3WJZA

Orotidine 5'-monophosphate decarboxylase d75n mutant from m. thermoautotrophicus complexed with 6-amino-ump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVANIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 83
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wjzA00
2ZRUA 3CQ0A 2RFGA 1SZFA 1D3HA 3SECA 3EX6A 2ISVA 2QAPA 3ABSA 5HUPA 3RFAA 1LRTA 1O5XA 3CIWA 3HO8A 3NQ7A 3FYPA 3L2IA 4JXCA 2YGYA 4IOTA 2FIQA 2FLIA 1OFRA 5BOOA 2CLKA 1MEIA 4O13A 3DI1A 1U83A 4DQWA 2AAMA 1KV8A 5FF7A 3HG3A 2ZA3A 1ZFJA 3C2OA 3RU6A 5K2ZA 3IIZA 3LX9A 3N19B 3MHUA 4UTWA 4DO5A 5J5DA 2VFIA 4PA8A 5KSWA 3E49A 4AHPA 4PL1A 5EPDA 2X16A 1VR6A 3I7QA 3CPRA 3G18A 3MP3A 1EB3A 2ZBTA 3BG5A 1LOLA 2BWGA 3FJ6A 2PC4A 4IWWA 5DCDA 3N9SA 5HWNA 1WXJA 3NA8A 5KZEA 4NZJA 1YPFA 4K8EA 2Q8ZA 4ZQOA 5AHFA 2WNZA 3PULA 1TQXA 2ZRWA 4WUIA 3E9AA 3BW2A 2ATMA 3C2VA 1GT8A 1TPFA 3BK0A 1KM2A 2H8XA 5HULA 4DF0A 2A7PA 1UASA 3W6YA 1DV7A 5HR6A 4XWUA 1LZOA 2P0OA 3E0IA 1JQXA 4JTEA 5H91A 1GOXA 1XL9A 1TTJA 2J9ZA 5BRBA 4O4WA 1SO5A 3TUUA 1Q6RA 2W79A 3NGJA 3S5NA 2NWSA 1MXSA 1EIXA 4MZ8A 1WYIA 3RNDA 1OYCA 4ZMGA 1OK6A 5DN1A 3CWNA 2BTMA 4JIPA 3O06A 3R5EA 4GUGA 3Q2DA 5C55A 4UTWC 1YDOA 3C0JA 1GG0A 1PV8A 3I68A 3NO5A 2C19A 3W1RA 1EUAA 3QFEA 4DXVA 4LT9A 3LCFA 5LKYA 4DBDA 4O52A 3GDRA 3BLIA 1W3NA 3UZ5A 4LU0A 2QUUA 3LRLA 4TMBA 2QKFA 4MYAA 4UTMA 1F6KA 4DPQA 2H3BA 4H4IA 3TFCA 3BG9A 5DY2A 3C2EA 3A9IA 3W74A 3B8DA 1SZGA 1GVFA 5A8GA 3SSJA 3IGXA 4ZQCA 1HL2A 5G2IA 4Y9AA 3ABQA 3HPXA 1GPWA 2C14A 3SR7A 5IBXA 3WJXA 1G4TA 1HO4A 3NPWA 3IIVA 3RK8A 1Q6LA 1W54A 3W9ZA 2FTPA 2XN2A 4X9SA 3LOTA 1EP1A 2PRHA 3O15A 4UFJA 1OYBA 2D73A 3PB0A 3R13A 3LCHA 4JDYA 4K8HA 3P80A 5KZMA 3DFOA 4EOUA 3L0KA 4O1BA 1XDLA 2PE4A 4CNNA 4WQ6A 3QJAA 3SGZA 2FQIA 1OJXA 1S5WA 1LLWA 2A0NA 4GUFA 3NQFA 1UBSA 2X1SA 1VCGA 2Y85A 1H1ZA 4UFMA 1L9WA 1TSIA 1EP2A 4RZ6A 4KFNA 3EKLA 3W2UA 1DBTA 2JGYA 1KBJA 3W1LA 5G4EA 5D2WA 3E12A 3N2XA 1ZAJA 3L5MA 1K8ZA 3UY8A 1XCFA 1HTIA 3F4WA 4O1CA 4Y90A 3GAKA 4O15A 4L4LA 1D3GA 5DCEA 3QW4B 4QM1A 3LHUA 3HOJA 3L21A 2WKJA 3W2LA 3W7DA 4I7WA 3FIGA 1H7NA 4JTKA 1GQNA 3TKFA 1ICPA 3OG3A 2ISWA 3I6RA 1FCUA 3W75A 4NNCA 1FX6A 1ZY9A 3W22A 3TMLA 5D30A 4N6FA 4QQ3A 1ONRA 1AW2A 4A29A 1E51A 3TJXA 5IBXC 3PUOA 3I65A 3MHFA 4K7VA 4Y6GA 4LRSA 3BLFA 1OFBA 1MEHA 2B7PA 4N6EA 1YPIA 4FNSA 3A22A 1M7OA 4O8RA 1JULA 1RQHA 5E0KA 5C54A 2QUTA 2YSWA 5AHMA 3CHVA 2Q8LA 5HQEA 2V81A 3NL2A 1G7VA 3L65A 4YCOA 1BWKA 4OE7A 2A6NA 1H50A 4LVAA 1DOSA 4I7UA 3PUDA 3TNOA 2V5BA 3LHWA 2NX1A 2CLHA 1I8JA 1FWNA 2G97A 4UIOA 4TR9A 5A5WA 4BI7A 3IEBA 4R33A 4JYEA 1W3TA 3TXVA 4PEKA 5KZDA 1N7KA 2IQTA 3G0SA 3BVJA 1FWSA 4AAJA 3EX2A 2GQAA 1RD5A 2WV8A 4RXGA 3W1PA 3EX4A 1AW5A 4WOZA 4KWWA 5G4WA 1W37A 4Z1CA 3NL5A 3PG8A 4UC5A 1OABA 4FNQA 4JIQA 1OX4B 1THFD 5GVJA 3TW7A 1EX5A 3GDMA 1LRNA 3LTPA 5I3GA 3V1PA 3VCRA 1HFBA 2EF9A 3PR2A 5DBUA 5FF3A 1SFJA 3WJWA 4NNAA 4MZYA 2ABAA 4JTGA 3STFA 4IXXA 3O6YX 2ZZ3A 3L5AA 1U5JA 2CW6A 3C8FA 3G1VA 2Z1BA 3TR2A 2RDTA 1TCDA 3GDKA 1S5TA 4WY0A 2A85A 3W1QA 1O94A 3L67A 5AC8A 1EEPA 4M6VA 3LCLA 4D2JA 5EBUA 3UWUA 3NQMA 1A5BA 4XZ9A 4GUJA 1KTCA 1OFOA 1W56A 1RQEA 3C4UA 4ORMA 1IIGA 1TJRA 1ZHAA 1NAL1 3PY2A 4Z08A 1EPXA 3ATYA 5AYYA 3EX1A 1XUUA 3DFSA 4O10A 1TPB1 2R94A 1WDWA 5DY3A 4H3DA 4X3ZA 4N4QA 1I4NA 3NPUA 4AEOA 4BI5A 2I14A 3G1SA 1HG3A 2C15A 3TXZA 3QSTA 4WY0F 1O5KA 4UFHA 4O1DA 5FEWA 3WK2A 4IX0A 3GK0A 3SGUA 1FDZA 3GVGA 4AF0B 1G4EA 3GYEA 3PBYA 4JX4A 1QCWA 1RZMA 2HMCA 4Q32A 2ABBA 5K9XA 3TC6A 1W1ZA 4LRTA 3LCGA 1WQ5A 2VFFA 2QDGA 4LUIA 5D38A 3G22A 4QNEA 4JTHA 3LLDA 2C6QA 3QMSA 4RLIA 2V5LA 4P61A 1WX0A 4EVZA 3LBCA 4AHQA 3OVPA 1QPQA 3UNDA 3IGUA 3QMRA 4UMAA 1JR1A 1OFPA 3BO9A 4H6KA 1FUYA 4B5NA 5MHBA 5LGXA 3LXCA 3CB8A 4LNYA 1YDVA 2VKZG 3S1VA 2YFNA 3ANYA 3MO7A 1RR2A 5CKSA 3O1NA 1K7FA 2B4GA 1QPOA 4JDBA 3B0PA 2E6DA 3DENA 2VFDA 4NNBA 1BEUA 4O57A 1SW3A 1SU5A 5D32A 4QITA 2A2IA 4TIMA 5HWMA 3JR2A 2E6YA 4WOQA 4LVDA 4O0ZA 4Y96A 4UTJA 1ZAHA 3BPWA 3MI3A 3WJZA 1JUEA 3G0UA 5CZTA 1G67A 4XKYB 3S1XA 4YXGA 4JEQA 3F03K 4OV9A 3HF3A 1LCOA 5HUOA 4NJHA 1VJIA 3LHYA 3F4NA 1GWJA 1G4SA 3M16A 3TE9A 3MBDA 3KRUA 4DF1A 4O18A 4S2CA 3MI6A 3W86A 1NFBA 1KM3A 5CPNA 4K37A 2C3ZA 2JBMA 1C29A 3S8HA 3G1FA 2WSQA 5FF0A 2YZRA 1VYRA 3DKLA 4TX9A 4RXFA 2QEZA 2YYUA 4O12A 1KA9F 4Y8FA 5FI8A 2B7OA 2E1DA 1IXOA 2DZXA 2WO5A 2P10A 3QPYA 3B0VC 1QOPA 2Z0IA 4ZVJA 4TU1A 3Q58A 1XFBA 1KFKA 1YADA 2QCDA 2V2DA 3HQ1A 2BSLA 3QF0A 1OF6A 1WOAA 3W88A 3O8AA 1X1ZA 4GWEA 1KTNA 3TDFA 2CLIA 2R14A 1PL9A 4HNNA 3BG3A 3NL6A 1F74A 1Z48A 3LCWA 3MYOA 2Y88A 2E5BA 1OFAA 1GTEA 3S1UA 3FKKA 2A6LA 3QH2A 4OHQA 3VE7A 2YCEA 2AGKA 3HMJG 1KM6A 5LNSA 3S0CA 1TTQA 1PIIA 2NXIA 3M5VA 3L66A 3NPXA 2FPVA 4WZHA 1VHCA 3SY5A 3GAYA 4HN4A 3B04A 2Z6IA 2C0AA 1AL7A 4R34A 1TPVA 2JK2A 3M7WA 4GC4A 5CSSA 4FXRA 4FIRA 4LS0A 4HPJA 3MUXA 1TV5A 3TV8A 1JUBA 1GVOA 4FO4A 3W7PA 2YR1A 3CLMA 4ADSA 1O60A 3EB2A 3QYQA 1VYPX 4GFSA 4MYXA 4FX8A 2YPIA 4UCGA 4JTSA 3UPBA 2CLLA 4YL2A 2P1FA 4MOZA 4ONVA 2DZVA 4FX7A 1RQBA 3SJ3A 3W87A 1DQWA 2A1YA 5LNUA 4MIMA 1SO6A 3QC3A 1K7XA 4PODA 3USBA 4JTTA 3UXAA 4QISA 