1PPIA

The active center of a mammalian alpha-amylase. the structure of the complex of a pancreatic alpha-amylase with a carbohydrate inhibitor refined to 2.2 angstroms resolution
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase (o-glycosyl)
molecule keywords ALPHA-AMYLASE
publication title The active center of a mammalian alpha-amylase. Structure of the complex of a pancreatic alpha-amylase with a carbohydrate inhibitor refined to 2.2-A resolution.
pubmed doi rcsb
source organism Sus scrofa
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1994-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ppiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ppiA01
2VZVA 5CZKA 1C91A 3N18A 4QCEA 1M01A 3AZSA 3N1AA 3WD2A 5I24A 4OZOA 4UFJA 2X0YA 4PMDA 4AD4A 3M07A 1GJWA 3VGHA 4BCEA 3WQ5A 3D4ZA 1FOBA 4DO5A 1JFHA 2J7CA 1KR0A 2D73A 4AZCA 2W5FA 3A21A 1UH3A 4H8UA 4NRSA 1WAWA 4JZ5A 3QHMA 3WF4A 4AISA 1KGWA 4ML4A 1HKMA 1RH9A 1SR0A 5GNZA 1W3LA 1I75A 1MYRA 2OYKA 1QNRA 3W37A 2WC3A 3AYRA 2ZXQA 1G0CA 1H41A 1V02A 2VRKA 2EPLX 3G6MA 1CXIA 1VBUA 3I3DA 4D6DA 3IAQA 2VZTA 1PAMA 1KWGA 3JUGA 3VIMA 4GKLA 4J27A 2D2OA 2CKRA 5CLWA 1VB9A 4AXNA 4P7LA 1JDDA 4BA0A 1ODZA 3AMCA 5FKYA 1ZB5A 4S3KA 1EO7A 5A1AA 3ZJ6A 3BUBA 2XN0A 1RP8A 3CZNA 2E9MA 2XGBA 2CEQA 3LRMA 2W63A 3AI0A 4OBRA 1PPIA 3VIFA 1BTCA 1B9ZA 2ZX6A 5CGTA 3E1F1 2PI6A 2E3ZA 5BRPA 1MQPA 1YQ2A 3S6TA 1LL4A 3WMSA 2ZX7A 1CENA 1B3XA 3GNPA 1W3HA 1E0VA 1E6SM 3LPFA 4J3VA 1CGVA 2YA0A 2C8NA 4LQ1A 4W86A 5KZ6A 5A2CA 3WL1A 4TX6A 1QNOA 2MANA 2WM0A 4ACZA 3BVUA 4UQDA 2ZIDA 2X09A 2XFFA 1HKJA 3PZNA 5HPOA 2CCRA 4GI6A 2F61A 1EQCA 1GQLA 3DC0A 1V0MA 1EH9A 4IUGA 2DH3A 5JIWA 4W93A 4IPNB 1UWUA 1E71M 3ARRA 4A3YA 1CXLA 4XB3A 1CGUA 4FNQA 2DT1A 1QOXA 1EOKA 3THDA 3MMDA 4Z2JA 4JFUA 4QFUA 1FP9A 2PWDA 2WVTA 2VX7A 3LXAA 3CZGA 3WNMA 5DF0A 3PZVA 1H0GA 1LL6A 2VTFA 3L4ZA 3HG2A 1L8NA 3M46A 4HMCA 2ZX9A 4N42A 1FA2A 4AYSA 1R47A 1B31A 4GIAA 2VMFA 3T09A 4NI3A 5ABFA 1DTUA 4JCLA 2ZUVA 2G41A 2JE8A 1FHLA 3RPMA 4W87A 2Y2WA 1GPFA 2CYGA 3ZT5A 4P8WA 3IJ7A 1W3KA 1GVYA 1JI1A 5I6SA 1UD8A 5IFPA 3FAWA 4W8BA 3NUKA 3PZGA 3SIMA 1UD3A 1V0KA 4GPNA 3MSDA 2V3DA 3ECQA 1J0YA 5BWFA 1GHRA 1SZNA 5E0CA 3VD7A 2OYLA 1KQYA 1TR1A 4C7GA 2Z1SA 4XZBA 2YL6A 3K8MA 1ISVA 1U33A 1WB0A 4MNLA 3BVWA 2TAAA 4QLLA 1FP8A 1QWNA 4UFMA 4UFHA 3EJSA 1E4MM 3B9AA 2C7FA 4AD1A 4EE9A 3D50A 1UR0A 2G8ZA 1MVYA 1TUXA 3UCQA 2YFOA 1ZJAA 3F5KA 3CZKA 1JAEA 2WKGA 2DIJA 4PMRA 5ECUA 1C93A 4CU6A 2OLHA 2A3CA 1QI3A 1CXFA 1WNOA 3BGAA 2E40A 3K8KA 4Q7NA 3N17A 2FHCA 4AW7A 2IXVA 1UWQA 1SYTA 4AZ6A 3FHAA 3IK2A 1WDRA 2WW5A 5A6BA 2XTKA 5A94A 3CLWA 3VGFA 4FF5A 1OB0A 2C0HA 3KLLA 4NSBA 3OGRA 4U31A 1CEOA 2XHYA 2DH2A 5EFFA 1B30A 3M7SA 3A22A 1WDPA 2YKKA 3VDHA 1BPLB 3AIEA 2PWEA 3ZJ8A 1AQ0A 4P8XA 2W4XA 1B3VA 1QHPA 5C71A 1PIGA 3ARWA 2XVKA 1HKKA 2GVYA 4M24A 3CUHA 1OIFA 3CPUA 3DHUA 1UKOA 3VX0A 5CQ1A 4DWSA 1W3JA 2OSYA 1MFUA 2BXYA 2YFNA 3CMJA 4P7QA 2CBVA 4AY1A 3F5LA 1Q6CA 3SCOA 3OLDA 2BHUA 1UR9A 3N11A 1BAGA 3W29A 4CD4A 4CD7A 2XSBA 4JKKA 3WIJA 2F7QA 4FLSA 2CIPA 4QLJA 4V2XA 2WWCA 4GZEA 2OWWA 4WSKA 1OINA 1MW3A 3BUQA 1C92A 1HJWA 4GINA 1ISZA 5JBFA 4W7WA 1LWJA 2CITA 3D4YA 5M17A 3AS1A 3SUSA 2YIHA 4UFKA 1GOQA 3ARYA 4HMEA 3HU7A 4R5EA 3MV11 3BH4A 4LPCA 3LRKA 4ZENA 3CGTA 3OGVA 1QBAA 2F7PA 2BFGA 2FHFA 3B8SA 2XWEA 3K1DA 1LL7A 1NM9A 3QHOA 2IXUA 3TTYA 1XYFA 4W84A 2CBJA 4B9ZA 3NSNA 2VT0A 4YPJA 3EDJA 4LXFA 1CDGA 1KB3A 4QAWA 1MWOA 5A6KA 2BVTA 3I3BA 3I3EA 2X0HA 5IFTA 1GOMA 1CPUA 1Q6FA 5F7UA 3WQ4A 3BAKA 1KBBA 1E40A 4PTMA 2WVVA 2EJ1A 1NWSA 3QR3A 2VX5A 1C8XA 1ZBWA 2VX6A 4MNKA 2FYVA 5A2BA 1BHGA 4LYQA 1PEZA 3FW6A 1E73M 4B16A 1EOMA 1JYWA 5EFDA 3WQVA 5BCAA 1ZL1A 2XJ7A 3ARTA 5A69A 3K4AA 2VO5A 3WFLA 5M03A 4LGXA 3W38A 4TVUA 2JIWA 5C8BB 1B1YA 3MO4A 1E6ZA 3WY4A 1V0NA 3VVGA 4AZCB 5EMYA 5DEZA 3MKKA 3CBWA 4JFVA 1R87A 3UESA 3MMWA 3KEHA 3HJEA 5JBDA 3AQUA 4RL3A 4ATDA 3ZMRA 4JL1A 3W53A 1TG7A 3ARVA 5CLTA 4E2OA 2BVYA 2VOTA 1HF6A 4D1IA 1GOKA 2NSXA 4XUYA 1V6VA 1HT6A 1XH0A 4D6GA 3ZT6A 1UHVA 1E6QM 3SUTA 3LXBA 4DO4A 2XN1A 1E0WA 5FD0A 2VZSA 1JAKA 3GXMA 4QCFA 4NRRA 2DEPA 3MU7A 1QI2A 3EMZA 3L2MA 3GH7A 1H49A 1W9VA 4W7UA 1CGXA 2X2HA 3RILA 1UD2A 4UZSA 1K9DA 1G94A 4JL2A 5CGMA 3AMGA 2BY1A 2PB1A 4B3KA 4Z2GA 2E9LA 3NYDA 1CZ1A 6CGTA 1OT1A 2BXZA 1E70M 4V28A 5BXPA 1Q6EA 3AIUA 6A3HA 4HA3A 4DO6A 2VCAA 5A8MA 4MDPA 3BVTA 3G6LA 1JZ5A 3WEZA 3WQ6A 1MQRA 1BG9A 2QMKA 1HP5A 3WDJA 1OGBA 1V6YA 3B9DA 3W81A 2WCGA 1V6XA 3ZSTA 3N13A 4MB1A 1MW0A 4PMZA 2Z1KA 1IT0A 2FE0A 2UWFA 1V3KA 2VZUA 1WZLA 2WHKA 1G01A 5E0FA 3W4RA 5HXMA 3WMBA 2B31A 3VX1A 5A3HA 4TXEA 3VKKA 3GZAA 3KL5A 3SCQA 1TCMA 4TX8A 3SUWA 5I23A 4KRUA 4DM2A 1HX0A 3O9NA 4ACZB 4FLRA 3VM5A 1JGIA 3S5ZA 4PCSA 4OOZA 2X05A 1NP2A 1ZBVA 3T2QA 1HL9A 1UWTA 4D6HA 4D6IA 2EXOA 3WNKA 2QHAA 3O6AA 1QI0A 3IANA 5CSYA 1X6NA 2UY3A 3IGUA 4D6JA 2WVUA 1PX8A 3CZJA 2QPUA 3VNYA 1PS3A 1GZJA 3W28A 4DWSD 2V3FA 2BVDA 2WCAA 3K4DA 3MANA 2WZIA 3DYPA 4FLOA 1LF1A 2ZUWA 2VRQA 3A23A 3AMLA 1CXEA 5DFAA 1BVZA 2VR5A 1VRXA 5IXEA 1BG4A 3WMCA 1DP0A 4HMDA 4ZE5A 1E1EA 5ABGA 3W27A 5HOSA 3VIGA 1C8QA 2W62A 2F2HA 2WSKA 3SCTA 