1GVIA

Thermus maltogenic amylase in complex with beta-cd
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
588
structure length
588
Chain Sequence
MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPAISPKGARPWGSEDPTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGAASRYKDWFHIREFPLQTEPRPNYDTFAFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGLIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRALRRGDVAFLTADDEVNHLVYAKTDGNETVMIIINRSNEAAEIPMPIDARGKWLVNLLTGERFAAEAETLCVSLPPYGFVLYAVESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclomaltodextrinase, Neopullulanase, and Maltogenic Amylase are Nearly Indistinguishable from Each Other
pubmed doi rcsb
source organism Thermus sp.
molecule tags Hydrolase
molecule keywords MALTOGENIC AMYLASE
total genus 165
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gviA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gviA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gviA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1gviA03
4ZOEA 3QIBB 4UIKL 1G7JA 4YE4H 4WNQB 4ODTH 4KWUA 4APQA 1UG9A 1JPGB 5C0JB 4OUUB 3CFCL 5E6IC 4RGNB 3WD5L 4D9RD 2XWEA 4TPRL 5BVPL 3RDTB 3MV7A 1V6UA 4K8RH 1EHLH 4NZUH 2OP4L 5B39B 3ZYIA 3BD5A 4P7RA 1YPZB 3AQUA 5GSRB 1C8YA 2IGFH 2DQIL 2FD6L 5EB9A 3VFRB 4HWNA 1HXJA 2J2ZA 3O2WH 5HY9B 3UBXI 2X9XA 3HC3H 4PG9B 3G6LA 3LKNB 2ZCHH 3BD3A 2MJWA 2DDQH 2GUOA 1LE5A 2YFNA 1EO5A 5KSAB 4HGWB 2NMSA 4NQDB 2WIIA 5E95B 3DXAB 3RWGB 4RQQB 3CBWA 2FR4A 5E1AB 4M7JL 1VPOL 1MSPA 2IBGA 2X2YA 1V6XA 5HHMB 1TTFA 1OW0A 3FFCB 3D2UA 4XWGH 1J0HA 2J75A 2BXYA 1RURL 4WFHD 4U4BA 1NMAH 4JHAL 3V5HB 2I24N 2DI7A 3EDFA 4MD5B 4R97B 1OTSD 4V28A 3ULUC 2JJSA 4U6YA 3Q1SL 4OF8A 4XWGL 1D5XB 5EU7E 1KCRH 3DO7B 2C3VA 1KTDA 1VGKB 2D0FA 4MNMA 5DJ2B 1AGEA 1N8ZB 4XB8A 1BHGA 3NZHL 2AS5M 1OTTD 1UKOA 1F3DJ 3IS0X 5C0BA 2F1AA 3WD5H 1OGSA 3DSFL 5EU3A 3CVHH 3B3IA 1AGDA 1TQSA 1QX1A 3HNSH 3BSZH 3W6MA 3AIUA 3WDRA 1FPTL 4G7YH 5HYJE 4IJ3C 1ZU8A 3VTRA 3HPJB 5JA9A 1LL7A 4U6HB 3D87B 2GTZA 3FQUA 4L9LC 1MCPH 1PG7W 3TA3A 4DUWA 4JHWH 3BQUA 5GGRA 5HDBE 1G84A 1CXHA 4U7KA 3C60D 3BVWA 3DLQR 4HCRA 1M01A 3D6GA 1KN4H 1OGTB 1J1PL 1E6JL 1OAZL 4PR5B 1FZOA 4UQEA 4Z0BL 3DX7B 3QIBD 3ES6A 1DDHA 3ZSTA 3RX5A 3MMUA 2OW6A 5EPMB 2XVNA 3LRSA 3W0WA 3FOMA 3HZKB 2R2HA 4O4YH 2J6EH 3VIOA 5FYLD 5A94A 4JRYB 1T04B 3DUUA 4ETQB 3VXTA 3WENA 4FLRA 5I8EB 5F88B 2MANA 4DVRH 2EPKX 3QFJE 5F7HA 1P84K 4MAUL 3WN5B 1BBDL 1XF4A 1F4XL 1VFBA 4M5YH 2WKGA 4NKOA 1RVFL 4RMVA 1P7QA 1NBZA 4QHLB 2R4RL 2FLRT 3OAUH 4ALAH 4Z7UB 1J1OH 3EOTH 1PD6A 4P2QA 4TTGA 2V38A 5ALCL 4RISH 3HRPA 4OLZL 1MUJA 1UEYA 3P73B 2D3VA 3F7YA 3OG4B 3T0EA 4IPLA 1LO5B 1Y7VA 1J87A 2X6MA 2ZCLL 5C0DB 4LSSL 4BQ4A 5C0CE 1M05B 2IQ9L 3DXAD 5SWZD 3RNQB 4KUZH 4NZTL 1A4KA 4Z95L 3DURA 2GITB 3PGDA 3DVNA 4JPWL 4X6CA 4ETQA 1BZ9B 3GIVB 4ZOBA 2EAEA 1AKJB 4HXBL 2H6PA 3OLEA 5FUCC 5DJ8B 4J6RL 4JY4A 3TN0B 1HCFX 3V6OA 1MNUH 1OQXA 3WDJA 4CCCA 4YDVB 3ES6B 1MWAB 3P4MA 2BHZA 2AGJL 1W3JA 1RV6X 2K1MA 2BNQD 1DWFM 1EVTC 4JFFA 2NW2A 4EN3B 1KIUA 1WEJL 4N5EC 3QDMA 4KROB 1AQMA 3PJSB 5EBMB 5ISZD 4AIUA 3WO4B 4PRIE 4YXKH 1N6QH 4UNIA 4J8RB 3VIJA 4NQUA 1HJXA 4HPOH 1ITXA 3MRMB 2EPNA 5JDJA 3TNNB 4QO1A 1NGYB 1AGDB 3INUL 5DJAB 1JTPA 5IVZA 1JFQH 4HU0A 5JPNB 3RWJB 4JY5H 4OI7A 1FORH 4XHJD 4GPNA 4KY1L 4HWBA 1A6VL 5E0QA 2WUBH 3VINA 2LU7A 4CCDA 4CW1A 1GHSA 5FECB 3L7FB 3RVUD 2R1XA 1JDAA 4HKZB 3CFIC 1AO7D 4KQ3L 4RNRA 5ABDE 4X0NA 5BO1L 1MVFA 2VI0A 4I13B 1BFVH 4GAJH 3AUVA 4X99B 3BVVA 1UJ3C 1XIWB 4W7WA 1FO0A 1MJ8L 1AGBB 4AY0A 3KPSB 5HGDB 1G9NL 2AK4B 5GRVL 1V0KA 4D0DA 4G6KH 4X7SH 4YHLL 3HKFA 1TTGA 4L3EB 1HCVA 5EC1B 2CLVB 1JL8A 3OKMA 2XQYG 4EI5A 2YPLE 1X5KA 3HC0B 3PTKA 3ZJ6A 4PGDA 4XC1L 1TPXC 1QSFD 1SFSA 5KN5B 4L8SC 3ZR5A 1BJ1H 3EOBA 3AMGA 4P9ML 3EO9H 5TFSH 4F8XA 2C1PB 3BN9C 2OL3H 3DYOA 5DJXA 2PYEA 4U6XA 1QHPA 5DHYA 1JGEA 4WUUE 4PMDA 4H0GA 3O6FD 1JYWA 1GAFL 2DLGA 1BD2E 2ZWYA 5IESL 2H6PB 4X7EC 4LXFA 2IMNA 4DN3L 5J6GA 4IBLT 2P5WD 3MOAH 4HMCA 4HKJA 4YHZH 1DQQA 1EUUA 4PJFB 5DRXB 1T7VA 1EEYA 1EQCA 4Y1AA 1NARA 2VRKA 4PMQA 2HVKB 4XBPA 2DQHL 5CLTA 1OWRM 1U42A 1ZKAA 3G6JE 4YX2H 5I1HH 2KZWA 1G9HA 3IFLL 4H20H 1ZVYA 5J0BA 1KTCA 3NH7H 4PJHA 2DQDH 4IMLB 3T77A 2MFNA 2YPVL 4ZTPH 4B15A 5EOQH 1P6AB 1IARB 4EOWH 2CBIA 4JR9H 1G7JB 5AWNL 5H8DA 1WV7T 1ES0B 2FJFA 3DUHA 1JPTL 4P2RA 5CZVH 1KJVB 1C93A 3BEWA 3RMEA 1ZGLM 1TQCC 2G5RA 4NRYA 1OAXL 3HI6L 5JW4Q 1TQUA 2VIRA 2V5RA 4PGCB 2Z0BA 3A6BL 5DJDB 1F3JA 1MFVA 3KYOA 5IG7A 5TDNA 1VB9A 4K23L 1JWMB 4JFDD 4Z2IA 3HR5B 1G6RB 4WTZA 2WVTA 4YFLF 1BBJA 3B6SA 3RWIB 4HJGA 2L4OA 5GGRY 4LBEB 4KMTL 2HFFA 4BSWB 2X4SA 3VGHA 3G6DH 4E4PA 4MMZC 1YHTA 4UAOB 4LCUA 1E27B 2CBJA 5ESVA 3QGVA 4FZEH 4WLCA 4DTGL 4RMUA 4OOZA 3RY4A 1GGCL 4R2GC 2PW2A 1FFPA 1J8HE 2Y7QB 2YUVA 4W4OC 1TQVA 3KPSE 1BX2B 1I8IB 3O6LH 4EKXA 3CH9A 3I3DA 1VJSA 5KW9L 1B0GA 1ZAGA 3J8F7 5E2WH 3ECBA 5CUSH 4AEHH 1E1FA 3SCVA 1YY8B 4QT5A 4DN4L 1BWWA 1T5XB 3KLHC 5A2AA 1QNQA 3MC0A 1UZ6E 5IVXA 4TQEH 3SDYL 4WJXA 4M62L 3PQYB 3KWXA 3T0EC 4EE9A 5L8JB 1AXTL 4HZLB 1GQLA 5CLWA 4JM2F 1YEJH 3S7GA 1HQRB 4Z7OF 2J7FA 3PWVA 1QFUH 3ARED 1DQJA 3TIEA 1D5XA 8FABA 4R97C 