3WJZA

Orotidine 5'-monophosphate decarboxylase d75n mutant from m. thermoautotrophicus complexed with 6-amino-ump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVANIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 83
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wjzA00
4C1KA 4UTTA 2A6NA 4HHPA 4OT7A 2WJZA 4TMCA 4Y90A 3HG5A 4Y6GA 1TTJA 4O54A 3QSRA 3DKLA 2R91A 1BWKA 1XDMA 3G1VA 4AMAA 3NEVA 5EBUA 3HG3A 3SFKA 1ALDA 1GVOA 4HIBA 1TRDA 2ZTKA 1GPWA 3MJYA 2OMAA 2CLOA 1DV7A 1Y0EA 4GC4A 4LV4A 2EF9A 4GUFA 3ZWSA 2Y7FA 4AF0A 1OVDA 4N9EA 1YDNA 1N7KA 1QO2A 1LP6A 1QO5A 3LHUA 3MI2A 2V8ZA 3KAOA 1MO0A 1GQNA 2ZZ7A 3T7VA 3TW7A 1P1XA 4RLIA 4MLJA 1OK4A 1FXQA 1F7BA 3EXTA 1ZJIA 1OF8A 3M5ZA 4MJZA 3W72A 3OVQA 1P4CA 3E9AA 2C14A 3S5YA 3W74A 4LVFA 1ML1A 2G5WA 1UUOA 3N73A 5HINA 4ADUA 3TNOA 4Q4KA 4DQWA 2A7NA 4WOZA 2RH9A 3C3NA 5L9FA 4RZ4A 3TFCA 1FWNA 4JYFA 1K7FA 3TH6A 3P67A 2CLIA 1X6UA 4GRSA 1YXYA 4D2JA 3PY2A 3O06A 4K8EA 3UQNA 3CQ0A 3GR8A 5D03A 5CSSA 3EXRA 3W7NA 3W22A 2ZBTA 3NZ1A 5F2GA 3LI1A 3N19B 1RQHA 5L6UA 2QCDA 3S5ZA 4UFKA 5I3KA 3BPWA 2IQTA 2WKJA 4AHPA 3EWWA 3N3MA 1IIGA 3QH2A 4FNUA 3W2LA 4RZ6A 2BSLA 2WSRA 1YLVA 3GDKA 2V2DA 2PRMA 3PBVA 4XUGA 3OVPA 3UXAA 2TRSA 3GIYA 4EOUA 4EWND 1EP3A 3B06A 1BTMA 3MP4A 4AWTA 4IMDA 4EVZA 3O6DA 3INPA 4QISA 3PBWA 2C13A 2A2IA 1OX6A 4JX6A 1GVFA 1LTDA 3P61A 3S1VA 3W1PA 4HNNA 1ME7A 1QDSA 1DVJA 5D04C 1W0MA 2WNQA 1M7OA 3B03A 3VKJA 5AC6A 3NL6A 1MEHA 2ATSA 2VFFA 3IGXA 3E49A 3ABQA 2J88A 2FLIA 4HSOA 2FJKA 2ZTJA 4O0ZA 5KZDA 3FS2A 1VC4A 3PSWA 1U5JA 3TV8A 4DEFA 2V5BA 5FF0A 3L0NA 4DXVA 3RNDA 4ZQRA 3LXBA 4HKPA 1WAUA 4IX0A 1FDZA 1SQ7A 3B8DA 3P74A 3A5FA 2Y63A 2C1HA 1ICPA 3FA5A 3VNDA 2HSAA 3R89A 4IXHA 2Y70A 2WOQA 4GBUA 5CPOA 5DY3A 3W76A 3U6WA 2C15A 2Y85A 1ZNNA 4EF8A 5K4XA 3RMJA 3TFXA 4OBTA 4UNKA 1ZCOA 3KX6A 2LLEA 1GVQA 1TQXA 3NQVA 2E77A 3W7EA 3WJZA 2X30A 4TX9A 4AB4A 4ZQOA 3HG2A 1PVNA 3G1HA 4Z1CA 4MLRA 5HWNA 3IGUA 2ZRXA 3PF3A 4KWWA 2VC6A 3PG8A 2Y7GA 2ZA3A 2E68A 4N9DA 3P80A 4IXXA 3LHWA 4RKAA 1JUBA 1JUKA 4LU0A 1W1ZA 3G3DA 4LT9A 5FESA 4JR5A 1KLYA 1P5BA 2DZVA 2H6RA 4DO4A 2R14A 3Q2DA 2DJXA 2EKCA 3LGEA 1JQXA 3FEMA 4IMEA 1W5QA 4QITA 5DCBA 4O10A 2E5BA 1E51A 2EHHA 4C1LA 3EKLA 3M9YA 2Y62A 4DELA 2UV8G 1F6PA 3LLFA 4O1CA 2FTPA 5E93A 3LHTA 4MY1A 1ICQA 4PCFA 4PODA 1K3UA 3LHYA 4N6EA 2DP3A 4LVAA 1SU5A 4DO6A 1H50A 5A8GA 3PSVA 4QAIA 1SSGA 4JNMA 4XBSA 4A21A 3A23A 3P7YA 1NFBA 3P8JA 3PM6A 3TK7A 5HMSA 4UMBA 4HT3A 4GUJA 3CIXA 4N4QA 3W1TA 2A4AA 3T78A 2Y6ZA 4O53A 5HNRA 4CCCA 1W54A 4X9SA 1YDOA 1B4EA 4I7UA 1KLZA 4UTHA 1W5NA 1X1ZA 3W73A 1EP2A 2RKXA 1T0OA 4GNJA 4UTTC 1Q6QA 3C4UA 3NDOA 3I6RA 3QZEA 1H7RA 4K7YA 2QCNA 1ME8A 4RXGA 4U4MA 1VLIA 2B7QA 3NYZA 4RJEA 4K8HA 3KRSA 1HO4A 5DLCA 2V9DA 2PCQA 4GUIA 4E2BA 1SO6A 1UBSA 4WY0B 3SECA 1TJRA 4XTIA 2A85A 3L67A 3QJAA 2P1FA 2CWNA 1LDCA 2H90A 2QJHA 1KFCA 4AHOA 3OEXA 4ORMA 1DQWA 4O1DA 4WJEA 4MKNA 1I2RA 3W71A 1WV2A 4M6PA 3WJWA 4K6AA 5LHEA 3LTPA 1WOBA 3W7PA 1TSIA 1TPWA 5AHFA 1LZOA 3QFEA 1XM3A 3G1XA 1S5WA 2VFDA 1UCWA 1A5BA 3TR2A 2F84A 1N55A 3P84A 2YSWA 3DFTA 5EPDA 4Z0JA 4JD4A 2PE4A 2ZZ3A 5D2VA 1R46A 3L0KA 1IGSA 1GG0A 4MOZA 5LGZA 3GAYA 2CLKA 3T55A 4TU1A 4UTIA 1LBLA 5EL1A 1TREA 5BNKA 5D38A 3MI3A 2PC4A 3LHZA 1EWEA 2E09A 5G2WA 4WX2A 1LRNA 3C2EA 3HG4A 2BTMA 4X2RA 2ISWA 4XKYB 1AMKA 3TAKA 1JQVA 3DFPA 2ZFAA 2XN0A 3FOKA 4I9AA 3M7WA 3GXPA 1W5OA 3STCA 1XI3A 1SO4A 1MZHA 2BLEA 2I14A 2PURA 3NA8A 3BG3A 1GYNA 4Z1DA 3DH7A 2QDHA 1YPIA 1MEIA 4BF9A 3HBLA 2NUWA 3QM3A 2AAMA 3LCHA 3ABSA 5D32A 1JCJA 1NF7A 2ZZ5A 3OVRA 2CZFA 4G1KA 3SI9A 3MYOA 4UTMA 2FPTA 1OF6A 3BVJA 1TPVA 4NX5A 3UD6A 1LOSA 3N2MA 3CEPA 5AHNA 1ONRA 2J6XA 2YFNA 1FDYA 1NF0A 1VHCA 1VLWA 1ZENA 1LCOA 3TW6A 4NUWA 4YLWA 3W1UA 4POCA 2J24A 3M5VA 3V75A 3GLCA 3RFAA 3UYCA 4Y8FA 3UZ5A 1WA3A 2NX3A 4LY8A 4WXYA 4FO4A 1B9BA 2H3BA 4NZFA 4X22A 1KV5A 4WUIA 1QOPA 3C61A 5EY5A 5U7SA 3KVJA 3A21A 1EX5A 4JTFA 2BZNA 2WV8A 2Q3RA 2YW3A 3G1DA 3I65A 3G0XA 3OIXA 4MZ8A 3OG3A 4CLMA 5KINA 1OYBA 3FJLA 2CLLA 4NJJA 1IF2A 4QNWA 4JTUA 3SIZA 1AL8A 1FWWA 4MYAA 2V30A 5FEXA 3BO9A 1HUVA 4PL2A 4KFNA 3R13A 1OFDA 3Q94A 4LTSA 1BWLA 5FF4A 3UY7A 2GOUA 1FWRA 4LS0A 3W1NA 2WNZA 3STFA 3VI2A 4UTUA 5U4NA 5LZLA 4Y96A 2GJLA 2ZRVA 3G1FA 1M6JA 2X16A 1P0KA 3GYEA 4RXFA 4ORIA 4UMAA 2CLEA 2V0TA 4Y9AA 4FXRA 1W3TA 3NQEA 3WFAA 4JTLA 2DZTA 2BX7A 4JTEA 1VRDA 3E12A 1TV8A 4MVAA 1J4EA 3CIWA 3I7QA 3QMRA 4HPXA 5D09A 4N9CA 1WYIA 5G4EA 2B7NA 4ONVA 6TIMA 3EXSA 4CNPA 5HQEA 4M7TA 1Z42A 1SR9A 1KBJA 4ZMGA 1LORA 1ME9A 1YYAA 4GXMA 1R2RA 1YTKA 2V2CA 5AC7A 1PV8A 1FWTA 5EYWA 3M5XA 5G5IA 3W84A 1AW2A 3BG5A 4S2CA 5H2ZA 2CLMA 4NJHA 2ZA1A 3KHJA 3W2NA 1JCLA 1KFJA 1VGAA 1PCWA 3TSMA 3W2MA 3BW4A 1TPC1 4A29A 3MP3A 3LERA 3SY5A 2HS8A 4I7VA 3TAOA 1GVSA 4EIVA 4HSNA 4YL2A 4ZVJA 2TYSA 4S2BA 3DHDA 4FHAA 4RZ5A 3UY8A 1OFRA 3ATZA 2Q3OA 1FY6A 1QCWA 2FB3A 3DAQA 2E6FA 2RDUA 2H3DA 4IJBA 3EX2A 5C2XA 2RFGA 1VR6A 3GDRA 3B4UA 1Z41A 2WNNA 3DFOA 1OX4B 5CSRA 4IMFA 1C29A 1WBJA 1LOQA 1G4PA 4K39A 3E96A 4FNPA 1M5WA 2RHGA 3PWAA 4O11A 5G1YA 2GJNA 5C54A 1GYLA 2B0MA 3MI6A 5E0KA 5CZTA 