2Z7GA

Crystal structure of adenosine deaminase ligated with ehna
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Adenosine deaminase
publication title Conformational change of adenosine deaminase during ligand-exchange in a crystal
pubmed doi rcsb
total genus 142
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2z7gA00
1RA5A 2Z25A 4EPKA 4CEXC 4C6KA 1NDYA 3MVTA 2EG6A 4IH3A 3B0YA 2Z27A 1EJWC 3GRIA 3NEHA 4PBFA 3MVIA 4C6NA 1KRBC 4LAOA 3FDGA 3E0LA 3WMLA 4XD5A 3PANA 4HJWA 3GIPA 4F0SA 1HZYA 1A5OC 4CNTA 1W1IE 1A5KC 1GKQA 4QRNA 3LU2A 3MPGA 1V4YA 4R85A 3F4DA 1NDWA 4DIAA 2BB0A 1WXZA 4C6PA 4XD3A 4DZHA 1A5NC 2GWGA 2R1NA 3UR5A 2HPMA 5LXXA 3GIQA 4INFA 1VFLA 1M68A 3GU9A 2EG7A 3PAOA 3QY7A 1FWAC 1I0DA 3F2BA 3URNA 2ADAA 2VR2A 3S2JA 4KESA 4IFRA 4J5NA 3DC8A 3OQEA 1KRMA 1RK6A 3URAA 1EJSC 3KM8A 1A5MC 3AU6A 3IPWA 4C65A 1UIOA 2OOFA 3UPMA 2WM1A 1NDVA 3PNUA 3HM7A 2OODA 2G3FA 4KEZA 4H9ZA 1UMLA 1YIXA 3QY8A 4H9MA 4HK6A 4IG2B 1KCXA 3QGAC 3S2LA 4OFCA 1S3TC 4RDYA 4GYFA 4M51A 2Z2AA 4C6JA 4ZSUA 2FFIA 1FWHC 1O5RA 2Z24A 2Z2BA 4C6OA 4GK8A 3MTWA 4C6LA 3IARA 2I9UA 4J35A 2E25A 3D6NA 2XIOA 2P53A 3OJGA 4L6DA 3LGGA 4H9UA 4MUPA 3T8LA 1JGMA 3GU1A 4B90A 2D2HA 5HMFA 3AUOA 2ZC1A 4C6DA 4NI8A 2EG8A 3O7UA 4LCQA 1YBQB 3SO7A 3K4WA 2FTWA 3TN4A 4V1YA 4BY3A 3RCMA 3T1GA 4CEUC 2OGJA 4H00A 5CH9A 4CNUA 4DNMA 2WJDA 4C6CA 1FWFC 3RYSA 4B92A 3ISIX 1POJA 1A4LA 4ZSTA 4DZIA 4WHBA 1EYWA 2AMXA 4GZ7A 4XD4A 1BF6A 1J6PA 1UBPC 1K70A 3TN5A 1RJQA 2DVUA 4LAKA 2PUZA 2FTYA 1A4MA 4D8LA 3G77A 4GX8A 1XGEA 4I6VA 3OVGA 1O12A 3R0DA 4XAZA 4B3ZA 1FWCC 2RAGA 3LSCA 3AU2A 2PGRA 3QY6A 2HBVA 4P5UA 2QT3A 3PBMA 4QS5A 1V7AA 4H01A 3OU8A 4IFKB 1I0BA 2VUNA 4LAMA 3TNBA 2OQLA 2VM8A 1XWYA 4PCPA 3WZ0E 2DVTA 2HNHA 1EJXC 4C5YA 2PLMA 2Z7GA 4UBPC 2QPXA 3FDKA 2HPIA 3LA4A 3GTFA 3GG7A 4ICMA 4KQNA 4C6EA 5E5CA 2A3LA 1PSCA 4XAFA 4DO7A 2W9MA 2CZVA 3E2VA 3K5XA 4G2DA 4HK7A 3ORWA 4KETA 4KEUA 4GY7A 3BE7A 4IGNA 2GOKA 1XRFA 2VHLA 1YNYA 2WJFA 4QROA 2VC5A 2Z28A 1FWGC 2BGNE 4F0RA 4KIRA 2QS8A 2Z4GA 3IJ6A 4EPBC 4C6QA 4EP8C 4IQJA 1RJPA 2FVKA 3O0FA 5FSEC 3S2MA 3IV8A 4YIWA 1FWDC 1FWIC 3TN6A 3JZEA 3OODA 3SFWA 2YB4A 3LS9A 4DYKA 3LNPA 3GTIA 1K6WA 2UBPC 4F0LA 4DLMA 3IGHX 1FKWA 4TQTA 1V79A 1EZ2A 2GSEA 3F4CA 4RE0A 1NDZA 4KF1A 5A6TC 4J2MA 4B91A 1IE7C 3EWCA 3GU2A 4R7WA 3ID7A 4WGXA 4G7EA 4LCSA 1KRCC 1P1MA 4HA0A 3IRSA 2YXOA 4R88A 1PB0A 1FWBC 2AQOA 4H9TA 3LGDA 4GX9A 2F6KA 2AQVA 1E9YB 4CNSA 1POKA 1FKXA 1E9ZB 1PTAA 1RA0A 4QSFA 3EWDA 2Q09A 4H9XA 4AQLA 2PAJA 2ICSA 2YB1A 4C6MA 4GBDA 4RDVA 4LFYA 1NFGA 2QVNA 3DUGA 4QTGA 4GY1A 3LSBA 1ITUA 4HK5A 4DI8A 4BJHA 2VC7A 2D2GA 4GOAA 3EGJA 4CQCA 2R1PA 3WYZA 2Q01A 3CAKA 4Z42C 3B0XA 1R9ZA 4G7EB 3E3HA 1J79A 3V7PA 5G4HC 4GY0A 2DVXA 2R1KA 3URBA 3K2GA 4H9YA 1EJUC 1QW7A 2O4MA 2D2JA 4GC3A 4IF2A 4XAYA 4E3TA 3F2CA 3A3WA 3A4JA 1J6OA 4L9XA 3T81A 5FSDC 3LY0A 3GUWA 4JOMA 1ITQA 3C86A 1A5LC 3HTWA 4IG2A 3N2CA 4IFOA 3IACA 4IGMA 4PBEA 2WJEA 2GWNA 1YRRA 4ERGA 4PCNA 2O4QA 3HPAA 4XD6A 3E0FA 3S2NA 1XRTA 4LEFA 3ITCA 4EPEC 1FWEC 1K1DA 3GTXA 2R1LA 5HMEA 1KRAC 4ERIA 4CQBA 2HQAA 4CQDA 1GKRA 1R9YA 2KAUC 1YMYA 5HMDA 1YBQA 4GXWA 1ONWA 4XAGA 4DI9A 3DCPA 3QGKC 2UZ9A 2YZ5A 4C6IA 4PE8A 2GZXA 3MSRA 2HBXA 4LALA 1PO9A 1V51A 1EJVC 1ZZMA 1P6BA 4KERA 2PGFA 3MKVA 4H9VA 2Y1HA 1ONXA 1WXYA 3S4TA 4RZBA 4LH8A 4RDZA 4C5ZA 1DPMA 3CJPA 3E74A 1FWJC 2E1WA 4KEVA 2Z00A 1V77A 2Z26A 3CS2A 2IMRA 2ANUA 3F2DA 1P6CA 1R9XA 1M7JA 3E38A 4DLFA 3FEQA 3RN6A 3ICJA 3A3XA 1RJRA 2FVMA 3RHGA 3UF9A 3B40A 1UIPA 4BKNA 3NURA 4LANA 2R1MA 4C60A 4AC7C 1M65A 1ADDA 4NP7A 3GTHA 1RK5A 3PNZA 2P50A 4QS6A 2OB3A 4NG3A 3MDWA 4IFKA 4EPDC 1J5SA 4UB9A 1EJTC 1EJRC 3UBPC 1EF2A 3OOQA 3TN3A 1QXLA 2Z29A 4RDWA 3URQA 3NQBA 4ERAA 4LCRA 5AKQA 3MDUA 4V1XA 4C6BA 2I5GA 4C6FA 1RAKA 4I6KA 4WVXA 1GKPA 3UR2A 3MJMA
chains in the Genus database with same CATH superfamily
1H5YA 4IH3A 1XYZA 4UXDA 2E6DA 2Z27A 2AGKA 3E0LA 4XD5A 4DJFD 3MZNA 3WLPA 5FF2A 5BOEA 1MDRA 2PDMA 4OBTA 3ATZA 1EH9A 3MPGA 4OV4A 2GUYA 4JTFA 2FGBA 4DIAA 3CZLA 4JIHA 1WXZA 2ZUVA 3G3MA 3SUWA 4AD5A 4PGLA 3BMVA 4KEMA 2A7PA 1KBJA 3FN9A 4IOTA 3N4FA 2VC6A 4W86A 3KVMA 2PDPA 5I6SA 1JFHA 3AXIA 2IKHA 3N17A 3R89A 1KGXA 1C8YA 1BQCA 3OQEA 2HK0A 4BQ3A 4PUMA 3KM8A 1QHOA 2Y5SA 4JIRA 1BXCA 3BZJA 4R7JA 2CLFA 3H12A 3M0LA 3WDJA 4AHQA 1S5TA 3B9EA 1R3WA 4Q8WA 1QUMA 1RALA 3KHDA 1PYFA 4RXGA 1BGAA 5GPRA 2NT1A 1O94A 1F74A 4TVCA 3CPUA 1Q6QA 3H2NA 4MKVA 3GG0A 4B15A 1FWHC 3G24A 2HMCA 3EDJA 1VFHA 3TAKA 1V03A 6XIAA 3KOFA 3UG8A 1IEWA 1W1B1 3CZJA 4A2RA 4GYJA 1KR0A 2ZXAA 2XTKA 3ALFA 5A3HA 2Z1SA 4K6AA 2WZHA 3VO0A 1UD6A 3ZVIA 2EG8A 3RCYA 4UTWC 3WDRA 3MCMA 1M7XA 1XLAA 1K8CA 1ZU8A 2FPVA 2PGWA 3UWVA 3GNNA 3MYOA 2RHGA 4MY8A 1MEIA 2DJXA 4FP1A 1A4LA 3S83A 3M41A 2NQ5A 2Z1WA 4NSBA 4ZB2A 1G67A 5CZKA 2PA6A 1W3IA 2A5HA 3B8IA 3P14A 4HKPA 3A6OA 3ZFHA 1B3OA 3RX4A 2ZXDA 1EGMA 4MF4A 1VIZA 4WDTA 1YW1A 2BG5A 1PKYA 4X61A 1JZ5A 1Q85A 4JQ4A 2WPGA 3KWXA 4F9JA 3G1SA 3QKEA 2CIPA 1BGGA 3L4TA 1K3UA 4XBKA 4IJBA 4ACZB 2J24A 4C7DA 2C71A 1JPIA 1JYXA 3CTLA 3FVDA 3POHA 3SUUA 2OEJA 3CIXA 3VILA 1PTDA 4QG9A 