3ULVD 1WBXA 1CTNA 3CDCA 3BXNB 2V2TA 5BXTA 1MFCL 3SGDI 2EQDA 2AEQL 1M7DB 5IB3B 2X4OA 1S3KL 2N7BA 3QEQD 5ISZA 4AIXA 1QO3A 5HXMA 2EPMX 1MJJA 3HAEB 1NGPH 4TOYL 5KVGH 5A2KH 5C6WH 3SDCA 4LAQL 4AT6B 3CAFA 1GSMA 1IQWH 3VFWB 5JORB 3TT1H 1A1MA 1Q9LA 1ORSA 2X4TB 3MR9A 1IM9B 5T3ZL 1TPXB 4QWWC 3WIFB 1HP4A 4AMXA 4ODTL 3BAWA 1C1EH 1F90H 3SBWA 2XIDA 3BWUC 2J88L 4EKJA 1P7KA 3MLSH 4S1QH 1E6QM 4LSDA 2I5YH 3KPRA 1AR2A 3O4OC 5JHDA 1N3NB 3U7YH 4HS8L 3TCXA 3DBXB 2C3HA 4Q6IB 5FOOA 1IEBA 2NY1C 1A6ZA 3MSDA 4WHTB 2D22A 3LD8C 1A02N 5AWNH 5D5MB 3V6BR 1Y6NR 3SUWA 1ADQL 2JCCF 3TYFB 1IM3A 1UA7A 1A14H 3CU1A 1NCWH 4AYGA 3IDJA 1CDYA 5CEZE 4U1LB 3SOBL 2ARWA 5L6YL 3WIIL 1A3HA 1UXWA 2Q8AH 4HPGA 3QIWC 3LEVL 4F57H 3WDQA 4FFVD 2DJUA 2XNAA 4ZXOA 1K4DA 3U0TB 1S7TA 4GRWB 4MAUH 2BVOA 3NIDE 2OJEB 2R56H 4JDTL 3ZDZF 2HG5A 4PMUA 4PJBA 4TTUA 4KKCD 1P6WA 1H8SA 5K9KB 4QHNA 3QJFA 5DJCB 3VRLE 3GMMA 4OT1H 1T0MB 1X5IA 5GRVK 5C0CB 3RIKA 4G42B 3MRQB 2AK4D 4FMFA 4G8IB 4ELKB 4HS6A 5LCVH 3WJJC 2A1WH 3FHQA 4F7CA 1VKXB 2BC4B 4JM4L 5FM5O 3ZO9A 3RZCA 4PUDA 1YY9D 1VESA 3ARDB 3RVWD 3SKJH 2A3CA 1HSBB 2GFBB 3MV8E 3ZT6A 1S9WA 2FDMA 3WUEA 2X0HA 3C5SA 1K4DB 3CFEB 2BNRD 3RVXC 2B1AH 4LP5A 5DRZB 3SJVE 1C8QA 3HFML 4TSCH 4D9QD 4Z0XB 4W8LA 5E2UH 5C3LD 1FGVH 3CCHB 5IVOA 3UX9B 1W1VA 5AY7A 1VEMA 4P46C 1R86A 4CD7A 3O81A 3ARGA 1CFBA 5J06A 2MCPH 2FL5B 3QHMA 1IM3B 4TULL 2EDFA 3KR3H 4PJBF 3CV5A 2H32B 3DX2A 1YA5A 3MFFA 4IISA 5E08H 1IGTA 4G5ZL 5I8CB 3G08A 4ZYKA 3HNVL 4JPKL 4ODSH 3RWCA 4V27A 3IU3B 1I75A 2QPUA 4YXKL 2V7HB 4QGYA 1E28B 3MA9L 3BVXA 3TH3T 4PTXA 1HHJA 4PJGA 4NSBA 3WSUA 4DO4A 5GRJH 4N0RA 3EO1B 2GEEA 4D9RE 4OLZH 4XVUD 4OKVB 1BLIA 3AIQA 2OWWA 4G9DB 1UD3A 1RUQH 1EXUA 5FHAH 4EI6B 3MLZH 4TX6A 4U31A 4KPHL 1X6NA 3DV4A 3TBYB 4WK9A 5IFTA 1IQDA 5BRQA 3AJ7A 4WI8A 3ARQA 3QR2A 2D24A 1KG0B 1DFBL 2WQRA 3HG5A 1LE9A 3BKYH 3QEQA 4HW6A 1KXQE 1TENA 4OLYL 3ETBF 4L8SB 4YHLH 1BOGA 5D1XC 3L5HA 2IBZX 1NCTA 4Y2DD 2ZUXA 4TSAH 5KAQG 1EHXA 4PUEA 2XM1A 4KJWD 4JREC 1WZLA 4N8VG 3G6JA 4NHCH 1AD9A 3VRIA 1I8MA 5EUOB 4FQHA 2QMJA 1T1XA 4P4RA 4JQVA 4OQTA 3F5KA 1HNGA 1G9EA 4K3JL 4OCMC 1MY7A 4RZCB 4PJ9A 1EO8H 3NIFE 4N5ED 2BNQE 5CFHA 2GAZB 4OFDA 5TDPB 1OP5H 4P7QA 5F1KC 4WKAA 4MQ7B 3MRJA 1BQHB 4QLLA 1YZZA 3FT2A 3UO1L 3S4SB 4B9YA 3D3VD 4LGPB 1JFQL 5JHDD 5I8OH 4F9LC 5DWUH 4NCDA 3FO1A 5C07B 5IF0A 4Y5YC 4CVZB 3ROLB 2F54B 3BMWA 3OKOA 2K3TA 1H5VA 5TDOB 2W66A 3VIKA 2O5YH 2DBJA 3U9UA 1ACZA 4JFFD 4PY8I 4NQSB 5JDSA 3QCTH 2CPUA 2RFXA 3L9RA 4H25A 5D7LB 1U6AL 1S7UA 3NZ8A 1FIEA 5EOQL 4HEME 1OAQL 4JPIB 3ZKMC 1VIWA 4Q9CA 4XTRD 3PXHA 4NO5B 1PPIA 1R46A 4GMTH 3DOSA 4HIJA 3ARBC 4P5KA 5KSBE 3B2VL 3DARA 4HZAA 2CUMA 2VDKL 5CZXC 5FOJA 1NWUA 1FVCA 2E7MA 2G60L 2HN7A 4CN1A 4KUZL 1H09A 3F5WB 1LP9A 4H1LH 4DKEL 1OM3L 3QDJA 3QFJD 4XWOC 3WV0A 2TAAA 3DHJA 3WEMA 4X4YA 4G43B 4YHYB 2VLKA 2AJVL 1J9CT 3DWTA 3JSSA 4M1CD 4YHML 1EDGA 3SCMC 1MCBA 1LNUB 5E9DA 3BWAA 2VRAA 4D1IA 5JUVA 3EMZA 1V7NH 1I1AD 3QHOA 4M7ZC 3JZ7A 1QSEB 3MGOB 4LCYA 2BNRA 1W3KA 2I25N 4JDZB 2Z8RA 4N9GA 1ZLSL 5DVOA 4I4WA 1Y0LB 3BDYL 3H0TA 5FKPB 4KVCL 4D9LL 4NO0B 2PYED 2Q86A 1JUFA 2UY3A 1VDGA 5F7WC 4D8PA 1F6AB 3PHSA 1BYBA 5IHSA 1FNGA 1KCKA 1LO3H 3IU4H 4JQXC 1A7QH 5DD3L 5HBFA 3EJZD 1RIVL 4N1CA 3OZOA 2JJWA 1G7QB 3ESUF 4MNGE 4FTVE 4HPYL 2XN0A 3FB6A 3CUPA 1R87A 2E6QA 3MRDA 1KPRA 4KY1H 1T0NA 1ORQB 3VFPA 4AYSA 1FNEB 1QOKA 1X5JA 1LL6A 4MJID 3QFJB 1BJMA 2BZDA 3RTQD 2VX5A 2E5EA 4OZOA 5GS3A 4RCAA 5BJTB 1JPTH 4X6CF 1FL3A 4FQIL 3FO9B 1Q6GA 4P46A 5FF6B 2IEPA 1GPFA 4HOWA 5EOTA 1QRNE 2OCFD 4JY6B 5EO9B 3ZDYE 3GHBL 5KVFH 1XAUA 2HMIC 3ARYA 1LVEA 3CPUA 4ENEC 1FFOB 4OM1H 2GK1A 3WY2A 3QEHA 2ICCA 4YDKL 5LJYH 4W7UA 1CZ8H 3B4NA 4E41A 4ORZC 2WBWB 3SGDH 6A3HA 4MA8H 4K7PY 5E1QA 3NPSC 3H9SB 2PW1B 3ZO0A 2J7CA 3AXXA 4TUFA 5I1DB 1A3LH 4P8UA 5MERA 4TXEA 2FYYA 2ZJSL 2HT3D 3DPBA 1FH8A 2A3EA 5EOCJ 5GGUB 1UB5B 4MJIB 3WYRA 4KRLB 4GH7B 1KXTB 4CDHA 2ARJQ 4OF7A 3SQOH 4M7LH 3NABH 1QR1A 3P30L 4AWEA 1JCKA 2CO6B 2YN3A 4R2GB 5D1XD 3POHA 1YEDB 4WGVB 3P0GB 3HS0B 3WLWD 4IMKC 4PPTA 2NW0A 2ORBH 5BVJA 3G04A 4X6CB 1NWTA 1UR4A 2EXOA 1N5AA 4PGBB 2OS7A 3BAEH 3DMMA 4NNPL 2QHRL 1G1CA 3PZTA 2Y06L 5HDQL 3W28A 4QRSA 4XX6A 4FQPA 4KAQH 3PWNB 5CMAB 4X7FC 4HIHA 2X89A 1BZ7B 4LPXA 4Q97A 3UG4A 4MNHB 5SX4I 3TO4B 3WH7A 2XWDA 4DUXA 3AREA 1XF3B 1MUJB 4NXSA 3ARFD 2AJ3A 3L5WA 3CFBA 3L6FB 2W9DH 4NM4L 5FEBA 4LLWB 4ZQKA 1OSZA 1MF2L 4BFGA 1GNXA 3HZYB 1KUMA 4FG6D 3WHXB 3L2MA 4I5BB 4OIIH 4X7TA 5DHVH 5ANME 5CEZH 5FL1A 4YWGH 3W6LA 2WUCL 5DT7A 2EDKA 5CP3A 1FGNL 3QUKA 5JIPA 1ZJAA 4Y19B 2ZX8A 4JO2H 2W67A 4Y5YA 1FFRA 3C60C 5FDWB 5SWZE 1NFIB 3SDXE 3ARZA 4PP1C 4FXKA 4K3EH 3VDHA 4B5EA 4JRYA 1RIVH 1LEIA 1IC5L 4UFKA 1P7HL 1RHHA 5LBSH 3AB0B 3P11L 1O7SA 1MELA 5CBEA 1XH3A 3U36B 5L9DL 5K9OA 2ESVB 1U58A 1I1WA 5F1IA 3SURA 3KPRD 2VDRH 5EDXA 4RWHA 1BM3L 4KKLD 3VXMB 1CBVH 4JN1L 4QRPE 4OIFA 3NACL 4ODUB 1YN7A 4WO4C 1TCRA 3CFJA 1AJ7H 1KOAA 1ZA3A 5D70H 5C9KA 3EGSA 2W0PA 3REWB 1BZQK 1W32A 2FEDC 3QNXB 2FATL 5JOPE 3BZFA 3BLPX 1P4IH 3IFPB 1UYWL 5E2JA 1IL1B 2BVEA 3WFDH 4NNYA 3NPSB 3AS3A 1KCSH 3SHSA 3TBSA 3HR6A 5ALBL 4UINH 2FLBT 3BGMA 2VX7A 1A6AA 1R3LA 1RK0B 1ZHBA 3VRJA 3DUSA 