1GVIA

Thermus maltogenic amylase in complex with beta-cd
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
588
structure length
588
Chain Sequence
MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPAISPKGARPWGSEDPTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGAASRYKDWFHIREFPLQTEPRPNYDTFAFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGLIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRALRRGDVAFLTADDEVNHLVYAKTDGNETVMIIINRSNEAAEIPMPIDARGKWLVNLLTGERFAAEAETLCVSLPPYGFVLYAVESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclomaltodextrinase, Neopullulanase, and Maltogenic Amylase are Nearly Indistinguishable from Each Other
pubmed doi rcsb
source organism Thermus sp.
molecule tags Hydrolase
molecule keywords MALTOGENIC AMYLASE
total genus 165
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gviA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1gviA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1gviA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1gviA03
1GQLA 5EC2A 3RJQB 2B20A 3SIMA 1Q1JL 4GMTH 1JHTB 1KYOJ 5AYBA 1AKJB 3HHRB 3MNZB 4MNHA 2VXQH 1QO3B 5DC0A 5I1CH 4JCLA 32C2B 5C0RH 5F88B 1U33A 5D1XB 2B7DT 4V2XA 4GW1B 5FDWB 1UVQB 3PP4L 1GOQA 3NCCB 1B9ZA 1Q8MA 3NFPB 4LX4A 3VMNA 5J9PB 1NFDE 4Y5YC 3GBNL 5DMIH 1NLDL 1UKOA 1UWQA 1FORL 2ESCA 2C4XA 2AEPL 3Q0HA 3V0WL 2R29H 2WWMC 2ZX6A 1HKLH 3LS5H 3SCMB 4M6ML 4KJQC 4FS0A 2AW2A 3IJHB 4U1MA 4MAVA 2XI9A 5HHNB 1XH1A 1UB5B 4W4OC 3CHCA 5KSAD 2HTLC 5IEHB 1QSEB 1MHPH 2PN5A 1B2WH 4AEEA 3QPQD 4L4TB 2O9PA 4XMKH 2GUOA 4UU9B 4XP1H 1XIWA 3BP5A 4QT5A 3NFSH 4PJFB 2VQTA 3OJMB 1J10A 5TDOB 4YHYB 1QPPA 2D9QB 1JMZA 4U6YA 3ULUL 3PABA 2MSPA 1S7SB 5FYJU 4DKAA 3O4OB 4N0CC 1HINL 4PGDA 4PB9L 2VLLB 4YDJB 1H3TA 3NN8A 3QQ4A 4YHPA 2FD6L 3BP5B 4IRZL 4HPOL 5KAQF 1ND0B 1PJ9A 1Y0LB 4EQ3A 2VITA 3RVTC 4F9PC 3HMCA 2VRAA 5LG1A 1FNSL 2A6IA 1MCSA 4Q22A 4Y1AD 5I0DA 4Z7OF 1C08B 2QV2A 4ZENA 5MEQA 1PG7L 1DUYB 1QSFE 5C6TL 3U4EB 2PWDA 4JZJC 5HHQA 1ZBKA 4J12A 3OR7A 3OAUH 5C0AB 3V5KA 4HXAH 5E9DA 2PTUA 2DQEH 3IDMB 5DD0H 4CW1B 1UASA 1HKJA 2ICES 1K8DA 4H5SB 5ITBH 5HHOD 5BYWA 1BFSA 1UD8A 5EZJA 1CD8A 2IF7A 1QLFB 4D0BB 1UM5L 1S7QB 3RWFA 1WZ1L 4PR5A 1YEHL 4JM2D 4Q97A 3ZYZA 3U9UB 4W85A 3U5YA 2G41A 1DQLL 3L3DB 4XC3L 4HC1L 3BVTA 4P9ML 5HDOA 3MRIA 4FP8H 3F12B 3KPQB 4MD5B 1MIMH 1F3JA 1K5NB 4MNKA 5F9WC 1OGSA 4Q9BA 4M8UA 1F97A 1LLOA 2VLJD 1HDMB 4MJ4A 4XCNA 1KACB 2DI9A 2W59A 4RSVA 4OAWB 4CMHC 3DYOA 2GKIA 2A83A 1C5BH 3CSYB 4NPYB 2P42B 4LKCA 1SJEB 3ALPA 3RVXC 4MD5A 1XRVA 1BOGB 3MZGB 3MSDA 3VI3F 2A1WH 5IMKB 1T21B 4PMRA 1Z2KA 3T1FA 2AVGA 3A4WA 3LN4A 2F58L 3EOAB 3SGKA 1LE9A 1NL0H 1Q0YL 3N85H 3ULVH 1SY6L 5M95B 2DQXA 4JRXE 4Z7QE 2Z92A 2FRGP 4AG4H 5C9JA 1MF2L 2XG4A 3W5MA 1RV6X 4XNZB 3V6BR 5IB3A 4MSWB 3O3EB 2EH7H 4HFUH 1W0WA 2J5LB 5JIHA 1OGTA 4I3GA 1U8OA 1K3ZA 3CZKA 3JUZA 3VRIB 4AEHH 3BSHA 2CIKA 1CE6A 4U05A 4JAMB 4XXDA 1LF1A 4KUCF 2OZ4L 4NBXB 1PSKH 2AKRB 4ELKA 5DQ9B 5F7NC 4TUKH 1MJJA 2YA2A 1F4YH 2D73A 3WKZA 2WIIA 5IMLB 5A8NA 2CDEB 1K4DB 5DC9B 3G5VA 2X2JA 3ULVF 1MW1A 5KZ6A 4GW4B 1JWSB 4WUUD 5AUMB 3H42L 3HCVA 3C60D 5ACLA 3CVHH 4L8CA 4G8GD 4PG9A 5KW9H 4W87A 3V6FA 