3WJWA

Wild-type orotidine 5'-monophosphate decarboxylase from m. thermoautotrophicus complexed with 6-methyl-ump
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 86
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wjwA00
2P1FA 3C2RA 1NAL1 4WXZA 4N9DA 3N34A 4XQ6A 1OFEA 1TV5A 1TV7A 2FFCA 5FEZA 1JCJA 5C2XA 2E6DA 1GYNA 4N9BA 1A5AA 3LB0A 3G18A 2BTMA 3EX3A 5AYYA 4YXGA 2VEKA 3TQ0A 3S5OA 4NNCA 2BLEA 5D2YA 3LTSA 3HBLA 3W7MA 3P81A 2XN1A 1F74A 5L6UA 4WY0F 2C3ZA 3HGRA 3VFLA 1KM4A 2V9DA 4UC5A 4UMBA 5EBUA 3QMRA 3W6YA 4KWWA 1GEQA 4K36A 2H3DA 2CLIA 3HMJG 3STEA 3TK7A 2Y7EA 3A21A 2YZRA 1LBMA 5TIMA 3HB9A 5BMWA 4GC4A 1TV8A 4Y6GA 2VELA 1GPWA 3L9CA 3B0UX 3LI1A 1OF8A 2YW4A 4J9JA 4NJIA 3LHZA 3M41A 5KTLA 1HO1A 3PUOA 4JTJA 1GVSA 5HMSA 2YDAA 2PC4A 2QCDB 3HG4A 3NQEA 4LV9A 6ALDA 4ADTA 2OCZA 3H54A 4ZQOA 3TROA 1DJQA 3CEUA 4U4MA 4QAIA 3UXDA 2ATMA 2TSYA 2Q8ZA 1K8YA 3C52A 4FNQA 5MHBA 4IPIA 1JUKA 3IIVA 1HG3A 3PS7A 4FX7A 4JGDA 4QM1A 4JEQA 3TKFA 1XKYA 4FNUA 3W86A 4JTKA 3NQ8A 3IRDA 4Q33A 5AHFA 4AF0A 4ONVA 3TSBA 4BI6A 1W3NA 2LLEA 3UPWA 2DZXA 3NO5A 3GX9A 3SJ3A 1IXOA 1H7XA 4JTGA 4IMEA 3E0IA 1X1ZA 3N2MA 4LVFA 3THAA 1TPB1 3TQKA 2QCHA 2QAPA 1JCLA 4MJZA 4ICNA 4S1FA 2WKJA 3NQ7A 4BWLA 2E68A 3UWQA 2WNZA 4WXYA 3G24A 2H3BA 1JRBA 1BTMA 1TB3A 1QO2A 3TAKA 3W71A 3BGJA 4WQ6A 3R8RA 2QUUA 1WDWA 4H3DA 4AH7A 3S5ZA 4O0ZA 4P2VA 3NEVA 3G1AA 4E2DA 2C15A 3INPA 3GLCA 3O8AA 3W7CA 3QPYA 3L68A 4HKPA 3O6YX 4YL2A 4HPXA 1XC4A 2Q3RA 3W7RA 2NXIA 4IGHA 1H7PA 2A0NA 3A24A 3DKJA 3R13A 2ZZ2A 2CZ5A 2BSLA 1ME7A 3G1FA 4UTKA 1ZAHA 2E6FA 2ZDRA 2ZZ1A 3S8HA 5D2WA 1SFLA 5H2ZA 3G8EA 3TA6A 4NXSA 2W0UA 5HWMA 1QOQA 3V75A 4A2RA 4JTTA 4JDBA 3SZ8A 2ZZ5A 3T40A 1Z41A 1VS1A 1F6KA 1N8FA 5TBOA 3E12A 1A5BA 3IVTA 1P5BA 5C6MA 5FESA 1B4KA 3TQVA 2YYTA 3LXAA 3M5YA 5F2IA 3FYOA 2GQAA 1W31A 3T4CA 2HS6A 4AXKA 3UWYA 2QJHA 4HIBA 3BK0A 1EEPA 3NQFA 1RD5A 2PURA 3NZRA 1W5NA 2EHHA 1VHCA 4O52A 1TRDA 4WUIA 2A4AA 4XKYA 1AW2A 4PODA 3GAYA 2NZLA 4UTHA 1WBHA 3GDMA 2WOQA 1YADA 2DZUA 2PE4A 1V5XA 4PFMA 2W79A 3ABQA 1LROA 2Y62A 1LRQA 5G1TA 1G7VA 3S6DA 3M47A 3L21A 3N3MA 4KFOA 3P8IA 4Y90A 3HPSA 1WX0A 4C1KA 2R14A 1UUMA 4ZVJA 4A29A 1ZAJA 1Q45A 1GTEA 4UTUA 4Y9AA 1TTJA 3NL6A 3RNDA 5TQLA 5I3HA 2XN2A 3I7RA 3PF3A 4DO6A 2CLMA 4EF9A 4DO4A 3CQ0A 4JIQA 2FQIA 3TAOA 4M6VA 2JKEA 4IQLA 1TO3A 1SZEA 3FA5A 3FJLA 5DBTA 2AAMA 1Z48A 1WQ5A 4Q4KA 3EKZA 3G3DA 4QISA 1KFJA 2TPSA 1IF2A 2H8ZA 5K9CA 1M6JA 4MZ1A 1H7WA 1XCFA 4GXMA 4O18A 2ZBTA 3FEMA 1RQBA 3BPWA 5AC8A 4R53A 4GUFA 3PB0A 1QDSA 2A5HA 3S0CA 3P8JA 1R47A 2ZCGA 3D0CA 5AYZA 1JCNA 2EGZA 5KITA 1RQHA 2BXVA 3UZ5A 1EUNA 2Z0IA 1OX4B 2G96A 2QDHA 1F76A 1KBJA 1AL7A 2ZRWA 2J6XA 1SO3A 1TPWA 2A6NA 1XM3A 2Y6ZA 4IUOA 4GUHA 4RZ5A 1N7KA 3G1SA 4AB4A 4MLJA 3GVGA 5G2HA 4IXHA 4JDYA 4RJEA 1ZFJA 1FUYA 1B9BA 1G4SA 1LBLA 4RCXA 3O15A 5HWNA 2QR6A 4DELA 2P0OA 1H5YA 5A8GA 3PR2A 5E0KA 3L0KA 2V81A 3PBYA 1SUXA 1EP3A 1FXQA 3L2IA 4JTHA 5AHIA 3NA8A 1SW7A 1ICQA 4BK9A 1U83A 2QKFA 1VYPX 4X22A 2QCEA 4WOZA 1PS9A 5K4XA 4W9TA 1MEIA 5U7SA 3G22A 1OFAA 1NSJA 4ZQMA 3VCRA 3ZFHA 1JQXA 5DY2A 4IJBA 3R12A 4JD4A 4ZQNA 3M6YA 1LLZA 4JYFA 1F05A 3CU2A 2ZZ6A 3I6RA 2C14A 1PL9A 3BW3A 2NX9A 1LP6A 1F5ZA 4UTIA 1VRDA 4ZQRA 3KFTA 3TMLA 4JY9A 4AHQA 1O94A 2WJZA 3SGUA 4UFLA 5KZEA 3W07A 4OHQA 3TMQA 1O5XA 4NXKA 1JR1A 3HGOA 4B5NA 1R2RA 4WY0B 4RR4A 4HNVA 4NNBA 2GPTA 2O7SA 1T99A 3L5AA 4DO5A 2GUUA 2QDGA 5EA9A 1H7NA 4K39A 1ICPA 3WJZA 4AHOA 4UMAA 2C19A 4HSNA 3CC1A 5I3JA 4FO4A 5BMXA 4E2BA 2RFGA 3SIZA 5LGXA 2CLEA 3P74A 3B03A 1TREA 4WD0A 3EWYA 3I7QA 2CWNA 2NXGA 1XDMA 2R91A 3N19B 2FLIA 2PRLA 2Z6IA 4PL2A 3W7KA 1QOPA 4A21A 1I2NA 4OGZA 2DU2A 1GVQA 3OVPA 1V7YA 2HSAA 3KRSA 4IXXA 4JTLA 3GZ3A 3L65A 2X1UA 1YPFA 3LI0A 3W7PA 1UJPA 3MWAA 5F4SA 5HR7A 4FNTA 1TJPA 2VEIA 1G7UA 2ZRUA 4UTMA 4O1DA 4QNWA 4FXSA 1FBAA 4IMCA 3TE9A 4IWWA 1AG1O 4ORMA 3P5ZA 2BX7A 3RLVA 2ABAA 3DAQA 1FWRA 4JTUA 3GK0A 4GWEA 3A5VA 1TRIA 5K2ZA 3BLFA 2VENA 3W1RA 1K03A 1WBJA 3C2FA 1LM1A 1I45A 3GIYA 2RHGA 1QPOA 4EF8A 4DPPA 3ABOA 4K8HA 3MO7A 2ZRVA 3G1YA 2R8WA 2CFFA 3UY7A 2RKXA 2YFNA 1A50A 3M43A 1QWGA 3SR7A 4Y96A 1ZAIA 3FFSA 4XBKA 1Q3NA 3VI2A 5AB3A 2VEMA 2CLLA 3MYOA 3PWAA 3W88A 1TQXA 3JRKA 4NZFA 3S1UA 4KWVA 1Z42A 4N9CA 2Y7GA 3M5ZA 3TCEA 1R30A 1XXXA 4MFDA 2GVLA 3TV8A 1NEYA 3Q94A 2A7RA 3EXSA 2E5CA 4QSHA 1JUBA 3EWUA 4I7VA 5G1YA 5G5IA 2A1YA 1G6CA 2QCNA 4LVAA 2NUWA 2B7PA 4UR7A 3W7HA 3A5FA 3PC0A 5LZLA 4AAJA 2FDSA 2Y70A 1FCBA 4Z08A 4O17A 1T96A 4UFJA 3STGA 1TTPA 3NPWA 4I7UA 4WZHA 1OHLA 5CZ0A 2CLKA 2ALDA 1YXCA 3PUDA 1SO6A 2I14A 5F4WA 1XUZA 3QW3A 3TJLA 1LTDA 4CCEA 2Q8LA 1H7RA 3QF0A 4EOUA 1EUAA 1TPC1 5D05A 1XL9A 1I4NA 3HGSA 3W2LA 4LS2A 3N9SA 3FS2A 3H53A 4MPQA 1LRNA 5C55A 4UNLA 5CZJA 4TIMA 1GG1A 4ML9A 2X1SA 3DH7A 5U4NA 4LRSA 4GNJA 2A7NA 3ZS4A 2ZTKA 4RZ6A 1SQ7A 3TUUA 4YCOA 2QF7A 1OX5A 1QPRA 2Y7FA 3CPRA 4N6FA 5I3FA 1LYXA 2ATSA 1W5OA 2A2IA 1LCOA 3PY2A 4O12A 5DCDA 3G1HA 1GWJA 3M0ZA 1DQWA 2E5DA 3N2XA 4N4QA 4S2CA 3W87A 4QQ3A 5EL1A 4HT3A 2CU0A 4JTIA 1WOAA 1G4PA 3MUXA 4KKXA 3BVJA 1THFD 4ADSA 3RK8A 4JYEA 4M19A 3GDLA 2A6LA 3S9YA 