1G67A 3EWBX 1KFLA 2ZA2A 3MUXA 1WX0A 1RD5A 4JN6A 3EX4A 3DI1A 1W56A 1V7YA 1JRBA 4FX6M 1QOQA 2YDAA 1KM6A 4MFDA 5C5YA 3LM7A 1XXXA 3KXQA 1XFBA 1TCDA 3SW6A 1FX6A 4FX7A 3T4CA 1RZMA 4UUIA 1KM1A 1OFOA 2X1UA 4AH7A 4WY0F 2VXNA 1KFBA 1TPDA 3MW7A 2D73A 1C8VA 1RQBA 1JCYA 1D3HA 2W79A 3S0CA 1OABA 3H54A 4RX0A 1FBAA 3I7SA 3O1NA 2Q8LA 1QNVA 4NX0A 3W7RA 1THFD 4Q32A 5BRBA 5HJLA 1G7VA 4WD0A 3W6YA 2GVLA 1JUEA 5GVJA 3PUOA 5CPNA 1JVNA 5D2WA 4O16A 1GTHA 2NXHA 3KVKA 2B7PA 3MBDA 1A5CA 5I3JA 3HMJG 4O52A 3I7RA 1VQTA 4KFOA 5F4XA 4OE7A 1KFEA 3H53A 3KOFA 2BWGA 3C0JA 2XFWA 3N14A 4AEOA 3OA3A 4NNBA 4JS3A 4O0KA 2ZDRA 3C2VA 1DJNA 3SJ3A 4M5PA 4ALDA 1Q6RA 1K8XA 4LVBA 1F76A 4XZ9A 3M43A 3MBFA 2XN1A 3JRKA 3RLUA 1UB3A 2DZUA 2QJGA 3G3MA 5J5DA 2V81A 1F2JA 4JTSA 1YPFA 1LYXA 3LLDA 5AOUA 5AHIA 3LCIA 1OFBA 3VE9A 4UFHA 4JGDA 1NAL1 1DKWA 3NG3A 4S1FA 2WO5A 5I3HA 1L6SA 4WY0A 5LGXA 2WSYA 2B4GA 2J9ZA 3Q58A 1B4KA 3S42A 3W7HA 1I2QA 3W2JA 4BWLC 2QCGA 5F2MA 4B5NA 2G95A 3DZ1A 4R7JA 2QAPA 2OT1A 3W9ZA 2VEMA 4CCEA 2A7PA 3TXZA 1EUAA 2QR6A 5FF2A 5D37A 5LNWA 4N4PA 3DXIA 3KRUA 2CLFA 4IUOA 3LBMA 1UUMA 3S1XA 1OJXA 1SFLA 2HS6A 5AHMA 2R94A 4RK8A 1SO3A 2I1OA 4PTNA 3W1XA 5D02A 2Y7DA 3G24A 1X8FA 5FEZA 5BMWA 1IIHA 3GK0A 3P82A 2AQWA 5FEWA 5HULA 3FIGA 1KFKA 2Z0IA 3JR2A 3O16A 2QUTA 2NWSA 1RQEA 4FIQA 2JGYA 3BARA 1EUNA 2ABBA 4AWSA 2CFFA 3K30A 3HPZA 2Y88A 4OHQA 5I3FA 4ADSA 1XDLA 1QWGA 1LRQA 4WZHA 4ZQNA 5KZMA 2FB2A 2V5LA 4XKYA 3IIOA 3LBCA 1PL9A 3FYOA 4NT0A 4NVTA 2F7FA 3PB2A 4GWEA 1KW1A 3GXNA 2QUUA 3PC0A 1DHPA 1VCGA 2OCZA 3TXVA 1VH7A 4DBEA 2Y61A 3C2RA 1WXJA 1YTDA 1TTPA 1QFEA 3W23A 2Z6IA 3C56A 4UMCA 1J2WA 3FYPA 5DY2A 1TJPA 4UIOA 3W2UA 1TPH1 4MUZA 3TU9A 4XBKA 3TDFA 1P0NA 3QEZA 3QYQA 4MY8A 4EF9A 3LRKA 1AW1A 2NUYA 1JULA 3RLVA 2H8XA 4UCGA 3G0UA 3V1PA 4LNYA 4A3UA 3GXTA 4O18A 1TO3A 4NJGA 2ZYFA 4WXZA 4K37A 1MSSA 1EEPA 4LC8A 3P5ZA 4Z1AA 1OFPA 1T99A 3W3OA 2E1DA 3HO8A 1A5SA 1EPXA 5TIMA 3BW2A 3MP5A 3NM3A 3NQ7A 5AHEA 2ISSA 2H8ZA 1SZNA 3CU2A 1AG1O 1AW5A 1KM0A 2QKFA 4AXKA 2DZSA 3TIMA 3N9SA 3PUEA 2CZDA 3S6DA 1T8XA 4L4MA 3M47A 1VPXA 4WOQA 2QJIA 3WJXA 1GT8A 4OGZA 2I9EA 2VEPA 3TSDA 3UWQA 3S5NA 1I4NA 1FUYA 1G6CA 3W7LA 3W7JA 3BLIA 3LXAA 2FIQA 3B0UX 1I8JA 3DFNA 1HTIA 1ICSA 2DORA 5DBUA 4LS1A 3GR7A 2DZWA 1VJIA 2OJPA 4UFJA 3NQAA 3ZS4A 1XCFA 3HB9A 1HFBA 4NZJA 4JTIA 3WJYA 3ATYA 2E6DA 4O15A 1H1YA 4QIUA 4N2YA 2E5DA 2ABAA 4PC8A 5A5WA 5F4WA 3L5MA 4AWUA 4IPIA 4LC6A 1KTNA 1I2NA 3WK3A 4PH6A 4LV9A 3L65A 3DU0A 3N9RA 3W70A 5C55A 4M6QA 1XL9A 5D2TA 3SZ8A 3QQ0A 1NSJA 5CGQA 3UWYA 3W2KA 1EB3A 4OU1A 4BI7A 3BW3A 2VKZG 5F4SA 1UASA 5HWMA 6ALDA 1Z44A 3M5YA 3D0CA 2VFEA 3H55A 1I45A 5HR6A 3USBA 1G7UA 1QPRA 3NNTA 2O7SA 2QCFA 3BLEA 4OQVA 1HG3A 4UFIA 3KVLA 1W8SA 1TRIA 5AC8A 5BOOA 2QF7A 3CWOX 5AB3A 3QC3A 4FNTA 2VFHA 1R2TA 3ELFA 4N6FA 4R33A 5FI8A 1X1OA 3HF3A 4CQAA 1H61A 3NVTA 4E38A 4K36A 1KM4A 2YFOA 3LDVA 5D30A 3NQCA 1S5VA 3GNNA 3R8RA 1I2OA 1O94A 2ATMA 5K9XA 4HNUA 1VYSX 3UPBA 5LNRA 3UWZA 2NXGA 4GUGA 3O6YX 4JDBA 1OX4A 4RV8A 2RDTA 3EWYA 3KFTA 1ZHAA 4MIMA 3C2OA 4QSHA 4IGHA 3TMQA 3W7DA 5D2XA 5ABTA 4KWVA 4O17A 2A7RA 3IRDA 1LBFA 3MWAA 5KMYA 1TTIA 2ZZ6A 2P0OA 3F4WA 4R34A 2C3ZA 3T44A 1KV8A 4JIPA 1G4TA 1RV8A 2VELA 3HOJA 2NX1A 5CG7A 1T96A 3R12A 2J9YA 2A6LA 2ISVA 3S8HA 3CWNA 1GTEA 4MJMA 4UFMA 2ZRZA 3W1RA 3W83A 3VCRA 1DBTA 4O12A 1SZFA 1L2UA 4LVGA 1Q45A 3MMTA 1TMHA 3NQMA 1OFQA 3RK8A 4UNLA 4JTKA 5FF7A 3NPWA 5K7JA 3LOTA 1B3OA 3W7OA 3FJ6A 1K8ZA 2A1YA 3GAKA 4UTWA 2CZ5A 4M7SA 1V5XA 2NV1A 3I68A 3SSJA 3R2GA 1W3IA 3VFLA 1DL3A 1W37A 1CW2A 1XUZA 3HGSA 4HPJA 3HGRA 4Z1BA 3NPVA 3PAJA 3THQA 3L66A 3BK0A 3P62A 2DZXA 4UXDA 1I2PA 3YPIA 3E02A 1XBVA 1F5ZA 3U2OA 1JCMP 2P10A 1TIMA 2VFGA 2Y89A 3LTYA 4UC5A 3WJSA 3EX6A 3NZRA 2G97A 1F05A 2YZRA 2V82A 3W1QA 1ZAHA 2DU2A 3NAVA 3QW4B 4O8RA 1G4EA 3QF0A 3TMLA 3W87A 1TPFA 4DF1A 1ZY9A 1MEWA 2JKAA 2ZZ2A 2FDSA 3TUUA 5G2HA 4IMCA 3R5EA 4ZQPA 3NO5A 5IBXA 1EWDA 4O13A 1KTCA 2C16A 4FXSA 1IXNA 3P8IA 2GUUA 2ZRYA 3DGRA 4M6VA 3GDTA 3O6CA 4DBDA 1YADA 4XQ6A 4IWWA 2Z6JA 1K8YA 3TC6A 3TQKA 4ZQCA 4FX8A 1EA0A 2QCHA 1ZFJA 4DPPA 1IXOA 2QUVA 5HUOA 1TPB1 5K4ZA 4O57A 2C6QA 1ZAJA 1TQJA 2QCEA 4GUHA 4JY8A 1TTQA 3EX3A 1OK6A 2G96A 2NX9A 4PEKA 3LCLA 3O63A 4HNVA 1TPEA 2NXIA 1X7FA 3G1AA 4A2RA 1H60A 3PS7A 5K9DA 3IIVA 3OHIA 4O28A 7TIMA 1GZGA 3M1ZA 1Q6OA 5FEPA 5MHBA 4NU7A 1O5KA 1R47A 1XKYA 4MY9A 3B05A 3CC1A 4CCDA 1MXSA 3B0VC 2DZPA 1FCBA 1DQXA 2FFCA 2YR1A 1QPNA 1XC4A 3W88A 3GNDA 4JTTA 2VFIA 1BKSA 1ZAIA 2Z1BA 3EWXA 3NQDA 3LXCA 3F4NA 3GZ3A 3CM4A 3L68A 4O4WA 1NVMA 2WQPA 1AK5A 3P5YA 1OFAA 1EIXA 1OFEA 4ZZ9A 2TPSA 4P2VA 4PFMA 3IVSA 5J5RA 2Y7EA 1WQ5A 1W5MA 4IX2A 4X3ZA 3THAA 1R30A 1CI1A 5CZ0A 3QPYA 3QRHA 4JXCA 3DI0A 1GG1A 3IGSA 4BFAA 3O15A 1WOAA 3EKZA 2W0UA 5CKSA 4H4IA 3TA6A 3UXDA 1A50A 1J5TA 1TV7A 5LNSA 5K3VA 3O05A 3BV4A 3LX9A 2OT0A 4GFSA 3HPSA 2TMDA 3B04A 3NQFA 3W75A 1C9DA 4JTHA 2O7QA 5LNVA 1FWSA 4GE8A 1H7OA 3W07A 2R8WA 4Z08A 3UWUA 3EWZA 3IIXA 3M6YA 3QSTA 1JR1A 2QDGA 4JX4A 2B7OA 4YCPA 2C0AA 2J27A 5KSWA 3L0GA 5KTLA 2X1TA 5EMUA 3QQ1A 4MZYA 4KFPA 4K7VA 1O60A 4MFEA 2X1RA 