3RIKA 3WEMA 4KWUA 1LG2A 1ECEA 2V3EA 3CUJA 3KE0A 3WNOA 1H0IA 4H04A 4UQAA 3CZSA 1ZBCA 3PTKA 2EQDA 3OLIA 1E4NA 2UY5A 2JEQA 4NXKA 4NXSA 1PBGA 1YHTA 3EJRA 2DT3A 2ALWA 2CKSA 4CD5A 1XH1A 4BF7A 4P8UA 4BS0A 3VMOA 3KLKA 5A6JA 3PZ9A 2PWGA 1JIBA 3TV8A 2Y8VA 2WXDM 3TTSA 2VL4A 1FFRA 2WMKA 4F66A 1ITXA 2A3HA 1VENA 3GM8A 1AQMA 2WC7A 4HZ7A 4RE4A 2D20A 1GJUA 3ZO9A 3WUGA 4J3SA 1C90A 3WNPA 3WH9A 3KWXA 4BQ2A 1H11A 4AC1X 2X2JA 2BNJA 3F5JA 2WAGA 1R7OA 1JNEA 1IZJA 3RJYA 4WKFA 1K9EA 3VDBA 2OYMA 4D71A 1SFSA 4M80A 4HP5A 3WY2A 3ARQA 1I1WA 4UCFA 3PZMA 3OA5A 8A3HA 2FH8A 3VIHA 2NW0A 2VI0A 1X1NA 4CKQA 1CGWA 1H1NA 2IGTA 3BVVA 2EPOA 5E1QA 2WHMA 3N9KA 3WSUA 4DWSC 1XCWA 2O9TA 2WKLA 3T0BA 1E6RA 2A3BA 1XYZA 4MB4A 3WEOA 1P6WA 3QOMA 5A8OA 3RDKA 1UKPA 3LPPA 4YN5A 3BUPA 4JAWA 1EXPA 4UOZA 2GK1A 3TA9A 4E8CA 3N04A 4JHZA 4PCTA 1JNDA 2WZEA 2FGZA 4MTVA 4KMQA 4U33A 3HG5A 4B15A 3N15A 2XUCA 4HTYA 2WWDA 4DWSB 2ZXBA 3AHVA 4JFSA 3ZOAA 1BF2A 2VRJA 5D9NA 4YHEA 3VMPA 4ACYA 3APGA 1QVBA 1V3HA 2GSJA 5FIPA 4CCCA 4HOXA 3OGSA 4W7VA 2VVNA 5CG0A 5GQBA 1UOKA 5I79A 4PMYA 4ZXOA 1US2A 1NOWA 1HN1A 2WBGA 4DUWA 1BVNP 2EAEA 2ZX8A 4FNTA 1EGZA 3UR7A 4IPLA 3WD0A 2XSAA 1E43A 3BAIA 1V6WA 1JZ7A 3AIVA 3U57A 5AYBA 2ZE0A 1W1TA 1ZBKA 5LA0A 1F4HA 4GQQA 4FMVA 2DSZA 5E9AA 5DT5A 4HOZA 3VIKA 1TQUA 1KR1A 4AMCA 4JFTA 1CLXA 2BY2A 2OW7A 3W82A 5HNNA 2DQXA 3UG5A 3BUDA 4WK9A 4M82A 2E9BA 3WDHA 2WNWA 3U5UA 3K46A 2CPUA 4KRTA 4BZYA 3GXIA 4PYSA 1QBBA 3D3AA 2X2IA 4LYRA 3FNDA 4AD0A 2D3NA 3VSTA 4P7RA 3WH6A 2E0PA 3WD1A 1XCXA 3BMVA 1LQ0A 2DT2A 1KXQA 1E1FA 1XSJA 1UR1A 2ZUMA 4W85A 2BHYA 3NCOA 5I2UA 3AHYA 3MUY1 1EQPA 1HXJA 1W91A 1TQWA 1V3IA 3WKZA 1XGZA 4P7NA 2WVVB 3AIWA 1W9UA 3VIPA 1GONA 2JEPA 1LG1A 4MJ4A 3DYOA 1I1XA 1J12A 5BYWA 3VD4A 2F18A 2D0GA 4MB5A 2AAAA 5LA2A 2DSUA 2WMGA 1GUVA 2O92A 4TVCA 3ARSA 3VU2A 4ATLA 1NP0A 5CSUA 4MJ2A 3U7BA 3MMUA 2BY3A 2CNCA 2J4GA 3WFZA 2DDXA 4ZE4A 2VQTA 4H8HA 1V3MA 3GXNA 4UNIA 3KL0A 2WMHA 1TMQA 1OT2A 3PTMA 3A4AA 1W9PA 3VGEA 2YA2A 2J7BA 3KZSA 2G3IA 4WKHA 1ZJBA 3CZEA 4AIEA 1FH8A 4NF7A 1QNQA 4JKMA 2CXGA 2FDMA 1KGUA 3SCRA 1GQJA 1L0PA 3RCNA 3QOKA 5HDRA 3CTTA 5E09A 1NOFA 4CN1A 2E8ZA 4J3XA 3TP4A 1WZAA 3H55A 3H53A 4H7VA 2VZOA 3HN3A 5A8NA 3BCFA 4WLCA 3CO4A 5I0DA 3WQWA 1JZ3A 3WUEA 4IISA 3IJ9A 3EJQA 3AOFA 1XRVA 4OOUA 5DMYA 4TOQA 4HPGA 2D0FA 3GBEA 4A4AA 4ZXLA 4J3WA 2VX4A 4MNJA 2WZHA 2QV4A 4E8DA 3DX3A 2VCCA 4FNUA 3VDAA 3CIVA 3VGDA 2UY2A 3DECA 2OSXA 2J7DA 3VSVA 2W61A 1BYBA 1V6UA 3AMKA 4MAVA 4AMXA 1GCYA 1EO5A 2EEXA 4C7FA 2J74A 2ZUSA 4UTFA 3L4VA 3AFBA 4UQBA 1OGSA 2JIEA 3DDGA 2V5DA 3AXXA 5AC5A 2BV9A 4UOQA 3ZR6A 3EBVA 3HZ3A 1KTBA 3BSHA 2X2YA 3DX1A 3BLKA 1J0IA 3WNNA 1GNXA 1KBKA 3W26A 3ALGA 1EDQA 3B9EA 1JYXA 2G4FA 3VPLA 3MUIA 1DWJM 1J0ZA 1R34A 1JXJA 1OBAA 1EDTA 1XSKA 1FH9A 1W1VA 1AVAA 1PJ9A 1E6NA 4X9YA 3RM9A 1OSEA 1CNVA 4PUDA 1VFMA 4U3CA 3VGGA 3AZTA 4GZIA 1JF5A 4Z2IA 1NWTA 1CXHA 1E9LA 1RPKA 1BYDA 5I78A 3EDFA 5BROA 1WE5A 3CMGA 2EPNA 4F79A 1HJVA 4AZ7A 4HU0A 5GNYA 3WBAA 5A2AA 2JF6A 1HWWA 3NDZA 2G3NA 1HJQA 4WIWA 4UZUA 6TAAA 4QP0A 3VM7A 2J8GA 2YLAA 4HU8A 2VURA 5C70A 4FNRA 2VVSA 2OSWA 3GDBA 1U30A 3FN9A 3WUFA 2DGAA 3DX0A 3S2CA 3NDYA 1ZU8A 3AZRA 1BYAA 4EKJA 4M81A 4EANA 2ZICA 4GI8A 1W9XA 4MADA 3RM4A 1CTNA 2D24A 3ALFA 2WK2A 1MFVA 3WH7A 1EA9C 4AD3A 1O7AA 1WO2A 2A3EA 4PMUA 3ZSSA 5CPTA 1UKTA 2XWDA 3OG2A 1V3LA 2YA1A 2ESCA 4OUEA 1TA3A 1R8LA 4K68A 2QPSA 1OWQA 4W8AA 2EPKX 1VFUA 3EMCA 2VC9A 3L2LA 4PEEA 1H5VA 3CUGA 2D22A 2J75A 5GNXA 3T0DA 1LLOA 1D7FA 4Z2HA 1C7SA 1HNYA 1HJUA 3CHFA 4U5KA 1HJXA 5CPQA 3UERA 4FNPA 5BXSA 1AMYA 3PZUA 1G5AA 1JXKA 1E5NA 2BS9A 2EACA 1GQIA 3ZM8A 4A3HA 1JL8A 3VIIA 1XD1A 3L4TA 3W6LA 4W5ZA 3BCDA 1UA3A 2YDQA 1R33A 4RE3A 3SCPA 3O2LA 4R27A 2GJRA 1HJSA 4TTGA 1BGGA 3UEQA 1M03A 1BQCA 4QLKA 1O6IA 4CN4A 3PZQA 1Q6DA 3AMDA 3RMEA 1XD0A 3MS8A 1QI5A 1VJSA 3WH8A 4AZBA 1B3ZA 3NIYA 1QW8A 5E6YA 3CH9A 1KQZA 2XIBA 2FH6A 3DDFA 3GXFA 1E3ZA 3RJXA 3GXTA 1Q4NX 2GK1B 3IJ8A 1WCGA 2BHZA 3BSGA 3A4XA 1CLVA 2EBNA 1MXDA 2XFYA 4GO9A 3U7VA 3OLGA 1AQHA 1QNSA 2J7GA 2WMJA 3DHPA 2WMIA 1QHOA 1MW2A 3VO0A 1E15A 4WF7A 1VBRA 1W2VA 1NARA 3WL0A 5AC4A 2CHNA 3IAPA 4MDOA 1JYNA 3TTQA 4CD6A 3VMNA 2EADA 1PX3A 3OZOA 1VJZA 1H4PA 1B0IA 1QX1A 2Y4SA 9CGTA 5AY7A 5ABHA 5LYRA 4D72A 4BQ5A 1EIBA 4TUFA 2J77A 2DSKA 4UFIA 1UQZA 4XX6A 1GHSA 2DSWA 3PZIA 5ABFB 1B90A 1IZKA 1K9FA 5EBAA 2J78A 3OB8A 1UWRA 3BAJA 1E3XA 1TFVA 1TE1A 5DT7A 3L4XA 4GI9A 1QI4A 2PWHA 2WSPA 3A24A 2D0HA 4J7RA 2YOCA 1O7DC 3CUIA 3DX4A 3WF3A 2J79A 2F1AA 2FHBA 1M53A 1GORA 2GUYA 2YJQA 2WYSA 1XV8A 2VUYA 1VFFA 1JZ2A 1KXTA 4OJYA 2OW6A 2GDUA 2Y5EA 4DUVA 2ZOXA 3CZLA 1KGXA 3FY1A 3UETA 1TQTA 3SCNA 4HZ8A 4ZEPA 3WF0A 4U3AA 1H3GA 3BLPX 3CHCA 1OGGA 2XVNA 2PBGA 3ARPA 4M8UA 1JZ4A 3EJUA 1A47A 3FXYA 4Q22A 5I3DA 2NT1A 4CUCA 4AEEA 1M7XA 4PMNA 5BXTA 3VNZA 3GYCA 1CWYA 1VEMA 1JD9A 2XYLA 1B3WA 5A6SA 3T0AA 5CPSA 3SCWA 3WDIA 3EDKA 2ZUTA 1KCKA 4JFWA 4AZIA 1JYVA 2WMFA 1HIZA 2OWXA 2XFRA 2J7FA 4E4PA 5A8QA 1K9TA 1UD5A 3BAWA 3GBDA 4PTVA 4URIA 5IDIA 4BQ3A 3ZT7A 1UH2A 2J7HA 4PBGA 4J3TA 1WDSA 3LMYA 1EDGA 3SUUA 3GXDA 4M29A 4PMVA 3GXPA 3ZQ9A 4RE2A 2V3GA 5GPRA 3SUVA 1DWAM 1ISYA 4PSRA 