4UBPC 1H62A 1FRBA 1BTMA 1ICQA 1QNRA 3UWWA 1LP6A 2CBUA 3W6YA 4G2DA 4D71A 4HOZA 4AISA 3BAYA 5XINA 2NV1A 1EIBA 1LCOA 3QR0A 1JZ8A 1UPPA 3O63A 1DXEA 4QDWA 4S2BA 1UROA 1I4NA 1TJ1A 2OYMA 4HU8A 1FWGC 2BGNE 3VKBA 2WVSA 3O6AA 2F6UA 2QS8A 2Z4GA 5FA5A 2JEPA 3N9SA 1F6YA 4CQ8A 3N18A 4O0KA 1LT8A 2ZE0A 1VIWA 3S47A 1V02A 1TV2A 1VR6A 5CZSA 5I2UA 2I16A 2IPFA 1E3XA 2BS9A 4F0LA 3PUDA 4DLMA 4TQTA 1TJPA 2PWEA 1PX4A 5DMNA 4YJ5A 1TCMA 1GOMA 1SYTA 1CDGA 3ITTA 4TX6A 1GOWA 1E1CA 1QHPA 3A13A 3EOLA 5FD0A 2YSWA 3MI6A 1GNXA 2JGYA 1FUYA 1XV8A 2G4FA 1XR2A 1C90A 1GZJA 1PHWA 4OQVA 4ZA0A 4M80A 3HQPA 4JTGA 3I65A 3BLIA 2DV0A 3P5YA 5HPOA 1IIHA 3SRHA 1KBIA 1EQCA 3CAVA 2QJIA 4DBEA 3KS5A 1PZ0A 3UXAA 4O4WA 5C5YA 2J8FA 4DXXA 4DXKA 1RZMA 1MWOA 3TK7A 3DYMA 5D05A 3EAUA 4MKNA 1V02E 2QQ6A 1CWYA 5D9OA 3MUAA 3KOYA 3AALA 4IIHA 4QCFA 4WR3A 4G7EB 5DRIA 3EA3A 1PDYA 3WG6A 4O1DA 4LGXA 5CLWA 3LTYA 4XAYA 3W70A 3QHNA 1SUXA 2C0AA 2PWGA 1Q65A 1RCQA 2YCJA 1BYCA 1TMHA 5HR6A 2J6XA 2QVHA 3KVKA 3TYBA 3LRKA 4IFOA 3HGRA 3PR2A 1DE6A 2A4AA 4PBEA 2D0FA 2GWNA 3TR2A 1PKMA 3HPAA 4FXRA 4PCNA 1ZGDA 4Q7BA 4LYPA 5I3DA 1K1DA 2GK1A 1XS2A 3DKLA 2Y8UA 3FJNA 1VPQA 3GXFA 1L6FA 1VZWA 2FZ8A 3G2GA 4J40A 2HXUA 1XUUA 3EPNA 4DI9A 1EFZA 4MGGA 4JS3A 1EBGA 5LZLA 2DH3A 2E5CA 3A3HA 4HNNA 3AFBA 1M7OA 1WDWA 4M29A 4LBUA 2WMFA 4CKQA 1DPMA 1MQQA 1ZCCA 3ARQA 5HJXA 3SN0A 3UERA 3AWNA 2IMRA 4V15A 3TOPA 2FZMA 2ZDRA 4A6GA 4JQ3A 1VAHA 3CT2A 1FWSA 3AXMA 4B2DD 2HDJA 4WSJA 1QWGA 2WMIB 4IT1A 2GYIA 3FS2A 3ANYA 4AC7C 2OOGA 1V6TA 1WKYA 5ABFA 1V3KA 4QS6A 3MDWA 3ZJ7A 3VE7A 4PTVA 3ECQA 4WSHA 1T5AA 3FNDA 5LA0A 2DIEA 3URQA 4ERAA 2DZUA 4V1XA 4KWVA 2EO7A 1OX5A 3GHRA 3LGEA 3VPLA 2WWCA 2X1SA 2Z25A 4EPKA 3EX6A 5DXXA 3B8DA 2EG6A 4MNKA 2EXOA 1TFVA 1PKLA 1V3LA 3SGGA 3WMLA 5BRBA 1KBLA 4FLSA 3VIPA 1HZYA 2HVNA 1W1IE 4Q8UA 1E55A 4V33A 1V7YA 3AHYA 2BY2A 3NO5A 4AXNA 1V4YA 4GD0A 4FIQA 4A22A 3N11A 1DORA 4N6FA 3PZUA 2BB0A 4W4QA 1EBHA 4PODA 3SM0A 3KXQA 3I3DA 1W5OA 2QCCA 3GX9A 2VZUA 2PS2A 3WL1A 2PB1A 4NYYA 5GQBA 4NJIA 2VR2A 2E67A 4JYDA 3VNIA 4HHMA 2GGHA 5EKYA 4M5PA 5F2IA 4IPPA 5DQPA 4UR8A 1L2QA 3USBA 1UMYA 5E6ZA 3TTEA 1VFFA 4H9ZA 1ZB5A 3QY8A 4J3TA 1SM9A 2J7DA 1RHCA 1SO6A 3SRKA 2Z0IA 2XN2A 3C3NA 3OIHA 3T0TA 1WDQA 4GK8A 2J8GA 2NXIA 3SEPA 1OX4A 2GJXA 3S5YA 3TSDA 4K1GA 1B31A 3VKCA 5ABEA 1JQXA 4MUPA 4XIAA 5F2MA 2OZ3A 1NTHA 3GU1A 1G7VA 4EWND 3U4FA 2FJUB 4JTDA 2NX3A 3A47A 3CNYA 1V3IA 3GNDA 3VD3A 1MW3A 1EWEA 4WGHA 2H8ZA 2OGJA 3ZXWA 1QRQA 4K3ZA 3CB8A 3HPXA 3SR7A 3WL0A 4AYGA 4GZ7A 4PTNA 2BY1A 4HSHA 1E6ZA 2E40A 3W87A 5ABGA 2C19A 4E4FA 3BPWA 3GXPA 4FB7A 3A64A 3M0HA 4G5DA 1EX1A 4C1KA 4I6VA 2VVNA 3CPRA 4FXJA 1GTHA 2ZX7A 4E8CA 4QEHA 2WSQA 4QS5A 3OHIA 1QI2A 4YTUA 2VUNA 4LY8A 3ITVA 4PH6A 2POZA 1XWYA 3WZ0E 5I09A 2V3GA 5DF0A 1E5NA 1XLFA 4ZTXA 5FF4A 3ZMRA 3NEVA 3LG3A 3LA4A 3GTFA 4R9OA 3LHWA 1XPGA 4CCEA 2RDWA 1H09A 1HGYA 3T55A 3KVLA 5AOUA 4X9SA 4YTSA 2DEPA 4IGNA 4Z1BA 3H7VA 4R53A 4UFLA 1T0OA 2WPBA 3W7JA 4TV5A 3PSVA 1FH8A 2DSUA 1VYSX 6ENLA 3ZT5A 4PRWA 1RJPA 2TPSA 1QI0A 3O0FA 2PODA 1M3UA 2WHKA 3WK2A 4GKLA 4HNCA 1EC9A 3CU2A 3CQIA 2YDQA 3GC5A 3CZ8A 1K6WA 5CG0A 1EXPA 3VKKA 1ODUA 5C9RA 1UQYA 2OPJA 5EBUA 1EZ2A 2XSXA 4R7WA 4G7EA 2G4JA 4M0XA 3FVMA 3KBWA 3KE0A 3M44A 5FEXA 2ABBA 1T41A 1HJQA 1RPKA 9XIMA 3AMGA 3MMWA 2G3NA 1ZQ5A 3ZOAA 4FK9A 1AQHA 4V2XA 1NSJA 3VKDA 2PMQA 4L1WA 1UJPA 3DUGA 3STPA 4ZBCA 1G1YA 1TV7A 4GOAA 3KP1A 4L80A 4HZMA 3EKZA 3R8HA 3E3HA 6REQB 3W7DA 1OK6A 2R1KA 1Q13A 1KXVA 2CESA 1HGWA 3S9IA 3TFXA 3A4JA 2V3DA 4DBWA 1Z7AA 2PTYA 1EX5A 1XFCA 4IG2A 2OMAA 3AXHA 1HVXA 3GR7A 3PM6A 2GQ9A 3ARXA 4CNNA 5A5WA 3RM9A 3WK3A 3GVQA 5AB3A 3H24A 3VDBA 3ZZ1A 3WIJA 1QI5A 2JIWA 8CGTA 5AC6A 3MC5A 3UVIA 1F5ZA 4AEOA 3CAQA 1ECEA 5IBXA 3SZ8A 2WMIA 3QEZA 1V5XA 3T42A 3CTTA 3GNRA 5HA7A 4G1NA 3R12A 1CEOA 1ONWA 3HOJA 3LZ3A 3AHZA 2YZ5A 3NQ6A 3W7LA 3WJYA 5FEWA 3B9AA 3P82A 2CEQA 1TJ0A 5A6SA 4GBUA 2PGFA 3UFYA 1MXGA 1LQ2A 4RDZA 5TAOA 1UASA 1X8CA 4P2VA 1I2QA 3SQLA 2ANUA 5DBUA 3NO1A 1ISVA 4XV0A 3T2QA 3ERPA 4POCA 2I9EA 3N13A 1RP9A 1BXBA 3GZ3A 5CPQA 4CNOA 3LHYA 4DN1A 4IFKA 3RMEA 4LWWA 3T4CA 3N29A 1GWJA 3J7HA 2VDGA 2D0GA 2O56A 4YCPA 3NVTA 1CLXA 2NSOA 3KRZA 3NQBA 3W82A 1C9WA 4HBKA 4C6BA 4HSNA 3I6EA 3TLQA 1RAKA 3R43A 4JNMA 1OIMA 3VA8A 1JYWA 1U5HA 1NDYA 1QNQA 5REQB 1V6WA 1KXQA 1DWGM 4D72A 1XH1A 2VO5A 3S1VA 1NFPA 1E3ZA 4PEKA 1DWIM 1YDVA 2XM1A 3ZSTA 3HG5A 1VBUA 3WDQA 4QRNA 1VKFA 2PTDA 1HX0A 4FIRA 5IHSA 3XISA 1H7PA 4BI7A 3QTGA 4J7RA 1I75A 2E3ZA 1K02A 1VENA 1M68A 1SMDA 3AS3A 3QV6A 3EOEA 1O6IA 2I14A 1QI3A 5JU6A 2WB5A 3N6JA 4OHQA 4QM1A 2NV9A 4IFRA 1C8QA 1KV8A 5XIMA 5HANA 2Y7DA 3M0VA 2V5LA 3RLGA 2Q6ZA 2MNRA 1E1EA 3NAVA 1EPVA 3C2VA 2QPSA 2ZADA 2OOFA 1X8FA 3MY9A 1NFBA 1YXYA 2YCIX 1YIXA 5H8PA 1R46A 1FOBA 4OKDA 4OFCA 3TJ4A 2FJKA 2Y0FA 2PTXA 4KGLA 2Z2UA 4XBSA 4UFIA 3K13A 3W2NA 2QCNA 2Z24A 2DZAA 3TA6A 3VKAA 2DH2A 2V3EA 4OE7A 1KM5A 1UA7A 1EP2A 5LA1A 1QWKA 2VCBA 5C71A 4KCVA 2EPLX 3B8TA 3MHGA 2ZC1A 1GHSA 1VFOA 4PUUA 3ARUA 1V08A 3SUVA 3TQKA 3T1GA 4D6IA 3VVGA 3G0UA 2WC3A 1H5VA 3VUPA 2P8BA 1UD4A 3KRUA 2WSYA 3ARSA 5D32A 4IICA 