2Z7GA

Crystal structure of adenosine deaminase ligated with ehna
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title Conformational change of adenosine deaminase during ligand-exchange in a crystal
pubmed doi rcsb
molecule tags Hydrolase
total genus 142
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2z7gA00
3MKVA 4BY3A 3URQA 2EG8A 2WJDA 2VC5A 2R1NA 1RK6A 5AKQA 3EWDA 4ZSTA 2HNHA 3EGJA 3AU6A 1A4LA 3NURA 4B3ZA 4KIRA 1FWDC 1V51A 4C6IA 3QY8A 3O0FA 2VHLA 4CNSA 2P53A 1GKQA 5FSEC 2ADAA 4H00A 4EPKA 4ERIA 4DI8A 1XWYA 2GZXA 2VC7A 4CEXC 4GX9A 1BF6A 1RJRA 4GC3A 2RAGA 4H9TA 2R1KA 3GTHA 4ERAA 3LNPA 3OODA 3HM7A 4LCRA 3D6NA 3GG7A 4C5YA 1HZYA 1M65A 3OJGA 2BB0A 4XAGA 2OOFA 4LCSA 1S3TC 4C60A 4IFRA 2A3LA 4I6VA 2ICSA 4C6DA 3PBMA 4LAMA 4AC7C 2UZ9A 3G77A 4HK5A 1FWIC 1FWBC 4IG2B 3UBPC 1FWJC 4H9XA 1V79A 4QS5A 4H9VA 1JGMA 3GTXA 3TN4A 4XD6A 4DZHA 1FKWA 4PBFA 4J35A 4WGXA 1YRRA 4H9MA 3GRIA 4IQJA 1YMYA 2FTWA 3KM8A 2F6KA 1PTAA 2DVXA 4V1YA 2WM1A 1R9XA 4KQNA 4RDZA 4LAOA 1EJWC 1FKXA 1DPMA 2D2GA 4KF1A 3IGHX 4EP8C 4PCPA 2GOKA 2QVNA 3B0XA 4EPDC 1K1DA 4PBEA 2HPIA 4QSFA 3K2GA 4DNMA 2HPMA 4DYKA 3F4CA 2UBPC 2Z27A 2OGJA 3MDWA 2Y1HA 1XRTA 4KESA 4LH8A 1FWAC 3F2BA 3V7PA 3TN3A 1I0DA 1P6CA 2QS8A 3T81A 2O4QA 2KAUC 2FTYA 2YZ5A 2Z7GA 3QGAC 1KRMA 4C6PA 4EPBC 4DLFA 4J2MA 3S2NA 1POJA 3OOQA 1UIPA 4G2DA 4EPEC 3RCMA 1J79A 2IMRA 4CQCA 3GTIA 2Z4GA 1YNYA 4LAKA 3MTWA 3PAOA 4QRNA 4GZ7A 3GIQA 1VFLA 4LANA 3SFWA 4GYFA 3OU8A 3WMLA 2I9UA 2W9MA 3ID7A 1PB0A 4LALA 1ADDA 3JZEA 4C6MA 4XAFA 4DO7A 1YIXA 3AU2A 4KEUA 3E38A 3CS2A 2O4MA 1RK5A 1EJVC 1EJSC 3O7UA 4UBPC 1UIOA 5LXXA 1POKA 1P6BA 3E0FA 4XAYA 2Z00A 4L6DA 2P50A 3MVIA 1FWGC 4GK8A 4GY7A 4CNTA 1QW7A 2DVUA 1O5RA 3F4DA 4C6EA 1RA5A 4C6NA 3NQBA 2VR2A 3QGKC 3LY0A 4LCQA 4HJWA 4C5ZA 4D8LA 4BJHA 4C6QA 4C6FA 2PUZA 3RN6A 4CQDA 4XD5A 1PSCA 4IGMA 2PLMA 2FVKA 1EJXC 4INFA 4B90A 3IV8A 4PE8A 1E9ZB 3F2DA 4ERGA 3ORWA 3UR2A 3IARA 4C6KA 4G7EB 1RJPA 3ISIX 3C86A 3IRSA 4J5NA 3TNBA 3N2CA 1EJRC 1UMLA 3E0LA 4XAZA 1NFGA 4RDVA 2XIOA 3B40A 1NDWA 3MPGA 5A6TC 3OVGA 4IH3A 1V7AA 4LEFA 4RDWA 3UF9A 2Z24A 4LFYA 2GWNA 3LU2A 1KRCC 4GBDA 3S2MA 4IFKB 4CNUA 4C65A 2PAJA 2Z26A 1GKRA 1R9YA 3GU1A 4F0SA 1W1IE 2AMXA 4F0LA 4IF2A 1RAKA 4HK7A 2R1MA 1A5OC 3LGGA 4DI9A 2D2HA 4NP7A 3MSRA 1P1MA 4P5UA 4HA0A 1QXLA 2G3FA 1IE7C 2R1PA 1EF2A 4G7EA 4GOAA 1RJQA 4IG2A 4C6BA 4Z42C 3B0YA 1I0BA 4BKNA 2VM8A 1A5MC 3DC8A 4DLMA 2FFIA 1ITUA 2I5GA 3E2VA 2AQOA 3A3WA 4R7WA 2GSEA 4KERA 4OFCA 5E5CA 1EYWA 4QS6A 2EG7A 2QT3A 4GX8A 4RE0A 1GKPA 5CH9A 3A3XA 4IFKA 3SO7A 4QROA 1RA0A 4IGNA 3BE7A 3AUOA 1XGEA 4IFOA 4NG3A 3RYSA 3FDGA 2ZC1A 3LSCA 5HMDA 3IPWA 1ONWA 2E1WA 4DZIA 3LA4A 3GUWA 2WJEA 1O12A 4MUPA 1K70A 1V77A 5FSDC 1EZ2A 1EJUC 3A4JA 2D2JA 4KEVA 1EJTC 1NDYA 3ITCA 3WYZA 1ZZMA 4B92A 2DVTA 3LSBA 4UB9A 2QPXA 3URBA 4B91A 2OB3A 2Q09A 1YBQB 4NI8A 1XRFA 3URNA 4XD4A 2Z2AA 1J6OA 4KETA 2Z29A 3S2LA 4CQBA 4QTGA 4R85A 5G4HC 3CAKA 3NEHA 4KEZA 4HK6A 3F2CA 4C6JA 3UPMA 4M51A 4DIAA 2Z28A 2Z2BA 1WXZA 1PO9A 1ITQA 4I6KA 2FVMA 3S4TA 2YXOA 3MVTA 5HMEA 2AQVA 3E74A 4ICMA 3URAA 4GY1A 1A5NC 1WXYA 3MJMA 2R1LA 3UR5A 3ICJA 4V1XA 3IJ6A 2VUNA 1K6WA 2PGRA 3TN6A 3K4WA 4YIWA 3GIPA 4R88A 1YBQA 4L9XA 3TN5A 3FEQA 2HBVA 2ANUA 2YB4A 3GTFA 4H9ZA 1UBPC 2EG6A 4RZBA 2HBXA 5HMFA 1KCXA 3K5XA 4WVXA 3QY7A 3EWCA 2HQAA 1A5LC 4XD3A 2YB1A 3OQEA 3DUGA 4AQLA 1KRBC 3GU9A 2E25A 4C6OA 1M68A 1FWEC 3CJPA 1E9YB 4GXWA 3DCPA 1FWCC 4H9UA 2OODA 1J5SA 2OQLA 3WZ0E 4WHBA 3GU2A 3RHGA 3T1GA 3LS9A 2Q01A 1KRAC 1NDZA 2GWGA 3E3HA 3IACA 3PANA 4RDYA 2Z25A 1FWHC 1R9ZA 3LGDA 1J6PA 4E3TA 1V4YA 3R0DA 3FDKA 4ZSUA 4JOMA 1A4MA 1ONXA 2PGFA 4C6CA 4GY0A 3MDUA 1M7JA 3HTWA 4CEUC 3QY6A 4TQTA 2WJFA 3T8LA 4H01A 3HPAA 3PNZA 4C6LA 4PCNA 1FWFC 1A5KC 3PNUA 1NDVA 2BGNE 3S2JA 4F0RA 2CZVA 4H9YA
chains in the Genus database with same CATH superfamily
2WNWA 3W1AA 3G24A 3BV7A 2IXUA 5HJLA 1TCDA 3T9PA 3T7VA 1VP5A 5DCEA 3ONCA 3EOLA 3R4IA 5TAOA 4GFSA 3GBEA 3W53A 3ZFHA 2HXTA 3WK1A 1JPKA 4RUBA 4EAMA 5JBEA 3V16A 3CPGA 4E8GA 1VH7A 3C0LA 2FB2A 2ZX9A 4ACZA 1TG7A 1DHPA 1OD8A 4FLSA 1YHTA 3D6NA 4XWUA 4A29A 3AZRA 3CQ0A 4MJZA 4DN1A 4QCFA 1AQFA 2A3LA 1A47A 1Z44A 2G5WA 3SADA 3MSYA 3NSMA 4AX7A 5G1YA 5C55A 2YA0A 3KOWA 3UZWA 3KOZA 3CTTA 3MHGA 1M41A 3LMZA 1J10A 4IP4A 4I8DA 1VFMA 1N8FA 4UNLA 2GGHA 4NXSA 2WSKA 3VU2A 1ZENA 1LWIA 3K8KA 1L6GA 5JMUA 2PDLA 3W2JA 3DHUA 1GOKA 3XIMA 1DQUA 1CEOA 2GQAA 2QW5A 1KLYA 1K1DA 2PB1A 4QSFA 4MB3A 1JCTA 2V67A 4PUEA 3F4CA 2V38A 2KZHA 2QCDB 1R3VA 1JR1A 1NEYA 2OLAA 5I03A 4IXXA 3OYZA 1R5YA 3W38A 4MLRA 4W87A 1JXJA 1UHVA 4YMZA 2XM2A 1H7NA 3QR3A 3MMUA 4J3XA 1NF0A 1C8VA 2ZWYA 1YLVA 5FACA 2H3BA 3KW3A 1XLKA 3FGCA 2VVNA 1FX6A 1W56A 3V0TA 2GPTA 5BW6A 3FY1A 3H6OA 2I9UA 3KTXA 2F6UA 4LALA 4XAFA 3OO2A 3UGVA 1UOZA 1OFDA 3NOEA 4JNMA 1TQJA 3SUUA 2VRQA 4QDPA 3N4FA 3ITVA 5DLCA 1FVPA 1FHLA 2YL5A 4P7OA 2BBFA 2J7EA 1BWVA 4PN2A 3WQDA 1XIEA 4A35A 3HB9A 3QTPA 4JTLA 5EB8A 2PU1A 4JY9A 4YCPA 4O16A 2UV8G 3W87A 1GVOA 1PTDA 4E38A 3QR0A 5I3JA 4MAZA 4G7EB 3W22A 4AXKA 3L5MA 3KVMA 1FY6A 3PPGA 3LG3A 5ABFA 4MJ4A 4PCTA 3SRFA 