1OYAA 1SZGA 1TPFA 1KM0A 3HF3A 2VXNA 4O8RA 3CTLA 1OFDA 2NWSA 3S42A 2WSRA 1EPXA 2P10A 5HR6A 3LXBA 3W9ZA 1KV5A 4BR1A 1BWLA 3JR2A 1Y0EA 1EX5A 1F6PA 2YR1A 5KZMA 1QMLA 1AW5A 3OVQA 3NQ2A 1W5QA 4LC6A 4JN6A 3OHIA 4DXVA 2QCMA 1J5TA 5CG7A 1CI1A 4PC8A 4TO8A 4FX6M 3LLFA 3M16A 4N4PA 3ZWSA 4XKYB 3HG5A 3PBUA 1JQVA 3S1XA 5DXXA 2QCLA 1EP2A 1O95A 1SR9A 2ZRZA 3U2OA 4CCCA 1A53A 1TYGA 3QW4B 1JRCA 3TR2A 2V8ZA 2QUVA 1YDVA 3FKRA 3IEBA 2Q3OA 5FI8A 4LS0A 3T55A 3W72A 2ZZ4A 5EYWA 3STFA 2V82A 2VFDA 3GAKA 1OX6A 5CZTA 1WAUA 3NL2A 1TSIA 4HNTA 1I8JA 3CM4A 3FLUA 4NJJA 1QPQA 3DI1A 3TDFA 1O60A 2V0TA 3W1LA 2CLOA 3L0NA 1AL8A 4POCA 1KFCA 5DN1A 3ATYA 3NM1A 2X30A 1OABA 5HULA 1EA0A 3OG3A 1JCXA 3W7JA 4MJMA 3MHFA 3PBVA 5J5DA 1TPEA 4M6QA 4FNRA 1TMHA 4O0KA 3O16A 3NGJA 1W5MA 3EEGA 4JS3A 1QNVA 4CNOA 3R5EA 4PTNA 4CQ9A 4K7VA 3QMSA 1YPIA 4O1BA 2HMCA 4OU1A 4FX8A 2QAFA 3G0XA 2ISSA 4ZL1A 4JXCA 4QNEA 5LKYA 2BZNA 1DJNA 4QITA 5IM51 2J9ZA 1D3HA 1VLWA 1OK4A 1HL2A 1W3TA 2F7FA 1ZHAA 2RDUA 2WV8A 2ZYFA 1OFPA 4O53A 3P67A 1XFBA 1IGSA 4LU0A 1Q6QA 3BARA 4UIOA 2F84A 3LHVA 1PE1A 4LC8A 4NX0A 4YWIA 3G1DA 5DCEA 1P0NA 3NAVA 4BFAA 1K8ZA 3GR7A 3CWNA 2UV8G 3EKLA 3ELFA 4LV4A 4UFHA 1GQNA 1OYBA 3KX6A 1TPDA 1GG0A 3GNDA 2OT1A 4NJKA 1KM3A 3EWXA 4U28A 5DXYA 2OT0A 3MHGA 1TPVA 1KBIA 3WJWA 1LOLA 4AVFA 2C0AA 1JVNA 3GDTA 4DF1A 2AGKA 4CCDA 3O63A 4JTFA 2DJXA 3LERA 3KHJA 3Q2DA 2C6QA 1D9EA 2Y61A 5C5YA 4LVDA 3DGRA 1VH7A 3GXPA 1KTNA 4RX0A 1SW3A 2J24A 4UUIA 3NPXA 4MYXA 4LVGA 5GVJA 1XI3A 2KZHA 2WSYA 3P60A 4IPJA 1TPUA 1E51A 3THQA 3TJXA 1VYSX 2JGYA 3EXTA 3RLUA 3VKJA 7TIMA 4OBTA 2V5BA 3G1XA 3LV5A 2DZWA 4IMGA 3W74A 2Z6JA 1VCVA 1ZENA 4MZ8A 4O28A 4NU7A 5HUPA 1ICSA 4FNPA 3W3OA 3SY5A 1W0MA 4PEKA 3NL5A 3P82A 1UCWA 4HNUA 2VEPA 2DZVA 5FF4A 3KVKA 1GVFA 3SSJA 1IXQA 3W85A 1O4UA 3QMTA 1L6SA 1PVNA 1F73A 3LDVA 2NXHA 1OFQA 2NUXA 3BW4A 3PG9A 2ZFAA 2CZFA 1KM5A 3L66A 1ME9A 4HSOA 5D32A 2YYUA 2GVJA 2DZPA 2NV1A 4DQWA 3C6CA 2CZEA 1VHNA 1MXSA 1IXNA 3PULA 4HHPA 4WOQA 1I2QA 1PHWA 5DCBA 5LNWA 5E1QA 2A85A 5D2XA 3W7IA 2RDTA 2Y89A 5A5WA 5D03A 4CNPA 2OZ0A 5F1VA 2YXGA 1L2UA 3EX4A 1F7BA 1VC4A 2GVGA 4IOTA 1J4EA 1H1ZA 3MJYA 3RFAA 1GZGA 5D38A 4RXFA 3EWZA 1FY6A 4BF9A 1KM2A 1QAPA 4GUGA 3W22A 2ZRYA 1RPXA 3WJSA 4LT9A 4UTTC 1TQJA 3DFNA 1S3HA 1CX9A 3BLIA 1LDCA 2ZZ7A 3O07A 3LCXA 1PHQA 1UB3A 1WOBA 2X1TA 2A7PA 4O10A 3PVFA 4Y8FA 3MP5A 3SGZA 3IGXA 3NDOA 5KSWA 3HPXA 3QEZA 1K7EA 4E0CA 5C54A 1KFKA 1Q6OA 1YXYA 3C56A 3W75A 2ABBA 5D2VA 5AOUA 3W76A 1PV8A 3W7GA 4L4LA 3CWOX 4K7YA 1SO5A 3LLDA 1VYRA 4OQVA 5FEWA 2WNQA 2NX1A 1MO0A 3TSDA 3TXVA 2C1HA 5AHEA 3S1WA 1ZNNA 2DZTA 1NF7A 1BKSA 3KAOA 3KRUA 2FB2A 4MLRA 2X2GA 1YDOA 4JX6A 3WJYA 4E38A 5CKSA 2ZQ0A 3MMTA 4OWGA 1FWWA 4PCFA 3E49A 6TIMA 1ZALA 2E6YA 3B8DA 1C8VA 3G1VA 1DOSA 2ZA1A 1SU5A 1OFBA 1CW2A 4FIQA 3GYEA 1S5TA 1LOQA 2PCQA 3FKKA 3CLMA 3PSWA 3I65A 1H61A 3UD6A 3N73A 3TW7A 1FCUA 4ZMGA 1AK5A 3HQ1A 5FEXA 3BLEA 4TMBA 4RK8A 3LCHA 4L4MA 4UFMA 5T26A 2X1RA 1VPXA 2NUYA 3W1PA 3G3MA 1KTBA 3E02A 3HG3A 3W7EA 1IIHA 3DBPA 1XBXA 1H63A 1QPNA 3F4WA 4H4IA 1W54A 4GE8A 3A9IA 3WK2A 3ABRA 1KM1A 1XBZA 3MP3A 4KFNA 3U8GA 3NL3A 4MZYA 2JKPA 3DFOA 3W1AA 1GVRA 2FJKA 1ZY9A 4UTWC 4PH6A 3N14A 1KA9F 1P4CA 2V5LA 3B05A 2FB3A 3K30A 1ME8A 2EAWA 1QO5A 5D30A 1VJIA 4LUJA 4Z0SA 4G1KA 3W1TA 3O6CA 1H51A 3GDRA 3NQCA 8TIMA 3EWWA 3BG9A 1FDYA 1ZCOA 3P5YA 4AHPA 1VQTA 1K7XA 1L6YA 3TH6A 4UNKA 4YMZA 3EWBX 1DVJA 1WYIA 3QM3A 1OK6A 2VFHA 3T44A 3W70A 3NG3A 1RZMA 2YX0A 4IX2A 1MEHA 1OYCA 3NR0A 3QH2A 5HUOA 4P61A 5AC7A 1L6WA 3NQ6A 4M6PA 3UYCA 3BGGA 3BG5A 2H8XA 4LTSA 5I3GA 1SFJA 3W7NA 5LNRA 2A21A 1H62A 3IV3A 3LTYA 3SECA 2GQ9A 1X6UA 4GJ1A 4JICA 3LGEA 2ZTJA 5BNKA 1BEUA 5CPOA 2V2DA 1P1XA 3QSTA 4NNAA 3W2UA 3WK0A 4QJ1A 4LS1A 5CSSA 5K7JA 3NM3A 2VFFA 4Q32A 3U6WA 3L67A 1TTQA 4AF0B 4NJHA 1FXPA 2Y85A 3G0SA 1F2JA 4MY1A 4OE7A 1TPH1 5HINA 2Y7DA 4ZZ9A 4JX4A 1W1ZA 4DPQA 3M44A 1I2RA 3LRMA 3LOTA 4XTIA 1VCFA 1M5WA 3O05A 3I68A 3LRKA 4NUWA 1PIIA 4CLMA 3M9YA 1C9DA 4XUGA 4DBDA 4K37A 4WY0A 1YTKA 2B7OA 3DENA 1H1YA 3MBFA 2D73A 3M1ZA 4YLWA 5EPDA 4KFPA 4ORIA 3B0PA 3CHVA 4YCPA 3DZ1A 5D04C 1W3IA 3S1VA 4O19A 4D2JA 4AWSA 1KFEA 4FF7A 3QSRA 2CW6A 1IXPA 5LNVA 2DJLA 1H60A 3W23A 3NQGA 3MHUA 3W1QA 2WNNA 3W73A 3W7OA 4XTDA 3O1NA 2YW3A 1RQEA 3SI9A 3HOJA 4FEZA 3UQNA 4ZQCA 1B3OA 3NXFA 3C3NA 2H6RA 3F4NA 4UFIA 3VE7A 3VNDA 3UPBA 3PM6A 1DL3A 3KVLA 3A22A 3P7YA 3CIXA 4NJGA 1EWDA 1R2TA 4ZQPA 4MY9A 3W83A 4EWND 3DFTA 3FYPA 4IMDA 5L9FA 5HWJA 5CPMA 4K6AA 5CPNA 5IBXC 3DFQA 5G2WA 2X16A 3HJZA 4ADUA 2TRSA 3M5VA 4O1AA 3QPZA 4PA8A 3QC3A 4DF0A 2AQWA 1K3UA 2NX3A 3W1NA 3QQ1A 2DP3A 1WV2A 5LGZA 2V2CA 3KVJA 4O54A 3DKLA 3GXTA 5F2GA 4NQ1A 1YLVA 4A22A 3VE9A 1RV8A 4FNSA 3ABSA 3W84A 3Q37A 4MY8A 3NOEA 1S5WA 1YTDA 3DI0A 3NQMA 1X7FA 3LV6A 4RXGA 1XBVA 4N2YA 1LBFA 1OFOA 4X9SA 1GJPA 4TMCA 2Y88A 4WJEA 5G4EA 4JTSA 1D3GA 3BW2A 1DHPA 4AWTA 3ATZA 5AHMA 5SWUA 5BRBA 3W2MA 4HPJA 1HUVA 1RVGA 2FTPA 4MIMA 3B4UA 3UNDA 4LY8A 1ONRA 4CNNA 3OBKA 1FCQA 3IGSA 4K38A 3T78A 2DZSA 5K3VA 3LTPA 3LHUA 3UZJA 5F4XA 3B04A 5G4WA 3ANYA 5K9DA 2YFOA 4X2RA 5AN7A 