3WJWA

Wild-type orotidine 5'-monophosphate decarboxylase from m. thermoautotrophicus complexed with 6-methyl-ump
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 86
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wjwA00
1JCYA 3W76A 4JICA 4ORIA 2PRHA 1GPWA 2P10A 4RJEA 3G1VA 3KAOA 3WK1A 1T0OA 5FF3A 4ZZ9A 3RFAA 4ZQMA 2V2DA 4RZ5A 4WQ6A 4IMDA 4GE8A 1W56A 2FPYA 3ABQA 5G4WA 1SO4A 2QCNA 4MPQA 4WZHA 4FX8A 1FDJA 3LX9A 1DJNA 1P4CA 1TTIA 3MP4A 3GXNA 3W7NA 1KFLA 3G1SA 3TSBA 1Z41A 2V5BA 2C18A 3P5YA 1WBHA 2TYSA 4NJHA 3RLUA 3DI1A 3KVMA 4JIQA 1FCVA 1JQXA 5IM51 4BWLC 4DPPA 4E2DA 1D9EA 4HT3A 3E49A 2A5HA 3W1TA 1ICPA 1TPWA 2YZRA 3E02A 1TPB1 1G4PA 4TR9A 1H7NA 1M7PA 3FIGA 1LBMA 4Y9AA 3N3MA 4DO4A 4JX4A 3NQFA 1UUOA 3DFSA 2CZFA 1ZAIA 1XCFA 3IVTA 4AMAA 2NWSA 3LLFA 4GNJA 2E6AA 3NOEA 2RHGA 1OF8A 4I7VA 3S8HA 2J9ZA 1H61A 2DJXA 4H4IA 2FTPA 5CZ0A 1XC4A 5FESA 3QMSA 3T7VA 2QUTA 3FYOA 3TU9A 4K8EA 2H90A 1LTDA 2ZZ2A 3BGJA 2YPIA 5D05A 4LVDA 2C14A 1H51A 3LCLA 3NQAA 2NX1A 3KVJA 4MYAA 5IBXA 2J9XA 1OFPA 3LRLA 2B0MA 2E6FA 1VYSX 2PRMA 4MZYA 3I7QA 3BLEA 4N4PA 3PULA 1T96A 5D2XA 4IX2A 5EBUA 2OJPA 1RD5A 4NJGA 1A5CA 3ABRA 5FF4A 2PURA 3B8DA 3PAJA 2PRLA 1W1ZA 1YXCA 1GZGA 4R34A 1Q45A 4NJKA 4O1BA 1HFBA 1ZAJA 2A2IA 4TMBA 1YYAA 5GVJA 3DKJA 3EWBX 3VNDA 4CNOA 2QCDB 2VFEA 1OYCA 2WJZA 1CI1A 3L67A 3TFCA 3RU6A 1IF2A 2AGKA 2BTMA 4LVBA 1LCOA 3TQVA 3PSVA 2ZRUA 5U4NA 4MJMA 1P1XA 1N55A 3TKFA 1QR7A 3PG9A 4HNNA 3SR7A 3W1PA 4O15A 4O54A 5L9FA 3G8RA 2V5LA 3OA3A 5AHFA 3W7MA 3BPWA 1LRQA 3GXTA 1BWKA 4Z0JA 5K3VA 3AO0A 4GWEA 2Y7GA 2ZRWA 2X1SA 4JYEA 5C2XA 4AHPA 3PM6A 1QMLA 3N73A 2C13A 6TIMA 4HSOA 1QDSA 2YFNA 3L5MA 1DJQA 1I4NA 2ZA3A 1F74A 2WV8A 2I14A 2F84A 1SO5A 3OIXA 3QZEA 3M0ZA 1UB3A 1YTDA 4JTSA 3TFXA 3TMQA 3NZ1A 4O16A 3PS7A 1H50A 2GOUA 3LDVA 1Y0EA 3C2RA 2Z6IA 4CCCA 1SR9A 5J5DA 2DZPA 1M7OA 4ORMA 5HULA 3NPUA 2ZZ6A 3T78A 1K03A 4PC8A 3ZWSA 2YX0A 3DFNA 2VOMA 1A5BA 1YTEA 5HR6A 3HG2A 3O63A 3M7WA 2A1YA 3BG9A 3BG3A 5FEWA 5KTLA 3NZRA 3L66A 1M6JA 4N2YA 1K8XA 2F7FA 4MIMA 3W7OA 4JIPA 2E68A 3S1VA 1LZOA 5G5IA 1I45A 2A7RA 3UPWA 3SIZA 3WJYA 4C1LA 1EP3A 1KM0A 2HS6A 1OFBA 2Q8LA 4O0ZA 3TNOA 4RCXA 1V7YA 1JUEA 2QCLA 3NQEA 3G1FA 4DO5A 3R12A 1IIHA 3LTSA 4MZ8A 5A5WA 1XXXA 2Y89A 3C8FA 2CLFA 1U83A 5BNKA 3ELFA 5D02A 4RV8A 3OVRA 5J5RA 3EXTA 5I3IA 3LERA 2D73A 4QJ1A 1SUXA 3A5VA 5AC7A 3HG3A 3QEZA 4BWLA 4A2RA 3LM7A 2VKZG 3TSMA 1GOXA 2OMAA 4UC5A 3TR2A 2JK2A 3NG3A 4Z08A 1NAL1 4OGZA 5K9DA 1C9DA 1VCFA 2FB2A 3E12A 3S1WA 3S5ZA 2RH9A 4UFMA 3TW6A 5BMXA 1Q6OA 5TIMA 1KM3A 4KFPA 4XWUA 1ALDA 3TIMA 2XFWA 3L5AA 1VRDA 1F05A 1KV8A 2NZLA 5EKYA 1PV8A 1OVDA 1THFD 1PVNA 3IIZA 3BO9A 1FCUA 3LLDA 5HUOA 4POCA 3W07A 1VR6A 5AHEA 3PG8A 1N7KA 5DCDA 2A6NA 4DEFA 4NVTA 4BFAA 3ATZA 3CLMA 3R5EA 4M6QA 1QOQA 4W9TA 1GVFA 4RZ6A 4QSHA 3CWNA 3LGEA 3L65A 1GJPA 4OT7A 2KZHA 2NX9A 1OX4B 3NL5A 3TUUA 2ZZ3A 4K38A 4O8RA 3NPXA 3MHGA 4FF7A 1TRDA 4HPXA 4JTEA 5FI8A 4NNAA 3FYPA 3GNNA 4K37A 4ZQCA 5AYXA 2QCCA 1N8FA 2ZDRA 2CZDA 5EA9A 1DQWA 2GQ9A 4XKYA 4P2VA 1FQ0A 4WJEA 4UTTC 3V75A 3ANYA 3UWQA 3W2MA 4X2RA 1TREA 1CX9A 3C6CA 4CNPA 4Y8FA 5AHMA 1SSDA 3W2JA 1NVMA 1W5QA 2TRSA 4X9SA 3INPA 2FIQA 1IGSA 2BX7A 3TCEA 3GNDA 1ZENA 3IGSA 2C3ZA 2EAWA 1TV8A 3C61A 5CPOA 3CIXA 1GYNA 4UFLA 5MHBA 3DGRA 1RQEA 3G0XA 4O28A 1RPXA 4JY8A 1Z42A 4J9JA 2W0UA 3FFSA 4JTHA 1OX6A 3C52A 4ADUA 2QDHA 4S2CA 2YFOA 3S1UA 1ZHAA 4QNEA 3S42A 4YXGA 2FB3A 4HPJA 1X1OA 4LRSA 1LP6A 1JRCA 5DXXA 1O94A 5CKSA 4LS0A 1FWTA 1BKSA 3CM4A 5E93A 3USBA 3QQ0A 3TMLA 3VFLA 1R2TA 3LHYA 2FJKA 1KTBA 3Q58A 3BW2A 1SQ7A 1TTPA 2DZWA 1ZAHA 4DPQA 1RR2A 1SZEA 3W22A 5AN7A 3N9RA 3BG5A 1HG3A 3P7YA 2RFGA 3S6DA 1NF0A 1JCMP 2FDSA 3IEBA 4GC4A 1LRNA 4OWGA 3O07A 1DQXA 1K7XA 1SZFA 4BF9A 2WSYA 4ZQPA 4TMCA 1F76A 2IQTA 2CLKA 2GVJA 1I2OA 4H6KA 1G4EA 3STCA 1SZGA 4AWUA 4YL2A 4BK9A 4JDYA 3MP5A 3E96A 4K39A 4JTLA 2I1OA 2NX3A 2E5CA 4EIVA 2FLIA 3NQ2A 4Q4KA 2H3BA 4IXXA 1O5KA 5FF7A 1VCVA 3IIVA 1VPXA 2ZRVA 3JR2A 1TPH1 2WPBA 1FXQA 2NLIA 4N4QA 3HQ1A 2Y7FA 3LV6A 4MKNA 4GBUA 1MO0A 2C1HA 3HOJA 4QIUA 5DXYA 4E38A 1DBTA 2CLHA 2G5WA 3LI0A 1PHQA 1I2RA 3SI9A 3F1QA 1F7BA 5KZMA 2NV2A 3MBFA 4IMEA 5DCEA 3MW7A 4AF0B 3PBYA 5F4XA 4Q33A 4XZ9A 2CLMA 1FX6A 3U6WA 3MI3A 1VYPX 5AB3A 3HPSA 2QDGA 3Q94A 1EWDA 1VHNA 1EP1A 3A24A 5KMYA 2ZZ1A 5KZDA 4I7UA 5G2IA 2J88A 1QNVA 1TPUA 3W7LA 4JGDA 3W70A 2FPTA 5TBOA 3PVFA 1TMHA 2X1UA 1VQTA 1JJKA 2FQIA 4O52A 1A50A 2Y70A 4ADSA 4GUJA 1VHCA 2ZA1A 4QAIA 3EX1A 3QF0A 3LTPA 5F2MA 3IIPA 4JTTA 3OHIA 1WV2A 4GXMA 1EP2A 4M6PA 3LCXA 1FCQA 4KWVA 4PL2A 4YMZA 3UYCA 1WAUA 3MI2A 4IGHA 2BSLA 2RDUA 5AYYA 1GWJA 3DFTA 3CHVA 2CZ5A 3LXBA 4OU1A 3KVLA 3YPIA 4OQVA 1K3UA 2DZUA 4DBDA 3MWAA 3QJAA 5LNRA 3PB0A 2B7PA 2QJHA 4ONVA 2DZSA 3W7IA 2ABBA 4BI6A 2JKAA 2Y61A 4MFEA 1K7EA 4LT9A 3CT7A 3F4WA 1WOBA 5LGZA 1EIXA 3IRDA 1D3HA 3IVUA 3TA6A 2VELA 4FNQA 2QEZA 3G24A 5K7JA 5CZTA 3PB2A 3GR7A 4IJBA 3O1NA 2E5BA 1I2QA 4JTUA 1C29A 2QCDA 5HJLA 1FUYA 4LU0A 3N19B 1H1YA 2X2GA 4I9AA 3SFKA 3RNDA 3TAOA 2VEKA 2VEPA 3TQKA 1P0NA 1HL2A 4JR5A 2VFDA 1YPIA 1QPOA 5F2GA 1K02A 1ZY9A 2X1TA 