3WJWA

Wild-type orotidine 5'-monophosphate decarboxylase from m. thermoautotrophicus complexed with 6-methyl-ump
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
215
structure length
215
Chain Sequence
b'VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 86
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wjwA00
5CSSA 2ZRVA 1QFEA 1GT8A 1Q6OA 3GXTA 1EEPA 1YADA 1H7XA 4UUIA 5KZMA 4OV9A 5TIMA 1UJPA 2FIQA 1W37A 1H1ZA 1PL9A 2FB2A 1JCXA 1JCMP 1VJIA 2YGYA 1FUYA 3C2FA 4JGDA 2QUUA 3SJ3A 3STCA 5E0KA 1DV7A 5FF4A 3W73A 3N9RA 3O15A 1UCWA 4LVGA 2ZZ6A 5DLCA 3AJXA 1XKYA 3W6YA 2P0OA 3TC7A 3EX3A 3C2VA 3ABOA 4MY1A 3UWYA 1JJKA 5BW6A 1JQXA 3LLFA 4IOTA 4LNYA 5CPNA 4AXKA 1G4PA 1VQTA 4QQ3A 3IIPA 2ABAA 3G18A 4DPQA 3LHYA 4XTIA 4DO5A 1CX9A 2F84A 3E0IA 3HPXA 3A5VA 1ZY9A 3TCEA 3RLVA 2PE4A 3WJXA 4IMGA 1B9BA 3MBFA 5HNRA 3O05A 3IVTA 4RXGA 3W7IA 3GNDA 4I7UA 3R8RA 2EGZA 3HGOA 1TQJA 1S3HA 1JUEA 3W1QA 2I1OA 4H4IA 3HO8A 4IXXA 4O50A 3IVSA 1ZHAA 3BK0A 5FI8A 5LGZA 2CLEA 4L4LA 2GQAA 3LRKA 3M43A 5D2XA 4LV9A 5G1TA 3QM3A 1X1OA 2CZDA 3BARA 3LCIA 3OEXA 5CZSA 1EUAA 3GNNA 4WY0F 3L2IA 3L0GA 3RNDA 3A21A 4AH7A 4N4QA 1LROA 5D2YA 2JGYA 3SI9A 1ME9A 3U6WA 2A1YA 3W7KA 4JDYA 3OBKA 1IXNA 5KTLA 4JTLA 1Z48A 3ZR4A 3RF9A 1OX5A 2W0UA 3AO0A 4RCXA 4XKYA 4FIQA 2Y7DA 2ZZ5A 4ZL1A 2Q8ZA 3CIXA 4PODA 2FQIA 3TQ0A 4XZ9A 1RR2A 2LLEA 3TFCA 1K8XA 5CSRA 2CLOA 1R2RA 1ONRA 3BV4A 3W1LA 2ZRWA 1EA0A 2NX9A 1LM1A 1G67A 3G1SA 3F1QA 4MLJA 1T8XA 3KHJA 5C54A 4PFMA 3TAKA 1G7VA 3TJLA 5F2LA 2V2HA 4GNJA 3KRUA 4GXMA 1R46A 3S5OA 1XI3A 1JCNA 4R7JA 3W1UA 4JYEA 4BWLC 1FCVA 2ZBTA 1IIHA 3O06A 1VHNA 4JYDA 4FIRA 3GDKA 2C13A 3PC0A 3G22A 1FWNA 1L2UA 4IX2A 3W7NA 1DOSA 3PBYA 2ZZ3A 4OBTA 5G1YA 3L65A 1O95A 3LGEA 3QSRA 2EPHA 3W23A 3W7CA 1TJPA 1SZNA 4Y90A 5AB3A 1TRDA 2A4AA 3NPXA 1B4EA 3NEVA 4EWND 2Z6JA 1H1YA 2AAMA 3NQ7A 2ZZ1A 2R14A 3B05A 3W84A 4UNKA 3KXQA 1WV2A 2O7SA 1DKWA 3L0KA 1XBZA 1WYIA 3MP3A 5AFDA 5G2WA 5IBXC 4MUZA 4RZ5A 3PG8A 3FJLA 2VENA 4HPJA 1OYBA 1QPNA 1G7UA 4O1CA 4NJKA 2CLFA 8TIMA 2P1FA 2BX7A 3P5ZA 2NUWA 4UTUA 1K7EA 1VC4A 1W8SA 1AW2A 4PTNA 2B4GA 1AK5A 1ICSA 4L4MA 4X2RA 4ZZ9A 4FNTA 4D2JA 4Q33A 1W5MA 3LOTA 1KM5A 3BGJA 3I7QA 4JX5A 5E93A 3M5VA 1ICPA 3P8JA 1SZEA 3IIZA 4FXSA 3TC6A 2HTMA 2YSWA 1G6CA 1KA9F 3N19B 3W1NA 3W72A 3EEGA 3DHFA 1LTDA 4NT0A 4E0CA 3EWWA 5EY5A 1WX0A 3HIJA 3PB2A 4RV8A 1OF8A 1DORA 3LHWA 4UTWC 4JTTA 4IPJA 3DFQA 1D9EA 1TO3A 3QRHA 5D2VA 1SW3A 3B0UX 4OE7A 1LLWA 3FA5A 4MY9A 1GPWA 5DY2A 4Z1BA 3N2MA 1BWKA 1TV7A 4M6VA 1F6PA 2XN1A 3G1AA 5F1VA 1GVQA 2JKPA 3E12A 3W7HA 3WK2A 3A22A 1UUOA 2YFNA 3V1PA 2QUTA 2EHHA 5LNUA 3DKJA 3LB0A 4WY0B 4FNPA 4H6KA 3S8HA 1B57A 4CNPA 4CLMA 2PURA 1OG0A 1WXJA 4O13A 4MFEA 1Q3NA 5G4EA 3TQKA 4ICNA 3WJSA 1A5SA 3WJZA 4GE8A 4GUHA 1LOQA 1OK6A 3MBDA 3OVQA 4LW7A 3PAJA 4EIVA 1IXPA 4IMEA 4ORIA 1Z44A 3N34A 2CZ5A 2R94A 3PBWA 5BRBA 5LNVA 4CCCA 5AHMA 3GXPA 3C2EA 5AOUA 2A2IA 1N8FA 3LCFA 4O11A 2DZVA 4RJEA 5D02A 2PRMA 4CNOA 3R5EA 2E6FA 5C55A 3R13A 1FDJA 4UMCA 3NL2A 1KTCA 3JR2A 2O7QA 1W54A 2FDSA 2WPBA 1R30A 3DKLA 4IMFA 5HQEA 3LLDA 4A29A 2YR1A 2OMAA 3QFEA 4DQWA 3L9CA 3L5LA 5AYXA 3LRLA 1XC4A 3NQMA 1K7FA 4NJJA 4AHOA 1VCVA 3RLUA 2QCMA 1GYLA 2FPVA 3L5MA 3QMRA 4HT3A 4YMZA 4LC8A 4O54A 1SSGA 5CPLA 2I14A 1WOBA 1JCLA 1OFPA 2VEIA 4WD0A 1LORA 1XBXA 2WSRA 3MJYA 1TPUA 5DXYA 1N7KA 1FX6A 1KM3A 3W07A 1TTPA 3DFPA 4UTIA 4N6FA 4R33A 3LCHA 5U4NA 3FKKA 1EP2A 1NVMA 1ICQA 2E5BA 1O5KA 1IXOA 2FTPA 2GPTA 4Y6GA 6TIMA 3KVMA 4EF8A 3B8DA 4JTIA 2YXGA 5D05A 3I7SA 3PSVA 3THAA 3G8RA 1VLWA 2Q3OA 3QH2A 3T40A 3HG4A 3NL6A 1U83A 1R47A 2ZA3A 3PUDA 1D3GA 3RK8A 4CCEA 1VPXA 2JKEA 3SR7A 3GXNA 4N6EA 1J5TA 4O1BA 3G3MA 1O94A 3TR2A 4OQVA 4UTHA 1QO2A 5DCEA 4LUJA 4H3DA 4GUJA 5D32A 3R12A 5T26A 4WY0A 2DZUA 2VOMA 4WXZA 5D33A 3W1AA 3W75A 2TMDA 4UFLA 3NQDA 3LCGA 1KBJA 3LXBA 4UTJA 3Q94A 3PY2A 4NNAA 3KRSA 3EXTA 4UTLA 3N9SA 3WK0A 4TO8A 3QPZA 4O1AA 1VYSX 1Q6QA 4AF0B 5FEXA 4UFHA 2OX1A 1XDMA 3EWUA 3KVKA 2CLHA 1ADOA 7TIMA 1WOAA 2KZHA 3HB9A 1KFCA 3LCXA 2ZDRA 3S6DA 3BLFA 3UPWA 3DXIA 3UQNA 1G4SA 3PR2A 2BZNA 2CLMA 3H53A 4O18A 3HG5A 1ZJIA 1GTHA 4O14A 3TKFA 4DF1A 1LRQA 3EXSA 1QPQA 3VCRA 2QF7A 3ELFA 5I3JA 2TYSA 3FKRA 4LVFA 2GUUA 2ZFAA 3GIYA 1LLZA 4EOUA 2WJZA 4N9BA 1NF7A 2YPIA 5CPOA 3QW4B 4NX0A 4MZ1A 1GOXA 1OF6A 3EKLA 2YX0A 5I3FA 5A8GA 2WQPA 3HQ1A 3OVPA 5U7SA 4POCA 2FPTA 4FNQA 1NFBA 5FF2A 4O16A 2BLEA 3TFXA 1MZHA 2OCZA 3B0PA 5AHFA 1BTMA 3W7QA 1SFLA 3QPYA 1EPXA 1YPFA 2BSLA 4JXCA 4NJIA 1GVOA 3LERA 1HG3A 4DBEA 3NYZA 3QYQA 3M5XA 1KFKA 3P80A 3LV5A 3TROA 3OG3A 3C0JA 1UB3A 5DY3A 1BKSA 1XL9A 4NZFA 5ABTA 1KM4A 1H61A 1FXQA 3MUXA 3MHFA 3VKJA 1WDWA 5G4WA 4CQAA 3QMTA 1F05A 2VFDA 3KRZA 4EF9A 4LV4A 2NUXA 1FDZA 1QR7A 2WSYA 4LT9A 4Z0SA 4EVZA 3LHZA 3BLIA 1O60A 4RKAA 1H51A 3F4WA 3LX9A 3PM6A 1DQWA 3FJ6A 1XFBA 3NA8A 3TW6A 1KV5A 3NZ1A 1H7OA 2OT0A 2PRLA 4E2DA 4ZMGA 2Y6ZA 1S5WA 4RX0A 1Q45A 1SUXA 1TPB1 3S5NA 3VE9A 4BI6A 5F2MA 3W74A 4ZQPA 4A3UA 1FXPA 4LY8A 3DFTA 1WBHA 3NXFA 2E77A 2NX3A 3ATYA 3C8FA 1YTDA 3DGRA 4RXFA 5D30A 4PEKA 3TMLA 5CZ0A 1J2WA 3TW7A 2ZA1A 2JBMA 2X1RA 2V5LA 