2Z7GA

Crystal structure of adenosine deaminase ligated with ehna
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational change of adenosine deaminase during ligand-exchange in a crystal
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Adenosine deaminase
total genus 142
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2z7gA00
1W1IE 4DIAA 2EG7A 3BE7A 1FWBC 4HK5A 2Q01A 2E1WA 1GKPA 2Z4GA 4GY7A 4CEXC 3QY7A 3NURA 4C60A 1E9YB 1K6WA 4KESA 2YB1A 3S4TA 3TNBA 3JZEA 3GU9A 2R1LA 1M7JA 4IQJA 4IF2A 3V7PA 4DI8A 4HK7A 5CH9A 3IJ6A 3F2CA 4I6KA 1S3TC 4CQDA 4D8LA 4HK6A 4IGNA 4KERA 3DCPA 1ADDA 1POKA 1RK5A 1WXYA 2GWNA 2O4MA 3F4CA 4H9VA 1FWHC 3B0XA 3PANA 4QS5A 4C6PA 4PCNA 4LH8A 1EJVC 4WGXA 4C6DA 4IH3A 2GSEA 1FWJC 1A5NC 2PLMA 1RJRA 3HPAA 4EP8C 2OGJA 3GIQA 4IFKA 2AMXA 4KEUA 2DVTA 4LAOA 4QTGA 4EPDC 3MJMA 3E3HA 2PUZA 1KRMA 4MUPA 4C6KA 4DNMA 2P53A 2Z27A 2AQOA 3GTHA 3URBA 3FEQA 3ITCA 4OFCA 4TQTA 2WJDA 3QGKC 3MDUA 3UR5A 4NI8A 1R9XA 3LY0A 4J5NA 2QVNA 1O12A 4V1XA 1UMLA 1V77A 3EWDA 5E5CA 5FSEC 4NP7A 1POJA 4C5YA 2R1PA 3DUGA 3CJPA 2Q09A 3GG7A 2VM8A 3UR2A 4GK8A 2WJFA 3T81A 4EPBC 3WYZA 1EJTC 4L6DA 2D2HA 4G2DA 1NDZA 3QY6A 1YNYA 2XIOA 3SO7A 1ITQA 5HMDA 2HPMA 1YBQA 1FWFC 1YIXA 2QPXA 4C6NA 2UZ9A 3HM7A 1UBPC 4LFYA 2RAGA 1A5KC 4Z42C 3UF9A 3CS2A 2HBVA 3E0FA 3MPGA 4ZSUA 3NQBA 1J6PA 1V7AA 3C86A 4PBEA 1P1MA 1EZ2A 2BGNE 3A3XA 1RAKA 1ITUA 1GKRA 1FKXA 5HMFA 1J6OA 1FWEC 2A3LA 3GUWA 3WZ0E 3GTIA 3RHGA 2YXOA 4PE8A 2FTWA 4XD5A 2Z26A 1K1DA 1J5SA 4JOMA 3LGGA 4M51A 3T1GA 4DI9A 1PTAA 4IFRA 4GXWA 3RYSA 1V4YA 2ADAA 4ICMA 3RN6A 2ZC1A 2D2GA 3K5XA 4IG2A 3N2CA 2IMRA 3GU1A 4RDYA 2OB3A 4IFKB 3R0DA 4H9UA 3K2GA 1YRRA 4XD4A 4DZHA 4EPKA 3E0LA 4J2MA 1M65A 2Z00A 1EJSC 4QRNA 2DVXA 3UPMA 1BF6A 3ID7A 2ICSA 3CAKA 4XAFA 1P6BA 1ONWA 1NDYA 1QXLA 3FDGA 2Z2BA 3GTFA 1M68A 3OODA 3E74A 4C6JA 1XRFA 4CNSA 2Y1HA 2HPIA 3E38A 3DC8A 3UBPC 4C65A 4H9MA 3IACA 1EJWC 2QS8A 2VC7A 4KQNA 1PB0A 2UBPC 4XAYA 1VFLA 3OJGA 4L9XA 4GBDA 1RJQA 1R9ZA 1NDVA 1ZZMA 2FVMA 2EG6A 1NDWA 4WHBA 4LCSA 4C6OA 2R1MA 4HJWA 1DPMA 4KETA 1UIOA 3LSCA 1UIPA 3KM8A 1NFGA 2YZ5A 1YMYA 4LCRA 4QROA 1RA0A 1XGEA 2VHLA 1KCXA 3TN3A 3MVTA 4EPEC 1XRTA 4E3TA 1K70A 4CNTA 2OODA 3A3WA 4IGMA 4BKNA 4C6QA 3D6NA 3T8LA 4LCQA 3IRSA 4KIRA 4C6EA 1FWDC 2VUNA 1I0DA 4H01A 5G4HC 4LAMA 3LGDA 4CNUA 2Z7GA 1A4LA 1FWAC 1O5RA 1V79A 2FVKA 4KEZA 3AU6A 4NG3A 3EWCA 3OU8A 3K4WA 4GZ7A 4XAZA 1I0BA 4GYFA 4R85A 4ERIA 3LS9A 2P50A 3LU2A 3MKVA 4AQLA 4BY3A 4RZBA 3F2BA 4XD6A 5AKQA 3URNA 4IFOA 3GTXA 4B92A 1A5LC 3LNPA 2FFIA 1ONXA 4I6VA 2HNHA 1KRCC 3S2LA 4C6FA 1HZYA 5A6TC 3PAOA 4J35A 4C6LA 4G7EA 4ERGA 1YBQB 3S2NA 4H9ZA 3G77A 4UBPC 4LANA 1EJRC 3TN6A 4BJHA 4F0LA 5HMEA 1P6CA 2Z2AA 3ISIX 1PSCA 4GC3A 1J79A 4WVXA 3AUOA 2FTYA 4LALA 3S2MA 3ICJA 2W9MA 2ANUA 3RCMA 3IARA 4AC7C 4B90A 5LXXA 1A5OC 2R1KA 4DZIA 1EF2A 2GWGA 2I5GA 1A4MA 3GIPA 4RDVA 2O4QA 4INFA 2QT3A 3AU2A 4C6BA 2E25A 1XWYA 3IGHX 1FWGC 4R7WA 4KF1A 3OQEA 4H00A 3F4DA 4DO7A 1EJUC 2AQVA 4DLFA 2WM1A 2G3FA 2VR2A 2Z28A 2Z25A 2F6KA 3HTWA 4ZSTA 4RDZA 4RDWA 4CQCA 1KRBC 2R1NA 4C6CA 2PGRA 4F0RA 1JGMA 1GKQA 3IV8A 2DVUA 4V1YA 3NEHA 3S2JA 1QW7A 4YIWA 2BB0A 4GOAA 4P5UA 1E9ZB 3B40A 4RE0A 4H9XA 3MVIA 1EJXC 3O0FA 1RK6A 1FKWA 1V51A 4QS6A 4C5ZA 4GX8A 1EYWA 1WXZA 3OOQA 3FDKA 3IPWA 4GY0A 2WJEA 4B91A 2HQAA 2GZXA 4H9YA 3LA4A 3URAA 1RA5A 1PO9A 2CZVA 4C6MA 4XD3A 4QSFA 2Z24A 3QGAC 4GY1A 3LSBA 4DYKA 4F0SA 2OQLA 3MTWA 2YB4A 4B3ZA 3PBMA 3F2DA 2EG8A 4LEFA 4R88A 3TN5A 1FWIC 2PGFA 2KAUC 3TN4A 3MSRA 3PNUA 2I9UA 4LAKA 2HBXA 2PAJA 3GRIA 1R9YA 2D2JA 3PNZA 2GOKA 4H9TA 4C6IA 3OVGA 3MDWA 4PBFA 4CQBA 1KRAC 4ERAA 5FSDC 4XAGA 4HA0A 3A4JA 3GU2A 1IE7C 2VC5A 3O7UA 3SFWA 4KEVA 3WMLA 4CEUC 3E2VA 4UB9A 2Z29A 3EGJA 1A5MC 1FWCC 2OOFA 4PCPA 4DLMA 3B0YA 4IG2B 4G7EB 3QY8A 3URQA 3ORWA 1RJPA 4GX9A
chains in the Genus database with same CATH superfamily
4QQ3A 2C1HA 1EDTA 3H2CA 3EA1A 5AC6A 1U5VA 3NURA 5LGZA 1E9YB 3SCVA 3JZEA 2R1LA 1I2PA 4ICCX 4UR7A 3Q65A 4LW7A 1IXQA 1EP3A 3DCPA 3MHFA 1TWWA 1EUNA 1POKA 1XIFA 1TMLA 3VZZA 2QZRA 3DKLA 4MY9A 4QE5A 4TIMA 4QS5A 4LH8A 3BARA 3K4AA 3ARTA 4C6DA 1C9WA 4NX5A 3RPMA 3PSVA 1O1ZA 4E38A 4X0VA 5DN1A 1U2YA 2PDBA 4EACA 3H55A 1PTGA 3HQ1A 3W2LA 3ITVA 3CUIA 3ZO9A 2DVTA 3C4UA 4QTGA 4CGTA 1TIMA 2Y8UA 3II1A 4N9DA 1KRMA 3S1VA 1NOFA 3B8UA 1XIDA 3I7QA 2OPJA 5AYXA 4CD7A 1F74A 3ITXA 3RX4A 1XSJA 1IZCA 2WM0A 2NT1A 5DLCA 4IMCA 3D46A 1SR0A 4OJYA 4FX7A 2YCLA 2VXNA 2PEVA 2ZE3A 3W27A 3CL6A 4MKSA 1XJBA 2QDHA 3NQ7A 1H5VA 3T81A 3MCNA 3WJXA 1JYXA 2YDSA 4G5DA 4JIEA 2J4GA 4HA1A 4DZAA 5JXQA 5F2LA 1SFTA 4DJDC 3BG3A 3CASA 3L21A 4LS1A 3ME3A 3ZWTA 1EDGA 1Q7ZA 1GPWA 4Z42C 3UF9A 3P7YA 1EFZA 1VPQA 1E40A 3BSGA 2HBVA 6A3HA 3W2JA 3GXMA 4LC6A 1TJRA 3CXOA 4JGDA 5FJUA 2YX0A 3C5QA 5HMFA 2X7VA 1VF8A 2WW5A 2XN2A 3LYEA 5CBIA 2OU4A 4KCVA 2OKTA 4OU1A 4FF5A 3IGXA 1OADA 3T1GA 1ITXA 2RDWA 2P88A 2FMOA 3BSMA 3KBJA 3OLEA 3SY8A 4OIFA 3RLVA 1R3WA 3L2MA 1JZ2A 3NYDA 4DBUA 2XISA 2E3ZA 1W8GA 4CCCA 2XH4A 1KCLA 4H1ZA 4TO8A 5I2UA 3L5MA 2I5QA 3VIJA 3OQ8A 1TTQA 1DWGM 3ID7A 2A2IA 4O4VA 4K8EA 2XZ9A 3IJ9A 4S39A 