1U5JA 2GOUA 3F03K 1EIXA 3MBDA 2NLIA 3NPUA 2BWGA 3UWWA 2WSQA 1GT8A 1NF0A 4M7SA 4JTEA 3E96A 1NVMA 4MFEA 4LWWA 4IMFA 3QZEA 3TX9A 1PCKA 3HGJA 3F1QA 4Z1BA 5EMUA 4X3ZA 4XBSA 3UWUA 1YXDA 5E93A 5FF3A 4DEFA 3TW6A 4R33A 1YYAA 1QFEA 1J2WA 4WX2A 4Z1AA 1AMKA 1FX6A 1W37A 3GKFA 3PSVA 3MI6A 1FWNA 3DHFA 2VC6A 3NZ1A 1UBSA 3UY8A 1FWTA 2VKZG 1SO4A 1C29A 1HO4A 1HFBA 5LHEA 2QCFA 1YTEA 3CIWA 3FJ6A 2RH9A 2VOMA 4JX5A 3W2KA 3C8FA 3WK1A 1AW1A 4M5PA 3MI3A 3NNTA 3GKAA 2YSWA 3LM7A 1P0KA 4AEOA 1TJRA 1DORA 4JY8A 5AFDA 1LRTA 2VFEA 4UMCA 3OEXA 1M7OA 2E09A 5D33A 3LHTA 5LNUA 3TC7A 1JUEA 2VFGA 4O14A 3UWVA 4BWLC 1R46A 3E9AA 1VGAA 3MYPA 5I3KA 1VCGA 3KRZA 1WA3A 3IIOA 3KOFA 3QJAA 1EB3A 1MSSA 3OIXA 2PRHA 5H91A 1RR2A 3M7WA 2H90A 1G67A 3CEPA 3HPZA 3PBWA 4NT0A 4R7JA 1N55A 4BI7A 5AC6A 4LOCA 5F2MA 3WJXA 4JR5A 5DLCA 4O57A 3LBCA 5CGQA 2B0MA 3TFXA 3HG2A 4RV8A 4I7WA 5F2LA 2ISVA 1MEWA 2QCDA 4O15A 2VFIA 2V30A 4DBEA 3EB2A 3CT7A 2CZDA 1OFRA 4S2BA 1H50A 3NQAA 3LCWA 2Z1BA 2V2HA 4TX9A 3USBA 1XBYA 2CLFA 3Q58A 3QYQA 4FHAA 2OMAA 3PB2A 1KW1A 2I9EA 1BWKA 3BO9A 1T0OA 3L5MA 2JBMA 4CQ8A 3WK3A 4FB7A 5BOOA 4UTLA 2ISWA 4JIPA 1S5VA 4LNYA 3TC6A 4O1CA 3V1PA 3B0VC 2YGYA 2QEZA 1FDJA 3HO8A 1FDZA 1YDNA 1SSDA 3UWZA 2HTMA 4NVTA 4FXRA 4M7TA 2ZRXA 3DXIA 3GNNA 3PAJA 3C2VA 2DORA 4UTTA 1L9WA 4A2SA 2QJIA 1M7PA 4O13A 3HIJA 5CPLA 4Z1CA 4O4VA 5K9XA 5G2IA 5FF7A 3W7DA 2EKCA 3LRLA 1FWSA 3FIGA 3LCGA 3M5XA 2XFWA 1OG0A 4N9EA 3OA3A 1I2OA 1LZOA 3EX6A 2RDWA 3MW7A 4MYAA 2QCCA 3BG3A 2IQTA 3IGUA 1X8FA 3IVSA 5KZDA 4GUJA 3RMJA 4N6EA 3N9RA 5AHNA 1KLYA 3IIZA 3NQDA 3AJXA 2OJPA 4O50A 4H6KA 4HN4A 2R94A 4TU1A 5LNSA 2GJNA 3LCFA 4O11A 1HTIA 1DBTA 5HQEA 2GQ8A 4A3UA 1VLIA 3R2GA 3P80A 3P62A 3W1XA 1B4EA 3PG8A 3AO0A 2C16A 3IVUA 2JKAA 1KLZA 2WPBA 2TMDA 4UR8A 4GUIA 1GVOA 1UASA 3R89A 3H55A 4GBUA 4NZJA 2WQPA 1W56A 3TNOA 4HNNA 4BI5A 4LVBA 1KTCA 2ZA2A 3LHWA 1SW0A 4I9AA 5I3IA 1GYLA 4Z1DA 2B4GA 4OT7A 3GB6A 4LRTA 1GOXA 5HJLA 3O06A 3RF9A 1R2SA 1Z44A 2ZZ3A 4O4WA 3P84A 4JNMA 1K8XA 3W2JA 4OV4A 3SW6A 4QIUA 2YCEA 5D2TA 1OVDA 1PCWA 3T7VA 1SZNA 3PUEA 3O6DA 5KINA 2FPVA 1DQXA 1JCMP 4R34A 4DF2A 5ABTA 2FPYA 1W8SA 2CLHA 4UTWA 1EWEA 5D37A 3KXQA 4MKNA 1W5PA 2W6RA 4LUIA 4GRSA 4TR9A 3S5NA 3NVTA 3STCA 1KM6A 2E77A 2I1OA 3B06A 4UFKA 2G5WA 5FF2A 1OF6A 2J9YA 2B7NA 5AHLA 4AMAA 1GTHA 3TXZA 1T8XA 1VR6A 3RU6A 2XN0A 2O7QA 5KMYA 3UXAA 1XUUA 4UXDA 2G95A 4RZ4A 4EIVA 4RKAA 4XWUA 1DKWA 4AWUA 3DU0A 3JS3A 2WO5A 5D02A 1TTIA 1ZJIA 1A5SA 5LHFA 4PL1A 3I7SA 4LW7A 1WXJA 1ALDA 3NPVA 2E5BA 4CQAA 4FIRA 3A23A 3G8RA 1G4EA 1JCYA 5DBUA 5CZSA 2J88A 2FIQA 3NYZA 3OVRA 4MUZA 1IIGA 1KFBA 3G0UA 1G4TA 3EXRA 4K8EA 1EP1A 2J27A 3IIXA 4ALDA 1A5CA 1X1OA 3ZWTA 1B57A 3TIMA 1OX4A 2C13A 5FF0A 3YPIA 5J5RA 1I2PA 4NX5A 2HS8A 4EVZA 1KV8A 5D09A 2EF9A 2GJLA 3W1UA 3TFCA 1MZHA 2NWRA 4JYDA 1O5KA 1QCWA 1SSGA 3SFKA 3P61A 4MVAA 3LXCA 4IX0A 3DHDA 3TU9A 4GFSA 1LLWA 3EX1A 3L0GA 3GDKA 3LCIA 2ZA3A 2JK2A 3C61A 1FQ0A 2TYSA 5BW6A 1QR7A 1JULA 4RLIA 3EX2A 1LORA 5EY5A 5K4ZA 1JJKA 3BV4A 4UCGA 3GR8A 2B7QA 3MI2A 3C2OA 3LHYA 2FPTA 3LBMA 4Z0JA 2QCGA 1ADOA 4O16A 3L5LA 3W7LA 2OX1A 1TIMA 5HNRA 5F1UA 1UUOA 3MP4A 2E6AA 3KVMA 1SZFA 1VZWA 2PRMA 2J9XA 3CB8A 1LOSA 3QQ0A 5DELA 1K02A 3IIPA 1TCDA 4XZ9A 3ZR4A 2EPHA 1H7OA 5AYXA 3W7QA 3C4UA 1XDLA 2E1DA 2YPIA 3QRHA 5FEPA 3C0JA 3C2EA 4OV9A 2NV2A 2JGQA 4MOZA 2Y63A 3TSMA 1Q6LA 3DFPA 5LSMA 3QFEA 2G97A 3W1MA 3DFSA 3S5YA 1FCVA 4UTJA 1KFLA 5EKYA 4C1LA 1K7FA 3NQVA 5IBXA 3FOKA 1Q6RA 5CSRA 2QUTA 3LX9A 3GXNA 5DY3A 3W2NA 4N02A 1ML1A 1NFBA 1OJXA 3LCLA 1G69A 3WFAA 2QJGA 1SPQA 2Z2UA 2C18A 1DV7A
chains in the Genus database with same CATH superfamily
2INEA 2CWXA 2EJ1A 2YXOA 4LBUA 4L7ZA 1AJZA 1O7AA 1W3LA 3LZ5A 1TV5A 2BGQA 4L80A 2PCEA 2HPIA 2FHCA 3QZ6A 3GM8A 2UY5A 4CUCA 5C2XA 2VL4A 4N9BA 2GGEA 3FA4A 3LB0A 3TQ0A 4Q4SA 4NASA 2BLEA 3W7MA 3CAWA 1OCQA 2EPLX 4DYEA 1LQ0A 3W6YA 4KWWA 1AMYA 3N13A 4U31A 3STEA 3URAA 4C6DA 3A47A 2G3JA 3TK7A 1VBRA 3QY7A 3A21A 1E1CB 1EH9A 2FYMA 4Y6GA 3VDHA 2VGFA 3HU7A 1GPWA 4KIRA 2NQZA 1JGMA 2OLHA 4J9JA 2BFGA 1Q65A 5HJYA 4ZB0A 4IGSA 1E0VA 4JTJA 3UG5A 1CXEA 1GVSA 2QCDB 4ZQOA 1DJQA 4QAIA 3UXDA 1K8YA 3O2LA 1R3QA 3AZRA 1FH8A 3GXDA 3EA3A 3IIVA 2BHYA 1S2AA 1UIOA 3W24A 3PS7A 4FX7A 4JGDA 4QM1A 1PIFA 1R9YA 1EL3A 1FOBA 1W17A 3DBNA 3SIMA 3T0CA 3A3WA 4QQUA 5AHFA 4W93A 3GX9A 1QBBA 2DUXA 3V5OA 5BOEA 1MVYA 2D0FA 3WD2A 3THAA 4GACA 3MC5A 4IP7A 2WQDA 2PBGA 3TA9A 5EMLA 3WDHA 2J7HA 3NQ7A 4OIFA 4BWLA 1CWYA 2H3BA 1H5VA 3ITTA 1TB3A 1DJZA 2WAGA 1Q4WA 5T9BG 3TAKA 3W71A 4WQ6A 3BAJA 2WKLA 1DJGA 4IL0A 3MKKA 4AH7A 1YNPA 3S5ZA 4A3YA 3NEVA 3RM8A 2C15A 3GLCA 5CH9A 3O8AA 3W7CA 3QPYA 3PPFA 3DECA 1PZ1A 1OCBA 4HPXA 1S46A 2QS8A 2EQDA 4B4FA 5C9WA 4RDYA 3NXLA 4YHGA 3R13A 2QUMA 2ZZ2A 2PU0A 2CZ5A 1ME7A 1YRRA 2DSKA 2H9AA 3VCNA 1ZAHA 2E6FA 2ZDRA 4AIUA 5C0QA 2ZZ1A 3RHGA 5H2ZA 4DNMA 3RJYA 1X98A 3VIMA 3BOLA 5HWMA 1CLKA 2X0HA 3LK6A 4A2RA 4JTTA 3FNDA 2PGEA 4E8CA 3T40A 1VS1A 4X2PA 4MTVA 1EC8A 2UZ9A 1GW9A 5TBOA 3W25A 3K4AA 4HU4A 3IVTA 1P5BA 3Q4DA 4R27A 5A6BD 4NAEA 4HK6A 2ESCA 3TQVA 2YB1A 3CAVA 3FYOA 3U2EA 3UG8A 2HS6A 