1H5YA 3W7LA 3GLCA 2RDWA 1KM2A 2OT1A 3MYPA 3CM4A 2J9YA 3W1XA 4K7YA 2ZRYA 3QMSA 1KLYA 2NV2A 4ADTA 3HGRA 1TPEA 1GQNA 3A5FA 4FNSA 4YCPA 2A21A 3BPWA 1OFOA 3DH7A 3LBMA 1P1XA 2R91A 2P10A 3ZS4A 5DN1A 1WQ5A 2QCHA 3GDMA 2NLIA 5DBTA 2DORA 1KW1A 3BW2A 4A2SA 2E68A 2GVGA 2TPSA 5AHIA 5C6MA 1H7NA 1SO6A 3A24A 2E6AA 1OABA 4YWIA 4FX6M 1JULA 1W5NA 3IGXA 1EWEA 1DL3A 3DFOA 2DJXA 3P61A 4BFAA 5SWUA 3HBLA 2ZRXA 3GVGA 3FLUA 4MJZA 3NVTA 4M5PA 5HUOA 3O6YX 3LV6A 3QW3A 1YPIA 3LTYA 3TAOA 4LOCA 3W7JA 4AHQA 4Z1AA 4JIPA 1X6UA 1I2PA 3UPBA 3TSBA 4ZQCA 1F73A 4A21A 3M44A 3W7OA 2V81A 4UMBA 4MLRA 3DFSA 1N55A 1TTQA 3NZRA 1KV8A 3TJXA 4FNUA 1XCFA 5L9FA 2Q8LA 4LTSA 2W6RA 4PH6A 4AB4A 1XUZA 3VE7A 5EMUA 1LRTA 3Q58A 3IVUA 4O28A 1QMLA 4O19A 2X1TA 4ORMA 1SSDA 3PG9A 3NQCA 3BW4A 2A7PA 4WZHA 1AW5A 4I7WA 3W3OA 4MYAA 1XBVA 3EX1A 3G0XA 1LYXA 3UXAA 4OHQA 1ALDA 1DBTA 4MKNA 5K4XA 2QAFA 3BLEA 1LBFA 1XUUA 5BMWA 4KKXA 3S0CA 4GJ1A 2C3ZA 2E5CA 4HHPA 1TPH1 1VCFA 1YTEA 2PRHA 4P61A 4DXVA 3NPUA 3TA6A 3NM1A 1HO1A 2G96A 1SO4A 1IXQA 2C16A 3SECA 4AWSA 1X8FA 1P0NA 4Q32A 3U8GA 5FESA 3N2XA 3G1YA 3NQGA 4O8RA 1JUBA 5CPMA 1TPFA 3NPWA 2C15A 4KWVA 5HR6A 1PVNA 4M7SA 1QPOA 4N02A 3W9ZA 2WNZA 1W31A 2CU0A 4O0KA 4AHPA 4E2BA 1XDLA 1AG1O 1AL7A 2J9ZA 3C2RA 1QCWA 1EP1A 5G2HA 1TJRA 5K9XA 1G69A 4IJBA 1GVFA 2VKZG 1TQXA 2NX1A 1MEIA 1PV8A 1VLIA 2NV1A 2A7NA 3GKFA 5DCDA 3IIVA 5AC6A 3GZ3A 3BG9A 4JDBA 4HN4A 2ABBA 4MJMA 1AW1A 4ZQMA 3SFKA 3EB2A 1RZMA 2AQWA 5BOOA 4P2VA 1RV8A 4JTEA 4LVDA 3GDLA 3NQEA 3HMJG 2J6XA 5DBUA 4WUIA 3W2KA 4BR1A 2RHGA 5C2XA 4N4PA 3O1NA 4C1KA 4LU0A 2CLKA 1J4EA 1VH7A 4U28A 4ML9A 4O10A 5AYYA 2YYUA 2XN2A 2W79A 5K4ZA 2VFGA 2H8XA 2CZEA 4PL2A 3I7RA 3O8AA 2A85A 3DFNA 2B7NA 3H55A 1G4TA 1K7XA 2QDGA 4WOQA 3W86A 1LBMA 3UWWA 4A22A 4HKPA 2B7QA 2JGQA 3GAKA 5H91A 5HUPA 2G5WA 5F4WA 5K9DA 3DI0A 3GR7A 2OZ0A 3QQ1A 4LS2A 3TMQA 5EL1A 1T0OA 3IIOA 3EX2A 4JICA 1JQVA 1SFJA 1FY6A 3PVFA 2Y62A 1Z41A 3G1HA 3M1ZA 1OX4B 1PE1A 1XBYA 4UMAA 4UTTA 3NQAA 3HGSA 3NDOA 5KZEA 2QCDB 2ISWA 1BWLA 4CNNA 4DBDA 4UR7A 3KVLA 1TB3A 3I6RA 3GB6A 4UIOA 3G1DA 2X1UA 1MEWA 4K38A 1SO3A 1XM3A 4KWWA 4UFMA 4IUOA 3UZ5A 5K2ZA 4MOZA 2H90A 3EX6A 2E5DA 1JCJA 3EWXA 4R34A 4UNLA 2ZYFA 3SSJA 1PHQA 2GVJA 3UYCA 3UWQA 4HIBA 4O15A 2Y7EA 1LRNA 3DAQA 1LBLA 3ANYA 1KTNA 1I8JA 1QDSA 2YFOA 4J9JA 4DELA 1M5WA 1W3IA 4JTSA 1S5TA 3GAYA 4M19A 5CZTA 2FLIA 3B4UA 1FCUA 2QCLA 3OVRA 3W1TA 1ZAHA 2Y61A 3N73A 3O6CA 3M5YA 3O07A 4QNEA 3C56A 3GKAA 4I7VA 1K03A 3CIWA 2TSYA 4MVAA 3NGJA 3PUEA 1X7FA 3MO7A 3M0ZA 4JX4A 1JRBA 4WQ6A 1MXSA 1MO0A 2F7FA 4UFIA 5GVJA 3MI3A 2X2GA 2EAWA 3STGA 1OFEA 3HOJA 4DF2A 4O4WA 1JRCA 5BMXA 3CWOX 2Y85A 1TPDA 2VFHA 4NQ1A 5LNSA 1JUKA 3CT7A 4ZQOA 1TREA 5AHEA 5F2GA 1SR9A 1NEYA 2A5HA 2HMCA 2ALDA 4GBUA 2QJIA 3OIXA 2WV8A 3FS2A 3P81A 2DJLA 1TPC1 1V5XA 3INPA 3FOKA 3I65A 3O63A 4MIMA 3B06A 2FFCA 3IIXA 3UWVA 4GWEA 4DO6A 5FF3A 3C61A 3ZFHA 3FYOA 5LSMA 2C14A 2HSAA 1I45A 1KFEA 3I68A 1ME8A 5EKYA 1H62A 4FX8A 2DZTA 4FXRA 1NF0A 4Z1DA 3KFTA 4JTGA 5K9CA 2Y7GA 1A5BA 1V7YA 3TNOA 4BI7A 4IQLA 4UXDA 1L6WA 2E6DA 4GUIA 5FEWA 3GR8A 3NQ6A 3UNDA 5F4SA 3EKZA 3EWZA 3M5ZA 1OFDA 4JNMA 3BW3A 3DBPA 4RK8A 5DELA 1SQ7A 2E09A 3BVJA 5D2WA 1K8ZA 3F03K 4GUGA 4XTDA 3UWZA 1I4NA 4S2BA 1MEHA 5FEZA 1ME7A 1K8YA 2ZQ0A 3LTPA 1C29A 1OX4A 4NVTA 1THFD 4Y9AA 2ATMA 2J24A 1YYAA 4TMBA 2J27A 2QCNA 2VFFA 1BEUA 4N2YA 3OHIA 2DZPA 4MY8A 1TV8A 2CLIA 3P62A 3W1PA 2Z0IA 4K8EA 3W87A 4TMCA 4JEQA 4PC8A 1W5OA 1W0MA 2WOQA 3P7YA 3IGSA 4IX0A 4UFJA 1EX5A 1KBIA 4QITA 1RVGA 1KM1A 1GWJA 5HMSA 3WK3A 4FEZA 4XWUA 1L6YA 4JR5A 5AC8A 2H3BA 4BF9A 4OGZA 3W7PA 1UASA 5HJLA 4AMAA 1AL8A 5TBOA 4RLIA 4DEFA 6ALDA 1W1ZA 2OJPA 2VXNA 3CB8A 4BWLA 4LS1A 3M41A 5C5YA 3EX4A 2WNNA 2ZRZA 1VRDA 3TXVA 4ALDA 1Q6LA 2C18A 2X1SA 3NQ8A 4FX7A 1O4UA 3S1UA 1VS1A 3G1XA 4TX9A 1GTEA 3G24A 3NNTA 5K3VA 3TSMA 4KFOA 4ADSA 3G8EA 2H8ZA 1W5PA 4IMDA 3QF0A 1GJPA 5LGXA 3C6CA 4ZVJA 3S1WA 3IGUA 1FBAA 2QCGA 1RD5A 1MSSA 2A6LA 2NXIA 2QUVA 3EWBX 5FF7A 2A7RA 4K36A 3Q2DA 3MHUA 2ZRUA 4O17A 1KFBA 2Q3RA 3HPSA 3T78A 1Z42A 1TV5A 2RFGA 3LI1A 3O16A 4HNNA 1F74A 4AWUA 5IBXA 4IGHA 1HUVA 4UTMA 1K02A 3RU6A 3TK7A 4JYFA 4WJEA 2GOUA 1T96A 3THQA 5EYWA 2RH9A 4UC5A 1F6KA 3HG3A 3VNDA 5CGQA 2V30A 3NQFA 5LNRA 4QJ1A 2FJKA 4O52A 1FDYA 2E6YA 4JS3A 1ML1A 2GJLA 2GVLA 2PC4A 2TRSA 1TTIA 3CLMA 3ABRA 3W7EA 4PA8A 3N14A 4NZJA 1QWGA 3LXAA 5A5WA 3VFLA 3A9IA 1NSJA 2Y70A 2B7PA 4X9SA 5AHNA 5I3HA 3PS7A 3MW7A 3W7RA 1A5AA 5LHEA 3IEBA 2VC6A 2RDTA 3JS3A 3W2UA 4Z08A 4DO4A 4UTWA 4HNTA 4I9AA 1UUMA 3LHTA 4QM1A 4LUIA 4QIUA 5KINA 1QOPA 3FYPA 4N9CA 4WOZA 4Y8FA 3PBUA 4QSHA 2ISSA 2D73A 3P8IA 4AF0A 2I9EA 1KM6A 4BI5A 2NZLA 3G3DA 4R53A 3M9YA 4RR4A 3W85A 2CLLA 3A23A 4MZ8A 4YXGA 1VHCA 3C52A 3WFAA 1IGSA 3HF3A 5HWMA 3GX9A 4LVBA 4Z0JA 3DHDA 3PULA 4U4MA 3RMJA 3KX6A 2QEZA 1Y0EA 3W7DA 2HS6A 3HPZA 4A2RA 2Y89A 2E1DA 1B3OA 3E96A 2VELA 3UZJA 4IMCA 3BO9A 3SZ8A 1AMKA 1HTIA 3SY5A 4FO4A 2V2CA 2QR6A 3NQVA 1KFJA 2J9XA 4YL2A 5BNKA 3S9YA 1F7BA 1I2NA 5E1QA 3E02A 5H2ZA 1SZFA 2QCCA 3GYEA 3N3MA 1SW0A 3STEA 2V0TA 2NWSA 3QEZA 1TPVA 4FNRA 3SGZA 2V8ZA 5D04C 5J5DA 