1GVIA

Thermus maltogenic amylase in complex with beta-cd
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
588
structure length
588
Chain Sequence
MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPAISPKGARPWGSEDPTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGAASRYKDWFHIREFPLQTEPRPNYDTFAFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGLIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRALRRGDVAFLTADDEVNHLVYAKTDGNETVMIIINRSNEAAEIPMPIDARGKWLVNLLTGERFAAEAETLCVSLPPYGFVLYAVESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords MALTOGENIC AMYLASE
publication title Cyclomaltodextrinase, Neopullulanase, and Maltogenic Amylase are Nearly Indistinguishable from Each Other
pubmed doi rcsb
source organism Thermus sp.
total genus 165
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gviA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gviA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gviA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1gviA03
4P8VA 4BQ8A 1KBKA 1AGCA 3DDGA 3UXFA 5LAXA 1MI5E 3O4LB 2DWEA 4QTIH 5I8OH 5CKGA 1MCCA 1IKNC 4Y88A 3GSWB 2ICWJ 4M82A 3ULUH 4TSBH 3H9HA 4JFOB 2R29L 5F72S 3PQYE 1X5YA 4GINA 4OZFB 4O2EB 5GSRA 4CKQA 2APWA 3QQ4B 3U79A 2GW5A 3HG1B 3T65B 3VXSA 4QLKA 3W29A 4NFCA 4G8GA 1JWSA 1FO0B 2YL9A 4A6YL 3RA7H 3DROB 1I85C 1R87A 2ZUMA 5E8EB 3SDAC 5JA8B 4MA3B 2EDKA 1HHGA 2LFGA 4J8RB 4HD9A 4LPYA 5CBEA 1X7QB 4OOUA 4YWGH 5BVPL 4R7NA 2HJKB 3A24A 1CR9L 3U5YA 1YY9D 3V8OA 1XIWA 2NX5A 2XN9A 3UEZA 3VFSA 4MDIA 5D71H 2ITDB 4RGMC 4TTDD 5HYSB 4FTVE 3RFZC 1LQSR 4FN0A 1T66D 4JFDA 1EFQA 1ZAGA 4M93B 5D5MF 3WS6A 1XH0A 2CMRH 2XA8L 1T2JA 3I3EA 5TQ0H 3PZQA 1CD1A 4P3DB 4RE4A 5EBGA 5C86A 4FP8H 5KG9B 1Q9LA 4P4RB 4N9OB 5BXRA 1BQSA 5MHSE 1IGTB 1MLCA 4WEUD 5IESL 5C08E 1CT8A 1RPQA 1N0XH 1GONA 1XT5A 1LNUB 1QFWH 1BM3L 3I6GA 5CD3A 4P8XA 1Y18B 3IFPB 4U1KB 3RQ3A 4MA7L 1PZ2A 1BMGA 1FZJB 2C3VA 3MRFB 3TA3B 1E6PA 4Z7WB 4PY8J 3VFTB 4ZFGL 3PNWB 4HHAA 1DDHB 2VLJA 1HDMB 3VGHA 1K4CA 4ZO6A 3S98A 3ULVF 5LKNA 3CHFA 1MNUL 3VGAC 2RQ8A 1UA3A 3SCOA 2R0LH 2MPAH 2IGTA 1T7XA 3EYPA 5GS0D 2YEZA 1SY6H 1CICD 3RX8A 4J2XA 1OOAA 3G5ZB 4U31A 5D1QD 1NMAL 3F58L 1K8DB 3IDGA 5GNXA 1HQ4A 3UAJC 2WVUA 5EOCL 3VU2A 4JFZL 4GAFB 3SE8L 1SZNA 2AJUL 4ODWB 3JTSA 5DD3L 1WV7T 1UVQB 4PJFE 3UG4A 3AMKA 5HVHC 4W7WA 2CJUH 3THCA 1G9MH 1BJ8A 3ZHLA 3FB5B 8FABA 3RBSA 1QP1A 1FGVH 2IANB 4OZHA 3PWUA 2D9CA 2OK0L 4S1DD 2BSRA 4IDLA 1I7RA 2EYSB 1NJ9A 2ZOKB 1RJYA 1TJHL 2QADC 3PGCA 3GSXA 4WDIB 3CK0H 1GGTA 2YD3A 5F96L 1M7IB 1IM9D 5FDWB 5F44A 1MREH 3PE9A 5IT2L 1XRVA 4G6KL 2EE6A 2IGFH 3DBXA 5E2TH 5C0AE 3WLBA 1ES0B 2YUVA 3NABL 5FYJL 4PTWA 3D3AA 1EGJH 3LKNB 1OSZA 3DVGA 2DGAA 2D0HA 2JELL 2VC2H 2Y7QB 4LCWA 4U0RB 3SDXB 1EOKA 3BD4A 4CN1A 2WHLA 3CLEL 4XPTL 4LCCB 4LPWA 1PIGA 3MCLL 2GTZA 1IEBA 2MQ0A 1JZ6A 1GZPA 3VFWB 4GAGH 3W9EA 2RBLA 4H8WC 3IGUA 5GSVB 4HMDA 1CL7L 1AC6A 5A2CA 3IXTA 3AY4A 2VRJA 4YDKH 3FRPA 3BLBA 3AGVA 2IH3B 2BRRL 3CFDA 5DURD 5DRWA 4M5ZL 4RBPK 4UB0L 1ACYL 2BY1A 2VDNH 1FHLA 1A3QA 2E3ZA 4M7KL 1CFQA 3MA7A 1PX4A 1PQZB 4LLVA 4PN2A 4D0DB 1UZ1A 2CLRB 1VF8A 3F62A 1G9NC 3DNKA 1LK2A 4KDWA 5CJOL 3JWDC 4HIEA 5BS0B 4NN7B 1MJJA 1IKFH 4CCCA 1S7UA 2FH8A 1SJEA 1J86A 1YDPB 1RUKH 2VRKA 2JIXD 4DN3L 1FH5L 2GCYA 4PJHE 3KPNA 3L1OH 5EUOA 4ZD3L 1OCWL 3DXAD 5HOSA 4BA8A 4RGNE 3BX7C 4N0YL 1GGCH 3SUWA 1QRNA 4LSPH 3RTQC 4Y4FB 2X4UA 1J8HB 1P4LA 4OD3L 3L4VA 2WMJA 32C2B 5JMOC 5EIIA 3QT2A 3MRQB 3IDNB 3L9RA 3QNZA 5ABGA 3MRDB 35C8H 1X6LA 1CI5A 5D72H 1IM3B 1V7NH 3HHRB 1MQKH 1WNOA 5JOEA 3ILQC 5GJSH 3OZ9H 1AO7D 1L7IH 1K9DA 1LF1A 1E4XL 1B4RA 1KUMA 1WTLA 5FAAA 3GMQA 4XPGH 4G5ZH 3BW9B 5ICYA 1KXQA 1A3LL 15C8H 4HK0A 3L4YA 4H20H 3T3PF 5MEND 2UWEE 3INUH 4PJCB 1KBBA 1P6FA 1Q0YL 1UYWH 3QCTL 3AYSA 3L7FA 3DV6B 1DHKA 2BOCA 4FNTA 1KACB 3POHA 1AIFA 2Z93A 3U4EA 1TVHB 1WWAX 4YIQA 3CXDH 1YJDL 1I1RA 5F7WC 1EPFA 1RIUL 3C5JA 4F9PA 3REVB 1N6UA 4JB9L 3IDYB 4GRLD 6FABL 2IQ9H 3TH2T 2NW3A 4G6AD 4Q0XH 1K9TA 1ZHKA 2ICEA 4PRIB 4XP5H 4DOHE 2X0HA 4AEFA 4IOFC 1BSIA 2WBJA 1OTTC 2QKIB 4QYOA 2G2RB 1CWYA 4CVXB 3AU1A 1JV5B 3O6AA 4OLVH 2FZ3B 3HZVA 4MVBC 1ZHBB 2HN7A 3WH5A 4MPKA 5FM8A 1GOIA 1HNFA 1X5JA 3WSQL 1C08B 2W0FB 4RFOH 2OYLA 1IGFL 1DVFC 5D7JB 3KPSB 2HTLD 3MGTB 1R5VA 1EFXA 4J4PD 5I1KL 1U8KA 5TFSH 3M1BB 1FL6B 4URTB 1IILE 1GGIH 5KW9H 2XXCB 1OPGL 1WQVT 4UOW0 2APBA 2Q7NA 4O9HL 3HLAB 3GBDA 1UR8A 3A6CH 3ARSA 1QSEE 2Y5EA 3L5WB 5EFDA 2IXUA 4YUEH 4EE9A 4GQPH 1DBAH 5D5ME 3U46B 1WDRA 3H42L 1X5LA 3BZ4A 4DGYL 4PY7A 2P5WD 2R0ZH 2VL4A 2NSXA 4R90H 4XT1C 4ERSH 4PCSA 3NCJH 5DQJB 1P4IH 4IS6A 4HQQH 3GSVB 5SWZB 5HHPB 2W0KA 3MGAA 4GKSB 3F6LA 4KKCD 4JFYB 2ZXBA 2J8FA 3T0ED 4N0UB 1SHMA 4U1LA 3RU8H 3CD4A 4F9JA 1TCRA 3QO0B 4Q97A 3QXDB 4MB5A 3FN9A 4LCYB 4YBLB 5HHXL 2JJTC 3VFMA 1QPXA 3VXMD 1E4NA 2P7TB 3SEPA 1J1XH 4X7SH 3SKJL 3FT3B 3O6KL 2JCCF 5GJTL 1QNZH 1Z9LA 3VFRA 4WU7B 3ULVE 3B5HA 3IK2A 2W66A 4PJ7B 5B21A 2XJ7A 2EC9U 5HGGS 4GLRH 1XCTB 2LU3A 4K3JH 3QIUC 2BXZA 5ACLA 2CK2A 4YH6A 1J0YA 2Q3AA 1QLEL 4V1DB 4Z2GA 3D69B 2HT2D 1WBYB 4GQRA 5GQBA 5I30H 3MJ9H 1ECEA 2PW2B 4I48A 2X4PA 25C8L 3S5ZA 4GBXA 1VKXB 3A6BL 4Y5XA 2ZX9A 