2W92A 5I5RA 1GQKA 1HXKA 3VINA 5I77A 1KFWA 1PX4A 1M04A 2E4TA 4FNSA 3UG3A 4PRWA 1ZS2A 3WQ8A 3AS3A 2J47A 4CN6A 3ARUA 3DYMA 2XM2A 4N0RA 3D51A 4W5UA 2YL8A 3SEPA 1T0OA 1GVIA 1F4AA 1E55A 4B9YA 3QHNA 1GW1A 1V0LA 3W25A 4D1JA 4IM4A 1UZ1A 5A8PA 1HP4A 1OCQA 5A95A 2WVSA 3PN8A 1CECA 1HTYA 3ZJ7A 3AYSA 4JKLA 2IUZA 1BLIA 3ZR5A 1NH6A 4GZJA 3BXWA 2O9RA 7A3HA 3A47A 5LA1A 1TZ7A 1WZKA 5FL0A 4FK9A 4LYPA 5CXPA 2G3MA 1UWSA 4HOWA 2O9OA 4JIEA 1WP6A 2YBUA 4D6CA 2ZX5A 3TOPA 5KEZA 1NWUA 3VUPA 3AHTA 3PZTA 1JI2A 5D4YA 5HPCA 1LWHA 3FHQA 3MSGA 2GJXA 4OKDA 1MXGA 1E0XA 1J10A 1BSIA 1MQQA 1C8YA 4KGJA 1X6LA 3SURA 2CETA 2AOSA 2CBUA 4D6FA 1B2YA 1RD6A 3PTQA 1E6XM 2F1BA 3L4WA 1W9BM 2VJXA 4AWEA 4S3JA 1S46A 4W8LA 3T2OA 3CZ8A 1HKIA 3WUBA 2D23A 3CHEA 3GH4A 2XPKA 4CCDA 4DM1A 2J25A 3UG4A 3WELA 3WDRA 1VIWA 3K8LA 5A6LA 2XVPA 4P8VA 5HBFA 5FCZA 1E72M 5JBEA 3AIQA 1K6AA 2O9PA 1E56A 4WJXA 4MB3A 2WB5A 1QHZA 1UQYA 3GTNA 4PSPA 2PF0A 1OD0A 1W1PA 2PWFA 1NWRA 4PMOA 3J7HA 3LXCA 5FOOA 3OZPA 1SMDA 1WPCA 1SMAA 1UR8A 2X8RA 1HL8A 2YDRA 4L4PA 1WZMA 3LPOA 3WNLA 2GJPA 1KWKA 2YBTA 2GFTA 3NJ3A 1UASA 1D2KA 2XG9A 3LX9A 1TQSA 1G9HA 2D3LA 1PZ3A 3UR8A 3WBEA 3AROA 5JUVA 1JD7A 1ODUA 3A4WA 1TVPA 3EJPA 4UR9A 3AXHA 4YHGA 3SCSA 3WH5A 3MI6A 2W91A 4W89A 4AMWA 1R7AA 2NT0A 1DWGM 1H2JA 3SCUA 1DEDA 1E6PA 1VFOA 4EAMA 3NSXA 1J11A 1FHDA 3EYPA 2ZUUA 3LRLA 1VEOA 1UZ4A 1TVNA 3W0KA 4NX0A 1NOUA 3AJ7A 2WC4A 2XGIA 1WDQA 3AHXA 3TONA 4U2ZA 1E4LA 1VF8A 4FLQA 1JZ6A 3LPGA 5BXRA 3VD3A 1KXHA 1HVQA 3PHAA 4MAZA 1H09A 3L4YA 2RGMA 1VAHA 3BC9A 2JFEX 3T2PA 2HVMA 4D6EA 3A3HA 3AXIA 1OD8A 4J3UA 4V27A 3MUAA 1W9DM 3ARXA 1ISXA 1UR4A 4H2CA 3W24A 3VSUA 1ESWA 1GOIA 1UD4A 2ZXDA 1BGAA 3WDPP 4M1RA 3OBAA 3H54A 2J8FA 1J18A 1W32A 2DT0A 3VILA 2HISA 5CJ5A 2YL9A 4QDMA 1JFXA 3OLEA 1CGTA 3HG4A 1TA3B 3THCA 2ZXAA 4J28A 1R46A 2V5CA 2EPMX 3POCA 1G1YA 3ZJKA 4GXPA 3KL3A 3ARZA 1UYQA 5D9MA 1Q6GA 2VCBA 1E4IA 1C7TA 4AZ5A 2VQUA 5IHSA 1QNPA 1R75A 4CVUA 3ZIZA 5M5DA 1PIFA 4W88A 1CBGA 5JIPA 1KCLA 2QMJA 2CHOA 2OWCA 1CYGA 4WKAA 5AYIA 1UKSA 2DIEA 1JF6A 3EJTA 5FL1A 3AIRA 4NZFA 3WY3A 1EHNA 2VR4A 4MNMA 3GH5A 4XZWA 1JZ8A 3AICA 4AYGA 1J0HA 1J9YA 3AIBA 3WD3A 3GNOA 1WKYA 1XC6A 4HZ6A 4CU7A 5E6ZA 1QPKA 5A6MA 2ZWZA 1NQ6A 2CESA 4F9DA 4H8VA 4P7OA 2WPGA 3RM8A 4GO8A 4ATWA 3VD5A 1QWUA 2QLYA 1OIMA 2YLLA 1CGYA 1GOWA 4HPHA 4HA4A 2XIIA 4DUXA 4AIOA 4LX4A 1V08A 4UFLA 1OM0A 2X1IA 2WMIB 1RP9A 1US3A 1EHAA 3U5YA 1JDAA 4OIFA 2GDVA 1R86A 1ITCA 3HMCA 3FAXA 1UG6A 1UKQA 2WCSA 3MV01 2EO7A 3VIOA 4AD5A 3PZOA 1HVXA 1LJYA 2QF8A 3RO8A 3L4UA 4AZGA 4B3LA 3MUZ1 2DSVA 1J0KA 3WN6A 3VTRA 1R85A 3CC1A 2WLZA 1D3CA 1FFQA 4AEFA 1U2YA 1MW1A 2VNCA 1UR2A 4XV0A 4X0VA 3AS2A 3QGVA 4UQEA 3W6MA 3VGBA 2CBIA 3D52A 2WHLA 4PTXA 1V3JA 5TD4A 3BLBA 2RGLA 1UUQA 1J0JA 1N82A 2Y24A 3AISA 3TTOA 1W2PA 3VD9A 1ISWA 2WANA 2CERA 2V38A 3BAXA 4PUEA 4TVDA 4PN2A 4Z2LA 1CIUA 7TAAA 1XSIA 1Z32X 5A6AA 3S5YA 3M6DA 4UQ9A 3PBGA 3T08A 5ABEA 4L4OA 4BQ4A 1VEPA 3N12A 3NSMA 1IV8A 1UWIA 4OBSA 3BVXA 4MPKA 4PTWA 2A3AA 3WENA 1DWIM 4M56A 5D9PA 2Q8XA 1GOOA 5DO8A 4KGLA 3VDCA 4JHOA 3BMWA 2XM1A 2WBKA 2YDSA 3AHZA 4U2YA 2Y8KA 4AIUA 5IHRA 4Y7EA 3F4VA 3A5VA 1DHKA 5D9OA 3CUFA 1FH7A 1C3FA 4JCMA 1QW9A 2AMGA 4H41A 3WY1A 2PC8A 1BYCA 2J62A 2ZUNA 3POHA 4AZHA 4EK7A 4PMXA 2W67A 2F8QA 2JF7A 3OIHA 2DPEA 1JG9A 3II1A 2UY4A 1BFNA 5D8WA 2W66A 2F7RA 4C7DA 1V02E 5D8ZA 4GQRA 1KTCA 4AD2A 2F7OA 1TQVA 3EDDA 3D5HA 1XHGA 1JDCA 3GNRA 1Y7VA 2WHJA 3BAYA 1A3HA 3WD4A 4CD8A 1B3YA 2XN2A 5A6BD 1UA7A 5E70A 4UQCA 4CU8A 2EABA 1J01A 3A6OA 3WDQA 1UH4A 5M3WA 4PMQA 1W1YA 3BUIA 3EDEA 2PBOA 4CCEA 1DWFM 4OGZA 2FGLA 3AS0A 4F8XA 7CGTA 1XH2A 1V03A 4NZJA 4UOJA 5BRQA 4Z2KA 2YL5A 4WSJA 3WF1A 4X0NA 3SCVA 2D1ZA 4ZFMA 3CHDA 2WLYA 4HA1A 4TTUA 8CGTA 1E5JA 3EMQA 2BY0A 3DX2A 3CV5A 1KXVA 1CXKA 2JALA 5EB8A 3HG3A 4CVWA 2GJXB 2E8YA 2G3JA 1UD6A 2ZWYA 4U5IA 1PZ2A 2J7EA 2XVLA 3VOCA 4CGTA 4KH2A 3VIJA 3WF2A 2XVGA 4NZCA 4F9JA 1DWHM
chains in the Genus database with same CATH superfamily
2VZVA 1H15A 4PCKA 1XRFA 2ED7A 4AQAA 1B4EA 2ENSA 7FABH 4OZOA 1A5CA 5G2WA 1D5MA 3M5ZA 1FIEA 4AZCA 4Z0XA 1UH3A 4BQCA 2ABBA 3NABL 1LHZA 3IMSA 3FB7A 3VABA 4P2QD 3LCFA 1UATA 1BXCA 2WC3A 5CEZL 3APMA 2DS4A 1K2DA 2GBVA 4C6KA 4FXKA 4UUIA 2IV8A 4ADTA 1HQ4B 1FWJC 5DY3A 4ZMVA 4AW4A 2WXQA 3F6LA 5FKYA 3TFKC 4MSSA 4JFPB 4AUYA 4URTB 3DMMC 1BXBA 3AI0A 4OBRA 4UT9H 3MLUH 3QXDB 5DCEA 2DWDA 3IJYB 5I6XC 4NQEE 1SDYA 4JTRA 5F97E 3MP5A 4NN5C 4OZGE 3PP4H 4GLRH 2AEIT 3FQXA 5F8QC 3VACA 3OJGA 3W83A 3EWBX 4W86A 3P0YH 3V6OC 3WL1A 2NY3C 4UQDA 4GUJA 3H2PA 1SY6L 5L6UA 2VLJA 1HKJA 3ETSA 4YHNB 5FYJD 1GQLA 1JK8A 1ITBB 3B5GA 3P61A 3BSMA 1CXLA 3ILQC 3MXVL 3KRSA 1UENA 2H3XC 4YSSA 4JFUA 4WZ9A 3WK3A 4DK5A 1K1DA 1AGDA 3CZGA 5J04A 2VLLB 1NOLA 3UTQB 4LNRB 3B0YA 3W7EA 1DTUA 1MF2H 2IC2A 3BLFA 4GUCA 4FZEH 5IFPA 3GB7B 3OAZK 3A67L 3QT2A 1GHRA 5E0CA 3DKLA 3DFQA 3VK5A 3LBMA 2YL6A 3BVWA 3QQWA 2BNRB 4ZS7H 5B22A 3HG1D 3RMJA 5EMLA 1UIPA 2C3HA 2PCQA 1MVYA 2JQAA 4KCWA 3PF2A 4N0YL 3Q2WA 5AVYB 4XP5L 2A3CA 1QI3A 4W9GC 4KKXA 5IFHL 4LSPH 4EXAA 2R69L 4WCJA 5DLMH 1NBZA 2WY3B 3RRAA 3ALPA 1F13A 2XQBH 5AB2A 4K8HA 1U41A 3IK2A 1OB0A 1RLBA 2VFEA 