1GVIA

Thermus maltogenic amylase in complex with beta-cd
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
588
structure length
588
Chain Sequence
b'MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPAISPKGARPWGSEDPTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGAASRYKDWFHIREFPLQTEPRPNYDTFAFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGLIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRALRRGDVAFLTADDEVNHLVYAKTDGNETVMIIINRSNEAAEIPMPIDARGKWLVNLLTGERFAAEAETLCVSLPPYGFVLYAVESW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALTOGENIC AMYLASE
publication title Cyclomaltodextrinase, Neopullulanase, and Maltogenic Amylase are Nearly Indistinguishable from Each Other
pubmed doi rcsb
source organism Thermus sp.
molecule tags Hydrolase
total genus 165
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gviA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gviA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gviA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1gviA03
3FFCB 2X0HA 1HEZB 3WLWD 3TNMA 3WNNA 1J18A 4JHWH 1WZLA 2V2XB 1QO3B 1NAMB 2DD8H 1AKJB 3INUL 3CAFA 5SWQB 4CDGC 1KBKA 3QJFA 3P2TA 4UAOC 2B1AH 2WVTA 4LYPA 2RJMA 4KK6D 4PGEB 3JWOL 3OHXB 1T4KA 3TN0A 2BSRB 3EOYG 1WO2A 2YL5A 3WSUA 4X80L 4TUFA 3CFEA 3CFJA 1NP2A 5FO7A 4WUUD 5GRUH 4JM4L 5DD1L 2C3VA 3P30H 1YMHA 1I3UA 4U1MA 4ODSL 4LEXL 12E8L 1BYCA 5ALCH 4S1RH 3V4PH 2CK0L 4UUJA 3SHSA 4UFJA 1OD9A 4LFHG 1E0VA 1MCCA 3VW3H 1C91A 1QKZH 2IANB 3FQUA 3FQWA 2FEDD 1UADC 3GNRA 3SGKC 1DQDL 1WP6A 1EO8H 3OJVC 4F7CA 1G6RB 2WBJC 2FL5B 5DT1L 1K5NB 1IGYB 4N0FB 4NCC1 4M48L 3MMWA 1ISZA 4DUVA 1A4KB 3U7AA 1JGLH 1YPZF 2VDKL 4HOXA 4MNMA 3HI6H 1JG9A 1UWSA 5CLTA 4GMSL 4KAQL 5CJXA 1PY4A 3IXAA 4M7LH 2O5XH 1R33A 5FDWA 1FA2A 3D50A 2UZIH 4OLWL 2J47A 1ZT1B 4NHCL 3RDTC 2O9OA 4OD2A 1UD2A 1NLBH 1ZHKA 4J3UA 1V6UA 2EDEA 1FV1A 1B3WA 1MCKA 1NGYB 4I0PC 3L3DA 3TBVA 2BMKB 2VLKB 4HWEL 3MBXH 3X13B 3BKMH 1DQLH 2N4IA 3HR5A 3KYOA 3QDMD 5CGTA 1PZ3A 1CICD 1GHSA 3BO8B 3RWGB 5IHUL 1V0KA 3EAKA 5GPRA 4WWKC 3ARFC 3IGUA 3VFTA 4PG9A 5BRZD 2LABA 4JREB 3U46B 3SKMA 3EW3B 1XGQA 3PHOB 1RZJL 1I1XA 5HHVL 4QTIL 2UY4A 4HJJL 1A7RL 4B9ZA 3RX5A 4S3KA 2IGFL 1I7TB 4JAMB 3RUGB 4GZJA 2ZWYA 3C9NB 3KJ4B 5DUML 2XJ7A 4JRXA 1A9EB 4X6FA 3RVUC 5D72H 3CK0L 1J5OH 1PZ2A 2EADA 2XYLA 4JFPA 3KPLB 2C9AA 3TV3L 2AKRB 4G7YL 4PJBF 3K8KA 4BSWA 1UZ1A 1IT0A 2AEWA 3BIKB 3IFLH 2P46B 3WNPA 5F7DA 1FRGH 4GRLA 2XZAH 1E4NA 4PS4L 3PL6A 5JW4R 4WI6A 4FF5A 3SKJL 3PZNA 5E6IC 2B4CC 4D6GA 2M2DA 1NWTA 4HC1L 2XY2A 2GY7B 3MCLL 4R97B 4NZCA 5TE6H 3MSGA 2B7DT 4HWBA 3V2AR 4EI5A 1MRCL 2VQUA 5D5ME 2YEZB 1HHJB 4CN6A 3VD9A 5ID1B 4I13B 5HDOA 3V6BR 3LEVH 2E7LA 5BXRA 3GI9H 5IWLA 2GSIA 5T5FL 2R69H 5SWZB 1S8DB 4DW2H 3DARA 2J12B 5JO5B 2FX8L 3LRMA 2DBJA 1KB9K 1HHKB 4V1DA 2NY3C 3MO1A 2JB6B 4OUEA 4FMKA 5IMMA 4YQXH 2NW2A 2YS4A 5C0GB 2XGBA 2YZ1A 1B4JL 2WHJA 1MAMH 2VKWA 3WS6A 2NR6D 3HCVB 1MOEA 1K8IB 1MCIA 5JIHA 1TZIB 5E2WL 4K68A 4PP1C 2HFFA 1GGIL 4DGVL 2VABA 3QHOA 3MJ9L 3QEGH 1TQBB 1YPZB 2YA2A 4F7EA 4YHYC 1AD9A 5FUOL 3TZVC 5EBLA 1ZHBA 1A6ZA 1LEGA 3CZGA 2JJUA 4PJAA 4PRPE 1FDLL 4XT1C 1CDIA 1H5VA 1I3GH 4WHDA 4C7FA 1QLEH 4DN4H 1R8LA 1NCCH 3IU3B 1HVXA 1NEZG 3PABB 2PBGA 4J3TA 1WAAE 5EDXA 5MEPA 5C09A 1TFHA 1CEOA 5KG9B 3OAYK 4X0NA 5F7LB 4N68A 3MROA 5LGHL 2N1KA 4IS6A 1M05A 2CDFB 1H3XA 3VM7A 4M9OA 4W68A 3SBWA 2DSWA 4ZXBC 4WUKL 1ZA6A 4PRDA 5F7EH 3D1MC 1QVBA 4HLZH 1FNFA 4YE4L 4GQPH 1XSIA 1M7IA 3SY0B 2Z8RA 5CEZH 1T1ZA 4DUXA 1OP5H 2F7OA 1QBML 2ED7A 4Y4KC 4Y8DC 2YLLA 5IK3A 3OGCB 2HTLD 5JW3L 2BC4B 4PBXA 3U79A 4RQQB 1WNOA 4YK4C 1YN7A 3BH8A 1FL6A 3TONA 4PJBB 1RUPL 4LHUA 1MJJA 4JQIH 1MFEH 3WJLC 2P5EB 4X7SH 1MNUH 4RFOL 1MFBL 2QHRL 1CGWA 3FFCA 3KLAA 4WFFE 1H3UA 1GIGL 1PGRB 4MYWB 1Z9OA 1FNGB 5E4EB 5MERA 4O4YH 4R8WL 4TNVK 1NAMA 1AKJA 1F4HA 2CKBB 2CGRL 3MRRB 4C54A 4QLLA 1YQVH 3KZSA 5E08L 3B2UD 5C86A 1OAYL 2DQJH 4K71B 1HKJA 1GHRA 3MRBB 4MADA 3JVGC 2J74A 2XHYA 1AFVH 4WUUA 4ZUUB 4BF7A 2YKLL 2IAMC 1PY9A 4NFBA 4XNYH 1WEJH 2WV3A 5DJ2B 3SUTA 3I2CL 4OQ1A 4PRPD 3NOIA 1WIOA 4TULL 1FYTB 5I66A 3RGHA 1OGTB 2IANA 4IRSB 4DO5A 5IBLD 2ZXDA 4LSUH 5J1TC 3BEWA 2X1QA 5IG7B 1HWGB 1LO0H 5J13C 2CDGB 1MXGA 1MI5B 4WJXA 2AVGA 1IGYA 4N0FA 4QWWC 5BOZG 2NZ9D 2F53B 1D6VL 2FO1A 3DXAE 1PZ5B 3VRLE 2R0LH 1F11A 4WF7A 1OARH 2YC1A 4NQDE 3MUZ1 1FNAA 3H7LA 1E6PA 3O3AB 3ULUE 1IT9L 2FH6A 4QF1A 3V0AC 3ARQA 3KLKA 5DEFB 1J12A 1P7QD 3PUCA 4P3CH 2F15A 4JY6A 4LAQH 4LL9A 4M6AA 5F7NC 4JO3L 3BGMB 4EBQH 1VBUA 2R0WL 4EKJA 2VLKA 5DD5L 3X13A 3WMSA 3GDBA 3DX9A 3LN5B 5C0IB 2PYEB 2FYYA 1LE9A 4N0CD 2WIIB 3FN0H 4P99A 5CWSA 4U3HA 4QY8A 3BX7C 5D1XD 3UCQA 3MYJA 4JVPA 5BRZA 3THML 4WFFD 4XVSL 3U46A 5MEOB 3WXWL 2HLFD 3NCJL 2GJXB 4EDWH 2EO7A 2D9CA 3PHOA 4FQXC 1QLRA 2X42A 3PQYD 3AZTA 3QIBB 3QXTA 5AAMA 2YPKB 3IDXH 1MQPA 4UZGA 5IDIA 4ZD3L 4RIRB 1I7TA 2KH2B 3RUGA 4R7NA 1K6AA 4K8RC 3C9NA 3IFPA 1DWHM 3FOMB 3BC9A 3L9RB 2N7BA 2PTVA 3W6LA 2ATPB 4GAJH 1GJUA 2DLIA 2JJVA 2J7EA 4OLYH 5GNYA 2J88L 1QSFD 4G5ZL 3IDYC 2GK0A 4QRTA 3QUYA 1CK0L 1GH7A 1BIHA 3RNQA 4YPGA 2Z8SA 4UIMA 4TPRL 3WUEA 3L3JB 4EN3C 2BCKB 2QHLA 4PGBB 3UTPE 4U1GC 