1PPIA

The active center of a mammalian alpha-amylase. the structure of the complex of a pancreatic alpha-amylase with a carbohydrate inhibitor refined to 2.2 angstroms resolution
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
b'QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title The active center of a mammalian alpha-amylase. Structure of the complex of a pancreatic alpha-amylase with a carbohydrate inhibitor refined to 2.2-A resolution.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase (o-glycosyl)
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1994-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ppiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ppiA01
1E0VA 2O9OA 3WD2A 2G3JA 1NWRA 1CWYA 4ZFMA 2J79A 1NWSA 2CBJA 4FNQA 4UFIA 1KXHA 3VDHA 5A8MA 3TONA 1OGSA 4CVUA 3ARWA 4UQAA 2CBVA 1BYDA 4F79A 4L4OA 4GQQA 1MYRA 1W9BM 3PTKA 4QFUA 3HG3A 4FMVA 2D2OA 3GH7A 4JCMA 3ARXA 4KH2A 1E6ZA 1E1FA 4UQ9A 3AI0A 3MMUA 1G9HA 3UG3A 5FCZA 1WE5A 1EOMA 4U2ZA 1HIZA 3G6LA 1UR4A 3OGSA 1E6SM 1JZ3A 2IXUA 3AHTA 1UR8A 2BV9A 3GXFA 3MUZ1 1PX4A 3S5ZA 3M7SA 1R7OA 2OSXA 3BXWA 2XIBA 5HXMA 4GINA 1QWUA 3HMCA 4GO8A 2XM2A 2EPOA 4UFKA 3F5KA 4K68A 4J27A 2WVTA 2CXGA 4OIFA 1BTCA 2FHCA 1BVNP 1HTYA 1D3CA 1Q4NX 2OYLA 2WW5A 4JKMA 4DWSB 2A3AA 1JAEA 2Q8XA 1GUVA 2ZUVA 3N04A 1OM0A 4NX0A 4C7DA 2CBIA 4KWUA 5EMYA 5KEZA 1OBAA 3CUFA 3ZIZA 3OGVA 1CGYA 2BY1A 3AIBA 1MW3A 3GXNA 1E5JA 1VBUA 3VMNA 3F5JA 1UKOA 3LXCA 1PIGA 4L4PA 5CLTA 1BYAA 3EDJA 1LL4A 1V3KA 4J3TA 2ZUUA 3CZJA 2ZX9A 1CBGA 5IHSA 1WZMA 3W0KA 2D22A 3BH4A 1DP0A 2X09A 1OWQA 1W9PA 2J8GA 3A4XA 4GI9A 3GNPA 3SIMA 3J7HA 4E8CA 5ABGA 2EBNA 3IANA 4IISA 1V3IA 4JKLA 4MDOA 1CECA 3OZOA 2J7CA 7CGTA 3OA5A 3LPOA 4WSJA 1GOOA 3W26A 4J3XA 2YJQA 2WK2A 5C71A 5E1QA 2Y8VA 5A94A 3S2CA 4NI3A 2ZX7A 1VFUA 3BMVA 1UWUA 3OLEA 3PN8A 4P7RA 1K9EA 2D73A 4PEEA 4AC1X 1B3ZA 4JCLA 2XFFA 2X1IA 1AVAA 1LWJA 1QNPA 3BAYA 3MKKA 1DHKA 3TA9A 3NSXA 1PIFA 1BF2A 2Y24A 5D4YA 1EDGA 2O9TA 1VENA 1QI0A 3OLDA 1RD6A 3VILA 2WSPA 1B90A 3WDHA 1O7DC 1A47A 2E9BA 3WL1A 3S6TA 3U5UA 2WSKA 3VMOA 4WJXA 3WY3A 5E0FA 3U7BA 2WC7A 3VKKA 4UFJA 2VCCA 2VVNA 1BGAA 2VZSA 4YPJA 4AMXA 1UD3A 3UESA 1CDGA 1QWNA 3HG4A 4PMQA 1GOWA 3IK2A 2NT1A 1OT1A 4W8AA 2F18A 3W37A 2WPGA 2VNCA 2MANA 3AS0A 2BVTA 2DSZA 1GQJA 1BG9A 3TV8A 5A6SA 5AYIA 1X1NA 2D24A 5E70A 3VOCA 2QPUA 1D7FA 3D4YA 3I3DA 4MB3A 1MQQA 2FH8A 5A6MA 2XN0A 4HOZA 3QR3A 5I78A 2CHNA 1E4MM 3ZOAA 2YA1A 2UY4A 2EPNA 1TCMA 2Z1SA 5I3DA 1E0XA 2DSVA 3ARTA 5LA1A 1J0ZA 1ZS2A 1Q6GA 2F2HA 2BVDA 1WPCA 1NQ6A 2VJXA 3ZSTA 3HZ3A 5BROA 2W66A 1JGIA 1CNVA 4UZSA 1GNXA 1VF8A 5A2AA 1BVZA 1V3JA 2G4FA 4IM4A 3A4AA 1TQVA 3LX9A 3DX0A 3EMZA 4Z2JA 2WHMA 2V5CA 4AYGA 2OW7A 5M5DA 1E56A 2X2YA 3E1F1 1TUXA 1AMYA 4BQ2A 2BY3A 2E4TA 5A6BA 1XD1A 3WNMA 2O92A 1CTNA 4PMZA 1ZBCA 4D6IA 2BHZA 5GQBA 5JBFA 1KGXA 2UY5A 1OSEA 2OYKA 3N18A 1ODZA 1KBKA 2DH2A 4HMDA 3A4WA 4E8DA 5FD0A 4HA3A 3WKZA 4XZWA 4AWEA 4D6DA 2WB5A 3NIYA 1DWIM 1U2YA 2BVYA 1HVQA 3WMSA 5AYBA 7A3HA 1UKSA 1QHZA 4PMRA 4TUFA 4HMEA 4CN6A 1QVBA 2D20A 1B2YA 3AYSA 1E4LA 3OLIA 3DX4A 2W4XA 5D9PA 3VIPA 1J10A 5DMYA 1XCXA 2ZWYA 2DT2A 1J0IA 3VU2A 3VIOA 3RPMA 1B9ZA 4D1JA 3SCTA 5A95A 1MQPA 4J3WA 4NSBA 1UKTA 2IUZA 2ZUSA 1W9DM 1JDDA 3EJRA 5EFDA 2XPKA 5A8NA 1GJWA 1HJUA 4WKHA 3WUGA 1UD5A 2W67A 1VAHA 3QHNA 5C8BB 6CGTA 4FNUA 1VJZA 2YLAA 4AD3A 3PZUA 4MB4A 2JFEX 4CN4A 5CPTA 1UQZA 3BUIA 5A3HA 1SR0A 3VD4A 3EJTA 2WZHA 4H04A 5KZ6A 1E1EA 3CH9A 3VD7A 3WL0A 2C0HA 2X05A 1ISYA 1UHVA 4PSRA 2YFOA 3MS8A 5A8PA 1JYVA 1HL9A 3TTSA 4W87A 4B9YA 4AD5A 3WENA 4S3JA 2WMKA 1TFVA 1XH2A 2V5DA 2J7EA 2WLYA 4BS0A 1CYGA 2J7GA 2VR4A 2ZUWA 5HPCA 2VCAA 1GW1A 1IV8A 4NZCA 1JZ7A 1GHSA 4U33A 4UQCA 3L4VA 3AOFA 3W27A 1HWWA 1KGUA 3GXMA 3CZSA 5CSUA 2ZUNA 2ZX5A 3CLWA 4BCEA 4EK7A 2PWFA 1JZ8A 3THDA 3EJUA 1R7AA 3WBEA 3UR7A 5E0CA 2PB1A 1XYZA 3W6LA 4M82A 4FNRA 2DGAA 3IAPA 2JEPA 3ZT7A 3GNRA 2FH6A 2WMJA 2VRKA 2WYSA 1M53A 1N82A 1CENA 5D8ZA 1HJVA 3RDKA 4AMWA 5E9AA 3IGUA 3AJ7A 4GQRA 1JL8A 4WKFA 3WH5A 1PBGA 3GDBA 3DHPA 4H7VA 1VJSA 4PTWA 3BUDA 2F7OA 3LRKA 1BYBA 5DF0A 3SCVA 1GCYA 3CZKA 3AXHA 1VFMA 4AZCA 3CHCA 2J4GA 1ISVA 1JDCA 3BSHA 3SCWA 1BPLB 2FGZA 2ZUMA 1TG7A 2DH3A 4PTMA 3CHDA 4CCCA 3L4UA 1HKJA 3B9EA 3WQWA 4D6JA 4HU0A 3WF1A 3T0BA 5CSYA 9CGTA 5BXTA 3H53A 5CGTA 5F7UA 2FGLA 4KGLA 3FAXA 2J74A 1BG4A 3GBEA 3VD9A 3LRMA 1R85A 3ZM8A 1QW8A 3DDGA 4M80A 4D1IA 4URIA 2EEXA 2F1BA 3GXPA 3A5VA 4NF7A 1HJXA 3DX3A 1JNEA 5BYWA 2OYMA 3FN9A 2WNWA 3AZRA 1JFHA 1JZ5A 1E15A 3OG2A 1ISZA 3WQ5A 3SCOA 3AISA 4CN1A 5I6SA 3HG5A 3GH4A 1UZ4A 4IUGA 2V3FA 4AD1A 1C7SA 1QI4A 3AXIA 1RP8A 4MAZA 3MSGA 3QOKA 4RE3A 3OLGA 1XRVA 4PTVA 2GJPA 2XVKA 4AEEA 1UR9A 1UZ1A 1LWHA 2XUCA 1WDPA 1MWOA 1V6VA 3K4DA 1B3XA 2E0PA 4W89A 2XWDA 3EYPA 2BNJA 3UR8A 4DO5A 1V6XA 4UFHA 4U31A 5A1AA 3SUVA 4WK9A 4HZ6A 5CZKA 3GZAA 1MW1A 3EDDA 2WC4A 1UYQA 1OGGA 3AS3A 4ZENA 1CXKA 2WC3A 1EDQA 4MNMA 4WSKA 2NW0A 5EB8A 3GTNA 2YL9A 2XM1A 4AY1A 1CPUA 1GJUA 1Q6FA 1TZ7A 3GXDA 1ZBWA 1US2A 3WUFA 4WLCA 1WB0A 2DDXA 3CZEA 4UZUA 4PMYA 4N42A 5BXRA 3AXXA 1RPKA 4AW7A 1DWJM 1W9VA 3GBDA 3MV01 5ECUA 1H4PA 4TX8A 