1YXDA 3N73A 4IUOA 3W1NA 3W7GA 4KWVA 5CG7A 1UCWA 1FCQA 1ICQA 2VOMA 2TSYA 1K3UA 2WQPA 4AH7A 3NG3A 5AN7A 3DI0A 2EPHA 4ADTA 1X6UA 3QRHA 4C1LA 4O4VA 2QAFA 4Z1DA 1IIHA 1TV8A 3MWAA 4TMCA 3LXAA 3LHZA 4NJJA 4R7JA 4BF9A 5LNVA 4MFDA 2WJZA 5F4SA 3W76A 1YDNA 4K7YA 1W5OA 5LHFA 1F5ZA 2W6RA 3NZRA 4MVAA 5FF4A 4MLRA 4PFMA 2QCNA 1SO4A 1F6PA 3EXTA 1XM3A 3L0GA 5G1TA 1JCMP 3MI2A 4FNPA 1KFLA 4NJIA 3BW4A 2A21A 1PHQA 2EKCA 3LCXA 1VS1A 3UYCA 2OT0A 3GXPA 4XUGA 1S3HA 3KRZA 1NF7A 1LORA 3AO0A 1A50A 1W5PA 4G1KA 4NZFA 4BWLA 1UUMA 2GJLA 4O1AA 2DZSA 4HHPA 1ZALA 4ZQNA 4QJ1A 3OIXA 5D33A 2QR6A 3Q94A 3LB0A 4M5PA 2Z6JA 1XKYA 2V9DA 1Q6OA 3EWYA 3KHJA 1PS9A 3E02A 1TRDA 2DZWA 3C52A 4NX0A 3D0CA 3LDVA 1ALDA 2VFGA 2XN1A 1QPNA 4IXHA 3W7RA 1IXPA 4AHOA 3NQEA 3KVJA 4FNUA 1YLVA 1IF2A 1TIMA 3DFQA 5AC6A 3CM4A 1ZCOA 2VENA 1RVGA 3M9YA 4NXSA 2DZTA 5I3HA 1ZENA 1I2PA 3P81A 1LLZA 1KFBA 4JTUA 1FWWA 3ZWTA 2YW4A 3EWZA 3GDTA 1VCVA 4LVGA 1W3IA 3PB2A 3HBLA 1TPEA 2Y7DA 1Q3NA 2BX7A 3N9RA 1I2RA 4QAIA 3W3OA 4RCXA 1F2JA 2CZ5A 3N14A 1DJNA 4YMZA 1TPDA 4A2RA 4U4MA 1RPXA 2VEKA 5C2XA 1SW7A 4MZ1A 4N9EA 3W7OA 2V8ZA 2CLFA 1VYSX 1H7PA 3QQ1A 4A2SA 2B7NA 2A7NA 4RZ5A 1VRDA 4O53A 4BWLC 2JKEA 3FKRA 5G2HA 4N2YA 1TJPA 1V7YA 2Q3RA 2QJIA 5L9FA 1H7RA 3T44A 4OWGA 5F2MA 4YCPA 4UTHA 2GVLA 3TIMA 1KFEA 1QFEA 4PCFA 1WAUA 1WV2A 1MZHA 3A24A 1Z44A 1EUNA 3G1XA 1FXQA 3W1AA 4IPJA 4E0CA 5F2GA 1TREA 1W5NA 5E1QA 4ZL1A 4GNJA 3FOKA 2FFCA 3GKAA 2QCMA 4E38A 3PC0A 2WSYA 3KVLA 3TQ0A 2ZA2A 1SZNA 1YYAA 4UTUA 2ZZ1A 3LI0A 4KFPA 3PG9A 2CWNA 1W8SA 5J5RA 1B9BA 3WJSA 1F73A 2YYTA 1LTDA 3G3DA 5G1YA 2NZLA 2V2CA 4M19A 5K9DA 3NNTA 2V30A 1TRIA 1TPH1 4O16A 3T4CA 1SO3A 3PAJA 4QIUA 1SW0A 4MKNA 2ZZ2A 3NM3A 2QCLA 3ZFHA 4AB4A 1UB3A 2CU0A 5U4NA 1YTEA 4KKXA 5I3IA 3FJLA 3PUEA 4XTIA 1N55A 2E77A 5HR7A 2VFEA 4LY8A 3ZWSA 3PBWA 3NQVA 3W84A 1EA0A 1Z42A 3LGEA 3NOEA 4MY9A 1GTHA 2NV1A 4IJBA 3FS2A 3TQKA 1H1YA 4MJMA 1H61A 3M41A 2F7FA 4M6QA 5D2XA 4I7VA 3M6YA 3KRSA 1XBZA 3K30A 2VFHA 2JKPA 4TO8A 2QCGA 5D09A 4JGDA 5D2TA 3W2NA 2C16A 1TMHA 4S2BA 1W31A 5I3KA 1KW1A 3S6DA 2X2GA 5LNRA 1P0NA 1VZWA 3IV3A 2E6FA 4W9TA 4DO6A 1B3OA 3B03A 2VEMA 2R91A 3TMQA 3IVTA 4CNOA 3MBFA 1H62A 1L6YA 1T96A 3N3MA 1MEWA 3DGRA 3SFKA 2ATSA 4GBUA 1AW1A 1M5WA 4NVTA 1H5YA 5HWJA 4UR7A 1QMLA 3HG4A 4K38A 1PCWA 1VC4A 3S42A 4AWUA 4UR8A 4OBTA 4ZQRA 1H7WA 2NXHA 2C1HA 3T40A 3TFXA 1SQ7A 4CLMA 3BGGA 3EWXA 5C6MA 5AHEA 4M6PA 2NLIA 4O54A 2RDWA 3MJYA 4BR1A 4JX5A 3G0XA 4BI6A 3B0UX 4O17A 1OFEA 3FLUA 5FESA 1JVNA 5EMUA 3PF3A 3G3MA 3UPWA 3HJZA 5K4ZA 3B4UA 2TPSA 4MPQA 4ALDA 4NU7A 4NJKA 5CPMA 4YWIA 1OK4A 3W1TA 4CQAA 3GNNA 4N9CA 3TA6A 3PSVA 2YW3A 2Y63A 2GVJA 4HKPA 1A5CA 1VQTA 3G24A 5AHNA 3M5XA 4JYDA 5LNWA 4KFOA 2NX3A 5F2LA 3AJXA 3QQ0A 2DORA 1YTKA 1ICSA 2Y6ZA 1XC4A 5AYZA 3M43A 5CZSA 3PVFA 1N8FA 2ZRYA 3F1QA 2ZRVA 5AYXA 3G1YA 5D37A 3PBUA 3I7SA 1DVJA 1OX4A 2RDUA 3U6WA 5F4WA 5F1UA 3W7LA 1X8FA 1KM5A 3SIZA 3C6CA 2NUWA 3A5VA 4AXKA 2E5CA 2B0MA 1J5TA 2FPYA 2WPBA 5C5YA 4O11A 1OFQA 2E68A 3LV6A 3VKJA 2V82A 2NX9A 3W7KA 3MYPA 3TK7A 3H55A 4GE8A 3QSRA 3GZ3A 4ZQMA 2CZDA 2C18A 4BFAA 4EWND 3W07A 3UQNA 5LGZA 1XBYA 1VLWA 3OA3A 3VNDA 1I45A 4FXSA 1JJKA 1R47A 4JR5A 5AHIA 5K3VA 3BV4A 4E2DA 4I9AA 5HINA 3M47A 3IRDA 3UWVA 1SZEA 4XBKA 2EHHA 4NXKA 3W72A 4OQVA 4OU1A 4FNRA 3O05A 1ZJIA 4O50A 5AOUA 2X1UA 1KFCA 2GQ9A 4O28A 3GB6A 1WA3A 1LDCA 4MUZA 4AF0A 1TYGA 3W1UA 2G95A 1JRBA 3DBPA 1K02A 3W7MA 1QO2A 1LBLA 2H3DA 3LHTA 4WD0A 3NQGA 4FNTA 1SFLA 3UXDA 1FY6A 2RKXA 1PVNA 1I2OA 5F2IA 4GUHA 3KFTA 3NQDA 1GVRA 3I7RA 1ME9A 1FWRA 1JCXA 4RZ4A 4PH6A 3NAVA 4DBEA 3P67A 4JY8A 3W85A 4E2BA 1XUZA 5BW6A 3Q37A 1TPWA 3S5ZA 3GKFA 5CZJA 4K39A 1G4PA 2GOUA 1G7UA 2QF7A 1T8XA 3TAOA 3DU0A 3STEA 3WK3A 1Z41A 5DBTA 1FDYA 1Y0EA 3GXTA 5AC7A 3JS3A 1H7XA 4PTNA 3NM1A 3SI9A 4FB7A 1AMKA 1FQ0A 5D02A 5CGQA 4N02A 2ISSA 4IPIA 2GUUA 3EWWA 3N34A 3LLFA 3CT7A 2NXGA 2GPTA 1IXNA 1KFJA 5I3JA 1T0OA 4UMBA 3DZ1A 5D2VA 3TROA 4CNPA 3TH6A 2YFOA 1UJPA 3GLCA 4UFLA 2WNQA 3H54A 1RV8A 4OT7A 1B4EA 3RMJA 2ZZ5A 3PBVA 4MY8A 3A23A 4CCCA 5DXXA 3MW7A 3NQ8A 3EXSA 3GIYA 4JNMA 4DPPA 4N9BA 2UV8G 3PM6A 4U28A 4NQ1A 3C61A 4XKYA 5ABTA 4HPXA 2QCHA 3U8GA 3CEUA 2TYSA 1CI1A 1P5BA 2Y7EA 4AMAA 6ALDA 3W73A 3UD6A 3TX9A 1KM0A 5DCBA 2A7RA 4Z0JA 1SR9A 3HPSA 6TIMA 1YXCA 2VEIA 4JICA 5U7SA 3LXBA 5AFDA 3TSMA 5TQLA 1O4UA 5BMXA 5D2YA 5K7JA 4OV4A 2O7QA 4DO4A 3UWYA 1SUXA 3FFSA 5TIMA 3JRKA 4RJEA 3CU2A 3HG5A 3RLUA 3HGRA 4LUJA 3DKJA 3THAA 1L6WA 3P60A 2ZRXA 1Q6QA 1GZGA 2EAWA 3P7YA 3TC7A 2OZ0A 3KAOA 5DXYA 4RV8A 4LW7A 2X30A 2X1RA 3ZS4A 5E93A 1H7OA 4MFEA 1HO1A 1ML1A 3QMTA 4GRSA 5KINA 1EWDA 2ZA1A 1UUOA 1AK5A 3CEPA 4GJ1A 3N2MA 1T99A 3P84A 2ALDA 2WOQA 2J6XA 1JCNA 3NZ1A 2Y89A 1LOSA 3PSWA 1C8VA 1TPUA 3LTSA 3IIXA 4RR4A 3UZJA 4PC8A 3O16A 5IM51 2JGQA 5EL1A 1TTIA 1DHPA 4N9DA 2I9EA 1JQVA 3GDLA 4IX2A 3WFAA 4DELA 3EXRA 3W7NA 2OMAA 1TQJA 3OBKA 1C9DA 3M5YA 3TQVA 1VCFA 3LM7A 3U2OA 1PHWA 2TMDA 2WNNA 3QM3A 4OGZA 4JTLA 1AG1O 2PRLA 4N4PA 2Y7GA 4A21A 1VGAA 5HMSA 3NQ6A 4LV9A 3NPVA 1OF8A 4FEZA 3DH7A 5F1VA 4DEFA 1NF0A 4XTDA 2W0UA 3SW6A 3BLEA 3TW6A 4L4MA 