5D2NE 3WFEL 3LD8C 3O6ML 4PLKC 2WUBH 3HZMA 2DQHH 3IAGC 5DJ8A 3WBEA 1TVDA 2VXQH 2CLVB 3MRMB 5HHNB 3MU7A 2PR4L 1BAFL 1W1TA 3RAJH 1DWJM 4L8DA 2HRLA 1ZLSL 2DBLL 5ID1A 3D5OF 4Q2ZA 4X83A 3DXAD 1NANH 3ZTNL 3KG5A 3AZSA 3QPQC 3WQ5A 1BFVH 4NQDD 3MREB 2VIRA 4F79A 1S8DA 1NUFA 1W8NA 4J3SA 1Z2KA 4AEIL 3ULUD 1S5IH 4K9EL 5HPCA 5KEZA 5MHSE 3QUMB 2JB6A 4LEOB 5DHVB 2WUCH 1OGGA 2VOTA 5EIQA 5JA9A 2L0DA 4OM1L 5BV7C 3HCVA 1HKLH 4WO4D 3R4DA 2WBGA 1K8IA 2NY5C 1JGVL 3UC0L 4M62L 3MLSH 5ENWB 3NYDA 4WTWA 4QKXB 1V7MH 3FB8B 4LSDA 2IG2L 3HPJA 1UR2A 4ZSOA 1P69B 4XNZC 4HF5H 3NH7L 4MB3A 1E15A 5ILTH 1NOWA 4CDHA 4P59L 5F44A 4P2QA 2ICWB 2H45A 5DVKA 3TA3B 3S34L 4GQQA 1A7OH 1EBPA 3BCFA 5FGBC 1W9PA 3ZYIA 3PWVA 4BA8A 3VFUB 1XIWD 3PGCA 3QEUB 1D9KC 1J88A 4YAQA 1BEYH 2ILLA 4G42B 4PRIE 1JXJA 2B2XL 3ULVH 4CNIB 1DBKL 2GYSA 5MEQB 3BUYB 3GHEH 4YXLL 3BDBA 1NANI 4OZIF 4IM4A 4EUPB 4XVJL 3OKOB 4CCDA 4X6DB 2DDQH 1G0CA 4YHOL 1AQMA 1G7IA 4O58H 4PBGA 3QXDB 2DLFL 1H8NA 5IW1A 2RHEA 1SEBA 2WYSA 1QLFB 5EIIA 4MAVA 3RWHB 5I1HL 3QHFH 1GVIA 3VXRA 1T7XA 3RI5F 5C7XH 1Q8MA 1ZHNB 2FEEI 2YFOA 5I1IL 3IDUA 4KKNA 1PKOA 4NUGH 3C5SB 5HI3C 1UA3A 3OGCA 3ZOAA 4L3EA 2D9QB 1E1EA 2D4DA 3BJLA 3VRIA 1YQ2A 5FCSH 2JIXD 4RMWA 2MWCA 1RIVL 4FZEL 5C9JA 5H35B 1GVYA 2OL3A 1A3LL 4IRZH 4TTDD 5MHSD 3KDMA 5CG0A 3GMQB 3QH3A 3MLWL 2P5EA 4XX1G 5F6IB 1S9VB 3RGVB 4DK3A 3QHZL 2LAAA 5AUMA 1CXFA 3WD1A 3GTNA 4JFWA 2EXYC 3VX1A 2CKBA 4JPWH 4X6CE 5LWYH 1G0XA 3C5ZB 2CO6B 3EOTH 4PJHE 3WF4A 1S7VA 1JUFB 1S9XA 1MCJA 1MCOH 4OUUB 1YECH 2ZCHL 4IRJD 5AAWA 1EAPA 1XH3A 1UJ3C 4KDTC 4HWUA 4Z78B 4LLMB 5IFHL 5M94B 1NC4D 4NSKA 3F12A 2PB1A 1OWQA 5IB4B 1I7UB 3FFDA 2BVUA 4U1IB 4X4ZA 5FYLE 2FE0A 4PJDE 4OV6F 5DJ2A 1MWAL 1MSPA 4J3WA 2JEPA 5HNNA 4WEUD 4I2XE 1ZLUK 4FNUA 3WIFB 5GS2D 1FYTA 2OCFD 4QHUB 1H15B 5DD6B 3JBG7 4PMNA 3G6DL 5DD3L 4H8VA 2DTML 4MAZA 3G08A 5IG7A 2CRYA 4PRID 2EIEA 5ITFA 2CHOA 5DEZA 1MI5A 3BEVA 5DVMA 5EBGA 3U36B 1A21A 3W0WD 4AW7A 4Z5RB 1KSRA 4LKXB 1QD0A 5A6AA 3S6CA 2F53A 5EC2B 3ARXA 1YEFH 5GRJL 1PZ5A 3KPRB 1L0XA 3JWDC 5T1DL 3RL1B 5EU3B 5DJDA 4LASH 5C0AE 2VZOA 5H2BB 4DCQA 5DEFA 1P7QA 5DMJB 5FUZH 1JPTH 3GXIA 4JZJC 2ZPKH 1RVFH 1CDGA 2DD8L 3BGMA 2BS9A 3H8NA 4P23D 1UCBH 2VCCA 2O9RA 5A6LA 3MBEC 2B1AL 4PRHE 2EZ0C 1GAFL 2HH0H 4YDLC 2FCBA 4WGVB 5K9OA 2WIIA 2ZP0T 3HG1B 5EU5A 5CLWA 4OZIB 1XV8A 5GRUL 3WHE0 5IB2A 5LQBH 4Y16B 3KHQA 4UZUA 1UQYA 2YKKA 3HS0B 1NGZB 5MEOA 3GSXA 5ALCL 3BP7B 4S1RL 3V4PL 3UEZA 4R6UA 3PQYA 4XXDB 4P5TC 1P2CB 3QIBA 1UA7A 1FAKT 2YPKA 1A3HA 3VXPA 1HIZA 5LBSH 3VFGH 2GJJA 2E7BA 4JKPL 3FOMA 4ZUWB 4LXFA 3G04B 1EO8L 4YHPA 3O6AA 2VXVL 4P9HC 5E00B 1P5UA 1SJEB 3F4VA 3C8KB 3RO8A 5I2UA 2YK1H 2XM1A 1QSFA 4HPYH 4LSRH 1JGLL 3WKML 4GXUM 3KE0A 2D31A 5T3ZE 3HI6L 3J8F7 1NP0A 3CUGA 5DR5H 1B2WH 4M4RA 5BZDB 4JFXB 3L3JA 4LPWA 4M7LL 4BFEA 2ZXAA 2BCKA 1JE6A 4PGBA 4U1JB 2UZIL 1EVUA 3VA2C 1TPXB 3N1PC 3WUWB 1NLBL 1U8NA 1YNKL 1NGQL 4QNPE 5D7JD 1NFIB 3CH8A 5ESQA 2CLVA 3MBXL 1PKQB 1HF6A 4N42A 3FNDA 3BKML 1DQLL 2A74A 3RVXC 3RI5K 3RY6A 2Z4QB 5HDQL 5ABFB 1PBYA 3GXNA 2JF7A 5IMOB 1LQSR 1J86A 1FFPA 1ZSDB 4M03A 5C0BB 5C0AD 1UR4A 3HR6A 1KUMA 1V02A 5FO8A 4MXVE 3QUMA 5FKPA 4WI3A 1YMME 2H3NA 1PG7H 1VRXA 4M6NH 1K4DB 4X9IA 5CIPB 1FN4A 2OYPA 1Y18B 1SM3H 1FGNH 3O6KH 4YHMH 3MV01 4V27A 4BM7A 3GSOB 2D7NA 3P0GB 4PRHD 3D18A 4XPAH 5D7IF 4PJGE 3QZWB 5ENWA 2XWBB 2VUOA 2VRJA 3KYMB 3FB8A 2F9BT 5D72L 5IROA 3P9MA 2BNRE 3O6FA 4KKAC 2O5ZL 4N9GA 1J5OL 2H32B 1F13A 2FO4B 2HVJB 3U4BL 5FFLA 3QDGE 1HKKA 4DKFH 5DFAA 2ICCA 4GRMB 3IFLL 2ZSWA 2ICWA 5ESAA 3VXSB 1FRGL 1I4FB 4UNTA 1X5JA 1RJYB 4PJXE 2I60H 3T4AB 2ESVD 1JNLH 4E4PA 1XIWA 3UR8A 4YFEA 1DWAM 4HSQA 5GS0D 4U6TA 3MRKB 4G42A 4M7KH 5K59E 1BOGA 5TE6L 3EDDA 2XVNA 3WDPP 5F1IB 2E6PA 3L5IA 3BUYA 3P77A 1I8MA 1X5GA 3FT2B 4E8DA 8CGTA 1WGOA 4S11A 4CVUA 3D2UB 3LEVL 3GI9L 1A5FH 1HH9B 1RIUH 2F8XC 5T3ZD 4X5XB 4EUPA 3PHAA 3OKOA 2R69L 1BD2E 4X6DA 3EDJA 5DUPH 2YMXH 3ALGA 4DW2L 1RZ8A 4R2GD 3GSQB 3W11C 3TO4A 4X5WB 2KQMA 1ZB5A 4Q0XL 1J9CT 3RWHA 1WBYB 4HK0B 4OFDA 4ZPVB 5HVFB 1W3HA 5AD0A 1MAML 1MCNA 2R9HD 3SE8L 1F90H 4Y4HD 1QNPA 3S35H 4TSBH 3C2SA 4PGJA 3C5SA 6A3HA 4JFEE 4JFZH 2PCPB 2LU3A 4LHUG 2JIXA 3QHNA 4Y5XB 2YBTA 4AD5A 3TBTA 3QEGL 5H35A 4UQDA 4PJ9C 4H0IA 3E2HC 1YMMD 3GMQA 4OZ4B 4IIQB 3QEQE 4GJTB 3HMWL 1R5WB 1XR8A 3A47A 5EZJA 3AM8C 3MZTA 1ZBKA 1ND0A 1I9IH 2EDQA 4D9LH 4V2BA 4OIIH 1KULA 3NN8A 3CC5A 3L6FB 4U0QB 1I3GL 1A3QA 1JUFA 2GJ6B 3PIQA 4DN4L 2BHZA 1WC7B 1NCCL 3D39B 4OUUA 2NXZC 4XBEH 2FHBA 5F89A 2BNRD 1U3HA 1HT6A 2A0LC 4LRNL 1NC4A 5IB4A 3QDGD 1I7UA 3EJZD 2HTKC 2WIMA 3N15A 1DN0A 2WCGA 4FNPA 1QBLH 4MLIA 1E6OL 2V7NB 4IDLA 4LKCB 4QHUA 1V3JA 5DD6A 5F1SA 1G7HA 5GGTH 4Z77B 2MCPH 3ZDZE 3KLHD 1MFVA 4X7TB 4WHTA 3REVB 3OKMA 3QP3A 4UT9H 3W0WA 1VBRA 4GW5A 5CEZL 3TT1H 3D69B 5D7IB 4LKXA 4Z5RA 4XMKH 3LHPH 1BD2D 3T1WA 3I84A 3BVWA 3RL1A 4PV9B 4OZFA 1OQXA 5GGRB 4X4YA 3V7AG 3SDDC 1G9NC 5EC1B 4X7SL 5H2BA 1KXTA 1MNUL 4M7JH 3LX9A 1HXMA 3GNMH 1IAIM 5GRYA 4O4YL 4PFEA 2YFNA 5EOQH 4MNKA 2LAGB 1UB6B 1L0YA 4MNQE 3TPKA 3OJDB 1ZGLP 4UILL 2OP4L 3PJSA 1YQVL 3T0EB 4D1IA 4JFED 2DQJL 3QDJA 3V9FA 3UG5A 2BFVH 2YJQA 4HZ6A 3RVVC 4PRBA 5J4MA 1KACB 2HJKA 