5A6LA 4J3UA 1EYWA 2O55A 2YKKA 4M3PA 1QR7A 4WDXA 4A3QA 2J7BA 5HAOA 1CTNA 4ATWA 1OYAA 2DVUA 3VD5A 3NXFA 3GYCA 4W8LA 2ZZ2A 5LNVA 3GTNA 1GOQA 3QZEA 3NTYA 4XAZA 3W38A 3B06A 5BXSA 1J0YA 3R79A 5I06A 4P7NA 4UQCA 4X3ZA 4DAIA 5PTDA 4Q8TA 3GC4A 3M6DA 5I02A 3LRLA 4AZCB 3CZKA 3DC0A 1YPXA 5CC3A 3AQUA 4YVPA 2V2CA 5C54A 4DF2A 4N9EA 3M47A 3IJ9A 3PS7A 4ORIA 2A3HA 4IX0A 2QUNA 1HKKA 3FSTA 5ECUA 4ICMA 5M5DA 4WXYA 4DUWA 4LVBA 1AD4A 3E2VA 2I5IA 1XIJA 1BRLB 3BVJA 4IXXA 3WDPP 2GOKA 2VRKA 2VHLA 3UT0A 2QCHA 2V5DA 5HJYA 5FEPA 2YYTA 4FF5A 7CGTA 1TV4A 1XLHA 5C2CA 4KCWA 4KIRA 4IL0A 3W27A 1R7AA 4O8RA 1NEYA 1UC5A 3HGJA 3IGXA 4EPBC 2NX1A 4C6QA 4IQJA 3U7VA 1H1NA 3T9PA 3S5OA 8XIAA 1TA3B 4IMAA 3U5YA 3STFA 1FCVA 1XC4A 2C13A 2YB4A 1QNPA 3FY1A 4Q7IA 4S3DA 3M7WA 3S8HA 1BKHA 3EX4A 5BWAA 3OGRA 3S5SA 3WEZA 3BO9A 2C16A 3TW9A 3U48A 4GKTA 3EDKA 3T0AA 4WGXA 4B5VA 1TVLA 6REQA 3M5YA 3GFYA 1PB0A 1FWBC 1BXNA 4WEVX 3RMJA 3AISA 1MXDA 4MAZA 2FQIA 3FKKA 1FWTA 3W7PA 5LYRA 3I7RA 3P8JA 1FKXA 4QXIA 1KW1A 4L64A 3CV6A 2J9XA 4G6CA 2JF6A 1W91A 1FP9A 3PJTA 3UR8A 4PUDA 4BQ2A 3KCJA 4AQLA 1MMFA 5BU9A 3A12A 1TMQA 1HP5A 3WH7A 4MAVA 1JVNA 1TG7A 4UMBA 3L66A 3EGJA 2ALRA 5CJNA 4FXSA 3WUEA 2PWFA 1E1FA 5FACA 1HQTA 4UNLA 1R9ZA 1J5TA 3TTSA 2A0NA 3G8RA 4PYSA 1QW7A 2XIBA 3W53A 3WLRA 2VP8A 2B7NA 4MIMA 3W7RA 3T0BA 4DELA 4E2OA 5A2BA 3HURA 1REQB 1D2KA 3QFEA 4H8UA 3TJIA 2J7FA 1ONRA 5AYBA 1KTCA 1S5VA 4K8HA 5KETA 3QLDA 4LF2A 1SJCA 3VAVA 4LX4A 1JCNA 5CC5A 1FP8A 4ROQA 3VINA 3N2OA 3LEPA 1BVZA 2ZOXA 3GHTA 4JEJA 4ZO6A 4XAGA 3M0KA 1OWQA 4IX2A 3VNJA 3M0YA 5CPOA 2AL1A 4Q7NA 4DQWA 2OQYA 3W75A 3LBOA 3ZIZA 4FX8A 4NJGA 3H6OA 3FSUA 1LWHA 3KRSA 4IIDA 1SU5A 3W1PA 1ODZA 4CU7A 2XVLA 4HNUA 3DU0A 4I7VA 4UTHA 3PSWA 3GDBA 2E8ZA 3R2GA 2B4GA 1HL8A 5HMSA 4LB4A 4QG6A 2CZFA 2QHAA 2TYSA 2VZSA 1KFLA 4RDWA 3DHUA 4PMQA 4Z2KA 2F38A 1P6WA 4IIEA 3LLDA 3NL2A 4WVXA 2FTPA 1Q66A 4KFNA 1VF8A 2B7PA 4DJEC 1EJWC 1YTEA 4IPLA 4Y8FA 3VXGA 2IQTA 4IM4A 3M5ZA 5LHFA 1KRBC 4ZTYA 1T40A 4MB3A 4RX0A 2QF8A 1US0A 1TE1A 4WK9A 2PC4A 3E12A 4TOQA 1PDZA 2WMGA 5A2AA 4BI6A 4N7QA 3PBWA 4LJ3A 1VLIA 2AQWA 1W3KA 3I10A 1YX1A 5E70A 4XD3A 3PWGA 4A8NA 4LQ1A 1S46A 1QK2A 3W7MA 1VEPA 1AK5A 3GG1A 3VOJA 2FHFA 2NWRA 5DRCA 3H2FA 5B7ZA 1TTJA 3TYUA 2FZDA 4GI4A 2AL2A 1J2WA 1RK6A 1PAMA 2VC9A 3AU6A 8A3HA 3W7CA 3NNTA 5G4WA 4P8UA 3AIQA 4O16A 2PD5A 4KEZA 3W1AA 3H2OA 3SCVA 3V16A 5I3GA 4RNJA 4RE2A 5G2HA 3CASA 4JYEA 3LV6A 5M1TA 4UTMA 1BVWA 1VFSA 1KLYA 3QM3A 4KRZA 4C6OA 1UCWA 1HIZA 3GVVA 4DJED 1VBRA 3LV5A 4HTBA 4IPJA 1WAWA 1V0KA 2I17A 2P53A 3UXKA 3ATYA 3DECA 2PZNA 3GLCA 3QOMA 3MI3A 3NDYA 3C52A 4M1BA 4B90A 3C56A 1BWVA 4GXMA 3RJYA 4QQ3A 1YBQB 2NVAA 2YDAA 2CWXA 2NT0A 5EFFA 5D37A 1T7LA 3H55A 5CH9A 4AIUA 2YL8A 1Q8JA 3EDEA 2YA2A 4DZIA 3NZ1A 2ZXBA 3NQDA 3CWNA 3MWCA 4XO6A 1XYLA 3TWBA 1H60A 2VGGA 1TWSA 3THQA 1ZJHA 3BW4A 2PUZA 2ZRXA 2P88A 3W1TA 3CV7A 3T05A 2HVMA 4JDBA 2AKZA 5DLCA 1EO7A 1VRXA 3KLLA 3WELA 3F4WA 1W3JA 5D9NA 4A3UA 1JF6A 2PDWA 2E9LA 4M24A 4ZE5A 2HE5A 3VIHA 4I7WA 1I0BA 4P8XA 2V5KA 1W8SA 5MHBA 1UUQA 1VYRA 5KINA 1WUFA 2QDDA 5FEZA 1TA3A 1TX2A 4C1LA 3ZJ8A 2V8ZA 4WLCA 2QUVA 2QUMA 3RM8A 1KFEA 4XAFA 1N8FA 5G4EA 2GFTA 3K5XA 2PDLA 1QO5A 4ECLA 3P8IA 2VGFA 4PB5A 3ZLFA 1B54A 3UJRA 1R2SA 3F5LA 4GVIA 4Q6JA 5A6BA 3UXDA 5D30A 4BF5A 1Y65A 3PTMA 4N2YA 5LIXX 1EEPA 3G1DA 2XDFA 2PDHA 1EP3A 1F7BA 3GSMA 3CMGA 3APYA 4O1AA 3GWQA 3UWEA 4PMVA 4QQUA 3RGTA 2J75A 3W29A 2E4TA 1FTXA 4DJDA 4F4RA 3NQCA 3W1NA 2W79A 3IGHX 4Z2JA 2RDXA 3PBUA 3B9DA 5IDZA 4C7GA 2BSLA 3B4YA 3ES7A 3FX4A 3GVWA 2BXVA 1XLJA 3QVQA 3EWXA 3STCA 3G1FA 2QZRA 1Y8BA 1W54A 4L7ZA 1XSIA 2PRMA 3WNMA 3SCSA 2QAPA 1LL7A 3GUGA 3SUTA 1REQA 3RU8X 4MOZA 4QEEA 3C8NA 1TJRA 2Q09A 3FEMA 1WKDA 1IR2A 3A9IA 1XINA 2W6RA 2IQDA 3TW7A 3VIMA 2OJPA 3A21A 4XX6A 3SRFA 1A3HA 4QTGA 3UPBA 4DI8A 4GQ0A 1CT5A 4LV9A 2QUTA 1SSGA 3T6CA 2B81A 3W26A 4ZQOA 3W1QA 1PZ2A 4MNMA 4L6HA 3VOGA 4H6QA 2X0YA 2I57A 3GKFA 3BUVA 1R0MA 4UFHA 3AS0A 3EMQA 2FHCA 1QOQA 3A3WA 3EMCA 1G9HA 4L4PA 4GI6A 1R8LA 1LG2A 3GXIA 5EBAA 3NSMA 1WZLA 4UCGA 3UESA 4QJ3B 8XIMA 1XX1A 1U30A 3G8EA 4M82A 1E4IA 2XVGA 4IXHA 3VGHA 2CPUA 4Q22A 4FMVA 2CHOA 3QC0A 2E9BA 1DWJM 4AVFA 1JAEA 4EPEC 4NAEB 3WLTA 1R47A 1UJQA 3KRBA 4AD3A 1LDCA 1TRDA 1P0NA 5F2GA 2VNCA 3IIOA 2E28A 2FKPA 1WZMA 3HO8A 4J9JA 1JPHA 1F3XA 1E43A 5T9CE 3DGRA 1ISXA 2WLYA 2E5DA 1J9YA 3TWAA 4FI4A 5HJLA 4W89A 4KERA 1C7SA 4LF1A 3MB9A 1THFD 1ESWA 4LH8A 5IHRA 5D2WA 2XGBA 4KEVA 2PDQA 4R27A 1DTNA 4D9PA 3ABSA 1Q6RA 1L2UA 1X1NA 5CZTA 5FAJA 2ESCA 2X1TA 3M43A 4LU0A 3ARPA 4N6EA 3WQ4A 1R86A 3VX0A 3RHGA 1GVIA 3UF9A 3TC7A 1NARA 2OEMA 4GGHA 4MFEA 4XUYA 5EMMA 3AYTA 4WUIA 3FV9A 1KFKA 3WMSA 4S3FA 3LTPA 2RKXA 4TXEA 4NNBA 5MF5A 3TA9A 1GYNA 4QDPA 1CXLA 3MHFA 3R13A 1XD1A 4JEQA 4W7VA 5EMYA 4XK2A 1YHTA 4JNZA 2W61A 4QNWA 3TTQA 3C2RA 4D6GA 3L0KA 4UTTA 4QAIA 4HJWA 3KDOA 2GQAA 1MDLA 3REQB 5EMLA 3W7HA 3LU2A 9CGTA 2WOQA 3V0UA 9RUBA 2YW4A 4KW2A 3EEZA 4JTCA 2GWGA 4LTSA 2HISA 2Y5EA 1HKIA 1EUNA 1XPYA 1PS9A 4WJ8A 2FPYA 3TONA 4RL3A 3W85A 2XVNA 1UP2A 3UY7A 3D47A 4RZ6A 3NGFA 2UY5A 2Q3RA 1UPMB 2WW5A 1EXBA 