3CHVA 3EWUA 3O8AA 3PVFA 3TX9A 4Q33A 1HL2A 4A22A 1ZALA 1H7NA 1VYRA 2X1SA 1QR7A 3RF9A 5KITA 2HTMA 4HN4A 2YGYA 2VEKA 2QAFA 4JTJA 5LSMA 2JBMA 4GJ1A 2WPBA 2QCCA 3KRZA 5D05A 1S3HA 3NQ2A 5AYZA 3IIZA 1YXDA 2EGZA 3EX1A 4LUIA 5SWUA 1RR2A 4E0CA 2KZHA 1EP1A 4ZQMA 1BEUA 4PL1A 3UNDA 3NL3A 1K7EA 5TBOA 3STEA 3S5OA 2CZEA 5CPLA 3LTSA 5F1UA 1PHWA 2A21A 3TQVA 5LKYA 3MHGA 3G1SA 5LNUA 4HNTA 1FQ0A 1XUUA 2WSQA 3LI0A 3C8FA 2GQ8A 2EPHA 1SW3A 3PBUA 1FCUA 5AYXA 5E1QA 4CNOA 3TSBA 1CX9A 5D2YA 2YYTA 4O1AA 3KVMA 3STGA 3MHUA 5DCEA 3SGZA 3BG9A 5HR7A 2A5HA 3SR7A 1D9EA 3A24A 3W7IA 4U28A 1KTBA 3UWVA 2QCMA 4JDYA 5DXYA 4CQ9A 3DKJA 3CPRA 1SZGA 2GQ9A 2E6YA 1RPXA 1GOXA 3G8RA 2CLHA 1H62A 4NNAA 1OG0A 1KM3A 3PBYA 5F1VA 2CW6A 1QMLA 5LHFA 5AHLA 2QCLA 3TROA 3CTLA 4M19A 2QEZA 3LCGA 4JX5A 1H63A 3BGJA 4LVDA 3EEGA 3E0IA 5HUPA 4NNCA 1SUXA 5TQLA 3N2XA 3M41A 4AF0B 1SW7A 4UTWC 4YCOA 3TJLA 3DBPA 4ADTA 4O4VA 3AJXA 4IPJA 3LRMA 1IXQA 3G22A 3MHFA 4UTJA 4FEZA 3GKFA 5DN1A 4LRTA 3W1LA 3QMTA 1YDVA 4JICA 4LRSA 4W9TA 1U83A 1IXPA 4LS2A 5DXXA 3NPXA 3WK1A 2GVGA 3DHFA 3LCWA 3HQ1A 4I7WA 4E2DA 1TYGA 4P61A 3W7CA 1VCVA 1QPOA 2NLIA 4BI6A 1PCKA 3W7MA 1M7PA 1FDJA 3A5VA 5DBTA 2OZ0A 5DCDA 3QW3A 3PULA 4O1BA 5D33A 1O5XA 4FIRA 3C2FA 3LB0A 4H6KA 2ALDA 1JRCA 2YXGA 4AHQA 4YWIA 3ABRA 1N8FA 3A22A 3TJXA 2ZZ1A 1Q3NA 3F1QA 3PB0A 3W1MA 3HGOA 3GKAA 3G8EA 1FCVA 5IBXC 2YX0A 1JCNA 4BI5A 2ZQ0A 3C52A 1LBMA 1F6KA 2TSYA 4TO8A 5H91A 3B0PA 1L9WA 1RVGA 2QCDB 3VE7A 2EAWA 2JKEA 1XBYA 3W7QA 1H51A 1DOSA 1PIIA 4JYDA 4Z0SA 1AL7A 3M44A 4FB7A 1LROA 1YXCA 2C18A 1VCFA 1H7WA 4QJ1A 5KZEA 4QM1A 5CPMA 2RDWA 4MZ1A 2J9XA 4UTLA 3LV6A 3S1UA 1SFJA 2VEIA 2A0NA 3HIJA 3NQ8A 1G4SA 3DFQA 1TPUA 2XN2A 2NWRA 4XWUA 2AGKA 3OBKA 2GVJA 3IIPA 1LLWA 3L9CA 4QNEA 5G1TA 1YTEA 2FPVA 4NQ1A 2HMCA 2X2GA 3G0SA 3NPUA 1SZEA 1SO5A 4O14A 5BW6A 4AAJA 3PG9A 1A53A 1LRTA 2FPYA 4FF7A 2ZRWA 4TR9A 4CQ8A 3QPZA 1KA9F 4MPQA 3NQGA 2NZLA 3HJZA 1W5PA 3CT7A 1W3NA 2JK2A 4UTKA 4L4LA 1LM1A 3MO7A 2Q8ZA 1KM2A 3IVTA 2YPIA 3IV3A 4YXGA 1ADOA 3GDMA 3LCXA 1DJQA 3G1YA 3LCFA 1FCQA 1OYCA 3JS3A 3LV5A 4JEQA 1D3GA 3UWWA 1H7PA 4A2SA 1XBXA 3CLMA 1SPQA 3NR0A 3M16A 3NQ6A 1WDWA 3T40A 2YW4A 1NEYA 4R53A 4IQLA 1QPQA 3BLFA 4O50A 4DF2A 1LOLA 3AO0A 3TQ0A 1TB3A 1OYAA 4JY9A 4WQ6A 1W31A 1B57A 4NXSA 4JIQA 3ANYA 5I3IA 1PHQA 1SSDA 3FFSA 4FNQA 2JGQA 1L6YA 1HO1A 1VS1A 3IVUA 3QMSA 1A5AA 2JKPA 2OX1A 4LW7A 1PE1A 2ZRUA 3DFSA 4NJKA 3W7KA 3NL2A 4IOTA 4UR7A 3TCEA 4UFLA 3W1AA 3ABOA 1KBIA 5HWJA 1TV5A 2E5CA 4UR8A 3W7GA 4BWLA 5BMXA 4YMZA 1K02A 4DO5A 4DPQA 4FNSA 4IMGA 3HPXA 4RR4A 5C6MA 3U8GA 4KKXA 1OHLA 3HGJA 3NOEA 4PA8A 4RCXA 5AN7A 4LOCA 3BGGA 1VYPX 5AYYA 1S5TA 5EA9A 2DJLA 4ICNA 4OWGA 5IM51 2Z2UA 3NM1A 2VENA 2CU0A 4BR1A 3M0ZA 5FF3A 2NUXA 4N02A 5CZJA 4FNRA 5G4WA 3W86A 5K9CA 1LLZA 1SW0A 4JTGA 3L21A 1GVRA 3ZWTA 4OV4A 4NXKA 2VOMA 3UPWA 3NXFA 1F73A 3LHVA 3NGJA 4ZL1A 1DORA 5F2IA 3UZJA 3PUDA 4LWWA 5EKYA 1PS9A 5I3GA 2ZCGA 5AFDA 8TIMA 4JYEA 3CEUA 3WK2A 2GPTA 1KM5A 4TMBA 3SGUA 1O95A 5DELA 1H7XA 2ZZ4A 4ML9A 4N9BA 1Q6LA 4DF0A 3P60A 1VZWA 1FXPA 3NL5A 2BXVA 4AVFA 3WK0A 3GB6A 3TE9A 1L6WA 3C6CA 4XTDA 4LUJA 4MYXA 2YCEA 1JCXA 3MYPA 5F2LA 1K7XA 2C19A 1OX5A 1GWJA 3ZR4A 3FKKA 1JJKA 2GQAA 4TIMA 1H5YA 1H1ZA 3N34A 2NV2A 3S1WA 2W6RA 3L2IA 4OV9A 3ZFHA 4H3DA 2PRHA 3CB8A 3GX9A 3GVGA 3IEBA 1XBZA 3P81A 1R2SA 4J9JA 2PRLA 4K38A 3Q37A 3G18A 2YYUA 3O07A 1GJPA 2V2HA 1K03A 3TKFA 4CNNA 4O19A 2E6AA 1VHNA 1QAPA 1F74A 1GEQA 2FQIA 1WBHA 3A9IA 3FKRA 3DENA 3RU6A 3EB2A 3S9YA 3L5AA 3L5LA 1G69A 3TC7A 3FLUA 4QQ3A 5G2IA 3GDLA 1O4UA 4NJIA 1UJPA 3LRLA 3W85A 1Z48A 3F03K 4BK9A 5K2ZA 5T26A 3PR2A 5CZSA
chains in the Genus database with same CATH superfamily
3ARWA 4HHPA 3EPMA 5CJNA 1GHRA 4GO8A 2PD9A 3TCSA 3TWAA 3T8QA 4QE4A 3APGA 1TTJA 1C7TA 3E38A 3DKLA 1VB9A 2PDMA 3LBOA 2CITA 4V27A 1XDMA 1QBAA 1POKA 4HZ6A 3TYAA 3NEVA 3O9NA 3HG3A 3U2EA 2QZRA 5I02A 3EAUA 3IS4A 1GVOA 4HIBA 1J0YA 2ZTKA 3HN3A 5D8ZA 1F3TA 5CGTA 3EDJA 4LV4A 2EF9A 4E5TA 4GUFA 4AF0A 2V5KA 1N7KA 1QO2A 3MI2A 1A5UA 3KAOA 3GVRA 5HMFA 4XZNX 1K9FA 3WY1A 5JIPA 4Y9MA 3QY6A 4QLLA 1HP5A 3M5ZA 1KXHA 3CAQA 3W72A 3GHTA 1P4CA 2C14A 3W74A 1A4LA 4DQWA 2A7NA 2IQ0A 3LUTA 4WOZA 4D6CA 3C3NA 2GGEA 1BQGA 2DY3A 1FWNA 4IIFA 4JYFA 3UYIA 3M07A 4HNCA 1K7FA 3P67A 4WGHA 1DTNA 1EBHA 1NOFA 4KMQA 4LAOA 2XTKA 3PY2A 3O06A 3UQNA 3VKKA 3CQ0A 4DJDA 4I90A 3W7NA 2FH6A 2WJDA 3NZ1A 1RJRA 1YMYA 4TUFA 5L6UA 3MJMA 3S5ZA 1XIMA 4UFKA 1V6TA 1BXBA 3KBWA 3ALFA 3DFHA 3CUZA 3I6TA 3EWWA 1IIGA 1OZQA 3ITXA 2BSLA 2WSRA 1MDLA 4XUGA 1ONXA 1S3TC 1VFUA 3OVPA 1EP3A 4L1XA 1XHGA 3N11A 1FVPA 1VFTA 3PBWA 3NSXA 5EMYA 2C13A 1OCJA 1BYBA 4MWAD 1GVFA 2AKMA 3R58A 3S1VA 4ZSUA 1B3VA 7TAAA 1TUXA 1W0MA 5D04C 3B03A 3VKJA 2JIEA 4MAZA 1WE5A 1H0IA 1MEHA 2VFFA 3E49A 4NASA 4YS1A 2FLIA 4HSOA 4J3SA 4O0ZA 1D3CA 1S2VA 3PSWA 3BCFA 1U5JA 2DIJA 4PTVA 1XG3A 3N15A 4S3GA 3WF3A 3OGVA 1MYRA 1WAUA 4F0KA 1FDZA 5JH2A 3IARA 3B8DA 3SQLA 3R89A 2Y70A 5DY3A 1LWHA 4LSBA 1ZNNA 4YHEA 3NZPA 4EF8A 1RUSA 1ZGDA 4IIEA 1M3UA 3B97A 1S46A 3KLKA 3QR0A 3T6CA 3WBWA 2CHOA 3NQVA 5T26A 2E77A 1VRXA 3ITOA 4HYRA 4AB4A 