3HG1A 2BVYA 4O02H 4NP4H 2YPLD 1A1OA 4IPNB 3V95A 4XNYL 3QEQD 3N11A 2Y25A 3HS0A 1WEJL 4IJ3C 5D8JL 3RQ3A 3TVMC 5BRQA 3BP7A 4N8PA 5A6BD 2X4UB 4H0HB 2XIBA 1A6PA 4POZC 5HTSA 3SDXF 3D25A 2P7TA 1KELH 1FH5H 4LSUL 3DMMD 5DXWA 5GS3A 1LO0L 4DOHB 3L3IB 4LHQB 4ZUWA 5DJYB 3ULSB 3CLEH 1MEXH 4GG8A 5F93C 4L9LA 3A6BH 5C8JB 3C8KA 1LVEA 2IPTH 1MQKH 5I71B 4PJDA 4Z7WE 3II1A 5JBDA 3BPCA 2F7QA 2R0LL 1OARL 1CGSL 1JL8A 2A6IA 3CMOH 1SBBA 4R90L 3RBGA 4NN5B 4BQ9A 1V08A 3MRDB 1I1AC 3BHBB 3TPUB 3D51A 1Z3GH 4U1JA 3BYYA 5D93B 4D9RE 5DMKA 3LEXA 4P3CL 5C8BB 2DMBA 2OMNA 4LAQL 4OUOA 3WN5B 5L88L 1E5NA 4P7QA 4EBQL 3VIMA 5J6GB 5H37G 1PKQA 2ATKB 4PJCF 5JW4M 3QNZA 2XA3A 3RNKB 1JNJA 2RR3A 4A4AA 2CPCA 3FN0L 4JY4B 4XCCH 1TA3A 4Z7UE 2DLHA 2P8LA 1QFWM 5JA8B 2BV9A 3VTRA 5DVLA 1VJSA 1GZPA 1CF8H 3IANA 1CQKA 4EDWL 3ZE0F 3QR2A 3CIVA 5CIPA 2DRUA 4Y88A 1MLBB 4MNQD 4MCYA 4I0CC 3NTCH 1N6UA 3IDXL 3GSOA 1F6AA 3RY5A 2AQ3A 2AV7A 1A3RH 3RWIA 3BVUA 4NKDB 4U7SA 4NQCE 1LP9E 5C71A 2XWBA 4PB0H 5AG8A 3UDWA 1T3FA 2HJLA 2QKIA 4FNQA 3DIFB 3MCKB 4D94A 3O9WC 4GAJL 2W38A 4C83B 4OLYL 2FO4A 4NZJA 2HVJA 3U6RA 3W29A 4OCNC 2BNQB 5DC4B 4JFDB 4GRMA 4CU7A 3RHWF 4JQXA 2CUIA 4C4KT 4RFEB 1ZLWH 1I4FA 1C7SA 2ESVA 3AHXA 2OXGA 3E3QC 1SYSA 2CDEB 1I1FA 2KL6A 3MNVA 4JM2D 3QQ4B 2WUBL 1OBAA 1JGEA 4GRWB 2DQHL 1NFDB 4JKWA 4L4VE 3MRKA 1MRDH 4GO8A 1HJWA 4NCC2 1Q9KA 3RAJL 3FT2A 4PJ5B 4O51A 4ONHB 1CFTB 2F7RA 3D2UA 4FNLH 2WWDA 1H3TA 1BFVL 2HT3C 2VZ3A 1KJ2H 1S5IL 3N1QC 4X5WA 1JAEA 5IJVA 5E8PB 2OWCA 4D9RD 3FCTB 3D85B 4B53A 4WI7A 5IJKC 1DVFB 4XWOC 5HGBB 4GKZA 2WUCL 4KTDH 3FONB 1RY7B 2EDRA 4NOFA 2ITCA 4PTXA 3TESA 3AIUA 1HKLL 4UFIA 5ISZB 2FEEL 2X09A 3C2AH 4UQEA 3RJQB 1ZS8B 3WIHH 3PZOA 2EPNA 1KB3A 2CIIA 3H42H 1X7QB 1V7ML 4UOJA 4Y5XA 2WB5A 2YR3A 1QSEE 2ZWZA 4HF5L 3KAAA 4PMZA 4OZ4A 5ILTL 1WT5A 1DTUA 2Y8KA 1R5WA 5FOOA 4N0UE 1DEEB 5DO8A 2ICEB 4UQ2B 4HK3N 4MNGB 1A7OL 4DWSD 3ILQC 1S7SA 3DV6B 5FOJA 5I6XC 2D3VA 3L6FA 1Z0NA 2XN9A 1V05A 4NQCD 1BEYL 3D39A 3LRSB 2OZ4A 4KMQA 3ULVL 4PJCB 4KTYA 2VZVA 3GHEL 1JCKA 1Z9MA 1NL0H 5HGGS 3WE6B 1KT2B 1G7JA 2DDQL 1KIQA 5LXGH 3JWDH 4HPOL 4BQCA 3F7QA 4LVHC 1DQML 2F8VA 1XR9B 5BOPA 1G7QB 3K80A 5GRVK 3MA7A 4KQ3H 3QIUD 1JWMB 4L4VD 5E4IA 1S7UB 4C57C 2R56H 4TSAH 4PSPA 3B8SA 1IC5H 3QHFL 1DL7H 2VLJE 2VTFA 3UESA 5C7XL 4P8VA 4PUEA 3CHDA 4RNRB 3GXMA 4NKMB 4NUGL 3CFIC 3GI8H 3MGOB 4PB9H 4G6FB 1CCZA 4W8BA 2B0SH 3LQAH 1KEML 4PV9A 2QLVB 2D4FA 1HIMH 5GGRA 1N2RB 1GW1A 4UQBA 4S2SB 4IRZL 1PG7X 1Q6DA 5EC1A 3NFPA 1AR1C 3MS8A 3ARUA 4JPVL 4Q7NA 1Q38A 3BKJH 1LEIB 3UBXI 4PLNC 4LOUD 3MKKA 4JPWL 3OF6D 4AIUA 3EOTL 2A6DA 2IBZY 4EAMA 3HE7B 3T0EA 1N59B 1MCOL 4PRNB 1YECL 5A3ID 3MSDA 1MUJB 1YEDB 5DQJB 1QSED 4JO1L 2YPLA 3KPPB 2IMMA 3LKSB 3DRTB 4MZ3A 3VXMB 5IT2H 1OWRM 3TTQA 3U7WH 4QYOA 1B0WA 1X5ZA 4QOKE 4BUHA 1KCSH 3DMMA 1OF2B 5JDJA 1UH2A 2YD3A 4NWUH 3LKRB 4KGJA 2VL4A 3L3IA 3HLAA 5DJYA 5IFAL 3AC0A 1SMOA 3PWUA 5ADPL 5GSVB 5ADOH 5KSAA 4KK9C 5L7XH 1YEFL 3DX8B 4IOFD 5SWZE 1AD0A 1ZHLA 3I3BA 5A2CA 4LASL 3T3MF 4CD8A 5DRNA 3LPGA 2A9NH 1G9MC 2HVKB 3BHBA 5SWSE 3ZR6A 3TPUA 2E3ZA 1SY6A 3B9KB 2QADD 1T1WA 1JPTL 5FUZL 3UAJC 2ZPKL 5D7SH 2VLJD 5E03A 2WPGA 1OAQH 5I2IB 1N5AB 3S35X 3V52H 1RVFL 3LXBA 1LNUB 5J6GA 3HE6C 4AG4H 1D5ZA 3L5WA 2ATKA 4J4PD 5GSRB 2VDOH 4LMQE 5EIVA 1PAMA 1U36A 3AMKA 2OYMA 2RAMA 4MDIA 1A7BA 2HH0L 4AZGA 1UM4L 1RURH 1FCGA 1HP4A 1NOUA 5L8LB 3OSKA 4AY1A 1JGDA 2ZSVB 2PNDA 1WE5A 1BECA 4OZHA 1MPAH 1YPZE 4FS0A 4QRRE 5LQBL 5GHWL 3BWAA 3O8XC 1JJUA 4M8QB 1MVUB 3CV5A 2RFXB 1MLBA 3DI2B 2MCG1 2Q76B 4OZGF 2PYFB 5KVDH 3PV7A 1W0WB 1DBAH 1PW3A 2G41A 3CSPA 1HX0A 2G3NA 4NKDA 5LBSL 3PDOB 4XB8A 3VFGL 2W0KA 3IFNH 2YBUA 3KEHA 3FTGA 4HKXA 4FHBD 1OGBA 1MCPH 3DIFA 3VU2A 3UCRA 3VWKC 2AJVH 4RFNC 3QFDB 1YNLL 2YK1L 4NNYA 4C83A 5F96H 4ZFGH 5B8CC 2G9HA 3OL2A 3LXAA 1V3KA 3UTSB 2XACC 2O9TA 4Y1AB 4LSRL 2PW2B 2WC4A 2AXHA 1QZ1A 3BLKA 3QCUH 1KPRB 3U5UA 5DR5L 1B2WL 5FF6B 2E8YA 3L4UA 4QOKD 3BP6B 1U8OB 1TMQA 3VM5A 4RMVA 2WMKA 2CDEA 3FOLA 3QQ4A 4XI5C 1QI2A 1NFDA 3LSOB 1S9KC 5CXPA 3MJ8B 3AZRA 3CCHB 4Q9RH 1R7AA 4OCXH 1V0MA 4H8HA 1PPIA 4EUPG 4PPTA 2FZ3B 3SCMB 1Y6KR 3QA3B 3RTQC 1XZ0B 4PJBE 2R2HB 4GG6F 5SWSD 1GOHA 3RL2A 3SDAD 4BK5A 5GS1C 5JUVA 5E8PA 1I1RA 1U93B 1IAIH 3AXHA 3FCTA 4L4TB 4M6NL 1X6NA 2J62A 3S96B 5I24A 3ECQA 1OAUH 5HGBA 4UU9A 3KJ6H 3FONA 5BW7C 5CFHA 2NCMA 2C8NA 4ZFZA 4ZS6D 1H8OA 4H26B 4NM8H 4EDXB 3L4WA 4XXCA 3O6KL 4YHML 3HI5H 4NKOA 5ISZA 3VFSA 3VOCA 4PUBH 3T8XA 4LNVA 5HDRA 4XPAL 3S88L 3SDCC 2IH3B 2AEPL 4JPIB 3LQZB 1E40A 5I1DB 3GUTB 4X99B 3HA0A 4QRRD 4ZAKA 5E7BA 5DTFB 5IESH 1HVQA 1JYNA 4DKFL 5A2KH 4JDZA 4N5EC 1DEEA 1JZ8A 5E6IB 4UQ2A 5F71A 4DWSA 4MNGA 1XH1A 4JFOA 5I0DA 1YY9C 2I60L 1XHGA 1JNLL 2R1XB 4U6HB 5BS0A 4NQCA 3X14A 4D9QE 4M7KL 3LRSA 3U7VA 3PE9A 4D8PB 2H1PH 1R47A 3TGXA 2AK1L 3WE6A 4TN9A 3Q3GB 1NKOA 2NY3B 2YMXL 2W91A 1BHGA 2G60L 3MV9B 4OM0H 1G7QA 1IAII 2I9TA 1R7OA 4APQD 2P44B 3NGBB 4ACPA 1GGCH 1JWMA 4P2RB 3DUHA 1I9JH 4LSPH 2D23A 4ZFMA 2V17H 3HB3D 3RY4A 1F90L 2IBZX 2YHGA 1T0NB 3S35L 4TSBL 4ZOAA 2A3CA 4NKMA 3STLB 2GUOB 3MGOA 4UFHA 3BLPX 2PYEE 1QFWH 4JFZL 5I18L 1G94A 2C7FA 1N2RA 4MD0B 4S2SA 4CU6A 2CLZB 2OTUA 2DSZA 3FN3A 4G9FD 1JGUL 