3VCCA 1YLVA 3EB4A 2J74A 2ZZ4A 4C65A 3WEMA 3MS8A 3UPMA 4HIBA 5FJPA 1FXQA 1BPLB 3A24A 3QF0A 1ZCOA 1GYMA 1Y5XA 1C8VA 4MWAC 4CD6A 1F4AA 2HK1A 4PUNA 1VLWA 4GO8A 5HOSA 2X42A 1KM6A 5LXEA 1IR1A 3W0KA 1IZCA 5CJMA 3QN3A 2W27A 3T4WA 4HGXA 1FDZA 4H9UA 4I9MA 4UOJA 1W2VA 2R6OA 3PTDA 2VD9A 3SO7A 1TZ7A 2QIWA 2CLMA 1GW1A 4WKAA 5I03A 4US6A 1XLBA 2NV2A 4ML9A 1VEOA 1U83A 1W8GA 4HYRA 4DNMA 3BLPX 3HPFA 4ZSTA 4O57A 1GYLA 2QGYA 2OELA 3CC1A 3EOOA 1JYVA 5LA2A 3CGTA 1BF6A 1IWPA 1W9UA 3GDLA 2G95A 4XQ6A 3T7VA 2W0UA 2PDBA 1AUSL 4LAKA 3G1VA 2JF7A 2PI6A 4URIA 4WDUA 1KM0A 1TSIA 2ACUA 3OVGA 1W37A 3EWBX 4LV4A 4US5D 2C15A 4PMXA 4E38A 3BDKA 4BHYA 1MUCA 3PBMA 2ZZ5A 4FAMA 4MWAD 4V27A 1Q4NX 4MJMA 4PCPA 2PRHA 1TVPA 1NJJA 2WXDM 1TUXA 2PLMA 1XCXA 5C9ZA 3ITGA 4ZO9A 1DOSA 1UD5A 1EPXA 3TTYA 3QPZA 2W9MA 5HNNA 3N3TA 3U7BA 3ORWA 3AIWA 3KZSA 4LAUA 5GNYA 1J0KA 1YDOA 3ABOA 5BCAA 3SSJA 1G94A 3MMUA 4AY8A 1F76A 3Q45A 1WAUA 2YA1A 2IKGA 1OZMA 1UKSA 2XN1A 1H7RA 4NXKA 3B05A 2DUXA 5J04A 3S1WA 3MCNA 4TTGA 2O9OA 1ENUA 1W5QA 5FF3A 3PBGA 3CWOX 3P7YA 1Q7ZA 4FX6M 5HWNA 2CCRA 2PTZA 4GYPA 3W7GA 3UETA 2ZTKA 2WKJA 3F03K 4DWDA 1Q6CA 4FLRA 4ALDA 5D04C 1V6XA 3WJWA 3OG3A 4GGBA 1RLCL 1UD3A 5CSYA 1W3HA 4V28A 4MJ4A 3AICA 1TCDA 3PZVA 1KCLA 5IFTA 3OW1A 1PTAA 3S2CA 2VZOA 4PTDA 1IXQA 1S2UA 3B03A 3IV3A 2PAJA 2PF0A 4LYRA 1OT2A 3MBFA 2QJNA 1VH7A 2UY2A 1MFUA 3VCRA 3PPCA 4HK5A 1C93A 4CQCA 2YW3A 4GNJA 1W3TA 4GJIA 3VM5A 4H04A 3VM7A 1AH0A 4HCDA 3FA4A 4H9YA 5F4XA 4Y90A 1HXJA 1W56A 2WYSA 4Z0SA 3EPMA 1LJYA 1E0XA 1IF2A 2VEFA 1MZRA 1Z44A 1TREA 1ML1A 4XKYB 2O4QA 1FXPA 3DIPA 4HCHA 5A1AA 5I78A 2XGIA 4PL2A 2PWDA 4UTIA 4RNHA 6CGTA 1D7KA 4A21A 1K9TA 4O0QA 3M0MA 3T2OA 2PLCA 4GABA 4E5TA 3OLDA 3IRDA 4JCLA 3NYZA 2QULA 2F7FA 2ASHA 3QMTA 4C91A 1WX0A 2YX0A 1EGVA 1E6XM 1CENA 3NA8A 4NILA 5D33A 1ONXA 5IOBA 4MMWA 1RCOB 1FWJC 4JFWA 2F84A 1M7JA 3XIMA 1R38A 1PCWA 3QQWA 2I5QA 1M04A 1LLZA 5EFDA 2WNNA 1W1VA 1UIPA 2X1UA 1PIFA 1HUVA 3XINA 3N14A 4XWUA 3GTHA 5G5IA 2CZEA 3PNZA 4W7WA 1J96A 1F3TA 3W1LA 1CLVA 2VKZG 1EJRC 2AOSA 3GNOA 1RSCA 1QXLA 4D1IA 1JAKA 4HZ7A 3MDUA 3AUJA 1XFBA 2CFFA 4ICCX 3KDNA 3FGCB 1DP0A 3CYJA 1GKPA 1TV5A 2PP1A 3W1UA 1MQPA 5D03A 5JH1A 1CGTA 4HU0A 2NW0A 3GRIA 3L0GA 3WD1A 3V0SA 1AJZA 3EOUA 4UWMA 1HJSA 3L5LA 1A5OC 5A6MA 2FH6A 4ZXLA 4U3AA 2WNWA 4ZO7A 2OFJA 3NPXA 1X39A 2ZZ6A 3FYPA 4AHOA 2D20A 3GIQA 1VJSA 3QKZA 1LG1A 4MHBA 5HQLA 3S9ZA 2HV5A 3KCLA 1BLIA 1I9CB 4MUZA 3SSZA 3W2UA 5TD4A 2HJPA 3WH5A 4UR9A 4GZEA 3LBCA 2VEPA 2C6QA 7TAAA 1HJWA 4FNSA 5E6YA 4FEZA 1L6GA 3NDOA 4FXFA 3SJNA 1UG6A 1TPWA 3G3DA 2WVTA 1DJIA 2JALA 3OEXA 4NAFA 1R2RA 4HOWA 3B8VA 2DJLA 1TO3A 3LXBA 3PZTA 2F8QA 5JH2A 4LUYA 4ZSUA 2FFIA 3DOPA 3V5OA 2YDRA 4DWSA 4OZOA 3PFRA 2OKOA 3VGBA 4HA1A 3EX3A 1LBMA 2WCGA 1SFJA 4MZ1A 4A05A 1E56A 5JBDA 2QXWA 5AC4A 2QCDB 4GACA 5LNSA 1UR1A 4OTKA 4TVUA 3I6TA 2FZ9A 2J47A 4J3WA 4H6KA 4HYWA 1H7XA 2J62A 1H4PA 3E49A 1X38A 2AMXA 2D0HA 1M7PA 5BNKA 1IEVA 1J0JA 3UVAA 5IXEA 1QPQA 1GVOA 3V4BA 1WUEA 1JEZA 4Y9MA 2PDNA 2WAGA 1OGSA 1JRCA 1XGEA 4PMOA 4EXAA 3OA5A 1ZENA 4W5UA 1SMAA 1WOAA 3L0NA 2PEVA 2ATMA 1I2OA 1Q6GA 2HBVA 2QT3A 4C7FA 5GJPA 1O68A 2JKEA 1DXIA 3ZVHB 5ECVA 1G5AA 3N2BA 4IP7A 4DPQA 1XQLA 2EGZA 3GHUA 2OYLA 2HNHA 1EJXC 4O0ZA 1QTWA 4UOZA 3FFSA 2QPXA 3FDKA 4ZVJA 3GNPA 3NSXA 1J11A 4O53A 4D2JA 2VTFA 3GG7A 3IK4A 1KFWA 4QSHA 1H2JA 3ZYZA 4JIPA 3WH9A 4AIBA 1PSCA 1IZJA 1R3SA 1TWWA 1DJNA 4O19A 4B2DA 5DANA 2G3IA 1OFPA 4LC6A 3BW3A 2G50A 3BE7A 4OVXA 1FCUA 3MT1A 4NX0A 5G1TA 1LBFA 3L4WA 1UKOA 3LCLA 2QIIA 4ZQRA 4M6UA 3R94A 4KS0A 4AVNA 2FVKA 3A5VA 3RXZA 5SWUA 2OCZA 1Q7MA 2V5CA 1V6YA 3S2MA 3IV8A 2CLIA 3TCEA 1KD0A 2A3CA 1W2PA 4P61A 3T09A 1AZ2A 1FY6A 3Q58A 5D9PA 4QLKA 3C0SA 1M03A 5CSUA 1V79A 1LLWA 5BOOA 5T8GA 5H1WA 1Q6OA 5CBJA 4LUIA 3VIJA 2A7RA 1KRCC 3W00A 4S23A 4UNIA 3OQ8A 2YXOA 3I4EA 4MSSA 4G8TA 3LPOA 1O4UA 3NDZA 3UPWA 1XDLA 2AQVA 3VNMA 4CNSA 4PRTA 2I1OA 1DJQA 2J77A 1C92A 5T26A 4W84A 3GIYA 3UZ5A 2DU2A 3MU7A 1I8JA 1OG0A 4ZOEA 4N0RA 4IZGA 1W5MA 3RPDA 4N02A 2FYMA 3LN3A 1NFGA 3P61A 3WNLA 4CUCA 1E71M 2XG9A 2Y7FA 4NKCA 3UY8A 1OCNA 5CC6A 1TV3A 2CLKA 2O4MA 2D2JA 3EPOA 2V3FA 3S1UA 4PSPA 1GJWA 3CYVA 3OZYA 3LD5A 4HYVA 1UKTA 2GJNA 4JOMA 1AVAA 4LAZA 3HTWA 3B4UA 3KFTA 4RUBA 5AYZA 4EK7A 4PMDA 3L4UA 4FNPA 3ZJKA 3E0WA 1OD0A 4XD6A 1E6NA 4N9DA 1WBJA 5G1YA 4H8NA 3M5XA 3G1RA 5H91A 4KWUA 3ZR6A 3NWRA 3RUBL 3C2OA 3BAKA 5I0DA 3A5FA 3VNYA 4JQAA 3W7QA 3WLLA 4JYFA 4ZMGA 4ZQNA 4EKJA 5A6JA 3F4VA 3IVSA 3PZQA 4ENLA 3E5PA 4M56A 6A3HA 2O0TA 4MZYA 2XIQA 4H9VA 4NY2A 3FGCA 3QQ0A 1ZFJA 2NLYA 3PZNA 1V77A 3QPEA 4KPLA 2CBIA 2VRJA 4JFUA 3ZT6A 4DLFA 3S6DA 1YE6A 1XIDA 1J8VA 1UH3A 2AGTA 2FVMA 2IXVA 3O2LA 3UD6A 2DP3A 2G8ZA 1YKWA 5GNZA 1K4GA 3W1MA 1CXKA 2DDXA 3K4AA 4NRRA 3QR1A 3VD9A 2V0TA 2VEMA 1PUDA 1O5KA 3R11A 2PURA 3AMKA 4LCRA 2ZUTA 2QPUA 4I6KA 1W1PA 4E2BA 4CEXC 2V68A 3I7SA 6XIMA 2TAAA 2ZRVA 3W37A 3R8GA 2QMKA 3WENA 5C9UA 4HNOA 4UTLA 3W73A 4CQAA 3WDHA 3PZGA 2JGQA 5C55A 4PCSA 1F61A 4QBXA 3WBYA 2C18A 4AWEA 1AL8A 4TTUA 1KC7A 4J28A 3AS1A 4INFA 3BQ5A 3PK7A 3EX1A 3DBPA 3GY1A 4DF0A 5A2CA 1M5WA 4WZHA 