1QDSA 2NV2A 3W7QA 3T55A 3S1WA 2EGZA 4IMDA 4K6AA 3KOFA 1NEYA 3P62A 4XBSA 1FDJA 2VC6A 4BK9A 5K9CA 1KTBA 4M7TA 1DORA 3ZR4A 1I2NA 4HIBA 4MLJA 3HGOA 1L6SA 3LTYA 4UMCA 2ZYFA 3YPIA 1PE1A 3W1XA 3GNDA 3EWUA 2CLOA 2ZFAA 5D04C 1YTDA 4NUWA 1F7BA 2QCFA 3GXNA 1LROA 2GQ8A 1QWGA 3TAKA 5FEZA 2OT1A 1VH7A 2ZDRA 1OG0A 3A5FA 1GYLA 1LBMA 3R8RA 1J2WA 1GJPA 2I1OA 3INPA 3G8RA 4XQ6A 1JCYA 1OX6A 3LHVA 1IGSA 3HIJA 4NJGA 4EIVA 2HS6A 2VEPA 3NQ2A 4EF8A 2DP3A 1S5VA 4JS3A 2C13A 5DLCA 3GX9A 1R2SA 3O63A 2F84A 3TU9A 1KLYA 3C56A 3LRKA 3DFNA 3RF9A 1HUVA 1K8YA 4MY1A 3W2MA 2PURA 3DHFA 3LERA 1DL3A 2E5DA 2QJHA 3G8EA 3W7JA 2RH9A 3BGJA 3C2RA 4M7SA 4FX6M 4IMFA 3NVTA 2J24A 5CZ0A 2VXNA 1GVQA 4UFKA 4IMGA 5EA9A 3L68A 1WBHA 1KM1A 2GVGA 2Y62A 3MP4A 4AWTA 1ZAIA 5HJLA 1K8XA 3WJYA 4AWSA 3EEGA 1R46A 1FXPA 1EWEA 3MMTA 3QPZA 4LS2A 3NQAA 4IQLA 5KITA 4UTTA 3ELFA 5FEXA 4LC8A 1BWLA 1LM1A 2CZEA 3UWZA 3ABRA 2XN0A 3O07A 5G2WA 2FPTA 5EYWA 5LZLA 3FA5A 3L9CA 2X1TA 2A5HA 5G5IA 1KBIA 2NWRA 4WY0B 3KVMA 1OVDA 3IVSA 2A4AA 2OCZA 3KXQA 1F05A 2AQWA 3S9YA 2FB3A 4POCA 1TPC1 4HSOA 3STCA 2V2HA 2FDSA 1QNVA 4MJZA 4UTIA 2YDAA 3H53A 2B7QA 1QOQA 3LRMA 4K36A 1GVSA 2XFWA 3OHIA 1QPRA 2FB2A 3DXIA 1TO3A 1VLIA 4HSNA 2VELA 5FF2A 1XDMA 1SPQA 4CCEA 3FYOA 5TBOA 8TIMA 1OFDA 5DELA 1XBXA 2R8WA 1A53A 4PL2A 3CTLA 4UNKA 4FF7A 5LHEA 1TB3A 4GUIA 4UFIA 3W2JA 1F76A 1QAPA 3O6CA 3TSBA 3C2FA 3RLVA 1ADOA 4UTLA 4IMCA 1CX9A 1DJQA 2ZZ6A 2OJPA 1BTMA 2H6RA 2BZNA 3ABOA 4LTSA 1O95A 3P82A 3DAQA 3GR7A 1EP3A 2O7SA 4Q4KA 3OVRA 4NT0A 3HG2A 1M6JA 5D05A 4P2VA 4UTTC 4O0KA 3DHDA 4JTJA 2E09A 2JKAA 3T78A 1V5XA 3UWWA 3GR8A 3EX3A 1I2QA 3CC1A 1ME7A 4Q33A 1TTPA 4JYFA 3W7HA 4CCDA 1JCLA 5CPLA 3M5ZA 1X7FA 2DZPA 2GJNA 4LWWA 5KMYA 4JD4A 1G6CA 2HSAA 2ZQ0A 3P8JA 1W0MA 2QJGA 1LOQA 3NXFA 3KX6A 3CIXA 1KLZA 4Z1AA 3KVKA 2G96A 3G1HA 1ZNNA 5EY5A 3W70A 1SSDA 3W83A 2J88A 5HNRA 1XBVA 2QDHA 3P61A 2Q3OA 4X2RA 3W7CA 4LVFA 1VPXA 3G1DA 3R12A 3IIPA 4NX5A 4ZQPA 1ME8A 1VHNA 3HPZA 1FBAA 4ML9A 3HGSA 4RKAA 5SWUA 3W71A 2CLMA 1QO5A 4UNLA 3MHGA 4O19A 3WK1A 1KM4A 1P4CA 2ZTJA 4ZZ9A 2HS8A 1GEQA 1SSGA 2J27A 3ATZA 2J9XA 3S5OA 1XXXA 3NR0A 1FWTA 3W23A 1Q45A 4FIQA 3EKZA 3P5ZA 2Z2UA 3V75A 1IXQA 2ZRZA 1B4KA 3EWBX 1H51A 3MP5A 3PS7A 3NEVA 5BNKA 3OEXA 1GG1A 4ICNA 3NQCA 1J4EA 1H60A 3TSDA 2WSRA 4WXYA 2DU2A 2H8ZA 3E96A 1L2UA 2BXVA 3L0NA 3A21A 1LRQA 3P8IA 5AB3A 4A3UA 3LV5A 5T26A 4YLWA 1K7EA 2V0TA 1YXYA 1A5AA 2OX1A 2QCDB 4HNUA 4WXZA 2ZZ4A 1P1XA 4JTFA 5EKYA 3THQA 4O14A 3NYZA 2Y61A 1H63A 3BW3A 1WOBA 4WJEA 2ZCGA 1CW2A 4JTIA 3BARA 1KV5A 1BKSA 4S1FA 3W2KA 4HNTA 3QEZA 5LSMA 3SZ8A 4JX6A 1OHLA 3R89A 1D9EA 3DFPA 4LV4A 1JRCA 1PCKA 1NSJA 4DF2A 1K03A 1W5QA 4HT3A 3VE9A 4QNWA 2CLEA 2ZTKA 4CQ9A 4LVBA 4GXMA 2HTMA 4UUIA 1AL8A 3HGJA 1FCVA 4AVFA 2CZFA 3PWAA 3T7VA 1A5SA 4ORIA 3FEMA 1OYAA 2CFFA 3LCIA 4EF9A 3L5LA 1WBJA 4UXDA 4IGHA 5AHLA 2DZUA 3CWOX 3VI2A 5F4XA 1LBFA 1DQXA 4JY9A 5CSRA 3IIOA 4LOCA 4RK8A 3UY7A 3QZEA 2YX0A 2LLEA 2RHGA 1R2TA 2QUVA 2E6AA 2PRMA 2NUYA 3HB9A 2QCEA 4ADUA 3DFTA 4JN6A 4HNVA 1NVMA 4RX0A 1X1OA 4J9JA 3W1MA 4QSHA 1M7PA 1OX5A 3NL3A 3OVQA 2TRSA 1B57A 1G69A 4CQ8A 3STGA 1QR7A 3M44A 4A22A 4X22A 2Y70A 4R53A 4Z0SA 2Y7FA 3G1AA 4Z1BA 3B05A 3W7EA 2J9YA 2FJKA 1R2RA 3LI1A 3QW3A 3W7IA 3LBMA 2G5WA 2BLEA 5H2ZA 1R30A 3TJLA 3P5YA 4WX2A 1LP6A 2DJLA 2ZZ7A 5KTLA 3R2GA 1XI3A 4LS1A 3C3NA 2YXGA 3WK0A 2NUXA 4LC6A 3P74A 1GYNA 3S5YA 2PCQA 3IGSA 5BMWA 3IVUA 3M1ZA 2DJXA 5CPOA 1P0KA 5FEPA 1MSSA 2H90A 2QCCA 1LYXA 5I3FA 5D03A 1JUKA 4C1KA 5L6UA 1FCBA 3TCEA 1JCJA 2KZHA 4IMEA 1DKWA 1MO0A 7TIMA 3VFLA 4FHAA 1TV7A 5K4XA 3UWQA 3B06A 3O6DA 3NDOA 4UTKA 1W5MA 3M0ZA
chains in the Genus database with same CATH superfamily
3PPHA 1UWSA 3KOYA 3EX6A 4WDTA 2QAPA 1HJVA 2QPXA 2NQZA 2R1LA 3GU9A 2YGYA 3M64A 2CLKA 1MEIA 3DI1A 1U83A 3UGVA 1NOUA 4DQWA 2AAMA 1KV8A 5FF7A 1K70A 5JU6A 2ZA3A 1TE1A 3C2OA 1XLAA 5K2ZA 5H6HA 3MHUA 4DO5A 2Y4SA 1VFSA 3KTCA 2DZAA 5KSWA 1YDYA 3S9IA 2VP8A 4AHPA 4GMEA 2YCLA 1VR6A 2ZBTA 3BG5A 3FJ6A 5DCDA 3EDFA 2G41A 1UD4A 5HWNA 1E6RA 1YPFA 4GJJA 3T0TA 3WF0A 1EEXA 3PULA 1TQXA 3CLWA 2BODX 1OADA 2BG5A 1XWYA 3U5UA 5CJNA 2PWVA 1TPFA 3E2SA 1FWJC 3PFMA 1KM2A 5HULA 2XM1A 3BLPX 3DG3A 4KMQA 5HR6A 2XPKA 2W9MA 2P0OA 3E0IA 1TJ2A 1E0TA 4ZBCA 3R58A 4I3GA 1E4IA 5BRBA 1NELA 3SIMA 4UQCA 1SO5A 3B9NA 2XIBA 3CHCA 4MZ8A 1WYIA 3BANA 2CBJA 5DN1A 1PIFA 3CWNA 4NY2A 4D6IA 4JIPA 4DJEC 4GUGA 1W3KA 2V3EA 2PAJA 3UZXA 1SGJA 5EBAA 1VD6A 3LGGA 1PV8A 1GGOA 3I68A 2VZVA 1FH7A 3W1RA 1EUAA 1BXCA 3AYSA 2PI6A 4JTRA 4TV6A 3VU2A 5AVNA 3VOJA 4DXVA 1V02E 1D8WA 1WXYA 4DBDA 3BLIA 3DBNA 3Q65A 1JNDA 2J7BA 2QUUA 2QKFA 4MYAA 3CQHA 1F4AA 4H4IA 3TFCA 2CITA 3C2EA 3OHMB 1YMYA 3EZ4A 3W74A 2J66A 3OLGA 3IGXA 1B54A 3HPXA 1GPWA 5M3WA 3NZPA 5DEZA 3RK8A 4EACA 4Q8NA 1YRRA 4F2BA 4X9SA 4H6EA 1EP1A 1AODA 3VM5A 5C2CA 3O15A 3NGFA 3PB0A 3H4GA 4CU6A 4UWMA 5KZMA 2XDFA 4GGBA 2FGLA 2PE4A 4PB3A 4Q4SA 4CNNA 1UR4A 1XG3A 3U48A 9XIMA 2A0NA 4GUFA 3L4UA 2PGWA 2V5KA 1ISWA 4O8AA 4L7ZA 2Y85A 1QHZA 4ZGYA 1VEOA 4Q7NA 1U22A 4AD1A 1T6MA 1PSCA 1QK0A 1I1WA 1GORA 4XVEA 2PDXA 4UTKA 1OEPA 3E12A 3N2XA 1R7AA 