1NL0H 4UIMB 4G9FD 4PJ8A 1HINH 4OGAD 3ARWA 5T1DH 1C12A 3WQ8A 2AXJA 3ARDD 2FE0A 5BYWA 1KNOA 1UR1A 1EX0A 1AD0A 1BBDH 2X70B 4W4NA 5GGQH 5I1IL 1BZ7A 1NGZB 5BXSA 3HN3A 3LQZB 3T3PE 1O7AA 1FZJA 4O5LL 3T4AA 5JOFB 2F18A 4WSKA 3ARBA 5CPQA 1BQLH 1EEZA 4BQ9A 1EJOL 4FFWC 1BGXL 1S7WA 2YMXH 3P0YL 5JXEC 4YAQA 1IGYB 4LKXB 5D2LA 3LQAL 2CESA 2AKRB 3ZT5A 5H2BB 1UACL 5HPMA 4JE4B 1MNUL 4R96B 5IFHL 2WHKA 5IIEB 5KS9E 4JN2A 5K59F 3HPLA 2BVYA 1N7MH 4LHUB 3OKKB 5EFFA 4WFFE 5EU4B 2CSPA 2AGJH 3OL2A 3QO1B 1C5DA 4XX1E 1DWIM 3CZGA 6FABL 5HDBF 4B7IA 4Y5XB 2FSEA 4IRSA 2OXHA 1M6OA 3CVHA 3V52L 4HUWA 1FH9A 4DZBB 1C91A 1EMTH 3LCYA 2EH7L 5MERB 4PRWA 4FQ2L 4P3WA 3C2AH 1GOIA 1ZEAH 1RUQL 4OIBA 2EDTA 4X6FA 2AVGA 4WU5B 5ELIA 5C92A 1HDMB 3CIQA 1RJCA 1L9MA 2Y8VA 1JF1B 3CC5B 3TO4C 4W85A 4E41B 1ITBB 2YPLA 4M1DL 4HUMB 4GKZA 3FT3B 4UV4L 2CRIA 3QCTL 3RPMA 3SCMB 5EO9A 3MRFA 1R5VB 4X8XA 3SE8H 4F58H 2DLHA 1BP3B 4OQTH 5AYUH 2UWEE 3MNWA 3DX8A 4HH9A 5ESAA 1M6OB 4UT9L 4YK4C 1AGCB 5DQ9A 1UJ3B 2V2WB 4WUUB 4XZUA 4J4PA 1P84J 1WCGA 3K4AA 5I3DA 4G6FD 3V79C 2H26A 1U8PA 2X89D 3H42H 5IGXH 1UH4A 3F8UB 3IXTB 1U8JA 2WZIA 5IMMB 2GJXA 4NQEA 2NY5H 3HFMH 1IT9H 5DJZA 5CEXA 1IGYA 4LKXA 1UD4A 1HKMA 1F6AA 4UU9A 2F8VA 4K71B 3G5ZB 4U33A 2IGTA 3MV9B 4PRIA 5DO8A 1S7VA 2YBTA 1JVKA 1SMOA 3KHQA 5IJVA 1Q6EA 5E56A 2I07B 5I9QB 1FYTA 3D4YA 1MWAL 3OGRA 1QEWA 4NSKB 3W0WD 3NGBB 1I3GL 4POUB 5DDHB 1HILA 3MSGA 4NQDD 4MJ6B 3WF3A 1Z9MA 3IJ8A 2DIJA 1KQYA 3DIFB 5FUOH 1RJZB 4UIMA 4OJFH 4U5KA 3D51A 3CZJA 5TQ0L 1NP0A 1I3VA 5F7NC 4P2YA 1BFOA 3D18A 1WUNT 1F4HA 2GFTA 1B2WH 3B9KC 3ARPA 1A8JH 3LPGA 1KPVA 4KHXL 1T7XA 3QXWA 4WI5A 3FB7B 4W5UA 3QUXB 2XKNA 5ID1B 2JF7A 1CE6B 4G8EB 2R2EB 4LAJH 4PJCE 4BFEA 4MXWL 3QEQE 1EO7A 3WHE0 2R0KL 2CXKA 2J8UF 1XH2A 5FGCE 3WFZA 4L1DA 5JNYA 3WKZA 4GO8A 4OB5L 3TNMB 4TUOA 1B4JL 2DAVA 2VDQH 3KJ4C 3AREC 5F3HB 3BVUA 1GC1H 2X4QB 1MW3A 1JNNH 4KTDH 5CBEB 4P59L 1SBBA 1VCAA 1A47A 1AP2A 2VERN 2R69L 1ERNA 1VACA 4NQCB 4WIQA 2Q3ZA 4H8VA 4KMLB 4PYGA 1A2YB 5D93C 1BYCA 3RX7A 3B9AA 2WCGA 1T7ZA 4JM2D 4Z2HA 1ZEAL 4OZFH 4GRMA 2BVDA 3JWDL 3K4DA 1G0YR 5KSBB 4L8CA 1KEML 5DEGB 4R90H 4M24A 4F33A 1N64H 2NY3C 4FFYL 1CZ8L 3ZTNH 2YK1L 1UHVA 3ZE0E 4ZTOH 4ZO7A 2F9BT 1IQWL 4AEIH 3PHQB 3FQRA 4AIZA 1MHCB 3CFCH 3RJXA 2ICES 5K9QI 1T5WB 4Y7MA 4N90D 3WFBH 4C58B 4GRLB 3TH2T 4OAWA 2H2SC 4XNYH 4YEFA 1PX4A 3RM8A 5CJXA 2YJQA 3VRIB 1I8MB 2ZUWA 4QRSB 2MHAB 1EBAA 4TN9A 3OQ3B 4LEXL 3BP4A 4LHQB 2QQNL 1MRCH 5TH2B 1K5NA 3CO4A 2BP3A 4EZMA 1GOOA 3EYUL 1V3IA 1HL8A 4LDOB 3HA0A 4U3HA 1F4WL 4UBDD 5L7XL 2ZUYA 2VITB 4JRYE 4M61A 1T89A 4HUXB 4AK1A 4YHPA 5JXAH 4GRMB 2O9TA 2UY6A 4C55A 1MIML 1KB5B 2OZ4A 5IHUH 1IQDB 2HMID 1I1CA 4E5XA 4J23A 2AJSH 1F2QA 1LO2L 2Y07L 2QLVB 3FJTA 2O5ZH 5I16A 4NKIL 1HKLH 4RGOL 3IK2A 3SE3C 2DICA 1HF6A 4L3CB 3WY1A 5E8PB 3V7AG 5I66B 4U0QB 4M82A 4X7SL 4WEBH 3SDXB 3LKOB 1QBBA 2VLRA 1XF5A 5ETUA 1FNFA 4P9HC 5EN2A 1I7RA 1OSEA 1DLFH 3U7BA 3WL0A 1OB1A 2ZUTA 1INDL 2ESVE 4JDTH 1KB5H 4PRNA 2P8PA 4Q6IC 4H8WL 4EDXA 3VXOB 3MODH 3PIQA 4UDTA 3SDXF 5D4YA 1OT1A 5IBTL 4U1JB 4BZYA 4TYUA 3T8XA 4GSDL 2EE3A 4CMHC 3RL1A 4QWWD 4KDVA 1HQ4A 4TUKH 3S37H 4ZFFB 2DQUH 2GSIB 3EFFA 4EDWL 5L9DH 4PBGA 1F3DH 1WZKA 4PJ9C 1YEEH 5T5FH 1HHKA 4ODBD 1NCDL 3VWKA 1NBYA 3VE0B 1UWUA 3HC3L 1ADQH 3BKML 3C09B 4DEPC 4XXCA 4ZFZA 3GO1L 4NOFA 1OAQH 4J4PC 2AJZB 2Z31A 4KRPD 3ULUE 2VLKE 5DZNA 4M80A 1MREH 2CDEB 1E4WL 4OTXL 3C5SB 1P4IL 3LPOA 3QDHA 1WF5A 3VXUA 4A2LA 4MDJA 1LP9E 4G6ML 1IGML 1KGUA 1TVHA 1DN0A 4MS8D 3MRIB 3BQUC 4OCLC 5DJZB 1C7TA 5I1GH 2XQYK 2DSZA 2F58H 2J12B 3QXDB 2ITDA 4R90L 3ZL4L 3NFPB 1OTSC 4WIWA 4JDZA 2DYPD 2D2OA 3SDDD 4OZHB 3U1SL 1JZ5A 2VC2H 1K8IA 1KCRL 4LPVA 1IC1A 1NGQH 1F11B 2CRMA 3HZ3A 4RMWA 4EN3D 5C2BL 2XN1A 2AI0H 4J3WA 3O11A 3GMQB 3QIWA 5EIIB 2Y72A 2A1WL 3MO1B 4KJYA 3T3ME 2IH3B 4BZ1L 2BSTB 3VIFA 2VE6A 1CL7L 1LP9B 3QEUB 1NCAH 2M1KA 1WDQA 1S8DA 2FB4L 3HG1B 1LWRA 5JBEA 1OGBA 5GZNC 1QSED 5INCB 3T0VA 4DZ8B 1X5FA 5HYQB 3PIQB 2NY5C 1L7IL 4OV6F 2ZCHL 5L0QB 5I74C 1G0XA 5CIPA 3OKEB 2WINA 5C3TA 2BSRA 4JKLA 4J3VA 1H0DA 1A6ZB 3SDAB 1FVDA 2A6IA 4GW4B 4V2XA 3PNWB 3VXNB 1K8DB 3EO9L 2PWGA 4LRNH 3RPKA 2HTKC 2ZX7A 1UKTA 3DGGB 2EDYA 2ZXBA 3MLTB 5IFJB 5GS0H 5DS8A 3EO0B 5IIEA 3WQVA 5DT5A 1XEDA 3GHBH 4FXLA 4YBLC 4E0RB 2B4CC 1F00I 4Z7VF 1CR9H 3TYGH 1GOFA 2AKRA 3ZE1F 3UTTD 1PBGA 2I9TA 3B5HA 2C3WA 2V2XB 3EYOA 1V3HA 2DQHH 1HK6A 1W9VA 1KN2H 2EDQA 1MLBB 1FVDB 2A6IB 2BY2A 3RY6A 1W0VB 4A6YH 2E7HA 4JKWA 3LXCA 4KVNH 4WTZG 1GGYA 1ZLWK 1T3FB 4P3DB 3CDYA 3VO0A 2W91A 1NANI 1XGPA 1CI5A 2BCKB 1RULL 4G6AD 4HKBA 4AIZB 4HLZH 4EUPA 3B9KB 4PJ8B 5IKCB 4X8JA 1H5BC 2VR5A 4LLDB 3BIKB 2G3JA 5IFAL 2Q7YB 1WNOA 4QT5B 1IGFL 2IMMA 1FL5A 2J3SA 4C83B 5B3JE 1B0GB 1A2YA 5LGHL 1UCTA 2UVEA 4QTIL 5ITFB 1XD1A 1ADQA 1OSPL 2FJGB 4AD3A 2MCG1 4MCYA 1KULA 2ENYA 4HGKC 1S7VB 5AZ2H 2HP4A 1IJ9A 5D71L 5HGGS 3PBGA 4M00A 3VFTB 2IF7A 2HFFB 5IB5B 2HKFL 4RAVA 4R27A 5D71H 3PE9A 5J1AA 1I1AB 4WWKA 3K4ZA 4AZ5A 4RFNB 5D7JD 1WITA 1G6VK 4DVRL 3HNTL 1GYAA 4HIIB 1DL7H 1NOUA 1QZ1A 5ADPH 2XG9A 4OCWL 2Z31B 1MRDL 4PGCA 1UWEH 2XFXA 3PWUB 2FB4H 3QH3B 5K93A 2CR3A 1ZHKB 4WU7B 3FAWA 1GHFH 2CDFB 4NZTH 4ZUUB 4N0UB 4PRBA 