1GOMA 2NNAB 3VGBA 1UA6L 2WC7A 4NOFA 5D7LD 2P5EE 2X09A 5CMAA 4WFFD 5MEPB 2QF8A 2EZ0C 1WIPA 3PV6A 1JGUH 4TPRH 3MLXH 1WZLA 3RDTC 1JYXA 3CZFB 2ZIDA 5MERB 1OLLA 3RWFB 1NCDH 4M1CC 3MRKB 3IFLH 1HNGA 2MKWA 3H0TB 5B22A 1UWUA 4WI7A 1MH5B 4D0CB 2IPTL 5EO1B 4IRZH 4J7RA 5F8RC 1R3JA 3WFDH 4CMMA 1FLRL 3EZJB 3BAIA 1F3RB 2IBZY 4JKPH 1CPUA 1DQQB 3DIFA 2OX5A 5D7IA 4Y16C 3PP4H 4AQ1B 3V6OA 3EO9L 5EWIH 3CFBB 4A6YB 1L8NA 1MRCL 4DO6A 4XP4H 1WVZA 2DIAA 5ISZB 5CD5C 4FFVD 5I1EL 1XZ0B 5EOQL 5ALBL 1V8HA 3MX0A 5HYFA 2D22A 1XGRA 1MFBL 4LPTA 3SCTA 3AISA 2I25N 5C9JA 5TGBA 1N7ML 4PJGE 3C5ZB 3PDOB 3QCVL 4OJFL 3PZUA 5E6ZA 3N85L 3P4LA 5E6ID 4LPUA 1KJ2L 2J6EH 4E8CA 3QI9D 3ESVF 4KTDL 7TAAA 3F8UB 1OGAE 2Z31B 4JRXE 1L0YA 3DX1A 3W27A 3O3DA 1F4WL 1AI1L 1RZGA 1CZ1A 4P2QA 2ICWB 1G7QA 1YC7A 2J8UF 2GAZA 5D8JL 3EIFA 1UZ6F 3TJEL 3VXRB 4ZUTB 2BSSB 1ORQB 4LLUB 4GRMB 4F66A 2Q8XA 3E0GA 3SHSA 5FGSA 4JFPB 4QXTB 2NY5H 5J3HD 3Q0HA 3CVHH 2N1KA 5D93B 3GMRB 5C09B 4NM4H 2DQDL 2CLZA 1T80A 4QHMB 3G08B 3VDCA 3SY0B 3D39E 3E6FB 2XFXB 1YN7A 3MCKA 4XMKH 5AC5A 3TESA 1NPUA 1BYCA 4KDTC 4NO5A 3VGDA 5ADPH 3U36A 3HUJB 4N1EA 4IMLB 4XPFH 3JWNC 5C6TH 3U0TA 2R56H 3P4NA 4NNYB 3T3PE 4H1LA 1B3JA 1N64H 4HGWB 4XNQA 4F7CB 2BNRE 3PG2A 4PJ9C 1HKIA 4MJ6A 1BYDA 1KLUB 3WNPA 2GJPA 3T3ME 4TVCA 4PJ5E 4PYGA 3LEVL 5IMKB 3SUUA 1UQYA 4IHOA 4MX7A 2W9EL 4FQPA 2WINA 2FHCA 3O9WD 3MREA 5EULV 3S37H 5C0IB 4ONHB 1CNVA 3RZCA 2FEEI 5E5RB 1T89C 1FL5B 2RHEA 2X1WL 4NQSA 4U6HB 2Q7YB 4K2UL 1JMZA 3MUY1 5GNZA 3B2UD 5EU3A 3CV5A 5JW4N 43CAA 2C4XA 2QBWA 4LHUG 4MSWA 1G7MA 1IL1B 2UYLA 5HI5C 3HE6B 4L4JA 4F57H 2BNQD 1E4KA 4MNKA 2AXJA 1IQWL 4P2OB 4GW4A 4L9LA 4POZD 2MFNA 4E42B 5I23A 1MFDL 2X2YA 2HMIC 4PJAA 1YEFH 1IT0A 4OCXH 4XPAH 4MB3A 4P4KD 3R1GH 4HWUA 4FFWD 3IFOA 2C3XA 1UKQA 1AFVH 5I73B 3JV4B 2GFTA 1LD9B 4H8HA 1EHNA 3V7AG 3ZJ7A 5E5UB 3QDGA 4KU1A 2H3NA 4LOUD 2YPKA 2OW7A 3MBEB 3O8XA 4OV5A 4W87A 4MD0A 5HVFB 3QUMA 1TQUA 3S5LB 1XF4B 3VWKC 3A4XA 2FD6H 3FB8B 2B39A 3QP3A 5DMGC 1FNSH 2VISA 2MQCA 4UTFA 1CDIA 4PGBA 1HVXA 1D5ZB 1F42A 1TIUA 5IEHB 3U4AA 2ZUWA 4OGAD 3RBGA 5TE4L 2P8PB 4BSWA 1UR0A 2VDLL 2XVNA 5DK0B 1MCHA 5HI4C 5GS2D 4M1GL 1ZJBA 1TETH 5JDSB 5D1ZB 5DDHB 4P0DA 3L7EA 2VX7A 4M02A 4HS8L 3MV7E 1SVZA 4K23L 4EN3B 3IKCB 3GMPB 4S2SA 1I8MB 2APXA 1OWQA 1HT6A 4KVNL 3VW3L 1CIDA 4M6NL 3VFOB 4QRPE 5DFWH 1L4IA 3MRBB 4KHTH 3DURA 1BZ7A 4HLZG 4YHPB 1NC4A 1WE5A 3RGVB 4KRPC 4AZCB 3SKOB 3LRGA 4BF7A 4R0LC 4HJJL 4HUWB 3CZGA 4RMRA 1BFOB 3GTNA 1ZL1A 3WDPP 2XIBA 4RGNB 5J11C 3V7AE 3O2VH 5KS9E 1XCXA 4U6XB 4MCYA 1SQ2N 1EO8H 1BBJB 4K94L 4MDJB 3DX2A 3JUZA 3MGOB 4DUXA 2JFEX 4MJ5A 3ALWA 3EOBB 2XWBA 1A5FH 4E5XA 3DETD 5ICZA 1UD5A 4KK9D 4XCFL 4XCEA 4WW2C 2VLME 1NLBH 5JQHC 4ZE5A 5B8CA 1Y0LB 4RFNB 1S5IH 3UDWC 1MFCH 4M7LL 2Q76A 5DT1L 5JPNB 2WMHA 1BZQK 1I9JH 1UM4H 4R2GD 2G8ZA 1AJ7H 3RDKA 3D3VE 2GITA 4JGMA 3WDIA 3HZ3A 5E9DD 5BMFL 2VLRE 4YC2B 4QRRE 1MAML 4KQ3H 2FLBT 1MFAH 2JB5L 4PG2A 5ICXB 3SPVA 4XAWH 5KSAC 4MA1C 2DIJA 4TQEL 3ARTA 1TZIA 4AK1A 2FLRT 3OR7B 3UYRH 5D7KD 1KXTB 1D9KD 4P5KB 3TA9A 1KSRA 2VZTA 4YHOH 1GW1A 3WL0A 4LIQH 3BKJL 5D4QA 1FIEA 3LS5L 2GTWB 4GQ9L 5CPTA 3WQ6A 3MYJB 3LPWA 4OB5L 4L4VA 2IQAA 4LLAA 4AIOA 3V4VH 1KGUA 1KGCE 4JJ5B 4V2CB 5IHLB 3MJ8A 1NMCB 3LIZH 4ZNEE 4HCRH 4GMSH 2UWFA 2W4XA 5GZOD 1MUJB 2NW0A 3WJLC 3O4LA 2DEPA 3GBNL 3GSWA 2B7DT 4JFOA 2A9ML 1XF3B 1CK0H 1TJGL 1ZXQA 4O2EA 4OZFA 3MLWL 2XM2A 1U8NB 3QQ4A 3HG1A 4OLYL 4AMKH 3T65A 2FWOB 4N0FB 4XVJH 1YEIH 4TSCH 4R26L 5BRPA 3BVVA 1FO0A 4M4RA 3UTTB 3U6RB 3K80A 3DROA 1VACB 5E8EA 3U7WH 4MA3A 3VUPA 1CFBA 3Q1SH 4J8RA 4APQB 4NSBA 3PL6D 3JSSA 2ED7A 1X7QA 5D6DA 3VDBA 3CZEA 2J8UE 2NY3B 2H26B 1DLFH 2IAMC 2EICA 2NY2B 2HJKA 3CFKB 4B5EA 4MJ2A 5DMYA 1R3KB 2XA8H 4NUGH 3OG6B 2YR3A 2KQMA 2ITDA 5HYSA 3TFKD 5CHNB 5IESH 2YD8A 4JRYD 5FYKE 2ESVE 3RWDB 1AH1A 2QMKA 4P3DA 4O02H 5F7MC 1UWRA 5KG9A 1GORA 4JFWA 4NZJA 4P4RA 2Q8BH 4YJZL 1IGTA 4U6VL 2GJXB 3ZO0A 4F2MB 3P30H 1FGNL 1NCCH 5HDRA 4F37F 2O9TA 5DJYB 1IFHL 1Q38A 1LNUA 4KI5C 4ZFGH 5I1CL 4M7JH 1EAPB 2XZQH 3RJQB 3NPSC 1WK0A 1Y18A 3IFPA 4U1KA 2ZCHH 1FZJA 3MRFA 3TA3A 4U5KA 5IVNA 4MMZC 4Z7WA 1S9YB 5JUEL 2PXYB 3MLYH 3DMMC 3VFTA 2CBIA 1NBQA 4HK3J 3HZYB 1SFSA 1N6VA 1OHQA 3SDAD 3PNWA 1DDHA 5A2FA 3BGAA 4MGXA 5D2LF 5A8PA 1HDMA 4XAKE 1JWUB 4WENB 3IDIB 1CLVA 4MNGB 3TF7C 5LGJB 4FNRA 1PKOA 2F53E 5BO1L 2I27N 5L7XL 4KZEH 4M6ML 2VDQL 2PYEE 4P49A 4JPIB 2FHFA 4DWSC 4JZ5A 4C56D 2XQYK 2YD5A 1W9BM 4OFIA 3G5ZA 3MLVL 1UKOA 1K8DA 2ZG3A 3IU4L 2VXVL 4DFHA 4YHYC 3UPRB 1ZGLM 4CD7A 5C0DB 1YNTB 2Y8VA 4JHWL 2DSVA 3PGFH 2AJYL 4MQXC 4ODWA 1YNLH 3MUHL 1HKKA 2SEBB 1EUTA 3AZRA 3D9AL 4Z2JA 1UVQA 1OWWA 4FQ1L 5SWQB 3WIJA 5L88L 2E6QA 3HC4H 3L3HB 4D71A 4MB1A 4M1RA 5KEZA 4HMCA 3Q6GL 5I1GL 4IRJB 3FB5A 4GXVL 2F54D 2G3NA 2WHKA 1G6RL 3EO0B 2EYSA 3BEWB 4QDMA 3EDFA 2P8LB 2ZOKA 4IPNB 3P4OB 4NO0B 4WDIA 3IS0X 4LLMB 1M7IA 2X41A 4GAJL 5E1QA 5FDWA 1JNEA 2AERT 1EDQA 5E2JA 1DEEB 1BQCA 1GOQA 3D2UD 1LO0L 4LCUB 1ES0A 4HIXH 1YEJL 2XIDA 3LKNA 1HP4A 2XQBL 2Y7QA 5GRJH 3SDXA 1HINL 3UAJD 3ETBF 3UZQA 4LCCA 1CL7H 3VFWA 1KJ2B 1ISXA 5KOMC 5JOPD 1HL8A 1EMTL 4ODVH 2BRRH 5HVWA 3KYKH 5GSVA 2B31A 2WC3A 3PZIA 3AHYA 1I7TB 2PNDA 