5FYJE 1CLOL 4UQBA 3KPOB 4GAFB 3TCLB 1OSPL 3V79C 3PQYA 1PBYA 4MS8C 1R5WA 5TE6L 2YBRB 3OXSA 2PW1B 2IXVA 1CGUA 2V9TA 4M48L 1UWTA 1DLHA 4RBPH 2ED7A 3C6LD 3QUMB 2JJVA 5C07E 3TTSA 4TVPE 4UFKA 1H3WM 1LQ0A 3QQNA 4UIKH 4BSWB 1AR2A 3NZ8B 4K8RL 4YXLL 1I9RH 1G9HA 2ORBH 2P43B 3R8QA 4KROC 5E4IA 1MY7A 3LH2H 3T65B 5JOEA 1HT6A 3F7PC 4U3CA 1BEYH 2Q87A 1KEGL 4M7LH 4OAWA 1DUZB 3T2QA 1A5FH 3B6SB 3EO9H 1XD0A 3CVIH 4D8PA 1G7IB 2V3EA 4UR9A 3BVNB 4LCWE 3K74B 4DCQB 5DT1L 2G60L 2BOBA 3NFNA 3QIWD 4FQLL 5EUOF 5HI4C 4LPUA 1OAQH 5LCVH 4M4RA 1KB5H 3EW3B 3B2UD 3KXFA 5IHRA 4DUWA 2GK1B 2VLKB 4ZPTA 2BSRB 5L8KB 1J12A 5M5DA 1W91A 4R4BA 2UWFA 1G7QB 2IAND 3C8HA 5SWQA 4U3HA 1C90A 1DBJH 2ZCLH 2AXFA 3SGJA 3MRHB 2DLFH 4P5KA 2ZIDA 2DDQL 3MO1B 5IQ9B 3H7BB 3QA3A 4I8DA 3TEUA 4ZS6C 2XM2A 2YRLA 3RVXD 4UQ2A 1IC5L 5I23A 1MY5A 2WHKA 1S78D 4N9GA 4OD3H 3U57A 2R0WH 1FJ1A 4H88L 5TGBA 5GGSB 5IOPA 5HI3D 4M61A 4B41A 2EACA 1CNVA 1G9NC 1CFTA 2J75A 4AD1A 3WN5A 5C0GB 3MI6A 3GH7A 3MJGX 3SUVA 3F8UB 3F5KA 1U8KB 3RTQA 1Q1JH 3JV6B 2X44D 4MZ2A 4MNGB 5DQJB 5CEYA 3D48R 1RI8A 3DX7A 3B2UC 2NY2C 1OARL 3TIDA 2EDRA 1BG9A 2ZG2A 1DQDH 4Y5VA 5ILTL 3SDCA 4FFYL 4LRIA 4U1SB 2YBRA 3OXSB 1XAUA 4YGVB 4TPRH 1NCBL 2A9MH 3UTSD 2I26N 4F8QA 2GTZA 1XH3A 3IS1X 5EFDA 4P5MA 4U1KB 3RGVD 4ZS6D 3MO4A 4EXKA 3OGVA 4JN2B 3WUGA 1A1MB 1FGVL 3NYDA 3KPSA 4BQBA 2H1PL 1JGVL 4NF7A 4XB8A 4P7NA 4GXVL 5C0BD 3ELAT 2XZCL 3BDXA 4I2XA 4KMTH 4KVNH 3RY6C 3GNMH 1YEDB 4OLZL 2CKBH 3UAJD 4MNMA 5ALCL 4I1NB 4LPWA 3NOIA 3G6LA 3BIAX 3UBXI 2EIZB 4M1RA 3L5IA 1E27B 5DUPH 3WD0A 3C9NB 1G01A 2EQDA 4OFYA 1EHXA 3KYOA 4G8IB 4NZUH 3I6KA 1E70M 4OB5L 1PLGL 3ARFC 4M6NH 5IG7B 1QACA 5CINL 4D6CA 1HQRB 5SWZE 2ATPB 1Y6MR 4M80A 2LE9A 3D2UD 3T0ED 2K7PA 4BZYA 2DSUA 3UJIH 1UADC 1K8IA 1QD0A 3ZJ6A 4YXHH 2ZZUT 3DMMB 1I1YA 1NGQH 1IEBB 2V9QA 2ICEA 2P5WB 3ZKMC 1RIUH 2OS7A 3F7QA 3KXFB 4FTVE 2Z35B 4KMQA 3VXRA 4BH7B 3A6OA 2C5DC 5J1AB 1H15B 5CXPA 4EUPH 1O7DC 2Z31A 1YMMA 3HNTL 4WU5B 5EBAA 4NO2B 1CLOH 3W39B 2NY3D 5DJ8B 5FKAB 4LDEB 5I74C 4C57C 5EFIA 1MXDA 1NMCB 4YIQB 2F19H 4FFZL 4KKAD 1P7QD 2B1AL 2NY5C 4W84A 5IB1A 2G9HA 5C07A 1KTDB 2IQ9L 4JDZB 4O02L 4Z8FL 4OZHF 2WV3A 4KRMB 2YUWA 4RGOL 5ID0A 5TF0A 1QA9B 1SYSB 1GYAA 1MCPL 1IQDA 2DRUA 2VL4A 3WH8A 1I8LA 4J3UA 2FECL 1JNEA 5J12B 1NBYA 1QSFA 3T0XA 4OZFH 5C86A 3P4OB 4GRWE 3BEVB 4QRRB 1RULL 3D85D 3V7MA 5BROA 1CFSB 4WLCA 5FGCB 5FM4A 2J8FA 4H8UA 5F3BB 1S7WB 4WW2C 1ZOXA 3PZQA 5CJ5A 4M93C 3MLSH 2QQNL 5JO5B 4AT6B 1VJSA 3HJEA 1XR8B 3EIFA 1KYOK 1UQYA 3Q2CA 1A6UH 3RVUD 1YN6B 2BY1A 3CGTA 3F4VA 2C3GA 3PWVB 2AV1A 3WFHB 3I6GA 3KPLA 4WEBH 4UZSA 1NM9A 1RZFL 2EBNA 5HGAB 3C9NA 2J7HA 3LIZL 1F3RB 2FEEL 3QXVA 4JQIL 1IC5H 4ZOAA 3OSKA 4LGRB 1ZJBA 1AJ7H 1C3FA 1YDPA 1II4E 3HE6A 1HHIB 1PS3A 3BPCB 3VWJC 4LPTA 4RZCB 3Q5YA 3SKMA 1CU4H 2FLBT 3KWWB 4S10A 2Z8RA 4O4YH 2YPLB 4HQQL 3FN3A 4TNWK 4Z5RA 3RDKA 1D5IH 3CO4A 4HBCH 4YX2H 1UJTA 4OLWL 1UB5A 12E8H 3RNQB 3RHWF 3ARFB 5DS8B 5T1KD 2J77A 4BA8A 2PC8A 5CLWA 3RJYA 1UQZA 4YH6A 4L8BA 4XXCC 5FUZH 1MEXL 2FJFA 2B4CC 3QIUB 3THMH 4F7PA 1JGEA 3R06A 2JB5H 4OGAD 1BVZA 4KI1A 2C26A 5DUBA 4YAQA 3SE8L 3UDWC 3W11C 5HVWA 2RGMA 4OZFG 1HE7A 3NA9H 5D7IA 3HUJA 3VKKA 3CMGA 2J7FA 3QAZC 3ZT6A 4R96A 