5LKYA 4XBSA 3PUOA 5I3GA 1WBJA 3YPIA 2VEKA 3RFAA 1FCBA 1ZNNA 5AC7A 4XQ6A 3W2MA 4K8HA 1LCOA 4IXHA 4HNUA 1QOQA 1HO4A 3M7WA 3TDFA 3O6DA 2H6RA 1EP3A 3FIGA 2R8WA 4CQ8A 3C2OA 3ATZA 3NL3A 2BTMA 1KM0A 3DI1A 2G95A 4JN6A 4LVAA 1NAL1 1GVSA 3MP5A 3U2OA 4C1LA 4NNBA 4IPIA 3WJYA 1P0KA 1K3UA 1OHLA 4O1DA 1PCWA 3CHVA 1C8VA 1EIXA 1VYRA 3QQ0A 2UV8G 1KLZA 3CQ0A 4N9EA 1YTKA 3NOEA 1RQBA 1U5JA 5KITA 3CTLA 3PB0A 5AHLA 1T99A 5MHBA 1VR6A 3L66A 1TPWA 1LOLA 1OK4A 3T55A 3TH6A 4CCDA 1VGAA 3STFA 2C1HA 4LC6A 1QNVA 2PCQA 4NJGA 5F1UA 3UY7A 3DU0A 2AGKA 3G1VA 4JTFA 3TXZA 1JCYA 4AEOA 1E51A 1OFQA 5DXXA 1H7WA 4MYXA 4NUWA 5G2IA 4JTJA 1L6SA 1PHWA 2RKXA 3GDTA 4ONVA 2GJNA 2CFFA 1JVNA 1OYCA 4WXYA 1R2TA 1QAPA 1B4KA 3NQ2A 1CI1A 4M7TA 1I2RA 3M16A 1Q6RA 1ZFJA 4MPQA 4AWTA 2RDUA 3W83A 2ZTJA 1F2JA 5CKSA 1QO5A 5I3IA 2VEMA 5EPDA 1W56A 4CQ9A 1TIMA 3W70A 4RZ4A 2Z6IA 4O53A 3QZEA 4UCGA 1SZGA 4N9DA 4NU7A 1FQ0A 1P5BA 1G4EA 1S5VA 3GDRA 2VEPA 3E49A 3HGJA 1OFRA 1H7PA 3L0NA 1TYGA 2C6QA 3UWUA 3UY8A 4FHAA 3HG2A 4Y96A 3GK0A 1W3TA 1PIIA 3TE9A 1RPXA 1M7OA 1ZAJA 3W1MA 4KFNA 3S42A 3LBCA 4NJHA 3EWYA 3JRKA 1R2SA 3OA3A 4UR8A 4X3ZA 3TU9A 2ISVA 2EKCA 4JY8A 2ZZ4A 4GFSA 2WKJA 1SW7A 2Y88A 3WJWA 3CEUA 4JIQA 4WX2A 2B7OA 2YW3A 3F4NA 3DENA 5F4XA 2CW6A 2QJGA 4UTKA 3R2GA 1W5QA 3W2LA 4KFPA 4O0ZA 4K37A 3NM3A 5EBUA 2V2DA 2BWGA 3PWAA 2ATSA 4TU1A 4HPXA 1OYAA 4LS0A 1KFLA 1W3NA 2Z1BA 1L9WA 2QDHA 3D0CA 3LRMA 1YDOA 5LHFA 1RQHA 4O57A 1F76A 1LOSA 4DF0A 1WA3A 3BGGA 4O4VA 3PSWA 5HWNA 1FWSA 2JK2A 3WK1A 4GUFA 2A0NA 4GRSA 1TTJA 3LXCA 3P67A 1P4CA 5D2TA 3BG3A 4MFDA 4QISA 2YW4A 1C9DA 3MWAA 5CG7A 2FPYA 2YCEA 3B04A 4JY9A 3T4CA 5FEPA 1H63A 3CWNA 2WNQA 4S2CA 1UBSA 5KZDA 4LRTA 3HJZA 4E38A 4S1FA 4YLWA 1ZENA 1DJNA 3BG5A 1VCGA 1GZGA 3FEMA 2NXGA 3QJAA 1YDVA 2DP3A 4HSOA 2XFWA 3V75A 4W9TA 1KTBA 5EA9A 3B0VC 4JTKA 3DZ1A 1SU5A 3IRDA 3W76A 1IF2A 3S1VA 1FWTA 4LWWA 1EB3A 2QCEA 2NUYA 1LP6A 4HSNA 4IWWA 3TX9A 4HNVA 3P5YA 3LTSA 3C3NA 1H60A 4OU1A 2IQTA 2CZFA 3W71A 1GEQA 4ZQRA 2XN0A 4FF7A 5CZJA 2G97A 3CPRA 1VZWA 2Z2UA 5HULA 3ABQA 3L21A 1XXXA 4UFKA 1I2OA 1YXYA 3TUUA 3MP4A 2YDAA 3NAVA 2QJHA 1X1ZA 4ZQNA 3CEPA 2ZZ7A 3T44A 1FWRA 1JR1A 5L6UA 2H3DA 1ZAIA 4NNCA 3LI0A 4XUGA 3W7GA 2DU2A 4M6PA 1EWDA 5HR7A 3ZWTA 1OFBA 2YZRA 3S5ZA 2B0MA 3NL5A 4M6QA 3SW6A 3QSTA 3PBVA 1LDCA 4AAJA 3LCLA 3SGUA 2WO5A 3L67A 1OVDA 1DVJA 4JTHA 4X22A 1YDNA 3E9AA 1OJXA 3G1FA 3KVJA 5D09A 2V82A 3CU2A 1YXDA 5D38A 4AVFA 1D3HA 3LHVA 2ZZ2A 4B5NA 2C19A 2Y7FA 4JTUA 4YCOA 3G0SA 3L68A 4GC4A 1A5CA 2ZTKA 3MI6A 2X16A 4OV4A 1A50A 1SO5A 3MYOA 5HINA 1HL2A 1LZOA 2CWNA 1DHPA 1I2QA 2A6NA 2JKAA 3NO5A 2HS8A 4JD4A 2DZWA 3P74A 1PCKA 5AYZA 2GQ8A 3MI2A 5K7JA 4BK9A 1YXCA 1M7PA 3C4UA 2BXVA 1SPQA 1OX6A 2DZXA 3T7VA 3TSDA 1GG0A 1PS9A 3USBA 2EF9A 4MZYA 3W22A 3R89A 4OWGA 5G5IA 3P60A 5D37A 5KSWA 1CW2A 1QPRA 2QAPA 3UD6A 4PL1A 1IIGA 3SIZA 3MMTA 1VYPX 1FCQA 3QC3A 3S1XA 2ZCGA 1GG1A 1ZALA 3W2NA 3LCWA 3P82A 1O5XA 3L5AA 3W7MA 2QCDA 3ZWSA 1TSIA 3NG3A 4PCFA 3W1RA 3EXRA 4QAIA 4JX6A 2V5BA 4TIMA 4QNWA 2NXHA 4Q4KA 3NPVA 2FB3A 3TQVA 3H54A 3MHGA 3VI2A 4NXKA 5LZLA 2QCFA 3Q37A 1F5ZA 3G0UA 2NWRA 2J88A 3CC1A 3LDVA 3W88A 2QKFA 3M6YA 5J5RA 3S5YA 2C0AA 4K6AA 5KMYA 2VFIA 4Z1CA 1ZCOA 5IM51 3ABSA 4O12A 3LHUA 1M6JA 5TQLA 1TMHA 2WSQA 3B03A 3NR0A 3TV8A 3FFSA 4K7VA 4DPPA 1A53A 4XBKA 3TIMA 5DCBA 3P84A 2VFEA 2ZA2A 4RZ6A 1EUNA 4K39A 4FB7A 1TRIA 4OT7A 5D03A 3LM7A 5I3KA 4TR9A 1GVRA 1WAUA 4G1KA 2Y63A 4UTTC 1H7RA 1YLVA 4ADUA 1OFAA 1H50A 3M47A 1RQEA 3W2JA 5F2IA 4NX5A 2DZSA 3K30A 5AN7A 4XKYB 3PF3A 2V9DA 1DQXA 1HFBA 2X30A 5LNWA 3KOFA 1DJQA 1FWWA 2GQ9A 3UXDA 5HWJA 3IV3A 2YYTA 1TCDA 3KAOA 4LRSA 1GYNA 5FF0A 4NXSA
chains in the Genus database with same CATH superfamily
2ZRVA 1QFEA 2HBXA 1JDEA 1EEPA 3W28A 1Q7QA 1Q8JA 5KZMA 5AC4A 4OV9A 3VNYA 3E0WA 3W26A 1FUYA 1AODA 2E1WA 1DJHA 3SADA 1JZ5A 3EPOA 3UVAA 4ZSTA 2CKRA 1U1HA 4XSLA 2CERA 2ZZ6A 5LA1A 2QW5A 2QLYA 1XKYA 2J7FA 5LIKX 4S3KA 4MY1A 1VB9A 3WUFA 1QTWA 1Q6DA 4FPSA 4DZHA 5BW6A 1IZCA 3TN4A 1G4PA 4QQ3A 2G4JA 3G18A 3DERA 4WIWA 1XLIA 1M53A 1NJJA 3E0IA 1JZ3A 3H12A 1ZY9A 3RLVA 2PE4A 3BMXA 4IMGA 5HNRA 4ZSUA 3O05A 2AKZA 4RXGA 5TNVA 1TQJA 1JPMA 1JUEA 4KCWA 3PTKA 5LIUX 1E0WA 4O50A 1US0A 4WSJA 3CH9A 1UBPC 5D2XA 3VK5A 3BARA 3LCIA 3IJ6A 1QOXA 3B0XA 3L2IA 2XWDA 4Y2WA 3A21A 4N4QA 1JZ4A 3UVIA 3T1GA 1TELA 2PDMA 1L6FA 3SI9A 1ME9A 2Z1SA 3BQ6A 3U6WA 4ZO8A 3EOLA 3WNLA 1J0HA 3W38A 1EC8A 3UXLA 1IXNA 5HMFA 1ZGDA 1ISXA 3GC2A 5KTLA 5JVLA 1J11A 4JTLA 1Z48A 3E38A 3ZR4A 1A5NC 4AC1X 5A6AA 2D20A 4FIQA 4UNIA 4ZL1A 1V02A 2HZGA 4MWAE 4WHBA 1ONXA 2GK1A 4RPQA 3TQ0A 3CZKA 5M5DA 1ONRA 3LGGA 2PGEA 1EA0A 1PTGA 2OOGA 5M03A 3KHJA 3UZXA 5C54A 4PFMA 1KR1A 3MCNA 2V2HA 5F2LA 3MV01 4A3YA 4S3FA 3KRUA 2D3LA 1FCVA 1CGUA 3GVVA 4GX8A 3H26A 1FWNA 3PJUA 2J7DA 4P7OA 4P8VA 1DOSA 1XIHA 4HGXA 4H2HA 4C65A 3GQYA 4IFKA 5G1YA 3L65A 3QSRA 3AISA 3W7CA 1TJPA 4L9YA 2J7GA 1TRDA 3UPMA 4EXAA 2QNEA 4BQ2A 2ZZ1A 3AXMA 4A8IA 1GOOA 3KBWA 1DKWA 1IEVA 1XBZA 3AMLA 5AFDA 5G2WA 3GH7A 1G0CA 4MUZA 3PG8A 5GNZA 2ZUVA 1MI3A 1G7UA 1RY0A 2CNCA 2P1FA 2BX7A 4UTUA 1VC4A 3WQ8A 1AW2A 