4AZHA 5GJMA 4YN5A 5IDZA 2QJHA 4A4AA 3MZ2A 1M68A 2NLIA 4IGSA 4W8LA 5J5DA 3FOKA 2FVLA 1FTXA 2HPIA 4EAMA 1EB3A 2GQ9A 3ITGA 3AHYA 5AC8A 1FCUA 1RQHA 1BKSA 4P61A 3F03K 1X38A 3O05A 5AOUA 3W00A 4D6CA 2BASA 4WF7A 2H8ZA 3LSCA 1JCNA 4O1FA 1LUCA 2X09A 4E0CA 1G01A 3UZJA 3BL3A 4CD8A 4HNUA 1EP1A 2J7BA 1VS1A 1LF1A 2WB5A 3TN3A 4MB5A 3H2MA 1YLVA 5GNZA 4FOJA 3IIXA 1J96A 3WF4A 3PBVA 4FXRA 4QE4A 4EXAA 2ZDRA 5D09A 2PGWA 1LL4A 4V33A 3A64A 4IMDA 3R79A 1VEMA 1VQTA 4LV4A 3S47A 4I5XA 3AU6A 2NV2A 4JHMA 3B8DA 5DXXA 1J0HA 1EEXA 1O60A 4UMAA 3LU2A 2YOCA 2VNCA 1DJQA 2GPTA 5FL1A 2G3MA 2WZEA 3LGEA 2FFIA 2B0MA 3UWVA 1T40A 2VOMA 5KZ6A 4XTIA 4QITA 3M0VA 1VEOA 1PZ3A 4ADUA 3KXQA 5FOOA 4XVEA 2RGMA 3VIGA 1VFMA 5AYBA 1QUMA 4JL2A 1GOWA 3WH5A 1LYXA 2Y6ZA 3JU2A 1OYBA 6TAAA 3IUIA 3EXRA 4TTUA 4O1AA 4ADTA 1PS9A 3EB2A 5DRIA 3S2MA 2YCJA 2Y61A 2GVJA 2YBVA 4B90A 1FCQA 2XINA 4MZ8A 4WR3A 4XAPA 1A5OC 3ARRA 1TUXA 3SM0A 3VUPA 3W7DA 4INFA 3L2LA 1NFPA 1F3XA 3GX9A 3DFPA 3S83A 3GBEA 2DU2A 4LUSA 1VJSA 1UWQA 3BW3A 4DN1A 2YCLB 1E1EA 1EJUC 3G3MA 3HJZA 3FYPA 5EMUA 2AQVA 2G3FA 2VR2A 3EA3A 3G1FA 1OIMA 2W0UA 4DUOA 4GABA 4HOXA 4ZOAA 3KOZA 1E15A 2QCHA 2PWUA 1FHDA 1DIEA 5HQMA 3L23A 4YLWA 4EF8A 2MNRA 1TSIA 4GGBA 3W70A 4MB1A 1LRTA 4A8IA 1F05A 2WOQA 3MSGA 3QTPA 1UMYA 3UPBA 2ZX9A 2WJEA 2OT0A 3BGJA 1OF6A 1QHZA 7XIMA 2QCNA 1TPWA 2X0YA 2PLKA 4MNKA 5JQ9A 3FAWA 1GZ1A 1OFEA 1VHCA 4Y7EA 5CGTA 4NI3A 4WQ6A 1JXJA 1UZ1A 3SQMA 3W74A 3L65A 3L5AA 3N13A 2Y7EA 4R27A 5CCZA 2J8GA 3OGVA 1W9BM 2I5IA 4L1WA 1R30A 3KVLA 2CLKA 1YQ2A 1RZMA 1XSKA 2YCKX 4LUYA 1WKFA 3WMLA 1VLIA 3PZTA 3WO8A 4RR4A 2OOFA 3TC3A 3GDLA 3B0YA 4XO7A 1UR1A 3GAYA 1UPPA 4JN8A 4A2RA 3AHZA 3GR8A 3UJ2A 5HBFA 5FF4A 4I3GA 2PB1A 1O95A 2ATSA 3WDHA 2WHMA 1WDQA 4RZ4A 4PMVA 3L0NA 2QCLA 1V3LA 4GVHA 3TYZA 2VDIA 2ISSA 4PMNA 5M3WA 1MVYA 2DSKA 3S5YA 3R1ZA 4V2XA 3VNIA 3F4VA 4F66A 3U9IA 3KRUA 1BTMA 1JR1A 3HPFA 1RK5A 3IIVA 1UH3A 3Q4DA 1FWHC 3ENLA 4HPHA 1S46A 5FJJA 4W9TA 2O9TA 2J8TA 3PPHA 3EAUA 4PMDA 1J01A 1KFWA 4HMDA 3HPAA 4JIPA 1I2OA 3WX7A 4HD5A 1ELSA 2AMXA 3VM5A 1TV4A 4JY8A 1EXBA 4FHAA 2ZYFA 5G4WA 1MUCA 3WD4A 2CETA 3PF3A 5D2WA 1VBGA 1AJ2A 1GOOA 1SFJA 1K3UA 3GNXA 2NWRA 3ZQ9A 2YZRA 3WNLA 3QHMA 4XUYA 3YPIA 5HA7A 3K13A 4HNVA 1I1WA 1C8QA 4BF9A 3PS7A 1UUOA 5CSRA 5E5CA 4FO4A 1XIMA 3T8QA 2VX5A 3GHRA 2Q8LA 2XGBA 1H63A 1B3OA 3N73A 1JPMA 1TV8A 3BLDA 5H8UA 1IZJA 1OX5A 5HMDA 1TTPA 3BLLA 4AY7A 4C1LA 1CEOA 1TZZA 2Z6JA 1MSSA 2RAGA 4L4MA 1DVJA 1TX0A 3ELFA 3VGDA 4UFLA 3A23A 4QCFA 1THFD 1ZTVA 4PBEA 1QASA 4ZO7A 5HDRA 3NTYA 4X2RA 3POCA 3PB0A 1VHNA 1W1B1 3T4WA 3EOUA 3W87A 5ABFB 1SMDA 1DQUA 2YXOA 3WK1A 5IFTA 4M7TA 2QXWA 4B5TA 4M6PA 4W7VA 4ZO8A 2VCCA 4ZO9A 2QEZA 4LUJA 1QPRA 5A6KA 2L5HA 4W87A 2H8XA 1K7XA 3CZGA 3K2GA 4N9EA 2I14A 3P8IA 1EJSC 1QWGA 1AODA 3ES8A 4BZYA 5HATA 3D3FA 1K7FA 1QXLA 2PC8A 5I3JA 1LQAA 1AK5A 3GTFA 4HPXA 3HJEA 4BF7A 3B9AA 3QZAA 2Y1HA 5LA2A 3C2EA 2PWGA 3KCJA 3NJ3A 4K7YA 4KQNA 3OVRA 1U1JA 2EG6A 3OZOA 3NQAA 3AZRA 3E2RA 4C6OA 1ECQA 3WQ8A 1E6ZA 4UFKA 3SIMA 3NZGA 2ZA3A 3R0UA 2WSPA 2B31A 3QZ6A 1HO4A 1TV5A 4OQVA 3QMRA 4LB4A 4DNHA 1XRTA 4ASTA 3CK5A 3IVTA 1ZAJA 1A3WA 1QCWA 2OMAA 3BW2A 1FWDC 5MKGA 1Z44A 3QC0A 4DHGA 3EDDA 1JVNA 2Y4SA 3K8LA 2C91A 1FUYA 3QJAA 4NG3A 5ECUA 2PDGA 3KOXA 3GNOA 3E0IA 4RXFA 4MSSA 4ACZA 3M5XA 2E8YA 1CT5A 3VFCA 4GZEA 4B92A 4AY8A 1ONXA 5I24A 4C6FA 1HKVA 3KEHA 4PRTA 4MY1A 5A6TC 1FCBA 4D6GA 3WQCA 4ERGA 2G0WA 3G77A 3QHOA 4HZ8A 2Y24A 4XV0A 3GXIA 4Z1YA 3NL5A 4DBWA 3RNDA 2GDVA 3KBNA 2GYIA 2D22A 4Q7BA 3AUOA 1FWNA 4LALA 3FJNA 5LNRA 4CQAA 3VUSA 4Y9NA 4ZQMA 4KWUA 1EF2A 1SFLA 3CWOX 1NJJA 1AMKA 1R3VA 3DU0A 4NVTA 4WXYA 3VPLA 4I8YA 3N29A 2QUUA 2R91A 5AB3A 3E0WA 5JBEA 3FX4A 1YPXA 3DEQA 1B57A 1JF5A 1XLLA 3ZYZA 3K1DA 2GUYA 2PODA 4A3QA 3TJLA 3EOSA 2OYMA 1IEQA 4Z2HA 1DOSA 3BDKA 4ZB5A 3TW6A 3S5NA 3UZXA 1Y65A 2A3EA 5AZ0A 2W91A 5J5RA 4ZL1A 3MUY1 3H4GA 3LENA 3MVIA 4HPGA 1FKWA 1KXVA 4KH2A 4QS6A 1KGWA 2HTMA 4QJ1A 2GGEA 3WUBA 4WDTA 2QPSA 3GW3A 4XBSA 4HHHA 4B5WA 1YNQA 1JFHA 4UTFA 4QSFA 4MDOA 2PU0A 3O16A 3LSBA 3CUFA 3N6HA 5E1QA 4MUZA 5CC7A 2JGQA 4Y2WA 5EB8A 4ZFMA 2PGFA 3DI1A 1E0UA 4Y8FA 3QSTA 3RM9A 2ZRXA 4NJIA 1BYBA 3T0BA 4P7OA 2VOTA 5AZ1A 3N4FA 1R9YA 4H9TA 3TKFA 2WBKA 2ODOA 5A2CA 5EPDA 5TF0A 1IHIA 1FWSA 4CQBA 4R33A 4YJ5A 1NQKA 2D0FA 2O56A 3AQUA 4X60A 1I6NA 1AH0A 2WJZA 1BD0A 2P3EA 1PYMA 4R7OA 1AJ0A 4X2PA 3TOYA 1E5JA 4UB9A 3MU7A 1A5MC 2DDXA 4PODA 1E3ZA 4G7EB 1Y8BA 3TR9A 1TVNA 5DT5A 2J62A 4UOJA 1L8NA 3AS0A 4HCHA 4UTJA 2F2KA 3NCOA 3RCYA 3KE0A 3W2MA 1HNYA 4PUJA 4AXKA 1XD1A 2QCMA 4RPQA 3FXYA 4UQEA 5HNNA 3U48A 5LIYX 4UQCA 4LSBA 3SECA 3QHNA 1US3A 3RIKA 3TW9A 4FEZA 1Q65A 3ZSSA 1TPH1 3G18A 1PDZA 4H9VA 1Z3NA 3PANA 2ZRUA 4Z2GA 5H2ZA 5D2TA 4C91A 4X61A 2IQDA 2VWTA 1PZ1A 4DXXA 1L2UA 1CNVA 5HUOA 3PG9A 1EPXA 3IS4A 2PCEA 1OINA 4DNMA 4HNLA 2CZEA 4FLQA 2OZTA 3WSUA 4DBSA 4OFCA 5GJPA 1X6NA 4L7ZA 4REQB 1G6CA 2YYUA 2FTPA 3LY0A 2ZUSA 1V77A 1KM0A 4J4KA 1QOXA 1MFUA 3U2CA 4N4QA 2QIWA 2INEA 3DI0A 1C8XA 2Q09A 1DJNA 2PRMA 4JAWA 1U5JA 2XSAA 2QNEA 1S3HA 3NA8A 4FPSA 4LUTB 3RUBL 3SN1A 2AAMA 1NOUA 4LFYA 5JMUA 