4UTIA 2A4AA 3W74A 3BGGA 3C0JA 3SZ8A 2C19A 3W7EA 4RZ4A 2GPTA 3V1PA 4AEOA 3TC7A 1I2NA 1HO1A 3G1DA 4UIOA 4DF1A 1UCWA 1W5PA 3QRHA 1W5MA 3C2OA 3BW4A 5CGQA 1MEIA 3B06A 1OYAA 3LCGA 3P67A 5DELA 1VLWA 2G97A 4C1KA 4UFKA 1H7PA 4WX2A 2OCZA 3OG3A 5AFDA 3TQ0A 4DELA 3WK0A 3TE9A 3GIYA 1TPDA 3RK8A 3GDKA 4QQ3A 3M5YA 1S3HA 2GJLA 3GX9A 1RQBA 3CEPA 3L0KA 4KFNA 4UTLA 2G96A 3STGA 5LHFA 3KXQA 4IUOA 4UCGA 1OABA 1K7FA 5K4XA 5F2LA 4CLMA 1SFJA 1GG0A 3NQCA 3GR8A 1TPC1 3LCFA 4RK8A 4U4MA 4KKXA 4OBTA 3VE7A 1JCXA 3CEUA 2EHHA 2DZVA 1PCWA 4TIMA 4JS3A 4HNUA 3HGSA 2R94A 2GVGA 3LOTA 2YYUA 3HF3A 1KM5A 5CSRA 5D38A 3KX6A 1HUVA 1ICSA 1L6SA 4AHQA 1IXPA 2TMDA 3LCWA 1V5XA 1KM4A 2WNZA 4A21A 4O11A 1AW1A 2E09A 4O1AA 1GVSA 3DHFA 1R2RA 5I3FA 1TRIA 3HMJG 2C16A 3LHTA 3NDOA 3B0UX 1JR1A 4DF2A 1EA0A 3SSJA 2A7NA 3DBPA 3A23A 1A53A 5I3KA 1GYLA 3SW6A 5AC8A 4HNTA 5I3GA 4LVAA 2DJLA 3A22A 3WK3A 2YW4A 4MVAA 3A9IA 3W7QA 2QJGA 4JTIA 4XTIA 3NGJA 1ZFJA 2Z1BA 2V81A 4UUIA 4FNRA 1R2SA 3NPVA 2V0TA 2H8ZA 1QPNA 3LBMA 4MY8A 4PCFA 4E0CA 3G1HA 5D2WA 8TIMA 3MJYA 3SJ3A 4PH6A 2ABAA 3ZR4A 3PUEA 1OF6A 4ALDA 2Q3OA 3EX6A 4LTSA 1QCWA 5A8GA 3IGUA 3HBLA 4LV4A 1AW5A 1LBFA 1UJPA 4FNSA 2H3DA 3DZ1A 2YSWA 3NM1A 5E0KA 3QFEA 5LNWA 3DFOA 3L5LA 3UY7A 4LS1A 3NL6A 4JXCA 3NL3A 4LNYA 5DN1A 1YDNA 3LHVA 4JDBA 4JD4A 4LVFA 1AMKA 5K9XA 2C0AA 1LLZA 1LBLA 1JRBA 3M41A 3MHUA 1RVGA 1TPVA 1TYGA 2JBMA 3UQNA 3L0NA 3TJXA 3O6CA 3TX9A 5CPNA 2NUXA 3G3MA 1BWLA 1F5ZA 1XI3A 4OV9A 1OJXA 3LTYA 3OVPA 3DENA 3HJZA 4P61A 4GFSA 3MYOA 3HGJA 4NXSA 3GKAA 3HGOA 2CFFA 2TPSA 1UASA 3UZ5A 2GVLA 2E6DA 3UWUA 5K9CA 1YTKA 1WXJA 1JUKA 3C2FA 3IIOA 4MUZA 4FNPA 1IXOA 3UNDA 1PCKA 2WSRA 3C2VA 4IPIA 1ZCOA 2HMCA 3UY8A 3B04A 1L6YA 3Q2DA 4LC8A 2CLLA 5F4SA 3VKJA 4PA8A 2NXGA 1G7UA 3MI6A 4E2BA 3MUXA 1W5NA 4ZMGA 2Y88A 4GUFA 1PL9A 4X22A 3UZJA 4WY0B 4ML9A 3NQDA 4FHAA 3W1QA 2NXHA 5CG7A 5K2ZA 4FEZA 1KM1A 3DAQA 3N2MA 3PBVA 2J6XA 5G4EA 4CCEA 1S5WA 1FCBA 1XBYA 2Q8ZA 3EXRA 2I9EA 3UD6A 4K7YA 1TPFA 1TTQA 4LY8A 2DU2A 3H55A 2XN1A 2YYTA 1KM6A 5CZSA 4NU7A 3M43A 4PTNA 5D2VA 2ZBTA 1H60A 1IXQA 3L21A 5G2WA 4UFHA 5FEZA 3W7CA 3PBUA 5G2HA 4NT0A 1OK6A 4QISA 3P60A 4O17A 4MLRA 3QSTA 3N2XA 4N02A 4HNVA 2C15A 5AC6A 1KLYA 3W2LA 5D37A 5CPMA 3N14A 2J24A 3F4NA 5HUPA 3S9YA 3OVQA 1VJIA 4GUIA 2E5DA 4XUGA 2ISSA 3Q37A 3EX3A 2RKXA 2QUVA 5C6MA 1FBAA 5D30A 4O13A 1XUUA 3T40A 4Z1AA 2ZCGA 1ML1A 5HINA 4PODA 4O19A 5LHEA 3DXIA 4ZVJA 1EX5A 1L6WA 4MLJA 2CLOA 3G0UA 1YXYA 2CW6A 1I2PA 4AWTA 3IV3A 4WOQA 2DZTA 3W1NA 4N9CA 2QCFA 2ZQ0A 4JYDA 4IMCA 1G67A 1G6CA 2EKCA 5CPLA 1WX0A 2ZTJA 5KZEA 4GUGA 5H91A 3DI0A 5L6UA 3TW7A 1WOAA 4IMGA 3N9SA 3H54A 1LOSA 1O95A 4LS2A 2YR1A 2ZYFA 1VZWA 5G1YA 3K30A 4WUIA 1KM2A 3W87A 1H5YA 3W7PA 3EXSA 3G22A 1OFQA 2ISWA 3LCHA 3W7HA 3LXCA 4RX0A 3W1XA 1JVNA 3R8RA 1MEHA 1YDOA 6ALDA 3B0VC 1GQNA 4CCDA 2JGQA 3FKRA 3CQ0A 4YWIA 1SW3A 4YCPA 2OZ0A 2OT0A 4IPJA 1X6UA 3W3OA 2TSYA 3VCRA 1J4EA 3NQ6A 1TQJA 1XBXA 1XM3A 2V2HA 4N6FA 4FB7A 1Q3NA 5EL1A 3SGUA 2VENA 4JTFA 5HWMA 4LW7A 4AAJA 1J5TA 2NUYA 1RZMA 2A6LA 1PIIA 2Y7EA 3W6YA 2WKJA 4NUWA 3M9YA 1RV8A 1EPXA 3FJ6A 2Y62A 2VC6A 2P1FA 4DF0A 2ZRXA 4XKYB 3O6DA 3M5XA 3W86A 3PUOA 4XBKA 3ATYA 3EKZA 4M7SA 4Y6GA 1P5BA 1GVRA 3PF3A 3NO5A 3HG5A 1TPEA 3STFA 3L9CA 4FIQA 1IIGA 4IX0A 2PC4A 4O53A 2A0NA 4AHOA 3W7KA 3C2EA 4UMAA 3M5VA 3GVGA 1AG1O 2BWGA 2V30A 1XDLA 4DBEA 3HGRA 1R30A 3W71A 2Z0IA 4NNBA 2VXNA 1S5TA 1DVJA 1WDWA 3LCIA 4DO6A 4Y90A 1W31A 4L4MA 3KFTA 1OYBA 3ZWTA 1R46A 2WQPA 1AL7A 1SPQA 2GJNA 1SU5A 4XBSA 1VC4A 1KTCA 2ATSA 4IWWA 4O0KA 2JKPA 5TQLA 3SY5A 3QSRA 4H3DA 3NR0A 1DKWA 3VI2A 3THAA 3CC1A 3W9ZA 2CLIA 2PE4A 1LORA 3DFQA 4FX6M 3P74A 3D0CA 2ALDA 4K7VA 3B0PA 3LB0A 4Y96A 1PHWA 1DV7A 1J2WA 2ZA2A 3GDMA 1NF7A 3IGXA 3LRKA 5FEXA 4EF8A 4AVFA 5BOOA 4CNNA 4OHQA 5BMWA 3W73A 1WQ5A 1G7VA 1L2UA 2A85A 3TC6A 4O10A 4AB4A 4B5NA 5D2TA 5K4ZA 3WJZA 4O14A 2DP3A 1JCJA 1QAPA 1VLIA 4ZQOA 2DORA 3TSDA 1A5AA 4OE7A 3EX2A 2OT1A 3P62A 1KLZA 1XBZA 1QO5A 4UTWC 5LNSA 3QYQA 1XL9A 5LKYA 2NWRA 3RLVA 2QCMA 4RLIA 1PE1A 5F1VA 3B03A 2YW3A 3E9AA 1HTIA 4S2BA 1RQHA 2R14A 3LI1A 4QM1A 1R47A 4DXVA 3CB8A 4O12A 2V9DA 3NQVA 1GTHA 5FEPA 2GQAA 4LV9A 3TXZA 3ABOA 3LHZA 4UTMA 3FLUA 1GVQA 4UTTA 3RMJA 4EVZA 3G1YA 3WJXA 4R7JA 3G1XA 1H62A 4XTDA 1ICQA 3BARA 4WXYA 3P8IA 4JX5A 3S1XA 1F6PA 3CPRA 2B7QA 4AXKA 2GQ8A 3HB9A 3DFPA 1OX5A 4WD0A 5HR7A 1I8JA 3U2OA 4LVGA 3WJSA 1T8XA 4HHPA 3NPWA 4HIBA 3W85A 3MO7A 1WA3A 5HMSA 7TIMA 3OEXA 4UTJA 3LHUA 4O4VA 3TROA 4UTUA 4LOCA 2RDWA 3TDFA 4O1DA 1DORA 4WXZA 5G1TA 1W5OA 4CQ9A 1VCGA 3DU0A 3W1LA 4JNMA 4M19A 3G3DA 1VGAA 5DY3A 3QW3A 2ZZ4A 3KVKA 2A21A 3M47A 4JY9A 3GZ3A 3P81A 5C5YA 4BR1A 1FXPA 1TB3A 3NQ7A 5BW6A 1H7RA 3GDRA 3NVTA 4NZFA 1K8ZA 1Q6QA 3MBDA 1DOSA 1OHLA 3G8EA 1B9BA 3WFAA 3A21A 3FOKA 3TJLA 1YADA 2BLEA 3PR2A 5HWNA 4GUHA 1XBVA 3O06A 3W2UA 3DKLA 3LXAA 4IQLA 4EOUA 1GTEA 1X1ZA 1LYXA 3EWUA 1MSSA 1UUMA 2Y7DA 5F2IA 1K8YA 3GKFA 2QF7A 2H6RA 1LOLA 2E1DA 3O8AA 3SECA 2QCGA 3NNTA 5D04C 3NQGA 4RXGA 4MOZA 2ZTKA 4JN6A 4NZJA 3NXFA 2ATMA 1B3OA 4I7WA 1QOPA 3PY2A 1Q6LA 1TJRA 1D3GA 2QAFA 5HQEA 3TAKA 