2H3DA 2G3JA 3CBWA 4X63A 1OVDA 2ISFA 3OGSA 1AW2A 1U22A 3DC8A 1WE5A 3W7IA 3SCTA 1UP0A 1J2BA 1HNYA 1JCJA 1RVKA 3PNUA 3HM7A 1UKQA 1BWLA 3TU9A 1TPDA 3WCZA 1K7FA 2BNJA 3THDA 4YTTA 1KCXA 4FLQA 1S3TC 3LHZA 3U2OA 2QDEA 5D38A 3EZ4A 3DFOA 3G6LA 4H19A 3SGZA 2BVDA 3CHCA 2VOMA 5J5RA 5CSRA 2QV5A 3ARZA 4G1KA 4AXKA 3KS6A 1RQHA 1Q3NA 3KUMA 1JJKA 2DPEA 3PF3A 3K4WA 3ZVHA 2PLKA 1RVGA 4HQVA 2CYGA 4LVDA 2DSWA 4PMUA 3ISIX 1ZY9A 4DEFA 1QPOA 3VDAA 4WHBA 1SO3A 4NASA 2QR6A 4R9XA 4HT3A 5C8BB 2CNCA 4TX9A 3TN5A 4B4HA 3IAPA 1RJQA 2XYLA 5KSWA 1LWIA 2HXTA 2XIIA 3AYVA 2D23A 3LMYA 1JUKA 4QFUA 1QFEA 2WK2A 1CPUA 5EMUA 3F5JA 5IBXC 4NHVA 4Q33A 1L6YA 3BMWA 3W24A 4JKMA 2VM8A 3GXTA 4DXVA 1LWJA 3WFZA 5DCEA 2UY3A 4LEQA 2A85A 1OCJA 3GM8A 2VDIA 1PXGA 2DFAA 2DY3A 2HPIA 3CMFA 3WD0A 1XF0A 1GOIA 3ZWTA 3V1HA 5DXYA 4A3HA 1W3NA 1PL9A 4C1NB 1B3YA 2XJ7A 4Q4RA 3WH8A 2WZTA 2C7FA 4GCAA 3UJ2A 4YYFA 3VZXA 5AYXA 3RCNA 2CLPA 4L1XA 2WNQA 1RQBA 3N6QA 1UWRA 1GEQA 4NJKA 5AC8A 1DIOA 1J01A 3UZYA 4U3CA 1CXIA 3H54A 3S6TA 1KR1A 3M64A 1V8EA 3SFWA 3UZXA 3GXDA 5I3FA 3W6LA 3F4CA 1XLEA 3T0CA 4TMCA 4PULA 5IM51 3TDFA 1E72M 3EA1A 2VCAA 3EWCA 2J9YA 1MEHA 4DRSA 2QV4A 3PPGA 4LVGA 1G4EA 3CMJA 2NUYA 3LGDA 4NZFA 3LHVA 4U33A 3U5UA 4JFVA 1E9ZB 2YLLA 1R3VA 4NZ1A 1VCGA 4JICA 3VDHA 1UR9A 2ZE3A 2OU4A 5FAGA 4AMAA 2JKAA 5BOFA 5MKGB 3CL6A 2QCLA 2VC7A 1GHRA 3ELFA 4LUTB 1KKOA 4ZOCA 3BG5A 1GOOA 3NUKA 5A94A 5H8MA 3B0XA 1T6MA 3UZJA 4D6JA 4O8AA 1R87A 2PDJA 3PZOA 5G2IA 4YTRA 2X09A 3QXBA 3LB0A 5BZAA 1YTDA 2JEQA 2UWFA 3BGJA 3C86A 1F4HA 4BA0A 1AQMA 5H2ZA 4KIEA 2VX4A 1FWRA 4MNLA 3W1XA 4GVGA 4ERGA 2WZIA 3E0FA 2ZFAA 1R5YA 2V6AA 2DSZA 3E02A 3P80A 1TZZA 1K77A 2GVYA 4IP5A 1OF8A 3DDMA 3II1A 4ONVA 3KWSA 1TIMA 3WQ8A 1AQFA 1A50A 4CQDA 4HHHA 1R9YA 1XDMA 4HZ8A 3QGKC 6TAAA 3GBEA 4C6IA 2CC0A 2HBXA 2DZPA 1ZZMA 4WKHA 4GJJA 5FJUA 5A95A 4ADTA 4C5ZA 3ALGA 4OWGA 1DQXA 3WSUA 3HMCA 1P6CA 1IXPA 2GGJA 3ITOA 3W84A 4AEFA 2C1HA 3QTPA 2HCVA 4K37A 4QX4A 1ISWA 2V2HA 2R1MA 3RX3A 4NP7A 3VCNA 1IEXA 3VUSA 4FSAA 1AMYA 2VX5A 1XLKA 1A0CA 3EWYA 5GJNA 2DSVA 4ZR8A 1JIBA 4LOCA 3MI2A 5AKQA 5CGQA 2WANA 3GFZA 3M16A 3CL7A 3IVUA 4B16A 3H2AA 2PRLA 3M6YA 1RA5A 1XIBA 4NF7A 2OZ0A 4WDWA 3MVTA 3UA3A 1ZP3A 4HA4A 3NEHA 4MYXA 1LM1A 4C6NA 4O54A 1V6VA 1WA3A 1OB0A 3SFKA 4LBRA 1DJHA 4AFYA 1XM3A 1DJZA 1IXNA 4M7SA 3LCFA 1CGWA 3MCOA 4Y8EA 5KMYA 3HG3A 3QGVA 1Z32X 2E6AA 4JKKA 4DZHA 1DBTA 1D3GA 5JBFA 3KL0A 4GHRA 2WHJA 1ZAIA 2FVLA 3PAOA 5A8NA 4X60A 3JRKA 2XGZA 1WO2A 5AYYA 4H7VA 4EAMA 1YYAA 1US3A 1HT6A 1UR2A 3TIMA 1IV8A 2PE4A 7PTDA 5I23A 1XLIA 4R7OA 1LTDA 4IQEA 4Y2WA 2PDKA 1DIEA 1ZSXA 1IQ8A 3VC6A 1UMLA 2YL5A 2GSJA 5M3WA 4D8ZA 1CXFA 1E5JA 3ARTA 3G0SA 4JQ1A 1OFOA 4XAPA 1VFTA 1GQKA 3V35A 4EAYA 2Y61A 1XGDA 3K8KA 4C6JA 1UWAA 2DQWA 4AD0A 3TAOA 2D3LA 1E6RA 3UJFA 4J1OA 5I77A 2Y8VA 3L7RA 3UWYA 1LORA 1R3QA 2VFFA 4NZ4A 3D6NA 3NSNA 4L6DA 1SW0A 5M17A 3K1GA 1OFBA 1R7OA 2D2HA 1GONA 1C9DA 3UNTA 3O7UA 3C4UA 5EB8A 2KX9A 4XTDA 3T8QA 4V1YA 3RCMA 3IIPA 1QNVA 4WXZA 5L6UA 3C2EA 1QPKA 4MM1A 1QOPA 3NPWA 3DKJA 1HKWA 3WLKX 2V5JA 4CGTA 4XD4A 3OBKA 2BV9A 3LTSA 4C1NA 4LSBA 3WBAA 3N4EA 3NGJA 1KWGA 3TNOA 3SDOA 1QU4A 1GG0A 4KCUA 3ARRA 2G37A 4DUXA 3SBFA 1X6UA 4A8LA 3C5QA 1SW3A 4JDYA 1TTIA 1HKVA 4HP5A 4TUFA 4KWOA 3TNBA 3AIRA 3G0XA 1JL8A 2J25A 4TO8A 4AF0A 2WC7A 1H3GA 1YXCA 2PWVA 2GL5A 3UEQA 4JXCA 2QDGA 3LK6A 5KTLA 2JE8A 3QH2A 3Q37A 2QCFA 2EQDA 2YBTA 5CZJA 1AW5A 3M0XA 2A3LA 2BDQA 2W3ZA 1ZBKA 2ZUWA 4QLLA 4GIYA 5EMJA 3MUY1 3RK8A 3O16A 2CLHA 1J93A 3PG9A 2BGQA 2EBNA 1PE1A 2OGYA 3MQTA 1XYMA 2VX6A 3PG8A 5C9WA 3W01A 4ZOBA 1U2YA 3UJEA 4JHMA 2C0HA 3UP8A 3IGSA 5I07A 2NXHA 4FNRA 4H2HA 5LIKX 3SUSA 1TPFA 1UWIA 1VRDA 1SJDA 4F40A 4AUBA 2DT2A 4BI5A 2MUCA 4WJEA 4M7TA 3CV2A 5MKGA 3GTIA 3DG3A 2FPTA 4ZZ9A 4CCCA 1FKWA 4Y9PA 4O1CA 3MUXA 1OJXA 4LUTA 1B3VA 4W5ZA 1UD8A 1EOMA 5A6TC 3RM4A 2JK2A 3DYPA 4TMBA 2ZUUA 4TX8A 3PUGA 3OLIA 2BVWA 3SN1A 3WY1A 4GIAA 4J3XA 2Z1BA 4B4FA 1VS1A 3QJAA 1L6SA 1PHQA 4U31A 3TVAA 3VZYA 2ZDSA 1ZALA 4IMCA 3TYEA 4H9XA 3QYSA 3WLMA 1F2JA 5FKYA 1PBGA 2QLYA 4HMDA 1OC5A 4GY1A 3LSBA 4UTKA 2DUZA 3RR4A 4PTXA 1JF5A 1PKNA 3UNDA 3VIIA 3BJFA 3O0KA 4ES4A 1UUMA 2FB3A 1CB7B 3DFNA 1HW6A 2RH9A 2INEA 3C8FA 4S3AA 4DHGA 2GGGA 1GCYA 1VEMA 3MUIA 2CETA 5HNRA 3F2CA 2ZA2A 4IQDA 4YYCA 1AH4A 3T81A 3LY0A 4QG8A 5HPCA 1ITQA 3LCIA 4XZ9A 3UYCA 4DJEA 2FIQA 4WCJA 4K7YA 3ZLHA 1JZ6A 1Z6KA 3UQNA 1C91A 4YMZA 3MSGA 2XFYA 3BJTA 5I7GA 3C0JA 1WPCA 3DBNA 3GDMA 4PSRA 3K4DA 4PMYA 1H11A 5HMEA 4BCEA 3FAXA 4S3KA 5HNUA 4YL2A 3QHOA 4ICNA 4CD5A 2BWGA 2BY3A 5HXMA 3MP3A 2OWXA 1EQPA 2J66A 1QK0A 4N4QA 3WLIA 4Y96A 1FFRA 4LALA 3ARVA 3IJDA 3HQOA 4NZJA 5AC5A 3CJPA 2PDCA 1B5TA 4FZIA 5HNTA 3IS4A 3KZPA 2DZVA 1JCTA 3VC5A 3H70A 1LL4A 1NAL1 4E8GA 1X7IA 4MB5A 2V2DA 4J4KA 1C7TA 1MSSA 2GGEA 4A4AA 3AC0A 4BKNA 3NURA 3UCCA 4Q4OA 2REQB 1U5VA 3O1NA 2HS6A 4ACZA 3GG8A 1AFSA 5CEWA 1EJTC 1A0EA 4F2UA 5D9MA 4Z08A 1S5NA 3SI9A 2XIMA 5C7HA 1V3HA 3CUGA 5LGXA 4GIRA 4C6FA 4ACYA 3JR2A 1QAPA 1HG3A 3L4XA 1XRVA 2J9ZA 5CPTA 2CXEA 2J88A 3PTQA 1IGSA 4OT7A 2C79A 4JTIA 4GUHA 2BOEX 3W3OA 2WC4A 1ZLPA 3PHAA 