1M7XA 2UY2A 1UH2A 1ESWA 4ATWA 3D50A 3ZJ6A 3VO0A 3WY4A 1J12A 4B16A 1L8NA 3WD4A 1GQKA 1UG6A 4LQ1A 4GIAA 5IFPA 3PZMA 3BVTA 4EE9A 5DEZA 1MFUA 1NARA 1JD9A 2WCAA 4V28A 2J25A 4M56A 4QAWA 1UWIA 3PZGA 4W88A 4CU7A 2X0HA 1E5NA 2EABA 1C92A 1PAMA 1EO7A 3EDEA 5I0DA 1GZJA 3WEOA 1QOXA 5LYRA 2O9RA 3RMEA 1V0NA 1JF6A 2G3MA 3CZNA 5HDRA 2DSWA 1J11A 3BLPX 3PHAA 2D23A 1XD0A 3M07A 3PTQA 2CYGA 3A3HA 1FH8A 2PWHA 3WUBA 1H0IA 2GSJA 4LYQA 4C7FA 4UQBA 3ZJ7A 2VZTA 3SCNA 2OWCA 3WQ6A 2YBTA 4BF7A 1VEPA 7TAAA 1UKPA 3WH6A 2YL6A 3K8MA 4UTFA 5JIWA 2XVGA 2J75A 3BVUA 1R75A 4W93A 4X0NA 1ITXA 1UUQA 1B3VA 3NDZA 2PWEA 3WDPP 2E9LA 1PX3A 2J77A 3WSUA 5GNXA 1Q6DA 3RCNA 2XFRA 3BUPA 4KMQA 1QI3A 3W4RA 3OB8A 2YA0A 2WXDM 2PBGA 3OBAA 4WF7A 1KBBA 2VT0A 1UR2A 4ACYA 3PTMA 4P7OA 1JAKA 2ZX6A 1GQLA 3K4AA 2Y8KA 1W1YA 4UOJA 2V3GA 2PI6A 2WLZA 4H8VA 1K9FA 3TOPA 1YQ2A 4PN2A 2NSXA 1JFXA 5IHRA 1E43A 5TD4A 5CLWA 1YHTA 1JI1A 1E0WA 2EXOA 3LPFA 1G5AA 1HF6A 3AIWA 1C90A 2J7BA 3ZQ9A 4JFWA 3BAJA 1W91A 3HN3A 4JZ5A 5I5RA 3AIQA 4OBRA 1GONA 2WMHA 5E09A 1E4NA 4AIEA 3AMKA 4P8WA 2ZXDA 1B0IA 2UWFA 1UH4A 3SCPA 3VIHA 3FAWA 4DO6A 1XSJA 1EH9A 2GDUA 3NCOA 1HJQA 4FF5A 1JIBA 2XTKA 2VZUA 4UFLA 4NZFA 3WQ8A 1IZKA 4CU8A 4V27A 3BCFA 2CITA 1UKQA 3WEZA 2G3IA 2ESCA 5D8WA 5C70A 4XX6A 1FP9A 1Q6EA 1QPKA 3LPGA 1J0HA 3VIJA 3VIIA 3KWXA 4M29A 4OJYA 4GI6A 3AIVA 5DT5A 5I77A 4BQ3A 3ARRA 2FHBA 1P6WA 1QI5A 1EIBA 5A2CA 4FK9A 4HOXA 1NM9A 1HXJA 4MNLA 3UCQA 5JBDA 2WAGA 1BSIA 3ARUA 1NOFA 2W63A 3WMBA 3KEHA 4B9ZA 4HMCA 1WDRA 3GYCA 4W84A 2CERA 1R34A 3VDBA 2JALA 2QLYA 1WNOA 5FOOA 3I3BA 1NWUA 1CZ1A 1M04A 4QCEA 1MXDA 1R86A 3VSVA 1QHPA 4AD4A 2QMJA 2XVNA 1DTUA 4AZBA 3LPPA 3WNKA 1TE1A 4DM2A 2EACA 1NOWA 3MO4A 4AZCB 3BSGA 1JD7A 1RP9A 3WFZA 4JL1A 4IPNB 4A3YA 2E3ZA 4J3UA 2W91A 4OOUA 4PCSA 3QGVA 2V3EA 3NDYA 4OGZA 1OB0A 2E8ZA 2FHFA 4W85A 2EPLX 4J3VA 1GOIA 5A69A 5ABFA 1E9LA 5D9NA 3T2QA 4F9JA 2WVVA 5AY7A 1CXIA 4OOZA 4GZEA 1MQRA 4AYSA 3SCUA 1KXTA 4AZHA 3CUIA 4PMXA 1TVPA 1FFRA 4FLSA 1EHNA 1UWQA 3U57A 2OLHA 4CU6A 3BAXA 4JL2A 2JE8A 1QNQA 3UERA 1BGGA 5CPQA 3WDRA 1GOQA 3QHOA 4PSPA 5M3WA 4D71A 3AMLA 2EQDA 2WBGA 3MUIA 2J62A 3CUGA 4X9YA 3VDAA 3W53A 3L2LA 3CMGA 4PMDA 4HPGA 3NSMA 1V08A 4DWSC 3B8SA 4CUCA 2WVSA 3VIKA 3VD5A 5BXPA 3CZLA 5M03A 5CGMA 1R87A 1MXGA 4R27A 2W5FA 2BY0A 2WWCA 4EAMA 4GI8A 2CNCA 4ZXLA 1JDAA 3BLKA 4JKKA 2YOCA 3N9KA 1K9DA 5E6YA 3PZQA 3WD0A 2XYLA 3RJYA 1QW9A 2WM0A 4J3SA 4YHEA 2D0HA 2VX4A 1W3LA 2PWGA 3AICA 3T2PA 1W3JA 1CIUA 4PUDA 1R8LA 5FL1A 4W8LA 4OKDA 4OBSA 2VC9A 3W82A 4AD0A 1BLIA 2G41A 4ACZA 2XG9A 3MANA 2FE0A 3ARYA 3W6MA 4D6CA 4J7RA 1QBAA 1V0MA 4S3KA 4A4AA 4BQ4A 1R46A 1B1YA 2V38A 2VTFA 1L0PA 2G3NA 4ML4A 3VPLA 1LG1A 3POCA 1VEOA 3SCSA 1SMDA 3G6MA 3BAKA 1FFQA 1J01A 1SFSA 4D6FA 2DT0A 3VTRA 1EA9C 4YHGA 1F4AA 4PMNA 2WCSA 4TVUA 4NRSA 3QHMA 2GVYA 4WKAA 1OIMA 1I1WA 3W25A 1HX0A 1KB3A 1QBBA 1H49A 2WMFA 5CJ5A 1WDQA 2IGTA 1E6PA 2GDVA 2OW6A 3IJ7A 5DT7A 2XFYA 1ODUA 1GOKA 3TTYA 1KFWA 3GM8A 4UOQA 2ZE0A 1VFOA 3PZ9A 1MVYA 1CXFA 1GHRA 5I2UA 4AISA 5GNZA 3KL0A 2EPMX 1X6NA 3FHAA 2XVPA 1R47A 5HOSA 3HJEA 1V0KA 4UR9A 3B9DA 3KE0A 1XV8A 1C91A 3TTOA 2WKLA 3LMYA 3D51A 1LQ0A 2QV4A 3AHVA 2OWWA 1KWGA 5A8QA 1UQYA 3O2LA 1LJYA 4X0VA 2D3LA 3DX1A 1WAWA 1OD0A 4P7QA 4MJ4A 2ZXAA 2YIHA 4BA0A 1FA2A 4ZE5A 5BRPA 1CXLA 3CIVA 3DYPA 1G1YA 1AQMA 3ZR6A 4ATDA 1HL8A 4MB1A 2J7DA 4U5KA 1TQSA 1QI2A 2WMGA 1M01A 2WZIA 3WFLA 1KCLA 2Y5EA 3MMDA 3O9NA 2WWDA 1WZLA 3SUSA 4W5UA 1XH1A 1O7AA 1HT6A 3ARPA 4M24A 1V6YA 3W28A 3IJ8A 4GZJA 1V03A 4PYSA 3PBGA 1H3GA 1K9TA 1GQIA 5E6ZA 3WF0A 4FNTA 1W32A 4D6EA 3L4ZA 4CCDA 3CUHA 3LXBA 1V3LA 3KL5A 2C8NA 3AIUA 1ZJBA 1FHDA 1H2JA 4H41A 4CD4A 3WD1A 1TQWA 3WEMA 2XSAA 5I24A 1ECEA 1BHGA 3WQVA 2VRJA 1PX8A 4RE2A 4M81A 3UG5A 3WH9A 5HPOA 4FLRA 2XN2A 3SUWA 8CGTA 5ABEA 2WHLA 1UWTA 4AZ7A 2QF8A 3K8KA 4U3AA 1EDTA 3HG2A 4D6GA 1CXHA 5IDIA 2ZXBA 4H2CA 2JIWA 3BCDA 2PWDA 1HJSA 4Z2HA 3A47A 1U33A 1X6LA 3AMCA 5JUVA 4P7NA 1G0CA 2D0GA 1ISWA 3OGRA 3NJ3A 3VX0A 2HISA 2J7HA 4GZIA 1UH3A 1E70M 1CXEA 2JEQA 4FLQA 2X2JA 3ALFA 1C8XA 1KQYA 3HU7A 3APGA 4AZ5A 1KTBA 3ARQA 3POHA 1E6XM 2C7FA 1QNRA 4XUYA 1V02A 2X2IA 4NRRA 4QLKA 3CZGA 1W9UA 1VIWA 4HPHA 1TMQA 4DUVA 3EDKA 1EOKA 3BAWA 1UA7A 2Z1KA 3EMCA 4OUEA 2Y2WA 4XZBA 1O6IA 2VUYA 3WDQA 1XC6A 3BAIA 1LL7A 1SZNA 1FH7A 3UEQA 4BQ5A 1CLVA 4HA4A 4Y7EA 1EQPA 3VSUA 3T08A 3I3EA 4WIWA 1J0YA 1UD6A 2NT0A 1VEMA 2VX7A 1E73M 5I79A 1J9YA 1DEDA 1CGXA 2TAAA 3AFBA 3PZTA 1G01A 4PMUA 3N12A 3WF2A 5ABFB 3CV5A 1NP0A 1WZKA 2WVVB 2X0YA 2VI0A 2DEPA 4YN5A 2ALWA 3RJXA 2X2HA 4F66A 2XSBA 1RH9A 3CUJA 3BLBA 3CO4A 4W7VA 3VINA 4CKQA 1MW0A 2BXYA 5JBEA 1CLXA 1VB9A 4EANA 5DO8A 1NH6A 4FLOA 1WCGA 4NXSA 1M03A 4W8BA 1UA3A 4N0RA 4PMVA 3VDCA 1V3MA 1IT0A 3WNOA 4P8XA 3ZSSA 4Z2LA 3WF4A 1XYFA 2CEQA 1V0LA 2WVUA 3RILA 3ZT6A 3A21A 2BY2A 3VVGA 3VGFA 1OINA 1JF5A 2DSKA 2VR5A 4E2OA 4W7UA 1OIFA 4XV0A 4ZXOA 4AZIA 5A6AA 3B9AA 2XJ7A 2WHJA 1JG9A 3D5HA 2JF6A 3ZR5A 3FY1A 4PMOA 2FDMA 3EJPA 1ZU8A 4F8XA 4MNKA 1FHLA 4DUXA 5IFTA 4H8UA 1KXVA 1KXQA 4B15A 1XGZA 3AMGA 4CCEA 2F8QA 1JI2A 2WHKA 1W3HA 4ACZB 2ZICA 1OCQA 2BFGA 1J0JA 3LXAA 1PZ3A 2PC8A 3F4VA 1TA3A 4CD6A 3N15A 