1GVOA 2BXVA 1LDCA 5U7SA 1H7WA 4AH7A 3ZS4A 1QPRA 4Z1CA 3EEGA 4ICNA 3LV5A 5I3JA 3NAVA 3MHFA 4NXKA 2ZFAA 4CQ8A 4A2SA 2EGZA 2JKEA 1AW2A 5LZLA 2R91A 2QKFA 3LBCA 5HNRA 3BVJA 3IVSA 4N9BA 2Y63A 5EMUA 4LUIA 3S0CA 4MJZA 4UMBA 4CQAA 3N34A 3B4UA 1XKYA 4XQ6A 1QFEA 3W2NA 1W8SA 1QWGA 5H2ZA 2NV1A 3P61A 4QNWA 1B4EA 2W79A 3P8JA 3GAYA 2PCQA 1XFBA 1KFEA 4NNCA 3M44A 1SW0A 3M1ZA 4HSNA 2QCHA 4G1KA 3GDTA 1GG1A 3GDLA 1TJPA 1NFBA 1L9WA 1O60A 5EY5A 2A7PA 4RXFA 2E77A 2YDAA 2EF9A 5DY2A 1O5XA 2Z2UA 1TTJA 4JEQA 4MY1A 1H1ZA 3HPZA 4UFIA 4FXSA 4A3UA 1W3TA 3G18A 3AJXA 3NEVA 3O6YX 4L4LA 3E0IA 2C6QA 1KW1A 5T26A 2QJIA 1ZALA 2VFHA 3W7JA 2J27A 3GXPA 5C54A 4WY0A 3UPBA 3WJWA 1KFJA 1DHPA 2CWNA 4Z0SA 4FIRA 4AWSA 1NEYA 3JRKA 3KRUA 4UTWA 1Z48A 1ME7A 1JUBA 3TV8A 4RKAA 3M6YA 2ISVA 3EKLA 1Q6RA 3MMTA 4MYXA 2J9YA 5FF2A 3EWWA 4EF9A 3FKKA 1O4UA 2BZNA 5AHIA 2X1RA 5EYWA 1X7FA 2UV8G 4FNUA 5DCBA 1EEPA 2GUUA 4M7TA 3L0GA 2VFFA 5F1UA 1KBJA 5DBUA 1SO3A 1GEQA 4YCOA 3RF9A 3O05A 1OX4A 3TH6A 2XN0A 4UMCA 3KRZA 3BK0A 1FY6A 2QUUA 3P80A 3EX4A 2WOQA 5KSWA 4UNKA 4NJIA 2VEIA 3QPZA 3BLFA 3W23A 3JS3A 4YLWA 3HPXA 4FO4A 3KOFA 3DHDA 3GYEA 3F03K 1W0MA 3QW4B 2RDTA 4NJJA 5AHLA 3W7RA 3ZFHA 2NXIA 1MZHA 1YXDA 3W88A 1FWWA 5LGXA 4ZQRA 1VH7A 1U5JA 4O1CA 1X8FA 1YLVA 3W1RA 1Z44A 3QPYA 5BRBA 1LM1A 3VE9A 1ADOA 3U8GA 4UR8A 3EB2A 3I65A 3I68A 3W7DA 2H8XA 3EWZA 3W1UA 1W54A 3QC3A 3SGZA 1FWSA 3NA8A 1T99A 2OX1A 1FWRA 1KFCA 4LWWA 5EPDA 3NQMA 1SW7A 1FDZA 1OFEA 2X16A 1G4SA 2WSQA 5D32A 3I7SA 1ZJIA 2DZXA 1MXSA 3FEMA 4N9DA 4MZ1A 1IXNA 1JCNA 4O50A 1TV5A 3QMRA 5LNVA 1TQXA 4JTJA 3PC0A 2W6RA 3W75A 4R53A 3G1AA 2EPHA 3NYZA 1ZNNA 2B4GA 3R89A 1CW2A 1ME8A 1OFAA 4Q32A 2FPVA 3A5FA 1WYIA 3NM3A 2Q3RA 5D03A 4A29A 4JTKA 4LRTA 4WOZA 4K36A 4DQWA 5C55A 3S5YA 4N9EA 1FDYA 2V82A 2Y6ZA 3WK2A 5CSSA 1OFDA 1KV5A 3S5NA 1A5SA 3KRSA 2WNNA 1LRTA 2VFGA 1C8VA 1H63A 2WNQA 4ADTA 1BEUA 3B05A 3NQ8A 2ZRYA 4O57A 1TIMA 1QO2A 2CU0A 3C56A 4N6EA 3QQ1A 3HG4A 1JQVA 2NUWA 3PSWA 3C4UA 1SSGA 3BW3A 1NSJA 2P0OA 4Z1DA 2CZEA 4HN4A 1EUAA 3W7GA 4NQ1A 1UBSA 2YGYA 3W72A 5I3HA 1ONRA 4GRSA 1XUZA 1KFBA 3CIWA 3TK7A 4PFMA 3C3NA 3O15A 3P5ZA 1EWEA 3GLCA 1QPQA 3GAKA 2AQWA 3CU2A 3IIXA 3H53A 1PS9A 1W3IA 4EWND 4S1FA 3TXVA 4OV4A 4IOTA 2WO5A 2ZZ5A 5D33A 2B7OA 2E6YA 4O18A 4FX7A 4M6VA 5FF0A 3ABSA 1S5VA 3W84A 1BTMA 3EWYA 4HKPA 1VS1A 3P82A 1XDMA 1JCLA 3T55A 4AF0A 1H7OA 4NX5A 1KTNA 1HO4A 5AHNA 3MP3A 1G4TA 4JX6A 5DLCA 2B7NA 4TX9A 5AYZA 1SO6A 2VFIA 3KHJA 2R8WA 3HIJA 4O4WA 2VEMA 1P0KA 4MFDA 4IMFA 3LRMA 4X3ZA 5IBXC 2JGYA 3NL2A 2CLEA 5ABTA 3EWXA 3LHWA 5KINA 3CTLA 1OFOA 3THQA 5LSMA 1F2JA 1H7XA 3HO8A 4WY0F 3M16A 3STEA 2YCEA 4D2JA 3T4CA 2ZRZA 1B57A 4UNLA 3UWVA 5D09A 4ZQNA 3UWYA 4K6AA 5AOUA 1EUNA 4QITA 4FXRA 2V2CA 2Y85A 5HWJA 5DBTA 3UWZA 1LOQA 3GK0A 1ME9A 3W83A 3DH7A 1AL8A 1E51A 1YDVA 4GJ1A 1TO3A 3QH2A 3FA5A 1EB3A 1YPFA 1GT8A 2G95A 2QCEA 2X30A 3CWOX 3T44A 4TU1A 3G0SA 1VYRA 4PL1A 4U28A 1F73A 5LNUA 4LUJA 2QAPA 2HTMA 3L68A 4PEKA 1M5WA 1TV7A 4Z1BA 2LLEA 1AK5A 3BLIA 3W1MA 2YXGA 3P84A 3R13A 2O7QA 4UTHA 1G69A 3MYPA 3GB6A 3FJLA 3PBWA 4JTGA 1FWNA 3OBKA 1W37A 1TCDA 3O16A 4KFOA 2FFCA 4UFJA 4UXDA 1KFKA 4UR7A 3UXAA 1B4KA 4R33A 1WBJA 5KITA 3UWWA 3W1AA 1KA9F 2V8ZA 4UTKA 3QM3A 4LC6A 3R2GA 3I6RA 2ZZ7A 3BV4A 2XN2A 4TO8A 2AAMA 4ZL1A 1SFLA 3S5OA 1MEWA 5E1QA 1F6KA 1W3NA 4M5PA 3UXDA 4IXHA 4BI7A 2O7SA 3FS2A 3PWAA 3PUDA 1OG0A 5F4WA 3I7RA 1SZNA 2QR6A 1OK4A 1LLWA 5SWUA 1DL3A 3M5ZA 5D2YA 1LROA 4RR4A 2HSAA 4MY9A 1JULA 4K8HA 1KBIA 4KWWA 2HS8A 3QMTA 1TSIA 4JYFA 1OFRA 3L2IA 5CZJA 3W2KA 4A22A 4FNTA 4BI5A 2Z6JA 4NX0A
chains in the Genus database with same CATH superfamily
4LX4A 3REQA 3UG8A 3Q67A 4GY0A 3QYSA 3U3HA 1YHTA 1E43A 4GNKB 4WQ6A 4QLLA 1C7SA 1QNOA 2XSXA 3ABQA 1W1IE 2QCNA 1TZZA 3VD3A 4MPQA 4FX8A 1UP3A 1DJNA 1P4CA 1Z3NA 1TTIA 4YNGA 1TUFA 3TSBA 2C18A 4H04A 4O1FA 3DI1A 3EPNA 4EXBA 1SJAA 3EDFA 3N18A 4BWLC 3KTSA 4E2DA 3F4CA 1D9EA 1ZJHA 3IJ9A 4WSHA 2E8ZA 3W1TA 1TPWA 2VEGA 4IP4A 5CXPA 1EJSC 1Q7MA 1TPB1 3B9EA 4TR9A 3FIGA 4BZYA 1LBMA 2YDRA 3N3MA 4DO4A 4GACA 2EG8A 4YTSA 1UUOA 1H5VA 1UR4A 3CHFA 3PAOA 1X6LA 3BAWA 2XVNA 3U4FA 2E6AA 3NOEA 4PTVA 4I7VA 4XX6A 3S8HA 4FOUA 4JNZA 4TQTA 1H0GA 3T7VA 3MSYA 3MCNA 2H90A 2PB1A 2ZZ2A 1PAMA 1MFUA 3BGJA 3T07A 1E72M 5D05A 5D9MA 4GYPA 1XF0A 3NQAA 3RLHA 1E9YB 3QR1A 4YU1A 4D6IA 1JDCA 2PRMA 3XINA 5ABFA 4MZYA 4XVEA 3BLEA 1YNYA 2WCGA 2PWFA 3PULA 5EBUA 1XC6A 3TTQA 4F9DA 2PURA 3B8DA 1XISA 4F8XA 1BVNP 2TODA 1MQRA 4PMRA 2GDVA 4WVXA 3QV8A 4NRSA 3DKJA 2XVLA 5GVJA 3OG2A 3VNDA 5C9XA 4CNOA 4H9YA 4KRTA 2R24A 2ICSA 4GIAA 3DC8A 3L67A 4D8AA 3T1GA 3OP2A 1H49A 4DJEC 2BY2A 5FAJA 1Q85A 1LQAA 1P1XA 3SCPA 1RA0A 2HNHA 4J7RA 2ZX9A 3SR7A 4O15A 4O54A 3MSGA 2V5LA 3OA3A 4ICMA 2QIIA 1R9ZA 5D9NA 2Y7GA 2V68A 5C2XA 3URNA 3TYBA 2C13A 4GZJA 4C7DA 1K70A 2YFNA 1DJQA 4PMDA 1XYFA 2ZA3A 4QBXA 3RYSA 3ARZA 2G3JA 4GZEA 3SCNA 1SO5A 4Z42C 1S2AA 3M0ZA 1UB3A 2XIQA 1GZJA 4JTSA 3NZ1A 4H9VA 3NZPA 1B0IA 3ITYA 1UQYA 3THUA 3C2RA 3DERA 3OQEA 1UR9A 1BYAA 1ISXA 2PEVA 1SR9A 4CCCA 2V6AA 5J5DA 3GTFA 3FDKA 3QY8A 3WF0A 4ZOBA 5I7GA 3GG7A 3LS9A 