5HHPA 5FM5M 4KPHH 1TVPA 2ZUQC 5CEXB 3KNBB 1I9IL 4NQEE 4OIIL 4EIGB 5B4MC 4FZ8H 4M9PA 2Z91B 4KJWD 5D1QA 4XB7A 4XPHH 1JZ7A 4LCCB 3TC9A 4GFTB 2YL6A 4HH8A 1GOQA 1W9VA 1N59A 2IXUA 2J7LA 1QEWA 2VITA 3FRPA 43C9A 1YEDA 3IKCA 2AJSH 3B8YA 4MD5B 2QQKH 4WHYH 5K33A 1BREA 3LKSA 5FOBB 3BQUD 3DRTA 4GZIA 1OVZA 5E99H 3VMNA 4ZXBB 3IJSA 4KJQD 3DETC 1DWGM 4IRSD 4A6YA 4D9QD 4ZS7H 5GGTL 2Q3AA 4NZDA 5DQ9B 3EJPA 1ZTXH 4RGNB 2MCPL 1P84J 1NOFA 5J0BA 1DP0A 1A7QL 3HC0A 1P7HL 4UT9L 3TT1L 4GQRA 3WD2A 3RIKA 4XMKL 4AMCA 3P0VH 5JIIA 2HT4D 2NNAA 3KXFA 1QFWI 5TDNB 5HHOE 3LHPL 2GVYA 4AWEA 3EMCA 3QNYA 4FLRA 2HRPH 4ODTH 4QXUH 4FFZH 3TEUA 5I76B 1S78D 4M7JL 1CGTA 3B9KA 4TOYH 3GNML 4MQ7B 5HI5C 1BVKB 2ZE0A 3F62A 5EOQL 2IH1A 3ULUH 5CP3A 3GHBL 4J4PA 2OWXA 2PTTB 5KS9A 1AC6A 1INQB 3QSKB 2BFVL 3FL7A 1L7IH 1IFHH 4OLVH 2XFFA 4O02L 3GBML 1PJ9A 4M5ZH 2H2SD 2BXZA 4YIQB 3EYQC 4NP4L 2NY4B 4KV5F 5E2UH 2MTPA 2DQEH 5DMGC 5F7FA 5ERWA 4QRUB 3DLQR 1MVUA 1DWFM 2YRPA 3S7GA 4NQED 5E8DH 1R85A 1NJ9B 2UZYB 2Q76A 5JHLH 4M8UA 1KPUA 3AIEA 4AMXA 1FH5L 4XPTH 2NLJA 3A24A 5FEBA 3PDOA 2XTJD 4H0GA 3Q6FA 1MEXL 1MCQA 3RZCA 4GSDH 2X2IA 5HVHB 3MRJB 1ZK9A 3A6BL 5CZXD 4FOMA 4YHLH 3QFDA 1MQKL 3GKWH 4Z0XB 3OG2A 1HXYA 4RGMC 4BQ6A 3UTSA 4HCRA 3E6FA 3MMDA 3FT4B 5IEHB 3RP1A 4KMLB 4IMLB 3CMOL 4HPGA 5BMFH 4U5KA 4FXGA 4PYHA 1DBJH 4JG1L 4GI6A 3NPZB 3GBEA 3LKPB 3ZO0A 1Z3GL 5EH1A 3W39B 5I73C 4Y89A 3L2LA 2W66A 3ZSSA 3PL6C 2IXVA 4GIAA 5D7LB 4WNQA 2D7QA 3MJ8A 1XGRB 3W38A 2OYLA 4NPYB 3UMTA 1VACB 3CH9A 2VVNA 4CRPA 1GOIA 5HHOD 3LMJH 3O9NA 3MGAA 2FZ3A 4L3CB 3SCMA 1MHEB 2IALB 4EI5C 4XCCL 1MFCL 2XQBH 5C6WH 4Z7VF 5KSBF 4NRZB 2E7LC 4H2CA 4NC0B 2XA8H 5IWLC 4P46B 5JQ6H 4XNQB 4BSVB 1I3VA 4LARH 4ZOEA 1TQCC 1HOCB 3M07A 3CXHJ 3S96A 4AIZB 3F65A 3ZKMC 1J1OH 3N50A 4EDXA 5DHYA 3GGWB 3NTCL 1KBBA 1CBVH 1A3RL 1C08B 3X12A 1E73M 4Y5VA 4P4KA 2ADIB 2IH3A 5JLZB 4PB0L 5CD3A 3NZHH 3PZMA 3IDYB 2DSUA 3EDFA 1NCWH 3KPOB 3U30C 3GUTA 5BYWA 4UFMA 1W32A 2F5AH 4P49A 1I9RH 4X99A 4C59B 1TDQA 4CKVX 3HG2A 5DTFA 4G6AC 3RWDB 1OIFA 1NMBH 1FVEB 1ZBVA 1F42A 3L5XL 3TA3D 3LD8B 3BP4A 5IMKB 4MS8C 4LRIA 2VSDA 4KUCD 3VA6A 4L8CB 1R3HA 1YN6B 3D6GA 1MRDL 5E2VH 3H0TB 1LL7A 4PJ7A 3EJYC 1TITA 4X98A 3GSNH 4D8PA 2F18A 1NGXA 1SHMA 5GS2H 3THCA 2MHAA 3RJDA 1V3HA 4FNLL 4YZFE 1QSVA 3C09C 4BZ2H 3KPRE 2OTWB 5E9DB 1KJ2L 4HC1A 3D3VE 3MV9A 4F80A 4B5EA 3HC3H 3MYZA 4APQA 3MOAH 4N0YH 4PV8A 1X6LA 3CZJA 4TX6A 2XG4A 4KTDL 3ZTJH 3MR9B 3SBWC 4M7ZC 1UHVA 3VDHA 3BN9D 1SEQH 4JFYA 5I8EA 5C0CB 3C2AL 2XOTA 4QP0A 3TYFB 3GNOA 3GXTA 3STLA 2GUOA 5F9DC 3WIHL 4ATWA 1GC1C 3KYKH 1LG1A 3H42L 3ZT7A 4GS7C 3WLBB 5IV2B 1QRNB 3VFOB 2DQCL 2LTQB 2FX9H 3JTTB 1RZKC 4MDJB 3S5LA 4OZIE 4MD0A 3T77B 4ISVB 2NX5E 3RGVD 5ALBH 1QI0A 3WY2A 4G9FA 2VXUH 5A8MA 1P7KA 3JV0A 1MJ8L 1Z9LA 1HHHB 1KTRL 2XVLA 2J78A 3NCOA 4MWFB 3QQ3A 1E6ZA 1D9KB 3C5ZD 3MJ9A 3MNZA 3TH2T 3BVNA 1JZ4A 5IVXB 2DGAA 4LCCA 5GISH 4O5LH 3EBAA 2KZ1B 5GGVH 3CMGA 4MJ6B 2YA0A 1A6AA 4HUXB 4K3HA 3S98A 3BVTA 3OTTA 2BRQA 4MD5A 2OSLA 1AGFB 1OM0A 4M81A 3Q6GH 1CS6A 1NL0L 4FQCH 4HKJB 3SCWA 1R0AH 3IJ7A 3HPLB 2Y7QB 5KSBB 2AABH 1JPFA 5LXGL 3JWDL 4RDQF 1YZZA 4MAUH 3A22A 3SQOH 1N64H 5CD5C 4MB1A 3CFBA 2WBKA 3WQ8A 4KQ3L 5FYLH 4M43H 2A38A 5EG6C 2R56L 4TSAL 5DQ9A 1IC5L 1DL7L 2M8XA 1KTDB 5HI4D 4KFZC 1OW0A 2UVEA 3PWPE 3RPMA 1IL1B 1EFQA 3OZ9L 4K94H 5TDNA 1HQRB 2B0SL 3LQAL 4FQIH 4AY0A 5AY7A 2X70A 3D3VD 5LA2A 1UACH 2AV1B 2J3SA 5C0BE 3BIBX 3ABZA 4BJLA 1LE5B 3O2DH 1E28B 2YLAA 3FQTA 4H8WH 3TIEB 3Q5TA 5IM7A 4WDIB 1ZS2A 5MENB 4W4OA 3UZQA 3BKJL 4LNRB 3EUUA 5E8OB 1WK0A 5BXFB 2APBA 3IJYA 1DEDA 1SJVA 1GNXA 3ILPB 3F58H 4YBQD 4OCSH 1UWQA 4F37K 1ZGLB 2IEPA 1INQA 3OQ3B 5L8JB 1FZKB 4JHZA 1JTOA 2XWEA 4ZO6A 5M95B 1CQYA 4HDIA 4Y5YA 3L3HA 1H5BB 4YIQA 2NX5D 2P49B 2YD9A 4PTUA 2LU7A 2HKFL 1EBAA 1C8XA 4OGXH 3VSVA 4LLYB 1QQDB 1KN2H 1KJVB 4H1LH 5IT2L 3G5VB 5F88A 3POHA 2UY6A 25C8H 5F7KC 1UD6A 1BBJA 1JWSB 4PJFB 1RUQH 3RJXA 5DT7A 4NWUL 3P4OA 1MWAB 1C16A 4ELMA 2YSSB 2X89D 2K3TA 4NF7A 3MRJA 1WWCA 4IUGA 1CFBA 2W9EH 3KJ4C 3GIVB 4C56E 5ADOL 3FKUS 1QP1A 1MFUA 1CGVA 3T1FB 3T65A 5L7XL 3FT4A 4P3DB 5IEHA 5GS0H 4I5BB 3AJ7A 5DA4A 2E6QA 4E9LA 4JZJB 2A9NL 3CFDB 4OCMC 1XSJA 1P6AB 3QUYC 2FDMA 3RMEA 2YWYA 5T5NG 1Q6FA 3MGTB 5DFVD 3W39A 5D7SL 3FZUC 5T3ZH 1OAQL 3NCYP 3V52L 4QT5B 4BKLA 1TCRA 3O4OB 4AG4L 3LRHA 3LV3B 1F58H 2J1KA 3PWPD 3RX7A 4F58H 2VDOL 4NDMA 3CPLA 4L3CA 2IALA 1RURL 1W91A 3NABH 5CGYC 3SOBH 3E6HA 2NSXA 4HAGA 1UC6A 4YHKH 1JNNL 5ITBH 4NRZA 1MPAL 4AT6A 4OLZH 5AC5A 4P46A 2EEBA 4P5TB 3OGSA 2PXYD 5IHLB 5DFWH 2JCCE 1HOCA 5ANMA 4F2MA 3G6AA 3MODH 4RZCB 4P9MH 3U2SB 4AMKH 1BJ1H 2Q6WA 1HP5A 4W84A 2BOCB 4KHTH 1FNSL 3GGWA 5KVDL 2HG5B 2RGSA 4AENB 1C08A 5CBAB 4LBEB 1T1XA 2GJ6E 4RSVA 2CITA 3ZE1F 5HJ3B 4FP8H 2VRAA 4I8DA 5JLZA 5KSUA 1CIDA 4WRLA 1OTTD 2XKUA 1MCPL 2NYYD 1JV5B 4N0RA 2IPKA 3GMMB 2AJVL 5E2TH 5F96L 1F8TH 4ZFGL 1WLHA 4M3JA 1XYFA 3SGDI 1KXQE 1YEHH 5DRWB 2UY3A 1FVEA 1YC8A 3G6JB 2Z92A 3TYGH 1TQBC 3JV4B 4LGRB 3LCYA 3F5JA 1LG2A 5IMKA 1EUTA 3V6ZB 1CXLA 5C08B 4LPVA 1BYAA 4WKAA 5FUCE 3IFOB 4ZQKB 1C7TA 5BVJB 4L8CA 3RILA 5GGVY 1YN6A 4M1GH 5DDHB 3KHOA 5GRZA 4LSQH 4RBPH 1U8LB 1S3KH 3T0DA 4Q9RL 5D7IE 