2J77A 5C8BB 3ZLHA 1DJGA 4X2RA 4D2JA 1FFRA 3VIHA 3V35A 1J79A 3P8JA 3WQ6A 3UJ2A 1E1EA 1G6CA 1RSCA 2X42A 3N19B 3RJYA 3UETA 3A64A 3GTXA 3DHFA 1LTDA 4E0CA 5EY5A 4LB3A 3HIJA 2BHZA 5CG0A 3GTFA 4DWSD 2FFIA 3ZSSA 5I2UA 1U33A 1WDSA 2GGIA 2FDMA 2VR5A 3QRHA 1UD2A 5D2VA 3B0UX 3BCJA 3WLHA 2HK0A 4MY9A 1Z69A 3C0SA 5A6BD 1BWKA 4M6VA 1H1NA 2XN1A 4Q3MA 3W7HA 4UZSA 1UUOA 1DWHM 4PSRA 4R85A 3SCTA 1QBAA 4GNVA 4FNPA 4H6KA 1B57A 4NAFA 4A8LA 4CLMA 3H2AA 4O13A 1V3HA 3KWSA 4JFVA 1HP5A 4ICNA 4M81A 2VUYA 4QS6A 1EDGA 4F0LA 3WJZA 3MBDA 4LW7A 2ACQA 4M29A 4EIVA 1IXPA 4E3VA 4ORIA 2PWVA 1PWLA 4RNJA 3MVTA 4R7OA 4AD2A 1WO2A 5BRBA 4J28A 5AHMA 3C2EA 4PMYA 3LCFA 4O11A 1R3YA 4CN4A 4CNOA 3R5EA 2HWGA 4C90A 5DMMA 3WQ5A 2WPBA 1GOQA 1B31A 3CXOA 3GVRA 4IMFA 5HQEA 3LLDA 2ZC1A 4MB4A 1WKEA 3L9CA 3L5LA 1GKPA 5AYXA 1XIMA 1L2QA 1XSKA 3LN3A 4GIEA 2WW5A 4NJJA 4FOJA 3RLUA 4ACZA 2I14A 2Q02A 1JCLA 2VEIA 4WD0A 2WSRA 3MJYA 3WIJA 5C9WA 3BJFA 1FX6A 4IM4A 1D7KA 4M82A 5TF0A 5AVNA 3N1AA 3D5HA 3FKKA 2E5BA 3ZYZA 1PXGA 3EDKA 2CBUA 1A4LA 3H2OA 4Z2IA 2RDXA 4C1NB 3N9KA 3N15A 3PSVA 3G8RA 1VLWA 4PMVA 1E1FA 3QH2A 1U83A 1K6WA 3RDKA 5JU6A 1D3GA 4CCEA 2JKEA 1VPYA 4MKVA 4I5UA 3VMPA 1B2YA 4LSBA 1NOFA 1O94A 1DJYA 1L8NA 4PMQA 4OQVA 1HT6A 3KBSA 5IRPA 1VFOA 1S1PA 1UZ4A 1WNOA 3F7JA 4QHRA 5PTDA 2VM8A 5D33A 3W75A 3LYEA 3ISIX 1KBJA 4HHHA 5BWAA 4NNAA 1H49A 4Y9OA 5REQA 1E3XA 5A8MA 1NOUA 4AY7A 1PPIA 2OLSA 1DE6A 4R7WA 3WH9A 2OB3A 4IQJA 4UFHA 1BLIA 3CL6A 3EWUA 7TIMA 3CQKA 2FH8A 2P8BA 2BHUA 1I1XA 2KZHA 1KFCA 2DH2A 1KRMA 4YHGA 3S6DA 3BLFA 3UPWA 3DXIA 2Y0FA 2PWDA 3H53A 4DF1A 4WGXA 3VCRA 1GONA 2QF7A 4HN8A 2ZFAA 3WD3A 1A5LC 1PDYA 4GO9A 2YL6A 4UQBA 4MZ1A 4PMXA 1L0PA 1KNWA 2YX0A 1S2TA 1KCZA 4UCFA 4C6LA 1TR1A 4GYFA 1NFBA 5FF2A 4O16A 4CUCA 2XGBA 1F8MA 3SCVA 1PAMA 1S2AA 1CPUA 3OYZA 3B0PA 5AZ1A 1BTMA 2FTWA 4U3AA 2EEXA 2PCEA 1SFLA 2P50A 4NJIA 1EPXA 1CLKA 1YPFA 3K13A 4WDXA 3QYQA 3TROA 3C0JA 2W61A 5DY3A 3EDFA 5ABTA 4H8HA 1VIWA 1KM4A 1FXQA 3MUXA 1UKSA 3VKJA 1MW2A 1WDWA 4PMRA 4CQAA 2CITA 1M04A 3GNRA 1FDZA 1QR7A 4Z0SA 4DWSA 4C1NA 3W27A 3AWNA 1W9BM 2YCKX 2OLAA 3PM6A 3WEOA 2XZ9A 2XJ7A 1A4MA 4TQTA 3KOXA 4MDOA 1UWTA 1B9ZA 1OBAA 4ZMGA 4RX0A 2EQDA 5A6BA 4A3UA 1E0VA 4LY8A 4J3XA 3WDPP 1WBHA 1WKYA 4PEKA 1EFZA 3CZJA 3OBAA 3V7PA 1H5YA 3AHVA 4RE2A 2RGLA 2V68A 2RDWA 1RCQA 3CM4A 2PDUA 2INEA 3PZIA 1KLYA 1FKWA 3JW7A 4YCPA 3DUGA 2WZMA 3BPWA 4DIAA 3DH7A 3LBMA 2R91A 4U2YA 3ZS4A 1E6RA 1WQ5A 2QCHA 3ZJKA 2BY1A 2X2YA 3VXGA 3WMBA 3WLQA 3RILA 3ITCA 4L6DA 3WEMA 1QI3A 5IDZA 3BW2A 4A2SA 3ID7A 3RHGA 3ERPA 2PWHA 4GYPC 3VDCA 5AHIA 1S38A 4DUWA 3SAZA 3A24A 1UWRA 2WMJA 1EX1A 3DG6A 1JULA 4GGBA 4XAPA 1P6WA 3ZVHB 3LBOA 1DL3A 2D2JA 3HBLA 2ZRXA 4WKFA 3FLUA 3O2LA 4MJZA 1TJ0A 4PZVA 4XVEA 3O6YX 2RUSA 2VR4A 5CGTA 4CD6A 9XIMA 3W7JA 4FP1A 4S3JA 1J0ZA 1DXIA 3MJMA 2ZICA 3BWWA 3UPBA 1XLHA 1F73A 2VDGA 4PUMA 3W7OA 2V81A 4MLRA 5ABEA 1D8CA 3NZRA 3VD9A 2Q8LA 3RR4A 3N2BA 2W6RA 1M41A 4PH6A 2X41A 1XUZA 1V0MA 1LRTA 4L64A 3WMLA 2ZIDA 3TN3A 3NZPA 3WG6A 5LIWX 4ORMA 3M0MA 1ZP3A 4MDPA 3S6TA 3NQCA 2A7PA 1AW5A 4LCQA 3W3OA 1UD4A 4MKNA 1O1HA 3K8KA 3OGSA 2G3IA 3SQLA 3BLEA 1LBFA 3S0CA 3ZR6A 4NZCA 1JYXA 2QVNA 4HHPA 1VCFA 1YTEA 3H2MA 2YLAA 2PODA 3OVGA 1VBGA 2G96A 3KOWA 4AWSA 1X98A 3U8GA 3WDRA 4RDVA 2RGMA 3QGKC 1EJVC 2F9RA 3EDEA 3VKBA 4B5WA 2C15A 4KWVA 2J7EA 1G9HA 1YRRA 5TAOA 2WZIA 4O0KA 1Q4NX 4JIIX 4PCNA 3FAWA 1TJRA 4L1GA 4K68A 5ABFB 2CHNA 3GRIA 4PMNA 3BANA 1D8WA 1TQXA 2NV1A 2A7NA 5BXRA 4MJMA 4DLMA 3SFKA 1W17A 4P2VA 1RV8A 3SN1A 4GY7A 2Z7KA 3OIHA 5BXTA 2P5NA 2J6XA 3ZVHA 4PMDA 2WHJA 3O1NA 1GW1A 4LU0A 1R5YA 3URNA 1E0UA 1FWDC 2CLKA 3NO3A 1J4EA 4O10A 4DJDA 2W79A 2BVWA 2H8XA 2OODA 4ILSA 2B7NA 3W86A 2BY2A 4A22A 1UYQA 1SVDA 4XZIA 3EPMA 3S2LA 5BCAA 2JGQA 4JFSA 4ZOCA 4HYRA 2Z00A 2OZ0A 3QQ1A 4ZXOA 3RO8A 5CC7A 4E4PA 5M3WA 4LS2A 4IP4A 2PDCA 1SFJA 2Y62A 3GTIA 1UIOA 4JHOA 3M1ZA 3QOMA 2EG6A 3KCJA 3VNJA 1OD8A 4MJ4A 1PE1A 3NQAA 3STPA 3ZXWA 3ARYA 3R94A 4Q8VA 1BWLA 3U2EA 4UR7A 4XV0A 4FOUA 2PLKA 3G1DA 1UWIA 4H7ZA 1TMLA 3SIMA 3BH4A 2X1IA 5LYRA 1XM3A 1PX3A 4IUOA 2REQB 2I56A 4UNLA 3SSJA 4JOMA 4GA8A 4O15A 4D71A 3GSMA 1QDSA 4GI9A 5EMMA 1M5WA 4JTSA 2FLIA 1MZRA 1CXHA 1MVYA 3VM5A 3NQBA 4CU8A 1GHSA 4P7RA 3WH7A 4N0RA 3C56A 4NHVA 4I7VA 1B3ZA 4JBRA 3TYAA 2TSYA 3NGJA 4KETA 4QG9A 5BU9A 5DFAA 2X7VA 4WQ6A 1MXSA 2JF7A 1XKJA 2F7FA 1UR9A 5GVJA 4PRRA 3TTOA 3L23A 3STGA 5JUVA 2BXZA 2DZAA 3BV7A 3WDJA 3HOJA 1JRCA 3H22A 2Y85A 3WH6A 4A3RA 3WKZA 3CT7A 1ISWA 1TREA 3SQMA 5AHEA 5F2GA 3AXHA 1M9HA 2H9AB 3OODA 1TCMA 1TPC1 4ZE4A 1V5XA 1CGWA 4P8XA 2VQUA 3B06A 1M01A 1RA5A 3IIXA 4GWEA 5FF3A 1E9LA 3C61A 3ZFHA 2HSAA 1KCXA 3SUVA 1IZKA 1ME8A 4C6FA 5EKYA 1H62A 4FX8A 2J7HA 2WZHA 4BI7A 2NSOA 5I06A 4GUIA 5HNUA 4G8TA 2YDSA 1P0BA 1KBKA 1UH4A 4CEXC 3EWZA 3M5ZA 2MANA 3ORWA 4JNMA 2UY2A 2J62A 3FGCA 2G37A 3XISA 4PB4A 1WDRA 1DWJM 5D2WA 2Z29A 2WKLA 4XTDA 1I4NA 3S6OA 4S2BA 3AROA 1MEHA 1ME7A 2XGIA 1K8YA 2BGNE 2XWEA 4NVTA 2ZUUA 4G5DA 2J27A 3N6JA 1UA7A 5DRCA 1TV8A 4S23A 3W1PA 1IGWA 4J3ZA 1B0IA 1W0MA 2WOQA 5C9XA 5E0CA 3T0BA 3RPMA 1EX5A 1H2JA 1KBIA 3B8TA 3E2SA 