1SFSA 3UWYA 3BK0A 1EEPA 1RD5A 2PURA 2F61A 2EHHA 1JAKA 1VHCA 1P1MA 1TRDA 2XFFA 2J74A 1BD0A 4WUIA 4XKYA 1AW2A 1M04A 3VK5A 1YX1A 2E1WA 3GHRA 2OYMA 3VDAA 3GDMA 2WOQA 4DUWA 3CBWA 2DZUA 1MUMA 3ABQA 4R7OA 3DFYA 3QV6A 4DB7A 4LUSA 2YL5A 1L6GA 1O6IA 4EPEC 4GQQA 3IARA 4RL3A 1NTHA 4PCNA 3CTTA 3P0WA 4C6PA 2DUZA 2Z1KA 3W6MA 1TTJA 3SCVA 5LXEA 5LA0A 5GQBA 2P88A 2XN2A 2CLMA 4UQ9A 1TV4A 5EMYA 3CQ0A 2JKEA 1V8EA 4FZIA 3FJLA 1QT1A 2AAMA 5E6YA 4D8ZA 3WF1A 3FN9A 1CGYA 3WLNA 4IQEA 4JNZA 3MS8A 4O18A 1MDRA 4I6KA 4ZB5A 1QDSA 4JKKA 4H8NA 5XINA 4YVXA 2HK0A 1QNQA 4ZOAA 2ZCGA 1V6XA 3N1AA 4Q8WA 1TZZA 5KEZA 2Z2BA 4GZEA 5AYZA 2NT1A 3SRFA 1JCNA 1EFZA 1DJXA 3GTNA 1V3KA 2YBTA 3Q45A 1OX4B 2VHLA 1FA2A 1OY0A 1F76A 1AQFA 1SO3A 2A6NA 4JHMA 3BE7A 3U2CA 4US6A 3G1SA 1MYRA 2AOSA 4XISA 5G2HA 3AXIA 2WC7A 3W28A 1ZFJA 1A49A 1FUYA 2HE8A 4GYFA 4B5WA 4RCXA 3V4BA 5A6BA 1F3XA 5A8GA 1E5JA 4ERIA 3VU2A 1UWRA 4JTHA 2AMXA 2DPEA 2P50A 4AMCA 1U83A 2QKFA 5K4XA 2PDLA 3WO8A 3BZJA 1OFAA 4QTGA 1NSJA 1XQLA 1RBAA 1XYAA 1RHCA 2VR2A 1BVNP 4DLFA 5BU6A 1DJHA 2WM1A 3N17A 4JD4A 1F05A 4UOJA 4AZCB 2ZZ6A 2HWGA 2EPKX 4S23A 2J7GA 1CXHA 1IZCA 3GO2A 4CD5A 3MV11 3KFTA 3SGUA 4UFLA 2DZAA 2BV9A 4KF1A 1QK2A 3QBUA 1JR1A 4B5NA 2BS9A 4RR4A 1Q6CA 4N42A 1H1NA 4GZJA 4DO5A 3SBFA 3REQB 2QDGA 4M1BA 4DO7A 3BAIA 4B90A 1BPLB 4UMAA 2FTWA 2C19A 2MANA 3CC1A 4FO4A 5BMXA 5LGXA 4PUMA 5CJ5A 3R1ZA 2XUCA 4AFYA 4GZIA 3B03A 3OODA 2CWNA 1XDMA 1EJUC 2R91A 1OIFA 1V02A 1XLMA 5DFAA 4PL2A 2ZC1A 4A21A 1GVQA 4IXXA 2VYOA 2CIPA 3GZ3A 2FVMA 1UOKA 4AVOA 3BJTA 3MWAA 2Y8UA 2YZ5A 4JN7A 3LGDA 2VEIA 1G7UA 3ME3A 2A3EA 1OGBA 4Z2GA 2FFIA 4IWWA 5JVLA 4ORMA 3P5ZA 1JFHA 1XC6A 3AHZA 3RLVA 4AIOA 4CQDA 2ABAA 3PBMA 2PWEA 3A5VA 1TRIA 2OLSA 3PTMA 2HDJA 1K03A 2RHGA 4Q6JA 3I3DA 2Z7GA 3UFYA 3G1YA 2V67A 1DWFM 4C6NA 1LLOA 2RKXA 2EEXA 2JIEA 1VJZA 1IEVA 1Q3NA 2IKIA 3VI2A 5TAOA 2VEMA 3MYOA 1XIJA 4JL1A 4O0QA 1DQUA 2PI6A 3W88A 3VXGA 1L8PA 2DY3A 2J75A 3H6OA 4K1WA 1GNXA 1NEYA 1NARA 3H2AA 4QSHA 5G1YA 4LFYA 3QC0A 2JEQA 1FFRA 3ZSSA 2BG5A 1HP4A 3W7HA 1BRLB 1A5KC 4Q8MA 4O17A 4I90A 1T96A 1W1PA 4IF2A 1TTPA 3B9AA 4GY1A 3II1A 3WLLA 4EPKA 3WFZA 1XH0A 3QW3A 3WLTA 2Q8LA 1H7RA 1OCJA 4FF5A 1EUAA 1TPC1 2Q09A 5D05A 1RK5A 1K9DA 4PULA 1XKJA 2GSJA 4U3CA 5HNTA 2JF7A 5U4NA 3ZS4A 3TUUA 4YCOA 1JFXA 3AUJA 2QF7A 1QPRA 3DX5A 3CPRA 4N6FA 1HJSA 2PWGA 3PFMA 1W5OA 1DIKA 2QV5A 4O12A 4PRWA 3WQWA 3SQSA 4W4QA 3G1HA 4PMQA 1N2VA 4L61A 3N2XA 4XO6A 4S2CA 4QQ3A 2GOKA 1S2UA 2H9AB 5I03A 5LIWX 2CU0A 4JTIA 2XVKA 4KKXA 1OWQA 4FS9A 4U33A 4ADSA 3RK8A 4Y9OA 4M19A 1ADSA 1TG7A 4O1FA 3F5KA 3I4KA 4W8BA 5I02A 4S3FA 4ZFCA 1OYAA 2Z2AA 3QOKA 2VXNA 4X60A 4IP4A 4LAKA 2WSRA 2P10A 5AYBA 3M07A 4NAEB 1XJBA 4BR1A 1BWLA 1VBUA 3LG3A 4LC6A 1CBGA 4TO8A 1S1RA 3LLFA 5FACA 4HMEA 2HXTA 3M16A 3ZWSA 2BHZA 4XKYB 2PS2A 1UOZA 3UZXA 3PBUA 1U22A 4B9YA 1UPMB 1EDQA 2VGGA 4IQDA 4AY7A 1UR0A 4PCTA 2AL2A 4LUSB 1JZ6A 1MZRA 2CPUA 3TTQA 3FKRA 5CBIA 3H2FA 1UD8A 4LJ3A 2ZZ4A 3UZZA 3STFA 2VFDA 3GAKA 2PPGA 4YIWA 3PZGA 1U5HA 2REQA 5FL0A 5M03A 3NL2A 4J2MA 1TSIA 2C79A 4NYYA 4NJJA 4WDWA 3TDFA 1JZ7A 3PPHA 9XIAA 3NM1A 3WL1A 1YE6A 4J3ZA 2ACQA 4ZB2A 5HULA 4KCTA 1LUCA 4MJMA 1R86A 3MHFA 5J5DA 1FWJC 1TPEA 4YTRA 2VP8A 1WKFA 3UBPC 4NIRA 3EDJA 4GVIA 4O0KA 1W5MA 2FZDA 2CZVA 4C65A 3H7UA 3AQUA 3QMSA 3OQ8A 1EYEA 4Y2WA 2QAFA 3G0XA 4C1NA 4IIFA 2E7FA 1EGZA 1HL2A 1EGMA 2WANA 3TLLA 3OGRA 1ZHAA 1JDAA 2ZYFA 3GG0A 4NL1A 4IICA 4O53A 3ZZ1A 1EQPA 3TYEA 3H26A 2XISA 2XVLA 1JDEA 4FXJA 4PN2A 4BFAA 1K8ZA 3CWNA 5BXPA 4UFHA 3K4WA 1OYBA 3KX6A 1V51A 5IDZA 1UP2A 3EWXA 1SGJA 1KGUA 1EXBA 3EGJA 4F8XA 1KBIA 2AQOA 3SN4A 1E70M 1LOLA 3MY9A 4AVFA 5FOOA 3GDTA 4MUPA 4F4RA 1ONEA 2AGKA 1HVQA 3VNMA 4JTFA 4QG9A 3HQOA 3BCDA 1NP0A 1C90A 3P0XA 4LQ1A 1TA3A 4HPGA 1X6NA 1MQQA 4BS0A 5CJNA 1NOWA 3DYMA 4H7VA 4AY1A 4G7FA 2DIJA 4MYXA 5GVJA 2WSYA 1F3TA 4IPJA 3SJNA 4XZLX 1E51A 1TWDA 4AD4A 3VKJA 7TIMA 3E2VA 1EHNA 3G1XA 1VFLA 2CCRA 4HD5A 2D69A 5IDIA 4NRSA 5DMNA 4H8HA 4DZHA 2PGRA 2FZNA 2PD9A 4ZE4A 3NURA 3NL5A 3P82A 1HJUA 1S2VA 4GVGA 2F2HA 4RW5A 4U10A 1L6SA 1F73A 4GY7A 4JTDA 1RJQA 2PUZA 2ZIDA 3KLKA 4Q8QA 4C90A 4PB4A 4GVHA 1XIEA 1XIHA 3UETA 4O8AA 3KCJA 2DZPA 4DQWA 3APYA 1VHNA 4WOQA 2F6XA 1PHWA 5D2XA 3W7IA 1QI2A 2Y89A 1QVBA 1DJWA 2XIMA 3GH5A 5A5WA 5D03A 5F1VA 3VKDA 2R1LA 2PWDA 4ZBCA 3RFAA 3A6OA 3AALA 1GZGA 2WBGA 5D38A 1FY6A 3GTFA 2ZUUA 4GUGA 4PBGA 1LL6A 2XGZA 4J3WA 3BLPX 3WDQA 4A3QA 3C86A 2EXOA 1LDCA 5FSEC 4R9XA 3LCXA 4O10A 3PPGA 4Y8FA 1QHPA 5KSWA 3HPXA 4F2UA 1MUWA 3WBWA 4ZR8A 4UQDA 1AA1B 4IP5A 2WPGA 5C54A 3PUGA 3W75A 5D2VA 5CAKA 1UA7A 3RRXA 1PV8A 3CWOX 4K7YA 4QFUA 4GQGA 2I56A 3GSMA 3L4VA 1R7OA 1P6BA 2D22A 4LYKA 1NF7A 2PWUA 1BKSA 2X2GA 1KKRA 2HBVA 4OWGA 2VGBA 1TIWA 1UR2A 4TVDA 3CUFA 1ITUA 1ZALA 4P7NA 3G1VA 3WNPA 1R6WA 4FIQA 2XH2A 1B2YA 1Q85A 3PSWA 5H8PA 1FCUA 1AK5A 5FEXA 1XR2A 4TMBA 4RK8A 5A1AA 4L4MA 3Q67A 1VPXA 3LU2A 1KO0A 4C6FA 3HG3A 4ICMA 4OFCA 1GORA 4L9YA 2FH8A 1E6QM 1XBXA 3W29A 3WG6A 3R7MA 1QNPA 1R3WA 4GE8A 1MNZA 3PK7A 3WK2A 3W0KA 5BCAA 1XBZA 2VJXA 3VPLA 3QQWA 3U8GA 1B0IA 4Q4QA 4AX6A 5DT5A 