4ACYA 1W2KT 3LAFA 3EOBB 1X5GA 4KZDH 1S3KL 4L8BB 4WY7L 4X4YB 3V4UH 2GDVA 5E8EA 1U8IA 1CDHA 4KJYA 1Q9LA 1LO5A 1NGWB 4F33B 1D6VH 4GS7B 1J88A 1LP9B 3EMZA 3HLAA 5EU6A 4E0RA 3T3PE 5IW6A 2F53A 1E71M 1LWJA 4RFEA 4X0KB 1XC6A 5IMMA 1M03A 2W4XA 3WLWC 3VGGA 3LQZA 4OGAC 4LGSB 1DFBH 3I50L 5E00A 1F58L 5EU5A 1MFDH 3O3AA 2DSVA 3ARBB 2W9LA 3ARGC 1IGYA 1NMBL 2ZCLL 3PF2A 4MNQD 4LSQL 4P4RA 3V5KB 2OYMA 2FHFA 3NSMA 4MCYA 5HHME 2E9WA 1YEFL 5HVFB 3DETC 2O93L 4BKLA 1SJXA 3S3SA 1JZ2A 1MCWM 2AK4E 1Q9KA 3C5JB 5DJAB 1KXVA 4GO6B 3ARDC 4UINH 1QRNB 2WUCH 1D3CA 2TAAA 1UM6H 4HLZG 1IGYB 5E2VH 2OLHA 4M48H 5DFVD 3O6LL 5GRVL 4RQQB 3WUWA 2ESVB 3JTTA 2RAMA 3UJIL 5D6CB 1QLEL 1MJ8L 3CH1B 5IKCB 3VX0A 6FABL 4WFFD 1LDPL 1LO2H 1QNZL 4RBPK 3WQWA 1OCWL 1T83C 2NY4D 3OLIA 2AAVA 3VIPA 3NPSC 2Z4QB 4AISA 5C0CA 4I9WE 1JFHA 1FGNH 4CDGC 1FNHA 4MXVE 5DJCB 1ZANH 3CFBB 3ZO9A 1CK0H 3KWXA 3ZDZE 1CXIA 1CDBA 1MFAL 1MNUL 4ONOA 1S7XB 2PF6A 5EU4A 3WBAA 1LE9B 3FQNB 1LEKB 4G8FA 2CDGB 4UTBH 3CZSA 3DSFL 5DRNB 2E4TA 3QNXB 2X70A 4U1IA 2IQ9H 3VFGL 3QP3A 1OB1B 1TZHA 3VDCA 5KZCB 5ILTH 1PYWA 5GRJH 5CSUA 3D0VA 5ESVB 3GRWL 2Q6WA 5I1HH 1Q6FA 1TDQA 4HUVB 1YMME 4WO4A 4FQQB 5D1QB 5D7LB 1KF9B 3MQIA 4S0SD 3ZT7A 1KIRB 3QEQE 5JHDA 1CXHA 1ZT7A 1RUQL 1I85C 3NIGF 4NZDA 1P9MC 4X9IA 2XPGA 3KLLA 5DQ9A 5I0ZA 2R2CA 3U6RB 2BCKA 3VFMA 3VIJA 1T20B 4LPXA 2QR0B 3T4AA 1D5XA 3LCYA 3CU1A 2CDEA 5D5MB 3PGFH 2F54B 2VWEC 3NCEB 4O9HH 1KJ3H 4RISL 4E9LA 2WC3A 1XGUB 4CNIA 2J4WH 1AO7E 2VLMD 4XXCA 3BGFC 3QEUB 4I18B 3AZRA 5D2NB 4AY0A 3T0WA 5JORA 1DE4A 3WE6B 4R7DB 3VM5A 5JUVA 3LZFL 3OGCB 4P2RB 1YN7B 3MJ8B 5A16A 3FQWA 2DWEA 4R97B 3U1SL 1KB9J 4CKQA 1F2XK 5D5MA 5I71B 3E3QE 4JDVB 4Q0XH 1E6SM 1P7QB 5EZOH 5H2BB 5C0AA 4NQCD 4UB0L 1YMHB 4HAFA 2ZG1A 2O92A 3QHMA 4HPGA 1XF5A 3O6MH 4GMSH 2FDMA 1YPZF 4ZUUA 2J4GA 4OLWH 1JAKA 3DETD 3QUMH 3CC1A 4NQSB 4LSDA 2DWEB 3TBSB 3LKRB 3KR3L 5CBEA 2HKFH 4NKIL 2C3HA 1FDLL 1G9EA 2CUHA 2X4SB 4NWUL 3BPLB 3R1GH 5BXRA 4Q9QH 4UQAA 3RDTD 2DBLH 3ULUF 4QWWD 1LDSA 3QWOA 3TO4A 3U0PA 3FQRB 4AZCA 3RGVC 5HGBA 3AREC 4NI3A 5AWNH 1D5MB 4X8XA 1UCBL 1QFWL 3C5ZD 4I3RH 3AFLA 3ZE0E 1B88A 4M8QB 4X4ME 5ICZB 2F7OA 4K8RC 2A0LC 1UA3A 1ODZA 3MLTB 3VSVA 1E55A 2BOCA 4NPYA 3QZWG 2A6KA 1A2YB 1EEYB 4FN0A 5FO8A 3VGAC 2HJKA 4NO0D 4JZJB 2V3GA 3DGGB 1AY1H 3GBLA 1D5MA 4WW2A 3HZYA 5HHQB 4XVTL 1NMAH 1EDQA 3HG5A 1A1NB 1JNHB 1MFCH 3TBWB 2D03H 4ESKA 1HILA 1S8DB 4LPVA 5DVLA 5IFHL 1X44A 3UZVB 2IQAA 1KC5H 2BOCB 4J4PC 2P8MA 3HRZA 4XPTL 3VD9A 5FK9B 1RZGB 4DK6A 4JZOB 4JFXB 4NC1C 5IVZB 4TOYH 2CGRL 1NUGA 1YQVH 5J13C 2VL5A 4D9RE 1R3IH 1CI5A 4PJ8A 4YHGA 1RSFA 5KBNC 1KCVH 1B3YA 4G5ZH 3UPRA 2J5LC 4TVUA 2WLZA 1K5NA 2VDQL 5IW1A 3CFJB 4JZOA 4NQDD 2DQCH 3L7FB 4GXUN 4U3AA 3GJFB 5ICXA 3E6HB 1UM4H 1FZKB 3STBA 3BXNB 2RCSH 1QLEH 1VKXB 1WZKA 1PY9A 4MVBD 4IM8A 3W6LA 4DKEL 3BW9A 1B2WL 3OAYH 3JUYA 4GJTB 1OCWH 1UYQA 1CWYA 4PYSA 1BVKB 4KVCL 5F3HB 1IAOB 4IOFC 3ARGA 4QLKA 1LO3H 2E7CA 1NSNL 4I4WB 1J8KA 1ZLSH 3WEXA 3S35X 1MCLA 4B9YA 2FX8L 2KZWA 4CVUA 3OX8A 3BDYH 4G6JL 4RFNC 2YD9A 3AICA 2EXOA 1A6WH 3JUGA 1PQZB 1G7MB 3GDBA 5CMAB 3T65A 1H41A 4UINL 2NY7H 1QNSA 1C8XA 1QSED 4C55A 3FFDB 5DQDH 4KROB 2R0ZL 1HH9A 3ZL4L 4ZFGH 4LU5H 2ZXQA 4NCC2 