5JW4N 4MJIA 4U6YA 5EORH 2W59A 1ZEAL 5EFFA 4ZFQA 2C15A 5DLLA 1WDPA 3FTWA 3Q8CA 3C60C 3ATYA 2Q8BH 4PGEB 5CPLA 4A2MA 2VABB 4JM2B 4ZAKB 1TJ2A 1YLVA 2X16A 3KH4A 2X6MA 4AY7A 2OCCB 4G7FA 4CQ8A 4U0RC 2CK0L 4WW2A 4GAYB 25C8L 4F37K 3CMJA 2ZNXA 2DFAA 3C5JB 1BAGA 1SXBA 4NO0B 4HQVA 4CD4A 1DE4A 2RUSA 1RUPH 2W6RA 5I15L 1MW3A 4J1UB 2ZADA 4JG9A 2QJNA 1HNGA 3QI9C 1S7SA 1ZTMA 3AS1A 3RF9A 4BHYA 1U8LA 4YDLB 4MKNA 3ARYA 2YXVA 1UPMB 2P42B 5F7DA 2GT9A 3DGCR 2DJXA 5CC7A 1P2CA 1N3NB 4IMDA 4G8FA 4U1KB 1PSKH 4MWAB 3UXFA 3VXSD 3EDJA 3H9ZA 4I77H 2IBGA 4C6DA 2X0HA 3T8QA 3ZFHA 5IFTA 2VDQH 4RRPG 2OT1A 3GSWA 3P2BA 4LAZA 3NTYA 2CDGB 1RHCA 1MNNA 1RJZA 3PWPD 4H9VA 1HEJC 3K74B 3PWUA 3UC2A 3TNMA 3AU2A 1BKHA 3IUHA 1ZL1A 2BOBA 1ZE3C 4PHXA 4RWHA 3CBWA 1AXIB 2LU5A 4Z7VF 2FQEA 4ODUA 1H3PL 4P4KC 2BVYA 4E2OA 3MWCA 1OGTB 1CE6B 4QITA 1B6UA 1UB6B 3JV5A 4JS7A 5A3IC 4JRLA 3FFCB 3QA3B 5CZSA 2X4OB 2UZIL 1DQVA 5EU5B 4H8WL 1DSFL 4JJ5A 1XH3B 2UV3A 1F1AA 5C09A 3NWRA 2BM3A 2YB4A 4Z2GA 2QSVA 3BKYL 3WS6C 3H0TB 1A9VA 3WQ6A 1MQRA 5FGBA 1HP5A 5AZUA 4K3DH 5HYJB 3E2RA 3FT4B 1CI5A 4OT1H 2OZ4H 3OVGA 1TTAA 1QBLL 5DJAB 4JMXA 5JHBA 5FLUA 3KNBA 2IXQB 2O4QA 4U1LA 1U8IB 3KPPB 3DO3A 3WLBA 3DFOA 3SUWA 1MCFA 1QFWI 3PWVB 4HIQA 3MA9H 2B4GA 5TQ0L 1K7EA 3OAUH 2ZT9C 1T1ZA 1XAKA 3MUJA 3TT3L 5L7XL 3C5XA 3PG8A 4S0SD 1PX8A 3CZJA 3U0WH 2R2HB 2A4EA 4WRLA 4RGNC 3VNJA 4M7LL 4H6RA 3A23A 2B9BA 3LEPA 2YEZB 4ELMB 3T42A 5B8CB 3EJJX 3SQMA 3WLTA 4WK2B 3QSRA 1JNLH 5IHZA 3IDJA 4PUUA 4RNHA 5TDOA 3CUJA 4HUXB 1XHHA 4K5OA 3TPUA 4F80A 3SDDD 3P30H 1TPXC 5DCDA 4PS3A 2PPFA 4EAYA 5CJBA 1JIBA 1G7LA 3B8IA 4XP9H 1ITXA 5AFAA 3C0QA 1E27B 1X5IA 2WJFA 5JHLA 4HLJA 4ENEC 4NFBA 2HSAA 1XXFC 2FATH 1S9XB 4GG9A 1JRHL 3Q6GL 1IGCH 1JNEA 3BJSA 4PD4K 2FB4H 3LPWA 2CRZA 1NL0L 2N1KA 3LXUX 4N2CA 4I0CC 3SPGA 3Q1SL 1X1NA 4XAKD 4FI4A 5INCA 2QQKH 3RB5A 3FQYA 2FX8L 4L05A 3T0BA 4MD0A 3DX6B 1W8SA 3BUPA 5C0FA 1MWAL 1D8CA 3BUVA 1U58A 1FG9C 4ESKA 5EU7C 4X5PA 4H9XA 1T03L 4HJSA 2DQIL 1AZ1A 4OLUH 1WYIA 4J9JA 1FH5H 2FJFA 2AJVH 3G5ZA 3AY4C 2VVNA 3HB3C 1HS6A 1XR9A 2RAMA 5F7MC 3SSGA 2VKZG 4FNTA 2ZX8A 3OVRA 3QCTH 1V6WA 3FOMA 3MI2A 1UOZA 3BLEA 3GRBA 2PDPA 1IIKA 1P4BL 3HHRB 5DT5A 4GIYA 4WENB 4AQLA 3HRZC 1MIEH 3BUDA 3DTUB 5EF3A 3VB9A 4KQNA 4A2RA 5BQ7B 5E1AB 5KBKA 3CXOA 2BIIA 3WEBA 3HMWH 4IMLB 3HPSA 4LCCA 3WD5H 1JHLL 43C9A 1RZMA 5CNHA 1DJSA 1WUEA 1Q9WB 2CO6B 2Y6SD 4N8CL 3ETTA 1K4CB 2JJSA 1TR7A 1H61A 2JEPA 4MJ4A 1I1AD 5HYIA 4LQFH 1IEXA 1G0XA 1Q9KA 5CN2A 3QXUA 2PGEA 4PIRF 3FYOA 1G69A 3VU2A 3AREB 3GM0A 4M6UA 4M61B 1NGZB 2BY3A 4JNYA 2ZE3A 3EO0B 4TV3A 4AUUA 3LEXA 4M7JL 1A5SA 5LXEA 5HDQH 4NO3A 5AC7A 4JLRA 1Q0XL 3ENLA 4DP2X 5DD3L 4DXKA 1IBBA 3HE7C 1YDPA 5GZOC 2CRIA 2E8ZA 2VH5H 5KBLA 4IFOA 3NDYE 3MKCA 2VZOA 1NFDE 2R2CA 1EHLH 5EWIH 3MV7B 1XRVA 4HFUL 4A8RA 1S9YA 4ZTEA 1GVQA 3OSKA 3W2MA 3NJGA 4E8DA 4UTKA 1KPRB 4YLBA 3VDAA 1MZRA 3BRFA 1P7QD 1E5YA 5F7EL 1D7DA 1CCZA 4Y9CA 5ABDE 3CL7A 4UTFA 5JH2A 3RVVC 4GNVA 2WBJA 4L0PB 5J5RA 3B40A 3I6RA 5DUBA 5SWUA 5CP7B 4NNBA 3HZ3A 1A25A 1GNXA 4GHRA 1XL4A 2ZWLT 5HNRA 3C87A 1URIA 4JFDB 1AD0B 4AL8C 2TRSA 1EDTA 3TBSB 4EX4A 1VFBB 1I7RB 3AZTA 4OB5H 4XXCC 1RPKA 1KPVA 2PTTB 3PIQB 1QLEH 1YEGH 1AH3A 4FX7A 2A2IA 3PWNA 1JWSA 5KVDE 4WIWA 3W02A 1LQAA 3MLTA 4HU8A 2OJ1A 5DJYA 1OWRM 1I8MB 4Q4KA 4UYPA 1K6QH 2E6YA 3L3DB 4LOVA 4I5BB 3GZQA 4RA3A 2E25A 2VXQA 5L9DL 1HSBB 3AM8C 4LLUB 1C8VA 1V93A 3BOLA 4M81A 3G08B 2E5CA 4O1DA 4CGUB 4NP9A 2FJGB 4JPKL 1CTNA 3KYKL 2D7TH 1PKOA 1PD6A 3WH7A 3DGGA 3CVIH 1ZSDA 4ZDHB 1RZIA 2UZYA 3ZSSA 2O5ZL 4AENA 1F3JB 5E8DL 1JGDA 2EINB 4KPLA 1GEQA 4IFKA 3G5YA 5ILTH 3TA6A 2QHRH 1LLOA 3QUHA 4TRPL 1WAEA 3HPJA 3CHFA 1MEIA 1BEYL 1GQIA 2OLAA 9XIAA 1XD1A 3W6LA 2VDGA 4W5ZA 2WQWA 4WIQA 2CNYA 4FD0A 2G30A 3EIFA 3GYRA 3W0WE 2WV3A 1Q6DA 3RMEA 2M83A 3AGWA 1AZRA 1MLBB 1RURL 2X4PA 2OPJA 2BJML 1HYSD 3OJMB 5F1IA 1EPXA 1OY0A 3GU9A 3OLGA 4IX2A 4O8AA 1BMZA 1BVKB 4G9FE 4APXB 5EF2A 2G4GA 2WMJA 2AJ3A 5BXFA 4RJEA 2R8SH 5CLXA 5DHEA 3TZNA 4PV9B 3M0YA 4XO4A 3K1GA 2FX9H 5AVZB 5JYMA 2PCEA 3MBEA 4MNGB 1HW6A 4D8PA 3EG9B 1ML1A 2HNHA 1UT9A 5LHDA 2J77A 5IVXF 5BNKA 1E5BA 3GHEH 3U48A 4XMLL 4GA8A 3KPRE 3MLVH 1TFVA 4L4LA 1SJHB 2VXVH 3GSRB 3MRCB 2D0HA 5JIKA 1CICB 1O7DC 3DG3A 4W4NA 1BBDH 2J79A 2F1AA 3OGCB 2VEFA 4OLYH 4Q4EA 4OJFH 1JZ2A 1U8MA 1S7RB 5CEYB 3CZLA 3KGSA 1LEKA 4ERIA 3EOSA 3SCNA 2AABL 3ROOB 3KHDA 3LMJH 3IFPB 2VLRA 5EOCJ 3TBBA 1AZBA 5AZEH 2FO1A 5MI0C 4C56D 4HZLB 1KCKA 5HGGS 1ZRQA 4X8GA 2OWXA 1PKLA 3QPXH 4PRIE 4Z7QE 4UV7L 4ZW7A 2YN3A 4U10A 2BNQE 1EK3A 4F20A 3LB0A 1LQBC 4H9ZA 2NNCA 2J7HA 2CBMA 3VAEA 3GXDA 4Z7VA 1TTCA 1CG9B 5EO9A 3BT2L 4ORGB 1YBQA 5LDSA 3FT2B 3R25A 3AS3A 3PGCB 4HT3A 4MHHI 4Q8QA 4HGMA 4ILSA 4BHUA 4HEMA 2BINA 5GS0H 3ERPA 3D6NA 4R3SB 4ODSH 1VZHA 4GZJA 5G2IA 1S39A 4GZ7A 2HS8A 2QPEB 2VXTL 3KPNB 4CQ9A 3GSVA 2WZ6A 1MEHA 2JQXA 1UB3A 4M4RA 3T77B 4WV1B 1UWSA 4JIRA 1MVUA 1QSZA 2YBUA 3ELQA 1MCHA 5G1TA 3SDDC 2EEDA 2VC2L 2X53A 1LM1A 1JI2A 1P0KA 4KK6C 4ZSOB 1B4KA 1TZGL 4U6XA 3TW9A 2AOSA 4NAEA 1BAWA 3HMXH 5H6HA 1W9BM 1A1NB 3IVTA 4UANA 1S3KL 3REQA 1MCRA 1OADA 3ISIX 4IOFD 4ZMYA 1QHZA 4KEVA 2VIRB 3J7HA 5FOOA 4WFEE 