1GVIA

Thermus maltogenic amylase in complex with beta-cd
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
588
structure length
588
Chain Sequence
MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPAISPKGARPWGSEDPTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGAASRYKDWFHIREFPLQTEPRPNYDTFAFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGLIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRALRRGDVAFLTADDEVNHLVYAKTDGNETVMIIINRSNEAAEIPMPIDARGKWLVNLLTGERFAAEAETLCVSLPPYGFVLYAVESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALTOGENIC AMYLASE
publication title Cyclomaltodextrinase, Neopullulanase, and Maltogenic Amylase are Nearly Indistinguishable from Each Other
pubmed doi rcsb
source organism Thermus sp.
molecule tags Hydrolase
total genus 165
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gviA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gviA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gviA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1gviA03
4AH2A 3V4UL 1RZJL 3DV6A 2COQA 4K94L 2J7DA 1FH5H 2W0FB 3TBTA 4OZHE 1HHGB 2YBRA 2W62A 2FO4A 1MI5B 1C1EL 3GSXA 2PWEA 1RUML 2YDSA 1ZHKB 5D9NA 1Q38A 1FFNA 5BZDA 3RL1B 3EOTH 4LP4A 4BM7A 3EYVA 4I18B 1LD9B 1OF2A 2V17H 3U1SH 5AD0B 5ESAA 3U4BH 4UQAA 4RNRB 4NUGH 1IKFH 5T1KA 3DSFL 1K4DB 2BFVL 1K9FA 5JIHA 2KZ1B 4JN2A 3BPOB 1CLXA 1QUNA 4L4VA 4LKXB 1ISVA 4D6EA 3THML 3EO0A 5IW3A 3KYOA 3X3FL 3AHXA 4KVCL 5F6HI 4W89A 1WF5A 4WV1C 2VDPL 2PUQT 3TBYB 1T1WB 3F7PC 3QEHA 4M1RA 2O93L 1XGYL 1LEKA 2Y6SD 1F4YL 5JIIA 3LY6A 5D2LE 5HHQB 2EPLX 1T66D 1MHCA 1S7UA 2OZ4L 4G8IB 2J7GA 1YNLL 1U58A 5D7KD 1QX1A 1Z3GH 3NIGE 3LKPA 4HJGB 5KOMC 5IIEA 3MROB 5CUSH 1E6RA 4UZSA 1B6UA 1R3IL 4P2QB 3SKOA 4TUJA 5FYKE 5IVXA 3EOAB 3AB0C 2XACC 3N1QC 2WHLA 3QHMA 1LP9A 5F96H 4PD4K 4RFOL 5D1QB 3HTLX 3L2LA 2IUZA 4BA8A 2KBGA 3OHXB 4PJHB 1UZ6F 4PG2C 3V7AE 1JAEA 3LHPL 3D3VB 1CWVA 4M62H 2WWKT 3KWWB 5ITFA 4DOHE 2I5YH 5I1DA 3LIZL 4OV5A 1FORL 4W4NA 1GGUA 3FO0L 4LASH 2VIRB 1RMFH 1BFOB 5CSZB 3TA3B 3FQXB 1EGJA 2NNAA 2ED9A 4L4JA 4K9EL 2BSTA 3L4XA 1YYML 3U0TB 3E8UL 4KUZL 2X1WL 3DX3A 3WUWB 1A5FL 1ZTXH 4FFWD 2YA1A 4CADA 2DYPA 3V6ZB 1PQZA 3BPCA 4NGHH 2Q8AH 4D1IA 1QA9A 1AI1L 2VJXA 3CPUA 4ZUTA 3JV0A 3MR9B 2W60B 3OJMB 4WDIB 4FQJL 4QP0A 3LN4A 4U1NA 3O2DH 2F58L 3ULSA 1B3YA 1N2RB 4O02H 3O3DB 4J3TA 1QPKA 1F6AA 1U8LA 2JE8A 1Y6MR 3LPWA 5CJXA 1J12A 4HWBH 4PJDB 3RUGA 1I1AA 4HAGA 2WLYA 3BGAA 1NSNH 2PW1B 4KKCC 4U1SA 3RWDA 3QNZB 2UWEF 2RGSA 5MEPB 3VXTB 1WZLA 1A8JH 5E08H 1MCPL 2X89D 3QDAA 4AYGA 5E70A 5HDQL 3D87B 1KPRA 1L0XA 3QAZC 2WHJA 2XQYK 3B5GA 5IHSA 3QSKB 2XN9B 2P5WD 2XA8H 1OSPL 3PZOA 4HA4A 1RP9A 4PJ9C 1PX8A 3BUQA 1WCBA 3APGA 3AXLB 4HIHB 4CD5A 5MERB 2O61B 3ZHKA 1CLOH 3UC0H 4MCYA 5A16A 3WN5A 3SE9H 2Z8RA 3EYOB 4K7PX 1UD5A 4NQSA 1IAKB 1XGUB 1GORA 5EIIA 1CLCA 2FJFA 1XF4B 3NYDA 4YNYA 3D25B 3SCTA 5F72S 2WBJA 1HEZB 3JTSB 3BKML 4ODUB 2Z92A 5DQDH 5TE7H 3ARUA 3GSRA 4EOWL 4RE4A 2AGJH 1T6WA 3KPRD 3RJXA 1BJMA 4UT7H 2ORBL 2A6KB 5GNZA 2EEDA 4NCDA 1OAZH 3L5JA 5IK3A 3V5KB 1UUQA 3RKPA 3SGJC 4EUPA 2G60H 3OAZK 1MQ8A 4YHYC 5IHRA 4LSRL 4KDWA 2FBJL 4QYOA 1XIWC 3C87A 3G5VA 3KNBB 2CD0A 4L9DA 2A6JA 4W68A 2ICWA 5CHNA 7CGTA 2IANB 3V6BR 1WBXB 5BXTA 4PGEA 4JZJC 1T6VN 3H9SB 5B22A 1EUTA 1CXIA 2MPAH 1DDHA 4FK9A 2E8ZA 3STLB 3RPMA 1HYSC 2VERN 4RDQG 1KN4H 4HJ0D 4G9FD 2NY4B 4HH9B 3QDMA 4U05A 5J6HB 4L3CB 1UZ6E 2NTSP 2WAGA 4CMMB 5IJKC 1GOQA 4GW4A 5CZVH 3DUSA 1VAHA 2IBGA 5HYJA 3IDJA 1BF2A 3HUJF 3L5HA 3V0AC 1XF5B 4OF0A 1KGXA 3EFDL 2OXGA 4JFEE 4N0UE 1RVFH 4F9LC 2VE6A 5BV7B 5BS0B 1KTRL 1EOMA 2VLRA 3CZEA 5GS3A 5GJTH 4OZHB 3P9LA 4M3KB 5AG9A 3BAEH 5J12B 5CILH 3L9RA 3D51A 2W0KA 1KR0A 2HT3C 4Y16B 5E8EA 1DWFM 3LV3B 4HFUH 4O4YH 2VAAB 4PTWA 5FOBA 4RE2A 5CZKA 3DETC 4Y89A 4G3YL 2CKBL 2UWEE 5CEZH 2VO5A 4HS8H 3BWUC 1FGNL 4A6YL 4H8HA 5FUOL 3MNWB 1O7SA 4FHBD 2Y2WA 1A6VH 1FZMB 4Y5XB 4L3EA 5T3XD 1TQWA 2ZOXA 1ZT4B 2QMKA 2PO6C 4WJXA 3ZYJA 1GONA 1P7QB 4TSBL 5T1LD 4AEEA 1I9RL 3NIFE 4I1NB 4R4FL 2GJ6E 3TO2A 4AXNA 1US3A 4P59H 2WMGA 3FB7B 2HYMA 2Q3AA 5DQ9B 1YDPB 1JI1A 5D2LB 2YA2A 4GRLA 4LQFL 1Q9OA 3LN9A 3P73A 4EVNA 4HT1H 1W72B 2HAZA 1SYVA 3QDJE 1NAMB 4W81A 5GS0H 1FHLA 1G0DA 5SWZE 3UERA 3SKJH 1MRCL 3ARRA 3O45A 3WJLA 4QXUL 4XB3A 5FO9A 2E9LA 5I1GL 3CVIL 4LCWD 2YZ8A 1FRGL 1LEIA 2YPLA 4GSDL 4J8RA 4HG4J 5L88H 2B39A 1JP5A 3CLEH 5JO5B 2VCCA 3MLUL 5GS2D 2CBIA 1BYBA 2BRRL 1YEDB 5F89A 1JHLL 4DOHB 1DQLL 3QWOA 2BS9A 5H2BB 3ET9F 1I7ZB 3ZKXC 2D03L 1UA6H 3M7SA 1UR2A 4MDPA 4ZFOL 1JDCA 1Q6GA 2QQQA 3CFJB 4KRMB 5CGTA 3S3PA 3EJRA 5I23A 4YFEA 5F93C 1DBKL 4LSSL 5IBTL 4HK3N 4KMTH 3T0EC 4G5ZH 1YNKH 4GLRI 2DTSA 5JXEC 2WWDA 2EKSA 3SE3A 5EH1A 1E70M 1HXJA 1CR9H 2HLAA 4P7OA 3GIZL 2FR4B 4WJ5B 1VFAB 2VT0A 3ILPA 4F15B 5D4YA 5CEZE 3VW3H 5D7JC 5E8DH 5F7DA 3CHCA 2LABA 2APVA 3BXNB 5A3IC 2CNCA 2N1KA 5DEGB 3WXVL 3VTRA 4MDJA 3WD2A 3GMNA 1KR1A 1PZ5A 3QEGH 3B9KC 5DUPL 3ULUD 3JUYA 4PMZA 4PYGA 3NAAH 3TTQA 3OXSB 4U2ZA 1T1XA 5EC1A 2VLKE 5JOPE 1AGFB 4FXKB 1BD2D 3MCKA 4XMKH 3FQTA 4CGTA 3SHSA 3BPNC 4AD4A 3O3AB 5E7FA 1D5ZB 4F80A 4K55A 5KS9F 5LA2A 1MFBL 4OI9A 2GT9B 5LXGH 2VLJE 1HYSD 