3WH6A 2V3FA 1C91A 1UH4A 1UOKA 1YTEA 3EAUA 4UQEA 3O63A 5I79A 3GVQA 4W85A 3SRHA 3L66A 3UCQA 4JFVA 4P7NA 2E68A 1I45A 2A7RA 4AMCA 3BLDA 1J11A 4CNSA 2HS6A 3NUKA 1PDYA 5M3WA 1QNRA 1V7YA 2OZ3A 1VF8A 4PSRA 2DSZA 1V0LA 2F9RA 3G1FA 4DIAA 3WN6A 1KRCC 3PP7A 4JBRA 3R12A 4C6DA 3SY8A 2Z29A 2VI0A 2CLFA 5HJYA 1T7LA 3T05A 5JBDA 1PYFA 3OVRA 5J5RA 1PIFA 1N2VA 4HHLA 1KXTA 1SUXA 5AC7A 3GTXA 2E9LA 2DEPA 3NO1A 3LM7A 2VKZG 5CJMA 4IQEA 6REQB 1J6OA 4HYRA 3TR2A 5IHRA 3KE0A 4D1JA 4ZXLA 1JYVA 5K9DA 3AXXA 3IAPA 3VGGA 3ZJKA 3TTEA 4C1NB 3TJ4A 3HTWA 5TAOA 5BMXA 1Q6OA 1LT8A 2F8QA 1KM3A 4KFPA 4P8XA 4UQCA 3PZQA 2ZX5A 2NZLA 1LF1A 1PV8A 2XJ7A 4L80A 1TWSA 5HUOA 2VJXA 5AHEA 2EO7A 2A6NA 3BLOA 4NVTA 3ATZA 3R5EA 3SCOA 1CNVA 3LGEA 2VL4A 3L65A 3PTKA 7CGTA 4OT7A 2KZHA 1DPMA 4Q8UA 2Y1HA 1K6AA 5DMMA 3TUUA 3AWOA 4O8RA 2W63A 4FF7A 5HMEA 3AXHA 4DI9A 4EP8C 1TRDA 4HPXA 3FYPA 5AYXA 3R0UA 2QCCA 2PZNA 4ASTA 1DQWA 3CPGA 4P2VA 1FQ0A 4WJEA 1ZPTA 4LGXA 3ANYA 3W2MA 2FJUB 4X2RA 5D8ZA 1B1YA 2OEMA 4CNPA 4GCXA 3SCRA 2WAGA 1E6QM 4H7CA 3W2JA 1W5QA 4LYPA 3LYEA 1K9TA 4X9SA 3INPA 1IGSA 2BX7A 2OEJA 5CGTA 3TCEA 3GNDA 4JL2A 2WM0A 1TWDA 1OCQA 3CIXA 1XIEA 4UFLA 3BAXA 3DGRA 3N4FA 1RQEA 1QVBA 3FHQA 4O28A 1KBLA 1E0VA 3FFSA 2VGGA 3O2LA 4ADUA 3GFZA 3RLGA 1V08A 2YFOA 3WLLA 1QJWA 1NP0A 3FAWA 1X1OA 1WXZA 4HMNA 5BXPA 1OGSA 1JRCA 5CKSA 4YTUA 3HQOA 1AMYA 5I2UA 2NVAA 3LHYA 1KQZA 1V0NA 1KTBA 4OKDA 3GU9A 3BW2A 1UWIA 1TTPA 4GQRA 2WJFA 1XSKA 2PDLA 3SRDA 1SZEA 3N9RA 1E0XA 2RFGA 3A3XA 1M7JA 3TTYA 1JCMP 3IEBA 1XLJA 1LRNA 1LT7A 2BFGA 5JXQA 4TVCA 3SM0A 1TV4A 1HJVA 1SZFA 2HPIA 4P8VA 4GZ7A 4BF9A 2OSYA 4PMNA 4ZQPA 1F76A 1J0KA 2GVJA 1XHGA 1S39A 1SZGA 4YL2A 4JDYA 1QI5A 3UA4A 4GVGA 4PUNA 4HYVA 3MP5A 2I1OA 1R8LA 3NQ2A 3A4JA 1O5KA 1NWRA 3PTMA 4C91A 3IIVA 4FLSA 3JR2A 1TPH1 2OYKA 3MB9A 1UKQA 3UW6A 1TVLA 3AS2A 4G9PA 3S83A 4GBUA 3RCNA 2C1HA 1DJGA 4E38A 1MYRA 4EWJA 4GISA 3D46A 1MXDA 3SI9A 2Z24A 3MBFA 4F4RA 3M0IA 1J5SA 3PBYA 4FXJA 2QDGA 1VHNA 3KOZA 1EP1A 1O66A 3A24A 1V02A 2ZZ1A 1E0WA 2NW0A 5G2IA 2FYMA 2PGEA 1JF5A 4B5WA 3R4IA 4MB1A 3MUY1 5TBOA 1TMHA 4HOWA 1ODUA 2FQIA 1A50A 3VMOA 4GUJA 4PCTA 2XVKA 2IS7A 3EX1A 3RJXA 4QAIA 5F2MA 5CC7A 3DYPA 5FD0A 1GOQA 2GK1A 3BXWA 1J0IA 1E1CA 4G2DA 3B3DA 4M6PA 4M1BA 4GG9A 4LF2A 2VZUA 4UQDA 3UYIA 4GJIA 3DFTA 1WAWA 2XINA 3BCFA 3CHVA 3V0SA 1IHIA 4J3WA 3WMSA 4AZ5A 3GSMA 2P5NA 3GNPA 3QJAA 1P6WA 2Z25A 2B7PA 2QJHA 2Z2AA 4MFEA 1OD0A 1T5AA 5LGZA 2Q6ZA 5BWAA 3Q4DA 2PDPA 5K7JA 3GR7A 3O1NA 1I2QA 4HZMA 3M0LA 1C29A 4HJWA 4CN4A 1MW2A 4QGCA 4LU0A 4ZFCA 1H1YA 3TOPA 3TAOA 3S2JA 1ZBCA 1XLIA 3IACA 1RK5A 3M0XA 4FR6A 3R8GA 4JR5A 1YPIA 3OBEA 4C5YA 3BGGA 3C0JA 1U2YA 1A3HA 2QLYA 2WB5A 1GNXA 3E2QA 1I2NA 2Z2BA 3GH4A 3BW4A 3O7UA 5DELA 3PNUA 3WD2A 4C1KA 2D2OA 4UFKA 1H7PA 4WX2A 3ALFA 3ES7A 1RLCL 3WK0A 5LIKX 3H70A 2QDDA 3OO2A 1XYMA 3EOUA 3IUHA 3EMQA 3GDKA 4QQ3A 3M5YA 2GJLA 1RQBA 3L0KA 3CV6A 4HN8A 4UTLA 1PTAA 1XPGA 2J6VA 4KCVA 2YXXA 2VC7A 4D9PA 1BD0A 4RK8A 1FWJC 5H8MA 2EHHA 3ALGA 1JXJA 5A6BD 3HGSA 3RU8X 4FLOA 1O1HA 2GQ3A 2WBGA 1IXPA 3SUWA 4Z2HA 2TMDA 1FWHC 1SJDA 1KM4A 3ARWA 4BQ2A 4PMXA 4O11A 5BCAA 1AW1A 2QULA 1TRIA 3M07A 4RNHA 4D8ZA 3LHTA 4IT1A 2Q02A 4K3ZA 1EA0A 3LPPA 2XDFA 2A7NA 3ZQ9A 3DBPA 1XIBA 1DTNA 3BC9A 4YIWA 1AH3A 1HP5A 5I3GA 1QI4A 2DJLA 3A22A 3WK3A 1FKXA 3UVIA 2QJGA 3NGJA 2Z1BA 3QGKC 5CBIA 4R9OA 1PPIA 1P43A 3ZXWA 4E0CA 3LBMA 8TIMA 2FTYA 3G1HA 2EPOA 1G0CA 2PSNA 4HA4A 4GK8A 2WHMA 2VGFA 3QOMA 7PTDA 1G94A 4Q4PA 5I23A 4LTSA 2WW5A 5BXRA 3VKKA 5A8GA 5LYRA 3NFUA 4JFTA 3IGUA 4L1WA 3R1ZA 1AW5A 3BSMA 4D6JA 4FNSA 1JDEA 1LQ0A 1X6NA 2EXOA 4RDZA 4C6CA 1X39A 1YDNA 3LHVA 4JD4A 4LVFA 1ZGDA 1Z8AA 3TYDA 1FWCC 3M41A 3MHUA 4V15A 2JBMA 4A35A 2VZSA 4GOAA 3L0NA 3O6CA 3TX9A 3GFYA 2HVNA 3S9IA 1Y5XA 1O7AA 1OT2A 4OV9A 4NL1A 3OIHA 2ZXQA 4XD3A 4CN6A 5A8OA 2J74A 3IANA 2C79A 3PJWA 1HX0A 3K46A 3HGJA 4NXSA 2VUNA 3E6EA 1XSIA 5A2AA 1A4MA 5M17A 2GVLA 3UWUA 3DECA 1VENA 1ZB5A 4MUZA 4FNPA 1IXOA 1WKFA 5DFAA 1BF6A 2D3LA 4Y8EA 2VC9A 2VURA 3C2VA 4AIEA 2HMCA 3B04A 5AY7A 3T0DA 3AMGA 4PA8A 2NXGA 3KTXA 2X0HA 1A80A 2CYGA 5I03A 4J28A 5C0QA 3OZPA 2PWHA 3DG3A 3MUXA 4ZMGA 1J93A 3GNOA 3MDUA 1F61A 5E0CA 5FAGA 3SSZA 4S3EA 3PZNA 4GUFA 4IFKA 5C9UA 2YL8A 4W93A 4QQUA 5CG7A 1KM1A 3DAQA 5C2GA 3N2MA 3THCA 2OODA 3PBVA 4M82A 4D71A 2Q8ZA 3IWPA 2EBNA 4LY8A 4RDWA 1AH0A 1CB2A 1JNDA 5CZSA 3WNMA 5D2VA 2ZBTA 1IXQA 3CB3A 3WBEA 1KXVA 2Q09A 4AZBA 2CBIA 4QJ5B 5A69A 1M41A 2Y8VA 2PDKA 4DM1A 4QISA 2AMXA 4DLMA 4MLRA 4DX3A 4N02A 3B9NA 4Q4MA 5AVNA 4GH3A 1KLYA 1SJBA 5CPMA 1A0EA 3S9YA 1JAKA 1W1TA 1EC7A 3OVQA 3BJSA 4GUIA 1ISZA 3VNZA 1MXGA 2W91A 1EZ2A 1FBAA 4ZE4A 1PKMA 5D30A 2OWWA 3UR8A 1XUUA 3T40A 4JL1A 3T8QA 4Z1AA 3DXIA 5CH9A 2WXDM 3NURA 1CGXA 5HAOA 2J7EA 2WCAA 4I90A 3W6LA 3W1NA 2WZMA 4Z1YA 5XIAA 3JZUA 4LF1A 1G6CA 2J47A 1Q8JA 5H91A 3TW7A 4R27A 1WOAA 3N9SA 1IT7A 1YQ2A 1O95A 1ZBVA 5G1YA 3F4DA 8A3HA 1Y5WA 2XWDA 4WUIA 1KM2A 1M03A 3W87A 1UZHA 2PAJA 3G22A 3GRIA 2Z1WA 2AL1A 3R8RA 4KMQA 3B0VC 1GQNA 1F3XA 5HBFA 3WEOA 1JZ6A 1VJSA 4GQGA 4IPJA 1XBXA 5GJPA 4N6FA 4A8LA 4FB7A 5CC5A 1Q3NA 