3JWOH 4JCLA 2PR4L 4HUXB 4PV8B 5DMJB 4WKHA 2IH3A 1E6ZA 1CGSH 5T5NF 4GRWF 3MKKA 4XCNB 1PQZA 5I17B 1VFFA 4HA3A 4HA1A 2QADD 1D5MB 1G0CA 3WH6A 1EEUA 3KL3A 4G7YL 2PTTB 4D0DA 5J6GB 3MJ7B 1QI0A 3WNLA 2VR9A 2CLRA 2EE9A 4W68A 3LN4B 2OR8A 3OJDB 3ARPA 4KK8C 2XGBA 4JQIH 5BS0A 4DN3H 2HJLB 3FKUS 4Z7VB 1JDCA 3K2MC 1QWNA 4ZUVB 2QHRH 1ZS2A 4D9QD 4AZ7A 4P2YA 1YDPA 1UCBH 1F6AB 1IAOB 2C1PB 4POYA 2NXZC 4OD3H 3ILPB 1H8SA 2R1XB 4W8BA 1F58H 4IMKA 4P9HH 3DGCR 4BM7A 3FXYA 1P9MA 5JHDB 2J78A 3ALGA 1FG9C 1W2VA 1XEDA 5JBFA 2YKKA 1DUZB 4Y4FA 4GMTL 1R86A 1J8HA 5CQ1A 32C2A 3QPXH 4U1SB 3MRQA 5GGRB 3IDNA 1VFBB 3I2CL 1S7RB 3ARGB 3LZFL 5D9NA 3FB7B 1E4XH 1ZLSL 1KT2B 3MRDA 4PRHB 5CIPH 5A3HA 4OCRH 1IM3A 4I3RH 2DQEH 1C8YA 4PMDA 3MLTB 3O6FB 4ODTH 5AYQA 3B43A 1QTYT 3P0GB 5CILH 1FH7A 2QQKH 5C0RH 4NQED 5IMOB 1C5BH 3BW9A 3IVKB 4V27A 3K2UL 4N5EC 3L5IA 3OLIA 1KEMH 1I3GL 4MQ7B 2XYLA 3FQTB 5T3XL 3Q6FB 1YJDH 4PJCA 1X5HA 3MXVH 3GIVB 3JVGA 2BFVL 4Y7EA 2CSPA 3DV6A 4HBCL 4JB9H 3RNKB 3BIKB 3QUZC 4MYWB 4Y5VA 1OIMA 2AJZB 1V0NA 2GT9B 1INDL 3TT1H 4CU8A 1TVHA 1JPSH 4POUB 3RL1B 3T0BA 5EOTB 3REVA 2CETA 2E5EA 5DRXB 3L4WA 2X4NB 5I74C 3RTQD 2C4FU 1NLDL 4JKMA 4BUHA 5C0JB 1XMWA 1CGTA 3ZE1F 4PRIA 2BRQA 2ZWLT 4R6UA 4D9LH 4WUKL 5FGBC 2NY7H 1TPXC 4XNZB 2LTQB 2QKIA 2G2RA 4J3TA 4CVXA 2AI0L 4GSDH 1JV5A 2KQNA 3FB6B 5IHRA 4M62H 2FZ3A 5F3BB 3ILQD 5TF1L 1XHGA 3C6SB 4M5YL 2ZZUT 5DJZB 3WFCL 1M01A 1C08A 2W0FA 3WO3B 4JDZB 2CYGA 5D7JA 4OLXL 3KPSA 3HCVB 1OPGH 3SOBH 1YEHL 3MGTA 4UDTA 5I71B 4GO9A 4EQ3A 4Y2DC 3MRHB 4PD4J 3V6ZB 2QQNH 1FL6A 1JPST 3M1BA 5HNNA 4JDVB 3PWNB 5AZEH 3WUWB 1GAFL 3SDCC 4PRPD 4QHKJ 5EB9A 3HLAA 3EDJA 2EYTB 2BFGA 3L5WA 1HE7A 1ZANL 5BXSA 1XFPA 3MO4A 4AYSA 5E99L 1T2QH 4I77L 3QFJD 4IOFD 4DUWA 2NT0A 5DLMH 5DQJA 1OTTD 1Q1JH 3GSVA 4LVHC 5SWZA 2FEEL 5HHPA 2I07B 4GKSA 1U93B 1R75A 2OTWB 4JFYA 5L2KB 1U3YA 4MVBD 4PMNA 2EAEA 4N0UA 1C93A 3MV9B 2R1WB 2JCCB 3VWJB 3QO0A 1YEKH 2A83B 4HJ0C 4I9WD 5DA4A 2CPCA 3QXDA 4BA0A 2PI6A 5ECUA 1DVFD 4HX1B 3MANA 5FO9B 4KHXH 5FEBA 4LCYA 5F1KC 4OAWB 2VH5L 3AFLA 3SGDH 3KXFB 5F1NB 3POCA 2P7TA 1PG7X 3FT3A 1NOFA 1OSPL 4WU7A 1JTPA 1RZKL 3UBXB 3RY5A 4PJ7A 4XI5C 3D1MC 3ULVH 4D6IA 2D7QA 3EYUH 5EH1A 3DHMA 1GHSA 1XCTA 5FUOL 1T6WA 3F7YB 3CGTA 2X6MA 2G4FA 2NXYB 3VFUB 1FP9A 2WB5A 1HP5A 2NCMA 4RNRB 4V1DA 5L0QB 3D69A 1TUXA 1WBYA 3T04D 3BZDA 5KAQG 4LMQI 1WO2A 1NAMH 1OAZH 3FN0H 3SCSA 4U33A 2PW2A 4JM2C 4AY0A 3HMWL 3D3VB 2ED8A 3ZDXF 1VKXA 3K3QA 2NNAA 4L3ED 1IGMH 5T5NG 1MF2L 2VLRB 1UT9A 2M1KA 1TDQA 2ZX5A 5MEPA 1G84A 1RHHB 2XGIA 5ITBH 3QDJD 3B5TA 3LPFA 3CZFA 5MERA 1MJ8H 3RWFA 3MRKA 2CIIB 3DPBA 3QIWB 3ARZA 5GS0L 1AY1L 3H0TA 1KR1A 2MOVA 4EZMA 1MH5A 1WZKA 1T5WB 2WUBH 1CU4L 3EBAA 4D0CA 5EO1A 2A73B 4O2FB 4Z7UB 3QIUD 3VIGA 1R6VA 1QSVA 3B5GA 1R34A 1KTRL 4OLZL 4NN5C 1DQQA 1MRCH 4UT6L 2WXDM 2AEPL 2YZ8A 5ELIA 1JRHI 4U7SA 5C0FB 3EKCA 3RJDA 3CFBA 4A6YA 2HLFC 4PGEB 2W5FA 4JLRB 5ISZA 5LCVH 3MZGB 2CRMA 3QZWB 1XH2A 1ZS8B 1XZ0A 4S1RL 1IE5A 4BZ1L 1N26A 2EZ0D 1CQKA 1XIWC 3RDTD 4OJFH 1E6OL 5DHVH 4ORZC 3BOVA 5E8DH 5DHXB 3B8YA 2KBGA 3LMJH 1AVAA 4KTDH 4M1CD 4ZFMA 2ZUQB 3C5ZA 3PDOA 3WS6C 5CZVL 5IV2B 1RQ5A 3BN3B 4HDIB 1E4JA 4MAVA 2Z31A 4NC0B 4YHLL 5SWSB 4KGJA 3N0PB 5D8JH 3BPOB 5C0BD 3GSRB 2M26A 4HW6A 4JG0H 4ELME 2ICWA 1V02E 2WP3T 3KPRD 1TENA 3EDEA 3B2VH 4LHJB 4JFEB 4Z7QF 4Y16D 3BPNB 4L29B 2DSUA 5IJKA 4FQCL 2CXGA 2ZCLL 1I1AB 2XKUA 4ZUTA 2BSSA 4LLUA 3GJFH 4GRMA 2DQDH 5CD5D 2Z1KA 4U2YA 2VX4A 2O26U 3DTXB 3PWLB 2DQIL 4JFPA 4QXTA 3KS0J 3N18A 5I2UA 3GMRA 2CGRL 5C09A 1LP9F 5IG7B 3A4AA 3WN6A 2X4QB 4QHMA 4YDJB 3BP6B 3QB7C 4MA8H 3VXNB 3SCMB 3MLRH 3RIFK 2N7AA 2DMBA 3QG7H 3SY0A 3E6FA 1IVLA 1RULL 5C92A 2XFXA 5JTWA 2QQQA 3FONB 3DXAE 5C3LD 4QNPF 3N12A 3ZKQD 1KB9J 3HUJA 4IMLA 4DCQB 4F9LC 3BT2H 2TAAA 1Z5LA 5H94B 4NNYA 2DBJA 5EZOL 4HGWA 4FLSA 4F7CA 4WV1C 1N3NB 4DUVA 1KLUA 2AGJH 5IB2B 2W9EH 4TOYH 2OYKA 4W5ZA 4C4KT 3DUUB 1MFNA 1IAIM 4HZAA 3SGEI 1JI1A 4DW2H 2DKUA 1AO7E 5IMKA 4IM4A 5M17A 1YEGL 5LWYL 1G6RB 1O5DT 5DQ9B 3ZE1E 5C0IA 1QI3A 1UOKA 4ONHA 3N15A 1UQSB 4P3CH 4U6HA 2Q7YA 4MDPA 3LD8C 2BVTA 1V6VA 1I3RB 3VKKA 5MENE 1MFVA 4BCEA 3EYFB 1EJOL 1K9EA 1LGVA 1AGEB 4M43H 1IL1A 3HE6A 4XX6A 1CDYA 1K4DB 1D7FA 3ROOB 1CFNB 3NACH 4P2OA 1PS3A 4E42A 5ABHA 3GDBA 2A3HA 3TVMB 4BJLA 4PJ9D 2BVQB 3NFSH 4K8RH 4TVUA 3D52A 1S5HB 3LKPA 4AEHL 2XVGA 2XIIA 2I9TB 3JV4A 3N50A 1LD9A 3RWIB 2J4WL 3HG5A 1W8NA 1ADQH 4PJIF 5TDNB 1LO4L 3ISWA 3UO1L 1DWIM 1Q9WB 2YD9A 3MBEA 4AIZB 4UQDA 3P11H 2R4RH 3FOLB 3THMH 2B4CH 3G6DL 5C71A 4YXKH 1CXLA 2ZWZA 1A7RL 3S5LA 1XF4A 4UUJB 3U1SL 3FB8A 2WLYA 3A0OA 1VGEH 1WZMA 3IDUA 1YQVH 1D5ZA 5IEHA 4K7PL 4TSAH 4HS8H 5KZCD 3NIGE 2P8PA 5HDOA 4M81A 3VD4A 1J7VR 1QR4A 5DK0A 3DX6B 3GXPA 5JDSA 5D1ZA 5DDHA 5HI5D 3SO3B 4X6EB 3TTOA 3U48A 5A8QA 4EN3A 3HG4A 3IKCA 3GMPA 1UR4A 1I8MA 4H0GA 1PDKA 2HMID 2P5WE 4UOJA 4OSUH 3VFOA 3DRTB 3QDMD 3MRBA 4X9HA 4GIAA 4YHPA 1QKZL 2DQUL 3OKEB 4NWTL 2DH2A 4D6FA 1UKTA 3RGVA 4AZCA 2WW8A 3SKOA 4UIKL 1LVEA 3T0EE 3BHBB 4HUWA 4Z8FL 1BFOA 3DHJA 1NQ6A 3VDAA 3LHPH 1HCVA 3MROB 4MXQC 3U30C 3PZVA 3LRSB 4U6XA 5LBSH 3VWKD 5BXTA 4NBZB 3AFBA 1BBJA 4R7DB 1MYRA 4MDJA 2H6PB 5DMGD 3VXME 3DX7B 1V3MA 3BVXA 