4ZQOA 1PVNA 4LUYA 4KESA 3DHUA 4MLRA 4XZBA 4YU1A 3IGHX 4N9DA 2PB1A 1GNXA 3PNUA 1JPHA 1BXCA 5BXPA 3JUGA 1VBUA 3IJ9A 1JUKA 4LU0A 3TOPA 1O7AA 5FESA 4D6GA 5CC7A 4GIEA 4JR5A 1CENA 3BLLA 3VINA 2H6RA 2R14A 3Q2DA 4K8GA 1C92A 3UR2A 3LGEA 2YLAA 3I4EA 4I5RA 3B8SA 2WCAA 1CPUA 1E51A 1XLGA 2EHHA 3M9YA 1E43A 5H1WA 2FHFA 3PNZA 3SJNA 1ZJBA 2Q02A 1UD3A 4MY1A 2BGSA 3LHYA 2GVEA 3WO8A 1SU5A 1XIJA 4DO6A 3WLSA 3PSVA 3CJPA 5E09A 1SSGA 4DYJA 3UETA 4YVVA 3W4RA 5DRCA 1V0LA 1TJ2A 1EXPA 4A21A 2XU2A 2HJPA 4UMBA 4N4QA 4O53A 1UH2A 4I7UA 4QG6A 1P6CA 1X1ZA 2PLCA 1T0OA 4PMUA 3NDOA 7A3HA 3I6RA 3MO4A 3QZEA 8RUCA 5C9UA 8A3HA 2VDGA 5CC5A 1Z9AA 3FSTA 1DJGA 1VLIA 5LIXX 2D3NA 4K8HA 3SUUA 2OWXA 3KRSA 1HO4A 2PCQA 1E6NA 3L4WA 2F9RA 4WY0B 2QIIA 3K1DA 4PRWA 3L2MA 3L67A 3QJAA 4AISA 2H90A 4PMRA 2QJHA 1TE6A 4NL1A 3OEXA 3VIPA 3B40A 4D6HA 4ZXLA 4REQB 3WJWA 1TMLA 1TSIA 1TPWA 1EHNA 4L6OA 1S5WA 2FZDA 2YOCA 4GGHA 5EPDA 4Z0JA 4LAMA 4JD4A 1FWHC 3S83A 2ZZ3A 5D2VA 3JU2A 3REQA 3W38A 3PAOA 4D6DA 3SQMA 1BYDA 3HQNA 3G77A 1LBLA 3FDGA 5EL1A 1DJXA 3EMZA 3GBEA 2INFA 3MI3A 2PC4A 4EWJA 4IPNB 3MUAA 1LRNA 3C2EA 3HG4A 4X2RA 2ISWA 3S1GA 3CUIA 1H11A 1AMKA 4JKKA 2ZFAA 4PBEA 2XN0A 3FOKA 1O68A 1SVDA 2BLEA 3BQ6A 4GYFA 4GJIA 4H9XA 3K8KA 2V3DA 4V33A 1UD2A 2PTDA 4Z1DA 1IGWA 5ABHA 4AU0A 2NUWA 2AAMA 2PC8A 4PUMA 2ZZ5A 2CZFA 3SI9A 2QV5A 2AMXA 4K1WA 3MYOA 1I0BA 3HFTA 3BVJA 2DUAA 3N2MA 5AHNA 1ONRA 1FDYA 1VHCA 4B5SA 3EA2A 3K4WA 3BAWA 1LCOA 3TW6A 1OD8A 3R1ZA 4YVXA 1XGDA 4POCA 3MSDA 5GJMA 3WDJA 3M5VA 3GU9A 2E8YA 3UZ5A 4E4UA 2I56A 3UU0A 3FCPA 2H3BA 4H8NA 4X22A 1KV5A 4WUIA 4AX7A 3GWQA 4L56A 1CDGA 3CH9A 4J2PA 5HANA 5A6BD 2BZNA 2WNWA 5DF0A 1SFSA 3CB3A 2Q3RA 4FZIA 3I65A 3G0XA 3PZUA 3M6DA 4DO7A 4RDWA 2OR2A 3RRAA 1JDAA 1IF2A 1YIXA 3NSMA 4QS5A 2J7CA 2A79A 2Y5JA 4KFNA 4ZOCA 4LTSA 5M03A 1BWLA 1JCTA 5C8BB 3W1NA 4MNKA 1IWPA 3STFA 1EJ7L 3K1GA 2GJLA 2ZRVA 3VNMA 1PZ1A 1E6XM 1Q2SA 2R6OA 1VJZA 4RXFA 4ORIA 3N04A 1EJUC 1KXTA 2V0TA 3CMGA 3QC0A 2FTWA 1WXYA 1WZAA 3BAIA 1Q63A 1EKOA 4BY3A 5FCZA 1CZ1A 3C0SA 1E4NA 2B31A 1JG9A 3E12A 4HPXA 4AD2A 6TIMA 3EXSA 1MFVA 2AL1A 1ZU8A 2OSWA 1Z42A 1LORA 1ME9A 1XIBA 3KM8A 2Z00A 3NO1A 1YTKA 1FFRA 1ITUA 1PV8A 4R7WA 5EYWA 3UVIA 4IF2A 3FYYA 3W84A 1AW2A 3BG5A 4IQJA 2CLMA 2ZA1A 3VVGA 3SRHA 3VIGA 1JCLA 3DEQA 3TSMA 3CL7A 4A29A 3S4TA 1B31A 3GU1A 2HS8A 4B4HA 1UR8A 4M29A 3CUHA 3CZKA 4Q8QA 4ZVJA 1XGEA 3DHDA 4RZ5A 1OFRA 4GQGA 1QCWA 2PU1A 1VENA 2P76A 5FAJA 2RFGA 3N1AA 2WNNA 5CSRA 1C29A 4NHVA 1G4PA 4GY7A 1Q5MA 1M5WA 4O11A 2GJNA 2B0MA 3H2MA 2NQ5A 3CQJA 1GGOA 4JCMA 1H2JA 3MWCA 3DC0A 2Y5SA 2QVHA 1W56A 1V7YA 3DFYA 3WLQA 1BFNA 4FX6M 2YDAA 5AC5A 5TD4A 1XFBA 3SW6A 1FX6A 2Y8VA 2VCAA 3TTSA 3CASA 4FX7A 4UUIA 4AH7A 2VR5A 4FPSA 1KFBA 1TPDA 3L4VA 5GJPA 3POCA 5T91A 4QEHA 4EAMA 1EJRC 3CZLA 4Q8PA 2NVDA 2BHYA 2W79A 2PTXA 3H54A 4L6DA 1FBAA 2R1KA 2WC7A 3GW3A 4IL0A 3QGKC 2DH2A 2A3AA 4C91A 3M64A 3W6YA 2GVLA 2WMFA 1OC7A 2NXHA 4XZIA 3SUVA 3RUBL 3TNBA 5I3JA 3WQ6A 2AAAA 4AEOA 3KOFA 2BWGA 2ICSA 4JCLA 3COTA 1XQLA 3W25A 3WFLA 3WNLA 2IXUA 1P0EA 2YXOA 1UB3A 1M9HA 4D1IA 3ONBA 4JTSA 2OFJA 1LYXA 5AHIA 3LCIA 3F4CA 2DSKA 3TYEA 4JGDA 1HX0A 2QDDA 3HURA 2WO5A 3ITYA 4L7ZA 3ARTA 4WY0A 1L6GA 2WSYA 2J9ZA 3C5QA 3U57A 2R9RA 2V67A 3W7HA 5F2MA 2G95A 4IP4A 3W9ZA 3WLPA 3GH5A 2A7PA 4HZ8A 4DUXA 2CERA 4REQA 5FF2A 5D37A 3DXIA 3WMBA 2BHZA 1A3XA 3AHXA 1OJXA 3ZZ1A 1KGUA 3BXWA 2EBNA 5DO8A 4MAVA 5M17A 1J01A 1EC8A 5D02A 2D24A 1CT5A 1X8FA 5FEZA 4HNLA 5HJYA 3KBJA 5BMWA 3RCNA 2EJ1A 1VPYA 1JAEA 2XH7A 1JZ5A 2Z0IA 4KCUA 3WNNA 1EL3A 3O16A 3F4VA 2CNCA 2UBPC 2QUTA 4D72A 3AQUA 1RQEA 1Q8JA 4FIQA 4LF1A 3BARA 1EUNA 2ABBA 1ZBVA 1K4HA 1KCXA 5CAKA 1LRQA 3BWWA 4WZHA 2CHRA 3IIOA 3FHQA 4DVOA 4DNHA 2Z1KA 3F2DA 2DFAA 3OLGA 2WWCA 3PC0A 1VCGA 4IT1A 1VH7A 4I5UA 3HPAA 3KLLA 3MA8A 4JPGA 2WMGA 1UMYA 3W23A 1BF6A 2D20A 4GVFA 4UIOA 5DT5A 2VD8A 3LYEA 4MUZA 2X09A 3M0IA 2PDQA 4IL2A 5DMLA 4U31A 4PZVA 1JULA 2YDSA 2BY2A 3RLVA 3SAZA 3V1PA 4A3UA 4IIHA 4P7LA 3OQ8A 3TYZA 4O18A 3EZ4A 3WF4A 3G6LA 2WMKA 1TO3A 2NQ9A 1J79A 2WB5A 5CH9A 2ZYFA 1M03A 4UQ9A 3MMWA 4DIAA 1Y5XA 1O1ZA 2E1DA 5TIMA 3MP5A 3NQ7A 2BDQA 2H8ZA 1XW8A 3E2QA 3JZEA 1SZNA 2DT1A 3LZ3A 4WIWA 1AG1O 1AW5A 1KM0A 3Q65A 3N9SA 3PUEA 4RZBA 1J0KA 1V0KA 1CCWB 3M47A 4WOQA 3FVDA 3AIBA 3TSDA 3UWQA 4P8VA 1GVEA 5E0FA 3W7JA 3LXAA 2FIQA 4Z1YA 4CEUC 1ICSA 1VIWA 3S46A 1VJIA 1FWEC 1XCFA 4J7RA 2P3ZA 3KP0A 1PB0A 1R86A 1CGUA 1H1YA 2PWGA 3E2SA 2WKLA 3PPHA 4JEJA 4IPIA 4LC6A 2GFTA 2ZE0A 4P7NA 1I2NA 1K1DA 3SADA 3BDKA 3ZT5A 1P7TB 2YZ5A 4FSAA 1RBAA 1PIFA 2YDRA 4LV9A 4PH6A 4US5D 3WF2A 3N9RA 2WMIB 1GQIA 1V7AA 2EG8A 1P48A 3UWYA 2IKIA 4OU1A 4NKCA 1VEPA 1UASA 6ALDA 3I3BA 4XG1A 2PDWA 2O9RA 1CLKA 2O7SA 2CCRA 1TRIA 1V3HA 2PTZA 3IRSA 4LYKA 5BOOA 4ZO6A 3V18A 2ACRA 3ZT6A 3UNTA 3NUKA 4AD5A 4D8AA 1XSJA 2VFHA 1UA7A 1ADSA 3WLRA 4KEVA 2XG9A 2DQWA 1ZUAX 3HF3A 3VIOA 7PTDA 3QYSA 3T0AA 4MB4A 1I2OA 1O94A 1IEQA 4FAMA 2CKRA 4V2XA 3U4AA 1DWGM 4P7OA 4ZO7A 3T08A 3VOCA 1G0CA 4GUGA 2BOGX 5FA5A 1R7AA 1JZ4A 3EPNA 2RDTA 1KQYA 2ZE3A 3EWYA 4X60A 3KFTA 4PUDA 4AY7A 2HQAA 1UD6A 3I3EA 3U5UA 