1PPIA

The active center of a mammalian alpha-amylase. the structure of the complex of a pancreatic alpha-amylase with a carbohydrate inhibitor refined to 2.2 angstroms resolution
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title The active center of a mammalian alpha-amylase. Structure of the complex of a pancreatic alpha-amylase with a carbohydrate inhibitor refined to 2.2-A resolution.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase (o-glycosyl)
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1994-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ppiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ppiA01
1V02E 1B0IA 3AS0A 2ZUVA 3N18A 4NZFA 3MMWA 2V3GA 2DPEA 2G8ZA 1H5VA 3H54A 2WHKA 2PBGA 2DIJA 1HXKA 3W0KA 1MW3A 4GKLA 2WLZA 2VZVA 1PS3A 4ACZB 2CBIA 1H11A 1Z32X 4PMNA 2ZICA 1JF5A 2X0HA 1JF6A 1TG7A 3MUY1 5BCAA 2CBJA 3OIHA 4CD5A 3OBAA 5LA2A 3BCDA 1KQZA 4OOZA 3THDA 1PZ3A 2UY3A 4W93A 1W2VA 2GJXB 4GQRA 5E9AA 4Z2GA 1UZ4A 2PWEA 3BUQA 1WB0A 1HJVA 3T2QA 3WENA 2PWFA 2XVNA 4KH2A 2F18A 1E4NA 1K6AA 5I0DA 1BGAA 1WCGA 1TCMA 2ZXQA 3PZOA 1H09A 2Y8VA 3RPMA 1TVPA 4HU0A 4B3KA 2WVUA 1VFUA 3VO0A 3EJSA 1LQ0A 3KE0A 1IZJA 1SMAA 4BA0A 5A6MA 1VAHA 2XFFA 3PZIA 4A4AA 4J28A 1LG2A 1B31A 4U2ZA 1B3ZA 1E1EA 2D0FA 2ZIDA 1W9XA 1QW8A 5CLWA 3LRKA 3AZRA 3T0BA 3WBAA 3WDRA 5BRPA 1LL4A 4D6IA 2YA2A 1OCQA 2X05A 2ZX5A 3CZKA 4J3UA 1DWIM 1UWSA 1QNSA 4F79A 1GOMA 4V2XA 4OIFA 4JIEA 3BMVA 3II1A 2PC8A 2YL6A 4D72A 4TVCA 1CGVA 3SCWA 1E5NA 1K9DA 3WNNA 3FHQA 2QF8A 2YL8A 2ZWZA 2G3NA 1BF2A 4W8BA 1PAMA 1QI0A 1EH9A 3QHNA 1RP9A 3AYRA 4PTVA 1W9VA 4C7DA 8A3HA 3D51A 4ATWA 2BY2A 1KBBA 1RD6A 1SMDA 2WKLA 3WQWA 1AVAA 3GXDA 7CGTA 3RM4A 3QR3A 1MFVA 1J11A 3OA5A 1BYBA 4TTUA 5A1AA 3PHAA 2O9RA 3N17A 1JIBA 1R7OA 1AQHA 2EAEA 2GDUA 3A3HA 1QHOA 5D9NA 2YKKA 3WL1A 1XH1A 2YIHA 3NDZA 3VNZA 3VSVA 1B3XA 3W38A 3VDHA 4UFKA 4KWUA 2XIIA 1TFVA 1W3LA 2C7FA 2Z1SA 3BSHA 3VGBA 3QOMA 3WNLA 3FY1A 1GJUA 4P7NA 2XJ7A 5C71A 2OW7A 1V3KA 4AZCB 4AYGA 2ZXBA 2X0YA 1KR1A 2VR5A 5HPOA 1E4IA 4NRSA 2VOTA 2OLHA 4M56A 3AIWA 2F1AA 2CXGA 1OGSA 5GNZA 5BXSA 1JYXA 2A3EA 3AXIA 2UY5A 1HWWA 5JIWA 2VO5A 1J01A 1JZ8A 3WQVA 1B9ZA 4MAVA 3MMDA 1GVYA 2ZX7A 1VBRA 1R7AA 3K46A 3BVVA 1EHNA 4GO8A 4KGJA 3VIOA 1HJUA 2OSYA 1Q6DA 2PI6A 4E4PA 3SCVA 1BPLB 1JDAA 3LX9A 4Y7EA 1RPKA 3VDCA 2VTFA 1DWAM 1YQ2A 2CIPA 3CZEA 1BGGA 3H53A 2F1BA 1CNVA 3DECA 3VIPA 2QLYA 3UG5A 2G41A 1K9TA 4WKAA 5CQ1A 4DO5A 4M24A 3WUGA 5C70A 1OT1A 1LLOA 1X6LA 4M80A 4OBRA 4DUWA 3CZGA 2EPOA 2X2YA 1KWKA 1ITXA 1UR9A 3ZO9A 4OOUA 1CWYA 2A3BA 4AD5A 1TVNA 1HTYA 3M7SA 2XIBA 4HOZA 3ARWA 3OLDA 1WP6A 1UR8A 1XC6A 2WVVB 4WIWA 2VC9A 4N0RA 3DHUA 3EJTA 5CPSA 1K9FA 3A4WA 5HOSA 5D8WA 2FGZA 1QI2A 4Q22A 4AZHA 1R33A 5D9OA 2BXYA 4V28A 3TA9A 1E6NA 4AY1A 2ZUWA 1TR1A 3POCA 4H04A 3UERA 2DIEA 2E9MA 3T2OA 3FAXA 2CBUA 4PSRA 3WEMA 4PBGA 4F9DA 3UEQA 2DSUA 4OBSA 5EFFA 3GZAA 1TE1A 2DSVA 3EJUA 4LPCA 4JCMA 1V3LA 1BYCA 5A8OA 4Z2LA 3VOCA 3BVTA 1QOXA 1NOFA 3BAJA 3D5HA 3WD2A 1CXFA 2XSBA 1OWQA 4AYSA 3GBEA 3VILA 2DSKA 3D3AA 3EMQA 4NF7A 5GNYA 2D1ZA 4K68A 3ZMRA 3IGUA 1GQJA 4EK7A 1B30A 3AMKA 4D6HA 3SCNA 5A6BD 1HVQA 4W5ZA 4FNSA 3W82A 2VZTA 1A47A 3H55A 3CUIA 5A8PA 2Y2WA 1L8NA 1E71M 4FLQA 4W7VA 1JAEA 4PYSA 3PTQA 1XGZA 2OWCA 1E6PA 2PB1A 3OGSA 4ZXOA 1NWUA 2YDRA 3WUBA 1XH2A 1V0NA 1VEPA 4LGXA 1WZMA 4D6FA 4YN5A 5HXMA 1DWJM 3GXNA 3WELA 2BXZA 3FXYA 1QWNA 5D9MA 5E1QA 1JXKA 4JHZA 4B9YA 1XYFA 5DT7A 1E6RA 3EDFA 1BLIA 5HPCA 3W26A 3BLPX 3CHFA 4AD3A 1MWOA 3WDIA 3HG4A 1J12A 4BQ2A 4UQCA 1NP2A 4LYRA 1R8LA 2W62A 1PPIA 1V6XA 4RL3A 1DWFM 3AMLA 2JF6A 1UR1A 3L4WA 2F7RA 1OGGA 4W84A 5GQBA 4JFSA 2OWWA 2XGBA 1GJWA 3F5LA 1R46A 3GXFA 2PWHA 3OB8A 3ARXA 2J7FA 1AMYA 4CCDA 4J27A 1BVNP 3CPUA 1MW0A 2C8NA 3ALFA 4FNQA 3VMPA 4P7QA 2WAGA 4W7UA 2DEPA 2GFTA 3WF4A 1KTCA 4P7RA 1UKQA 1MW1A 5FCZA 2WC4A 1HJQA 4L4OA 1GQLA 1DTUA 4JFUA 3AMCA 4BQ3A 4D6EA 4QCEA 3VDAA 3S5ZA 1MQQA 2WBKA 3AIUA 3N15A 2FH8A 1JL8A 3WNOA 2MANA 1CDGA 2XWDA 3MS8A 1J0IA 3UETA 1EO5A 2GVYA 1XYZA 4JKKA 4GI8A 1G9HA 1JFXA 2Y8KA 3CUJA 1JNEA 1BYAA 1ECEA 3D4YA 1GZJA 1PJ9A 2XGIA 2NT0A 1KGXA 4HMEA 1JDCA 1ESWA 1TQWA 3WQ8A 4KGLA 3L2MA 3HN3A 1U30A 1E15A 2E9LA 2J8GA 5I6SA 1J9YA 3BAYA 1TQSA 3TP4A 2QV4A 3AHXA 4W7WA 4PUDA 4TVUA 4U3CA 4R27A 1XCWA 3DX1A 2EO7A 1QWUA 1KR0A 1Q6CA 1UD2A 3SCOA 3VIHA 1EDGA 4B9ZA 1C93A 2VX5A 3AIBA 5A2BA 4TVDA 3NJ3A 3IANA 1KQYA 1IT0A 4CD8A 4QLLA 5BRQA 2W66A 4CGTA 1QBBA 2VCBA 1LJYA 1NWSA 1QNOA 4YHEA 2VZUA 1HP5A 3VSTA 3AHYA 4MDOA 3PTKA 3ZM8A 3K1DA 3L4YA 4UZUA 1BAGA 4ATDA 2ZE0A 1UZ1A 1OT2A 4CN6A 3WUEA 5BYWA 1HT6A 2XVKA 3A22A 1V6UA 4JCLA 1H0GA 4ZE4A 4BQ5A 1R85A 4NXKA 4FLOA 2BHYA 3EMZA 1QNQA 1MXGA 1J0YA 3S5YA 1CPUA 2NW0A 5JBFA 1CXLA 1FH7A 3BAIA 1C7TA 2X2IA 4HTYA 2BHZA 1FH9A 3AHTA 4TOQA 2WXDM 5KZ6A 2OSXA 3LPPA 2ZX9A 2BVTA 1UH3A 4V27A 1E0XA 3GYCA 1JD9A 2GSJA 3SUWA 4KRUA 3PZNA 3CZ8A 1FHLA 1UR4A 3RDKA 3AZTA 3WEOA 3FN9A 1O6IA 3AXXA 3HZ3A 1CXIA 1EO7A 2Z1KA 1C92A 2EPKX 1O7AA 1QHZA 2XM2A 2PBOA 3CHCA 1KCKA 2EPMX 4D1IA 1WE5A 4MNLA 3BUBA 1OD0A 1W1YA 1JZ5A 2FHBA 1G01A 2WZIA 1DEDA 2VRQA 4B16A 3OGVA 1ZBCA 2J4GA 5CPTA 