1LT7A 1YDYA 1EXPA 2REQB 2TSYA 4N6EA 2OLAA 3NR0A 5CQ1A 5A94A 3GG1A 1AG1O 3H54A 3W9ZA 2I7GA 4LRSA 4GNVA 3ZLFA 3VZXA 4UTKA 4LVAA 1TE6A 2PP0A 4JOMA 4MNLA 1QHOA 5BNKA 4MKVA 4KS0A 4LBSA 3KW3A 1BWLA 1IF2A 2E9MA 3E5BA 1Y5WA 1MWOA 2IQ0A 5D2VA 2PZNA 4TX8A 1J0IA 4GYKA 4D6DA 3VMPA 2WSQA 1A5SA 2FZDA 4FALA 2Z00A 2C16A 2A6LA 4FMVA 4KT2A 4UFIA 5A8QA 3CAKA 3M0LA 5HR7A 4GQGA 1XCXA 1JUKA 3WK3A 3W88A 1VCFA 2VZTA 3DERA 1FDZA 5FI8A 1W6TA 4DYEA 3CUHA 3W82A 5AHEA 4JTHA 3WQVA 3XIMA 3PJWA 3F5JA 4AH7A 1ZJHA 1IXNA 2GJPA 3AYVA 1LWIA 1D9EA 5T9CE 2HJPA 4MWAD 2G41A 1MDRA 1XIEA 3B04A 2WVTA 3T55A 1SW0A 3HPZA 4FNRA 4UOQA 4B5VA 1WQ5A 5A8NA 3L2IA 2VKZG 2Z1KA 1B2YA 2DIKA 4WKFA 4JTEA 4LCSA 1T6MA 3W7GA 2ZUWA 5A3HA 4AEEA 4JN7A 2TYSA 2WPGA 3FNDA 3CB3A 1RA0A 3TUUA 3GM8A 5GJNA 5A8GA 1W1TA 5IBXA 4HCDA 2ZDSA 3J7HA 4MZYA 3W7CA 2P0OA 3GVGA 1SZEA 4F8XA 3PJTA 1W91A 2F9RA 2YLAA 4DPQA 2J8FA 4HTBA 2OTDA 3OYXA 3G1VA 4ES4A 2V38A 4X63A 2IQTA 1E4MM 4S3EA 2F61A 3THCA 2DZUA 4PB3A 3DZ1A 4GIYA 1UD8A 1QK2A 1H7PA 1EGZA 4KEMA 1CW2A 5HR6A 1PYFA 3ZS4A 5C9XA 3EX3A 3DFQA 3MT1A 2DORA 5HULA 1NIUA 1E1FA 3B97A 1DWAM 3TEVA 3T2PA 4ZODA 4WEVX 1EX1A 1QOQA 1H2JA 1VCGA 3RCMA 3Q58A 3IARA 1OT1A 3LM7A 3GIPA 3EMQA 5CZ0A 4BWLA 3KS5A 3U2OA 1W9DM 3SBFA 4PA8A 4GGHA 1ISYA 2C3ZA 2GQAA 4LBUA 3W1MA 5E70A 4MJMA 1N8FA 3U2ZA 3UJRA 1S5WA 3PB2A 2NV1A 1AL8A 2ALRA 3ANUA 3PULA 4C6CA 3SFKA 4ZFCA 4RNIA 1AZ2A 1E6RA 3WK2A 3MCMA 2ACQA 1VBHA 4Q8TA 2PF0A 2VEGA 2D20A 1TV3A 4UTTA 3VX0A 1EZWA 4AVOA 3G0UA 3AROA 3RU6A 1OFRA 3NDYA 3BICA 3S1UA 4CKQA 1W1VA 1JGIA 1KQYA 5D38A 3HFTA 1RK6A 1AA1B 2GQ3A 4QLKA 3AS2A 4UCGA 1LBFA 2HVNA 1WXZA 3M0ZA 4IT1A 3IPWA 3S2CA 3VO0A 1UKTA 3UY7A 1PO9A 3ANVA 2Z24A 3BJTA 2XG9A 1UR9A 1VEPA 1LL7A 1WX0A 3WH9A 4JFUA 4B3ZA 2DY3A 4NJHA 3CQKA 2V63A 3EXTA 4MG4A 3WF3A 2I9UA 1R7OA 3AYSA 3UG4A 3KBSA 3SRHA 4QDMA 3LCXA 2YGYA 3QM3A 1HVXA 1H09A 2WCAA 4EF9A 3TK7A 1LWHA 1KRAC 2ZA1A 1S2UA 2P8CA 4Q6JA 3WF1A 3VDAA 4W4QA 5DCDA 3LXBA 1ONEA 1A5CA 4M29A 4W7UA 1PL9A 3TIMA 3DN5A 1XF0A 1DKWA 2TAAA 1W2VA 2XWDA 1HO1A 4QDWA 1HG3A 2NVAA 3MC5A 4DPPA 1TR1A 3V1PA 2BHUA 3S6DA 4Q22A 4JXCA 1K7EA 3LN3A 1G4TA 1XSIA 1NWTA 1VFFA 4U31A 1OFQA 2D69A 4HK7A 2E40A 3MV11 1E3XA 5C55A 1L6SA 4GJJA 5FF0A 3TJIA 3R89A 1WXYA 1PPIA 1HF6A 3S8HA 3XISA 4AB4A 4WGXA 2NW0A 1GVQA 1RXOB 1DJHA 1LDCA 3MWCA 3SRDA 5REQB 1H7WA 1DTNA 5DCEA 3ARUA 1Q6GA 3VOCA 3PBWA 1EQCA 3VXGA 3GH4A 1CYGA 4MFDA 1B0IA 1NM9A 3WLJA 2IKIA 2WZIA 4JTGA 4XZIA 3GO2A 4Y9AA 4D8AA 4J2PA 3URBA 1EA9C 3JRKA 3QGKC 2PD5A 2OEMA 3EWWA 4NZ1A 2Q8ZA 1HUVA 3K30A 2ZCGA 3FEMA 1LOSA 3L4ZA 2VUYA 1SSDA 2ZX6A 1A0DA 2GK1B 1ZP3A 1JXKA 3TLQA 3VKBA 4GD0A 2QGHA 5FACA 2WJFA 2HXTA 1HL8A 3S5SA 1UA3A 1M01A 3KZSA 4G8TA 3U4AA 1FDJA 4GI4A 4K39A 3IGSA 3PJUA 4HJFA 4XO6A 2GLKA 4DJDD 3HM7A 4ZEPA 1CCWB 3RLHA 5HINA 4J3XA 5BOEA 3NQBA 1EBGA 1CXLA 4NIRA 1W9PA 1V0NA 3TSBA 1W9UA 1FKXA 3ZT6A 5BOFA 3CZEA 5D33A 4IPIA 1JPKA 1JULA 4YTQA 4F4RA 4F0KA 1V4YA 4A8NA 1A3HA 2GJXA 2ZWYA 3RN6A 2E0PA 3SCPA 1LROA 3N2CA 1BRLB 4K1GA 4IFKB 1GVOA 2XIMA 1D2KA 4BHYA 3ALFA 4UC5A 4KFNA 3V1HA 4L64A 1XFCA 2DJXA 3WLLA 4NNCA 4JZ5A 2EF9A 3DFNA 4M6QA 4WY0A 4DO6A 1ONWA 5KITA 3UXLA 4DJDA 3NQ2A 2Z2BA 2NVDA 1JCTA 4GUGA 4FK9A 1Q6EA 1R47A 4LRTA 4HIBA 3PZGA 3WELA 4QG6A 4GQBA 4HNOA 4JTTA 1BAGA 1UWTA 3KRSA 1P5BA 3GSMA 2DUXA 1GEQA 4AD4A 1E9LA 3FKKA 2R1MA 3W2UA 4KETA 2DSWA 5AHLA 3CO8A 3BVJA 1SZNA 3W1QA 1M5WA 2B81A 5KEZA 5EA9A 2XU2A 2YL5A 4H7CA 2ZZ3A 3W24A 1QI2A 2WNWA 3R10A 1UKQA 3AIUA 3WH6A 3PUOA 1FHLA 3QVQA 3EKZA 3R6IA 1CXHA 2E4TA 3MUCA 3M64A 5BROA 4ZMGA 4NL1A 2ATMA 1SO3A 3D3AA 1FCVA 4KMQA 3RX2A 3WCZA 5EFDA 2PDYA 3BC9A 2Z1SA 4OGZA 1DWJM 4RZ6A 2VFDA 3OU8A 3MMWA 4F3HA 4R85A 5GQBA 3MKVA 5AKQA 3QN3A 4EOUA 3TA6A 4I6VA 1RP9A 1K8XA 1RLCL 3PAOA 1TPVA 4O0ZA 4H6EA 4NJGA 4H9ZA 4LANA 1XLHA 3N17A 4M1BA 2Z2AA 5HJLA 4B2DA 1PSCA 2FPVA 2CZ5A 4GQRA 1Z48A 2V9DA 4Q7IA 3CB8A 1UASA 4K38A 1Q5MA 4JBRA 1FQ0A 5FJIA 5JH2A 3TE9A 3L66A 4JTAA 1AQMA 3CUXA 4HHPA 6REQA 4LVBA 2GGIA 4PTVA 2J7CA 1XLAA 2H9AB 1FWGC 1V6VA 4JD4A 3OQEA 1F73A 1QWKA 3GE7A 2CZFA 2JEPA 2VD9A 3AC0A 3RCNA 3POHA 3SCTA 1KTCA 4TVDA 4IP5A 3T07A 4A6GA 5D2XA 1YE4A 1ZBVA 2DVUA 2G3JA 2XJ7A 2VP8A 4U5IA 5CZJA 1P0EA 3QBUA 1OY0A 1NF7A 2QPUA 2BB0A 3ZFHA 4CNNA 3P62A 3C8FA 3TQKA 4MZ1A 3CAQA 4JTLA 3KBVA 2CPUA 5H91A 4D6HA 3U5UA 3LBOA 3MO7A 1WKEA 2BODX 2QDDA 1PEZA 3KWSA 4U3AA 4ML4A 1PUDA 2E6YA 1RA5A 5T9BG 4M82A 1KW1A 5K9CA 3D47A 2FZ8A 3GR4A 4NZJA 1P0KA 4YVPA 3O6CA 2DQWA 3VD9A 3CNYA 5F2MA 3U57A 3ZOAA 1XS2A 1KTNA 4NU7A 5FAGA 3HG3A 4MY8A 1ODUA 1VC4A 4LAKA 1Q8AA 4IL0A 3O9NA 1W54A 4AZCB 4Q4PA 2D2JA 1FHVA 3AYRA 1XR2A 2DT1A 4LWWA 2NV9A 3TVAA 1QHPA 3TXVA 3W1UA 1EHAA 4DJEA 1OQFA 4B15A 1TJPA 1X39A 1X96A 2REQA 2Y8VA 2E6FA 3RGTA 1GVRA 1J4EA 1J5TA 2PF8A 2WNQA 1FVPA 2JK2A 1S38A 3DG7A 4JCLA 1E4LA 1FBAA 1E6QM 3SRFA 4G6CA 3EOOA 3FIGA 1W1A1 1MRAA 3CUGA 3RRAA 5XINA 2VZOA 2X16A 4E2BA 2A79A 3B4YA 1WZKA 1BXNA 4A3HA 1TYGA 5HQLA 1EJ7L 5LNSA 1VPYA 3DHUA 4U2YA 1LG2A 4HN8A 4ROPA 4TVCA 5A6BA 5I77A 3QYQA 1RJRA 1R0MA 3VKDA 3CLWA 4CNPA 3IAPA 5LGXA 1CBGA 4WLCA 5FJPA 5IOBA 2VX6A 