4MWAB 4ZOAA 1BTCA 3PN8A 1AH3A 1JD9A 4ZQCA 1ZJBA 4JN7A 1PZ3A 3FAWA 1JDCA 5EMKA 3IIZA 2V30A 5AHLA 2QGHA 4EACA 1OQFA 2GOUA 3Q94A 4WY0B 1Y0EA 1I0DA 2Q8XA 2MANA 3BC9A 5D2YA 2BHZA 1ZRQA 2ZZ1A 3T44A 5FIPA 3R7MA 3CQJA 2OR2A 3HG4A 3NVDA 4AZBA 2QUUA 2R82A 3O15A 3LM7A 4AYSA 1JD7A 1EJSC 4MG4A 4RR4A 3NOEA 5ABTA 3NL3A 3HZ3A 1LQ0A 4UQAA 1M6JA 3I3BA 4Q4SA 2ZX6A 3H7RA 4B5UA 2YYUA 1WNOA 1OG6A 4DVOA 2J13A 5I24A 1O7AA 3WD2A 4WIWA 1R3TA 3PAJA 1CB2A 2Y62A 4YXGA 2OTDA 3LDVA 3IAQA 4JTKA 4BEQA 2Z1KA 4RW3A 2WMJA 1ALDA 4B5NA 4OOZA 4C6LA 3STEA 3IARA 4PRRA 3W28A 4AZHA 3FKRA 2XIOA 3OJGA 4I5UA 3KP0A 1UP3A 1XL9A 3LGGA 3LRMA 5DCDA 4D6EA 1TWDA 1GQJA 1DWFM 1MNZA 3BAWA 2FTWA 2B7OA 4LRTA 4TIMA 3K8MA 3MBDA 3I68A 5L9FA 1FWFC 4OECA 4R5EA 1POJA 3FYOA 3GVGA 2WQDA 3MSDA 3SCQA 3ABRA 3S46A 1K70A 3N15A 4IMEA 2DZBA 2PDIA 2GQ3A 1A4MA 4UMCA 3UZZA 3GK0A 4W93A 1SFTA 2YA0A 3RF9A 2XH7A 5LNWA 3QQ1A 2BMBA 3W1RA 3KEHA 4P7LA 3NQFA 3B97A 4MB4A 3GHSA 2BHYA 1UWUA 2F61A 3VMOA 2RFGA 1FHDA 1QO2A 4JTEA 4PUEA 3KBJA 4S3JA 4DBDA 4NNCA 3M07A 4C5YA 2I7GA 1OFQA 2GVLA 4E4UA 4HNLA 3TMQA 1SO5A 3TKFA 1L8PA 1KTNA 1YE4A 4AEEA 4PR4A 4AU0A 4KRTA 1H41A 4C6EA 2ZZ3A 3H4XA 3PUOA 1WZAA 1JNDA 7A3HA 4S3CA 3R25A 5FCZA 5XIAA 2A3AA 2OSXA 1J4EA 4AZGA 4CD4A 1XRFA 5I3IA 5FJTA 4DO5A 3EXTA 2VGIA 2JIEA 3CO8A 3S5ZA 1M01A 1ELSA 3P0WA 3BCDA 3EX2A 1TPEA 1UHVA 1E9LA 3LI1A 3P3BA 4IWWA 1C3FA 4AMCA 4YIWA 3QR3A 5I00A 4DYKA 2X1RA 4PUWA 4NT0A 2W5FA 3IJLA 5DO8A 8RUCA 4RE0A 4P7RA 5AYIA 3GU2A 3GE7A 4I90A 4LCSA 4I8DA 1EHNA 4OOUA 1SZRA 4HPHA 3P0XA 9XIAA 4C90A 3NQEA 3OLGA 3VGGA 2DSKA 1LRTA 4GX9A 4DX3A 2WO5A 1ZP4A 1E9YB 2CHNA 4YHEA 1POKA 4P8WA 2VOTA 4K39A 4F79A 3L4ZA 4H2CA 1CX9A 5CGTA 1SFLA 1M1BA 4QE4A 4H7ZA 1PV8A 4HSOA 2GDVA 1FCQA 1X6NA 1G7UA 5A8OA 4IISA 1OGBA 3MYPA 1QATA 3WYZA 1AODA 3QRHA 3CAKA 4KWSA 4Z42C 3AIEA 3WFLA 2XZ9A 2DUAA 3WLQA 3AOFA 2BVTA 3MUCA 1KXHA 4GZJA 2BOFX 4L65A 4HPJA 1ZJAA 2YBVA 1IXOA 3HQNA 3LCWA 3COTA 1XLGA 1U1JA 3WQEA 1A5LC 3CZEA 3BJSA 3GXMA 3OP2A 3QHMA 4UFKA 1WDPA 3W7KA 1GPFA 4R33A 3WK0A 3PULA 3UGVA 3TEVA 3BARA 5A8PA 1KFCA 4AZ7A 2EJAA 3R0KA 1G0CA 4M19A 3VGFA 4DM2A 3H2MA 1HF6A 2PCQA 1I2RA 1GVFA 2HVOA 1BYBA 2PWUA 4RCXA 3L4VA 1MI3A 1QHZA 1CGXA 3CAWA 2D22A 3RPMA 1OFAA 3BICA 1FBAA 2Z26A 2E6FA 4UFJA 4US5A 4W88A 3BCJA 4ZQMA 3V3WA 2GJPA 2J7CA 1Q63A 1BF2A 4EXBA 3PC0A 4GPNA 1IGWA 3ZSSA 2P76A 5B7YA 1T96A 3VDGA 3NL6A 3PJUA 1AW1A 4MWAA 1ME7A 1RBLA 2E68A 1EDGA 4IGSA 2AAMA 2P5NA 2VMFA 4XSMA 3KTSA 3BAXA 4EPDC 4QLJA 1EF2A 3OOQA 4AB4A 3KVJA 4UQDA 3SQMA 3WUBA 2Q71A 1R6WA 1S5WA 5FF0A 4PFMA 4WY0A 4UC5A 3W23A 1OCQA 5LNUA 3VI2A 3N4AA 1F07A 1YDNA 3UGRA 3EBVA 4C6KA 3OBEA 1WP6A 3BSGA 1GORA 1E1CB 4NYUA 1ZS2A 3FJ6A 4EF8A 3PANA 1QI4A 2H8XA 5B80A 1NF0A 4BK9A 2XZ7A 2V38A 3GD6A 4JX6A 1H63A 4FF7A 1OC6A 4R85A 2VELA 5E0CA 5IRPA 4MWAE 1SGJA 2R1NA 3HIJA 1F05A 4MPKA 5CXPA 4DF1A 5FF7A 3TSMA 1R2TA 1W3LA 5FL0A 1QT1A 3BH4A 2PU1A 1FHVA 4RW5A 2E6YA 2TSYA 3U2ZA 1DYSA 2VYOA 1PEZA 4PB4A 4DB7A 1MNSA 1TPUA 2EPKX 2ZRUA 2ZYFA 4Y6GA 1D8CA 1E40A 1JCXA 3URAA 3GH5A 3NZRA 1WDSA 3DFYA 1UWQA 4GA8A 3U6WA 5K4XA 4ATDA 4OV9A 1HJVA 3SAZA 1TQJA 1VJZA 2WM1A 3Q65A 4FLOA 3W2KA 2W66A 1YNPA 2E5BA 1JI2A 1JDEA 3CHVA 2OX4A 4JL2A 4RDYA 1H7NA 4M51A 4O1FA 4LS1A 5C7VA 3A22A 4ZXOA 2VT0A 2GK1B 1VCVA 2B7QA 3FW6A 2BY0A 2GDQA 4HNVA 5KZDA 4JR5A 4JTAA 4O15A 1A3XA 2P10A 3ZR4A 3PP7A 3SADA 2QJMA 3VOCA 3WLOA 2V67A 1CCWB 5HUPA 5D2VA 4EX4A 4B92A 3BZGA 1DHKA 1BQGA 4K7VA 3UWUA 4ZB0A 1SVDA 2Z1XA 5HDRA 1E0UA 3IUDA 4MDOA 3GKAA 1BD0A 3P6LA 3QV7A 2POTA 4QJ5B 4AY1A 3BWWA 1MXSA 2RAGA 2YPIA 4LC8A 2EKCA 5ABFB 4KWWA 1HFBA 2L5HA 3EMZA 3N73A 4P7QA 3N9KA 1O1ZA 4ILSA 1DJXA 1UR4A 2R91A 1ZHAA 1UOZA 2R9RA 1DJWA 1XBYA 4LNCA 5T9BG 4YU1A 1FWWA 4JNYA 4WX2A 1TPH1 4IQLA 1ZTVA 2PBGA 4ZE4A 3HN3A 2OG9A 5K9CA 4Q8QA 3OYXA 3GDRA 3WUGA 2NWSA 5DY3A 3SIZA 2CZVA 3DESA 1WCGA 4KETA 5U7SA 4GY7A 1GQLA 3TQPA 4M6VA 1K9DA 1HJUA 4GQRA 2QCEA 4QIUA 2H90A 3TYDA 5AC7A 3W72A 3WH6A 1XIGA 4EP8C 2Y4SA 4DAFA 3LXCA 2E09A 3HG2A 4XG1A 3N9RA 2QNEA 1JQVA 3LNPA 1W1A1 2TODA 1OIFA 1KFJA 4PZVA 4UOQA 3LCXA 2WMKA 1S2TA 5REQA 1UZ1A 3L65A 1MRAA 4F48A 3NPUA 3OG2A 4B91A 5FJJA 5H8UA 1MVYA 4NI3A 4FA3A 3IRSA 4GUGA 1E6QM 1X97A 4HPXA 2QEZA 3APGA 4H9TA 1XLCA 4IL2A 4GCXA 1XIEA 3PJWA 3M0ZA 2FB2A 2O92A 1GUVA 3TCSA 5TF0A 1GGOA 2J78A 4KT2A 1OX4B 2GJXB 2NVDA 5BWFA 1NWTA 2IS7A 1FHUA 3WN6A 2D2GA 1J12A 3NOYA 3CUIA 3TTOA 5BXPA 2PCEA 4JD4A 1JG9A 1NOWA 2Q01A 1YEYA 4DNHA 3S6OA 1H0IA 1S5MA 5G4HC 2P8CA 1QNSA 3U3HA 1KM1A 4LS0A 1OBAA 4IF2A 1A80A 3QBUA 2DT3A 2QDHA 2ZUNA 3IJ8A 3U2CA 2PTWA 2SFPA 3WQVA 2C1GA 2BODX 4GH1A 2RGMA 3CIVA 4XZIA 1YADA 3L21A 1YRRA 2VD8A 5DMYA 4B3LA 5H6HA 4DWSC 3S2NA 2DIJA 2FMNA 1SZNA 1XW8A 2GJRA 4OUIA 3DENA 1H49A 4D6FA 1OGGA 1XIMA 4QNEA 2HQAA 1TE6A 3C2YA 2FLIA 3OTRA 4A2SA 1CLKA 4YWSA 2YLAA 4RZ5A 5AZ1A 3WLHA 1PX3A 2YGYA 2FHBA 3CHEA 2EPMX 3V1PA 3DI1A 3AMDA 1KBKA 5A8QA 3NM3A 3H7UA 4K2SA 3K30A 2X05A 1SZEA 4PMZA 1GJPA 2BZNA 4S3GA 1KM4A 5LGZA 1WXYA 3VYLA 3C61A 1RLDA 3G1AA 2YL6A 2E1WA 2ACRA 2ZRWA 1CW2A 5CBIA 1HKJA 1XP3A 3BOLA 1B30A 3M4HA 2VWSA 1TUFA 4EXQA 