3UR8A 2RGMA 3GDBA 3AIQA 5M17A 2YL9A 4QP0A 1ZB5A 3ZJ7A 7A3HA 3T0AA 4MB4A 4AZ6A 3CC1A 1C7SA 1V6VA 7TAAA 1CGXA 3UG4A 1MQRA 3WH5A 3AROA 2XM1A 3AI0A 4CN4A 3BMWA 3A4XA 3VSUA 4MTVA 4U5KA 4FF5A 3SUSA 1QHPA 2WHMA 3VGHA 3DDFA 2VJXA 3OZPA 1R47A 2DT0A 4WLCA 4U5IA 5A6AA 3BXWA 5IXEA 5JBDA 2ZUSA 4XV0A 1J0KA 1GOOA 2YA1A 2YFNA 4FNTA 3AFBA 4ATLA 1G94A 1OM0A 3PZGA 3UG3A 4DM1A 1LG1A 4E8CA 1JZ7A 4Q7NA 5DF0A 1UH2A 1KBKA 4FLSA 1R34A 4EANA 3WH9A 4NZCA 1GW1A 1W2PA 4DWSA 4CVUA 2XN0A 1G5AA 5KEZA 3ARVA 1VENA 1CIUA 1WNOA 1E3ZA 4XUYA 4GQQA 1HJXA 2XFYA 4AIEA 2BV9A 2E0PA 2VRJA 2WHLA 1WZKA 2QMJA 3PBGA 2VRKA 4MB3A 1JZ2A 3VKKA 1C90A 3K8KA 1E70M 2WZEA 3ARSA 2F7OA 5E6ZA 4M81A 4Z2HA 2QMKA 3HG2A 4HA3A 4N42A 4B15A 3BVUA 1C91A 2D24A 1R86A 2E9BA 1GCYA 4YPJA 5LYRA 3LXBA 2UY4A 2WMFA 1W3JA 1MXDA 3B8SA 4QDMA 1KGWA 4MB5A 1W1TA 3WSUA 1E73M 3MI6A 3PZQA 3VMOA 3QHMA 1V0KA 1D3CA 2WHJA 3WF2A 6TAAA 2O9PA 3WUFA 1QI3A 4FNUA 6CGTA 3U7BA 3A23A 1TMQA 4P8XA 4HZ7A 2VI0A 2O9OA 5IDIA 3EMCA 4J3XA 8CGTA 2FE0A 3EDDA 1JI1A 3LPOA 1E9LA 1NQ6A 3KZSA 3MUAA 4PMOA 5M5DA 4W5UA 3A47A 3TTQA 4FNPA 5CSYA 2JEPA 3AS2A 3DYPA 4P7OA 3A24A 4UFHA 1TQTA 3T2PA 3CZLA 5IFTA 4J3SA 2VX6A 3A5VA 2DDXA 3AZSA 1HN1A 2VVNA 3ARPA 2WYSA 3M6DA 4YHGA 4GI9A 1EOKA 3VIKA 4BS0A 2DSZA 3OLEA 4D6DA 1B2YA 1B90A 3OG2A 3MSDA 4P8VA 4PMVA 1PEZA 4WF7A 1NWRA 2WLYA 3FHAA 2WC3A 1ISYA 1UH4A 1EQCA 1CTNA 4BZYA 2VZSA 1F4HA 2D20A 5A6KA 2X2JA 2W67A 4QAWA 4NXSA 1E1FA 1EXPA 4E8DA 1UKPA 1ZS2A 3RILA 2D0GA 3AHVA 3ZT6A 3WN6A 4OZOA 4CUCA 2VT0A 1HL9A 5I2UA 4WJXA 1E56A 2YJQA 1H2JA 4UQAA 1V0LA 3D4ZA 3GH4A 1FFRA 2OWXA 4R5EA 5E09A 3MUIA 4X0NA 2CCRA 1DWGM 4GZIA 2IXVA 2XG9A 3L4ZA 4NI3A 4BCEA 3GH7A 1UQYA 3NCOA 2CBVA 2J79A 1G1YA 2Q8XA 2WMIB 1GONA 1XD1A 2VQTA 1PX8A 5A8NA 5BWFA 1XSJA 4QLJA 1WO2A 3PZVA 3BVWA 2EXOA 2XYLA 1SZNA 4ZEPA 5CGTA 1UR2A 2CYGA 3WKZA 3B9EA 3OLIA 2ZWYA 1GUVA 3CBWA 4URIA 5E70A 3CMJA 5M3WA 1GQKA 4AMXA 1V3IA 4GINA 2D0HA 1NOWA 5CJ5A 1WKYA 2WMGA 3HU7A 3A4AA 3TTOA 4MNJA 5ABFB 3OGRA 4D1JA 1GHRA 5FD0A 1SR0A 3AJ7A 1HP4A 3CUFA 1WZLA 2PWGA 3W25A 4UZSA 1FFQA 4UFJA 5I5RA 1P6WA 4J3VA 2FGLA 2G3MA 3NYDA 3GXMA 3WIJA 1VJZA 3ZOAA 2J7CA 1UD6A 4PTWA 1FOBA 4XX6A 3U57A 2J77A 1CLVA 4UQEA 3CMGA 1V02A 1V6WA 3WMBA 1W3HA 3RM9A 4Z2IA 1HKJA 3VD9A 3ZT5A 5A6LA 5F7UA 4JHOA 1C8XA 4AEFA 3E1F1 2XSAA 2XN1A 1CLXA 5D8ZA 4GPNA 3OZOA 2JIWA 4DO4A 1V3MA 2YBTA 3S6TA 1ZL1A 3BAWA 3ZQ9A 1MQPA 3ARZA 2YOCA 2XVLA 3AQUA 4EKJA 1WDRA 1GHSA 2ZXDA 3W29A 5FIPA 4MADA 2VUYA 1HKKA 2W4XA 2ZUNA 1LL6A 1XH0A 1UASA 5A6SA 3OLGA 5E6YA 3T09A 3PN8A 3NSXA 3B9AA 4CKQA 2DSWA 1X1NA 2J7HA 4KRTA 3IJ9A 3ZIZA 1UWRA 3FW6A 1HJWA 2WK2A 3IK2A 1UKTA 2V3EA 3GXTA 5FL0A 2C0HA 1CYGA 3MV11 1HVXA 2D23A 3VD5A 2A3CA 3W27A 5CGMA 3LMYA 4TTGA 3VIGA 1UKOA 5AYBA 3RO8A 2YDSA 3MUZ1 4IISA 1UUQA 2EACA 3BLBA 2BS9A 3BVXA 2Y4SA 3CTTA 3KL5A 4MPKA 1VEOA 1BQCA 1AQ0A 2WMKA 2XN2A 4IUGA 4W8AA 2FH6A 1QI4A 3G6MA 3DHPA 4AC1X 1UR0A 3O6AA 2E40A 4DWSB 5DFAA 3WFZA 1G0CA 4UQBA 2CESA 5I77A 1C8QA 4PSPA 4WSKA 3MSGA 1CXEA 1NWTA 5A2CA 2JEQA 1FP9A 1W1PA 4W8LA 1E5JA 4NSBA 2F2HA 1U2YA 1UD3A 1BVZA 4LYPA 3MO4A 3T0DA 1MYRA 1E6XM 1WDPA 2CEQA 2DH2A 3WH8A 3EJPA 3BGAA 2O92A 5I24A 4L4PA 4UOQA 1OD8A 3CV5A 2RGLA 2QHAA 1PIFA 3WNKA 4RE3A 3M07A 1QNRA 4RE4A 3I3BA 4H41A 2Y24A 1ISXA 1W91A 1JZ4A 5C8BB 4W86A 4HZ6A 3VMNA 3WBEA 2W91A 1GPFA 4LXFA 5HDRA 4AMWA 3ZSTA 1GQIA 3AIVA 1H3GA 3VGDA 2E8YA 3W6LA 6A3HA 3KLKA 3VPLA 2QPUA 4PTMA 4HOXA 5A8QA 1ZU8A 2NT1A 1B1YA 5LA1A 5ABHA 2WANA 2G4FA 3D52A 4JL2A 3IJ7A 2D73A 4XZBA 2OW6A 1W9UA 2UY2A 3BUIA 3U5YA 2JF7A 3WNPA 3VX1A 1JFHA 4AZIA 4D71A 4OKDA 3N11A 2G3JA 2CITA 3BC9A 3AHZA 3WQ5A 3CH9A 3MANA 2X2HA 4CD6A 3VM7A 3AIEA 1CEOA 2D3LA 3N13A 2A3AA 5DMYA 2V5DA 4J3WA 4OGZA 4FK9A 2EPLX 2WMIA 1I75A 2XPKA 3TONA 1W3KA 3LPFA 1NH6A 1JG9A 2BVYA 2VNCA 2J7EA 3EDKA 4WSJA 1V3JA 4U33A 1BG9A 3DYOA 2XFRA 3J7HA 2VL4A 3LPGA 2YFOA 2ZXAA 2BY3A 3DDGA 4W88A 5TD4A 3VIIA 2FHFA 3AISA 2BNJA 5ABFA 3T08A 1WDSA 4CU6A 1TZ7A 3WF1A 4M82A 1QW9A 2O9TA 5EBAA 5CG0A 1E72M 1EOMA 1W1VA 1ZJAA 3CHEA 1I1XA 1KFWA 1HX0A 3LXCA 4CCCA 5A95A 4MNMA 4PMYA 3K4AA 4PMDA 9CGTA 5AC4A 3F5KA 2JE8A 4UNIA 1OIFA 5A6JA 2WSPA 1HIZA 4D6GA 3K8LA 3WDQA 4BQ4A 1KXVA 1O7DC 2CPUA 3KEHA 2CKSA 4W85A 2B31A 3SCUA 4QCFA 1GOIA 1EDTA 3CO4A 2WBGA 3VIJA 1QNPA 3GNOA 3VIFA 5A6BA 3U5UA 1VFOA 4F8XA 2J8FA 4AIOA 3KL3A 4GIAA 1ODZA 3NIYA 3BAKA 1E0WA 3DX4A 1ZBKA 4MJ4A 2OYMA 3DX0A 1US3A 1CXKA 1D7FA 3ARRA 3NUKA 5HBFA 2J7DA 4P7LA 3WQ4A 3VGFA 1ZBVA 3I3EA 1WZAA 3RMEA 4AD4A 2W92A 1ZBWA 1H0IA 5EB8A 1FHDA 2CHNA 2YDQA 1TUXA 4ML4A 1KXQA 3EDJA 1EGZA 1Q6EA 3W24A 1GOQA 3VU2A 5FL1A 1FH8A 3K4DA 4DO6A 2ZX6A 4CCEA 2WMJA 1W9BM 2BHUA 2EBNA 3A6OA 3G6LA 3AIRA 3N1AA 1E4MM 2BVDA 4HPGA 3F5JA 4NRRA 4JKMA 1J18A 5I3DA 4LX4A 2F7QA 5I79A 3BUPA 1H41A 1US2A 4W89A 4UTFA 2F61A 1EIBA 3SEPA 1VFFA 2UWFA 5E0FA 3BAXA 2GJRA 1H49A 2F7PA 4XZWA 4H2CA 2BY0A 1VF8A 4HMDA 1XV8A 3W4RA 4PRWA 3WF0A 3L4VA 3EJQA 4QLKA 1M53A 1TA3A 3WF3A 3SCQA 5DEZA 3RCNA 2DH3A 5JIPA 3MV01 4P8WA 5IHRA 1JD7A 4FNRA 3TTSA 3L2LA 2WNWA 2D2OA 2XVGA 3B9DA 1TQUA 3FAWA 1QVBA 1EDQA 1ISZA 3VD4A 1CBGA 3O9NA 2E4TA 1XCXA 4A3YA 3D50A 1NARA 5AYIA 