3VUPA 3CBWA 4C7GA 3WUEA 4M8UA 5D9OA 2XVLA 3D4ZA 3RIKA 4HTYA 3WIJA 1PEZA 4TTUA 3PZVA 4JFSA 5EBAA 1V3HA 4KRUA 1W2PA 3KL3A 3ZJ8A 4MAVA 3VX1A 3BUQA 4A3HA 2YA2A 1EO5A 3DYMA 4JFTA 1FOBA 3A23A 1E4IA 3BVXA 2V3DA 4GXPA 1WP6A 1KR0A 3AHYA 3L2MA 1NP2A 2Y4SA 3RM9A 5A6BD 5BCAA 3DDFA 2X8RA 3WNLA 4MB5A 2A3EA 4PCTA 4TXEA 3WY2A 1E3ZA 1CEOA 2VRQA 3AZTA 3CHFA 3FHQA 6A3HA 1JZ2A 3FNDA 3NYDA 2J78A 1XCWA 1W2VA 4R5EA 5A6KA 3VNYA 2AAAA 3ARVA 4Q7NA 3EBVA 1V02E 1LLOA 1UWSA 3M46A 1HJWA 3DC0A 4CD5A 4DWSD 2D3NA 3VIGA 2A3BA 4EKJA 1Z32X 1EXPA 1E40A 2YKKA 1I1XA 3ECQA 4P7LA 1TR1A 3BUBA 4FNSA 1H0GA 1WZAA 3AIEA 3BMWA 1E55A 4PRWA 2VX5A 4PTXA 4TOQA 2WMIA 3D3AA 5IXEA 2XIIA 1AQHA 3KLKA 4UOZA 2GK1A 3IJ9A 3A22A 2RGMA 2J8FA 1B3WA 1UD4A 1DWAM 4P8UA 4JIEA 2QPSA 1E72M 3VD3A 1CGUA 4W7WA 2YDRA 2OSWA 3MUY1 5HBFA 3T09A 3WNNA 1C7TA 1B3YA 3L4YA 1UWRA 3L4TA 1BFNA 1LL6A 4H8HA 1HVXA 4IPLA 2QMKA 3EDFA 5A6LA 2ZOXA 1T0OA 1J0KA 3MUAA 3U5YA 1E6QM 5LA2A 3CPUA 3T0AA 2ZUTA 2YLLA 4W5ZA 4DM1A 8A3HA 1W3KA 1PPIA 4MPKA 2XWEA 3KZSA 1EGZA 1DWGM 2HVMA 1LF1A 1OT2A 2GJXA 1JYNA 3VMPA 1JYXA 2CBUA 4M1RA 1KTCA 1ZB5A 3UG4A 4QLJA 3ARZA 1TQTA 2EPKX 2YBUA 3H55A 3CHEA 1HKKA 1E6NA 1OD8A 2W61A 3AS1A 5AC4A 3VGHA 3L4XA 4AIUA 4KGJA 3CZ8A 1SYTA 5FKYA 2EAEA 1GOMA 1HNYA 3VNZA 1JZ6A 2J47A 2PF0A 3VGBA 4QLLA 5JIPA 2D0FA 4AMCA 3F5LA 1CGWA 4NZJA 1EQCA 4HA1A 1HXKA 2UY3A 3S5YA 2XN1A 2ZXQA 2WCGA 5CXPA 2O9PA 1S46A 4CVWA 1KCKA 1VRXA 3EJQA 3MMWA 2VCBA 3KLLA 2DIEA 4D6HA 4B3LA 1EHAA 4NXKA 3VM5A 1I75A 2YDQA 5A8OA 4QP0A 4HP5A 4AIOA 2ZIDA 3TTQA 4TVDA 1W1TA 3U7VA 2F7QA 2ZWZA 2BS9A 1GVIA 2DIJA 5I23A 2W92A 5GNYA 2VQUA 2E9MA 2VQTA 3GXTA 3AS2A 4PUEA 4DUWA 4UQEA 4AEFA 3EMQA 3T2OA 3MU7A 2QHAA 2WKGA 1HN1A 4GO9A 3BC9A 3AYRA 4Z2KA 2CPUA 4LGXA 4KRTA 3OIHA 3WMCA 3LRLA 2FYVA 4UNIA 1BAGA 4U3CA 2GUYA 1UD2A 1HKMA 4MNJA 3DHUA 4XB3A 5A6JA 3N13A 3O6AA 2VZOA 1TVNA 2VL4A 4TVCA 1VFFA 5FIPA 2DSUA 4GPNA 4U2YA 1H1NA 5M17A 3ZT5A 1XSKA 4JHZA 3WF3A 4RE4A 4DWSA 4MADA 3AMDA 1DWHM 4J28A 1GORA 3BVVA 1BQCA 4CD7A 2XHYA 3AZSA 1J18A 2DQXA 1JXKA 1G94A 4RL3A 4AZGA 1JXJA 3NUKA 3VGEA 4E4PA 4LYRA 3K1DA 1U30A 2A3CA 3PZIA 2OSYA 3WELA 3UETA 1JYWA 2BXZA 3WNPA 1UOKA 1H41A 1HKIA 2GFTA 1WKYA 1KGWA 3N11A 3AHXA 2PBOA 1KWKA 2VOTA 3SEPA 1E71M 4Z2IA 1PJ9A 2B31A 3K8LA 3CMJA 2XGIA 4MJ2A 4LPCA 3AQUA 2WANA 2ZX8A 3N17A 3AIRA 2F61A 3AROA 5CQ1A 2CKSA 2DPEA 5BRQA 2D1ZA 2EO7A 1WO2A 2IXVA 3RM8A 2G8ZA 2GJRA 1H09A 1QX1A 4UCFA 1PZ2A 1W1PA 5BWFA 2E40A 3II1A 3ALGA 4LXFA 1MW2A 1R33A 4D72A 2CCRA 4MDPA 4AZ6A 1B31A 6TAAA 1PS3A 1CGTA 3BVWA 3MSDA 1XH0A 3ZO9A 3SCQA 2WBKA 3DX2A 2CETA 1W1VA 1Y7VA 1ISXA 1LG2A 4P8VA 2A3HA 2BHYA 4JHOA 4U5IA 4UFMA 2J7FA 3A24A 1TA3B 3SURA 4TTGA 5ABHA 5A2BA 1XHGA 1C8YA 4V2XA 3WN6A 1GVYA 3SUTA 4ZEPA 2DT1A 5AC5A 2F7RA 2YL8A 3A6OA 3IAQA 1NWTA 1UD8A 1QNOA 1QHOA 3RO8A 1WDSA 1NOUA 1DWFM 1AQ0A 1JNDA 4UQDA 2EADA 1KQZA 3CGTA 1ZBKA 3SUUA 3W29A 4PBGA 3W24A 3DYOA 5CG0A 4OZOA 2VURA 3CTTA 1SMAA 1TQUA 3BGAA 2DT3A 1KR1A 5LA0A 3M6DA 3WD3A 1FH9A 4GKLA 3H54A 1C8QA 1JZ4A 2YL5A 2AOSA 2BHUA 4F9DA 3RM4A 3K46A 1W9XA 3ARSA 3W81A 3PZNA 4Z2GA 4DO4A 1F4HA 5FL0A 1IZJA 1MFVA 2CKRA 3TP4A 2W62A 1A3HA 3GH5A 1US3A 2JF7A 2AMGA 4Q22A 1OGBA 3VM7A 2F7PA 5BXSA 2CHOA 4HZ8A 4TX6A 2CESA 5CPSA 1UR1A 4JFVA 3W38A 4AXNA 1ZL1A 2VO5A 1E6RA 4LYPA 4FNPA 3DECA 3WH7A 3SCRA 1CGVA 3VSTA 4CD8A 3ZJKA 2F1AA 2CIPA 3MV11 2RGLA 2YDSA 1V6UA 3GNOA 1ZBVA 3GXIA 2WZEA 2WMIB 1V6WA 2JIEA 2VMFA 3THCA 4ZE4A 3FXYA 2OWXA 3N1AA 4QDMA 3WDIA 3CC1A 2GK1B 1VBRA 2EJ1A 3VIFA 1H5VA 3ZMRA 1QNSA 4CGTA 4B3KA 3JUGA 1UR0A 3VIMA 3VGDA 1HP5A 2YFNA 1H11A 4AD2A 4MTVA 1GPFA 3T0DA 2VZVA 4LX4A 1UASA 2VX6A 1B30A 3WH8A 1XSIA 3WQ4A 5GPRA 1E3XA 3MI6A 3WY1A 5EFFA 1C3FA 4QCFA 4HU8A 4HOWA 4HZ7A 3VGGA 3L4WA 1Q6CA 1FP8A 3D52A 4BZYA 1C93A 1BYCA 4JFUA 3FW6A 3QOMA 4ATLA 5DFAA 5HNNA 1D2KA 3WDJA 1HP4A 2XGBA 4W86A 1ZJAA 4JAWA 3WBAA 1ITCA 1K6AA 2GJXB 3EJSA 2VVSA 2E8YA 3PZOA 3NSNA 5D9MA 3OZPA 3AHZA
chains in the Genus database with same CATH superfamily
4AC2A 1ZAHA 4ZMQA 1RZ7H 1CWYA 3T0WA 4DHLA 4FNQA 4UFIA 5LIWX 3N9GH 3EOAA 3RTQC 1RJPA 2HMID 4Z23A 4F79A 3ML9A 2M83A 3B7YA 3HTLX 5KSBE 4EVZA 3KLSA 1A2YA 1T20B 5JOEA 3ARXA 3EO0A 4K7FB 4DJDA 2C1HA 4IBZA 4IOSD 1G9HA 5HGBA 2ICSA 4WWOA 3MLYH 1DIEA 3PHSA 4FMKA 3RL1B 1KKOA 4WK4B 3PM6A 3K2GA 4KZDL 3T7VA 2OZTA 1O6SB 2BP5M 3FQRB 3HMCA 4GO8A 4O2FB 3DBNA 2V5SA 1S7WA 2F53D 3KBMA 4K68A 2CM6A 2YXXA 4HWZB 1DVQA 1AA1B 4PJXB 3QY7A 5C0EA 1D3CA 2ZZUT 5GHWH 1EPFA 4GRWE 3DUSB 3ET9F 1OM0A 4RAHA 4LSVH 2P76A 1Z7AA 1AS8A 2WIIA 5IGXL 3NJVA 1LT8A 1UKOA 2C1PB 5HVHC 4L56A 4I48B 4FL4B 2ZUUA 1HKLL 4JNXA 2WCPA 3PWLA 4FXLA 4NQ1A 1U8OB 2X09A 1IC7H 1FIEA 2HX7A 4WZ9A 5CINL 1R3SA 4UR8A 2OQJA 3C86A 4QHNA 3M45A 4LARL 1ME8A 3VFRB 3OA5A 2Z91A 4WSJA 4KPHL 2AV7B 2ETWA 4HT1L 2YJLA 3SD5A 5E8OA 1HGYA 4EBQH 4NI6A 2CJSA 1MUMA 3CFBB 2EDXA 5MEQB 2VDML 1FUNA 2EVJA 4N2EA 3OKNA 2EC8A 1VENA 2YXMA 2YPKA 1K8IA 2ZZ2A 1O7DC 2E9BA 5EZOH 1U93A 2MNJB 2I5QA 1QYGH 1THAA 1E27A 2IPJA 3GU9A 2DQIH 5ITFB 4S0HA 2DTMH 4RESB 3DGDA 1F3EA 5TQ2L 2R1WA 4LNYA 1DL7H 2HVKB 4Y9GA 3CDGB 1GOWA 2P88A 2EKSA 1Q9KA 4TL4A 2PTVA 4MOZA 3UAEA 2F18A 2OQLA 