4ZUVA 3RBSA 2H45A 3ET9F 3HE6D 3SDXA 3BUTA 1KJMA 2YRZA 5BVPL 3VXSB 5BMFL 4CRPA 3GXTA 5CP7B 5T3XH 5JHLH 2ZXBA 4P2QB 1BD2B 2UV3A 4Z7WB 1EAPA 2ZG3A 2NTFA 1LHZA 4L1DA 2OWCA 5F72S 1F58H 5CSBA 4PJ8B 3WH5A 4XWOC 4P9HC 1T22A 1A7NH 3N0PB 4TVSa 3OR6A 5EO9A 2FO4B 1QVBA 2DQEL 3TBVA 4K8RD 4JFTA 1KGWA 2NY2D 5JBDA 5CZXC 4Y4FD 1QNOA 3TCLA 2WSKA 4KKBD 1KCUH 4ONFL 4HX1B 3HC4L 3DVIA 1MFAH 3ROLB 4ZXLA 4I3SL 2AV7B 2AQ2A 3DVFA 3HE6C 2EPKX 3QIUC 4MNQB 1ZTXL 5HDRA 4A3YA 3O6FD 3LRSA 1X5XA 3WDHA 4KRLB 4B7LA 5DD5H 3UPAA 4LYPA 4XGZB 2FSEA 1UR4A 3NCBB 2DICA 2UZYB 4TOQA 4AMXA 2FYYB 3WF1A 5IVOA 5FYLH 5GRYA 3WF3A 3N12A 4L4OA 3MMWA 2PWGA 5T33L 5C92A 1WWCA 1JTOA 4LVHC 2D7OA 4M7KH 4AEIH 1Z9LA 4XWGL 5I17A 3TBYA 3WFBL 4MJ6A 4PRDB 4Q6IC 3WDPP 5JPMB 4DKFH 4UFJA 1T89C 1HHGB 1I1AB 2O9TA 4RGNC 5AYUH 3V4PH 3QDJD 1JF5A 1Q0YH 2E9LA 1NAMA 1N7MH 2CO6B 1I75A 1HH9B 2OWXA 5EUKB 2HFFB 2A83B 3QWQB 3RI5F 4UDUA 1E5JA 1QBAA 4NYLB 3NZHH 3OKOA 3FN0H 3A23A 1CL7L 1G1YA 3RWEB 2E0PA 4CJ0A 2X8RA 1XCQB 4HEPG 4XNMB 3CPLB 3ZKSD 4LCYB 5I1JL 1CIUA 2YXMA 1A6TA 4POUB 1UM5H 3TYFB 3WN5B 4XMLL 1ZS8B 4KHXH 3DX7B 2UUDK 3LEXA 4NXSA 3DHMA 4PJXF 1G7LA 4OGYH 1DBKH 4X4YA 4XPTH 2WANA 4HKZA 1X5HA 2V2WB 4LHUA 5L7XL 3QUYB 2Z9TA 5E6ZA 2YBUA 3LN9A 3VIMA 3LY6A 1ZGLB 2NY4C 1XIWD 2ICWI 4NOFA 1KIQB 2BVEA 1R3JA 3FL7A 5DJ0B 1EHLL 4X0KA 1YA5A 1WEJH 1E4NA 1G7HB 3OMZA 4HMEA 1Q4NX 2AJ3B 2DJUA 1MLCB 2EEXA 4JO2H 1R3HB 2V2XA 2I9TA 4PJCF 3MJ7A 4KY1L 1A6AA 4XNXL 5EC2B 5GJSH 5TF1L 2C1PB 5GIRB 3KPOA 4OZHE 4ISVB 4WFGD 4J23A 5LGHH 3LH2L 1MF2H 1RJLB 2QPSA 1IQDB 1OP5H 4W93A 4PJEB 4IDLA 3EJYC 32C2A 4YUEH 3K7UA 4N5UA 4EVNA 3SCPA 1N5AA 2Y9RT 5MEND 1G0XA 4DN3L 4W88A 4JFDB 3PV6B 4JO3L 2LTQB 3G6JB 1CQYA 2GK0B 4IS6B 1OWWA 2HFFA 4ZUWB 4KTEH 5HYSG 1INEH 1IGML 5DRZA 1DWIM 3R1GL 1VGEL 3AM8C 4IIQC 4JFPA 3DVNB 5JW3H 3HR6A 3MCKB 4EJ1C 1XEDA 3JWOC 3GM8A 5L2JA 5TE7L 5J6HA 4HGWA 3DUSA 3KLHC 3HE7A 5LQBH 4DWSD 4L3ED 1EA9C 3A67H 3K3QA 2DSKA 4P0DA 2ZX9A 5I1KL 4WI6A 1GGCL 3KXFD 2X4RB 5H94A 3ZKQD 1O7AA 3PDOA 4D9LH 3U0TA 5I74B 4C83B 2GJ6D 4PREA 4D6EA 1T04B 2WCAA 5DF0A 1H0IA 4LYQA 3KPTA 3QUXD 4QHUA 2ZOLB 3VE0B 5GGUB 1V0NA 2W0LA 3M07A 3S35L 3KL3A 3VGAB 3UJTH 3CUFA 4MA1B 2CKNA 4ORGB 1I9JL 2HKHL 3LPFA 2B1HH 5DHXB 4PY8J 4GBXB 4L4VB 4KHTH 5JW4R 1MFVA 2CR3A 4YHLH 1T6WA 3M1BB 2D31A 3T4YB 5CBAA 2DSZA 2NY5H 4PJDB 2VXTL 1HCFX 4NQEE 2ADGB 3ZTNL 4QLLA 2EE3A 3BYYA 3P30H 3W28A 5EBWA 4PV9B 3REWB 1IILE 1S9KC 1BIIA 5AZEL 3E0GA 2E9MA 3BDBA 5I77A 5IMOB 1JPFB 2VDRL 5CJQL 1G5AA 2I07B 3EDDA 5D1ZB 3VMOA 1A14H 1B0GB 2YA1A 4XC1L 5EU7E 3RBGA 2CQVA 5FHAH 4HUUA 1L0PA 1DL7L 2YIHA 4WWKA 4FXKB 1E1EA 1KLUA 5I1GL 5JXEC 1HK6A 2PXYC 2AK1H 1FVCB 1NCBH 2A9ML 1RUMH 1HYSD 5GGRB 1ESWA 3BEWA 5JOPD 3VI4F 1E4XL 5F1OB 4OCWH 4IDJL 4YQXL 3S8WA 2YHGA 5I18H 3QXDB 3SGEI 3BLKA 4UOW1 2PI6A 4P8WA 3RUGF 3BPCA 2IH1B 3SQBA 4ZNEA 4Z77A 3RVVD 3HN3A 1T3FB 3FQWB 2CETA 4QRUA 5EU5B 4XP6L 4F66A 3BDYL 4HBQA 1FVDB 2XQYK 2P48B 5DHVH 5HGHB 2E5EA 4H25B 5DUPL 3W27A 3BLBA 4JRWA 3D4YA 4C83A 1N4XL 1XF5B 3VDHA 5C0AE 1TQVA 2E27H 4D0CB 4PLNC 4X6CF 3P73B 3BN9C 4TUJB 2W07A 5I9QB 4KVCH 4X4XB 3CXHK 4QHLA 1XCXA 4HF5L 1VFAB 2VX4A 4PMDA 1FAKT 4ZUSA 4JG0L 1JI2A 1U0QA 5DRWA 5F9OL 1OY3B 