2FYVA 1AQMA 2HISA 4BF7A 2G3IA 4UFLA 3WD4A 2WWCA 5BROA 1BSIA 1C8YA 3GH5A 3WD1A 3KLLA 4P8UA 4AZBA 5JBEA 3VINA 1N82A 4CN1A 1WPCA 2VR4A 1KTBA 1EQPA 4AZ7A 2IXUA 2ZX8A 1UD5A 2XUCA 1DP0A 3WMCA 2VVSA 2PF0A 3WEZA 3AMGA 4WKFA 1UA7A 5BXPA 2A3HA 1VFMA 2ZUUA 3W28A 3PZTA 1XRVA 4PCTA 1K9EA 3PZUA 4IPLA 2AOSA 4EAMA 2X09A 3AICA 1LF1A 1GORA 2GK1B 1GNXA 3AYSA 3SUTA 2ZUMA 2J78A 4JZ5A 4PMQA 3VGGA 1UQZA 4JAWA 3CGTA 2FDMA 4PTXA 5I78A 3CZSA 1OINA 2WWDA 2F8QA 3JUGA 1BFNA 4M1RA 4H8UA 1CGUA 4CVWA 4DM2A 5I23A 1YHTA 4M8UA 1XHGA 3TTYA 5AC5A 1UWUA 3WD0A 1CGTA 4PCSA 4ACYA 1X6NA 3BH4A 3ZJ6A 2PWDA 2V3DA 3WY2A 3DYMA 2EQDA 3GM8A 4FLRA 3ZT7A 5AY7A 4WKHA 4B3LA 3SUUA 1VBUA 1ITCA 1M04A 1E4LA 4AD1A 2WCAA 3ZR5A 4UQ9A 5D9PA 4J3TA 5CSUA 3N04A 1CGYA 4MDPA 4HOWA 1OB0A 2DT1A 1E40A 4LYQA 1TQVA 2E3ZA 4GXPA 4PMZA 1XD0A 3AOFA 3AXHA 2EPNA 4PUEA 2D22A 4M29A 4ZENA 2ZUTA 4HP5A 3M46A 4HPHA 3VM5A 3RM8A 2V3FA 2CERA 1CECA 3W6MA 2X8RA 3ALGA 2AAAA 2YL5A 4PEEA 1BTCA 1CENA 2E8ZA 1KB3A 3NSMA 5CPQA 3N9KA 2IGTA 3F4VA 1UOKA 3KL0A 3WDPP 4U2YA 1JXJA 1JZ6A 1B3WA 3DX3A 5A8MA 3GBDA 1V03A 3DC0A 3SCPA 3SCRA 4MJ2A 5ABGA 3WY4A 3VX0A 4J7RA 1UWTA 1LL7A 1UWIA 3CLWA 3BSGA 5FOOA 3IJ8A 4GI6A 2WW5A 4UFIA 2Y5EA 1Y7VA 3EBVA 1R87A 1L0PA 3ZR6A 1MFUA 4AMCA 2J74A 3L4TA 3NDYA 3WL0A 1OGBA 2WM0A 1J0ZA 3W53A 3UCQA 1A3HA 1JYVA 2XVPA 4UCFA 2W61A 1W9PA 3EYPA 3EDEA 2JALA 4TX8A 5GPRA 1SFSA 2WKGA 4DWSC 3ECQA 4NZJA 1IZKA 3BCFA 4NX0A 2BFGA 4AW7A 2WZHA 3VDBA 1LWJA 4AEEA 2J25A 3DX2A 2WC7A 4MNKA 1VRXA 2DGAA 2V38A 1W32A 3SUVA 1B3YA 5A2AA 2EEXA 3WY3A 1VB9A 3WD3A 1ODUA 5GNXA 4TX6A 5A69A 1JI2A 4Z2KA 2VQUA 3S2CA 4H7VA 3N12A 4ACZA 4AZGA 3EJRA 2J75A 4U31A 2J7GA 1I1WA 3RIKA 5BXTA 2GDVA 4CU7A 2WCGA 4KMQA 4UFMA 4X9YA 1UYQA 4AD0A 3HG3A 3A21A 3U7VA 2OSWA 3BUDA 3IAPA 3LRMA 2V5CA 2WPGA 2GJXA 4S3JA 4Z2JA 1KXTA 4CD7A 3APGA 3ARQA 2ZOXA 3IAQA 1T0OA 4IPNB 1PIGA 3VNYA 3TV8A 1UA3A 1HKMA 3POHA 2DT3A 3MU7A 2WB5A 4AD2A 3GTNA 1OIMA 5D4YA 4F9JA 5HNNA 1CGWA 2EJ1A 4LQ1A 1UKSA 4HA4A 4PMRA 2XHYA 1RP8A 1KXHA 2VCAA 4HMCA 2JIEA 1C3FA 4UOJA 4E2OA 5JUVA 3WMSA 5DO8A 1NM9A 1Q6FA 4W87A 2X1IA 5FKYA 1ZJBA 1HKIA 2VURA 1UG6A 3PTMA 2W63A 1MW2A 1TA3B 4ZXLA 1BHGA 3RJXA 2JFEX 1GOWA 1LWHA 3CUHA 2VX4A 2DQXA 3VGEA 2GK1A 2YLAA 3O2LA 1UHVA 2VX7A 3RJYA 2WCSA 5DT5A 1U33A 4X0VA 1S46A 3BLKA 1UD8A 2VCCA 1UD4A 1QX1A 1J10A 3HMCA 1XSKA 1PX3A 4H8VA 3PZ9A 3VTRA 2D3NA 2YBUA 1Q4NX 2W5FA 1JYWA 2ALWA 1E3XA 3W37A 4MB1A 3W81A 2WSKA 1KWGA 1E43A 1QPKA 1M7XA 4HU8A 3GXPA 3CIVA 2J47A 1JAKA 4D6JA 5LA0A 4PMXA 2WVTA 4GO9A 4JKLA 1QI5A 1E0VA 4CD4A 1KGUA 2QPSA 3CHDA 2NSXA 4AISA 3WDJA 3WY1A 3HG5A 3LRLA 2CETA 2CNCA 3VUPA 3UESA 2BY1A 3QGVA 2GUYA 5BXRA 4RE2A 3WNMA 4FMVA 2DT2A 2GJPA 3I3DA 1GVIA 4C7FA 1JZ3A 4H8HA 3QHOA 4DWSD 3GXIA 1CZ1A 4DUXA 1M01A 5CXPA 2YA0A 1E55A 3THCA 4AZCA 3K8MA 1OSEA 2OYLA 1BG4A 1V3HA 1J0JA 2XWEA 3CZNA 3ARUA 4OJYA 5E0CA 4S3KA 4JFWA 3GNPA 1V0MA 3AS3A 4WK9A 3HJEA 1VEMA 2CHOA 3SCTA 1PX4A 1XSIA 2YLLA 4F66A 1WDQA 4TXEA 1HXJA 3WDHA 3WH7A 1E6ZA 1KCLA 1DWHM 3FNDA 3PZMA 1QBAA 1B3VA 3SURA 5M03A 5CZKA 1JGIA 3SCSA 5IFPA 2EABA 3VD7A 4AZ5A 1R75A 5CLTA 1FP8A 4PMUA 4U3AA 3VD3A 1RH9A 1GOKA 4UR9A 4UOZA 1NP0A 1V08A 1OBAA 2FHCA 4UQDA 4AXNA 1SYTA 1EA9C 3TOPA 2HVMA 1F4AA 1V6YA 1IV8A 1VJSA 3MMUA 4IM4A 3VVGA 2ESCA 3SIMA 1J0HA 2IUZA 1PBGA 5EFDA 2VMFA 3WQ6A 1UWQA 3L4XA 3AMDA 1HF6A 3QOKA 4MAZA 1Q6GA 4JFVA 1H4PA 5A94A 4GZEA 4JL1A 3NSNA 1CXHA 3UR7A 5IHSA 1DHKA 4DUVA 3WFLA 1ISWA 5ABEA 1W9DM 3L4UA 1E6QM 1FA2A 2J7BA 3MKKA 1JYNA 1D2KA 1ISVA 3CZJA 5ECUA 5A3HA 3AS1A 2WVVA 3VIMA 1JNDA 1PZ2A 3LXAA 4GZJA 1H1NA 2WVSA 4XB3A 2OYKA 3ARTA 4HA1A 2WMHA 2AMGA 4C7GA 4D6CA 1EHAA 4ZFMA 4OUEA 4CU8A 3ARYA 4A3HA 4HZ8A 1MVYA 3WH6A 2TAAA 1HJSA 4AIUA 3CUGA 4AWEA 5EMYA 3ZJKA 2VZOA 4EE9A 1M03A 1WAWA 3GNRA 4QFUA 3ZSSA 1JDDA 2XTKA 1NOUA 1HL8A 3ZJ8A 4ZE5A 1VIWA 4TUFA 2CKRA 3KWXA 1HNYA 4JFTA 2EADA 2J62A 4PN2A 1E6SM 1BYDA
chains in the Genus database with same CATH superfamily
3SE4A 1B0IA 1A5FL 5FV2A 4ZD3H 3CFBB 1I3RB 1NGQH 1OANA 1G4RA 4LCSA 4BELD 3T8MA 4Z77B 1ANUA 2X0WA 2O56A 2DIJA 4PJ5D 3DBSA 5D4HA 4Q8UA 4X2UA 4P5TD 1MJUL 3OWRA 3MBWA 4DIXA 1W72A 3ML9A 3KPNA 2D7QA 4FFWC 3UJJL 4FP8L 1PE1A 3BPOB 4ZPTB 2ZOWA 1EANA 5LB1A 3S96A 4XNDA 3NQAA 4KH2A 1E4NA 2IDFA 4NAEA 2DJXA 4H1ZA 5BVPL 4HYTB 4YDLC 3RPMA 4B3KA 3JWDH 2HG5A 1UURA 1ORQA 5E1GA 4KCWA 3KE0A 5ESAB 3ZMNA 1HZKA 1Y6KR 3QUMA 4BFFA 2JIXB 2QQNL 2BIPA 3WBAA 4OLYH 4QYOA 4IW4C 1DWIM 1E6OH 5I8EA 4AL8H 2XG4B 3P0GB 4MNQD 1QPOA 1DCLA 3S9IA 1FBIH 3HFML 4XZHA 1AHMA 3P54A 3QYCA 5D1QA 1U83A 1EH9A 3MBFA 1U5JA 4R34A 3O3RA 4U1GB 4JKWA 4JFPA 3TE9A 3GG0A 2Y69B 4Z1CA 1I1FB 2X4RA 1DJXA 2DB8A 3ZYIA 4MHBA 4HV8B 4HBCL 1BWWA 4HTBA 4WW2A 1OE2A 4LEQA 3VGAB 4YFEA 2G95A 2WLMA 4LO9A 3PWLA 3OZKA 1YHPA 1VBGA 3FO2B 4ORMA 5F1NA 1ZA6A 3FTGA 2XTJC 5C08E 5C71A 3VFPA 4LSBA 3BL3A 5IJKA 4U4IA 1ODAA 2VR5A 1QSEE 3ZRCC 2P5WE 1B57A 1LMKA 2OLHA 2Z6FA 2RFXB 4A3RA 3JWOL 1HWWA 3M0ZA 3U2OA 2HAZA 2VO5A 3A9BA 2YSTA 5JOEA 1TR7A 4MAVA 4XZMX 1QOPA 1EHNA 4DJED 2IFGA 1DJGA 2YEZA 4S1SH 4XAPA 1DLHA 5DFTA 2DD8L 5DYFA 5I76B 2BVUA 5LNUA 1DVJA 5EUKB 3GO1L 4D9RD 3GVGA 1A6PA 4LLVA 4RGNC 