1GVIA

Thermus maltogenic amylase in complex with beta-cd
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
588
structure length
588
Chain Sequence
b'MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPAISPKGARPWGSEDPTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGAASRYKDWFHIREFPLQTEPRPNYDTFAFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGLIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRALRRGDVAFLTADDEVNHLVYAKTDGNETVMIIINRSNEAAEIPMPIDARGKWLVNLLTGERFAAEAETLCVSLPPYGFVLYAVESW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALTOGENIC AMYLASE
molecule tags Hydrolase
source organism Thermus sp.
publication title Cyclomaltodextrinase, Neopullulanase, and Maltogenic Amylase are Nearly Indistinguishable from Each Other
pubmed doi rcsb
total genus 165
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gviA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gviA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gviA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1gviA03
3FO0L 4AENA 5BOZG 3H9SB 3RHWK 5C0DA 3W37A 2WUCL 3FO2B 4RL3A 3PL6A 1R3HA 5D2LF 4PJ9C 4P59L 3CFEB 1AXIB 5HGHA 1D9KA 2IAMB 2VC2H 1WIOA 1X4YA 3QCVL 2CDFB 4P5KB 3RVXC 3LRLA 2XWTA 1M7IB 3MV11 3MREB 3GIVB 3GSQA 3MV9E 1QFWL 4XMLH 4B0MM 5BS0E 1MQPA 2CKBL 1W3JA 3HPLB 3WFBL 2AI0H 1RVFL 5D5MB 3TBTA 3TJHC 2GJZA 5HNNA 2JB6A 4BUGA 2YPLB 4O2FB 1C93A 3I6KB 4BYHA 4XVTL 3WUZA 3JWOL 1KIQA 3DDGA 4XNYH 5EU6E 2AABH 3ARVA 4JZOB 2WBGA 2EACA 2PYEE 4NZRH 5F7YC 1A6PA 3I02A 2Q8BH 5C0AE 1M01A 5GGVL 4GBXC 4KDVA 4CCCA 1IQDA 4LARH 4ZXBB 4FABH 4M1RA 1AKJA 2P1YA 2HVKA 5J9PB 1JWUB 3ZOAA 3KPSD 2R56H 2WMIB 2EQDA 4PJXB 3RIAK 4LRNH 5M7QA 2X09A 3GI8L 2NY7H 5ILTH 5KJRL 4PMVA 3D85D 4BZYA 4PJFA 3T65A 3DMMD 2R29L 1UA7A 1EIBA 4JPKL 1WAAF 2XI9A 1OGAB 1NUGA 2A6IB 3N12A 5HHNA 4XXCC 3LN4B 4I77H 5D71L 2VE6B 1A3RH 4AIZA 3FRUB 3QG6B 3STLA 2AK4E 4JFDA 4AZHA 2FHBA 4AD1A 3TBVB 3LRSB 4UV4L 3IJSB 4KUZH 5HJ3B 1OP3H 3ZTJH 4WTZA 2WC3A 4L8SC 4M56A 5I1KL 3KEHA 1PKQE 3G5YB 2AJYL 4V1DE 1F58H 2JB5L 2ADFL 3G5VA 3IU3B 4HKJB 4JFDE 3MZTA 1GONA 4PLKD 3G6JA 4M93C 3QO0A 4HC1A 1PKQA 4W5UA 6TAAA 3FZUD 5HGBA 1BM3L 3BH9A 4P3CL 3JV6B 2B31A 1BFOB 1RZFL 5C07A 4XVJH 4P8UA 2PKDA 1ZLUK 1WCQA 3HAEA 3LEVL 5L0QC 1UWEL 4I1NB 3GGWB 5HBBA 2HT4C 1ZGLP 1KJ2H 5A3HA 4FFVD 3MUGA 3VTRA 3FCTA 4HDIB 4JAMA 3QIWD 4ZQKB 1RUKH 1E4NA 2ARJB 1UD3A 1JK8A 2H2PD 3BQUA 1CGYA 5C07E 1YEDA 5D6CB 5JHDB 4HX1A 1EOKA 5LGHH 3V7AG 2DLFH 1J0JA 1I1CA 4DN3H 3KPPA 2HRPL 1L0XA 4I48A 2XA8L 3W29A 4GS7B 1AO7D 4R5EA 5T3XL 1DWHM 3GGWA 4ZFGL 2R8SL 4Z78B 3CV5A 4PRPB 1BQHB 3RIKA 4KI5C 3ZL4H 5DSCA 4D6FA 5BXTA 2XZCL 2HLFC 4W70A 3KPRE 4K3DL 4D9RD 2N56A 4UDTA 4AC1X 1FDLH 2EIZA 1LEKA 3S6CA 4ZUUB 5FM8A 3VWKC 1JXKA 2EXWD 3PZTA 4N90D 1UKTA 3QO1A 1FHGA 1T1WA 4Y4HB 4I77L 5TF1H 2R1WA 4N9OB 3OR7B 1QSFA 4QY8A 5DK2B 3K7UA 4H25B 2J3SA 4JRWA 3P30H 3KG5A 4MD0A 3G5XA 1XF2B 1T80A 2JE8A 3G6DH 5DMGD 1XF1A 2H8PB 1E28A 3FTGA 3ZJ8A 1XH1A 3SGJA 1U8IA 3TT3L 4S10A 1LK2A 4UT9L 5HI5C 4FF5A 3CDYA 2B2XH 3AXLB 2ZXDA 1IZJA 3VFWB 3JVGA 4Y5XB 4LP4A 5EB9A 2ADFH 1UHVA 5DFVC 3MLVL 1LJYA 4OF8A 3QQ9C 1F6LL 3RVTC 3AIRA 5DJXB 4IDJH 2CIIA 2Y5EA 4ODBD 1LG2A 2NR6D 3K2UH 3RKPA 1QNPA 4CRPA 1RU9L 2XQYG 4ZO8A 4PMZA 2P5ED 4HG4J 3FFCB 1MSPA 4CDGC 5ERWA 3SO5A 4ZFOB 1NDMB 2EZ0D 1MI5E 2YPKA 1JJUA 3D51A 5DC9B 1NEZB 1A7QL 1RZFH 4RRPA 3PP3K 1VB9A 5FGCB 4WSJA 2JLLA 1J0YA 1U8LB 3VWJA 2AEQH 4P57A 1CE6A 1HF6A 3IGAB 5EFIB 1MHPH 2OR9H 2WWDA 1A7NL 4P9ML 4ELMA 5DRNB 1JWUA 5BXFB 1MI5A 4A3HA 4W6YB 4JGJA 4PTMA 4WI2A 1IE5A 5JBDA 3RJYA 4P23C 3M7SA 4OOZA 2EEBA 4Y4FD 1HSAA 3TLRA 3CTTA 4OLXL 1HKMA 1KENH 4EOWH 1I9IL 3SDDC 3WDRA 2JJSA 3MMWA 5DO2D 3VXOA 5BO1H 3CFJB 1QO3A 4F7CB 1NMAL 3RZCC 4GI9A 2AOSA 2A38A 4MJ2A 4YQXH 5BXSA 4AK1A 4HS3B 2DQDL 1J18A 3IAQA 4G42A 5IHBA 3NSXA 5FV1L 2Z1SA 1SYVA 1SHMA 2H26B 3U7YL 1K9EA 2QBWA 3N04A 3O3BA 4AL8H 1FH7A 1JYWA 1C90A 3BAEL 4KUCD 5DYOA 3IXTB 4R2GB 3W9DA 4FFYL 1NFIB 1FNAA 1KG0A 1S9WA 4RDQF 1VDGA 2XYCA 1P6FA 2VWEC 1XGYL 3B5HA 4NQXB 5DVMA 4NP4H 3WNOA 3VXMD 1QWNA 4F37K 4ATLA 5I8CA 3L7FB 1GAFH 3TO4C 2XPKA 4K23H 5I76A 4OCLC 4QRRB 3WFZA 4L29A 2J7HA 5HXMA 3S37X 5GRJL 4U6HB 3VCLB 3V5KA 4OI8A 5KSBB 4PSRA 1ITCA 1GC1C 3DROA 1I75A 1FGVL 1NQBA 2VZOA 3ARDB 4Y19A 4FG6D 4M4RA 2YBRB 2IBZY 5DTFB 2GY7B 2VX4A 4R8WH 3QCTL 2NY2B 4XRCA 1ZBWA 1GH7A 3H0TB 2EICA 4XMKH 4JPWH 5TJWK 5FDWB 4AYSA 2V7HA 4X7SL 3Q0HA 1RZ7L 5D5ME 5CG0A 3WNNA 4UZUA 2C4FU 2WSKA 2YMXL 1KBGL 1W1PA 4LPUA 1LEIB 5FCUL 3M17B 4IIQC 3WUFA 3DXAA 4PRHE 4ODWA 4PD4J 3BYYA 2V2WB 5D9PA 3VGDA 4ACYA 4M62L 3WEXB 3LKPB 3BD3A 3RDKA 5EU3A 3BEVA 1JTOA 3HNTH 5EO1A 2HKHL 4S1SH 3QI9D 2YD3A 3OSKA 1UH3A 3SUWA 4HIEA 3RI5F 4EN3A 1Q9LA 1WBYA 3JWDH 2B1AL 4HUXA 4JDTH 4OM0L 3OA5A 3UR8A 2AAAA 5F96L 1SYTA 4PJBE 3MXVH 3CVHB 2D0GA 5HHVL 5ISZE 4H8VA 1G7MB 3ZMRA 5D1QD 4WUUE 3F5WA 1A6AB 3UROR 2EAEA 4M02A 5F1SA 1RURH 1K4DA 3NZHH 4G8EA 4JZJA 2V5CA 1KACB 2CO6B 4YC2C 2BOBB 1VPOL 3H55A 4JIEA 2Q20A 5C08D 5HHXL 5EC1A 4JCMA 3WF4A 1KT2A 1JBJA 5I74C 2AMGA 3LS4L 3MJ9L 1JN6A 3U4BH 2G3JA 1KTLA 3S5ZA 2Z91A 3SIMA 3MRJA 5FHAH 3O6KH 3HLAB 1UM4L 4LOUD 1IQDB 