3TIDB 4I13B 5J3HD 4RZCB 3WY4A 4DZ8A 2YDQA 1FH9A 1ZXQA 5INDA 2EIDA 4OJYA 4PJIF 4KMQA 2R1WB 5A8NA 4M1DL 1UM5L 3HG2A 4DWHA 1GAFL 1RJZB 4EIGB 2BMKA 1W0VB 1GOKA 4RX4A 4TVCA 1KEMH 1NLBL 4YO0A 3A5VA 1E55A 3RNKA 1XH0A 4XNUL 3RM8A 2VH5H 1QSZA 3BQUC 1S9YA 3RA7L 5LYRA 3U46A 3P11H 2WMFA 4KTDL 3RWGB 4D0BA 1E27A 3STZB 5BVPH 1K9DA 4R27A 2CDEB 5ELIA 5EO1B 5EU5B 2F5AL 1MOEA 2RJMA 4WFGE 5C8JA 2Z93B 5CP7B 1JI2A 4FMVA 3MV7D 1MJUH 5C0BD 4GBXA 3PTQA 5CGYC 1GOIA 1Q72H 2EDHA 1ONQB 1C12B 2V5SA 4JJ5B 4KK6D 4UQ2A 2VZSA 2WVUA 5LG1A 3QCVL 2HT3D 2RFXA 5I18H 4J4PD 4JQVC 5I5RA 1T7VA 1G7JB 1FVCB 3IFNH 4Z7VF 4NZCA 4D6DA 5F7MC 3KPLA 5I17B 4WKFA 2B4CL 1UZ4A 3DROA 4NFCA 3VXNB 1SEBA 4NHUA 3OLDA 3DETD 3QCUH 3LMJL 4S1DD 3IXTA 2NQCA 5F7NC 4KJPC 1QR1B 1ODZA 1YNTA 1AKJA 1RH9A 1OQXA 2DJ4A 1K6QL 4M4RA 2G3MA 3V0VB 1KGWA 3HN3A 1DWIM 3QEQA 5J4MA 4N0UB 3SPVB 4DAGL 3TO4C 3TWCL 2ALWA 5I1KH 3N9GL 2FRGP 4G80B 1A0QL 2OYKA 1QFHA 1M03A 2V9RA 2VDRH 1FL5B 4I48A 1IC7H 1QBBA 2DS4A 3TT3L 4QY8B 3O6FD 3OB0K 2HMIC 1A6UL 4JFHD 2EPMX 2NXZC 1WUNT 1Y18B 3INUL 4E8DA 5E4EC 4HIEA 4GKNA 4JREC 1GYAA 3GFUA 4FXGA 3WD1A 1MH5B 2QL1A 3PWUB 1HNFA 3GMMB 2Q8BL 1XC6A 2AEPH 2UWEB 3S6CA 1ZVYA 5DO2D 3L95A 3MRLB 2P8LA 4MAYC 3NGBB 5LWYL 3TYFB 3GXNA 1QPPA 1R3JA 1J0KA 5E9DA 2FX8H 2AXJA 5FYJD 1LO0L 1MEXH 5INCA 4BUHA 1A7QL 4X83A 1A7RL 5JHDD 1DN0A 3ESVF 3Q0HA 2MKWA 1QWNA 2PCPB 4AZ7A 3C5ZA 2CK0H 5E6IC 1SEQL 1OARH 1E6OH 2GJ6B 4I0PC 3V5DB 1N5YH 4M80A 2HRLA 1KB5H 4R97B 1ZVSA 4PMYA 5J57B 1LJYA 1N4XH 2Y06H 4MLSA 4RMQA 2R0LH 2YIHA 3BGFB 3QDJB 1HKLL 1F4HA 1KFAL 1TIUA 3MO1B 5EC2B 5ADPH 4UQEA 2CYGA 3WO3B 1HKIA 2I25N 5SWZB 4HWEH 5ENWA 1YYLH 2PWHA 2KPNA 1KIPB 1P4IL 1I1YA 3TESA 1JWMA 3S4SA 3BH8B 5D7JD 1A4KA 5JR1L 3OKDA 5D72H 5A3ID 3DYMA 3D85B 1F5WA 1EDGA 1IEBA 3SDXF 2DJSA 3QFJD 4X0KA 2X70A 3SCMA 3WFHA 4U1HA 4ZMAT 3EZ8A 1GOGA 3W5MA 2P49B 4JFPB 2OL3L 4NOBA 2Y07L 3ZYOA 5KSAA 4NNPL 2FJGB 3M1BB 3VJ6B 2ENSA 1ORSB 4Z7VE 3FB5A 3DNKA 2ZPKL 4AM0B 2FJHA 4PJAA 4OSUH 2OI9B 1PLGL 2F53D 1S5HA 3KXFD 4ACYA 4P46A 3JV4A 4LLDB 5K59F 3OXRB 4IMKA 1E5NA 5IB4A 2ZUUA 1EHLL 3OAUL 2ICCA 4JFDD 3BSHA 4PRDB 4MB5A 3BQUD 1C92A 4XC3L 4XVTL 3WUGA 3F6IA 2WWMD 3OG6B 1HSAA 1AHWB 3W29A 1U2HA 3JTTB 1NOFA 4UB0L 5I1IH 4GO9A 3N11A 3GMPA 3U7YL 1NCBL 1W3JA 5EZIL 4MD4A 3VVGA 3OB8A 5I9QB 3S35X 1JUFA 3O6ML 1YPZE 4P3CH 3H9ZA 2F19L 2AERT 4GQRA 4HLZH 3VI3E 2AJXH 3LEVH 1NUNB 4K07A 2NCMA 4JRWA 4ZPVA 1A4JA 2W5FA 4CJ1A 2IGFH 4HEPG 1JTPA 1X4XA 2KQMA 3R8BB 4M29A 1G7LA 1FDLH 4NQVB 4JJHA 4WI6A 1J18A 3HZKA 3C09B 5JOFB 2F61A 5C9JB 1BLNA 4X6BA 5JW3H 5IFPA 3G5YB 5GRYA 3VGAB 4GKSA 1G7PB 1H2JA 4XI5C 1ZT1A 4KJPD 1XR8A 3SGDI 2A6DB 2AJZB 2LE9A 4H2CA 4OQTA 1CBVL 5D5MF 1RU9H 4LF3A 4RA3A 1FN4A 3O81A 2BSRB 1A7PH 2ZX8A 1E6XM 1N6VA 2P44B 1BVKB 2OP4H 3BRGC 1B0WA 1FGVH 2NTFA 2FHFA 5HHOA 2BC4B 1R8LA 3EZJB 4W4OC 3T65B 1GOMA 3ALWA 1HSBA 4PJEA 3SDDD 2KH2B 4NSBA 3WL9B 1G7HB 4PRPD 2BJML 4FQQB 4OCMC 5HPMB 1FJ1A 4OT1L 1AGDB 2AEIT 3SCOA 1MFAH 1E4WL 1I8LA 1NBZA 4M03A 1F4XL 3VA2C 4H8VA 4JY4A 4K7FB 4FFYH 2Z31A 1RSFA 5AAWA 2CIIB 5IQ9A 1YC7A 2X9YA 5IB3B 3KL3A 4P4KA 3QIWA 4GS7B 4YWGL 4XGZB 3N13A 3P2TA 4WI3A 1RD6A 3E6HB 3MCLL 4V2XA 3SDXE 4U6XA 5IMLA 3VO0A 3S34H 5F1SA 2ZSWB 3WEOA 3CSYA 2IQ9L 1HYRC 1B0GB 1HKJA 1DHKA 1P2CA 2DM3A 1UHVA 1H8NA 3H3PH 4IMLB 3MA9H 2XQBH 5A8QA 4HK3J 3EW3B 5CBAB 4YHIA 4I3SH 1IGMH 4JFSA 1FH7A 4F9PA 3MRJA 4HS3A 1CDBA 2CRZA 3WKNA 5CLTA 4X9FA 3WFDH 2VITA 4MAVA 3GI9H 1MIML 1DQDH 2F54E 2X9WA 3U82B 4YXLL 3PGCA 5IW6A 4M6ML 3MJ6A 3VG9C 1U8OA 5K59E 3AMCA 3D39E 3O9WB 3SDYL 2WINA 4PRWA 2OSLB 1E9LA 5FV2A 1JFQL 2EPKX 3S5LB 3SDCC 5B21A 3VXPB 4NNXA 4XVJH 3C08L 3DUUB 5A6LA 2VZOA 3VFPA 1T21B 4KH2A 4MJIE 4PBXA 4AIOA 1U8HA 4WWKA 1E4MM 2DI9A 1BFVH 5IW1B 1XZ0A 5DJ6B 1CEOA 1VACA 2YRLA 5BVJA 2X7LB 4HLZG 1HE7A 4OIFA 1OCWL 2HTKD 5IHZA 3VH8A 3W2DL 2C4XA 2VC2L 2R9HD 4GXVL 1IAIM 4OI8A 5HHMD 5DJXA 3TBSB 4JO4L 4ACZB 5B4MC 2MFNA 3M8OH 1KTDB 5JPNA 1L0PA 2J4WH 1E71M 2VL5B 2X4PA 1U95B 3MQIA 3S96B 2HVMA 3MBEA 3MRKB 5DI8B 4PJIB 1HXKA 3QUMH 3RIAK 4BSJA 5HJ3A 5D93B 3VD5A 1QNSA 3HG1D 2VQ1A 4GMSH 4H0GA 4NM8H 5I15H 2AK1H 1YN6A 5I76B 4V2BA 2F18A 1OAUH 5EDXA 5BCAA 3OLIA 3W25A 3HU7A 4PGBB 5D96C 1CE1H 2ZX9A 3ZKMD 3MJ8A 5I16A 4H7VA 5D9SB 5MEND 2ZUVA 1FSKB 1K8IB 4Y19E 3R06A 3QXVA 3CU7A 1A3LL 1WICA 4JQXA 3WD4A 1OBAA 3T1FA 3E3QC 5KVEH 4XMLL 3RAJH 4L4TE 1P9MC 3C60B 3HCVA 4AIZA 2R1YA 2WCSA 5IB2B 1FFQA 2CQVA 4EXKA 4QOKD 1MFVA 5J9PB 2GI7A 4Z7VB 3QHNA 3BZFA 1H5BA 3QIBD 5L2KA 2R69L 1KBKA 4KC3B 1D2KA 1RURL 1UR1A 4ZAKA 2R2HB 3MNVA 1I4FB 1MCDA 3WIIL 5J89A 1ZLUK 1JYVA 4WFFD 3BKCH 4G8GD 1J8HD 2OYPA 4XVSH 1H0IA 1GQIA 2DJUA 4HZLA 4Q0XL 3IDNA 4LSDA 5EUOA 5BXFB 1JD7A 4XI5D 1BFTA 2IAMC 1IAIL 4TUKH 1N0XL 1WIOA 1N26A 4Q9BA 2W63A 4XBEH 3KPMA 4N5EC 1ZS8B 2CMRH 4EEEA 3MYJB 4X9GA 4YHZH 5JHLL 2MCG1 1TCRB 1OD9A 1P7KA 5EZJB 5L6YH 3ZR6A 2EDJA 5HBFA 3I6KB 1EHAA 3NSMA 5EG6C 3O2WL 2DQDL 4LOUC 4N0YL 1R47A 1KB5B 3P30H 2D31B 1I8MB 2WSPA 3QZWB 4MHHI 4HZAA 4MNMA 1FIGL 1T2QH 4LSQH 3MX0A 5EIVA 1BZ9B 5F7HA 5JW5A 2X8RA 1KGCE 3DRTA 3PP4L 2XVKA 1Q1JH 1J05A 1EV2E 4F8TA 3WIHL 3FTGB 5C2BL 1OD8A 2Q7YA 1P4LA 4H41A 4E8CA 5IT2H 4LKCA 4PEEA 3D9AH 