5FS5A 2QLVB 3WUGA 1Z3GH 3DXAB 5XIMA 3BXNB 3H2EA 4BWLA 1XGUB 1E9OA 1PZ5A 2IJ0C 3MBXH 4MMYB 3QIWC 4IOSD 1ZVSA 4YHYC 5HNRA 4C6QA 4QNPF 4BH7A 1MZYA 2VC9A 1NAML 4C54A 2ENJA 3GVRA 3LNIA 4Y0GA 2DY3A 1ZHNA 1ASQA 4LCIL 1RERA 3VXPB 1DBKL 3BP7A 2VXUH 4GG6B 2DWYA 1WH0A 4MKNA 2E77A 1VLWA 3ZE0F 1A3LH 5MKGA 1GKOA 4RZKA 3W0WE 1H60A 1KYOK 2WZAA 5A6BD 3M88A 5GRJH 4FZ8L 1BJMA 4X4YB 3H55A 3G8EA 1E71M 4FLQA 3CYJA 2ZTKA 3BHBB 2FFIA 3BD4A 4ANXA 4TUKL 3HRZB 3PCYA 1R9XA 1J93A 4YN5A 3DX8A 2R94A 1T66C 1MN4A 1BGXL 5C6TL 3RXZA 4L8SB 3QI9A 1Z0MA 1VBJA 5AW1B 3UWYA 4RL3A 1IVLA 5I1GL 3UBXA 1QACA 4HWEH 4BD4A 1SPQA 3TYGL 3AM8A 5FB8A 3VOGA 4LLDB 3LNEA 2BGNE 4CCDA 2C8NA 1PVHA 1V55B 2WZMA 3ID7A 4P7RA 1UKQA 5DT1L 5FCZA 5FKAA 5EUOB 3AMCA 4QCEA 4LBEA 4YL2A 5LNVA 4NQQA 1JL8A 2PO6A 4PUBL 3BSZH 1WX0A 1XX9C 1XYZA 3DFTA 4GQGA 4A35A 3I6SA 1NCWH 4NN5B 3PWPE 4QE5A 3O45B 1EXGA 3R18A 1MHPL 4IOFD 2HMCA 3S36X 4Y4KC 3Q0HA 4QE1A 1AIFA 3IE9A 1K03A 4Q8VA 3DX1A 5ABAA 3QB7C 3QDMD 1T5KA 4G11A 2A4ZA 3UTOA 4NZ8A 2IAMA 4KO6A 5IT2H 1A9BB 3C5QA 3L5XH 4DXXA 4KZDL 1DSFL 1W8NA 5HVHB 5L2KD 3EJZC 3CB8A 1MJJB 3L9YA 5CC5A 1HXYA 1LJYA 4B5ZA 2F5BH 4OT7A 3ESMA 4WGHA 3FQRB 4B90A 3BPLB 1TU2A 2X30A 3C5SA 4BQ5A 1Q9OA 4GQBA 4B5VA 4O13A 3KPPA 3GMQB 2AZAA 2YKLH 5F88B 3UXIA 4DKDC 2QKIC 4ADGA 4JE0A 2HMIC 1GZQA 4CSSA 2Y07H 5CNHA 1YDNA 3CNKA 5DA0B 3CZ8A 2B4CL 1OX4B 3PE9A 5F9WC 2FHBA 4HHGA 2MWCA 1HNFA 3SGDH 2EDHA 3AXLB 4KKCD 4DZ5A 2XDFA 3GFXA 1T5XA 5HGHA 5B7YA 1WHOA 4MLIA 1MQRA 4J2QA 1I60A 3TJHC 1FNGB 2JI2A 3MACL 4FXJA 1WKFA 3NZRA 5CD3A 1ZGLB 3DDFA 3TQKA 3RE0A 1UJQA 5ICYA 4U5IA 5DURD 2V5TA 2ZA3A 1GS7A 4D0BB 3VG0L 2PR4H 4WO4B 2QBWA 3ULUF 1DLFH 4R2GC 1EJWC 1TZHB 1ZZMA 3CT7A 4XNYL 3L5JA 4FQIL 1DXEA 4FABL 4MXVE 4AZUA 1KTRL 5CJMA 1DVFD 4EI5D 4XUYA 1LO2L 3MI2A 1DN0B 2O6DA 4Z3IA 3E2HC 1AQ8A 5D9SB 1TJXA 3VKBA 2KERA 3QQ1A 3KJ4B 1FWEC 5L6YL 1FZOB 4FCAA 4KROD 2YK1L 1HHJB 4QF1B 1BYOA 4PCNA 2CA3A 1I85C 1XDMA 3TC3A 4X63A 2HJLB 3GMMB 5D2VA 2Z31B 5C2BL 1D3CA 2YPVH 4CSTA 5HYSG 4LVDA 2QL1A 3GMLA 2X4UA 3EBAA 5FF6A 1R4XA 4J3XA 2GTQA 3VWJA 3ZLGA 4NZTH 4D9LL 4ZAKB 1FWBC 3ITXA 2AJVL 5SWZE 3IJIA 4CQCA 1TEGA 2KZKA 4UI2A 1NCCL 2JEPA 3VD0A 2B1HH 4V11A 4UFHA 2B59A 2UY7A 2BVWA 2VVNA 3ARPA 2XU2A 2QHRL 5CGYD 4YBLC 3P67A 4UAOB 3PXLA 2E47A 3SR7A 4PI2A 3ZGHA 4Q6JA 2ZZ4A 1J05B 4I7WA 3MKVA 2D0GA 3AHVA 2QJMA 4OHQA 5D1ZC 3G6AB 1H2JA 3B97A 4UQAA 4HK3J 4GUGA 4MIMA 3C86A 5KVEL 4LAKA 3W1XA 1YJDC 1T20B 3OAUH 4LNYA 1ID2A 5GGRB 3F01A 3U6RA 5BUAA 4P2AA 1NAKL 2B3RA 4IKNA 1PX8A 1W0MA 2VFDA 2NY1B 4QLJA 3R4IA 1U41A 3MREB 5MEND 3EZ8A 1SZNA 3WKZA 4GKSA 1CFTB 2QJNA 3ELQA 4AHQA 4PJ5A 5AW8B 3BOXA 2ZOUA 5EL1A 1U8PB 4P5TA 1GOHA 5C2GA 2GJZB 3ARED 2G5WA 5HWJA 1JXFA 3CDCA 1BKSA 4LFHG 3LS4L 2NY7L 3KBHE 4HZLB 1CI1A 3DOSB 4P49A 4L4TD 1RVFL 2HZHA 2NXHA 3U3HA 1CG9A 1SU5A 3SO5A 1VFAA 2NLJA 3U2SB 4QO1B 2JCCA 3DX7B 2PCFA 1TT6A 1MF2H 4MQTB 1HKJA 2BDNH 4Q9RH 4FG6C 3L3HA 2H47C 3AJXA 3VXGA 3QWOB 3BOLA 1ZL1A 2OMUA 3AQUA 4MNQA 3OLGA 3B9AA 4JQVC 4RFNC 4CKQA 3SE8H 1S5TA 2J7HA 2OGJA 4ODVH 3HPLA 3D9AL 3TC9A 5PTDA 4J6RL 2D2JA 1G4MA 3Q01A 1KUMA 2VLRE 2GEEA 1HK6A 3MUZ1 1MAKA 5KANI 2O7QA 1A6TB 4XMZA 5MERB 4MPKA 3OSVA 4WJKB 1T3FA 2MKLC 3P3UA 3TJPA 4G9DA 3DHPA 4DWSB 5C0EB 2EDWA 2JEQA 5EU9A 1NDVA 3D3VD 5FKPA 4Z7QB 4HGKC 3WEXB 3CUXA 4A8LA 3MCLH 3KM2A 4IH3A 4C6PA 1ONQB 4DVRL 1OD8A 2CD0A 1PIFA 3QIBC 3G5XA 1AD0A 4OI8A 4NO0D 3CHVA 3M4HA 5CINL 3GU1A 1IWPA 1HH9B 3WMQA 3S36H 4DJEA 3MTWA 2N1TE 4X7FC 1ZK5A 1FFTB 4AJWA 3RZWA 4LEEA 4JGUA 4AYBA 3VPLA 3H21A 3IMUA 4PLJD 2V8MA 1DBJH 5FACA 2OMAA 1LROA 3FH7A 3HZKB 3IJ7A 1OZMA 1Z66A 4XC1H 4FQ2L 3UJIH 4XP6H 4YDZA 5BMWA 2O6EA 5BU9A 2A6DB 1LM1A 2GOKA 1JERA 2FZNA 3CMFA 4IOSA 3V16A 4ZSOA 3MANA 1CEOA 5I1KL 1X5YA 4NKQB 1UM4H 3GJFH 4FK9A 5T9CE 3LPFA 3GS4A 3GFUA 1JG9A 4K38A 1TZZA 4F9LC 3P77B 3UGEA 5K93A 3EOYG 1CD0A 4U33A 2WNNA 1UA6H 2P26A 2E09A 4ZGYA 4M93C 1SDAB 3VXTB 5JTWA 3M0KA 4Q7DA 2DLTA 4R0LC 5ABFA 3ULAB 4KTDH 3QHZL 3WF1A 2DPKA 3VXQA 4ELKA 3TBWA 1ZJAA 3CHEA 1XGTB 4CCCA 3S3DB 4DN3H 3PU7A 4IKJA 4DN4H 1O75A 4BWUA 3LEXA 1QLFB 4N2LA 1RUSA 3B40A 4XI5D 5A6BA 3FH8A 2TSBA 3U0PA 5LSMA 4BK5A 1NCDL 2OMZA 3DGGB 4NIYE 4MNGE 2B7DT 4MJ4A 1IFRA 1E4XI 4GKZB 1U5VA 1D7FA 4W9DC 4AEOA 4GFIA 4QQ3A 4V1DB 4HXAL 4YZWA 4N8CL 1Q7MA 3LGEA 3SE3C 3KX6A 1A3RH 1DQUA 2NVCA 4UILL 3W24A 1KKRA 4ELDA 4XO6A 5D2LA 5JDJA 1AHWA 2DZEA 2BDQA 1J18A 4AVJA 3QW3A 3OMNB 2X1SA 5LIXX 4B97A 3PGFH 1VBHA 1KM3A 5E0FA 4AVNA 3L3OA 4E5XB 2BY0A 4D0CA 1VP5A 4JPVL 5AZEH 4JFOA 4WFFE 4L5ZA 3MWAA 3IIPA 3BKCH 3BT0A 1JD7A 4ZPVA 3RYMA 1XIGA 3KOYA 2P45B 1UACH 4G56A 1KB9J 1CBGA 4DBUA 4R4BA 5AYIA 4U4MA 4WI0B 5H8PA 2DJSA 5CAKA 5F7DA 1BSIA 5BVJB 1J88A 2Q86A 2VR4A 1GL4B 1S9VB 5IIEB 1N6QL 3OC8A 1W72H 1DP0A 1TJHL 2RACA 2GFBB 4UNLA 2P8MA 3QDMA 4JHAH 5JO5B 3MUGA 2EGZA 5DRNA 4Y5VB 1KG0A 4O5LL 3NCWA 5L2KA 4G1MA 2YO3A 3SOBL 4LVNC 3EXJA 1W5MA 5DO2D 4HHHA 4E41E 2OL3L 3P6LA 4PBFA 4ODHL 4LV4A 3QUMH 4U6HB 2R23B 3GMRB 4WY0B 4QHKJ 4GUCA 5FECB 3S3SA 2GPZA 4U1HA 1KCSH 3UZQA 4J4PA 4MWAD 3P9WB 3MY9A 1D5IL 3DJ9A 4YHZH 2FPVA 4HPHA 3VM5A 4BDVA 3T8LA 3RUGB 4C56D 2X0VA 1Z7JA 1O7VA 