2BC4A 3OGVA 5F89B 3SDXF 1G6RA 4LAQH 3TCLB 3KXFA 4QXUH 3LB6D 3MRKA 4FQLH 5K9QG 4JQVA 2PW1B 1KFWA 5EH1A 1A21A 1S7SA 1UQSA 4GW5A 1MF2H 3RMEA 1RY7B 1IGTB 4R7DA 2BNJA 3QIBC 1OLZA 3QUZC 3D25B 1XSJA 2YRLA 1G01A 5C6TL 3RUGE 1CFVH 5AG9A 4LPCA 4EKJA 1KXQA 1A8JH 5FHBH 3T1WA 3QUXD 3JTTB 1T7VA 4QCFA 3RTQB 2OXHA 4AM0B 4Z2JA 2VVSA 3JVGC 4GS7C 4Z2GA 5CZKA 4X4YB 2A1WH 2WZEA 1N5AB 4W4OC 1NEZG 5EOQH 3D25A 2D1ZA 4U7SA 4HJ0D 4JM2D 4FFZL 2EO7A 1R5WA 4DWSB 1L0QA 1K85A 1T1XA 3L5XL 2YC1B 4WRLA 4LQFH 2ED9A 1N0LA 3NA9H 5C08A 3ZDZF 4QRUB 3RWGB 1UZ8A 5HI5D 3SOBH 5B4MD 3D9AH 2BJMH 4EDXA 3PNWB 3AB0C 4TULH 4FHBD 3D52A 4G8FB 3C8KB 1GIGH 1TQBC 5IT2L 2E0PA 1OP9A 1Q4NX 1OIFA 5JXEC 3M17A 4K8RD 5A2BA 3G6LA 1GGCL 4Z95L 4XPFL 5K9KA 3ABZA 1DBAL 1C3FA 1T1WB 2BRRL 5EUKB 3OAZK 4NO2B 5AYIA 2R2BA 1HP4A 3O4LA 4J8RB 1QSFD 4G8GE 3LKNA 2XNAB 2F5BH 5CEZH 5AD0B 1W32A 1OD9A 1H8OA 2PO6A 4ZD3L 5DFWH 5DZLA 1KIUA 4F57L 3WBEA 1NDMA 1IAIL 1H3TA 4RRPG 3RWCB 5MHSD 1WDRA 4JAWA 4MNJA 2QKIA 5FA3B 2G75B 3S4SG 4Z7VB 4U1GC 1NLBH 4XP1H 3OZOA 2CKNA 1PG7W 3OIHA 1CGSL 5BJTA 2MQCA 8CGTA 3TBWB 5C9JA 1PQZA 5CJOH 3STZB 4OI9A 3GO1L 4WWKA 4RA3A 1QOKA 1ED3B 3QULA 3CDCA 3GTNA 1FNGA 3FB5B 4P46D 3KL0A 2KZ1B 3ULUH 4OCWH 2JIXA 1DQQA 1MH5B 1YNKH 3U48A 4I3RL 1YPZB 3CFIC 1KJMB 1HQRB 1GGBH 2AERT 3VE0A 2OYMA 1IL1B 2MKWA 4QT5B 2CESA 5GGTL 2L0DA 1R47A 3S9DB 5FHBL 1GPOH 1HINH 4RMSA 1L4IA 5DFTA 5DLML 1QNOA 5L6YL 3AI0A 5IFAH 5ESVA 1WZ1H 6FABL 4ODTL 1UB5A 5DDHB 1A22B 5F7LB 1YUHA 4HQQH 2Q8AL 5I1IH 2X1XR 3UMTA 1XGUA 3UO1H 3PUCA 3SY0A 3PTKA 3TCLA 5DC0A 1FFPB 5LCVH 5EBWB 3G5YA 3WDJA 1JPST 4S1DC 3SDDA 2VXUL 1MXDA 3S96A 3CUGA 1VCAA 2E7CA 3SOBL 4F7EB 2BSSA 4P23A 3GSRB 1IKFL 5M03A 3IJHA 4L5FH 1DHKA 4HX1B 2R4RH 1NWTA 2ZG2A 2DI8A 2DBJA 2VQ1A 1YMMD 4LF3B 4WFGE 3GKWH 4CVXA 1H0DA 1UR1A 4KC3B 5FD0A 1QOXA 1FA2A 1UADC 2O5ZH 5J12C 5IBLD 1A6AA 5I8OL 3T0EC 4W8AA 4MZ3A 4OUUA 4KI5F 2C5DC 2HKFL 4LCWD 3WDPP 2ZOKB 2K7QA 4UZSA 3BAIA 1LO4L 1JFQH 1KJVB 2QSCL 3VJ6A 1AE6L 5I78A 3PGCA 1ZXQA 1WLHA 5E99L 2OJEB 2E40A 4YBLC 1RIVH 1A6TB 4M7KL 3L3KA 4F58H 1X5YA 3OB0H 3EJUA 1TR1A 4LHJB 3QG7L 3R8QA 1F4XH 4UT9H 1NLBL 1SMOA 3BPOB 1T83C 2DLTA 1OLLA 5IMLB 2F1AA 4UQAA 1B30A 4LVHC 2EABA 3T0EE 2AV7B 3CU1A 4MS8C 4Z2HA 1A3LL 32C2A 2V2WA 1NANH 1G84A 1W9VA 3QIBB 2A73A 2NX5D 3G08B 4M9PA 3OKOB 3OLEA 4I4WB 4BKLB 5K9JL 1G9NL 4EI5D 4K7FA 1VFOA 5CUSL 1RZJC 3U1SL 5FL0A 5IB4A 1MPAH 2R9HC 2WC4A 2Y7QB 2O92A 1A9EA 1TJHL 3MTRA 4ODVL 3P0GB 3BUYA 4OUOA 3DV4B 1CDYA 1KB3A 3MREA 3W0WD 1R87A 4JKWA 4BH7A 3QDME 4HWUA 1LE9A 5EB8A 4AQOA 4PJGF 4X7EC 1K6QL 9CGTA 4X6FA 4Y19D 3FRPG 5CJ8A 5GQBA 3L1OH 4YIQA 4GI6A 4GT7A 1H5VA 1WVZA 3A67L 1XAUA 5T5NF 4DGIL 2JF6A 5J06A 1NLDH 3QDAA 2VLMD 3IYLW 1N3NA 1W72B 2Y06H 1TVBB 4KI1A 1OD8A 5T1DL 2HH0L 4X6DB 2QTEA 3V5KB 1ZWIB 2C1PB 5DQJB 2OZ4H 5HVFB 1NGXB 4J4PA 3SKJH 3UDWC 5HGDB 2J6EL 3UTTD 4QRPB 1ZLVH 4GKZA 5F97E 4GZJA 4OLZL 3B43A 4YIQB 2VKWA 1XYZA 1QQDB 1QSFE 4TUFA 2FDBP 4QHUA 4EI5B 4UBDC 5I1LB 1NFDA 5D1XC 1PS3A 2VLRB 4FS0A 3UYRH 2CJUL 3QIUD 3UETA 4XWOD 3BUYB 3O9WA 1U91A 2CUIA 2VDMH 2X89A 3QXAB 1UB5B 1EERB 3A0OA 1KC5H 1UT9A 4Z7WB 4MLIA 4XCFH 5HHOB 1J8HD 1FZOA 2GI7A 2VTFA 2IANE 4CBPA 1R75A 1IGTA 4NZCA 5E8EA 2J1KA 2VXSH 4MQXD 2RBLA 4KTEL 2GJZB 5SWZA 4HKXA 5DRXA 2XZAL 4B5EA 4U7KA 3EW3B 3UYPA 1R5IB 1VJSA 4RGMC 4YHNB 1KOAA 4JFYA 43C9B 1IAII 1D5XA 2DIAA 3SQOH 4N90E 4AG4L 3IJ9A 3I6LE 1HDMA 3RUGF 3TV3L 3HN3A 4UV7H 5D7IA 2Q8XA 5J89A 1M1SA 4M7JL 3DIFA 4HUMB 1DWIM 5E9DA 4QXTA 3U36A 5D7JB 2XA8H 4CNIB 4TSAH 1GPFA 4K07A 3P2TA 3SUVA 4MAVA 1NCCL 2XTJC 3HZVB 1OSPH 5C0NC 1Q6EA 4OBSA 3QCTH 3JXAA 3L5WB 2EKJA 4HWZA 5D4QA 4JFHE 5EC1B 1O7DC 4ONHB 1ZHKB 1NANI 5MENE 3GIZL 5DFAA 3K8KA 4P7OA 4XV0A 3OBAA 4XPHL 3UJTH 1EHLH 1VFMA 1F3JA 2YMXH 3DURB 5FA4B 5FGBC 4MXVF 2VISA 4WY7H 4DCQB 5IOPA 2NY0B 2GJ6A 2QV2A 1EO7A 4JPVH 3Q5OA 5D2LA 2WHMA 1LDSA 1KCKA 1UQYA 1DL7H 4OLYH 4Z76B 2XKSA 2WINB 2E3VA 5E9DD 4D9QD 1P1ZB 4HMDA 3RM9A 3G6AB 3A4AA 2I27N 2Y9RT 3PV6B 5T1DH 3TVMD 5DHYA 3GK8L 3VM7A 1JGIA 3B8SA 1E40A 3G08A 5BQ7B 2ERJB 3AM8A 1FE8L 4WTWA 4KTYA 3WD1A 4PV8A 4E41B 4ELME 1A1MB 2N7AA 4NBZB 2GSIB 4M6ML 3P4NA 3PZIA 1KYOJ 1WBXA 2HTLD 4JE4B 4TSBH 3ALPA 4PGZA 3MMEB 4X6BA 1JZ5A 1E55A 2J79A 4WIWA 3VFOA 3LDBC 3VILA 4GG8B 3EYSL 3SKNB 4X4YA 5I1JL 4S11A 2EEXA 3TA3A 3D69A 1QSEE 3CSYB 1PIGA 4MNQE 1KC5L 1PW3A 1HI6B 3RY6A 5HHXH 1BJ1J 1PAMA 3B9AA 3LPWA 5TFSH 5HD8C 4BJLA 3HMCA 5HYIA 3C6LA 3GHBH 4DW2H 4TVPD 4CVXB 4XCNB 1HJWA 4OZOA 3HR5B 5DZNA 4PR5A 2ZUWA 3EKCA 4NBXB 3QP3A 5KSBA 1JNHA 2WBJB 4I0PA 3MCG1 4XC1L 1KENL 1BGXH 5E2UH 3WF3A 2UWEE 4HAGA 2AS5M 3PP4L 4P7NA 4NM8H 4IOFD 3VXNA 3BP4B 3AHZA 1BPVA 4Z6AT 3H9SD 1GQJA 3AIBA 1S7UB 4KVCH 2PW2A 3FQTA 1GZJA 3MRFB 1D5IH 3RU8H 4IOFC 5BS0B 4PP2B 4YNYA 1H8NA 3U7YH 2NY6C 2RFXB 3D69B 3MV7A 5DRZA 2IEPA 3HE7D 2J7EA 4KRLB 1PZUB 3LKRA 2B8OT 3S34L 4LSUL 4Y19E 4FQQB 3MRDB 2X70A 2F7QA 4MPKA 1YMMB 2JJUA 3RL1A 2JB6B 1ADQH 4BKLA 1GCFA 1XGYH 3QIWC 4JY5L 2IH3A 3ESUF 5A2AA 3C08H 4OJYA 5CIPA 5E2WL 5HVHB 5D9SB 3VH8G 4MNKA 4TUJA 3DTXB 5IV2B 4ZNEE 4NUGL 1QQDA 1JV5B 3ARBD 2GDVA 2FD6L 4O9HL 3K8MA 1X7QA 3C09C 4TNVK 1XSKA 2X2HA 5C0RH 4TULL 1YY8B 4PRHA 