1VHPA 3HZMA 3CFIC 4RBPH 1BQHG 3RWEA 1AXSB 3TV8A 4JFFA 3WELA 2WHKA 3FOMB 3GMRB 4RISL 1DQTA 5DFAA 1IQWH 4AIUA 4XPGL 1G9MC 2X4OB 3QEUA 1BQLL 3C2SA 3U1SL 1V6UA 1PGRB 2B5IC 5CMAB 1U92B 4PJCF 2W91A 3ALPA 1DBML 3EYSL 1EA9C 4I77H 5DC4B 1NFIA 1Q0XL 3BIBX 4BS0A 4MZ3A 3UX9B 4S1SL 6FABH 3CSBA 3WHE0 3UPCA 1T04A 1NP0A 4YDKH 2IADA 1A6ZB 1R3KA 2V2XA 4PB0H 4P9HL 3WE6B 4TX6A 2EDBA 2P5ED 3UJTL 3WQ5A 1PBGA 5BRZA 1KXVA 2E7HA 5A1AA 5DJDA 1E4NA 3LH2H 2WVSA 3T77A 3KLHD 1FBIH 4G7VH 5IHUL 3VSVA 1PG7X 1BZ7A 3CUPA 2VLME 4XZUB 5GGVY 3QR3A 1UWUA 3SDCD 1INDL 2I60L 3G04A 3FT4A 4MZ2A 5CUSL 4YQXL 3H7BA 3SDXB 3WL1A 5E2VH 1MRFL 2J7BA 4Y4HA 2YWZA 3WSUA 5B8CA 2W9EH 5FEBA 1YZZA 3BZ4B 4W86A 3W11C 4KQ3H 3MXWH 2X0HA 1IM9D 3N1MC 4ODVL 2IALA 4HC1H 1IAOB 1PPIA 5KANG 4PJ5D 3GMLA 5F7WC 5FCUH 3S98A 3BH9A 5LAXA 5SWQB 4WHDA 1BGXH 5ILTH 1OB1B 3KYKL 4NC1C 2OR9L 1CTOA 1YY8A 1RMFL 1MLCA 3N50A 2MQCA 1AXIB 4YGVB 2YC1A 2F54B 3HMXL 2Y36H 3W0WB 3B2UD 3D39B 3MV8A 5EPMA 4K3EL 1ZTXL 1ZA6A 4E41A 1ZEAL 3UO1L 4S1QH 2QHAA 2J25A 1B6DA 5I1JL 4F37K 2QHLA 3DX9B 1XCQA 4AL8L 3HE6B 3VWKB 3EDKA 4MJIB 3NZ8A 1G1CA 2H45A 1UQYA 1XYZA 2DQCL 4XWOC 3ARDB 3VIMA 4Z7WA 4ZXLA 5EBLB 1B31A 1OPGL 4ATLA 3BP7B 1U8MA 3DTXB 3C6SA 4MD5A 35C8L 3VFTA 3WS6A 5I66B 5E03A 3RM9A 3SKMA 2R0KL 3FQRA 4RFNC 1UA7A 3BMWA 4KZEL 3TTOA 3MLTB 3GNRA 1NGQH 2E27L 3WNKA 4R0LB 2OBGA 2ESVE 3WXWL 3VSTA 4C83A 4POYA 2J79A 3NA4A 1DUZB 3IF1A 3B6SA 2QLYA 3CHDA 1AFVH 4XCYA 1BVNP 5FKAA 2WBKA 1KEGL 1VDGA 4F57H 3RX7A 3BD5A 3BP4B 4IRJC 4IIQA 3JUGA 4DWSB 4PJCE 2R2EB 5BZWB 5D5MB 2IAMD 2BNQA 4KTYA 4B7LA 4FFZH 2VABB 3KYNB 2JB5L 4N5ED 1EO8H 2BNUA 4NO0D 4LGPB 2XZAL 4Y19B 1JZ3A 3FQWA 2XICA 2Q76A 1DUYA 3RPIB 1IEHA 2VXSH 3KPPA 2XWDA 3TNNA 5E1AB 5A6JA 2QSVA 3QDGD 4L4TB 5CJXC 1Z6JT 2DLHA 3RFZC 1F8TL 1RIVH 5DVKA 4Z77B 5BWFA 1I1AC 1OIFA 4ODXB 3PWVB 1NCAH 2XFXA 3EHBC 2GFBA 4NO2A 3MMDA 3UEZA 3FOLA 4LAJH 5IFAL 1YEGL 5A2BA 1EFXD 1UJ3A 1S7QA 1V05A 5FCSH 2D7QA 3I85A 3V7MA 3GHBH 2FD6H 4KRLB 3FAXA 5FYLD 5DMKB 3ARFD 1WT5A 3I6GB 4MD0A 4XH2A 2I24N 3FT3B 1UD3A 3QXWA 4O51B 3NA9L 3PHOA 4MQ7A 3WN5C 3ZTNH 1IQDB 3EO9L 5ICXB 1OL0A 5KZCD 3MGOA 4QHLA 5IJVB 2DD8H 5SWSE 1A9EA 5F8QC 3CFBA 1DBAL 1W8NA 2WBJC 3DXAE 3ECBB 3MV9D 4XBGB 3QB7C 1WIPA 5CFHA 3SJVD 4FQHA 4OGAC 1AMYA 1ZJAA 4NRSA 1KELH 2XFRA 4LSVH 3JV5A 4M5ZL 4MTVA 3BEWA 4TTUA 1LWJA 2PBOA 4G43B 5GJTL 1RK1B 3KPQB 2P42B 5TQ2H 3QNYA 4JKLA 4NN5C 4YDVA 1B30A 3QUMB 5E8NB 1QHOA 3GSVA 4NRYA 3O11B 3LSOB 5ABHA 4X5XB 4K7PY 3OKNA 3L3JB 4Z95H 3NACL 4L3AA 5DUBA 1L4IA 5IOPB 1OWQA 3P77A 3MYZA 1YECH 2XWTA 1TZHB 2A0LD 3SDAD 4K8RC 4RGND 1CE6A 1C3FA 1ZHLB 2EC9T 3EDDA 3NFNA 3RO8A 5C0GA 4HHAA 3QQ4B 5CEZL 2HKFL 4HS8L 1M71A 5CEXB 3X14B 1T5WB 4TRPH 2VDNL 4E42B 4NKIH 3LQAL 1ED3B 2ZCKH 3H9YA 5IVZB 4BQ9A 3QJHB 5DR5L 2ZOLB 1FE8L 4ZDHB 2HH0L 4UAOC 2JELH 3ZT6A 4Q9RH 1NCCH 3F4VA 2R23A 4P59L 1X4YA 4Y1AA 1G6RL 4OCYL 4KAQH 1FNSH 3ES6B 5L8KB 4HIIB 4JM2A 1TJHH 4PS4L 1QBLL 4FQ1H 4NJ9L 3MA7A 43CAB 1PS3A 1MCKA 4PMVA 3VXSA 1CXEA 3BP5A 1TFHA 3PWPA 5TGBB 4UTBL 5TE6H 4Z2HA 4I4WA 5E6YA 5GS0L 3OKOA 2NSXA 2FEEI 2YPVH 3JBG7 3IAQA 5DJAA 3TVMA 3EJTA 1T5XA 4LL9A 4XWOD 3MOQA 1SM3H 1S7TA 4EANA 3L4WA 1DEEA 4Z78A 2A3EA 4OZ4A 4XXCA 1OGTA 3V6FB 5A8PA 4L9LB 4NQDD 5IMMA 4AISA 4GFTB 1T7XA 3JSSA 1RPQA 1A6AA 2R2BB 4LLVA 1FVEB 1N59B 4LHUD 4XTRC 1H3UA 3LN5B 4RRPA 5IB1B 4LAQL 1ZANL 2PWDA 2W67A 5JBFA 5IMKA 4LLMB 3GO1H 1W9PA 3RWJB 1KJVB 1NMBL 1CLZL 1Y0LB 2YL5A 5HD8C 2RBLA 1FZKB 4BSWB 4IRJD 1BYDA 4GO6B 4GPNA 1AQKH 4X6CA 4GQ9L 3EOBB 3BHBA 1SFSA 5K33A 4GRLC 3BGMA 1J9CT 1TQUA 1LK2A 4G6AD 1WWBX 2NR6C 1AGCB 2VDQL 5GGTH 1E4JA 3QUYD 2RCSH 3RL2A 1NBQA 2XWEA 5EU3B 3IXAB 4Z5RB 5JTWA 5EO0B 5D7LD 4OLYL 3RZWA 3WJLC 4U1GC 4GO8A 2FL5A 2EH8H 3DO3A 4GUPA 4TPRH 5C7XL 1FLRH 4HMEA 1I1AD 3K8MA 5ABFA 4APQA 2R15A 4L5FL 3VWJB 2XG5A 3EHBD 1KPVA 4QRQB 3DX7A 2H3NB 5DJ2B 4UQ3B 3TNMA 4Z2JA 2DLEA 4M61A 1JWUA 4H8WH 1OOAA 4PRHE 3QH3A 3L1OH 5CJ5A 1QFUH 3NUKA 5IR1B 4PJ8C 2GSJA 1FNGA 4X0NA 3FMGL 1TETH 2PXYA 4PJCB 1HILA 2C3GA 3LKQB 2GY7B 4JFXA 1OGAE 2BHZA 4TUOA 4XVUC 2V2WA 5GSRA 7FABH 5T3XL 1KEML 4QCFA 3CC5A 3SE3C 1DR9A 1JGLH 4PFEA 4KK8C 1GOOA 2VUOA 3TIEB 3JWOC 2WK2A 2EICA 4OD2B 4MNHB 1D5BA 3HNTH 2J5LC 4PCTA 1MXGA 4OGAD 5BO1L 4PBWD 1CU4L 1YEHH 5LCVH 2DQUH 4ZTOH 3UTPE 3HPLB 3F7RA 3B9VA 4LLUA 4M1CC 3DHMA 4QRUB 5J6GB 2XNAB 1NMAH 2DKUA 3LPPA 5ISZA 4I3RH 1MPAH 3GJFK 3AMDA 1W3KA 4Y2DD 4XZBA 2VCBA 2FZ3B 2OW7A 4QTHB 4X9IA 3G6DH 3QHOA 2W0FA 4FTVE 1HHGA 5DC0A 4M7KL 4K8RD 1MI5A 3HC4L 1UKPA 4P3WA 1JHKH 1V3HA 1NH6A 3TYGL 3KLSA 3ALFA 3QCUL 2HA1A 4PIRF 1ZHKA 3RI5K 5ACLA 5AWNH 1CFTB 4OGZA 2VR9A 3O6KH 1ZLVH 5L0QC 5I3DA 3MSPA 2VN7A 1LD9A 3QDMD 4I18A 1JGDB 5AD0A 3O8XB 1B4JL 2E3VA 3H8NA 4P7LA 4RNRA 3DXAB 2ZX6A 4N8PA 4G6KL 1JYWA 3VXME 3UJIL 1K4DA 1GCYA 1E5JA 3RDTD 4LKXA 3RPKA 4P2RD 3N1PC 1HJUA 2BHUA 5C92A 1EGJH 1JZ8A 3KLAB 4LCUB 4MGXA 1MRDL 4OFYD 3BH4A 5I74C 1E4KA 2R29H 4KRPC 3WF2A 4OIBA 4HWZB 3QG7H 5T3ZH 1S46A 4TVPL 1T1WA 3HNSL 4GBXC 4TNWK 5TJWK 3KJ4B 5HHQA 2GTZB 5FIPA 3IJYB 1OSEA 4G8IA 4KY1H 4HJGA 1H3PH 1HH9A 3MROA 4KDTA 4P2QA 1NCDH 1IM3B 2JIXD 5F9JB 3CZNA 1N82A 5F6IC 3EOAA 3LRMA 1CZ8H 4X80H 1WAWA 5DLMH 