3OW1A 4FI8A 3CAWA 4LSQL 3Q8EA 5F0JB 1MFDL 4OZ4B 4JFQB 4L3ED 4IJTA 4FR6A 2V2WB 4Z7UB 4XVEA 4BINA 4TQIA 3SCPA 1F3JB 4EI0A 3FX4A 1RZFL 1Y7VA 3VNKA 4QHPA 4HW6A 3B8VA 1YC7A 1B3OA 3P2VA 1JGMA 3VXME 2DLFL 2OVLA 3H12A 1AIZA 1WC7A 3DRQA 2HVOA 3M1BA 4QNPE 2JQMA 4GRLB 4K5OA 2EDNA 3ECQA 2X2UA 1FN4A 4M8VA 4WXZA 4ZO7A 2P8LB 4Y1AB 4LL9A 1DVFA 2COQA 2DGAA 4EI5A 3MRNA 1LWRA 3UF9A 3WD3A 3RKPA 5A69A 2XQYK 4FL4C 3SO3C 1T0MB 3KS0H 3UAFA 4X9YA 5FYJU 4EIBA 1KM2A 3MZGB 2EZ0D 5KVGE 5F0MB 4YS4A 2OX1A 1LO0H 3U4KA 2PDBA 5C6MA 3HHSB 1BD2D 2QGBA 1ZJIA 5ACLA 4EXQA 2VDLL 5E99L 4XCNB 1WEJH 2BPBA 4HUCA 4CADB 1F42A 3UWWA 1KXHA 3BZEB 4H2AA 3BO8A 3FDKA 4A63A 4JY6B 3GEFA 3PTMA 4JYEA 3QEQB 4EACA 3R0NA 4AT6B 5IJCC 4IBTA 1P0EA 1IX2A 3ULSA 3QWNA 4FN0A 2ISSA 1J10A 4GNKB 4LWWA 3IVKA 1JYWA 1BBDL 3V18A 1ED3A 3U4BL 3JVAA 4TQ8A 1N0LB 3CXDL 4HJGA 4YSEA 1GW6A 4LB3A 3VOFA 4F4RA 3H4WA 5I3HA 3P0VH 3NL6A 4X6FA 1CLYH 4P2CG 5MENA 1IIHA 4GOSA 1IC5H 4KQ0A 1PD0A 4DUXA 1XF2B 1JZGA 3HB9A 4TUJA 4I18C 1R6VA 3AREA 1DQKA 4UB0L 4NASA 3WJYA 1NIUA 3GYEA 3DGDA 4M7ZC 4S3KA 2M8XA 1HAWA 2DQUH 3MV9B 4O2EA 4L4TA 3SAZA 1JULA 3GS7A 2V9DA 3BWUC 4F66A 2RCSH 1N55A 3B6SA 1FG2A 5G1TA 5EH1A 2CM5A 5BS0E 3S2JA 2IH9A 3DFSA 2IMNA 4UR9A 2GTZA 1UIOA 3UXAA 3TFKC 4BFJA 3HAEB 4AAJA 1OHQA 3UTSB 1UJ3C 1RCOB 1J0HA 2IUZA 4G8EA 3QPXL 5FGSA 5DLMH 3E8UL 3W7DA 1IGFH 1SN0A 4UT9A 4FALA 4I85A 5FYLH 4PFHA 43C9B 4P2RD 4PTTA 3OVGA 4NRYB 4BSWB 1RJPA 1W9DM 3GSNA 1E6QM 3MKKA 4G5AA 4ZXBB 1PZ2A 3A5FA 3NQEA 4DGYL 4EQ3A 4KK9D 2WMHA 3MUXA 3ZKND 4BRJA 3H8AA 5HHQB 4ZFMA 1U8OA 4LCCA 2HE8A 5D7IB 4I1NB 5TF1H 3LMJL 4KW2A 2DLEA 3RWCA 4NPYB 1T7LA 3GW3A 3B9NA 1JHTA 1INDL 1XYMA 2OLAA 5LGZA 1MDAA 4WZHA 3HNSH 4YSSA 1HUVA 4JJ5A 4NO2B 3MJ9L 5GJSL 3M0VA 2XIDA 3D3VA 1YX1A 4NKDA 2EE3A 3GHRA 2YWZA 5F8QC 2PDFA 1MW3A 4O17A 4LGSB 3GDRA 3L5HA 3KDMB 3UYOD 2DQGH 4JNYA 1IFHL 2BSRB 4JYFA 5MEQA 3ULUE 3NZ1A 3AG2B 1L9WA 3THDA 1W2VA 1K77A 5E9AA 5I6MA 3FXGA 4IF2A 5DTFB 2DQHH 4LPUA 1BM3L 5TFSL 4EDWH 2OAAA 1WIUA 5KSBA 2ZXQA 1S3KH 4KX9A 1H09A 5HHOB 3NEVA 1RK5A 3H4GA 1PNDA 3OKNB 3S6CA 1QPQA 1BBJB 2LU4A 2CR0A 2GITA 1W17A 5KTLA 2VMCA 3ZLHA 4GVGA 2F5AL 5I19L 1OCQA 1FL3A 5KYUA 3II1A 3PHQB 3S35H 5DRWA 4IOIA 4MDRA 2VM4A 3HE7C 4XO4A 2ZWZA 2AAVA 2FYYB 1O94A 1F18A 5LXGH 4PTVA 3GSXA 1KBBA 3CB3A 1WCBB 4IBZA 4RNRA 3RZCB 4XWOC 4FMKA 5JPNA 1MFVA 4PREA 4PRTA 2PDJA 1B88A 4HKXB 4YSCA 1QTPA 4K7FB 3GJFB 3N17A 2FKPA 4C55A 3X14B 3Q3GA 1RV6X 4GAGH 1RIVH 1K8ZA 4DF9A 2OSLA 4GXVL 4NZ3A 3CHXA 1E30A 2Q8BL 3OB0H 4P5SA 3TN0D 3QOMA 3FY1A 2L7EA 3SIZA 3M1ZA 3NQ7A 1AANA 3CUPB 3EOAA 2C9XA 2DRUA 5GNZA 1H7NA 3PWUA 4JZOB 2VFHA 2Q7NA 3EOSA 1L4IA 3MMDA 1XLDA 4ZZKA 3H26A 6PTDA 3H2NA 3BPNC 4PBDA 4FXGC 3SQOL 2ADJA 3H7LA 3BESR 2XH0A 2F1BA 3DECA 3NTCH 2R1MA 1OSZB 4DO5A 4ZCWA 4DHGA 1OT1A 4AQAB 3G3MA 3JV6B 2ADFH 1PDYA 4KERA 2ESVD 1IO4C 4UUIA 4FLHA 4CNNA 4K3ZA 4UNUA 2W07A 4PJBB 4R97B 3NFPA 2EKGA 4O4VA 4ZSTA 1TETH 1N3NB 2F7IA 3N44B 4G6JL 5J6HA 5E00B 2VQ4A 3IDIA 3EYUL 3ZXWA 1M7OA 1K9FA 3BG3A 3FRPB 4G6KH 2HVJB 2DWXA 3MRMB 1D5MA 5M94B 2VEKA 2OO0A 3PV6A 3PWNA 4HLZH 3SCMD 5FGRA 4QXIA 5LGKA 2DY2A 2EVFA 1EC8A 3FAXA 3IJHB 4M5SA 4F9DA 1GAFL 5ALCL 1YTKA 1XGQA 2P88A 3GTHA 4R7JA 3NJXA 4YCPA 4PY8I 3VOCA 3C61A 1KCXA 3EHBD 3N9GL 5T1MA 2E27H 2FT7A 2WUCL 3W7QA 2D1ZA 1JZHA 1PQZA 3KPOB 2BWGA 4QTHA 3R89A 1I2OA 1I3GL 3TUUA 4LPWA 3MBWB 3W3OA 5KSAD 5DQDH 1HHKA 2QZ5A 3MLXH 2ISVA 1W72B 3ANVA 3KPNB 2OWCA 1Y1DA 4NO5A 3GYRA 3I9GH 1V0NA 4LMQE 4D6FA 1R3TA 3UXLA 3NAAL 1DWJM 4U1JA 4HAKA 2NY6B 5DZOA 4NAEB 5C8JA 3W26A 1MWOA 4O4YH 2HG5B 2BP1A 1ORQB 5I0YA 5F1SA 3NZ8A 1V6XA 4MWAA 5RUBA 4NAMA 5E9DD 3U82B 1MIML 4C56A 4XN2A 4FQQA 3ARXA 3QUMB 4J27A 3CPUA 3QR0A 4L3EA 4QYOB 5AYYA 3DKLA 3L9CA 5I8EB 1J8KA 1HKVA 3UTZA 4A6YL 3HGOA 4HK5A 3L0NA 3WNOA 4AM0A 1J0IA 4I2XE 5D1QB 1V54B 3GI8L 2X53A 4MAYC 4P2QE 4OZIA 3TW6A 4JFPB 4I0CC 2X6AA 1CB7B 1CE6A 1P0KA 2PTZA 4CGUB 4FZEL 2X4RB 4XN5A 3H4FA 1DIEA 3LCIA 1A49A 3V1HA 2VM9A 3QZOA 4WW2B 1OGAD 4MKMA 2QV4A 5AVRB 1B0WA 3PWLB 2XTLA 1ZA6B 3FTGB 1SVDA 4AQ8C 1UT9A 3VFPB 4IGNA 7TIMA 2IPKA 2JK5A 5I30H 1PO9A 1HP5A 3AHYA 1AOZA 3S8FB 3NEEA 3N1PC 2YD8A 2QADC 3SKOA 1IMHC 1TTFA 2CLRB 4YXHH 4Z8FL 3D0LB 2YEZB 1DLHB 3R8GA 1D8WA 1BD2A 3ZRSA 3NR0A 2D7OA 1OHLA 2ZBTA 4TOQA 4XXDA 4LLVB 3VXUD 2QDEA 5FF0A 1SDDB 1E3FA 3NQVA 2X89D 3WEOA 3R2GA 3KYOA 4WUUE 3DFNA 1F1DA 3S3PA 1E9OB 1PZ5B 1XH3A 4R7OA 1QKZH 1W1YA 2OLSA 2ENSA 4B16A 4LHUG 2QAFA 1ZVSB 4F7PA 3FOMA 1F00I 1BYPA 5F2FA 4BH7B 5KVEE 5FEBA 4O0ZA 1C7SA 2VKXA 3OB0K 4ETYA 5E2TL 3L48A 3LD8C 3N85L 2CLOA 2PS2A 3AI0A 4LAMA 3VSUA 4U5KA 5CD5C 3BP7B 2JVUA 1G0DA 4FC3E 5JBDA 4FQXD 3ZIMA 3AO0A 2EXSA 1Q2RA 5JW3L 1A5BA 2ROXA 4XCFH 5MKGB 4DM1A 3HZVA 3ULVL 4RETB 4WWKC 1W2PA 2PYED 4U7KA 4JX5A 2XFYA 3WQFA 2YX0A 25C8L 1C90A 2NLIA 3BT2L 5E6ZA 1UZ8B 4YWSA 4N42A 3WJXA 3DX8B 4PR5A 2D24A 2F6UA 2NCEA 1GCYA 3FIGA 5IVNA 2WMFA 2ARJQ 3FCSA 3QI9B 5E8NA 5AYXA 1EYEA 1M7JA 3QDAA 1AR1B 1IU1A 3UBXB 3RX4A 1TMQA 4P8XA 1V77A 5FB8B 5EMLA 3GDKA 5JHDE 1PCSA 3EDDA 2FX8H 1EBAA 2KS0A 2JB5L 4P05A 4P2RA 5FKAB 4P7OA 4LBEB 3BN9D 4PWKA 2PO6B 2P48B 3M6DA 5EZOL 5H6HA 