2FJKA 1TVLA 4PH6A 3N14A 2YJQA 3B05A 1PXGA 3AC0A 3NSXA 1QO5A 5D30A 3NZGA 3W1TA 2NSXA 1H51A 3KTSA 4LCRA 1WDDA 5GNYA 1R8LA 1FDYA 2B81A 1K7XA 4UNKA 1WYIA 2VTFA 3T44A 4PB5A 2VDGA 4IX2A 1ONXA 4HYWA 5C8BB 3PTKA 3LQLA 1MNSA 3WFLA 4KEVA 3UYCA 5LNRA 1SFJA 3W7NA 4YTUA 2A21A 4TV5A 3IV3A 1XIFA 5BXRA 3QOMA 1D8WA 4QJ4B 3BLDA 2V2DA 1UWAA 2AL2B 1F8IA 1Z69A 2YCJA 2V5CA 5CSSA 4DJDD 5FAGA 5MKGA 2WLYA 3S46A 1WE5A 3GYCA 1TTQA 3UNTA 5JBDA 4B9ZA 3G5EA 2Y85A 4OE7A 2REQB 2IMRA 1P0BA 1IT0A 1HGYA 2D24A 3MCNA 3AMKA 2V3GA 3MMUA 8XIAA 3I68A 3LRKA 4NI8A 1Y5VA 4M82A 1A3WA 3CL6A 1EJWC 1K6AA 4WY0A 2B7OA 1OCNA 3DENA 4M8UA 1H1YA 3VIJA 2CHRA 3OGSA 3WLRA 4E2VA 4GLEA 4KFPA 3RCNA 2DT1A 1EDTA 3B0PA 3RM9A 1W3IA 3S1VA 3CB3A 3MPGA 4IIBA 3N2TA 3ICJA 4QBXA 1TX0A 3VOGA 5GJNA 4A4AA 3W23A 4AYSA 2CXGA 2E25A 2WNNA 3MQTA 4Q8PA 1L0PA 1E6SM 1KBKA 4FEZA 3U5YA 1XRSA 3GNOA 3C3NA 2H6RA 4F66A 3U4FA 3CZJA 4B2DA 4MKSA 3VGFA 1QUMA 1QNSA 1DL3A 3VGBA 4MWAD 3A22A 1SMAA 4B5SA 1FHLA 1E40A 4BEQA 4ZQPA 3W83A 4EWND 3DFTA 1BLIA 2V3DA 1UKOA 3GFYA 4QG8A 5CPMA 1PB0A 4Z1YA 1H49A 4XD6A 4NAFA 3B8UA 5G2WA 1K4HA 3M5VA 4O1AA 3QPZA 4HK7A 4LSBA 4DF0A 4FK9A 4JL2A 1OG6A 4O54A 1X7IA 1YLVA 3VKAA 3VE9A 4Z2JA 1IEQA 5AC4A 3W84A 2PDGA 3H4WA 2Y1HA 3NOEA 1YTDA 1AJ0A 4H9UA 3LV6A 1IWAA 4W7VA 1TKKA 4N2YA 3LNPA 4WJEA 3CZEA 2Z7KA 1D3GA 1DHPA 5AHMA 5SWUA 4KPLA 1HUVA 1F3EA 2CEQA 3C0QA 4MIMA 1M7XA 3B4UA 3BJFA 4TV6A 2GVEA 3OBKA 4X0VA 3CUGA 3FSTA 4K38A 1XCXA 1XLGA 2IKGA 4QP0A 3GE7A 2DSZA 4V33A 5G4WA 1XINA 3HPFA 1V0LA 5AN7A 4Y7EA 2FVLA 1W9PA 2BWGA 3BXWA 1GT8A 1EJ7L 1Y5WA 4QLLA 1ESWA 4X3ZA 3DCPA 1E1FA 1YXDA 5FF3A 4LF1A 3TW6A 1RPKA 5A2AA 3T1GA 1AMKA 1W37A 2GUYA 4L6HA 4H9TA 3RDKA 3UF9A 1EEXA 1FWNA 3ZJ7A 3NZ1A 1UBSA 5A8OA 3L12A 1MRQA 1XD1A 3FHAA 1SO4A 2YIHA 3MUY1 1C29A 1HO4A 5LHEA 2QCFA 1YTEA 4MWAA 3S9IA 1ZQ5A 3FJ6A 2VEFA 3EB3A 1REQA 3E38A 1H0GA 2VOMA 2OTDA 4UZSA 3WK1A 2MNRA 1BAGA 4HHHA 3NNTA 2CHOA 3AMLA 3GKAA 2YSWA 3H4XA 2PC8A 1RD6A 3TN5A 1LRTA 1XWYA 4QLKA 4JQ1A 2PDFA 8RUCA 5HNUA 1M7OA 1C9WA 2FGLA 5HNNA 1U1HA 1ODUA 3UJ2A 3UWVA 4LYPA 3OLGA 2PTXA 1JPHA 1R46A 4BWLC 3RR4A 5I3KA 2PWHA 1ZU8A 1W9UA 3GG1A 1ZBVA 4DXXA 3OIXA 4HHMA 8CGTA 3N6HA 1PZ0A 4DI8A 4QDPA 4R5EA 3NUKA 3QR3A 4PMRA 2VR4A 2G37A 1J12A 3TFXA 4DNHA 3GZAA 5F2LA 3WLOA 1NJJA 3AHXA 1S2TA 3WDRA 4XAZA 4FOUA 2GLKA 3CT7A 4S2BA 1TFVA 4GIRA 4TX9A 4FOJA 2TAAA 3OU8A 2CLFA 4OZOA 1KRBC 3RYSA 2I9EA 2ZX9A 4ZCWA 1PJ9A 5GJPA 1RCQA 2JBMA 4S3BA 4CQ8A 4F9DA 5C70A 4HQVA 1A3XA 4J5NA 4O1CA 3V1PA 1FHUA 4FXRA 3GNNA 2VX6A 4GIYA 1UR8A 4MM1A 3LD5A 4GFIA 1O68A 3C2VA 1NQ6A 4A2SA 4IZGA 2YDSA 3E74A 5A6KA 4Z1CA 3W7DA 3LRLA 3ZLHA 4KESA 1OG0A 1E6NA 1AFSA 3OA3A 5CXPA 3EX6A 2VC9A 4FOKA 5HPCA 1RALA 3VOCA 4U3AA 3N9RA 5E9AA 5AHNA 3NQDA 2WWCA 2OJPA 1UC5A 2GWNA 3E0WA 1GGOA 2R94A 4TU1A 4OBSA 4GK8A 1DBTA 4JCMA 2GQ8A 4A3UA 3TYAA 3NFUA 3PZIA 3R2GA 3URBA 1UZDA 2W5FA 3WLPA 3M4HA 5M3WA 1CGTA 3FXYA 3B8TA 1KLZA 1UWSA 1WCGA 1R7AA 3W6LA 4WHBA 4LY4A 1RLDA 4UR8A 2WMKA 2X2YA 3R89A 4H6RA 3WQ6A 1LWIA 1ZTVA 3VGHA 1E0XA 4HNNA 2VURA 4DHGA 2XWEA 4OKDA 1SW0A 4N0RA 1S2CA 4AYGA 1GYLA 2B4GA 5C9ZA 2V68A 4GIEA 1Z44A 3IUDA 2CC0A 2A3BA 1JG9A 3O0KA 2XGIA 1QWKA 1NH6A 1B30A 1H4PA 2YCEA 3OQEA 3W27A 3PUEA 1JCMP 5JH1A 1JGIA 1Z7AA 1W8SA 1F9CA 3ZLFA 1GW1A 3APGA 2YA2A 1FKXA 3STCA 1PKNA 4UFKA 4HPNA 5IFPA 2G3IA 5BRPA 1ZRQA 1VR6A 4CEXC 2O7QA 1VFFA 4UXDA 4I5XA 4JFWA 1C93A 4EIVA 4XWUA 4OTKA 1DKWA 3LMYA 1GQKA 2WO5A 5IHSA 2ISFA 1CYGA 1TV3A 3BANA 4PL1A 1V4YA 3AZSA 4CQAA 1DWIM 3A23A 2QNEA 1G4EA 1JCYA 3G8RA 3AS1A 4IM4A 5DBUA 2J88A 2FIQA 3G2GA 3BLLA 4REQA 4K8EA 5M1TA 1EP1A 1A5CA 1KBBA 3D3AA 1BG4A 1O5QA 1B57A 1WKDA 3FGCA 1JZ5A 2XJ7A 2G8ZA 4RDWA 4ZTXA 4WJXA 3W1UA 4KWOA 3V18A 3BWWA 3GRIA 2BVWA 2PAJA 5LIYX 1E9ZB 4U2YA 1QCWA 4JBRA 3LY0A 3RILA 3RX4A 5C9XA 4ATDA 3S47A 5D9MA 2G50A 3ITGA 1JYXA 2E67A 1FH7A 2NW0A 3FY1A 3VAVA 1ZGDA 3HV9A 4MHBA 3NSNA 3L0GA 1JI2A 1IWPA 3L7RA 1ELSA 1CLXA 2JK2A 1HQTA 2A3CA 3C61A 3SUSA 2FHBA 5EY5A 5K4ZA 3BV4A 3B97A 4L64A 1XPGA 3GR8A 3ZMRA 2B7QA 3GU9A 3MI2A 5MF5A 4C7FA 2FPTA 4ATWA 2ASHA 2QCGA 1J79A 2PODA 2XDFA 4O16A 2BASA 3QFWA 4BQ5A 2OX1A 3GHUA 5F1UA 3TYDA 3V16A 1PZ2A 2WB5A 1DE5A 1TZ7A 3IIPA 1TCDA 3SCPA 3E2SA 5D8ZA 3ZR4A 3T9PA 1C91A 4CU6A 2DFAA 3WLJA 2XYLA 5LA2A 1TWWA 3TSMA 2BVDA 4BJHA 4Q4RA 4J3VA 4QS5A 4HK5A 3F5LA 1BHGA 2D3LA 2G97A 3M64A 3CMJA 1KFLA 4C1LA 3NQVA 5IBXA 2QF8A 3FVDA 1VFHA 4MNLA 1Q6RA 2F6UA 4RNFA 2J8TA 1NFBA 3R8GA 2XM1A 3P14A 2F38A 2Z2UA 3KBMA 2VX4A 1IE7C 4S3CA 1UWIA 3C2RA 1FP9A 4DVOA 1EJXC 2PDBA 5JXQA 3ALFA 4DJEA 4XQ6A 1OFEA 4MWAB 2FFCA 2VWSA 3N4FA 5FEZA 1GKRA 2YLLA 3WLQA 1T7LA 4ZODA 4OBRA 5C9UA 1A5AA 3G18A 3EX3A 2YL8A 5T9CE 3POCA 4NNCA 3TVAA 5D2YA 2P8BA 3LTSA 3P81A 5JQ9A 2HISA 1F74A 2X7VA 1Q5MA 3HGRA 2OKOA 1KM4A 2V9DA 1E4LA 2D2GA 3H2CA 1RA0A 1GEQA 4K36A 2H3DA 2VZSA 5FKYA 3UJRA 4A8NA 2HROA 4GQ0A 3THCA 1UIPA 4S3EA 2YZRA 5TIMA 3HB9A 4GC4A 4HCHA 1TV8A 2XFRA 1FWAC 3L9CA 4JKMA 3U7VA 1OF8A 5DRIA 2NT0A 3MANA 3EDDA 5KTLA 1HO1A 1MXDA 1O5RA 3H54A 2HV5A 3CEUA 4B3KA 3SUTA 5EB8A 3GUWA 1JUKA 3WQCA 4UOQA 1WB0A 