1HOCB 4P2QB 2J44A 3IGAA 3EYSL 2Q8BH 4FABH 3MJ7A 4K5LA 4TVPH 1KPUB 2F8OA 1AD0A 1WKEA 2XN0A 5IDZA 5FYJH 2B1OA 1LNUB 3VXQA 3IACA 3ZE2E 1SFJA 1MHCB 4X7TA 4EI5C 4FFZA 1FFNB 1IC5H 4ZSOA 1BJMA 3X11A 5I1DB 5EU5B 2WNGA 1SN5A 3JTTB 3UYRH 3SPHA 5FJTA 1EJFA 2A9DA 2YSSA 4JQVA 3R8GA 5IHUH 4PGJA 1OFAA 3DSNB 1NIBA 4MLIA 2XWRA 2Y9RT 4B9CA 3BVJA 3EKLA 1QSFE 3UPAA 1KGXA 2DH2A 3ZKSD 4K8EA 3O3EB 1CJYA 4TQIA 4HXAL 1Z9SB 2CDFA 4D6DA 2XKNA 1RQHA 2MOVA 3L81A 3TCLA 1PD6A 1SN0A 3D34A 2XRAH 2QGCA 1NCAL 3U2OA 4OIIH 3VIOA 3IRDA 3O11B 3HI1B 1G6RH 2DWDB 3VFUA 3N9SA 4LLUB 1MEHA 4YZFF 3PBMA 1YX1A 3BZGA 2BVUA 2NNXA 3TT3L 4DGWC 5L2KB 5CSSA 2EDDA 1L5GA 4DQOH 2X05A 4UWMA 1CE6A 1JYVA 4AI7A 5DO2C 1IBFA 5L4JA 1E8YA 2AJSL 4WI6A 4MSSA 2A9AA 2A6JB 3SJVB 5BW7A 1P5VA 1YZZA 3PWPB 1KSRA 4Q9BA 1J8HB 1GW1A 4TUKL 4PGDA 3VG0L 3LS5L 5A3ID 3CAWA 4D8OA 1MLBA 4Z7IA 2BVQA 2AS5M 4G9DA 3W1UA 1EDYA 4X98B 5IVNA 1FL3A 3WEXA 2JEPA 4R7LA 2A73A 4M6MH 1JL8A 1WV2A 3B56A 3TF4A 3PP7A 3QKZA 4TTDD 4PBFA 4PTWA 2QYGA 4UT7L 3F62A 1DQUA 4QHLB 4WFFE 3OWRA 3RI5F 5ALBH 3V6OC 2H0EA 4AZCA 4YCPA 1QFUL 2K1MA 1ISVA 2PDYA 2J9YA 4LHUA 1M9HA 4JFFE 1KJMA 3PJXA 4ODVL 4O4YL 4U6TA 2CLVB 4P4RA 1Q38A 3QFDA 4OM0H 5J12B 3DRQA 4R26H 3K1KC 3QPXH 1JRHI 5JORB 5IOBA 3WXVL 2XV6B 3N6HA 3ZY7A 3CVHL 2DQFB 2VXQA 2A9NL 5CGTA 2ADGA 5TH2B 4KGLA 3FAXA 2FJGB 1NF0A 4HS6B 3BPOC 1I9RL 3G6DL 2F1BA 3EOTL 5E9XA 3QZAA 2N0MA 2A21A 4IUOA 4M6PA 4L1WA 3MUJA 3GH4A 1UR3M 3V0WL 2O61B 3KWWB 3Q8EA 2J8OA 2XVKA 5EZJA 1WDPA 4KEZA 2E0PA 2YGOA 5J04A 1SFHA 1Y18A 4JNMA 4PLNC 4ZPTA 4D3CH 1H3XA 2WC3A 5C6PB 3JWNC 1Q7MA 3WFCH 4LH8A 1V77A 4KEMA 3WU1A 3ISYA 4NERA 3APCA 4X6CB 4GKNB 4RMWA 4HKXB 3EWZA 4HN8A 2VDPB 4OJEH 2LFGA 3GBDA 4H8WL 4UB0L 3DFTA 4MKSA 4QT5A 2L4OA 1TVBA 3K6SA 1GQKA 4LQ1A 3WUWB 5IFPA 1FHNA 4K5OA 4FFVD 4PD4J 2CWNA 3L0KA 2IDQA 2OL3L 3RMEA 3H3KA 1XL9A 1A5AA 4MHHI 4G42B 2PWHA 4B53A 3H21A 2CNYA 5DCBA 3GBNL 1G7VA 2A6DB 3VKJA 4FDWA 3WL9B 3IJSB 5DQPA 2QPFA 3LYEA 2I16A 4QWWC 4W93A 2PE4A 3TQ0A 1ERNA 3SE8H 1INEH 1Q6DA 4IM8A 3PGCA 2R15A 3KJ4C 3C09B 2VLJD 2PBGA 2Y1VA 4P7OA 4TV6A 3P82A 4JZNB 2B77A 2Y7SA 5E6RB 4B5TA 2QKIC 4J2PA 2G9HB 4L1HA 3TWAA 3OSVA 2X2UA 1WD9A 4RUBA 2VN6A 5CLWA 5KBKA 3U83A 3LPFA 3GVRA 4W9KC 2YPLB 3W71A 1A5NC 3P80A 4DGYH 4JVWA 5DRIA 3APMA 2ZXDA 2I5GA 1WYJA 5FJUA 1EH9A 3NCOA 5D2NC 3S5LA 4KQ4H 1RUAH 2UXFA 1TZGH 2HN7A 4G8FB 3L7EA 3VIJA 2X9YA 2KZ1B 4H5SA 1A3RL 2QVIA 1YEHH 3BFWA 4JTAA 5GGTH 3PGFH 3NL3A 4OFDA 1UJ3B 4XVOA 1QWGA 5DRWB 2XJKA 2YN3A 1XLGA 4UM9D 3R58A 3I3BA 3PQYA 4OFQA 3VDGA 2A79A 1E5CA 3QM3A 2GJ6E 2GTQA 3QTPA 1UXSB 1XIWC 3LPPA 4NHCL 4KERA 3KVKA 4G8EB 5I5JA 4ES8A 1EQWA 4PIBA 4WR3A 2LFEA 2NW3A 2WNNA 3JTSA 2VELA 2V3EA 5AW7B 4MMYB 1QU4A 2DM7A 3CFDA 2ZCZA 3T2QA 4PE8A 2BX7A 1CXIA 4YLQT 2F5BH 5AFAA 1WFOA 4E0RB 2QGEA 1QRNA 4BUQA 1I1AA 3U57A 4FHKA 1MHPL 1MVUB 5CPQA 1HHIB 3QHOA 5EFIB 3W7EA 1MREL 1E9ZB 2K9UA 3VDAA 2HMCA 1J87A 2X0UA 3F2CA 4YTTA 1SZRA 3QW9A 5HMEA 4TSBL 1JWMA 4O4VA 3DMMC 2EH7L 5KVFE 4QY8A 1PZ5A 2WM0A 4LUTB 2HJKA 3TF7C 1OM3H 4L8SC 2R83A 4XH2B 4ICMA 4PUDA 4Y4KD 1D5ZB 3BJLA 5E51A 4APQA 1DQLH 1IGFL 1BCIA 4MAYD 4ACZA 5DK2A 4S3KA 2WSQA 3WJYA 3LKRA 5ANMA 2VHLA 5F7MC 1CBJA 2ITDA 3FSVA 5D5ME 4Q52A 1QP1A 3CX5J 3EH3B 1I60A 3QR0A 4MGXA 4R0LA 4NRSA 3L45A 2CO7B 1MRCH 1KFWA 4A29A 1WWCA 1H5YA 3BP6B 1JPSL 3ROOB 4MSWB 3LCXA 3VNMA 3P1VA 2P5WD 1R47A 4RRPA 1Q0XH 2JKPA 3BD3A 2B8OT 3TASA 3D51A 2NUWA 3P3YA 2J1YA 3NIFB 4PG9B 1FWXA 5T5NG 1ITUA 1PQZB 4NBYB 5L4IA 1CTMA 3B2DC 1V6YA 4X50A 1ZOXA 4MF4A 4I4WB 4UTBA 1NGYB 1YUKB 3GNDA 4O11A 2XSKA 3LXBA 5EGRA 1U8HA 3BEWB 3IDIA 1SBSH 5TE6L 4CD4A 4Z1DA 5F96H 4BI7A 4C6MA 2Z7KA 4ZSOE 3LV6A 4HUUB 3C6CA 4LVGA 3RWCA 5HVGB 2Q76A 5ESQB 1G43A 2OK0L 3L08A 4TRPH 1RLBA 3SAZA 3DX8B 4BJLA 1U8PB 2OMYB 1BQKA 2GK0A 1K8DA 2XIJA 3T4AB 2VSDA 4HIIA 4P8QA 2V5BA 3PABA 4H1LH 3EYUL 2QEJA 3UPWA 2YN5A 3F7YA 1U5JA 4XMLH 2YB1A 4YK4B 3SDXA 5I73C 4LY4A 5H37G 4J5VA 2DI8A 5ECVA 5TGBA 1MFAH 2G9KA 1P43A 4XZBA 1U1JA 4ETQA 4Q8BA 3RE0A 3CFKA 1AI1L 2LLGA 3EO9L 4MVBC 4BQ5A 2WBJD 3DPDA 2MCG1 3VU1A 3OBEA 2IBZX 4PLKD 2UZPA 4FHBD 4LRIC 1JCTA 3QQ1A 3H2EA 3HZVB 1YCSA 4JS3A 3QG6B 1KPRA 1PYWB 4C83A 1MCLA 3FU5A 3V5DA 1U6AH 2DZSA 5HMDA 1YEDB 2WHVA 5AAMA 1RJYB 5J6HA 1BJ1H 1BZ7A 1CO1A 2WWMD 5I16A 1A0CA 2R82A 2HTLC 4PFMA 1A1MA 3E1ZA 1N4XH 3VDCA 2ICWA 2VLME 2YW4A 4Q4PA 1L9SA 1V0LA 3IV8A 3ZT6A 3IIPA 2Y0SA 4FQQB 3VVGA 1JCXA 2Y23A 1DUYA 5C3TA 1OIFA 3C5JA 4F33B 2HSAA 5A6AA 4Z7OE 2XJ7A 3H9HB 1XCTA 4KK8D 3NQFA 1F6YA 1UROA 3JBG7 3APTA 5HHNB 2QUTA 3FO0L 4ZAKA 4CCEA 4W9GC 2JB5L 1F2XK 2QFRA 4QE5A 5L6YH 4QXTB 3FQUB 4DCQA 2BFGA 3NPXA 1J2WA 3F4VA 3BHBA 4FXTA 3HI6L 3MQTA 5EMMA 2ITFA 4IRZL 32C2A 4XZHA 3MLUH 5B8CC 4NKMA 4A1RA 3EF4A 4OLUL 1ZCCA 4NZTL 1THCA 4KRUA 1F11A 4GP5B 3GJFH 2KPNA 1RZJL 2VW7A 2J6XA 1W72A 4DN1A 2FKPA 3QDJB 3WNLA 1Q94B 3NIGB 4LDLB 3L5AA 4DI8A 4UM9B 4OCXL 2WLIB 5HDLA 4NQTA 1HQTA 35C8H 5AZ2L 2XFGB 3OZLA 4X2UA 1W2VA 5C9JB 2Y69B 2YEZB 5FYLD 2DQTL 3CS2A 1AXTH 2DQHH 2JBMA 1Z32X 3GUWA 2YKKA 4J3OD 4UIKL 1N8ZA 3RGBA 4W81A 3KR3L 3WFEL 3W1ZA 1A3QA 4GABA 2QPSA 2PR4H 5L8KB 1JGUL 1TJIH 3NAAL 3SW6A 1KFGA 3G7TA 