3RTLA 3IFNL 1DVYA 3GK0A 5T1JA 1EQCA 4ZQCA 3OKKA 3N50A 4NUGH 1QQDA 1GC1L 4BFKA 4XBGA 3PL6C 3ZT6A 4AHOA 3FT3A 1NIEA 1PGRB 2HPMA 3PUCA 1AIFB 1A8ZA 2IAMB 5AHLA 4NJAH 1N26A 2F38A 2W9MA 5JQ9A 3BVWA 4WTZA 5FEWA 4KWOA 5M7QA 1MCDA 4NJ9L 3LZ3A 1IB5A 1HXYB 4K1GA 5DK2A 3NDOA 5H4ZA 2ZPKL 2WMGA 4FHKA 1J5OH 1TU2B 3C5SB 4B9IA 3E38A 3BP5A 5LHEA 1Q9OB 3CUFA 3IFLL 2RIKA 3L1EA 3KPPB 1OFRA 3BGFB 4RWHA 3QSKB 4XR8C 5GS0L 2D7NA 4LESA 1GZQB 3MNMA 3NCMA 1A5MC 4C6OA 4KFNA 1Z48A 3W11C 4E68A 3FDGA 4LFYA 2V5MA 2XV0A 4NJIA 2ODOA 1TJGL 5J12C 4N5ED 4X5QA 4L6OA 1NFDA 2VN7A 3ARZA 4L37A 5EMJA 3QXWA 3GS0A 2XVLA 5MF5A 1T5XB 5I8CA 3UTQA 1J1PL 3VA6A 2HVNA 5J1TC 4HCHA 2DLIA 1SQ2N 3LVEA 1UWRA 4NZUL 2VR6A 1AH0A 3GXTA 3RI5K 2AMXA 1CK0H 2ZSVA 5ICYB 2MIZA 2O30A 4YDMA 4I4WA 4HWBA 3EPMA 1SM9A 2EO1A 5BW7C 2UXGA 1E50A 2C13A 3BLDA 1IC4H 4BEIA 1OYAA 2IWEA 3TN0A 5I3JA 1G0CA 3MSGA 1H15A 1NWTA 4P59L 1FP9A 2F2HA 4QRRE 2APBA 4IRZA 4HG4J 4BE6A 3BGAA 4OLXL 1UP0A 1IBGL 3UR5A 3KPRE 3BLOA 3O2DL 2DJ4A 2Y5TA 3WFBL 3LSBA 1QAWA 5ACZA 2XIOA 3CSGA 4HHAA 3WBEA 4AMWA 3ZSTA 3AIVA 4G7SB 1MWAL 3FV9A 5A8QA 2YXXA 4M19A 3SGJA 5B7MA 3L95A 3GMLB 2X4UB 4U3SA 5FF6B 5AOMA 5E51A 32C2A 4FCHA 2XRAL 3VWJB 3HA0A 3RJDA 2KT6A 3TZVC 3MXVH 2ESVA 4OKDA 3ARFC 1YNPA 3GHEL 3CH9A 3UTTE 3UEZA 1C9WA 3G5EA 4JQAA 2B59B 2UY7B 1CICC 1LILA 1YEIL 1SZGA 3V0VA 5LGJA 4GNJA 1EJ8A 1V3JA 3QLLA 5GGUA 1MFCH 3SCMA 3DYOA 3VNDA 2BJML 4IU3A 2VL4A 5BZDA 3NWRA 1QPRA 3E74A 1FHUA 1Q94A 4ABVA 3FQXA 1IUZA 4P9HH 3FDWA 3INOA 3U7WL 4XC3L 2R4RH 3EFOA 1WKEA 4DOHE 3U6RB 5F72S 3TMQA 4S11A 3N1FC 4GKSB 1CGSH 4OLUL 5C92A 1DN2A 2B31A 4PJ5B 2UZ9A 3CO4A 5C9WA 4P5TB 1L3NA 3I74A 4OCSL 5KSAA 3UFIA 3M5XA 3CPGA 1QABA 1E0WA 3VFCA 3QXAA 1EX5A 3OHXC 4M48L 1NL0L 1CWVA 3LY0A 4YBQC 1AL8A 1UOLA 4UT9H 3QZEA 4NNYA 1QEWA 2Q7YA 5A8GA 1CG9B 1VFAB 1D5BA 2NLJB 4DLFA 3GSNH 3EO9L 3E3QE 1KCUL 5LCVH 2PCFB 2PGWA 3N1QC 4FYSA 3V4VA 4G8IA 2QGDA 4OH2A 5FF3A 1WUFA 5E9DA 4H4NA 4YTSA 1N6UA 4OIBA 4FE9A 1BQHG 3L3HB 3P3BA 2F7QA 5I79A 3D0VA 2ACUA 3O6FD 3R12A 5FYJH 1RK7A 2OMUB 3EJQA 1YEWA 1SFJA 4FGMA 4MNQB 5EU6E 1XRFA 2A5UA 3S3CB 1J4EA 3O0RH 3HPLB 1XCXA 4QHUA 2Q76A 1FV1A 4UTBA 1GMEA 4HXBL 2BCKA 2EG8A 5BROA 2P24A 1C8YA 1TV5A 3A4FA 3KLLA 2W3ZA 5LZLA 1QRKA 1N82A 4F5CA 1KTBA 3P4MA 4AZ7A 1OGAA 4B5XA 2XUCA 1T3FB 4IMEA 2VVSA 3N73A 4WDUA 1AK5A 1P5UC 3AMGA 3MW7A 3H8NA 2ZUUA 4G9DB 3TN5A 1Q6RA 1K9EA 1I9RL 2NY4D 4PRAA 1PYMA 3Q6GL 4TULL 3AYSA 3J2PA 4KTEL 1JTTA 1BQ5A 5FKPB 2CIKA 4ONHA 4JN1H 4RDBA 4K7PL 4IJCA 3ZU8A 1XHGA 4M8UA 4S1QH 3HPSA 4LSSL 3G5XB 1M42A 1AD0B 4HAGA 1FYTD 5BV7H 3VZYA 1RIUH 5IHBA 2NDGA 5I1CL 3R1ZA 4GUPA 2EQDA 2JJSA 5DGQA 4HPNA 4UQ9A 3B9KC 2EVJA 3VXUA 1LHZA 1H8OA 4PMZA 2NZ9C 3V36A 3LHPH 2CRYA 1GPWA 4YHLL 2X89A 3P2DA 4HISA 1CL7L 2V3FA 5T3XE 1I8MA 3CHQA 1TJRA 1ZMYA 5CPQA 4YHNA 2Z65C 4QXWA 4FZIA 1UOKA 4UTWA 5TGBB 2Z92A 3ONBA 4KY2A 1THCA 4UOW0 3DX3A 2MHAA 3VWKD 2ADGA 4RBPH 1B0RB 2BOGX 1XCFA 4WK4B 4L0YA 4OCXH 4GG9A 2N1KA 3QE5A 4Q8PA 1YN7A 1L6WA 4YZFF 3MC0A 3VXQB 4ELKB 2AGJH 1JPTH 2BS71 3TYZA 3TBWB 4N6FA 4FQXA 2J8UF 5C7ZA 2ICWJ 1P53A 4KKPA 3T78A 1NSJA 3FT1A 1DIOA 1HFBA 2BFGA 3LEXB 4KQ3H 2PLKA 2DQIH 2PYEA 3KBPA 4MYWB 4QR6A 4WOQA 1O9VA 2K7PA 5C0CE 4FIRA 2OMZB 4JS7A 4HVBA 5DBTA 1E5AA 1E42A 4IMKA 1I1WA 2X3BA 4UIMA 5AD0B 2OQJA 4KESA 1XRSA 1MMFA 4KMLB 5XIAA 1O5QA 3V5FA 3M0JA 4IIGA 4G83A 1T7XA 5D2LB 1AHWB 1K8YA 1CGWA 3V9FA 3EWWA 2XKNB 5F0PB 1A5KC 4N2OA 2KMWA 1E8XA 4EXKA 4HZ1A 5A7EA 5IJDC 3C4UA 2P80D 2DLGA 5JYLA 5DO8A 1NM9A 35C8H 4L2YA 3QDGE 1YEHH 4JFOB 3WTTA 4ZPVB 3MODH 1IKOP 3D87B 4KWSA 3P80A 3DHJA 4R4BB 1YDVA 4HU3A 3WHE0 5IF0B 2VFEA 5F7DB 1U8KA 2GQ9A 1N8FA 4QHMA 1UXSA 2Q86B 5EF1A 4RAVA 3QUXD 4LOFA 2J47A 5ADOH 3F83A 3CFKB 2P8MB 3QDMB 2JK2A 5HI4C 3MUGB 2ZKXA 5DRNB 3HI1A 1KG0B 4QY8A 2GUYA 3QRHA 1M05A 2HTKC 5L2KB 4G1MB 2ZDSA 2GK0B 1XFBA 5DCEA 5GZOD 2PRMA 1RVGA 4HZMA 4JO1H 5TQ2L 5L6UA 1V3HA 4GY7A 5ADPL 2I57A 3GO2A 4YTUA 2FTYA 5T26A 2NY3D 2ZXEB 5EOTB 3MVSA 2DQJH 1O6TA 2V68A 3G1RA 1XG3A 1E5CA 5I75C 3LCHA 4L56A 4TLUA 5CZKA 3F7LA 3VI4A 1ZAIA 4U1HB 3UZQB 3QUZA 3FA4A 4LRSA 2FHCA 3MAWA 3U2JA 2HVMA 4ZTOL 4FIQA 1BIIA 5FO8A 3KVMA 3X3FL 1FI8C 2GG1A 2FBRA 1XZ0B 3ULUC 3V0SA 3NSNA 5IHSA 5KG9A 3UZEC 5HI3D 1CX9A 2WVVA 2QCCA 1JNDA 5T1DH 2R0ZH 3HE6D 4A55A 4XB3A 5IWLC 2UXFA 4Q7IA 2JGYA 4NRXA 1H7RA 5TPWL 3GSUA 5J4MA 1ID5I 1JUFA 5DURB 1S2CA 5FO2A 3IWPA 3X13A 2TAAA 1WC7B 3W56A 3DRQB 4AWEA 1OC5A 3M1BB 3IVSA 1QFOA 5BMFH 5G4WA 3BVDB 1SLVA 1N2RA 3NACH 1TV2A 1FGNH 1FN4B 3V75A 5GJNA 5JORA 1X98A 2ZG2A 1E27A 1GW9A 1DVFB 2QGHA 4EI5B 3CJJA 1XG4A 3FO9A 1SVCP 1RUAL 4EO5A 3ISWA 5HSFA 1OVZA 3FCPA 1XF4B 4XOEA 4WTQA 4YWGH 2K0RA 1A1MA 2E7DA 4KROB 1S9XA 5E8PA 3EW3B 1DBTA 4PIRF 4UT6A 4O02L 2UY3A 4HQQH 3WIHA 1UZ4A 2PTTA 1OFPA 1ACYL 2GVEA 2BBFA 4RBPK 1CFSA 2YZ5A 3TFXA 2VMEA 4HU0A 3PQYD 3WLTA 4X4XA 1IZJA 3TBCA 1VAHA 4HZAA 3QFDA 1CTOA 4A4AA 1FWRA 3BO8B 1B3ZA 3DBNA 4JTKA 5F89A 1OARH 4ONOA 5BRPA 1GOMA 4L6DA 3RVUD 4OV9A 3ARGC 3SW6A 1PZSA 1U58A 4MY9A 5IOKA 3K30A 3ULSB 4NP4L 2ZJSL 4GYPC 4QWWD 1QI0A 5F1UA 5G2NA 1MFAL 4NJJA 3IVKB 1M3JA 3REVA 1ED3B 2ITFA 2C1PA 3SGZA 2PP7A 4HJGB 