4XAZA 1NFGA 1H0GA 1LL4A 3IVTA 4D2JA 4Q8TA 1DJNA 5E0CA 4MTVA 2O56A 3T07A 3B9OA 3R13A 1OFQA 2PI6A 2NUYA 4GIAA 5U7SA 3HQNA 2QIIA 3WJWA 4AYSA 3BC9A 3LMYA 4BI7A 5CZKA 3A47A 5BYWA 2D2HA 1XC6A 3LLDA 1L6FA 5TBOA 1BVZA 2R1PA 4D8AA 1XBYA 5HULA 4I9TA 2VM8A 3AMGA 5G2WA 1K8YA 1UD8A 4QSHA 1EYWA 1LQ0A 2J6XA 4PA8A 1QOQA 1W5NA 3A3XA 4QROA 5F2MA 4HHMA 3FDGA 2ZC1A 5HMDA 4ZCWA 1IYXA 1AMKA 3MZ2A 4IM4A 4B5UA 2ZUNA 3AIRA 2V3GA 1GQKA 3QRHA 3VNJA 5FD0A 2XFYA 2ZDRA 1IXQA 3H2MA 4W5UA 2WQDA 3U57A 4JZ5A 4DF1A 2DVTA 3LSBA 1TIMA 1EQCA 4LS0A 3NQCA 2GL5A 2E09A 4P7QA 3NPXA 3T2OA 1RQHA 4TX8A 1YBQB 4QE1A 3W28A 1DXIA 3DFQA 1AL7A 1XG3A 2JGQA 2F2KA 2H6RA 2Z29A 1S46A 4DWSB 2IQ0A 4NF7A 4EWJA 2GUUA 3EA1A 5CC3A 2VZSA 1KFJA 4H4IA 4DIAA 2Z28A 3SCUA 1JDAA 1C9WA 1VEOA 4DRSA 1QBAA 1G01A 1T0OA 3QQ0A 2WC4A 1VGAA 4AY1A 4D6HA 3C0QA 4U3CA 3TQKA 1YTDA 3T44A 4O19A 8RUCA 4L1WA 2B7OA 1YPIA 3KL5A 3SN1A 2J9YA 3PBVA 2B4GA 2XYLA 1F4AA 1XH2A 1VJIA 5CSYA 3F5KA 3HURA 2WK2A 1OC7A 3KRZA 5L6UA 4KCWA 3N17A 4AQLA 3SSJA 1S1RA 2V3EA 4FOJA 4BF9A 1GNXA 1W1A1 1PV8A 4HOXA 1QPQA 2DV0A 1QCWA 4GXWA 4IPNB 1S39A 4MIMA 3UWVA 6TIMA 1XH1A 1NDZA 2SFPA 1YXDA 3HO8A 4RDYA 2W6RA 3H7RA 1PIGA 2GDUA 5KTLA 3GXDA 3IVUA 3POCA 2EPMX 3ABZA 1T96A 1A4MA 1ONXA 1TRIA 2V8ZA 4PCFA 3FXYA 3S9ZA 3EWUA 4O13A 4GJJA 1QI0A 1H5VA 4HU0A 3T8LA 4R7JA 3M0ZA 5B7ZA 1Q65A 5HINA 4M29A 2BHZA 4GYPC 4JDBA 2TRSA 3CAVA 5HA7A 2VQUA 2NXHA 4TXEA 2J6VA 1W5OA 2CW6A 4QJ4B 3ELFA 1PE1A 4TTGA 3A9IA 5DFAA 4LJ3A 3WJSA 1BVWA 2BWGA 4DI8A 1I60A 1H1YA 3E1F1 5GNZA 2RAGA 2QLYA 3ZMRA 3MCOA 1OYBA 5J5RA 3WH5A 4LTSA 3OODA 3HM7A 3TJ4A 3GZ3A 2ESCA 3MV01 3SGUA 3NA8A 3UXLA 3W4RA 2EXOA 1SZEA 3G1FA 2E67A 3GXNA 1AQMA 1SMAA 3LHYA 4H9XA 3UXAA 4IIGA 4GZIA 3LZ5A 1JNDA 1US2A 3TN4A 1E1CA 3VILA 1HJSA 1ISVA 1KV8A 3KM8A 3GAYA 4FO4A 3TYEA 1NFBA 4RDZA 1MQPA 2Y5SA 3ME3A 1V0MA 3AHVA 1FKXA 1CZ1A 3QKZA 1LOSA 4MB5A 1KW1A 3GKFA 3GNRA 4WKFA 4QJ5B 3GR7A 3AYVA 2QXWA 3WDPP 5LSMA 5E93A 3GK0A 3QQWA 3UA3A 1Y0EA 4GH1A 3II1A 4GKTA 3BLKA 4ZOEA 2J75A 3S1UA 2C16A 2POZA 2GJLA 3GYEA 3ZOAA 3B03A 5L9FA 5AC5A 4GWEA 4ZO6A 4C6PA 1QK0A 3RX3A 2XFFA 2I9EA 1TREA 1N2VA 2XTKA 4GYPA 2BODX 4MNMA 2ZRVA 1EYEA 3SJNA 1KKOA 1K8ZA 1H61A 4IJBA 3F5LA 4IPPA 4AH7A 1XD1A 3H2AA 1LRTA 4U5KA 2QCGA 3TYAA 4IMFA 5CC7A 1GZ1A 1RK5A 4UBPC 3WMBA 1POKA 2E40A 3G1AA 5A2CA 3CIWA 4MHBA 4F8XA 2XN2A 1IXPA 4CNTA 2DVUA 4NI3A 4W5ZA 3F4DA 2YGYA 5BNKA 4JPGA 3IIXA 3QGKC 4MKSA 1JEZA 2R94A 2X40A 3TAKA 1EO7A 1UA7A 4YU1A 4NUWA 2I7GA 4IIEA 3N4EA 1W6TA 4DBUA 3ZWTA 4BFAA 4B90A 1TCMA 1V6UA 1RBAA 5K2ZA 4Y9NA 1EC9A 4QHRA 5HWNA 1R2TA 2E9BA 3AS3A 3IRSA 3VFLA 4A8RA 2XIOA 3IUIA 8XIMA 4AU0A 4V33A 4LEFA 4KGLA 3CV2A 3O6YX 2GQ8A 1ZBVA 4QFUA 5C6MA 2QHAA 1KM2A 3OZYA 5REQB 3SQLA 1EWDA 3LPOA 3GXIA 1HKJA 4JTTA 3G1HA 1ADOA 3GHUA 1OY0A 2C79A 4G7EA 3UP8A 1EX1A 4FX8A 4JYEA 4L5ZA 2YSWA 4QJ1A 3WD2A 4H04A 1LORA 1KNWA 3P14A 3SFKA 2I5GA 3G18A 3SN0A 2PE4A 4IPJA 3FS2A 4NZCA 4CQ9A 3WNLA 1UC5A 5F4XA 2DJLA 4DJDD 3S9IA 3AIEA 3SEPA 4PZVA 1LUCB 1ONWA 3WN6A 3SIZA 3MCMA 4I7VA 1TWWA 1GYNA 2XIMA 4CNOA 4MUPA 4KWOA 1LROA 1W0MA 1DVJA 3CB3A 3CZGA 3P5YA 3E49A 3CV1A 3DYOA 3OPSA 4YVPA 2J4GA 3UA4A 3KE0A 4DAFA 4IQLA 1OQFA 3NQGA 1A3XA 3AAMA 3WJZA 1DYSA 3FSTA 3BWWA 4ATLA 3FJLA 1VYSX 1QI5A 3WLTA 1RY8A 1TUXA 3NDZA 1QNSA 4FLRA 1WA3A 1ZUAX 1WBJA 3AMDA 2DSWA 4R85A 5D2XA 1HJWA 1QI4A 4M51A 2XZ7A 4PRRA 4EE9A 2PF8A 2W62A 2Z2BA 5A6AA 4MJMA 2CLOA 1XIHA 3OBEA 3C4UA 4PRTA 4L64A 1GOIA 4GVHA 1Y8BA 2WZMA 4NJGA 5IBXA 3CQKA 1EQPA 2PP1A 1Q63A 1IR2A 1VFSA 1YBQA 1UR8A 3NDOA 3IJ9A 3CEUA 3GTFA 3ZR5A 3FFSA 4DWSA 3WL1A 5LNRA 5AHIA 2HBXA 3BAXA 1DJHA 3UJRA 4IJCA 4QCEA 1PDYA 3NJ3A 3L4TA 1TE1A 2X30A 1ZP3A 4AIOA 2GVGA 4RXFA 3TAOA 4HNTA 4O11A 5GNXA 3CJPA 4DHGA 1G4TA 1TA3B 2WMGA 1XLBA 1OX6A 1ZFJA 2IKHA 1WAWA 2WBGA 5GQBA 3R8GA 3FXGA 4PB5A 1H3GA 4H7ZA 1XM3A 3LXAA 1UWQA 5AYXA 1FWRA 1EUNA 2X1UA 1V4YA 3BCFA 1KFLA 4IL2A 2BS9A 4O4VA 1E73M 1OZQA 2PDXA 2QV5A 1CXIA 4CEUC 1Q6CA 3CHDA 4W8AA 1PKLA 5G5IA 1GYLA 5AC6A 1UOKA 3CWNA 1C8QA 1Q6RA 1T40A 2OJPA 2AKMA 2XVKA 3SY1A 4C6LA 4CVWA 4GRSA 3RG6A 4ADUA 1D2KA 4AHQA 2BGNE 4C6BA 3TCSA 5BU6A 2DIJA 3V18A 2H90A 4GZJA 2MNRA 1ENUA 3OLEA 2ISVA 1P0EA 3CNYA 2PDJA 2QGHA 3KVJA 1KM1A 4JN7A 3LX9A 2BTMA 2JF6A 1W3TA 1LQ2A 2AAAA 1V6YA 3E9AA 1JPDX 3KS6A 6XIAA 5F2GA 3RFAA 1SPQA 3CZLA 5EPDA 4HU8A 1N55A 3TWBA 2GJXB 3PN8A 2OZTA 2C19A 1JPIA 3NO1A 2GK1B 3LENA 1MW2A 1FHUA 4OKDA 2FJKA 2D0FA 3ANYA 5C70A 2YA1A 1UR4A 1Q7QA 4JFVA 2FTWA 3GXFA 3VDHA 3EDEA 4KKXA 3BANA 1R6WA 3FKKA 2OQYA 1EJWC 2QCNA 4AVOA 3D3AA 2NWSA 2VZTA 3V4BA 4NASA 1R0MA 4HSHA 3KVLA 2QR6A 3MUXA 2D24A 1IV8A 1GHSA 2WMIB 2ZUMA 3LTYA 1LYXA 1B54A 5AYBA 1EEPA 2PDHA 7CGTA 3U7BA 3EX3A 3UWEA 3AYSA 3VMOA 3K8LA 2VEPA 2FTYA 4O53A 1F4HA 4PGLA 1R3QA 3O1NA 5LKYA 4XKMA 4YN5A 3UETA 1UIPA 1W3LA 1EPXA 3UYCA 2XJ7A 4Z2JA 4AD4A 1K9EA 3UPWA 3CK5A 3KS5A 1GTHA 2AQWA 2W9MA 2YDRA 4POCA 3CS2A 4FB7A 3OVRA 3QW3A 4YXGA 3LHUA 4GNVA 1G5AA 3RDKA 3QC0A 4LUJA 5LXXA 1P6BA 3L7RA 1S2WA 3F7JA 1W3IA 4PL2A 1UP2A 3AJXA 2C1IA 4PH6A 3G6LA 4GY7A 4AAJA 4K8EA 1YADA 4A8IA 3PTKA 4LVAA 3B9AA 