2A3AA 5D1ZB 3WEXB 5IV2B 4L4VE 5D1QA 1Z0NA 3MLWL 1HK6A 4GW1B 5FGCE 1NEZB 5I8CB 1OD0A 3OHXA 1YEKH 4PJHA 5F7KC 1A1NB 2QQNH 3D0VB 3D3VA 4MNGE 1NLDL 1E6OL 3KWWA 4KJQC 1B0RB 1GGBH 4N1EA 5FUCE 4L29B 3L3KA 3MJ9L 1N4XL 4JKPL 5J11B 3KAAA 2VIRA 1BJ1H 1T0MB 3CFDB 3TA3A 3RVXD 3EDFA 3FQXA 4AT6B 1T0NB 3CFCL 1VFBB 4L8BB 3RM4A 1WV7T 1IAMA 4GRLD 3U0TA 5AZEH 3NCYP 3WUWA 4FMKA 1J0YA 2NR6D 1NC2B 4HKJB 3V6ZA 1BQCA 3S37L 3K2UH 4OUUA 2BV9A 1QRNE 5MEOB 4Z18A 3MR9A 2W60A 4RMVA 4WDIA 1KBBA 5DGRA 1N2RA 3O3DA 1BBDH 4QWWC 4NQED 4EXPX 5D7KE 5ADOL 4JGUA 2AV7B 5JIPA 4OI7A 3S5ZA 3V9FA 1KNOB 4PJDA 1UCBH 2YPLD 1FL3A 2J6EL 4YH6A 2VB5A 2A9NH 3QNZA 5DK2B 3VXTA 5MEPA 4PLKD 1H4PA 1BEYH 3QP3A 5EU6D 3KJ6L 2DSZA 1X5JA 4DEPC 3C8HA 4FLRA 5LA0A 2Z8SA 1AP2B 1GW1A 4YHOL 1VKXB 3C5ZC 4ZOCA 2XN9A 4PJ8D 1OAXL 3OSKA 4OKVB 5T3ZE 2H1PL 4F79A 3AQUA 4LBEB 3NVQA 3SBWA 2E9BA 3WSQH 4EBQH 2V2TB 4KKBC 3AXLA 4HIHA 3GKWH 4NZTH 2CRIA 4P5TB 2O61A 4CVZB 1P6AB 5HDLA 3RZCB 4M81A 3GBNH 3MJ7B 2XJ7A 1GC1H 2YK1H 1CGSH 4GAYB 2CLZA 1MNUH 3EYOA 4CCDA 3QHFL 4MNQD 1XGUA 4EJ1C 4KTEL 3RUGE 4P23B 1MFCL 3BDYH 2BY1A 1R5WB 4QHUB 1K3ZA 3MRFB 3D25A 1WITA 5T33L 2X2HA 4M7LL 3JTSA 1TPXC 3BIKB 1LO2H 4AZCB 1SY6A 4ODUA 3PGDB 4O9HH 2D3LA 1HJVA 4MB1A 4M1CD 2A6KA 3SEPA 4JRXD 1KCKA 3SCMC 3V5KA 2JEPA 1KF9B 4PRHB 5HDBF 3LEVL 4BZ2H 3C6LD 3ZT5A 1S3KL 1S7RB 4NNYB 3T3MF 2IFFH 1X5FA 5KSAC 1GGYA 1WEJL 3KNBA 1NFDE 3HLAB 2IANA 3DV4B 1F4AA 1WBXA 4ISVA 3H9SA 3CGTA 1CL7H 2Q87A 4WO4C 2P5WE 1FG2B 4Y88A 4M7JH 2AAVA 4KHTH 3STLA 5ABDE 4P46C 2OSYA 2IPUG 4GZEA 2O5XL 4PV8B 2IPKB 4L3CA 4IMKC 1CFSB 4LMQE 4M9PA 1I1WA 5M03A 5F1IB 2BOBB 4CMMA 1OTTC 2OP4L 1F3JB 1KJ3L 3DIFB 4QRRD 3AICA 4H0IA 3D2UB 5DF0A 4M82A 1XF5A 1BWWA 5FXCH 2DQIH 1MHPL 2YLLA 2G41A 3LRGA 3G6MA 4HMCA 4F7EB 4LX4A 1ISZA 2ZWYA 5BS0A 5EIQA 3AHVA 3KPRE 5I0DA 5JORB 4XCCH 4FQXC 1DSFL 3BW9B 2OSWA 4A3HA 3BMVA 4FTVB 4KROB 4OZHA 3HB3D 4OFIA 2VDLH 3B9DA 5J1AB 4HBQA 5IESH 3V4VH 4NI3A 1I8IA 4F8QA 1D5IH 2WQ8A 4HPGA 1LO4H 4Y16A 2WZPD 3LV3A 1UENA 1B3ZA 1N64H 2VAAA 32C2B 4DKEL 3RWFA 4UNVA 5I8KH 1DVFB 4FNSA 5FFLA 2AMGA 5HI3C 3W28A 1MJJB 1JZ4A 2YHGA 5J0BA 1A21A 2D0GA 1XH3B 2AK4D 4UQ9A 3MNWA 4UBDC 1ZS2A 4OCWH 4PTMA 4PG9B 4G9FE 1FZMA 4Y5XA 3QEQD 4DUVA 1ZT4A 4JY5H 4M6NL 4E5XB 1LEGB 4XP5H 1W9VA 3DSNA 3CC1A 1P7QA 1JNLH 1QI4A 1TXKA 4N1CA 4YK4B 2IH1B 4GAJH 3DX4A 3DUHA 5GS2H 3FB7A 4ZFZB 2ARJB 3QO1B 5DQ9A 1Q9LB 1YDPA 5D2LA 2MJWA 1G9HA 3RIFF 1I8LC 1CLYH 1W72A 1ACYH 3J8F7 4NP4L 4PRNB 1NAMA 1NL0H 3DRQB 3ULUF 4NZUL 3ZLQC 3ZL4H 1UFUA 4P4KC 4Q58C 3QIWC 5DVOA 3FN0L 1T4KB 4KZDL 4AJ0A 1UD8A 4UFKA 1E4XL 1XCWA 5FGCB 4OLZH 2FEDD 3QISA 3KS0H 4H0HB 3FFCD 5E9DD 4MNGB 3WEMA 5JO5A 3T3ME 2WUCL 4E0RA 4GMTL 5JQHC 4OZIF 4WEUD 1FL6B 2J4WL 4BZ1L 5H2BA 1I7ZA 3C5ZD 3DX1A 1V3IA 4C56E 1FFOB 4B53A 3BO8B 4F9PC 2OLDA 4O58L 4DM2A 1DBJL 2XWBB 3CFJA 4KKBD 3PBGA 4MA7H 1YJDC 2EJ1A 2R4SH 1L7TH 1A9BB 1A14H 2AJSL 3ULUH 3L7FB 1UZ8B 1OAUL 4M93B 4JPVL 1QRNB 5DT7A 5DUML 3Q3GB 1XGTB 3LS4H 4N68A 2JEQA 2FR4A 3FW6A 4WJ5A 4DCQB 1A3HA 2V5YA 1VFAA 1CGXA 1H8OA 1JPFB 5AZ2H 3CZGA 3M46A 1EGZA 1EXUB 1II4E 4M5YL 4WWKC 4YUEL 1L6XA 3WUZA 4G7YH 3BXNA 3VX1A 5DEGA 3MRMB 5BOZG 1R75A 3SGKA 2QHRH 4WI7A 4LNVA 2AI0L 5D8ZA 4UCFA 5TQ0H 3OXSA 2ZZUT 5M5DA 5A2JH 1AGFA 1T0PB 4FXKA 1R5VB 1P6FA 5HHXH 3WY3A 2CBJA 4WO4D 3MBEC 4I3GA 3P4NB 3O3AA 5A2CA 3I50L 5ICZA 1D5ZA 2CR6A 2GT9A 3MGAA 2Y8KA 3AS3A 3TIDA 3D48R 4GQQA 4RZCA 1QEWB 1DP0A 2R1WA 4UDTB 3RMEA 3O0RH 3AIVA 3QWRD 1EFQA 1W0VA 2IXVA 3F58H 2BVDA 2ARWA 4X7TB 5DD5H 3VIGA 3VRJB 4N9OB 3RWGA 3MLVL 5FHAH 1M6OB 4HJJH 3STZA 4XP4L 1MWOA 4PUBL 1RUKL 3BP6B 2CDEA 5EO1A 5EU5A 4LSQL 5E2WL 5GHWH 3WHE1 2Z93A 5CP7A 2DQEL 4YHLL 1WIUA 2FHCA 4FQXD 2VXUL 3DLQR 2Z91B 1GQJA 4NKOB 1UM6H 5EN2B 1NFDB 1C12A 4JJ5A 1VPOH 4N90D 3MRPB 3UJJH 4D0DA 5K9QI 5IXEA 3ULUE 4QGTA 2DSUA 3QPXH 1TG7A 1AH1A 2P5WB 4ZAKC 3Q1SH 15C8H 3ZE1F 3EMZA 2R0ZL 3RVVC 1G7JA 1FVCA 3LS5H 4R7NB 1YQ2A 3VXNA 2D1ZA 4WGVB 4LMQI 1IGCH 3FL7A 3O2DA 2J8UF 4P5MB 3RVTC 4AD5A 2FX9L 4OIAA 4EI5A 1VJZA 4LSPH 3UPAA 4KI5D 4B0MM 1DCLA 4EI6A 2QQKL 4XCEA 5T1DL 4HWBA 1JE6A 1MYRA 4UBDD 1ZBKA 1Y6NR 1JF6A 1QR1A 4OZIE 1RP8A 4YDKL 1VEMA 1QHZA 2J4GA 1TENA 4M6AA 3V0VA 3SOBL 4D94A 4JFEA 4N0UA 3SPVA 1HIZA 3AIBA 3KR3H 4LSTH 3LH2L 3LEYL 4PRID 3KPRB 4G80A 3OBAA 3FZUC 1GHFL 3OAYK 1D6EB 1FL5A 5FYJH 2AQ1A 1A7NL 4QY8A 5DT1H 4MJ4A 1HXYB 4TULL 4LRNH 1Y18A 3LD8B 2AS5M 4PGZA 3WMSA 4CVWA 3OZPA 3PGFH 5EU4B 1GVYA 3NCJH 5F9DC 1NEUA 1ZBWA 3HI5L 1JNNL 4P4KD 4WFHD 3QIWD 5GJSL 1MH5A 3JWDH 3OWEA 3ME0A 3PWUA 3GMMA 2UWEA 4LLYB 4S10A 4MJ5B 1UR9A 3MRLA 3MSGA 4J12A 4G9FB 3FCTB 3SE4A 3TYFA 2XUCA 1QSED 2AEQH 4WIQA 2OK0L 2VDML 1GIGL 2PCPA 4H20H 4F58H 1JD9A 1OQOA 1ISYA 3Q5TA 1S9WA 2GJ6A 1WDQA 1INQB 3B9EA 1KXVC 3KYMA 3LZFL 5EOCH 1BFNA 2QADC 3OKYA 4QHKI 1WGOA 3QDJA 2VRJA 3A6CH 3MO1A 5EC2A 2X2IA 5GRUH 4YXKH 3IJHB 4ODHL 4P99A 5SWZA 2ERJC 4JFHE 5I1LB 3IDXH 3A24A 5DHYB 2XTLA 2NY6C 1PZUB 2WXDM 2GJPA 2WMPA 2ZX7A 4C4KO 3EJYC 4OLWL 1U6AH 2WUBL 4Z7UE 3BH8A 3WDQA 3MACL 5GNXA 3ARGD 1J1PH 2NY2D 4RAUA 4Y4HC 2AABH 1XF2B 3AB0B 3D85A 5B8CC 4YC2B 1D5XB 2DGAA 3BJ91 3RU8L 1I9JH 1ADQH 3BYYA 4HK0B 4K71C 1P1ZB 3AS2A 2UYLB 