3SGUA 4XZHA 4LW7A 2WVUA 2GWGA 1XJBA 2NUYA 3MMDA 3N13A 3R0KA 1DWAM 2WKJA 4NUWA 2DVUA 4FLRA 3M9YA 1EPXA 4QHRA 5E0FA 2OKTA 4GVIA 3OOQA 3UJ2A 2ZRXA 4S3KA 3EKZA 4M7SA 4Y6GA 1P5BA 4JIIX 1NARA 4IX0A 2PF8A 3PJTA 4M56A 3C2EA 1DWJM 4KIRA 4QG9A 4H01A 1XDLA 4HB7A 3RG6A 4GINA 1R30A 1I6NA 1A5KC 2VXNA 3AHXA 5AZ0A 1WDWA 4U33A 4B3LA 3D6NA 1W31A 3DYMA 2Y2WA 4W4QA 3CLWA 1AL7A 1BQGA 3PPFA 4S3FA 5C2CA 1EFZA 3KM8A 4O0KA 2JKPA 4MTVA 4NZ5A 3HV9A 2JE8A 4PTWA 3QSRA 3RMEA 1XCXA 5CAHA 1XYLA 3WFLA 3GVRA 2FZ8A 3EPMA 3OLEA 2PPGA 1EGVA 3P74A 4K7VA 3UZYA 1PHWA 1DV7A 1DJIA 3BANA 5FEXA 3OW1A 1QHZA 4AVFA 5LA2A 1VRXA 1T8QA 3WQ8A 5BMWA 3QHOA 3AAMA 4EXQA 1MDLA 1G7VA 3H4GA 4L9XA 3TC6A 4BQ4A 4RE3A 4O10A 3ITOA 1UWAA 3CL7A 2JIWA 2IPJA 4B5NA 1M68A 3WJZA 4O14A 2RAGA 1FWBC 2DP3A 1JCTA 1UWRA 3UXLA 4ZQOA 4DBUA 2DORA 3TSDA 1A5AA 5CPQA 3HZ3A 3QYQA 1S3TC 1XL9A 5LKYA 3ZLGA 4DN1A 4LPCA 5CBBA 5F1VA 3B03A 3WH9A 4XAYA 2YCJA 4OJYA 5I3DA 4Z2GA 4PUEA 5FEPA 1GTHA 1ITUA 1EHNA 3WUBA 3BAYA 3LHZA 1HT6A 3FLUA 3VKDA 1ZRQA 3AOFA 3GBDA 1E6NA 4WXYA 1JAEA 4PRTA 2CHNA 3CPRA 3VPLA 3UGVA 2GQ8A 1TR9A 3AXIA 2REQA 1RP8A 2D1ZA 4HPNA 1OX5A 1J0HA 2NQ9A 3OGRA 3NPWA 3MO7A 1WA3A 1A0CA 1E3ZA 3CAQA 1YBQA 4DUXA 3TDFA 3CTTA 4JTDA 1XDJA 4O1DA 4WXZA 1I1XA 4S3AA 4GX8A 1C90A 4LYQA 4I5UA 3ITTA 4JKKA 3W1LA 3UP8A 3G5EA 3ARYA 3F4VA 5HPOA 3WF3A 2R6OA 2R1KA 1TB3A 3ZR6A 3ZYZA 1VFMA 4NZFA 3VOCA 1KXQA 1DOSA 3A6OA 1FWIC 5BOFA 1CCWB 1HGWA 3E0VA 3FOKA 4NAEA 4XAGA 4DBSA 5HWNA 4GUHA 4JHOA 3W2UA 4HOXA 5I00A 4ZSUA 2H9AA 3QPEA 5BXSA 1TELA 3GVVA 1Q6FA 1UUMA 4RNJA 2QF7A 3NOYA 4H9ZA 3V5FA 2FMNA 5JU6A 3NQGA 2GGJA 4MOZA 4ZO6A 4NZJA 3NXFA 3IJ8A 4L6OA 1UR1A 2QJNA 4UQBA 1OCBA 1OGGA 4HK5A 4HU3A 1Q6LA 3WD3A 4JFSA 2QAFA 6A3HA 3TAKA 1GVOA 4XB3A 1VPYA 3MKKA 1H7WA 4AH7A 3G6LA 1HIZA 4O8AA 3W27A 2PLKA 4Z1CA 3LV5A 3ZSSA 4NXKA 4HP5A 3KL5A 4CQ8A 1FP9A 2Z28A 1RHCA 5LZLA 2R91A 2QKFA 1DJYA 3IK2A 1TWZA 4Q3MA 2Y63A 1RJQA 3ZT7A 4MJZA 4AD5A 3AUOA 3R25A 2J62A 3N34A 4AYSA 2V5KA 3EDJA 2DV0A 3W2NA 1QFEA 2J78A 4ZGYA 4IQJA 2WLYA 1GKQA 1XFBA 4NNCA 2QNEA 3GDLA 2AMGA 3CPUA 1O60A 5EY5A 2A7PA 4RXFA 4IMAA 2YDAA 1HVQA 2Y24A 3KS6A 4XIMA 4MY1A 4FXSA 4LCRA 4A3UA 3KCLA 3G18A 1B3XA 4JHMA 4Q8NA 2ZE0A 4E3VA 4MWAC 3V0TA 1BYBA 3W7JA 3GXPA 3UPBA 4BEUA 1KFJA 4GYKA 1JFHA 4FIRA 1NEYA 3JRKA 1Z48A 1DQUA 3VD9A 4RKAA 4QJ4B 3EKLA 1Q6RA 5I5RA 3AIWA 3ITCA 3FKKA 1GZ1A 2OVLA 3MO4A 5AHIA 4WKFA 2X1RA 2PWEA 4H7VA 8CGTA 1PWMA 3N25A 2GUYA 1IWPA 2NQHA 3RF9A 3WH8A 5CZKA 6ENLA 2QQ6A 3TN5A 1N8IA 3BK0A 3CS2A 2WOQA 1FRBA 3HV8A 3FHAA 2E9MA 1CGVA 3V4BA 3BLFA 5FJRA 2HK0A 4IIHA 4UOQA 1W0MA 4NJJA 4PEEA 5AHLA 3WDPP 3F7JA 1FH9A 1VH7A 1YLVA 1Z44A 4LCSA 1LM1A 1ADOA 1NFPA 4DM2A 4GLEA 3WMCA 1JGMA 3EA1A 1W9VA 3W1UA 3SURA 1FWSA 3NA8A 1JYXA 3NQMA 2RJHA 2Z1XA 4YS1A 1RVKA 5AYBA 1CXHA 2VR4A 1FDZA 2XFYA 3A47A 1Q13A 3TVAA 1VBGA 1MXSA 3FEMA 3ITVA 4WCJA 1IXNA 3MJMA 4O50A 2W6RA 4MB5A 1U1UA 2EPHA 1QRQA 1C93A 2QIWA 1WYIA 2Q3RA 5D03A 4JTKA 4LRTA 4WOZA 3WLTA 4V33A 4MJ2A 3S5YA 1FDYA 2GLKA 1SFTA 2Z00A 3SN1A 2WNNA 1LL6A 1LRTA 3CZGA 3TQPA 1C92A 1P0BA 3PWGA 3ZLHA 2VWTA 3MS8A 4ADTA 1R7AA 3NQ8A 4O57A 2HWGA 1TIMA 1QO2A 2AOSA 2CU0A 1JQVA 1W17A 2WC7A 5A2BA 4JN7A 3T0CA 3PSWA 1SSGA 2X1IA 3BW3A 3WLOA 2X05A 3W7GA 3A12A 4NQ1A 1JGIA 3OLDA 4KRUA 2YGYA 3OGVA 1CBGA 4FMVA 4YN5A 3CIWA 3TK7A 4XAZA 1W91A 3V36A 1EQPA 3GR4A 4S38A 4XUYA 3IIXA 5HANA 1XSJA 4EWND 1PO9A 1W3HA 4IOTA 4U2YA 2WO5A 3ARRA 1VFUA 4O18A 4M6VA 4AZ6A 3TYZA 3DBNA 1QXLA 1REQB 4HKPA 4QE4A 4AZ7A 1P7TA 2J25A 1JZ7A 2ESCA 1AD4A 4NY2A 2DUXA 3T4WA 1Y8BA 2R1NA 3AIBA 2YL9A 2O55A 2R8WA 2UBPC 4GYPC 2W62A 4GQBA 3IJQA 3S9ZA 2Y5EA 4HMDA 3UERA 4W5ZA 3UFYA 5ABTA 2ZUSA 5KINA 3CTLA 5H6HA 3F5LA 3WQFA 4B5SA 5LSMA 5M2FX 1CEOA 1F2JA 4Y9NA 3HO8A 4LUSA 2NSXA 2IKGA 3SRFA 3STEA 4D2JA 2HBXA 3UWVA 5D09A 4N42A 5C70A 3GC4A 2AKMA 1LLOA 1IE7C 2Y85A 2V63A 4HMCA 1LOQA 3VNMA 4B4HA 3W83A 4E2OA 3O0KA 1M53A 2W9MA 3RILA 1EB3A 2QCEA 4YWSA 3D3AA 5LNUA 1Z69A 2V3EA 1XRSA 5DMNA 3BLIA 2YXGA 2GVYA 3T0BA 2QUMA 4Y2WA 3V3WA 4E5TA 4JTGA 1FWNA 3OBKA 1W37A 1TCDA 5CPSA 4NZ4A 3O16A 2FFCA 2I17A 5H8PA 4LBRA 4R5EA 3VNIA 1J0JA 3ARTA 3K8KA 2PWGA 1SFSA 2IQDA 4UTKA 3R2GA 3I6RA 4L61A 1K1DA 4E3TA 3DHPA 2XH2A 4F0RA 3PZVA 1F9CA 1PKLA 3UXDA 1L2QA 2ZIDA 2VWSA 3FS2A 2VCBA 3AMKA 3THDA 5F4WA 3TZFA 1SZNA 2QR6A 4U3CA 5C9WA 2XGZA 4UQAA 1F3TA 3UA3A 4JFWA 4X60A 4MY9A 4XBJA 1JULA 2QMKA 2X40A 3CK5A 1OFRA 3WDIA 2Y8UA 3VGDA 4A22A 4FK9A 3KOWA 4RJEA 4BHYA 3G1VA 3WK1A 1ZTVA 4BF7A 3RFAA 4ZQMA 4RZ5A 1QNQA 2GSJA 2WZEA 4LUTB 1G9HA 4W86A 5HK4A 3WNPA 5A95A 2FPYA 3WLNA 2JEPA 3AWNA 4UB9A 4O1EA 7A3HA 3GS6A 1QK2A 3KVMA 4JIQA 5A6SA 3UEQA 1EDGA 1JQXA 5IM51 1FOBA 4GIEA 5I77A 1MW0A 4HK6A 3LMZA 2Q8XA 4FOJA 1KRAC 2A5HA 2G8ZA 1UKTA 1V6YA 3QOKA 4ZB0A 1R38A 1OQFA 1OCNA 4JCMA 5DO8A 3IV8A 1G4PA 2XIBA 3H23A 3C0SA 1WZAA 1ISVA 2C8NA 4JX4A 4K1WA 1XPYA 3DFSA 1C8QA 1W3KA 9RUBA 1BRLA 2NWSA 4GNJA 2IPWA 5GJMA 2O9RA 1JPDX 1UD3A 2DJXA 2FTPA 5FESA 2QUTA 3FYYA 3NO3A 3TNBA 3D3FA 4LY4A 2PTWA 2C14A 3EWDA 1UPPA 4B4FA 2J9XA 3GM8A 1VYSX 2ZVIA 3PPHA 1US3A 2OJPA 9XIAA 