2OT0A 3ARZA 2VR2A 3MJYA 3LY0A 4BEUA 3TYZA 3KDNA 1E6SM 3FKRA 1J12A 4AD3A 1L8PA 3LBOA 3VKKA 4X9YA 4PE8A 3QF0A 4JTDA 3VZYA 5GJPA 2G50A 2PDFA 5DELA 3W0KA 3TFCA 1NOFA 3C2EA 2QJMA 5DXYA 4AZ5A 3CUFA 1HN1A 1ECQA 1KRCC 3U2EA 1V6WA 2ZZ7A 3VMNA 4MNKA 1F2JA 1UKSA 4YVVA 3S0CA 4V15A 1R9YA 4F0SA 4KS0A 1OGBA 1UB3A 3B9EA 3M0LA 5BMWA 4KWSA 2P0OA 2VMFA 1IT8A 1VQTA 4MFDA 3WQGA 3V5OA 3HG4A 1LT7A 2Y85A 1Q6LA 3MSRA 4EAYA 1PIFA 1KKRA 1Y5WA 3M7WA 4Z42C 2A6NA 4I5RA 3ZWSA 2XH4A 5H91A 3B8IA 3EDKA 4BKNA 1XLHA 4BQ5A 3IIZA 3PVFA 4KRZA 5E9AA 3EEGA 4ZBCA 2OU4A 1EFZA 1L8NA 1KO0A 1ELSA 4S38A 5REQA 3QXBA 1KFKA 1QU4A 3BAIA 2RH9A 4LYPA 3S42A 3LN3A 4WCJA 3KX6A 2XGIA 3BGJA 3DHFA 3NQDA 1KXVA 1FHDA 1EJTC 3NYZA 3TTOA 4U5IA 1O6IA 4B92A 2PD5A 3QOMA 2X1IA 1OABA 2BVDA 2RGLA 4K38A 2J7DA 2V30A 3DFSA 2NT0A 1XJBA 1EC7A 4L6OA 1LLWA 4HSOA 4ZXOA 1YDYA 4HK6A 4LUTA 4RX0A 3F2CA 2NSOA 1LUCA 1GOQA 4UNIA 5I3FA 1VR6A 5K3VA 1WDPA 3ZT5A 3I65A 2IKJA 4XX6A 3E74A 2FIQA 3I68A 2OLHA 1XIFA 5CZSA 2BVYA 4O18A 3KBMA 3T09A 2VELA 1MEIA 1R8LA 1JAKA 2C0AA 3A23A 1ZAJA 1E72M 2DJXA 4H9ZA 1FXQA 4H6EA 3PZGA 1H7XA 5HMFA 3K5XA 5JH1A 3M0HA 2J77A 2YB1A 3OQEA 5HWJA 2Y2WA 2FZDA 3VVGA 4MG4A 1IXOA 5I2UA 4FK9A 3OGSA 3ALGA 4MNJA 2XIBA 1UYQA 2XIQA 2YCJA 1WV2A 4C7GA 2XH2A 2PDIA 3L66A 4IP5A 3H70A 1JCJA 4QX4A 5ECUA 1H62A 2ZUSA 3R6IA 2WVTA 3N9RA 3JUGA 4PTVA 2DSZA 1HP5A 4RE2A 1K4HA 2Z1BA 1QW9A 3W7RA 5HNTA 4J3ZA 1QHOA 1UROA 3N3MA 3WH7A 3EWWA 3IV3A 5TD4A 3FAWA 3G0XA 1TA3A 1RBLA 2J24A 4AEFA 1IEVA 4Z1DA 2EG8A 3O6CA 1JPHA 4UFMA 3VC6A 3PZTA 1EBHA 1ZAHA 4WSJA 5C8BB 3NG3A 1UWRA 4BF7A 3AMLA 3PC0A 4WOZA 1GJWA 5LNSA 1B3OA 4JY8A 3GDTA 4UTIA 3WFLA 4Q3MA 1PX3A 3P62A 1VFTA 3MBDA 4H9TA 3P8JA 1NOWA 1TB3A 3EPOA 2I16A 3S5ZA 1KTNA 1I2PA 5A8PA 5KZEA 1K7XA 2PRHA 2GUBA 4BCEA 4WX2A 4E4UA 5DF0A 1W9VA 4JIIX 4U28A 1UCWA 3GNXA 1OZMA 3UBPC 1EWEA 2WLZA 3DG6A 5K9XA 1CWYA 4HPXA 1NWSA 4H9VA 1KWKA 4ZE5A 4XZLX 1B9ZA 3I7SA 1IWPA 2ZUVA 1OFRA 5A6BA 5FAJA 4CU7A 1M7OA 4KW2A 3VOCA 4G56A 4LAOA 3MMTA 1WUFA 4AHPA 2E3ZA 2O7QA 4PFMA 4PULA 3ZZ1A 2QZRA 3CV7A 3UZ5A 4E2VA 2CLHA 5I06A 3WENA 3N9SA 4JNYA 3VKJA 4Y7EA 1FA2A 1QNVA 2Y1HA 4JICA 3VIOA 4WZHA 2GJXA 3WLSA 1A53A 2GK1A 1BKHA 2GQ3A 3BZJA 4DLFA 4HCHA 3M0VA 4G2DA 4V2XA 4Y9PA 3R8RA 3ITGA 6TAAA 5C9WA 4A05A 1UR2A 3MTWA 1I2OA 1V02A 3BW2A 1MUWA 3EOSA 4HKPA 3TCEA 5HMSA 4NJKA 3NO5A 1EJSC 3QGVA 3U9IA 3PBWA 3BARA 3IAPA 3PF3A 2YCKX 3W2LA 3LRMA 4LY4A 4DXVA 3BLEA 4XAYA 3TC7A 3CM4A 4E2OA 5MHBA 3STGA 1JRCA 3KBSA 5A8QA 4L65A 2QMJA 2R82A 3T4CA 1LF1A 4PSPA 1VJZA 3B8TA 3LNMA 4PUKA 2Y62A 3UGRA 4KWVA 3BLOA 3VDCA 3N6QA 5CPMA 2PPGA 1LBMA 5K9CA 4IIBA 4XV0A 2QF8A 2QDGA 3WQWA 1H7PA 3IARA 3MS8A 2VL4A 2YX0A 4QLKA 5FOOA 3BGGA 3WUGA 2BY1A 3LPFA 4MB4A 1JYWA 4AISA 2D20A 1Q6GA 2PA6A 3B40A 5BXTA 3NL6A 4J9JA 3W1TA 1E5JA 1UKOA 1W3JA 1L6WA 3DENA 3IS4A 1W9UA 4L9YA 3N2XA 1TMLA 2PWGA 2PAJA 2ZRYA 4ZB5A 3RM8A 1YTEA 1GQNA 1Y5VA 2PCEA 5A69A 5BU9A 3AROA 4IG2A 2PLCA 3W71A 2X7VA 3PFRA 4JS3A 3W81A 2WQPA 3AQUA 3AXIA 3E0VA 7TIMA 3P3BA 4LNCA 5CSRA 2BHYA 1PUDA 4OUEA 2EG7A 1AH3A 2J74A 3RGTA 1UR9A 1AUSL 1GKPA 3P67A 4IGNA 1I9CB 4XZNX 1EXPA 2PDYA 3H24A 5ENLA 1XUUA 4HPHA 1J11A 4B5TA 5BRBA 3MBFA 4YTSA 5BRPA 1KQZA 3IJ7A 8TIMA 4KEVA 2XHYA 4UQEA 2FZ8A 1ZY9A 3AICA 2XFRA 5CJ5A 3JZUA 3TJIA 1ZZMA 4W7WA 1T8XA 2DQWA 3V1HA 3F4WA 2Q09A 1BQCA 5FF7A 1SO5A 5D8ZA 3NZQA 2D22A 4DELA 1XYZA 1OFOA 1YX1A 5D2WA 3CAKA 1RV8A 1VLIA 1XBVA 2PWFA 4JCMA 3CH0A 4TTUA 2FZBA 3RX4A 3WUBA 7PTDA 1K7FA 3CYJA 2BG5A 1WXZA 2PWDA 4J28A 1TV4A 3EPMA 4TVUA 3GLCA 4MSSA 3TXZA 4ADSA 2AAMA 3QYSA 1IT7A 2AQVA 5FL0A 4GY1A 1A5NC 4IISA 1VC4A 1AK5A 1JDCA 1AW2A 4BWLC 1K6WA 2VEFA 2YB4A 4HN4A 3TC3A 1K9DA 2VZVA 1EPVA 1Y65A 1F9CA 4MDOA 1XBXA 3AXHA 2PTYA 3QY7A 3LEPA 2I1OA 4GI4A 4O10A 3U0HA 3TMQA 1CXHA 3AMCA 3T0CA 1A0CA 4GIRA 4HVXA 1M68A 3BG9A 2WZIA 2NVCA 1YE6A 1QJWA 3TA9A 1DWFM 5D4YA 4UOQA 1QOPA 2FGZA 3H22A 3TW9A 2F38A 2GWGA 4UZSA 3DN5A 1KWGA 4GH3A 2IPJA 4JTEA 5HNUA 1JUBA 1S2CA 3DDMA 1M53A 4GJIA 2PSNA 1VYRA 5KSWA 7ENLA 4NJIA 3U6WA 2PC8A 4YLWA 3REQB 1JL8A 4FF7A 3QW4B 5DN1A 4WF7A 1V03A 3SCSA 2VRKA 2X05A 2A3BA 3FJ6A 3TTSA 3WH8A 4P7RA 1HF6A 1J0IA 3VGGA 2E0PA 4YVXA 4GA8A 3BMWA 3S2JA 3CMFA 4IFOA 1W3NA 3UNDA 2VR4A 4ZEPA 3EWDA 4Q22A 4EF9A 3AU6A 4FXJA 2PP0A 3G3DA 1JGIA 1EGZA 3QY8A 3BAWA 4AXNA 4FOKA 2BOEX 3A3HA 1A3HA 3W2KA 2DW6A 1F5ZA 3M0XA 3DHDA 3QOKA 4MZ1A 4J3TA 1QT1A 2FGBA 4CN4A 2B31A 3RIKA 2RUSA 1D3CA 3GC2A 2E5CA 5LZLA 4P7LA 4LEQA 3V3WA 2VDIA 1V02E 3WNPA 4C5YA 2PS2A 3W76A 5I07A 5K9DA 1LTDA 2CZEA 3VIKA 3SCTA 3CAWA 3NSXA 2Z1VA 5F2IA 4LAMA 2PWUA 3RO6A 2UZ9A 4HK5A 2G95A 1J0KA 4LX4A 4MWAB 1EA0A 1NWTA 4RW3A 3CC1A 2XIJA 1T6MA 4IMGA 1F8MA 1PHQA 3QKEA 4XTIA 1MRQA 4JTFA 3UJSA 1GVRA 3L2MA 3PUDA 3UESA 2F6KA 3CMGA 4LU0A 2VOTA 4HCLA 4H8NA 1DP0A 2CETA 1SQ7A 1TZ9A 5G2IA 4G7FA 3WQOA 4M6PA 2GSJA 1XCWA 5IFPA 4EPDC 1XBZA 5K4XA 1IT0A 1BSLA 3DESA 3PFMA 2WYSA 3GQYA 3I3BA 4DBDA 1K9TA 3A4AA 1TJ1A 5CGMA 2OO6A 3WEOA 3O3RA 1G1YA 3H2FA 3F2BA 1UMYA 5FIPA 3RF9A 1R2SA 2B7NA 5DBTA 3O8AA 4F9DA 3W24A 5J5DA 4AZGA 2F7FA 4QXIA 5BOEA 1VPXA 2F61A 3L0NA 3W3OA 