3IV8A 1E70M 3G6MA 4FEZA 4JR5A 5AC8A 1GKQA 2VD8A 5TBOA 2EKGA 3WQFA 1NM9A 2B81A 3M41A 3EZ4A 1KWGA 2Q6ZA 2PGFA 1Z8AA 3U57A 5CPSA 1QNSA 2C18A 4MAVA 4UQEA 1GGOA 4TX9A 5K3VA 2YA1A 2PP3A 4DAFA 3QF0A 4H9TA 1GJPA 5FCZA 3S1WA 1CXEA 3R8GA 3NSMA 2A6LA 3W53A 1MMFA 2A7RA 4TVDA 4GKLA 4YTUA 4F2UA 4GCAA 1WZLA 3HPSA 3T78A 2H9AA 3CZLA 4X0NA 1XSIA 2JIEA 3OTRA 4AWUA 1HUVA 4JYFA 4BJHA 2XFFA 3CZGA 4HK6A 4CEUC 3ZOAA 3ITYA 4NZ1A 3NQFA 3I6TA 2FJKA 1ZJBA 1FDYA 1JGMA 2E6YA 1TV4A 1A5KC 1ML1A 3R8HA 3FCPA 5A6MA 2EPKX 1QWGA 1XPYA 3VFLA 3VNZA 1NSJA 4LGXA 4QDPA 4QSFA 2XH0A 4N7QA 4IL0A 2E40A 5I3HA 3MW7A 3UG8A 3QVQA 2XM2A 3IEBA 3F5KA 3SJNA 3LGDA 1U1UA 4QM1A 5KINA 4N9CA 2Y5SA 3WNKA 3M46A 4QSHA 5C71A 4AIBA 1E9ZB 2I9EA 1Q6FA 3G3DA 1IWPA 3M0VA 3W85A 3KDNA 5GNXA 3LQGA 1A0DA 1U30A 4R88A 3GX9A 2BVDA 1Q7ZA 6A3HA 4IIHA 1UQZA 1Y0EA 3TC3A 4TUFA 2F6XA 1B3OA 4FALA 4H41A 3UR2A 3LZ5A 4W93A 5D4YA 2W9MA 1HTIA 1V77A 1F61A 2QR6A 4J4KA 2I17A 5BNKA 1XCXA 4TTGA 3TP4A 5H2ZA 3V4BA 3MZ2A 2ZVRA 3QEZA 3WDQA 3SGZA 4XIAA 1AJ2A 5J5DA 1DWFM 2I9UA 3PUOA 5I3GA 5CC3A 2VEKA 3G5EA 4RE0A 1FCBA 2CBVA 5FJOA 5MF5A 3CHDA 3F4DA 3RUBL 4IXHA 3T0DA 3M7WA 3TDFA 3SN4A 2H6RA 3DDMA 4D72A 3NL3A 2G95A 4YTTA 1WB0A 1BSIA 1GVSA 2O92A 2W62A 4XUYA 3KZPA 2PZNA 4QEEA 3BLDA 1HQTA 1ZL1A 1OHLA 4O1DA 1PCWA 1C8VA 1KR0A 4RV3A 1GNXA 2UV8G 1KLZA 3ICJA 1YTKA 4Q8WA 3A9BA 3VU2A 3PB0A 2P3EA 1T99A 2ZXDA 4PR4A 5C9RA 3E2VA 1TPWA 1OK4A 4PB3A 2DW6A 2PB1A 2D24A 4CCDA 1ADSA 2NT1A 4NJGA 8XIMA 5A8QA 4GJIA 2OWCA 1E51A 1OFQA 5DXXA 3OZPA 1Q66A 3UFYA 3HMCA 4NUWA 4JTJA 2WLYA 4ONVA 2GJNA 2CFFA 1EJ7L 2OQLA 4MNKA 3NQ2A 1N8WA 5LIYX 3M0HA 1E72M 2FZDA 1LQ0A 4MPQA 1F2JA 3U2ZA 2VEMA 3AIBA 1RPKA 2VX4A 3CT2A 1TIMA 2BV9A 3LMZA 2Q09A 3QZEA 4UCGA 4IG2A 4AZIA 4N9DA 4NU7A 1G4EA 2Y24A 1H7PA 4W5UA 2VRQA 4IP7A 3UY8A 4V15A 3HG2A 4Y96A 3GK0A 3SM0A 3LMYA 1K9TA 1W3TA 4ATWA 4PSPA 4CNUA 4DWDA 2W27A 3H7VA 3OA3A 2XVNA 4UR8A 4X3ZA 1UQYA 2YCIX 4GFSA 3W4RA 1SW7A 4HZ7A 4LYKA 4F0HA 4AZGA 2QJGA 1W5QA 3W2LA 5GQBA 3PUGA 2GGHA 1AZ2A 1UZ1A 5FSDC 2BWGA 4AMCA 2J25A 4PUJA 2VRJA 2ATSA 3LPGA 1OYAA 1KFLA 3VCCA 4GLEA 4GBDA 1OCJA 1GZJA 2GQ3A 3TTQA 2XDFA 1NFPA 3S46A 1RQHA 2ZWZA 4O57A 1LOSA 1WA3A 2Z25A 1OY0A 4YVVA 4GUFA 1XRVA 2IPWA 3OZYA 3EDJA 1E0TA 1P4CA 5D2TA 1EO5A 1EQCA 4MFDA 1C9DA 3W00A 3GNXA 3GFYA 4IFRA 4GACA 4ZO9A 2WNQA 1UBSA 4LRTA 3HJZA 3VD3A 3AIUA 2PF0A 3GTHA 4PFHA 3XINA 4H9UA 4XK2A 3BG5A 3FEMA 1CCWB 2NXGA 3QJAA 1YDVA 4CD7A 3OGVA 1TA3B 4HSOA 1RH9A 2XYLA 1GPFA 1PO9A 4W9TA 4JTKA 1NIUA 2Z1WA 1B5TA 3IRDA 3W76A 2PFHA 3GC5A 3S1VA 3B8IA 2QCEA 4A3HA 2IPJA 1LP6A 2OFJA 4HQVA 3K5XA 1NDYA 5BU6A 3SUUA 1YNQA 4YTQA 3IK4A 1UP3A 2X7WA 4FF7A 1HGYA 2V5CA 1VZWA 2Z2UA 3VNLA 3L21A 4UFKA 1W9XA 3LS9A 1XIFA 4P7LA 1GOWA 3MP4A 1V4YA 1X1ZA 4ZQNA 4W4QA 5A8OA 1HIZA 1FWRA 4NZ5A 1ZAIA 3LI0A 4XUGA 5G4HC 2YBVA 1N8IA 1EWDA 2NVAA 1OCNA 2CCRA 4M8UA 1FP9A 1R0MA 1DVJA 4JTHA 1YDNA 2PTXA 4TX8A 3G1FA 4DXXA 1LWIA 3KVJA 3WFZA 2V82A 1GW9A 3FV9A 4B5NA 2Y7FA 4JTUA 2A3BA 3KRBA 4YCOA 3L68A 2ZTKA 3HJEA 4XIMA 1X39A 5FAGA 2CWNA 2FZMA 1I2QA 3FA4A 1DJIA 1I6NA 4JD4A 1RBOB 1J2BA 4BK9A 4REQB 1YXCA 2GWGA 5BRPA 3B97A 1SPQA 4GYPA 4MZYA 4IIDA 3ZMRA 1BKHA 3VOCA 1QPRA 4IH3A 1Q13A 4GYJA 1IIGA 1VYPX 1ITXA 4ECLA 4DUVA 3L4TA 4LAKA 4TVUA 3LCWA 3P82A 1O5XA 3DGBA 3W7MA 3RCMA 3ZWSA 4GZEA 2IPFA 3EXRA 2VCBA 2VD9A 4W8AA 1WDPA 3B9NA 3CQJA 4RDZA 4QAIA 3PTQA 4A8NA 2P76A 3E2RA 4GHRA 3H54A 2HVMA 1R7AA 1TA3A 5LZLA 3GG1A 3H7UA 3GXFA 4WDWA 4QX4A 3ZIZA 4PTVA 3W88A 3LU2A 3S5YA 3CUXA 3UG5A 3GG7A 5IM51 4WKHA 3LHUA 2WSQA 3K2GA 3K46A 3FFSA 1KGUA 3CB3A 3GXDA 1KC7A 3C2YA 2OO6A 2ZA2A 1JAKA 3BQ5A 4K39A 3WLKX 3AYVA 1VAHA 5D03A 3PTMA 3O0KA 4HYWA 4TR9A 4NILA 2XFRA 3TW9A 3MU7A 4KW2A 1TMQA 1H7RA 1QNPA 1PIFA 1HL9A 1OFAA 1H50A 3M47A 3TEVA 1PKNA 1SJAA 3MUY1 4XKYB 4LQ1A 2PS2A 3KOFA 4PUKA 3IV3A 1E15A 5FJTA 1XLCA 3SB0A 4H9YA 1FVPA 4WDUA 3B0YA 3PPFA 2PSNA 5FF0A 4NXSA 3GUGA 3UR7A 4W5ZA 3HQNA 1GT8A 3WL0A 1Q6OA 1VP5A 3GXTA 3CWHA 4F0MA 4FMVA 1S2WA 1OADA 5FD0A 1UJPA 4E5TA 2FB2A 1W3KA 4LBSA 1CXLA 1JCXA 4C91A 1VJIA 4H8NA 2OSYA 3C2FA 4JTQA 4JGDA 4KRUA 1SGJA 3STCA 4AISA 5E0KA 1MQQA 2J7CA 4GGHA 3IS4A 5FF4A 1J0IA 3VNMA 5I5RA 1K8CA 3W73A 3DIPA 3N9RA 4L6OA 3LPOA 5DLCA 5FACA 3W6YA 3PANA 2HVNA 1N2VA 1JJKA 1VRXA 4AZ7A 3LLFA 4LNYA 1UWAA 4W87A 1OIFA 3KZSA 1OEPA 3WQPA 3WD4A 3SCSA 3AHZA 3G1RA 1Q85A 4DXKA 3A3WA 1ZBWA 3KWXA 1AVAA 4NKCA 3TCEA 3KCOA 1S46A 4DJFD 3WJXA 1B9BA 1PDZA 4CN1A 3R8RA 2EGZA 3WBEA 1DHKA 1JFXA 1S3HA 3RIKA 1EH9A 5C7HA 2I1OA 4H4IA 3HO8A 3E5PA 3IVSA 3C3UA 4ENLA 3BK0A 5LGZA 1SYTA 1M03A 2JIWA 2CLEA 3LG3A 1AUSL 3FSUA 4H7VA 3LRKA 4QE5A 4P7NA 1X1OA 4U31A 3AS3A 3OP2A 4OJYA 1UIPA 2IW0A 3RNDA 3RM4A 4GO8A 4AH7A 4E2VA 1LROA 4GXPA 4DVOA 5T8GA 1F8IA 3VX1A 2GLKA 1Q4WA 2XIIA 1PBGA 3VNIA 1W1VA 4AVOA 2XH2A 4V2XA 3WF2A 4TV6A 4XZHA 4NIRA 2QXWA 1GQJA 1J0KA 3RF9A 1OX5A 2W0UA 3AO0A 4XKYA 4BF7A 2Y7DA 3DOPA 1XSJA 2AL1A 3EGJA 3RCNA 2LLEA 2W4XA 4W88A 2NX9A 4EAYA 3KTCA 1T8XA 2DVUA 1RLCL 7TAAA 4H6QA 1G7VA 3TJLA 3GR4A 2CXGA 3RJXA 1EJWC 3S5OA 1XI3A 2ZBTA 3O06A 2GUBA 4GH3A 4FIRA 2VX5A 3WF4A 