3HZKB 3MGOA 5DUML 2G41A 4M29A 4WUUB 4NKOB 4WWKB 1NCWL 4R97C 5C8JB 1PEZA 3MNWB 1I1YB 2P48B 5HI4D 3ZDXE 3LDBB 4JN2B 1Y0LA 2VAJA 2EC9T 4YDIL 1IT9L 5I1IH 6TAAA 5DQDH 1V0LA 5JPNA 1I3UA 4UQBA 3O9NA 1C7SA 3S34H 1PD6A 2R69L 3OAUH 5SX4I 4OIAA 2C3GA 2V38A 1MCSA 1T21B 3DI2B 4KRPD 4NPYB 5E8PB 2WBJC 2WP3O 5ICXA 1BWWA 2CIPA 4HLZH 2V2XB 1L9MA 3CO4A 4OZIF 3OR7A 5D7LE 4MLSA 1Z0MA 4ORGB 4P5KA 1KXTA 1SEQL 2ARJQ 4X7TB 3E8UL 5DD0H 1ZBCA 2GTWA 5EG6C 2XSBA 3MYJA 4PJDE 4NHCH 3EJUA 2WZPD 4UFHA 2CDEB 4PPTA 1CBGA 4FXLA 3GBNH 4JJ5A 3M46A 5T3ZH 1J88A 3BXNB 2A9MH 1TVDA 1MUJA 3M17B 4D6GA 1TJGH 2FGWH 3DX4A 1IQDB 2FE0A 3GBML 5ENWB 1W1PA 5FUCE 1XF3A 2WW5A 1IJ9A 1YY8B 1U8NA 2KH2B 1KJMB 5AUMB 5DMIL 5E09A 2WBKA 1AD0B 1L6XA 5F9OH 5HBBA 1E4WH 1LO2H 2FWOA 4N0FA 3WNNA 5KVEL 3UTTA 3U6RA 4KTYA 5KSAD 3T4YB 2PCPB 5FOBB 1VACA 4YDLC 4C4KO 1XC6A 2DRUA 2W1NA 5DFAA 2A9NH 1DP0A 2FATL 3CLFL 4APQA 3TTSA 5I0DA 3DUSB 4OKDA 4QLJA 2ZUXA 1PLGH 2H26A 4Z7QE 3CFKA 4CMHB 1R3KA 4I3GA 1J05B 1GC1H 5FV2A 1JIBA 3RKPA 3VD3A 3MO1B 1RVFH 4XMPL 4K9EL 2PWEA 3O3UN 1T1XB 1UKSA 3FT4B 5CHNA 1HHIB 2PETA 4GI6A 1ZE3C 3RWDA 4PB0H 5KVDH 4JVPA 1FSKB 4NQCD 1A02N 5FYKH 1A4KB 4F2MA 2FX9H 2DD8L 5DJYA 3AZTA 5D2LB 1OQXA 1EAPA 4LCIH 1UD3A 4XRCB 3ZT7A 3PJSB 3SBWA 4QNPE 3AZSA 2PXYA 1FIGL 1HZHL 3GMOB 1TJIL 1T5XB 3HZYA 3LS4H 3VG0H 1XV8A 3GJFK 3ZKXB 4DJMA 3U2SB 4AENB 4C58B 2X42A 4GBXC 1JWUA 3IDIA 4MNGA 4Y5XC 1A8JH 5LGJA 2FNBA 2IC2A 2IAMD 1U8OB 3UJJH 4D2NA 2G60L 3DHUA 4UQEA 1S9VB 1E4LA 2F61A 2V3EA 2WWMC 3VO0A 2DLFL 4EUPB 2VXVH 1Q72L 4JPIA 4JHWH 4JDTL 4KZDH 4Q7DA 5JBEA 3UPRA 3VGEA 2O5YH 4ZXOA 1UR1A 5C0DA 1YNTA 5GISL 2F15A 2RCSH 1E5JA 3WIHH 2EECA 3Q6GH 1RFDL 3FW6A 2IADB 1QFUL 2SEBA 2JF7A 1U95B 1A0QL 3IRPX 3BD5A 4KI5D 3P0VH 3WEXB 5SWQA 3ZR5A 3BKMH 4LSUH 3L3HA 4H5SB 2I60H 2NY4B 4P23A 1E55A 4IRJA 5DR5L 3DMMD 1HJUA 4ZPVB 3OHXB 3V6OC 4NWUL 4RSVA 3APGA 4XCYB 3EO0A 4TNVF 2XTJC 3BEWA 3W11C 6CGTA 2BHZA 2P8LA 3BGFC 2J7DA 4F7PB 4D6DA 3P4OA 4NO0A 3SE9H 2A1WH 3IGAA 1BEYH 4LLMA 5BRZB 3FT2A 5ANMB 2NY1C 2RGMA 2A6KB 1EH9A 3HR5B 3GRWL 1DEEA 1V03A 2VQ1B 4DWSD 2D7MA 2F5AH 4LCUA 2PUQT 4LMQE 1C5CH 3PWPD 3I6LD 2BNQE 3ZE2E 1MEXH 3VXOB 2QSCH 1KCUH 4Y19D 4OZGF 4RA0C 4Y4HB 4MQXD 1XGUA 1KJ2A 4GRWB 2CUIA 1UH2A 3VXTB 2DSWA 5JUVA 1IC7H 5EU5B 1I7TA 4FA8A 1XH1A 4HUXA 4PV8A 1BVLB 3C08H 2B1AH 3O2DH 1DCLA 4KROC 5A6BA 5IF0B 3ALFA 2HFGL 1PZ3A 4W81A 3VIIA 1JN6B 1XR9B 5A6SA 3T2NL 4XCNA 5I17A 3VIFA 1D5MA 3LQAH 1I1XA 2EDTA 4GPNA 2DKSA 5J6GA 2PTTA 3MJ7A 5FCUH 2D7NA 3UG3A 1OWRM 1KEGH 1TQVA 3LN4A 3OJDA 3WL1A 2VJXA 5I2IB 5FIEA 5GGTL 3WXWL 2OYPA 3WQ5A 5EU6D 3PDDA 2HJLA 4Z7VA 4OCYH 4WEBL 4ZUVA 1X44A 4XB7A 3U7YH 2DB8A 1FHDA 4RDQF 4J6RH 1UASA 4TTGA 2UY4A 1FJ1B 1F6AA 1IAOA 3QA3B 2C1PA 2VB5A 3VGGA 4OCSH 4XP9L 5DJDB 3ILPA 2R1XA 5KSUB 2BSED 2WSKA 5L8JB 3CIVA 4AEIL 4L8SB 5JHDA 4HWBL 1JRHL 1RURL 3T0VA 4MDOA 1ZLSH 3RY4A 1DUZA 5J0BA 3ZKNC 5JA9A 4P7NA 5IB3B 1Y6NR 3WD5L 4U1SA 4Z77B 1EHXA 1HIMH 5GGRA 4YHZH 1VFBA 4LRIA 4AY1A 1S7RA 3ARGA 3FB7A 4WTZA 1KT2A 2EKJA 3BSZL 3G6JE 1GHFH 4PRHA 3U9PL 1H3TA 2XM1A 4LDOB 2DT0A 4XNYH 4RFEB 2YOCA 5F9AC 3MLTA 3O6FA 3AS0A 2CCRA 2IPKB 3QFDB 1LEKB 2J88L 1M1SA 4KK8D 2FDBP 4LSQH 5IMOA 3UETA 4ML4A 3IVKA 2J7HA 5JW4R 9CGTA 3KPPB 1TZHB 4MQ7A 1INDH 5D96C 4OZIE 4MWFB 3FQTA 5I24A 3Q6FA 1YECL 1FFNB 4ALAH 3GIVA 3DO3A 3RNKA 3BIKA 3VG9B 2AJZA 1NLDH 2GT9A 2NXZD 4MJIB 3PHSA 3K7UA 3RL1A 4JG1H 4L9LC 2J5LC 5C1MB 3F65A 5EOTA 4HP5A 3MOAH 5E9DE 5DRXA 4ONFH 2ARJB 2X4NA 3WMCA 5C0JA 3CFCL 4BQ3A 2DPEA 4NZRL 4MZ2A 5I18H 3KG5A 3TWCH 4BELD 4HC1L 2GHWB 2H1PL 3SDYL 5CLTA 4FFYH 5D7KE 3QXAB 3O8XC 4UAOC 5FHAL 5F3BA 1CXKA 3BVUA 1N6QH 3C6SA 3KLSA 1V0KA 5DJZA 3X3GL 1UB6B 2MSPA 4R8WH 5IR1B 3NTCH 3C9NB 4JDZA 4P5TB 2OCFD 3HCVA 3WD1A 3QEQD 4YHML 1LO5B 4N5ED 1G0XA 4YGAB 4FABL 3CH9A 3MRHA 3V6ZA 2JE8A 2GK1B 5E2VL 1QRKA 5F21B 4UQCA 4JDVA 1ZEAH 3PWNA 4G9FB 3WUWA 2FB4H 3AMCA 3QUZD 1BAFH 5I3DA 4DKAA 1T0PB 4OCNC 4F8TA 1WF5A 3GIZL 4GXUM 2EYTA 2DAVA 3U83A 1RIVL 1OGGA 4IDJH 4QAWA 4E41B 3T0XA 2KL6A 4OZOA 2X1PA 3CX5K 4RX4A 2AJSH 1J0IA 1H8NA 1P1ZB 4AD2A 4RWYH 4YQXL 5C2BL 4X8JB 1AGDB 3S2CA 3NMEA 4N42A 2I07A 1U93A 2MCG1 2OTWA 2AK1L 1QFWI 4MNQB 3OLEA 1A21A 5L2KA 3D4ZA 1MW3A 3OGVA 3NAAH 2AEQL 3MV9A 1ZVYA 2JCCA 2R1WA 3VWJA 4X6DF 2A83A 1FAIH 2DQHL 1GJIA 2AJ3B 4HX1A 5FO9A 3O81A 1H11A 4PJEF 4HEPG 3TN0C 3CMJA 2GJJA 4OAWA 4AG4H 4DN4L 2CKBH 3KXFA 3U9UB 4Y2DD 4JRYE 5DVKA 5F1NA 4P9ML 5EA0H 5BYWA 1UACL 5JXEA 3EOTL 4JO3H 2VXUH 4IISA 3UBXA 5B8CC 1HYSD 1XAUA 4NF7A 3B8SA 1J1PL 3SDCD 1E0WA 5B38G 1VFMA 4DGIL 3W38A 3MRPB 2OZ4H 3GXDA 3TBVB 4Y5YB 5DXWA 2W67A 1DE4B 1UM5H 3CFJB 3F7YA 4XPHH 2DQFB 4YFLI 1NQBA 3AXLB 4PBXA 5JZ7C 3AM8C 3VFUA 1OAXL 4RNRA 5JW3L 4FQIL 5HDQL 1HYRC 3HI5L 4PG2C 4KY1H 4NRYB 3C2AL 1T04B 3RI5K 1NCBH 3BQUC 5KJRL 1KYOK 5TE6H 1W9UA 1VCAA 3D3VA 1NBYB 2EDQA 1WWBX 2XKNB 5KSBF 1KG0B 1O0VA 4HJ0D 5EORL 2VLRA 1P7HL 3NGBB 2HWZH 1NSNH 4YE4L 5IW6B 4QRRA 3W0WB 1RHHA 4M8UA 4HPOL 3K1DA 3SJVD 3DWTA 5GS0H 5TF0A 1U36A 3MFFB 4I0KA 4PB9L 2H2SC 1T03H 1MIML 2CIIA 3FFCD 2WIIA 2BMKB 3QIWA 1HL9A 3KJ4B 4WIQA 2W65B 2MWCA 4RGOL 1NGQH 4UV4L 4XI5D 1JJUA 1T5WA 1F90L 1YMMD 2PWDA 5T1KD 1I7UB 