1R8LA 4GXWA 1OCBA 3CO8A 1MQQA 1HTIA 4HU4A 3F4WA 2HCVA 3FDGA 4L4LA 3LHUA 3N2TA 2YLLA 4RNJA 3W2LA 3W7DA 1EX1A 4I7WA 4LUTB 1GVYA 1H7NA 4JKMA 1GQNA 3WQ8A 2ISWA 4MB1A 3BC9A 3TYDA 4ILSA 3PNZA 3KOXA 4LAKA 3AIEA 3I65A 2DQXA 1AQHA 4LRSA 1B3XA 1OFBA 1MEHA 1RP8A 2TAAA 5CAHA 4KEMA 4N6EA 1YPIA 1ZGDA 4O8RA 1RQHA 2QUTA 3LLXA 4UB9A 2F2KA 3WBWA 2V81A 1G7VA 2JIWA 3TTEA 4YCOA 2QHAA 1H50A 4IL0A 1DOSA 4I7UA 3TNOA 5HA7A 1V6XA 2NX1A 1I75A 2CLHA 1F8IA 3BOXA 2G97A 2OPJA 3LBOA 4UIOA 5I23A 4YVPA 2OKOA 5KZDA 3G0SA 2W5FA 4H8NA 1RD5A 2WV8A 3EX4A 4KWWA 4Z1CA 1V51A 4UC5A 1OABA 3C5QA 3GVWA 3N18A 4JIQA 5GVJA 3GDMA 3LTPA 1X96A 1RK6A 3PR2A 1SFJA 1GW9A 3STFA 3O6YX 4KETA 4GJIA 4KWUA 5HNUA 4HA4A 3UGRA 1C8QA 1EEPA 5HOSA 4FXFA 3F4DA 1ZP4A 1PX8A 1LUCA 5EBUA 1A5BA 4B4HA 3EAUA 4W84A 2PGFA 4GUJA 2YL9A 2R1MA 3EDKA 4NAEB 1RQEA 3C4UA 4XBJA 4DWSB 5DMYA 1CIUA 5AYYA 3EX1A 4NAFA 4H7CA 1HJWA 2GJXB 2L5HA 3ZO9A 4GI6A 2QQ6A 3VC6A 1HG3A 3NCOA 2JALA 2F6UA 4AC1X 3P3BA 4IX0A 3GK0A 3SGUA 4PUNA 1FDZA 3GVGA 4AF0B 2C8NA 3EEZA 1YKWA 2ZICA 1W1ZA 4QNEA 1QUMA 4KQNA 4J4KA 2XFFA 2DSZA 1RLCL 2C6QA 4RLIA 4FLOA 4LAUA 4UOJA 5FKYA 1WX0A 3LBCA 3OVPA 1M9HA 1KC7A 3CAVA 4UMAA 4DYJA 5B80A 1OFPA 4ECLA 4H6KA 1FUYA 5C2GA 5AY7A 3VNMA 3V18A 4UQBA 1JAEA 3U2ZA 4AD0A 2YFNA 5G4HC 1RR2A 3O1NA 3TTQA 4G7EB 4MMWA 1PYFA 1TG7A 3DENA 3GVQA 3B8UA 2VFDA 1Q4NX 4TXEA 1CCWB 1FWGC 4O57A 4FSAA 3L2LA 3AS0A 4JPGA 3U3HA 5CBIA 3NUKA 3IAQA 2YCJA 4Y96A 4UTJA 4BQ5A 4JQ1A 2ZWZA 1P43A 2ZUVA 3EBVA 1R3YA 1QWKA 3SM0A 3F03K 3PTKA 4OV9A 3WMLA 1ENUA 4L4PA 4ZE4A 1LCOA 4NJHA 3BURA 1B30A 4RL3A 1FTXA 1J01A 3MI6A 3W86A 4FOKA 4WDWA 1UROA 2W3ZA 2DSUA 3SCUA 1VYRA 5GNXA 3AS3A 4PMZA 2QEZA 4O12A 4DM2A 1KA9F 4Y8FA 4XV0A 3GVVA 1IXOA 1ZCCA 2DZXA 1C92A 1UPPA 3MKCA 1E0VA 4HJFA 2V2DA 4B5TA 1PIGA 1XLJA 1NQ6A 4Y9NA 3KBWA 3NQBA 3LG3A 2E5BA 1OFAA 3FKKA 3QH2A 4Q22A 1E1CB 4F0RA 2YCEA 2EG8A 5KEZA 1AQ0A 3NPXA 3TYAA 1JXJA 3WNMA 4WGHA 4J3SA 3IJQA 4R34A 5REQB 2JK2A 3S2JA 1U1UA 4FXRA 2OX4A 3I6TA 3T0AA 2D2OA 2Z27A 4FO4A 9RUBA 2JEQA 3CLMA 4AD2A 1XH1A 3EB2A 3QYQA 4W5UA 4MYXA 1XYCA 3VGHA 1XYBA 5HQMA 4I8YA 2WZIA 1KB3A 3POHA 2ICSA 4YJ5A 2CLLA 3VVGA 2O55A 3RN6A 1DQWA 2A1YA 1SO6A 1K7XA 3OB8A 3N2CA 3USBA 3TN4A 3W6MA 3UXAA 4GXPA 4S3EA 1DPMA 4PEEA 1GONA 4BQ4A 1PZ2A 3N4FA 1ICQA 2VOMA 2DVXA 2WVSA 1X6UA 3VIFA 4O4VA 2Q8XA 3UXIA 1IIHA 1WPCA 5PTDA 4OBRA 4L6OA 2W92A 4LF2A 5F4SA 3TWBA 1V77A 4AY1A 2PDNA 2W61A 3WNNA 5LHFA 3ANVA 4LYRA 2WHMA 3SBFA 1KR0A 1W32A 4B5UA 4P7LA 4PFMA 3W4RA 3GYCA 3UXKA 4MB4A 4FNPA 3W24A 1XW8A 5C9XA 3IJLA 3COTA 2A21A 2PWHA 1VS1A 3LPOA 3SCVA 3MJMA 2VD9A 5AECA 4FP1A 4PMRA 1NF7A 1LORA 3AO0A 1E6ZA 1Q6CA 1A50A 4BWLA 1UUMA 5CAKA 2DZSA 4HHPA 2WLZA 4JIRA 5D33A 3S4TA 4W89A 1V4YA 1W9VA 5BWFA 4RDYA 3N2OA 2A3AA 3A9BA 4JAWA 3H8AA 1PS9A 4JIEA 4D6GA 1QI5A 3C52A 3LDVA 1E40A 4HK5A 1ALDA 2VFGA 4TTUA 2VL4A 2EEXA 3TYBA 3W7RA 3E74A 1KBLA 1IF2A 3DFQA 3CM4A 5HPOA 1RVGA 4ICCX 1KKOA 1ZENA 1LLZA 4PBFA 1RP9A 3AHVA 1EGVA 1QW7A 4JTUA 1FWWA 5RUBA 3G6MA 3ZWTA 2PLKA 2RDXA 1W3IA 3HBLA 1TPEA 2Y7DA 4V1YA 4QAIA 4Q7BA 5E6ZA 1DJNA 4GA8A 4PCPA 2J7EA 3A6OA 4IG2B 4AXNA 3F5KA 4A2RA 3CZGA 2VEKA 4OZOA 4WF7A 4MZ1A 3B8SA 4N9EA 1VYSX 3TONA 1CGXA 4PFHA 1E72M 1I0DA 3AXMA 4H9VA 3N15A 4PMNA 4HTBA 3ZOAA 4RZ5A 1VRDA 3FAWA 3N04A 5XINA 5G2HA 3XISA 1QRQA 1O68A 1TJPA 1A80A 1XIMA 4O1FA 4YCPA 2GVLA 5IDIA 1WV2A 3CZLA 1MZHA 1V02A 3A24A 4GY1A 1TIWA 2Y0FA 3G1XA 3T08A 2VC5A 3W1AA 4Q6XA 1WDDA 1YQ2A 3ITVA 3ZMRA 2P76A 2AQOA 3PC0A 2WSYA 3TQ0A 4GVIA 1SZNA 3SN1A 3LI0A 4KFPA 3WO8A 2CWNA 5BXRA 2ZX5A 4KCWA 1F73A 3WELA 1LTDA 5G1YA 3CUGA 3OA5A 2NQLA 4AVNA 4M19A 3NNTA 4GK8A 3B0XA 4RE3A 4E5TA 4UOZA 3NO3A 1HKKA 4MKNA 2ZZ2A 3CASA 3ZFHA 1UUQA 3L4TA 2E3ZA 1EQPA 4AYSA 4AB4A 2CU0A 3URAA 3NURA 4XTIA 1N55A 3N17A 3ZT6A 5H8MA 2WBKA 2VFEA 3QY6A 4WSJA 2XYLA 2BFGA 3H22A 5T8GA 2YA2A 1Z42A 1TMQA 3NOEA 1XX1A 3LNPA 1H1YA 4W8BA 2J13A 4M6QA 4LBUA 1JD9A 4NHVA 3NWRA 4GZEA 5D2XA 1SR0A 3GHTA 4J2PA 3C3UA 3VAVA 2JKPA 1R3VA 1EYEA 2PDIA 1LF1A 5D09A 3W2NA 2J77A 2C16A 1XLBA 1TMHA 1KW1A 1OCNA 3NXLA 3GNPA 1Z8AA 1W9DM 5LYRA 1B3OA 2R91A 3GTIA 4RDVA 2PS2A 3WQ4A 3VGGA 4K3ZA 2VTFA 3SFKA 2ATSA 4F0LA 4NVTA 5DRIA 2J74A 5HWJA 1CLXA 3ABXA 3AJ7A 4IPPA 4HOXA 4XZMX 3O0FA 3ICJA 2DUAA 2J6VA 4UR8A 1JG9A 2ZE0A 1OSEA 4OBTA 3VGFA 5CC6A 2C1HA 5JBDA 5JH1A 4CLMA 3QR1A 3ITLA 2DT2A 3QPEA 5C6MA 4M6PA 3GXFA 1H49A 2UWFA 4V33A 4M29A 2RDWA 4G5DA 4JX5A 4I9MA 3B0UX 1LQAA 1AQFA 5EMUA 1XSIA 4GX8A 3UPWA 3LSCA 1R3TA 3B4UA 4BHYA 4MPQA 3RXZA 4NJKA 2WKGA 2VC7A 3PSVA 1PAMA 2GVJA 2RGLA 3G24A 5AHNA 3CV1A 4KFOA 2V5DA 2NX3A 1RA5A 4PB5A 3TYEA 2YBUA 2VX7A 3TJ4A 2VWSA 1ZL1A 3QHOA 1XC4A 3UVAA 1OBAA 2ZRVA 5AYXA 3G1YA 3GFYA 1K8CA 1VFOA 5F1UA 3BAYA 4BEQA 4PSRA 1BVWA 3MPGA 3WDHA 1X8FA 4DO7A 3PZTA 3SIZA 3C6CA 4JFTA 6REQB 2BY0A 2E5CA 2PBOA 3BJTA 4J5NA 2WPBA 3DFHA 1WDSA 2Q01A 3LV6A 3T81A 3F2CA 3VKJA 2V82A 3QXBA 4EANA 2JF6A 2VWTA 5F7UA 4GE8A 1PYMA 4BFAA 1UD8A 3W07A 4YS1A 1XBYA 4QR6A 1E5NA 4US5D 4NAEA 3C0QA 4DWSA 3IRDA 4I8DA 3IJ7A 2GJXA 3RM4A 3RU8X 1M68A 3GU2A 4OU1A 5AOUA 2GQ9A 2ESCA 3GB6A 2ZXBA 