1R7OA 4NKIH 3H6JA 4A2RA 4X6FB 1FCCA 5MENB 1GKEA 4FJYA 4K23H 3H2OA 4PJCF 2E5EA 3RU8X 2XWBA 4F33A 2B0SL 4TUJB 4KKBC 1TIUA 1QBML 4FG0A 3OJDA 2K9FB 1KJ2L 2F1AA 1H1ZA 3QTGA 1GK8A 3ERXA 4O2EB 4L4TB 3ABRA 4FNLH 1EZ2A 2J6EL 3B6SB 1FG2B 1MCWM 1LT8A 4E9TA 3D05A 4ZFGL 5G55A 1UG9A 5DEFA 4ZS7L 4GH1A 5B8CC 3OV6A 2GTZB 4Y7EA 3BZFA 3WK1A 1JS4A 1TYGA 2GHWB 2CIPA 4YYFA 4YEEA 4N28A 4G8EB 4R5XA 1F86A 3LAFA 4WCJA 2X2YA 1QFWM 1JVLA 4XXWC 3HAEH 3L7FB 3O6FA 4N0YL 3CS2A 1YNYA 4PTTB 1CWYA 2UWEA 5DC0A 3IVTA 5EBUA 3GSNB 3DSFH 2NY0D 3GS6A 2E74C 3CX5J 4B9JA 3OLDA 3MRBA 2G2RA 4Q22A 1W2KT 1U8OB 4LCCB 1L6XA 3HG1B 3HKZA 3NH7L 1TR1A 2WKJA 3KBSA 3G5VA 4U6YA 3CFIC 3RWCB 1JPSL 1JHTB 4GSDL 3QLDA 3R0MA 3R8HA 5A40E 1F56A 4AY8A 3JV5A 3BAJA 2E28A 1OWQA 4JJ5B 4JY4A 3KBNA 4RRPG 3D3VB 3DCPA 4RISL 2O93L 4RNJA 3EBHA 4TN9A 1EMTH 2E1WA 1ECZA 2HLFC 2DVTA 4W7VA 4E2DA 4LQFL 1FYTA 4MHHG 5J5EA 1HEJC 4ABUA 4CSZA 1FWAC 4MVBC 2XY2A 3EDFA 4D9QE 3SKUD 5KSBB 2AEIT 3NCJH 3AWOA 3C08L 2W62A 1IAIL 5SWSE 1Q0YL 4UTAA 5BV7B 4P2YA 5IVZA 1DVZA 5L8JB 2MNWA 2DIKA 4HWBH 4CC1A 4CNSA 1FL3B 4NC2B 4QCIA 4L4OA 2ICEC 4IOIB 2I07A 3AIUA 2PDWA 4A8IA 1ITQA 3VWKA 4Y6GA 2IBBA 4GI8A 2PTUA 4ODWA 2P49B 3GSXB 1HYSC 3H6OA 4GB9A 1ZENA 5T3ZD 3VXRD 4RNRB 3TA3C 3S1WA 4PREB 1DR9A 4IRZH 3AT8A 4U6VL 4XCYA 3Q3GB 1ROWA 3TBSA 3TP4A 2OSLB 2QDVA 3RTQD 4JG0H 1XCWA 3JT0A 3RAOA 4UWQB 4R9HA 1K02A 3VIHA 5ILTL 4NP7A 5LBVA 3MJ7B 1NPUA 1NAL1 1QR4A 3EOAB 2J55A 4IFKA 2L04A 4I5BA 3VSTA 1NA8A 2EE2A 5D1XB 3PWUB 1EGJA 4Y9EA 5DXXA 1OW0A 3NIGB 3RDTD 1NLDL 4JB9H 2Q02A 2ZUQB 3EMZA 1QNQA 1EGMA 4LLYA 1CXLA 4J3ZA 4ODXA 1QG3A 5AWNL 2ADJB 2OZ4A 3AG4B 1ZT1A 1OAXH 2QPDB 5C97A 3CSFA 3C56A 3F04A 4ZOCA 2WQVA 2ZZ6A 3QZWG 1MKFA 4JQIL 3AXXA 2A9CA 3C87A 2X40A 1DUYB 3B9OA 4MNLA 4YAQA 2W07B 1GVFA 3NFPB 4KMTL 3RHWK 4CC4A 1SUJA 4FEZA 2RGMA 4EAEA 1HSAA 5J6HB 3N1MC 3IDIB 4TIMA 3T0AA 5F2MA 4JKPL 1ASPA 1NANI 1NCTA 1D5MB 3IBOA 2A85A 3BDYH 3PWNB 4HJ0D 2IH3A 2YOAA 3W84A 4XTIA 12E8H 1HS6A 3FTSA 4MJ6A 3T6CA 3QUXA 1HKLL 4K5MA 2GQAA 1A6UL 5IXEA 3ZE2B 4XV0A 1XGQB 4JG5A 1LK2A 5HUOA 3SD2A 5F7BA 1R1CA 1KIRB 4X7TA 3A4JA 4JM2F 3JRKA 2Z91A 3FZUC 3TIMA 1SXNA 1R34A 1PQZB 5LN8A 4QTHB 1OFAA 1GYUA 5JPMB 2E25A 5GZOA 1KO0A 1S2VA 2W0KA 3G1XA 3V4VH 2BV9A 1HHKB 3URAA 2I69A 5CGBA 1KCRL 4ZVJA 2AVGA 3FTVA 4XP9H 4U1JB 4H9ZA 4FFZL 5I6NA 4ZMOA 1SFTA 1O7SA 1GSKA 5C8JB 3ZTNH 1K6WA 1CVSC 3VB8A 3QIUD 3IIZA 2TRYA 2GBAA 3TO4D 4K94L 3NZ8B 4MWAB 4KS0A 3JVFC 4KXZH 2HXTA 3MRPB 3GBMH 1PCWA 4DERA 1T1ZA 4FNUA 3EX3A 1LK3H 3U7BA 4C56B 3WFAA 3EMCA 4FQQB 2XZ7A 5AYTA 3US9A 1S7XA 4L3EB 2B2XL 2YAEA 5FAJA 4W5UA 4Y5YA 3QJSB 4TVPL 1MI3A 2ZC1A 1Q72H 1IEHA 4F2TA 3FQYA 4FOJA 2ZT9C 3UTZB 4FX5A 2DDXA 4AM0B 1B2WL 3EX1A 2VAAB 3U4AA 1GA2A 3VIKA 3HE6A 1KFAH 1B90A 1HILA 3UG8A 1JFQL 5JMRA 5D2NE 4OZIB 1QMLA 3KHQA 1CE6B 5HMSA 5CC7A 1W54A 2APVA 1EXPA 1UKPA 1NMBH 2VT0A 1HL9A 1IC0A 2QGEA 2YJQA 2W65A 2NUYA 1FFRA 4W9IC 2OWXA 2J5LB 1ZLWH 1TENA 1UQYA 2G9KA 2M83A 1A6WL 2VQTA 4TYUA 3K1KC 4Y4FD 2QV5A 5F7EL 3P62A 3SGGA 3NK3A 4WOZA 4ZEPA 3C60C 1JTPA 5CGTA 2IPKB 2JK5B 3MLYH 4YZFE 4FKKA 1MEWA 4ZX5A 2ITEA 1KV7A 3LCLA 2L0DA 1TLMA 3UADA 4UCGA 3CFQA 3CVBA 2J8UE 1IHIA 1FKXA 2Z93B 3H9YA 5FD0A 3QPZA 3SKOB 5JQ6H 2P5EB 1P6WA 1CLZL 1BD2B 3SDDC 4XXDB 4PS7A 1BDYA 3BPWA 4B9FA 3GTVA 3PQYA 2W5PA 1XLLA 3ISIX 3KYOB 1TSHA 1B9KA 1XBXA 5I1EH 2INEA 2ZWKA 3MWCA 4F7PB 4LZKA 1JWSA 2NV1A 5FV1L 3FOMB 2D4DA 4XISA 2CZFA 2HS8A 3ZE0E 4OU3A 1XXFC 2W4XA 1HKKA 2FIKA 8XIMA 4MD0A 1GY1A 1XLAA 2Z2UA 4IBUA 1R3IH 3EEGA 3FULA 4XPHL 1X8FA 3FCTA 2C0HA 1II4E 2D23A 4YHPA 1K2DA 3U7YH 2OJZL 3EOUA 3P8JA 2YDSA 4KVNL 5EORL 4G6CA 4EEEA 5HHPA 1QSFE 2YD0A 3UP1A 4Q4RA 2G0KA 2MCAA 1E6JH 3HZVB 5ESVA 1SQMA 3RGHA 1N64H 4Y2DD 2NNFA 3RRXA 5DI8A 2R29L 4MS8D 1MEXH 1MRDH 2RGLA 4PR5B 3B2VL 2XXGA 1KRBC 5C8BB 2L4OA 3SY1A 4WFED 3BTNA 4LS1A 3UZJA 1NFIB 3FCSB 2R1PA 5E8NB 3QCTH 3LS5H 1U0QA 1Q8JA 5DRZA 5E9NA 4OB5L 4DETA 1JE6A 1W9UA 5I1HL 1YE6A 4C1NA 5A7BA 4P2RB 1KM1A 3F4DA 4W9ZA 4XAZA 3VM7A 4DX3A 4FHAA 4OGZA 3OG3A 1MCKA 3MA9H 3UYRL 2COVD 2HX9A 3E3QC 1AFVH 5L2JA 3PJWA 5DD0L 2WLHA 2HK1A 5LWYH 1RZKL 3OKKB 1OCCB 1QQDB 3OG4B 4XBGB 4P4KD 1CW2A 3T2LA 3MT1A 3FT3B 1JPMA 4L1SA 4LSRL 1RURL 1KM4A 4YMZA 1W1VA 4XVTL 4W4OA 4D8PA 2A6NA 3NSDA 3STEA 1X9UA 3LEVL 1X5MA 4UNIA 1MNUH 4PUJA 3M5YA 1FWJC 1R3SA 2VFGA 1FPTL 4ADSA 2Z35A 3FB8A 1WAAA 1MPAL 5DJ0A 3WYRA 1E5BA 1X1OA 5DK2B 4M5ZL 4XZLX 1HJCA 4ZJ9A 4RZBA 1F45A 3NIYA 2DICA 3DX4A 2FD6H 3KFTA 4H9VA 4X6CA 3WEAA 2KDYA 4CKVX 3CH8A 3BP5B 4ZMLA 1VGKA 1VADA 1SVBA 3H23A 1VA9A 3KW3A 2GYSA 3RMEA 3SB3A 3SY8A 4QRBA 2P0IA 3A3XA 5EB8A 1Y65A 1UROA 4PCFA 5HDWA 1IEAA 5DS8B 5FEPA 1J8HE 1ZXQA 2ZX6A 5AAWC 4TNWF 2Y70A 4PJEF 3DKJA 3WTWA 4LX4A 5DWPA 4B41A 3QZBA 3QEHA 2BOLA 2X1PA 4P3DA 1VFFA 2ZCKL 4KFZC 1NFDB 7ODCA 1JPFA 1UT1A 4L37B 2VC5A 4NO0A 4WWOA 5BZXA 4QDPA 1ZLWK 5EIIA 3UTQB 2VERA 3T42A 4PRIE 4NERA 1VSCA 3P4LA 3KP0A 4EAYA 4HLZG 1IGIL 2GW5A 3TYDA 3VXRA 2ZSVB 2B16A 1RULH 1VCBC 3KS5A 5GHWH 2G3IA 2IAAC 4I4WB 5CSRA 1E1CA 1UYWL 4MD5B 2LE9A 4JGDA 2FX7H 2IXUA 3B8IA 3RTQA 4UT6H 3RIAF 2J44A 4L1WA 2F53E 3WIHH 4CNOA 1HI6A 4GBDA 4IPLA 