5TE7H 3HCVA 3N1AA 3FRPG 3BP7B 1ZHLA 3PP3H 4I0CC 1TZ7A 5FL0A 2BFVH 4P8VA 3FQWA 4BQ2A 3SGKC 4DK6A 4LLWA 4J28A 4U0RB 5DMGC 1MCSA 1I85A 4I0PB 4P7NA 1S46A 3CZ8A 4TNWK 3AZTA 3I75B 2IPTH 2DKUA 4J4PD 3EOAA 4P99A 2G60H 5A8QA 2VQUA 4LSTH 4XPHH 4MTVA 3IJSB 1QRKA 4DO6A 1A1OA 1XR8A 3MGTB 1FIGH 3STBA 4Z2LA 3RZCB 4ENED 4PBWD 3ARDC 2OK0H 4XXDB 1TDQA 1OP9A 4NQED 5ERWB 2NPLX 4GUPB 3MUGA 4HS6B 2YXFA 3IXTA 3ARTA 3K80A 3GB7A 1E5NA 4M6MH 3RWDB 1A6WH 3DECA 5D5MF 3BUDA 4X5XB 2JB5L 3H7BA 4QKXB 5DJCA 1A6WL 4OZIF 1FAIL 1MI5B 4IOSD 1SYSA 5F6IC 1BMGA 4AMWA 2NT0A 1E6NA 5I9QC 3D25B 5A2FA 1CXIA 5FO9B 2Y1VA 4HS3B 3OGCA 5EC1A 1FA2A 1DQDH 5CGYC 3DROA 1JGDB 4OF3A 3TBTB 5FYLE 4H7VA 3I9GH 4YAQB 3VXPA 4EAMA 5HTSA 1CFNA 5A8NA 4OZFA 4BCEA 2F15A 5TH2A 1Q4NX 2UY2A 3AMDA 4P59H 4M62H 1UENA 1ZT4B 4AIOA 1TJGH 2HTLC 2R1XB 4K3DH 1AO7E 4OAWB 4WU5A 3CZSA 1UFUA 2A83B 5JZ7D 1Q9KA 5IDIA 3EJJX 4JQIL 2VDQL 4LYRA 5MP6L 4O9HH 3D1MC 4JFOB 4CMMB 1A1NA 2CPCA 2V6HA 2V5DA 1KV3A 5KSBF 4ZEPA 1WWBX 3WJLC 4K7PX 1U92A 4NZFA 3IKCA 3TBSB 3MRMA 4RGNC 1HKLL 1E0OB 4MNGA 2V5MA 4KI5D 5AUMA 3CUPB 1UZ8A 2UY5A 2V3FA 1E55A 2XZCH 4UT7H 3DGGA 4HJ0C 2XZAH 1H11A 3N11A 3F5LA 4XUYA 4LF3A 1HOCB 3CPLA 1H9VA 3THMH 5GZOC 4JFEE 3ARBB 3GSXA 5E8EB 5C7XL 4HFUL 4WCYL 4JG1H 4TUJA 5CIPB 4Z0BH 4QYOB 2CMRH 1J1PH 1OAZH 1W91A 2QSVA 3PZOA 5GS2H 1R5WB 1BIHA 1YEJL 3EJQA 3RNQA 3BKJH 1H3GA 2X4UA 2LVEA 5FKYA 5SV3A 3P9MB 4L4TA 5CP7B 1TA3A 2G2RB 4NYLB 1Q94A 3EJYC 4PB9H 4HMEA 3IFOB 2EDDA 2DDXA 3T0EB 4H8UA 5IGXL 5C0BE 3O11B 4MXQD 4X83A 3SPVB 3V8OA 4PV9A 5CIPH 2RAMA 1QLRA 4P2QB 3CSGA 5DSCA 5I8KH 5DFTA 1N0XL 3CDFA 1ZWIB 1MW2A 3BLBA 4I9WE 1LG1A 5FCUL 3OF6D 5D1ZC 4TVPH 3LX9A 2APWA 4X5XA 3SQBA 1NMAL 4JHAH 1UD6A 4JFQA 4AD0A 1W0VA 3ZDYF 2VLKD 4JPIA 4NBXB 1C8PA 3BIBX 2N56A 1SEQL 5F7EH 2FEEI 3ORJA 4IJ3B 4YH6A 1XGQB 4PG2A 5IHZA 1DUYB 4F9PA 3NBNA 2O61A 4YBLB 2R2HB 3FB8B 2XI9A 2OMBA 1B30A 3I3BA 1UB6B 1CL7H 2O93L 4LDEB 3LRSB 2DBLH 3W0WB 4Z7OE 1CZ1A 3ZJ7A 5AUMB 3VXMD 5DS8B 2VSCA 4BQ5A 4GRWF 1WC7B 4CVZA 2VLME 2GJZA 4NCC1 5LGJB 4MHHI 1TQBC 4OQ1A 4NN5B 1GGUA 1KACB 3GXPA 1FG2B 2NTFB 1AGCA 3JVGA 1I8LA 2A9ML 2BNUB 3RVTC 3TM6A 3S98A 4JL2A 1JDDA 4ZUWB 4YJZL 1HHIA 4M7KL 4N0UA 3VM5A 3LMYA 4BSVA 3L6FA 1R8LA 3QYCA 2IPUG 4TVCA 2Q8AL 3BQUD 1UM4L 1XGYL 2BHYA 3C60A 2JCCB 3VNYA 4NNXA 2X0YA 1IRAY 1LO0L 1ZBWA 4P4RB 3QDGB 4M8VA 3QUZB 1XGYH 3BOVA 4K8RD 3OLIA 3THDA 1HDMA 1ISWA 3QNYB 3EYVA 3KYNB 4QRPB 3UEZA 4AEIL 1VFOA 1LGVA 1TVBB 3L7EA 3VGDA 3AHVA 3SKUD 1K9FA 4GXVL 2A9NL 4NHUB 1G5AA 5D96C 2E7BA 4K7PL 3QIUC 1UCBL 1JGIA 3OB0K 5EBWA 3SDXA 4JZNB 2A0LD 5DMYA 5A1AA 4JGUA 1KEMH 4IIQB 1HJQA 4HX1B 1B0RA 1DSFL 3O8XB 1H5BB 5I0ZA 1FLRL 4E41D 1HINL 3AIEA 1QFWI 3ZIZA 5IOPA 2Z92A 1MW0A 4TSBL 4G3YL 35C8H 1Z9SA 3BSZL 3WDHA 2AAAA 5DEFA 1KB5L 2EZ0D 1C1EL 3OB8A 4PY7B 4B0MM 3QXDA 2DQEL 4DM2A 1FYHB 1I85C 2C1OA 4PJCA 5IMOA 2ZE0A 1I1YA 1WFOA 1MJ8H 1D9KB 2R8SH 1PFCA 1XV8A 3OAYH 4GW5B 5KEZA 1NCNA 4F79A 4OFVA 4I4WB 1T89C 3H0TB 2YHGA 4NFBA 3BJ91 4Y16A 5DD6B 4RX4A 4CKVX 3O2LA 5B3JF 4AMKL 1RIUL 3EOAB 3PL6D 1B3ZA 4P9HL 1ESWA 3IU3A 4ATWA 5D6DC 4H1LG 1OM3H 4CNIA 4ZYKB 3VCLA 4GRLA 5HOSA 1WLHA 5DURB 1MXDA 2EC8A 2XVPA 3CK0L 1FHLA 4M43H 5BXRA 1BFSA 3BGAA 5JBDA 5D7KE 5DWUL 1UA6L 3WMCA 1EAPA 1RFDL 3M17A 2MKLC 43CAB 3CHFA 3OKDB 4ZXLA 3EYOB 4ZUUA 3VVGA 4OJFL 1QWNA 3TT3L 4GXVH 2IADB 4ERSH 2GT9B 3LEYL 1RZIA 2VABB 1N6VA 2X9WA 4QRRB 2X40A 4Y2OA 1GGBH 1MCLA 2ENSA 5JHDE 4W84A 5E2TL 3QDMD 1U93A 2BX5A 4WW2B 1K9EA 2DQDL 3P0VL 4IRSC 1ZHNB 4NFDA 3A4WA 1OTUC 2J62A 4HAGA 5I18L 4QRUB 5ICXB 4WO4B 2EEXA 4K9EL 1N5YL 4QY8B 2QHLA 1AXTH 1Q72H 3BGFB 3OLDA 3RTQC 4OIAA 2FJGA 3MRGA 25C8L 2NYYD 2GJRA 3U9UB 1NCCH 1YMHA 2XTJD 5HVHC 3LN4A 5FO7B 5M7QA 4NBYB 3WIHH 4BZ2H 3D69A 1MY5A 3KYAA 4FNQA 4ZAKB 3QEUA 4YUEH 1XF2A 1AO7A 1S7RA 2P5EB 3EJPA 2Q8BH 1B4JH 4GKNA 3M7SA 2XG5A 3IFOA 2G2RA 1SHMA 1YDPA 1YN6A 3HZYA 5DO2D 3SCOA 4L4TB 3LKQA 5SWSB 4P4KB 2J5LB 3KG5A 4M6OL 5GRJL 3A47A 5E4IA 4EI5D 3WIJA 4CNIB 1V7MH 4NKOB 4OCWH 5KSAC 1S78D 1NMBH 2J25A 1NUGA 5CMAA 1KC5L 5I1KH 1ITCA 5EU6B 1O0VA 2JIXB 3VH8B 3UBXA 3GSXB 2JCCE 5ID0A 1GHRA 3MO4A 2CKBL 4RMRA 3CPLB 3FO2A 3CGTA 3ALXA 5D93B 4O51B 1HOCA 4XMPL 2Q6WA 4P2OD 3BRFA 2X1WL 1HP5A 1FZMB 4H25B 1I1YB 4YHNB 5IMMA 4L8CB 2GJXB 1B2WL 1S7SA 2P7TA 2P5WA 1OHQA 5HI4C 1W72L 1J7VR 4A3HA 4LYPA 4XZWA 2R23B 3BEVA 4BK4A 2QSTA 2GT9A 3ARBD 2EABA 3MJGX 1SEBA 1H41A 3I02B 1K8DA 2F8XC 5E99L 1S3KH 1FFNB 1U8OA 4ONFH 4KZDL 1RZ7L 2VZTA 2R0KH 3RVTD 1QO3B 1I3RB 4IDJH 3KPLA 5AD0A 1IZJA 4U2YA 5EORL 4WY7H 4O2CB 2A83A 4M43L 1I8KA 3AIWA 1UJTA 4UAOC 4OFPA 4U1JA 3UO1H 1DVFC 4OD1L 4OZGE 4PREB 4F7TA 1BQHG 5INCA 2F5BL 4DZ8A 1MAML 5DUBA 1KLGA 3KXFB 1EH9A 4NNXB 2P8PB 4X4MA 1QRND 5T5NF 1BWMA 2C3VB 2ZNWA 4LRIC 4GW5A 1MAMH 3PQYA 1D9KA 4LHUD 3ARXA 4J7RA 4YLQT 2Z1KA 3OG6B 4WRLA 1VSCA 3KDMB 2EEDA 2E8ZA 5FGCB 2BNQB 3BGFC 4L3ED 4Z8FH 3I02A 5JUEH 2X10A 2OZ4L 4XNUL 4ODXA 1T20A 4Z76A 1WC7A 2B1AL 4RQQA 1SJEB 5EU4A 5FXCH 2XGIA 5D9OA 1EEUA 4DKFH 3PL6A 4LSUL 3UEQA 3HNTH 4XBGB 5HPCA 4HJJH 1B0RB 3O8XA 4HX1A 3TPUA 3UMTA 5L2JB 2HTLD 5D72L 1B88A 4Y2DC 5F6HJ 4P46D 4HUXA 5JIKA 5CEYB 1PY9A 4HSQA 4D6GA 2GIYA 4YGAB 3SJVA 1I9IL 