4GBDA 1ZP3A 3VKBA 4AF0A 3W7MA 1EXPA 1TJ1A 1LBLA 1M53A 1VFTA 2H3DA 4WD0A 4CD5A 1SFLA 3UXDA 4DJFA 1W1TA 2RKXA 4GUHA 2UZ9A 4ERIA 1FWRA 4WRHA 3ERPA 1JCXA 4PH6A 4DBEA 1HJUA 3HN3A 3W85A 3QHNA 3Q37A 1TPWA 3S5ZA 4K39A 1FHUA 3P14A 2ZUSA 5CCZA 4ZOEA 1TVPA 2GOUA 1T8XA 4GI9A 2FZMA 4QE4A 3WQCA 2ZUMA 2XH7A 1H7XA 3EOSA 3QY8A 3SI9A 2JIEA 1J2BA 1A0CA 4AMCA 1FQ0A 1Q8AA 2ISSA 3APTA 3ZXWA 2VHLA 1AD1A 4E4FA 3SCRA 4G7EA 2GPTA 1T0OA 3PK7A 4WK9A 1J9YA 5DANA 1ZZMA 4OJYA 4J40A 4OT7A 1B4EA 4QX4A 2W63A 1A5NC 4K68A 2RGMA 1XYAA 3WLTA 4O1EA 3KBVA 3T4WA 1NWRA 4U28A 1BG9A 3CBWA 5FD0A 4UTFA 3VD4A 2OVLA 4HPXA 2QCHA 2TYSA 2E7FA 3OLDA 6ALDA 4CQBA 5DCBA 6XIAA 1J18A 4HQVA 3GHUA 1SR9A 5A6MA 4HHHA 3H26A 3FA4A 2JQXA 1KRBC 1DJHA 5GQBA 4JICA 2WJEA 5M03A 4DUWA 1XKJA 5AFDA 5HMFA 1MFUA 5TQLA 4JHOA 3UWYA 3WNPA 3FFSA 3FA3A 2PP3A 3WEOA 1EHAA 4KGLA 1GZGA 2EAWA 3P7YA 2I57A 4RDWA 1XSKA 4F0HA 5A6BA 5JIPA 3I3EA 3ME3A 2NV9A 2GYIA 5E93A 1H7OA 4US6A 3H2EA 4EKJA 5DF0A 1PWMA 1EFZA 4DI8A 1ZU8A 1UUOA 3SCOA 3N2MA 1MRAA 2VRJA 3WYZA 1RVKA 1E1CA 2PDUA 1BFNA 1C8VA 2D2GA 4KEVA 3S46A 1E5JA 1I60A 1G9HA 3UZJA 4PC8A 3BAXA 8A3HA 3ZZ1A 3CZEA 1DJZA 1JDFA 3MUCA 4IX2A 3UA4A 4DELA 3EXRA 4PGLA 3W7NA 4GX9A 2OMAA 5REQA 1JZ7A 3L7RA 1UR3M 3TZNA 5BXSA 3TQVA 5ENLA 2FZDA 1BG4A 3U2OA 3WQ5A 2TMDA 4W7UA 4DZAA 3QM3A 4H8HA 4JIIX 4A21A 4CD6A 1V0MA 2E9MA 5HMSA 4V2XA 1OF8A 2AKMA 4DEFA 3VMOA 2PSNA 3KWXA 3SW6A 3VIHA 4L4MA 1QDSA 2NV2A 3NIYA 4GQRA 3W7QA 3S1WA 4GY7A 4IMDA 3KOFA 5JBFA 3V16A 9CGTA 4BK9A 1FDJA 4X9YA 3KCLA 4WKFA 2CCRA 3OQEA 4ERAA 4UMCA 5HNNA 8RUCA 2UY3A 1UR1A 4FA3A 4HB7A 1GEHA 1F7BA 4AZHA 1LROA 1QWGA 2FH8A 1ELSA 3ARWA 4D6DA 2F9RA 1HP5A 3KDOA 5HJYA 1LBMA 2REQB 3R8RA 1DIOA 3QV9A 1GJPA 3INPA 4XQ6A 1JCYA 3LHVA 1DWHM 1IGSA 4AIOA 4LEQA 4KESA 4NJGA 2WZEA 4C65A 3W0KA 3ENLA 3GX9A 1DP0A 5AYIA 3TU9A 2EO7A 1KLYA 5E09A 1Y5XA 3NOYA 3OQ8A 4JFWA 3DFNA 3AS2A 3RF9A 1K8YA 2SFPA 2PURA 1WDQA 3LERA 1GKRA 3PZNA 3WEMA 2QJHA 4M7SA 2VXNA 2HNEA 1GVQA 2OQYA 1BF6A 5EA9A 3SCPA 4OBSA 3W38A 2Z7KA 2XVLA 2HZGA 3CXOA 3AC0A 1QI3A 5AZ0A 5HJLA 3AYRA 1K8XA 4JN8A 4AWSA 1OB0A 3QPZA 2FJUB 1QK2A 2DT0A 3POCA 1H3GA 5FEXA 3UWZA 1Q7MA 3ABRA 2XN0A 3VIKA 4ZE5A 3GW3A 2FPTA 5EYWA 5LZLA 2HBVA 4LYQA 5A2AA 1XINA 2IPWA 1KBIA 1WCGA 1OVDA 3KXQA 2AQWA 1CGWA 3STCA 2DZBA 3WH7A 1QNVA 2OGJA 1XPYA 1A3WA 3WLRA 2YDAA 2VGBA 5AKQA 2Y8VA 2B7QA 4UQDA 5FJJA 2YCKX 2ZX7A 2XH2A 1OC7A 1W17A 3A3WA 2FB2A 4HK6A 4DIAA 4C60A 1VLIA 1NDWA 4RUBA 5FF2A 1SPQA 2X8RA 4CCEA 4I9TA 8TIMA 3WUBA 1MZRA 4PL2A 1PTGA 3RLGA 4FF7A 1UH3A 3IK2A 4UFIA 1FOBA 5ABFB 4QEHA 2BDQA 1E70M 3C2FA 4IJCA 3AHTA 1TUFA 2BZNA 3ABOA 4J28A 3KL0A 1B3WA 3P82A 4AWEA 3GR7A 1EP3A 2O7SA 3IS4A 4JBRA 4C7FA 3OVRA 1XYMA 4QSFA 1M7XA 3I3BA 2Z1WA 1TVNA 1Z9AA 3GXIA 3THDA 4O0KA 4S3DA 3W28A 1EZ2A 1PX3A 2DY3A 1V5XA 4F0MA 4PTXA 1TTPA 5I79A 2ISDA 4CCDA 2DZPA 4B16A 2GJNA 2ISFA 1A0EA 2G4JA 2HSAA 3VNLA 3KDNA 1KCZA 3CQKA 4LAZA 3VNKA 3LPGA 4ZOBA 3NFUA 4YN5A 3CIXA 2IPGA 3GUWA 4W4QA 3G1HA 1ZNNA 5EY5A 1TA3B 1IEWA 2J88A 1P48A 2RJHA 2PWFA 1V6VA 2QDHA 1KCKA 2Q3OA 5CPTA 3G1DA 4ZQPA 1E0WA 3HPZA 3L23A 2NT0A 1XFCA 4AG0A 1IWAA 3W71A 1MFVA 1MUMA 3N6HA 3PTQA 4FMVA 2ZC1A 5BYWA 3DUGA 4JFSA 1VAHA 1XXXA 3NR0A 3BCDA 3EKZA 4ZB5A 3V75A 4LEFA 1B4KA 3OEXA 1XCWA 3FW6A 4MG4A 1OT1A 3NQCA 2VDHA 2BXVA 3A21A 1LRQA 4P7NA 2J7FA 3WEZA 2V0TA 2V3FA 2OX1A 3W00A 1P1XA 2PF8A 1FKXA 4GFIA 2EG7A 1DXFA 4NASA 2ZCGA 1CW2A 4S1FA 3GVRA 2PDMA 1OHLA 1FHDA 1CTNA 4Y7EA 1XPGA 1D9EA 1Q85A 4LV4A 4NZ1A 1JRCA 1PCKA 1B2YA 4DF2A 1YNPA 2PDKA 4HT3A 2WHLA 3VOIA 2CLEA 1MYRA 4XK2A 3EDJA 2QMKA 1BKHA 4LVBA 2AKZA 2BY2A 4UUIA 3T2QA 4L64A 4EPDC 1DYSA 2GLKA 3BDKA 3PTDA 3S2LA 3TTSA 4AVFA 2Z00A 3K8LA 4QDMA 3FEMA 4KIRA 3LCIA 4EF9A 2J7HA 4JCLA 4IGHA 1HKMA 2Z1VA 3VI2A 3RPDA 2GGIA 4LOCA 5A3HA 1MQRA 1G94A 1R2TA 1XV8A 3VNIA 4XKMA 4YTQA 1KXHA 1M7PA 3NL3A 5A8OA 2TRSA 2XH4A 3STPA 2PDYA 1PUDA 4CQ8A 3STGA 4S23A 1S46A 1QR7A 3IWPA 2G3FA 2WM1A 4X22A 4R53A 6REQA 4D72A 1C8YA 3V0UA 3G1AA 3ONBA 3B05A 2WBGA 4MAZA 4QS5A 2IXVA 2G5WA 5M1TA 3WG6A 2QT3A 2XM2A 2QPSA 4OIFA 4UQ9A 4P8XA 2HK1A 3BUVA 1IEXA 3CZKA 1O6IA 1XI3A 3C3NA 2BVWA 4LC6A 1KRAC 2VZUA 3P74A 4GVGA 2FKPA 4C6CA 1GYNA 1K4HA 2PCQA 4KWOA 4FR1A 3S5YA 3IGSA 3M1ZA 2Y8UA 2A3BA 2DJXA 4PR4A 2H90A 2PDHA 1HX0A 3I10A 4C6QA 4N0RA 1J0HA 4LX4A 4I90A 1QNPA 1MO0A 3OGVA 7TIMA 1CENA 1SJCA 2O9TA 3B40A 3UWQA 3B06A 2DSWA 2NQ5A 1DJIA 2ZRUA 1Z89A 3CQ0A 2WVTA 3AIVA 3SECA 4DB7A 2WMHA 3ABSA 2EPNA 3N3TA 3TNBA 2XHYA 2BHUA 4KRUA 1LRTA 1J10A 1D3CA 3N6JA 3KE0A 4EX4A 4IOTA 2FIQA 1OFRA 1KXTA 3WLIA 1QHPA 3CYJA 3KWSA 4L1WA 3HG3A 3E0LA 1ZFJA 3RU6A 3VD9A 2ZX8A 2POTA 3N19B 4UTWA 4LH8A 3SDOA 4BJHA 5J5DA 4PA8A 3PZIA 3E49A 2XSXA 4S3BA 5EPDA 1E1FA 3G2GA 1GUVA 5EMYA 2HVOA 3ABZA 1J96A 2OKTA 2OSXA 4CU7A 4R88A 1PKYA 1EB3A 1LOLA 4IISA 2Q6ZA 3DEQA 3AXIA 2PC4A 1R0MA 2HVMA 3UJFA 5KZEA 3NA8A 4HPGA 2XISA 4Q3MA 4NZJA 2PTXA 3H2OA 4DUVA 4PRTA 2WVVB 3WD3A 2WNZA 1F9CA 4Q4RA 3E9AA 3UCDA 3RCYA 3GG1A 2PTWA 3FDKA 2BASA 4QJ5B 2GJRA 1XIFA 2A7PA 1E55A 1MW1A 1PKMA 2J79A 4XWUA 4GIYA 1PB0A 3GS6A 2ADAA 4ACZA 5DMNA 1XRVA 