1XIBA 1JHKL 2ZUMA 1R6WA 3WIAA 8FABB 4PJDA 3F6IA 4XPAL 5I78A 1A6ZA 1G9NL 2IOOA 5EEYA 2VCOA 1RAMA 3CIWA 4L3AA 4B7IA 1OLLA 4A7GA 3RDTA 2Y5TB 1A7NH 3TWCL 5ACZB 4HHAB 2CGYA 3VNMA 1ICPA 4JUSA 4PJCE 1M04A 1E4LA 1P4CA 4JO3L 2GY7B 1QYGH 3L95B 4U3SB 4E4FA 2D22A 4HP5A 3MP4A 4KY1H 4H0GA 2ESVB 3UCRA 2PTYA 1FA4A 2DQFA 5G2HA 1KB3A 1AACA 1YNQA 2I25N 1NJJA 4ES9A 2QNEA 2CW6A 3QYSA 4RH4A 3JZYA 3S2AA 1AW1A 3NA4A 3V0VB 1B3WA 5LGJB 2AK4E 3RN6A 3ZVVA 5GGUB 3SCMB 1UWIA 3CLWA 2WOBA 4IU3B 5BZDB 5LNWA 3CBRA 3ESOA 1BVNT 1PSKH 1NKGA 4EKXA 1L0PA 1Q94B 3KRUA 4O58L 5FUOH 4JTIA 1MCNA 3FQXB 3CDYA 3M45A 2EUZA 5I6LA 5DHXB 1UWEH 2ERJB 2JELL 5ECVA 4O8AA 1W9PA 4GXFA 2H3NA 1I7UA 4BEQA 5A43C 3BCFA 4B0MM 3C5XA 2P47B 2J25A 3K6IA 4LP5A 3LOTA 2CBMA 3EYSL 1XLKA 5KSAB 2R0WH 4HJJH 1HAUA 2ENYA 4ZA0A 4LVHB 4YS1A 1SDYA 2GDVA 3K91A 3A13A 3QG6A 4NNYB 4TSCH 4G43A 1QEWB 2Q7YB 3BQUC 4AEHL 3V3WA 2WPGA 1GVRA 1AG1O 3QIUA 4PWIA 3TO4A 2YD7A 3V4VB 3TLQA 1RQ5A 3BGMA 5E9DB 1SSGA 4UBDD 2EJ1A 4PD4K 3UZWA 3AAZA 3ZE1F 1OCZB 2ZXCA 1Q7ZA 5DWUH 4Z3EA 4KF1A 5CZVL 1T6MA 3NPSC 3P8IA 1PHQA 2JFEX 3WLLA 3CUHA 3S96B 2DQXA 3FYYA 1U33A 2K3HA 4QHUB 2Q76B 1FFPA 1FV1B 1UD4A 2BZDA 4C60A 1PX3A 2BCKB 1ZXKA 3VTRA 2A79A 2W5FA 2P24B 2X4OA 4OIAA 4YJZL 4XPTL 4Q4MA 1EWDA 2UZXA 8XIAA 2R83A 4HNTA 1SXZA 3P4MB 1OGAB 1TKKA 2H2PC 4X7DC 2HFGH 1JAKA 1YKWA 4PMXA 5KS9F 4Y4FA 4PRAB 5C0BE 4XWGH 4Y8FA 3EYVA 4A2HA 5K4XA 1M4KA 3QHFH 4F0KA 3PNUA 4M8RA 4EWND 3QHOA 2CIKB 3D69A 4ONHB 5FOBA 3LZFH 4PG2A 3T4YA 1S38A 5L88L 1NCAL 4BH8A 3LEYL 3QRGL 1WOAA 2DMCA 4UTAH 2EVGA 1XSIA 5I74C 4N4PA 2NMSA 4GUPB 1ZT4A 3BKYH 1AR2A 4HIPA 1YDYA 1WFUA 1EERB 4Q9QL 2NY5L 3VXUB 3A3YB 1V08A 3JV0A 5D6CA 1SYTA 2C0AA 5F1NB 4V1XA 3MLVH 1I8MB 2YB4A 1TWZA 2BP0A 3D47A 5A3ID 4YHNB 4ALDA 2Z92B 3EG9A 3I9AA 2MHAB 3V6OE 2ADGB 3O3EA 3IFOA 3O06A 5LQBH 1P7KA 1L6GA 3FQUA 4QITA 3EAUA 1YN7B 4ODSH 2XYBA 4NG3A 2F6XA 2F8VA 4U6TA 1NWPA 3AAMA 5CN3A 4FOUA 1KCWA 3UJSA 1EGJH 3GNRA 3W75A 3B5GA 1JZDC 4TL4A 3KWTA 4ZE5A 1X8CA 3KVLA 1NCJA 4JY9A 1SO6A 4IRSD 4Y2DA 3AS0A 2Y5QA 2PYEB 2UV8G 2QPEB 1IT9H 1DVQA 3REWA 1AGDA 4M1GL 2OZ4H 1GGUA 3LQZA 5JMOC 3LENA 1ZHNB 4RV3A 3F7PC 1XF1A 5K9QI 2GBVA 2R2EA 2X16A 5CO1A 5GGRY 4TQEH 2ETWA 1JCMP 2WBXA 3B5TA 1QNZH 4UIMB 2OQJB 3U2ZA 2CRIA 3OMIB 4Y19E 3TASA 5EN2A 5EO9A 5DVKA 3G1DA 5FK9A 1O7DE 5B39A 3O6DA 4QXGL 2XVNA 2F8OA 3LGGA 1WA0X 1UM5H 3F6JA 5C54A 3QQNA 4ZFZA 3RWDA 3LV3A 3ATZA 4AKPA 4ZO6A 1VGAA 2D03H 2DQ6A 3LVTA 2GSGA 4P3CL 5J8OA 3ZTJH 3TR2A 3QO0A 1MCBA 1W9XA 2AJZA 4TQTA 3RCYA 4LL4A 2QCLA 4BV1A 1IKFL 4Q8WA 4JIEA 1BVKA 4LLWA 1YYLL 2YPKA 3UPRA 3OA3A 3W7LA 1BF2A 5HDBB 3U48A 1MELA 3SN0A 3OJVC 4P4KA 1SMDA 1U8KB 4ANVA 1TJPA 3WQWA 4QHMB 1UXSB 4I3RL 4RAVB 3OA5A 4RA0C 4PBVC 3STLA 2WXLA 4HQVA 3BCJA 4H88H 1WT5A 3IEBA 3A3HA 3KPMA 1TXKA 3HI1B 4YHML 4QY8B 3C3NA 3WI9A 4G42A 1XH1A 4JTQA 2H2SC 5I1AA 2WYIA 1CLCA 1M05B 4R8WL 4DBDA 3IXAA 4GFSA 2ATPA 3HG0A 1NBVL 3SN4A 4KOCA 3MHFA 3CFDA 2MQCA 1A4KA 1INEL 4KUCF 1SHWA 1J01A 4KCTA 1JZ8A 3P2TA 3G3LA 3O2VH 3VI4B 3BVVA 5H2BA 3QUZB 1IEQA 2PI6A 1D5RA 1JDAA 2TMDA 2VTFA 5KUMA 4A2MA 1I9EA 1BIIB 5FO8B 3VIPA 2G41A 1A3QA 3N2CA 4ONVA 2AI0L 1WYJA 4X8CA 3CZGA 1FWXA 4G2DA 1DQQA 4YE4L 2IO5A 2NYYD 3L67A 5KG9B 2YN5A 5BOOA 4M6MH 2WVVB 1EJTC 1DANU 2X1WL 2BW5A 2UVFA 5J1AA 1O1HA 4XNXH 5HHVL 1GZHC 4NHVA 4MJHA 4HNUA 3GSUB 4QXUL 2FEDC 1H3VA 1JUFB 4A38A 3X13B 3SJVE 2DIEA 5E4OA 1TFPA 3AG1B 2Z7GA 3A0OA 4PSRA 2VELA 4MZ3A 3O9WC 1KXQE 3IRDA 3GZAA 1N2RB 3EJUA 4I5XA 3W2KA 3P2BA 5JORB 1Y5VA 3U1SH 1YG9A 4DJDC 5HGHB 3GBEA 4JFHE 4S1DC 2UX6A 2QFPA 3FO9B 3O4OB 5HHMD 1KC5H 4R7NA 3V4PL 4K8RL 4FNSA 3W82A 5CD3B 1A1MB 2INFA 1S9XB 5E8PB 2IGFL 3DO4A 3WUBA 3BQ6A 3TN6A 5I6XB 2WZPD 2PTTB 4ZNEE 4ZMQA 4JFEE 3HURA 5DQJA 1CFSB 3L4CA 4CMHB 4E3TA 4AD3A 4UTJA 3T40A 1J8SA 3HS8A 3T81A 3ATAA 3NCCB 4X4XB 1UR1A 3KGSA 2IDSA 3QFDB 1P7HL 4N2EA 4GG8A 1S7VA 1V8EA 4P7QA 1W37A 1EC9A 1DTUA 3DUHA 1U58B 5CJOL 1MI5E 3TX9A 1AI1L 5KVDL 1CDGA 3LH2H 4M62H 1R24A 2GVYA 5E5RB 5DMKA 3RITA 4FYRA 1GZJA 4PJAF 1N18A 2C1PB 3ULVF 4IX2A 4QM1A 4WUKL 2OTPA 1GC1C 2JQZA 1K6QH 5CBJA 5I1IL 5FM8A 4NQXA 1LP9F 2L3BA 1KR0A 3TJ4A 1UD2A 1U1HA 5AAMC 1EKOA 2XWBB 4F33B 2Z7WA 4MA7L 3O2WH 3S88L 1DYZA 3JR2A 5BRQA 4HSCX 3OJDB 1QBBA 3WKML 4WTWA 4MDOA 2PETA 4F0LA 1UZ1A 3IM1A 3PYCA 1DQDH 1NQBA 5BYWA 1JRHH 3LDVA 4R7DA 4EN3D 1R30A 1R85A 3QZAA 4FLOA 2PWUA 3ECWA 4HIHA 2KLRA 5DEFB 3UWZA 2J8TA 3M43A 4PP2A 4XP5L 3TESA 2HS6A 1GT8A 5GS0C 3KGRA 2L5HA 1E0XA 3VRJA 1X3DA 3T2NH 1O6IA 3SJNA 1C92A 1OFEA 3O6LH 3QMSA 2PBOA 3LHTA 2FWOA 1KPRA 3O6FB 2GHZA 2UWEB 4AG4L 3CVHA 4M7LL 1WBYA 2WZIA 1Z5YD 3WQOA 1AH3A 4DK6A 1GYNA 3TNBA 1JOIA 4AITA 3MRBB 7TAAA 4X8XA 4UDTA 4PJEE 2G2RB 3V7PA 2JCCB 1SLWA 4KHTL 3NFUA 4CN4A 2J9ZA 4PB0L 5SX4I 1DJHA 3M6YA 3W7KA 3MRRA 3G5VB 4U6YB 2OK0H 1H3PL 4H40A 3N41F 1FP5A 2YDAA 5D05A 1J0KA 2IC2A 5EEWA 3LTSA 1KRCC 3AWGA 2NY4B 3MJ6A 2DW5A 1H7XA 3BW2A 3QNXA 2WYZA 2UZIL 2GWGA 4K3DH 1DPMA 1VENA 1CIUA 5D2NC 4HJIA 1A5AA 1E3ZA 3A6BL 1WWAX 4HOMA 2A7RA 2VDPL 1H5BC 3PXHA 4TSBL 5DR5H 4UT7H 5HQEA 1E70M 4DKFL 2IPTL 2OB3A 2F9BT 2BRRH 4KPHL 5KVMC 2UY4A 1H9DA 1UTDA 5TIMA 3A3WA