1XIBA 3CL7A 3SFWA 1LLOA 2ZA2A 3BICA 3OU8A 2XVLA 1OC6A 2DUZA 3JZEA 2YDSA 1E70M 3VKDA 4S2CA 1EOMA 1OINA 1U30A 3VFCA 1AA1B 5E6ZA 1IR1A 4UTKA 1ML1A 2J7HA 2OKOA 2ZUTA 1JYNA 5T9BG 4TOQA 1DXFA 3NPVA 5A95A 1M7XA 1NARA 3OVQA 1YE4A 2QJJA 4C6NA 4O52A 1TWIA 5MF5A 1JDEA 3B04A 3EAUA 1FCVA 1J18A 4ICCX 3TNOA 4C6QA 3TSMA 1L6YA 1EJXC 2WKGA 1TJPA 4UTHA 4HMCA 3MU7A 3ENLA 3SW6A 3VE9A 3W37A 1BF2A 1Z8AA 2VD9A 3KP0A 3LHTA 3ONBA 3AIBA 5HUOA 1X1OA 4L56A 4EKJA 1P0NA 2V2HA 2G3JA 2PTZA 4RE4A 4IH3A 1UR1A 1QI2A 2Q71A 1QNOA 4MKNA 4O4WA 2OFJA 2OSYA 3G1RA 1EOKA 1EKOA 4YCOA 4CD8A 1GJPA 1RCQA 4XZBA 5PTDA 2H8XA 3OVPA 1EDTA 4PUMA 3WLRA 3E02A 4JL2A 4P5UA 4AEOA 3CZKA 2Y89A 2E6YA 3T4WA 3VD3A 3VAVA 3ZS4A 1TJ2A 1B30A 3PZIA 2GVEA 1A5AA 1PL9A 4LQ1A 2HJPA 1EP2A 1FDZA 3N2OA 1E9LA 2PF0A 5DY3A 3EKZA 3I6TA 4E4PA 4DJFA 2C18A 1Z7AA 2YXGA 5DXXA 1MVYA 4K3ZA 4OZOA 3ARRA 2E28A 2DZPA 2JBMA 3WQCA 3QMRA 2VURA 3S6TA 2Q6ZA 4NG3A 3EBVA 1ZJBA 1QI3A 1VBJA 3R0UA 1TPEA 3LA4A 5F4SA 2D2OA 5H2ZA 1O12A 3T42A 2ATMA 4AZIA 1K70A 5FSDC 2ZZ4A 3KBVA 2D2JA 1G4EA 4U2ZA 1LZOA 2B0MA 2RJHA 3GDKA 4QE4A 4DWSD 5I78A 3I4EA 2ZWZA 3V5FA 5BXSA 3EDFA 5IM51 4CNPA 5HOSA 1DIDA 2FMOA 4HHLA 5G4WA 4CQBA 5AB3A 2NUWA 3MWCA 5LGZA 2REQA 2PGEA 3N3TA 1RP9A 3F03K 4C6JA 2JF7A 2XWDA 1U22A 1F76A 1OT1A 3WELA 3M41A 4I6KA 2E4TA 4U2YA 3O2LA 2JE8A 4GO9A 2YXOA 3N25A 1YW1A 3PWIA 2ZICA 3HJZA 4N4PA 4OV9A 2QNEA 5DCBA 4ILSA 4FIRA 2VUNA 5EYWA 3WJYA 1DJZA 1PTGA 2H3DA 3FEQA 4XBJA 1YPXA 3H2EA 2E6FA 1VD6A 3G1VA 4AG0A 1Q7MA 4Q4SA 7A3HA 3MY9A 2Z0IA 2F8QA 1OADA 1W5MA 2PWEA 1JIBA 2AMGA 5HPCA 2GUYA 4OHQA 3C3UA 4ACYA 4AMCA 1KRBC 5DRIA 1E4NA 4RW5A 1JCYA 4GD0A 1F6PA 5HBFA 2QJHA 1WP6A 2CERA 4JBRA 4B9YA 3T1GA 3QN3A 3B06A 1G67A 2EF9A 4WJ8A 1J0HA 2Z25A 2G41A 3W01A 1FWHC 4I8YA 2X2YA 1U1JA 1X8FA 3W7NA 5HQLA 1GOOA 5H8PA 4FR6A 3NZRA 3LRKA 1W8SA 2C91A 3WF4A 3OG3A 3HTWA 2XGZA 2X0YA 9XIAA 3EYPA 1MI3A 3LHVA 1MXDA 4PCNA 3OZOA 3S5YA 1GVEA 2CLEA 3WDIA 3UJFA 3ERPA 3UCQA 1F05A 4WUIA 3EGJA 3C8NA 3AI0A 3NURA 1YDVA 4Q6XA 2R91A 2BP1A 3L4XA 1XKJA 3H8AA 4CNSA 3CLWA 2VNCA 1JCLA 4HZ6A 2OKTA 4C91A 4CCZA 3CQHA 1M03A 1VPYA 2OYMA 2WWCA 3EMCA 4QGCA 3HPXA 2BZNA 2R1KA 5K4ZA 5LA0A 1PVNA 2NQHA 3GG8A 3ZJ8A 8XIAA 3KLKA 3O05A 4A3YA 4U4MA 3HV8A 2ZZ2A 1PYFA 3DFPA 2NV1A 3NM1A 4LUSB 4C6DA 2QDHA 2PTWA 4KMQA 3H26A 1TPH1 1G0CA 1PBGA 1FWJC 2ZTKA 2GDQA 3N11A 1LOLA 4KFNA 3W7EA 4XG1A 3NGJA 2OWXA 3LQGA 4CQ8A 1ZCOA 3VPLA 3AS2A 3L4VA 4KQNA 4TIMA 5D2TA 4PTNA 3QMTA 5C5YA 1DPMA 3P74A 1E0TA 4H6KA 3K13A 1AODA 3AO0A 4ZR8A 3EDJA 4JTSA 3VNMA 3C2VA 2JFEX 2QVNA 3VNIA 4CCEA 1FDYA 2CKSA 4PBEA 4GIEA 1E0XA 4LPCA 4J3UA 1R38A 4MWAA 5IDZA 1Q8AA 1UD5A 1NJJA 3NGFA 2QEZA 1NVMA 1XR2A 3UWUA 5HPOA 2BY0A 1GVYA 2PFHA 1KBIA 3UZJA 3H12A 1UUQA 4MAVA 4J3SA 1HL9A 3L68A 4J2MA 3QHMA 1HVXA 5BOFA 1IZCA 3OIXA 2XH0A 3N73A 3TP4A 1XIIA 2XVPA 1M3UA 4GZ7A 5AOUA 4UMAA 4YHGA 2ZYFA 1ADDA 4DO7A 2Z6JA 1YIXA 3AU2A 3PBGA 4F2BA 3NEVA 4M56A 2QQ6A 1G6CA 3GB6A 1P43A 1QNPA 4KPLA 3GFYA 5EFFA 1O95A 2ZC8A 3B8VA 1FWGC 2R9RA 1OCJA 2QCMA 1B1YA 3EMQA 4G8TA 4OTKA 2BV9A 2WZHA 4A2RA 1ADSA 4UZUA 1GK8A 5KZ6A 3NQBA 2A79A 1GVFA 1N8WA 5AHEA 4N4QA 1P1XA 4IXHA 3VOFA 4C6FA 1UPPA 3H4WA 2PDMA 5A6MA 1J96A 3W88A 1HT6A 2ATSA 5D9OA 4HPJA 1E9ZB 2GJNA 3W1RA 5GVJA 4ERGA 2BVWA 1B3YA 3SZ8A 3U2ZA 4JTCA 1LG1A 5D04C 3SECA 4DPPA 3B8UA 4W85A 4XSMA 1HQTA 1XF0A 1XUZA 1WDWA 2DDXA 1F74A 1C91A 2RJGA 1IIHA 2DZWA 2J66A 2DT1A 1W1IE 1V3HA 3LM7A 3QEZA 2WKJA 3EX6A 3S1WA 4IHCA 3PWAA 3T0BA 3VIJA 5AC4A 1YQ2A 4AZCB 2CYGA 3DH7A 4JKLA 1KCLA 3N13A 3EWZA 1A5MC 4JTRA 4CU8A 2VFDA 2AQOA 3DFYA 4OGZA 2HS8A 1ZBWA 2ZVIA 4HOWA 1CXEA 4M3PA 5E5CA 1US0A 1QDSA 4AIUA 2ZRXA 1QWGA 1HVQA 2XM1A 3WLNA 3W7KA 2PP3A 3L2IA 1PX4A 2BY3A 3EB2A 3N9KA 2EJ1A 4GCXA 4ROQA 4Y8EA 3V36A 5HR7A 4L1XA 1YXCA 2E1WA 5EMUA 3UPBA 1EDQA 2X09A 1R3RA 3SUWA 2YLAA 1TJRA 1P48A 4UTTC 3O9NA 4O0QA 4Z2HA 1RQBA 3PUGA 4A2SA 4PRWA 4AX6A 4X61A 5HAOA 3MHFA 2Y5JA 4FR1A 4HU3A 1HXJA 3G0UA 5TNVA 4G1KA 1XRFA 1EB3A 5FEXA 1TWDA 2GJPA 3S2LA 2ZX8A 5C9RA 3RM4A 3W6MA 2VC9A 5M1TA 3R8HA 5G4HC 4DJEA 2WM0A 2D1ZA 4KCVA 2ISFA 3UPMA 2W66A 4HYWA 3M44A 3SURA 3AS1A 3PB0A 1MZRA 3S4TA 3B05A 1VCVA 1NFPA 2Y24A 3CQIA 1XYBA 5CC6A 3K4WA 1XSJA 4WD0A 3AJ7A 4UMBA 1KGXA 1OF6A 3C6CA 4UIOA 2PLJA 1JZ2A 3HV9A 2V5JA 1Q66A 1TPDA 2GJRA 3D0CA 2AL2B 4PTDA 2HQAA 2BVTA 5F1VA 1A5LC 3UJEA 3THUA 1O5XA 3VKCA 1FQ0A 1TKKA 4GQRA 5DBUA 2X16A 1DWHM 4I3GA 4N6FA 2WSQA 2WC7A 4WHBA 1XXXA 4PMQA 5CPSA 4JTHA 1FCQA 3TQ0A 2Q01A 2ALRA 1EEXA 2VC6A 5CQ1A 4AD0A 4U3AA 3ZJ7A 3RO8A 5FCZA 1B5TA 1TVPA 5EMJA 2VJXA 4Z1BA 1AFSA 5C2CA 4NJHA 4LS2A 4XKYB 4K8HA 2C1GA 1D3GA 1FCUA 2ACSA 4GPNA 4S3JA 3CHVA 1XISA 4F0RA 5EBUA 2CZVA 4TU1A 4MWAE 5M17A 1UUMA 3P80A 1E4IA 1HKWA 1FWDC 1CGYA 3KL3A 4UCFA 4Y8FA 2XPKA 3E0IA 3VNLA 1BFNA 5A6BD 2P53A 1B57A 3HQPA 2FKPA 3C52A 1BXNA 2YBUA 4JIRA 3A6OA 4S3CA 1J2WA 1MRAA 3T0AA 4RZ6A 2ALDA 1TYGA 4AWUA 4ENLA 2A3AA 2VEMA 1ONRA 2CESA 1PWLA 4MYXA 3W7HA 2EPKX 5D37A 1F3EA 1YPFA 3BMXA 1TR9A 4MZYA 4C60A 1UG6A 5JXQA 1ME9A 4CKQA 3EOUA 3PBMA 2X1RA 1HW6A 1J2BA 2DH3A 1AJ0A 1FWIC 2JIEA 1PZ2A 1EL3A 4QS5A 