3SE3C 3IKCB 4Y2DA 4NZFA 3VFOB 4ZFOA 4D71A 2YJQA 2WAGA 4AD0A 1FL3B 3AM8A 1UH3A 4OFKA 4CD8A 4QHLB 3AFBA 4HH9B 5I1IL 4C56B 2QSVA 5TJWK 3IB4A 2XXMB 3IDJB 4AZIA 3WFBH 3VW3H 2VLKE 4QRSA 1TVPA 4GG6B 1KB5A 2KL6A 5GQBA 2QSQA 3CLFH 4HLJA 2LAGB 3MMEB 5EBWB 2I25N 3WHE1 3NPSB 4UMGA 3MRQB 1LO0H 4HPYH 1CECA 1HI6B 3W9DB 3IXAB 4K23H 4ONHA 4NFCA 3TFKC 1J1PL 3QNYA 4X5WA 5TDOA 3WNLA 1WEJL 5DJXA 4C56A 2CIKB 4Z8FH 4OKVB 1MJJB 5B3NA 2DQDL 5DRNA 2AKRA 4ELKB 3RU8H 2V17L 3RIFF 1A6ZA 3DXAD 3MRDB 2OL3B 5TF1H 2J88L 3ARXA 1V3KA 4MJIA 2VXVL 3HAEB 4ONFH 3FO9A 4KQ4L 1JYWA 1QBLL 5I1KH 1S9XB 5J1TC 4PMQA 1OGAD 1K3IA 1Q9WB 3ARDD 2DMCA 3ULVE 5J3HC 2XACC 1HHJB 5I75C 3RZCB 4Z0XB 4F37K 5EO0A 4PTWA 2BY0A 4OM0L 3SUWA 1H5VA 1OINA 4U0RC 2JALA 2QKIA 2EZ0D 1QFPA 3D39A 3S98A 4P57B 1MI5A 4Z7UB 1ZA6A 3IFLL 3VFWB 3RTQD 4UUJA 1F13A 4H8WC 1JNDA 1VKXA 4YR6B 5FD0A 2EE2A 1FO0A 2WHMA 3LIZH 3EDFA 4ZNEE 3PWPA 5B38A 2NPLX 4FNLH 2BV9A 1WFTA 3AU1A 5CINH 1KPUA 2HISA 5D8JH 3MRNA 4JR9L 3FXYA 1A7RL 3UTSA 1U9KA 5FYKD 3UBXB 5A2IH 3IU4H 4JO4L 4QHMB 1LEGA 1DBBL 4L8DA 1YNKH 3FQXA 1B3ZA 1KELL 4D8PB 3GSUB 1BQLH 1NGQL 3PV7A 4QWWC 3AIEA 1SJVA 2EDLA 5HDQL 1B4JH 4LKXA 5FHAL 1BQHB 3LXBA 2EADA 3GZAA 4NUGL 3NZHL 1QHPA 3VIFA 3O3DB 2N7AA 4R0LA 5LBSL 4QTIH 4XAWH 3RPKA 1FP9A 1LJYA 4PMOA 2CLVB 1RHFA 5BRZD 3R06B 2NY1D 3O9WB 5L0QB 1Q72L 1YYML 4YE4L 3KYNB 3QCTL 3AMCA 4MQ7A 1N6QL 2HT4D 1M04A 2F53E 1EUTA 1MHEA 4DVBA 1LL4A 3U7AA 3VRLF 4UTAH 3DHJA 1EJ6A 1UD4A 3CLWA 1ADQL 1HQ4A 3GBML 1KJMB 4EI5D 4JKPH 4FMFA 4R4FL 5DJZA 1M1SA 1FJ1B 3QDGA 1CEOA 3HS0B 4L4VD 3AJ7A 1T21A 2OTPA 4V2CB 3V4UL 4WKFA 4NC2B 1G7JA 3BKJH 2VH5L 4Y5XB 3PHOA 2ADJA 2DIJA 4U6HB 1M6OB 3L3GA 3ZJ7A 3KYNA 3QDME 5BS0A 4YEEA 1MCPH 2ZX7A 3B83A 3ZYIA 3L3JA 5EZIL 3WL0A 4JPVL 2E8ZA 5MENB 4FQ1L 4J4PD 2PYED 1X7QB 1S5IL 2FATH 3IDYC 2P7TB 5FO8B 2BNQE 2PXYA 2RHEA 3MLRL 3E2HC 3PDDA 3TH2T 2W0FB 3UTZB 3KEHA 1JNHA 4R6UA 5IBLC 3TBWA 3WIFA 3O2DL 4WHYG 1HYRC 2FX9H 3DJ9A 3SDAB 4P2OC 4LSTH 2UYLA 4X8JB 5TFSH 3VRJB 2DQJH 4QEGA 4ZUUB 3X12A 3T09A 1HJUA 4H7VA 3BC9A 5LXGL 1D9KB 3D39D 1A3LL 3UR8A 5GPRA 1JPTH 1XF4B 2W63A 4U6XB 4XMKL 2DPEA 4XHQA 5C0IA 4JO3H 5ANMA 2VSCA 4OF5A 5C7XH 3F7YB 1TLKA 1BQHA 1EBPA 5HGBB 2WC4A 3TA3D 5T1LB 4ZOBA 4NZRL 1MNUH 1XGPA 2XICA 2G5RA 2R2HA 4O4YL 2X4PB 1D9KA 4MJ5B 3QCUH 2J3SA 3MBEB 2OTWA 5INCA 3FNDA 4RAVB 2ATKA 1OHQA 4DGIH 2JF1A 3C5ZC 4XMPH 1MSPA 3AXLB 3D1MC 3FFCB 1MXGA 3TPKA 1RJYB 5SWSE 5D72L 2P49B 4WTZA 4HXAL 2YKLH 3KNBB 1B4RA 3V95A 1OAKH 4NUJA 1AXTH 1QKZL 4M03A 2Y25A 5EOCH 3STLA 4ZQKA 1KFWA 2OK0H 8A3HA 4ZUTA 4HWEH 4PJ9B 3G6MA 3BP7A 2G8ZA 2HWZL 4U1GB 4XP6H 2BSRA 3X17A 1A1NA 4BH7A 5BV7B 4YC2C 5DYOB 4OTXH 4M7LT 4WFGE 1W1YA 1XV8A 4HU0A 3L3JB 3L5HA 5D71L 3LPWA 3DV6B 3WIHA 1S3KH 4U1HB 4JQVC 1TENA 1GJUA 3MO1A 1E56A 2VT0A 2ZKHH 1NLBL 3U5UA 3GSXA 4K2UL 5DVKA 3BKMH 3I84A 2W0FA 4XT1C 4GRWF 2XN9B 5J6GB 5JXAH 3V8CA 4WKHA 5JHDB 1HWHB 5AD0B 3N04A 4P2RE 1G7PA 3D69A 5EN2B 4I48A 3HNVH 5CJQH 2BY2A 3AY4A 3X12B 2DQGL 2I24N 4P46C 2VI0A 2XT1B 4QRPE 4GOSA 3E6HA 3G5ZA 3QH3B 1SBBA 1YNTA 4LAQH 4E8DA 2N7BA 2HLAA 4JHWH 3NVQA 4I0PC 1NL0L 4ACZB 1U8NB 4Y4FB 3CAFA 4HC1A 5EOTA 5FGBC 1T2JA 5ESAB 5F6IB 1MQRA 4X98A 4PRWA 3CBWA 2XRAL 