3ARRA 4GD0A 3TUUA 4IP4A 3RO8A 1ZTVA 1C7SA 3WLKX 2G3JA 2OOFA 2IPJA 1JPKA 3RNDA 4ZMGA 1VJSA 1DE6A 5C55A 2XZ9A 4PB4A 4Y9MA 1GG0A 3WQFA 3R79A 3GNOA 3FHAA 3BTNA 3D5HA 3QFEA 5LXEA 1B31A 2CHRA 4GPNA 2V5JA 3LCFA 4O52A 3GDRA 1W3NA 4LU0A 1PZ0A 3DERA 4TMBA 4MKSA 2E4TA 4M1BA 4XO6A 1MNSA 2FTWA 4KF1A 5A8GA 5G2IA 3WJXA 1HO4A 2XN2A 4V28A 3LOTA 2PRHA 1MW0A 1OYBA 2D73A 3R13A 4JDYA 4K8HA 3P80A 1C7TA 3FV9A 1IT7A 1XDLA 1NQKA 4WQ6A 5KETA 5JMUA 2DH2A 2FQIA 1OJXA 1S5WA 3R0KA 1LLWA 4L65A 4K8GA 3OW1A 4JNYA 1BYCA 4U31A 2XSAA 1GOIA 3WFLA 4UFMA 5CC3A 1L9WA 1TSIA 1VEMA 1I1XA 1QBAA 1EP2A 1XIEA 3WF2A 3TYUA 2X1IA 3EKLA 4HMNA 4IICA 2JGYA 3AS1A 1TX2A 3W1LA 1ZAJA 3L5MA 1PKNA 1W3JA 3IGHX 1DJYA 2UY5A 4O1CA 4Y90A 2WKJA 1V3KA 3KCOA 3TKFA 2E8ZA 4B90A 3I6RA 3WBEA 3DYMA 4PUEA 5ECVA 1ONRA 4GQ0A 2O9PA 5IBXC 3PUOA 4K7VA 4Y6GA 4AZGA 1JFHA 2IPFA 4HPHA 3L4VA 3A22A 5E0FA 1M7OA 1YE4A 3UFYA 2E9BA 2Y5SA 2VCCA 3CHVA 3LSBA 1BWKA 1PEZA 4OE7A 2A6NA 3K5XA 3SRDA 3PUDA 2V5BA 4L9XA 1I8JA 4RW5A 4MNMA 4TR9A 3IEBA 3O6AA 2PZ0A 4JYEA 3V5FA 1W3TA 2KAUC 3TXVA 3BLKA 2IKHA 1E4NA 1N7KA 1FWSA 1IV8A 1HVQA 2P8CA 4RXGA 1DWJM 4WOZA 1X8CA 5G4WA 1WKEA 5I7GA 4MF4A 2CESA 1THFD 5DT5A 1LRNA 4S3CA 3RDKA 3VCRA 1HFBA 5DBUA 4BY3A 5TNVA 2ABAA 3VIOA 3L5AA 2CW6A 3G1VA 3UYIA 4LF1A 2VT0A 3A4XA 1S5TA 3W1QA 1O94A 5AC8A 4D2JA 1KXQA 4NZ5A 1RAKA 3RJXA 3UWUA 3MB9A 3TN6A 4GVFA 4Q4OA 2O4MA 3QGVA 3H2AA 1EKOA 3KLKA 4HP5A 1ZJBA 1J6OA 1IIGA 1TJRA 3PY2A 5D9MA 1EPXA 3ATYA 3U9IA 2ACSA 3AISA 1TPB1 4N4QA 3BE7A 3NPUA 2HRWA 4BI5A 3G1SA 2C15A 2D69A 4WY0F 3BLDA 4O1DA 1G4EA 3PBYA 2D0HA 5K9XA 3TC6A 2GJPA 3CIVA 3AUJA 5C9ZA 3LCGA 1WUFA 1WQ5A 1ADSA 4QG9A 3LLDA 3WDJA 1B3YA 3QV8A 4P7OA 4CN1A 2V5LA 1SZRA 1NDVA 1FWIC 4AHQA 3UNDA 1J93A 3IGUA 1QBBA 1FKWA 5I5RA 3K4WA 5MHBA 1XCXA 3LXCA 3USZA 1V8EA 4KIEA 3S1VA 1KO0A 3BJSA 1EYWA 3D46A 5FSEC 2O0TA 2B4GA 1M03A 3CUJA 3B0PA 1U1JA 3UESA 2NQJA 3TA9A 1TA3A 1SW3A 3KP0A 4MNKA 3RIKA 2FMOA 5I3DA 5IDZA 5HWMA 3JR2A 2E6YA 3BXWA 1EC8A 4WOQA 1AZ1A 4IQEA 2Z25A 4Z2IA 1Q7ZA 4AIEA 3WD4A 1L8PA 1G67A 5FJIA 2P0IA 4QTGA 1X7IA 2GVYA 1H5VA 2HE5A 3F4NA 3S6OA 3WQWA 4MWAB 3MBDA 3KRUA 5DX7A 3UJEA 5CPNA 4K37A 5I2UA 3DKLA 3E2QA 3VD5A 4Q4QA 4RXFA 1JDCA 2B7OA 4W86A 4L80A 3M07A 3VMNA 1JZ3A 4CEUC 2WO5A 3QPYA 1YIXA 1QOPA 4JL1A 4ZVJA 1IR2A 4TU1A 1P6BA 3C8NA 4KH2A 3WL1A 1LWIA 4WSHA 1UQZA 4GLEA 3HQ1A 1PZ1A 3W88A 3ZJ8A 3O8AA 2OYMA 2IW0A 2R14A 2OODA 1PL9A 4QG6A 4HNNA 1Q65A 3F7JA 1UKPA 4TQTA 3LCWA 2AGTA 5BXTA 5A6TC 1CWYA 4FOUA 3U57A 3VE7A 2AGKA 4R9OA 1KM6A 4IFOA 1PIIA 5C0QA 2NXIA 2P3EA 3M5VA 3OIHA 3CPUA 2FPVA 4WZHA 5D9PA 1SYTA 4MPKA 3TLLA 1JL8A 4HN4A 2Z6IA 3H7VA 2C0AA 1AL7A 1DIKA 5A2CA 4GC4A 1JPMA 3MUXA 1TV5A 3W7PA 1JF6A 2QMJA 2I56A 2YDRA 2GSJA 3H2MA 4UCGA 4G6CA 3TW9A 4JTSA 1SFSA 2ZE3A 1GZ1A 1GOKA 2P1FA 4MOZA 4ONVA 3AHXA 1QATA 1RQBA 3SJ3A 3W87A 5LNUA 3K8KA 3GIPA 4IUOA 1IZCA 1POKA 4H9UA 1HJSA 4R85A 1XLLA 1FCQA 1DJGA 4QCFA 3PPGA 1O66A 1JIBA 2FZ9A 1K3UA 4AH7A 2YCIX 3UBPC 5AN7A 2AQVA 3DI0A 2X2YA 4ADTA 4I9JA 3QRHA 5I78A 2XFYA 4IGNA 4Z1DA 4DLMA 3R8HA 5I00A 1R87A 4JTAA 1LG2A 2PDCA 2JFEX 2G37A 3HPFA 3LXAA 4HA3A 4NJJA 4BF9A 5LNVA 3W76A 2WJZA 4K7YA 2ASHA 1TWDA 1UP0A 3B8TA 1S2AA 3CH9A 1AUSL 1R9ZA 3TJIA 3CUZA 3EXTA 3MI2A 4RNHA 3A12A 4NJIA 4KWSA 1PHQA 4JCMA 2PMQA 2WZMA 1RY8A 2OT0A 4XUGA 1JYWA 5E6YA 3RPTA 3KRZA 1P0DA 1W5PA 4G1KA 4NZFA 4D1JA 1CGVA 4GYPC 3NSXA 1OGGA 3WLPA 3UZZA 4O1AA 1ZALA 1M01A 3OIXA 2QR6A 3Q94A 1ZBVA 4M5PA 2G50A 4M82A 3EWYA 3BAIA 4PCTA 3E02A 1TRDA 2DZWA 4ACYA 4NX0A 1TKKA 4BCEA 5JUVA 2I5IA 1CXEA 4QE5A 4WKHA 3TP4A 1B9ZA 4IXHA 4L61A 3ES7A 4ATLA 2QJJA 4DXXA 4AZ5A 5AC6A 4J3UA 2VENA 2EBNA 1KRCC 3M9YA 1EQCA 2XUCA 4U3CA 2DZTA 1TR1A 3P81A 2Z26A 2CKSA 1QXLA 1EJRC 4BF5A 4LVGA 2J75A 5A6AA 2BX7A 3N9RA 1LT8A 2CZ5A 3N14A 3EPOA 4YMZA 4PTMA 3LZ3A 3SUSA 2BY3A 1RPXA 4ZFMA 4MDOA 2V8ZA 4I5RA 1H7PA 3QQ1A 3ARTA 4PMUA 4GG9A 1W1YA 2Q02A 4S3JA 3V3WA 4O53A 4LQ1A 1KWKA 5J04A 2JKEA 3L4XA 1A5LC 1V7YA 2Q3RA 2XFRA 2PTYA 1FVPA 3UZYA 1SMAA 3EB3A 4GH1A 3QZ6A 1M41A 3WD1A 4QS6A 5FJTA 1Z44A 1FXQA 2WMJA 3EOEA 4IPJA 4E0CA 1TREA 2WPGA 3VD7A 1E56A 1VPQA 1V6YA 4GNJA 3GKAA 4C6PA 4E38A 3ZM8A 3EOLA 4UTUA 2Z4GA 3SQLA 5J5RA 3UJRA 3FNDA 3G3DA 4GIEA 2V30A 1TRIA 1HIZA 4O16A 1XISA 3IUDA 3PAJA 4CEXC 2WKLA 1GQIA 2D22A 1SW0A 3NM3A 2QCLA 2VVSA 2I9UA 4P8VA 4Q8VA 1YTEA 3M46A 6PTDA 3S3GA 1HVXA 2PUZA 3CZJA 4S3KA 4H19A 5TD4A 1OG6A 1RJRA 1NDYA 4LY8A 3ZWSA 2ZUWA 4A8IA 1HL9A 5M2FX 3UCQA 3NQVA 3W84A 1MW2A 2GWNA 3UJSA 4E2OA 4E8CA 1F07A 1XLKA 6TAAA 4M6UA 5JH2A 1R86A 3AYVA 1GNXA 3G77A 2Z1XA 2WCGA 3BAWA 3M6YA 3K30A 2VFHA 3V35A 1UJQA 5HK4A 4JGDA 1HZYA 4S2BA 1W31A 2VUYA 4UR9A 2AL1A 3SFWA 3S6DA 2X2GA 5LNRA 1P0NA 1VZWA 1OINA 3F5LA 2D3LA 4W9TA 2Q09A 4DO6A 3B03A 3UXLA 3IVTA 1W1B1 1H62A 1L6YA 5I24A 2OEKA 4K38A 3TLQA 4QE1A 3VZXA 1VC4A 3D3AA 4AWUA 3WMBA 4GI8A 1WNOA 1DHKA 4ZQRA 2NXHA 4IHCA 3M0YA 3T40A 4GIRA 3TFXA 1VENA 4WHBA 3WD2A 2HPMA 2NLIA 4BR1A 2HDJA 3G0XA 1OFEA 4XZLX 3FLUA 3D3FA 3VGDA 1VBGA 3HJZA 4MUPA 3TEVA 5K4ZA 1FFRA 3LENA 4ZO7A 3GNXA 4NU7A 1RLDA 3NO1A 1NY1A 2VM8A 1AA1B 1XS2A 3W1TA 