1PD6A 4C56D 3JXAA 5D70H 1JI2A 3BYTA 4CVZA 2Y6SC 1GRWA 2DI7A 3HI1B 2OTWA 5E9DA 1BG4A 1XF5A 5DJ6A 3CFKA 2F61A 4XB3A 1HZHH 5L2JB 4NI3A 1FYHB 1IAIL 4KKLC 5AYUH 1LO5A 5KSVB 2NY0B 1OAUL 1T1YB 4NGHH 4AMWA 3KJ6L 5D2LF 2X05A 5JMRA 1JHLL 3G5XB 4CBPA 1WFUA 3MR9A 3BVXA 4NM8L 4HH9A 3I9GH 2NXYC 3HI5L 2XSAA 4NBZB 1QWUA 5C0CA 4HFUH 3TYFA 4PUBL 1KIPB 2BDNH 4F7MB 3ECBA 4URIA 1QRNA 3VFOA 4OF5A 4UB0H 4L8SA 5EU4B 2YD7A 4RWYL 4TVSa 4AZ8A 4ISVA 1EDTA 3C60B 4WEMB 4KY1H 5IESL 3EJJX 5K9QG 1XRVA 4Y4FB 3VDAA 2X4SB 1TVHA 4D0DB 3RX8A 1T20B 3BSHA 4UDTB 3VI4F 5IVXA 1DE4B 2JK5B 5E4EC 5I17B 3FRPG 3VI3F 4DOHE 1VKXB 4MJ6A 5FO9A 4EVNB 2WXDM 5CP7A 1BZ9B 2WMFA 4WCYH 2J7HA 5HGDA 3MLXH 5FK9B 4C7DA 4ENED 4RMTA 4PJ8D 2ESCA 3HPLA 3N0PB 1UVQB 2Y7QA 1VAHA 1V6XA 5EBWB 4F9JA 3MOBH 4WFHD 3QG7H 4IEFB 4MA1B 5FA3A 2VERN 5BO1H 2BERA 3VE0B 5L2KE 4NKIH 1GGCL 2M1KA 4G6KH 3TLRA 3GSWB 1I9JL 3CSYA 4LSPL 1LJYA 3D9AH 1Z5LA 2V17L 3U7YH 5JHDE 1JZ6A 1E56A 5CHNA 1KTDA 1TFVA 3FO0H 1CNVA 3L3GB 3ET9F 3CVHB 4NZTH 2C4FU 3D3VA 2UY2A 2Z8VC 3VPLA 2XKSA 5KOMC 3VFWA 1JD9A 3KPSB 1WIUA 1NSNH 1E28A 2AJZB 5GZOD 3TIEA 2CCRA 2EYRB 5IVOA 4KPHL 3GMNB 1N3NB 4G43B 4KKCC 1IC4H 4KDWA 3C6LB 5BXFA 4FZ8L 3ILPA 4NUJB 1L6ZA 3ARBD 4S1QH 4BFGA 3P4NB 2KDGA 3K81A 1FZKA 4FNSA 3T09A 3OKEB 2BNJA 1H5BA 1UGNA 2A77H 2AJSL 2QQKL 1EHLH 1XH0A 2RCSH 2BNQE 5TE7H 4M1DH 4JFDE 5E99L 3ZSTA 2EC9U 3EHBC 2X10A 4XAWH 1OD7A 3G5VA 1A6VL 2APWA 3MMUA 2EPMX 3MV7B 3P40A 3RIFF 2E9JA 2ED8A 4U1SB 3I85A 4PJFA 4ZS7L 4FG6C 1S7WB 4OLUH 3UG3A 1MWAA 1ZTXL 3QIBC 2XVPA 4GPNA 1OGAD 4MAYD 2X89A 1FVCA 4HUVB 5FL0A 1QOKA 35C8H 1S7QA 3UTQB 4OFKA 2GUYA 1KB5B 4AH2B 3KLSA 4PJ5E 4BFBD 3LY6A 3IETA 2V2WB 4QEGA 5T1LD 3SDDB 4QHKI 4W81A 2JIEA 4I5BA 1WICA 4YFLI 5GGUB 2HRPL 4ODTL 3VXTB 4YUEH 4FFZL 2OBGA 3QI9D 4N8CL 5A16B 2GT9B 5L2KD 1ZT7A 1KTLB 2RIKA 4JKMA 3T0WA 4TOYL 4XAKE 3T0AA 3NZ8A 1WV7T 3SDXE 2CYGA 3OAZK 2B39A 4AEHH 5JHDD 3L7EA 3UZVB 4JFSA 3ULUL 3O4LE 1FO0H 3LV3A 3PWPA 5J3HD 3KL0A 3GJEA 4OF7A 3UTZB 2PWGA 4B9YA 1L7IL 1P1ZA 1IFHL 5CCKH 5DMYA 4LIQE 4OLVL 4P2OB 1H0DA 4IJ3B 5D1ZB 3TVMB 2CH8A 1AC0A 3RY6C 2FRGP 3ALWA 3F7VB 5E2UL 2GJPA 3GMOB 2DQEL 2PUQT 5DS8A 4F8XA 3R0MA 1RU9H 4RCAA 2X9WA 1IAKB 4RZCA 1UXWA 3MV8B 5E8DL 1WISA 3U0WH 4ZFOL 1OP5K 5DJAB 2HG5A 4XPTL 4AENA 3SCTA 2WCAA 3H53A 1C12B 3MSPA 2E8ZA 3H7BA 5IHZA 5HJ3A 4BFIB 1JNHB 5HHME 1J8HB 4R4BB 4GSDL 4PJCE 4CADB 2OW7A 1JV5A 5JXED 4YHLL 2V9RA 5C0RH 5L9DH 2BNQD 3VXUE 1K4CB 5DRWA 3UPRB 3G6JA 5IROC 5T33H 1GGBH 3O6FC 1QI3A 1BMGA 4MD4A 3L4ZA 5BMFL 5K9JH 1DBJL 2OLDA 3V6ZA 5GGSY 3ZE0E 1ZV5A 3IFOA 4ZQKA 2WK2A 4D2NA 2W59A 5DDHA 1XCTA 1YEEH 5EBAA 4PJ5D 1U8LA 4WW2B 3ARZA 1A2YB 1EUUA 3UYRH 1IEBB 3LMJL 3KVQA 4UFLA 4Q6IB 1YDPA 2VLRB 4HBCL 3W27A 3HI1A 3WDQA 4FQQB 2XQBL 1BGAA 4M7LT 3ZKNC 1OY3B 5L2JA 2I5YH 1RZKH 5DD0H 1FJ1B 2XA8L 4LSVH 4F15B 3D85D 4XAKD 1DVFD 5DURD 4GT7A 1T66D 3I6KA 1J1OL 4XP1H 4L9DA 5BZWB 3TO4C 3O4LD 5EO0A 3P9LA 5FV2A 4D0BA 3K46A 2A83B 1CBVL 2ZG3A 4KRPD 2FYVA 4HGWB 5SX5H 3PWNA 3RKDC 4G8IB 3EJQA 1Q6CA 1CFNA 1KIPA 5H94A 4F7MA 5E1QA 1F00I 3NZHL 1NCWL 3O3EB 4LDLB 2NY6D 2FB4H 2F5AL 1EGZA 1I9RL 1LK2B 4WI8A 3BSZH 1B88A 4ODXB 5EU4A 3WL0A 5F3BB 2OR8A 3M1BB 2JCCA 3C60A 1NMBL 4WU5B 4PP2B 4Y4FA 3VXME 4U0RB 1IQDA 3FT3A 2V5SA 1FHGA 4M8VA 4H25A 4TTDC 1CXEA 5A2AA 2P43B 5F6IC 4PGDA 2V3FA 4WFEE 5I1LA 5J12C 1OSZA 2BNUA 3ARDD 3O0RH 4OGYH 3RWJB 1DE4A 2JK5A 4F3FB 1E6NA 4UI2A 5HHMD 1CWVA 5E2VL 3QCTH 3UTTE 4HA1A 1TENA 4OFYA 1BZ9A 2EDXA 3GSNL 1R6VA 4JFFE 1ODUA 2EDFA 5IB1B 3G5YA 3VXUD 2CKRA 1ED3B 2P5WB 5F97E 2DI8A 4BZ2L 1JFHA 1U3HC 1A47A 1G6RH 3V0VA 2AXGB 3IJ9A 1EO5A 4Y2DA 1L9NA 4N5UA 3HC3L 4JL2A 2Q86A 4FQJH 2WVSA 2FECI 3MOAL 2BFGA 3VE0A 2GAZA 4GKLA 4WFGE 1KXVA 4B7IA 4PMXA 1LK3H 1P4IH 3IVKB 3AREA 3SCNA 3AS1A 1NBYB 1SEQL 5HVGB 1HJXA 3DHMA 5J6HB 5E5RB 4DZBA 2UWEE 4ZENA 2AERT 3NIGF 4UFKA 3KYKL 5LJYH 4Z9KB 5JIKA 4BQ8A 4K3EL 3ROOB 1CXHA 5C07E 1R3LB 1GZQB 2FX9L 2R4SH 1H8SA 5T1KB 4MQXC 3HNTH 3KPSA 4JKKA 1IKFH 2VC9A 5ALBL 3QXWA 4WSKA 1W72H 3TT3H 2VSCA 1YYLL 1N3NA 4G43A 1ITBB 1B6UA 3C6LA 1ZVSB 3INUH 4M1CD 3TJHC 4LPYA 3SCSA 4NUJA 4O5LL 4U6YB 4ZG1A 4J2XA 5GGVL 3EFFB 3P4NA 4W5ZA 3P73B 5EUOF 1M71A 2Q87A 5F9JB 4F7PA 3OKEA 1G7MA 3UPAA 1IGTB 4JM4H 3H9SB 4FQCL 2CBIA 4Y1AE 3VXMD 4NO2A 1R0AL 3AAZB 2C0HA 12E8H 2AABL 3NDYA 3IDGB 3LH2H 1XCQA 4Y16C 4MAUL 1R24B 3SQOL 1N64L 1K9FA 4NRYB 4NZFA 5ID0A 3MV7A 4NYLB 5FYLL 4M43L 4F8TA 1I85A 1OGAA 3QHTC 5HYIA 3UTTD 4HV8A 4MVBD 4HUVA 3AXIA 5DT1H 3K2UL 4JFFD 3TFKC 1KIRA 4KROD 5AWNH 1MHCB 2GKIA 4M4PA 1OCQA 1VCAA 4HJ0D 2HLAB 4GAFB 5T1LA 4K94L 4I48B 3LAFA 3OX8B 4L9LC 1WDSA 3QIWA 2J8HA 2EXOA 4UQ3A 1HXJA 5EU6A 1UACL 5GGUA 3OR6B 3WEXA 3VD7A 5JXAH 3FB5B 3O2DL 4KMTH 1KLUB 2RGMA 5A16A 4X5LA 3CZFA 2GT9A 1P84K 4RMRA 4WFGD 4NOBA 4L4TE 4MNLA 5A2BA 4DM1A 2WANA 1UWEH 1L0QA 3UP1A 2BY2A 1HDMB 5J8OA 5JPMB 4LCYB 3L7FB 4AZ5A 4X0KB 2GTZA 1OL0A 4HWEH 5IFJB 2CBUA 2DT1A 3F58L 4OCSL 3V6OA 1HWHB 4JRWA 4KJPC 3UTZA 5C07D 3GZKA 3CDFA 4WU7B 2IGTA 5DJXA 1MCDA 1U8IA 4JZNB 5HXMA 1QX1A 1C1EL 2CKNA 1W1VA 3GMOA 2YD4A 3AXLB 1XEDA 2APFA 3T3ME 4N1EA 4XP4L 4ZUVA 5DJ0A 5LKNA 3C5JB 5HYEA 2XPGA 2WBJD 1RHHA 4XPBH 25C8L 4QTIH 4OFVA 