2I16A 2C13A 3PC0A 3CIVA 3G22A 3VIKA 3RX4A 1HJQA 3WQGA 3PBYA 4I90A 2EPNA 2DVXA 3DG7A 4J3SA 1XYFA 3KTSA 4DBUA 1O95A 2TODA 3NTYA 1Q6EA 1XCWA 3CGTA 2EPHA 2XINA 4QCEA 1SZNA 2A4AA 4Q8UA 4EE9A 3NPXA 3NEVA 1JDCA 4Z1YA 4G56A 1UD5A 2R14A 3B05A 4QR6A 3W84A 2BVTA 2PBOA 4UNKA 4EPDC 4Q7BA 1WV2A 2O7SA 3L0KA 3S2CA 3E5BA 1CECA 5IBXC 3NO1A 5A95A 1A47A 3QV7A 4US6A 2OGYA 4AZ5A 1IR1A 1XLAA 3N2OA 4NJKA 1PZ1A 2HXTA 2R1NA 4MWAC 1JYWA 2B4GA 2OPJA 4XO6A 4Q33A 2YCLB 3AIRA 1KM5A 4PUNA 1VEMA 4JX5A 5E93A 2Z1VA 3CHEA 3ALFA 3FA3A 3CL7A 3IIZA 5A6JA 2G3NA 3W1NA 1D2KA 5CBBA 2YIHA 4NT0A 1WX0A 1FH7A 1XGZA 3PB2A 3GVQA 4RV8A 3B9AA 1RBLA 1OF8A 4WSKA 3N4EA 4AD0A 4UTWC 1MXGA 3DFQA 3VDAA 4KWUA 1TO3A 4PRWA 3I6EA 5M17A 2D0HA 4GQBA 1EGMA 1SW3A 1V6TA 1LLWA 3SURA 2IQ0A 3OO2A 4BQ5A 1O7AA 4JEJA 1TV7A 1W8GA 1V3MA 2PGWA 1S39A 4D8AA 4Q8MA 3IJLA 3REQB 5F1VA 3VD5A 3URQA 5A6TC 3B3DA 3E12A 3WK2A 3A22A 3V1PA 2WMHA 1ISYA 2EHHA 5LNUA 3DKJA 1O66A 2XSAA 1JD9A 4CNPA 1CT5A 1OG0A 3TA9A 4HZ8A 2CLPA 3TQKA 2GL5A 1GVYA 3HM7A 1R6WA 2B31A 2DQWA 1SFTA 4GUHA 3OVQA 3TTEA 4HPNA 1NWUA 3TLLA 4IMEA 1XLFA 4RZBA 1O12A 1J6OA 3C5QA 3WEZA 1A49A 5LNVA 2QMJA 1YX1A 4CCCA 3EAUA 1GOIA 1FWHC 3IARA 1N8FA 8A3HA 4RJEA 1YE4A 2PRMA 3LPPA 4E3TA 4FR1A 8RUCA 1FDJA 4JPGA 3NL2A 1KTCA 3JR2A 2UY5A 4ZFMA 3OB8A 3Q67A 3T2OA 1PKYA 2WAGA 3NEHA 2WPGA 1QNRA 4LF1A 1ONEA 2HJPA 3S1GA 3LRLA 3EOUA 3NQMA 1H41A 4H1ZA 1GYLA 3L5MA 5IFPA 4LC8A 1IT8A 1SSGA 1OFPA 1H11A 3P6LA 4QTGA 3WBXA 1TPUA 1N7KA 1Q5MA 4HK7A 4KH2A 3QN3A 4Q4OA 2HBVA 2XU2A 1NVMA 4AZBA 1IXOA 2FTPA 4Y6GA 6TIMA 4BEQA 4NI3A 3B8DA 2HEJA 4JQ1A 3GD6A 4X0VA 3KBVA 3V36A 5IXEA 5ENLA 3GXNA 1PIGA 3O6AA 2ASHA 1B90A 4ZR8A 3ARVA 3TR2A 2XVKA 3G6LA 5CLTA 5DCEA 2V3GA 2XH4A 3VIMA 4IL2A 2J78A 3SRKA 3R12A 5T26A 2DZUA 1Z9AA 2VOMA 4UFLA 4ES4A 4UTJA 3Q94A 3ARPA 1LUCB 3KRSA 3LUTA 4WJ8A 4O1AA 2QPXA 1OSEA 4EXQA 1Q6QA 4AF0B 2OX1A 3KVKA 4PBFA 2XIJA 1ADOA 1WOAA 2JEPA 4JQ3A 4WKAA 4XZNX 1CENA 1OGBA 1DJXA 3UQNA 2BZNA 4O1EA 3CV6A 1O6IA 3BUVA 4O18A 3HG5A 1GTHA 4O14A 3U7VA 4WF7A 3M07A 2X09A 2ON3A 1NP0A 2J74A 3CUIA 2HNEA 4U10A 5I09A 1I1WA 2Z1KA 4HNLA 2XIBA 2TYSA 3LNPA 3PPHA 4LVFA 3GIYA 2VEFA 2DT3A 4EOUA 2FHBA 4N9BA 4J7RA 3CNYA 3RPDA 2YPIA 5CPOA 3QW4B 1GOXA 1OF6A 3AJ7A 5C2CA 3MC5A 3EKLA 5EU9A 1IEQA 1YIXA 3M0KA 4UWMA 3SRFA 3OVPA 1B1YA 1XRSA 3KLLA 4LAOA 2FPTA 3BLKA 3ONBA 2BLEA 2EJ1A 1US2A 2F6UA 1KB3A 2SFPA 1AJ0A 1XINA 3AMDA 5AHFA 1EOKA 4EPKA 3FK4A 4ZEPA 4LCRA 3KS6A 3LV5A 2WJDA 1M1BA 5CLWA 4FXJA 3OG3A 2WANA 1XL9A 3NOYA 4NZFA 4NYUA 4H00A 5LA0A 1P43A 1QW7A 1H61A 3BAYA 3MHFA 4JIHA 3TWBA 1EGVA 4PCTA 3GHUA 3QMTA 1F05A 4GMEA 2NUXA 3AIVA 4I3GA 4L9ZA 4NZ3A 4EVZA 3LHZA 1QXLA 3UYIA 3UGRA 1H51A 1W9PA 3F4WA 3LX9A 3MZNA 5M2FX 1E73M 1Z89A 2P3ZA 1QI5A 1A5MC 3NDZA 1DQWA 3ARSA 3BSHA 3NA8A 3K8LA 1DEDA 3NZ1A 3RXZA 5RUBA 5LXXA 1XLDA 2Y6ZA 2BS9A 3S5NA 1TIWA 1MYRA 2DSKA 1XH1A 1HKMA 3BOXA 4LUYA 1YTDA 3GHTA 2NT0A 3TMLA 5CZ0A 4CQBA 2O4MA 1YBQA 3L2MA 3DHUA 5MKGB 2X1RA 4B4FA 3U3HA 4GI8A 1KM2A 3MYPA 3W1XA 1NTHA 3QMSA 2NV2A 3HGRA 3GXMA 1YEYA 4JTAA 1TPEA 4LBRA 4FNSA 2WM1A 4Q7NA 5HMEA 4B9YA 5DBTA 2DORA 1KWKA 1W9UA 3CZ8A 2GVGA 4F48A 2CWXA 2QJNA 4NI8A 3RM9A 2PDIA 1JXKA 3IPWA 5C6MA 1XC6A 4H04A 2ACRA 1F4HA 4YWIA 3VGDA 1W5NA 3T05A 1LT8A 3OGRA 2DJXA 5SWUA 4J27A 1UH3A 2PWGA 3KE0A 3QV6A 3LV6A 3K4DA 1YPIA 2X40A 1DXFA 4AHQA 4Z1AA 3UEQA 4GD0A 4JCMA 4PTWA 3CS2A 4GI6A 1CB7B 5J8LA 4A21A 1C8QA 1JNEA 3R11A 3M44A 4KIEA 4XD4A 3F5LA 5FJUA 1HP4A 4HSHA 3TJXA 4FNUA 4LTSA 1VEOA 2VZSA 5CQ1A 1EQPA 4RL3A 5EMUA 3Q58A 4KT2A 1VKFA 4WEVX 2NSXA 2X1TA 3TWAA 1KCLA 5EMKA 1GUVA 1SSDA 2A3HA 3PG9A 3QKEA 3R7MA 4DM2A 1IEWA 3G0XA 3KL3A 4MUPA 1KBLA 3UXAA 1DBTA 1REQB 4Q8PA 4GQQA 4KKXA 1T5AA 4MMWA 5IFTA 1A0EA 3NM1A 4CQDA 3SECA 3I4EA 1EJRC 1X8FA 4Q32A 4D1JA 5XIMA 4QLLA 3NYDA 4M7SA 1QPOA 4M56A 4D1IA 4UTFA 2WNZA 1W31A 2CU0A 1BQGA 2GVYA 4Z2LA 4FXFA 3VPLA 1AG1O 1XDJA 3C2RA 1DP0A 4X63A 2AQOA 4AY1A 4IJBA 3H8AA 2HDJA 2DH3A 4DWSC 1MEIA 3IIVA 3GVWA 4ML4A 2GSHA 4JDBA 2UWFA 4ZQMA 4ERGA 1JPIA 2ZC8A 3WLMA 4D9PA 4KRTA 1YDYA 1GKRA 4LVDA 2J66A 1BPLB 3HMJG 5DBUA 4UOZA 5DRIA 1UD8A 4MWAD 5C2XA 5KEZA 3UA3A 3QGAC 2XN2A 3PNZA 4H8VA 4V33A 3AHTA 5CGMA 2CZEA 5A2BA 4LXFA 4WOQA 3DFNA 1K7XA 2QDGA 4B5VA 1YKWA 3THCA 3UWWA 4QDMA 3IUDA 3ZLFA 4L9XA 3GU2A 1C91A 3ITTA 2B7QA 3BAIA 3L4YA 4ERIA 3GR7A 3FAXA 3SRDA 1O1ZA 3MSYA 4JTDA 5HMDA 3F2CA 3H23A 1NWTA 3PVFA 3QZ6A 1EGZA 3G1HA 3VOJA 3GW0A 3AZRA 1XGEA 1XBYA 1H3GA 4UMAA 4Y9PA 1T6MA 3EOOA 2VGIA 2ISWA 5AKQA 4WLCA 3UXIA 1EXPA 3KVLA 2ZKMX 3MMUA 2CBIA 2X1UA 4HU8A 1SO3A 4X61A 1KXHA 1XYMA 2WWDA 5K2ZA 4MOZA 2H90A 4IT1A 2E5DA 1JCJA 5AYIA 2HPIA 1PSCA 2ZYFA 3ABZA 3UYCA 3UWQA 4HIBA 1JGIA 3U5UA 1ZBKA 2Y7EA 3DAQA 1MNZA 1KD0A 4C6CA 1LL4A 4DB7A 5CZTA 1TUXA 3H4XA 4IICA 3W1TA 1ZAHA 1W3HA 3DESA 2Y61A 4HCDA 3VUSA 1G5AA 1NH6A 4W84A 4AW7A 3QTGA 3TYEA 3WF3A 3RGTA 3LSBA 4MVAA 4GYKA 3MO7A 3M0ZA 3JZUA 2JALA 1JRBA 3RYSA 3PZUA 5HBFA 2EAWA 4LUTB 3VGHA 4XX6A 4DF2A 1E6SM 4HTYA 3QV8A 3VNKA 1TPDA 2VFHA 4K2SA 4NQ1A 4HOZA 4PRTA 1JUKA 3SUWA 1JF6A 1SR9A 2A5HA 2ALDA 2R1PA 3RPTA 2QJIA 3FS2A 4ZB5A 