4N9CA 1YHTA 1T41A 4ENLA 1VQTA 4LY4A 4JTQA 4R5EA 2OOGA 4FF5A 5F2LA 3FHQA 2VI0A 1YTKA 2YB1A 2OLHA 3QOKA 5CZSA 3PVFA 4O0QA 2HBXA 2ZRYA 5D37A 3KS5A 3DGBA 4HGXA 2V3GA 3BV7A 2NVAA 2YLAA 3W7LA 2GL5A 2Y1HA 3PPFA 1KM5A 3ZT7A 1W3LA 3VGEA 4HZMA 1HKVA 1G01A 1J5TA 1Y8BA 1YPXA 2OWCA 1HF6A 2CNCA 4UZUA 3W7KA 3MYPA 4A8LA 3H55A 1G0CA 2CERA 3GZ3A 2Z28A 1YNYA 1T7LA 2HPIA 2BXYA 3UNTA 2OQHA 3EPMA 4EWND 3MWCA 3NZGA 3OA3A 4CD4A 1I45A 1UKSA 1R9YA 1JYXA 1FH8A 1R47A 5LIYX 3SY1A 5AHIA 5K3VA 4FS9A 3BV4A 4E2DA 2QUMA 3GD6A 3M47A 4DBWA 3RJYA 4XBKA 2EHHA 4NXKA 2VX5A 3W72A 3N9KA 3O05A 4O50A 4WCJA 1EZWA 4AZIA 5M5DA 4Q8WA 4MUZA 1KBBA 1UR0A 4DJDA 5EFFA 1QO2A 3LHTA 3VCNA 3NQGA 1XH2A 1QT1A 1UKQA 4XD6A 3DFYA 1GVRA 3I7RA 1ME9A 3B9DA 4RZ4A 2OSWA 3NAVA 3MANA 5DO8A 2RUSA 2VMFA 1XUZA 3E0VA 3TOYA 2PGEA 1NM9A 1TUXA 1G4PA 4IT1A 2QF7A 1O7AA 3JW7A 4PBEA 4XD3A 5D8ZA 3WK3A 3HU7A 2NQHA 2QZRA 1Y0EA 1PWLA 4PTNA 3I4EA 2BB0A 1UOZA 2HXTA 3FN9A 4N02A 2J25A 3VUSA 1AD4A 3PPCA 2GUUA 4F66A 1B3VA 3LLFA 5A2BA 3CT7A 2OZ3A 1UH4A 1KFJA 1JGMA 4BF7A 4H2CA 2G3IA 3DZ1A 3TH6A 2YFOA 1UJPA 3CUFA 1ISYA 1CB7B 3H54A 3MC5A 4PMQA 3RMJA 3PBVA 2ZX6A 2PDFA 5MKGA 1UD6A 3MW7A 3CZ8A 3NQ8A 3EXSA 4U2ZA 4B91A 4JNMA 4H00A 1S5MA 2D3NA 2PWEA 2UV8G 1BYBA 2GK1B 4MNJA 3UZWA 2A3CA 2QPUA 5CSYA 3CEUA 3PUGA 1CI1A 3EMZA 2WWDA 3W73A 2DQWA 3TX9A 1KM0A 2NLYA 3HPSA 4MWAA 4RE4A 6TIMA 1WKDA 3FX4A 3SO7A 2J8TA 1H0GA 3LXBA 3L4YA 1GCYA 1O4UA 4OV4A 4B5XA 2E25A 1SUXA 3AMKA 5LIXX 1OCJA 4L1GA 3FVMA 2O56A 4LUJA 1EL3A 1IT0A 3TC7A 2PDQA 2QF8A 1HGYA 4S3GA 4LW7A 5I03A 5CPQA 2X1RA 3ZS4A 3GC2A 4I5UA 4KT2A 4IFKA 5KINA 2ZA1A 1OWQA 1ZPTA 4GJ1A 3VYLA 2ALDA 2KX9A 1A4MA 2J6XA 1CGUA 3PSWA 4QEEA 4QCEA 3IIXA 1FWEC 4G9PA 1EA9C 4ZOAA 3WFAA 3RCMA 3W02A 2OYLA 3ZYZA 1FWHC 3BZGA 4J27A 4BQ3A 1TQJA 3OBKA 4ZO9A 3M5YA 2FHFA 2R1KA 3GU1A 3I3DA 2WW5A 1IQ8A 2Y7GA 4LV9A 1ECQA 3OODA 5F1VA 2VR4A 1NF0A 4XTDA 2WWCA 2WANA 1BYAA 2QW5A 3E1F1 3AZTA 2G3NA 1AH0A 3VX0A 3VFCA 4FLQA 2EGZA 3VINA 3P62A 3MVIA 3QVQA 4B2DA 3R4IA 3ARPA 3N11A 1SJDA 1OIMA 1KTBA 4M7TA 3HV8A 3THCA 8CGTA 1I2NA 4A4AA 3VCCA 3CPGA 1BPLB 4MLJA 1JI2A 2Y24A 1REQB 1PE1A 3W1XA 5BRPA 3LS9A 3BH4A 5E9XA 3GNDA 2D2JA 2YB4A 5D04C 4NUWA 2QCFA 3GXNA 3S2NA 2JE8A 5BU6A 3A5FA 1GYLA 4H2HA 3T2PA 5H8PA 2P8BA 2ALRA 2I1OA 3G8RA 1OX6A 4JOMA 2C71A 4KBXA 4YTTA 5C8BB 1US0A 3RR1A 2ANUA 2HS6A 4EIVA 4EF8A 1Q6DA 1WE5A 2DP3A 4JS3A 4L4OA 2C13A 5DLCA 3VIPA 1R2SA 3ARSA 3O63A 2GUYA 4HYWA 2NW0A 2CZVA 1G5AA 4MY1A 1DL3A 4Z2GA 1FHLA 2E5DA 4JHMA 3W7JA 1UWTA 3WX7A 2RH9A 2XG9A 1ECEA 1YW1A 3CJPA 3E2RA 2J24A 4UFKA 3L68A 3FY1A 2BGNE 1F4HA 1MRQA 4OOUA 2GVGA 3QV7A 4M51A 3VABA 3ORWA 4AWTA 1H2JA 1VJZA 2CXEA 2WHKA 4AIBA 4LS2A 1FXPA 3NQAA 1C9WA 3T09A 2D20A 1P0EA 3QKEA 4WVXA 4C90A 1ZBKA 2YIHA 1FWAC 2XGZA 4Z2KA 3FA5A 2X1TA 4AISA 4WY0B 3WBAA 2G3MA 4TX6A 3SQMA 4OUIA 2FB3A 2D23A 4F9JA 1TPC1 2V2HA 1PTDA 2ODOA 3LUTA 5M17A 2PWGA 1XDJA 1QOQA 4ATWA 3KHDA 2Q71A 2PDBA 2XFWA 1EDQA 1L0PA 2WHJA 1QPRA 4R3UA 3LY0A 1V6TA 3VDGA 3MMWA 3OLEA 5DELA 1A53A 1UG6A 1F8MA 1JCTA 4W87A 1QAPA 3SN4A 3TSBA 3UJ2A 1TE6A 4IMCA 1KCLA 2ZZ6A 2NSOA 1GOMA 6CGTA 2VEGA 2PODA 3BMXA 4S39A 2YDQA 4LAMA 2C7FA 1M6JA 3F4CA 4QDPA 1BXNA 3WNLA 4UTTC 1OGSA 3PWIA 4JTJA 3M0KA 2JKAA 3UWWA 3EX3A 3CC1A 1ME7A 4IIBA 3T0CA 5A6LA 1V08A 1JCLA 1EF3A 5CPLA 3M5ZA 2BBFA 1QTWA 5HJXA 4LWWA 5KMYA 4JD4A 1FA2A 1RHCA 1QASA 1G6CA 1CB2A 4XUYA 4HCLA 2Z1KA 3S1GA 2A3LA 3ZVHA 4IF2A 3SEPA 3KX6A 4G1NA 3V5CA 2VJXA 4Z1AA 1TWIA 2I5QA 4F2TA 3C2YA 5HNRA 4U33A 1XBVA 4MM1A 3BCFA 3W7CA 2QJMA 3R12A 4NX5A 4W8AA 1FBAA 2W91A 3NVDA 2CLMA 5LA0A 1QO5A 4UNLA 3MHGA 4O19A 3RLHA 3WK1A 5D8WA 1RY0A 1V0NA 4N42A 2J27A 4HNLA 3ATZA 3S5OA 2ZRZA 1OZQA 3OVGA 5B7YA 2VX4A 5BNKA 2MANA 4NZ3A 1J4EA 1J8VA 1H60A 2WSRA 3U4AA 4WXYA 2DU2A 2H8ZA 3E96A 3WY1A 1LL7A 3L0NA 4H9ZA 1O12A 4ROQA 5AB3A 2OYKA 4A3UA 1E3XA 3CV7A 4Z2HA 4AZCB 1K7EA 2VDGA 4RV3A 1KQZA 2GSHA 4EPEC 1QOXA 1YXYA 4GYJA 4WXZA 2ZZ4A 4A8RA 4YVVA 4JTFA 5EKYA 2NQ9A 4O14A 3RITA 4HU8A 1XYLA 3NYZA 5EGRA 1E6XM 1QU4A 2Y61A 1S2TA 3BW3A 2MUCA 1JXKA 4LYPA 3BARA 4LYKA 1KV5A 1E6QM 4KW2A 1BKSA 3QOMA 3A3HA 3CO4A 4A3YA 4F40A 1R3SA 3MSGA 2J4GA 3DFPA 3FJ4A 2PU1A 1K03A 1W5QA 4QNWA 3SRKA 1N8WA 4C1NB 2ZTKA 4CQ9A 4GXMA 4A3RA 3NSMA 1A5SA 1MQPA 3KBNA 5HMEA 3VXGA 2A3HA 4C6OA 3VTRA 5C9WA 1XHGA 1XIHA 4UXDA 1HNYA 3CQJA 3CWOX 1LBFA 5CSRA 4RK8A 4HZ6A 4BA0A 2YX0A 2RHGA 3SCTA 3VOCA 3M0JA 2NUYA 3HB9A 4MDPA 2QCEA 3DFTA 1NVMA 4RX0A 1OX5A 3OVQA 2X09A 3MMDA 4XIAA 5C7HA 1IWPA 4A22A 2Y7FA 2XIOA 4Z1BA 1YEYA 3W7EA 3KL3A 2J9YA 2FJKA 4PTVA 5E70A 3MCNA 2EPLX 3QW3A 3F2BA 1JDDA 1R30A 1Z3NA 1ZJAA 2WJFA 3TJLA 3NEHA 3VDCA 4DLFA 2VQTA 1LP6A 2DJLA 1EO5A 3E0WA 2NUXA 1MUCA 5CLWA 2QVHA 3QY7A 4QP0A 1CXLA 3ZSSA 3AIBA 2F2HA 1P0KA 2X0SA 5FEPA 3GR4A 1MSSA 1QNSA 3G5EA 1JUKA 4C1KA 1FCBA 3TCEA 2KZHA 1DKWA 3UG4A 1RCQA 2F8QA 3VFLA 3D6NA 1C3FA 1R3WA 3HJEA 3M0ZA 2RFGA 1D3HA 5E5CA 1ODUA 1ISZA 2GQ3A 5HUPA 2X7VA 2PDPA 3CIWA 4ML4A 3HO8A 4JFUA 3SCSA 4EP8C 3FYPA 3L2IA 2RAGA 4JXCA 3LMYA 5CLTA 5BXPA 4O13A 4Q8UA 2GGJA 3GTNA 2INEA 1FWDC 3H70A 4CN6A 3IIZA 4DJEA 