 3GKFA 3OGVA 1OYCA 1DWGM 3B4YA 1ITCA 1UR0A 3WQ4A 3FN9A 5AB3A 3N34A 4FPSA 1S5NA 1HJSA 1HUVA 1UIOA 2NLYA 4X2RA 3RM8A 3QC0A 1F5ZA 3C5QA 1JPIA 4I7VA 2CKRA 5HQMA 4AWUA 1FQ0A 1AQHA 3NPVA 5D9MA 5LNUA 2Q71A 4DXKA 2GGGA 4HCLA 1OD8A 2QCHA 1V0MA 4XISA 3LCXA 4A8IA 5FSEC 3DENA 2EO7A 4GX8A 4E4FA 1M01A 1TTPA 4QQ3A 2XIIA 3O05A 4J3VA 4W5ZA 3I6TA 4ACZA 3GBEA 3G3MA 1OINA 4AZCB 3PZOA 1IIGA 1TELA 2XFWA 3VD9A 1EF2A 2XIQA 2XZ9A 5DLCA 1E6QM 3GHSA 3SCNA 1E73M 4TMCA 1BFNA 5E0FA 5I6SA 1ICQA 2ZZ5A 3OP2A 4JFTA 3AISA 2YLLA 5GPRA 3NQ8A 2E9BA 4JN7A 3NQCA 3BVJA 2F38A 4HBKA 1QI3A 2R82A 2YB4A 2VZOA 2P76A 1XLEA 3B9DA 3M16A 5FAGA 1CB2A 1XBXA 2BZNA 4JTEA 1EJTC 1B57A 4ZE5A 4YTRA 4N2YA 5AOUA 4KWWA 1M7XA 4RNFA 3LTYA 1H62A 3OZOA 1AD4A 5I77A 1QNPA 4Y6GA 2BHYA 1J4EA 2DP3A 3EDDA 1Z69A 4REQB 5DRCA 2CHNA 2NVAA 1F07A 2J25A 1W9DM 1NOWA 4ZMGA 2VUYA 3UPWA 2C0AA 5G4HC 1XCWA 3ICJA 1E0VA 2MANA 4F3HA 4JL1A 1BTCA 2Z1SA 3QFEA 1TV7A 1B3OA 1GT8A 3CL6A 3MPGA 2XWDA 2FJKA 5G2HA 3HQOA 2NW0A 4US5A 4F0LA 1IGSA 2VQTA 5BROA 2YZRA 4O12A 1W3KA 5HULA 3UJ2A 4QQUA 3T7VA 1PZ1A 4PYSA 1QI5A 4PN2A 3QRHA 5A1AA 1BYCA 4MYAA 1S5MA 2CYGA 2QDGA 3MP3A 1L2QA 1SGJA 2JGYA 2XINA 1BVZA 1KM3A 3WQ8A 4GUIA 1XSKA 2VKZG 4F0SA 4LCQA 4H9UA 5F7UA 3CHDA 2P88A 2PMQA 1O1ZA 2Z1KA 2WVUA 3G0UA 4K1WA 1ZALA 1AVAA 1SW0A 4GIRA 1EXPA 3O0KA 3PZTA 1CI1A 2ZA1A 1AW2A 3VNYA 1K9TA 3USZA 3PC0A 2ZUNA 9XIMA 5LHFA 4CNNA 1NF7A 4DO4A 4D6CA 3IPWA 5G1MA 3SCSA 1B54A 1LQ2A 7TIMA 1K03A 3GU2A 4IPPA 4UOJA 1T96A 2GPTA 3W2JA 2ZYFA 1J8VA 1JDAA 2PB1A 1PV8A 3CTTA 2QJMA 1XW8A 1HJQA 3Q4DA 1C8XA 2XISA 3W7PA 1ECEA 3TWAA 3JS3A 2JKPA 4RNHA 5AZ1A 4Q8VA 1R2SA 1KBIA 3S2MA 4B5SA 3FA5A 4Z1CA 4ZTXA 1FTXA 3R79A 1UW9A 3HPAA 3OG2A 4JAWA 3NAVA 1FX6A 4NNAA 4RLIA 2YA0A 2WW5A 4KKXA 3DN5A 1LT8A 3HB9A 4L65A 2Z2AA 4OIFA 5RUBA 5DX7A 2ZRWA 2C16A 3VKAA 3VOHA 3TXZA 3HPXA 2GUBA 5AYYA 3O07A 3K4DA 4H6RA 2GGEA 3MSRA 3WH6A 2PS2A 3UCCA 4OBSA 4XSLA 5G1TA 3OB8A 1QNQA 1A5CA 4NYYA 3LCLA 4AD4A 2YFOA