3AXXA 3E0IA 3H2EA 3V5FA 3P74A 3RX2A 4JN8A 4ML4A 4H1ZA 4AZCA 1DKWA 2P50A 4ADUA 2PDFA 1VFUA 3M1ZA 5LKYA 4IIFA 2CZDA 2BXZA 4B5WA 1UBSA 4RZ4A 1P5BA 2I5GA 3WO8A 1SFSA 1Q4WA 3O3RA 4WSKA 4DWSD 1OT1A 5BYWA 1DTUA 3B0YA 3V5CA 3N2XA 4ZO8A 3KTXA 4LAOA 2ZVIA 1BRLA 4GI9A 3GR8A 2Z6IA 4LUJA 4X9YA 2D24A 3KX6A 4UTJA 3CL8A 4FNTA 4X0VA 2Y63A 2CU0A 3S1XA 2WMHA 2HPMA 5LXXA 4R3UA 4F2BA 5DCBA 2GVJA 1IEIA 1KKRA 4WOZA 3G22A 3NYDA 1G69A 2OWCA 5FESA 3WQWA 5DX7A 1SZFA 4GH3A 5IDIA 1E9IA 2YR1A 5EGRA 2ADAA 4HVXA 3QMRA 4Z0JA 3S2JA 4QP0A 1Q6DA 3LQLA 3VIOA 5C6MA 4ZL1A 4MNJA 3EXRA 3B0VC 1VBJA 1S3HA 3IPWA 3SIMA 4HCLA 4B9YA 1SZGA 1NDVA 4M81A 3N2MA 1O66A 5DMMA 4IG2B 3SN4A 4LT9A 3MV01 1FA2A 3LBMA 1FX6A 4YPJA 5CC7A 3STGA 2VZVA 3IUHA 2EKGA 1NQ6A 4ZB5A 4H3DA 3AO0A 4YS1A 2I9UA 2D73A 1OYBA 1XIIA 3L2IA 1YPIA 4LNYA 1Z48A 3OYZA 1HL2A 3RG6A 1PCKA 3PZ9A 3AUOA 2VR4A 3N1AA 4NI8A 1OADA 4FOJA 1WZKA 1K03A 2OX1A 1X6LA 3JVAA 5HQEA 4O13A 4BY3A 5CLTA 1JZ7A 3ZR5A 2CKRA 4C6CA 2A6LA 1FWNA 4MLRA 5EA9A 2PP0A 1TPVA 1QVBA 3DFTA 3IGUA 3A4XA 3RAOA 1UBPC 1DVJA 2W67A 3TMLA 3TX9A 2PPGA 4EE9A 2QJHA 1UA3A 4D8LA 2GQ8A 4AWUA 4HZ6A 2X30A 1J0ZA 4EF9A 2XINA 4GO9A 3LSCA 2OT0A 2CZ5A 2AKMA 1WDDA 4IFKB 3VIGA 3L9CA 3GFXA 2UV8G 3LXAA 5DEZA 3H4GA 3VDCA 2HZGA 1G4TA 3P60A 3L12A 4BWLC 5D09A 3C0QA 2XHYA 4Y9NA 3UCDA 3RR1A 1VBGA 1XH0A 1OK4A 5E0FA 2PP3A 2VJXA 3B9OA 3IJIA 3BTNA 5JUVA 3GQYA 1XDJA 2YOCA 1GZGA 3ES8A 3TH6A 1B90A 4PMJA 3K46A 4JIQA 2CBJA 2A6NA 3DZ1A 4F0RA 4CCZA 1RY8A 2Y24A 3IJ6A 3AHTA 1DJGA 4GNKB 2VFHA 2WJZA 3BAIA 1W1YA 3CZGA 2NSXA 1K7EA 3RIKA 1LZOA 1E6SM 1FWIC 1XBVA 3IIXA 1NOFA 3WX7A 1W31A 3EXSA 3ONCA 2WHMA 3AZRA 3B0UX 1OFRA 3PWIA 3ZWSA 2F2HA 3GDKA 4ADSA 1LT7A 1Y5WA 3WF0A 5AHIA 3UA4A 3TFCA 1FDYA 1SSDA 2GSEA 3BLLA 4I7UA 1RXOB 4AH7A 2B31A 4JTLA 2PU0A 3EB2A 1P1MA 3LX9A 3MWAA 3RJXA 1MW2A 4JTHA 3CLWA 5CPLA 4R88A 1B57A 2ZX9A 4JY8A 1PZ1A 3OIXA 4IGHA 1AQ0A 4G7FA 4RPPA 2R94A 1IT7A 3V75A 3VKJA 1LOQA 3N6HA 1JR1A 1ZJIA 4EWJA 3EWDA 3WJZA 5CJ5A 1RQEA 3VOHA 4RDVA 4MPQA 2IQ0A 4BQ4A 1AMKA 3PB0A 1KTBA 3NZGA 5TIMA 4F0HA 2FDSA 1UWTA 4CCDA 1PYMA 4QJ1A 3V7PA 1FH9A 4E3TA 4DY1A 2VWTA 1J6OA 4CN1A 1XYAA 3BLFA 3MMTA 2J7HA 1P1XA 1U33A 3N2CA 2ISDA 4M8UA 3B04A 1ZBVA 1DIKA 4O1BA 3LQGA 1KFBA 2F9RA 4IIBA 3F1QA 2X1IA 1NY1A 3VMPA 3CV1A 4YTQA 3SW6A 2VFGA 3B0PA 3M46A 4CQBA 2C8NA 4JPGA 3FA3A 4PA8A 1UYQA 2KAUC 5ABHA 1YPFA 5HMDA 1YBQA 4J3VA 4JN6A 4H8VA 2WBGA 3LM3A 4B5SA 1DJYA 1VGAA 2O7SA 3Q4DA 4AIOA 1JCYA 4PCTA 1DQUA 1JPMA 1TTQA 3TJXA 4HN4A 1P6BA 4D6DA 1RY0A 1KQYA 4W8BA 3VZZA 2INFA 4IMFA 2P0OA 4O14A 5CBBA 4P8VA 3ZS4A 1L0PA 1ZAHA 4L9ZA 4GRSA 3CS2A 4JTSA 1R9XA 1KM3A 4CLMA 3IANA 1W9DM 4BF9A 1RBOB 1GQNA 3A3XA 3WF4A 1JUEA 3KL5A 1RBAA 4N9CA 1UQZA 1XHGA 4E6MA 3B40A 3TZFA 5CAKA 2Y5JA 2ISVA 4CD7A 4XKMA 2E8YA 3W2JA 2WHLA 4MY1A 3M0JA 2OB3A 4H4IA 3SURA 4JCMA 3VK5A 1LRNA 1EF3A 2Z29A 4GVFA 3PBYA 3LI0A 3FOKA 3BSMA 3KAOA 2J7EA 1Z89A 1TQXA 3TJLA 3MO4A 4PTWA 1GOXA 5BMWA 1E0TA 3A9BA 3MJMA 3VGDA 4L4MA 4AD4A 1C29A 1P0DA 4ZGYA 4O28A 4QE1A 4F8XA 4PBFA 3QW4B 4JQ2A 1JPKA 4UFMA 1X1ZA 2FGZA 5E0KA 3Q67A 1TX0A 3CM4A 3L4YA 3GIPA 3NJ3A 4AAJA 4L4LA 1B0IA 3H2CA 1M53A 1A5KC 3D3FA 1D9EA 1GKQA 2RGLA 3N2TA 1KGUA 4UQ9A 3A4AA 3QFWA 4RV8A 3LYEA 4EOUA 1QW9A 4FPSA 2EPNA 2IPGA 3B8WA 2W4XA 4UQEA 3KOZA 5K9XA 4C6PA 4UMAA 5LIWX 4K1WA 2BXYA 5A8MA 3WD4A 4O10A 5DELA 1EB3A 3WF3A 7ODCA 1FWAC 1CXEA 1TR1A 3HPZA 4S3BA 2IXUA 5HINA 3HJZA 3NFUA 4YN5A 2YL9A 3WQ5A 3D3AA 3BV7A 3ZLGA 4NQ1A 3G5EA 3L5AA 3SCOA 3WQPA 1F8MA 2OEKA 2YIHA 5D8ZA 1UKPA 1V93A 3A4WA 3NQ8A 4QJ4B 1XKYA 3O06A 3DN5A 2QW5A 3CUZA 4ZCWA 3POCA 2EPOA 3TYAA 4ORMA 4REQB 2BLEA 5FJRA 3HQ1A 3CLMA 3ITLA 4QHRA 2YDSA 3KW3A 2BTMA 1OINA 3HJEA 2ON3A 4NZ3A 2DZSA 4A3YA 4UNKA 5HWMA 3DEQA 3W76A 2TRSA 3M0IA 3T8LA 4DJFA 3MP5A 1KGWA 8TIMA 2BASA 3E1F1 5F7UA 3OZOA 3R10A 2F2KA 1ADOA 1XLMA 3P2VA 1KCKA 2J8TA 4H00A 3SCPA 2WJDA 4OBRA 4PCFA 2VEGA 3QV9A 2DZWA 3MUZ1 1I2PA 3T07A 5FOOA 1BAGA 3AAMA 5E09A 3SCUA 3DFHA 4Q4QA 3BGGA 2V69A 4JKLA 2WZEA 3WLSA 5DT7A 4N4PA 4E2DA 3LUTA 4GZIA 2PDYA 4YVXA 1O12A 4NAEA 5BRQA 5LSMA 2CITA 1BFNA 1RD5A 4ZENA 1YNQA 4CN6A 3AYSA 3OBAA 1V7AA 3O07A 4RJEA 3APTA 2YCEA 5CAHA 1VC4A 2OXNA 1FQ0A 3CQHA 5C2GA 3SCWA 4QITA 1TIWA 2W91A 2HWGA 5AZ0A 1ICSA 2FZNA 3MO7A 1QMLA 4D1JA 3MZ2A 3HGOA 1O5XA 3A23A 3SY1A 3M5VA 3PZMA 2GSHA 3VIFA 5JXQA 4HK7A 2H9AB 2XH0A 3DGBA 3QSRA 4K36A 1Q45A 4XZNX 3V18A 4GQGA 4LS2A 5ENLA 3QZAA 5KEZA 1KQZA 2G96A 3EKGA 3GZAA 2W92A 4E0CA 1YNYA 3SY5A 1JDDA 3AIBA 3LENA 2HEJA 2YFNA 4YVVA 1F9CA 3WBWA 3EB3A 1MUWA 4Q6XA 1DHPA 5E9AA 4XZLX 1JDAA 1BYAA 2XPKA 1UW9A 4NUWA 4WD0A 3FHAA 3JZEA 4M6PA 4XO7A 3VOFA 3K8LA 5CG7A 2YFOA 2VFEA 1X96A 2A7NA 1VB9A 2VEKA 2AL2B 1GVYA 1K8ZA 1TJ2A 3RO8A 3HGSA 1P43A 1XCWA 1JDFA 4J2MA 1EYEA 4HMEA 3WQDA 4E3VA 1K8YA 2E7FA 3O6YX 3OZMA 3EYPA 2O9RA 3REQA 1XCFA 2NUWA 3WMBA 1S1RA 1TRIA 1XYFA 2F6KA 1JZ3A 3MHUA 3WNOA 4TU1A 2C14A 2XFRA 3NZPA 3LNMA 1D7FA 2VENA 1JZ2A 5I3KA 4QSFA 2YB1A 4MLJA 4WOQA 4GBDA 4F0KA 1KLZA 4KBXA 1ITUA 2H3BA 1GG1A 1AJ2A 4H7CA 1PIIA 4JX4A 1J0IA 3W2MA 4A8IA 1T8QA 3IIVA 1J79A 4UTWA 3VU2A 5A6KA 