1PZ2A 2PUZA 1XYLA 1JD7A 4Q8UA 4QJ3B 4JL1A 4Q8NA 5EYWA 3GQYA 2VEIA 1JPHA 2HV5A 1VJIA 2OQYA 1GVFA 3M16A 3IVSA 3GWQA 3B0VC 4F48A 1R9XA 3ZT5A 2WHJA 2QVNA 4Q8MA 1AW1A 1UH4A 3LQGA 1TMHA 3VC5A 2PA6A 3QV6A 3WL1A 1TIWA 3FA4A 3K4DA 4Z1AA 3N3MA 2VM8A 4AD1A 3ZT7A 1Q7QA 2VVNA 1FFQA 1XYZA 1IXPA 3UXIA 1EJTC 1V5XA 4RPPA 5SWUA 2DT2A 2TODA 4HZMA 4EX4A 4JFWA 5D03A 3LHTA 5CEWA 3CUJA 3H12A 3B06A 4WIWA 1IIGA 1TO3A 4S3KA 2GOUA 3PY2A 3PBGA 1B3VA 1EZ2A 2BGNE 2FZMA 4QE1A 4GIEA 3R7MA 5C9ZA 1I75A 4QR6A 5GNYA 1DJYA 3DC0A 5E93A 2GVLA 4M51A 4UTWA 3NXLA 1H1NA 1ZENA 3WQ5A 3QRHA 3K5XA 3BCJA 1F4AA 4AD2A 4RDYA 3U3HA 3W7NA 1MXGA 3GC2A 3WD2A 3LLXA 5C70A 4J2MA 2PWHA 3NOYA 1ITCA 4AYGA 3ANYA 1VBRA 1UH2A 4IOTA 4C1NB 5REQA 1W9VA 3W7QA 4DWSC 1HX0A 3M0MA 2WYSA 3HGJA 5I09A 1SUXA 4G1KA 3E74A 2E5DA 1XQLA 1AFSA 3CIVA 3IACA 2WSYA 3ARZA 3TH6A 2HS8A 4IIDA 1B4KA 3PWIA 2Y0FA 3DDMA 3B03A 4ENLA 2E9BA 2XGZA 1ME9A 3WDRA 4US5D 3WQPA 3HQNA 4FXJA 4HQVA 3ZJ6A 5J04A 4UZUA 4X9SA 4XK2A 3LRLA 3AISA 4PSPA 1XL9A 3DFTA 2GK1A 1ICQA 5BWFA 1CI1A 5TD4A 3T78A 2DEPA 4N7QA 2BHYA 3A3WA 4IGMA 2XZ7A 1S2TA 4U10A 3WFAA 4C6EA 1K8ZA 1OZMA 4YL2A 2E28A 3CMJA 4NAFB 3UGRA 3SN0A 4H01A 4CN1A 4CU8A 2NT0A 1DQWA 4Q7NA 2YR1A 4E8DA 2J66A 4DO5A 4PMOA 4B5NA 1C91A 2GUUA 3P80A 1HT6A 4C90A 5DMNA 4FNSA 1B4EA 1Z7AA 1GYNA 3KS6A 4AZ7A 3T9PA 4QAWA 1X1NA 2CXEA 3BGGA 1AH4A 3EX4A 4KCTA 1HJQA 3NPVA 4HYWA 4WKAA 1ISZA 4JFTA 4RUBA 4RNHA 1NF0A 1DV7A 2ZFAA 4GYPA 3KL0A 5CAHA 3TFXA 1B3YA 1Q7MA 1XIJA 4FF7A 3P3BA 3VNJA 5LIXX 1ALDA 1GOXA 1YDNA 3S6TA 2XVNA 3SY5A 2WZMA 3T09A 4BEUA 3QXBA 1K02A 3GVQA 5ECVA 1CGWA 3VMNA 3L67A 3N6JA 4UTIA 2E25A 3C2VA 3CIWA 1OEPA 6CGTA 2Y7FA 4H00A 1H62A 4NY2A 3LERA 1XGZA 2E5CA 4DLFA 4UR9A 2HE8A 2PDKA 3NVDA 4GA8A 3B9OA 2YDRA 1Q3NA 4CQCA 3KHJA 1HGYA 2PBOA 3A4WA 1FHUA 4JTFA 4AD5A 3LMZA 3LTYA 3B8SA 2C14A 4QLLA 4AMCA 3QQ0A 3MCOA 3F4WA 2PWVA 3SUTA 1KKOA 2FH8A 1TWDA 1AL7A 2AL1A 3P5ZA 2BGQA 2W62A 2X41A 3TNOA 1RQBA 3PUDA 1O68A 1H51A 3H2NA 1E0WA 2DZWA 3PSWA 1C93A 3PPGA 3UFYA 4MPQA 4H7ZA 1R46A 1LOLA 3W75A 2A1YA 3IAQA 4L6OA 3PVFA 4WX2A 1W5NA 3DGBA 3LI0A 3MTWA 2VC6A 2IS7A 2B7NA 1PWMA 3TN5A 4KBXA 1Q6OA 3V0SA 2TPSA 3UWWA 1L6YA 1S5NA 2OELA 5I3IA 2PAJA 3LEPA 4JYEA 4Y96A 3NO3A 1IWPA 2FLIA 4G9PA 4ZGYA 1DE6A 4KPLA 1J18A 4JIQA 3LPGA 2ZKMX 5CAKA 5FSDC 1JAKA 3Q37A 4OV4A 1EL3A 1BRLA 3C3NA 3PM6A 4OBTA 3SFWA 1W17A 2A7RA 2IPFA 2VQUA 1J0JA 2HZGA 1X98A 4AFYA 2XIQA 4D6IA 3NQ6A 4GX9A 2E1WA 5HNRA 1F76A 4E8CA 3QY7A 4TV5A 3ZWSA 4RV8A 3W23A 4GO9A 4N02A 3EKLA 1SQ7A 3H26A 5A8OA 1ZS2A 3LCFA 4LB3A 1OD8A 3W1XA 3VCNA 1PXGA 3MP4A 3L12A 4FX8A 3LPOA 1GOMA 4LAZA 4S3DA 3N2XA 3VE7A 4RCXA 2J74A 2A5HA 3DXIA 1OGGA 1G4PA 1V0KA 1IYXA 4PSRA 2NXGA 1GOQA 3P81A 5K9XA 3JR2A 5FIPA 3VNYA 2CLPA 3B8VA 3GDBA 3AOFA 1JYWA 4HNTA 3P5YA 4JQ1A 3AJXA 1XP3A 3ZXWA 2YL9A 5G4EA 3MUZ1 1ZAIA 1VGAA 3FEQA 3F4NA 2WVVA 4D1JA 4PBGA 2OX4A 2J79A 3CEUA 1B9ZA 3NQFA 1REQA 5I00A 2GJLA 1U1UA 2QUTA 3GKFA 3HMJG 1HP5A 1E6XM 5CSUA 4CCEA 3NL3A 4ZE4A 3AZSA 4S3CA 3W6LA 2CESA 3BLOA 1I60A 3R25A 4EPBC 3ABOA 4JNMA 2J24A 4NZFA 3APYA 4JHOA 3MY9A 3K8MA 3AJ7A 1UKOA 2VFHA 3NDOA 2CERA 3BG9A 3STGA 1W37A 5CJNA 1H1YA 5K7JA 2WSKA 2RKXA 1IGSA 5I3DA 1V7AA 1BPLB 4GLEA 4GACA 1IGWA 3UG5A 5F1UA 4UWMA 4D6EA 1K8YA 2VELA 3A4XA 2I9EA 4DJFA 1AVAA 1ZBKA 3ZMRA 3UJEA 2FKPA 3PPCA 3O07A 4ZTXA 1H7NA 3SCQA 2DIEA 4J3SA 5BU6A 4AYSA 2J78A 1YYAA 4LXFA 1FH9A 2B7PA 2ZZ1A 4AMAA 3I4EA 1GT8A 4Z1BA 2DVXA 1W1ZA 2CBJA 4O53A 2PTDA 4UNLA 1K8CA 2QDEA 1P6BA 1KCZA 2FZ9A 1HKWA 1KR0A 2OLSA 2QJMA 1GONA 4C6JA 3H4XA 3E2SA 3C61A 4H9MA 3VDCA 2ZX7A 1R7AA 3PZNA 3FYYA 1QBAA 4LS0A 1N7KA 2A7NA 1R9ZA 1MRQA 3ZSTA 4E5TA 5E9XA 3WDIA 3WLTA 1UHVA 4A3UA 4V27A 2YZ5A 2XYLA 3RR4A 2CHRA 4GI9A 1W0MA 4TVUA 3BV7A 2VQTA 2BZNA 1J8VA 2CCRA 2YFOA 1VLWA 4QHRA 3PUEA 3UCQA 4JY9A 5GPRA 5G4HC 2GDUA 4MGGA 2J27A 4XSLA 3OGSA 1QOPA 1DJIA 2Z7GA 2O9PA 2J7DA 4HHLA 2WCSA 2DSZA 2D0HA 4DF2A 4XAZA 1I0BA 3B3DA 3BAJA 1ODZA 3HV9A 1WAUA 4GVFA 5LHFA 1C29A 4L65A 3SZ8A 3RDKA 1CX9A 3V75A 4EAYA 3CV6A 3BMWA 1JZ7A 4MMWA 5LIUX 1EJRC 4BJHA 4ORMA 1MNZA 1OZQA 3PWAA 2XGIA 2QJGA 1A3XA 3EMZA 1DL3A 1DYSA 1J79A 4S2CA 5MF5A 1TVPA 5CJ5A 3WD1A 3S6OA 2ANUA 1GGOA 4CUCA 3HG4A 4AC7C 2GWGA 1SFSA 3JS3A 1DIOA 2J6XA 1N2VA 3AU2A 4CQ8A 1EQPA 2WQPA 3B8TA 3DHDA 3PZIA 3PN8A 1RY0A 1D3HA 2DGAA 1WV2A 2VDHA 3BG5A 3LTSA 4D71A 5F7UA 7TAAA 1Y5XA 4PFHA 2Z25A 3RX3A 2VI0A 3O0KA 4XKYB 3IJ8A 4ECLA 5C7VA 3I6EA 1EOMA 1UCWA 2DFAA 5M17A 4AIEA 1VCVA 2BFGA 1TWSA 3PZVA 2KZHA 1G69A 1UC4A 3AXMA 2ON3A 3DG3A 4QJ5B 3BK0A 4HZ6A 1T41A 3ZVIA 4RW5A 1TMQA 4ALDA 1D3GA 2OJPA 2DUAA 2CKRA 3ONCA 4O17A 4WDUA 4LUTA 1MXSA 2GZXA 4UTLA 5DELA 3DENA 1VD6A 3L4WA 3QH2A 4NSBA 3CYVA 2NQZA 4BWLC 1SJAA 1C9DA 5BOOA 4S3GA 3WNNA 3QFEA 2F6UA 5DRCA 1NTHA 3HG2A 1PX3A 4JNZA 4R88A 4GG9A 3W7HA 4QG8A 2ESCA 4NASA 4AD0A 1B9BA 3BH4A 2NUXA 1Q6QA 1VFOA 2HBXA 3GFZA 4HMNA 4NAFA 1LT8A 3OIXA 4AXNA 2DSVA 3WBWA 5KZEA 2VC5A 1FP9A 2BLEA 3EOEA 1SSGA 2V67A 2BBFA 4IQEA 2ISFA 2X2GA 4EIVA 1BLIA 4BQ3A 3URQA 3GS6A 4BS0A 4PZVA 4W85A 3PTQA 1W1IE 2EG7A 3BE7A 1FFRA 2OVLA 3UWUA 1UWAA 1GKPA 3L7RA 