1MFEL 4XHJD 3BKCL 2NTFA 2YFNA 2DIBA 1UKPA 3HZMB 4DZBA 5CJXC 3W39B 5EU3B 4F2MB 4Z7VA 3GHEH 4HZ8A 3EOAA 4JPWL 2WNWA 5IVXE 1L7TH 3FAXA 3VGBA 5M5DA 1IC1A 4ODWB 1B2WL 2GAZA 4N0CD 2PXYD 1XEDA 4ONGL 3BPNB 2ICWI 5E8DL 1V5JA 3H53A 2UVFA 4HV8A 4LLDB 5SV3A 4BK5A 4X80H 1MUJB 3GSNL 4UINL 3TVMC 4GG6A 3WHE0 4GUPA 2EPNA 3HG3A 1IFHL 3VKKA 1YN6A 2D03L 3L3JA 3EIFA 4U1SB 3VRIA 1BD2E 3MROA 1NAKL 4U3CA 4OLUH 4JY6A 4HUVB 1V3KA 4RMUA 2D2OA 3VFSA 5IMOA 4F8XA 1MCJA 5F3HB 5JA9A 3HU7A 3DROB 1E6PA 1DUYB 1XIWC 1MVYA 4Q6IC 4XC3L 5A8OA 4Z7QF 2EDNA 4CCEA 4B3LA 1FYTD 5BXRA 1DJSA 1JFXA 3V7MA 1NM9A 2VRJA 4MSWA 4NKMB 3V6OA 4HK3N 5EBMA 5IHLB 1CFTA 2VH5L 1XF4B 4PJGE 2HLFD 3O6LH 3BMVA 3EOBB 5SV4A 2F7RA 2WIIB 4BH8B 1MAKA 5DLMH 4R9HA 5ETUB 1J1OH 5HHME 4AZCA 2CEQA 3QPXL 3D3AA 2CDFA 1F6AA 3N1GC 5EG6C 1LO0H 1J1PH 4GKNB 3E1F1 3MOBL 4ONFH 4XVSH 1BZQK 1H0DB 4LCCC 5GGUA 1Z9SA 4PJ5A 2E6PA 5EBMB 3WQWA 3AYRA 4C7GA 3C5JA 4CKVX 2FYVA 4HH8A 4M4PA 2DYPA 3FO9B 4YHPB 4IRJD 5JDSA 5E8NB 1CWYA 3DJ9A 5C0AB 1BIIA 2ARJA 2IQAB 2HT4D 2NY5C 3D0VA 3FQRB 2D4DA 4MQ7B 1HKJA 3MQIA 1J1XH 2D9CA 3B83A 5LGJA 5IMOB 2Z92B 3F8UB 3IDUA 4BSWB 2KPNA 4LP5A 2VN7A 4WKAA 4IM8A 4UOZA 4YDVA 2MJWA 2DBLH 1FLRH 3G6AA 2EIEA 2YL5A 1T0NB 4RGNC 2ZP0T 1J8KA 3DVFA 3MV8D 4S1DD 4WGWB 5FCZA 5HI3C 5TQ2H 2VZUA 1MQ8A 1TITA 4HIIB 3NZ8A 1PD6A 5IM7A 3FW6A 5C86A 3VO0A 3LQAH 3MRPA 2HKFH 3EMCA 2WW8A 4HBQA 4HZ7A 5J11C 1DVFB 2IJ0C 2ZCHH 3BJ91 4Y4FB 5JXAH 4OZFB 3W0WA 3MCKB 3LHPL 1TJIH 1H5BC 3OX8A 4G8FA 5EOQL 4Y8AA 5BOPA 4B9ZA 3VFRA 1TZGH 5GRZA 5EU6B 5JDSB 3EO9L 3NCFB 3QNXA 1FYTB 5SWQA 2DQCL 3WHXB 5E70A 2AQ3A 3SE9L 4M29A 1NGQH 2XIDA 3ARTA 3C5JB 4I9WD 1V03A 1VJZA 3ROLB 3X3FH 1JPTH 5CEXB 4HFWB 3TH3T 3BUBA 3ZR6A 4IJ3B 2WP3T 2BVTA 3RIFF 2EYTB 3HTLX 3O2DA 3VH8A 2HJFA 2BVQA 5KSVA 2IAMC 4O2EB 1AGEA 3TTOA 3QWOA 3T4AB 1U0QA 4OLVH 4U1JB 5E94A 1BX2B 5CMAB 3R8BB 1YJDL 3NABL 4ODHH 4JPIA 1KB5A 5I2IA 1SMAA 2FSEA 1KLGA 2GW5A 4AT6B 3IDXL 3UTSD 1KN2H 5EPMB 5BS0A 4L8DA 2EDJA 2VZTA 1W1YA 4OFDA 2HVKB 1AQHA 1N64H 2EH8L 1OAUL 1HCVA 4UT6L 2Q7YB 3REWA 1SBBA 1YHTA 2J7LA 4LLVA 3I02B 1OQXA 1CFNA 5F9JB 4Y5YC 1ZJBA 3GMRA 3ES6B 2IQAA 3GO1H 3QIWB 4P23D 2C3VA 5FKPA 5AZ2L 5D2NA 4X0KB 1Q0XH 2UY2A 3QGVA 4QDMA 2BNQE 1MCFA 3DX7A 1GQLA 1MY5A 1JDCA 4HGWB 3UTZA 4XBGA 1FH5L 3L9RB 4UDUA 1QFWH 3H9ZA 3P4OA 3TWCH 5T3ZE 1JGEB 2AI0L 3NCMA 5FYJE 5DMYA 3WQ6A 1LO3H 2APVA 1U30A 3KLHD 4PYGA 3S36X 4LSRL 3SDCC 4AM0A 3S36L 1EBPA 4GW1A 1YEJL 1CF8H 5J12B 1WGOA 3QZWB 1F45A 5BVPH 3HNVH 4NWUH 3NYDA 1TE1A 3CLEL 5D7LA 1ED3A 3A22A 4NRYB 4OZGA 3GMNA 4DK3A 2NX5B 1FJ1A 2UY6A 1BVKB 3IU4L 4YX2L 4I0PD 1AXSA 3TT1L 1TZGL 5C0EA 5GGVH 4P8XA 1HOCA 4OQTA 4G80A 5CEZD 3VD9A 5SWQB 4KVNH 3MOQA 1UM6H 4JQXA 4JKPL 1VFFA 3QEQE 3VOCA 3CZFA 3VGGA 2NLJB 1FG2A 1HHGA 5B39B 2AK4A 3UERA 3VI3F 4OZHF 2GFTA 4QHNA 5CBAB 3W0WB 4DOHE 1C5BH 2W65A 2OI9B 2EJ1A 4MB4A 4EANA 4KRTA 3ARBB 5FOBA 5TGBA 2R2HA 1BQSA 3GKWL 3KGRA 5TDOA 5IESH 3A6BL 3UJTL 2X2IA 3MANA 3T0EA 1MNUH 5EFIA 1OW0A 5EZIH 2HMIC 4PRAB 5HHQA 1QWUA 1YJDH 1DQJB 3LN4A 3G9VA 5D4YA 2HA1A 2VMFA 4KKCD 3H9YA 1BQHA 3V4PL 4PJHE 1S7VB 3IFNH 1JF6A 4OQTH 3BYTA 4L8SA 5L2KE 1WZAA 1XC6A 5F6IB 1EX0A 2EC9U 3I9GH 3CNKA 3F5KA 1OAUH 1UB6A 4HWEL 3OKLA 4ZUVA 1IT9H 2J8HA 3BQUB 2VIRA 5D5MF 1QBML 4CNIA 3VXMA 4LNVA 4PBVC 3UC0H 1C5CH 5FIEA 4EJ1C 2BRQA 4JHWL 4DO5A 4IMKA 4YUEL 1TMCB 1FFPA 3MRNB 1NBYA 4ZS7L 3PWPA 4M7LT 4RX4A 4LLYA 1ORQA 5JPMB 3W9DB 1BM3H 4WHYH 3WUGA 4KRNA 1PG7X 4POZD 3NCBB 2IH3B 2DQJH 2O9PA 3BIKA 2XN9A 1MCEA 1NCUA 3DETC 2YXFA 3HS0B 1TVHB 3KWWB 4GXVL 4DKEH 4BQ9A 5C09B 1FHDA 3EDEA 5A6LA 1K6QH 5IHZA 3BQUD 5DEZA 5EO0A 1ZU8A 2RR3A 1VBUA 3EUUA 3V4VL 4UQEA 1NWSA 1DTUA 3QXTA 3KAAA 4OKDA 2QLVB 4I2XB 4YX2H 4QHUB 4I9WE 3EFDL 4N0UA 3OKNA 4W81A 5EORH 2LV4A 2GDUA 5DJYB 3FONB 3PZUA 1EJOH 1H5BB 3LRHA 1MLCB 1KNOA 3VCLA 3SCUA 4KVCL 3SCNA 5KZ6A 2KL6A 4ZQKA 3R4DA 4PRBB 4JKKA 5E1HB 2OTWB 1O7SA 2C3WA 2BMKA 2VQTA 4PJIE 4H8WL 4PP1D 4NQEE 4RFNC 3RZCB 5D6DC 4RFEA 3K80A 5CINL 2ZE0A 1N7ML 1NUNB 4Z9KB 5IKCA 3T77B 3EZ8A 3OAUH 4N5UA 4F9LC 1IAMA 2E27L 1A6VL 2PR4H 4KY1L 1HHHB 2MCPL 4HOXA 1JP5A 1T89C 4UQ9A 5TH2B 1UR9A 3VIFA 1BD2D 1KTKE 3P9MA 4F7CA 1JPSH 2H1PL 4D0CA 1RK1B 3PG2A 4WO4D 2F53D 4LU5L 3LN9A 4LGRB 5A6JA 1F8TL 4NM4H 4BM7A 2BNRA 1JAEA 4I3GA 1YEIH 4QKXB 1YEHL 3PV6A 2GJPA 4YHMH 1JYXA 3FQTB 4Y4HA 1U95B 1RZIA 4ZPTA 1HKIA 3GIZH 3GZAA 1U42A 4O00A 3P11L 4LPYA 4U3AA 4XP9H 1C1EH 1M6OB 5T3ZH 4ZAKC 4POYA 3AUVA 5TDPB 2UUDK 3L3IB 3HI1A 4NO3B 4AJ0A 3ZT5A 3VXSA 3QUKA 1T66C 1HHIA 1S7WB 3V6BR 1U8LA 4LMQE 4ISVB 3EBAA 3AXXA 1MHPL 2OR9L 5INCB 4OLYL 2P5WD 4X98A 4Q6IB 4UDUB 3M46A 2VQ1B 4LVOC 4BQ6A 3GBML 5HTSA 3BESR 2QPUA 3MJ9A 1FC2D 2FGZA 4ZEPA 1MJUH 3IDJB 4WSKA 5H2BB 5SX5H 3DUHA 1CFNB 5F9JA 1X5GA 3C6LB 5CHNB 1RD6A 4TUKH 3CX5K 5EBWA 3TBYB 3WLBB 3EO0A 4UTBL 1FBIL 4CUCA 5GSRB 4W8BA 1RZKL 1XR9A 2GEEA 4KUCF 4U2YA 4K94L 1I8LC 5LXGH 1PBYA 3OF6A 3WIHH 3DMMB 3SCPA 4LFHD 4LNRB 2PWFA 5BMFH 3RWJA 4NSBA 3C2SA 2X41A 4ZUTA 2XRAL 3MXWH 5CSZB 1CDJA 4JHZA 3ZE1E 3V9FA 2X4OB 4NBYB 3ARFD 1YPZA 4OF0A 2KQMA 3ZLQC 4WFFD 2AV7A 1UWRA 5F7WC 5E8OB 5IBUG 2IXVA 3IF1A 3S3SA 2XQYK 3CMJA 3MRNA 4R96A 3O8XB 1A7PL 3ZDZE 4XUYA 