1XKYA 3PJUA 5F7UA 3OLEA 4FNUA 1DP0A 3NQ8A 3TN6A 3IRDA 4Q33A 4AF0A 4BI6A 2LLEA 3UPWA 2DZXA 3NO5A 3WL0A 3JW7A 3BL3A 3SJ3A 1KR1A 3TQKA 1JCLA 1XV8A 2WKJA 1OSEA 3G77A 1Q6FA 2J8FA 4WXYA 3G24A 1JRBA 1BTMA 1EIBA 3JU2A 4V15A 1OEPA 4L65A 1M41A 1D7KA 3SO7A 1C8QA 4JFTA 2QUUA 3UCQA 3ITOA 2FKPA 4O0ZA 3V36A 4P2VA 4W87A 3K8MA 4LYRA 2OB3A 3INPA 3FDGA 1LT8A 1UBPC 3PWGA 3TW9A 2O0TA 4MKVA 1RH9A 4FR6A 3WCZA 2NXIA 4DWDA 3DKJA 1EBHA 1WZLA 1CPUA 4CN6A 4CN4A 4L5ZA 3C8NA 2YCKX 4X0NA 4UTKA 1YPXA 3WUGA 4E8GA 5CAHA 2OYKA 4URIA 4NXSA 1PSCA 1QOQA 2VMFA 2DZBA 3LZ3A 4JDBA 1PAMA 1JZ2A 2DH2A 4D71A 3MCOA 1F6KA 1N8FA 1MRAA 2ODOA 1SFTA 5FESA 1B4KA 2YYTA 3LXAA 4YNGA 1F61A 1RXOB 5HMEA 3RLHA 1BYDA 2E3ZA 2QJHA 1MW3A 4HMCA 3G6LA 4M1RA 1L8NA 3MWCA 3DG3A 3R25A 1TMLA 1W5NA 1WO2A 3W81A 4ZEPA 1CENA 3CHCA 3IANA 2A4AA 3GAYA 4K8GA 2NZLA 1RUSA 3L4WA 4UTHA 3DGBA 4WVXA 4PFMA 2Y62A 1LRQA 5G1TA 3FJNA 2WMFA 3KDOA 1YDYA 1SJBA 3GVRA 3P8IA 3G1RA 3HPSA 1PDYA 1R3YA 1EJRC 4A29A 3VA8A 3U0HA 2ZUTA 1Q45A 3NL6A 3WZ0E 1GEHA 1E43A 5I3HA 1E3ZA 3F4VA 3PF3A 4EF9A 1A0DA 1V6VA 3ZT6A 1AH4A 4JIQA 4M6VA 3NZPA 3RIKA 3RX3A 2BVTA 1SZEA 4LBSA 2HK1A 2DEPA 4QAWA 1Z48A 4Q4KA 9RUBA 3EKZA 4QISA 2TPSA 5D4YA 1IF2A 1UWTA 3MUZ1 4MZ1A 4LANA 2XWDA 1NELA 3HMCA 1BFNA 2ZBTA 1XRVA 1XH2A 3H12A 4AVNA 5A8PA 3BPWA 4GUFA 2A5HA 4F40A 3STPA 3P8JA 2CITA 2QW5A 4HMDA 4RE4A 4MB4A 2PDYA 3BLKA 4Z2IA 2VCCA 1RQHA 3UZ5A 1DTNA 2Z0IA 2FZ9A 2G96A 4C5YA 1OINA 2QDHA 3FDKA 4DWSC 1AL7A 2O92A 3SN0A 2Y6ZA 4IISA 3WYZA 4IUOA 4FPSA 5HDRA 4KRTA 1N7KA 3CMGA 4AB4A 1QOXA 3QLDA 1TR1A 4JDYA 3EMCA 3LEPA 4RJEA 2GGHA 2I5GA 1B9BA 4F2BA 1LBLA 4EX4A 1DJIA 3BICA 1GOKA 3ZQ9A 1H5YA 5LA1A 1K77A 3I6EA 3PR2A 2IPGA 5E0KA 3LM3A 4QE5A 3PBYA 1VFUA 4QEHA 5AHIA 1SW7A 4BK9A 3KTXA 1HJQA 4M56A 2QYGA 4PZVA 4W9TA 1MEIA 5U7SA 1NDWA 5GPRA 4DZ5A 4GGBA 3ZFHA 2BVYA 1JQXA 1E55A 4I6VA 4IJBA 4GXWA 1VIZA 4JYFA 1BYAA 4IUGA 1RBOB 5AVHA 2NX9A 1DWHM 4J35A 1JDDA 1QTWA 2PDIA 3LSBA 4GCXA 1VRDA 4ZQRA 3NJ3A 3TMLA 4AHQA 2WJZA 3WH5A 4OHQA 1KCKA 2QJMA 3TMQA 2P76A 4QG6A 4NXKA 5ABEA 3KOWA 4HNVA 4NNBA 4R88A 2WSKA 1I75A 3EMQA 3BGAA 2DVXA 3ANUA 4JTRA 4K39A 3BAKA 1ICPA 4AHOA 2HEJA 4QE1A 2WHKA 3F4DA 2MUCA 5I3JA 3RJXA 1VFMA 1VEMA 4LX4A 1XD0A 3P74A 2J66A 3S5SA 3GC2A 1V03A 1POJA 5A6AA 3I7QA 1PZ3A 2Z6IA 3RCMA 1EC7A 3LYEA 3MDWA 1GKQA 1VF8A 3WQDA 5PTDA 1V7YA 2QULA 4D6EA 3LI0A 1UYQA 7XIMA 2OR2A 1DTUA 4UTMA 4QNWA 4FXSA 4A3RA 4ZOEA 3ZVHB 2PEVA 4Q7NA 1AG1O 1CDGA 4CU8A 1U5VA 4ASTA 3WIJA 3QXBA 4E4PA 3WQ5A 3GK0A 4GWEA 3TOPA 1UR9A 5E0FA 4HZ7A 2VENA 5C7VA 3W1RA 2W91A 6PTDA 1LM1A 1QPOA 5JUVA 1U2YA 1ZP4A 2ZRVA 1W3KA 2BHUA 3WBEA 5JBFA 2YFNA 4FSAA 3M43A 3KE0A 1QWGA 1ZAIA 2CLLA 1EDGA 3QYSA 2VZTA 4J28A 1PTDA 1TQXA 4R9OA 3WEZA 5A6SA 3S1UA 1WDRA 2Y7GA 1DXFA 1H2JA 3TCEA 1R30A 2VQTA 5JMUA 3Q94A 1YBQA 3ARQA 4XSMA 4I7VA 1AVAA 4NSBA 2A1YA 2QCNA 4UR7A 3A5FA 3PC0A 4MPKA 2FDSA 4HHLA 4Z08A 3FCPA 4I8DA 2QLYA 1OHLA 2ALDA 1SO6A 3UR5A 5F4WA 3TQPA 4CCEA 3QF0A 2ZKMX 3W2LA 1I4NA 1ZS2A 3FV9A 3FS2A 1SMDA 4MPQA 1LRNA 4UNLA 3MA8A 4GNJA 2A7NA 1OADA 1UC4A 2VUNA 1UH2A 1J2BA 4AWEA 2OYLA 2I5QA 4YWSA 1JYWA 4K1GA 1DQWA 2FDMA 1G1YA 3NEHA 2O9OA 5EL1A 4MDPA 4HT3A 3SY8A 4GI4A 4L1WA 2BXYA 1WOAA 5ECUA 2FZBA 3BVJA 3ISIX 4JYEA 3MTWA 3GDLA 2A6LA 5FJIA 1M53A 4CQCA 3S9YA 3IAPA 3HF3A 4O8RA 3CTLA 4D6IA 1YKWA 2NWSA 1EPXA 4E8DA 3QPEA 2PTWA 4G1NA 3WBAA 1QXLA 3M0KA 3C3UA 2YR1A 2X0SA 5KZMA 1JNDA 3PZNA 3NQ2A 3E5BA 3OHIA 5CG7A 1CI1A 3EPMA 4FX6M 5XIMA 1E6RA 4N4PA 4YTTA 2YA1A 4KGLA 1XSKA 3HG5A 4UBPC 5IOBA 4DZIA 4NZ5A 4L1XA 1O95A 2ZRZA 1S5NA 3HV8A 3XISA 2I7GA 1A53A 1WUEA 5A6LA 3TCSA 3B40A 3QW4B 3GUGA 3GWQA 3TR2A 1VEOA 3C0SA 4H2CA 1EC9A 4BEUA 4YN5A 3VYLA 3W72A 4UR9A 3IAQA 5EYWA 3BH4A 4GIAA 1FWGC 3ITXA 2P0IA 4ZO6A 5HPOA 3UVIA 4HNTA 1I8JA 3CM4A 2BY0A 2Y24A 4UQEA 3CO4A 1ODZA 3OZOA 1QPQA 3DI1A 1KB3A 4IPPA 4ZO7A 1X8CA 5G4HC 1QASA 1O60A 2CLOA 3L0NA 4POCA 3TN4A 1KFCA 5DN1A 1VBGA 1RAKA 2X30A 5FD0A 1OABA 3UCCA 1ZBCA 3NWRA 3BV7A 1G0CA 3OG3A 4D8AA 1IWBA 5DRCA 3N2CA 3L4XA 3PBVA 3L4UA 3ARTA 3V5FA 4XVDA 4M6QA 4FNRA 1TMHA 1GK8A 3O16A 3EEGA 1QNVA 3ITVA 6XIMA 2J77A 1BKHA 3F2DA 5CC7A 4HZ8A 1YPIA 4XVEA 5B7ZA 3UP8A 3MVTA 4FX8A 2X1IA 4QNEA 1A80A 5LKYA 4QITA 2OKTA 4LB3A 3BCJA 1D3HA 4HZMA 1Q13A 1VLWA 2WVSA 2WZHA 5H8UA 3VIHA 1K9TA 3SCRA 2WV8A 1OFPA 1VPQA 1A0CA 3P67A 2DT2A 4IG2B 4LU0A 1ZZMA 3AXKA 2F84A 4LC8A 4V1YA 3LBOA 4NX0A 4PTWA 2XVPA 3CWHA 3NAVA 4G56A 3GR7A 1XCWA 4QEEA 3AHVA 3EKLA 4WSHA 3DEQA 4MNMA 4H04A 3UA4A 1GQNA 4NJKA 1KM3A 5DXYA 1XGEA 1XG3A 3RGTA 1KRMA 1LL4A 4CCDA 3O63A 4H19A 2V5JA 2ZC8A 1E6ZA 4F0SA 5C5YA 1XLAA 1HNYA 1KTNA 1Q7QA 4KEUA 2J7BA 4GC3A 4P7RA 4UUIA 4JHOA 3KL3A 3T0DA 3VD4A 4RE2A 1TPUA 3THQA 3TJXA 1EO7A 2Q6ZA 1VYSX 3FA3A 4KWSA 3K46A 4OBTA 3C5QA 3TTOA 3LV5A 2OPJA 4IMGA 4HZ6A 3S2CA 4GG9A 1EBGA 2WC4A 1YHTA 5FJJA 1ZENA 4GQRA 4O28A 4NU7A 5HUPA 4FNPA 2GGJA 3SY5A 1Q2RA 4PEKA 3TC3A 1RSCA 2DZVA 5FF4A 3KVKA 3AIVA 4TTGA 1O4UA 2PTDA 4CGTA 4XKMA 3WUEA 1RP9A 3LDVA 1OFQA 1OQFA 1V6WA 2ZFAA 2NQ9A 1XYZA 3T81A 4B5UA 4HSOA 1XISA 2Q71A 4DRSA 2NV1A 3C6CA 3A4XA 5EBAA 4JNYA 