4JFPA 4WLCA 1MFDL 1RY7B 5LGKA 2VQUA 4C56B 1AJ7H 1UOKA 3QUXB 2QMJA 3VXUD 1JXJA 2ZCHH 2FJGA 3QOKA 1S7XB 3M1BA 1UD4A 5FYJE 3VJ6A 1E4IA 3ZE1E 5KJRL 5CBEA 1NDGB 3CV5A 1ORSA 2DDQL 3OGOE 2W61A 4F57L 4YX2H 1HZHL 5T1LB 1QYGL 5KSBF 4OZOA 4KKAD 4AM0A 3CDCA 3GNOA 2J8UE 1HDMB 1ZGLB 1ZK9A 3MFFB 1WTGT 3WQ4A 1TQBC 4KPHH 4J3VA 4OD3L 4LLDA 2ZJSL 3OXRA 1ZA3B 2BERA 3H42H 3NMEA 4PRDA 4RMSA 1V02E 4JE4B 3KWXA 1AHWA 5C09E 4NN6B 3MLRH 2YWYA 3JTTA 3HAEH 3DX2A 4UOW0 4FFVC 2APBA 4MPKA 4GQPH 1EEQA 3WS6C 3PHAA 1UWEH 2XKUA 1KTLA 5F3HB 2VLKA 4KHXL 3GHBL 4KV5F 3S4SG 2IPTH 1NGPL 3KLLA 3O2VH 4HZ7A 2W0PA 5L2KD 5I8EB 1Q9KB 3NFPB 4JHOA 1ODUA 1XGQB 3VFWA 1L0YA 3T2NL 3B43A 2BVUA 3BISA 3NABH 3I6LD 4U0RC 4X7SH 1DN2A 1KCUL 4MWFB 2WQRA 4NQVA 2VLJA 1XHGA 4QCIA 2FE0A 5GISH 4KK5C 5JOFA 2UUDH 5C9JA 4ZEPA 4PR5A 3ZTNL 5GGVH 3GXTA 5ID0B 3G5YA 1FO0H 5B39B 3THDA 1G9NH 1OP5H 1G7PA 3DC0A 3T09A 4KJYB 2F53E 4LEXH 2A6DA 1RFDL 2WZIA 1XCXA 1Y6KR 5A69A 4ZUVB 5E1QA 3LDBC 3AHZA 5J1SC 2GK1B 5DMIH 1BVKA 5I75C 2LU7A 4JFDE 1S9XB 5ITBH 5KTEL 2DSWA 4Z0BL 2BC4A 4BQ2A 2PYED 3T65A 1JAKA 2G3JA 3FNDA 1CXLA 4RMWA 1W0WB 5TQ2L 3PWLB 1WBYB 2C1PB 4ZTPH 3WL9A 1G7HA 4FQQA 1J1XL 4HCRH 3B5HA 4XP9L 5HPMA 1AGDA 4JHAH 1X9QA 2D73A 1IGJB 1UJ3C 1YECL 1KLUA 5DA0B 5BQ7B 3MKKA 3ARTA 4ZFFB 5I1EL 2LTQB 3CK0H 3SURA 4B41A 1YN7B 4S1RL 5I6XC 4JFFD 1WT5C 2CIIA 1VEOA 1RZKH 4JB9H 1UWIA 2YL8A 1YEIL 5A6BA 2H8PB 2H2SC 3E6HA 4TRPL 3VIJA 2NW0A 4WHYH 5KVGH 2EDEA 2FYVA 2ZSWA 4OZIB 4ODBD 3CVHH 1B0GA 2OS7A 3UTZB 3CU1A 5D8JH 3DX8B 4MQTB 1N6QL 2F1AA 4Q9RL 3EO1B 4EN3A 1MAML 4H5SB 4OGYL 4IMLA 5DMYA 1WCGA 1QSFD 3IDMB 2HFGH 2XPKA 5CBAA 2IPUK 2JLLA 4TYUA 3BOVA 3S36L 2UY4A 1PZ2A 3PDDA 2YXMA 2AV1B 3BKYH 3D18B 1HKKA 1BJ8A 5L7XL 3KLKA 5DTFB 1YMME 2OR7A 2PC8A 3ARBB 2FSEB 4PGDB 3UCRA 5C0BB 2OSLA 2P4AB 2VZVA 4IRSC 3KYAA 3S5LA 2HTLC 3VXPA 3P4MB 3W53A 3EJYD 5HVHB 2KUTA 3DUUA 2ENYA 3VM5A 3PP3K 2NW2B 1T21A 4MA1B 4NWTH 3T0VA 4CW1B 4UNTA 5IW1A 5DJ6A 3WFCL 1LL6A 4HQQL 2X7LA 4R8WH 4F7MB 3L5WB 4V2CB 1QQDB 5T5NF 3S88L 3CMJA 3WV0A 4KV5E 2UZIH 2D20A 2H41A 1MCIA 3MNZB 3TBSA 2HT2C 4ACZA 1MVUB 2HVJB 1KTDA 5EZOL 4ZOEA 1Z32X 3PZNA 4MDOA 2CBUA 1ZB5A 2VL5A 2ZWLT 3ARYA 1U95A 3S96A 2ZNWA 4XNXH 4R26L 1AQKL 5KG9B 5DI8A 4PJIA 3GH7A 1UD6A 5C08D 4JM2C 4UTAH 3AC0A 3CDYA 2EE6A 2HISA 3O6FB 4JDZA 5L8JB 3H53A 5DD1L 1C8XA 1ZHNB 1IGIH 5I76A 2NY5H 2DLGA 4BQ3A 3TVMC 1EXPA 2CXGA 2J1KA 3KGRA 4WTZA 4PGBA 3AXHA 3MFGB 2YJQA 5LA1A 3IDIB 4XXCC 2FGWH 2CH8A 4TPRL 3HC0B 1V7NH 1K85A 5D9SA 3OIHA 3L3DB 4FFVD 1EDTA 3EUUA 2V5CA 2ZUNA 1PEZA 3HNVH 5LKNA 4BQ8A 3CZSA 2H26B 1A7BA 3C60A 3L3IB 2VURA 4XV0A 4RAVB 5J9PA 2PN5A 5B38B 5JHDB 4YZFE 4Z7VA 1RZFH 3K74B 4JPKH 2XZZA 3QIUA 2R2HA 1Q8MA 2J8UB 5HHME 1I4FA 5ABEA 2JKXA 1NAKH 5DRXB 4KK5D 4P9ML 5DEFB 3VH8G 1N5AB 4BZYA 5IROA 4TOYL 4K7PH 7FABL 3BCFA 2OJEB 5BXFA 2NY3C 3CFEB 3I3BA 1IILE 2UZYB 1ZS8A 1IARB 3EKCA 4DN3L 3MYJA 3BKJL 1Q4NX 3K4DA 4NXKA 3ISWA 4U1KB 5IUSA 3AISA 5LCVL 5HOSA 4NT6B 4R96B 5EZJA 1JGEB 3I6KA 3IJ8A 3ROLB 5AY7A 2V38A 2YD5A 1PSKL 4G6MH 4H8UA 5MENE 1YPZA 4G6FD 4APQC 1KB5A 1E28B 2D31A 1U8KA 3QFJB 1I8MA 4GG6F 4PYHA 2Y7QA 1EJ6A 2CHOA 4TQEH 1BZ9A 2DQJH 1QZ1A 3MRBB 4OOUA 2ATPB 2PETA 4DTGL 2JCCE 5EUOE 2VQTA 3A21A 4CUCA 3FTGA 1HJWA 5DJ8B 1OTUC 3LPGA 4LARH 1Q9WB 1AXSA 2DM4A 4YE4H 3FOMA 3U57A 3GMRA 2PXYC 4IOSD 1A7OL 4DGVH 2H2SD 2NXYC 1UYWL 4MMZC 2BSSA 2X4OA 3HS0B 5FD0A 2O5YH 5GRJL 2UVFA 4DK3A 1CXKA 2F53B 3KXFB 2GTWB 5CMAA 3EIFA 1U92A 3L5XH 3OLEA 1J0HA 1OD7A 3NH7H 2X4UB 2Y9RT 2EEAA 4Q74A 5HHVH 2XG9A 3ZDZE 2VR5A 4JFDB 1VGEH 4J6RL 4NQTA 4AD0A 1DL7L 3BQUB 3GDBA 5I71C 1A6ZA 3I3EA 1EGJL 3WE6A 4OD1L 4ALAH 4KK9D 3PIQB 4HXAH 5D8WA 1HINH 4ZFGH 2R29L 4IDJL 4X4ZA 4ONGH 1RZIB 5DZLA 3AYRA 3BEVB 3ZYZA 3DI2B 2XY1A 4NPYB 1AO7E 3V5HA 4IRSD 4XZUA 1HNGA 4ERSL 4PUDA 2CJUH 2HVKB 2VOTA 3L3OB 3ULVC 4Q9QL 2TAAA 4FQ2H 4WTXA 2VXVH 3VD9A 1MLBB 3SDXA 1RZ7H 2MCPH 1FP8A 2MKLC 1OCQA 5FA3A 3ZDYF 3MZGB 2QF8A 4UFHA 2UY5A 3HAEB 4U2YA 3BZ4A 1LVEA 5MHSD 4I18C 4QRTB 1RJYB 2YD4A 4MA8H 3G9VA 3VG0L 1IAOA 3VINA 5DD3H 5SWQA 1JPTH 2HT2D 4UUJB 1OB1A 1LO3L 5KSBB 4DO5A 4HPYL 4PYSA 3OLGA 4XWGL 3GSWB 3BPOC 3VSUA 4TSCH 4YGVA 1SJHA 5DQJA 1A47A 2F54A 5LGHL 3SUSA 1YMMB 4JM2D 1WQVT 2YD6A 3D39A 3SDDB 5AZEL 2MHAB 4OM0H 1UWTA 1E4KC 1KJMB 3TTSA 5DJCB 4JR9H 1Z9OA 3M6DA 3GMOB 5FM5M 1WZ1L 1FO0B 3TVMD 4IRZL 3K2UL 3DX9A 3QRGH 4N9GB 3HE6A 3VWKA 5E4EB 1A3QA 4JPWH 4MJIA 1G5AA 4YEFA 1OHQA 4JFYB 3ARDA 4N5UA 4JREB 1TZGH 5EBLA 1KQYA 1I75A 1IFHH 1N0LA 3BP7A 5HSFA 5BMFH 2ZOKB 3DTXA 1AE6L 4PP2B 4KDTC 5E8OB 1UCBL 3RWIB 3ZT7A 4W7VA 2G8ZA 5I66A 1FYTE 2ZNXA 4X6EB 5D1QC 1N8ZA 2WBGA 1EOKA 5KVDL 2CGRL 4G8FA 4WUUE 1XF1A 1JCKA 1XF3B 4K8RL 1E0XA 5I30L 3SO3B 2Y72A 4LIQL 1OAYL 4AEIH 4MNJA 4EKJA 1W0YT 4XHJC 3BUTA 4D1JA 1E3XA 3RGHA 5JUEL 3FJTA 3MRNB 3TJEL 3GBNL 1QNOA 3TA3C 1TR1A 5ALCL 3BP4A 5DD0L 4DWSA 1JPSH 4FABL 2QPUA 3NSNA 2R2EA 3HMWH 5BZWA 1CICC 1GZPB 1HX0A 1IT9L 2EZ0C 1NKRA 2WANA 4OLUH 2VABA 4P57B 3KYNA 4FNUA 5FYLH 3TT1H 3CVHB 1REIA 1L0QA 3MRHB 5DYOB 3O3BB 4PJ7F 2F7PA 1LO2L 2OMNA 4Y19A 5CG0A 2VWEE 4O9HL 4HH8A 4FG6C 4XUYA 3RPIA 5GGUB 5AEAA 3MV01 2J7LA 5E1AA 3REVA 2E3ZA 4L4TA 4RMRA 4Z77A 4AZHA 