2A73A 3DLQR 5HGHB 4O2FA 4Z7UA 1W0VB 2COQA 3VX0A 2YK1L 3GK8L 1AQKH 1FZMB 3BE1H 1JGVH 5ILTL 5KN5B 5E4EB 5JHLL 5DD5L 5HHMD 1CZ8L 3VSVA 3W26A 3UJTH 1TFVA 2F54E 4BQ2A 4YR6B 5FHBH 4OD2B 5I8EB 3WY4A 3U82B 5FK9B 1P6WA 3DV4B 3BDYL 5C0FA 3ALXA 2BY2A 3WXVH 4JM2D 3ARRA 3MA9L 4PGEA 1BOYA 4JLRA 4XGZB 2WPGA 3F7VB 4ZTOH 3CX2A 3NZHL 4OI8A 5D6DC 4DTGH 1ZS8A 3S88H 3Q2CA 2E9JA 4XHQA 2C8NA 1N5YH 4CKVX 1TTGA 1ZJAA 1BQHB 4QY8B 1E3ZA 2CERA 1J5OL 4EANA 4M93C 4IIQB 2PYFB 1F8TH 4G43B 3R8QA 3SO5A 4XNXH 4YHLH 2XG9A 2W9DL 4PBGA 5IV2A 3WDRA 1R0AL 1KPUB 2VAAB 4IJ3B 5JOPE 4HDIA 4XXDB 5F1OB 4AYGA 3VA2C 2F8VA 3OPZL 3FZUC 5SWSA 6A3HA 1KB5B 3BDBA 5EIVA 1WZ1L 3TIEB 1AQ0A 1KBGH 1YMHB 3GSRA 5ADOH 2XWEA 3GO1H 3VXSD 1QSFB 2ORBL 1H49A 3NZ8B 2XWDA 4G8GD 3SKMA 3WDQA 3TA3C 3VINA 1SM3L 3HE7B 4U7MA 4LBEB 3IJHB 4L29A 4PJBF 1RZJH 1TLKA 2C7UB 1B3ZA 1LP9B 3FO0L 1I1AA 4Z7OE 2HLFD 1P4BH 1LK3H 1MCPL 4D6EA 4CD8A 2YBRB 4KV5F 3ULUF 5DEFB 4JFQB 5C7XL 2D9QB 3DTXA 3PWLA 4JN1L 1JK8B 3WFHB 4RMSA 1QFPA 1W2KT 5GGRY 4Y4KB 4NCDA 3BEVB 1P7KB 1OP3K 1S8DB 3HFML 2HH0H 1V3IA 4HOZA 1XIWD 2NX5D 2XN9D 1U3JA 4PFEA 5H37H 5IG7A 3I9GL 1O7VA 2X4QA 1KGWA 4YDJA 3BP6A 4OUOA 3UTOA 3RO8A 3VXNA 1FRGH 3SCMA 4D9QE 4JFDD 4FNQA 4QXGL 5DI8B 3FONA 2X0YA 5TQ2H 1FNGB 2ESCA 4OT1H 3GHBH 3U7VA 2JJUA 4TOQA 5JW4Q 1OF2B 2BVPB 4DCQA 4NQDB 1W9PA 4V28A 2K7QA 1D5XB 3I85A 5H94A 5D8ZA 3K4ZA 3GSNH 4FFZL 3OXSB 3UTSB 1FORH 5D70H 4DVBB 4OIIL 1N3NA 5MP6H 2VVNA 2OTPA 3CZNA 5I1DB 2AEIT 4JHZA 4Z7NF 1HXYB 5IB2A 5LWYH 1KJVB 3DUUA 2E9WA 3OG4B 2VLJD 3V4PL 4OQTH 3JUGA 1G6RA 2Q8AH 5DQ9A 3KS0H 4NQEE 3QDHA 3EJQA 1I8LC 3D25B 3P77A 3S97C 3ZJ6A 1UQSA 3TYGL 2EDOA 1MCFA 3FAXA 3NCFB 4F3FB 4KKAC 2O5XH 2VWEC 4MAYB 1IBGL 1I3RA 5K33A 3QWQB 2Q1EA 3EYFA 3AXHA 1CBVL 1I9RH 1UJ3C 5I15L 5B3JF 1AGEA 1TMQA 4U0RC 4LCCC 4W4NA 1K4DA 2DI9A 3ROOA 1BQUA 1CFNA 3T1FB 1A7NL 1QNOA 4M1DL 4PJIB 4ONGL 3PZOA 1PAMA 3TVMA 1KCLA 1JP5A 4WIWA 3H7LA 2ZE0A 1HYSC 4KJYB 2BVQA 4UBDC 3WYRA 2DT1A 3ZM8A 5CINH 1A6UL 1S5HA 4DVRL 3L6FB 4YFLF 3WD4A 1NWTA 2J75A 4H0HB 3BRDA 1YYLH 2I9TA 2JLLA 3BDXA 3RWIA 1FLTX 1C7TA 1S7VB 5TDNA 4DM1A 3SN6N 1ISYA 1Q9WA 4HEME 1CFVH 2X2IA 4FNLL 4AIZA 3FOLA 1S9KC 3B4NA 4UUJA 3MMUA 1PBYA 3ARDB 3RP1A 1H4PA 4CD6A 3VD5A 1BGXL 1NCNA 3KR3L 4NN7C 1N8ZB 1BGAA 2V17L 5GPRA 4X6DE 3DX6A 4PRPE 3S36X 3W6MA 4LCWD 2E7BA 5CP3H 4H2CA 4X6EA 3WIIH 3CU1A 2A38A 4IMKC 3RZWA 2QHAA 1ZU8A 3QPQC 1P9MC 1YPZE 1HN1A 2ZOLB 3HA0A 2VZUA 3DRTA 1AC0A 3ARVA 4Y4FC 4CVZB 3QFJE 4OFKA 2HVJB 3OKEA 4HWEL 3PZNA 1WEJL 4F9DA 1D2KA 3LH2H 4BS0A 1AE6H 1DBKL 5E8NB 3BHBA 4OCWL 1BGGA 4RISH 2OL3L 1A6TB 1E6RA 4I9WE 1FPTL 3MROA 3T4AB 3LRSA 3CDGB 3QGVA 4J3SA 5D2NB 4QLLA 4R7DA 4XP6L 2H6PA 3DX7A 3HZKA 1JVKA 1UWQA 4TUJB 4YO0B 3VA6A 4QGTA 4R5EA 3KYOB 1S7XB 2MCPL 4WUUA 4NKOA 5IHBA 4LSTL 4WWKA 5C8JA 4UIMB 3MNWA 1I1YA 5L6YL 1T22B 3UG5A 3JVGC 4X4YB 2FX8L 3AREB 4JN2A 2P24B 4M3KB 4XB8A 3MMDA 3HI6L 1T0OA 1KC5L 3O3BB 3CDYA 2I9LB 4WK9A 3WBDA 1QRND 3IDYC 4O4YL 4QXUH 1OD9A 1BAGA 1G7JB 3GGWB 1T21A 4N1CA 4QWWC 2IPUK 3NA9L 4S0TD 1JPTH 2YBUA 5DJ8B 4NPYA 2AQ3A 5E8PA 4WI9A 1SEQH 4KJWC 3MMWA 3QEGH 1JD9A 3E8UH 2EBNA 1OGTB 5FGCE 2V2XA 4L3EE 4I4WB 1EJ6A 5GGVH 5JPMB 4MXQD 4ORGA 2YC1B 2KPNA 3GSQB 4LVEA 3OGRA 4ISVB 3E2HB 4X7TA 3QDJE 4GFTB 2YD1A 1VRXA 3PP3H 1ZB5A 5D7JC 1MXDA 3AIVA 3DRQB 4XBEL 1XGYL 5FD0A 3S3SA 2CDEA 2ALWA 5TD4A 4OFYA 3KJ6L 5GS1B 5AEAA 4Z0BH 4NT6B 4OLUL 2R0KH 3BXNA 3EFFB 5EFFA 1W2PA 3CUPB 1CEOA 3M17A 3GI9H 1W3KA 4K3DL 4LYQA 1IQDA 5ENWA 3OB0H 1D3CA 4D3CH 4Y7MA 4J3UA 1G1CA 1YY8A 4XVTL 4DK6A 5AUMA 1KJMA 1QNRA 2DDQH 4S3KA 3VTRA 3QHMA 4OM1H 4ZMAT 1AD0A 4U3AA 1D5BB 3M8OL 2WBJD 5H35B 1MY7A 5KZ6A 3T4YA 2PCPA 5FOBA 2OWXA 3DSFL 2A77L 5IFAL 43C9A 3X11B 5LQBH 3DUSA 4QOKB 3UP1A 2Y5TB 3P9LB 2Y36H 2YDRA 1X3DA 1KELL 4AZBA 5C0CB 1J05A 2DOCA 3D50A 4YBLC 3MO1A 3WN5B 1Z3GL 1T1XA 4JZOB 1TR1A 3D85D 1EFXD 4YFEA 3FT4A 2QLVB 5EU7C 5BQ7B 5IWLA 3OA5A 3W53A 3WELA 4LHQB 2VRAA 1IC1A 5EDXA 3MLUH 4DFIA 3MLZH 1A4KA 1F3DH 2B0SL 4FS0A 4L4TB 4QTIL 3ZHDA 5I8OL 3EYSH 5C0BE 3LVEA 3ULUL 4U3CA 1M7DB 2H32B 1L9NA 3KPRE 5D2LA 5A6LA 5BXPA 2WBGA 5DRZB 4XRCA 3CSPA 5IKCB 3PJSA 1CLOH 1FYHB 4EAMA 5AC4A 3GMOA 1T5XA 2Y9RT 2ERJB 3U2SA 1JPFB 4AENA 3RA7L 5JO5B 2ZWYA 4FLOA 4WFGD 2W60B 5DJ0B 4JAWA 4RWHA 1H9VA 1S9VA 1U33A 4YWGL 4EUPA 1ZWIB 2YMXH 2D7PA 3VGFA 1CD1B 4I3SH 4ZXBB 2EEBA 5D71L 4ATDA 2NY0B 4HWZB 1AR2A 1F45A 3BN9C 1I3VA 3WFLA 1BFSA 2CMRL 5TQ0L 2AXHA 4FP8L 1YHTA 2EKSB 3K81A 1INQA 1HXMB 4C56B 1DWGM 1G7IB 2IADA 2BY0A 4CN6A 1CENA 3TTYA 1U95A 3RL2B 1E0OB 1N0XL 2IBZX 2NYYC 3QUYB 3WEXA 2UUDH 1UWIA 5DK2B 3EDDA 4H5SA 1QFWL 4YHGA 2V9TA 3WH8A 3IAPA 1VEMA 1PSKH 4LFHG 4WFED 2R0WH 4ZPVA 3OHXA 5GGUB 4XCYA 4CCEA 4GBXD 4F7PA 3EOYG 3B3IB 3FHAA 4ZQKB 3VIPA 5BRZA 3U0PB 5ANMA 2WWMD 2A6KA 1DBJH 4H25B 2YUZA 4OZGB 3HR5A 3VI3F 1RIHH 2VQ1A 3RHWK 5CP7B 2MPAL 1YYMH 1SY6L 2LVEA 5DC4B 4B15A 4N0CC 3C5ZC 1QSZA 3UERA 2ZUYA 4BQCA 1W0WB 1EGZA 1UZ4A 4Y4HA 1NARA 3M7SA 1II4E 2Z31C 3L3OB 3FOMB 3VXTA 2VDKH 4JHAH 2W61A 2HFGH 1IAII 1RSFA 5EU5A 3CFEB 3LOWA 3MFGB 2Y23A 3C09B 1RZJC 2VN4A 1BVLA 1AQDB 3CUIA 2CJUL 1MWAH 2CBJA 1G9ML 5IF0A 3O41B 5IJKC 1E6SM 4WCYH 4NRXA 1JN6A 5A95A 