3RFZC 5DJAA 2BP3A 5I3DA 1RUQL 2IGFH 2NY1B 1C12A 1XGTB 2R15A 4GO9A 3BMVA 1EAJA 1JNHA 3HMXH 3KWWA 1J8HA 4CADA 4IHOB 4B16A 1R34A 1A4JB 5DF0A 2UY5A 2W9EL 4Q9BA 2Z93B 3MFFA 1Q0XH 2DLGA 1NPUA 3UPRA 5GS0L 3JUYA 3TM6A 3RDTD 4CMMA 4CAGA 3W2DH 5C0NC 2WQRA 3MUJA 1ROWA 1VDGA 3QISA 2JE8A 2ARJA 3RDKA 1QFOA 3RVTC 4PS4H 4I0PD 5EWIH 5F3HB 1WCGA 3SDYH 4JQXC 3DUSB 4J8RB 5IW3A 4P2RE 4YGVB 5D6CB 5FYKU 3HE6B 4HOWA 5T3ZL 5CPSA 4CN4A 4OZGE 1PSKH 1AGDA 1X1NA 2LQRA 2ZUUA 5E9AA 3CGTA 5DLMH 3Q0HA 4WW2A 4WWKD 1U8HA 3ARFD 1F58L 1A2YA 2ERJC 5EUOB 1IEBA 1OPGH 5DRXB 1ZLVK 2NW0A 1QNZH 2YPVH 3NABL 1ZT4B 2VLRA 1KEGH 5A2IH 1UEMA 3O8XB 4FQQA 1UR1A 3K4ZA 5I74B 4YHKL 3MRPB 4LMQI 4XVTH 3HZVB 4H88H 4OLZL 3BKYH 2D7TH 4L4TD 1JZ5A 4TVPE 1CL7H 3U9UA 4YDVA 5IIEB 4NWTH 4P9ML 5EOCH 4AMKL 5BZWA 1ES0A 1ZKAA 2NY2B 2X2YA 1CD0A 4KHTL 2ZOLB 4EXPX 3GRWH 3AGVA 4PJEF 3F5LA 1BX2B 2NTSP 2AAAA 4HGWA 4ORGB 4RFNB 1MW2A 5B8CB 1UWUA 4FP8L 4BZYA 3P9WB 3KL3A 3OR7B 5D4QA 3G6MA 2FJHB 3O3EA 4GUPB 1JYXA 5A6SA 5E2TL 3UZEA 2PO6B 1F8TL 5F3BA 3CHEA 1YEHL 4WU5A 3PZ9A 1Q94B 4Y5XC 4Z2HA 1IM9D 2Q7YB 5E6ID 4GG6E 2GFTA 2Y06L 3TIDA 3MRNB 3BAEL 3M17B 1WT5C 2DQTH 2LV4A 1A02N 3EDKA 1GJIA 2ZUMA 3SKNB 2ZUXA 4F3FA 4EOWH 4TVUA 4M1GL 2X4PA 4LSQL 2VQ1B 1BVLB 1H3GA 1NAKH 1S3KL 4JZOB 4X4MA 3RTQB 5IB1A 3VXUA 1CE6A 3BLBA 5D70L 2P5WA 4NO5B 2NY3D 2WQ8A 4R3SB 1SYVB 3KPMB 2GEEA 2AXGA 5CSBA 1HZHL 1HHIA 3RWFB 4DKEH 1Q9LB 4PRAA 1N0XH 3VNZA 1T83C 4P2RD 4HIIB 1CL7I 5AYUL 4WUKH 4DFIA 2R29H 3KLDA 3ZQ9A 3WD5H 4PP1D 1N8ZA 2BOBB 1HH6B 4P57B 1ETZB 1MJ7L 4YE4H 3SJVA 3OKNB 4HFUL 1LWHA 4L8BB 2HT2C 1OLZA 2V5DA 2Z31D 1KC5H 3TZVD 4UB0L 4FFYH 1R3LA 1GZQA 5T1KA 5C3LD 2OK0H 5E0CA 5DHXB 1BFTA 1CT8B 4KY1L 5GJSH 2VMFA 1EEQA 4RFOH 1MFBH 4FXLA 4Z8FH 1B0RA 1U8PB 1I8KB 3EGSB 3MRIB 4ORZC 1CWYA 5IEKB 1ZVSA 3OV6A 4R8WH 4PJIF 3AIQA 1GZJA 2EDLA 3Q1SH 4OI7A 4W7UA 2SEBA 4ALAH 3S36H 3R06B 3P73A 5KAQG 1I1YA 1YEKH 4X6EB 3A4XA 3DX0A 1C5DB 5KANI 4H5SB 4H04A 4P4RB 3MLXL 3JV5A 2ZNWA 3B9DA 4FRWA 3T0EC 3H9SA 3VSUA 2VCAA 4MTVA 1DANT 3BGFC 5DA0B 1U95B 4EZMA 1VADA 3GSVA 2UV3A 5D6DA 5J7CC 4U3CA 1HJUA 3BD5A 1U8QA 3MOBL 4TNWF 1CLVA 3QG7L 1LD9A 1RZIA 1CGXA 5FGCB 3SKOB 4TULH 3QFJB 1IGFH 4U4BA 1QHZA 1FHDA 4RMUA 4G6KL 4Y4KD 1HILB 3MRQB 3DGGB 1AQDB 3VFVA 5JQHC 4HUUB 1I9EA 3D9AL 3U7YL 5D7LE 3DMMC 3BDXA 4KRMB 4UR9A 1FFNA 2BHUA 2D3NA 1H41A 3BRGC 4Y19D 3MLRH 4ZYKB 5IF0B 2DL9A 1OP9A 4NZTL 4NNXA 3OX8A 4BZ1H 5ABEA 1UB5B 4OI8A 3AU1A 3O3DB 1EO7A 4OCWH 3ZE2F 5I71C 2XY1A 4KI5C 5KSAC 3FB5A 1NSNL 1KLUA 1S7TB 6FABH 5EOTA 3VCLA 1IT9H 1E4KA 5JDSB 1EFXD 5DZNA 5EBMB 4U7MA 1CFSA 2VKXA 5HD8C 2A1WL 3TNMB 3MUY1 1IGIH 1IC4L 5EB8A 1HDMA 5JPMA 4OB5H 1ZA3A 2W60B 3CZEA 1OAKH 5D93C 2UWEA 3QJFB 4UBDC 3WN5C 2G5RA 2IAMD 5DHVH 4HTYA 3TN0B 5HPMA 1LGVA 3CFEB 2E9LA 1NKRA 2A77L 3NBNA 1EHLL 5FO7B 3B6SA 1JIBA 5ACZB 2C3VB 4ODUB 1YMHB 1W3JA 1F2QA 1YA5A 2WINA 2QR0B 4RDQG 3AXLA 1AGEB 4U1MB 4M1DL 5TE7L 5F7HA 3VIJA 3WXWH 2CO7B 4MQTB 2GIYA 2QV4A 4XAWL 1T2QH 4UUJB 2XTKA 5BWFA 2VQTA 1J01A 4JDVA 3BISA 3EJRA 2DQGH 4ZD3H 1XGTA 4OLUL 1GPOL 4U33A 1MWOA 4HMDA 3MRGA 4F7CB 35C8L 1KCVH 1M1SA 2GCYB 2ZUYA 2Z93A 1S7RA 4G5ZH 3W26A 1SZNA 1FG2A 2CETA 5I23A 4YUEL 3C6SA 2OX5A 3IXAB 3NPSB 5FDWB 2P8PA 4PJAF 4J7RA 3WFEH 3NJ3A 4DTGH 1DBMH 1ZHKB 4PJIB 5D7LD 4AEHL 5I0ZA 3NA9H 1UR0A 1AP2A 1FV1B 1W0YT 3L3DB 3TBVB 5B38A 1FO0L 5I8OH 1BAFH 5EUOA 4DVBB 2DBLH 3LPWA 2XZCH 1VFBA 3HR5B 5HBFA 3KYOB 3WDIA 5DRXA 4UV7H 5IP4A 1JK8B 5CCKL 1B2YA 3DVGA 2GK1A 2VWEC 5FGSA 4FQXD 2HVMA 5F6HI 2ORBH 3VFTB 3NMEA 1RU9L 1NC2A 1IGMH 4ZO7A 5DJCA 5IIEA 4K8RD 3T4YA 1ZLUH 2XVKA 3U0WL 3W28A 1RP8A 4LCWE 1Z0MA 5TE4H 3HUJA 2ZOLA 1NCDH 3MANA 1MFAL 4LCUB 4MB5A 1DQQB 4FTVD 1BQLH 4XXCC 3IDIB 4JRXB 3OR7A 4PREA 4RGMB 5CEYA 4E41A 4GW4B 4GUPA 1OGSA 4KQ4H 4KTEH 3OKYA 1HL8A 1V3MA 4JFPB 2PO6A 5C0RL 5L9DL 2F2HA 5CZVH 4BSJA 3QB7C 1DQJA 3NH7H 3F5WB 4EN3D 1Q94A 2BVPA 4BSWB 1GGBL 5T33L 4Z7VE 5KSBE 4PLKD 5DZOA 4ZAKC 3PP3H 1IAOA 5F7DB 3MRNA 3M17A 4GRLB 1KIUA 4P8UA 1JF1A 1TVBA 1UASA 1V0NA 3SKNA 4TNWK 3PP4H 2DMKA 2A3HA 2WZPD 2C1OA 3QQNA 2HN7B 1T03L 1M6OA 1P4LA 3QPQD 1NBVL 1YEEL 4LLVA 1BVLA 4J12A 1GC1L 1A6UH 2GSIB 2FHFA 4PLJC 4XVJH 1FIGH 5GIRA 1TQCB 1F4XH 5AEAA 3RWFA 1RZKL 3VMOA 5DD0L 5F7YC 4AZ6A 4LSVL 2DLFH 2ZJSL 4QRPA 3VFPA 2EPOA 4V1DB 3MO1B 1U6AL 1BQUA 3NVQA 5MENE 5IMMB 5JMOC 4C4KO 5I1HH 4XP1L 2WMGA 4RRPA 1BLIA 4P57A 1ETZA 1HKMA 1SMDA 3OKNA 4U1LB 4NQXB 1E6JL 3W9DB 2HFFB 2Z31A 5TF1L 3TZVA 1NAML 3PZIA 2VABB 5A40E 2FB4L 1H1NA 5ACMA 3BSZL 3ELAT 1LEKB 2HKHH 5CILL 5ICXA 4PMQA 3BD3A 4OJFH 4F7EB 4YXHH 3ARTA 3ZT6A 1JMZA 1BWMA 1AD9B 4YDJA 5C1MB 3QHZH 3MRFA 1I8KA 2VZSA 1D9KD 2CR6A 4LCWD 1ZHBB 2AK4B 4JRYE 4PJAB 4TYUA 4NKQB 3O0RL 4OGYL 5LGJB 2F1AA 3K2MC 3X3GH 3QCTL 4HP5A 5D1QC 3B5GA 1C5DA 5C70A 3WHE1 4ZOCA 5LA1A 4OBSA 5IFHH 3HE7C 4Q97A 2CERA 1FNLA 4ZNEE 3CU1A 5C09B 1CGYA 3UYPA 4CD4A 5FM5O 1G6RL 4B50A 3MROB 2EDYA 1YJDC 1DQTA 5IW6B 3SKOA 1HYSC 4HWZB 2LVEA 4KUZH 3CPUA 2AOSA 5DD3H 1ZA6B 5HI3D 1MCFA 2J77A 3DGGA 3WENA 4MGXA 1LL4A 3REWA 1KJ2B 1B1YA 2P48B 2V5RA 4HS3A 3ARGB 3N18A 4JQVC 3ARRA 4PTMA 4Y19A 1JP5A 3QEHB 5IK3B 3T08A 1RUMH 4NO0B 4ZYKA 4HLZG 4LLAA 1ZLWK 1UB5A 