4L4LA 1DHKA 3SGUA 3TSDA 4M80A 1TWZA 5DO8A 4NJKA 3WH7A 1M7JA 2YXXA 2UWFA 3KBMA 3A21A 3UJFA 2OFJA 1WB0A 5I3FA 3G5EA 1TR9A 1W8SA 1UP3A 1DP0A 3PFMA 4HYRA 1J9YA 1VYSX 1UUMA 2O4MA 3STPA 2FB3A 2ASHA 2MUCA 1KFEA 3T7VA 2GSHA 3W2NA 4N6FA 3HZ3A 1U83A 2A4AA 2X0HA 2O7SA 3T2QA 5K3VA 4W8AA 5IHSA 2X40A 1UP0A 5IBXC 1BKHA 3EX2A 3GXFA 5AN7A 4AIUA 4PR4A 1KFCA 3VDGA 1IV8A 1XHGA 4PMXA 3MZNA 4L1XA 3IIOA 4YWSA 1PIIA 4IPJA 8A3HA 1GWJA 2PP3A 1FXPA 4EE9A 4WZHA 5ABTA 3BMVA 3E2QA 2CXGA 6XIAA 4MYXA 3UT0A 1JCYA 3UW6A 4B16A 5A6SA 3GG7A 4FLRA 1CDGA 3WL0A 4NKCA 4LF1A 4D2JA 1WDSA 5CPTA 4OT7A 2H9AA 2JEQA 4OVXA 3QKZA 3TW7A 2QPXA 3AWOA 1E71M 4AG0A 2UZ9A 3VMOA 3W25A 2GDQA 1KM6A 2IXVA 5LA1A 1F9CA 1M7PA 3VU2A 1J2BA 3TC6A 5C71A 1GKRA 3TTOA 4JKKA 1QI5A 3SDOA 4EK7A 2HISA 2Z26A 3THDA 5EMJA 1TE1A 4GXWA 1F8IA 4JTUA 4JEQA 2DZBA 4KWOA 1WNOA 3P93A 4MWAB 3O3RA 1GEHA 5I5RA 4XQ6A 4GWEA 2ZICA 4WKHA 2QJJA 1JQXA 3WUFA 1H41A 4AAJA 3V18A 3UPMA 1QBBA 4NRSA 1GTEA 1HVQA 1RUSA 1DWHM 3CZ8A 3AZTA 2FZNA 3APGA 2I16A 3N6QA 5CGQA 4K1WA 3WLQA 1EJWC 4HSOA 2QV4A 3PR2A 4JR5A 4Q8VA 3W81A 3ABRA 3DFOA 2Y5JA 1NDWA 3EBVA 5BZAA 1UIOA 1UR4A 4GCAA 3KOYA 4Q33A 4DXKA 3G1HA 5FL0A 2IXUA 4B9ZA 2OYKA 1Z69A 2C7FA 5GVJA 3SCOA 3H2FA 4FNPA 5FA5A 3EPMA 4NZCA 4O52A 4CNTA 4PUDA 2OODA 3SJ3A 3N9SA 4AWUA 4AVNA 3I68A 4C6QA 5HWNA 5F1VA 4KIRA 4H6QA 4JEJA 2EO7A 2J13A 4JTIA 1KQZA 1NVMA 4PC8A 1ZUAX 1TVLA 3R2GA 2RH9A 3EWCA 2PDNA 3A22A 1P48A 1YKWA 4NXSA 2QIIA 3KDNA 4HOWA 4AQLA 5DX7A 2E67A 2R14A 3UU0A 3B9EA 3GTXA 1GYLA 3IK2A 1F3WA 3BAIA 1S2WA 2A3AA 1YW1A 3OBKA 3CQHA 4IL2A 4QIUA 1ZCOA 3LPFA 3SIZA 4GZIA 1PCWA 3W1PA 1VBJA 1CB7B 4TUFA 4JDBA 4PMJA 2CIPA 2C6QA 3C3UA 4ZZ9A 1QPQA 4FXSA 3KWXA 4KFPA 2J77A 1IEVA 1RALA 4QM1A 3DHFA 1T8XA 4DZIA 3RO8A 3KFTA 5CSYA 2O4QA 1ZJAA 1ZBCA 1QPKA 2HXUA 3R5EA 7REQA 3C0QA 1B3WA 9CGTA 3VD7A 1WBJA 3E1F1 2OKOA 2VX4A 3AIVA 1HIZA 3VOGA 1OFOA 3DHPA 1C90A 3BW4A 1MW2A 3A13A 3V4BA 4MJZA 4BCEA 1YDOA 4MM1A 2PGRA 4RZ5A 2GVGA 3IV8A 1UR0A 1MFVA 2AKMA 3S2JA 1P0BA 3OA3A 1L6WA 3W85A 4ML9A 4U2ZA 1V6YA 3TC7A 3WMBA 2VR4A 4PMUA 2AOSA 1OVDA 3L9CA 1B54A 3G6LA 3WLRA 4AZBA 3FY1A 4H9YA 3QOMA 3OLGA 1ZJBA 3URAA 2OZ0A 3CHDA 1K6AA 2INFA 2IPWA 2PU1A 4M7SA 4RKAA 2E5BA 4GZJA 2OQLA 1XLKA 1Z8AA 1M1BA 5IM51 1LLOA 2CEQA 1UOKA 1Y7VA 3UA3A 2Y63A 4TV6A 1H50A 1JYNA 2XWEA 4IIGA 4FB7A 3LDVA 4BQ2A 3HQOA 3C52A 3CPGA 3NFUA 3SUSA 4MAVA 3AYTA 7CGTA 4M0XA 4J1OA 3QEZA 2RFGA 3PBYA 1CIUA 5A2BA 2E6AA 3AS1A 4FR6A 4IG2B 1BYCA 4PMRA 4P8WA 1RJPA 3B9NA 3W02A 1GYMA 5EL1A 3ITYA 4L9YA 2WC4A 2WNNA 3FGCA 1ZPTA 1K03A 2V69A 3OPSA 3WQWA 5HQEA 2IKHA 1HJWA 3VKKA 3ZJ7A 3U6WA 1EGMA 4IQJA 3UZWA 3RRXA 3V36A 1XH2A 3AIRA 1T99A 2GWNA 5K4ZA 1SJBA 3ARPA 3GDKA 3TQ0A 3FVMA 3LZ5A 3OA5A 3BOXA 5CZTA 1IR1A 2QUVA 3EDEA 3W07A 1VB9A 4S3BA 1BHGA 3UEQA 3PBUA 5HPOA 4HKPA 3GIQA 3VGEA 1HW6A 3FSUA 3M6YA 4LAOA 3VIIA 3LI1A 3OHMB 2E6DA 3NQMA 1MZHA 4MUPA 5HWMA 2WHKA 6PTDA 4TQTA 2BG5A 4K7VA 3V0TA 4ZO6A 2XFRA 1UMLA 1JYVA 1YPIA 4AX6A 1C7TA 3H7VA 2HVMA 2IKGA 4N2YA 4GK8A 4GCXA 2SFPA 2FGLA 1VIWA 2QCDB 4A29A 5MHBA 4H2HA 2HMCA 4HU8A 4IIEA 4RJEA 1F07A 4CCDA 3THQA 5AYYA 3B9DA 5LHEA 3LK6A 5CG7A 1CENA 3E0FA 1CZ1A 2FGBA 2JKPA 3W6MA 2WLYA 1XINA 3C86A 1ME7A 3AI0A 5HXMA 1UOZA 3LHYA 3F1QA 3WD3A 3N19B 1J6OA 3THUA 3GUWA 3TOPA 1UA7A 4M24A 2V0TA 1G9HA 3N12A 4WJ8A 2Z2UA 1DWFM 2OO0A 4W89A 4LYQA 3UJSA 1ISXA 3FHQA 4OOZA 1W32A 3VINA 5CPLA 5TAOA 1N8IA 2PCQA 1IR2A 4AF0B 3DECA 4G1NA 3R8RA 3M4HA 2P76A 1GG0A 1XYBA 4R9OA 3KVMA 3TYDA 4V15A 4LOCA 3UZ5A 3USZA 2ICSA 3MUAA 4LY4A 2WLZA 4UCFA 3RAOA 1B3ZA 1NDYA 3FYOA 4PUKA 1T8QA 3S0CA 3VOHA 3OTRA 3UBPC 1WZAA 1ZB5A 2JKAA 4GMEA 1QATA 3STCA 4FLSA 8CGTA 4TR9A 3TYUA 4XAYA 3AHXA 2PS2A 3MP3A 1ZP4A 3H24A 3N2TA 5DXYA 1J0YA 4PUWA 1XDLA 1O94A 3GDTA 2Y85A 4E4FA 2D2OA 8XIAA 1Q13A 4GKTA 4AC1X 4DO4A 1LLZA 4ONVA 3ABXA 5G1YA 4OOUA 4UOZA 1AW2A 1JDDA 1KFKA 1FDYA 2PDMA 5EY5A 4CNUA 2Q8XA 3W71A 1O5RA 3TYCA 4O50A 3WQOA 1V79A 1WE5A 1OWQA 2BNJA 3GZAA 4UFHA 4RX0A 1SW7A 1BXBA 4YWIA 1TRIA 1SJCA 1PIFA 1V3MA 1XIBA 1WCGA 3K8KA 3QZEA 2VFGA 3EWYA 1KBLA 3N2MA 3QGVA 3W7EA 1ZU8A 4GNJA 4R9XA 4DAIA 5FCZA 2XHYA 4NF7A 3AMDA 1M04A 4OECA 3NO1A 3Q94A 4UBPC 3P0XA 3TONA 4F0LA 5C0QA 5HMEA 1Q2SA 1Q45A 3PTDA 1EHNA 2VL4A 4O0KA 2VC9A 1PDYA 2B4GA 3BOLA 4XZMX 1XG4A 2R1KA 1KFLA 3HF3A 3IJ7A 3W1RA 1B5TA 4EANA 1KM5A 3W53A 5B7ZA 2WPBA 2EKGA 1R87A 4IMGA 1WBHA 1RHCA 3N4AA 3OO2A 3CQ0A 3QPEA 3N1AA 1SVDA 4M6UA 3UWYA 1AJZA 3GVRA 4CD4A 5DMLA 3FJLA 3MA8A 1YX1A 1KM3A 3A6OA 5A95A 3BLIA 3MUXA 5ENLA 3MI2A 2XPKA 1KRBC 4L4OA 1EBHA 1KXQA 1PX4A 3R43A 1MQPA 2XN1A 3TSMA 3QR0A 4N42A 3SW6A 3W86A 3CGTA 4HU3A 3RLUA 1R3YA 3AXIA 1P4CA 1FWWA 2VRQA 4O28A 1QNSA 3ABQA 4RNJA 3P67A 3GH7A 1HN1A 2EPKX 4L6HA 3AHVA 3OBEA 3WH8A 3C2YA 3UCCA 3UZZA 2Z1VA 1ICSA 4O1BA 1TPB1 2E77A 3G1AA 1GJPA 4FA3A 5DMYA 2NWSA 3BZGA 3GD6A 2PSNA 2QF8A 1K9DA 4UTWC 1DIDA 3E49A 3QR3A 4HPJA 3EEGA 1KFJA 1YHTA 3MP5A 4RLIA 1I2NA 4MWAC 2INZA 3GU2A 3VABA 3UVIA 4O15A 4JTKA 3O8AA 2YLLA 2PDXA 1TV7A 2HK1A 2G8ZA 2O92A 3GY1A 3T0CA 3QY8A 4JIIX 4ZE5A 5M03A 4AHQA 1RY8A 3P6LA 9XIAA 3PHAA 5CG0A 4DWSA 