1ONXA 1RD5A 4C6NA 2PRLA 1UWQA 1W1ZA 1YXCA 1Q45A 4NJKA 4XSMA 1ZAJA 2A2IA 1YYAA 3EWBX 3W37A 1R3YA 4H2CA 2QCDB 2HXTA 2IW0A 3WBAA 4HU0A 1CI1A 3TFCA 1WUFA 3MSRA 2AGKA 2YB1A 3H4XA 3PSVA 2ZRUA 4QEEA 2FGLA 3KOYA 3RUBL 4MJMA 3GUWA 1EJVC 4UOZA 2W27A 4Z2JA 5REQA 3BWWA 4Q8MA 1R3SA 3PG9A 3WQVA 3LPOA 1JXKA 3BPWA 1BWKA 4WKHA 4X2PA 4DZAA 5K3VA 2QV5A 4GWEA 2HVOA 1ESWA 2ZRWA 2YLLA 4AHPA 3PM6A 4TXEA 5FACA 1QMLA 3N73A 4EE9A 2V5DA 3MPGA 4HSOA 5EMYA 1HKMA 4DWSA 3L5MA 2EPKX 1R5YA 3BUVA 3MSDA 3H22A 2FH8A 3IGHX 4I5XA 1KKOA 4PZVA 4DAIA 1KKRA 3L4XA 4NIRA 4H8VA 1OINA 2VM8A 1UD5A 2Z6IA 4GJJA 4BQ5A 4J3SA 2XFFA 4MADA 1PEZA 2YCIX 5HULA 1QW7A 2ZZ6A 3AU6A 2DW7A 4F2TA 3DFNA 4F0MA 2WKLA 2VOMA 1A5BA 4C5ZA 1XIGA 4YYCA 3CV1A 1JYWA 3M7WA 1GJWA 3CHDA 4M0XA 3N1AA 4H1ZA 4A3RA 3BG3A 4Q8PA 3WQGA 1A0DA 4OBRA 4DJDD 3NZRA 4N2YA 4JIPA 4AC7C 1AJ2A 2HE5A 1CIUA 5JH2A 3SIZA 1EO7A 2PTDA 1OFBA 2Q8LA 4DNMA 1JDFA 3BL3A 5AVHA 4RCXA 2ZC1A 1ZLPA 3NQEA 2PDWA 1S38A 4DO5A 4L4PA 1EGZA 1XXXA 4GCAA 3UR2A 3C5QA 3LSCA 4NP7A 1V6TA 2HDJA 3TA9A 2D73A 4QJ1A 5XINA 3U0HA 2EEXA 4HMEA 3QEZA 5M1TA 2O9PA 2OMAA 4XD5A 6PTDA 1UWUA 3CJPA 6TAAA 4URIA 4OGZA 1KD0A 1C9DA 3I3BA 3L12A 3S1WA 4B15A 4L1GA 3TW6A 3MANA 4DXKA 2D0GA 1VRDA 4UWMA 1L6GA 4MAZA 1F05A 1KV8A 4M3PA 5EKYA 4KWUA 3N11A 3LLDA 2P76A 4POCA 1V3MA 5A94A 4KF1A 1VR6A 5DCDA 1SVDA 4KEUA 4DEFA 1K4HA 1QOQA 2WLZA 4W9TA 4RZ6A 2BVWA 3N12A 4Z2IA 3KZSA 1NDWA 2PDXA 1PUDA 1RJPA 3W38A 3NL5A 3NVDA 1JD7A 4MSSA 5CSYA 3NPXA 4ZCWA 4JTEA 4NNAA 2FZMA 3ISIX 5DRIA 2ZDRA 2CZDA 2VP8A 1MWOA 5EA9A 1IEWA 1Z32X 2QYGA 5H1WA 4UTTC 1AODA 2F2HA 2ALRA 2QJJA 4ZA0A 1J79A 5KZ6A 1XLCA 2G3FA 2YBUA 2TRSA 2X2YA 1RBAA 5FJPA 1R3WA 3MCOA 3N6HA 4KW2A 1Q6GA 3IGSA 2EAWA 2MNRA 1TV8A 4QR6A 5MHBA 4JTCA 6XIMA 4J2PA 4H8NA 1RPXA 4JNYA 2DZBA 1OX6A 4JTHA 2QDHA 4S2CA 4AEEA 1D8WA 3S1UA 3VILA 3EA3A 5GPRA 1XCWA 1GCYA 3ZSTA 2FB3A 1AVAA 4HPJA 3TN6A 3ICJA 3W26A 1QK0A 2BV9A 4LRSA 4OOUA 2Y5SA 4LS0A 5FOOA 3CM4A 3QHNA 5DQPA 5E93A 3USBA 3QQ0A 3VFLA 4IJCA 4GIRA 2FJKA 4J1OA 1NDVA 4YTQA 3Q58A 5EMMA 1ZAHA 4DPQA 3WD4A 5E6YA 5MKGA 1NOUA 1TZ7A 4GC4A 1F4HA 3O07A 1NU5A 1K7XA 3MZ2A 5CLTA 2PMQA 3S3GA 4F40A 4TMCA 2OWXA 4G1NA 1I2OA 1MQQA 5GJNA 4QG6A 1XP3A 3UG4A 2INEA 4ACZB 3GYCA 5HDRA 3B0XA 1WDRA 3E96A 3UBPC 2E5CA 4EIVA 5FF7A 4MWAE 3ZJ8A 1VCVA 1VPXA 3LUTA 1NDYA 2AKZA 2NLIA 3PANA 1NIUA 1WDSA 2BVYA 3LV6A 3MT1A 4MKNA 3WUFA 3MUIA 1MO0A 4C6PA 4FPSA 3EOSA 3LI0A 5GQBA 1I2RA 3ZJ7A 1W2PA 5KZMA 2NV2A 4LUTA 3UZZA 1J2BA 3VD5A 4AF0B 4U5KA 3L4YA 3GBEA 5F4XA 2CLMA 4LFYA 1VYPX 3S2NA 5JIPA 1ISWA 3Q94A 3DDMA 4PMQA 4OBSA 5KMYA 3H2AA 1ODZA 4AD4A 4L4OA 1DJXA 2J88A 1TPUA 3W7LA 4JGDA 3W70A 4Q22A 3G2GA 3EB4A 4GGBA 5C7HA 1JG9A 3EZ4A 1VQTA 4ZOAA 4O52A 4ADSA 2DPEA 4G6CA 3SQMA 1AUSL 4AWEA 2GJXB 1GGOA 3OHIA 2TAAA 1WV2A 3CASA 2WZTA 2YB4A 3I6TA 3LENA 2YL5A 3UYCA 4EXAA 3MI2A 4US5D 4HJFA 1VIZA 3W81A 2CZ5A 3LXBA 4OU1A 4IM4A 4U31A 4MHBA 2CBJA 2DZUA 4Y9MA 4DBDA 3MWAA 5LNRA 1Z7AA 3O9NA 4KS0A 2G4FA 4C6LA 3PB0A 3S2CA 1EA9C 4FZIA 2ZX7A 2DW6A 4BI6A 4LT9A 1WOBA 5T9BG 2OTDA 1EIXA 5HXMA 4JZ5A 3TA6A 1AJ0A 1UH3A 2QEZA 3FJ4A 3EEZA 1WZMA 2PD5A 4IJBA 2E5BA 3OYXA 4Y9OA 4LAUA 2QCDA 1FUYA 3QZAA 2VRQA 2POZA 2INFA 3SFKA 3LQGA 2VEKA 2VEPA 3L7RA 4DYEA 4HCDA 1P0NA 1HL2A 2BS9A 1F4AA 1YKWA 2VFDA 1QPOA 2ZXAA 2QMJA 2Z1SA 2C19A 2CKRA 3ARQA 2PP3A 3CL6A 3TC7A 3HFTA 3FA4A 3WDQA 3QRHA 3ARUA 5CGQA 1MEIA 2VCCA 3B06A 3P67A 1E71M 1J10A 4QFUA 3REQB 5AFDA 1Z9AA 5KEZA 3NDYA 3VX1A 4GMEA 1SZRA 3WEZA 2DT0A 1XR2A 4DZIA 1NDZA 4CD4A 2G96A 1BLIA 4PTXA 4F66A 5GNYA 4Q8TA 1V3JA 1OADA 3KL0A 1EXBA 1OABA 1E3XA 4CLMA 4NSBA 1SFJA 1HJSA 2WMFA 4KKXA 4S39A 3CEUA 1QBAA 3ZT6A 3DFHA 4TIMA 2ZXDA 4JS3A 4FLQA 5FL1A 2R94A 4CD7A 3LOTA 3AIRA 3KX6A 1QI2A 5BU9A 1ICSA 3LCWA 1UMLA 2WNZA 2BODX 2E09A 4O1AA 1XGEA 3DHFA 2VDIA 5JH1A 5E9XA 2YCLA 1P1MA 1R2RA 3VUSA 3HMJG 3NEHA 3NDOA 3B0UX 1JZ4A 2VMFA 2XVGA 3SSJA 4CU8A 4LEQA 1MUMA 1A53A 1V51A 5AC8A 4ZOEA 3AHVA 4ERAA 4IICA 2V81A 4TTUA 2J7BA 1QW8A 1R2SA 3NPVA 1GQIA 1QPNA 1RCOB 1GOIA 2BG5A 1BGGA 3MJYA 3VOFA 3URBA 3K4DA 3PUEA 4HK7A 1JNEA 3EX6A 2XG9A 4LV4A 5IDIA 2DSUA 1UJPA 4JIHA 2YSWA 3ES8A 3T2QA 1XQLA 5BYWA 1JI1A 2PU0A 4FP1A 2XWEA 2ZUNA 4LNYA 2XISA 1E1FA 5ECVA 1LLZA 4I9JA 3EMCA 1RVGA 1TPVA 3VGEA 5CPNA 2Z7KA 2E25A 1F5ZA 3CMJA 5JBEA 1EQCA 3WY1A 1OJXA 3IK4A 4YTTA 2J7CA 2OSWA 2D23A 4P61A 3ID7A 3RM9A 3MYOA 2P50A 1V3LA 3GKAA 5EBAA 1UASA 4PMOA 2XVPA 2C1GA 3CZEA 4CD6A 2E6DA 3ERPA 1T40A 1JUKA 1EKOA 3IIOA 3DEQA 3UNDA 1PCKA 2HBVA 2A3AA 1UWTA 1PKNA 1TJ1A 3UY8A 3JZEA 1CWYA 3Q2DA 2CLLA 3VKJA 1G7UA 3MI6A 5EGRA 5AKQA 4E2BA 3EDKA 1YDYA 4B5UA 2Z1VA 3NQDA 4FHAA 1EBHA 3HU7A 4FEZA 1JDAA 3U2EA 4CCEA 2GSEA 1FCBA 5IFTA 1GUVA 2I9EA 4K7YA 2DUZA 1EJXC 3BOXA 4F0LA 3H55A 2XN1A 1V0KA 1RBOB 2OO6A 3TCSA 1R3VA 2G4JA 4UFHA 3W7CA 3PBUA 4B3ZA 3ZJ6A 1OK6A 4PULA 3QSTA 5AC6A 3N15A 4OFCA 3WMBA 3W2LA 5D37A 1A3XA 1H4PA 2IKHA 3F4NA 4DLFA 2OU4A 2E4TA 4ZOCA 1VJIA 4JKLA 3QKEA 1TA3A 2WHKA 3KOXA 1GQLA 3OLIA 3EX3A 1HJQA 2XIIA 3QGAC 3VOGA 4FF5A 1B30A 1WXYA 4DJEA 3BOLA 1BG4A 2ZCGA 5LHEA 4ZVJA 9XIMA 4GHRA 1EX5A 