1XR9A 1FGVL 2XTJD 3W11D 4TUFA 3OAZH 1Q0XL 1LLOA 4CBPA 1HF6A 5J6HB 2NY1D 5I2IA 2D4FA 1JDDA 4WNQB 3FN3A 4N8VB 4XP9H 1FYTB 5E2TL 2KZWA 1ZHNB 5GS2H 3MSPA 4M61B 2OSXA 1EGJL 4AZ6A 2IFFH 3RX5A 5LG1A 1FJ1A 3GMLB 3ZE0F 2VC2L 3QA3A 3NN8B 2ADJB 5D7SH 5DD6B 4C59B 5DJDA 2O61B 5KSUA 3QDME 3V5HB 2GQHA 3MUGB 3KLKA 1HKLH 4GAGL 4L5FH 4L8SA 4P2QD 1Y6MR 4X7CC 5M5DA 4GG8B 3GHEH 1S7TB 3OJ2C 1HJWA 3BSZH 4ZO8A 5IB3A 1NCTA 4WO4C 4Z77A 4KROD 3V0VB 4YDKL 4XX1G 4LVNB 4LLVB 3A23A 2N7BA 5GRUH 2G75B 5CJ5A 2ZUTA 3DJ9A 2J88H 3G5YB 4R96B 4RFEA 5JW5A 2VDNL 1VAHA 4W93A 1WDSA 1K9FA 1N82A 2IPKA 3QFDA 1LEKA 3QCUH 3UCRA 5INDB 4ENEC 3L5JA 2E7CA 3GZAA 4ZFZB 3KPPA 1NDMB 1TZHA 3MRRB 3AYRA 2GK0B 4S1QH 4MWFA 1FFNA 1BVKB 1IKFL 1EBPA 4JE4B 3HE6C 3CZ8A 3N1MC 3QSKB 4WFHD 3MSGA 1S9WB 3QJHB 1RUKL 2L7JA 2Z9TA 4P59H 2AAAA 4MJIA 4P2OC 2X4UB 4TX8A 3L1OL 3IT8D 2YPLB 4TULH 4XVUC 2ARJA 4C83B 2VSCA 3QHNA 1GGCL 4XH2B 3ZKND 1BD2B 4LSPL 1U0QA 3SE4A 2J8GA 1FV1B 5CXPA 4JPKH 4I18B 5I73C 1E27B 2OBGA 3O45B 1KWGA 4UDUB 1JFQH 4XX1E 3QXAA 3MBEC 35C8L 4WTWA 3L4UA 5D72L 3OKDB 1X1NA 2R2BB 1OGSA 4AWEA 3PP3K 3MQIA 3OZ9L 3MCG1 1L7IL 2AJVH 1UB6A 4WI6A 5IR1A 1ODUA 2VCBA 5JMRA 3C9NA 1FVCB 4P5TA 2Y06H 4XPGL 1LO5A 2GJ6B 2WUCH 4G5ZL 3VSTA 2WMFA 15C8L 4KRMB 4NXKA 2Y07L 4K71B 5SX5H 4H20L 2ADFH 3HNSH 2GK1A 2VKWA 5D1ZC 5J1SC 4EK7A 3INUL 4G9FA 3G9AB 1UYWL 3SGEH 3OB0K 4FQXB 3X17A 4EDXB 3MODH 4MAUH 4EN3C 5IFPA 1AXTH 2AVGA 4HTYA 4D9RD 1HKJA 1JDAA 2YJQA 3KLHC 3CXDL 3ZYOA 4E41A 5ESAB 2J7LA 1P1ZA 2IQ9L 2K3TA 4QYOB 3GNPA 4Q0XL 3RGVC 4XP5L 4X8JA 1KCKA 1AGDA 3BZEB 3ARBB 4PJEB 3VJ6B 1PYWB 3FTGB 4ZEPA 4MNQA 3O8XD 1HILB 5FXCH 4OLVL 2VDRH 4DN4H 3S4SG 4YX2H 2VLKB 2DYPB 2I5YH 2AJ3A 3EJPA 4RFOL 1SJHB 1MPAH 5DZOA 2QPUA 3U9UA 2IEPA 4XHJC 1SJVA 2ZX6A 4K7FB 1DWFM 4NQCE 5BW7A 3NH7H 5TFSL 3LRMA 1KENH 1DVFB 4RFNC 5E1HB 2XTKA 1GGIL 1KN4L 4ZPTB 5KW9L 3HRZB 3MRPA 2ZNXA 4I0PB 4G3YH 4G9DB 1RZ7L 4Y5YA 1IC5H 3TBVA 2PWGA 1DE4A 3CFJA 1RH9A 2DQFA 3A6CL 3AXLA 2V7HB 1U3HD 5IVXF 4YUEL 2HLAB 1DBAL 1KQZA 1NGXB 1RZ8B 5KSBB 3E1F1 4YC2C 1FBIH 5ETUB 5KJRH 3W5MA 3NIFE 4R90L 3WHXB 4ERSL 4JVWA 2AK4B 4M9OA 3WFEL 3NCJL 5A2AA 2C26A 4NRYA 1T04A 1YZZA 4HQQL 5DEGB 4E9LA 5C07B 1NBYA 4EI5B 2XKNA 1KG0A 2NR6C 3LPOA 4FQJH 4ZSOE 2EXYC 4P2CG 4PB9H 1JNDA 2M8XA 1M03A 5IW6A 3W0WA 3TN0D 2N4IA 3GH7A 1LWJA 1A7OH 2DLTA 2CKSA 3MFFA 1NMCC 3TT3H 1J1XL 3WCYA 4X7SL 1DQJB 5E08H 1QNZL 2E27H 2W65A 4N90D 2ZXAA 3X12B 1CZ8H 4NRRA 2J7EA 4PJXE 2E4TA 1I7UA 4KI5E 5HGHA 1TQSA 2HRPH 1W0VA 1ODAA 5JZ7D 1FZMA 2XXMB 3IAQA 5F6IB 5KN5A 2R8SH 4K3JL 4NQXB 1UYQA 2VZOA 1UG9A 1I7ZB 4YR6A 1G7LB 4OD2A 5I8EA 5FK9A 3NZHH 3TLRA 4HXAH 3DV4A 4A4AA 2GKIA 3BQUD 1ZMYA 4EOWH 5I30L 3MJ9L 4DQOH 4XGZA 4APQC 4KVCH 3F7VA 4LYPA 3SCWA 3UR7A 4DGVH 1PG7H 2NY3C 4H26B 5AD0B 2J62A 2NY2C 1U8QB 1UXSB 2D23A 3MV01 1C16B 4DKDC 4L4VD 1BQHA 5SX4H 5T3ZD 3RIKA 3PWPE 3I6LE 4QY8A 4RMTA 4TPRL 1JGUL 3MLXL 2VUOA 1U6AL 2H2SD 1OQOA 2EDDA 5BJTA 4IIQA 5IP4A 2PYFA 4G43A 3W2DH 3W37A 4Y19E 3OPZH 3IFLL 4NKDB 3O4LD 3UCQA 1KPUA 2VAAA 5I1HL 4XXDA 2ZCKH 4JM2F 4WLCA 3Q48A 3S6TA 4PJBB 5F93C 4IRZL 1HJVA 1KB5A 1OBAA 4YBQC 1LL7A 3TIEA 2IF7A 3DDFA 1YMHA 3HG1D 1Y6KR 3WFDL 1ACZA 1QSFA 3NZ8A 4NP4H 3SBWC 5I76B 3WNMA 1QG3A 2HFFB 4JKPL 2PXYC 3HE7A 5HHVH 4LBEA 1KJ3H 3IJHA 5ERWB 2C7UA 3OAZK 1LP9A 5C3TA 1PX8A 5EU4B 3PP4L 5HTSA 5I75C 5EWIL 2YBRA 5DEFA 4JFQA 4XP4L 2WAHA 3QEHB 3WFHA 1JK8A 4H04A 4Y4KA 3V6FB 3BEVA 1P7KA 1S8DA 5EU6E 3VXUB 5I1LB 1NBZB 5FA3B 1C90A 4ODUB 1E6NA 3ZSTA 5K59E 5FYKD 1HI6B 2DJ4A 5DI8A 5IFHH 3AB0B 4WI8A 1FNGA 1OF2A 2J6EL 2BVPA 4ODSH 4P3WA 4NQDA 4H8WH 3ZTNH 3FZUD 1D5XA 1G7QB 3ES6B 3OXSA 3UTSA 4DVBA 1YNKH 1B0RB 1CGWA 4FMKA 4RZCB 3AIEA 3TA3D 5I1DA 4IRJC 1J01A 3TOPA 5CUSH 4K3EH 1HXYA 2L4OA 4F58H 1NFDB 1KJVA 3H6JA 1CWVA 2BHYA 4LSSH 4X6CE 2EEDA 4E4PA 1EHLH 4TRPH 5I6SA 1B9ZA 4E8DA 3D25A 1FZKB 3Q3GB 1G9NH 2FYYB 3KYAA 1FFOB 4YK4B 4MAYA 4PV9B 3JWDH 4QRUB 3GNOA 4HUVB 4NM4L 5EZJB 3GRWA 3RVVC 1AQMA 1A7PH 1RZFH 2YHGA 1UWEH 1KCVH 1CGXA 1BF8A 1BVZA 4XMKL 5KVGH 5IBUG 1UKPA 5ADPL 1SBSL 3T1FA 2CDFB 2XG5A 2LAAA 4PJIA 4XPFL 4OI7A 5C6TL 2BP3A 2R56L 2X9YA 3HAEH 4K7PY 3NIDE 1MVUB 4KJYA 1N64L 4Z78B 3P9MB 3L6FA 4ODHH 3AOFA 3U4BH 1IZJA 2IAND 4JR9L 2BC4B 2FH6A 1S7VA 4QLRA 5CJXA 3KHOA 2OR9L 3QEQE 3ARDA 3S37L 4KKAD 3DI3B 4PJFF 2EDEA 5JOFB 1E15A 1LMKA 1N8ZA 5GGTA 5SX5K 4D72A 3MJGX 1JGIA 3GUTB 5FECB 4Y89A 3MRNB 4AXNA 2CUMA 4I2XB 5T1LB 5L9DL 2LAGB 3DECA 2WSPA 1RU9H 4F57L 4P7QA 2Z8RA 4NHUB 3GKWH 3CAFA 2ZOLA 3ARYA 4NCC2 1JGDB 4UBDD 4XNUH 4CVZA 1DN0B 1HWGB 4OCWH 4TUKH 2O9OA 3IDXH 2HVJA 2OL3H 4HWBA 4OCXL 1S78C 3TEUA 4XPAL 4GQQA 3OZPA 1Z6JT 1X5XA 2PW1A 1J1OH 1JUFB 3BAEH 2R4SH 3R1GL 1QNPA 2YL8A 4LRIC 3HMXH 3ARGC 2YL5A 1NANH 5E8NA 4WF7A 1AFVL 2DM2A 1A6TA 2P4AB 4XP6H 3V0WH 3O6FC 5IVXE 3A22A 4GZEA 1QHOA 4X4XB 3T4AA 3CDGA 1OAYH 4TNWK 2BDNH 5CKAA 3F5LA 5D2NA 1MRFH 3WMSA 5GS3A 1KTDB 2CHNA 4TVPD 1EEZB 5I77A 2GVYA 2FD6L 4TUJA 4YO0A 5BS0D 1WDQA 3KYOA 1S7XA 1FNSL 4G7VH 4UIMA 1CGVA 4OTXH 5IW1B 5FO8B 1T22A 3L5HA 1KTKE 4YEEA 5K93A 3BFOA 4Z95H 4X4YA 3AREA 1RUMH 2P24A 3VFGL 2QSVA 4S1SH 1AQHA 1TETL 4B50A 1NCUA 3UESA 1FNFA 3O3BA 1BG4A 2I9LA 3QPQD 3V4UH 