3EX4A 4AZUA 1XLBA 2QMKA 5A6LA 1BJ1J 4ZNEE 1ND0A 4HC1A 1A49A 5MEOB 4DM1A 2W8CA 3H9SD 4YHYB 2NWSA 4Y5YA 2FDBP 2BWIA 3WV0A 1OD8A 3RX4A 2YSWA 4F7TB 4KGJA 3NPWA 3SSZA 4Y4KB 1BDYA 4QI3A 4AEOA 4MAYB 4WO4A 4JM4H 4PJ7F 5B80A 2VFHA 4FG6C 3J07A 4NM4H 4HT3A 1ZLWH 3UPCA 2OMNA 4ELKA 1W8OA 1VRXA 5CHNA 5EU4B 1BQHB 3D3VA 3SCMC 3BIKB 3DX5A 4JIPA 4Q4SA 1SDYA 2OEMA 2VQTA 4U49A 5BRZA 2HT2C 2UV3A 4C8XA 2WKGA 1HN1A 4NHUA 4PL2A 1VKFA 4CILA 3BC9A 3V0AC 2X7LA 2P5WB 4XPBH 2DLFL 4MMZB 3DHUA 4KFPA 3L5JA 3C56A 4K7PL 5BJTB 2ATPA 3NQAA 5INCA 1QTWA 5K1JA 2BZDA 3P30L 3BQUD 5T8IA 1TCRA 4LBRA 3FRPA 2XLLA 4DERA 4YIQB 3KZ8A 1IMHC 1KTJA 4WJ8A 1IE4A 3INPA 1DXIA 2JCCA 1H41A 3QDGA 1HHJB 2XTJD 4GIOA 4LCCC 3QY6A 1PU0A 5F9AC 2B4GA 1FWCC 1GIGH 3TJEL 1HH9A 2YB4A 3STZA 3B8IA 3GHEH 2G8ZA 4XNBA 2HTMA 1SGJA 1JXDA 3II1A 1VPYA 1IAKA 1Q4WA 4V1XA 1B31A 4QRTB 3MSDA 1VERA 4KKRA 1DCLA 3PQYE 4YXLL 3IGFA 4U5IA 4BZ2L 3A24A 1A7PL 4YDVB 1ES0B 4U6XA 3W00A 1NWTA 3RGVA 2DBLL 3U2ZA 4OZFB 5EN2B 1P5UB 2VERN 1GW9A 3JVGA 1NOUA 1JNDA 5E9DD 4XZNX 5IBLC 3W29A 4OZOA 2YD4A 2DT3A 4PRIA 4QNWA 2PUZA 4BH8B 3TCEA 5ABAA 1C8QA 2YL5A 1QRNE 4O9HH 3ZKMD 1W37A 3TP4A 1U1HA 2W62A 5BZDA 5C0GB 2GC7C 2Y1YA 3PPGA 3DJRA 2WBJB 3THAA 1KBPA 4ZO9A 1XISA 1KYAA 1C8PA 2YUXA 1RQEA 3KPSE 4JRYA 3A3YB 1W80A 1KRAC 3F7QA 3STLA 2WZEA 3MGTA 1D2OA 3LKOB 1R5VB 1U8JB 2VMFA 3M0MA 4O0QA 1EDHA 2YZRA 3G5ZB 3N1AA 4BA8A 1XCFA 4IGSA 4QBXA 1XGPB 2DZBA 2EJ1A 3SE4C 3ZMRA 4KO7A 2WO5A 1KLGA 3DHMA 1TQBC 4WXZA 4AEIH 2JKWA 2FVLA 3MI6A 2NX1A 3L4WA 1X7TA 3NQVA 2F15A 1QFWH 1OEPA 1QW7A 3DXAB 3C5SA 3L3DB 5JPMB 3RG1C 3WDJA 3MRQA 3RL2A 4C55A 2G4JA 4YHMH 2O6PA 2AERT 1E0VA 3MHFA 4GC4A 1D9KD 3CSFA 2X4TA 3MLZH 3MFGB 4JB9L 3VDHA 3BAEL 3NRFA 3SGKC 5DCDA 4RGOL 3BLEA 1T3FA 4C4UA 1OCOB 5ENWB 4K3DH 3TFKD 1WWAX 2EDRA 5DRZA 4XAPA 5JXAH 4AIXA 3U1PA 3ZTNL 5PAZA 3V4PL 2AJUL 5FCZA 1PCSA 5FFOA 4PMFA 1VRSA 1CR9L 1YTEA 3GUTB 2YKLL 5A2IH 4CQ8A 4CDHA 3QXAB 3QPZA 2W65B 4PRPD 4OZ4A 3S5ZA 3S4TA 3M7SA 1EBPA 1TWIA 4H6EA 5EBLA 3VWJA 1RV6X 4U6VH 1WBYB 3GBLA 2QDHA 1YYMH 4IP7A 3UWEA 2FHCA 4XPFL 3V0DA 4V11A 1GC1L 2IV9A 3TX4A 5HBBA 5AOUA 2Q8XA 3DURB 3QXUA 1GUVA 1XR9B 5HY9A 3S36X 1N59A 4C7DA 5AC7A 3VXSE 3BGFB 1KV5A 1XL4A 4XPHL 3F5JA 2GUUA 4KJYB 3KYNB 4TNVF 2VFDA 3HZYA 2FIQA 4EEEA 2C1IA 2JLPA 3I65A 2IADA 1EGJH 1B4KA 1RUPH 4YSQA 4APXA 4ABQA 4HIPA 3VGAC 4EP8C 1UCTA 4NCDA 4A2RA 3TMLA 4BQCA 3D2UD 2POTA 4PJCF 3CUPB 2QAPA 1OG6A 4IU3B 4O02A 1AH3A 1YYLH 1OO2A 3Q65A 4JCLA 1KNWA 4JTDA 3H9SB 1LWJA 3TW7A 3MKKA 3TA9A 3NSXA 4JAMA 2WZMA 1SJHA 5D4YA 2HT4D 1YLVA 1DEEB 2VXTH 4A2LA 2UUDH 2GYIA 4KS0A 5E0KA 3U5UA 1BVLB 4AIZA 3WLBB 1FKWA 4JTTA 3UXLA 1NDGB 4N8VA 1CVSC 5D4QA 3UD6A 1BGAA 1ONQA 1XYMA 1JDEA 4FQHA 5DJ2A 3I7SA 1SW7A 2F5AH 1NBZB 4Z17A 4AWUA 3ZRCC 5D1XA 1T6MA 3PSVA 3VXMB 3RPBA 1BOGB 1F3JB 4Z78B 2PZNA 4KKAD 3HHRB 4XSLA 5HGDA 1MJJA 2J5LB 3S3GA 2W66A 1JGIA 5GGQL 3S6DA 5DMMA 4WDIA 3WFHA 4ZFOA 3A4AA 3CHRA 5HD8C 2FD6L 5EOTB 2D7TL 3FYIB 2Y5TA 3PL6C 1A4MA 2YK1H 1J6OA 1I8LC 3EGXB 1IQ8A 4G1EB 3QI9C 5CMAA 1B4EA 5IBXC 3B05A 5GQBA 3TIEB 5CZ0A 2XTJB 3ULSA 3LDBC 5AOJA 1T2JA 2LOEA 3NN8A 2VDQL 2FB4H 5KBNC 3L12A 1II4E 1VLIA 4ZT1A 2J2ZB 3CT7A 3N2MA 1U3YA 3DX4A 4WXYA 1PLGL 3OP2A 5H8UA 2ZWYA 4X2RA 2AQ1A 3ZTCC 4Q0XL 4TSAL 3FCSB 3JWOH 1GVRA 3KPNA 3KPLB 1VZWA 2CMRH 2QHRH 3SKNA 2NX5A 4OHQA 3MJ9L 3RLVA 5AFDA 1S3TC 5E9DB 4KWSA 1GZ1A 3SQOL 3GSOA 4GXVH 3FCPA 3LTYA 3S96A 3NM1A 1P69B 2WWNA 3RVXC 4IXHA 2I60H 3V5KA 1WH0A 4RDWA 1HWWA 3CLWA 2BMBA 4JFOB 1T6WA 4YTRA 2GOKA 2PDBA 5CD5D 1KDIA 3TFCA 3SZ8A 4FCHA 2DZVA 1BX2A 1DBJH 1S3KL 4LC8A 2PMZA 5DJ8A 4PRDA 3AJ7A 3BV4A 1BZ9A 2XPYA 4Y9MA 2GVEA 3DHPA 4KI1A 3L9RB 4ONGL 4QHUB 4IBTA 4LNVA 4Y9EA 4PJDB 4TPRH 1GCYA 2VEIA 4F15B 3E9AA 5BMFL 3UBHA 1SR9A 1FE8H 3LEYL 2VXUH 3FB5A 3H2MA 4CCCA 2OB3A 3CH0A 3E6HA 1KM2A 3E3QE 2OXHA 3D3VE 1V10A 5B3NA 2AQRA 3PHQA 1S8DB 5JHMA 4LAQL 1R3RA 2POZA 2BNUA 5LNGA 2EKCA 3G6AA 3OD3A 1R85A 5EEYA 3MNDA 3WXWH 4KDTA 3KCLA 1INDL 3GXPA 2IH8A 3AISA 4FOJA 3TJIA 4X6FA 1TVHB 1SEQH 2G2PA 4I5UA 4UQ3A 3K4DA 4HX1B 2QVNA 4IFOA 1DQKA 5CZJA 3IJHA 4QGCA 3G08A 1D5BA 5F4XA 4P2OB 3EDDA 3GRWA 2O6EA 4RDVA 4PRPB 1OSPH 3OQ3B 5E9NA 3FFDA 3STGA 4FC3E 2E68A 4QLWA 1R3HA 3QDGE 3UGEA 3WUFA 5D7LA 5T5FA 4XP4L 2R29A 2V81A 2AK4A 5MENE 3TPUB 4PEKA 1UG6A 3G8RA 3SFKA 2WCAA 2EXYD 1M71A 3ISIX 3WJWA 1AODA 3VCRA 4G7YL 4NUMA 3WEOA 2PDNA 3KAOA 3S2NA 5LYRA 3L3JB 2O9RA 5DVLA 2CJ3A 4BFJA 4ABVA 4K38A 3EJYD 2GYSA 5DUJA 5TE4L 3WUBA 1QA9B 1JPGA 4CC0A 1DQMH 1RCXB 2NR6D 4NQCA 3OMAB 3ULVC 3FH8A 4NZUL 2O5XL 3GHBL 2HT3D 4X0NA 1ZSHA 5GS0C 2XU9A 1A9BB 5KSUA 4CMHC 2AK1H 4DJEA 4YMPA 4YFLF 4R2GC 4C6QA 1AIFB 5I6PA 4GC3A 3D2UB 4GQ0A 2YR1A 3OB8A 3HKFA 2AJ3A 4DN4H 2IDFA 4GQBA 2OVLA 2Y8KA 4U3SB 4WQOA 3X14A 3B9VA 4PWIA 3WTWA 4RMRA 1LM1A 4ZUUA 3EYOA 4LEQA 1OZTG 1ZAGA 3P73A 1UACH 1LQAA 2NZ1A 3AIWA 4W9DC 3PUEA 4BD4A 3J27A 4NT0A 4AIEA 1E6OL 4GRLB 5FO7B 3MNVB 1TPFA 2BGNE 3IFLH 2XBZA 5C70A 4YO0A 3O6DA 2VDOL 3IF1B 4HUWB 1A4JA 4ZTYA 1QPKA 3N3TA 3VIIA 4LBUA 3QQ3B 4KWOA 1YJDL 1DJSA 5CU5A 3ZL1A 2AXWA 3QFGA 1GVOA 4BEIA 1OSZA 3HB9A 4PGBA 4JO1H 1HEJC 4ODXA 5MERB 3LLFA 3BIBX 3TN4A 