2Z27A 4M5YL 1EYEA 2IANE 2APVA 4L4PA 4NQ1A 1YEDB 4L1XA 3PP3K 2R0WH 4X7SL 2ZOOA 2WLIA 5CGQA 4YHIA 1BQ5A 3PLYA 3CLFL 4DVRL 2XZCL 1AO7D 2BERA 2V6AA 4YHGA 5FUZH 3U2ZA 2NT0A 3D85A 1H2JA 3NQDA 1UT2A 3EYPA 3V5HB 5KG9B 2JQMA 1IFRA 1DJZA 4J3OD 4PGBA 4G11A 3TROA 3M41A 3SO7A 1W2KT 2CR3A 1FZOA 1A1OB 1QSFD 3SJNA 4F7CB 3PYCA 3B06A 2LLGA 3O11B 2WO5A 1VAHA 2HVBA 2J8UB 5I1JH 3T2PA 1V77A 4D6EA 1UB5A 1SDDA 1OD8A 4Q8OA 1FLRH 4LPXA 5L2KE 5DWUL 3N2CA 2YSSA 4ZTYA 1IB5A 1KENL 5G5DB 1YC8A 4LSUH 4TSCH 2XFWA 3NQBA 4R26H 2VDMH 1R46A 4JHVA 5IBTH 2Y72A 4LGSB 1GR7A 5T5NG 4WY7L 2AJZB 3H9SD 1ZOXA 4AITA 2PDBA 2FX7L 4WK4B 2Q09A 3VFNB 4HD9A 4TLTA 5JORA 3Q2VA 4JANA 3MNVB 4NJ9H 5C9UA 3BKCH 4A7VA 4XZWA 2Z93A 1DVTA 1VZIA 4RZKA 1J9YA 4DI9A 4M3JA 3TJLA 3OV6A 1TE6A 5E6ZA 2A6NA 5FW6A 3V4UH 5A6MA 5JMRA 1OYCA 5EEWA 2ATMA 3GGWA 4H8VA 2WNQA 4GO8A 3VD5A 1FCCA 2E7DA 3QM3A 5IQOA 4PP2A 4DUXA 2VSCA 4LX4A 3WIAA 3GNNA 1YDOA 4QR6A 1US3A 1U9KA 4CJ0A 4N1CA 2K6WA 4A8NA 4NC1E 1UG6A 4AD5A 3UIZA 4S2SA 1ZANL 3NA9L 4HZ1A 4ANXA 4LCQA 3BD5A 3LSOB 2IKHA 1J0KA 2WXMA 2G3XA 3ZDZF 2PODA 5BVPH 1FFQA 4AI7A 2FIKA 4IX0A 2NWSA 4YGVA 5GGQH 3OOQA 2BP0B 5DBUA 3SY8A 3RLVA 3ZIYA 5AVQB 3H42H 1OOWA 4BKNA 4N25A 1UUQA 3C2VA 1Z2KA 3UZQB 1RK6A 1MFAL 2Z35B 1VFAB 4JRYA 3LZOA 2HRHA 4I7WA 2QXWA 1DVUA 1GTFA 5DJ2A 8XIMA 3TL5A 1AGBB 2WXFA 1D7BA 4JAMA 4JQ3A 4KUZL 3KBEA 2PD9A 2ODHA 5JW4R 1FL5B 2J62A 3HJ0A 5C9JB 4YXLL 5AD0B 2ZZ7A 3EBHA 2FQGA 4P2RA 5FDWB 4HS3B 1CWVA 3KPLA 4IU2B 5HHOB 4OZFA 5ALBL 4KY1L 5DFTA 3DAQA 5D1QD 1USQA 4YVPA 4IT1A 2F58H 3BAYA 3WD4A 3URAA 1BX2A 3KXFB 4CCEA 4AEHH 1PTDA 1UIOA 4YQXH 3AQZA 3NA4A 4RSYA 3QFDA 3HNVL 3NQAA 5EZIH 1NCUA 3CHDA 4W9EC 3WK1A 3SE4A 4OTXL 2BY0A 4HUWB 3LN4B 4MSWA 5HGBB 1B0RB 3HR5A 3FXGA 1MDRA 3VXGA 4YH6A 1YW1A 4H20L 4O17A 5H94A 3E8UH 1WT5C 4B60A 5HK4A 4JTGA 4OZ4B 3SO3B 4FI8A 3LSBA 4LUTB 1FN4A 5TTRA 3PGFH 1IARB 3RTQC 4AISA 3TCEA 2QW5A 4X6FA 1Z6JT 3OJ2C 5LNVA 4XBGB 1ND0B 1QNRA 3ZVIA 1BVLA 3ZKNC 1VFLA 2QJJA 2ZTJA 1ES0A 1PAMA 4PJ7B 4NVTA 4EIGB 3VFPA 4DN3L 1PBYA 3WQGA 3CVBA 4P4KA 1M5WA 4BA0A 3GVGA 3DFNA 2D8KA 1LROA 4XTRC 2XGBA 3W84A 5IMMB 4MZYA 4G8GE 5JMOC 4Y9MA 2E3ZA 2X30A 2NXZD 2I9UA 2G60L 2CKBL 4HUCA 1MCPH 1B3XA 4PJ8D 1MNZA 1KJVB 4XC1L 4JVWA 3QY8A 4B0MB 4B2DA 4JMNA 1OE3A 3S3PA 3GO1H 2MNWA 3WO4B 4O4YL 5KZ6A 2QR0B 4R5XA 4PREB 4HCRL 5F0JB 5HPOA 2J4WH 1Z3GH 2B20A 3P2VA 3W7PA 2DH3A 4IPNB 5B4MD 2FTPA 3LCIA 5I1GH 2E7HA 1DIKA 2RQ8A 3O15A 4AVFA 3BPWA 4F7TA 3VFTB 2WVTA 4GSUA 5D2LE 3G1YA 4ZMLA 4DN4L 4GRWE 4FQHB 3L4ZA 1TZAA 5KBPA 3QW3A 3MMEA 4N2KA 3D1MC 2NY6D 1FHLA 2EJAA 1WZ1H 1KJ3L 1EA0A 2YGOA 1MI5D 4U6HA 1TPFA 1V8HA 3HTLX 3M7FB 4P48A 3HFTA 2YXXA 2J88L 1Q65A 2ZZ3A 2PPEA 4MZ1A 1GGCL 4UM8A 3LN3A 4W81A 3LCWA 5HA7A 1L9RA 1XPYA 2CHDA 5FAGA 1DQIA 1FFNB 1JAEA 4FFWC 5F89A 5IVXA 3E0LA 4Y1AE 5JZ7C 4OUUA 2CZNA 3QWNA 1RCYA 3CC5B 1N8ZA 2W0LA 1F58H 4RNRB 1PNCA 3QZ6A 3RU8L 1XF3B 1P5VA 2GITA 1KGCE 5ERWB 3TYAA 4B9IA 3OGRA 1S5IL 4RDWA 4HAGA 4XP4L 1UUSA 3CHQA 5C0RH 3Q67A 1G0DA 1KCVL 4LESA 1UA6L 4QRPD 5MP6L 4LVDA 4YE0A 1FWRA 1RQ5A 4Y2DB 2GJJA 4ES9A 2BHUA 3BZFB 1G6VK 4JKKA 2PSNA 3GHSA 1JSYA 4QLJA 5FSEC 1TSIA 5CPOA 4LOCA 1L8PA 2I85A 4O4VA 1RIVH 1WA2X 4US5D 5M17A 4DGIH 3LHVA 4K94L 5BZDB 6FABH 4GQZA 2V37A 4NZRH 4ECLA 3QV8A 3MUHL 4HWZB 3HU7A 3RX8A 4JHWL 5DVOA 1QPOA 3BH4A 4OI8A 5LWYH 2B4CC 4G2DA 3C5ZC 3FB5A 2DZWA 1QBAA 3MUCA 4BGLA 3QUYB 5LGHL 4AJYV 3GHTA 3GRGA 2M1KA 4ZVJA 3MJ7A 2JJTA 4XCFH 4NZTL 4XHJD 1YEHL 1VGAA 5IJDC 3GG1A 4Z7IA 3CXHJ 1RY0A 5EMMA 3IXAB 4OIAA 3HRZA 5IJCC 3KZPA 4QNPE 3C9NB 3BAKA 3UTZB 4Z95H 5J5EA 2VMEA 5I1CH 1S7QB 3MNMA 4YDNA 2FQDA 3FW6A 1E73M 5EA9A 4OCXH 1ONQA 4LWWA 3ZL1A 1XBZA 1EUAA 3O6DA 4NQCE 2HG5B 3ML8A 3L3GB 4XP1L 4KJQC 1KLYA 4BGDA 4TNVK 1R87A 4OGAD 4P5MB 2OMXB 3CWOX 5DZLA 4HBCH 1Y18B 4QWWC 3I68A 1F6LL 4FJYA 4FAMA 3SUTA 1TJGH 3GZPA 2VZSA 2C13A 2WSDA 1S9WB 1JAKA 4PJFF 2NUPB 1H49A 2QCEA 3CSGA 3BG9A 3RILA 4I8YA 3ABQA 2C9PA 1D2OA 3PPCA 1RK0B 2OMWA 5HMFA 4PBDA 5CGMA 3K13A 5FIEA 2PWVA 2BY1A 2DQJH 4HCGA 3T3MB 2ZTKA 3PABB 1W6LA 3QWOA 5EN3A 2OFJA 4HA3A 2DYSB 3HE7A 2M26A 2OTPA 5GZOA 1EYWA 4TL5A 3NQ7A 4Y2LA 4L0YA 1TJHL 5T33H 3D25B 1FWGC 2QAPA 1U95B 4X6EB 3MZTA 4BQ9A 3UU0A 4KMTH 4YSPA 1HO1A 1BXUA 2HRLA 3WKYA 1TMCB 1TCMA 2WINB 1HJCA 4LSQH 5DHMC 2YCKX 5AKVA 2MKLC 2VW6A 2DVUA 1I60A 3MROB 4YHYB 2W07B 4NKMB 3IJLA 2PCXA 3PJNA 3TEYA 3BD4A 2NX5E 3CN2A 2D4DA 1FFOA 2AJSH 1Q38A 4IIQC 3O41B 1AGCB 4QT5A 3FO2A 2XIOA 4OQTH 3SB3A 4HMDA 5JIIA 3QO1B 3PS7A 4R7NB 2R4RL 2BS8A 4XXCA 3RIKA 5DO2C 1H1YA 1WSST 1SN0A 1SVDA 4LCCC 2P5WB 2I9LA 3R8GA 3QCVL 3WQOA 4JX6A 2CO3A 1JGEB 1K72A 2HE8A 2XA8L 4BK4A 4HLEA 1PBGA 1K03A 1IC7L 1J5HA 1EO8H 4PWKA 3QCUH 1J8HE 2HT4C 3O9WD 1S5HA 2OQJA 4OD3L 2EG6A 4Z1AA 4PJHE 3PWIA 4A04A 1YA5A 1BF8A 3RJYA 1Y1DA 5CSZA 1AD9A 4HP5A 3N3TA 2XWXA 1V7YA 4N3UA 5GRXG 1TPVA 2VDIA 3URQA 4DWSC 3S4SG 2QCDA 3VXSA 1P6WA 3X12B 4A7UA 2GJ6D 1XLCA 5A6TC 3RR1A 5HHMD 4Y1SA 4BSVB 3UJIL 3TA9A 4S38A 3AQDA 4JDBA 4PJ5E 3STFA 3CZFB 4UDUA 3PWPA 3AHVA 3E6EA 5SWSA 3C0LA 4J3OG 4WKZA 2F0CA 2CGYA 4MMYA 4AOFA 2FLMA 2VSKB 4XVSH 4A2LA 4H1LB 3CQHA 4GW1B 4ZPVA 4HKXA 3RBSA 