3LX9A 3PJUA 2VFIA 1W91A 4C6IA 4OKDA 5BWAA 2X16A 3I7QA 3AU2A 5HAOA 3AWNA 1WZMA 4JFVA 2BWGA 3MDWA 3N9SA 1NWTA 4M0XA 2FVLA 4K8EA 4E4PA 1TCMA 1XD0A 1EJVC 1FH9A 3GWQA 2GK1A 4YWSA 2ATMA 3C2VA 1GT8A 3BK0A 4GIAA 5FJRA 3ALFA 1JF5A 1DV7A 3W6YA 3S47A 3IJ6A 4UBPC 4RW3A 3GG8A 3MT1A 1B5TA 4JTEA 5H91A 1QNOA 1TZ7A 1OCQA 1GOXA 3IAPA 3MSYA 2HK0A 3DX5A 4NF7A 1TTJA 2VNCA 8XIMA 2J9ZA 3U0HA 1C8XA 4YTRA 1WDPA 1Q6RA 4DAFA 1N2VA 4KS0A 3S5NA 1MXSA 4HCHA 1EIXA 2QGYA 2AMGA 1CLKA 1EGZA 2BTMA 3O06A 3LD5A 3R5EA 3QR0A 3V0TA 3Q2DA 3TTYA 3T07A 3NO5A 1HW6A 2C19A 1BYDA 2A79A 2G0WA 3M0XA 3U7BA 2W66A 3JZEA 1CYGA 1US3A 5A94A 3LRLA 5JXQA 3K4DA 2YXXA 3BG9A 1TV2A 2CETA 5DY2A 3U5YA 1V6WA 3GBDA 1UMLA 1GVFA 2CBIA 4CVUA 4CNUA 1WZLA 4Y9AA 1XRFA 5FACA 2O9OA 3SR7A 1UWIA 4YPJA 3IIVA 1W54A 4AIUA 2PDJA 2YJQA 3W53A 4PMXA 4MB3A 3PZOA 2XSBA 4QLLA 2BVDA 2EPOA 2WC4A 3KL5A 4R7OA 3DC8A 3GNRA 3CUHA 3DFOA 1CPUA 3QLDA 3L0KA 4O1BA 2GSEA 3CTTA 3WQ6A 3SGZA 2EKGA 1W2VA 1UIPA 3CT2A 1FP9A 4H04A 4F9DA 2OEJA 2WVUA 2X1SA 3E38A 4JQ2A 3DDMA 1FP8A 2J47A 1PTAA 3EYPA 2FMNA 3WUFA 5JQ9A 4L6DA 3SURA 4RZ6A 1HXJA 5LA2A 3MV01 3W2UA 3VNYA 1DBTA 1KBJA 2ZXAA 3AXKA 2DSKA 4ZO6A 1K8ZA 3LN3A 3TYZA 3K1DA 1XCFA 1HKIA 3GAKA 1REQA 3WNKA 3QW4B 4QM1A 3HOJA 3MTWA 4XAFA 4EE9A 3HPAA 2J8FA 3MKKA 4X0VA 3SUUA 4Q4PA 3W75A 4NNCA 1FX6A 3W22A 3TMLA 4N6FA 4A29A 1AW2A 3TJXA 3IJ9A 3D47A 1S5NA 2R1NA 3BLFA 2D0FA 1CXKA 3KZPA 4ERGA 4FNSA 3U4FA 5E0KA 5C54A 2PGRA 4E6MA 2Q8LA 2WZHA 1GOQA 3NL2A 2DGAA 4G2DA 1N8IA 3WQGA 4W85A 3NDZA 2CBVA 4IPNB 2OTDA 2DW6A 3I4KA 3SY8A 3WLNA 1OZMA 3OPSA 2XIMA 1DJXA 2PDGA 4BI7A 1R38A 3EA1A 1AH4A 1TX0A 3IACA 4PEKA 3S6TA 2XIIA 1XC6A 9XIAA 4AAJA 2HXUA 1JI1A 1X38A 3W1PA 1WO2A 1AW5A 3MUIA 1W37A 3PP7A 3OZPA 1WDRA 4FNQA 2XTKA 3V1PA 3B8IA 3AMCA 2EF9A 5FF3A 3MUY1 4NNAA 3OZOA 3QGKC 4JTGA 1RUSA 5FL1A 4IXXA 3TQPA 2ZZ3A 2Z1BA 2XWDA 2OO0A 4H9YA 3PZGA 4MAVA 1CXFA 4WY0A 4LUTA 2A85A 3L67A 4JL2A 3H12A 2DEPA 1LWHA 5EMKA 4XZIA 2V67A 1TELA 3VDAA 2XIQA 3PJTA 1TZ9A 1KTCA 1OFOA 4ORMA 3H2CA 1ZHAA 4GCXA 4Q8TA 4XIMA 3DFSA 4O10A 4TVUA 3KOZA 4H3DA 1XLDA 3UF9A 4GKTA 1D7KA 4AEOA 1AFSA 2OEMA 3FGCB 1B0IA 1XGEA 1IYXA 1MVYA 8XIAA 2R9RA 2X05A 3QSTA 3BQ5A 2INZA 3UVIA 4JX4A 1RZMA 5FL0A 2HMCA 1WXZA 2ABBA 1OC6A 2I7GA 4NIRA 4NG3A 3UR5A 3APYA 4LUIA 3G22A 1JD7A 2B31A 5GJNA 1J0JA 4AFYA 3N6QA 2Y5EA 3PZUA 4QBXA 1I9CB 2OO6A 3VZYA 3MUAA 1QPQA 2BOFX 4TX8A 4IGSA 2V69A 2H9AB 4FLSA 1C90A 3BO9A 4B5NA 1D7FA 1V0KA 1WZKA 3ARXA 1GQJA 4LNYA 2VKZG 5CBBA 3ANYA 1MXGA 2ZXQA 1E9IA 1K7FA 1NARA 3UCCA 2XWEA 2HV5A 4JDBA 4NI8A 5IRPA 4NNBA 1DWGM 3ZLFA 1BEUA 3KBMA 4MJ4A 4TVDA 1V3JA 4HZ7A 4QITA 4DI9A 3I6EA 1SVDA 1CGYA 2A2IA 4CQDA 3BOFA 1BWVA 5EMJA 4LVDA 4O0ZA 2ZDSA 4LSBA 1ZAHA 2ZKMX 3KTSA 3A3XA 4JKKA 3MI3A 3WJZA 3TWAA 1E0UA 1JUEA 3WQOA 4XKYB 4E4UA 4YXGA 1EJSC 1QI0A 4D8LA 4JEQA 4C6MA 1TV4A 5HUOA 2D2HA 4H8VA 4L9ZA 3V4BA 1VJIA 3LHYA 4MHBA 6ENLA 1GWJA 3TE9A 3WQPA 4DF1A 4O18A 4S2CA 1XLGA 1NFBA 1CT5A 3LNMA 3EA3A 3G1FA 2WSQA 5FF0A 2YZRA 1UZDA 4TX9A 2HEJA 2YYUA 1VFFA 3OP2A 2P10A 3WN6A 3GH7A 3B0VC 2GZXA 2Z0IA 5JIWA 4BEUA 3GFZA 4WSKA 3Q58A 1XFBA 1YADA 4FALA 5HNTA 2BSLA 3GTFA 1X1ZA 2UY4A 3GHRA 1PJ9A 5CQ1A 4PTDA 2CLIA 5TAOA 3XIMA 3ITGA 3BG3A 1F74A 3MYOA 3CHEA 3WZ0E 1EBHA 1GTEA 2E8YA 3S1UA 3EWDA 4HOZA 4B3LA 1RBOB 3VUPA 3HMJG 5LNSA 3S0CA 2DVTA 3KBJA 4KEUA 1Q6FA 4C1NA 3QV6A 1O5RA 3SY5A 3GAYA 2YXOA 2Y8KA 3WF1A 3B04A 2FHBA 1TPVA 3Q45A 4AYGA 3U7VA 3UA3A 4V15A 4HPJA 4I5XA 1JUBA 4LALA 3WIJA 1GVOA 2YR1A 4ADSA 1RD6A 1O60A 3TN5A 4PN2A 3MY9A 3VX1A 2YPIA 7CGTA 3VOHA 2WB5A 4L1XA 1UOKA 3FSTA 3R0DA 4XAYA 5HANA 3UG8A 2WCSA 3UPBA 1QVBA 1OIFA 2ACRA 1GVEA 2DZVA 4EXAA 3MQTA 4XZBA 3WH9A 4XISA 3E0FA 1LG1A 1VEPA 2ACUA 4QISA 2VVNA 3N73A 3APGA 3W1NA 1JPDX 4KWVA 5CG7A 2WQPA 3MSDA 1W9BM 3NG3A 3QYSA 1UD2A 4FPSA 3KW3A 3RRAA 3UG5A 4QHRA 2QAFA 3R43A 3MWAA 2ZX9A 3WLHA 3LHZA 4F2UA 4GO8A 1YDNA 4CCZA 4U5IA 1NOWA 2W6RA 3NZRA 1ADDA 4MVAA 5FF4A 5DMLA 4H9MA 4M81A 4MLRA 3TYCA 1HL8A 1SO4A 1F6PA 3H7RA 1H4PA 1XM3A 2P50A 4IQDA 1JCMP 4EAMA 3GG7A 1XGZA 2VOTA 3BW4A 5DQPA 2X0HA 3CYVA 1XSJA 1VFMA 3UYCA 4LANA 1JDEA 3KLLA 1S3HA 3OG2A 2QIIA 4M56A 4IM4A 3GBEA 4ZQNA 5BOFA 3GFXA 5KZ6A 2HROA 1ONEA 3LB0A 3H21A 2XZ7A 2Z6JA 1A5MC 6XIMA 1Q6OA 2GDVA 1Q66A 2XN1A 4WGXA 3F2DA 1QPNA 4H01A 2VZOA 3UERA 3KVJA 1F3WA 4EPKA 5E0CA 2QULA 1RBLA 1R3QA 3EMCA 1ZCOA 3GG0A 4HTYA 4QFUA 4NXSA 2TODA 1KFBA 3GW0A 3JZUA 4MNLA 1JPHA 3GDTA 1NFGA 3EWZA 1VCVA 4QAWA 1LWJA 3DCPA 1K9TA 5LIKX 4CD8A 1I2RA 3DHUA 3W3OA 4RCXA 1F2JA 3AU6A 3ARVA 3THUA 3W7OA 2CLFA 4WKAA 4DWSD 4GH3A 3CS2A 4A2SA 2B7NA 2A7NA 2E67A 4BWLC 4GC3A 4JZ5A 4N2YA 2X40A 1NDZA 1ZLPA 1Y7VA 1H7RA 3PAOA 3MCMA 4GHRA 4OWGA 5F2MA 4UTHA 4LBSA 1QFEA 3EOOA 1US2A 1TJ0A 4NL1A 3XINA 1EUNA 1LJYA 3SB0A 2EPKX 2PLMA 4DJFD 5F2GA 1W5NA 2FZ8A 3FOKA 2FFCA 3LMZA 1X97A 1RK5A 1U1HA 2VD8A 2ZA2A 1YYAA 3CMGA 3PG9A 1QPKA 2WSPA 1W8SA 1VBJA 5ECUA 2YYTA 2FDMA 3UR8A 3T4CA 1RBAA 4M80A 1SO3A 1CZ1A 4QIUA 1WB0A 4LFYA 3REQB 4ATDA 1ZJHA 2C1GA 1UB3A 1G1YA 1B3ZA 2V38A 5I3IA 3FJLA 2BVTA 1A3XA 3OOQA 5IFTA 3UETA 1MMFA 3KOWA 1O5QA 3PBWA