4B3LA 3FOKA 1J96A 3O63A 7CGTA 4MIMA 2FFCA 5IDIA 1LL7A 3I4KA 3FYOA 1EYEA 2C14A 2POZA 1W9VA 2YOCA 5D9NA 5HJYA 4YVXA 2OZ8A 4E2OA 4MWAB 2V3DA 3A12A 3D46A 4Z1DA 4CQCA 3KFTA 4JTGA 5K9CA 1HF6A 2IQDA 2QUMA 3M64A 1A5BA 1V7YA 1CEOA 3PJXA 2E6DA 3WLSA 4LNCA 3V18A 3UNDA 3WYZA 4EPBC 2PWUA 5F4SA 3W6LA 3CMGA 5F7UA 3EKZA 3MUAA 3BW3A 3H24A 4RK8A 1ZTVA 2JFEX 1SQ7A 2ZX7A 4LH8A 4NAEA 1K8ZA 2NLYA 1QATA 4B92A 4S3AA 1QHOA 4I9JA 1FWEC 2GYIA 4Y9AA 2ATMA 1BF2A 1YYAA 4AX6A 2QCNA 3GIPA 3OHIA 5ECUA 2DZPA 2X8RA 2PPGA 5LIXX 1QNQA 4K8EA 4A05A 2DIJA 4FLQA 3W87A 4JEQA 1Z7AA 1W5OA 3P7YA 5DMLA 5CEWA 4IX0A 2V3FA 2CEQA 1RVGA 1RJPA 4IJRA 1MRAA 3AHXA 4B5XA 4XB3A 3WK3A 4WDTA 1DIOA 3UCQA 3VTRA 3ZJ8A 1C7TA 3BAJA 4RLIA 1W1ZA 3OHMB 2XUCA 3B40A 5DO8A 3E6EA 2VXNA 3CMFA 4V1XA 3MWCA 2J13A 3WQVA 1A5UA 2ZRZA 1QW9A 1VRDA 1WXZA 3TXVA 2QDDA 4FX7A 1V6XA 3CH0A 1VS1A 3G1XA 3VGGA 2DZBA 4CD5A 3TSMA 3GE7A 4ADSA 4Z2HA 4J3VA 4IMDA 4ZGYA 3QR1A 3RG6A 4ZVJA 1FBAA 2IKIA 2E3ZA 3UWEA 1XYBA 2NXIA 3DYPA 4W8LA 5FF7A 3T6CA 3MHUA 4O17A 2GK1B 4LUSA 4RNIA 2BHYA 3TYZA 7PTDA 3O16A 2OTDA 1MUMA 2BP1A 3GS6A 3NWRA 1F74A 5IBXA 4IGMA 1EHNA 4UTMA 1UPPA 3TK7A 2EPLX 4H01A 4F40A 3VKKA 4AD3A 2GOUA 3VC5A 4WR3A 3KEHA 4MWAA 1CDGA 2V30A 3BURA 2ACUA 5LNRA 4QG8A 3DC0A 2HXUA 1AZ1A 4C7DA 4F9DA 3UW6A 1TTIA 1ZS2A 5IHRA 3AIQA 4IFKB 2PD5A 4V28A 1W3JA 3LXAA 5A5WA 4IGNA 3A9IA 1K6AA 1EPVA 2WMGA 4MB3A 2V67A 4HVXA 5FOOA 4KERA 2B7PA 2ANUA 1CZ1A 1K9DA 2PLCA 3ARRA 3PS7A 5LHEA 2GJPA 4IMAA 3AICA 3QQWA 1VFUA 1TR9A 5KETA 1GQKA 4UTWA 5H8MA 2W63A 4QIUA 3POCA 2VR2A 4WOZA 4Y8FA 2QUNA 2ISSA 4NRSA 6XIMA 3O3RA 3S2JA 3P8IA 1PYFA 3C86A 2O9RA 1PZ0A 2VC5A 2YBUA 3W01A 2O9PA 2ISDA 3MKCA 4MZ8A 1EJTC 2UY4A 3GH4A 4XD6A 3WFAA 5HWMA 4D6IA 3B4YA 3PULA 3QLDA 4U4MA 2OLHA 3BJTA 3CO8A 3WUBA 3A4AA 4K8GA 3SCOA 2WHMA 3E96A 2VELA 1R3WA 3UZJA 4DYJA 4TTUA 3SY5A 4FO4A 1QHZA 1E4NA 1JCTA 2V2CA 5DT7A 2J9XA 4YL2A 1I2NA 1SZFA 4PN2A 2QCCA 1VFHA 4MPKA 3STEA 4W89A 1TPVA 3R4IA 1W1IE 1JD7A 3CHFA 3RMEA 2OGJA 5A8NA 1PTDA 1QVBA 3OYXA 3N18A 1LCOA 1I75A 1QOQA 1HO4A 3O6DA 1R38A 3E0VA 1P7TA 2R8WA 4FR6A 3BZGA 3E0FA 4HU0A 3DI1A 4JN6A 1NAL1 2BOGX 3NXLA 5DMYA 5CCZA 3BXWA 3U2OA 2PP1A 4NNBA 4IPIA 4XZLX 4NAFB 1E1CA 3HPAA 3DFHA 4KGLA 3CQ0A 2XIQA 4N9EA 2QIWA 1RQBA 4KWOA 2C0HA 1R9YA 3FX4A 4HPHA 2CKSA 4Y9MA 1D7FA 5MHBA 1WDDA 3H7RA 3N4FA 1BVWA 4MB1A 3TH6A 2PAJA 1FFQA 2ZDSA 4LC6A 3SQSA 1JCYA 4KRZA 4AEOA 4IIBA 2AGTA 2XVGA 1BYDA 1H7WA 3N3TA 1JVNA 1OYCA 4WXYA 1CI1A 1B30A 3EWDA 4M7TA 1C9WA 1AD1A 4AWTA 2ZTJA 5CKSA 1QO5A 5DF0A 3NVDA 2ZUMA 3BGAA 4B9ZA 5EPDA 3EMCA 4PUEA 5JH1A 3K1GA 1GHRA 4CQ9A 2W3ZA 4BHYA 1YNYA 1OT2A 1XHGA 2Z6IA 4O53A 4D6EA 1SZGA 4QDWA 2OYKA 3GDRA 2VEPA 3GC4A 3E49A 2WJEA 2OXNA 1OFRA 4P8WA 3GIQA 2C6QA 3UWUA 1LQ2A 4ACZB 3GHRA 3UESA 2XVLA 3KBNA 3SBFA 1PIIA 2VC9A 3TE9A 1RPXA 2FYMA 1QI4A 3W1MA 1UR0A 3LBCA 5HJXA 3VZXA 4S3DA 5E09A 3TU9A 3CO4A 3VDBA 4IJCA 4JY8A 5HANA 3BDKA 4QRNA 2QJJA 2PU1A 3ITVA 3WJWA 4JIQA 2YW3A 3COTA 3F4NA 3FXGA 4BA0A 3NZQA 3R2GA 1W3LA 1OZMA 2WB5A 1DE5A 1JI1A 3ZT6A 4K37A 1GZ1A 2V2DA 2GVEA 1E4IA 1VF8A 1JDDA 4UOQA 2UZ9A 1MDLA 4ZO7A 3LRMA 2EJAA 1HZYA 4QEHA 3B8UA 4XBJA 1YDOA 5AZ0A 5LHFA 1IT7A 5HAOA 1L8PA 1FWCC 4Q22A 2WHKA 4ZOEA 4HHLA 4DF0A 8CGTA 3BGGA 2JK2A 3TQPA 2A0NA 4GRSA 1TTJA 3EA1A 3P67A 4OUEA 4QISA 5CG7A 4C60A 1TWSA 1E6ZA 4N42A 1UMLA 1H63A 3CWNA 5GJPA 1L6GA 1Q6GA 3OBEA 4CKQA 5KZDA 5T91A 2VEGA 1J0JA 3PAOA 4E38A 3TYCA 2YB1A 2FZNA 1HKJA 3B8SA 4XZMX 5REQB 5AC5A 1OCBA 1T40A 1WUEA 2O4QA 1M3UA 4HMCA 1KTBA 3MY9A 1WDQA 4ZOAA 2PTDA 1QNOA 2WVUA 4IP5A 4IQEA 2GUYA 4S3EA 4JIRA 4LWWA 1EB3A 1RUSA 4A3QA 3OW1A 3POHA 4KEUA 2W91A 4JNYA 1X8CA 5A2CA 3BC9A 5CXPA 2IQTA 4XZBA 2CZFA 4JL1A 3V5FA 1J9YA 4ZQRA 2XN0A 1VPQA 3HQOA 1PX8A 2ONEA 1PYMA 2OQYA 4D6CA 3AMKA 5HULA 4RNHA 3CPUA 3ABQA 3VDHA 1I2OA 1YXYA 4LYPA 2YDAA 3G77A 1TZ9A 1GEHA 1XIDA 2PDFA 4R9OA 4GVFA 1K77A 4HD5A 1V03A 1BVZA 5L6UA 3W7GA 5H8UA 4M6PA 2YZRA 4JQ2A 3QFWA 4OUIA 3S5ZA 3NL5A 4XD5A 2QV4A 3SW6A 1UP0A 4AAJA 2J75A 1OVDA 3E9AA 5D09A 3CU2A 1YXDA 5D38A 3LHVA 2C19A 2HV5A 3G0SA 3PBMA 1SJDA 3WLRA 1SO5A 3MYOA 1RLDA 1AJZA 1E5JA 2C1GA 1XIIA 2V5KA 5HINA 1DHPA 4DWSB 2A6NA 4IUGA 1WXYA 4IIFA 1M7PA 3C4UA 2VURA 2BXVA 3T7VA 2DZXA 4UQ9A 3WLNA 2EF9A 4PEEA 1UHVA 1IZJA 4FLOA 4JHMA 3P60A 5KSWA 3ZT7A 1KBBA 7ODCA 3QC3A 3QY7A 1U22A 4UR9A 2ZCGA 1ZALA 1LJYA 1E43A 3PZGA 4MAZA 2QCDA 3MSRA 5CC6A 3NG3A 3EKGA 1XICA 1K70A 1EBHA 4EANA 1E71M 2WVSA 2V5BA 4GH1A 4MNJA 2XHYA 4M1BA 4QLKA 1X97A 3VI2A 3MHGA 4HP5A 4NXKA 3AOFA 1VD6A 4E8GA 2QCFA 1RCOB 2QULA 3SEPA 4B2DD 4MG4A 4CU6A 2OSWA 4K6AA 1FRBA 3QOKA 4AC7C 1ZCOA 2W5FA 7A3HA 3ABSA 3WQCA 3OLEA 1M6JA 4C6OA 4K7VA 4DPPA 3HV8A 4AD4A 3TIMA 2FH6A 2VFEA 5CC5A 4J1OA 1OC6A 2F38A 4RZ6A 2VGGA 1TRIA 1V6WA 4OT7A 3PNUA 5HDRA 1GVRA 2Y63A 4UTTC 3MKVA 1V6YA 1HVXA 5F2IA 1CGXA 2DZSA 5AN7A 2X30A 4MNMA 2VTFA 1MUCA 3NDYA 4S39A 1DJQA 1FWWA 2GQ9A 1TX2A 4E6MA 3T81A 4LANA 2YYTA 4G9PA 1NFGA 3T42A 1GYNA 2PLJA 1IWBA 2VI0A 1HX0A 2GJXA 5CSSA 1TZ7A 5JBEA 4HBKA 4IZGA 1H7XA 4UUIA 2ZOXA 2FIQA 1W37A 1H1ZA 1HJSA 4RDYA 1S2CA 4YYFA 3IAQA 1WZMA 