2QKIB 4O51A 2Q6WB 4NRSA 1FNSH 4HQQL 4RBPH 5F7FA 5FA4B 3BKCL 1A21A 4RAHA 3G5VB 3MRQA 1KJMB 4N9GB 1RUAL 2O92A 4NJ9H 3B2VH 4ONHA 1MPAH 2JF1A 3HMWL 4M29A 3LRMA 2VLJA 2DEPA 4JRXB 3SE9H 2V2WA 4HWBL 1HHKB 4NF7A 5E8OA 3IJ7A 2J7EA 2VLKB 4YK4B 4NQXA 1T2QH 4K94H 2CDFA 1F02I 5C0JA 2VISB 3BP5A 1MCCA 3LDBB 1ZXQA 4U1LA 5HI4D 2P5EE 1EQPA 4GKSB 3DRQB 3G9VA 2VOTA 4S0SD 1H3VA 3FL7A 1UB6A 3KS0J 2VTFA 1S9KC 4HPYH 4Q58C 1DUYA 2IAMD 5D7SL 5E6ID 1QUNA 5E8NB 4ZFGH 4IRJC 4TVDA 3PZ9A 4QRUA 5ICXA 1NGWB 4HJJL 4N0FB 1J9YA 2GSJA 2YPVH 3BZ4A 4MSWB 4HOZA 4G42A 4PLJC 4R4ND 4U3AA 4Q7DA 2IG2H 3VG9B 3FHAA 1V3JA 3GRWA 3MRNB 5CXPA 2J77A 3MV7E 5I1GL 4XNQA 1W1TA 1FNAA 1WJ3A 2OTWA 4R7DB 5DMGD 1GOKA 4C83A 5HHQA 4PV9B 1A1MB 4Y5VA 1X9QA 2YFOA 3QG6B 2XNAB 4AIEA 2WW5A 2DKMA 3HE6D 5BQ7A 5C0CD 3AIBA 5LA0A 1VRXA 2QPSA 3HMWH 2NQCA 1CLCA 4JM2C 1XHGA 4CU8A 5I8KL 3MBEA 4YHKL 1RMFH 2YC1B 3L4TA 5FGRA 3GBEA 4XCNA 3WUZA 4LLUA 1I7UB 1HILB 3MRBA 5DJYA 2CBVA 5D5MA 2IANE 1ZT4A 4JO3H 1YC8A 1GC1C 3WEOA 1OGAA 2OZ4H 1KIQA 3MV9A 3DMMB 5LA1A 1CS6A 1QFWM 4JL1A 3ZKXB 4FZ8L 2VDNL 1XIWC 1NCBL 4GAJL 5BQ7B 4OV5B 2CRZA 4PJAF 3OX8B 1HX0A 3S5LB 5HGHB 3BMVA 4JHWL 4JGJA 4M48H 1EZVX 3V9FA 4K94C 5B21A 5A6JA 3AHTA 5HVWA 4HWZA 3P9LA 5MI0C 3PGFH 4OBSA 5A6BA 3LKSA 1UD2A 1U2HA 1WWAX 2NR6C 5DMJB 4MSWA 2VXUL 5F97E 4G9DA 4LCUB 3UJIH 2JALA 1QSFE 1T0PB 5L2KD 3PQYD 1Z5LB 5HD8D 2XTJB 1KTBA 3MNWB 2CKBA 1WPCA 3CXDL 2PWHA 1GAFH 1JI2A 3DHPA 4XVTH 5DTFA 1U8IB 3KLAA 3TA9A 4MQSB 3DETD 3TC9A 4YZFE 3OV6A 3BD4A 3MSPA 4LPYA 4PRAB 3ULUD 4X7DC 3DURB 4M6NH 3T0EE 3X12B 5TQ2L 5LAXA 1KJ2L 2WW8A 3KPRE 4JM4H 4I77H 3BP5B 4DCQA 3U0PA 2IH3A 1PS3A 1C5CH 5JMOC 1HHIB 4NP4L 4H8HA 3RGVB 3UTQB 2R0ZH 1BFNA 4A4AA 4EOWL 2F7PA 4QF1A 3I50H 2NY0C 4X6CE 5HSFA 5GXBB 2ADJB 3FN0L 1FQ9C 5EC2B 5J11B 3OKKA 3JXAA 3KYMA 2PW2B 2QSCH 32C2A 5KOMC 1CLYL 4URIA 1N5YH 4JHBA 2X4RB 4MGXA 4HT1H 5DVKA 5J3HD 3APGA 4GUPA 3UPCA 3MCG1 4N8VB 5CCKL 1IC7L 3W0WE 4H0HB 1J05A 3GXIA 3DX9B 3GI8L 5CEYA 5GJSL 1A1OB 5DLMH 3ZOAA 3SUSA 5E0CA 1U8JB 1T21B 2X8RA 2A6KB 1NUNB 4OI9A 2PWDA 2PO6B 5EH1A 1KCUH 1NBVH 5EPMA 1EXPA 4FQ2H 1OIMA 5A8MA 4FMKA 4PJIE 4LSRL 4HKXA 4AZ8A 2CBUA 4ZE5A 4PMOA 4UFHA 3T3PF 4D0BA 4S1DC 1U8HA 3EW3B 4OCYL 3OKMB 3DUSB 5I8OL 1ES0A 1G7IB 3RGVA 4C56A 3U4BH 1YEKL 3BN9D 3ZL4H 3FFDA 2ZG1A 4EN3C 4ZFFA 3BIKA 1XGZA 2DL9A 3D3VA 4PS4L 4KH2A 1OTUD 4V2BA 5TE4L 4JY5L 4IMLA 3RWFA 4UDUB 4DQOL 3QEGH 2QSQA 2IFGA 5E2TH 2CR6A 4PRPE 1WGOA 3A0OA 1NC2D 3REVA 5K59E 3L7FA 3ZE1E 5F72S 1A7OH 4JFWA 5BRZE 1C92A 3W27A 2ZKHH 2FHFA 1U8IA 3IAPA 1P4BL 5F70A 4DGYH 3MCLL 1R3IL 2XICA 5FO8A 1G9MC 3CLFL 2D0HA 5E6ZA 1SY6A 3UJTL 2GJ6B 3O2DH 2FIKA 5JHDB 2V2XA 4BELD 2VCAA 1OD0A 2YR3A 2VMFA 2A2QT 5C07D 3TNNA 5F9AC 1QI2A 3ULVC 1A5FH 4PLKC 1W9DM 3LRGA 3WO4C 2X1XR 3QO1A 4QNPF 1ZBKA 1M04A 4Z9KB 3NVQA 3SCTA 4M7KH 5TDOA 2GUYA 3V8CA 4GAGL 3IS1X 2YXMA 3SEPA 3FN3A 1G7QA 1PEZA 4D2NA 5JORA 3RKDD 3NCCB 4PRDB 5ITBL 1FZMA 1NCUA 3VILA 1QLFA 1JE6A 3BDBA 1NEUA 2P5WE 4XC1H 4H8WH 2J4WH 3JWDC 3KPPA 5F7KC 4XRCB 5BMFH 5HI5D 1OTTC 1U8NA 4XB3A 3DGCR 5JUEL 2JIXA 4HIEB 4Y2DB 1MOEA 2DQEH 4ZSOE 3RRQA 3GSNL 4LLUB 5GRZA 2J5LC 5C08B 1BVKB 5HYIA 5DRNB 3TEUA 2J8HA 1DCLA 3LDBC 3UTTA 3TJEL 2XKUA 3SCUA 3FW6A 3KL0A 1V08A 4K3DL 1KB3A 1SYVA 2UZYB 3EYQC 3G04B 3ZHLA 4CVWA 4YQXH 3O41A 4V1DB 4NPYB 4OSUH 3S88H 4RA0C 1PJ9A 4G9FE 4WNQA 1AE6L 1UM5H 2H41A 3MYJA 1A7BA 3ARUA 2OTWB 1ACYH 3IDMB 4NQCA 4JVUA 3EIFA 4KHTH 3WNPA 3EJYD 5DLML 1QSEE 3MA7A 3LKPB 1QI5A 4ACZA 5CZVL 12E8H 4MJIA 2YLLA 1EXUB 2FHBA 3TO2A 2X4SB 3MRIA 3NTCH 3LVEA 5LVEA 3V4PH 1ZHNA 3OGSA 3CX2A 4ETYA 3RAJH 3K1DA 3OKEA 1G6RA 1H3UA 3DO3A 5FUZL 3O6FC 1QI4A 3GNML 1QNRA 1RHHB 2AK4E 2VC9A 4XCFH 2V5SA 3T0WA 2CETA 5IP4A 2BJMH 1HWGB 2N1KA 2C8NA 3T1WA 4XP6L 2VVSA 1OGTA 3LEYH 4NQCE 1E4XI 3D18B 1NCAL 1KJVA 3EBVA 5AYIA 1TQCB 3JUZA 3O6AA 5A69A 4GSDH 5MENE 1JAEA 4HP5A 4P46B 1L7IH 3HCVB 3HPJA 2GAZA 2PYFA 4MB1A 3QCUH 4PLKD 4GG8B 5TGBA 1HQ4B 1DWAM 3PWUA 4JHZA 3C6LD 4UQ3A 3DV6B 5DQJB 4FQHB 1WZMA 4CADB 1CWYA 2PKDA 5AAWA 2DF3A 5D7LD 3VWJB 1BVNP 2OX5A 5I8EA 1S9XA 5H37H 1PYWB 2O5ZL 1I1AC 3BVTA 2FATH 2EECA 2VLRB 1B9ZA 1F6LL 4JFYB 4U05A 1V0MA 3OZPA 1H3WM 4MDJB 3QFDA 2YWYA 5L2JA 1GRWA 2CERA 3BYYA 1DZBA 1HJWA 3NCEB 2Z31C 4WTWA 3LKRB 1NLBL 3R8BB 3GKWL 4WY7L 2YD7A 2Z92B 4NN7C 2EIZA 2OJEA 1NC2A 5KSAA 2XN9B 5EUOE 1OVZA 1UB5A 2DM4A 4P57A 4S1DD 2VLJD 4BZ1H 2CLVA 4JQXA 1FN4B 4JO2L 3IDNA 3CSBA 1VGEH 4M7LT 4YHIB 1BVZA 3E8UH 3F6IA 5C0BB 1JF1A 3CC5A 4X5LA 2OP4H 2XTJC 3EJZC 3H42L 4G6JL 4PLJD 1BYAA 2F53E 5I30H 1J1XH 3CH1B 1MFUA 3KPLB 1RUPH 2A3HA 4UOQA 4P2OB 3RWJA 3W2DL 2BNUA 3PP4L 3C2SA 3VIPA 4QRPD 4MAZA 4B7LA 1T0OA 2I9TB 3W37A 5BJTA 4XC3L 3UG5A 5DEGA 5E5MB 1II4E 2XGBA 3QUYD 2FR4B 2YIHA 2CQVA 4LCCC 1PQZA 4UNUA 4JANB 5BS0E 4I0PD 4QHUA 4AM0B 1KB5A 1C16B 4GW1B 4KV5E 2J74A 4EN3A 3O2VH 1S7SB 2EYRA 3VPLA 5H2BA 1AQDA 1E4XH 5IK3A 4F15C 3R06B 5EBAA 4FG6C 2CUHA 2XWBB 1VKXA 2Z9TA 2Q86B 2GK0A 2VNCA 1XSJA 3ULUL 5J4MA 3DETC 5JNYB 5IB4A 4HCRL 5F7DB 5I71B 4H5SA 4X6EA 4MHHG 5MEQA 3QA3A 1R7AA 4K3EL 1HN1A 3HUJE 3UXFA 2X70A 3IDXL 1EK3A 2QSCL 5GZOD 3L3DB 3N1GC 4ZFOB 1AQHA 5IW3A 5HYQA 5E03A 3PL6C 4HK0A 1FJ1B 