3GSNH 4DVBB 1MW3A 3IDGA 4HV8B 2IFFL 4MXQC 4NHCL 3N85H 4YFLI 2UY7A 1HIMH 1RZGB 1UM4L 5CCKH 4HLJA 4PTXA 5HHMB 3FRUB 3CZJA 5EZLB 1S78C 1X4ZA 3F65A 2OWCA 1W2KT 1CL7L 5DMKA 4JDTH 3EJSA 3I6GA 4M7JL 3SBWC 2P46B 2VX5A 3FT3A 3ZDYE 4O51A 2BY0A 4MJ6B 5CSUA 3MRGB 4MXWH 5E2TH 4D3CL 4KVNL 1INEH 4PY8I 1IQDA 1CGYA 2DIEA 3C2AH 3VDCA 2MQ3A 4PP1C 2DQTL 2LVCA 3VD7A 5ICXA 1I1CA 5TPWL 3PZTA 4LDOB 5CSYA 1NCTA 4JAMB 4OZFB 2PYFB 4HFWB 1DLFH 3IRZA 3U4AA 3ECBA 4XBGA 2X9XA 1CF8H 5MENB 1UXWB 3CCHB 3WDJA 1Y7VA 1SYSB 1MCBA 1HP5A 4G43A 1RK1A 1YEEL 3KPQA 3QDGE 3RKDD 2JCCB 3V52L 3QUMA 5E8NA 3O4OB 3O11A 2VDLL 3I84A 1RUAL 3LSOA 1NOUA 4X5XA 3V4VL 4KUCD 3L3JA 3QIBB 5IOPA 3ULVD 2I9LB 4LCCB 4NWUH 4TVDA 2BHYA 1TZHA 1MI5D 2CKSA 2YBUA 1TJGH 4WCYH 5I8KL 4G42A 1ZHLA 2EEXA 3U9UB 5FYLE 3IS0X 3U7WH 2P8MB 4G8GB 2A83B 1FNHA 4D6GA 3QQ4A 2WZEA 4UZGA 4JN1L 3ZQ9A 5CEXA 1S5IH 3SO5A 3X14A 3QXDB 1T5WA 2PWFA 2NY4C 4E42A 3GBDA 5DFVD 4WW2F 3VRLF 1ED3A 3HI6L 5IVZA 2HG5B 3QJHA 4LCYB 2NY7H 2ZOLA 4ZDHA 3ZZ1A 1VJSA 4LNRB 3L2MA 4M24A 1VIWA 1BIIB 4CDHA 5EORH 3GBML 1XMWA 3Q2CA 5EUKB 3MMWA 1MVYA 2EXWD 4U6VL 5ABGA 3MV9E 2EABA 4LPXA 3D50A 1WBZB 5HTSA 5FF6B 3ES6A 4HIIA 4XC1L 43CAA 3EJJX 3BVXA 5TGBA 3JWOL 3VI4E 1KCSH 3CXDL 4QHKJ 4UV7H 1MQKL 2C4FU 4EK7A 3PV6B 4PJ7E 2J7HA 4UMGA 5CKAA 4PLOB 3W81A 1RUQL 2A1WH 2HJLB 3LXCA 3TJHC 4TN9A 2BVOB 5CPSA 2GEEA 1V6XA 2HFTA 3DGCR 4L9LA 4WKHA 1MREH 2GJRA 3CHEA 2ZP0T 5LVEA 2V3DA 4XPAL 4RGNE 2R2BA 4C58B 1FVEA 8CGTA 1L7IH 1UQSB 5GZNC 3LN5A 1E6QM 5F44A 3RP1A 2XVLA 4ZUUB 4Y5XC 5C07D 3VXSE 1MFEL 3WLWD 3LVEA 1H3GA 3C8KB 3PWPE 4LLMA 3BFOA 4ONFL 2R8SH 2PR4L 4DW2H 3RWJA 3NIYA 2VRKA 1KJVA 4EDWL 2ZE0A 2P5EB 1HN1A 1L7TL 1Y0LA 1FZKA 3MLSH 4BSWA 1MJ8H 2YA0A 5F1NB 1LLOA 1CICD 3VG9B 2E9JA 3EOBA 4NYLB 2D22A 1IC5L 4LDLB 4DZBA 3MUY1 4WY7L 1MIEL 4NM4H 3U9PH 1J5OH 4GI9A 3WBAA 4YDIL 3GSOB 3VOCA 1AGCA 3MMEB 3CAFA 4FG6D 4MAUH 5EU3A 3IXAA 4Z5RA 2OW6A 5EO0A 2AQ2A 3ARZA 2DL9A 2GVYA 1ORQB 1FYTB 4GG6B 2FIKB 5JZ7C 1ND0B 4NQDE 4ZPTB 4URIA 4WUUB 2JK5B 4OGXH 2IF7A 1TVPA 4QRQA 4MXQD 4R7DB 1IM9B 2H3NA 4FP8H 5DJ2A 4EKXA 3AREA 2ESVA 4UQ3A 1AY1H 2IJ0C 2VKXA 3QQ9D 4WNQB 5GGRY 5LQBH 3O3UN 3PJSA 1ZMYA 2XN9D 1KQZA 2ADIB 3BN9C 12E8L 3GSQA 5IR1A 2CHNA 4YR6B 4Y4FA 1QHPA 1V7MH 5KSVB 1FAIL 4PJCA 1KSRA 3UTSE 3AFLA 3LKQA 2XFYA 3I02B 4JG1L 3DX6B 3VRLE 4PP1D 2OYLA 4BH8B 3ZYIA 4D9QE 1I3RA 3KPSD 4V1DD 3TIEA 4HC1A 4TUFA 5HXMA 5TDPB 4PY7B 4OD2A 4N8VB 4MNHA 4HKXB 4F15C 3WS3B 1YEJH 1FPTH 4BK4A 3TH4T 4F33B 3S35H 5C6TH 3QI9D 3S37X 3HPLA 2A73A 4OTXL 5SX5K 4ODTH 3GK8H 4QRUA 3T0AA 3SGKC 5J6GA 2XNAA 2FGLA 2R56L 4JL2A 1D9KD 3FO1B 1EJOH 3QPXL 1MVFA 2FZ3A 3K1KC 4QTHA 1S7VB 2XKSA 4XNYL 3WF0A 2W9DL 3BYTA 1GJIA 4M02A 3OJDA 2XTKA 3U30B 1QVBA 1QG3A 4DQOH 2XYCA 3Q5OA 2EXYD 1CFTA 2I07B 5SWSA 2CERA 1JGDA 3BVVA 3O8XA 4U0QB 1QW9A 2CSPA 2IEPA 3DXAA 2Z1KA 4NO0B 1B0IA 4DVRL 1KUMA 3KR3L 5ALBH 2KKQA 4U3HA 5E5MB 2AJUH 2GJXB 1RZ8B 2ZKHH 5DZNA 3SQOH 3QDGB 1JFXA 5CZXD 3KLAA 4LCUA 4HIXL 1V08A 5BS0D 1C5CH 1RHFA 3TZVB 4UQBA 4ZD3H 4AZ8A 1UR8A 5CS7A 4AENA 4HWZA 1A6WH 1I3GL 5EO9A 1LE9B 4PSRA 1EFXB 2GTZA 4LCIH 3T2PA 3IJYA 1X6LA 2IBZY 4X8JB 3ARFB 1RHHB 3OMZA 3VXQB 5E99L 3CZFB 4U4BA 5F9JA 1IM3A 4DUWA 1LDPL 1MJ7H 2B5IB 5D1ZA 4LLAA 4XP1L 3WEXA 4EI5C 1T03H 5IGXH 4OLVH 4RL3A 3K3QA 4GW1A 1VADB 4YHKH 3GSNB 3RQ3A 1NEZA 3X12B 5I8CA 5KZCB 3EYUL 1F3DH 4F58L 1A1NA 3D0VA 3AIRA 1NQBA 5BXPA 3WKML 4AEHL 2NY0C 1BAFL 3MV9B 2VDKH 5I1HL 1B0RA 1GPOH 5EOQL 1QKZH 1P7QD 4L29A 1KC5L 4HXBL 3MRQB 1N7ML 1T0MA 4AT6A 3GJEB 1T0NA 4P2RE 3TLRA 1VFBA 1QNPA 3OPZL 1SBBA 4L8BA 5ESVB 1BG4A 3TONA 1LL7A 4PJ7B 4XX1E 4P2QE 5HYEA 5HGDB 1KJ2H 2YD2A 3D6GA 5TE4L 4WI4A 3UPRB 1NC2A 4HKJA 3W37A 1U6AL 3U48A 2V3EA 5D2NE 5FGBA 4AD3A 3QA3B 1TMQA 1HHIB 1J1PL 3X3GL 5CJOH 3SDAB 1WDRA 4RGNB 2DQHH 2YR3A 3HZVB 2NZ9C 2DBLL 4DN4H 3D3VE 2VDOL 5JZ7D 1ZT7B 5A40E 2AV7A 5I8OH 1NGWB 4UILH 3VDAA 3O3EB 2XGIA 1KNOA 3GRWH 1R24B 1T20B 2FATH 4ZXBB 2O5ZH 3SE4C 2E7LA 2CKNA 5DK2A 4FZ8H 2ZCHL 4LVNB 4D8PB 5JNYB 2WMKA 1EDQA 3PNWB 4UOW1 1DWJM 4DKDC 1AP2A 3O41B 3BN9D 4P4RB 5IFJB 1VKXA 3P0VH 4WHTA 4PREB 3EO0B 4LBEA 1CIDA 2V2TA 4P5TA 3U5UA 4CVZA 3P0GB 2XTJD 4OQTL 3RZCA 3MJ7A 1X5AA 3BGFC 1CBGA 3PE9A 3KL5A 2R1XB 1IC4L 2ZWZA 4GAYA 4D6HA 5J8OA 5MP6L 4Z0XB 3T4YB 3CMGA 4MSWB 4P23A 1SVZA 1MHHB 1R5WA 4DGIL 4QHUA 4K2UH 3MRFA 4HP5A 2HRPH 1CZ1A 5DZOA 1AQDB 3BIKA 3ZO9A 3W6LA 4AZCA 3PGDA 4NQDB 1FA2A 4JAWA 5BV7H 2ITDA 5GGQH 2VC9A 3QXAB 1YEFL 4CKVX 3WUWG 5GGSY 2XZCH 1U91B 2W59A 43C9B 4XCFL 1LQSR 4LHUB 1R85A 4PRHA 2Y1VA 5EOCJ 1GGIL 2JJWA 1JFHA 1IKNC 4NNYA 3B83A 1C5BH 2F1BA 2A9ML 4Z7NE 3NABL 5HVWA 5EU6E 2AJVL 3HLAA 1BREA 4XPFH 5I1DB 3DV4A 1JTOA 2FECL 3UTSB 1JF5A 3B8YA 3Q6GH 3VFUB 1W32A 1U3YA 1ZAGA 1FG2A 4BQCA 1DQMH 4PJXF 1G9NL 4WW2B 4IRJB 1OGAA 3WDPP 2OI9C 4HPOL 4LEXL 2WZHA 5TDNB 4K3DL 3CSPA 2A74B 4PV8A 1OB0A 2IPKA 3IANA 5HI5C 1CFSA 4MXVF 5F1IA 2BOBA 3UBXI 3QUYB 5KVFL 1F3JA 3UBXB 1NMCB 4MNQE 4O5LL 3DIFA 5D7LB 1YJDL 1AHWC 3D2UA 4R9HA 3MXVH 1FFPB 4AW7A 2HP4A 1ZLWK 5C71A 3ZKNC 4ZTPL 4F7EA 1V6WA 2C7UA 5HYSB 4MB3A 5I9QC 4JHAL 1ZHBB 3MSDA 5JORA 3I2CL 1YQVH 3BN3B 3MZTA 1W72H 3HE7C 4JDVA 4JRXE 4FTVA 4OJFH 4UOQA 