2ZXBA 2PU1A 4ZENA 5DCBA 2POZA 5E1QA 1W1VA 5KZ6A 5HA7A 4KCUA 3V3WA 3B8VA 4WK9A 1KGWA 2RDTA 1M7JA 3O9NA 3XINA 4GI6A 4S3KA 3CQIA 1HF6A 4CNPA 1GYMA 2YXGA 3I3BA 1AZ1A 1VC4A 4P8UA 1EYWA 2XIBA 4IOTA 1J4EA 1H1ZA 3WNMA 3KM8A 3OBAA 4RXFA 4BF9A 1KM2A 1MW0A 1RPXA 2BDQA 3VNIA 2I5IA 4S38A 5AZ0A 1V6TA 4G8TA 1WOBA 1E0TA 1BYBA 1ZLPA 2GK1A 2DSWA 1HKIA 3IGXA 2ZVRA 3UYIA 4E0CA 1KFKA 3VGEA 1JPMA 5AOUA 3OTRA 4EXQA 2WJEA 5AVNA 4HOXA 1VYRA 4OUIA 5FEWA 3TXVA 3TSDA 3S1WA 2FB2A 4MLRA 4P7OA 1LJYA 4UQBA 1ISVA 4HOWA 3CH0A 4DLMA 2WMIA 1SR0A 3M46A 6TIMA 4ACZB 2E6YA 1C8VA 1DOSA 2ZA1A 4B4HA 5JU6A 1SU5A 3ZLGA 1CW2A 1LOQA 1EA9C 3PZQA 3I65A 2KX9A 3TW7A 1V3MA 4ZMGA 3GD6A 3VDCA 3U4AA 3LCHA 3RUBL 3D5HA 1KTBA 2ONEA 2WWDA 2Y4SA 1IIHA 3DBPA 3M0XA 1H63A 4M80A 4J1OA 2X05A 4H4IA 1W54A 4TTUA 1V0KA 3VUPA 3CHDA 4S3DA 4KFNA 3OLDA 3NL3A 2W63A 4MZYA 2JKPA 3DFOA 5CPQA 4O1EA 1KA9F 3KWSA 1FWHC 3MMWA 1ME8A 1P6WA 2EAWA 5HMDA 4G1KA 3PNZA 3O6CA 3GDRA 2BP1A 4U5IA 8TIMA 2Z1SA 2G3FA 3C2YA 1ZCOA 1ISZA 3P5YA 1WAWA 2QZRA 1L6YA 3TH6A 3EWBX 4D6GA 3AXXA 2VFHA 4GISA 2R6OA 2YX0A 4OECA 1XYFA 3QV7A 1GJWA 3RMEA 3QH2A 5HUOA 4P61A 5AC7A 1L6WA 3BGGA 2W61A 4LTSA 5I3GA 3RN6A 2ZVIA 1JI1A 4TX6A 4HPHA 5I0DA 3FJ4A 3OZYA 4GH1A 3LGEA 4RUBA 5BNKA 1BEUA 2FZ8A 2J7EA 3A12A 3BOFA 1JPIA 3W01A 3W2UA 1NQKA 3AYTA 1B54A 3WK0A 4LS1A 1U33A 3TN3A 3WN6A 2PLCA 4BA0A 2DSVA 3U6WA 4CVWA 2GJPA 4NJHA 1XPYA 3BTNA 1FXPA 3VNLA 3G0SA 4MY1A 1UKSA 1TPH1 2Y7DA 5DMLA 4ZZ9A 1DPMA 4JX4A 3M44A 2X0YA 1I2RA 1K6WA 3UJFA 3GH4A 3LRMA 1BYCA 1VCFA 4BF5A 3O05A 3QTPA 4NUWA 1EJVC 1PIIA 4CLMA 3M9YA 4DBDA 1F8MA 3CJPA 3MBFA 2D73A 3VIPA 5EPDA 3T0AA 1XYBA 3M0VA 4O19A 4EPDC 3UZYA 7TAAA 1KFEA 2CW6A 3WMCA 3WUBA 3E2RA 2DJLA 4HCDA 3NQGA 3B9EA 3MHUA 3BQ6A 4QJ5B 1PEZA 2J79A 4XTDA 1GQLA 1RQEA 4J4KA 3HOJA 1Q6EA 3UQNA 1EF2A 5EMKA 3RU8X 1B3OA 2J13A 4D6HA 5A6TC 3VNDA 4CVUA 4RNHA 1CNVA 4NJGA 3RO8A 1R2TA 4Y9MA 2W92A 4MY9A 3MB9A 3FYPA 3OA5A 5DT7A 3MT1A 1AD4A 5HWJA 1HIZA 4QXIA 1XLLA 3SY1A 5IBXC 4F48A 1CEOA 3M6DA 4PRTA 2X16A 2OXNA 4Q7BA 3ZR5A 4LBRA 2R82A 1FKWA 1K3UA 2NX3A 4JQ3A 1RJRA 5LGZA 2PDPA 3KVJA 1KQZA 2QGYA 3GXTA 1VBJA 1WXYA 1Z32X 4LEFA 3Q37A 4MY8A 1EJTC 1S5WA 1LWJA 3DI0A 1YEYA 1QHOA 3EA1A 4DJEC 2D2HA 4OOZA 2Y88A 4G5DA 3D47A 1E73M 4AIBA 1XH1A 3UNDA 4CNNA 2W27A 2PLKA 3UT0A 3LTPA 1TVNA 3ID7A 3IJDA 5AY7A 2ZX6A 4FLSA 3WF4A 1ADDA 1S1PA 1Z89A 3AIRA 2GOUA 3F03K 3MBDA 2NLIA 4MAZA 4AX7A 2RJHA 2WSQA 1GUVA 3E96A 1AH3A 1BRLA 1LQAA 3AIQA 3GH7A 1K4GA 3M7SA 4NRRA 5BWFA 5EMUA 1PKYA 1XIBA 3A64A 3ARPA 3SCTA 4WKFA 4XBSA 3UWUA 4DEFA 3KS5A 1BF6A 3HZ3A 4PMUA 3DHFA 1FWTA 4D1IA 2J7DA 1EO5A 1NOUA 2PF0A 3CZGA 3CIWA 4OJYA 2RH9A 3AHYA 2Z25A 1AW1A 4M5PA 3MI3A 1QJWA 2INFA 3EZ4A 4E2OA 1P0KA 3ITCA 2ZX5A 4M81A 4X9YA 4AEOA 2IQDA 3BMWA 4JY8A 2QHAA 2BB0A 1KC7A 3EOEA 2VFEA 4CCZA 3QV9A 4E4UA 1JNEA 3K4DA 4F2TA 1X38A 2DDXA 2E09A 2PDUA 5D33A 3B9DA 3LHTA 3P2VA 3GY1A 1PIGA 3OOQA 3WQPA 5LNUA 5D9PA 2VFGA 3NDYA 3TC7A 1SJDA 4S3AA 1M03A 3ZO9A 4BHYA 4A05A 3GS6A 1VCGA 3QJAA 3ZOAA 4IGNA 3T8QA 4AQLA 2PRHA 1RR2A 2GK1B 2Z1VA 1CTNA 3V0UA 1G67A 3CEPA 1ZCCA 1UUQA 4XAPA 4CD7A 2JEPA 2WNWA 5F2MA 4H9MA 3WJXA 3M0JA 4PUKA 3GW0A 5E9XA 1UR3M 2UWFA 3SQMA 5RUBA 4RV8A 2DW6A 4I7WA 2ISVA 4UCFA 4MNKA 2J6VA 1E3XA 2VFIA 1J9YA 3FW6A 3GBDA 5FJTA 4JN8A 2Z1BA 2V2HA 1GVIA 3USBA 1XBYA 3SQLA 3Q58A 3QYQA 1DHKA 2FGZA 4W7WA 2WMIB 4IFRA 3P6LA 4FB7A 3LGGA 5BXSA 3VCCA 2ISWA 4MJ4A 1IEWA 3IWPA 4IIGA 1ZBKA 3TC6A 5TD4A 4CKQA 3TYZA 1YDNA 1SSDA 1JF6A 3R4IA 4NVTA 3OGVA 2ZRXA 2NVCA 3PAJA 2ZWZA 4UTTA 2D2OA 1L9WA 2F2KA 4O13A 3EWDA 3HIJA 2XVNA 4RDVA 1I2OA 1NY1A 2RDWA 3MW7A 4NILA 1V6UA 4DYKA 4NY2A 3OJGA 5KZDA 1G94A 3RMJA 4WDXA 5ABGA 3IIZA 1GHRA 3VFCA 2IKJA 1UD2A 3PZUA 4C7DA 1J01A 1UKPA 1DE6A 3MKVA 3WH7A 1VLIA 2XH4A 3P80A 1K9EA 3IVUA 1H41A 2ACUA 2ADAA 1NDZA 2YCIX 2WPBA 4GUIA 1UZHA 3IJIA 1UASA 3CLWA 4GBUA 2QGHA 3WQVA 2QXWA 3T07A 3AIEA 2OQLA 4H9XA 3N6QA 1B90A 3LHWA 4ZFMA 4EAMA 3OZPA 4OT7A 1HJXA 4LRTA 1GOXA 5HJLA 4H41A 3RF9A 1HXJA 2ZZ3A 2R1NA 3FK4A 1JYNA 4JNMA 1K8XA 3W2JA 1QRQA 1HZYA 2ZICA 3ERPA 3MDUA 3TLQA 1W1TA 2CBVA 4LAZA 1PCWA 4R34A 5ABTA 3DG7A 2XSXA 1HKWA 3ONCA 1AD1A 2R9RA 1RLCL 3SB0A 3LS9A 2A79A 3KXQA 3AYSA 1W5PA 2V6AA 1KM6A 4KBXA 4D72A 5FF2A 4WJ8A 5I78A 2HBXA 4R3UA 4AMAA 3K5XA 3KBJA 3TXZA 4C6IA 5I7GA 3RU6A 3AS3A 4TVUA 1XUUA 4LYQA 2G95A 1QW9A 4W5ZA 4C5ZA 4AWUA 3JS3A 1C3FA 4IJRA 5D02A 1O1ZA 1TTIA 1ZJIA 3HFTA 2Y2WA 3I7SA 4LW7A 1TVPA 2E5BA 1XLDA 4ATLA 3HPAA 4Z2HA 3M0MA 3EXRA 2P3ZA 2J27A 5BROA 4C91A 3TIMA 4OOUA 5FF0A 2Z29A 1I2PA 4ZA0A 2OGJA 4EVZA 5D09A 4GBDA 2A3HA 2Y5EA 3BUVA 3AAMA 2PDJA 4HA4A 4JYDA 1O5KA 1SSGA 2DT0A 3FVMA 3LXCA 2A3LA 3S6OA 1FWCC 3SAZA 4IX0A 3WQFA 4WCJA 1XLKA 1MWOA 1PYMA 3SRHA 3LCIA 3R79A 2OWWA 1XYCA 1J0HA 4RLIA 3EX2A 4DAIA 1TJ2A 2OQYA 4YTQA 1YE4A 4WEVX 4V28A 2QPSA 1UWQA 4IHCA 3LBMA 2DIKA 3WQGA 1ADOA 3E1F1 3W7LA 2GL5A 3AJ7A 4D9PA 1SZFA 5H6HA 1W9BM 4C6LA 1R3RA 2P5NA 1VZWA 5E70A 5DELA 3KBSA 1K02A 2EPHA 2JFEX 5AYXA 1CXKA 4ZSTA 2GDUA 3C2EA 4XB3A 1PTGA 5LSMA 1B3YA 3DFSA 1FCVA 3TYBA 4UTJA 3FOKA 2X09A 3F7JA 5DANA 