3QG6A 4YDLB 4HPYL 5DJ2A 1JHKL 5KSBF 2VZ3A 3BQUA 5T5FL 4PGJA 3GXNA 1EV2E 2A9NH 3KDMA 4OV5A 2ED9A 1S7TB 1RJYA 1Z9OA 2QQKL 4OZIA 3LRGA 5EU3A 3UESA 1E27A 1IC1A 3PQYE 3FB6A 3G5YA 4LSVL 4X6CB 4YWGH 3HE6B 1N26A 5IV2A 5LVEA 4NO0A 2FGLA 5B39G 1Z9MA 4ZUTB 1NC2B 3L5XH 2G3MA 4M6AA 6TAAA 1WLHA 5CBEB 5DHVA 3KR3H 2C4FT 5FYLE 1Q6EA 2DQTL 4KKNA 2RGSA 4J8RB 1U41A 5EDXA 3EFFA 3LQAL 2X9XA 2Y2WA 3ZHDA 5C6TH 1T2QL 3STLB 4M56A 5IHSA 4JHOA 3FFCD 3MRLA 3P0YL 3KPRB 3VFRA 4MZ3A 4NNYB 5I1LA 2O61A 1OSPH 2R1YB 2DQFA 3IFLH 1OSZA 4BSVA 1JFQH 1QP1A 3B9AA 4MD0A 3W24A 3DUUA 4WJ5B 4YFLF 4LLQB 1ZHLA 4GRMB 3ZKXC 3ARYA 4HT1L 5DQJA 5ABFA 3QDGE 5IF0A 3D25A 3VXOB 1FYTD 1LQSR 1T83A 2NY6C 1XCWA 2ZX5A 2XPKA 3TV3H 4DTGL 3GXDA 5E24E 4HX1A 2JIWA 2IFFL 2W91A 2W61A 1GPOL 2WMIB 4D1JA 3IDXL 1DN2A 1WB0A 4NKOA 4POZC 1LP9A 2Y1VA 3MLRH 3WIHL 1KTDA 2LQRA 2VTFA 3W2DH 3O3BA 2BSTB 2UWEF 4S2SA 4X99A 3QQ3B 4PRNA 4HUWA 3PHSA 5ENWB 5T3XE 1IAIL 4TVPL 1VFOA 2ZWZA 3P0VH 1U3HD 4PJEF 5IFHH 1OGAA 3ARDA 2BC4B 3ROOA 4NQDB 3MANA 2OR9L 1HCVA 3UR7A 4JQXA 5F71A 4LCCB 3QIWB 5E00B 2A74A 1I8IA 2WWCA 1T1WB 2J8GA 4PJCB 3ME0A 4HKXB 3NCJH 4HP5A 4N8PA 4L3AA 1H3VA 4JG1H 5D93C 4HS6A 2OK0L 4ALAL 4E4PA 3O0RH 1UD6A 4N0UB 1AIFB 1W0VA 4R26H 3OKKA 1SZNA 4ZO7A 4OFIA 1OQXA 4E42A 3CNKA 4DOHB 3WH6A 3KJ4B 2QMJA 3TVMB 4GKSB 3KPLB 1UWEL 1PZ5A 4NKMA 1NDGA 3F58L 4H26A 3L4WA 2E6QA 2EH7L 4JFQB 3H9YA 4MJID 4V1DB 2D3LA 5FAAA 1SBSL 3EFDH 1RK0A 1P5VA 4X4ZA 4HA4A 1RJZA 2R1XA 1LO3L 3INUL 1OLZA 2DLFL 3VX1A 1FAIH 5DHVB 2CRIA 4JR9H 3WY4A 3VIKA 5IFPA 4X4XA 1ZLSL 3VFPA 2FX7H 1Q72H 1KN2L 3D3VE 4ZTPL 5JR1L 1NDGB 4KKCD 3VU2A 4PYGA 1KQZA 1F11A 2VNCA 3L7EA 3MCKA 2YDQA 3SCWA 4OZGF 2EDBA 4LLAA 4C7DA 2R69L 1N5YL 2VDML 4WTXA 2IALB 4XX6A 4KJWC 4HCRL 2YFOA 3TO2B 4J27A 3QAZB 1DVFD 3N1GC 1YHTA 3P77B 2CDGA 3OKMA 1BLIA 1T1XA 3FQNA 5C0JB 2HVKB 2VDOH 5F9JB 1BREA 1FL5B 2NXYC 3QDMA 3LKQA 2ZPKH 5ESVA 1M05A 4L29B 3ULUE 5IHUL 4L3EA 2E9IA 4XPFL 1I7TA 1TJIH 3AC0A 3OR6B 2DT2A 2NR6C 5C0BB 4OZHB 1INDL 1FZOB 2APBA 3WFCH 1S7WA 3DX3A 3VFMB 1ZV5A 5IW6B 1L7IH 1EVTC 5CEXB 3RPIA 1EOKA 4R96B 4YBLB 1R3IL 3MRBA 1IGTA 1IM3A 1UKTA 3BIKB 4MX7B 5HHOB 1TUXA 4PRPB 3UZEA 2BK8A 1RZJH 1U8HB 3O3AB 1K85A 2WVTA 1WCQA 2YWZA 3JV5A 5J56B 3CVIL 2GAZB 4JFVA 4AIZA 3HLAB 5EU6B 4E0RB 1EHAA 3SO3C 3WE6A 1YPZE 5IBTH 3CX2A 5GS2D 3KYMA 2Z8SA 3RPIB 1WAAA 2VUYA 3RVUC 3QCVL 1ED3A 1QLFA 4D0BA 1UH2A 4P2RA 1V05A 4DQOH 5MEPA 3ISWA 4EI5C 5A3ID 1JGUL 5D2LE 3S3JA 3PHQB 4PJ7A 3KWWA 2OJEB 3WO3B 5D72H 2CITA 4AZBA 1A8JH 5FECB 4AYFA 4QHKI 5D93B 3K81A 2GJXB 1ZWIB 5H94B 5EPMB 1NBZA 4AL8H 4HG4J 3TV3L 4H8HA 3SDXF 2YD8A 4EOWH 3VXUA 2QLYA 4G80B 2XYCA 2HTKC 2ID5A 3DO7A 4U31A 4LSPH 5H37H 3IKKA 4FF5A 3CH8A 4GBXA 3CVHB 1EJOH 4FQPA 4QHNA 4WV1A 4BH8B 4W5UA 1P4BL 1TCMA 2VQ1A 4MXWH 3CH9A 3ZLQC 5HGHA 4U6VH 2IAMD 4XP9L 1AD9A 4FFYH 1IZJA 4NC1E 5T1MA 3VXTA 3BVWA 1JNNH 2G5BA 3CFBA 4ONGH 2X40A 1NGZB 5HPMA 4ODUA 2CLVA 4H8VA 2EEDA 3NCJL 4N68A 4LLVA 5KZCD 4K3HA 4QOKE 3HNVL 3BESR 3QUYD 1AQ0A 3L3KA 3BZFA 4PJIA 3X11B 4U2ZA 1TQCB 1CFNA 3F5JA 3UC0H 4BYHA 4BA0A 4YWGL 3RX5A 3QUXA 1LG2A 4RIRB 3MV01 2XZCH 4JQIH 3MREA 4KVNL 4PJ5A 3O8XA 4FXKA 4RDQG 1F3DJ 3IJ8A 3CD4A 5J11C 2WBKA 3E1F1 4U1NA 4FFWD 