4M6OL 2CRMA 4DKDC 4UZGA 5DS8B 2HISA 1UWIA 4NKQB 4YAQA 3O2LA 4OD3L 2WVVA 2ZCLH 4Z77A 3N11A 3EO1B 4PRBA 5GGSB 4NM4L 4BQ3A 3FO2A 5A6BD 3ZYZA 4WI9A 2VE6A 4AIZB 5CEZE 3W28A 2A3HA 1RMFL 1C08A 5I1CL 5I16A 4MTVA 5FGSA 2OYKA 3MI6A 1U8OA 2HP4A 5DD1L 2X4PA 1ADQA 3FB6A 5EBLA 2O5XL 2FL5A 2W91A 3O41A 5HDBF 4D6DA 4MHHI 1KPRB 3T0DA 2H3NB 1T1ZB 4OB5L 3C8DA 2J4WL 1P2CB 2QHRH 3QI9B 1N0XL 4AH2A 3NCJL 4NO2A 2Y7QA 3NACH 3QOKA 5IF0A 2WQRA 3D3VB 1RUML 4AIXA 4J2XA 3EO9H 2X9WA 5IW1A 4HZLA 2FATH 2P5EA 3AIEA 5FAAA 4JFZL 3FT2B 2V5TA 4H0IA 4GMTH 3HJEA 4PV8B 1ZANL 3OZPA 1UXWA 3C9NA 1MIMH 2VDLH 2C7UB 4ZO9A 1NDGB 4QWWC 5DD3H 2PO6D 5I17B 1QKZL 4X8JA 1EAPA 3VFVA 3HZKA 1QSZA 5T1MA 1S7XB 4KRPD 1KFAH 1CFSB 4KPHL 3VRJA 4XCYB 1WITA 3BP5A 3W81A 3AFLA 5GSRA 3BJLA 4ZE4A 1SEQL 4PJ5E 3VWKA 4YPGA 2J8GA 3DX4A 3R1GL 5F9DC 1E6XM 3QHMA 3ARDD 1IMHC 2F5AL 1QRKA 2PWGA 5ELIA 3P3YA 1V3JA 3NFPB 3PWPB 2ADJA 2EXOA 3RO8A 2X4RB 1IFHH 1S7TB 1KN2L 4QTIL 3WBAA 2Z31A 1U6AL 1CT8A 2GFBA 1PSKH 2VIRB 3BZFB 4Q9BA 5F9WC 1GHRA 25C8H 3HZVA 3RRQA 4AW7A 1XGRB 4HGMA 3KXFB 3BH4A 3MUGB 4RISH 1AQDB 5GJSH 1BREA 5JOPD 2DM3A 1OAKH 2HAZA 3MMDA 4KJWC 3DARA 1J01A 1RUAH 2R2HB 3U46A 2PBOA 2Z91B 1Q38A 2X44D 1KGUA 1MCOH 2DDQH 4WWKC 1FAIL 1I1FB 4ENEC 2H32A 4HPYH 3O9WC 4P59H 2JF7A 2WBKA 5EZOH 4GZEA 2PC8A 5GRVK 1G1CA 2PTTB 2YUZA 3D3VE 1MLBA 2AGJL 1VADB 4MJ6A 2GAZB 2E8ZA 3T2NH 3K1KC 2XV6B 4NSKA 1E6OL 4AMCA 5ITBL 3MBEC 3IKKA 3LIZL 1T5WA 4KKCC 3SDCD 5DI8B 1FRGL 3GB7B 3VMNA 2PTUA 4LQFL 2CDEB 3QZWA 2YC1A 5JW3L 1WZKA 1B4JH 2H9GB 3MLRH 3RDTA 1HXMB 5CEXA 4M81A 2NX5A 5BJTB 2IANB 2WMGA 3L4WA 1QLRB 3OLIA 3F7YA 5E0CA 4O4YL 1AC6A 1FLRL 5EU6A 4Q7NA 4RMWA 1S8DA 5HY9A 3AAZA 4ZE5A 3OX8B 4QLKA 4C7FA 2OSXA 1JGEA 1CLCA 2NX5E 3WN5A 1HZHH 4YBLB 2F5AH 1A4KA 5CEYB 4F15C 4G7YH 2NW2B 1CK0L 3DX3A 1KB9K 3MA7A 5ID0B 1E1FA 1QFUH 3EDDA 1OGGA 4M48H 1X4XA 3W38A 3QDJD 1HXKA 3CFCL 4X9YA 5FKYA 3T0EB 4CMHC 3N13A 3DETD 4G7VH 3HG4A 5KVFH 4JRXE 4Q6YA 4FTVB 4Z7UA 1PSKL 3K1DA 3MRFA 3U7WL 2D3NA 1YUHB 5GS2H 2YJQA 2ZX6A 4J6RL 2YA1A 5DTFA 4HK3J 1HXYB 4CU8A 3KE0A 5C0JB 3BPLC 2XGBA 4UU9B 4HP5A 3MACH 4CL7A 3PZOA 1A9BB 1RJZA 1G5AA 1OSZA 5L7XL 2VI0A 5D7SL 5JW5B 2NXZB 1T89A 4RISL 5GJSL 2ZSVA 5IB3B 1QBBA 1IVLA 4K55A 1G1YA 4WTZG 4L4VA 4KUZL 1XH2A 2F8QA 4ZS6C 1GZQA 4DWSC 4AEIH 1B0GB 4ATWA 4PTTB 2JIXB 1JPFA 2WVTA 1SM3L 2DWDA 1CZ1A 2NQCA 3MRHA 4PREA 3SDAA 5ITFA 4OCYL 4CJ0A 5L2KB 2G3IA 1OARH 1K4DB 2IBBA 3X11A 3PBGA 2OSYA 4GXVH 1WC7A 2W5FA 4KWUA 5DD0H 5FIPA 1U8KA 1MREH 5F8QC 5CQ1A 3WV0A 5IXEA 1ZHBB 1OCQA 4W85A 3RPIA 3QXVA 2ATPA 4X5WB 1JI1A 3BH9B 2NW3A 4GO8A 1CEOA 2VURA 2UWEF 2VOTA 4MB5A 3LIZH 4GRLB 3DX7B 3QXDB 4PRPE 3HZKB 5JMRA 4CD6A 2B1HL 3CCHB 4HAFA 5AD0A 1R7OA 1GOOA 5E4EC 5JOFB 4RE2A 3HE6C 4DM1A 2DJ4A 4OIIL 4OZGE 5CKGA 5GS1C 5C0JA 1R3LA 1I1FA 1PZ2A 3QDMA 2BC4B 1PY4A 4PRDA 1I1RA 1QPXA 4H41A 5J3HD 4LCUB 5TDOB 3ZHDA 4F33A 1K9FA 1VACB 2CK0H 3E6FB 2V2XA 4GRWE 5F6HI 1NCAH 4OGAD 2AW2A 4MMZC 3WEMA 1AQ0A 3R06A 4XXCA 4P5TA 2D7QA 5SWSD 3MLYL 1BAGA 1OVZA 5DEFA 1GJUA 1HZHL 5JUEH 4UQDA 5IB1B 4OGAC 1YEJH 3VWJB 2WUCH 3BGMB 1Z3GH 4U6VL 5BV7C 3GH7A 1F3JB 4U1MA 3GXNA 3ALGA 3A47A 3AS0A 1KJMA 3MJGX 2DQGL 4JG1L 5BVJA 5EOCJ 4X5WA 1H3GA 4Y4KB 1INQB 4WU7A 1Q9WA 2UVEA 5IFHL 3F7VA 4PG2A 3V0AC 4KKNA 3WUBA 5LQBH 4R0LB 3KJ6L 3LD8B 4NRXA 2J5LB 1XF4A 3G6DL 4CD4A 4KMLB 4XVTH 3WL9A 4LIQE 1MJJA 2DT1A 3CX5J 5BROA 3KLLA 5D9SA 1KG0B 3MGOB 2EDLA 3FQNA 1PPIA 3U1SH 3PABB 2V7NB 3MJ7A 1TPXB 1U3JA 1WJ3A 4R7NB 1WAAE 2WSPA 1OARL 1NDGA 4FMVA 2ZNXA 2P4AB 3GEWB 2Q6WB 2FLBT 2NNAA 2ID5A 2J7DA 3AREC 1EDTA 1C7SA 4KQ3L 3H42H 5IHRA 2IFFL 1W9UA 3QUXA 3VXUE 3IFOB 1JNJA 4CN1A 4RWYH 4NO0A 2X0HA 3UPAA 3TO2B 3PWNA 3TIDA 4PJGB 4FQCH 1YY9C 3VIKA 5DVNA 1KGXA 2XVNA 3BEWB 4Q22A 1UYWL 1WCBB 4P2OC 4P2CG 3U0PA 5JNYA 4HV8B 4LLDA 2FEEL 4LYQA 3MGAA 1NKRA 4QRPA 4ZXLA 5E94B 4EVNA 3QFDA 1QLEL 2IG2L 4I0PB 3SJVE 5C70A 5HYJA 5EWIH 1FBIH 3PABA 4Q7DA 3QUMH 4NIKB 1AGCB 2PUQT 5A2KH 5JZ7C 4CW1B 3DI3B 1JYNA 3LQZA 4HWNA 3EYPA 3VIHA 4X6CF 3MA9H 5HD8D 4PJXF 1S7TA 3VXPA 4PJEB 2V9QA 4P5TD 1T5XB 3T2QA 2BHYA 4YJZL 4P46B 4P9HH 1NMAH 4QP0A 1GZPB 4R0LC 3H3PL 1IGFH 3KL3A 1A6WL 5EFDA 1JUFA 2CQVA 4TUJB 1N8ZA 4PS4H 4BSVA 3QOMA 1QTYT 4D2NA 4P2QB 1LO5B 1F6FB 4HH9A 4U6TA 2ZKHL 4AEEA 5T1MB 4OZFA 1I8IA 4MCYA 4JFOB 2HFTA 4OFIA 1EEZA 5FECB 1CLZL 4OD2A 2YL9A 2WIMA 2WZHA 3GXIA 4MXWH 1RV6X 2ENYA 4MNQA 1KCRL 4WI6A 5IF0B 2E7LC 1F3DJ 4AD5A 1UGNA 1GAFL 2XGIA 1KGWA 1EO8L 4PJEE 2W60A 4IRJC 1XGPA 4UAOC 1CXKA 3PXJA 3OGOE 4IOSD 4TTUA 4WV1A 5DD1H 1J05A 3ULVD 2HWZH 1IGCH 3WS3B 1S78D 1RUPL 5FO8B 2JTDA 2I60H 1ACYH 4H7VA 1IAOB 5L9DL 5KW9H 4X5XA 4OUUB 1BAFH 3RNQB 4AEHL 2XN1A 1FORH 3MRLA 1KV3A 3OB0K 5DGRA 2GFBB 1T2JA 1YMHA 4X7SH 4ZFGH 1OGSA 2QMKA 5DQ9A 5C6PB 1OM3H 1I1WA 2XA3A 1CLVA 2ESVB 3CFBA 2YSSB 4M1DH 2J7FA 5DJ0B 2ZX9A 3BCFA 2K1MA 3BE1H 2W59A 4HUXB 3FQWB 4M43L 3WFEH 4X9BA 1AO7B 3OHXA 3WKZA 3ARDC 4L9LA 1NCWH 4ZTPH 4Z7UF 1OW0C 1LO2L 1XH3A 2FBJH 3KPSE 4YXKL 3HG1D 3TVMA 5J6HA 5JOEA 2JIWA 4GG6F 4PTWA 5T3ZL 1Q72H 1MHCA 1RZKC 1CQKA 1XR8B 4QOKA 1YMMA 4YO0B 3WJLA 2Q76A 2IAMD 4JFUA 1V0NA 1MRFH 2J8UF 4Y1AB 3V0VA 1H09A 2EEDA 1WFNA 1ISVA 3O11B 2W0FA 