5EUKB 4Y4FD 3SGJC 1J8HD 1G7JA 2F74B 3GGWA 2YPVH 5HYQB 5CGMA 1FG2B 1VESA 4KHTL 3KE0A 1O7SA 4N8CH 3C6LB 5DJ8A 1ITXA 3RIFF 1XSKA 5J1TC 4LAQH 4XNZC 2LTQC 1CF8H 1JZ8A 4HXBH 4HC1A 3CH1B 1OGTA 1EOMA 4I4WA 4X9FA 5JPMA 2VDMH 3PXHA 1MCOH 2YC1A 3GSQA 1BOGB 3O2VL 4PJHF 1M4KA 4ISVA 3CHDA 4PMVA 3SJVE 1NMBH 5IGXL 1AXIB 5M7QA 3D5HA 2BNUB 4JPVH 1EO8L 1ZK9A 5GGQH 3DRQA 5I71C 2B5IB 3FFCE 5GS1A 1B4JH 4Y1AB 4NT6A 3GSOB 4Q2ZB 3EFFA 1A5FL 3CUPA 1YMME 3G04B 1NLBL 2J25A 2DBLH 1S5IL 3BUYB 1MFCL 5HHME 1NUDA 4RQQB 3SCQA 3K1KC 2VDPH 3AMLA 1I9JL 1UM4L 5AG9A 1AJ7L 5F70A 4QWWD 3SPVB 2X1IA 1XCWA 1D5BA 3PHOB 4O2CB 5H35A 1JZ2A 4KJWD 5A2BA 3MXWH 4KQ3L 4JREB 1MFAL 1CYGA 3W6LA 3D48R 5SV3A 4XAWL 3WHE1 3M45A 3X11A 4F15B 4QOKA 5DJ2B 2QEJA 2Y5TA 3P9LA 3UYRL 4YHOL 5D7JD 4KKNA 4LIQL 5C0CA 1X9QA 3C87A 3WN5A 4K94C 1Z9MA 4JZOA 2OQJB 2B0SH 2F58H 5JXEC 3V4VL 5EBWB 5BQ7A 4D6CA 2VL5B 2VO5A 4FXKB 3LIZL 1DWHM 4HCRL 4GMSL 2YL6A 2A74B 4C57C 3LKSB 4L4TA 3BYTA 3D5OF 1EQPA 5GZNC 1NGWB 3VXSE 4E0RB 2ZUSA 1M7DA 2H32A 2NXYC 5DJAB 3TO2B 4G8GE 4QCIB 1CS6A 1CK0L 2DQJH 3CU7A 5L0QC 4W89A 4Q58C 1F02I 5CPQA 5DRZA 3S3JA 1IKNA 5IKCA 4OLEA 1TG7A 4AMKL 5C8BB 2YKLH 3SIMA 4XVJL 1YEIL 4TSCL 5SWZD 4LPVA 2FL5B 1JPFA 5M95B 5JO5A 2V3GA 1EXUB 3QJFB 3NOIA 4P2RB 3U7WL 4EDWH 3Q1SL 4LL9A 2W60A 4FQQB 3KL0A 5DJ0A 2YFOA 3IKKA 2NX5E 2XN9E 4HAGA 3QWRA 4JFFB 1GOGA 2AABH 4MTVA 3HRPA 1PVHA 1DLFL 1X4ZA 1ZWIA 4JFDE 5FYLD 2Z4QB 5HPOA 4QO1A 4ZXBA 4NUGL 3IS1X 4HIHB 3QIWC 4HWZA 5ABFB 1U8HB 1UZ8B 4O02L 3N11A 1VEPA 2EKSA 4PREB 3WQ8A 1N4XH 1VADB 1MCQA 4KTEH 3S4SB 1HXMA 4HT1H 4C56A 2Q8BL 1G7IA 1S7SB 3DSNA 4J3OC 3BVNB 3RL2A 3P30L 1NCCL 3QUYA 1QVOB 1QFHA 5DK2A 4XZWA 2DS4A 3PWJB 4M7JL 4PJ8B 2XZQL 4KWUA 1V3JA 1CXHA 4C55A 2ZCHL 3O0RH 2VLJE 2ICCA 3MLYL 5GGUA 1JYWA 5C2UB 4CCDA 5KANI 2Q20A 5F71A 1DR9A 3CDCA 3O4OB 4HMEA 3B3IA 4ZQKA 5HYJB 4M48H 1MJ7H 3DMMB 2QR0B 3U0PA 4X0NA 3WKNA 3D0LB 4H25A 4OZGA 5I6XB 4FXGB 5JIHA 4KZEL 3H9SB 5CP7A 1IGIH 3ARFB 5LYRA 4G8FB 2ZUQC 5EC2B 3T09A 2JTDA 1OD0A 3BN9D 3L2MA 2VTFA 2ZKHH 3BVWA 4B0MM 1W0WA 5ABDE 2VRQA 3UC0H 3TYFB 2F9BT 3BSGA 3FRPG 3S35X 3PGFL 4IM8A 3L3OA 2QQLH 3FOMA 3STLB 3FO1B 2NYYD 3ZYIA 1YNLL 3OQ3B 3BPOC 1BJ1H 3CFEA 3WO4B 4OZHE 4JM4H 3HC4L 1Q0XH 1AQDA 1MHPH 3BPNC 3O41A 5HGAB 2ZSWB 1IARB 2FCBA 4OZ4B 1I1AC 2V5RA 4GAYA 3WLWC 1MXGA 3W39B 5ISZD 3QOMA 1UADC 3BGMB 1B6DA 1CXFA 4AJ0A 3FJTA 4XZUB 1RUPH 3H3PH 5J6HA 2I24N 3TH4T 3C60B 3ET9F 3S3PA 4WNQA 2Y6SC 2XWTB 3SCMC 1GSMA 4LCWE 2D7TH 4N8VA 5D9PA 4N0CD 3C5ZD 1FYTA 3QIBB 2FDMA 1ZHNA 3CLWA 3BP7B 2HVMA 5H8DA 4HIXL 4M61A 4P46B 2B2XH 4Q22A 5F9JB 3GMLA 3NBNA 1PKQB 5DD6A 3NN8A 2ADJA 5GRJL 3O2WL 5HPCA 3MUZ1 2Z31D 2O61A 3V5HA 3MUGA 1BREA 4M7ZB 2ADIB 4GG8A 4ODVL 1S7TA 2YFNA 3KYKL 1SBBA 3JWOL 1V3LA 3V0VA 2G75A 3VXRD 2NT1A 3MU7A 4P8UA 4PJGF 3BZFB 5GGSY 1DQMH 1CGSL 3G5YA 4R96A 5HHOD 4W70A 5EO9B 2XZAH 1WAAA 3D18B 3TZVB 3UROR 1KOAA 3HKFA 5INDA 1YA5A 5C09D 1W3JA 1JWMB 5J89A 1CE1H 2ZX7A 4ZFZA 1NDMA 1F4YH 3R06B 3MRRA 3ZT5A 3NIYA 4JQIL 2GK0A 3CVHB 3DGGB 2CESA 3MV8B 1BVKA 5EUOE 3T0AA 2QHRL 2X4OB 3PWVA 5IOPB 2DN7A 1S9WA 3QJHA 1UCBL 1IRAY 1QRNE 1M6OB 2DQTH 1ISVA 2YPLA 4OLWH 3TVMC 1F58L 4P9HL 4C83A 1HNYA 1I8IB 4XH2A 1BD2A 3QHFH 3EJRA 1X5KA 4UINH 4WO4D 1FV1A 4LEXH 2XYCA 4I18A 4JANB 1E27A 3O45A 3QPXL 1R24B 4UDUA 2DM7A 4D1JA 4W85A 3QNYB 4OCRL 1L7TH 3OKDA 4I3RL 2DQEL 2R2BA 4DKEH 1BX2B 3KYMA 1B3XA 5CZKA 4ODTL 4H8VA 2Y07H 4ENED 2HT3C 2EDYA 1FVCA 5CILL 2QQKL 2O9PA 4G6FD 4JRWA 1NUNB 1C5BL 2PN5A 2GJ6A 5C0RL 4WWID 1MVYA 4OF5A 4Y5VB 1KEML 4HUUB 3MNVB 3BCDA 5FYJD 2J7FA 3PTMA 3T3MF 2EH8H 3HE6D 5JXAH 2FIRT 2MKLC 3SO3C 3MXVL 1FH8A 4EDXA 4FQXA 3IXAB 4I5BB 3LAFA 4P2OD 1XF5B 3ME0A 1Q6DA 3TT1L 3RRQA 1JPSL 3EBVA 4ZUWB 4XWOC 4XVUD 1PEWA 5ESAA 4NKMB 2WK2A 3MYZA 2AV1B 3VMNA 4I13B 2AW2A 4G6JH 1LILA 4D9LL 1QI5A 3RUGB 2NY7L 3BZEA 3ARBA 4PJEA 3K74B 3RAJH 2F7PA 3VJ6A 1PYWA 3FTGA 1JHKH 3MBED 1KN2H 1NC2B 1HILA 4GSDL 4M62L 3RCNA 2YDSA 2VLKA 2DYPA 5ITFB 1X5IA 4UDTB 2WWKO 5JORB 4CL7A 5E2WH 5AYBA 2J2ZA 1SJHA 2BXYA 2F8XC 3VRJB 1KN4H 1N2RB 4WWKC 3SOBL 1ONQB 4K7FA 1RZ7H 3WQWA 5D1ZD 2FBJH 3LDBC 2QQNL 3VIKA 1DVFA 1BF2A 4EN3D 1E6XM 2PF0A 4ZPTA 5AZEL 2RGLA 3HRZA 5CSZB 4I0PA 3FMGH 4G9DA 1XGQB 2VERN 2R39A 3KLHD 1C92A 2CXKA 3TV8A 3SDDB 1F97A 2V7HA 3SQOH 1T83C 2FYVA 3WEOA 2DSKA 3WFEH 2HLAA 1NGXA 1RZ8A 5KSBA 3BAKA 5ETUA 1FFPB 4RAHA 3RGVD 1EQCA 1Q9KB 2EYRB 3WHXA 3SCVA 1T2QL 4NUJB 3U57A 3BMWA 3CUJA 4WFGE 2AK4A 5JR1H 5DLML 3T8XB 1Q1JL 4JFHD 5DEGA 2VT0A 1FFRA 2QL1A 1CDJA 5C07A 4OFVA 2Z35B 5ABEA 3OF6A 4RIRB 4X7DC 4EI5A 3RPMA 1NL0H 1KLGB 1YEKL 3DX9B 3PV7A 5CS7A 5A3IC 1E6QM 4KHXL 1UB5B 4XHJD 2ILLA 3SUSA 4HLJA 1T0NB 4JL2A 2X7LB 4M3JA 1MVFA 3OZOA 1JXJA 4CADB 1DQJA 3SKUD 1NCAH 3BO8B 1OAKH 4NC1C 2X89A 1E1FA 3X12A 1BIHA 4YPGB 4LGXA 4AD5A 3ULVL 5KS9F 5K9KB 2HRLA 3EYUL 3AVEA 3EJZC 3VX1A 4NQXA 4WFEE 1SR0A 2DLHA 1I7ZA 1G7LA 3GKZA 2NY6B 1MCNA 5BV7B 2APVA 4LP5A 1NGZB 1QUNA 4TXEA 1NAML 4O58H 1OAZL 3FN0L 2HFEB 1HHJB 2NR6D 4X6BB 2EXYD 4QFUA 3VI4E 4H26A 5AD0A 1U6AH 5F97E 1U8QA 1IGML 1UXSA 4CMHC 1JGEB 3WEMA 4KRUA 1QYGL 4JM2B 1C16A 5EPMB 5I1HH 5ITBL 5FKAB 3FQWB 1VENA 4Z18A 4DZBB 1FVDB 5IB4B 5IWLC 