2OMBA 3QJHA 1FCCA 5D6DA 2NXYD 3HMXH 4LIQE 2HYMA 3D2UA 3MV8D 1ZGLA 4F7CB 1VHPA 2GT9B 1GJWA 1FIEA 1KB5B 1NCTA 3O4LD 2FJHA 2FZ3A 5D1XD 2BJMH 2XA8H 5CG0A 3PXHA 1UWGL 4YDVB 5I1AB 5D9SB 2AEWA 1M7IB 3ARWA 4HS3A 1GGYA 3TYGH 3KJ4C 4APQC 1E6OL 5DJXB 3AZTA 2F9BT 3JV4A 4DFIA 4G3YL 1U42A 3F5LA 2PTTB 1MYRA 3KYMB 4HFWB 2AK4D 1A3QA 3BPNB 4RWYL 3S5LG 2L7JA 4Z7NE 1MAJA 1KBGL 1E4JA 2EDYA 5KTEH 3L5XL 4PJFF 2AOSA 2YDRA 2F7QA 4B16A 2GK0A 4IS6A 4M1DH 1WZAA 4W8BA 2GK2A 4U6XA 2P5WE 4TXEA 5FUZL 2DGAA 3HTLX 4I2XE 5ADPL 2ZJSH 1JHTA 4P3WA 4FTVD 4PJDF 1NCUA 3D85A 4OQTA 4CVWA 1QI0A 3MV9D 3GSRA 1V6XA 4LSVH 5DTFB 2UY4A 1NLDH 4WU7A 1T4KB 1A1OB 2WZEA 3V0WH 3FN0L 1K6QH 4P5TC 1N2RA 2X4RA 2MHAB 1BOYA 4GSDL 5J11B 3BX7C 1CFNB 5F7LB 4NNPH 1RUAL 5JQ6L 1GOHA 1MJ7H 3O41A 1IMHC 1XH0A 4F9LC 4QHUB 4NN5B 1MLBB 8FABB 3DECA 1U6AH 4ZAKA 3V6OC 5AG9A 4M9OA 4J4PA 5IB2A 3WHXA 5C08E 5HHMB 3IRZA 4AZHA 1CDGA 4TSCL 3F58H 1YY8A 2IGFH 1KNOA 4U1JA 2YUZA 1S9VA 1T0MB 3K46A 1YNLH 5F7UA 1FLTX 4XCEB 4YDVA 5I1AA 2DM3A 3MMUA 1NC4A 5TQ0L 2WHJA 2NTSP 3LKNA 3Q6GL 4LP4A 4Z7WA 1LE5B 4M6OL 1BIIB 3BSGA 3GK8H 4NO5B 5IWLA 4ZD3L 1YEFH 2VMFA 1J1XL 3TZVC 1J0KA 4UZGA 4FQXB 1RVFH 1CE6B 3I02A 4MA8L 5DZLA 2ADIB 1DZBA 1JCKA 3MRFB 3WELA 4TUFA 3QHFH 4GXPA 4P9HL 4K71B 3TBTB 3D39B 3DI2B 1GHFH 1YJDC 2YPLD 5D5MF 1WWBX 1E0XA 4EUPB 3IJYB 1DDHB 5FA4A 1T5WB 2R8SL 4M7JH 5E2UH 3BVVA 2V38A 1O5DT 4WI4A 5GRUL 1MFBH 3BP6B 3EYFB 5L2KD 3CDGA 2VERN 3SJVD 1JPSL 1G6RB 3HNSH 1FNEB 4LL9A 4MA3B 4WU7B 1GZQB 5EBLB 4QHMA 1VJZA 1YC8A 4GT7A 3QUMA 4OJYA 1C7TA 2HFTA 1BLNA 4FQHB 4WUKL 4JG0H 1N8ZA 2R0LH 5F44A 3P4NB 4PJFE 5E8OB 1W2VA 1BSIA 1WZ1H 3WCYA 4PJIF 4M6MH 1OTSC 1DQML 1CF8H 3OIHA 5DEFA 5DT5A 1N3NA 4NO3B 3T0DA 4LFHD 3FT2B 1OTUD 4U6VL 5HHVH 3C5SB 1AXSB 5ICXB 3BH9A 3MRGA 4S1QL 3I6LD 4HF5H 1U3HC 5J3HD 4X9FA 3MX0A 4UILL 1NUNB 3AISA 4MCZB 5F96L 3ZHLA 4LYRA 2YL5A 4Z0BH 1IAIM 3BO8A 3QIBA 3O4LA 2RBLA 1T7ZA 4UV7L 4NQXA 1WIPA 4P4KD 5DUMH 1F3JB 3FO0L 3CPLA 4V27A 2NMSA 4YHIA 3UTQB 2M8XA 3HA0A 4AYSA 2A6IB 1BYAA 4C7FA 4QY8A 2IAMA 1L7IL 4NO2A 2X09A 3EYVB 5DD0L 2A73B 4RWHA 2NY3B 1JXJA 1MHCA 3BWAA 1R8LA 4YZFF 1P6WA 3MMEA 4NFDA 3RWDB 1KXTB 2XZAL 4MJ2A 4FABL 3VXSA 4URIA 1YEIH 2VXVH 3SBWC 4CN1A 5GGSA 4N9GB 4YBQD 3IXAA 1LO0L 1PKQB 5E2VL 2H6PA 3QJFA 1RZJL 3T1FB 3OR7B 1WISA 3N1PC 4KAQH 3L4VA 4O2EA 2IBGA 1QZ1A 4LCUA 2QQQA 4H0HB 1H3XA 4OUEA 3DMMD 4JHZA 4YBQC 3BSZH 3HAEA 25C8H 1ZEAL 4YGVA 4OJFL 3MRMA 2FD6H 3H7LA 5DURB 2ESVE 2UZXB 2EC9U 5KS9B 1CXFA 4NNPL 2WPGA 4WCYH 2PKDA 3VUPA 1ZE3C 4UAOB 4JN2A 4WO4D 2C1PA 5C0BE 2ENSA 2W38A 2G3IA 4H8WL 2Y4SA 1DBBH 1JNJA 3GSNH 1R24A 1WPCA 3WH7A 1ZVSA 2D7TH 3MKKA 2OP4H 4EVNB 3MLUL 3SJVE 4K23L 1U3JA 1F90H 3AGVA 4KUZH 4GZEA 5I71C 4PRPE 1EDGA 1W9VA 4PG2A 5SV4A 4JKMA 1JF6A 2FBJL 2XXCB 2VIRB 2VC2L 4PRDA 3SO5A 2P47B 3MLXL 5F6HJ 1QO3A 3DNKA 3NAAH 3DRQA 5D7SH 5GXBB 5BXSA 1AFVL 3VD4A 3VILA 1UHVA 2EO7A 4FNLL 4Y4KD 5KOVC 2VLRA 5K59E 1N6QH 1GZJA 1CGXA 1FG9C 2ICWA 4D72A 3NH7L 4KKLD 2YD7A 2Z92B 3WY3A 2APVA 1P4BH 2D7QA 4WGVB 1OTSD 1QSEE 5E08H 4WI3A 3ZOAA 1T04A 2J12B 4IUGA 1U3HB 3C8KA 4OF3A 4Z7OE 2LABA 5L9DL 4EDWL 2BNJA 1UUQA 3VMPA 3WIJA 1ZXQA 1OT1A 2JJSC 2Z31B 1R5IB 2KPNA 2WW8A 3OPZH 3L4YA 