1KJ2B 2MWCA 2XHNA 1E2ZA 4PVLA 2CGRH 4JRXD 4H26B 5AHLA 4NI8A 3IJHA 5CCZA 2WBJC 5KBMA 3ZDXF 2IOMA 2F53A 5K59E 5LNSA 4NWTL 2ZZ5A 4UTHA 4Y96A 3TQPA 5K9OB 1CLXA 3MJ8B 5F1OB 1R3SA 3GIZH 4GB9A 4KRTA 4TNFA 3KLDA 4UT7L 3D3AA 2K4WA 3P73A 3NIFF 1ZVSB 4P7RA 3WD1A 1XCXA 2FO4A 5C3LD 3S3JA 4RMTA 4YWIA 3CVHB 2EYRB 2BHYA 4XN2A 4UU9B 3WE6A 3RBGA 3T40A 1R9XA 4FXTA 3TN0D 3VNIA 4GUGA 1GONA 3QPQC 3OP2A 2D7MA 5AALA 2BW4A 2COVD 4BFAA 1ZSXA 1Z66A 3U7BA 5B4MC 1XSOA 2YAPA 3CPRA 4AXKA 4UNIA 3S34L 3PTMA 1NIBA 3W9DB 3OKMB 3CZEA 2PF6A 1U2CA 4QX4A 3QC0A 2ZXWB 3TBTB 2MKWA 3RCNA 1H6UA 3GTIA 1UQSA 1VDGA 4MVAA 3MVTA 4P5TC 1ADQA 1S2TA 4LCWB 1WZAA 3ZKMC 4ZUVB 3W1QA 5DT1H 3WQWA 5I71C 3O8XB 4JEQA 3PWLA 4IHCA 2AK1H 4AH2B 2ADIA 1CQKA 4J3OF 2R1YB 4L48A 4J2XA 2J7DA 4QIRA 2CXKA 2W61A 1BYBA 3SDDA 2FEJA 1BQKA 3KCPA 2CLVA 3NVDA 3CPLA 4G7VL 4MNQE 2MPVA 4GJTB 3DDGA 3ULUE 4L2YA 2NNAB 4JS3A 1EJ7L 1FZJB 5I3JA 3FYIB 3KJ6L 5AZ2H 4DN1A 5GJTH 4PGDA 5DZNA 3P0WA 3NAAH 1DWJM 3N91A 3MLWH 4M3PA 1A5KC 3WLOA 3I85A 1BYDA 4I1PA 1ZAJA 5BRZD 2ZUQC 4GYJA 3VOJA 2MRYA 1E6JL 3PF3A 3CQIA 1N8WA 1NDGB 2VZ1A 3BP4B 4JFDE 4WEBL 2GVJA 2MTPA 1UOVA 1XF5B 4QRRB 4RSVA 3CYJA 4KUCD 2NZ9C 3MRNB 5I1HH 4UTWC 1OSPH 3RM4A 4E9YA 5CU9A 3DUSB 1YY9D 4NSKA 3ZK0A 2HLEB 5JOFB 2OMAA 5ALCL 1D5IH 2ESCA 1KRCC 3FRPA 3PSWA 1EC7A 4J23A 2N01B 3IDYB 5PCYA 4HUUA 4JGNA 4HKBB 1SLUA 3QZBA 4Z7WE 4QXUH 5IY5B 3NZGA 5T8IA 1NMCC 1H5BB 5BXSA 3UTTA 4YIQA 1JTOA 5CEZE 2ASHA 1KLGB 4PL2A 5TE7H 5E95B 1BVNT 3BX7C 1DVFD 2F8XC 2Q20A 3AMDA 1WAAE 2A4CA 5BS0A 3WH8A 4AZBA 2EUZA 1N59A 5F9WC 2ZF8A 3BH9A 3VRJB 2GEQA 1FCVA 4N9CA 5DVKA 3RJXA 4KV5F 1Q4NX 4L5FH 4N90E 4NT6A 5JU6A 2E7LC 3SE3C 2X4RB 1AQHA 3FNKA 3GQYA 4HDIB 4OCWL 4TNGA 3QYSA 4N4QA 2H6PA 5L2JA 1I1AA 3Q65A 5T91A 5T1LB 1LEGA 3PRZA 3LB6C 1QLFB 5TDNA 1BG1A 3TO4D 4D72A 5CP3A 1I3GL 2PFHA 3SJVE 1K9FA 2UYLB 3DO7A 3R7QA 1TXKA 3VCRA 4U4MA 2JSFA 2B7PA 3O4LA 3Q43A 2G2PA 5D1XE 1M71A 3OF6D 3ZZSA 4XIAA 3C12A 4GX9A 5A16B 3HFFA 2BOCA 1R3JB 3LQMA 3NP3A 4GKZB 3ARPA 2VITA 5KSAB 3QTPA 4X7CC 2NT1A 1OM3L 2WZ5A 2M8XA 3MP3A 5LXGL 4EVNA 3T0AA 4JGDA 2KZHA 3KYNA 3QXBA 2J5LB 3QZPA 3FO0L 5GRJH 2A7BA 3QV7A 1DSWA 3ALWA 1ADSA 4RE2A 2HX9A 4PSRA 1I8KA 4FP1A 1HXKA 3VINA 3I9GL 1HHJA 1FZMB 4LRNH 1XCTB 4NN6B 5FAJA 2OI9C 5E9DA 5DEJA 5BNXD 1A4KA 1YAZA 1E5ZA 4BFOA 1OK0A 1FBAA 1CFQB 1RKRA 1F4AA 4PJFA 4M8QA 1GW1A 1HP4A 1RU9L 5E6ID 3CFUA 1UP2A 5HNTA 5E5LA 1UM5H 2JKTM 3A4JA 5CINH 4V11A 3GDKA 4O1FA 2DWTA 1GYMA 3MREB 5AB3A 2Z8VC 2ZSVB 1X9LA 3JWDL 1ZA6A 3FHQA 2GJXA 5CMAB 5CD3B 3BL3A 5FOBA 5CD5C 1X6LA 2ZFAA 2PPDA 3RX7A 4X6CF 3PHQB 4HU4A 3PS6A 2KYIA 4XUGA 1MSPA 5D5MF 4YL4A 2J25A 3UXIA 3VG9C 3P4OB 4OZHE 4MCYB 3EH1A 1Z1WA 2ZG3A 3AIQA 4GUOA 1K6AA 4WNJA 3W23A 3JV4A 4LVHB 2W0PA 3WBWA 2ITDA 4JM4H 3VQLA 4LLVB 1OZUA 3X3FH 2DDQH 4N20A 3WXWH 1WT5A 3HQPA 5JW4Q 3JZEA 2P8LB 1XUUA 1JPIA 5E9NA 4KRLB 3RTQA 4RESB 1Q9OA 1X5XA 5JPNB 3QQ3A 3IFOA 3N42B 4LSVH 3VXME 2DM7A 1PWLA 1DN0B 1QSEB 3FFDA 3R8BB 1J11A 2P7TA 1SYVB 1LDSA 3ULVL 4JYFA 3IETB 4P4RB 4U2ZA 2H9AB 4FS9A 1ZGLM 2BSSB 4N6EA 2WQVA 4Q8WA 5EO0B 3ARGD 3V9EA 4R4BB 1HZHH 5CBEA 1F9CA 5H1WA 3MV9E 1SW0A 3UWEA 2NQCA 3W2DH 3ZLQC 2OZ3A 3ORWA 1I8AA 3H6AA 1A4LA 2NY5C 3Q48A 5EZJA 2VXNA 3C5QA 4C58B 3QORD 1J18A 5FK9B 4Z3IA 3MRKB 1QUMA 3ZTNL 2GOKA 3E02A 4DKEL 3DIVA 2Y07H 3FUHA 4JHUA 1UYQA 4GG6F 1YEYA 3GIPA 3KX6A 3P82A 4R34A 1OLLA 4ICWA 3UEZA 1F2XK 4Q0XH 4WO4C 4Y9NA 2GTWA 2ARJQ 1RZFH 1KB5H 2N59A 4FA3A 5SV3A 4PJCE 4APQB 4CU7A 3I6SA 1QPKA 1A5LC 2EDXA 1Y6MR 4DPBX 2W0KA 1FL6A 2QLYA 3BVNB 3SE4C 3H2FA 4K7FA 5H35A 3HHMA 1V08A 4GAFB 3L7FA 3AWGA 2WMIB 4YEFA 3GHUA 4ETQA 1J9TA 4H3DA 2GDVA 3MV01 2QZ5A 3EX2A 4LVGA 3TCSA 5IG7B 1KFEA 3CAVA 3LSCA 4EIVA 4RZ6A 3TR2A 3UD6A 4XB8A 3QSTA 2DQGH 4WTQA 3MC0A 3ZE1B 3NSCA 5GGUA 4NJKA 3O2DL 3O3DA 5L88L 3TDFA 5CJQH 3TLRA 4RAUA 3EB3A 5F1NB 4A7SA 1XSIA 4A2DA 3Q2LA 3V0WH 3QDGB 2MOGA 3TO2B 1IV8A 2HT3D 5HPMB 1WA0X 4NQQA 5ITBH 4O02A 2VFGA 1RUML 1WCBA 4M56A 4P06A 1EGVA 2XG4B 5DO8A 3VDCA 2BIPA 3BMWA 3OB0K 1B57A 4M48H 4AG4L 1BBJB 4UM9D 3ECUA 2E47A 4PFEA 3BKJH 1W56A 4AMKH 3POHA 4AZHA 1YYAA 2EUVA 2PR9A 4O2FB 5D8WA 1FI8C 4JFEE 5HDOA 3TIMA 4HPOH 4LSTH 2FPYA 4MM1A 2I69A 1EJSC 1K5NB 4JXCA 2PXYC 5EMUA 5FSDC 3EX1A 3TA3D 2OAAA 1F8TH 2DMHA 3GG0A 4UQCA 5IOBA 4Y4FB 1EX0A 3VFRB 2A4AA 2FNBA 3SSJA 3FTVA 4YWGL 5D7HA 7CGTA 1YNTF 3F58L 1Z6KA 4NZJA 1AO7A 5D4QA 2EDEA 4WSJA 4KBXA 4GJJA 1QFWL 3GBML 3JWOH 4X0NA 3C5ZA 4D2NA 4ZMZA 2D1ZA 4ZFMA 4L4VE 4KC3B 1L0XA 3OKLB 3CV5A 1ZD6A 1QR1A 2P50A 4JO8A 3NQKA 5H37G 1LDPH 3I7RA 3GJFA 1U3YA 3G3MA 4IHOA 1S5TA 4R85A 1QSFA 3L21A 1OF2A 3AZSA 5EYWA 4HWBL 4R2GC 4XN1A 4KQ4L 1FWDC 3ZTDC 3ENEA 3WF4A 1E8YA 4K9EC 1HKMA 2CDFB 3X1FA 3DX5A 1OVDA 1BQLH 5XINA 3S1GA 2ZWKA 5I1LB 4MDIB 3ABKB 3AYRA 1NFIA 1H41A 2YD3A 5FHAL 4MYAA 1P43A 1U93A 4AX7A 2KLRA 4PRAA 4ISVA 4LY4A 2H2SC 3H9SA 3JUGA 5D30A 2D2OA 4PJEB 4HETA 4J39A 2PRMA 5C7XH 4L9XA 4H9YA 3UBXA 1ZB5A 4XVDA 1GZPA 1I4FA 2YOAA 5BOJA 1TV4A 4O19A 2OMZB 3Q6FA 1OD7A 1VYSX 2UWEE 3LA4A 2GTZA 1IT7A 5DUJA 4FQIL 3BLDA 5E0KA 1UM4H 4IKNA 2VAJA 3C4UA 1ZCOA 1JP5A 5HDBB 3WTUA 2C8NA 1A6UH 2QQNH 4GQ9L 4F3FA 1NBVH 