1G9HA 3CXOA 4JTUA 4FX6M 5I24A 4PBFA 3BUVA 1EGMA 2QCCA 4DZ5A 1AD1A 2ISWA 2WOQA 3BAKA 3COTA 3IIOA 4GUGA 3RJYA 1Q7ZA 4RR4A 2HROA 1ZJHA 3L2LA 4PEEA 3U3HA 4ORMA 2Q8ZA 4UTLA 3VNDA 2GOKA 4LUSA 4GISA 2KX9A 1RXOB 3S6DA 5LYRA 2E7FA 1UUOA 3GW0A 3KP1A 1V5XA 5AHNA 1MQRA 4UMCA 3SQSA 2V3FA 1TZ7A 5JIWA 1X6NA 1TMHA 2BDQA 2O4QA 4CD6A 3QV6A 3OEXA 2JKEA 4J40A 4RNJA 2P10A 1OCQA 1HL2A 4B15A 3O15A 4UQAA 1DIOA 1W32A 3CT2A 1MDLA 1JZ3A 3PWGA 1SR0A 4DNHA 4FPSA 2OWWA 1ZLPA 1BWKA 1EJ7L 1V6XA 4NAFB 1I8JA 1FWSA 4DO5A 4LF2A 1DOSA 4M8UA 2ZTJA 4U33A 4L6DA 4JEJA 4OE7A 1JDFA 1UQZA 4E0CA 3DFOA 2QUVA 3UU0A 3FCPA 4XBKA 3WQ6A 4UTJA 1ME7A 1S5TA 4A4AA 4B2DD 1JAEA 3W2MA 4Y96A 4D6CA 4MDPA 2QPUA 3HFTA 4EXQA 4QQUA 1PSCA 1SO4A 4WKAA 1ODUA 3WK3A 3OGVA 2WSRA 3L4UA 4BF5A 4HHHA 3ORWA 2V2CA 4MLJA 3W7QA 2OWCA 4UR9A 1W37A 3UJ2A 2J8GA 4OJYA 4HNNA 3OVGA 2XSAA 3WNOA 1PKNA 1BSIA 2Z24A 2Z7KA 2QKFA 4B5WA 4KH2A 2VCBA 2YYUA 1UWIA 4WK9A 1CGVA 4G9PA 3ABSA 4JEQA 3C2RA 1JCXA 2DT3A 3CL8A 4HA0A 4RCXA 2G3FA 5LIUX 3GW3A 4DWDA 1K3UA 4GOAA 1RJQA 4Q33A 1SUXA 3DC8A 4MY1A 3GZAA 6A3HA 4PC8A 4M6VA 3A5VA 4JIEA 1T99A 2ZADA 2GOUA 2INEA 2P5NA 3W73A 2E5DA 4HYRA 1NQKA 3RRXA 4ZTYA 3AUOA 5C9ZA 4J3VA 1XQLA 1BEUA 4QNEA 3NFUA 5ECVA 1JPMA 2BHUA 1I4NA 3VOJA 3OHIA 3W00A 3NR0A 4A6GA 1IWAA 1J8VA 1LBFA 4WR3A 3D5HA 1OB0A 1OHLA 1TV7A 4GYKA 4ZQRA 2HE8A 4AZCA 3ARUA 3P0WA 1VAHA 1BWLA 2QPXA 3GY1A 2PDQA 4B91A 1XLAA 3MANA 2FFCA 2IXVA 2PCQA 5RUBA 3UWQA 4XVEA 4XD4A 4KETA 1OK4A 4L4MA 1UWTA 4ZB0A 2WHJA 3EWXA 2JKAA 1WZKA 4KEZA 4F4RA 1E1CB 3C8FA 4U10A 1WKYA 4GQ0A 5H1WA 3NSNA 3P60A 1BG4A 1GVQA 2CLLA 1PKMA 2JKPA 2IQDA 3O63A 4Q4KA 5M03A 4JKMA 1Z6KA 3IK2A 3URAA 3R79A 4D8ZA 5A6SA 3LBMA 2GVYA 5DMYA 3THDA 1QK2A 3DFTA 4GVIA 3L9CA 3P82A 1DV7A 3TZNA 4HJFA 1XLCA 5I3IA 2OO0A 4Y9MA 4PMUA 4WVXA 4LBUA 3EWCA 4M1BA 1UD6A 2YL9A 5BZAA 3PZVA 1WBHA 4F0HA 3N2MA 4HNCA 5GJNA 3N34A 2YFOA 3G5EA 3KVKA 4F2UA 4YYFA 5C9UA 4HYVA 1QPRA 1QO2A 3ARTA 1PWMA 2OODA 4HTBA 2XISA 3A13A 1QPOA 3WZ0E 3QV9A 1EA9C 3MO4A 4DAIA 4HZMA 4E5TA 1WE5A 3NOYA 1KBJA 3GVGA 3HG2A 1KCKA 5IRPA 4WDWA 2FPVA 2Y63A 2BX7A 3R11A 4FS9A 1N8IA 4QDWA 2AL2A 1H41A 1KFEA 1U5HA 4BR1A 3GIYA 4US5A 4NNBA 1OGGA 4QLJA 1E55A 3M1ZA 3W07A 1JQVA 2ZVRA 3ITTA 4QNWA 4AZ6A 1NDVA 2WSYA 1M01A 4WDTA 2V68A 2QUTA 3HJEA 4DXXA 3CUXA 2WB5A 2YPIA 4L6HA 4NIRA 3DKLA 1CGTA 3WUEA 2DZXA 4ZQPA 1W5QA 4XZHA 2YJQA 1UBSA 2A0NA 2EO7A 4OT7A 1SGJA 5TF0A 4RPPA 4GX9A 3CU2A 2VFEA 2EPLX 3JS3A 4IT1A 3W7PA 2PEVA 1RD6A 3GTHA 1QNRA 4ERAA 4M80A 5BXRA 1X39A 3BW4A 4XKYA 2AGTA 4WDUA 4Q8PA 1VBGA 1B2YA 4ZODA 1L2QA 2QMKA 4X63A 3TW7A 1DTNA 4NQ1A 4N02A 1IEQA 3G1SA 3B97A 4HBKA 2HV5A 3PP7A 3WD1A 1VIWA 3O06A 1QASA 2W91A 1AH0A 4P61A 1C90A 2F9RA 3S1XA 5A8OA 2ZZ5A 3SRDA 2E9MA 3PTMA 1GGOA 3WBXA 5FL1A 4GCAA 4A3HA 1FH9A 4NX5A 5CKSA 3M43A 1FKWA 1VFOA 3LCGA 3FOKA 3TE9A 1AW5A 3L4ZA 2E77A 5D05A 4H2CA 1KM3A 4MMWA 1KFBA 2HDJA 3B8DA 4PCPA 2VFHA 5G4EA 3A5FA 4PUDA 1H7RA 3SSZA 4R3UA 4GABA 3KCOA 4LAZA 5BRQA 1EDGA 3SQMA 1R86A 2VGGA 3D47A 4KESA 4JD4A 1JXKA 2ZRUA 5DT5A 1MSSA 1RR2A 3BLLA 3HGRA 5I23A 1SZFA 2BY2A 4NZJA 2IMRA 5CJMA 1ESWA 1B4EA 1ODZA 3RR1A 2WC3A 2Q8LA 4EXBA 4KIEA 4GIYA 4LANA 5HJXA 3KXQA 4EOUA 3RILA 1D8CA 1AJZA 1EJVC 4Z1YA 1R46A 4HNVA 2Z1WA 3N18A 3SCVA 5JBDA 3H54A 2HWGA 3KBNA 1DIKA 1B3VA 4LUYA 4N6EA 4Q32A 4F2TA 1YEYA 3TYDA 1LL6A 3ZLGA 1KV5A 1R47A 2QJGA 1B0IA 1Q6OA 1SFLA 4XD5A 1XSIA 3OA5A 2PLMA 1NSJA 2AOSA 2QCLA 5IXEA 5DEZA 4BHYA 2VVSA 4P2VA 4DJFD 3UR2A 4C6KA 4HA1A 4J5NA 3TNBA 1EJRC 3W6LA 4NAFA 1HG3A 3G3MA 3TONA 1B3ZA 2EKCA 1E51A 1UC4A 1YDNA 3FN9A 4N0RA 3S2MA 4XBSA 2C6QA 2HXUA 5LXEA 2JK2A 5CBIA 2P3EA 1UQYA 4ZO9A 2Y8VA 4TVDA 3VIPA 1JI1A 4LAUA 4OBTA 5FJOA 3PULA 1W1PA 1CDGA 1SJDA 4QR6A 4XQ6A 3BL3A 1JRBA 3SDOA 3Q67A 3A3WA 3FX4A 1YDOA 3TR2A 1THFD 4E3VA 2DFAA 1QAPA 2R6OA 5CAHA 2XFWA 1BTCA 3IANA 1RA0A 2ODOA 1F3TA 3FVMA 3LTPA 2R14A 4EWND 1LT8A 1REQB 1UD2A 4LXFA 5FJTA 1SFTA 1W17A 1V77A 2V81A 3N4AA 3A21A 1XV8A 3WFZA 2W27A 3WYZA 5AN7A 4GFIA 2ON3A 4DYJA 3PK7A 2EQDA 3MP4A 3URNA 4C1KA 3U5UA 2YZRA 1NP0A 1XQKA 3VUSA 1EC8A 2O0TA 3USZA 4HGXA 3H7VA 4KRTA 1CLVA 5FJIA 4C1NB 3AHYA 4HN8A 4CD7A 2J13A 5C2XA 3MT1A 1HP4A 2VRJA 3S3GA 3SJ3A 3UR5A 1S1PA 2CNCA 1JJKA 4K1WA 1TZZA 3BSMA 3VUPA 4UWMA 3E96A 2VXNA 1CIUA 2NVAA 3TN5A 2DH2A 4X0VA 3V75A 1A5CA 4AUBA 1ZU8A 1UBPC 2QCFA 1V7YA 4J4KA 2YR1A 3W1UA 3PUOA 4K8GA 1HGYA 5HQEA 4DF0A 4H6RA 1E5NA 3AYRA 4LF1A 4FNQA 3RCYA 3QPEA 5D38A 4S3KA 3RLHA 3W72A 4QITA 1H1NA 3FA4A 1GZGA 1XFBA 4NYYA 4C6OA 1I75A 4DUOA 2BASA 1HKVA 3WLQA 1FWCC 2FYMA 4MUZA 4MYAA 4NX0A 5BXPA 3PJWA 4NL1A 2VDHA 3RHGA 1D3HA 3AXMA 5E0KA 4F66A 1OX4B 3PZUA 3IACA 2OELA 2PTDA 3TSBA 1VYPX 5KINA 3I6EA 4ATDA 1PDZA 2W79A 3K8MA 2X42A 5DMLA 2J88A 4JOMA 4WY0B 5SWUA 2G37A 1SJBA 3W7DA 2I17A 4LB3A 5U4NA 3WLPA 3AALA 2P3ZA 1XYFA 3QFEA 4YHEA 3THCA 5FF0A 3C5QA 2XWEA 3OP2A 4H9YA 2W5FA 3WQFA 1TTIA 4KIRA 4X9SA 3DEQA 5CSUA 4IX0A 1BRLB 4FNTA 3OBAA 4G5DA 4H00A 2XH7A 2GGGA 1SFSA 4BQ2A 3CAQA 3ZLHA 4HA3A 4JFSA 2BMBA 1EHAA 4DUXA 1A49A 2BOFX 2C15A 3O6DA 3IJIA 4WGHA 2D73A 4N2YA 2CZFA 3SY8A 3I3DA 2VWSA 4MWAD 