2QUUA 5BROA 3U9IA 1JIBA 2BDQA 1DV7A 2VQTA 4GY1A 3TN6A 3O15A 1UCWA 3AJXA 1RY8A 1ZUAX 3WL1A 3UWYA 1OINA 1JQXA 2QVHA 4C6DA 3UJSA 5CPNA 3HU7A 1JZ2A 2Z4GA 1SJCA 4AXKA 3IIPA 1EYWA 4C7FA 2CYGA 2D1ZA 4DPQA 3LHYA 1ONWA 4AZCB 4DO5A 1XYCA 4C6QA 2F84A 4BF5A 4LAUA 3VOFA 3EB3A 2XM1A 1PZ3A 1RHCA 2XVPA 4WVXA 3IVTA 3W7IA 3WELA 4XO7A 2VP8A 2NQ9A 4CNSA 3T08A 3W1QA 3VIJA 4RW5A 3NSXA 1ZHAA 2PDLA 3CYJA 4F0KA 4L4LA 4O8AA 3CQHA 3M43A 4LV9A 3QM3A 3VKCA 1DTNA 5M1TA 3OEXA 3AUJA 5CZSA 3T2PA 1EUAA 3GNNA 4WY0F 1YHTA 3CV7A 2PDYA 5D2YA 2D2GA 6REQB 1NWRA 3W0KA 4LB4A 3W7KA 3AIWA 4JDYA 4H9ZA 3QY6A 1JNDA 3WENA 1BGGA 2E25A 5BYWA 3GDBA 1ISZA 4NSBA 4RCXA 2ZZ5A 2Q8ZA 3CIXA 5LXEA 3TFCA 5B80A 1K8XA 4AFYA 1R2RA 4IGSA 1OG6A 3BV4A 3W1LA 3QY8A 5CH9A 3QHNA 2BGSA 1LM1A 1LG2A 3VINA 2EXOA 4PUDA 3TAKA 4GNJA 4GXMA 1JF5A 1R46A 3GM8A 2VHLA 1JCNA 4W7VA 3W1UA 4JYEA 4BWLC 4JYDA 3GDKA 3DN5A 3S9IA 4A6GA 1L2UA 2VZVA 2ZE3A 3F4VA 2Y4SA 4YS1A 1QASA 3W23A 3Q45A 4Y90A 5AB3A 3ANUA 4JFTA 1VEPA 1E40A 3KS5A 1HJXA 1B4EA 2Z7GA 4B4HA 5T9CE 4EWND 1NDVA 2Z6JA 1H1YA 3UBPC 3ITGA 4LEQA 1CLXA 5I0DA 4JHZA 4AZCA 1JI2A 5JMUA 3MP3A 3GWQA 4AYSA 4RZ5A 2YA0A 4YU1A 3QXBA 1QPNA 2VMFA 4YNGA 3DFYA 3RX3A 1EL3A 1U1JA 4PTNA 3VIFA 4L4MA 1AH0A 3SY8A 1OQFA 3BGJA 4DX3A 4RNFA 3IWPA 3M5VA 2F2KA 4FAMA 1SZEA 3GHSA 3JU2A 1B3VA 4GIAA 4FXSA 4B2DA 3TC6A 1UKOA 2HTMA 4QG6A 1UW9A 3N6HA 3PWIA 4A8RA 2E8ZA 2ZXBA 3EWWA 4L80A 3F4CA 5C0QA 2VL4A 9CGTA 6REQA 3UJFA 4JFUA 3LHWA 3A47A 1K4GA 1D9EA 4I9TA 4ZE5A 2BMBA 4LEFA 3U4FA 3ARXA 3MKKA 2GOKA 3FA5A 1GPWA 2OWXA 5DY2A 4Z1BA 2PF8A 3N2MA 2E67A 4YVPA 1GYMA 1F6PA 1V51A 1GVQA 4HCLA 1H0IA 2YFNA 1XX1A 2GDUA 3WQEA 3AYTA 3LB0A 4WY0B 3FGCB 5I00A 4E8CA 1DPMA 1WXJA 4MFEA 4H83A 1A5SA 4GE8A 3TCSA 4H8UA 1IR2A 3CAWA 1LOQA 4ZFCA 5I07A 1QPKA 1MW1A 3N34A 4ZOBA 2R94A 4YPJA 2HK1A 4F2TA 3L4UA 1VFTA 1XH2A 2A2IA 5A8PA 5D02A 3NCOA 3RRAA 2E6FA 3O0FA 2CXEA 3R13A 4UMCA 4C6NA 3UZWA 2O7QA 3UZYA 1W54A 1R30A 3DKLA 5HA7A 2QGYA 3E0LA 4ZODA 3W02A 4A29A 1UZHA 5FSEC 2QIIA 2YR1A 2OMAA 4B15A 4DQWA 3VIIA 3EDDA 3BJSA 2WHLA 1FP8A 4KGJA 1K7FA 3SCPA 4AHOA 1VCVA 2QCMA 2FPVA 3QMRA 1AMYA 5CZKA 4O54A 3ME3A 1HN1A 1WOBA 3QBUA 2QDEA 4FOKA 3PJWA 3CJPA 1KM3A 3V5OA 1TTPA 3DFPA 5E6YA 4AU0A 4AEFA 4DYKA 2WYSA 3DBNA 4R33A 3MMDA 3UXKA 2VGBA 1BD0A 4YJ5A 1ICQA 1E9IA 2PA6A 1O5KA 3CBWA 2CBJA 1KFWA 2GPTA 3TNBA 2L5HA 2Y8UA 3A3XA 3ARUA 4JTIA 3UU0A 1B3YA 3THAA 2AKMA 3M0YA 3RK8A 1VPXA 4N6EA 4O1BA 4ZBCA 3BMWA 3G3MA 5CJMA 3PFRA 2Y2WA 4UTHA 1QO2A 4H3DA 3IJDA 1J6PA 2PDHA 4D6JA 4WY0A 4GISA 3W1AA 1E0XA 2TMDA 3R0KA 3LENA 1C3FA 1BYBA 1DTUA 3IJ9A 5ABGA 3GNPA 2XSXA 3ZR5A 2EBNA 1UG6A 2VNCA 1AFSA 3PY2A 3EXTA 3AXXA 3N9SA 3QPZA 3PP7A 3GG0A 5DX7A 5FEXA 3LLXA 1XDMA 4OBRA 5HATA 5C70A 2IKJA 2HRWA 5CAHA 3SUTA 3MSGA 2PDXA 3LCXA 1WPCA 4Y8EA 1QI2A 4AQLA 1TG7A 4DRSA 2ZDRA 3PR2A 1WUFA 3SGGA 1ZJIA 3O7UA 3TKFA 4B5SA 2HNHA 4PYSA 3UA4A 1IHIA 1HXJA 3BICA 1LRQA 3EXSA 5I3JA 2GUUA 1WE5A 2WJZA 1P6CA 4ICMA 4K1WA 4NX0A 1P0EA 3EMQA 3VAVA 5I3FA 4JZ5A 1XIJA 2HISA 2WQPA 3HQ1A 5U7SA 1H5VA 4PE8A 3DEQA 3T0AA 4Y9NA 1JYNA 3TFXA 5I3DA 1MZHA 2TAAA 1SZRA 3KDOA 3W7QA 4JXCA 3SCNA 3WUEA 1HG3A 4DBEA 4HNCA 1KFKA 4DZAA 1PKLA 1XWYA 1IT0A 3MSDA 4QJ4B 1UD3A 1XIGA 4ACYA 3MDWA 3T9PA 1S2VA 5G4WA 1Y65A 4DNMA 3KRZA 4EF9A 1UKPA 1E4MM 2JE8A 4LV4A 3NIYA 2YL8A 2WSYA 4LT9A 3AC0A 1MNSA 2C71A 1O5QA 4UB9A 3ZJ6A 1EXBA 1O60A 4AEEA 1V93A 2W92A 1NWSA 1XFBA 3PTDA 3OZMA 3TW6A 4E4UA 4QJ5B 2C79A 2OT0A 5E0FA 4E2DA 3RLGA 1S5WA 4DJFC 1Q45A 3VE9A 1X6LA 5F2MA 3W74A 4ZQPA 3H6OA 1FXPA 3DFTA 1GQIA 3VABA 4EACA 1SMAA 2E77A 2NX3A 4RXFA 3UZZA 4FLSA 1HVQA 1J2WA 4UZUA 2ZA1A 4NY2A 3TW7A 5DEZA 2VJXA 2OQHA 1BXCA 2V5LA 3W7LA 3GLCA 2D22A 3V16A 1F07A 2J9YA 2QPUA 3HURA 1TE6A 4ADTA 2EPMX 3OQEA 1R3TA 1GVEA 3A5FA 4BZYA 5FL0A 2EG7A 2A21A 3QYSA 3WUGA 2P10A 4IG2B 2NLIA 5FIPA 4GZIA 1R7OA 1EA9C 1T41A 3W6MA 1KW1A 2ZUTA 2PDWA 3OA5A 2TPSA 1W2PA 2ODOA 4DBWA 4ICCX 4FA3A 1H7NA 1EBGA 1TVNA 2G4FA 4Q7IA 3IGXA 1EWEA 4FS9A 2ZVIA 3DFOA 5FAJA 2YZ5A 2P88A 1CB2A 1AD4A 3NVTA 3SRHA 5HUOA 2DQXA 2AL2B 3CHCA 3LTYA 5E6ZA 4GIRA 1KO0A 1WAWA 1I2PA 1XS2A 4ZENA 3TSBA 4ZQCA 5A3HA 5T9BG 1E3ZA 2OU4A 4UMBA 3TYBA 3DFSA 3P0WA 3IK2A 1TTQA 4AB4A 1AA1B 3VE7A 3AUOA 1RXOB 2VVNA 2GWNA 3ZLGA 2O56A 4RW3A 3THDA 3M0LA 3BAKA 5BZAA 4O28A 3VZZA 1QMLA 2HROA 4O19A 1G1YA 4XAYA 3UJEA 3AU6A 1E55A 1XYZA 3U2CA 3BW4A 4WZHA 3BSGA 4I7WA 1VBUA 4MYAA 1XBVA 2OOFA 1LYXA 1ALDA 3JVAA 2QAFA 1IQ8A 3ENLA 3WLTA 1XUUA 5BMWA 1DIDA 1NDZA 3GZAA 3TLQA 2C3ZA 3JUGA 3IACA 4P61A 4B3KA 4DXVA 1OT1A 1RJQA 3KP0A 3NPUA 3TA6A 1HO1A 2WZTA 4F9JA 1P0NA 3W81A 1RK6A 3QZAA 5XIAA 3G1YA 3THUA 3NQGA 1JUBA 5CPMA 4U3CA 1TPFA 4H6EA 1F3XA 4CNTA 5J04A 4N02A 3L4WA 4QP0A 4ZO6A 2PDPA 4E2BA 1AL7A 2Z24A 4IHCA 1EP1A 2YKKA 3CZEA 5K9XA 1EHAA 1G69A 1Z3NA 3OQ8A 1GVFA 2VKZG 3PN8A 4O0QA 2NX1A 2ZADA 1PTAA 1VLIA 5DCDA 3M0XA 5AC6A 3TOYA 2GDVA 2PTZA 2PTYA 4HN4A 2ABBA 1V6VA 2E28A 3EB2A 1RZMA 2QV5A 3P93A 2AQWA 4GY0A 1V02E 3L2LA 3CL8A 2AMGA 4C6IA 2C7FA 3NQEA 2QMKA 1B3XA 3VKDA 3SY1A 4Q4SA 4WUIA 3W2KA 2RHGA 1FKXA 1XD0A 2PDQA 2WXDM 1EDQA 2ZX5A 4AVNA 1VH7A