1MW1A 1LBLA 3DHPA 1N82A 4GC3A 1M9HA 1DE5A 1NP2A 2WSRA 1V3JA 3GH7A 5D02A 3S42A 3RDKA 1TV8A 1EA9C 4WQ6A 2NQJA 4IJRA 3CUJA 5FI8A 3WNPA 3E2QA 4K8EA 1LOSA 1KBBA 1FWEC 3U57A 4DBUA 1Q6LA 3MMDA 4L6OA 2CXGA 3NG3A 2WWDA 1HL9A 2WCAA 2DIKA 2GPTA 5LHEA 4MB1A 1U5JA 2WQPA 1XGZA 3P81A 2ZVRA 3THUA 1W32A 1HTIA 2UZ9A 3VE9A 2NXGA 4HPNA 2G3MA 1P0EA 1O60A 1IHIA 3AWOA 2ZRZA 4Z2IA 1ZBWA 1KCZA 3WEOA 5C70A 4DYJA 2OSYA 1US2A 1TZ9A 1MO0A 3K1DA 4LVAA 1JCLA 3ICJA 3OVPA 1J0HA 4JFTA 4AIEA 2A3EA 1A49A 1XLDA 3L2LA 1VQTA 1ZBCA 3OO2A 4C60A 5HUOA 1ADDA 3CQ0A 2FDMA 4F3HA 3OLEA 2GVEA 3GAKA 1E0VA 3VABA 2O9PA 1R85A 1KB3A 4MVAA 3TQVA 3VNDA 4JHOA 1F3WA 2IKJA 4XVEA 1JFXA 3CEPA 5TNVA 3BSHA 2X7WA 4QCEA 1WB0A 4AHPA 4MFDA 2VFIA 1G4SA 1WBHA 3BAJA 3N25A 2IPJA 2KZHA 3WKZA 3PFMA 3WBXA 1NVMA 3E5BA 1CYGA 1A5NC 4REQA 3YPIA 4QDMA 5DN1A 2ODOA 3GU9A 4KRUA 1Q5MA 5G2WA 4RE4A 4YNGA 4X0NA 2NLIA 1JXKA 1E4NA 4J5NA 1KV5A 1QDSA 4I9TA 4Z1YA 3QC3A 3DG6A 4UCFA 3UZWA 5AECA 3TZNA 3FIGA 2ZUSA 3KBSA 1NOUA 1CNVA 2R24A 2INZA 2G3FA 3EOSA 2XH2A 2GDUA 2G5WA 1BG9A 1IWAA 1S2VA 1B4KA 1XH2A 3QGAC 3CUXA 3CPGA 5AN7A 3SJ3A 1XG4A 2Z2BA 4XVDA 4OGZA 3BMXA 1GW9A 2PGEA 4J35A 5GVJA 2HROA 3WNNA 1UC4A 4ATLA 3C3UA 3NL5A 3GB6A 3PVFA 3MANA 4HA3A 3ABXA 1HVQA 4U10A 4OIFA 1TVNA 2OO6A 4M6QA 5K7JA 3GAYA 5IFPA 5AHFA 3N34A 4CEUC 3LHTA 1ME8A 2JKPA 2ISSA 3VFLA 2B0MA 3LCGA 3SCRA 2A2IA 4S3EA 4E4PA 3CXOA 1A5BA 1RUSA 3E2SA 3W02A 3VIKA 1F6PA 3GW0A 4AZ5A 4XKYA 2H9AA 4IUGA 1W17A 2E77A 2FTYA 1B3ZA 3DG7A 5AVNA 4HJFA 1UR0A 2NQZA 1S2CA 4Z2GA 2DW6A 3W71A 1R30A 3L23A 4GQBA 3CHDA 3W07A 3DHFA 4U5IA 2V9DA 3OU8A 1OFDA 1J10A 1GTEA 4EVZA 4RV3A 1Q2RA 1PWMA 2VL4A 2GVGA 4NU7A 2XWDA 1PVNA 4CN4A 2DZXA 3VOIA 1JGIA 6PTDA 3IUIA 3SB0A 2VRQA 4X2PA 4S38A 2ZX8A 2VUYA 5AHEA 1PIGA 3E96A 3H53A 3S1GA 4FOUA 3GO2A 1B3WA 1WOBA 3RITA 4K38A 5U4NA 3FYYA 3W7EA 1C8XA 1DV7A 1OCBA 2Z28A 4JFSA 4ZQPA 4NVTA 3U8GA 1K8XA 1ICPA 1GPWA 2OLAA 4GISA 2AAAA 4PN2A 2VDHA 3ENLA 4NRSA 2GUUA 2VQTA 2Y85A 4JIIX 4GINA 3BG9A 4GQQA 3GC2A 3MW7A 2BGSA 5C9XA 3R58A 3AHVA 3EWUA 4FALA 5JMUA 3UR7A 4KF1A 3LZ5A 3O05A 4RXFA 5T91A 2FGLA 2CERA 1E6PA 4NJHA 4UQBA 2VFDA 1WDRA 3IWPA 3WLJA 3UG5A 2WKLA 1OEPA 4L5ZA 5J5DA 5BW6A 1OZQA 1XSKA 2X0SA 3RRXA 1DIDA 3V36A 1NWSA 5AY7A 1VCFA 3S5NA 2ZWZA 3LPPA 4PB3A 3JU2A 1ADSA 1LLOA 3AZSA 2BFGA 4GXPA 1KNWA 3GDTA 4C6MA 2NQLA 2WM0A 4LFYA 3CQKA 5JIPA 4O18A 2VR5A 2D1ZA 1E0WA 3EDFA 5I3JA 3GR4A 4I3GA 4Q8VA 1SJAA 2PC8A 4LBSA 1DEDA 4EANA 1V3MA 1XISA 4H41A 1H1ZA 3P62A 1Z9AA 3OB8A 1CIUA 3ITYA 1XYBA 2PBOA 1QPRA 4Z17A 2DVXA 3JW7A 2A79A 2Z7KA 1GVQA 3NPVA 3I6RA 3RLHA 1K9EA 3W86A 3N12A 3OHMB 1JXJA 1TPB1 4PUKA 2BOGX 4PC8A 3CUFA 4N42A 3CIWA 3RNDA 1EGZA 1PWLA 1OYCA 3PPHA 4LB3A 1BSLA 4UZUA 1E70M 3IVTA 1XRTA 4GC4A 4AWTA 2DQXA 4NIRA 4GJ1A 1FHLA 1I45A 3R0UA 3HBLA 3BOXA 1P0BA 1U1HA 2E9MA 4Y7EA 4ERIA 4M1RA 4MDPA 2QCDA 4RE3A 4J3SA 3WF2A 1UZHA 5K3VA 3S9YA 3DCPA 1S2AA 4CD8A 4PE8A 3GXNA 2DORA 1XXXA 3ABZA 4QGCA 2Q3OA 3W25A 4UR7A 2C91A 4ROPA 1ZNNA 3HFYA 3HPSA 2Y1HA 3ZT7A 1KM2A 1JI1A 4HHLA 2Z00A 3WNKA 3QPYA 3L67A 2P1FA 3TXVA 3IEBA 2PLJA 1P48A 3CHFA 1H1YA 4WJXA 2X16A 6TIMA 2Y7EA 4LVFA 1XI3A 3V0TA 3USZA 4I9AA 2OVLA 4LANA 3NCOA 3O6CA 2PWHA 1CZ1A 4W8AA 1YTKA 3BG3A 2Z6JA 4DYEA 4HHPA 3HF3A 2V82A 3WDIA 3AI0A 2QAFA 3UBPC 4AG0A 4D6CA 2HS8A 3TN3A 1EP1A 5JIWA 4RKAA 1D3CA 1N55A 3B9NA 4HU4A 2OT1A 1Y5VA 2VI0A 3WFAA 1H51A 3FK4A 5M03A 3W22A 3UR2A 1RD6A 3TR9A 3PB2A 1Q6EA 3ANVA 4WRHA 1L6WA 1MQRA 4HD5A 4AZIA 3MVIA 4IJCA 1VJIA 1VYPX 4F0SA 3DXIA 4CNTA 1DQWA 1VFMA 5LIUX 3BGAA 1ECQA 3G1XA 3QMSA 3QZ6A 4MZ8A 1ZPTA 5BMXA 1O5QA 3FHQA 2BBFA 1M41A 5D8WA 2QJGA 3P5ZA 2VVSA 4MADA 4L9YA 4FHAA 5F1UA 4OUEA 1VFLA 3KBVA 1FH7A 2EG7A 3EWWA 3QYQA 3H23A 1N7KA 2CWNA 3N04A 4TVDA 3NXLA 4Q8NA 1NWUA 4LY4A 3T0DA 2C1IA 3UU0A 2Y88A 4E8DA 2X8RA 4MY9A 4B5TA 1HJXA 1SJBA 5HQMA 4ZFCA 1W0MA 3UXLA 3AMLA 4R34A 4B9ZA 2GGIA 4BQ5A 2Z1VA 1XLLA 4K68A 4DO6A 1UR3M 4RNFA 2H6RA 4H9MA 2JQXA 5FL1A 3NR0A 1MYRA 3KOWA 3R8RA 1JZ4A 2NVCA 4QE5A 4GYFA 1BYDA 1CGVA 2CBVA 1O5RA 1Z42A 7REQB 5E1QA 4PMRA 1FVPA 1ITCA 1HN1A 5HWJA 3CO4A 1B9ZA 2E25A 4Z1DA 4Q32A 1H0GA 3TC6A 4HNTA 2J7GA 1JGMA 1V6UA 1P4CA 1UH2A 1CI1A 4MYAA 4AY7A 3TN4A 3VNZA 3VD4A 5CPSA 4CNUA 1UR8A 4E2VA 4L61A 3DFQA 2JBMA 1Q8AA 3WMCA 4GYKA 2ONEA 1ISYA 4KGJA 4AD2A 4PL1A 3VX1A 2J27A 5AFDA 1XG3A 2Y6ZA 3H22A 4GX8A 4F2TA 1BHGA 4HN8A 4N9BA 4ZFMA 1EO5A 4PFHA 2NX9A 3SRDA 3ANUA 3CB3A 1O95A 1GK8A 3AU2A 2PGRA 1XSJA 3GYEA 3QY6A 1AA1B 3C0LA 3FXYA 2NZLA 3GH4A 4FS9A 2BP1A 4H01A 5HULA 1LYXA 2X0HA 4XIMA 2OQLA 1OHLA 2ZIDA 3SGUA 3TP4A 5BROA 4CVUA 4LW7A 3T08A 1B4EA 4NXSA 1WKFA 1VHCA 5E5CA 4YLWA 4DPPA 2BVYA 3E2RA 2WSKA 4IUOA 4O52A 1W1TA 3HV8A 5GJMA 1Q6FA 5C2XA 1GVSA 5G1MA 2X41A 4GVHA 2ACSA 4QROA 1DL3A 4OBSA 1HO1A 3S3GA 4GI8A 2YZRA 2AMGA 1QPNA 3R5EA 2ATSA 3QOKA 2WV8A 1AJ0A 3RLUA 2FMOA 5FSEC 5FJIA 1CECA 2EF9A 3NQ7A 2ABAA 1BKSA 1UOKA 1EJ7L 3M7SA 4G56A 3ZO9A 4DO4A 2ISWA 3VTRA 1UUOA 3WQCA 4O50A 1JPDX 5KZMA 2ZXQA 3O9NA 3GW3A 1ONEA 1EDTA 1B9BA 3NQGA 2IUZA 3ID7A 1GQIA 4U2YA 3E9AA 4Q4MA 2V63A 4NAFB 3KOXA 1E51A 1N2VA 1OC7A 3TYZA 2NQHA