2R4SL 2C26A 2H26A 3BH8B 1VJZA 1FL6B 3PGDB 2D7PA 4S10A 1MJJB 1UM6L 3HNTL 1J05A 4Q9QH 1IKFL 4XZUB 2EXYD 1S7TA 1NCNA 1UENA 1EFXA 2J6EH 3PN8A 5MEND 1W72L 3KLAB 3TT3L 5JUEH 4KK5C 3DROA 5MERB 3JVGA 2YUZA 4MA7H 2W60A 5MP6H 1CLXA 3B9KC 3KLLA 4MMZC 2ZUSA 3AICA 1GAFH 4J4PC 3MX0A 1T5XA 3UBXB 4AM0A 1CLYH 1MCWM 4WUUB 2F1BA 1XCWA 4X4XB 5ACZA 4ODUA 2AJ3A 1TR1A 1EEUA 2QR0A 1AGEA 1UT9A 3VGEA 2WVUA 5C6TH 2WVVB 2CLRB 4PY8J 3WFZA 3WFCH 3MUAA 1HJVA 3LH2L 4JRYD 1F3JA 2Y8VA 4P8XA 2H32H 3E0GA 5C08E 4YDKH 5I66B 3DX4A 1L4IA 1WDQA 4Z2IA 1REIA 3BEWB 1OM3H 4JKPH 2AS5M 1EH9A 2VXVH 4M80A 1HL9A 2DS4A 1UZ4A 5AWNL 2GCYA 5E5MB 2UY7A 2ED9A 5D8ZA 1INDH 2A3BA 2G5BB 5EO1A 3RZCC 2F54A 5GGTA 3AIVA 3WMCA 3WKMH 4W8LA 1KR0A 5DGQA 1F11B 1HN1A 2YC1B 3R0NA 4CKQA 5HY9B 5JXAL 2DH2A 1YY8A 4KMTL 4QF1B 3ETBF 2JFEX 3MBED 1JN6B 1UWEL 4PJIA 1KV3A 1YNKH 2ZCKH 4JY6B 4NZUH 2GSJA 1NGQH 1CIUA 2EZ0D 4HMEA 4KRNA 4LLUB 4NX0A 5DT5A 5HVWA 4HEME 4G8GE 4DVBA 5EZOH 3QDMB 4OOZA 3DX9B 1BGXL 1CICB 5HDQH 2BHYA 2R23A 3G5ZA 3CX2A 2FYYB 1LE9B 1JK8A 1E4MM 3PWLB 3NIFE 3L1OL 1IM3B 5CWSB 2XYCA 4QHKJ 4QY8B 1BVZA 3SCMC 3CHCA 4P5TD 3MYJB 3VGBA 5BRZB 4R7DA 4NQSA 4JVWA 4TNVF 3BZ4A 3OMZA 1PIGA 4XHQA 2GHWB 2R2EB 3QUXD 3MACH 1QLRB 3OG6B 4OTXH 3RU8H 1CR9H 1R75A 4XPBL 1MHHB 1LLOA 2QMKA 1T7VA 3GFUA 1EHXA 3WF3A 3S36X 1IKNA 3H9HB 4R7NB 4LCUA 3BMWA 3IFPB 4FTVA 2A3EA 1DQQA 4Z7QE 4D6IA 4EJ1C 3HMXL 3IDIA 1CZ1A 4GW4A 4FA8A 1SJXA 1WZAA 3WDRA 2O5ZH 4P4KC 5JNYA 1Q0XL 4CCCA 2BY1A 1RZJC 3U4BH 3F5WA 2EIDA 4XZBA 2GK0B 5FYJL 4QRTB 3QUYB 1KCRH 5IQ7L 3W2DL 2FATH 3RNQB 1UOKA 4YPGB 5M5DA 3OBAA 4QXGH 5C08D 4UIMB 3GM0A 4FN0A 2NTFA 5EWIL 4ZNCD 3SDYL 2G75A 4JG0H 4AYSA 5HSFA 4IMKA 3RVXD 3HZMB 1K3ZA 1XCXA 1H3PL 2HN7A 2YRLA 3DTXB 5DJ8B 1PSKL 1Z6JT 4LRIC 3OAUH 3WEZA 5DLML 3ZE1E 5HYJE 2VISA 1OTSC 4RAVB 2GJRA 4NSBA 3WEMA 4L8DB 4Q2ZB 4FLQA 2ZUVA 1OPGL 1QNZL 2YPVL 3AS2A 1KFWA 1KEGL 2VIRB 4PD4K 4ZTPH 4YHZH 4X7FC 4XVTL 3PWJA 4OGAC 4H88L 3BKYL 2D7TL 3IS1X 3V8OA 3MPCA 4Q0XH 1CL7L 3WH5A 4NWTL 3WHXB 5EOCL 4APQC 4G8GD 2DYPA 3SE8H 3NGBC 4F9PA 3GRWL 4KKAD 4U1LA 1GOWA 4L1DA 4NQXA 2I07B 3EZJB 3SE3A 4OGZA 3HB3C 3W9DA 3W81A 1ISYA 1IVLA 1QPXA 2BVQB 2CKBL 4XP6H 3HPJB 3KYNB 3UETA 1AO7A 3SO3C 4ZSOB 1VA9A 1LEKA 4NN7B 1UQSA 4ODVH 2VJXA 1P6FA 3HMWH 4P2QB 2AK4A 3I50H 5A8QA 5T1MA 1AMYA 2DQTL 3TH4T 5LGJA 2IQAA 1NDGB 3PWVB 5D2LE 4EOWL 3PGCB 1JI1A 4I3GA 4YAQB 2YDQA 3VXNA 3LEYH 4LCCC 4LRNH 1NAKL 4KZEH 4YWGH 3W11D 7TAAA 3QOMA 2ZNXA 3I3DA 1RZ7H 3MJGX 1EDQA 2DKMA 5EPMB 32C2A 4UOQA 3V5KA 1UH4A 5IW6A 1G7IB 1E6OH 3D0LA 4HWZA 4XGZB 4DKEL 5F9WB 2XWDA 3EBVA 4BQ5A 1N0XL 5IW1B 1SEBB 2ADGB 3OKKB 4KJQC 1BPVA 2NXYB 5EIIB 2R29L 1EOKA 3WD5L 1KJ2A 4GBXD 3VI4E 3VXRB 3STZA 2EDKA 3UJTH 3ARGA 5HYJD 5D5MB 3AHVA 3VI3E 3WD3A 1TG7A 3BKCH 1JBJA 1IARB 5MI0B 4PJ9D 3QEHA 4RGNC 4P5KA 2ZUNA 4NO0A 2BVOA 3BH9A 4L3EB 1E0XA 3MLZL 1OD0A 1KC5L 3VRIB 4FFYL 2OK0L 2Y23A 1R3KB 1OW0C 3PGDA 5C9JB 3AOFA 3W25A 4ACYA 2OL3B 4W87A 4TRPL 3KDMB 4XZUA 3QH3B 4W89A 5GJSL 3U4EB 1U30A 3WIHA 1Q0YL 5FYJU 3CDYA 5AUMB 4Z8FL 1K9DA 4W5UA 1U9KA 3WF0A 1KPVA 3MV8E 4TQEH 2NXZD 2DPEA 1QFUH 1UJ3A 4JGUA 1SBSH 2A0LD 3Q1SL 2XSBA 4UILH 4W4OC 4KH2A 2OW6A 2OP4H 2NY7H 3Q2CA 1S7VB 4XNUH 1S9XB 4ALAL 3S36L 3M7SA 2HTKD 2XG5A 1YEKL 1EAPB 1XH3B 3V6FA 1B31A 3VRLF 3UBXA 3DVIA 5LCVH 3VWJD 4NSKB 2P1YA 3F12B 4FQ1L 4X4XA 4Q7DA 2J8UA 3FFDB 4LDOB 4PIRF 1B9ZA 2WVVA 4MJIE 2I24N 2CLRA 2H2SC 3PNWB 4Y5YC 5D8JH 3TV8A 2NY4C 4PRPB 3N1FC 2WW8A 3DHUA 1IGFL 4CD6A 2J2ZA 4XCNA 3GM8A 2W65A 3O2VH 3G08B 3ZZ1A 3UG4A 1NUGA 3QJHB 1P5VA 3I3EA 4HUWA 4K3JH 5EORH 5ITFB 5CUSL 3BEVB 5E5MA 2XTJC 2G5BA 3IAPA 3SDDD 3MLRL 5HYSA 4BZ1L 5HVHC 1UD4A 3ZO9A 5TPWH 4OCWL 5LGKA 1CGSH 4R90H 5DJDB 5HY9A 2O93L 4MB4A 1E6QM 1E0WA 6FABL 1MH5A 4K07A 5A6MA 4V2CB 4DCQB 1P7QB 1JN6A 4B3KA 1IGIL 4LLUA 4HS6A 5L88H 5B38G 5GRXG 5DO2C 2V9QA 4OB5L 1OAKL 3RVVD 2QQLH 4KRTA 5JOFB 1FGVL 3NFNA 3QDMA 1CICA 3H3KA 3IDMA 4GXPA 2YUWA 1U0QA 5K9OB 3PWLA 1IM3A 1T6VN 2EKSB 5EU5B 1BOYA 5D1XB 4X6DF 5C0JB 4POZD 5TFSH 5IKCA 1QHOA 5IB2B 4XP9H 4YO0A 1AQHA 5M03A 2D03H 3GSXB 3E3QE 3QUXA 2R2EA 4LIQH 1QYGH 1T2QL 3PQYB 5D96B 2J75A 4P46C 1FNEA 1UFUA 1OINA 1MHHA 2DQIH 4LFHD 4J27A 3W0KA 1OB1A 3VXPB 2DQGL 2C3HA 3NAAH 4DGIL 3H9HA 3QUZD 2ZCLH 1C93A 5M17A 5E0QA 4YHPB 1KBGH 1KCVL 1IC7H 3O45A 5A43C 2J4WL 1M04A 4R26L 4I4WA 1H11A 5M7QA 3QWOB 1QSFB 3EDEA 5HDLA 4DO6A 5IFPA 2V7HA 3GB7A 1I1AD 4MJID 4XCFH 4KKBD 1ZOXA 5C0EB 2D31B 4W6WB 4F9LA 1H3VA 3U1SH 2J8GA 1E5JA 3GKZA 1BZ7B 2D73A 3WUZA 3BAJA 4R96B 3S4SA 4DTGL 1INEH 4M1RA 1DBML 1U8NB 5I30H 5INCA 3DTXA 1V03A 3NA9L 1A22B 4MA3A 5DC9B 3FQXA 5ESQB 4K55A 1EPFA 5I8OL 4RAVA 2A74B 2XZCL 1TQSA 3DXAB 3MFGB 3RKPA 5D9PA 4UV7L 1V0LA 4NQDB 4AISA 1FFPB 3DYPA 1VPOH 2ORBL 5TDOA 5FO8B 5E24E 5FKPB 2H3NB 3DSFH 1MVFA 1IGML 4RRPG 1X5FA 2DLTA 3WHXA 2FJGA 5C2BH 2WP3T 1FN4B 5TE4L 3DNKA 1ADQH 1QI5A 2ITDA 5I5RA 1NCDL 4NRRA 1Q9OA 3O9WD 3CXDL 4ACZB 2I07A 3D18B 1B3VA 2D1ZA 1BQLL 2X2JA 4L4PA 4LVNB 1DLHA 2BVQA 4K9EC 4XP5H 3AI0A 3KYNA 4KQ4L 3P9MB 3O6FB 4KTEL 2DKSA 4N9GB 3GMRB 2BVTA 2BSTA 5CZVL 3T2PA 3HC4H 3MJ7A 1ISXA 2LTQC 1JDAA 2ZSWB 5ESAB 1R46A 1FNHA 5AZ2H 4C55A 4WI4A 4PLOB 1RJCA 