2GJ6D 2XTLA 4JZNA 4N8CL 3WEZA 2H45A 3MSGA 3HC3L 1RQ5A 3HB3D 5ABFB 4M61B 5C0CE 3V6FB 2P43B 4PGDB 2E3ZA 5BRZD 4PJCE 4HUNB 1OTUD 1A7OH 1E6JL 5HDOA 2XPGB 3NSMA 3DVNA 2EDHA 5KSUA 2J8FA 1TXKA 4JZ5A 3AHXA 1OTUC 5DQ9B 2AVGA 3SPVB 1NEZA 4HLJA 4R6UA 3NOIA 5I8KL 1O5DT 3MRRA 2DM4A 2A0LD 4KJYA 5F6HJ 3QG6A 1CICC 1CE6B 4UR9A 1MHHA 4OKVA 5FHAL 1EO8H 5M17A 1S8DB 5HY9B 4U3XA 1ZLSH 3AICA 1F97A 1T0PB 3H9SA 3HR5A 2FZ3B 4PY8J 2ICWJ 2MSPA 4JJ5B 1IGCL 1RJLB 3GSNA 4WV1B 3WQ4A 3CC5B 2EDOA 1HHIB 1IGYB 4K8RH 4RMRA 3L4UA 1X5JA 4IRZL 4OGZA 3BEWA 3IXTA 5TE4L 4AYGA 2LU3A 2HRLA 4UAOB 1M6OA 2XZQL 5MEND 3L4VA 5LJYH 2J8UA 3CPUA 5HHMB 1RUQH 4IPLA 1FP5A 3TGXA 4Y5VC 1KBBA 1HK6A 5J1SC 5E08H 2BDNH 5C2BL 1VBRA 1T20B 1AFVH 1MY7A 2QJDA 1HVXA 3C8KA 2Y25A 1BWMA 1R3JB 3JTSA 3Q6GL 2OQJB 3BAEH 1CD8A 2Z31D 2FEEI 1P4BL 4HZAA 2DL2A 3W5NA 3VINA 2XY2A 3B6SA 3T77A 2RGSA 5IB5B 4N0FB 1FZOB 3U46B 4KKBC 4YH6A 4E8CA 1MI5B 2XTJD 2G41A 1MJ7L 3S98A 2O93L 5KSBF 3MBEB 3MU7A 4OF7A 1CL7L 3V52H 3DGCR 4TOQA 1CFBA 5IFPA 1EV2E 2QQLL 4G7YL 3II1A 5C0GA 4G9FD 3SDXB 4DCQA 5DT1H 5K9OA 2GCYA 4Z8FL 3AJ7A 4ZDHB 1INQA 2EDEA 1CTOA 1KJ3L 4LSPH 3GH5A 3S8WA 1IEHA 2WHJA 2JEPA 4UIKL 1MFDL 3UCRA 4C57C 4Z7VF 5HHMD 1ITXA 1ORSB 3LOWA 1A6ZB 1MVUB 4N9GB 2DMBA 5D2NB 1H5BA 1Z5LB 2HG5B 4S3KA 4MA8L 4KGLA 1KUMA 4BQ2A 3IDGB 3QHZL 2GJXB 3RUGB 2DKSA 4HUWA 3IFOA 3ZZ1A 2A6KA 1OGBA 3OZ9H 3N85L 3KYKH 2WWKT 3MV8E 4XPTL 4F9DA 3JWNC 4MNGA 3QRGH 5C71A 1T66D 1FFOB 4A6YB 2FJFB 2E7HA 4Y16A 1X5LA 5IFJB 1I7TA 4PJ7E 3Q5YA 5ESVB 2YK1H 3AOFA 4G9FB 2Y1VA 2HFEA 4UFLA 3KVQA 2VAAB 1WDQA 1JDDA 1P7QA 5F1IA 3W2DL 2E6JA 2WBJC 1HQRA 1ZTXL 3MR9B 3B9KC 3LCYA 3FQWA 4MJIB 1N8ZB 2HFGL 3WFBH 1JWMB 1P6AB 3E6HB 3OKLB 5GGTH 2BVEA 1Q9WB 5C0BA 3EBVA 2X40A 2B1HH 3RPIB 3TM6A 3MZGB 3MV8B 1KYOK 4PJ9B 3F7VB 2YEZA 1J1XL 4P46C 4NN5C 5LGKA 1G7IA 4HS8L 3MLUL 3QIUA 2O5YL 5DD5L 5DQJA 3RZWA 1DCLA 1YQVH 2VAJA 3ARSA 3BKJH 2EYRB 2EDBA 5HHNB 1BPLB 1XRVA 4L3ED 4PJDA 4JRXA 3MLZL 4YK4C 4OOUA 3EJJX 2DF3A 3GMRB 2YFOA 1J10A 2CRYA 2AXHA 5DT1L 2ILLA 2ZCHL 3BDBA 5D1ZC 1T7ZA 2F7PA 2D4FA 5GS0L 5I66B 1VHPA 3QSKB 2WMJA 1JWMA 5KSAB 3CIVA 2JJSC 2Q3ZA 4N5ED 3KHOA 3QFJD 4WFHE 1YQ2A 3I2CH 5IUSA 3DOSA 3SKOB 4AMKL 1C92A 3RVWD 1IM3B 5KSAC 5JW3H 1J0KA 1JHTB 1MHEA 2IBGA 2EPLX 4YXHL 3RGHA 2VLJD 2WC7A 1G9ML 5L88H 5D7LB 2IUZA 3CPLB 3AFBA 3E3QE 4GAYB 3KYKL 3WH7A 2QQKL 5ADPL 1NMBL 2FR4B 5AUMB 1T6WA 3ZKND 2MQ3A 4IUGA 2F8OA 4ORZC 3LMJL 3ROLA 1R46A 2YK1L 4W6XB 2ENSA 2VUOA 4H5SA 4ODHL 3BT2H 3NIFF 5DURB 3QFJA 2F15A 3QEQA 4JFFE 3ZSSA 3CFBB 1K5NA 2W9DL 1MVUA 3PWVA 4OCSL 2DICA 2BNUA 4WUKL 5BW7A 1KXQE 4G7VL 5EU7C 2FRGP 4RWYL 4S1QH 2VLLB 1ZTXH 5IT2H 5CPSA 2AXGB 5DRWB 4CVZA 1XH0A 4FQCL 3PGDB 3V8OA 1MLBB 4G8IA 4HS6A 1G0DA 4LLWB 2IXUA 1YNTB 5C0DB 4XZUB 1DQJA 5F1NB 4K2UL 3VXRE 1P4IL 3MNWB 4HFUH 3PQYD 2J6EA 3O4LB 4JQXC 3BW9B 3O45A 1HH9B 2VX7A 3WXWH 2E7LA 2WCAA 1CD0A 4HCRL 3MLUH 2X1IA 1OB1B 4ZTOL 4A2MA 2XKUA 2Y06L 4KRPB 1RUKL 3BDXA 1XGPB 3CXHJ 3BKJL 1NGZB 1GOHA 3GBNL 2EC9T 1FN4B 4JLRB 5ICZB 2A3AA 2DM7A 4X4XA 2EIBA 2ZUVA 4PJDB 1W2VA 4Z0XB 2VO5A 2AEIT 3VG0H 1E0XA 3P0VH 2VDQH 3PTQA 4FNSA 3QIUB 3BD4A 5TH2A 4NUJB 4WI5A 1E5JA 1K9TA 3U82B 3LH2L 4I0PC 1M03A 4XNMB 1GVIA 3UTSA 3B3IA 5I19H 1UZ8B 3THCA 4JRYD 1G7HA 3ZE0F 1G7MA 2ZJSH 1NH6A 3PWVB 3AC0A 4DZ8B 2VLKE 3W39A 2NY3B 4OCWL 2VNCA 3S5LB 1B6UA 2XQBH 3X3GH 5BRPA 2HLAA 3S35L 5DJ6B 3PDOB 5JHLL 3V4UL 2BV9A 3GSOA 5MENB 1EAJA 4FOMA 2W9EH 4XTRC 5L8KB 1PYWA 4IRSC 3SGDI 5IG7A 2BSED 3D0LA 3T3PE 3WH9A 4RBPH 4NO0D 5KOVC 4NUJA 3LPOA 2R0ZH 1YYLL 1I8MA 4JJ5A 3P73B 5L6YH 5DJZA 4RFNB 3GBEA 3OGSA 2ITDB 4U7MA 4HQQL 4OFVA 3PWJA 3UG3A 4KKBD 4GXPA 1CS6A 3DXAB 4OZ4A 3TP4A 1MCHA 1A14H 4GAGL 2NXZC 3MJ6A 1KN4L 4P2RE 1KCLA 1NCCH 3AIQA 3SDDB 2CXGA 4JY4B 4XB8A 1PLGH 3IFNL 3KPLB 2R2BB 2XHYA 7TAAA 3AREA 4QRPE 4GKLA 4I2XA 4KTDL 5HPCA 1HHKA 3TIDB 3PHOA 5BV7L 3GBLA 5FDWA 4HEME 1KEGL 2MPAH 2FX8L 5LA0A 1SEBA 1BZ7A 1IARB 2VABA 1A6ZA 1IT9L 2NY4D 3N17A 5FYLL 4UTAH 4GO6B 3WFEL 3BXNA 2V3EA 3BPCB 4Y5VA 2EIDA 3DWTA 3KS0H 4P0DA 3VE0B 3W25A 1A1NA 4Y1AD 1MEXL 4L29B 4RGOH 4YXKH 5I1KH 1I1AA 5GRUL 4MMXC 4NNYB 1ZVSB 3F7RA 3UTTE 3P73A 4M8QB 5D2NE 4L9LB 1CDGA 3EGSB 4RAVB 3ARED 4NCDA 5BO1L 1JPFB 4RMQA 3NCOA 4ENED 1ZLUH 4JDZA 2H9GA 4G6ML 3BH8A 2ZZUT 4X6CB 3PZ9A 1EAPB 3VFVB 2XYLA 5EUOE 4TVUA 2VZ3A 4ELMF 5LA2A 5L2JB 3QDMD 1W72L 4G6JH 1CLOH 5E95B 4GLRH 5JW5A 5L8LB 5A2IH 5IEHA 1ZAGA 4P9HC 3MR9A 1K3IA 4GQRA 4K3EL 3FN0L 1OQOA 2E9IA 1V6VA 4UQ3B 2ADIA 4DOHB 2X1PA 3TJEL 1XGTA 3RWJB 3CFKA 3HB3C 4PUDA 2DH2A 4J8RA 1EFXB 1QVOA 2OXGA 4Q9RH 4LDOB 4LLMB 3TO4B 1ULVA 4LSTH 4LGXA 4F8TA 4Z2LA 2F54E 4LCWB 4XHQA 5B38B 2FEDC 4C4KO 5I1HL 4G9DB 2FX7L 1UVQA 4P7RA 3SCTA 3QDMB 1DSFL 2JJTA 4JFDB 1YN6B 4UT7H 4B16A 3VD4A 2YA2A 4IHOB 4ETQA 5EU5A 3PJSB 4GAGH 2Y2WA 3CFDA 1FO0B 3MODL 4OLWL 3ZR5A 3QQ3A 1RPKA 4JFOA 1QFWI 3S7GA 3U9UA 2I9TA 4LASL 5I30H 2Z8SA 2XZCH 3E0GA 1ISWA 3UDWA 1RUQL 1H41A 4PJ9A 3N1MC 2R8SH 4K3JL 4TUOA 2BNUB 2E9JA 4LCIL 3C5SB 1MJ8H 5ISZB 3L6FA 3EJRA 1WC7B 3VIPA 1D5MB 3O6FD 3H2WA 1QW8A 2VC9A 5J1AB 1C5DB 5D1QA 1XF3A 2GTWB 3DTXA 4PY7A 3SE8H 3D2UA 3B8YA 1NCBL 2LE9A 2ICEA 1R5IA 3DMMA 1KIRA 3IAGC 4J23A 1YPZE 