3FUDA 1O1HA 3WK0A 1BWMA 4M1GH 3EYUL 5C8JB 2DQEH 1P7TA 1EH9A 3BSZA 5ADPL 4B3VA 1QOXA 4W6XB 4LKCA 3L0NA 2PWDA 2FTAA 1PZDA 7PAZA 4YS4A 1E9OA 3IU4L 1W8OA 4M6NH 2VWEE 2ZCKH 4WZHA 3WBYA 5FEBA 4TQEH 5A7EA 4L0ZA 2O1AA 5ABFA 1PLAA 2F54A 3VOGA 4LAUA 2JJTC 4XK2A 1GPFA 4Y9EA 3BPLC 4IIQA 1GVYA 1R0AL 3MRFA 4DF2A 5E8NB 4W8BA 2P8PA 1JN6A 1SHWA 3B5HA 3UOAB 3ECQA 1GW0A 1MNUH 2BGSA 4N8VG 1EWDA 4M1CD 4LSSH 3OAYH 4EE9A 2APSA 4X7TB 4IGMA 3Q2DA 3JTTB 4JKWA 3H4XA 4CADA 1HL5A 1XGTA 4IW4C 3ATZA 4IIHA 3GTHA 1QAWA 4XAZA 4XX1E 4C83A 2Q86A 5D1QA 3H9YA 3DV6B 3USBA 1OIOA 3MCOA 3KLLA 1CEOA 1KN2H 4FQQA 2YKKA 3FCTA 5IB1B 5DK0A 1MJJB 3N2TA 4NRYA 3R8HA 1E4XH 1VPOH 1H62A 1WICA 4YMPA 3C6LB 3FQUB 1AG0A 2XZAH 5DJZB 5CQ1A 4DWSA 3U36B 2ZKXA 4Z78A 2YFNA 4AY1A 4ODVL 3SCOA 2G4EA 4EZKA 3GMRB 4B9KC 3IJSA 3O0KA 4HA0A 4TMBA 2F7QA 5JW4M 2CIPA 4GVIA 4W70A 3BKMH 4ZUWA 3ABXA 3CBJB 1KCZA 4XO5A 4FG2A 4HJFA 2LU7A 4E9XA 1T1XA 1EHKB 4WU7A 2CJ3A 3IKCA 1TZ8A 5HY9A 1U91A 2WJZA 1GK8A 2DRUA 5BZZA 2LFGA 3U82B 4X4YB 1F0LA 2YPVA 2Y25A 1KXVC 2O4EA 2OPCA 3P9MB 2QUMA 3MU3A 1TVBB 4FXGB 2YCIX 4WWOA 3LHWA 1OKEA 5J13C 5J06A 2B14A 1EFXD 2ZOWA 2P43B 4S3CA 2VLKB 4G6ML 3RDTB 4XVUD 2GPZA 3T78A 3QR3A 4X6CA 1EUNA 5D7IB 4ICMA 1GRWA 2BIOA 2ADFH 2H45A 2E75C 1EOMA 4NZ4A 5D5MA 1PLGL 1PY9A 3G6DH 1NANI 1XGYH 3ARFB 3N41F 1IE7C 2V9UA 3V0AC 4KVCH 2EE9A 4G43B 3ZWSA 2HKHH 1TG7A 4GQBA 1IT8A 1G6RA 5F1KC 3P60A 4M8VA 4H25B 4PJGE 3SY1A 2HZGA 5FA3B 5IMKB 1DDHB 2PCFA 4P2VA 3EMZA 3OSVA 1W9VA 1CO1A 3D4GA 4OD2A 5ESAA 2DL9A 2PB1A 1IEIA 4YOKA 5BRBA 4QPEA 2P1YA 4V28A 2OXNA 4HHLA 4N6QA 5DHVH 4P5TA 3BG5A 4KKAD 4LVNC 1MI5A 1QACA 3DENA 3CLMA 3BP5B 1CFSA 2YXWA 3BIAX 5DQJB 3TLLA 2QVHA 2A5UA 2A2QT 2JF1A 3BGMA 4LLWB 4RDVA 2ENYA 3C09B 2HBXA 1KB9K 3AXMA 4GG6A 3RB7A 5E00A 3L95B 3RVXD 1C12B 2DWEA 1JQVA 3N3EA 1IWPA 3DYPA 3DV4A 4YDIH 2HT3C 2VR5A 2EO1A 3CFJA 2FLRT 3L4CA 4ZCWA 3D46A 2IGFH 5HOSA 1FVDA 4WUUD 1N8OE 4ES8A 1GC1L 4XKMA 1FWWA 1FKWA 3ZN6A 4NQDD 3VXUE 3WNOA 4NAFB 1YMMA 3QBUA 4WSHA 1UUOA 3KVQA 4B3EA 1WFMA 1NAL1 1FGNL 4QRPA 4XR8C 1FSKC 5TPWH 1XCQB 4GGBA 4NERA 3W9EB 5DR5L 2A3HA 3SPVA 5C3IA 1XLEA 3KCLA 3V55A 3VE7A 2GFBB 3WH9A 4UMAA 4UTWA 4YL9A 1RUAH 4BE5A 4GSQA 4WOQA 4KCUA 2DI8A 3BOXA 4JO2H 4UCFA 4LC6A 5L4JA 4JO3L 8A3HA 1MKFA 3NZHL 3NMEA 5FGSA 1G9NC 4ZPTB 3T3PB 4PJIF 2KT6A 2J9ZA 3V36A 2WKLA 3K72B 4PLOB 4CSSA 3QOMA 2EE6A 1AIFA 4HGKC 4YN5A 1QTSA 2D3JA 2B5IB 1JULA 5BZAA 4HCFA 4P59H 4M19A 3RRQA 5BV7C 2R1KA 5CC3A 2X1QA 3LQAC 1D7KA 4P57A 5DZOA 3V7PA 2INFA 1PDKB 3VFMA 5INDB 4W7VA 2LHAA 5GQBA 4YFLI 2Z7YA 2E7LA 3SE3A 1W72B 1KY7A 3BZDA 1F4WL 2EAEA 2PDNA 3QFJD 3OJDB 4C6CA 4GKSB 4TSAL 1CQYA 3KM1A 3KJ4B 1GY1A 3LEVH 4L1BA 2A1WH 3GHBL 1NM4A 3B7TA 1FNLA 2B3IA 2WLJA 4AMCA 2BY2A 3W82A 3ECBA 4UTTA 1RPUA 3GAYA 1YNTA 3U5UA 4M4PA 1NUGA 4PYSA 1DJXA 3WH6A 3MOBH 1LQ0A 1Y0EA 1FV1A 3QKEA 2V82A 4R6UA 1BCIA 3AHYA 1HXJA 1V3IA 4DPRA 1RCXB 1W5PA 1EQWA 3FT3B 1G7IA 4PJ9D 4NKOB 1YMYA 5GGTH 4RRPA 3JR2A 5F88B 3LIUA 3QJSB 3VD4A 2O6PA 4MB5A 1X7QB 3ARSA 5F6HI 1HKLH 3OTTA 1GS8A 4MCNA 4DCQB 4MAYD 1SW7A 4K6AA 2CR6A 4WGXA 2FGWH 1HZYA 4KZDL 1ZJBA 2PGRA 5DC2A 2PDIA 5EO1A 1T4KA 4XXWC 5DJ8B 5C0BD 3V4PB 4QXTA 1TZHB 3MACL 3UFYA 4H7VA 4ZX5A 2OOFA 4GWEA 2QELA 3UPRB 3HUJF 4LOFA 1M7JA 4MF4A 5AYUL 2D0FA 4J3WA 1KJ2L 3LOTA 2CA3A 4MNJA 4OVUA 2R4SH 5K93A 5KTLA 3R0UA 1PKMA 4H5SB 2QEJA 2AZUA 2V8ZA 2D2CC 2B7NA 3KPSE 1LP9E 4PJBF 2A6IA 1EO5A 2Y6SC 4BDVA 4OIIL 4UNUA 3VXRE 4PZVA 2C4FU 2KPWA 5ID0A 1V7NL 1I1AC 4LHUB 3MLYH 3O9WA 4OCYH 2X2YA 2OX1A 4IMCA 5DD0H 2ISDA 1P5UC 5EPDA 3ALGA 3K81A 2K3TA 4MD5A 1H3UA 3CFIC 1BFVH 4WHTB 3CVHL 1PG7W 1RZKH 1CDYA 3MLRH 1PJ9A 5F96H 2RJGA 3MBFA 1OSEA 3L12A 2C1PA 1AL7A 2FVKA 4JTCA 1LEIA 3DXIA 3ANYA 4HJWA 3CMGA 4N1EA 3K91A 4DLFA 5F93C 2YLAA 3GR8A 1J5IA 4HTBA 4HK0B 1TJXA 5IVNA 1EAJA 4DW2H 4X6BA 2OMTB 4XPHH 3GSNA 1DUYA 4FKHA 4PBEA 4AZ8A 3ZIMA 1T04B 3TBWA 1J1OL 1M3UA 1TTJA 3NZSA 4LE8A 3GMLA 4YZFE 2P8CA 2XH0A 3T44A 5FF6B 1E90A 1QRNE 1HH6A 4O14A 1XMEB 1HI6A 3D34A 4WEMB 4OUEA 4CILA 3NPSC 4W8AA 4UIMA 3QF0A 1DVJA 4WGVB 4ES4A 1NCJA 1D7FA 1T2QL 4JVUA 1H1ZA 1E2WA 4O54A 2J44A 1NAMA 1M1SA 1AMYA 5AYTA 1UG9A 4S0HA 1KIUB 1HESA 1GMIA 6ENLA 5FO2A 1ZLSH 1R33A 1K8DA 4XX5A 1EANA 5D03A 5T5NF 4R7JA 3W2NA 3LNPA 1JWMA 3C2AH 4MASA 1QI5A 2GSGA 3BP7A 5E6YA 1OARL 2G2RA 4WO4A 1IJ9A 4LIQH 3DURA 4GABA 2HZHA 3RWDA 1QNSA 3TN0A 1VHNA 3UY7A 2BZNA 5C7VA 2YZRA 3M86A 3T65B 5C07D 3QEQB 1M41A 1Q8JA 1NINA 2AFNA 4MDOA 1AGDB 4GNKB 2XV0A 2GVEA 2HDJA 1HSAB 1IAII 1IM3D 1MAJA 9CGTA 4EZLA 4P5RA 4EUPG 3T0WA 4XX6A 1HG3A 3RY6A 4C1LA 1AC6A 1B90A 3E0VA 3ZE0E 3HI1B 5DRCA 3W1PA 2V9QA 3FA5A 3D3VE 3NA8A 3B4YA 2IH3B 5ENWA 3DX4A 3BRGC 1L7IL 1YYLH 2GUYA 5ACZA 2GBAA 2WYSA 2H32H 4IGHA 3MX0B 3QJFA 4ZX6A 3FC8A 5J5DA 4PS4H 4IJCA 1H3GA 2YGQA 4XKYA 5D4JA 1FO0H 1S4IA 4JDEA 5KTEL 4WFFE 3C6EA 3WDIA 3X2QB 2ZUTA 4L4TD 2HXTA 1U8KA 4PRPD 3ASNB 2DQCH 5AYXA 3K4WA 1JRBA 4W9TA 4F93B 1C8PA 1HYSC 1UH2A 1D5RA 1R9YA 1KY6A 2Q8AH 4JPQA 4U6YB 3B3DA 1EJFA 4TIMA 2B1HH 2X1UA 3WQ8A 4R53A 4HYTB 1T0MA 3DYMA 4K71B 1I9IL 4ZQOA 2G95A 1S9VA 2DIAA 2DQ6A 4RGOH 2ZJSH 4MY1A 1KTLA 3AB0C 2BZ7A 2PXYA 