3CDGA 4NWTH 3MLXH 3UTPD 4WHYH 2H9GA 1YQVL 2IPUK 5GNYA 4PY8J 2GY7B 4PJXB 2QV4A 2G5BA 5GGSA 5D1QC 3OR6B 1GGIH 4GLRI 1PLGL 1SJXA 4NT6A 3CUJA 3P40A 3Q6FA 5IV2B 1PX3A 3BKJL 1NBZB 4QHLA 3BI9X 5B38G 4XPAL 3VIMA 1FFQA 2OK0L 5IW1A 4YE4L 3QWOB 1JWSA 4ERSL 3JV4B 4PJAB 4XCYA 2X9YA 2LTQC 3RHWK 4ODUA 3GSRA 1OAUH 4PJXF 5HYJB 1MH5B 4LARH 3RBGA 3NCOA 4K9EC 1RFDH 3F7VB 1ZLUH 5L2KA 2AV7B 2MTPA 4HOXA 2YEZB 4F9DA 1P7KB 2B0SH 1V0NA 2F58L 3V4VL 3BPOB 5E2WL 4YR6B 4JB9L 3S96A 1A7QL 4BQ6A 4YHGA 3LZFH 3WNOA 4UTBH 2XY2A 4A6YL 1R3KA 3LS5L 2UUDH 5GRXG 2DT0A 4M81A 4OQTL 3GGWA 3PWPA 1QLEL 1U92B 4MXWH 2G9HB 5HVHB 2M8XA 1JGVH 1FRGH 3IRZA 3S4SA 3U6RB 4PGJA 4GQQA 3OGVA 4QFUA 2QV2A 3MV7D 5GJSH 5MEOA 5E9DE 3VFNB 5MENA 4OOUA 2AJ3B 3B9EA 3NDZA 3UTZA 2WMIA 5D1ZB 4UMGA 1DQJB 2AJSL 3TIEB 5CP3H 4GAGH 1AD9B 3KPOA 1MFBL 3FRUB 4R4NC 5KZCB 5DD6A 4XMKL 4LLAA 3V52H 4D6HA 2Q7NA 5KSAD 5DGRA 5F6HI 2PXYC 3MJ8A 1MQRA 2EKSA 3OZ9H 1R33A 1D6EA 1B3JA 5D7JA 4HUVA 2DQFA 3S34H 4ELKA 4FTVA 3AISA 3X11A 1CN4A 4HPOL 1L0PA 3FTGA 5D9SB 4M6OH 2GK0B 2VSDA 4OJYA 3MA9H 5IBLD 4HV8B 5BWFA 3BO8B 3R06A 3ILPB 4NQDE 4ZS6C 4KDTA 5AYBA 4PJ7E 1H3PH 2NCMA 3RWDA 4XZUB 3LHPH 3U4BL 4ODHL 2BRQA 3W11C 4DWSD 2NY4C 4M6NL 4YHPB 3MREB 1U0QA 4IHOA 4PTUB 2Y36H 5B38A 1P2CB 5D9PA 2NY3B 2FRGP 3DDFA 1XIWA 1K5NB 3CSPA 4HWEL 3WEXB 3KYNA 4QRPA 5CD5D 2I60H 2PO6D 2ALWA 2E27L 1YNTB 2DIBA 5CGYD 1OP5K 1HKJA 2DWEB 3H53A 3P30H 3QDJE 5F9OL 2GK1B 3C60B 5I8CA 4YQXL 4I0PA 2VKWA 2WWKO 1C12B 4XI5C 3TLRA 3A24A 3BEWB 1MHCA 2DH2A 2DLFL 4X4ZA 4D6FA 3EYPA 3I6GB 3BGMB 2XVKA 1E9LA 1Q1JL 4RX4D 3TBWB 4E8CA 4X9BA 4YDJB 2XFXB 1BF2A 1B3XA 1UG6A 1QHOA 4QXTA 2WAHA 3WNNA 4L8DB 3GMNB 5DK3A 1XF1A 1EA9C 2BHUA 4Y1AB 4FQJH 1XCQB 1FP9A 3C87A 1E3XA 2LTQB 2O61B 3GNMH 1TZIB 4PMRA 2XYCA 1XGQA 3C5ZA 9CGTA 1ZVHA 5D2LF 5BZWB 1UWTA 2DQJL 4PJCF 1E4LA 2GDUA 3RTQB 2GY5A 2ADIB 1U8KB 1XT5A 5C0AE 4HK3N 3WIHA 5ISZB 5J56B 3MV01 3POCA 4O00A 4LQ1A 2EDLA 1BZ9A 5A2LH 3TV3L 4HHAA 4IM4A 3BUBA 4JG1L 5KN5A 4NUJA 1FLTX 4FQXD 5A3IC 2J7HA 2WANA 3QDGE 4OFKA 3L1OL 1LNUA 4ZNCD 4PJIB 3QUML 1W72B 2ESCA 1CGXA 4WEUD 2R4SH 3V0WL 2RJMA 1SMDA 5DQJA 1VBRA 3BP6B 1UM4H 1MQKL 4CVXA 3PDOB 4FNLL 3KPSA 2KKQA 4JPKH 3HAEH 3EBAA 3NCJH 3TBVA 5IHUL 3E2HC 4NNYB 2YA0A 2BOBB 5E7FA 3JTSA 5M95B 3WF0A 2IH1B 3CFBB 2IC2A 2Y06H 1WO2A 3VI4E 1R0AH 1NL0L 1BX2A 4GQ9L 1JTTA 1VENA 1CTOA 2OR7A 4GXUN 3MI6A 5IROA 4FNSA 2VDLL 5T3ZH 3EUUA 5J6HB 4B3LA 3ELAT 3GSVB 1R3JB 3TYGL 4TVUA 5FHBL 4UFIA 3INUH 3WL9A 5IVZB 4YHMH 5D1ZD 1TZGH 2YZ8A 4MQXD 1CVRA 1TLKA 4DVBA 3CLWA 3MNZB 4E0RA 4YO0B 1HZHL 3U30B 5JDSB 1Y18B 4BUHA 3MQIA 2W9EL 4J3TA 4NJAL 5MEND 3BAYA 4FS0A 1MCQA 4PJ5B 3D0LB 4F7PB 4JZJA 3O6FB 3U2SA 3QUKB 3MUZ1 4L4TD 2X4TA 3PDDA 2DQUL 3TZVA 5MHSD 4PV8A 2DQCL 1I9EA 3LN9A 3GDBA 4Z7NE 4ONGH 3BUPA 4PJHE 2NXZB 5CSGA 3TN0C 3JBG7 3T0BA 1G0CA 1CGYA 4FN0A 3SDAA 4XH2A 3L5XH 1Z3GL 3H9SA 4V1DA 3MUY1 2F8OA 3GIVA 2WHMA 2IG2L 1REIA 2AABH 1Y6MR 5LA2A 3BH8B 3PWNA 2CD0A 2J6EL 3AI0A 3IAQA 3HG1A 1MIMH 1HHHA 4WEBL 5CPSA 2UWFA 3RDTC 1OPGL 1DQQB 4KHTL 4M1DH 3F7YB 4JFUA 2HTKD 3ULSA 4GKOA 2P45B 3MACH 5HI3D 5DC4B 3D25A 4I48B 5I2IB 3HG2A 4XH2B 1UKPA 1QSFA 4Z7WB 5T1KA 4KI5E 1QNZH 3MMDA 1MI5A 3CVHL 1ZE3C 3QOMA 2XPKA 3Q3GA 3V2AR 4G6JH 3TZVB 4R96A 3GMPA 5DK0B 4PGDB 5ESVB 4MNKA 1TJHH 2JK5B 2FH6A 3ULUF 2FGWH 4P48A 5MI0B 1IAIH 5CJQL 3BESR 4PJEA 3KLHD 1DN0B 2G41A 3EO1A 2X42A 2X7LB 2VDNH 4U6TA 1XH1A 3B43A 3VXUB 4RWYH 1BVLA 3O9WA 1MCKA 4ZOAA 5ACMA 3D52A 2YOCA 5ANMB 1JV5A 3W0KA 1DJSA 4HKZA 4NQTA 3VG0L 4F37K 1E4WH 4OTXH 3R4DA 3VJ6A 1BEYH 3C5JA 2EE9A 1MVUB 1QSEA 2NY6C 3T2PA 4JFSA 4HZ7A 4KZEL 1FFOA 3KHOA 1KTLA 1C3FA 1Z2KA 4W68A 4WFHE 3MFFB 1QVOA 4LASL 3UPRB 1KBGL 5DT1H 2WB5A 2RGSA 3BP7A 3HMXL 2QJDA 4LASH 4JFTA 1GIGH 1SJVA 5IESH 5DJAA 1XGTA 5A2JH 1OLZA 1WBYA 4OGXL 4APQB 3NCMA 1XYFA 3F5WA 1LQSR 2EO7A 4Y4KD 5L8KB 1FG9C 2AAVA 5DRZA 1WISA 1UWXH 4H26B 3MRRA 3RVVD 3NSXA 4G8GD 2J6EA 1ODUA 1ZBVA 1HSBA 4HIJB 5EZIL 1E5JA 1EFQA 2DM2A 3CFJB 1XD0A 4LPCA 3VWJD 1RK1A 5CZKA 4E42B 2GK2A 1X44A 2CUIA 1U95A 1MWAA 2B39A 4PJGF 4R7NB 3TO4D 4UBDC 5C6TH 1TJIH 5GIRA 3VG9C 4R4BB 3KPSD 4L3CA 2OWXA 2C3GA 1X3DA 1UWQA 2OI9B 5I16B 4M3KB 3AM8C 4JAWA 3LPWA 4FHBD 3GXNA 3NN8B 3EDJA 3QJFB 3IDIB 5A2CA 1ZANH 4GRLD 4XZBA 1TZIA 3E6FA 1A7RL 4LSTL 4XPHL 3OKOB 5J1SC 3HE7D 4R5EA 4Y19A 2JK5A 4N9OB 1XSKA 1U3YA 3H7LA 5C09E 2XN9D 5DFVD 2YDRA 1ISZA 4Z7WE 2XOTA 4BKLB 6FABH 4LSVH 2R1YA 5DR5L 3NJ3A 4TRPL 4EIGB 4OD3L 4RGNE 2DN7A 3VD7A 5I1JL 4RDQG 2C4FU 1N7ML 3MYZA 3OBAA 2XWJA 4Q9QH 1HL9A 1CQYA 4QF1B 2KL6A 4HF5H 4RSVA 1G7MA 3X14B 1LO0H 2VLJE 4FQJL 3H9YA 4XAKE 5ENWB 3PHQA 3RJDA 2B20A 1XMWA 3EYSH 1MQQA 2F53B 4BSJA 5HGAA 5DRWB 2DL2A 4ATDA 5F9WC 5AYUL 5K33A 3DVIA 4F7EA 2XA8L 2BMKB 2K7QA 1WICA 3L9RB 2YUWA 5C0RH 4BH7B 3SKNA 2YA2A 4IHOB 4PTUA 4UV4H 3WKMH 2HH0L 2YWZA 3AIRA 3TONA 3WIFA 4CGTA 2P5ED 5DVNA 4P7LA 3FB5B 5F9OH 4O9HL 4YFLI 4PTWA 2X4QA 3U2SB 4NRRA 1BLNB 5M03A 3UJTH 5CEZD 2MOVA 2JIEA 1FHGA 2AXHA 4FLSA 3O4OB 4GW4A 4XPFL 1F58L 1GZQB 4OKVA 3U9PH 1RY7B 2ICWB 4H1LB 5TDPA 1G9MH 3GSWB 1MWOA 4JFDE 5IFPA 5D7JB 4YDLB 5BO1H 3GMOB 4PJ9B 5F1OB 1R0AL 3B83A 5ID1A 2WC4A 3W2DH 3M6DA 4XPGH 3PGDB 