5CBJA 1TFVA 3BCDA 2OOFA 2PDKA 2VDGA 1O94A 1Z41A 5HNRA 1LP6A 2ZXDA 3EX4A 4R9XA 3B9DA 3AXXA 1BQGA 3KRUA 3VCCA 5AC8A 5E6YA 7REQA 1MUCA 2FH8A 1G94A 3WEMA 2A7PA 5JBFA 5IBXC 3TYCA 4IUGA 5HK4A 3U7VA 1J4EA 3UXKA 3ZM8A 3GRIA 3P2VA 4OV4A 2XUCA 5JQ9A 3LCIA 4DWSC 1E1EA 3PPFA 3VO0A 3HPSA 2O9PA 3SCPA 1Q6EA 3S5SA 2PODA 3ARYA 4X3ZA 1NAL1 4H2HA 4B4HA 2NT1A 5DX7A 4W89A 4Y90A 4OBRA 3B0XA 1Q6QA 1VFHA 3UVIA 2ZFAA 1GYMA 3BJFA 3MP5A 1XSKA 2Z1SA 4HP5A 1VCGA 1TPUA 1QATA 1HUVA 3F5JA 1NELA 3B4YA 3IWPA 1JUEA 4S3FA 1W2VA 1I0DA 2W0UA 2FZNA 3EOOA 5FEWA 2YCIX 3ZLFA 3LGEA 3VZZA 1DE6A 5I02A 3GNDA 4O8RA 3OA3A 2X1TA 4F40A 4LUTB 3A24A 4YTTA 1WDRA 1K8XA 3GWQA 4W7VA 4ZB2A 3LQLA 3PAOA 1QBBA 2B7PA 2J7FA 2IQTA 2ZZ3A 3WMLA 3ID7A 1PB0A 3EB4A 3ZJ6A 1U2YA 3PJTA 5D30A 3C2FA 1XYLA 1UKQA 4LNYA 5T8GA 3P0XA 3BZGA 3NZ1A 4I5UA 1TPWA 4O1EA 2Z00A 2CLIA 3VGHA 2UWFA 3BPWA 4BEQA 1US3A 3SCWA 1QO5A 4UTUA 2HCVA 1A5SA 1VBUA 4W7UA 4PMJA 3E5BA 4Z1CA 4XZWA 4DEFA 5FAGA 4URIA 1YNQA 3W1MA 3FSUA 3UG4A 4TMBA 3QZ6A 1QRQA 3G1XA 1VHCA 3WD0A 3OLGA 4LW7A 1QMLA 2ZUUA 3IV8A 5F4WA 3GD6A 4E8CA 4MPQA 5CCZA 1BXBA 4YTUA 3KLLA 4QQ3A 4NAEB 2VCCA 4DO6A 1Z48A 3L5LA 2VZOA 3H55A 2WXDM 4R53A 3VKAA 1LRQA 4Z1AA 1KM4A 3VCNA 1I2QA 3QZEA 1KCZA 2V5KA 3VGBA 1RLCL 2V82A 1AZ2A 3P84A 1P5BA 2P8BA 4GZEA 1FWNA 4D71A 1TTPA 2DORA 3WQPA 4ZVJA 5DRCA 5H8UA 1W9BM 3BV4A 5AYYA 1VBRA 4WSKA 5I5RA 4WXZA 2FFIA 3M0JA 1DE5A 4DJED 3W70A 4J27A 3TIMA 3GVRA 2VX7A 4QS6A 5A8GA 3TLLA 3VGFA 4EACA 4FX7A 3OGRA 1VIZA 1PS9A 3TJLA 3DI0A 2VOMA 4RNIA 4A3UA 4NNAA 5AY7A 3A4JA 2ZUWA 3T78A 5CAKA 2RFGA 3OTRA 2PDBA 4C90A 1H51A 2XU2A 3JU2A 1U83A 4PB4A 3TR9A 2Q8XA 3SRKA 2WNQA 1SVDA 5I3HA 5F7UA 3NWRA 3KZSA 3AMKA 1TMQA 1BHGA 1TIWA 1AMYA 4B4FA 3WMSA 5FJUA 4AWSA 5D2YA 3DGRA 1REQA 3NQ7A 4M7TA 4M5PA 2Z1KA 4L9ZA 1ITQA 3U2CA 1TO3A 2POTA 3CUHA 1HGWA 3QTGA 5HMEA 1DHKA 4PMXA 4P7NA 1XD0A 5FEZA 4PL1A 3HG3A 3B9NA 3TQVA 1CLXA 4R7OA 3NNTA 2WKLA 1CXLA 3L67A 4OVXA 4CLMA 2I5QA 3LPGA 3HGJA 1S2VA 5I79A 2DPEA 1DJXA 4JHZA 4BQ4A 2INZA 2W63A 1H09A 3ZSTA 2D69A 4ZO7A 4AW7A 2PDNA 3BG3A 3OHMB 3BURA 1SW0A 5D8WA 1X97A 4C1NA 3EKLA 2RDTA 1CXKA 1BYBA 1FRBA 3NVTA 2WVVB 1B3WA 4BZYA 3AIQA 4RJEA 3CO8A 3MMWA 4NHVA 2CZDA 3GE7A 3W1LA 2HZGA 3G6MA 5I3KA 3PZOA 3VA8A 2B81A 5ABTA 3LGDA 1UW9A 3RLVA 3M0IA 1VF8A 3FDKA 2YBVA 2PDUA 4GXPA 4GY0A 4JGDA 3B0PA 3NVDA 1U5VA 1V8EA 3MDUA 3GXTA 5KEZA 4LYQA 1SZRA 4HNOA 3VKBA 4H01A 5KZMA 2QDEA 2UY5A 1E56A 3PNZA 3N29A 4UXDA 1FOBA 4DF2A 1G7VA 1HKMA 2W61A 3GG1A 3MKVA 3LTSA 3URQA 4UFJA 3BAJA 4ZSTA 4RL3A 4D6GA 3CH9A 2ZBTA 1OX4A 5T9CE 4GLEA 3ES7A 1IGWA 1ISZA 5CPLA 4CVUA 4LV9A 2J7BA 1M9HA 4KFPA 1TV3A 1XWYA 1SO3A 4WY0A 2DW7A 3MV11 2EHHA 1RJRA 3W6YA 1XX1A 3EX1A 3GG7A 3OJGA 4NYUA 3FYPA 3OZPA 4ES4A 1MXGA 1S3TC 4JR5A 3S5OA 1OT2A 1UA3A 3CUGA 3GSMA 2OZ8A 1A3WA 1AL8A 5CSSA 1ICSA 2OT1A 4IG2B 4ZFMA 1BRLA 2XG9A 4M6UA 2XZ9A 2HTMA 1W3HA 4UQ9A 1V3KA 3CZJA 4JQ3A 1EUAA 2CLFA 7TAAA 2ZDSA 2FLIA 2J78A 3C3NA 5AFDA 1YMYA 4GGBA 1S5MA 2EBNA 2JQXA 3LI0A 4GC4A 1CCWB 3TJXA 5HDRA 1GOMA 1WUEA 3P8IA 1Z89A 3A9BA 4N9CA 2VX4A 4AYGA 3HA1A 5FJPA 5GPRA 4ALDA 4JYFA 1BG9A 2DIKA 3SGGA 3LUTA 3W26A 2O7SA 3FA3A 3TW6A 4KWWA 3MDWA 4TVCA 1OJXA 1Q8JA 2JIWA 3SI9A 3GH4A 3TN3A 3TFXA 1C3FA 2YZ5A 1E71M 4Y6GA 4EPBC 2WHMA 3S1GA 2OX4A 5AVHA 5D32A 4DQWA 2OX1A 4MF4A 3RCMA 1KLZA 3QQ1A 3DXIA 3GTIA 3N6HA 2Z4GA 1CTNA 4C1LA 4AIEA 4TX6A 3DX5A 4S39A 3GIQA 4GUHA 4LRSA 4AD5A 3DFNA 1RALA 4LSBA 4GYFA 1WOBA 3W1NA 5JIPA 1V3LA 4FNPA 3DI1A 3KHDA 1VZWA 3PTDA 3QHOA 5AYIA 4ZMGA 4NZ4A 3MVIA 3V0UA 3DBNA 2TYSA 3GXMA 3DC0A 4W8BA 2CBIA 1RCXB 4C6EA 2JALA 4XVDA 4PCSA 4H83A 4J2PA 3UZYA 2V5CA 4JHOA 4AF0B 4RV8A 3VIHA 4C5ZA 4WJXA 4L1GA 3KWXA 1TPVA 1W54A 4GG9A 3OLIA 4HD5A 2ZE3A 3E0WA 5K7JA 4PFHA 3F2DA 3LB0A 4Q8OA 4ZXLA 4AVNA 3IGXA 3ISIX 2O9OA 3UWWA 4AZBA 3OIHA 3AZSA 5EL1A 4LOCA 2A2IA 4RDVA 4A21A 2PTXA 1VRXA 3MPGA 3PZ9A 2WW5A 1C8XA 1IQ8A 3WUFA 3PBYA 3HFYA 2Y4SA 1R3SA 3UD6A 3WKZA 2GGJA 2YYTA 3I3EA 3TUUA 3AHTA 3BOLA 4B3KA 1FCBA 1GW1A 3Q37A 4IF2A 3WQ4A 3P93A 3T6CA 4DXKA 1H63A 3CMJA 3GHTA 3P81A 1UWSA 4X2RA 1ONEA 1GQIA 3FAXA 4F0MA 3TXVA 3UR8A 4JIPA 5FESA 5DMNA 1Q5MA 1TR1A 1BGAA 1J5TA 4DLMA 1E0VA 3W02A 5TQLA 2VQTA 4NAEA 4FLOA 4ONVA 2GSEA 4KERA 4OFCA 3CASA 4PUJA 3I7RA 2FQIA 3QR1A 3GFZA 4RE0A 3I4KA 5EMYA 2NLIA 4YJ5A 1AH4A 3ZR4A 3IPWA 1IIGA 4XUGA 3CO4A 1IXNA 1S2AA 3GH7A 3NQFA 1GEQA 1X8CA 2ABAA 3HQ1A 1QHPA 2J79A 2A85A 3M7SA 4O28A 4GUFA 2CHOA 2NQZA 2VX5A 2PRMA 1QOXA 1DL3A 4LB4A 5KZDA 3W2UA 1GG1A 1LWJA 1JYXA 1MW1A 3BJTA 2VGFA 4HQVA 1L6SA 1Q2SA 4OOUA 4JTAA 3UY8A 3QHNA 4D6JA 3IRDA 3M16A 1NQ6A 4O12A 2BXYA 1FH7A 5CLTA 2XVGA 3TQPA 1X6UA 1MO0A 1R3YA 2DZVA 5LNVA 5B80A 3AIVA 1FP9A 4ICMA 1UKPA 4H19A 1WXYA 2EPNA 3BCJA 3MJMA 4KEMA 3ICJA 1TQXA 1CGWA 2DZAA 4O57A 3CUIA 4R27A 1XW8A 3NL5A 2CIPA 4MVAA 4US5D 5M3WA 3NQMA 4LVDA 4K6AA 4Q8MA 3FIGA 4RZBA 2WCAA 3STCA 4ROPA 1KCXA 1H49A 1ZGDA 1UR3M 1IF2A 4S3BA 1B9BA 1Q4WA 4QM1A 4UTWC 3DYMA 4U31A 1JYVA 2X1SA 3ZR6A 2BXVA 4I9JA 5HUPA 3LRLA 1Q6FA 1J01A 1RQEA 5C54A 1MNSA 2BGSA 3MI2A 4IJRA 4R33A 4IMCA 1F6KA 1P0BA 2OGYA 4QEHA 2X2GA 