5LIYX 3A3WA 4FR6A 4QSHA 4IGHA 4KWVA 1SR0A 3IRDA 3MWAA 3U0HA 3CAWA 1NDVA 4R34A 3AWNA 5I77A 1CLXA 1G4TA 1RV8A 2VELA 3HOJA 4PRRA 3S8HA 4PUJA 1GTEA 1RBOB 2MUCA 4YHGA 3B0YA 1VFMA 3W83A 3RR1A 1SZFA 4G7FA 4LVGA 5C7VA 4KRZA 1OFQA 4ACZB 1E5JA 1R3WA 5FF7A 4PUKA 3B9NA 1Z69A 3LOTA 1B3OA 5K7JA 1JXJA 2JIWA 4ICMA 2DSWA 2VT0A 4QCEA 1UKSA 1LQ0A 2J78A 1W37A 2PGWA 1EH9A 2VGBA 2PP0A 3BK0A 3VDBA 3H24A 4GISA 1Q6CA 3IV8A 2F2KA 1S1RA 4ZB5A 4OBSA 2YDQA 3CL8A 3E02A 3VZYA 4CCZA 3QV7A 2I17A 2CC0A 2Y89A 2X2YA 1AD4A 2YLLA 4QLKA 3NZRA 4G5DA 4US6A 1TR9A 2V82A 3BC9A 2DU2A 1UWSA 2PDLA 3EKGA 1MW2A 4NILA 3QF0A 2PGEA 3KTSA 4LYQA 4H01A 4L1GA 1RP8A 2ZADA 1W6TA 4IMCA 1EEXA 1TX0A 4ZQPA 5IBXA 1E1EA 4Y9OA 2C16A 1IXNA 1O1HA 3P8IA 2GUUA 2ZRYA 4M6VA 2WSKA 3F5KA 3RM9A 4XQ6A 1K8YA 1Q7MA 1X1NA 1TVLA 4JHMA 3M0JA 2IPFA 2FZ8A 4GUHA 1XD0A 2XM2A 3TTEA 3EX3A 2YCKX 1SZRA 1HT6A 3LCLA 3O63A 4ZENA 2YB1A 2P3EA 1BHGA 3AMKA 4WDWA 2BBFA 3W37A 1F3EA 3G1AA 3VABA 2WQDA 1NDWA 2QPXA 4O28A 3M1ZA 1Q6OA 2NQZA 3E5BA 1O5KA 1OCBA 4EXQA 1XKYA 4MY9A 3P2VA 1HKIA 1NY1A 3R4IA 3BSGA 4GIYA 1MXSA 2DZPA 1UBPC 2XSXA 1ECQA 1OG6A 5D9OA 3T2PA 3QV6A 1FWBC 2F6UA 3WUFA 3IUHA 3OU8A 5A3HA 4GK8A 1PBGA 4GI6A 3LQLA 3LXCA 4UWMA 2EPLX 5BOEA 2WPGA 2WQPA 1GK8A 1OFEA 4L61A 3K5XA 3UP8A 3I6EA 1AH0A 3DERA 3HA1A 2VC7A 1L8NA 1AQHA 3NO3A 3Q67A 3KWXA 4CN6A 3DBNA 5J8LA 3OODA 3QRHA 3DI0A 3PJTA 3H2NA 2P50A 2W0UA 3ERPA 4J3UA 1AJ0A 1E0XA 2YCLB 5LNSA 3BV4A 4GFSA 1DJWA 3GG7A 3LU2A 2TMDA 4B2DD 4B5UA 1Y7VA 2R82A 3TQPA 3KW3A 4JTHA 3L12A 2O7QA 5GPRA 5ABFB 5BCAA 3SRFA 3TR9A 4HP5A 4WGXA 3UWUA 3EWZA 3SQSA 4MB3A 2WZIA 4XVDA 5KTLA 1PTDA 1K6WA 1PYFA 4K7VA 3ANVA 2PDYA 2PDXA 2X1RA 3EWUA 4GH3A 3GNRA 3PVFA 4Q33A 5GJNA 4HK5A 3KCJA 1UPPA 3RF9A 3VZZA 5KITA 3BOLA 4HN4A 3H22A 4D1JA 2YBUA 3KCOA 3RN6A 5D05A 1S3HA 3ZLFA 2YKKA 5AYZA 3OIHA 2L5HA 2EGZA 3CZ8A 3K4DA 1Z89A 3UNDA 3NL3A 2V6AA 1P7TA 5CPLA 2IKJA 2QS8A 3VZXA 3TQVA 1NFPA 1E4LA 4JNZA 1TV2A 5LNUA 2JALA 2WMIA 1PZ3A 2BS9A 4Q22A 2Y8UA 2GQ8A 1T5AA 1WUEA 3T81A 1GORA 3NCOA 3D3AA 5AYXA 1CX9A 3S5SA 3STGA 4QE1A 2DT2A 3FAXA 5HNTA 2DIEA 2GJPA 1XLEA 2J77A 4OUIA 4IJCA 1KTBA 4CQ9A 4HN8A 3WH9A 4XD4A 1SZGA 1FH7A 4U2YA 1JDCA 1OY0A 3G8RA 4JQAA 1E9LA 5DQPA 4DJDD 1W1PA 4NAEB 5AHLA 2QCLA 2ISDA 3TROA 3VNLA 4EACA 5FSDC 4LVDA 3LM3A 3E0IA 1DPMA 3LQGA 1ISVA 4L9ZA 4PMVA 2ASHA 5DN1A 2XIOA 4LRTA 1ISXA 3W1LA 4FOUA 3QMTA 2CIPA 3UCDA 1YDVA 4JICA 4MADA 3WLOA 2WBGA 4PMNA 2DT0A 4OOZA 3KS5A 2J8GA 3WK1A 2XISA 3LCWA 3HQOA 1E40A 2PF0A 1FDJA 1PWMA 5DCDA 1NH6A 5EMJA 2OKTA 3NQBA 4AHQA 1V3JA 5IDZA 3DX5A 3NURA 5FJRA 1QNOA 1FCVA 2GSEA 5IBXC 2YX0A 1NWTA 2ZQ0A 1NOUA 4HMNA 1L9WA 4ILSA 1MDRA 2QCDB 3VE7A 1J12A 1X7IA 4GGBA 4NSBA 2V5CA 4H00A 3GXDA 2WJEA 4FB7A 4ACZA 1VCFA 1H7WA 1J96A 4QM1A 1IHIA 4JTRA 2J9XA 3GTFA 3V5OA 4C6QA 4C65A 1S5MA 3H7UA 4Y7EA 4AZ6A 1TPUA 4HMDA 3OBKA 4QNEA 3WLMA 1YTEA 2FPVA 3UJEA 1SO5A 3GUGA 3NZQA 3IUDA 1TMQA 3L7RA 2ZUUA 4C1NB 5ABGA 3PUGA 4LYPA 2ZX6A 3VOFA 4MPQA 3NQGA 4LBUA 3TYUA 2JK2A 4UTKA 4PSRA 3MMDA 5HQLA 1KM2A 5KETA 3IVTA 4H6QA 2OSXA 1XX1A 2DSUA 3QTGA 3V0UA 1F4AA 2P53A 1R3SA 3KOZA 1REQB 3GXMA 2R1PA 4A2SA 1C93A 4R88A 3NR0A 3M16A 5G1MA 2QUMA 1WDWA 1EDQA 4CN4A 1UP0A 4IQLA 1TV4A 2D0GA 3UESA 1FWGC 2CLPA 4JQ3A 4WQ6A 4XAGA 1B57A 3CH0A 5I3IA 1PHQA 2HE5A 1HO1A 3IVUA 1BF2A 3DFSA 5CXPA 4IOTA 3LPFA 3IJDA 4TV6A 3ABOA 3IJ7A 4L9XA 4UR8A 4BWLA 5JVLA 5BMXA 5BXTA 2YA1A 1W9XA 3HPXA 3SCUA 4KKXA 1HN1A 1EJSC 3HGJA 4PA8A 1XIFA 2G3FA 4RCXA 4LOCA 4DUVA 4TVDA 1W1B1 3C0QA 4LEFA 3GQYA 1UOKA 4A3HA 1TJ0A 3ITVA 5EA9A 4YN5A 1H0GA 4OWGA 5IM51 2VTFA 3U2ZA 1RCQA 4XSLA 3QY8A 3M0ZA 5T9CE 4N02A 2XIIA 4C6KA 3W86A 4JTGA 3NVDA 4KQNA 4UB9A 1GVRA 2VO5A 3M0LA 2VCBA 2P0IA 4HOWA 2FTYA 3LHVA 2YCLA 5F2IA 3W6LA 2VWTA 1F8IA 2ZUWA 3VKCA 5EKYA 1TJ1A 3WQCA 2Z4GA 2I5IA 1V0NA 5AFDA 8TIMA 3UCQA 3WK2A 2WVVB 5DELA 3G6MA 2GLKA 3UGRA 5ABFA 4N9BA 2F38A 2XH0A 2PWDA 1VZWA 1P6WA 2BXVA 5I7GA 4S3JA 2X42A 3OGRA 1EQCA 3C6CA 4MYXA 1NM9A 3GO2A 1YNQA 1K7XA 3MC5A 1XDJA 1E55A 1KKRA 7XIMA 3DYOA 1JJKA 2GQAA 1J18A 1H1ZA 1HZYA 3S1WA 1Q6FA 4JHOA 4OV9A 3L2IA 4P5UA 4H3DA 4LGXA 3U7VA 2PDIA 2O9TA 3GTIA 1OB0A 2PRLA 4K38A 4K3ZA 3WNMA 3Q37A 3G18A 3QV9A 3VKAA 4CNNA 4O19A 2FH8A 1F74A 1H4PA 2EXOA 1WBHA 3RU6A 1CXFA 3GE7A 3M0YA 3F2CA 3TC7A 3EMQA 1W9VA 3FLUA 5G2IA 1MXDA 3NDYA 1W17A 2CWXA 3UW6A 4NJIA 1UJPA 3W85A 3T42A 1UG6A 1M01A 2A6NA 3WH7A 2I9UA 3L23A 3HG5A 1SJAA 4O54A 2R91A 1BWKA 1GOOA 2QV4A 3O3RA 1KQZA 1XJBA 2OELA 5BYWA 3G1VA 1J0JA 1A3WA 4GVIA 5EBUA 3WIJA 1PTGA 3BTNA 4NAEA 2BHUA 1ALDA 1ZCCA 3VIMA 3U9IA 5AYBA 1Y0EA 1Q85A 2C71A 2Y7FA 2OYKA 3LSBA 1W91A 1LP6A 3LHUA 4F0SA 3PJXA 1GQNA 1A4MA 2J66A 1OK4A 1FXQA 5CLTA 1VFHA 1R85A 1ZJIA 2D0HA 1IEIA 4RUBA 3OVQA 3E9AA 2G5WA 2PA6A 4H9YA 2XIBA 2UZ9A 4X63A 4H9UA 2QPSA 3S3GA 5BZAA 5L9FA 4RZ4A 4M24A 2EG6A 1UWTA 4U2ZA 2ONEA 1QW8A 3V36A 2XFYA 4MNMA 3UR7A 3UPMA 3ECQA 4K8EA 2PWHA 3EXRA 4HPGA 1CGYA 3N19B 2QCDA 5HK4A 2BFGA 3S2MA 4AHPA 3W2LA 3BJSA 3GDKA 3K13A 1VBHA 3UXAA 4EWND 3P6LA 3B06A 1BTMA 1ONEA 4AWTA 4IMDA 1UHVA 4EVZA 2C1IA 3O6DA 1VAHA 4NRSA 1M65A 3TLLA 1KFWA 