2XWJB 2IBBA 5J1AA 3BT2H 4D9LL 5M7QA 1BOYA 2NT0A 5GGTA 5AC5A 3IS1X 3C5JB 2X44D 5GS0C 4OLXL 32C2A 5KVGL 2ZCLH 1E15A 3C09C 1DVFA 1EAPB 2BK8A 4NO5B 5FK9B 4ZOBA 3UROR 1MJJA 3GM8A 4EI5D 4D71A 3VGAC 3WMCA 4U49A 3JVGA 3BDBA 4UT6L 3EDJA 3GZKA 1H3TA 4EQ3A 4P7NA 3ZDXF 1XH3A 5FUZH 3WFEH 3AHYA 2ILLA 3VMPA 4PG9A 4YNYB 2VN4A 1CFVL 1CIUA 4YHEA 2NY0D 4JFED 4E5XA 1LEGA 3MLXH 1GGCL 3BKYL 2GUOB 4IHOA 4QRRE 5E94B 4JQIL 2IH1A 2A3BA 1LWRA 1PG7H 4HGMA 3SE8H 2YXFA 2XIDA 4ZFZA 2ARJA 2B0SH 3QO1A 3PZIA 1Q9LA 3GH4A 4I8DA 4H26B 1IBGH 4N0CC 4GLRH 3V2AR 4Y2DB 4HOXA 5C0CD 4PRNA 5T5FH 5HGBB 2WMIB 1FG9C 3PABA 3MOBH 3DRQA 3GHEH 1QVOB 1IGFH 1FHDA 3R0MA 1MCOL 4GS7C 1DDHB 1AXTH 2HWZL 1DFBL 5DWUL 4OCXL 2OTWB 1UACH 2NY1D 3WKZA 1F6FB 3U79A 4MNGA 3CUJA 1BMGA 3P40A 1WAAF 3CH9A 3VFVB 2XPGA 1JYNA 2ADFH 4EN3C 1JZ2A 1FL6A 2AK4E 5I1AB 4D9RD 3NCEB 2P1YA 5FV1L 4WU5B 1KG0B 2GJ6D 2EE2A 1NGYB 3MRIB 3RDTB 3BO8A 4F9DA 1EEZB 4P2RB 3G6AB 4XRCB 4PJXE 5KW9H 5CSBA 5D6DA 1LWHA 2G75B 5CIPH 1A9BA 3F62A 4TNVK 4O00A 1LG1A 1IGIL 3L7FA 2NY5L 2QSQA 1UZ8A 4OM1H 2OQJB 1O7VA 5FL1A 4R2GC 4MXVE 5D2NB 5SWZD 1QRNA 3L9RB 2WWCA 3Q3GA 4YEEA 1XGTA 4XPBH 2IWGA 4GAGL 1DBBH 1OT2A 4DCQA 1U33A 4Y8DC 4XAKE 1JPFA 1KENH 1EXUA 4RSVA 1NP2A 2B1AH 3D85D 2JIXB 1F58L 5EWIL 2OWWA 2EYRB 1NBVH 3FB8B 3MRMA 1M7DB 3R1GH 2J88L 4H88H 3FQUB 3QQ3B 4UV4H 1J87A 2Q6WB 3B9AA 3HPJB 3NCBB 5H35B 1WJ3A 2NX5D 4PB9L 5L2JB 2YKKA 1IGYB 4X9YA 2GIYA 4KI5F 5E2UL 4POZC 3WDHA 3EFFB 4JFOB 3A67H 6TAAA 1RIHH 3TFKC 1MY7A 2A77L 2DQGL 1JGVL 4V27A 3V7AG 5D7SH 3P4NA 4JFZL 3ZKQD 4UT9H 1TFVA 4YJZL 5DVNA 3MOAH 1T7YA 4GRLB 1CGWA 5C0NC 1LO5B 4Z8FL 1QEWA 3ZDXE 4PJEF 2WCGA 4PY8J 3L5IA 4HEME 2QQLL 4UDTA 5F7EL 1QWUA 3EMQA 4S11A 5CEZD 1UASA 2VSCA 4X7TA 4QNPF 4W87A 1BLIA 3VRJA 1FSKC 1R87A 1I9IL 3BP6A 4NQEB 2X1PA 5F9OL 4FXLA 3F5JA 3ARVA 1MWAH 5KVMC 2XRAL 4X9BA 3BXWA 4TQEL 5E5UB 2YPLB 1I1FB 2DQJL 4J8RB 5E8PB 1KCRH 1KOAA 3C60C 2DQFB 3HE7D 1GGTA 2VLKD 1C7TA 2Z91A 3EGSA 4JKWA 5EU6B 5JOPD 1KBGH 5EN2A 3HG5A 1NFDA 3IU4L 4QHMB 4JO2H 2EH7L 3MRPA 4BQ4A 3MODH 1KJ2B 3X17A 4PJ8B 1GVIA 2P5WA 3QIUC 3ZTJH 1HH6B 3N17A 3VFSB 1NBYB 2VLJD 5GS0D 4TXEA 3WIFB 5H8DA 4AZGA 4R7NA 1JBJA 5C0RH 3L5XL 1XCTB 3MLYL 4J1UB 5IROC 2IGTA 4P5MA 5F71A 1PFCA 3PL6D 4JZNB 3GI8L 4AZIA 3NH7L 2DKMA 1NCUA 1JNHB 1RULH 1L9MA 1F90L 1WAAE 3V4PL 2Q20A 3LCYA 4LEOB 4CMHB 4MNQB 3D1MC 3IFLL 1X6NA 3DHJA 1ERNA 3ILPB 3CZ8A 4XPHL 3PXHA 4WFGD 3PHQB 2BFGA 4LHQB 1KN2L 5HPOA 1VA9A 2DTMH 3L3GA 3KPRA 4NJAL 5FO7B 1D6EA 4JRXB 4UFLA 4AZBA 3VFMB 5FOJA 3WFBL 3C6LB 2EADA 5JXAL 1HXYA 5IWLA 5I73C 2IMNA 1M04A 1T1XB 5C2UB 1MF2H 3MI6A 5EU4A 1K5NB 4XAWL 2WM0A 4AG4H 1S9KC 5M17A 1WWAX 3HC3H 1PKOA 3H0TB 2YKLH 4AZ5A 4K68A 3WD3A 2WC7A 5DSCB 1V3JA 3GXPA 1UJTA 1CECA 3PXJA 4R5EA 2EQDA 1WZKA 5A6BD 4CU7A 2M2DA 4HUVB 1AQMA 2HKHL 4LLYA 2D7TH 4XCNB 1UH3A 4MJ5A 5L0QB 1WFUA 4JFUA 3EYQC 4NF7A 4HF5L 4G9FA 4XMPL 4OIIH 3RVWC 3UESA 4Z7QF 1I9EA 4EN3D 4YO0B 3DVIA 4KI5E 3SY0A 1R0AH 4HWNA 1P4BL 2XM1A 3U46B 4QRRB 1JRHH 1E6JL 3HFMH 4ONHB 1INQA 3UYRL 1E0OB 3AMLA 5JOEA 3F7VA 3BVNB 2DM7A 4AMKL 2FX7L 4PRIE 1X1NA 5HPCA 3BE1L 4U1MB 1I8KB 4R2GD 3IJHA 1JJUA 3GXMA 2YS4A 3V4UH 1RZJH 1TZGL 5I1LA 4QNPE 5C0AD 2EDWA 3U0WL 1IT0A 1BPVA 4K94H 4KKLC 3ZM8A 1HP4A 4K3GA 4C7DA 3PWJA 1E73M 1B4RA 2L0DA 1J7VR 1C1EH 2XZQL 1MCJA 4P2OB 1XF2A 2UV3A 4WFHE 3RDKA 4P8VA 1RUMH 2CDFB 3U7AA 5FHBL 5C8BB 4GXPA 1FC2D 3I3DA 1B2WL 4HK0A 2AK4B 1YNTB 1P1ZA 4UIKL 4I9WE 2VX4A 2UYLA 3W9EB 2NW3B 3ZTJG 3HA0A 4C56A 3SCSA 3GGWB 3QUXA 4LPVA 4POZD 4ATDA 4WSKA 3QEQB 1QSEE 4PJXB 3A0OA 1NDGA 4UU9B 2YD7A 3TFKD 2BFVH 2NMSA 5T1LA 2GAZB 4I5BB 3THMH 1HDMA 1ZGLA 3X3FH 1UXSB 3MFFA 3S36X 5C0ND 5FO8B 1GZQB 2VDPH 4NFBA 4HULB 4KKCD 3SGDH 1ZA3A 1H49A 5HHNB 3HE6C 3VWKC 1F4YH 2EO9A 3CUHA 3G5ZB 4OF6A 3WH5A 3ARDC 3UTTE 1P69B 4D0CB 2OZ4H 5I1CL 1YNLH 3GBLA 4NQXB 4O2FB 4JFVA 2YD9A 3VPLA 2DI7A 4FQCL 3ZJ7A 4UTFA 4PJ9D 4HPHA 5T1MB 1R3IH 5IP4A 1JGUL 4FQIL 1HIML 3C60D 1GJUA 3FFCB 5TF1H 3I75B 5F3HA 5CD3B 3RBSA 3HZ3A 5INCB 3GSUA 4OKDA 1E56A 3MLPA 4PCSA 4Z2LA 1KTCA 3A4WA 1HI6B 5I8EA 1Q9KA 3NFPA 3LHPH 2IH3B 3QIUD 1XGQA 4TVPD 4HBCL 3WNMA 3VXUE 4CD7A 4PLNC 3HUJE 4MWFA 3NOIA 3LIZH 1FORH 5DD6B 3NFSH 3FO0H 4TTDC 3R8QA 2C8NA 4NXSA 2GK0B 5CD5C 4DWSC 5E0QA 4MQSB 5ID0A 3AI0A 1LK3L 2YDRA 5B39A 2F2HA 4K9EH 2BOCA 4KJYA 3E8UH 3FT2B 4KUZH 3CZLA 4DGYL 1A5FH 1QFWM 1XH2A 3V95A 3IGAB 1G9EA 3TCXA 1XIWD 2GK1A 3REWB 5CPQA 1TPXB 2D23A 2ICEB 1AI1H 1NCWL 4OZGF 4EAMA 4P5KB 5DRZA 4GJTB 1XSIA 2K1MA 2F58H 4Y5VB 3AFBA 2X4RB 4AMWA 1FNLA 1W0WA 3PWLA 2VXQL 1WBYA 4X0KB 2X70B 2C1PA 4OCRH 3SGJA 3STBA 3QGVA 3IFPA 5CIPB 4CD6A 3BVWA 1IGJA 3AMKA 4HUKB 5BQ7A 1SJEB 4PJBF 4TSAH 3ZHLA 4ZFFA 1MCPH 2WKLA 2R4RL 5HDQH 1YN7A 3BD4A 3P4OB 1A1MB 1C8PA 4DKFL 2E7BA 4WO4B 5C0FB 4KKNA 2H8PA 4X7EC 4P8UA 2ATKB 2EIBA 1O7DC 5IF0B 5FL0A 3I9GL 5J06A 2MNUA 4OZIA 4W85A 3RVWD 3UTZA 3HZYB 1R86A 5AYQA 3DX8A 4M6OH 3EO1A 1G0XA 4H5SA 4RGOL 1EO7A 3IDMA 3CMOL 1HL9A 1F2XK 1PBYA 3BKMH 3GMPB 1UB6B 2AV1A 3D18A 4EOWH 4ODSL 5F1KC 2PYEE 2ORBH 4NO3B 4FQXB 1KACB 1QFWL 3KPNB 5DTFA 3TBWB 3ARBA 2FSEA 2B7DT 4PGDA 1QP1A 1DWAM 1OGGA 4QRSB 2IFGA 2XN1A 1MAKA 3P4MA 4LSRH 2FDBP 4KKLD 