3MKCA 5D9MA 4ZSUA 1ZBCA 3ABXA 1E4MM 3MMDA 2Y7EA 3L12A 4P8VA 1DWJM 2OSWA 5AECA 1XH0A 4LVBA 2WVVA 1SJCA 3UEQA 2R1NA 4ICNA 4D6DA 2TAAA 4HZ7A 3O0FA 1MFVA 2DT0A 2V2DA 3IEBA 4HPNA 1XDMA 1QPNA 3AUJA 3IAQA 3P61A 3PHAA 1XS2A 4H41A 1XGDA 2MANA 4K2SA 1WDDA 1HX0A 1M5WA 2VFGA 4H7CA 2OYLA 4ZZ9A 1MNZA 2A3HA 3PJXA 3GBDA 4LCRA 4GI6A 3GVQA 4PTWA 1Q85A 1HZYA 3ZQ9A 2BB0A 3TSDA 3MZNA 2XINA 2IPGA 1UH4A 2CPUA 3IVSA 3VM7A 1UJQA 6XIMA 1P0DA 3G77A 2WSPA 3NQVA 1C7SA 5DT7A 1EIXA 3H53A 3G8EA 1V79A 3AOFA 2PDCA 1RVKA 2DSVA 3H7UA 1OC5A 2ISSA 1CECA 1VB9A 2OMAA 4HB7A 1U1HA 4KGJA 1W9XA 2D3NA 4WGXA 5D2VA 3RK8A 4I7WA 4UTWA 1R3WA 3WLOA 2NV2A 2DVXA 3QM3A 1TUFA 1ZHAA 1RBOB 3GDBA 4KF1A 4KCTA 3BXWA 1WB0A 5GJMA 1MEWA 3AHZA 3WDHA 1KGUA 1TWZA 2PDPA 2Z1XA 3WBYA 2WMFA 4H6QA 2CHNA 1QW8A 3NQ2A 1FWAC 1SO6A 4L4PA 4OWGA 3FEMA 1GQLA 2YKKA 4A22A 2L5HA 3V7PA 1ITXA 3NQAA 2KAUC 3QGAC 1J9YA 4GI9A 2J8TA 2EAWA 4WSHA 2REQB 1CW2A 4RNFA 5ABEA 1KTCA 1YNYA 4OQVA 3GM8A 4H8VA 4D1IA 3H2CA 2FDMA 3AHXA 5LIKX 4IZGA 4J3WA 6PTDA 5A3HA 3BOFA 4M1RA 1OCBA 1RPXA 2O4MA 3FYOA 4ZOAA 5AHLA 1UIOA 1CBGA 3UZZA 3ZT6A 1D7KA 3TU9A 4MZ8A 2PZNA 4AZHA 3JW7A 4A3QA 1XRVA 2QV4A 3BLFA 4XO6A 1CLKA 4OBSA 3CPUA 1SSDA 4QP0A 2DEPA 5LGXA 4XZ9A 3MO7A 1KM5A 1TPB1 1KXQA 1NP2A 2VTFA 3W7LA 1Z9AA 4IGMA 1I1WA 2TSYA 5BWAA 5HJYA 1AQ0A 3VXGA 3UG3A 3S8HA 2YL6A 3TH6A 5FJJA 1W1ZA 4O50A 2XGBA 4MY9A 4ATWA 3EDDA 3WK2A 1H7OA 1IEXA 2OYKA 1LBLA 4DX3A 2IPFA 1EP3A 1W8GA 2WVSA 4NKCA 2Y70A 4TV6A 2DUXA 2Z26A 4AF0A 1O5QA 3V35A 2R1MA 4L7ZA 3ABRA 2EPHA 1TTJA 3EOEA 1GQJA 3HG5A 2LLEA 4RKAA 4DM2A 1DIEA 3MUAA 1X96A 1GOXA 3WQ5A 1ZBKA 4Z2IA 2ZOXA 1ZJAA 3ZYZA 3TWAA 1BPLB 4JCLA 3SB0A 4IMAA 1MYRA 2XSBA 1XDJA 3GH5A 4UFLA 3TA6A 5G2HA 3O16A 1DJWA 3M64A 2R24A 4DZIA 2C0HA 4MOZA 4MY8A 4JX4A 1XHGA 3HOJA 5DCDA 1KD0A 1XG4A 2J25A 5GNYA 3WF1A 1JFHA 4XTDA 1UH3A 3CQJA 2I14A 2QCDA 3KOYA 3WBEA 3QVQA 4UB9A 4XO7A 5LA2A 1N7KA 1FH8A 4JL1A 1MUMA 2P76A 4YTQA 4RV3A 4JIHA 3GDRA 1CYGA 3USBA 2BLEA 3B0VC 4S3AA 3QSRA 3PPHA 5I3DA 3THAA 3FK4A 1E6XM 5IOBA 4R9OA 3WDRA 1HKIA 1JCNA 4CQAA 1TJ0A 3N12A 3WH9A 3KCJA 3PBUA 1XINA 2ONEA 1QNQA 2OCZA 3GNNA 4ZO8A 4XZMX 1C8YA 3M47A 1NH6A 2DSKA 3TN6A 4YIWA 4PR4A 1WOAA 4LC6A 3VNKA 1CGUA 3KWSA 1GJUA 4HSNA 5HATA 4Q4QA 4GO8A 5T91A 2ZX6A 3B4UA 4XD3A 1GHRA 6REQB 4PMRA 2WJZA 3N2TA 3NYDA 4IQDA 2VGBA 4HIBA 1SYTA 4X60A 4J1OA 2DP3A 3GU9A 3NXLA 4JNZA 3LBCA 4FXRA 3AZTA 3T2PA 3WF2A 2JGYA 1A0EA 1YKWA 1KBLA 4BI6A 4RZ4A 4ASTA 3S9YA 5DO8A 3ITXA 3GAKA 3W7GA 3CLMA 2OOGA 1KRAC 3PANA 5CGTA 3WMCA 3DIPA 1WZMA 2GVJA 1WQ5A 4XK2A 3KL0A 1TX0A 1F3WA 3R0DA 3WQEA 2ZX7A 4C7FA 4TUFA 2DT2A 4O1AA 4DJFC 1SW7A 4PUUA 5G1TA 2NW0A 9XIMA 1J93A 1SMDA 1Z3NA 3PG8A 2Y5EA 3JRKA 4G6CA 3LPPA 2QUNA 4QG6A 2EPOA 5CC5A 3CB8A 3W82A 1FWFC 5A6JA 1G4PA 4AY8A 2TODA 3GNPA 5BMXA 3U2OA 3BGAA 4FAMA 2HNHA 1A4LA 3M5VA 3S1VA 1XYMA 3DERA 1AZ1A 1V51A 3IGUA 1CENA 3VTRA 4M7SA 3KTSA 4ERIA 1XPGA 2G8ZA 4PMVA 5IHRA 1ZAIA 2GZXA 4NZ1A 2QDDA 4GC3A 3WD3A 5BOOA 4Y9AA 5H6HA 1BKSA 3ZVHB 1P4CA 3AISA 3KUMA 2QULA 2CWXA 5C9XA 3RM9A 3R1ZA 4LCSA 1RCOB 1K8CA 1UP3A 4IFRA 1XYAA 1UZ1A 3MI6A 2VZUA 5XIAA 4AD2A 1X1NA 3WF0A 3T08A 1K4GA 4AFYA 3WCZA 3VGEA 3N1AA 1D9EA 1DJIA 4MNLA 4O15A 4O14A 4K36A 4EANA 3J7HA 2Y61A 4HHPA 2GFTA 1HKKA 5I00A 3TK7A 2DZBA 1RLDA 3R43A 3HGOA 1R9XA 3GNOA 3S46A 1LOQA 1KXHA 3CGTA 5HR6A 2ACRA 3GDMA 4PMNA 4Z17A 3CHCA 3S2CA 3WNKA 2HPIA 1HTIA 3GVVA 1W1TA 5EBAA 4DNMA 2VI0A 2WHKA 5EMKA 1X6LA 3PPCA 2IW0A 4GKLA 3W83A 1E15A 3UR7A 3GKAA 5CPQA 3W75A 1D7FA 1UP0A 3L65A 1KB3A 1XIGA 1KRMA 4MFEA 3W7CA 1HNYA 4ZFCA 2FJUB 1POJA 1UH2A 1S5WA 3LERA 4P8UA 2Z6IA 1SFJA 4CQCA 1O60A 1QPKA 4CUCA 1S2TA 4QRNA 3BSHA 2ACQA 1V08A 3TX9A 5M2FX 3M0MA 3H4GA 5CZ0A 2XSXA 4BK9A 3RRAA 3SCRA 3OG2A 1UR0A 4XB3A 4N9DA 1C92A 1W1VA 2Y8KA 1T7LA 3E0FA 3NUKA 1G7UA 1ZNNA 4UQDA 5LIWX 3FV9A 1QW7A 3S83A 1LWHA 3WLKX 3N19B 1WX0A 3IIVA 2IKGA 1EX5A 2MUCA 3WLIA 1V6VA 4D8LA 3W7IA 1RP8A 4GJ1A 3WJXA 3PS7A 1JQXA 4A3RA 3RN6A 4CQDA 3WBAA 3T0DA 4LUIA 3UYIA 4INFA 2WZEA 4KT2A 3RNDA 4JXCA 4XISA 2OEKA 5AHFA 3VIGA 2X7WA 4TV5A 1P6WA 4FALA 2HVMA 5A6TC 2ASHA 4IIDA 2HMCA 3D3FA 4N7QA 4RDWA 3BDKA 4ZL1A 3LU2A 3W9ZA 1OGSA 2BFGA 4HPGA 3WO8A 1GKRA 3WH6A 4DUWA 4NSBA 1KM0A 2CLPA 2V3DA 2PLKA 3MUZ1 2CEQA 1G4SA 1GWJA 2X41A 3A64A 1SZNA 3LLFA 4DO4A 1IE7C 3OYXA 1EF2A 3C2OA 3AFBA 3BJSA 3E2VA 4R7WA 4DVOA 2RKXA 1U5JA 3YPIA 4JFWA 4UR8A 4WLCA 3ABOA 1PCWA 2QGYA 4MWAC 3ANVA 3BE7A 1FFRA 3MHUA 4D9PA 4NRRA 2YDAA 3R0KA 4E2DA 3S5NA 1V0LA 4JAWA 1EZ2A 2P88A 2AL1A 3L4YA 3CIVA 1VEMA 1VJSA 3EXRA 3ITCA 4TO8A 3F4VA 4IMDA 3URBA 4O1DA 1H4PA 5IDIA 3VI2A 4M24A 2OSXA 5A2AA 2F6XA 3WLHA 1TV5A 3VOGA 4WRHA 4X0NA 1V6TA 3WLMA 4YYCA 1KFCA 1XLEA 4FF5A 2Y8UA 3NPUA 1OD0A 2BSLA 5DMMA 1XFCA 4S3GA 4O1FA 1ITCA 4GQGA 3CV6A 1JFXA 3TV8A 2GYIA 2INFA 5CPOA 2CLMA 2R1LA 2E6DA 2GVLA 3IJ6A 3IUDA 2EKGA 3W2NA 3M6DA 4A8NA 4LS1A 4PMZA 2ZZ6A 4CCDA 4LVFA 2V6AA 3MWAA 3KAOA 4GMEA 2EG6A 2YL8A 3VDBA 4W9TA 1QUMA 2ZXQA 3ALFA 1GPFA 1T5AA 2NX1A 5FA5A 3LXCA 2NQLA 3WQVA 4FSAA 2E25A 4FNRA 1XCFA 4B9ZA 3TROA 2OPJA 3M4HA 3WEZA 1D8WA 4H9UA 1OCNA 4LVGA 2P1FA 