4IGSA 3VX0A 1DVJA 3IJLA 1WPCA 1ZB5A 5CZKA 3NL6A 4JIEA 2ATSA 2IPWA 2PGRA 1AFSA 2VDHA 1W1TA 1Q6DA 4E8GA 2ZTJA 3IAQA 3C3UA 5KZDA 3FS2A 4DM1A 3RILA 1FHDA 4L4PA 1YQ2A 3QV8A 3TV8A 4C1NA 2J75A 2V5BA 4PB4A 1AH3A 1EIBA 3UZWA 3LXBA 5C9ZA 3WX7A 1SQ7A 3P74A 2C1HA 1ICPA 4D6IA 4IXHA 3LLXA 3B8VA 1MFUA 4GBUA 5CPOA 2ZX8A 2O55A 2C15A 2Y85A 1I6NA 3F5LA 2R1LA 1REQA 5I06A 5K4XA 4AEEA 1TV3A 1GYMA 3TFXA 4OBTA 4UNKA 3PPFA 1UQZA 4DB7A 3KX6A 1XC6A 3O0FA 1GVQA 2ZX7A 3XINA 3HG2A 3AXMA 4Z1CA 1HP4A 1UR0A 2FFIA 4YVPA 1S2CA 3KS6A 3PF3A 3B8TA 3PG8A 2GOKA 3S6TA 2E68A 1VBRA 1GHSA 3T0TA 3CLWA 3LHWA 1FWFC 3L4YA 4B9ZA 1JUBA 2DSVA 4GYJA 4LT9A 1QTWA 5H8PA 1KLYA 3AUOA 1P5BA 1DIOA 2OX4A 3PTDA 4RE3A 1D2KA 2DJXA 3BAXA 1JQXA 3FEMA 4QITA 5DCBA 1H5VA 5I0DA 3EKLA 4IQEA 4DELA 1WXZA 1T40A 1JFXA 3LLFA 3CL6A 5HXMA 4PCFA 1IT7A 1K3UA 1Q7QA 3IWPA 1F6YA 3OLIA 4N6EA 2DP3A 2XFRA 4RDYA 5A8GA 4QAIA 4AY1A 1GOQA 3BOFA 3WQWA 1F9CA 2XINA 3PM6A 1O12A 3KZSA 4HT3A 2Y6ZA 3OBAA 2XPKA 4CCCA 3WLTA 3FAWA 1AUSL 4YPJA 1W5NA 3LMZA 2WVVA 4GNJA 4Q8NA 1Q6QA 3C4UA 4TOQA 4H1ZA 2QCNA 4U3AA 2B7QA 4MF4A 4PCTA 1Q6EA 5CC6A 1O5RA 3BZJA 1RA0A 5DLCA 3VCCA 1GVYA 1SO6A 4GQBA 3QY7A 3SECA 5BXSA 3II1A 1JIBA 4M82A 2HRWA 4XTIA 2P1FA 4W4QA 1W2PA 1KFCA 1P0BA 4AHOA 4DAIA 1XLIA 4EXBA 5CPQA 1DQWA 4O1DA 2IKGA 3WLLA 3PZ9A 4M6PA 1R6WA 4D9PA 1WOBA 3W7PA 3QR1A 2W92A 4HCLA 3R79A 3QFEA 1UCWA 1XRSA 3TR2A 2F84A 1W1IE 3VNKA 2PBOA 3R10A 1JL8A 4MKSA 1UWAA 1GG0A 3R7MA 4MOZA 5LGZA 3A47A 5JBFA 2W9MA 2X0HA 3R94A 1TREA 4XB3A 5HA7A 3H23A 5XIAA 4TX6A 2PI6A 1FP9A 3FXYA 5KZ6A 1EWEA 2E09A 5G2WA 2RGMA 4HCHA 4C7FA 4LJ3A 2FDMA 1OEPA 3DFPA 4W8LA 2X7VA 1AQMA 3GC2A 4I9AA 5A8PA 1OCQA 1W5OA 3NWRA 1MZHA 1E56A 2PURA 3BG3A 4V1YA 2F8QA 3GY1A 1TWIA 3BSMA 2QDHA 4U10A 1ZTVA 3RCYA 1MEIA 4OECA 4R9OA 3HBLA 2A3CA 3QM3A 5EMLA 5E9XA 3ABSA 5D32A 4KEZA 1JCJA 5D9MA 3MUZ1 4KEUA 4G1KA 4G9PA 2FPTA 1E15A 4NX5A 4IH3A 2H9AB 3CEPA 3KDOA 4ATDA 1HJXA 1VLWA 2GZXA 1ZENA 3PZTA 2E25A 5EGRA 3GTXA 4S39A 3QKEA 1CXLA 3RFAA 1A3HA 2OLHA 3RITA 2ZDSA 3HV9A 3TJ4A 3ZMRA 4W7VA 3CAVA 1QOPA 5U7SA 1M7XA 2ZWZA 4JTFA 3CK5A 3FJNA 1HVQA 2DZAA 4PUEA 1UR4A 5ENLA 3V5FA 3OIXA 1JYVA 3OG3A 4CLMA 1QU4A 1OYBA 4H9TA 3ES8A 2KX9A 1HVXA 1XLKA 3W26A 4QNWA 1JNDA 2VEFA 1AL8A 4MYAA 1S2UA 3BO9A 2ZXDA 3AHTA 3MUY1 4RNIA 4UQDA 3VOIA 2GOUA 2I16A 1ZS2A 3B0XA 1GONA 3VI2A 1N82A 4HOXA 3QVQA 3AZTA 3G1FA 4Z2LA 2X16A 1UWUA 1KR0A 1GJWA 3GYEA 4GNVA 4KWSA 4O0QA 4AQLA 4DJFD 4C6NA 3WQPA 2A3LA 3MTWA 1MNSA 2C91A 4WSJA 3NQEA 1J0ZA 3WFAA 1EX1A 4KCWA 3MZ2A 4UQBA 4MSSA 5D9PA 3SUWA 1WYIA 2B7NA 1E4IA 4ONVA 4YWSA 3VOJA 4CNPA 1EBGA 4M7TA 1KBJA 1QOXA 4ZMGA 1V3IA 3XISA 2WM0A 2DZBA 2OLAA 2V69A 4GINA 3WQ8A 2BGQA 1D8CA 3N2OA 3ITCA 3KHJA 5E0CA 1Z6KA 2OQHA 1GOKA 3MKCA 5IHSA 4Q8VA 1UD5A 5ABEA 3MP3A 3T2OA 4G7EB 1ISYA 4I7VA 3N29A 1BYAA 1SJDA 1GVSA 4A6GA 4CQCA 3QQWA 4S2BA 4R27A 1CGXA 3ATZA 2CBJA 1FY6A 3AU6A 2FB3A 1U30A 4NYYA 2RDUA 3LNPA 3EX2A 3PWGA 4PBGA 4XISA 4DZ5A 3RDKA 1DIDA 1B5TA 3BMWA 1Z41A 2AMGA 3FJ4A 2W61A 4DHGA 3CYVA 3CZJA 4K39A 4WR3A 2RHGA 4QX4A 3PWAA 1UC4A 4PBFA 5C54A 3H2OA 3MI6A 3V0SA 3LSCA 2EG7A 3WLNA 4H83A 1NP2A 3MUXA 4FP1A 4YTRA 5GNXA 4DXKA 2GGGA 4OJYA 3VXGA 4ZTXA 3N6QA 4JQ4A 3THCA 1XYBA 1KM6A 4MFDA 5C5YA 4HU0A 1RZMA 4WY0F 2VXNA 1I75A 3MW7A 1J0HA 3B8WA 2D73A 1C8VA 3MS8A 1JCYA 2I7GA 4S23A 5C0QA 4HJWA 3P93A 2Q8LA 2VHLA 1JYXA 3ZM8A 1QT1A 4NX0A 3W7RA 3MDUA 3NZGA 4Q32A 4DAFA 3WDPP 1GCYA 1BVWA 4WD0A 1JUEA 3C86A 3EGJA 4EPDC 5CPNA 1JVNA 5LYRA 1GTHA 3PHAA 3KVKA 2B7PA 4UCFA 3PPCA 2VGIA 2VD9A 3HMJG 4O52A 3L2LA 1HF6A 4GLEA 4OE7A 1KFEA 1XYCA 2FKPA 3VIHA 3C0JA 2D22A 2QJNA 4O0KA 2ZDRA 1DJNA 3ZIZA 4JBRA 5HQMA 1QHOA 2QXWA 2XN1A 4JIRA 3RLUA 2DZUA 4M1BA 3VA8A 3G3MA 2OEMA 5AOUA 3FA3A 3ZJ8A 1OFBA 3K46A 2FYMA 3VE9A 1UWRA 3ZOAA 1DKWA 5I3HA 5CJMA 4GIRA 4A8RA 4HPHA 3S42A 1I2QA 3W2JA 2QCGA 4QQUA 3DZ1A 4R7JA 2YCJA 4FALA 1C91A 3MV11 3L4UA 4GZ7A 2HVNA 4FS9A 3O2LA 1RLDA 4ZCWA 3VOGA 3TXZA 4TXEA 2QR6A 5CQ1A 3UR5A 5LNWA 3SUTA 4N4PA 4I6VA 4GCXA 3HU7A 1MZRA 2Z2AA 4DLFA 4RK8A 3GZAA 4CQDA 4Q8WA 5EBAA 2Z27A 5M5DA 4H7CA 3W1XA 4F79A 4FI4A 3P82A 3GK0A 1PKLA 2VNCA 3FIGA 1A0CA 2NWSA 4UQAA 2JGYA 5FIPA 2VX4A 4EXAA 1IQ8A 1YHTA 2UY3A 2Y88A 1QWGA 1ZRQA 5KZMA 2VX5A 3FYOA 4NT0A 2Y2WA 1JXKA 1KO0A 2GQ3A 2IUZA 4FR1A 4GWEA 4JFWA 3GXNA 3EDEA 5HATA 1GUVA 2OZ3A 3AYRA 3TXVA 2O0TA 3GVQA 3C2RA 3BURA 1WXJA 2G3JA 5A6JA 1XLCA 4IG2B 4F9JA 2FVLA 4B5VA 4UMCA 1J2WA 4AZIA 3TTQA 5DY2A 2RJHA 3W2UA 3UXIA 3TU9A 3S6OA 4A3YA 1EJVC 1P0NA 3WH6A 4OKDA 2H9AA 4PMDA 4AD4A 3G0UA 2DSZA 4FLSA 1VFSA 2PLKA 1MSSA 1XKJA 2PDGA 4NRRA 1XLFA 5LIWX 1T99A 3W3OA 2V38A 1A5SA 3RG6A 3NM3A 5AHEA 4W8AA 4GQQA 4C5ZA 2ISSA 3CU2A 4GC3A 4XKMA 2QKFA 3TIMA 2BVDA 2CZDA 3S6DA 1VPXA 1GT8A 2Y8KA 4OGZA 2NVCA 1FUYA 3G5EA 1I8JA 3DFNA 1HTIA 2DORA 2E8ZA 4QDWA 4HK7A 1UKTA 3GR7A 2DZWA 3H4XA 1E6RA 1NELA 4P8WA 2OJPA 4JTQA 3UT0A 3ZS4A 1HFBA 4JTIA 4LANA 3WDRA 1E3ZA 3WJYA 3ATYA 4QIUA 4QBXA 3WD3A 4ERAA 2XJ7A 5F4WA 3L5MA 5A5WA 2DDXA 3DECA 3G1RA 1XS2A 3WNOA 4EX4A 3WK3A 3KOYA 1BXNA 3L65A 2OQYA 3DU0A 3CUGA 4ZR8A 3W70A 1DEDA 4W7UA 5C55A 