1G9NH 1LDPH 2B5IC 5KZ6A 2AJYH 3S37X 3C8DA 2P4AB 1SVZA 5CJOH 2E9JA 3TF7C 1P4LB 4Y4FC 4YBHA 2J88H 5KVEL 5C86A 1F4YH 5CD3B 5DJYB 2BSTA 5ITBH 1J8HD 1CL7I 4EVNB 4OLXH 3QBTB 1T5XA 3RL2A 3QIWB 3Q1SH 4LKCB 1B3VA 1I1RA 3FO9A 1CT8A 3MUJA 1JPFB 4JVPA 5TPWL 3ECBB 2AOSA 4P5TC 3LD8B 3MV9E 4E2OA 2QADC 1LK2A 1R24A 5SWSE 5T5NG 3RWHA 1BQSA 3BDXA 3PWPB 2DKSA 1J0KA 4L4VA 1WTGT 4HDIA 2C7FA 3VU2A 1N0LA 2LV4A 1S5HB 3JTTA 3S96B 3HC4L 3MRNA 3NN8A 3NAAH 4WUKL 2UYLA 1JI1A 4MD4A 2NY4B 5IR1B 3GJFH 1Q0YL 1YECL 4ODVL 5D1QA 3ZYJA 1ROWA 3BH9A 2H26B 2V7HA 3KYOB 3MLYH 4MA1C 3RWCB 1WP6A 2LAGB 4D94A 4K3GA 4J3SA 4KRMB 3O8XC 2VDKH 4PR5A 5B39A 1JWSB 4V1DE 5LXGH 5E9DB 1D9KD 1AHWC 3RIAK 1JXJA 4U1SB 3ARGB 4Y4HA 5KVMC 4GXUM 4F3FB 2DWDA 5ADOH 1NMBL 4OCSL 4RRPA 4X98B 2WBJD 4DTGH 3MRFB 5CWSA 1FL6A 3FT3A 2LAAA 4PGEB 3W26A 1H3XA 5I6XB 1WVZA 3PWJA 3BJLA 2CIPA 2V3EA 4KK6C 3C8HA 1Z32X 3SY0A 4YXHL 2EIBA 4ZUTB 5CG0A 3LV3B 1OW0C 1CPUA 4C56D 4HKJB 4LNVA 2D4DA 1T4KA 3D0VB 4GZEA 3UYOD 1US2A 5B8CC 2QQNH 5D2NA 1XF5B 4DZBA 3QISA 1RUPL 5C0GA 1CXEA 3N15A 5C9JB 2PTTB 1QQDB 3UC0H 2A73B 5E99H 3QR3A 4JR9L 5KANG 1P2CA 2XWTA 1PG7L 3G6AA 5D8WA 4BFBD 5K9KA 2VDPL 3JTTB 3HNVH 4JN2B 4M4PA 1NJ9B 3BPLC 2FZ3B 2M2DA 1S7TB 4JZOB 2FZ3A 4CD8A 1YYML 3MROA 1CENA 1VADB 4L9LA 1IFHH 3L3HB 3U7VA 1GVIA 5D6CB 1IAKA 1NGXB 4ODXB 4LCWA 4MA8L 5D9SA 1FV1B 1NFDE 4YDLC 5D7JC 1TIUA 4YNYA 3VGFA 3MBXL 4LKCA 1NGZA 3U4AA 4MVBC 3QZWB 5A43C 3UTTE 2L0DA 4EVNA 2VX4A 3RVWC 2D9QB 4AZHA 1KNOB 4GG6B 2Z8SA 4DGVL 3OAZH 1SEQH 3RIFK 5KSUB 2BVPB 3MKKA 4QLJA 1A3RL 1HHGA 4Y4KB 3HNSL 3C6LB 2E6PA 3SN6N 5TF1H 1INDH 3WCYA 4NFCA 4XNMA 4KRPB 3WKNA 5IMKB 4L3EE 2R8SL 4OLVL 2X4PB 4PJDB 3AS1A 5HGBB 1K4CB 5T1MB 5CBAB 2WIMA 1UR8A 4OM0H 5IT2H 2DD8L 4F3FA 1S9YB 5C1MB 5ICZA 4U3XA 1A9BB 1KXQA 2A3AA 2OYLA 3VD5A 3IJHA 4NM8H 3WQ4A 5I30L 1FFPB 1NFDB 4OF0A 3WNKA 3HUJA 3HUJF 3BE1H 3D9AH 4CBPA 5ABHA 1M4KA 3S3PA 4R3SA 1W1PA 1ETZB 4GLRH 3D4ZA 5I19H 4PJ5E 5J12B 5GS0D 2P7TB 4YO0A 3B8YA 1X4YA 4KZEH 2AV7A 1JWMA 3HZVA 4MA7H 3BCDA 3B9VA 4ZS7H 5FB8A 4G6MH 4L3AA 1D6VL 4HUUB 2D7OA 1M05A 2JEPA 4L4VB 2NTSP 4CADA 5EZLA 3ZDZE 2GSGA 4Y4FA 1E70M 3NTCL 3HG1D 1HNFA 1QW9A 1VFAB 1QFPA 4NDMA 3HU7A 1QBAA 2HKHL 4NC2B 1CFTA 4U1MA 5FOBA 1TCMA 5CILL 5FGBA 3H9ZA 4PJ7F 1XF3A 4WW2F 5D7SH 4PJ7A 5FV2A 3V0WH 5BCAA 5D1QD 3IETB 5F9JA 1S7RB 3GRWH 2AQ1A 3V5KA 1MI5D 3KVQA 3T1FB 3VXRA 1RZ8A 2HVKA 4JPWH 3WUFA 4PJIA 2DYPB 3SDDB 3FO0L 4UFLA 1YNKH 5DRXA 3HI5L 2BFGA 1AQ0A 1RJYB 3ZKXC 2YLAA 3TV3H 1YMHB 2APXA 2VXVH 1F58H 3IDIA 1IAOB 4XBEL 3O9NA 1KCUL 3QHZH 4W86A 3HS0A 1CICA 1YEDA 5J3HC 4MJIE 3FOMB 2LVCA 4R4BA 3T09A 3QHZL 3SCWA 4QAWA 3MXVH 4KK9C 3R0NA 1MEXH 2BOCB 5CJBA 3DYPA 3U83A 1JGLH 2BS9A 2WCSA 5DJDA 2D0GA 2EXYC 3HUJB 2DQGH 1HVXA 1OP3K 1NFDA 2WM0A 1UJ3A 2QF8A 1E6OH 3H3KA 4PTTA 4U1IA 4AM0A 3FQUB 5A40E 2LU3A 2ZSWB 2WAGA 2MQ0A 3OIHA 1EMTL 1C5BL 5IB1A 1RIHL 1RZIB 3QCVL 3ZDXF 1AGBA 5JW5A 2F1BA 1Q9OB 4X99A 4L29B 4KPHH 1EOKA 3KPTA 4NKDA 2ZUQC 4UV7L 2OSYA 4AD2A 1D5ZB 1MHPL 3QNZA 5EFIA 3RI5K 2F7QA 2DJ4A 3JUGA 1IAMA 2IUZA 5IHBA 5DRNA 4FFZH 3WDPP 2ZX5A 2XKSA 2X2HA 3RGVC 1CLOH 4WHTA 3OAZK 1BQLL 4QRQB 1JN6A 3OWEA 3WLBA 1XC6A 4X0KA 4U1KB 2V9TA 4Y5XA 5A16B 5DHYB 1M7IB 2Z4QA 5IFAH 4NRZA 1FYTD 1XFPA 4OLWL 1IGCH 1QA9B 1OAYL 2XIBA 1CFSB 3JWDH 1OY3B 4NQDA 4S1RH 4UZUA 2JB6B 4QOKA 1GVYA 4FQXB 2ZOLA 2Z8WC 2FX7H 3HE7A 3J7HA 43C9A 5D2LB 1EO8L 4QRTA 4D8PB 1OOAA 2XWTB 1HH9A 2D7MA 1H8OA 2DRUA 4N0CD 3WFBL 2DTSA 2J4WL 1JYVA 4CD6A 5DJ8A 2JEQA 3WFHB 2YD9A 5IB3A 1FNLA 5K9JH 3PHOA 3QHNA 4KXZI 4RGMC 3ARGC 1U9KA 5D2NC 3VFUA 3C9NB 3ROOA 4PRHB 1ECEA 4PJXE 4CW1B 2W60A 3ZTJG 5I0DA 3MV7B 3QQNA 2KBGA 2CYGA 3MRRB 1NCDH 4NZCA 3REVB 4HZLA 3H9HB 2Q3AA 1AC0A 4UFJA 4MDPA 4G3YH 3QUZA 5HDOA 1P6FA 4K3HA 1R85A 3IETA 2W63A 4NGHH 3MLVH 2QQLL 2YDQA 3WKML 2VVNA 2GI7A 5ABFB 2V9QA 1YECH 4M03A 4X6BB 1OF2B 4ZUVA 2OL3A 2JJUA 1NCCL 4XPBH 5D72H 2ZNXA 5DT1L 1FVCB 1T66D 1V0LA 1QNPA 3QXVA 1IKFH 3N17A 4KKBD 5B4MD 1PVHA 2EICA 1UM6H 4RFEB 1I7ZA 3MS8A 4EQ3A 4FFVC 3WIIH 3VG0H 3KXFD 4G6KL 5HYEA 3OJDA 1WFNA 1MF2H 4Y4FD 1CEOA 1SY6H 1T7YA 5D1QB 4DVBB 4I2XA 2DIAA 2RFXB 4EUPG 5F6IB 3AXLA 4OD3H 5FA3B 3SCRA 5TDNB 4N0CC 4EUPH 4LYQA 2BERA 1RJYA 4XHQA 4JJ5A 4UOW1 4YN5A 2XIIA 4JFQB 1RP8A 3AMLA 1CGSL 2GCYA 3RKPA 1WCQA 2HFEA 1SM3H 3L5JA 4U2ZA 5I79A 3KZSA 2I5YL 1WB0A 1EEQA 2LABA 3SDCC 4MXVF 4JO1H 2HLFC 3C6SA 4OCYH 2E9BA 1ZANL 5BXFB 1BQHA 2XA3A 4WI4A 5ACZA 4ZUVB 2JKXA 4YEEA 4PRPD 3NCBB 1CICD 3ALWA 4NQCD 2CHOA 5HYJD 2WXDM 3RU8H 1F3RB 1NEZA 4DKAA 4MNHA 1TJIL 5GGTH 4XNYL 3OSKA 1Q94B 3AU1B 3CFKB 2NNAB 4LPTA 2VX6A 2J4GA 2BK8A 4QHMB 3AB0C 4XC3H 4MLSA 3ME0A 1IKFL 1T2XA 4UT6L 4LVNC 2X2JA 4XP9L 3I6LD 1Z3GH 4CU6A 2Y2WA 3WIHL 4OZ4B 4WFEE 3W9DB 4BZ2L 3BPOC 5E9AA 2VLMD 1TNMA 3TTSA 3QHFL 4IM8A 1MCWW 3X13B 1IAKB 4PJDF 3RGHA 3LPPA 1J12A 5JZ7C 1BPLB 4JZ5A 1VADA 3R0MA 4MXQC 4AENB 1TZHB 2PYEE 2VZ3A 2IQAA 4ZAKD 5ECUA 2WBGA 1UZ8B 3EKCA 4NJAH 4KK5D 2XSAA 2WP3O 5F7LB 2DLTA 3GMNA 1TZGL 1NM9A 4U6HA 3DX1A 2DTMH 1XGUA 1KQZA 4FTVD 1H15B 3KPNA 1QA9A 2FD6H 3NIGF 1A4JB 1E40A 4ZO6A 2GJ6E 5GGQL 3S5YA 2BMKA 3ILQC 4W70A 3R1GH 5C9JA 1AFVH 4LRIA 1QPPA 4G7YL 3V5DA 4GI8A 4MNQB 2F5AL 