2FHCA 4F79A 4QTGA 2X0YA 1Q63A 4U2ZA 3VKCA 1HKKA 2VC5A 4AWTA 3WKZA 4XSLA 3W53A 5B7YA 4E8DA 2YA0A 4XG1A 1G67A 5CPLA 5KZEA 5L6UA 4MUPA 3H54A 3PWIA 4V2XA 3H2FA 1U1HA 3LD5A 2YR1A 2ZYFA 1VZWA 3K30A 5FJOA 5C9RA 2PFHA 3OA5A 3W7PA 4GVFA 4IISA 1WDPA 4EACA 3LXCA 3W1XA 4B90A 1BPLB 5HNUA 1JVNA 2SFPA 1BSLA 6ALDA 2DH3A 3GHRA 2JGQA 2F38A 3LLXA 4MNMA 4LAKA 3AZSA 2ZADA 4YCPA 1KRBC 1X6UA 4AX7A 4XD6A 3VUPA 8XIAA 1J4EA 3NQ6A 1TQJA 4RL3A 2V2HA 3DIPA 5EL1A 4AAJA 4NZCA 1J5TA 1PIIA 5LXXA 2CHOA 1DEDA 3GUGA 3AS3A 1RV8A 3FJ6A 5TF0A 2Y62A 4DJFC 2J66A 3CGTA 3PUOA 4XBKA 3ATYA 1GVRA 2YCKX 3ARSA 2O92A 3HG5A 3WBWA 5LA0A 2PC4A 4O53A 2A0NA 1S5NA 2WC4A 1AG1O 2BWGA 4NG3A 2V30A 1Q7QA 4PSPA 2ZWYA 2JALA 2Z0IA 4UNIA 4ES4A 2VNCA 4NNBA 4GZIA 1UH2A 2J79A 1OBAA 3CZJA 3T9PA 1CPUA 3LCIA 1H2JA 3KFTA 1U1JA 5C8BB 2CITA 1R46A 2FDMA 2V3DA 5A3HA 2VQTA 1T6MA 1VC4A 4IWWA 7REQB 2Q71A 1XIJA 1DKWA 3THAA 5AZ1A 3R94A 3CQIA 3DFQA 4H7ZA 2G3NA 5T8GA 4MDOA 4NYYA 4CNTA 1W1B1 1J2WA 1H09A 2ZA2A 3AYTA 1NF7A 3LRKA 2OPJA 1PZ1A 3BE7A 3WD0A 2I7GA 1DE5A 1I60A 3W73A 2VEFA 3FGCA 1WQ5A 2A85A 3VVGA 4RDYA 2INZA 3MUAA 4P7RA 4TUFA 3WNKA 5D2TA 2W5FA 5AC4A 2ZUVA 1F6YA 1JCJA 3IRSA 1J0ZA 4NZ1A 3LGDA 4PRWA 4JFUA 1LG1A 2OT1A 3P62A 4XO6A 1OCJA 3OZOA 3CIVA 4HNOA 3M4HA 2QCMA 3UG3A 4XZMX 2YW3A 3E9AA 3QFWA 3FJNA 1V02E 1HTIA 1P6CA 1R47A 2F6UA 4DZHA 2GQAA 3TXZA 4UTMA 3NSXA 4U10A 1O1ZA 2D0HA 3TJIA 3L4TA 4R7JA 4MNJA 1H62A 4F2UA 2JEQA 4JX5A 2YDSA 3SRKA 3S1XA 1F6PA 3T08A 3K4AA 4AXKA 3HB9A 2HXUA 4PB5A 3DFPA 1UD6A 3AMLA 2QT3A 3QLLA 4WD0A 3HM7A 3U2OA 1NOWA 4M1RA 1GVIA 4A8NA 4MKVA 4HHPA 2CCRA 1R86A 3N04A 4UTUA 2RDWA 3SJNA 5CAKA 1BAGA 1TWWA 3QV9A 1EC9A 4G7EA 3RRXA 2JF6A 2PLCA 3G3DA 3CL8A 3QW3A 2ZZ4A 3KVKA 1JPHA 1Q65A 1VD6A 3GDBA 2GK1B 3CZKA 3NQ7A 2FGBA 1E1CB 3GDRA 2I16A 3NVTA 3GXDA 3QN3A 4GC3A 1OHLA 3AHTA 3G8EA 3U2ZA 4JTAA 4HSHA 3TJLA 4GD0A 1YADA 5GNZA 1VFFA 1XBVA 2CBVA 3APTA 3DKLA 3LXAA 4IQLA 5DT7A 1MSSA 5BZAA 3TN4A 2NT0A 2PGFA 5F2IA 1K8YA 3GKFA 3AI0A 2H6RA 4M8UA 3NNTA 2OKOA 4RXGA 4KCTA 3UNTA 4JN6A 2P88A 1C7TA 4PUMA 3RN6A 4PBEA 1FHVA 3WLRA 2VGIA 3VM7A 1D3GA 3ABXA 2PZ0A 1PZ3A 4HPHA 3GU2A 4IP7A 5U7SA 3E1F1 1O6IA 1WE5A 1XLBA 4ZTXA 3ME3A 3EEGA 3NAVA 1X38A 4RZBA 5D8WA 3RCYA 1O5QA 4IIDA 1VBJA 2JKEA 1AW2A 3LBCA 1KC7A 5HATA 3LN3A 4LUIA 3S0CA 4LSBA 3CUFA 4CQAA 2PDBA 1WP6A 1H1NA 2PF0A 4MNKA 3VDHA 4LJ3A 4H6RA 1W8SA 1QWGA 1NWUA 4QG8A 4QNWA 4W7VA 3APYA 1B4EA 3P8JA 2ACSA 2PCQA 4MNLA 3KEHA 3M44A 1SW0A 1XX1A 3M1ZA 4G1KA 3GDTA 1ZBWA 4DNHA 3FA3A 1B54A 1B31A 2E77A 1M1BA 2EF9A 4AW7A 1TTJA 3KBVA 4UFIA 3W25A 3CMFA 1TCMA 3MVTA 3B0YA 1UQZA 3AJXA 3BZGA 2B31A 1IEQA 4WJ8A 4L4LA 4PMVA 3H2MA 2Y8KA 2QJIA 3RHGA 1ZALA 2VFHA 2XM1A 4D6EA 4EPBC 4Z0SA 3B9OA 4H9XA 4CD8A 3KRUA 4RDVA 3I4KA 1JUBA 3FEQA 1FWDC 4DYJA 3M6YA 4MYXA 2J9YA 3ZOAA 4JHZA 1HF6A 2BZNA 2HRWA 3WDRA 2XHYA 1XH0A 3KL3A 2OLAA 1EJ7L 1X7FA 4FNUA 3O3RA 3VGBA 4UTFA 3FSTA 2VFFA 5F1UA 2OYMA 3SCVA 4D6HA 1SO3A 3CH0A 4R9XA 4YCOA 4QJ3B 1OX4A 4UMCA 3WYZA 3LPGA 2D24A 4A3QA 2ZX6A 3EX4A 3GHUA 4TVUA 3WBXA 5KSWA 4NJIA 3QPZA 1XGDA 5M03A 4KBXA 1XD1A 1B3ZA 3F03K 3QQWA 5DMYA 3QW4B 2WVSA 3M7SA 1HZYA 2BY1A 4HZ6A 1XLAA 4O1CA 1X8FA 3QPYA 2V5CA 3WQ5A 3VE9A 4FALA 3ZVIA 3RIKA 4UR8A 1E0UA 4HU8A 1BVZA 3JU2A 5D9OA 1AD1A 1UROA 2OX1A 5EPDA 1T41A 3B8TA 1SW7A 2X16A 1G4SA 2WSQA 3KBMA 4PUJA 5D4YA 2DZXA 4H8UA 1JCNA 1TV5A 3QMRA 2DIJA 3PC0A 1W9UA 4Q4OA 3SUVA 3ARXA 3NYZA 3R89A 5H8UA 2KAUC 1OFAA 2FPVA 1ITXA 1ONEA 3A5FA 4QROA 4S23A 1E70M 4DQWA 2YA2A 4N9EA 1W3JA 2P8BA 1EOKA 2I56A 2V82A 1BVWA 3WK2A 5CSSA 1BFNA 1A5SA 2C1IA 5FIPA 3AALA 1Q2SA 2HEJA 2VFGA 1I0DA 3CQHA 3PTDA 3C2YA 2OQHA 2IPGA 1C3FA 4W84A 2ZUUA 3QQ1A 5BRQA 3W28A 1FVPA 4LAMA 3DG6A 3H26A 1NSJA 2P0OA 4Z1DA 3LZ5A 3F2BA 3TONA 4IFKB 1SGJA 1EUAA 1UP2A 4W8AA 1R9XA 4W7UA 4CUCA 1XUZA 4PMZA 3TYEA 1CLVA 3GAKA 3CU2A 3H53A 1W9DM 2EG7A 1POJA 2GJRA 5D33A 2XSBA 1LWHA 4GBDA 1E4LA 7REQA 3ABSA 1S5VA 4E4UA 3W84A 2EG6A 3EWYA 2DIKA 3RITA 2QPSA 2PTXA 1CGUA 1XDMA 1VEPA 4GI6A 1H7OA 2CERA 1KTNA 3C86A 1G4TA 3II1A 2B7NA 4TX9A 3PBMA 5AYZA 1ONWA 4O4WA 3B8IA 2VEMA 4MFDA 4IMFA 4AD1A 2HISA 3LBOA 3WLMA 2DIEA 1E6XM 1W1VA 2EQDA 3AIQA 4CN1A 1OFOA 3ECQA 1N82A 1H7XA 3F2DA 1D7KA 2XH4A 1ITCA 3M16A 4IL2A 4B2DD 4HA0A 1AZ2A 4K2SA 1RK6A 3NIYA 1B57A 4A8IA 2PGRA 4ZQNA 3UWYA 4K6AA 4DWDA 1IEIA 4QRNA 3U9IA 1QHPA 1E9ZB 3LQLA 1EUNA 4QITA 3BGAA 1B2YA 3UWZA 2O4MA 2OOGA 1AL8A 1E51A 4GJ1A 3S47A 3FA5A 5HNTA 1HGYA 1GT8A 3CWOX 4TU1A 3ITLA 3G0SA 7TAAA 4PMUA 4RV3A 3W82A 1TV7A 3W6MA 3VNKA 1AK5A 1W1YA 3JW7A 3W1MA 1GVYA 4B5XA 1V3HA 1UW9A 3N2CA 3R13A 4DWSC 1G69A 3GB6A 5ABEA 4IG2A 3PN8A 1W1A1 1IZKA 3M0JA 4WDWA 3L23A 4UXDA 4PGLA 2QW5A 3UWWA 2WMHA 2WWDA 2V8ZA 1AZ1A 2XFRA 2ZZ7A 1KCKA 2NV9A 3F2CA 3ONCA 2X8RA 1MQPA 1F6KA 4M5PA 4IXHA 4YPJA 2YKKA 3PWAA 2NSOA 4IIEA 3PUDA 1OG0A 3SUUA 3VOIA 1OK4A 4Q8WA 1A5LC 4ZBCA 2QPUA 3M5ZA 5D2YA 1ZCCA 1Q6DA 4MGGA 1KBIA 3CUIA 4KWWA 2HS8A 2J8FA 3L2IA 3T0AA 1PSCA 4NX0A 2BXYA 3W76A 1GOOA 4JICA 2PRHA 3QXBA 3N2OA 4GFIA 4H8HA 3V16A 3KAOA 1T0OA 5FF3A 2V2DA 1UZ1A 4RE4A 3WLPA 3B9AA 4IMDA 2BHUA 