2ZX5A 4M6QA 1XL9A 3SZ8A 4QSFA 4BI7A 3BW3A 3M5YA 3VUPA 3USBA 3GNXA 4OQVA 3KVLA 1W8SA 5RUBA 1RAKA 1MUMA 1NTHA 2R1NA 3CWOX 5AB3A 3QC3A 3RX2A 5DMNA 1M68A 4A3QA 3ELFA 1DXFA 1HJSA 1X1OA 1XYAA 4G7EA 2ZC8A 3WF0A 4ZOAA 4K36A 1KM4A 1XYZA 5D30A 1S5VA 1ZJHA 3PJWA 2ATMA 1CGVA 5K9XA 4HNUA 3UPBA 3XIMA 5DMYA 5LNRA 3HFYA 3KZPA 2NXGA 2GWGA 4JDBA 4RV8A 1H3GA 3R8GA 4Y9PA 1UZ1A 1L0PA 1MUCA 3AIQA 1LL7A 3D6NA 3TMQA 5D2XA 5ABTA 2W67A 1EYWA 2W3ZA 1E0WA 4GX9A 5KMYA 3F4WA 2QGYA 4JIPA 2DUXA 4IGMA 2NX1A 3NEHA 7ODCA 5JBEA 4QGCA 3CWNA 1XH2A 4BF7A 4NZ1A 3LPGA 4RE4A 4Q4RA 4UFMA 2ZRZA 3NGFA 3CMFA 3PZOA 1CTNA 4YTSA 3JW7A 1C8XA 3AICA 2HE8A 4CN1A 4NZCA 4EANA 1K9EA 1P1MA 1Q45A 5JU6A 4C7DA 1TMHA 4J4KA 3RK8A 4JTKA 4Q6JA 3NPWA 1U1UA 5G4HC 2HEJA 2ZXBA 1FWIC 2CZ5A 4JL2A 1V5XA 4PEEA 3BLPX 2HNHA 1IR2A 3R2GA 1W3IA 3ARUA 4HPJA 4FXJA 3BL3A 3NPVA 3L66A 3AMDA 1RHCA 2DZXA 3CZGA 2HZGA 3WQFA 1I2PA 5GQBA 3YPIA 2SFPA 1B3YA 3H8AA 1LL6A 3ZJ6A 2P10A 3QZAA 3CYJA 1TIMA 2J62A 2VFGA 2HNEA 2ISFA 1BQCA 3AS1A 3PP7A 3EX6A 3R0UA 2G97A 1F05A 3W1QA 1ZAHA 1W3LA 5T8GA 5HDRA 4D71A 4QJ5B 1V6WA 4O8RA 4DZAA 2RAGA 4UZUA 4FLRA 1DJIA 1FHUA 3CGTA 1TPFA 1YE4A 1ZY9A 2PD5A 2ZZ2A 3NDZA 5C2GA 4CKQA 3TUUA 5G2HA 3Q4DA 4HU3A 3CPGA 1ISWA 4FXSA 3WQDA 3CO4A 3VGBA 3DGRA 3GDTA 1YADA 3A3XA 3IJQA 5AZ1A 4E6MA 2IQDA 3FV9A 3ZSTA 5MKGB 4LAUA 5I79A 2OG9A 3ORWA 1X98A 2OWCA 1ZFJA 1IXOA 2QUVA 4IQDA 5K4ZA 3ZJKA 1XLMA 1TQJA 1OK6A 3ITLA 2NX9A 3RLGA 1I1WA 4DBUA 4QROA 4D6JA 4JTDA 1TPEA 2NXIA 1X7FA 3FNDA 1EJXC 3RHGA 4J28A 5K9DA 4PYSA 3H4GA 7TIMA 2D69A 1MW0A 4NU7A 3FVMA 1QK2A 2WLZA 5BWFA 3CC1A 3THUA 1QW9A 1BGAA 1BGGA 5EFFA 1QXLA 4IIGA 1OC5A 2HDJA 3MPGA 1XC4A 3T2QA 3BE7A 3W88A 3GNDA 3I3DA 4IG2A 3EWXA 3RAOA 3L68A 4QXIA 1Q6GA 2G3NA 1TFVA 2JEQA 1LQ2A 6PTDA 4DUWA 4ZZ9A 4Y8EA 2CESA 4P2VA 1Y5VA 4PFMA 3GC5A 5J5RA 3NOYA 1W5MA 2GK1B 4X3ZA 1CI1A 3QPYA 3KL5A 1GG1A 3TN5A 1O5QA 3AISA 2XHYA 3U4FA 1YBQB 3R25A 3H2AA 2WMHA 4H4IA 3TA6A 3H2FA 3S2CA 1J5TA 4ROPA 1TV7A 5K3VA 3HPSA 3WBEA 3N18A 1V8EA 1DJHA 1GQKA 3CZEA 3AZRA 3TZNA 5LNVA 1FWSA 1G01A 2XVLA 4RV3A 5JBDA 3IIXA 3M6YA 3QSTA 3TONA 3GSMA 1EGMA 1W9UA 2B7OA 2CEQA 4S3BA 1ENUA 2J27A 1WP6A 1NOWA 4IZGA 5E6YA 2X1TA 4MZYA 4HD5A 2YA2A 1O60A 4MFEA 4DI9A 2BGNE 4NG3A 4A22A 3M0VA 1FKWA 1ZALA 3B3DA 2ZICA 1H7NA 3WLHA 1QR7A 1UUQA 2YGYA 2G0WA 1NP0A 2J74A 4JTJA 4GJ1A 3KRZA 4LY4A 1PJ9A 5ECUA 1YXDA 3EX1A 4DZHA 5SWUA 3BLDA 3M46A 2KZHA 4HA0A 4QRNA 4ZQMA 1BEUA 1K7EA 3LA4A 3LTSA 1G9HA 1JFHA 1KGWA 3VU2A 3B9AA 3BLOA 4GXPA 1XUUA 3LI0A 3C8FA 3VK5A 1FCUA 4CNOA 5E1QA 1X39A 2HISA 3MHUA 3SGZA 3BG9A 5HR7A 1KCKA 1D8WA 3SR7A 2QJJA 1XGZA 4DZIA 3WL1A 3A24A 3E3HA 3UWVA 4JDYA 1QI5A 3CPRA 4MKVA 2GQ9A 2X7WA 1H62A 4NNAA 4A8NA 1OG0A 1W3HA 3DHPA 5F1VA 1QMLA 2VDIA 5LHFA 3ZQ9A 4XD5A 2X0YA 4XD6A 4Z2HA 4YYCA 1H63A 3BGJA 3DC8A 5HUPA 4NNCA 5TQLA 3N2XA 2XZ9A 4TV5A 2E7FA 4W89A 3TYCA 5A6AA 4YCOA 4IPJA 4KF1A 3G22A 1WZLA 3GKFA 3UZYA 1U83A 1IXPA 5DXXA 5LA1A 4UOJA 4C6PA 1SJCA 2A3BA 4RPPA 1PUDA 2WZTA 2GVGA 3DHFA 4E2DA 1NWSA 2HPMA 1TYGA 4P61A 1NQ6A 4WRHA 2NLIA 3W7MA 4W87A 2NSOA 5DBTA 1JZ2A 3H4WA 3PULA 5D33A 4LCRA 4FIRA 3C2FA 3LB0A 3S9IA 3WH5A 3W0KA 1JRCA 3ABRA 1J6PA 4IPLA 2Z29A 1N8FA 3A22A 2XVPA 4YTTA 3F1QA 4HGXA 1JCNA 3QKZA 2TSYA 4TO8A 1UH3A 1OWQA 3B0PA 1MW3A 4XZHA 3A4XA 4EAYA 5I09A 4G56A 4S3CA 1H51A 3UG5A 3G2GA 2J7BA 3GHUA 4R3UA 5BROA 2WVTA 4TVUA 4V15A 1GKPA 4ZGYA 1E1CB 4MZ1A 1E6PA 2QLYA 3UXLA 1XPGA 4UTLA 3VNJA 3VIIA 1C3FA 1DIKA 2Z1VA 4MJ2A 4X0NA 1IT8A 3HIJA 4AEFA 3DFQA 2XN2A 3DN5A 4DRSA 1XD1A 1LLWA 1UP2A 3L9CA 1P6BA 2BVWA 4NQ1A 2HMCA 3G0SA 3WEOA 4C6OA 3NPUA 1TA3B 3IK4A 3PG9A 1OIFA 1A53A 1LRTA 2QQ6A 3CHDA 3TOYA 3AHVA 4AC7C 1TWSA 4JFVA 3QPZA 4CU7A 2W66A 3HJZA 1W5PA 1CEOA 5IDIA 3CAKA 3UF9A 2YPIA 3A12A 1L6FA 1F61A 1ADOA 2VR2A 4I9JA 1PDZA 3LCXA 1DJQA 4JAWA 3FN9A 1OYCA 3JS3A 3CQHA 2OGJA 5KEZA 4JEQA 4KH2A 2QMKA 5MKGA 3POHA 3CBWA 4CVWA 1UPMB 6XIAA 4JFTA 4ERIA 1RY0A 4C6IA 1SPQA 3VGEA 4G6CA 3CWHA 4R53A 1MNZA 1QPQA 2HCVA 3BLFA 4DF2A 1JDEA 1G94A 4GG9A 1TB3A 5GNYA 1OYAA 5A2BA 4JIQA 3ANYA 1W3KA 3FSUA 3FFSA 2PEVA 4GQ0A 1S2WA 3ONCA 1PE1A 2ZRUA 5JIWA 4NJKA 4ZXOA 4JQ1A 1ITCA 3ARQA 4DWDA 3S2NA 4UFLA 1EGZA 1KBIA 5HWJA 2ADAA 5A8OA 2OPJA 2YBTA 3W7GA 5CPTA 4YMZA 1K02A 4DO5A 4FNSA 1WDQA 5C6MA 3U8GA 4JN7A 2AGTA 1OHLA 2WW5A 4AX6A 2D2HA 1VFLA 1VYPX 2PWFA 4AC1X 3TVAA 1J11A 3A4AA 5LIKX 1ECEA 1ELSA 5I2UA 4W86A 4Z17A 2VENA 3ARXA 3CXOA 2NUXA 1E0VA 5CZJA 5G4WA 5EMMA 2GK1A 1F07A 4PMJA 1LLZA 4UQEA 4MUPA 6A3HA 2E28A 3L21A 2OO0A 3RJXA 1BWVA 1YNPA 4GVHA 3P3BA 4WDTA 3AFBA 1YBQA 1NFGA 2VRKA 3NXFA 5XINA 3NGJA 4ZL1A 3WD0A 3PUDA 4LWWA 2G3MA 1F3WA 1PS9A 5I3GA 4F0LA 1E70M 1EJWC 4JN8A 3SGUA 3U5YA 1H7XA 2ZZ4A 5HPOA 4NI8A 4C90A 1Q6LA 3P60A 3NL5A 2E0PA 4AVFA 3GB6A 2EJAA 4F0HA 4LUJA 2J79A 1BKHA 1JCXA 5F2LA 1U22A 1WKYA 3O0KA 2C19A 1OX5A 3ZR4A 1K6AA 2J4GA 4L6HA 3VM5A 1SGJA 1CIUA 3PTKA 4TIMA 2OOGA 5CEWA 3U3HA 4C7GA 4B9YA 2PRHA 1IWBA 1V6UA 3GX9A 3GVGA 3VKDA 1R2SA 4BEUA 4J9JA 5CG0A 3B9EA 2V2HA 2PLJA 1K03A 1AZ2A 3TKFA 2VURA 2X0SA 2Z1SA 3FKRA 4V28A 1Z32X 2E1WA 2PDCA 2BODX 1G69A 