3LSOB 3MLSL 4S1QL 2H45A 4RGMB 5D2NB 1A1NB 2XXCB 5J12C 4CMMA 1PSKL 3U7YL 2J8UE 4QDMA 1QFWH 2YZ1A 1YC7A 4RMSA 2OSWA 2H32A 5CINH 4YHOH 1CG9B 3QP3A 2FL5A 3VDBA 3ISWA 1T22A 3GNRA 2YC1A 2MCPL 2IAMA 3LN5B 5KJRL 1NGYA 2HA1A 3RWFB 4M1CC 4YHIA 2Q1EA 3MV8B 3WFEL 2ORBL 3I2CH 3FFDB 2HJLB 4CVXB 4L9LB 1KCSL 3RWGA 2DM7A 2AEQH 2BSED 3BISA 4P49A 4ZSOB 1W72A 4AL8H 2DH3A 1X6LA 3UJJL 5F9DC 1T2QL 3ILPA 3ZE0F 4DAGL 3P4MB 1EHNA 1RU9L 1ZT1B 1CE1L 5J13C 2E9IA 4MWFB 2FGLA 1J0IA 4HWBH 1GW1A 1QQDA 3CXHJ 3CVIH 5EBLB 1Y0LA 1CGUA 1JFXA 3U7WH 1Q38A 1FP8A 4TVPL 4LCWD 4DQOH 4P23A 5IMLA 2UYLB 4MD4B 4QEGA 3LS4L 1IAOA 3MBED 4UOW0 3MJ8B 2B2XL 2EH8L 3VDCA 5LBSL 1S5HA 5D7KD 1I7TA 1XR8B 3MGTA 4XHJC 5SWQA 3WXVL 3BVNB 3LV3A 3RDTA 5EO1A 5IEKA 3O4LE 3CLFH 3S5ZA 4OLUH 4K7FB 4UQ9A 2NY6B 4AW7A 1V3KA 4G43A 3EHBC 4Z95H 2Y5TA 4CJ1A 2FH8A 2DD8H 4PJ7B 4LIQL 1K2DA 2CLZA 4KJQD 3V6OC 1NBVL 4U1MB 5FOBB 3VXSB 3IDUA 4K23H 1BD2D 4Z7UA 3RL2B 2CDGB 2WVSA 1CG9A 2ZXDA 2F54E 5JW4N 2GJPA 3UETA 5HYSG 3H3PH 5IBUG 2IALA 4D6EA 1U91A 3QI9D 3UG3A 4YHEA 1IZKA 4KAQL 2FHCA 3C2AL 4NBZB 1BIIA 4YFDB 2PF0A 4AD5A 1R3KB 1F45A 2GQHA 3SGJA 5E6IB 1G7HA 1RZJH 2IJ0C 1MCNA 2ED9A 3DYMA 4J2XA 5DTFB 4HIXL 1ULVA 3VXRE 2XT1B 4I3GA 5J1AB 3VW3H 2AK1L 4DWHA 2C7UA 4PJEB 5C6TL 4M1GL 4IMKA 5ILTH 4A6YB 2XFFA 5HYJA 3I85A 1CIUA 4JM2A 3DX7A 2YSSB 5DVMA 5EZIH 3JV4A 4PJAA 1KCVH 4XCYB 1QG3A 5DD1L 3LKSB 2XN2A 5F7EL 5HHNA 4LGXA 2HKHH 3MA7B 4U7SA 3UR7A 1R24B 3RWHB 5HJ3A 4IRJA 4LHUG 1DFBH 1HWWA 4MB4A 1QSFB 1OARL 2QTEA 4XNZC 5KSVA 3SE3A 3FZUD 1N59A 4BJLA 4NPYA 5IMKA 1E71M 2CIKA 3ZYOA 3CLEL 3IDYC 3ULVH 2P43B 5JPMB 4MB5A 2I26N 1V5JA 3KNBB 3GSNB 5EOCH 5GRUL 4YZFF 3NYDA 2ATKB 5H37G 3I3EA 4FQIH 3CX5J 4PUBH 4YBQD 4NM8L 4CKQA 1R7OA 4LQFH 3CK0H 4ZFOA 3UTZB 1RIUH 3QZWA 3SKMA 4WWKD 5FCZA 4HLJA 3QEQB 1OD9A 3U48A 1N6QL 1PAMA 2D7TH 2FO4B 4ISVA 4LSQH 3GUTA 2MQ3A 4Y19E 4HIEA 4D3CH 3MBEB 2WLZA 1U8NB 4RE4A 4OGYH 3BZEA 3KPPB 2PXYD 3BX7C 3MLPA 4PFEA 5HJ3B 4MYWB 2FCBA 1FAKT 1JF5A 3GJEA 4JZOA 3F12A 1GCFA 2EYRB 4UTBL 3D2UD 4C7FA 2R23A 4JZJB 2VLRD 4KVCH 5JIHA 1OWQA 5DURD 5FK9B 1B0WA 2J47A 2F19L 3MLTA 5IFJA 1TVNA 1LO3L 4KRNA 3KLKA 1PKQA 3S2CA 5D9MA 1UM5L 1YY9C 1KGCE 3A6CL 1EV2E 1TJGL 1HHJB 5I17B 5A16A 3WD2A 2ZXAA 4GXPA 1A6VH 5IG7B 5E94B 1JN6B 5DQDH 3PZMA 3QHTC 3NOIA 5FO8B 2W0KA 5LG1A 1W1YA 1JMZA 4RIRB 4PJ5D 1PLGH 1FYTE 5E00B 1WT5C 3L4WA 4O4YL 1GORA 1ONQB 4ONFL 1D5IL 2ADGB 3N1MC 4M7ZB 3NSMA 3O9WD 4HC1H 3JTSB 3I84A 4GAFB 1JG9A 3MRCB 3V4PL 1NSNH 3JUYA 4PJXA 4PJFE 1JBJA 2OYMA 5ABFA 5CWSB 2PR4H 1S5IL 2HJKA 4Z0XA 3WBEA 4PJHB 4Q2ZA 4X98A 4NJ9L 3QIBA 5JLZA 1LDPL 4D0CB 1NAML 1W2VA 4P23D 4POYA 2XG4A 4LVNB 4CCEA 2VT0A 2G8ZA 4PMXA 1CU4H 3QUMA 4HIXH 3VXUD 3I6LE 2W60B 1G9NC 2DMKA 5KAQF 2WBJC 2OSXA 1X4ZA 5C6PB 3VGGA 4LLVA 2CKBH 2EO1A 2W9EH 1GXEA 3EDEA 1F6FB 5FD0A 2PO6A 4S0TD 3UZQA 5EBLA 1T21A 3CZLA 5GIRB 1NDMA 1MHHA 1FC2D 4DFIA 1DP0A 3FQXA 4OFYA 3TOPA 1CDGA 4YC2C 4FRWA 5IK3B 1U33A 3NA9L 3S36H 1R3IH 4WW2A 3ZKND 1YEFH 3VWJA 2NZ9D 5GQBA 5JW3H 4KHXH 2NYYC 2AMGA 1Q6DA 3T0ED 4F37F 5BV7L 1Q72L 5F89B 1EGJH 1BFTA 4NRZB 1AHWB 5LXGL 5I24A 1JPFA 4PUBL 3KAAA 3WLWC 1JP5A 3MJ7A 2NXYC 3UTQA 5FYJH 3W81A 5C0EA 4HFWA 3BCFA 4EANA 3MV8D 5KS9A 2F5BH 1HHHB 1KLGB 4TRPH 1NGPL 3KLDA 5D2NE 1C8XA 3PDGA 3QAZB 3O3EA 3VXOA 4ZTOL 4XP4L 4QCIA 5EU7C 1KR1A 1YNTA 1WZ1H 1VPOH 3BT2L 3DMMC 3ZQ9A 3KLAB 1DVFB 1JK8A 1YJDH 2WZPD 3GI9H 1FVEA 3TCLA 1FN4A 2DQJH 1XGUB 3AS2A 4NQEE 2W65B 4HK3J 3I6KB 4N42A 1ISYA 4TPRH 1SM3L 3WD1A 2ILLA 1CDIA 4R3SB 4YXHH 2R2CA 1Q9LB 2XZCL 3GMPB 5FYLH 1KYOJ 3L3JA 4JEGB 2WK2A 4XX1G 2Z93B 4AT6A 3TIDA 3D0LA 3TWCL 4F7PA 3ALPA 3GH7A 5CINL 4YDVA 4OF6A 5DJ6A 3WUWG 1W0WB 2YL9A 1KENH 2G75B 4DKFL 2XYLA 1PSKH 2DQFB 4OZ4A 3W9DA 2UWEA 3BPCB 4XPTL 5M3WA 2E7LA 1DVFA 1AGFA 1JK8B 4NO0D 4M02A 1NQBA 3F58L 4MCZA 4KROC 2N4IA 3S35X 3O3EB 2I9LB 4WI6A 5DGQA 3C6LA 2ZZUT 3RHWF 1V6VA 3VFGL 4UOJA 1R3JA 1A0QL 2O5XL 4WF7A 1OAKH 3N9KA 1TQWA 4DKDC 4N0UE 4PSPA 1CR9L 3DX3A 4LARL 3HRZB 2EE2A 5MENB 1KXHA 4LGRB 4M5YL 4Q9RH 2HFTA 4YNYB 4UNVA 2F54D 3CU7A 3NDYA 1FV1A 1CFTB 1JTOA 3IT8D 4GBXC 4NDMB 1UZ1A 2NY0B 3O0RH 2UVFA 1P7QB 2R1YB 1WE5A 2HT3C 3WXVH 1VFBB 3TTQA 4ZD3H 1CDCA 2EH8H 1CD8A 3QG6A 4ZS6D 2KPNA 4AC1X 5HHQB 4ML4A 3O6FA 4ZENA 4N5UA 3GJFA 4PJ5A 2YD3A 1C5CL 1Z0NA 1BQUA 1AXSB 2WUCH 2X1OA 3OJVC 5GISH 3UAJC 3EJUA 1XSIA 4P2RD 4JG0H 3CSYB 1BYDA 3IANA 2O9OA 3FB8A 3UZVB 3H9SD 1MCHA 3W9EB 4Y1AD 1HYRC 2ADIA 3HE7C 4YX2L 2EIEA 1XH0A 3GTNA 2A6DB 5JTWA 4WO4A 5BZWA 2G4FA 2CMRL 4Y88A 4JFDA 3VSVA 4JHOA 1FGVL 3GEWB 2VQTA 1ZWIA 1QWUA 4WDIA 4H26A 3MMWA 1GOHA 4TOQA 4Z7QF 3QG7L 3STLA 2IH1A 3BFOA 1A22B 2HT2C 3BAIA 4LLMB 2X4PA 1YYLH 1DQMH 2J78A 3T77B 1EGJA 1AVAA 1DWHM 2ADGA 1V3MA 1JHTB 3QUYA 1GQKA 3WQ5A 4GBXD 5GGTA 4Q7NA 1HHGB 1GOMA 5I23A 5ECJE 4ZMAT 4RISL 4NI3A 1VGKA 5JBFA 5FCUH 3MBEC 5D8ZA 5C08A 3GSUB 4MJ6A 3C9NA 1HIZA 4HHAB 1A7NL 3X3GH 2WBJA 3GRWL 5I77A 2YL5A 4X9HA 1RVFH 5E94A 5C2BH 3AY4C 4MDOA 1R3HB 5DK2B 1BVLB 2RR3A 2N7AA 1NCBH 2PYEB 3P4LA 4Y89A 5BW7A 2X7LA 3K1KC 2YS4A 2C1PA 3PG2A 2QKIA 4XVSL 3WQ6A 3BPLB 3FN0H 1QLFB 1JDCA 3IGUA 2QR0A 1OM0A 1NUDA 4KKBC 1CVSC 4R0LA 2X1QA 1YEEL 4W81A 1RD6A 2D3NA