4PUNA 1VHNA 1BLIA 1NWRA 4KWUA 3E3HA 4DBWA 1JVNA 1F8IA 2X0HA 2JEPA 5D9NA 3K4DA 3T2QA 3UY7A 1AW1A 4L80A 3U4AA 4NZ5A 3W85A 4MJ2A 3AWNA 4UQCA 1E6NA 1GPWA 4C6CA 1PX8A 2I57A 2VYOA 4W88A 3KCLA 3OLDA 6REQA 3AWOA 1EH9A 3W84A 1M7JA 5D03A 4QE5A 2FB3A 3QFWA 1ISYA 2DGAA 3FW6A 4NU7A 2ZRWA 4FMVA 1K7EA 1NTHA 3VGDA 2GLKA 1DWIM 1XLGA 4QEEA 2WJDA 4AIBA 5AKQA 3W7MA 4DBSA 5E1QA 1W31A 2WCGA 2CKRA 1PKYA 1GKQA 5FSEC 5A8MA 3TOYA 4ZQOA 2HK1A 1U1UA 2VC7A 2ZIDA 1MFUA 4JIQA 4GQBA 3TTYA 3NQ8A 5ABHA 1H0IA 1SR9A 1R2RA 4EIVA 4QDMA 5XINA 1K02A 3PZMA 4NRSA 3WD4A 3IGSA 4DJEC 2BGQA 2WBKA 2FH6A 2ICSA 1ISXA 4H8HA 1XGZA 4AD1A 1E4LA 5LNUA 1JULA 2GDVA 4AC7C 2VT0A 3EA3A 2WPBA 2O92A 1FWBC 1FUYA 4Q8QA 5BROA 3VOIA 4BQ3A 4ZA0A 2VGIA 3WFAA 3ARSA 3UCCA 5CG7A 2OQHA 4JTKA 3KDOA 1XLMA 2YA2A 2G4JA 3PSVA 5C7VA 1YRRA 2H9AB 2PMQA 8A3HA 3BG5A 1MXSA 4Q8WA 1PTAA 4QAWA 2YIHA 1HFBA 3ZVHA 4FOUA 3CBWA 3CHEA 1AJ2A 2WLYA 4WOQA 1XCXA 2HISA 4DYEA 4NZFA 3K2GA 4FZIA 1FHVA 4CN6A 3GR8A 4DYKA 3N15A 4K7YA 5DY2A 4E8DA 1O5KA 2G97A 4AB4A 1H2JA 1QWKA 1F61A 4LY8A 2VD8A 2BNJA 2Y7DA 3E2SA 2CZ5A 3B3DA 2Y7FA 4EF8A 2XDFA 2PD9A 3S2NA 3T40A 1U33A 3OOQA 4Z2KA 2WPGA 2ZCGA 2NXGA 4NVTA 1OFEA 3EB3A 4REQB 5HQMA 2CITA 1RUSA 1OG0A 2ZZ1A 1VFLA 1EZWA 4NILA 3Q94A 1HJVA 1M7PA 5A94A 1WCGA 4C6MA 2FTPA 1VRDA 3E38A 1UKTA 1E43A 3N2BA 1H60A 3PTQA 3E12A 5M5DA 2NVDA 2CU0A 1AD4A 4I7UA 2PDWA 1X7FA 4PBGA 3WNMA 1R7AA 1ZPTA 2HVNA 3W25A 2GSHA 3PUEA 4Q7BA 4AMAA 1EBGA 1I2RA 3KOXA 3FJNA 3T0TA 2J7GA 1OF8A 4IL0A 3XINA 3EKGA 1GVSA 4I9AA 1WNOA 2WMKA 4HZ8A 1CNVA 1TVLA 2FPTA 2FVKA 1QTWA 3VDGA 1ZALA 1S2UA 2Y88A 2I5IA 3BK0A 3UWYA 4JQAA 4LRTA 5JUVA 4TR9A 1FP8A 4MB1A 1WAUA 2QUUA 3IUHA 3LHZA 4JHMA 2J9XA 3PR2A 3WG6A 1PZ1A 3FA5A 1ZCCA 2HRWA 3UQNA 1LDCA 3Q2DA 2XIIA 4PODA 4HMEA 1BGGA 1W2PA 1F6YA 1XLJA 4OUIA 3GU1A 3R94A 2VCAA 4F0LA 1RAKA 4HK7A 2DZSA 2NX3A 1NWUA 1A5OC 3ABQA 3TEVA 4NZ3A 3BO9A 1VLWA 1XLIA 2YDQA 5EA9A 4DI9A 3T05A 2PC4A 1SJAA 3KRBA 3EXTA 3QZAA 1EXBA 1NF7A 3RPTA 3NCOA 2YCEA 4UR7A 3GHSA 3UVAA 3VD4A 4DM1A 2NSXA 4YL2A 2XVNA 4ML9A 4TX9A 3XISA 4AHOA 1LJYA 3B8WA 3QJAA 2HNEA 4AC1X 3C61A 2NLYA 4Q4OA 9RUBA 5FF2A 3TYUA 3IIPA 2J47A 3CT7A 3G8RA 4FP1A 3MC5A 4GACA 4D1JA 4JX5A 2XN0A 3EZ4A 2H8ZA 3ECQA 3BLDA 2DQXA 1XC4A 3STPA 3LHWA 3DZ1A 3NDYA 2V63A 1W9PA 4ECLA 3GVWA 2E9LA 3EX2A 3HIJA 1O7AA 3SR7A 3MUIA 4PUWA 5A1AA 3GXPA 3ARPA 5C7HA 5EMLA 2WMIA 2AKZA 1Z32X 3TKFA 6ALDA 2G0WA 3W29A 4FLQA 4B5XA 1JNEA 4PTXA 3F4NA 2HVOA 1ZB5A 2YCLB 4LWWA 1PZ0A 4NI8A 3VK5A 1VBHA 3M5YA 3M5ZA 4X22A 4JKKA 2A21A 4TMCA 5HWMA 3ANUA 5LHEA 4W93A 2OZ3A 2QJIA 1K9FA 4IGHA 2J27A 5CJNA 2F84A 1HJQA 1HO1A 4YWIA 4B16A 3DFHA 3QV8A 4RXGA 3UFYA 1ICQA 3SUVA 3DHPA 1R85A 3UG8A 2V5LA 3RU8X 1DEDA 4IOTA 3W7OA 3CUZA 3KTCA 2ABBA 3QPZA 4Z2GA 1QR7A 2UY4A 3NQEA 3SN4A 2WCSA 3LCLA 4B5SA 3R10A 3CYVA 5EKYA 3MKKA 4WEVX 5AZ0A 1JUKA 3NL3A 4Y2WA 4QBXA 4B2DA 1XLLA 4IMEA 5AYZA 2Q3RA 4IWWA 3RMEA 4HA4A 1UASA 1W1YA 4O1BA 2F2HA 4HTYA 2Q02A 4LT9A 3MYOA 2ZKMX 3TYBA 4XSLA 4ZOBA 1PIIA 5CPNA 4HOZA 1IHIA 3NQ6A 3CZ8A 2J9ZA 4D6IA 4WQ6A 1JZ6A 2Z2UA 3R58A 3LV5A 4YS1A 4HNUA 3OW1A 3QPYA 2PGFA 4IPIA 1BD0A 2D0GA 3KFTA 3QMSA 4L61A 3L4WA 3NM3A 3RCNA 3THQA 1TV8A 3AXKA 2NV9A 4GXMA 4PMOA 3MUCA 5T26A 3LLXA 1JD9A 2HE5A 2ACUA 2W92A 5BWFA 2OXNA 4ZOCA 3LD5A 4OOZA 4UFIA 4NT0A 1J0YA 1RZMA 2VC5A 4E2BA 4E4FA 4H1ZA 1ZJIA 4OU1A 1JZ8A 1GVIA 1XRSA 4C6IA 4MKVA 5EU9A 4O0ZA 3ARWA 4QLLA 2CBVA 2ISDA 3SGZA 4UTMA 2WO5A 1LM1A 1E40A 4CEXC 4UNKA 1F73A 3IJ8A 3TZFA 4FEZA 4JDYA 2NUXA 1IEIA 1JD7A 3V1PA 1AQHA 3LNPA 1YXYA 2OZ0A 2VEIA 2WMJA 3L0KA 3LI1A 4RE3A 2A7NA 4LYKA 2QF7A 1DXEA 3GYCA 2CHRA 3L5AA 5E0FA 2FHBA 3T8QA 3H21A 4I6VA 1B4KA 3VC5A 4H3DA 3I6RA 4JFTA 3DYPA 5I09A 4UC5A 3RLUA 2YLLA 2IPWA 3MSDA 5DANA 5G1MA 2NZLA 1C7TA 3R25A 1FWWA 4O8AA 4WXYA 4EVZA 3U48A 1OFAA 3NZGA 1J0ZA 3KZPA 5J04A 4HU4A 1KM6A 4EXAA 1C9DA 3IGHX 4EP8C 4KRUA 4LGXA 1Q4NX 3IJQA 3UWZA 4Q4MA 2ZQ0A 4Q6JA 4NJJA 4F3HA 1HJXA 2A3EA 4C7DA 3LCFA 1GCYA 2E5BA 2UBPC 2Z27A 2FZ9A 1PAMA 3Q58A 2QVHA 1QFEA 4LH8A 1IZKA 4MADA 4AWEA 2WWDA 2H9AA 1BVNP 4UQBA 4V27A 1BAGA 1KXTA 1J79A 7XIMA 1B90A 4S23A 3LK6A 1ZL1A 1CT5A 3BVJA 3PY2A 3PB2A 2J62A 2AGKA 1X98A 3FJ4A 1A0DA 3O7UA 1TE6A 1XLFA 4WKHA 5I77A 3VABA 3MP3A 3W7JA 4JTGA 4LC8A 3HU7A 4GK8A 3VDAA 1W9DM 3C0SA 3CIXA 4UCGA 1TX2A 3F1QA 1DWGM 4ZQNA 3STFA 1H11A 1T8QA 3C0JA 1GZJA 4REQA 4BWLA 1RY0A 3GFXA 1JI2A 3HQOA 4ORIA 3G22A 1XIDA 4S1FA 3CTLA 3C86A 5H8MA 2TPSA 5EMMA 1JCMP 2FHFA 4O0KA 2YXXA 3D46A 3L23A 2QYGA 2W4XA 1CX9A 2P0IA 1UD4A 3RMJA 3UF9A 2PWHA 3N6JA 3VINA 4ZE4A 1UPMB 2A6LA 2HK0A 1C29A 4CNUA 3BAYA 4C65A 4H7VA 2A3CA 1EO5A 4JN6A 5FEPA 4K39A 2QPSA 3RJXA 2E8ZA 2RHGA 1WZLA 2G3MA 3W86A 1OIMA 1RD5A 3PZNA 4LBRA 2G96A 2W67A 3M9YA 4I5XA 1Q3NA 2VEGA 3R7MA 3NTYA 4HMDA 1IZJA 1RH9A 1DTUA 3AYTA 1I0BA 1ICPA 5B7YA 4IIFA 3R12A 3VX0A 3ZO9A 4Q7NA 2QT3A 1MEHA 3BW3A 3FYYA 3GUWA 1X38A 1R87A 2WMHA 4Q7IA 1OEPA 1UD3A 1A80A 4M19A 2OVLA 5FF4A 3G1YA 2O9RA 4S2BA 4IX2A 3A4XA 3LOTA 3LCXA 3DECA 5C0QA 5A5WA 4AVFA 3WY1A 1LQAA 4NXKA 3NPWA 2OEMA 3A4WA 4KCUA 4F48A 1YNPA 1J6OA 4B5VA 7REQB 1A5UA 3H23A