3KVQA 4R7XA 1LEKB 2RUSA 5AW2B 3DC8A 1KLUA 1OTSC 3WQEA 3B8WA 4JKWA 5A2JH 5F7EL 4XMXA 2Y7NA 1RP9A 3LKQA 1R3KB 2XBDA 1DBML 3GXUB 4RZCA 1YJDC 2E8ZA 2YPVA 3U4BL 3V4UH 3SY6A 1CICC 2XZCH 5AY7A 4Y88A 5DDHB 2GQ3A 3N3MA 1Z41A 5DVOA 2OMWA 1F42A 5FEPA 4E41B 5HYJB 4KF1A 4O2EB 1KCVL 2VC2B 5IQ7L 2XI9A 3IDNB 4X5WA 3SO5A 4NKCA 1LWRA 3CUGA 3W53A 4AFYA 3ZHNA 3NSMA 4CUCA 4UB9A 5T9CE 3CZLA 5CKAA 3NVDA 7ENLA 4PJHA 3ZW3A 3MYZA 4KKBC 3BUTA 1R3LA 3V16A 4G2AA 5IBUB 1QW9A 3HMXA 4DP9X 4NKDB 1TIWA 1TWDA 4UTLA 5I00A 4OKDA 1UJTA 3GNNA 3W73A 2W0UA 3W6MA 4J7RA 3LEVH 1H7RA 3ETBJ 3VQ2C 4E5XB 1IC4H 4ODHH 1F45A 5D04C 3VTRA 3FJTA 2X42A 3MQIA 4QYOB 5CLZA 4NEHB 5BXFB 1HX0A 2Q3AA 2DZEA 4MNGA 4G7EA 1VLXA 4PBXA 1EXHA 4ZI8A 1GOKA 3GM8A 4RW3A 3QYNA 3WO4C 4F92B 1FFTB 4YWGH 1ZAIA 1PUDA 3IWVA 4KY2A 4WW2A 3FIGA 5PCYA 2QV4A 2OWWA 3MLXH 4LSQH 1FVCA 2CQVA 3SOTA 2FDSA 1OD0A 3TN0A 3TBTA 4XN5A 4MA3A 43CAA 1QI2A 2P1FA 1FWNA 3WFLA 4DEWA 3SUSA 3FTYA 5FUCE 2CKBA 5IY5B 5D1XE 5FYKL 2A74C 1IWPA 2QKFA 4NKIL 3IXAA 2IQAB 3WSQL 3CUHA 1V3LA 1OTUD 5F1VA 2GKIA 3WS6C 3SDDA 1GAFH 1VCBC 3DV6B 3WH9A 3W2NA 3TYCA 3I50H 4LPUA 3VXUD 5ISZD 1AGBB 1FO0B 1SJBA 4HK3J 3GMRA 4WY0A 2PYFA 4Z2HA 3O4LD 2ACUA 4CAGA 4XP5L 5CZSA 1QQDB 1ZLSH 5D70L 4ZOEA 2VGBA 1DLHB 3UJRA 3DI0A 2X2JA 2XC8A 2C0AA 1U58B 3NA8A 4XUYA 1QRKA 4R6UA 1VIWA 3II2A 3QQ9C 2BIIA 5SWQA 2P24A 5FJJA 1W0YT 5AVHA 2FFCA 2EDOA 4HA4A 4LVFA 5KSBF 4PJBE 4XO9A 3MVTA 1RVGA 2QSCH 4WFEE 1RIHH 2NT0A 4D9RD 3RA7L 3MY9A 2GT9B 3CFJA 1Y5WA 1WCBB 2AV1B 3VZXA 2NZ9C 3DEQA 4FQLH 1NBYB 4NBZB 3RJXA 2EHHA 3U0TB 1CL7L 3CLMA 1OCJA 3FO1B 3DETC 3NFPA 1EC9A 2R0ZH 4JRXD 1ZANL 3LKNB 4HKZB 3HGOA 4EANA 2AJXL 4HD9A 1WCGA 4EWND 2EVHA 1OZMA 3GI9L 4TF4A 5KJRL 4PRNB 2Q1EA 3S8FB 1RIUH 3EXLA 4ZSUA 1PF3A 7FABH 4YE0A 5SWZA 3IDYB 1LO3H 2I14A 2F74B 2HCZX 4PG2A 1SDDB 4G3YL 4GJIA 4GRWF 1JG9A 2H9GA 1OAXH 1KYFA 3U7YH 1F4WL 1JFQH 3FB8A 1ZS8A 4H8UA 5K2ZA 7XIMA 1KXQA 4PJ5A 2F8XC 3L3GB 5H8DA 4XP9H 1VA9A 2YDAA 4EOWL 5ID0B 4LL9A 3V0SA 1T1ZB 3CHVA 2W9EL 2HH0L 1IL1B 1MDAA 1UM4H 5IJDC 5FOBB 3NQ7A 3C0SA 1ZVSA 2UXGA 4PUKA 3KL3A 4DUOA 4TQEH 3AGVA 3DYMA 4NSKA 4MWAD 1N67A 4H3DA 1A7NH 4WVXA 4PY8J 5TE7L 1UBSA 3GD1C 2QJGA 4PW4A 3WY2A 1E3ZA 4YTSA 5LHFA 1IEAA 1V54B 3SDCA 3HF3A 3HB3D 4N6RA 3ARVA 2WWOA 2IQDA 2HDJA 2EECA 4LSRL 2V9TA 4ZTPH 2CO2A 5J8OA 2QQNH 1EXPA 3GSNB 3OXSB 3O6KH 5C09B 3EGJA 5L2JB 4N2CA 2WMIA 5CP7A 3G5VB 5IXEA 3ZE1E 1H6UA 1EJOL 3IARA 3CVCA 1FH5L 1L7IL 2WY3B 4HS8H 1ZSDB 2DQUH 1EX5A 4CC4C 4OCRL 1BVOA 2YPLD 3NOEA 3DX6A 1JGDB 3K7UA 2RQ8A 1OF2B 2WLMA 3MXWL 4FP8L 1HJCA 3ZE2F 5HJXA 1T0OA 5AHIA 4ZS6C 3G5XA 3T0AA 4ZW7A 1P53A 4IFRA 4HQQH 2GEEA 4G7VL 4ZCWA 3QUXA 4RNHA 1DWGM 1DBBL 1JYXA 4JO4H 4HJGA 2QUUA 2YX0A 3VFOB 3W0WA 4CGUB 3CHEA 2JKSA 3MGOA 4K37A 2C7UB 2I56A 3K71B 1WTGT 4NQCE 4OAWA 3G1HA 3U0PA 4MWFA 2D0FA 1PL9A 5I6KA 1F8TL 4PULA 3F2LA 2ZKMX 4TSCL 1B6UA 5DUPH 1PY0A 4CNTA 1IFHL 5G2IA 1KCKA 4KTYA 2GJZA 4N2OA 3C8DA 4B2DA 3B8DA 1HWGB 3WUWG 1A5CA 4PUEA 1Y0LB 1PSKL 5B7FA 3T81A 1VGKB 1LE5B 2VD8A 3GS0A 3ONCA 3ZMNA 3E0GA 1BLNB 2IC2A 1XGUB 3LCIA 4XB3A 1RFDH 1DJIA 4HIHB 1ZAJA 2VZ1A 2E75C 5I66B 5C92A 1P9MA 5CBJA 4DWSA 5BU9A 3GMOB 1RHHB 1D7CA 3DVGB 1GORA 1A6WH 2VDKH 1RZGA 2XHYA 2EDFA 3CH1B 1JXKA 1UWEL 3NSJA 4XC3H 1QCWA 2AQSA 3SDAC 2OSYA 4HJUA 4F57H 5AZUA 1XQ4A 4NQXB 3VXNB 3FH5A 3BGGA 4P3DB 1HHGA 2ZOWA 3N17A 5GRYA 3NM3A 4I0PA 5F7DB 1H09A 5HQLA 4Q4MA 1NFKA 1MW2A 3ABXA 2AXGA 1I85C 2L3BA 2MNRA 3P0YL 4JFDD 3VXUB 5ISZB 1Y7VA 1LG2A 5KETA 4LC6A 1AKJD 4UFMA 3UA3A 4R90L 5DJZA 1CBVH 4V2XA 3SUTA 3AQYA 4OLZH 2F7RA 2YL8A 5JQHC 3O4LB 4JDTL 2VDNB 4ZQTA 4JPQA 1MCCA 1B3JA 2C16A 1TNMA 1TO4A 5HWJA 1JZ4A 5AG8A 1FDZA 3RM4A 3DXIA 3ABQA 1W9XA 2BOCB 3PSWA 1ZKAA 4LSPH 2J8HA 4I77H 3W7RA 3GTIA 2YCJA 5LWYH 4Q22A 5GGVL 4HWEL 2RMNA 2JF7A 5JQ9A 5FJPA 1UZDA 3QULA 5C6MA 3HOGA 2FX8L 5CPSA 3PJWA 2X1RA 4N9EA 1XB6A 4INFA 4FQIH 3H7BB 3LGGA 5AB0A 1TTQA 1YUHB 4R97B 3ZJKA 1GTEA 3R19A 4JN6A 1YNKH 2BNRD 7ODCA 5I9QC 2BVPB 3W7KA 2O26U 3QZWA 3QLDA 1DO5A 4JEQA 1A0DA 1VBRA 3CCHB 3O2VH 5B7ZA 4GIYA 4JRXB 2DIAA 3JUGA 3NK3A 3LCLA 4LEBA 2GIXA 2JTDA 1ZE3H 5I76B 1GZQA 3WBXA 3PFRA 3VGGA 2OMZA 3NJGA 3MA9H 5LBVA 3ZE0B 3B0XA 1BBDL 4D0DA 3TBCA 1FNSH 1K6AA 1NCDL 3N85L 4C4KO 3AHZA 4DFIA 1C8VA 3O3BA 4KXBA 4OVUA 1PD1A 2CBJA 4DEUA 3QEQE 2ZJSL 4CVUA 3OAZK 4B5VA 3BJFA 4HKBA 3GG1A 3H22A 3ZFHA 5CWSA 3CXDL 4KH2A 4Z7UA 2HTKD 1E1FA 5DS8B 4J4PD 4CLMA 1H50A 4FNLH 4JGNA 5IW1B 4PJ8C 3IMUA 3S3SA 1UR8A 4MWAB 3HOJA 4AY8A 2WUCH 2I5YH 3R7MA 3D46A 3WTUA 3VNDA 4OFPA 3TGXA 4FXJA 4X8GA 3GIVA 1WAAE 1BTCA 3QJOA 3DSFH 3HB3B 4O5LL 4Y5XB 2WW5A 1D7KA 2VD9A 2NUTB 3EH2A 2CC0A 1C9DA 1T5AA 3CD4A 5D1QD 2KDGA 2IQ0A 4PRAA 4E2BA 3AIBA 3MOBH 1KC5L 4LF3A 3M1CA 3LHUA 2AGJH 1UUNA 3US1A 3TVAA 4M1GH 1NFGA 4XP6H 4J3TA 5IHSA 4J8RB 4CVXA 4OLWH 5HJBA 1H8NA 3VB8A 5DA4A 5JHDD 3CXFA 3IWPA 2Y2YA 1W9PA 3MP5A 4XZUB 4FQXA 4GKSA 4MZ3A 4IISA 1SO5A 1XAKA 1G9NH 1DVFA 3LUTA 3OKOB 4M8QA 2FIKA 1BM3H 4JY5H 5E1QA 1VFUA 5HI5C 2C3VA 3HJ0A 1T1YA 1WICA 1GMIA 3FT4A 2IH3B 5MP6H 2OR8A 3CL7A 2XFFA 1GXEA 5E8EB 2DVXA 4F4RA 2Y24A 1XF4B 3QO0B 3OLDA 5IHZB 1X96A 4JFPA 3CSYA 4UTTA 5MEPA 