3L5LA 4QQ3A 3MT1A 4RNFA 1RVKA 3AAMA 3N17A 4BK9A 5K2ZA 4C1KA 5T9BG 2FZNA 5F7UA 1N8WA 5FL1A 4Y90A 3AMGA 2VGFA 2FHCA 3QSRA 1R5YA 1Y8BA 4B4FA 3SEPA 1C90A 1X6NA 5IOBA 2OMAA 2CLOA 3BV7A 5C7HA 4I5XA 4B5XA 3ZWSA 2GDUA 3OZMA 4N9EA 1YDNA 4UOZA 2V8ZA 3RO6A 2ZZ7A 4M8UA 2C8NA 4Z42C 4GI8A 3EXTA 3KBVA 3EMCA 2Y5EA 3KBNA 1OF8A 3W6MA 1JGMA 3QTPA 1EF3A 3MMUA 1SJBA 1K77A 1WDRA 4LVFA 1UUOA 5HINA 3IAPA 1TVNA 4IIBA 1VP5A 4FXFA 2QUNA 2RH9A 1I9CB 1PWLA 5H6HA 3WFZA 4MPKA 3GBDA 3CNYA 4JIIX 1UR1A 3CTTA 3LPPA 9XIAA 3VC5A 4QJ4B 3AHYA 1JPMA 5CSSA 3W22A 2ZBTA 3ISIX 5F2GA 3QGAC 3NSNA 1RQHA 1JPKA 1V08A 3BPWA 2FZBA 2IQTA 3RX4A 2WKJA 1XCWA 1VPQA 3QH2A 1J93A 4RZ6A 1UH4A 4QP0A 1YLVA 4DBWA 4LNCA 1XCXA 1YDYA 2PRMA 3PBVA 1TWDA 3T05A 2EPMX 4EOUA 3GIPA 3MVIA 3MP4A 4DYKA 1E1CA 3IPWA 1KB3A 3INPA 4QISA 1ONWA 4XZMX 2A2IA 4JX6A 1LTDA 3P61A 2PDHA 3W1PA 3TN3A 2UY4A 1AMYA 1JD9A 1B3XA 1J0IA 3P14A 1DXIA 2WNQA 1M7OA 3D47A 3PBGA 3VD4A 3IGXA 4ZOBA 2E3ZA 3ABQA 1MWOA 1TA3A 1Q65A 2NT0A 4CQBA 2YL5A 1X6LA 2AL2B 4DEFA 1OT2A 5FF0A 2TAAA 4DXVA 4MHBA 2CZVA 3URBA 4HKPA 4S3EA 3A5FA 4OOUA 1V79A 3VNDA 1MQRA 3W76A 4HU8A 3VGGA 1M53A 1ODZA 3RMJA 1ZCOA 1RLCL 3ZSSA 3T0CA 1TQXA 5FD0A 3W7EA 3WJZA 1ZQ5A 2WHJA 2WK2A 1GZJA 2YL9A 3RMEA 4OIFA 3VGDA 2VMFA 5HWNA 3GNOA 2YJQA 2VC6A 2Y7GA 2ZA3A 1UROA 1XWYA 3M0XA 3WSUA 4Q4QA 4IXXA 4US5A 4RKAA 1VFFA 2W91A 4HNOA 2G37A 3OW1A 1UYQA 3G3DA 1RJPA 3ME3A 4EP8C 1PKYA 3W81A 3GG8A 3HPFA 2YIHA 1GZ1A 4XVEA 3D3FA 3PBMA 1WKDA 2JE8A 3BGAA 4O10A 2E5BA 5BRPA 4C1LA 3THDA 4XV0A 2UV8G 4FLOA 1HNYA 1F6PA 2VVSA 4O1CA 1V02A 4H41A 5E93A 1KBLA 3LHTA 2MNRA 3K8LA 1MXGA 1B90A 2W63A 4J3XA 4LVAA 2CBVA 1WUFA 1B3ZA 3EA3A 4W84A 1DWJM 1V3MA 2BVTA 3LG3A 4JNMA 3U48A 2ZVIA 1VEOA 3A23A 1NFBA 1HL9A 3TK7A 4HU4A 5AC4A 3W28A 4GZJA 4GUJA 3S47A 3W1TA 4ICCX 5HNRA 1JZ7A 1W54A 4X9SA 1YDOA 2BXZA 2GVYA 1S38A 1EP2A 2VJXA 1FH9A 4RE0A 1EPVA 4K7YA 3GW0A 4F2BA 5DMMA 4U4MA 4CNTA 3VIKA 3VNZA 2W4XA 4O1FA 1LT7A 2EPNA 1NWUA 1TX2A 4B90A 4C6EA 4GUIA 4E2BA 5CCZA 4PB5A 3MUIA 4IPPA 3W27A 1WZKA 1CXKA 3OQEA 3BMXA 4ORMA 2DQXA 1H09A 4RW5A 4MKNA 1I2RA 1PZ0A 4Q7BA 2NQHA 3W71A 4H6RA 1K8CA 2XUCA 3WL0A 3LTPA 4N0RA 3TN4A 2WCSA 4NYUA 3VOHA 1LZOA 1XM3A 3G1XA 1KGXA 2VFDA 1A5BA 1J6OA 1N55A 2OEJA 3LN3A 5C2CA 3DFTA 7CGTA 5C9XA 2JF6A 1HL8A 1HJWA 1R46A 2WHMA 1IGSA 4PMOA 2NLYA 3GH7A 3GAYA 1NQKA 1GKRA 2CLKA 3D5HA 4UTIA 2YL6A 5BNKA 2POTA 4R85A 1LUCB 1WDSA 4J40A 5D38A 3TN6A 3WUEA 3QLLA 3WD1A 3AIRA 1VF8A 2HV5A 5B7ZA 1V3KA 4F2TA 3WD4A 1JPIA 5CLWA 3FDKA 4LBRA 4XKYB 5FJUA 1JQVA 4GXWA 3R0DA 3GXPA 9RUBA 3STCA 3IJ6A 2I14A 2Z24A 1WZMA 3DH7A 1YPIA 4MB5A 3ES7A 3EWCA 3LCHA 4J3ZA 1T6MA 1R7OA 3EDDA 1QATA 4AVOA 1NF7A 5FOOA 4BS0A 1JYNA 1RCOB 5LIUX 3RGTA 3GFXA 1QI0A 5CBBA 4UTMA 4D8LA 1UKQA 3RPMA 1HW6A 3GHRA 4H19A 1LOSA 1X38A 4S3DA 2J6XA 1NF0A 3SO7A 1MRQA 3GH4A 4L9YA 3MZNA 3SSZA 1OM0A 3SCRA 5B80A 4YLWA 4P8XA 2J24A 4AZ5A 2QNEA 3V75A 3GLCA 3EOOA 3UYCA 2FMOA 1H49A 3O7UA 1B9BA 3C61A 2Y0FA 4DJEA 3A21A 2YB4A 1BPLB 1TZZA 1C8QA 2BG5A 2XWEA 2WV8A 2YW3A 3G1DA 2GGJA 1HKMA 4EK7A 3UBPC 2PF8A 3FJLA 3HZ3A 4QAWA 1BAGA 4NJJA 3W82A 4Z2JA 3HJEA 4MB1A 5FEXA 4PL2A 3HM7A 1OFDA 1XRVA 2REQB 1FH8A 6ENLA 1FWRA 4LS0A 1QWKA 3DGBA 5U4NA 3ABXA 4C5YA 4LX4A 1QI3A 4KT2A 1P0KA 3RXZA 3AOFA 1R9YA 3CHEA 2GYIA 1W9DM 4OVXA 5C71A 1GOWA 4C6JA 3E0VA 8CGTA 4Y9AA 4FXRA 3ARVA 1V02E 1W3TA 4PMQA 2DZTA 4IP7A 3T1GA 2BX7A 2EEXA 2WSPA 4MVAA 3CIWA 3I7QA 1ADDA 1JYWA 2AL2A 5FJJA 5BWAA 3AS2A 3EYPA 4M80A 1RSCA 3ARZA 2IPGA 5H8MA 2PDPA 4WKFA 1FWTA 1S5NA 2XGZA 3M5XA 5H2ZA 1JZ8A 2FMNA 3W2NA 2XSBA 1SM9A 1VGAA 1PCWA 3OGSA 4XAFA 3BW4A 1TPC1 3F2BA 4F66A 3LERA 3SY5A 2WZHA 1DP0A 2G3IA 4AXNA 3EDFA 4FHAA 4MDOA 2PZ0A 4HQVA 1D7FA 1RH9A 4U3CA 4IJBA 1PO9A 5C2XA 1VR6A 3OYZA 4WKAA 3B4UA 3VD3A 4IMFA 1LOQA 4FK9A 3OA5A 3E96A 2FZ9A 4RE2A 2WJFA 5G1YA 5E0KA 5CZTA 1HJQA 1G67A 2ZA2A 3UXKA 1RD5A 2D0FA 3EX4A 3DI1A 1E3XA 4C6LA 1V93A 1XXXA 3KXQA 3IACA 3H70A 5DEZA 3WQVA 4H9VA 4F0RA 4HYWA 2G50A 2OEKA 3L4ZA 1EF2A 4AZCB 3AXKA 2VYOA 2I5QA 4YYFA 3DYPA 2Q6ZA 1OABA 4W5UA 1JEZA 2GUYA 1QNVA 3QLDA 4AYSA 5GNZA 4NIRA 5HJLA 3VD5A 1JZ3A 4IUGA 5GVJA 3Q45A 3BMVA 5D2WA 3CUJA 3TTOA 3MBDA 1A5CA 7ENLA 4YTUA 3I7RA 1VQTA 4KFOA 1KNWA 4TQTA 1XIEA 1YPXA 2XFWA 1P43A 3OA3A 2B81A 3AI0A 4JS3A 3N6JA 3SJ3A 3BJTA 4ALDA 1Q6RA 1V4YA 1K8XA 4QG8A 4GX8A 4XZ9A 1XISA 2QVNA 3CT2A 4Z2IA 2IXVA 3VDAA 4ZE4A 3AS3A 2V81A 1F2JA 1YPFA 3LLDA 2XSAA 1UP3A 3AMLA 4UFHA 1E9IA 4BQ5A 3NG3A 3BSHA 3OZOA 3VFCA 2WZMA 2B4GA 5CBIA 3Q58A 1Y65A 1CWYA 3E0LA 4H7ZA 2OT1A 2ZUNA 2CBUA 3EOEA 1HKWA 3KCLA 1NDYA 1EUAA 2X8RA 1UD4A 2R24A 3UZZA 3KRUA 3AXHA 1UUMA 3S1XA 3VYLA 1QJWA 3AALA 1JI2A 5C70A 2P8CA 1SO3A 4DWSB 3PFMA 3MCOA 2PDKA 2I1OA 1BVNP 2Y7DA 2XGBA 2AQWA 4L64A 5FEWA 5HULA 1XLDA 2XH4A 2G4JA 1LUCA 4DJEC 3VPLA 2CFFA 3K30A 3RX3A 3HPZA 5I3FA 4H2CA 1TZ9A 1XDLA 4ZQNA 2V5LA 2EO7A 4XKYA 1YW1A 3LBCA 4GMEA 4UQCA 1OGSA 4IMAA 4XZWA 2F7FA 4E4FA 1KW1A 2QUUA 4ZTYA 1DHPA 1I1XA 1F8MA 1PAMA 2F2HA 1TTPA 4Q3MA 1A80A 3C8NA 2Z6IA 3C56A 2CPUA 4GZEA 2PWEA 1TPH1 4HPNA 4WSKA 3W53A 2ZXAA 3UJRA 4EF9A 3QEZA 3QYQA 4MY8A