4ZQRA 3WLOA 1W56A 2J47A 3KCLA 4AISA 2QKFA 3GDRA 5AHFA 1QI4A 4ZBCA 3TJ4A 2YW3A 4I6KA 2XVPA 1GQKA 3DBNA 3ZIZA 5K9DA 1GQLA 4JQ2A 2OGYA 4JQ3A 5KETA 2QCFA 4C6PA 1DE5A 1DJZA 2W4XA 6REQB 2GGJA 3G6MA 1UD2A 1RVKA 2WMFA 3M0HA 2E7FA 2Y7DA 4XKYA 3HA1A 1RVGA 2NQHA 3TAKA 3U2EA 3MJMA 3CHFA 2OXNA 5CSSA 2DT0A 2WSRA 2PMQA 1GTHA 2Z27A 2X30A 1FP8A 2ZIDA 1Z32X 3VIMA 1HKKA 1Q4NX 2R82A 4NI8A 2F84A 3TJXA 2VWSA 2EBNA 2EPHA 4CD6A 1O12A 2VEFA 4JTSA 5IFPA 1Z42A 4MJ4A 1TZ9A 5FSEC 5K2ZA 3CJPA 1GW1A 1ADOA 3SCSA 2Y62A 2JFEX 3W01A 2ZVRA 3BWWA 4L6DA 3Q67A 1C3FA 1LWJA 2Y88A 4BI7A 3WLHA 6TIMA 1PKNA 1CLXA 4IIBA 4JTCA 5A6AA 5JH1A 3RXZA 2BXYA 1L2QA 1AQHA 3EX6A 1UD5A 4L4PA 2J9XA 1KO0A 1BGAA 1P1MA 1TG7A 2AMGA 1MNSA 3M6DA 1P0DA 1RAKA 1V93A 4Q3MA 4N4PA 1JD9A 3DH7A 3H23A 1W3IA 1M03A 1QK0A 3LGGA 1WYIA 2X05A 2EPMX 3KLKA 4EXBA 3CL7A 3VKJA 2CWXA 4ICMA 2G3IA 2ZC1A 2WCGA 3MMTA 1OT2A 1JZ5A 4HB7A 3WNOA 1S39A 1W3NA 4YCPA 3HGOA 2CFFA 4LBRA 1UWSA 2X1SA 5DANA 2DT3A 1XRVA 3VYLA 3VNKA 4IPPA 4LJ3A 2PDCA 3AXKA 1NFBA 3ZJKA 2J7FA 2A0NA 2DPEA 5JUVA 3RM4A 4HBKA 3UXKA 3V5CA 1PB0A 1UUQA 1BG9A 3GLCA 1RJQA 5E0FA 1NDVA 1RBLA 2BHZA 4EWND 3UCDA 2ISVA 5BXTA 2VZUA 1K9EA 4PCFA 5BRBA 4JKLA 5T91A 4YPJA 5IXEA 2DH2A 1SO6A 3TTEA 4NJJA 2ZZ2A 4D6FA 2QLYA 3UETA 3MVTA 4M1RA 4EPEC 4KFOA 1TB3A 4E3TA 3RITA 3D6NA 3LNMA 1QO5A 3RJXA 3L4XA 1XW8A 2E9LA 4TTGA 5I07A 3GXPA 2J9ZA 2YL8A 3MMDA 5XIMA 1ZBWA 1T0OA 1C92A 2QCCA 3QTGA 1XG3A 2AGTA 4KEZA 4H4IA 2PWEA 3ERPA 1H3GA 2P50A 2ZRWA 3CTLA 1ZNNA 2BV9A 1RPKA 2BY2A 2G5WA 2BXVA 4H83A 4DWSB 1HZYA 2QDGA 3A9BA 4JX4A 3WY1A 4HYVA 2BVTA 2NQ5A 2ZZ5A 2PTZA 2XUCA 4JPGA 5LIKX 4QAIA 5I06A 4QDPA 3BCFA 3ITLA 1VH7A 1PAMA 2D3NA 1KLYA 2ZUVA 3WQ6A 1JQVA 4K2SA 3M7SA 3GHSA 3S5ZA 4L9ZA 4QXIA 1LBMA 5DF0A 3P14A 3BGAA 3TLLA 3OB8A 1IWBA 1JI1A 3TA9A 1RSCA 5ABEA 1ME8A 3WLIA 1VFTA 3TTQA 3CV7A 5FF3A 4R7WA 4PEKA 4KF1A 2BY1A 3S1WA 2O0TA 1R2TA 1WDPA 3M47A 4O13A 5H8MA 2NSOA 3NPWA 4Q32A 1NY1A 3I3BA 1MDLA 5A5WA 3MQTA 4UNIA 5CPMA 4O57A 2EPNA 1S1RA 2HE5A 4GQ0A 4HTYA 2WC7A 4OWGA 4NYYA 1TTIA 2KX9A 4RE0A 3WLNA 3RLGA 2EEXA 2OG9A 3NIYA 4JNYA 1XCFA 1RV8A 2QCDA 1EYWA 4H6KA 3CZKA 4GY0A 1OFAA 3WF2A 2FH6A 4XZBA 3AIEA 3T42A 1GK8A 1A53A 2HQAA 4OKDA 4B91A 2ZRVA 1X1OA 2A3HA 2YW4A 3G8EA 2W92A 3I6TA 4DF1A 5BRQA 4H2CA 1F3TA 3RF9A 4DJED 5JIWA 2YB4A 3K1GA 1DXIA 3PTKA 1GPFA 1XIHA 1YDVA 3NZRA 2VFIA 3MSRA 2H90A 1V3KA 4DXVA 4F2UA 3BAKA 3WUGA 3KAOA 2A85A 4GRSA 2VCAA 3PNZA 2GOKA 4BI5A 5ABGA 1OX4B 3OG2A 2FHBA 1WKDA 1FY6A 4BA0A 2D3LA 1QNRA 3CAVA 4MKNA 4EKJA 1JDAA 5LXEA 1XH1A 1MYRA 2X8RA 4IX0A 4HP5A 4XIMA 2QW5A 1EYEA 3O6YX 4IJRA 1MXDA 4DEFA 2PPGA 3HIJA 1DQXA 4I5UA 4DIAA 5A2AA 2JGYA 3CH0A 1NSJA 1VBUA 2ZZ7A 3LTPA 2Q6ZA 1EEPA 4DRSA 2D0GA 1K6WA 1SMAA 3GNPA 3XINA 4GKLA 1BVNP 2V5LA 3WQDA 2YFNA 3GHUA 1FWRA 2GJNA 4GH1A 4ZCWA 2DZSA 1OSEA 1WUFA 1GOKA 2AL2B 1YNPA 1KKRA 4CN6A 4W5ZA 2GVEA 1PV8A 4DJFD 1EJVC 1R2RA 2QUNA 2X1UA 1LLWA 1QRQA 1A5NC 2PLMA 3CL8A 3WBEA 5G2HA 4KEUA 4A21A 4GIRA 2AL2A 4HOZA 1WOBA 2Y70A 1RBAA 3OIHA 5I3HA 3ZLGA 4U33A 3UR7A 4HN4A 4E2OA 4UXDA 4PYSA 3SUVA 3VIPA 2POZA 3SY1A 5AFDA 1IWAA 5AC4A 5EU9A 1ZHAA 3EWDA 1PHQA 4MWAE 4NP7A 5B80A 1R38A 1KM1A 4M8UA 2XH7A 2Y7GA 3IANA 3GKAA 5BMXA 2YYTA 4N0RA 1TFVA 2OWWA 3BANA 3I7RA 4LYRA 3GXTA 2XIOA 3SO7A 4US5A 2V8ZA 2D24A 1JDEA 1HJSA 1PE1A 3L0GA 4ICNA 3NZPA 1KR1A 1S1PA 1UBPC 4H6RA 3N14A 4QLJA 1FH7A 1XIIA 3L5LA 1J6PA 2JQXA 4R3UA 3REQB 1E56A 1EA0A 4J3VA 2BTMA 2ISWA 3W7JA 3NVTA 1DXEA 1TWIA 1ICPA 1GVEA 4H19A 1FWEC 3AXHA 3AMCA 3H70A 3GTIA 5IRPA 4PE8A 4YTUA 2FTWA 4AX7A 2QR6A 3ONBA 4IXHA 2QVHA 3WLKX 1JI2A 1J5SA 2OSYA 3HB9A 3LX9A 2W61A 1U5HA 1MW1A 4U5KA 2R6OA 4HSNA 3KTSA 4IG2A 4RE2A 1KBJA 1VRDA 1MUMA 2OB3A 4GYJA 1WZLA 4L5ZA 4GINA 3GFXA 4EPKA 1M65A 1TX2A 2DIJA 3VA8A 2PURA 1KGUA 1L8PA 1E51A 3BURA 1L0PA 2IPJA 1IZKA 1I1XA 3H6OA 4DJFC 3NXFA 1TELA 3WK0A 1RCQA 2RJHA 1IEXA 1M9HA 1R3QA 4D72A 3OODA 2QJNA 3R58A 1QAPA 1XRFA 3S9IA 4LEQA 5FF2A 4B9YA 1QO2A 2UBPC 3TR2A 3OJGA 1A47A 3CT7A 1KD0A 1RCXB 2FVMA 3HO8A 4W86A 4Y9MA 4KWVA 4WY0F 4YHEA 3ARXA 2ZRYA 1OC7A 4QEHA 4MLJA 1XQKA 1QT1A 2CZDA 1XGEA 2HDJA 4JS3A 4K68A 3LHWA 1JPDX 1BSIA 1G0CA 3V5OA 3W2KA 1E0XA 1XBXA 1F6PA 1JDCA 4F2TA 1D8CA 3COTA 5I0DA 1O4UA 4MYAA 2NUWA 3EWUA 2E09A 3L0KA 4LYKA 2ZWZA 2PRHA 4MFEA 3E5PA 3E6EA 9XIMA 4UQDA 3GYEA 4XD6A 5KMYA 2WMJA 3V3WA 3BAYA 3URNA 3LNPA 4YYCA 1E55A 2NSXA 4C6LA 2QJIA 3GBDA 4XTDA 1Q2RA 1FH8A 5KTLA 1QW9A 2X7WA 3SAZA 2FPTA 1M7XA 5D9NA 4Z17A 3NYZA 4GC3A 4XIAA 3W7IA 3TWBA 1JJKA 3HU7A 4O18A 1X6UA 3DFSA 5TNVA 4QFUA 1TUFA 1EP2A 2HSAA 2ZZ6A 3LM3A 2QYGA 1VFUA 4ORIA 1VIZA 1A80A 2CLFA 1TCDA 3IGHX 3LLFA 4YVXA 5D8WA 4JIRA 4Q4QA 2WC3A 1I9CB 1KB3A 2F6KA 1UZHA 1XLDA 3RR1A 1SU5A 4P7QA 1XLBA 1LOQA 2VGGA 1X7IA 1XPGA 1GKQA 4A8RA 3FSTA 1KBIA 5BMWA 1PX8A 3ARSA 2C19A 3ES7A 3PZQA 4P5UA 1OFDA 2UY3A 2PP1A 4UNKA 5AYZA 4UZSA 4UTHA 2WNZA 2OEKA 1BYAA 1PKLA 1F7BA 2J9YA 1KWGA 4JTDA 4LF2A 3GNNA 1YXCA 3O1NA 2DZVA 3THAA 2CZVA 1IT0A 2W27A 4J9JA 5CZKA 3DAQA 1H7RA 1BWKA 4BR1A 2J7EA 1R85A 1XC6A 4DY1A 1QTWA 1GOIA 1KM4A 3VC6A 4FOUA 1G7UA 4OHQA 1EUAA 1FWIC 3C8NA 