1W56A 5G4WA 1SO4A 4WZHA 3LX9A 4QCFA 4Y9PA 4DUVA 3L4VA 1Z41A 2PWVA 3POHA 2PDYA 4UCFA 1FP8A 1UC4A 3P5YA 4UQ9A 1WBHA 2TYSA 3E2SA 4NJHA 4F0HA 3VIKA 1FCVA 4S3GA 3E49A 4IPNB 3UR5A 5A6TC 4GQQA 4WLCA 1JPKA 1S5MA 3QR0A 1ICPA 1XRVA 4WDXA 2DSWA 2OZTA 4QE5A 3E02A 3EBVA 1H7NA 1M7PA 2R1LA 3QBUA 4AY1A 1R6WA 3WIJA 3H4WA 1OIMA 3K8LA 1UA3A 2CZFA 2J4GA 5CGMA 3BAIA 3IVTA 2EPLX 4QLKA 4IIBA 1FWGC 2RHGA 2FVMA 2AL2A 1CXIA 4DUWA 3MKVA 2J9ZA 4H4IA 5CZ0A 1XC4A 3QMSA 2OGJA 4PBFA 3FYOA 2VR2A 3TU9A 4K8EA 1LTDA 2P3ZA 3EPOA 4LVDA 2V69A 2VX7A 3LCLA 4A6GA 2NX1A 1NWSA 2D2GA 5IBXA 3LRLA 3HQPA 2P8CA 3GC5A 3I7QA 4N4PA 1T96A 5D2XA 1Q6EA 2JFEX 4IX2A 4GY1A 1N8WA 3PZIA 4NJGA 1A5CA 3ABRA 5FF4A 3WO8A 4MWAD 3WQ4A 3VOJA 3PAJA 3NZGA 3O6AA 3M0MA 1GZGA 4R34A 2HPMA 2PLJA 2REQB 1HFBA 1LWIA 1CENA 2I57A 2VFEA 2WJZA 1UD8A 3CAWA 1FFQA 1YBQB 2BTMA 1FKWA 5U4NA 1N55A 3W1PA 3N4EA 5AHFA 3GW3A 3W7MA 1LRQA 4UR9A 1IEVA 2WSKA 1RALA 3NCOA 4JKMA 4JYEA 3GXFA 2I5GA 4B9YA 2WK2A 1QDSA 4KCWA 5DF0A 1V6XA 4NAEB 1F74A 4LBSA 2WV8A 3XIMA 2I14A 2F84A 1UKPA 4YTRA 2ODOA 3MA8A 4C6EA 3OIXA 3QZEA 4GKTA 1NELA 4Q7BA 2D0FA 2W67A 3O0FA 1YTDA 2PDFA 1GPFA 3TFXA 3TMQA 2GJPA 1MUWA 3FX4A 2H9AB 2XH7A 3VKBA 3LDVA 1Y0EA 2QVHA 2DZPA 1M7OA 1UD2A 4ORMA 1MFVA 1HJWA 3NPUA 4B2DA 4PC8A 3ZWSA 1ZJAA 5A8QA 1AA1B 2GDQA 3ZVHA 2QGHA 4DXXA 1GHSA 4CGTA 4H19A 1Y65A 3FXGA 2A1YA 3TOYA 2XM2A 5FEWA 5KTLA 2AGTA 3H2EA 2F7FA 4MIMA 3W7OA 1E4NA 3SAZA 3H21A 3N6QA 4JPGA 1LZOA 3MU7A 2UZ9A 3U48A 4C1LA 1GVEA 1KM0A 1BTCA 2E9BA 3MQTA 4O0ZA 4MB3A 4UOJA 5A6LA 3WLIA 5I07A 3VDGA 3PZUA 3I6EA 4LBUA 3AIVA 4KH2A 1J6PA 2PTZA 2CESA 1IIHA 3LTSA 2Y89A 3RXZA 1QUMA 3EXTA 2QJMA 5I3IA 2G37A 4MG4A 4EPKA 3A5VA 1WPCA 5A8PA 2QHAA 4A2RA 2IPFA 3KBWA 1GOXA 3A13A 4UC5A 2JK2A 3UPMA 3VNJA 2BBFA 3NG3A 4Z08A 4OOZA 1NAL1 1BF2A 2PTYA 5IFPA 3JVAA 4UFMA 2DFAA 5E6ZA 1EZWA 2UY5A 4PMJA 1ALDA 4XWUA 3L5AA 2C71A 3M0VA 1TUXA 4P5UA 1XS2A 3AICA 1OVDA 1PVNA 3BDKA 3A3HA 3PG8A 1N7KA 2PDQA 5JVLA 2CETA 3C0QA 4BFAA 1PXGA 1HKWA 4QSHA 1GJPA 2PCEA 2NX9A 4XV0A 4DHGA 1JDDA 3DHUA 2ZZ3A 1WUEA 5C9ZA 3MHGA 5FI8A 1FH8A 3GNNA 4K37A 4ZQCA 1N8FA 3D5HA 4XKYA 5B7ZA 1TX0A 1LUCB 3GO2A 3V75A 2GYIA 1DWHM 1OM0A 1CX9A 1NFGA 3EOOA 3I4EA 1NVMA 3CO4A 2FVLA 2FIQA 1QBBA 7XIMA 6XIAA 1ZENA 2C3ZA 3C61A 2WCSA 5G4HC 4A8RA 4AUBA 3CNYA 1G1YA 1JL8A 2W0UA 1CXFA 2IXUA 1A5OC 1X96A 3TR9A 1ZHAA 4QNEA 3URAA 3S42A 4YXGA 4TTGA 3APGA 4C7FA 1XIIA 3OODA 1LP6A 1O94A 3CQJA 3VZZA 1BKSA 3TMLA 3TC3A 3W24A 4L9ZA 1GQKA 5F7UA 3W22A 2DH2A 1HG3A 3P7YA 2IQ0A 3BSHA 3S6DA 1NF0A 3LSBA 3BLPX 3OZMA 4S3DA 2UWFA 1M3UA 5DEZA 1JPMA 3FV9A 1XKJA 3GZAA 3TW9A 4F0KA 4H6KA 2BDQA 5A6BA 3STCA 4LB3A 4WIWA 1A3WA 4BK9A 3TZNA 2DT3A 2VDGA 4GIYA 4HU4A 1F3WA 2E3ZA 3GVWA 3P6LA 4K39A 4JTLA 1RPKA 3S6OA 2FLIA 2H3BA 4IXXA 3UGRA 2WPBA 2GUBA 4X0NA 2A79A 1DJWA 1XICA 3I3EA 1PX4A 2R1PA 2HV5A 4YVXA 4AD2A 3HQ1A 3LK6A 3TTSA 2Y7FA 1R3RA 3PZMA 2NVCA 3HOJA 1SYTA 5DXYA 2G5WA 1PHQA 4J3VA 1YW1A 3H2CA 4AZHA 1XLHA 5DCEA 1W9PA 4CU6A 2RGLA 1P7TB 3MW7A 4Q33A 4XZ9A 3KP1A 4KWOA 3MI3A 5AB3A 3HPSA 1US0A 3AISA 5J8LA 2V3GA 4EAMA 1MI3A 3VCCA 2R82A 3QZ6A 3IJLA 1QTWA 1QNVA 8RUCA 5JMUA 3PHAA 2D20A 1DIOA 5I24A 4LUSB 1JJKA 5BROA 4GNVA 1VHCA 5HJXA 3BJTA 3VDBA 3QF0A 3LTPA 1UR3M 1NQ6A 3IIPA 2E0PA 4JTTA 3UF9A 1XIDA 3IARA 3VIPA 4X61A 1EP2A 1X97A 3LCXA 1E5NA 4KWVA 3VZXA 4PL2A 2RUSA 4XZLX 4EPDC 1CZ1A 4IGHA 3LA4A 2BSLA 3RDKA 3B4YA 1PWLA 1XH1A 3VK5A 2WJEA 1TMQA 4HYWA 3ARVA 1S2UA 3KVLA 1E56A 4MJ4A 3VU2A 4M81A 4EPEC 2VRJA 2VOTA 4RUBA 4ZEPA 2VD8A 4B5VA 3DUGA 1QW9A 1OB0A 2DZSA 2Y61A 1K7EA 2CIPA 3CT7A 3W01A 3NGFA 3IRDA 1FWAC 1D3HA 3IVUA 3GNRA 3QY7A 4AVNA 4FNQA 5IDZA 4ZENA 4R7WA 2FVKA 1XGZA 1O5RA 1W6TA 4JTUA 4IHCA 4H9UA 3N19B 1KB3A 4I9AA 2GSHA 1FWFC 1A47A 4OUEA 3VD7A 1K02A 1ZY9A 2X1TA 4UTIA 2BGQA 3W7EA 1KFWA 4RZ4A 2GPTA 1PBGA 3V1PA 4AEOA 3G1DA 3P3BA 3PZTA 4DF1A 1UCWA 3LGGA 3C2OA 2NQ5A 1OYAA 4WDTA 3LCGA 2BXZA 1TZ9A 4DELA 5IRPA 2PDUA 1OWQA 3GIYA 4DZ5A 1TPDA 1QHOA 2G3MA 1QPKA 1TJ2A 1R3TA 1S3HA 1DP0A 1RLDA 4GX9A 3TLLA 4Q8OA 1AQFA 2Z4GA 3STGA 3U57A 1CGYA 5K4XA 3GG0A 3LMYA 3GXIA 3LCFA 1PDZA 2XU2A 4C6OA 5AECA 2DZVA 1PCWA 2P3EA 2X42A 3WX7A 4FI4A 3U7BA 3EOEA 4PN2A 3AMDA 3WSUA 1AQ0A 5D38A 4IPLA 4TV6A 4AHQA 1K8CA 3T42A 4U3AA 2GFTA 3SO7A 3UR7A 3WMLA 3SADA 3A4WA 4MMWA 4IGMA 4AD3A 2WSPA 2WMKA 2J7GA 1G5AA 2VO5A 4AQLA 1BRLB 2ADAA 3CAKA 1JR1A 5CG0A 3RX4A 3A23A 1L8NA 4R3UA 3U5YA 3NSMA 4HNTA 1IYXA 4LVAA 2YW4A 3W7QA 4XTIA 4JTIA 1ZFJA 4J3XA 1R87A 4FNRA 1S2VA 1UD4A 2V0TA 2H8ZA 4P7OA 4PCFA 5E5CA 1TMLA 3SJ3A 4PH6A 3SUTA 2ABAA 3COTA 3ZR4A 3C8NA 1XWYA 3G1RA 4K68A 4ALDA 2Q3OA 4QSFA 3HBLA 1DWIM 3EWCA 3DZ1A 3NM1A 5LNWA 3SCSA 3NDZA 3L5LA 3HA1A 4LS1A 1TVPA 4JXCA 3NL3A 5BXTA 3WQOA 2WYSA 5DN1A 4JDBA 5K9XA 3LPFA 1KWKA 1U5VA 1LBLA 1JRBA 3UQNA 3TJXA 1FWEC 2NUXA 4Z17A 3G3MA 1BWLA 2BY3A 5REQB 1XI3A 5JIWA 3S6TA 1ISYA 1EBGA 1EGMA 2CZVA 3A4AA 2FGZA 3HFYA 3WF1A 3DENA 3FVMA 4GFSA 3IPWA 1UKOA 3GW0A 3HGOA 2CFFA 2TPSA 4GI4A 3UZ5A 4ZO9A 4DWSB 3GTIA 3UG5A 5K9CA 1YTKA 3VDAA 2FHFA 4ZE5A 3UT0A 1AJZA 1ZCOA 4IPIA 3S46A 3ITGA 4KGJA 1LUCA 5DRCA