1MFUA 3W2NA 3GW3A 4DXKA 1E72M 3SEPA 3CUJA 3LCLA 1XLFA 3CPGA 1SPQA 4MSSA 2C18A 1DV7A 1K1DA 1FWIC 3N15A 1JXJA 4N9DA 3N34A 1C8YA 4LUTA 4UTFA 5GNZA 3GHSA 4YU1A 1GYNA 2X8RA 3WMSA 1V77A 4UQAA 2DQWA 3R11A 5AYYA 3S5OA 2VVNA 2GUBA 3HBLA 1FFQA 3U2ZA 1J8VA 2C3ZA 3VO0A 1OGSA 6A3HA 3CS2A 4DYJA 4JIIX 4UMBA 1OIMA 2EPMX 4LXFA 3HMJG 3ZJKA 1KFWA 4DAFA 3NQBA 2Y7EA 3SM0A 2YA0A 1LBMA 2PDMA 4Q8OA 5HXMA 2VELA 3AHTA 3GQYA 2XZ7A 3SCOA 3WBYA 3LI1A 3B0UX 4NJIA 1XIGA 2EJAA 3LHZA 4HSHA 1XIDA 3IV8A 5CSUA 3PUOA 4ZOBA 3HG4A 5I07A 3NQEA 4LV9A 2NSOA 3VABA 2OCZA 3TROA 3IJQA 1TJ1A 4U4MA 2ATMA 1CGXA 2VR5A 3C52A 4FNQA 1D7FA 4I5UA 1E9LA 5MHBA 4IPIA 2WK2A 3MVIA 4JEQA 2WZMA 3TKFA 4OUEA 3DHPA 2OELA 4QE4A 4ONVA 3TSBA 1GJUA 5LYRA 1P0DA 2ZE3A 1HL8A 1H7XA 1US2A 4JTGA 4WRHA 4IMEA 3E0IA 1X1ZA 3N2MA 4LVFA 2O9PA 1TPB1 4BQ3A 2QAPA 4GY0A 1H0IA 4MJZA 1IEXA 3WLHA 2E68A 5CLTA 1VP5A 2WNZA 3OVGA 4CQBA 3GFXA 2ZX8A 3TWAA 5AKQA 3BJSA 2ACRA 4BY3A 4J27A 1WDWA 5A6JA 4U5KA 3EPNA 3G1AA 1UROA 1XQKA 3L68A 1EZ2A 4KERA 3UVAA 3W02A 1XC4A 2Q3RA 3WD1A 3W7RA 1H7PA 2NQHA 4QHRA 1WP6A 2R1PA 1UZ1A 3S8HA 4DZAA 2V3FA 1XIIA 1SFLA 4F0HA 5CC5A 3G8EA 3B4YA 1IQ8A 4PSPA 1QU4A 2O4QA 2J7FA 3A4JA 2VD9A 3SZ8A 3T42A 4NKCA 1S38A 1M68A 2PB1A 1HGWA 3E12A 4EP8C 1UQZA 3N25A 4D6JA 5C6MA 3AI0A 3RXZA 1T40A 3M5YA 4WR3A 2PP0A 3MJMA 1KR0A 1W31A 1XSIA 4GKTA 2GDVA 1F4AA 4AXKA 4HIBA 3CO8A 3NQFA 3NZRA 4PUWA 4O52A 1EOMA 3ARXA 3VKCA 2BMBA 1POKA 1ZBWA 4XIAA 2O9RA 1YADA 5JH2A 1GOOA 2PE4A 1V5XA 2W79A 1LROA 4TQTA 3NO3A 1G7VA 3S6DA 2XH0A 3L21A 4HA1A 2XSAA 4Q4OA 1TUFA 1I0DA 1V3JA 4KW2A 1UR1A 2R14A 1UUMA 4ZVJA 3E0FA 1GHSA 3GNPA 3WMBA 1ZAJA 1GTEA 4JOMA 4UTUA 3RNDA 5TQLA 3ZSTA 2J25A 4DO6A 1RK6A 2FQIA 3HN3A 3RPMA 3T8LA 4IQLA 3UWEA 1UPPA 3FA5A 5DBTA 1B3XA 1EQCA 1Q63A 3G3DA 1MMFA 1E0UA 5K9CA 1UQYA 1H7WA 2FZMA 1A5LC 3FEMA 1RQBA 4KEMA 5AC8A 3B8IA 4R53A 2C7FA 1T6MA 2CBIA 1X97A 1R47A 3KOYA 2EGZA 2G4FA 3BC9A 2QJNA 3RITA 4H2HA 1AZ2A 4ECLA 4PR4A 4QJ3B 2V5KA 1KBJA 4EACA 1NP2A 2ZRWA 1US3A 1XM3A 1XLJA 3S2MA 3M0YA 3M0LA 4GUHA 4ZE5A 1CLVA 1TX2A 4RNJA 4MLJA 3GVGA 4IXHA 3QN3A 4KMQA 5HWNA 2VCAA 2QR6A 2P0OA 3KP1A 2Y8KA 4KEZA 3L0KA 5AYIA 2V81A 1SUXA 2D3NA 1FXQA 3L2IA 4DIAA 3NA8A 3WD4A 4AG0A 2QCEA 4WOZA 1PS9A 3DC8A 3G22A 4BF7A 3HURA 4KS0A 3MZNA 4H7CA 3PZVA 4ZQNA 3M6YA 1LLZA 3EDKA 3SN1A 2CHNA 2QUNA 3EEZA 3AYVA 3CV1A 1XYLA 1PL9A 3EDFA 1LP6A 1R87A 1F5ZA 2UBPC 3J7HA 3SCWA 3BOXA 4UTIA 1IGWA 1O94A 4WGHA 3H22A 5KZEA 2VNCA 1R9ZA 3QY6A 4MF4A 3E2QA 3SSZA 3GXMA 1O5XA 4INFA 1R2RA 2ON3A 1W32A 3QLLA 3AYRA 2GPTA 3U3HA 2O7SA 3L5AA 2GUUA 5EA9A 4KWUA 1H7NA 4HBKA 5A2BA 2E9MA 1JAEA 3TYUA 3WBXA 4E2BA 2RFGA 3SIZA 2R1MA 2WVVB 3AIWA 1V3HA 3DFHA 3K8KA 1HJWA 1TREA 3NTYA 2NXGA 4JAWA 3QR0A 1RBLA 4DN1A 2PRLA 5I77A 5H1WA 3EOLA 4LUTB 3W7KA 1QOPA 1E4MM 1QW7A 1I2NA 4OGZA 1ZL1A 2HSAA 1EOKA 1PPIA 2VRJA 4HTYA 4JTLA 4AD5A 2X1UA 3W7PA 3AS2A 1A5UA 1IYXA 4FNTA 1RVKA 1TJPA 2ZRUA 4XUYA 3MU7A 1FBAA 3CV6A 4B5VA 4GVFA 3TE9A 4ZO8A 5E09A 3Q65A 3I10A 2HVMA 3ARYA 3N29A 3BLFA 4Y8EA 3C2FA 4DPPA 3ABOA 2JALA 1EZWA 3UY7A 1YNQA 1A50A 4DJFC 5FIPA 2FMOA 4Y96A 4XBKA 3RM4A 4P7LA 5AB3A 3WLMA 5FJUA 3T2PA 3KL0A 2V69A 2XINA 2YDQA 4I8YA 4NZFA 1M65A 3ONBA 1Z42A 2PDKA 2PZNA 2QDDA 2V3EA 4N9CA 2VC5A 3PZMA 2Q8XA 3K1DA 2GVLA 2J47A 4PUUA 3F2BA 3EXSA 2E5CA 1JUBA 3EWUA 2QJJA 4LVAA 2OG9A 2NUWA 1JD7A 2B7PA 4HNCA 4AAJA 1EPVA 1XP3A 4HGXA 4UFJA 4GPNA 3STGA 5E0CA 3NPWA 4I7UA 1YQ2A 3FHQA 2CLKA 1EJSC 3PUDA 2I14A 1XUZA 2OOGA 3TJLA 1UD4A 1XS2A 3PNUA 3SUVA 2FTYA 2AMGA 4LS2A 3N9SA 3H53A 5C55A 5CZJA 1XW8A 4TIMA 4CEUC 2UY4A 1GG1A 4ML9A 5CLWA 3DH7A 4LRSA 3IACA 4W89A 1OX5A 4Q7IA 5I3FA 2ATSA 4K3ZA 2A2IA 5ABFA 1LCOA 2XFYA 3OZMA 3UR7A 1T5AA 1BGGA 3H4GA 3FX4A 1GWJA 3M0ZA 3CXOA 2E5DA 2VRQA 4KRZA 4N4QA 3T2OA 2WC3A 1G4PA 1THFD 5CCZA 2QIWA 3EOUA 2VZOA 4KGJA 3VOHA 3AXHA 3D46A 4W8AA 4PBFA 3FAXA 3LLXA 4AISA 7A3HA 4WKHA 3SUWA 1TPFA 2WJFA 4P8XA 1OFDA 1UMYA 1IHIA 1W2PA 5HR6A 3LXBA 3W9ZA 1KV5A 4IPLA 4ML4A 1EX5A 1QMLA 1AW5A 1I6NA 4JN6A 1J0ZA 2EKGA 1W3HA 1A5OC 2QCMA 2ZADA 1J5TA 4PC8A 4IFOA 4MG4A 3VMNA 4XD5A 3SDOA 4DBUA 1JQVA 3S1XA 2PTZA 4DY1A 4DJDA 2PBOA 4CCCA 4Z2KA 1TYGA 1E4IA 3GNXA 4GH3A 2QUVA 4K2SA 3T0TA 1O66A 3IEBA 3T55A 3NSMA 4JFVA 3OLIA 2YKKA 2V82A 2NQ5A 1OX6A 3AMGA 6REQA 4Q4MA 1BSIA 4NF7A 4PMNA 3T4WA 4XX6A 1UKQA 3K2GA 2WHMA 5D8WA 3R6IA 4H01A 3ATYA 3FXGA 3PP7A 4Q8UA 1EA0A 4IQJA 4DBWA 1AQMA 1ISWA 2HXUA 4A3HA 3W7JA 4YTSA 3DDMA 2OO0A 4PMJA 3KHDA 3PN8A 4GZ7A 2G41A 4CNOA 3R5EA 4HP5A 4PTNA 2VRKA 1DIEA 3KL5A 4K7VA 3QHOA 4CU7A 2WVUA 3VUSA 2HMCA 1WZMA 4PB3A 3U57A 4HN8A 3B9OA 2BZNA 3H7RA 3DYOA 2BY2A 1OK4A 1ISXA 1KCLA 1W3TA 4H8VA 3ZVIA 3KTCA 2OGYA 1PTAA 2RDUA 2CKRA 2V38A 2R1KA 2VUYA 3LENA 1GZJA 1IGSA 4UIOA 1PE1A 4HJFA 4YWIA 5DCEA 3AXMA 3OYZA 4CNSA 4Q8TA 2UV8G 4JIHA 3ELFA 4PMVA 1UWUA 3BAXA 4PMDA 5CC3A 3MSDA 2OT0A 2Y0FA 3UR8A 4B5TA 3MHGA 1TPVA 4MMWA 3UXIA 1UH3A 3WJWA 1JVNA 3TJ4A 1QI3A 4DF1A 5C9RA 3KZPA 4CD4A 3Q2DA 2C6QA 1D9EA 2Y61A 1U30A 4LVDA 3EPOA 5I00A 3DGRA 2HQAA 1IT7A 4GABA 1SW3A 1DIOA 4LVGA 3B9NA 3AOFA 3VGGA 3P60A 2VC7A 3RLGA 2JGYA