4F9JA 1OGBA 4RK8A 4GIAA 2X1TA 1B3XA 4I90A 1E6SM 1H7OA 4C6IA 3OVGA 3MDWA 4W93A 3JW7A 4M6VA 4ERAA 4ZQNA 3WNKA 2P1FA 3MSYA 4IICA 3CPRA 1MI3A 2PD9A 3R8GA 4IMFA 1JCXA 2UY2A 5FJRA 3AUJA 1GQJA 2CNCA 3GUGA 1OYAA 1X97A 2IUZA 2QAFA 5D9MA 2CBUA 2Z4GA 5LNWA 5DBTA 4C60A 4NILA 3AMLA 4NQ1A 3EWXA 5G1MA 1Z9AA 1W31A 4GC4A 3F2CA 4MWAA 2C0AA 4H8UA 4CQDA 4XSMA 4GJIA 5KZDA 2OSXA 3R11A 3KRZA 4TOQA 4IZGA 1Y5VA 1WDDA 1W9XA 2HNEA 4IPLA 5FF7A 5G5IA 4XKMA 1XFBA 4LVDA 5JBFA 2OYLA 5A69A 1WP6A 3UYCA 2PTYA 1M53A 1HKMA 2F8QA 3N3TA 4JQ4A 4MB3A 5DEZA 3S5OA 4KRTA 2H6RA 3C0LA 4MAZA 2P3ZA 3ITCA 4FAMA 4N9CA 1QNOA 1KA9F 4PB5A 3UR5A 1W3HA 4LNYA 3WBYA 3VKAA 3EXSA 5A6BD 1J0ZA 3CHVA 4V1XA 2HRWA 2DJLA 4FI4A 4D1IA 1POJA 1TKKA 4J3WA 1AH3A 4ACZB 4QG9A 3UA4A 2Y8KA 2V3DA 2ZADA 5CBBA 2MANA 3PUGA 3W26A 5HOSA 4PCSA 5DMMA 1NDZA 2Y89A 2HPMA 2AGKA 1FWFC 2VENA 2VDGA 5AECA 2O55A 3RJYA 4GISA 2CBIA 1VENA 4FIRA 1O7AA 4QBXA 3UZYA 5CGMA 2XDFA 3A3XA 2P10A 3GNDA 1XX1A 3TDFA 3RMJA 1QI3A 3WZ0E 2NZLA 4GE8A 1US2A 4O4WA 2BXZA 1IIHA 1C7SA 3L68A 1DTUA 2OT1A 4M56A 5HANA 4XBKA 3CO4A 3CT2A 2PDQA 2V5CA 2V82A 3SURA 3OZMA 5HJXA 4H04A 4PB4A 4XD4A 1S2CA 4YYFA 3TTYA 3UWZA 3W6YA 4JFVA 3W29A 4CVUA 4Y6GA 3P82A 2NUYA 2FJUB 1KBKA 4XAFA 3M0YA 3MHUA 1JRCA 4KIEA 1HJUA 1WDRA 3W0KA 1JZ4A 1OBAA 1BTCA 1ISWA 1ZSXA 2BY0A 1XDJA 5D2YA 4P7LA 4CNSA 3BZJA 1RPXA 1JEZA 2FFCA 4PMQA 4C65A 4Z1CA 2VC7A 5LIWX 2XTKA 3T0TA 4L9XA 2AAAA 4GBDA 3CHCA 1ZZMA 3WKZA 1EO7A 2GJRA 4ZQCA 4LUIA 1E6NA 1O5KA 3SI9A 1ZJIA 5C9RA 2GUBA 1PZ0A 3RPTA 4YTSA 4PCTA 4LCRA 2PI6A 3WNMA 6ENLA 5G2IA 3VCRA 4XUGA 5HNTA 3M0IA 2XH0A 1H60A 2G37A 4LVFA 4XB3A 1JPIA 3SB0A 3EWZA 4D9PA 2W63A 3LGDA 4PRRA 4EVZA 3B0PA 2A3CA 1V6XA 3FAXA 3LCIA 3OP2A 4JIHA 3CAWA 4PFMA 5D37A 4GZ7A 1VFSA 1VYPX 3TYBA 3VD4A 2YBUA 3LS9A 3OBAA 1AMYA 3F2BA 3KTXA 1EO5A 2V6AA 3CC1A 1OC6A 1J0KA 1RQEA 4DJEC 2GQ8A 2ABAA 4WSHA 1HXJA 4J3ZA 1KFBA 3CV2A 3C0JA 4J35A 1TPFA 3EOLA 4B3LA 4GVIA 1Z41A 2WMHA 4TXEA 3AIWA 3N4EA 3V0UA 3UVAA 3VIHA 1JAEA 2H3BA 3FA3A 3VIFA 1EGVA 3KTCA 1S5MA 4XZLX 3CUZA 1W2PA 3ISIX 3JVAA 1NAL1 3W3OA 2W3ZA 1U1HA 2UY5A 2YDAA 3ZR4A 1OC5A 2DZTA 1WKYA 1ZRQA 1ISVA 3TX9A 1JCMP 4IGHA 3WUEA 5DBUA 3LRKA 1JUBA 3VZYA 2XSXA 4NHVA 3FJ4A 1S2AA 4AZ5A 3G1DA 4RXGA 3NQEA 3UG8A 1A5BA 4XISA 4KCWA 4R5EA 4NNAA 2WWCA 4ROQA 5M1TA 4AWTA 4S3FA 4PTMA 4ZB0A 5D9OA 1DORA 1AZ1A 5EMLA 5I23A 1AD1A 2CHNA 4QNWA 2JIEA 4MPKA 1K4GA 5LKYA 4OUIA 3AHTA 4PTXA 3A24A 5D02A 4YIWA 3NPXA 3BLPX 3VFLA 4UIOA 2V2DA 2VO5A 2XFFA 1P6WA 5LZLA 2HVOA 2VRKA 2W79A 1LRQA 5EBAA 2VGIA 4H8HA 2YCEA 1J11A 3SQSA 1K77A 2FPYA 3OOQA 1WPCA 1R86A 3KDOA 1V7YA 4LS2A 4K8HA 4GY1A 3Q45A 4DYKA 3G22A 2CU0A 3UNTA 2OWCA 1P7TA 3DIPA 4WCJA 2GL5A 4MB4A 4AY1A 3PZ9A 3UP8A 2G3NA 3MHGA 3S42A 3T0AA 2DW6A 2VX7A 2O9RA 5C5YA 3G1XA 2BVYA 3DESA 2VEPA 2PTXA 2PRLA 1HJXA 4E3VA 3CQJA 3UR8A 3AIBA 2ZE0A 1U33A 2C1GA 1I2QA 3W7KA 1BQGA 1G94A 2JALA 3O7UA 1JF6A 1YXDA 2E8ZA 1GHRA 3W7PA 3DYOA 3U7VA 4IMAA 1OYCA 3QLLA 1SPQA 2C0HA 2QMJA 3EYPA 1XXXA 3ORWA 2YA0A 3LG3A 4GXPA 3WEMA 2Q01A 5TQLA 4Y8EA 1CGUA 3W28A 3H7RA 4J28A 2CLIA 1MZRA 3NWRA 5CC3A 1CXFA 2NVCA 4DI8A 1H1ZA 2VFEA 4O1DA 4FS9A 5CH9A 2FDMA 3RILA 4KERA 1HL9A 4AZGA 1RP8A 1LORA 7TIMA 3A47A 1A0CA 3F4CA 3LV6A 3RU8X 1OJXA 4XWUA 3B0XA 4J40A 4U28A 2NXHA 1XLMA 5HK4A 1OFPA 1XIGA 4I7VA 2PLCA 1VPXA 4JYFA 4KGLA 1XGDA 4X0NA 1TA3A 4WOZA 1NWUA 3IEBA 1V3HA 3AFBA 4IFKA 2PE4A 3QQWA 4JICA 2YKKA 5DQPA 4X3ZA 3WLPA 4FNQA 4GQQA 2GJXB 4F0HA 1GVIA 1MEIA 3GTHA 3B8WA 2ISDA 2Y5EA 4IQDA 4XVDA 3FHAA 8XIMA 4E2VA 3W22A 5C2XA 5HPCA 4J5NA 5AHNA 4S1FA 1JRBA 3W1NA 3NOEA 5CLTA 2AKZA 1YADA 3VNDA 2ABBA 3PAJA 4F79A 1OIFA 4NUWA 2VFFA 1JFXA 3MS8A 3K46A 1W5OA 4G2DA 3NZQA 1YNYA 5KSWA 4UUIA 4HA4A 4S3JA 3MYOA 3BJSA 2XIIA 2TMDA 3AS3A 3WMSA 1XRSA 1CGYA 5CXPA 2XVKA 1OK4A 3MPGA 2Z1XA 1JUEA 1XYCA 4D6JA 2A3BA 4L61A 5AVNA 2ZUUA 3ABSA 1SO5A 4GFSA 2G96A 3W7MA 3RHGA 1UZDA 3DGRA 3NZ1A 4GUIA 3WQFA 5C2GA 2R94A 1K1DA 3T44A 1JZ8A 4PUNA 3LHZA 5AC5A 4A2SA 2ACSA 4PUUA 3FXGA 3AALA 1FXQA 2Q71A 5EKYA 4O19A 1N82A 1HKIA 4H9UA 1YRRA 1CLVA 2G97A 1OFBA 1B90A 4ZVJA 3WJYA 1I4NA 2BOEX 3P61A 3UWQA 4LGXA 1JG9A 2RHGA 4G56A 1ZY9A 3TAOA 1Q6DA 1HFBA 3CWNA 2OX1A 1GQIA 1OX4A 1L9WA 3HGRA 2QS8A 3UXAA 2FB2A 2W5FA 3NDZA 5G2WA 3TV8A 4WDXA 3VOFA 2GGHA 4XZWA 3HPXA 3FKRA 3FJ6A 2X1RA 4BI6A 4LU0A 4B5SA 4MIMA 1YTEA 3HN3A 1QPNA 7REQB 3VI2A 3W84A 2CITA 1Q63A 5HWJA 1VAHA 4E4PA 3UGVA 4WSJA 1CECA 5ABHA 1D7FA 4JYDA 1PBGA 3A3HA 4A8LA 4O16A 3LZ3A 1XBYA 3CMFA 1G5AA 1UZ4A 1FWAC 5CPQA 3VGBA 3E9AA 1KBBA 3WENA 3ZVHB 3NL6A 3EDFA 4LYPA 2D1ZA 1FA2A 3PG8A 3TYAA 3CZJA 1M41A 4ACYA 2BY3A 1L6FA 4BY3A 1IT7A 4O1EA 3PZOA 4H8NA 3FFSA 4QQUA 4O8RA 2Q3OA 3QLDA 4OZOA 2GGGA 4LC8A 1TPC1 1XBVA 2OEJA 2HNHA 4LPCA 3S2LA 2X42A 3O2LA 4KWWA 4ZQOA 3B05A 1R5YA 2IW0A 1UBSA 4RW3A 3PZUA 3G0SA 3HQPA 2PGEA 1TZ7A 4NYUA 3TCEA 2VEKA 1RD6A 4AEFA 1P6CA 1J10A 3H8AA 3UWEA 4XZHA 2B7QA 3NM1A 1XKJA 1E0TA 2WVUA 1BWVA 3TMQA 3GZ3A 3AWNA 3CPUA 4YXGA 3AAMA 3D5HA 2OQHA 1GZGA 3MI3A 2QT3A 4ADSA 3CMGA 3I6RA 1WUEA 4YS1A 3ARQA 4FNTA 3VK5A 1IEIA 4K6AA 1NP0A 4DO7A 3L4TA 1UPMB 2BVWA 2JF6A 