3BAKA 1NDGA 1XIWB 3PP4L 1RK0A 4B7LA 2JF6A 4NC2B 1MFDL 1BOGB 1IEAB 2HT3D 3P77B 4LVEA 1I8MB 3W37A 4X0VA 2FLRT 3ZKSD 2XFXB 1J8KA 2KUTA 3V5DA 1A6UL 1AE6H 4ATDA 5EPMA 1FIGL 4JO4H 4XWOD 1F4XL 4HQQH 5IVZA 3APGA 3QCVL 4HPOH 1DQMH 1RZ8B 4XGZA 3UTPD 5E7FA 3LIZH 3TO4B 4Z2LA 2ADGA 3OKKA 4XVUC 3CMJA 1G7PB 3TBYA 1UWIA 4GBXA 1HJQA 5AD0B 4QO1A 3TOPA 5D5MA 2EO1A 4PJ9A 1GSMA 4F66A 2WZHA 3L4YA 4DUWA 2EC9T 1CLZH 1I8LA 3WXVL 5FYKE 4PJDF 4B41A 2VUYA 1PEWA 2JIXB 3QO0A 1F6FB 1KEMH 4WJ5B 3RA7H 1R3KA 2ZXQA 1U2CA 3TBTB 2OWWA 5TD4A 2HKHL 2YL9A 2IFGA 4OJFL 4YXHL 3U4EA 4NFCA 5J12B 1XR8B 1PS3A 4BELD 2ZIDA 4JPVH 5EZJB 4P0DA 3L3KA 2PWHA 1A7NH 1VESA 1ND0B 2VLLA 1TNMA 4ZUTB 3DX3A 3F7YB 3FMGH 3NN8B 1XGYH 3X3FL 5D9MA 3CC5B 4KVCH 3WUBA 1KCKA 5FIEA 3PIQB 5DI8B 1QRKA 4IRJB 5DQDL 5F89B 3X3GL 2PBOA 1MREL 1U3HB 1K85A 1NC4B 1WTLA 3NIGE 3VWJA 3TA9A 4JO1H 4G6ML 2OYKA 1W2KT 1E71M 1LWJA 3DPBA 1GHFL 1U58B 2CKSA 3UJIH 1E0OB 3MNWA 3PNWA 3HG3A 1DN0B 1H5BC 5BRZE 4PRPA 1MCRA 3SGJA 4KUZL 4XX6A 2YUXA 2CIKA 1G7HB 5FKAA 2AI0H 3QJHA 4PRIB 3RWEA 1A0QH 2EE2A 5KN5A 5IFAH 1WAAA 4WHTB 2CUMA 3OKMB 3W0WB 4GW5B 5J56B 4W86A 3DVFA 5ADPH 4MHHI 1RUML 1QR4A 2CR3A 2MQ3A 3AFLA 4HUMB 4Z6AT 3CZNA 1AR1D 4D3CH 4YNYB 4AXNA 1JWUA 5A95A 1VGKA 4OZFB 3RWCA 2X4NB 4X4YB 5EFDA 4Q9QL 1U33A 4POYA 3IT8D 1F45A 1KXTB 2J6EL 4NT6B 5IVNA 3EYUH 1XH2A 1JHKH 1HXMB 5JUEL 4NRSA 1GONA 5DSCA 3JTSB 3GO1H 4NNPH 1SFSA 4MA7L 3QGVA 5MP6L 5DFVC 3N1MC 4G8EA 1M7XA 2ALWA 1T04B 3PJSB 5JOFA 4P7RA 5FYKD 2EH7H 2EIZA 3QDJB 3O4OC 4Z7OF 1UM4H 2DLEA 3WNLA 1W3KA 5B3JF 4PRBB 2HJKB 1CLYL 4L4JA 2EKSA 5IQ9A 5F7UA 5D1XA 1HWWA 2X8RA 3PDGA 1A1OB 1KNOB 1WTGT 5C0JA 5F21B 5GHWH 2UWFA 3VIOA 2APTA 5C6TL 3WFCL 3NFSH 1X5YA 3D25B 3LKNB 4YDKL 4E0RB 1I7ZB 2P7TB 3BAIA 1QFHA 4X7EC 4G3YH 4LGXA 1OM3L 3QUZA 2UYLA 1LILA 2VXTH 3GSUB 2B4CH 4KK9D 3RRQA 1FP8A 3WUFA 5TF0A 1B3ZA 3EIFA 4GG8B 5ETUA 4L9LB 2JELH 1INDL 3GJFH 1YNLH 4U1NA 3E8UH 3QWOA 1XF4A 4PJDB 5FYLD 4QHMA 1K8DA 3RPKA 1RK1A 3BPCB 4ETYA 3WQVA 4DKDC 3WL9B 5C0EA 3WY1A 2FLBT 4BH8B 3LRKA 2A6IB 2WKLA 1AXIB 5FDYA 1KTCA 2C3XA 4PTWA 1BZ7A 2WWMC 3HE6D 4R96A 5DMKB 3LEXB 2OJZH 2ZCKL 4ODWA 4NZUL 1CLOH 4PJGF 3VFRB 5DK2A 4GKOA 5I75C 3QNZB 5EZOL 5IGXH 3DXAA 4D6HA 4QHNA 1FSKB 4NQDA 1W1PA 2D7OA 4DZ8A 1TA3B 2P8LB 5C0AB 1T0OA 1CBGA 1VSCA 5CSGA 15C8H 1U3ZA 4HA4A 1GZPB 3GBNL 2B1HH 1CECA 3OZPA 3MACL 4NHUB 4L1HA 4MSWA 4OTXL 3RU8L 3PTMA 1CR9L 4XNMA 4MCYB 4WO4A 2W9DH 3O9WA 3V4UH 3GK8H 1F6AB 2NY0C 2AV7B 2X5PA 4TVPH 2YBRA 3VWKD 4ZUSA 3RWIB 4UINH 4ACZA 2DWDB 3S88H 3NIYA 5JW4Q 4O2EA 2AEPH 4H1LB 3FQRB 1T3FB 2HJLB 2QKIB 3HZKB 3AIRA 4ZFOA 2VL5A 3GMRA 1UQZA 4ODBD 4ZE5A 3U6RB 1JF5A 5E95B 5F6HJ 3QQ9C 5D9NA 1KCRL 4XI5D 2FATL 2QSCH 4P8WA 3BCDA 3PZTA 4QXGL 2F8QA 5FGCE 2R0ZH 3C60C 4OIAA 5CPTA 2E27H 3QFJE 4LP5A 2ESVB 4G8FA 4Y4FC 4JG0L 5L6YL 1SYSB 1I1FB 3AY4A 3MNVB 1YC7A 3PXJA 1JGEB 2MQCA 1EJ6A 3CZLA 2ERJB 3TTYA 4PJEE 5IOPA 1BFNA 1NCUA 3OAUL 1IEAA 1OT2A 2BVEA 2ZX7A 5CJBA 3RTQD 1ITXA 2ADJA 1Q9KB 4O51B 2XN2A 1MY5A 2AK1H 2XFXA 5EU7C 1U91B 4ENEC 1DLFL 1AI1H 1F6LL 4AEEA 4ZTPL 4HX1B 4YHZL 4EE9A 2G60H 4R2GB 2XQYK 3H54A 2GTWA 5D2NA 3MJ6A 2MANA 1U8KB 2DTSA 3EYOB 5IJVB 4UZSA 4Y2DC 1QNSA 4XX1E 3VIIA 1G7PA 2QQNH 3VXQA 4GKZB 3SDCD 1TJGH 4MA1C 3AIWA 2ITCB 4JJ5B 3VGFA 1CDBA 1KXVC 1MFNA 5I8CB 1CN4A 3GH5A 3AREC 1F97A 2CIIB 1QBAA 4MJ4A 5I18H 4KI5F 4WJ5A 4N5ED 4XP6L 1GOOA 2UUDH 1CVRA 1UKQA 1J10A 2EDNA 2IBBA 1YMMB 4FFWC 3OKDA 1YY9D 4ODVL 4MPKA 1JGUH 2EDWA 4HLJA 2VT0A 2E40A 5DC0A 5B39B 2WAGA 5J06A 1E6XM 3I50L 3K0WA 2FGLA 3CLWA 4ZUTA 2DT3A 3F7YA 1S7SB 2G2RA 1CFVH 1L7TL 1NQ6A 2ZUTA 4YFLF 4ZDHA 2XN9B 1MCWW 4PJGB 3C6LC 4OIBA 5DI8A 2QLYA 4IRJA 3UBXG 1E4XH 2H9GB 3LEYL 1L6XA 1TZHA 3O3BA 1UZ8B 1R3IH 5DRZA 4KZEL 4IDJH 4F8QA 3QDGB 4YWGL 3DWTA 2NW3A 1E3XA 3MUGA 1U58A 3DVNA 3S8WA 4OZHF 1RZ7L 1AXSB 1G7JB 4QRSA 1B4RA 3VDCA 5I6SA 2DOCA 1KIQB 1MXDA 3ROLB 3QFJD 3GSNA 2Y24A 2COQA 3MA7B 2Y4SA 4EK7A 4MLSA 1QNQA 1B3YA 1JPSH 2VX6A 4PRIA 3S37H 2ZZUT 1ONQA 2E7HA 2HFEB 4WI2A 3UJTL 1ISVA 1A7QH 5EFIB 4G6JH 2IUZA 4HGKC 3BKCL 2VR5A 1HXKA 1I85C 3MLTA 5HYSG 4U1HA 4LLWB 1BD2B 1JMXA 2CNCA 1WFNA 4YNYA 4D72A 2VX5A 2X4NA 5CJOH 3L5JA 3I6LE 5B4MD 3NFPB 3QIWC 4MJ5A 4NT6A 5JW5B 1R3JA 4FQHA 2HWZH 4UOW0 4WEBH 3JTSA 1ZANH 4HKZA 4TQEL 4RBPK 4GRWF 1QFUL 2XZQL 4P23A 1NFDF 1SBSL 5T5NF 3GMPA 4GKNB 1T04A 3GHBH 2P8MB 2A6DB 2MOVA 2NY7L 4XNUL 4H7VA 4JFEB 2YZ8A 3RJYA 4JRXE 1E4XI 4K8RH 2YD6A 3BGFB 5GNZA 4LPXA 3V6OC 5LCVL 3GBMH 2YPLB 3DETD 2FNBA 4QAWA 1XFPA 3AIBA 3QEQB 4HXAL 1KNOA 1IGCH 1MQQA 2W62A 3WBAA 3CU7A 3UERA 3BD4A 1CD1A 3ZE2E 4TUOA 4JHOA 4P2OC 2Y9RT 1BYBA 5D1ZC 4W7VA 4AJ0A 4WK9A 2X7LB 4X6CA 1UWXK 1HSAA 3LKNA 4PJHA 4QYOB 2F74B 4E0RA 1I7ZA 2UVFA 1FPTH 4FXKB 3DMMB 3A23A 4HZ8A 3O2VL 4AZ7A 2P45B 2IADA 3GSUA 3HLAB 4K3JL 5EORL 1ZJBA 2EO9A 4A3YA 1CTNA 3P11H 1WCQA 3PF2A 5J1AB 1GJWA 3P0YH 1E27A 3O41B 3PWUB 3LPPA 3FO9B 4ZE4A 2E9WA 5KSAB 2OR9L 4I2XA 1AD0B 5TPWL 3WL9A 1ZHLB 3OGOE 4BH8A 3ZKXC 1E4WH 2PW1B 5DRNB 5CSZB 3S4SG 3CH1B 4JG1H 4RWHA 4L5FH 1A14H 4V1DE 1T1WB 2VR9A 5D7JA 3STBA 3L2MA 2VN7A 4NBYB 3WS3A 1WCBA 2ZOKB 3VFRA 3SUVA 4Z7NF 3O2DA 1CGUA 4OKDA 2QQLL 3A6CH 1D5ZB 3HNVL 5BV7H 3L5WB