4XPBL 1PY9A 3UAJC 4R4BA 4MAYD 1IBGL 4U1NA 2UWEA 1F02I 1DBJH 1LG1A 1QRNE 1MFEH 1CZ8L 4PLJD 1RK1A 2R1WB 1NBZB 4JO2L 2F1BA 1LEGB 2DQHL 3KPRA 4WDIB 3ALXA 4BF7A 3REWB 5T5FH 2VITB 4XCEA 2DQXA 2NY1D 3ILPA 4MA7H 3KPSA 1U8QA 2KBGA 2VZ1A 2X4SB 3RWIA 3BP4A 3SGJC 2UY5A 3ZJ7A 2D31B 2DRUA 3CFJA 4P3DA 2NYYC 1VEPA 4JFED 3N0PB 5ISZA 3RJXA 3TTSA 5H8DA 2F53E 4JFXA 4GG6B 1GOQA 2DLHA 5IKCB 1T1ZA 3H54A 1GCYA 5EULV 3S37L 4HXBH 3HE7A 3IDIB 1EHLL 1O6IA 2D23A 3U5YA 2Q86B 2GVYA 3U30B 2R39A 4MA1B 1HN1A 3OKKB 5FEBA 1QI3A 4FNRA 2DKUA 4DTGL 1CENA 4HC1L 1TA3B 3TA3B 5AEAA 4OLXH 2LAGB 5DO2C 3SKMB 2GHWB 4M5YL 3MBEA 4UT7L 5H35B 1VFAA 5D1XD 4H88H 3VFOB 4YBQD 4QXTB 3WF2A 2ZUUA 35C8L 4PIRF 4WW2A 1LK2B 4OM1L 4PG2C 1LP9F 3H9HB 5C8JA 4Y4KA 4CAGA 5IEKB 4E41A 3ORJA 4WENB 1A47A 2WVSA 2VH5H 3TNNB 4WVRA 3WFCL 2X4OA 5F7EL 2UYLA 4XNMA 2L7JA 3EJYC 4RE3A 5D2LE 3U4EA 3GJEB 3DNKA 2VAAA 2E5EA 3O6MH 1FVCB 2DM2A 4YO0A 4QO1A 4KAQL 1L0YA 4D0CB 5MEQB 3AMDA 1I7RB 3H9HA 3DVIA 2O5YH 4N8PA 1GORA 4UIMB 4WJ5B 4NC1C 5HYSA 3LEVH 5C0BD 3QUXC 1P1ZA 3HE6D 4X7CC 4DN4L 3MYJA 4LPTA 5GSVA 3FN3A 4HWBH 3W9EB 1MAML 1UD5A 5MERA 4P4RB 5JOFA 1ROWA 2W0KA 4WHTB 2EYRA 1KXVC 3NCYS 2B5IB 4PJHB 1N0XH 3EO1A 5GGSA 4FXGB 1ZT1A 4XMKL 3AXIA 2LVCA 4Q74A 1INEL 1QPPA 5T3XH 1RIUH 1VGEH 2LU4A 3UP1A 2AJ3B 2BOCB 3BSZH 4HCRA 1D5ZA 1HL9A 4UNIA 5C6WH 1WFUA 2GCYB 3WDHA 3VFWA 4L4TD 5FO8A 2I9LB 4FTVD 1BFOA 4TVSa 3P9LA 1G7JB 2VR9A 3MRHB 4PREB 5ITFB 3SDAB 5C7XH 3UJIL 5C09A 5B3JF 3HAEB 5J4MA 2AP2A 3PV7A 4WGVB 1SEQH 2I25N 1KTRL 4EKXA 4MDIA 2NY2C 4L4VB 1UKQA 5DVKA 4MAYA 1FH9A 4M62H 1TQUA 4KMTL 5IBTL 5B8CA 1J12A 5E2TL 3THMH 1A9BA 2V5MA 3BT2L 1F13A 1IC7H 4HPOL 3GXDA 4G80B 3WSQL 4F9PC 5IW1B 5D5MA 1U8NA 2FJHA 2EDFA 1PYWB 5IG7B 1JZ6A 2CIKB 2QR0B 2J8UB 1KPUA 3TTYA 5AYBA 5FYKU 5AAWA 4R2GD 1MW3A 5DEGA 1EMTH 2NXYD 4KRPC 4OLVL 4XPAH 1YEKH 4LCYB 5F96H 3S5LA 1OD7A 1FNGB 4ONOA 4WFHD 5E7BA 2APFA 2ZOKA 1E6SM 4I0KA 5ECUA 4TUOB 1ERNA 5CILL 4OGYL 3LS4H 2Z9TA 4V1DD 1GNXA 1INDH 1CXLA 1P9MA 3FB6B 3ARFA 4GPNA 5E8PA 4QRRD 1UEMA 2XN2A 5E8DH 2PF0A 5J11B 2R4SH 5GGRB 3GNMH 1LMKA 3LSOB 1MCOL 3TONA 3IETA 1A7NH 2QQQA 4P9MH 4QLLA 3Q48A 2WMIA 5DJXA 4QLRA 4H1LA 4LXFA 2VSCA 3BOVA 5D1ZD 1BFSA 5JW4Q 1C12B 2L4OA 5IW6A 3O6KL 3E6FA 3TV8A 4GAJH 3ZKMC 1MRDL 1SR0A 4YDIL 5IV2A 3RVUC 3OWEA 4GAFB 3JV6A 2N1KA 4YWGH 5D7LD 4PGEA 2OI9C 1D6EB 1MFCL 4NSKB 4XAKD 5F1OB 4ZXBA 4GINA 5IHZB 5CSZA 1ZHLA 3ARGB 1D9KD 3O6LL 3GMNB 4HUKB 3RWGA 1E4WH 2X4NB 3C87A 4F15B 3BAWA 4XX1E 5GNYA 3BAYA 1GJWA 3QFJE 1H15A 5DMJB 5B4MC 4HF5L 4NRXB 4YGAB 4OZIB 4R26L 2UUDH 4N1HB 5D1ZB 3WS6A 1KULA 1PZ3A 1UH2A 3NIDF 1BBDH 4NO5A 1FIEA 3L5XH 3A5VA 1ZBVA 4LPVA 1PKOA 1HJUA 3IDJA 3RQ3A 1G6RL 2V9TA 1FVEA 5HGGS 3CZ8A 5GS0H 3C5SA 5BS0D 1NBQA 1KF9B 3IVKA 1MQRA 2VC2L 5FFLA 3L5HA 3GI9H 4UB0H 1QBLL 3TPKA 3CZEA 2UY3A 1MNUL 2FX8H 1EMTL 3ARQA 1B6DA 1U8PA 2EADA 2WUBH 2F5BL 3KYOA 3LKSA 4XMLL 2AJSL 3BGMA 3BDYH 1CDBA 3QHNA 3PWNB 4Y4HC 1P69B 3W9EA 1S3KL 3CJJA 4KXZI 2R1XA 3RWFA 1W3LA 3U7VA 2E7MA 2VJXA 3OG4B 2R4SL 5K9KB 2NW2A 2YUVA 4QWWD 4PRDB 1AD0A 4LVNC 4OCYH 3WKML 1OGTB 4HMCA 2ORBL 1EA9C 1QBMH 3C5ZB 4JPIB 3ULVH 1C7TA 4G6MH 4ZO6A 5HYQB 4FN0A 3ZM8A 4XZWA 3MRQA 2WBWB 1BX2A 5CMAA 3N9GL 1B4RA 3QQ9D 1QI0A 4HFWA 3T09A 5KTEH 5I15L 1KXTA 4BQ8A 4OTXH 2HJFB 3GI8H 1VRXA 1ZT7A 5JBEA 4K71B 1JUFB 5GS1B 4UUJB 2OSWA 1IKNC 3BX7C 1T5WB 4QHLA 5DT7A 3CK0L 4KJWD 1P4IH 3UTTB 3Q6FA 5IHSA 2A6IA 3TZVD 4JPKH 4RGNB 5ABEA 1ZT1B 5CS7A 4KKLD 5L2KA 1I1XA 3CX2A 3QYCA 5HDLA 4HEPG 3HE6A 2VVNA 4PJBB 5T1LA 5BZDA 4DUVA 3MOAL 1IAOA 2XM1A 3GBNH 3DX9B 3MJ9H 3C5ZA 4FQ2H 3VDAA 4HKBB 3WFDL 2YDSA 2EO1A 1Z2KA 3MCKA 3U83A 3KJ4C 5T33L 3SPVA 1EJOL 1Z3GL 1WP6A 1OSPL 1EGJA 4LLVB 4UOW0 4WJ5A 2WMHA 4JFXB 3MRBA 4KK5C 1Q94B 2XTJE 3B9DA 4GKOA 4Z7WE 4EN3C 1IKNA 4NZTL 5ILTL 5D70H 5JBFA 2XPGA 1RP9A 2H2PC 3K4DA 3MNZA 5T3XE 3WH6A 2DD8H 3R0MA 5J6GB 3IXAB 3CUIA 1Q0XL 3SGDH 3C60B 4XBPB 4Y4KD 2DQTL 2MNUA 5EO0B 3A24A 4NZUL 1K2DB 3S35H 2I5YH 1FIGL 3ARDA 3KPRB 3MLPA 3AU1B 2IPKB 5D7IF 4DGYH 3EYFB 1MWAB 2AXGA 4G6AC 1Q9KA 4X4ZA 1E4XI 5C0AA 3OAUL 2EH7L 1FVEB 1S3KH 1AI1L 4D6JA 4KK9D 2X4UA 2ED7A 1ORQB 5CLTA 5BRQA 4Y88A 4YHKH 4ZPVB 3VGAC 1KQYA 1F4HA 3I85A 4PJ5B 1T5XA 1OWQA 5FGBA 1DP0A 5H35A 5CZXC 2JIEA 5IQ7L 4TOYL 3IDYB 5DMIH 2ZWZA 1T2QH 4ZAKA 4W4OA 1F4XL 1NOWA 3PDOA 3QR3A 3VW3L 5HGDA 3LQMA 2BY2A 3WD5L 1JF1B 5C3LD 2HTKD 2WKGA 1YDPB 2GK0A 4OT1L 3IJ7A 2BJML 1M04A 3BPCA 1FG9C 3OKDA 4KI5E 5JOPE 4IMLA 2EYSA 5F3HA 1VA9A 4XP9L 1JGLH 2CBJA 4JGMA 5I1JH 1H8SA 1OGAE 3QUYC 1AXTL 1T1YA 1DQML 3VGAB 1OTTD 3FN9A 4G8GA 4EI5C 3FMGH 3IDNB 4JDVB 4EDWL 4R4ND 3GDBA 5HSFA 4O58H 4PJIB 1JRHI 5DZOA 2RFXA 4FQ1H 4JFSA 1XMWA 1S7UA 4JRYA 1SYSA 1I7ZA 5A2LH 4R4BB 4WNQA 5DR5H 3TOPA 3QWOB 2XFXA 3IDNA 1FOBA 3I9GL 3RX8A 3CLFH 4UQ3A 2RCSL 1RHHB 2HN7B 3MRRB 3DUUA 4B50A 1W72H 1BOGB 4G6JL 5F7EH 4K3DH 4BSVB 3R0NA 4LVOB 3O4OC 2QPSA 3VXTA 3CMOL 3ULUL 1V0LA 3SDDD 2R15A 4P4KD 3X17A 4XCFL 3DHJA 4M1CD 3OXRA 4X6EA 1S9XB 3U7AA 4ZYKA 1IEBB 1KCRH 1HCFX 2Q87A 4PGDA 1ECEA 2XFFA 1JCKA 5HVHC 3HNSL 1DBKL 1AI1H 4CD5A 3JWDC 5D6DA 1E70M 4HBCL 4UFKA 5HYQA 1MCDA 5JIKA 2YD1A 2NTSP 4YEEA 5IHUL 3B2UD 3LPFA 4KH2A 4OF3A 