2DQXA 4UMBA 3T6CA 4UFMA 4B4FA 4JX6A 2ZUNA 2YL6A 1JGMA 1WZMA 3SQLA 1HKJA 3G2GA 3S3GA 3H21A 1SZGA 2OZ8A 5A8PA 3NEHA 1D3CA 4Q4SA 1V3IA 4GNKB 1ADSA 2QF7A 1G67A 2YA2A 2O7QA 1GCYA 3NQ8A 3I10A 4JKMA 1SJDA 4ZR8A 1E4IA 2DH3A 3AIQA 3LUTA 1CB2A 3GC5A 1JZ6A 3GG8A 3ITTA 4J7RA 2V81A 4ATDA 2F2HA 1S2VA 3FK4A 2I57A 1F8MA 3ALGA 3OVPA 5XIAA 3TN4A 1JCJA 1RCOB 3IVUA 4HCLA 3SGGA 4MHBA 1DIKA 3C2FA 4J3UA 2PFHA 4E4UA 4DUWA 3R4IA 1OM0A 3SEPA 1LG1A 3OW1A 3PJXA 4A22A 4IHCA 3CZLA 5F4WA 3EKGA 3QMTA 5D4YA 3VNLA 1EC8A 4TX9A 1V0LA 4FSAA 3MKCA 1H5YA 2Y5SA 2RJGA 3INPA 3NO5A 3CBWA 3LBCA 5DY3A 3TFCA 3NSMA 3F5LA 3O63A 4O8AA 3BPWA 4YVVA 5LA0A 3ATYA 3GC4A 5CZSA 2A6NA 5M2FX 3DOPA 1QR7A 4M5PA 3E0VA 3TNBA 3GU9A 1QNVA 5E09A 3IJ6A 3G1RA 1E1CB 1R3SA 2NQLA 4IGNA 3S9YA 2BVDA 4H3DA 3TMLA 1ESWA 3MMUA 2RDTA 2FHFA 3HFYA 3I65A 3QF0A 1G1YA 2GSEA 1OB0A 1PVNA 2ZXAA 4PRWA 1Q6CA 4EP8C 3O15A 4ZOCA 2UY4A 3UPWA 4IWWA 1GVYA 1LUCB 4EPDC 4I5RA 2CLHA 1XC4A 1EWDA 4FZIA 2PC4A 4QCEA 4O1CA 1MW0A 1P1XA 1T96A 1XICA 2AQOA 2NXIA 3G24A 4MLRA 4FXFA 2XVGA 1H0IA 1K9TA 4DQWA 1BF2A 2WJDA 2X0SA 2V3FA 3G1YA 4Z08A 4Y9OA 2CKSA 2VVSA 2Z7KA 3NQGA 2WZTA 3VVGA 1UWIA 3QPZA 1TPDA 3L4VA 3WD0A 4C5YA 1W1PA 1UYQA 1ZQ5A 5HUPA 3FA5A 3VGFA 4FR1A 2XIJA 3LHUA 1W1YA 4WJXA 1HTIA 4YCOA 4IMEA 1VJZA 3IIPA 2CWNA 2CHOA 2Z1WA 1LQ0A 4JTJA 3LOTA 4LAUA 4R34A 1A5KC 2C1IA 1CWYA 2V2HA 5FJOA 2ZTJA 3GYCA 1LRNA 3SADA 1Y0EA 1WA3A 1O6IA 4WXZA 4Y9PA 4E6MA 4NZ4A 3ARYA 4Q8PA 1UC5A 1FX6A 3LQLA 2ZC8A 4BF5A 3KCOA 2DUZA 4J3TA 1L6GA 3GXDA 4WD0A 4GXMA 5BXRA 2HROA 2XM1A 2IMRA 2WAGA 1PCKA 1F6YA 3N25A 5C6MA 2DP3A 5JBDA 3IK4A 3E0LA 3DYPA 1F4HA 1BF6A 1R2SA 1S5VA 2NQJA 5A8MA 1A5UA 3EZ4A 2YCIX 1KCKA 2YBTA 3HG5A 1P0NA 2XN0A 4PGLA 1QW8A 4CQ9A 4EWJA 4MJ2A 4AHPA 3QYSA 3MYPA 3CYJA 1XH0A 3KHDA 1QU4A 4XZNX 2WO5A 3C2RA 3M0XA 2PDUA 3EEZA 4IQLA 1M6JA 1WXJA 4Q8OA 1Q6FA 1UIPA 4JN6A 3RK8A 5TBOA 4QROA 3S46A 3STEA 3KRBA 3I4KA 4TMBA 1UJQA 1Q8JA 1OG0A 2ZUTA 1O1HA 2WQDA 4QNEA 4JHZA 1G7VA 1XYMA 3M41A 1XM3A 4UTMA 4F40A 2BOFX 1A5AA 1BSLA 2V2CA 4Z2JA 4UR8A 3UY8A 2EPLX 4GFIA 3LCLA 3VILA 1A4LA 4K37A 3BLKA 2FVKA 4BQ4A 4QSHA 1W5QA 1BVWA 3QSRA 1OCJA 5I7GA 1I2RA 5IDIA 3EPOA 4B2DD 4QJ4B 3UXDA 4RZBA 1VFHA 2PWFA 4PH6A 3UESA 5FEWA 1ZCCA 2V5KA 3KOFA 1F5ZA 5I6SA 3T0DA 3I3DA 5F4SA 2PDHA 2WKJA 4DM1A 4UFJA 5E0CA 1RR2A 3QKEA 4I7UA 1REQB 2J7GA 2XFYA 4US6A 3WNPA 4L80A 3T40A 1FWTA 1V3JA 3W76A 4H7VA 1W3TA 4O11A 1H61A 3ICJA 4YMZA 1MQRA 1TPUA 2DV0A 5CJMA 5J8LA 5FEXA 3KL3A 3NNTA 4REQA 1K4HA 2D73A 1Z6KA 4IUGA 1LTDA 4OBSA 5EGRA 2PBGA 1V6WA 1B30A 3C2OA 3ABZA 1QDSA 1EX5A 2YA1A 2WM1A 1DHPA 4PUEA 4FLOA 4LX4A 4O0QA 3WBAA 4IP4A 4RDWA 2R1NA 3BQ6A 3IGUA 2J75A 2R24A 3LBMA 1OX6A 3IJLA 4IJBA 1QVBA 4AEOA 4P8XA 3A12A 4ZTYA 1XBZA 3FN9A 3R8HA 3O06A 3N04A 5F2GA 2Y2WA 5M5DA 1EJXC 3O0FA 2ZVIA 2AQWA 4Z2IA 4IX2A 1NU5A 1R3TA 3WF0A 4C5ZA 3LMYA 3P84A 2VD8A 2Z0IA 4A3YA 3CH9A 1XYFA 4C6MA 4CU6A 3KBWA 2CW6A 4PUMA 3QW3A 3VIKA 3BTNA 1VZWA 2EG8A 3WIJA 2PDFA 3SJNA 1ZGDA 4ZB2A 4A05A 4CU7A 4BFAA 3PZMA 1OK6A 1AUSL 3W72A 2C18A 4K8GA 1WOAA 3IV3A 1YPFA 2FDSA 1UD6A 1OF8A 2WBGA 1XYAA 1EDQA 4P8UA 2G4JA 2WANA 1QNQA 4CEUC 1V08A 3EGJA 1OG6A 3LHVA 1CPUA 4HK5A 8RUCA 1W3JA 4NXKA 2V5BA 4GVGA 4IXXA 3MV01 4GY7A 3TQPA 5CPNA 3QPYA 3WBXA 1KNWA 4Q8QA 1TJ2A 3ZJ8A 3D0CA 5JU6A 1ZALA 3NEVA 3V35A 3NPUA 1UB3A 1UQZA 3WJZA 1E70M 1ADDA 4FP1A 3TWAA 3CM4A 4L56A 3N34A 1AD4A 5DT7A 4OE7A 3KLLA 1LP6A 1ECEA 3KOWA 4JTQA 3GVWA 1FWJC 2IKJA 3AO0A 3M1ZA 2V30A 2BOGX 1NP2A 4KW2A 2V3GA 4AD3A 4NZ3A 4XG1A 3G0XA 3CQIA 2WKGA 4CLMA 3WEOA 3CHEA 1T5AA 4E2DA 2XIBA 5AHMA 2G4FA 4GI8A 1V02E 1XCWA 4Z1DA 5A6LA 2QAPA 1CXEA 1D8WA 3QW4B 4PL2A 3RMEA 4OV9A 3ZZ1A 2YJQA 3S9ZA 5BW6A 3W1TA 2X2YA 3SCRA 1ZLPA 2YXGA 4NNBA 4WOQA 5K4XA 5HJYA 4W7WA 1UR2A 1UKPA 5D04C 2VZSA 1G4EA 3VKCA 1CGVA 1ITQA 3R0KA 4WSKA 3MBFA 3UNDA 1UWRA 4AZIA 1GHSA 5HMSA 4C6NA 3AMGA 2OLHA 2WZHA 2QGYA 4QGCA 1U22A 4BK9A 3QV8A 3GK0A 1MUWA 5TIMA 3FS2A 1OCQA 1OD0A 2CLEA 2QHAA 3M0KA 2POTA 5LNVA 1ITUA 4S3AA 5FKYA 3R13A 1KWKA 4WDWA 4LY8A 3ECQA 3QOKA 2HCVA 2NX9A 4DI9A 4IFRA 1QMLA 3GDMA 3RYSA 2WMGA 2WKLA 3NQVA 3T05A 3V16A 5IHRA 4ATLA 4PTWA 3PP7A 3SUWA 3OLIA 3M5YA 2GSJA 4ZXOA 5H6HA 4I9MA 4WRHA 2WVVB 1E72M 1X6LA 3GHTA 3M07A 3E38A 4NZ5A 7ENLA 3SR7A 3DC8A 3NGJA 5BCAA 2PWDA 2ZZ4A 1VFLA 3ZM8A 4IPNB 3LPPA 2WMKA 4Q8WA 1X8FA 4GUHA 4WHBA 5CC6A 4YU1A 4DF0A 4HJWA 3GB6A 2QQ6A 3WQGA 3MSDA 4IIFA 3VNMA 1YMYA 1NEYA 1GJWA 1XISA 3DFYA 1NOWA 2I56A 2P8BA 3MWAA 1KLZA 2Q3RA 1GW9A 3PTMA 4Q6XA 2VMFA 3RPDA 3OVQA 3ITOA 1ML1A 4AIOA 5FEZA 3G8RA 4LAMA 5EMYA 5F2IA 2UV8G 4AUBA 3VOJA 4RNFA 2WMIB 4ATWA 3CU2A 1E5NA 1MMFA 2OR2A 4F2BA 1RD5A 2G50A 3M0JA 1X8CA 4XBJA 5I02A 4GHRA 5KZMA 3MKKA 3MBDA 3T2OA 1Q4WA 3FLUA 4JDYA 2ZOXA 3VM7A 2ONEA 2ZXQA 4W5UA 4DUXA 3NSXA 2BSLA 2CYGA 4RE4A 3BAWA 1TRDA 3GG0A 4GUFA 2GVYA 1N55A 2VEMA 5BXPA 2OWXA 4A3RA 3JUGA 1VR6A 4AU0A 1E6PA 5A6MA 3FGCB 3KX6A 4WVXA 1M3UA 3NAVA 3LCWA 1YE6A 1V6TA 1QNPA 3PPFA 1V6UA 2I5GA 5E9AA 1UROA 3T4CA 3CV1A 1QI0A 2QV5A 1IEWA 2V5DA 2W6RA 5HNUA 1PKMA 3DG6A 8TIMA 4R7JA 3M43A 1MQQA 2E1DA 2RGLA 1JL8A 1PTDA 5A1AA