5GISL 4H19A 3QDJD 5AZ1A 3QCTH 3TVMD 1VHPA 3ESVF 1UA6L 3VKKA 2P43B 1YPZA 4Z7WE 4UFJA 2VZ3A 1CDGA 3DGGB 4NQDD 4PVBA 1JCVA 3QH3B 3W37A 1F3TA 2Q3XA 2VFGA 4LEFA 1MCWM 4AQ8C 3WLWC 4JDEB 5DWUH 2QPUA 4DIXA 1OYAA 5DBTA 3OKEA 2FH8A 2QKSA 5I78A 4JE4B 2X1TA 1G6VK 4HCFA 2KZKA 1H5BC 2C1GA 4XHJD 3W7IA 4HWBH 2GL5A 1FNEA 1TZOA 3N43F 1XDTT 4FOMA 3WYRA 4IM4A 5REQA 4MY1A 1TQVA 4PJ5E 2KLTA 2GGHA 5T3ZL 2V5CA 5DT1L 4N2FA 4BFRA 1DQJB 1NELA 4XNXH 4DYKA 5D5MF 2P9RA 3AREC 4LV9A 1BECA 5A6BA 4GJJA 4CC1A 1FCBA 1ZBCA 5L8LB 2C14A 4UTMA 1ZLUH 2IDSA 5J13B 3HTWA 1AQDA 1KFKA 4LCIH 4R8WH 3TYZA 5FUOL 4FA8A 1VCGA 1W5NA 1ADQA 1C5DB 1VCAA 2VISA 4MHHG 3BZ4A 4U1GC 3ZKXB 3PXLA 2CLMA 2W4XA 3BKMH 4JFDB 1P4IH 2G95A 1X8FA 3QCVL 5AVSB 1AKJB 4A2SA 2ZZ6A 5INDA 3VRJA 1VAHA 3QUZD 2VAAB 5ESAA 1L7TL 1UQZA 5HK4A 1MIEH 3I9IA 2E47A 1PFCA 3SO7A 2XQBL 4N3TA 1KCRL 2VYOA 2CHXA 2WZHA 3PGDB 3SIKA 1S7TB 1E2WA 4GBXC 4M7LL 5EB9A 2PRMA 4BR1A 2ODIA 2V5DA 2V2XA 2ZONA 1LEGA 4ERSL 3UOAB 1MPAH 3KHOA 1JHLH 1FUYA 3FMGH 4HGMA 3OR7B 2OCZA 1GHSA 3OQ8A 4HZLB 3QFEA 3TBBA 2G75B 3RPKA 3TZVA 4JPVH 3RVWC 4LPTA 2ZX5A 2HLAA 3VXPB 4ZB2A 4L64A 4M82A 4BKSC 2AQPA 1NGQL 3DIPA 5AVXB 2WMJA 1QFOA 2INFA 2VRKA 1S9YB 3I2CH 3EGDB 3BDXA 5FF3A 1MFNA 2BNRB 4UTAL 3IGUA 5JHLA 2RALA 3ZHLA 2HXAA 3CU2A 2FBOJ 2CGZA 2CLHA 2X1XR 1IEXA 2ZKHL 2R2HA 2VFEA 1OAQL 1U42A 2XNAB 3GE7A 4H88L 4PVMA 3RZCC 4OE7A 1Q65A 2NNAB 5C2BL 2VFIA 3H4WA 1OY0A 3IJEB 2Y1AA 4G6AC 3GYRA 4JM2C 1T5XA 1XG3A 5HI3D 3TFBA 4XTRC 2ESVA 4G6FD 4FFTA 3QO1B 1F6AB 1S39A 3L3KA 2DYRB 1SVBA 4AG4H 3TE9A 4QAIA 3F6JA 1ZA3A 3GM0A 3QS3A 5L88L 1HJXA 3DX3A 3TO4B 1JFHA 5FFLA 4IUGA 3WLLA 1F4YL 2BFVH 1TVDA 3RCMA 2R69H 3EYPA 1QFWM 2E56A 3EAKA 2D2JA 4HPYL 1PTDA 3SUVA 4I5RA 2WINA 3ARBC 2EYTA 2VDLH 3N6QA 1EDQA 4QAMB 1MIML 3DNKA 1FORL 1BQHG 4PAZA 4KRNA 4IIZA 2ANUA 4KY1H 3TQPA 3MOAH 4HUVB 1US2A 4AJVA 3H12A 4N9OB 5K4ZA 4QHRA 4Z7OF 1J7VR 3QT2A 4FKHA 2H9AB 2F58H 4AHOA 1UWYA 1QKZL 3QIUC 3EDEA 5D1QB 4MJZA 5FEBA 5KYWB 4UUJA 5DD0L 5IESH 3NAVA 3DXAD 2DSWA 1PB0A 5H35A 4UR7A 4G7FA 5CEZH 1H0IA 5HDQL 4JDBA 3CV6A 4O10A 3CB8A 5CSGA 5JHDB 4BF7A 3TXAA 3FHEA 4AY0A 2UBPC 1KB5B 3FDWA 5B3JF 1N5YL 4LPYA 2YSTA 1U3HD 3UZQB 1S5VA 2CLFA 2Z7ZA 2ROXA 2A1WL 1IWBA 4WO0A 1Q72L 5AZEL 2VT0A 3LKSB 2TYSA 2EDWA 5C0IA 1BV8A 4K15A 1XF1A 4OQVA 4XBEH 2PI6A 2ICEC 1O5QA 4JTEA 4DBEA 5CSZA 3NEHA 2D31B 5B3JE 5M7QA 3HN3A 3LHTA 3TVMB 2EDTA 4OZFG 2COQA 12E8L 2XTKA 3WQ8A 3VXRD 4NQDB 3JV0A 5DMGC 1UKQA 3CPLA 1QMUA 5JO5B 3ANYA 3KWXA 4B41A 4XN7A 5DT5A 1JZHA 2X6CA 4KEUA 1U4EA 5JXEC 4Q6IC 2AVFA 1HXJA 4ATTA 1JRBA 5MHBA 3CC5B 3WIFB 4X9BA 1OADA 2W63A 4AYFA 4WWKD 2H6PB 1QNZH 3MBWB 1HQ4A 4YSCA 2Z25A 1WT5A 2H3NB 1Z9MA 1DJHA 3TOYA 1DE4B 1U92A 4PP1D 4LEXH 4C1NB 4G8GA 3WFZA 2W91A 3HM7A 3O6ML 1GW0A 2XZ7A 4ICWA 4AXKA 5E6IC 4YNYB 5CD3A 4W85A 3QBUA 5D9NA 2ZCKH 3DOHA 4AXWA 3V2AR 5I19L 3L7FB 4UAOB 3CUIA 1MHEA 3UTQA 2H6RA 4U1HA 4OD1L 3FU3A 1MUWA 2XCMC 4Z7AA 3GJEB 4IMGA 1HILB 3TR9A 2RR3A 5M3WA 5JQIB 2E6AA 3AMLA 3OOQA 1CE1H 3B5TA 1L6FA 1I9IH 2WVSA 1RZKH 4XCFL 5KZMA 1G7LA 3WKML 1R0MA 2IAAC 4JKKA 5DS1A 1NCGA 1D6VL 3QUZB 5ENLA 3LCYA 2KH2B 4YHEA 2VX4A 3O8XC 1KDJA 5J3HC 5H37H 2YYTA 3G22A 1NFBA 3NTCL 4W4QA 3VXMD 3QWRD 4JD4A 5ACMA 1Y65A 3MRNB 4JHWH 5CIPH 2XKSA 3K0YA 1URIA 1B1YA 2DYSB 2G3NA 5I75B 2BTMA 4KOBA 3VPLA 4ML9A 4R4FL 3FZUD 3Q8AA 5TFSH 4Z8FL 1O5RA 4JVPA 4YHGA 4Z7NE 2G5UA 3GI8H 5EPMA 2GFBB 4A6YB 5I74B 4LRTA 3N1FC 5CILL 4H13C 5C07B 1NBCA 4RCAA 2YCKX 3AGWA 5AVTB 4F9LC 5T33L 4G82A 4L9LB 4NZ1A 5I1IL 5CPNA 4UOQA 3MCKA 3AB0B 4L3CB 3A3XA 1QZ1A 3REVB 2AQOA 2XYBA 4J3OG 1H1YA 1YMHA 5F0PB 2G0WA 2ZE3A 2OJZH 5E2JA 5I1GL 1X6UA 2EYRA 3O2LA 1LJYA 5K9KA 4X0VA 4FEZA 4MJIA 4M62L 5D72H 3N6JA 3RGHA 4K94H 1KNOB 3ZR6A 2PW1A 4JG1L 1M01A 3NNTA 5HYEA 1Z48A 4ZVJA 3HZKB 3GIZH 4QF1B 1DVZA 5AYUL 5FWRA 3U46A 1O7AA 4G6FB 5EMJA 3C12A 3PBGA 4JY6B 5DHYB 4ZUSA 4KO5A 3AIUA 4WJ5B 1JWSA 1H2JA 1AQKL 2XSAA 1NDYA 2Z7YA 3WQVA 3JWOC 1PX8A 4M81A 2P8LB 1YYCA 5E08L 4FLRA 1SY6H 5KG9B 3C5ZA 2FMNA 1O5DT 2QQLL 4F7EB 3SRFA 5I18L 1M1SA 3UJIL 2BIOA 2HWZH 5KVDL 3VFVB 5F72S 1KCZA 4LLVB 1KIUA 2ZPKH 4DKDC 2P48B 4QNEA 1MHHB 1RBOB 2REQB 2FZ9A 1ILUA 1VPOH 1DJNA 1ASOA 4EX4A 3HU7A 3LQLA 2YD3A 1KTBA 1TMHA 5GSVB 3KYKL 2AITA 3ESUF 3IDXH 1RXLA 3LV5A 4PWFA 4IJ3C 3QFJB 4WHCA 3PAYA 2CK0H 3DK2A 3BO8B 4G56A 1V7YA 3B3BA 2BLEA 5KYYB 4ELMA 5FB8B 4Q74A 4Y2DD 1BGXH 3RIFK 2WBWB 1SYVA 3K72B 1SZNA 2CO6B 1HQRB 1CK0H 1CLVA 5ANME 3SPJA 2KAUC 4BDVA 1OZQA 2OFJA 5ACZA 4I5XA 3N1MC 4LV4A 1ZPUA 5F2FA 3IS4A 4Y8FA 5B4MC 5AAPA 1KXTB 2PPFA 2PPCA 4F66A 3LQAH 2WUBH 1AFVL 5DO8A 1B6DA 1U3HB 4FTVA 3NCJL 1QLEL 4FCAA 4HIJB 3EHBC 3BISA 1CD1A 3E74A 1WV7T 3W9EA 4UOW1 5E5MA 2NY1C 2NVAA 5I7GA 1E9QB 1MLCA 2WKOF 4P2OD 2NY0C 3SPVB 3ZR5A 3IVKB 4RNJA 4DZHA 4DUXA 2PPEA 2NXHA 1M1XA 2ZYSA 5DLML 1UEMA 3QEUA 4LUSA 1PS9A 2G2RB 2VLLB 5GZND 1KBWA 1SZEA 4GFIA 1K4HA 2XPGA 3KLHC 1E9OB 2ZICA 5J9PA 3GB6A 3BGMB 3VXRB 1TA3A 3LKPA 1LDPL 1NJJA 3D0LB 1MRDL 4JW3A 2VB5A 4R7JA 4LOVA 3IEBA 4TTUA 3WGUB 1R3JA 2CDEA 4JO5A 1TPXB 3SYPA 1EO5A 1FOBA 1H7WA 3IGXA 2FLBT 2YGPA 4XR8C 2B4CH 3BKJH 1E5YA 4RDQF 2GLKA 1XR8B 4WWKB 4CSZA 