2FBJH 4J4PA 3GNML 3BSZL 3L4TA 2YD8A 2PO6D 3F12B 2NW2A 4CW1A 5D4QA 2AXFA 5F7YC 3EJUA 2P8PB 2UWFA 4F7MA 4AD1A 3L5WA 5HGHB 4JO1L 1MWAB 1T1YB 4LF3B 3ZE0F 4H25B 1NQ6A 3MNZA 1XFPA 1TITA 1DANT 2J7FA 2HVJA 1E0WA 1ZOXA 3FKUS 1ZV5A 1AD9B 4PRIB 2ZXDA 1QSFE 1FNEB 1MJ8L 4PJEB 3EFDH 4UFIA 3L4YA 4B16A 1VSCA 2D24A 1PJ9A 3O6FA 2EDTA 3E6FB 3D3AA 1K3IA 4W7WA 3H3BC 1KPUB 2VNCA 4Z7UA 1QBAA 2X05A 3WN6A 3D69B 3ARDD 4GOSA 4HZ6A 3PZUA 3IDIA 4OZGE 1OAKL 3CDFA 4F7PA 4L9LC 5F88B 1GQLA 4U3AA 1OP9A 2P24B 3L3DA 3VIKA 4PMOA 1Q6EA 2AQ3A 4U6XB 3A4AA 4JPIB 3IFOB 5KS9E 2GSGB 3S5LG 2H26A 3U2SB 2K3TA 3L3IA 4MVBC 4HA1A 2G4FA 4G3YH 3UDWA 3ULVL 3DO7B 2CKBH 2K7PA 4RAVA 3T0ED 1QSEB 4PJIE 4PJBE 1FGNH 4A6YH 1H09A 5FUOH 1RJCA 5B38A 5JXED 4ETYA 1SBSL 5TF0A 3AUVA 2DT1A 2PTTB 4L1HA 3RWHB 5C0JB 2B1HL 2J8UA 2J78A 1U0QA 2ADGA 1J1OL 1MFUA 1N5AA 3NN8B 4DWSD 5FDYA 4YHML 1SYTA 5L9DL 4R4FH 1BOGB 2OJEA 2V3FA 2F7RA 3DWTA 3CFEA 1KXTB 5C08E 4U7MA 5A8OA 2BNRD 1C08A 4LQFH 1V02A 3UTTB 1YUHB 3B9KD 3T4AB 3RY6A 3QCTL 5C09A 1ZE3C 3S6TA 1DANU 3VFPB 4AY1A 4U1KA 3PUCA 4NT6A 1LL4A 1GH7A 1JGEA 1JRHI 4M43L 1BECA 1EBAA 2NY2B 3ARGB 3ROLA 1MRCH 4L4TD 1KYOK 4LHJB 4QXUH 3GYCA 2EDLA 1VACB 3NBNA 5I1GH 1KTBA 3CVIH 2XA3A 1E28A 1FHGA 2CLRB 1C16B 1FRGH 2A3HA 1G7MB 2VRQA 3X11B 3T8XB 4WTZG 3AREC 4LSUL 4GSDH 3FFDB 3MRBA 4NDMB 1QI5A 5IVNA 3MLUH 2DBJA 3VXUB 1U3HC 1OM3L 1XD0A 2XIBA 2BRRH 3HUJB 5HGAB 1P53A 1JHLH 3DVFA 1DQLH 5DJ8A 1Q9WA 4Y4FC 2YZ1A 1I1XA 5EMYA 1TQTA 3WH9A 3HS0A 4GRMB 5CINL 3NTCL 3FN3A 1OP3K 2F53A 2GTWA 1DBKH 1WWWX 4LSSH 5E6ZA 3ZO0A 1XD1A 2QSCL 4JM2F 3VXRD 4PJGF 4OF5A 5DVMA 1MUJB 1X5LA 1VESA 3FONB 4O2CB 1ADQA 5CGYD 5DDHB 4JFDA 4WSJA 2AJUL 3BQUA 3GIZH 2EECA 1A64A 3PIQA 3NZHL 3OKLA 3WUFA 2BSED 1KGCD 4QXGH 4IOFC 3O6AA 1U2YA 4Z2IA 1OAQL 3WXVH 3BEVA 4NPYA 5F9WC 5CLWA 1SHMA 3UG4A 1NGXB 2BCKB 4WW1B 1ZWIB 5L2KB 5DUPH 2HVKA 5D70L 3L3OA 3N06B 4JQVA 1J10A 2BRQA 3KZSA 1KCVL 1MLBA 2XKNB 3A6BL 3QZWG 3TO4D 3VFGL 4RA0C 4MHHG 3R4DA 1H1NA 3RHWK 2VTFA 2BDNH 4HZLB 4OLVL 2V7HA 3IDNB 2WHMA 3HAEA 3RILA 1MFBH 1R7AA 4W70A 4QRTA 1BGAA 3LAFA 4QTIL 2WAHA 3FXYA 3N15A 2HMID 2OJZH 3O8XC 5F6HJ 2NXZD 3WD0A 3M17B 2VZ1A 4M1DH 1ITXA 4W5UA 2DIAA 2YEZB 4UUJA 5KSBA 1CK0H 1ES0B 1NLBH 3DX0A 4XNUH 1J9YA 1H0DB 4ZNEE 3RA7H 3N1AA 4WGWB 2PYEB 1X7QB 4KTDH 1KXHA 1JDDA 1YMMA 3OAZH 3SDDA 2MHAA 2F5AH 5IBUB 1KJMA 4CD4A 8A3HA 3MCG1 5DJCA 3SQBA 5F7UA 4MAYD 3GMOA 3ILQC 3ROOB 1FO0A 4GAFB 5F21B 3Q6FA 1SY6L 4EE9A 3BJLA 1T89A 2FIRT 2D0FA 3RWEB 4JFYA 3QCVH 4Y4KB 1Q0YL 4HDIB 3X13B 1GJWA 5I8OL 1TLKA 4XNQB 5E6ID 2ZOKA 4PP2A 4YXHL 4I0PD 5E8OA 4FNLL 3RWIA 3OZ9H 2B4CH 1BM3L 5D1ZC 1AC6A 4X6EA 5JDJA 2Y4SA 4L4OA 4DFHA 4MVBD 3LMJH 1NC4D 1K2DB 3BPLB 2EDOA 5KAQF 4TVUA 4IUGA 3W0WE 4HCRA 2OMBA 1XF3A 3P0VL 3HHRB 2IADB 1O5DT 1QSFB 3ABZA 1K6QH 3IT8D 3WYRA 3LRSB 3K1DA 4JHWL 4L8CB 4DAGH 3TWCH 3MRNA 3N9GH 3G08B 1PEWA 2EYSB 3S3JA 3CDGB 1A0QH 3GMQB 2G2RB 4QRPD 1GZPA 2DWDB 3CUPB 1CT8B 4HUWB 4PJGE 2OX5A 2CO7B 4P57A 2PNDA 1A6UH 1WSST 4OOZA 5CP3H 3CVHA 4OZGB 3MRHA 5DYOA 3PTKA 3O3BA 3INUH 5FGBC 3V0WL 1EMTL 4C57C 5BV7L 1F3DJ 1GRWA 4KUCF 5GGUA 2W66A 4UINH 3ULVF 5KS9B 2YSSB 3S9DB 1GPFA 3GXFA 4MA3B 2Q8BH 4DVBA 4PTVA 4PJBB 4HV8A 3ARED 2ESVD 3EBVA 1UH4A 2YUZA 3O6LL 4M48L 1WPCA 1RZGA 5LWYH 5LAXB 3MGTA 2FB4H 1K8DB 1U3HD 25C8L 5D5ME 3FRUA 2XN0A 2WYSA 1A7QH 3TN0A 1A7RH 5EZLA 2VISB 4Y4FD 1HOCB 4XPTL 4JVWA 3BAXA 5C86A 1AVAA 1SEQH 1J88A 1JHTB 5F9AC 1JF1B 2O9RA 1CYGA 3MRGA 5C08B 4P5TC 1QBML 2JJTA 4A2LA 3RZCC 4WF7A 1OW0C 3T2OA 4JO3L 1W1PA 1MFNA 4ORGA 5IQ7L 1NWRA 1AR2A 1XCQB 1MQQA 1HKLH 3VRIB 4K23H 4P23C 4JAMA 3ZJKA 3V8OA 2PYFA 4BFIB 3T08A 3QHZH 4HFWA 1EQCA 4V28A 1P4IH 5EU7E 5E5RB 3OKKB 5MENA 2O9TA 4E9LA 1UXWA 3CCHA 1WZMA 5JR1H 3U5YA 3AZRA 1SYSA 4IOFD 3SKMB 5MI0B 1W72L 4AIXA 4Z2GA 3WD5L 1NAML 1RUPL 2JCCA 4LVEA 4R90L 5TH2B 2YRPA 2HFEB 5FYKL 1US2A 2OL3H 2Y07H 4OBRA 3QIBA 2I9LA 4NNPH 4LCCA 4DJMA 1LG2A 4U0RB 1ETZB 2ZCLL 1AQ0A 2X4QB 4JVPA 4XCYB 3NCFB 1XT5A 2WC3A 1J01A 3U9UA 4CL7A 5FYJU 2P8MA 4G8GA 2A83A 2WW8A 3ESUF 3QXDA 5SWSD 3BUYB 3F6LA 2CIKA 3H55A 2HG5A 3O4LE 4LCYA 4LXFA 3RY4A 1FH5L 3LDBB 3MLXL 4LNRA 3N1GC 3OAUH 2CKBB 1BIIA 2AP2A 4A6YB 3OF6A 4XVTH 3QUZC 5EUKA 3VE0B 4JEGB 4W4OA 3BSGA 3RTQC 4UB0H 1WBZA 4PLJC 3FB6B 4G6FB 5FF6A 3EOTL 1AO7A 3W9DB 2BVTA 1JNJA 5EZIH 5IM7B 2V17L 3ILQD 2JJSA 2J77A 1EAJA 2X10A 4LFHG 3U4BL 3AY4A 4KROC 1ZLSH 3UTOA 3O6MH 1W2VA 2ADJB 4NUGL 1IKFL 2F19H 3PV6A 4JRYD 3BRDA 2BX5A 5CEYB 4I2XE 2HJLA 2E9MA 4HSQA 1ISWA 2BVOA 3PQYD 3LRHA 2YRZA 2NPLX 1UACL 5EOTA 3DHUA 1DVFC 1KYOJ 5D1ZD 1LQ0A 1TMCB 1OSZB 3EAKA 5I19H 5IVOA 1UQSA 2D7PA 4F3FB 4MS8C 1FZJB 1GXEA 5DRWB 1VB9A 2AJYH 2EIEA 4WEMB 4ZUUA 2VSDA 3IYLW 5JA8B 1CBVH 3DDFA 3C8KA 4H8WC 1Z3GL 3T1WA 1SZNA 3DBXB 4U31A 2H9GB 1SMAA 3CUFA 1RIUH 3THCA 4N0FB 2D7NA 4E4PA 4YK4C 2A6IB 4AC1X 1MW1A 3G5XB 3NSXA 5HY9B 5F96L 1BVLB 2J8OA 5F1NA 4ZFOB 4YDVB 4NYLA 2BJMH 4DO6A 1V0KA 5I78A 4IPLA 4XPBL 1GL4B 4OT1H 4IRSB 4X4XB 2WVTA 3GSOA 2J8GA 1KT2B 4H1LH 1E4WH 4M62L 3UR7A 3MMEA 1F4XH 5E09A 5I77A 2I5YL 3IDYB 5DMGC 5B4MD 1F45A 3VGGA 4LASL 1ORQA 1FYTA 4GG6A 3ZKSD 2FIKA 4YWGH 1ND0A 4YBQC 3LEXB 4ZPTA 3MCLH 4WUUA 2JK5A 2DWEB 1JTTA