4P5MB 1WP6A 2DDXA 1MJ8L 1CDUA 3WDHA 5EBLB 4U1HB 4NKDA 1FSKC 2Y1VA 1HJQA 1RZKC 1NEZB 5JBDA 1E28B 1FCGA 2WUBL 4PJBA 2HT4C 1FC1A 3IYLW 5F7KC 2V7NB 5TPWH 3VILA 5DS8B 2DF3A 3VPLA 5I19H 1MI5B 1W0YT 3LB6C 3V6OE 5I76A 2HFFA 3UTTD 1H3UA 2J12B 1AGFB 2XTJE 4LYRA 5F3HB 2GSIB 3PQYB 2RB8A 5ERWA 4RMWA 4HF5H 1ETZA 3ZKXC 5EU4A 3MJ6A 5K9JH 1T0MB 4APQD 4BZ2L 4PRNB 4CJ1A 1X6NA 3QEHA 5LCVL 2NY3D 1CDGA 1EDTA 2NY2D 3V6FA 1LJYA 3GM0A 2A3EA 3VXUA 2Q86B 3IJ7A 3SURA 5I1LA 5ACZB 4NO3B 1NBZA 5FA3A 4ODUA 4M24A 1LDPH 2BCKB 4ZOBA 5E8DL 3JZ7A 5T5FH 3LMJL 1HI6A 4H1LG 2AOSA 2YWZA 1HIZA 3WUZA 3CMOH 5BRQA 2VMFA 4P2QE 3ZKMC 4FTVB 3ES6A 4YBQD 4JPWH 3H9YA 4LF3B 1B0RA 4RZCA 2NY4C 3VRIB 1GCYA 4JG0L 2PXYD 5C08B 4PBVC 1NFDA 3B2VL 2Z1SA 1H3PH 4F7TB 5IK3B 4XBPB 2AMGA 1C5DB 5A6KA 3FRUB 3VIHA 3TM6A 1CG9B 1XF1A 5FF6B 1RMFH 2EDLA 4OBSA 1FZKA 4RMUA 3Q3GA 2FYYA 3PGDB 1FFOA 1EX0A 5D6CB 2DTMH 4PV9A 5FYKU 4QRUA 4HUVA 4ZENA 2D20A 5EZJA 4HUMB 2EACA 1UWTA 1QA9B 4MA8L 1SBSH 5KANG 3MLRL 1PZ5B 2E6PA 2ATPB 4WFHE 1SY6A 3QG7L 4PG9B 2FO1A 4NJ9H 3RI5F 1Z5LB 1VBRA 4Y4HC 4U5IA 4ZOEA 1US2A 2CDFA 4DO4A 2ZUUA 2ENSA 3BT2L 3A5VA 4JR9H 2P45B 1MVUA 4KDTA 4Z78A 3P9MA 5DA0B 2CRIA 4IRJD 2Q87A 2UY6A 2OR9H 1CLYH 4MNLA 2AGJL 2DKMA 4IRSB 4WI3A 4UILH 4ZS6C 3UJIH 2CKNA 2BC4A 4TOYL 5B39G 4PJFB 5DUPH 2VXSH 3EYQC 4DW2L 3NSNA 1H3XA 3KEHA 2V3FA 3EYVB 4X8XA 3R0MA 3W25A 4P3CL 3QXUA 5JOFA 5L9DH 2HVKB 3L3JB 3RVVD 3GUTA 5FECA 3EMZA 3PABB 4UT7L 3MRNA 4I2XA 5T1LA 4D9RE 4M6OH 4M43L 1QNSA 1EGJA 3GSUB 4PJAE 5C0AB 4UOZA 2HA1A 4TUOB 4X6FB 1MQRA 4NHUA 1ZLWH 3G9VA 3NACL 3EMQA 4L8SC 3LKPB 1EHAA 1JGDA 1DN0A 5I8KH 4AEEA 3NFSL 1A6VH 4K8RL 5DVMA 1JUFA 4NGHH 5A6BD 1GQJA 5F9WB 1QQDB 1NGPL 3W5NA 2KDGA 4JZJB 4D0BB 1ADQL 2EO1A 1OARH 4ONOA 1I8KB 1V7MH 1A6AB 4X4XA 5A8OA 3P11L 2R4RL 3THML 2B4CL 4GI9A 1KTDA 4YXKL 1EEZA 3VFGH 5AYIA 3MV11 1IAIH 1VGEL 1TVPA 5J56B 1YQVL 4PTTB 5DO8A 4TSAL 5IW1A 5FO8A 4HBQA 1RY7B 5ESQB 2CQVA 1MHHB 3HB3D 3V6BR 3VG9C 3Q5YA 2GDVA 5IMLB 1GQLA 5JHDD 3MZTA 5EUKA 5DZNA 3RX7A 2BVUA 1WTGT 4RMVA 2WKGA 2F74A 5HYQA 5ESVB 4OSUL 1LQ0A 1I4FB 1S78D 4R9HA 1I9IH 1FG2A 3SE4C 4W4OC 5JIPA 3MMEB 4PJHB 3C6LA 3A21A 5T1DH 3ARGD 1TQBB 4PRHD 3EJSA 4YDVB 3CH1A 5IGXH 1DN2A 3O6FD 4KQ4H 4GI8A 2IG2H 3QEUB 1UA7A 5CIPB 1BOGA 3LHPL 4XP1H 3ZQ9A 2PTUA 1W72H 5LBSL 2BNUA 3S36H 5J1AB 4P5TC 4LKCA 2F7RA 3HNTH 2BVOB 3WF0A 2MQ3A 4UTAH 4LSRH 4PRAB 3ZDYE 3U30B 3V7MA 5J13B 4Y1AA 4N90E 3GSOA 4Q2ZA 3RWJB 1D6VH 1MCDA 2W9LA 2F8QA 3KL5A 4OZFG 3G04A 4P7RA 5DC0A 2QV2A 3LCYA 3VFVB 1EO5A 2HTLC 5I1IL 3NYDA 3BUYA 4MZ3A 5DQDL 4C7GA 4RQQA 2UWEB 4KPHH 3TNMB 4W6YB 1UWGH 3S34L 5CSYA 3OAUL 3ZSSA 3BISA 3CX5J 4ETYA 5AG8A 3BCFA 3PHOA 3NDZA 4HSQA 4O2CA 2BOBB 4PJCF 3EJYC 1C3FA 5GRWA 1SJXA 4DOHB 2IALB 4LX4A 4JHBA 5I9QC 4BH7B 3D4YA 5DJ2A 5HYSG 5T3ZE 2ICWI 4L4VE 4AT6B 3C8DA 4CRPA 1TZ7A 3EFDL 4U0QB 3L3IB 4PGDB 5IJVB 5DD0L 5CCKL 1JNHB 4KMQA 3AJ7A 4NHCL 1VSCA 3HG3A 1SYTA 2OQJA 4WI2A 5EBWA 3O4LE 2EO9A 5BW7C 2QLYA 3UTPD 1QLFB 1LO3H 2VL5A 4FXKA 2OM5A 5T3ZL 4J3XA 3CIQA 1E3XA 2A74A 2FGWL 3LKSA 4Y5YC 3D85B 2NTSP 3HG1E 3BRGC 1NGWA 4E0RA 1IAMA 2ZSVB 5DJAA 3TO2A 4RX4D 3K4AA 4UZSA 4QCIA 1OM3H 1RJCA 3WJLA 3U0WH 3GM8A 1QSEB 5F9OL 1E4WL 1LO2L 3BKYH 3ZJKA 4ZXLA 5DVOA 2JK5B 5D5MB 2FL5A 1RP9A 5L2KD 4S3JA 1X4XA 5LA0A 1LE9B 1KYOJ 1EXUA 3QJFA 4P2RA 3MV9D 3AHXA 1J8KA 4FQQA 2A9NL 1J0KA 4O5LH 4JEGB 4JFFA 3NGBC 3QOKA 4QHUB 3BXWA 4CW1B 4KKLC 1PLGL 4BQ5A 4AD4A 2UZIH 3B6SB 4HS3B 1K8IB 2NPLX 2Z4QA 3KXFD 2RAMA 1GC1L 1VFOA 1MCIA 1RVFL 3QXWA 1DL7H 1H3GA 2XRAH 5JXED 3GH4A 3EZ8A 4HIHA 3KJ4C 2MANA 5ABFA 4HFUH 4YZFE 4PY8I 3QH3B 4H8UA 5I1JH 1KIQB 5F7FA 1JHTB 1U8HA 1UZ8A 1ZKAA 1MHCB 1W32A 4PB0L 5KVDL 4F8QA 4PREA 2VI0A 3OKKB 1VADA 5INCA 5FYKL 3S4SA 4Q9QH 2XN0A 2JIEA 1S7SA 5GZND 3N1PC 1VPOL 2D0GA 5HSFA 3BVNA 2NXYD 2FX9L 5E4EC 1QVOA 4Z7WE 4KI1A 3B9VA 3PWJA 3T08A 4UCFA 2D4DA 4PJ8A 1M71B 4EEEA 4HU0A 4LCIL 1A9EB 5TJWK 5JDJA 5DT5A 3VG0L 3LS4L 1A14H 1NP0A 2QSTA 4UFIA 5E7BA 4PJ7F 1NAMB 4HOWA 5DMKB 2ZP0T 2JF6A 3MJ9A 3I50L 5HYJA 3PXJA 3DMMA 2QR0A 1NWSA 4PLOB 5IHUH 3D0LA 3UJJL 4ZG1A 1ZSDB 1JBJA 4FXGA 2VCCA 3H9SA 2J1KA 3ARFA 1FP8A 2EJ1A 2EC8A 4G8FA 4IIQC 3QIWD 5EC2A 1RD6A 2P5EB 3QBTB 4BH8B 3EMCA 5J7CC 4KZDL 1QBML 4IJ3C 2O5YL 3TYFA 2RCSL 4X4MA 1PW3A 4P23B 3WIHL 3STLA 1KCRH 3FO1A 3PWPA 4XCCL 1QBAA 2KUTA 2P44B 2MTPA 3P0VL 5F89B 2IANE 5FA4B 1R33A 3BKML 4LSUL 4N9GB 2OI9B 2I60L 3HE7C 3IETB 5HGAA 4NBYB 4UQ2B 2ZSWA 3BUTA 4HV8B 4OZ4A 2EPNA 1QR1B 4PGJA 3IGAB 3W39A 4XVSH 3BGMA 3FT2B 4ACYA 4TTUA 2GI7A 4KK5C 1HK6A 1UEYA 2VWEE 4BFIB 4XZUA 1PFCA 4Y4KC 1R85A 3SE9L 1MLBB 2A1WL 3C60A 1FAKT 1BEYL 5HDLA 2XWTA 2BV9A 1RHFA 3SDXE 2ZPKH 2F5AL 3O2WH 3QIBA 1KWKA 1Z2KA 3BP7A 5DHVB 1JNLH 3HNVH 1C5CL 4AD1A 1XGUB 2NY1B 4P46A 5F9JA 5KAQF 1PKQA 1A7QH 1CDHA 1MEXL 1ZLWK 2QSCL 1KCUL 3QR2A 4OF3A 5SWSD 1HWHB 4PJGB 2B1HH 2J6EA 5C0GA 1W9XA 2ADIA 1BPVA 2GUYA 1IC7L 1NAKH 3FFDB 2WVSA 3HC3H 1WDPA 4JFED 4X5LA 4DAGH 5FKYA 1OGAB 4JRXB 1BECA 2B1AL 3C08L 4U1GB 3O2DL 3RVTC 1I1AD 1V5JA 2AJXH 3BZFA 4XXCA 3WLWD 1GZJA 1Q6GA 5A2JH 2CRYA 3I6KB 1REIA 5EO9A 4GKZB 3N9GH 4TVPE 3D18A 3TZVA 3VRLF 3LQAL 5BS0E 4B53A 3GJFB 5FCUL 5E5MB 4ZODA 5GNYA