2C1OA 1V6TA 2BMKB 2P26A 5AVUB 3TC9A 4G72B 5LN4A 1VACA 2NVDA 3KPPB 2A3EA 2NQLA 4JPIB 1KTLA 2P49B 5IV2A 5CC3A 3VFPA 3EWDA 4S1RL 1D2PA 5F8QC 2AAAA 1UMLA 1LLOA 3GMPA 3WKPA 4DEPC 4CD5A 3SDXE 1SDAB 2XVBA 3E9TA 2A77L 4WJG3 5I02A 3MLVH 4PTXA 2AABL 4POCA 1B4JL 4AGPA 2VABA 3RLUA 2V5YA 4EZJA 1RQ5A 4RAVA 1B3WA 2VE6A 4XGZB 1EJXC 2A1YA 4BKLB 5C86A 4QKXB 3VD3A 1TITA 3RO6A 2CCWA 3D4GA 3R12A 2OMUA 3KD4A 4L5ZA 4GRLD 4I3RL 1I3VA 1G7JA 3F3HA 4H8HA 1GS6X 1CU4L 3EDFA 3T9PA 3TEUA 4JQ1A 3ZDZE 3U5YA 4Q8VA 5D7SH 2YLLA 4NC1C 4QG8A 1A1NA 8A3HA 2R56L 4MXQC 1UYWH 3DJ9A 4LEEA 4XIAA 2YARA 2CBUA 5GS1C 4QLJA 2QCLA 3L4XA 3HNVH 1RBAA 2BVEA 5JPNB 1WQVT 3SGDH 4NRYA 2WIMA 5G2WA 4XXDB 2C4FT 1AGDB 3WE6B 1UATA 3Q48A 1RJLB 1S2CA 3PP4L 1EV2E 1R3QA 5IBTH 4DK3A 4LKXB 1A64A 1S46A 4ZPVB 2FBJL 2FX9H 3ITVA 3RFZC 4MLJA 3QSTA 2P7TA 3D39D 2YDQA 3P9MB 3VB9A 4WI9A 4KX9A 1LHZA 5G1TA 4Q2ZA 5KTEL 4Y16D 2VXSL 4GYPA 4B3VA 2X70B 3KXQA 4Y4FA 4OY9A 4GO9A 4MTMA 2HXTA 4IF2A 2WLKA 5G55A 4MNJA 4OGAC 2VZOA 4E41D 5HYJD 1H1NA 4IOFC 4YPGA 3RBGA 3QUML 4K71B 3CFUA 4RXFA 4E4PA 3U6XS 2QZ5A 3UYPA 2D03H 1S5IH 2BSRA 3LBMA 4LKCB 4KKCC 3OU8A 1J5DA 4FYRA 2IO5A 3OPUA 3M8OL 4YR6A 2XQYG 3TV3L 1TTUA 3AQUA 4LLWB 4ODWA 2OTPA 3MJYA 1T7WA 2D1ZA 4M7ZC 3BWUF 2GSIA 1K85A 3DHDA 4XO4A 3ZWTA 5DFVD 4D72A 1DQVA 2R8WA 1PS3A 5DI8B 4I3SH 1XICA 3RLGA 4NG3A 4RFOH 3W39A 1J05B 2B0MA 3MODL 4CMMB 1MNSA 3MFFB 4P2YA 1YDOA 5GGRA 2A6NA 5AC5A 3SZ6A 5EMLA 3IEAA 3OVGA 3ZKND 4U4BA 4L61A 1T04B 4FQ1H 1KQZA 5KSVA 3WLKX 5HDBB 3Q3GA 3DOSA 3BPNC 4NNYA 3I6TA 1T1WA 3M0VA 2BVOB 4N9GB 3L1FA 1OQFA 5BUGA 5DJCB 4MX7A 3W75A 4Y2DB 3TBYB 4KZCA 2TSAA 3S7GA 1MWAA 4TX6A 2CESA 1MF2H 3NPZB 3ALWA 4JUTA 1J1PL 4LYPA 2VXVL 1I9CB 3VSTA 4CD8A 4TN9A 1I7TB 3B7SA 3VOJA 2UV8G 2X7WA 2DZAA 1V6WA 3THCA 1RIVL 4LMQI 2PXYC 1MMFA 5HR7A 4GUPA 3BLDA 5DC0A 5IOPA 4YDKL 3NABH 2XGZA 4QXIA 3V4VL 5HYSA 3VIFA 5BRZE 2GSMB 1B4TA 3NEXA 5E1HB 1BF6A 4QUOA 4KH9A 4FYQA 2HFEB 4H2AA 4ZTEA 5EU9A 1GPFA 1YN7B 4G6KL 2HPTA 1E3XA 4OKVA 4JGJA 4ZS7H 1FN4B 2GCYB 4QCIA 4PJIA 2P0OA 4DP5X 5IB3A 1BQ5A 2G5BA 3FL7A 1JZIA 3WBAA 3ZYJA 4R4NC 1W6TA 4F1ZA 2E8YA 3PZOA 4ODTL 3LSBA 1SEBB 3NQEA 2JCCE 3C6LA 3ULVL 3QQDA 5IBUG 3TONA 3F4WA 1L6PA 3PAJA 5GS0L 4NRZA 2ZRXA 3ZL2A 3WLNA 5DR5H 4RLDA 2Y85A 4M1CC 1WE5A 4LVOB 5AWNL 3ITGA 1MZHA 1KYOK 4LHQB 1JZ3A 2KUTA 1RZ7L 3N9GL 3MRBA 3CIQA 1M1BA 2JMRA 3OGOE 3QIWD 3UAJA 3F5KA 5E00A 4DZIA 3DROB 3O2DH 3UXDA 4L8BA 4PRIE 2LAAA 3MLYL 4E9QA 3BPLB 4DJFC 2H1PH 5EMYA 4UDUB 3VWKD 4XUGA 3LS4H 1WKDA 5T26A 1PCWA 3RKDC 1KLFB 1W6LA 2NWRA 2JXMA 3S2AA 3AY2A 2V6AA 1DP0A 1VFAB 1DSWA 3GNPA 1T8XA 2B7DT 3VYNA 4JRYE 4JKLA 5GHWL 2NY6D 2XG4A 4MBRA 4QHKJ 2A0LD 5LGZA 1XX9C 4WI0A 5CC6A 3H2WA 4ZDHB 1MFMA 4IHBA 2AL1A 3U2IA 3BG5A 1JTOA 2E6QA 5KINA 4PEEA 4L9YA 1L6YA 3GZPA 4H8PA 5JH2A 3F7KA 2SFPA 5FK9B 3RRAA 4EPEC 2Y7OA 3TNNB 1IC7L 3IB4A 4Y19A 3OTTA 4XX5A 2DJLA 4U1NB 2OJ1A 3MROB 1MDLA 3S6TA 2OLAA 4PWJA 1W8NA 3DESA 1KFAH 2PDPA 2QVFB 1IGMH 1UD3A 3VYPA 3BOFA 4EBQL 3HG4A 1KJ2A 4PMQA 4POZD 1OE3A 1B2WH 1TTBA 4Z1AA 3NTYA 4RDBA 3AS0A 4FFYH 5DJDB 3D39B 1I2PA 4LVNB 5E4EC 4PGEA 1U1UA 4P46D 1Z3NA 2R1XB 1EFQA 5B1JA 4G9FA 5C09D 4XNAA 2B59A 3LENA 4Y16B 3QUKB 2KZBA 5FM4A 5EZOL 5DZPA 5A6MA 3WI9A 1QYGL 3QR3A 2PDJA 4IZGA 1FI8C 4IW4C 4DBSA 2DTML 1GKOA 4QRRA 3FDGA 4PTNA 5ETUA 1B0GA 4PMJA 5K33A 1JPHA 4J9JA 2JH2A 2FL5B 4BWTA 2X1SA 3UR2A 4WGXA 4HIEB 3OVPA 4C56A 3AWOA 5EOQH 3W7GA 1IJ9A 3OM3B 5M5DA 3VAEA 2V5TA 4FABL 4TVPL 5JOFA 3IETA 1J9RA 4RV8A 5FYJL 4WTZG 5J6GB 4LOCA 2JJWA 4HJIA 1ONWA 1IC5L 1UP0A 2GSHA 2ADIA 1JHTA 3G04A 3W74A 3WKZA 3DO4A 1M7DB 4TQPA 2VC2H 5DUBA 3LI1A 1UKSA 2PW2A 5I1LA 3UYRL 4JN1H 1J10A 2ALRA 1J0IA 4BK5C 5E2UH 1ED3A 2YQGA 5KYUB 5IHUL 3NJXA 2ZUSA 3LZOA 2ATKB 3NJIA 2ON3A 4XODA 1LLWA 3BW4A 2YLAA 4FX6M 4FA3A 4MB4A 2JFEX 2V7HA 3SODB 3F6LA 5A3HA 2HAZA 4HK0B 1Z5HA 1KGIA 1ZENA 3VD7A 2X38A 3MJMA 4F91B 5IMOB 4A2GA 3TTSA 1E8ZA 4LB4A 1GYUA 2XRAL 5IJKC 4OIIL 4MYPA 2BVWA 3LN5A 1IM3D 1XDMA 1XINA 2OMXA 1G6RL 3SJ3A 2ZXWB 3W27A 5FX3A 3LNFA 1DBAH 2ZUNA 2PRHA 4PB9H 2ZYRA 4IBYA 3UPRB 2ED9A 2Q86B 3GKZA 3ZT7A 4DQOL 4C6OA 3MDUA 1MQKH 4IK7A 5TAOA 2RFXA 1BFOA 4HUXB 3IKKA 1XGTB 3NK4A 4UTIA 3L6FA 4DQWA 1WFUA 2E7MA 3BUDA 3TLQA 5DF0A 3SCVA 3CZKA 5F1NB 3AAZB 3MRCA 1VFMA 3RAOA 4XMZA 3CHCA 1TYEB 3AM8A 4WD0A 3GEFA 2V33A 1OHZA 1ZGLB 1NTDA 4PJ6A 3RPIA 4O1DA 4BSVA 2J27A 1USQA 2ISDA 1NCHA 5E8DH 1JMXA 3I6LD 2FJFA 1HU8A 4PJBF 2PCFA 4UQ2B 4L4VD 4AQAA 1NDMA 5ALBL 4HALA 3BPWA 2FMOA 5EIIA 3FN9A 3NJKA 1IEVA 2WXGA 3WQ5A 1XJBA 2CUHA 3VD0A 5DVMA 1NSNH 4UTWA 4OM0L 3MT1A 3CN0A 1LWHA 4R26L 1OCRB 3VH8A 3BP4A 2Q10A 3T6ZA 2NXYC 4TLUA 1FHGA 1RH8A 3ECWA 1U91B 1NMBH 3TYBA 4B4FA 5E8PA 3VCLB 1OGTB 1JERA 5DGQA 4HWNA 1CPUA 1GJUA 4WW1A 3GXDA 2NX5E 1OP3K 3QIWB 3ZX1A 4OLYH 1KXVC 4IP4A 3BJSA 3VZZA 3F64A 2IFFH 3R8QA 5FOJA 1M9WA 2H2SC 3H0TB 1OWWA 2R2BA 2DZXA 4O14A 1TR7A 2QCGA 4KUCF 5I0DA 4HCRH 4S2CA 4PM1A 2YGQA 3VWKB 3NO5A 3CSBA 1D5IH 3WFCL 4P61A 3BP7B 3A3HA 4KFZC 3FA5A 2QR0A 4LYQA 4C7FA 4F7PA 2DI9A 1NDTA 3LHWA 4XBPB 2R2CA 2NXZB 4Q58C 1ZE3C 4HWUA 2NY6B 3NDZA 3DFHA 3CN3A 5AVYB 1Z3RA 1S3RA 3ES6B 4LAMA 4RPQA 4YX2H