1MHHA 3UW6A 4YO0B 5DRNA 5FJOA 5BRZA 4ZZKA 1DE4B 1O5QA 2E59A 2AK4D 2BOLA 3RGTA 5D4YA 3MSGA 3X3GH 5C0AD 1QYGH 2CJUL 3NOEA 4RUBA 4CMMB 1SJEB 4S3JA 5AOLA 4V2CB 1ME8A 2VXUH 1UYWL 3W73A 3CHEA 2XPKA 4NG3A 3GC4A 4ODHH 4QY8A 3TC6A 4DOHB 5DJ0A 1EJUC 4KK8D 3AAZA 5EU6B 3E80A 3SKJH 2PWFA 3P93A 4X60A 3CV6A 5I8OL 4NKIL 4ZB5A 1A5FL 1YKWA 3P3SA 2YDRA 4I9AA 1E28B 5KSVB 1KWKA 5DMKA 4L64A 3G0UA 3ZQXA 1YEIL 3WBEA 2IAMD 1RJZB 3U2CA 1L9QA 3EJPA 2YQ3A 1KYUA 2O6CA 1YYMH 3PWUB 4BUGA 1IQDA 4N5UA 2NZ1A 1WG3A 3LNGA 2OJEA 3G9AB 1VEOA 3CFQA 1RJYB 4HCDA 3AJ7A 3UJTH 1NFPA 1WKEA 2BNRE 4BWLA 4KTDH 3EA1A 3HTWA 1NMAL 2WTRB 3L5WA 1YTDA 5E8PB 2XFXA 2RKXA 4NZ3A 3OG4B 1A9BA 4WDWA 4GBDA 2AJYH 5TGBB 1DBML 3VSUA 5MEQA 2ZXDA 1BGAA 1LOSA 3R8RA 2VDRH 5REQB 1V10A 1X4XA 1JCMP 2Y1YA 4DH2A 1QQDB 3BPOC 2X4QA 5L9FA 3QNZA 3FN0H 5C09B 3RPBA 1R5IA 5JDSA 4NNYA 4IOFC 2EIZA 3CEUA 4PCNA 2BMKA 4WI7A 4NQVB 4BUQA 4XRCB 3GDMA 3CIAA 1OAYH 3C8KA 5DS2A 5M5DA 1PIFA 1CMOA 4PJIA 2VUNA 3CFMA 3T1GA 1UKSA 1TPWA 1JZ8A 3IJEB 4RV3A 1WWAX 1J0HA 4A8IA 3GNOA 2O61A 2NCEA 4P2QA 1AI1H 3KPMA 4F9DA 4MA1B 4QRQB 3S5NA 1T1ZB 5GRUL 2YLLA 5JHDD 4HPHA 1KA9F 3ZR4A 4J3OC 3TWBA 4YBLC 5IP4A 5EMJA 2J2ZB 4L3ED 1QR4A 3TTEA 4WI0B 5F9AC 3KTXA 1DLFH 3MUZ1 3A4FA 4GP5B 1VJIA 4MWAE 5MENB 3CTLA 4EJ1C 2F2KA 3BQUD 4JPWH 3NFUA 5T1MA 1MAML 2E77A 3A5FA 2DZTA 3IDJB 1RK1A 3GMNB 3D52A 2WHLA 3MRJA 3DJ9A 3SDCB 1W5MA 1AG6A 1N82A 2Y24A 2FO8A 2JTDA 3VD9A 2WANA 1IGJB 1II4E 5E6IA 1JVNA 8FABB 3M6DA 2CBQA 1JCNA 3EGSA 2V2WA 2HMCA 4NRXB 2BXVA 4Y4HD 4MYPA 1KIQB 3GC3A 2XXMB 4JIHA 3AHZA 1MCNA 4XMWA 5IHRA 2IBBA 4OY9A 4ZUSB 4Y7EA 3F4VA 1E4HA 2HFEA 4A21A 1M05A 4H41A 4KXZH 1CL7I 1BYCA 3CFBA 2W67A 3NFPA 4DUOA 2F8QA 3IDGA 5LNRA 3SCMD 2DPEA 1XG3A 3GLDA 2XWBA 2R2EB 4MQ7B 5I0YA 3EPMA 5D8ZA 4RE0A 1MCJA 4BWUA 2BOEX 3FFCE 1KFKA 5TE6H 2YMXL 3Q8FA 1E65A 1TQVA 1AQKL 4HCIA 2VN4A 4CD8A 5JXAL 1EDYA 5C0FB 1WLHA 5KVMC 3WDQA 1OAQH 2AQPA 1KLUB 1SM3H 1U58B 5JR1L 3JV0A 4IOSD 3HZMA 2AI0H 3HG1A 1ZPUA 3QUXD 4L29B 3SYQA 4YNGA 3HUJA 2DLFL 2HWGA 3QEZA 5HYJE 1EUTA 4QKTA 1XR8B 1MQKH 1P6FA 4HA1A 1KXVA 4WWID 2AV7B 1BTMA 3K2UH 4DEUA 2YAMA 1XR9B 3WEXA 4JQAA 3GMPA 2AQRA 1EGJL 4IJRA 1XF1A 3FOMB 5T1KD 4PJBA 1A4CA 1O0VA 4G8TA 3VI4A 3VKBA 3LCYA 2CUHA 4HNVA 1GZQB 3A21A 1TKWB 3FULA 4O2CA 5AKQA 3QHMA 1AJ7L 4M7TA 3PXJA 4JG0L 3QORA 1OCCB 3SQOL 3HAEB 4PRHD 4KW2A 1U8JB 5IFAH 3G6MA 5AKSA 43C9B 1P7KA 1RUSA 5D9SB 4ELME 1X5GA 4PAZA 4XZIA 2A21A 4BF5A 4WHYG 5IMLA 4IBQA 3QNXA 5D1QC 1KV7A 4PLKD 1A3WA 3D0AA 1BQHG 2V5LA 1F8MA 3E2HC 5GIRB 1MLCB 2JB5H 4HPXA 5IOPA 3NG5A 2ZX6A 3W00A 1BP3B 3I9IA 2AS5M 5FGRA 4O0KA 3KVKA 3FQTB 3LN5A 4N0UB 1OK6A 1CW2A 3CHPA 1Z48A 4BK9A 3CFKB 1SQ2N 35C8H 2BVOA 2F61A 1S5WA 1LGVA 5JIWA 3STCA 4YSAA 1Q0YH 3GDRA 1OFOA 1Y0LB 1TWWA 4Z2JA 3HE6B 4IQHA 2WNGA 2A9MH 5C0CB 4PTNA 1XIWD 2P48B 3HG2A 1YEKL 6XIAA 1ZHLB 1K4GA 1FA2A 5DVNA 2Z92A 4Q6KA 4MX7B 3W85A 2PDGA 1X9UA 5JNYB 2CYGA 1A14L 3VYPA 2AL2A 3IJ7A 3QUZD 5I6SA 4IOIB 1S7WA 2YGNA 3HLAB 3PZGA 2MIZA 2IW0A 1N7ML 1WUFA 1UZ6F 3NP4A 4ICCX 1YE6A 1WB0A 4G2AA 3C5SB 4P2AA 1FP8A 2P4AB 4CEXC 4UM9A 5C2UB 2NXZC 2ZZ2A 3HA1A 1UM6H 5BMFL 3LIZH 4PJ8C 5LIKX 1C93A 3LH9A 5I1EL 1MJ8L 4OM0L 3PWNB 3BGAA 5HMDA 5KITA 1JWSB 3A3YB 3K8KA 3MLTB 3N17A 2QPXA 4M6PA 4ZQPA 3DX8A 7PTDA 1F6AA 5C6TH 3FHAA 1WDRA 2FD6L 3MCKA 2I5QA 3RR4A 3W57A 4XMKL 2W60B 1T66D 2XZ7A 4HS6A 1NKOA 1GGYA 5IREA 1ELSA 2XLLA 3LBOA 4GUHA 4OAWB 1QHPA 1ETB1 1PIGA 5CJOH 3F7QA 4DP0X 5FECA 2GSIA 3G5YB 2YCLA 3CSPA 2EXTA 1N4XL 4ZMPA 1MFUA 1IEBA 2NY6C 1RPXA 3K6DA 1Q6CA 2PRLA 1WGOA 3EYOB 4PUBH 3ZZQA 4S1SL 2WWCA 3QUMH 1BMGA 1QVOB 2Y1ZA 4HIEA 2C34A 3LZ3A 4HMEA 4GFIA 1G9ML 3AO0A 1A0EA 3EO9L 5DBTA 3PUOA 3K1DA 4UUJB 1KZQA 4XXDB 1GZHC 4X5XB 3NGBC 4BD4A 3MV7E 5C54A 4AUBA 1DQLL 4QBXA 1OGAD 4RETB 1X38A 1CDGA 5A6KA 1BJ8A 3ES6A 4KAQL 4MPQA 1IGFH 1K4DA 3MRPA 1J9RA 3VSQA 4L1GA 1E40A 2MNRA 4LYQA 2ZC8A 3CB8A 4Y4KD 4MLRA 1U8NA 5F6IB 4P3CL 4U1JA 5D37A 1B1YA 1HJBC 4B5XA 4GUPB 3SPIA 1QFWM 5EMYA 5IM51 2FNWA 4GACA 2OMUA 3ZE2B 3ML9A 2X88A 3ARVA 3CFEA 5CLTA 1JPSL 3VJ6A 1GOKA 3U2SB 3ZXWA 1CBVL 3H56A 1XZ0A 3OZMA 2QCFA 5D7JB 4PN6A 5C0EA 2FDSA 4DKAA 4JY5L 1XIHA 4NRRA 5D2YA 5I1DA 4F7MB 2NQ3A 1CGXA 3GJEB 3LAFA 3I7QA 1G94A 1XICA 4Y19B 1H9VA 4JFFD 5CCHE 3AMGA 1NLDL 2B59A 2X28A 3UAJD 2YXFA 5BXPA 1IXNA 3AIUA 6A3HA 4XXWA 4DO6A 1RQEA 3M7OA 1TWSA 2XWZA 2B39A 2E6DA 1N68A 4XHJC 4AQOA 2Q2LA 1QUNB 5T3ZE 4DP9X 3ULSA 4P3DA 1ZS8A 1WZLA 2DKUA 3SBFA 4YHMH 3W4RA 5K39A 3WMBA 1MHCB 3R1GH 4CMHC 3VKKA 3V5FA 1NIAA 3CNKA 4KXDA 4FLRA 1XR2A 1JGIA 3VFWA 4FEZA 2VELA 1LWIA 2OL3B 2F5BL 1HIMH 3WNKA 4E5XB 1GTHA 1MVUB 5FJTA 1YMHB 2ZCLH 3IGUA 4GMTL 3G04A 2QPUA 4OGAC 5T1DL 2WZIA 4U6XB 3WXVL 4JHAL 1P5UA 4UTTC 1EEYA 4HBKA 3UJJL 4XMUA 3W1ZA 4KZEL 1E1EA 3FJ6A 1EZWA 4LLQB 4TUJB 3GZOA 3TX9A 4KWUA 2YD4A 4PQXA 4UILH 3RI5F 3KE0A 4MNGE 2PCPB 2ALWA 1C9WA 3MZ2A 2ATPB 2OEMA 3PZ9A 4G9PA 3P0VH 4EZJA 5DMJB 4P46D 3GSQA 3GVVA 2G3ZA 2I60H 3WYZA 4IRSD 4U3XA 4IG2A 5T3ZL 3I50L 1ETZA 4LT9A 1RHHB 4HC1H 3IRDA 1Q63A 1B0WA 5LN8A 3QDMB 1CB2A 2OYMA 3ZVHB 1AXTL 1SFSA 3PG2A 1DE5A 3ALXA 2RFXB 4RXGA 1P7QA 4EQ3A 4ADGA 3GNML 4K2UH 2X1TA