2W67A 3TV3H 4LVEA 3KLHC 1M7DA 4EN3D 1VERA 1RUPH 4PTXA 4X9HA 4JRYB 2TAAA 1QSFB 1T0NA 3BKCH 4DM2A 4FQQA 4F33B 3H7LA 2W63A 5CWSA 5I30L 5I1DB 2J7BA 4HIJA 4PUBL 2ADGB 2GITA 1ZLVK 1EQPA 4R90L 3OPZL 1GGTA 1Z0NA 4ZOCA 3TBSB 1A5FH 5HPOA 4Z76A 3NCEB 2G60L 4GQ9L 4POUB 5IVXA 2MHAA 5IWLA 3BE1L 4QRRA 3T3ME 1UZ4A 1IQWH 3QWRA 3VSUA 5KJRH 4W68A 1TVHA 5D1QC 4EDWH 2FL5B 1GHFL 3IVKB 5BXPA 3KPPB 4LSSL 1XF5A 4ESKA 1BTCA 3MNVB 1Q9OA 3TA3C 3UJIH 4FQIH 1NAKH 4PP1C 5D7IE 1TFHA 4CJ1A 4WI7A 1UENA 4Y4FC 1GC1H 3EOAB 1S7RA 3WD2A 2W07A 1OD0A 4JO4H 5F3BA 4U1KA 4ZOBA 2BSRA 2CIIB 4AZ7A 1L9MA 3HZ3A 3CHDA 2QMJA 1A6VH 3TNMB 3WJLC 5DQDH 4KMTH 5DR5L 4KY1H 5E2VL 1DDHB 3NAAH 5EO9B 1CFSA 4J3WA 3VGEA 5JIWA 4OCXH 1FL3A 3ET9F 5ANMA 1ZS8A 1QEWB 4TSBL 4TX6A 2OX5A 4NQEA 2NY4C 3FY1A 4W86A 1A7OL 1NC4A 1KIPB 2DQUL 1F8TH 1TTUA 4N8VG 5A40E 5A6MA 5E09A 1HSAB 2B20A 3D18A 4FFYH 2W1NA 2X70B 4HH9B 5CUSH 1F4WH 5DHVH 4HXBL 2A9NL 2BERA 3QO1B 1CD9B 2P42B 1CICD 1PG7H 1WWAX 4LIQL 1KR0A 3EFFB 3GNML 5DJ2B 4OF5A 5E5UB 2XTKA 4RFEB 3RBGA 1ONQA 4DTGH 2PW2B 2GY5A 3WMSA 2CERA 2KH2B 2LTQB 4F7PA 4X7FC 3EO0B 3I75B 4OV5A 2AK1H 5FYKH 3F7PC 3RKDC 4ZFOA 4KHXL 4AEFA 3D39D 4LHQB 4E9LA 1R3IL 4GRWH 1BOYA 4S1RL 1RH9A 5GGRA 4XBEH 5EIIA 3BMWA 2DBLL 4LHUD 1G0XA 4OAWB 1W8OA 5ABHA 3EMZA 3OAZH 4KK6C 3PGDA 3UBXG 3DHUA 2W38A 4G9FE 2A9ML 2LQRA 1MFCH 1BHGA 5C0IB 1I9RH 2FX9L 3O8XA 2G60H 2ARJQ 4NQXA 1VIWA 4GRLD 1QFOA 3LQAL 3M1BB 1KCSH 1EGJL 4X6FB 1RZKH 3PGFL 1D5XB 1P5UA 3N50A 5C0FA 2VERN 1G7HB 3BVWA 3VXSB 3NZHL 3OKEB 4M82A 1ADQL 5F9AC 3U36B 1FDLL 4O2CA 1A9EB 1AR1D 4LSUH 2VLME 3MRIA 4F8QA 1E1EA 5ESAA 3G5ZB 3WY2A 4GI8A 1FLTX 4DN4H 3MRCB 2UWEB 4BS0A 1LLOA 1ZOXA 1KWKA 3SCMA 5F93C 3ES6A 3WIFB 1LP9B 3VWJC 1B3YA 3NAAL 3T4YA 3LY6A 5IMLA 3SCQA 4LSDA 1MJJB 1BEYL 2EEAA 4GXUM 3PWLB 1XCXA 3RWEA 2X2JA 3QXAA 1QYGL 5H94B 2FECI 4XZBA 2Y8VA 1QBLH 3LKOA 4FXKA 2ZG1A 4OD3H 1BFVL 2GUOB 3CHEA 4W7VA 4M1GH 4PB0L 3RGVB 3SGKA 2YSSA 4N9GA 5B21A 2XVPA 1T22B 3T0ED 2FIKB 2KQNA 2X5PA 3N1FC 3O41B 3VXRB 1WK0A 3GMPA 1RJLA 1S7VA 1DBMH 2AXJA 5CAYB 1TJGL 1YEDB 2CLZB 5D6CA 5JHDA 1JGUL 1E0VA 3S88H 2J2ZA 4X7DC 1X5ZA 3SKNA 4W4NA 3VG9C 4LKCB 5DFVD 3BPOC 4Z7VE 2ZX8A 1I3RA 1KCVH 4P99A 3RDTB 3VGFA 2EDYA 3IANA 4K7FB 3ARGD 1WBXB 5ACMA 3TIEB 1HDMB 2NR6C 4GAYA 2P48B 3QJFA 3REVA 4EOWL 3IF1B 3VSTA 3JV0A 5SWSE 2DIJA 3D50A 2CR6A 3V0WL 4D3CL 4XNQA 3CCHA 4WLCA 2GJJA 2XOTA 3O2VH 2R2CA 1A7BA 3N06B 4YQXL 3H3KA 5DD0L 2XXMB 1P84K 5DK2A 5C0EB 3SE3C 4PJCF 5C07D 3UZVB 5FB8B 3G5VB 2YKLL 5B8CB 3RCNA 3MV9B 3WO4C 4LEXH 5FV2A 4LEOB 2V17L 2WM0A 2CITA 3F58L 1NSNL 2IPTH 4OZHB 1MW1A 1DR9A 1G9MC 5D72L 3L3KB 1KPRA 5TFSL 1UWXK 3KNBA 4QLJA 2PYEB 4Z5RA 1PGRB 3MOBH 3P9LB 1B0IA 4JRXB 5FYJL 3NFNA 4HUWB 5CSBA 1W3KA 4NC0B 4NRSA 3VFGL 1ZE3C 2G5BA 3WL1A 5BCAA 5J13C 5EN2A 3ZKSD 5FO9B 2DS4A 1N82A 2PXYB 3M8OH 4EIGB 4JM4L 1HL8A 2D0HA 3HG1A 3QIUC 3MUZ1 5EZIL 1B1YA 1QSED 4PFEA 3GRWH 1S9WB 2XNAA 1OAQH 3WIFA 4YXHH 3ARFC 5E6ID 1IT0A 5MERB 3DXAE 3KPLA 5EZOL 3RWEB 2NXYB 3VDHA 3CVIH 2A77H 2DQGH 2QQKH 4M6AA 4BZ1L 3O11A 3QB7C 4N0FA 2DQCH 1LP9A 3CVHL 3SY0B 3RY4A 1TCRA 1UCBL 1EH9A 3T2NL 3FJTA 4V27A 1WEJL 3WUWA 4JFVA 3CZFB 4ALAH 3FZUC 4XCCL 4IS6B 3BSHA 1W0VB 5JHDD 3O6AA 4PJFF 1C5DA 1I8IB 5D1QB 1V7NH 4EI6B 5JMOC 3L3HB 3QQ4B 4HLZG 1AD9B 1X5IA 1TZ7A 3TBVA 5IK3B 3MROB 2ALWA 3V5DA 4S0SD 3D3VA 3L6FB 4OJFL 4MGXA 4KZDH 3TN0B 3AMLA 2ATKA 1X3DA 3MLSH 4OZFG 3EHBD 5E0QA 3RX7A 5FA3A 1OF2B 4QGTA 3SGEI 3MRGA 2R0KH 4L4TB 3CO4A 2CBVA 1BOGA 3S2CA 2E4TA 2YPKB 3UEZA 4MJ6B 3EHBC 1CK0H 4YXLL 1BD2A 2Y4SA 4QGYA 4HA1A 1Q8MA 2NY2D 2BFGA 2DJUA 4X5XB 3KYNA 1CVSC 2VXQH 3HG2A 3CFDB 1UD2A 4NQVA 3OJDB 4AENB 4ERSH 5CD5D 1KTCA 1HKKA 4FLRA 3IAPA 4IBLT 2ORBH 1CICB 3SCMD 2CBUA 1TNMA 2BXZA 2DPEA 4EVNB 1IGJA 4P2QE 4DO4A 3S96B 5D7JA 1F58L 2CMRH 3QHOA 1A3LH 4PJ5D 1OAZL 1ZA3A 4NQTA 1MFUA 3BUIA 2PYFA 1IC5L 3BKMH 4L8DB 3ZKXC 1NL0L 2X7LB 5B39G 1K8IA 3OG2A 4QRUA 1FV1A 4KK8D 1LF1A 2X2YA 4S0TD 1GHSA 1U2YA 3IS0X 5EZJB 1T1YB 3DSFH 3EZJB 2DYPB 2RGLA 4LHUB 1BMGA 5DJCB 3UTQB 3RPKA 1C8PA 1DWAM 5BVPL 1S7QA 1ZHNA 3GMLB 4YGVA 4APQD 1WUNT 5JQ6H 5FYKE 4PGJA 3TNMA 3T4AA 3NFSL 3WENA 3PGCB 3BP7B 4X99B 4YNYB 2A77L 1S7RB 5EUOA 5KS9F 4TTGA 1UWEH 2ZKHH 4H26B 1GGUA 4Y2OA 1KJ2L 1IM9B 2VN4A 4DEPB 4P49A 3MLWH 3ZIZA 5AUMA 1BG4A 2Z35B 3QWQB 3T04D 4ALAL 2YD8A 4YZFF 1UB6B 4ZUVB 3EJSA 2Z4QB 1S9YA 2WP3O 4MNHB 4WI4A 1XIWA 3BCDA 1Q9KB 4JFEA 1DEDA 5BZWA 3QDGB 1UXWB 3C9NB 4ODUB 2E8YA 4GQ9H 5E1AA 4KJPC 1C5BL 4NKIL 4TX8A 1E4XH 4WIQA 4NQSB 4NZUH 3ZO9A 8A3HA 3O0RL 4H8WC 1G7PB 4KJQC 4RQQB 1ESWA 2F53B 4FFWD 2V3FA 1RP8A 2R2EB 4MDJA 1KTLB 1SBSH 4LSSH 4ZFMA 3MLYH 1X5FA 1CECA 4JFEE 5LWYL 2ZXBA 3RWIB 5JUEL 3SO3C 2FDMA 3BUQA 3L2MA 4FQXC 1GC1L 1N2RA 3H0TA 4G43A 3KPTA 3QQNA 4LCWA 3SO3B 4NZRL 2J6EH 5ICYB 2Z92A 1M7DB 5DC4B 5GGQL 1W1TA 1F00I 5EUOF 2D73A 2C3GA 3WO4B 4OD2B 5E2JA 4EQ3A 3VH8B 4OSUL 2B2XL 1DLFH 5ECJE 3BVUA 1AGDA 4JFPB 3LB6C 3BZEA 5IBUB 4YDKH 3AM8C 3GJFH 4MJIE 2VXVH 3TBWA 4M3JA 5IIEB 3WIHA 5FK9B 2RIKA 2OJEA 4ZENA 4LRNL 3DECA 2J4GA 2Z0BA 5DUBB 5E8OA 4DZ8A 3LX9A 1RZJL 2G75A 3ZTNL 1XCTA 2IH1A 2VXSL 4EN3B 1MXGA 5CJQL 1QRNA 1UR2A 4WNQB 2RGMA 2XSBA 1TTGA 3NFSH 1I7UB 2K3TA 2DQFB 2HFFA 5FUZH 2GQHA 3LQZB 4ZUSA 3RFZC 4HS3A 5IB1A 4HGWA 4NQCE 2HMID 1JE6A 4PJCA 1CGUA 5IM7B 5KBNC 4QRSB 5FYKL 4N8VA 4C56B 3GMQA 1V0MA 1HJVA 2V2XB 3MLTB 3K8LA 4UU9A 1OB0A 6A3HA 2UZYB 2BHZA 1JL8A 2FWOA 2JK5B 1GQKA 1YEFH 4NQCA 4ZOEA 4HGKC 2I26N 1QW9A 2DSVA 4IMLB 5CXPA 1I9RL 4K9EC 5EBAA 5E8NA 1RIHH 2Z93A 1NCDL 3OJ2C 1U33A 1R3KA 5GPRA 1EHAA 1JZ7A 3VGHA 4YDLC 3UZEA 3FRPA 4DUXA 3U57A 2Z35A 2EBNA 2AQ2A 3I6KA 4OIAA 4X98B 3QUMB 4P9HL 5IQ9B 3UTOA 1NUDA 3H3PH 4H5SB 1T0OA 4XHJC 3NIDE 4U1LB 3KPOA 3ZE0E 4XPBH 3GHBL 4CVUA 4H0HB 5HVGB 3O4LD 4WWKB 2XWDA 2XVGA 4NKDA 5KEZA 3MFGB 3DX6A 4ZPVA 3HI6H 1I8LA 2Y24A 4XBGB 3VFMA 5K9QI 1K2DA 1E4IA 4IRJB 2GSIA 3WLWD 1R0AL 4PUBH 3GJFA 1G9EA 4CMHB 1IGML 1JVKA 4HIHA 4XAKE 2EKSB 3VXOB 1A4JA 3I3DA 3QNYA 5F72S 4B7LA 4JM2B 5E5RB 4PBWD 3QPQD 4ZXOA 4G8GD 2DTSA 4M9OA 1JHKL 2BFVL 3VWJD 2WCSA 4HZLB 4H25A 1DVFA 4HIXH 4PJAE 1Q6FA 3BN9C 4FTVA 4Z7UB 3ME0A 4PTVA 3BVNB 1OP5H 4X4ME 3GUTB 5DK3A 1D6VL 1H11A 2YDRA 3D39E 2FGWL 1DBML 1FYHB 4URIA 1HH6A 1Q94A 4OFPA 1KB5B 5I2IB 5JXEA 4PCTA 3QI9C 4J1UB 4AXNA 2H2SC 5CCKH 4C56E 5ADOH 1NJ9B 3QXWA 2E9BA 4Z78A 4M5YH 5E2UL 5CBAA 5ESQA 1FFNB 3BW9A 1UWSA 2V7NA 3IS1X 3MJ7B 3PNWA 5A6SA 4KK6D 3FT3B 4MD4B 1TVPA 3GBMH 3HNTL 3OZ9L 1DQTA 2BVQB 2AEPL 2VL5B 2OZ4L 5EOCL 4NPYB 2WWKO 3U5UA 3C2AL 2YXMA 4X0VA 4R0LA 1Y0LB 4HULB 2B1AH 3PWPE 3MLVH 4PR5B 2DQEL 5TPWH 1C5CL 1CT8B 4IDJL 4LX4A 2Y6SC 3DIFB 1JGVH 1T6VN 2DIEA 3ALWA 4FLSA 2ZOLA 5FUOH 2A9NH 1E3ZA 3MJ8B 4M80A 3L4TA 5LXGL 3VFTB 4Q9QL 3AMKA 2P8LA 2GTZA 4FQPA 1BGAA 3K2MC 3VU2A 5BMFL 1NSNH 2W0FB 1FZKA 3ULVF 4FK9A 5HHOA 3VIMA 1WSST 5EC2B 2AJXL 1CXIA 4X9GA 2IPUG 4APQB 2BY1A 5FYJH 5C0RL 3CDGB 5HOSA 2PWDA 1HILA 4RGND 3EYQD 1TPXC 3VFNB 1FHLA 3QISA 4P5MA 3FT2A 5HBFA 4NI3A 3DRTA 4UV7L 5C09E 4Y8DC 3VA6A 3VNZA 1LDPL 1VAHA 3B2VL 1XV8A 1L7TL 3VXMB 1OHQA 5JPNA 2V5YA 1C16A 3QR2A 5HI4D 4JG0H 1FZJA 2FJGB 4PJ7A 4AT6A 4HS6B 4E2OA 3ZE1F 2AJ3A 4J12A 4X6DA 1W0WA 3QHFH 2J88L 2PCPA 1YMHB 2GJ6E 3N1AA 4Q58C 4BQBA 1NGWA 3JUZA 4PJ8B 1GQIA 4WUUD 4XP4L 4WW2F 3PDDA 2NW3B 2O5XH 1GJIA 2YIHA 3AZTA 4Y89A 4FXGA 4UOJA 4M93B 5C8BB 1CPUA 2WAGA 4BZ1H 3U7WH 2ADJB 5CFHA 3LEYH 1AGEB 3CH1B 1DWFM 3F6LA 1I3UA 1OCWL 3SDYH 3VA2C 5B8CC 5ALBL 1GOIA 4ZFZB 3C8HA 3H9SE 4NQDB 4PYHA 3TN0D 1QA9B 3IDMA 4U6XB 1UWUA 3FAWA 4W7UA 3FB8B 1AHWA 4RZCB 1K8IB 32C2B 4L4VE 2EPOA 1YEEL 1RJZB 1TIUA 5AYUL 5FECA 5T1KD 1YYML 1YPZF 2GSGB 4R8WL 1ZVHA 3RX5A 3VFSB 1JG9A 1HVQA 2BVPB 1QSEA 4YPJA 3U30C 4ZFFA 2VLJE 1JNLL 3KLSA 1BVKA 4TPRH 3WD3A 1JRHL 5DO8A 3D85A 2D7OA 2JFEX 5LBSH 1J87A 4RBPK 1QD0A 3ECBB 2FB4H 3O9WB 3VRLE 4F37F 4MX7A 2H3NA 3DVGB 2D7PA 4PJ9D 4DFIA 3ULSB 4HJGB 1DANU 1E4LA 4O51A 2C1OA 3SKMA 2WANA 4NRZB 1RURL 2EE6A 2OYLA 4HCRH 5I0ZA 3L5WA 1SQ2N 2XIBA 5C08B 2J25A 4CGTA 1JNHB 2WBJA 1QVBA 4L3EB 4QXGH 1UM5L 3SUTA 1T0MB 1IC5H 2SEBA 4LLQA 3FFCE 3LKOB 4FXKB 5E9DB 4RGNE 4JQVC 4YHOH 3QUYB 1N59B 2CDGB 2P24B 1P7QD 1MAJA 3PWLA 1J8HE 4KK9C 3RILA 4D0BB 2VCAA 5DI8A 3VG0L 4KI5D 3SDXA 1QLFB 4BFGA 4LAQL 4IRSA 4JREC 4MD0B 1HE7A 4QF1A 2H26A 1WWWX 3CAFA 4D9LH 2WKLA 3NN8A 3G5ZA 4JG1H 4U2ZA 2C26A 3LEYL 5A94A 4R7DB 2XN0A 4YHLL 2Q8AH 5I1IL 5A95A 1PX3A 4MAUH 4JFTA 4AZGA 2H32B 4GSDH 1E6OH 3SDXE 3QIBA 1E4MM 4X5LA 3GIVA 3L7EA 5LQBL 1CQYA 2X4QB 5TQ0L 3P0YL 3PWPD 4RX4D 1M53A 2CGRH 3SCSA 4CN4A 3W4RA 3INUH 4GRLC 4CD7A 3IJYA 4JFWA 4WEBL 1LD9B 3MRJB 3TYGL 4ZSOA 1S5HA 5ID1B 1H3WM 1YEEH 2PCPB 4HS8H 3BD5A 4NQED 5IVXF 5C9KA 1SJXA 3Q3GB 4FA8A 1JPGB 4KDTC 1BFNA 4FFZH 8FABA 1OIMA 1UXSB 2F19H 4JJHA 3BSGA 4FZEL 3VX1A 1LO3L 2ITCB 4QNPF 4E42A 3BLPX 4G8EB 3F7QA 4WO4A 4ETYA 4KZEH 3I75A 1GXEA 3SCMC 2PO6B 4KJPD 4F3FA 3VDCA 3VFNA 4TNWF 4FQHB 1GGCH 1HI6A 3CLEH 3PIQA 4MX7B 1TUXA 4PRAA 5E99H 2YN3A 3L3IA 3NACL 4Z7NE 1E6ZA 1I85C 1KNOB 4LEOA 2CLRB 3N15A 3VWKB 1H3PL 1YY8A 1Y18B 4J6RH 3WNPA 1G0CA 2VCCA 3RGVD 4OSUH 3NA9L 3PWUB 3G6JB 3O3EB 3SN6N 3W82A 1KBKA 1ZANH 1I3GH 5KTEL 1FH5H 2VDLL 1Q1JL 5D7SH 2ZUQB 1JZ8A 2A6JA 4L8BB 4QYOB 1BIIB 3D0VB 2JJVA 3FQRA 1MCCA 3FO0H 4DUWA 2CBIA 4UI2A 4M61A 4XPGH 2FYYA 4GRLA 4WW2B 1E3XA 1TQSA 1JTTA 3IFLL 4JM2F 2AJUL 4LKCA 4IIQA 4A2LA 1A3QA 3A21A 5T3XD 2J8OA 3LKQA 2HT3D 3MV7B 1HSBA 4U1KB 4D9LL 3IRZA 1GZPA 3FT3A 4MD4A 3QPXH 3A67H 4P5TC 5GJTH 3HI5H 2YLLA 2BMKB 3THDA 4JFFB 4JKMA 3GXTA 4EAMA 3ARWA 3OG6B 4G5ZH 1GGBL 3TF7C 3L9RA 3TCXA 2FZ3A 3IFPB 4FNUA 4B9YA 5F7HA 4NOFA 4HWZB 3RY6C 1W9PA 2NZIA 3ULUE 3D4YA 5HYJB 1M05B 5I73B 4I18C 4FLQA 1MCNA 1OAZH 5I8EB 4OCMC 4H8HA 2X8RA 2OTUB 1NCAL 2QKIB 5IESL 4JR9L 4Y5YB 1M7XA 2IADB 5I1DA 1ACYL 3DSFL 4LCCB 4TRPH 4OLWH 1HNGA 2DDQL 1QR1A 1J0IA 2BY3A 5JQ6L 1JAKA 3C09B 1Z32X 4NQCD 5F7DA 1GPOL 1HINL 4FFVC 1D3CA 4D8PB 5INDA 4XNYL 2MMXA 1KIQB 3BO8A 2EE2A 4L5FL 5IGXL 2XZAH 2LTQC 2Q76B 1LWHA 4JL2A 1GOGA 3S5YA 1YECL 1WBZA 2X05A 3DO7A 1T2QL 4HT1H 2XG4A 5DHVA 1UOKA 4ZYKB 1EK3A 2ZJSL 2O5ZL 5CIPH 2R29H 5LCVL 1NCWL 3CGTA 4PY7B 5J0BA 3CXDH 4NFCA 2VRAA 3ARZA 1B4JL 5IWLC 3T0XA 4NZFA 4JRYE 1D5BB 1EDGA 4ZUWB 1A6TA 1T21B 2R0ZL 2IFGA 2VUYA 3ESVF 3OXRB 4HWBA 1SJEB 2V3DA 5D9MA 3U9UB 4XPGL 4F58L 2I9TB 5DJ0A 3VJ6B 4HIXL 2V9RA 2VL5A 4R97C 2MFNA 3N1QC 3VXTB 4XT1C 1CXFA 1RULH 4UQCA 2W92A 1CGWA