4QYOB 3DX8A 3I9GL 2N1KA 2ZJSL 4XAKE 1GORA 4RMRA 4JZ5A 1CDCA 3T2NH 3HFMH 3NFNB 4K3JH 3V8OA 5IQ7L 3KJ6H 3PWLA 2QMKA 2XY1A 1K4CA 1YYLH 4C56D 1ADQH 5JDSB 4Z7UF 1KPRA 3TO4D 5FHBL 3CPUA 2BFGA 4GW4A 4KKLC 5EA0H 4MNQA 3KL5A 2I07A 4J3OC 1MIEL 2VOTA 5FYKU 3MFFB 4HGKC 2VH5H 4PG9B 4UQCA 1E4IA 3QULA 4HZ7A 1NARA 3EYQC 5EOTB 3SKNA 4BM7A 4PRIA 5JNYA 1SFSA 4QLRA 1R5WB 3W0WE 4LCIL 3T0EE 4WF7A 3BQUB 3SCSA 1UWGH 3TESA 4KI5C 1GL4B 2H8PB 4F3FA 3TJEH 5DMGD 4X6BB 3FCTB 5ADOL 1JXKA 2H9GB 4FG6C 3IFOB 3WFDH 5JPNA 3AIWA 5D8WA 5LKNA 3P9MA 1QSVA 1X5AA 5MEQB 1SM3H 1URLA 2FEDD 3QEHA 2FE0A 1DQMH 3ZKMD 4K8RH 4YXLH 2OXGA 1T7WA 1QRND 2W0PA 3EZ8A 2AEQL 4ODXB 1J1XH 2C3VA 4MQTB 3PV6A 4WRLA 3WFHA 5EBMB 3ORJA 3MLYH 4UTFA 4WSJA 1DANT 2BRRH 3DROA 1CTNA 5C09D 4EIGB 1A5FL 3EO9L 4H0IA 3IU4L 5ETUB 1A7QH 2D24A 2PO6A 3WNPA 1UZ6E 2ZOKB 1OIMA 1ITCA 2C4FU 3CZGA 2QBWA 5FUCC 2J25A 4P5TA 3BVUA 5IFTA 3FO0H 1AGBB 3MV8E 5LCVL 2DJ4A 3G9AB 3I75A 1SY6A 1V3LA 4CL7A 2Z4QA 3O4LE 4KTDH 3WMSA 4L3CB 5LJYH 2NY0C 2WMPA 3BD5A 1RFDL 4PMYA 3I3DA 3F12A 3KPQA 1W3KA 1FIGH 1JGLL 1BJ1J 4UNVA 3C8KB 3QQ4B 1BYDA 1IARB 4UBDC 3HE7B 5E09A 5JW4N 3BPLC 3BH8B 4MDIA 1I1FA 1E4KA 1LO4L 5K33A 5I2UA 2EC8A 2WWMD 1I7RA 4PLJD 5FDYA 3VFTB 5IM7A 5ENWA 1VEOA 4K3EH 3QPXH 1IBGL 1XSJA 3WJJA 3NMEA 1VADA 3CIVA 3ROOB 1JZ4A 1FC1A 4HXBL 3HI1A 3ARED 2F53D 5FKPB 3BN9D 4MDIB 4PSRA 5T1DH 3BSZL 1DQDL 4NRRA 5GRVK 4HIEA 1EHNA 4PJ8C 2X1PA 1FVEB 2WBJC 4QXWA 3RGHA 2Q76A 2I9LB 1A6ZB 1RZKC 4RAHA 4MAUL 3QH3A 4J3VA 1FH9A 3ARQA 1WQVT 4L3EB 2UUDH 2RB8A 4Y4HC 2XA3A 5EBMA 2ZCHH 3V52H 1BVLB 1F4WH 3AYSA 3BPNC 2HJFA 4MNJA 3EJRA 2E7BA 5D9MA 1EIBA 1EMTH 3NJ3A 1CVRA 5BXPA 5HYFA 5A16B 4AK1A 1AP2A 3TA3B 3VWKC 1T0NA 4X0VA 3F5WA 2BSED 2C3VB 2OYLA 1A47A 2YD4A 4S1SH 5D7SL 3DX2A 1QRNA 3VM7A 1HP5A 1EK3A 2DL2A 3DROB 1R7OA 4LU5L 3EMQA 2P5WA 2XFXA 1RK1B 2IAMC 1B6UA 4F9JA 3AAZA 3QFJE 4NBZB 1Q38A 3N15A 2WWDA 5C09E 4P5TB 1S5HB 1AJ7L 3M17A 3L6FB 4PBWD 1X4YA 2CRZA 3QQ9C 3JV0A 1VFAA 1FOBA 1NAKH 4XPGL 4EIZC 5FIEA 2BNRE 5DMKB 3ZHKA 4XVSH 1FBIH 1HJXA 3PTQA 2F8QA 4LCWB 4HQQH 4CN4A 4P49A 1NKRA 3B3IA 3GJFH 1QW8A 3B9DA 4AMKL 5DJCA 1HHIA 3T3PF 1G9ML 1IT9H 3O9WA 4JREB 3DX6B 3HC4H 5TE4H 1P4IL 3W2DL 5BRPA 3EYSH 1CYGA 1DQQB 4YUEL 2Q3ZA 5ADOH 5CILL 1UR0A 5ESQB 5DMYA 5IFAH 3BAJA 3FHQA 4FFWC 5DMKA 4BFIA 1LEKA 4IOSD 5FUOH 1IGJA 5DSCB 3SURA 3MLXH 5JUEL 4PGDB 1BFOB 1A6UL 1TMQA 1S7VA 2A6JA 3WEMA 5DK0B 5D1QA 5D7LA 2JJTC 4Q74A 1CD1B 4EE9A 1MFNA 4AMCA 5DVOA 4JGJA 4AIOA 3V5HA 4Z7VB 3WF2A 1TZGH 2PYFB 3MJ9A 5IQ9A 5A6MA 3TJEL 4ZSOB 5KSAB 4IRSB 5GS0H 4RMVA 4XH2B 1R6VA 4LIQL 1AP2B 5IP4A 2WUBL 3U7WH 4R27A 2AGJH 2X4UA 3M45A 4XPBH 5DT1H 5GZOD 5I75B 4HCRA 3W9DA 2A74B 4P46B 3MUIA 3SE3A 1XGRA 4U0RB 5CSYA 4V1DE 1RD6A 2NQCA 5HY9B 2RFXA 3AMLA 3P9LA 1OP3K 3T0EB 3DBXA 1DE4B 4W68A 4KC3B 2EC9T 5IQ7H 2ICCA 3EKCA 4JRYA 4KZEL 3LX9A 3B5GA 4DUXA 5B8CC 3DC0A 1OD7A 1OGBA 5BCAA 2VXUH 2H32B 2IFFH 2DEPA 3G5XA 5IB5A 1GGBH 3ARBA 1HHKA 4PJXE 2AJXH 4BFGA 4JVUA 4OT1L 2OP4L 4P4RB 4OF8A 4D9QE 1E28A 1Z0NA 5F89B 4LARL 3TP4A 4ZO9A 3IXTA 2XWBB 1P53A 2VCAA 2XFYA 1PZUB 1CG9B 3UP1A 2W9EH 1C16B 4XVJH 1FQ9C 3C6LA 5MERA 1S7RA 1U8JB 2DBJA 4HOXA 4CCDA 1DQQA 3MRPB 5LWYL 43CAA 1V08A 1E0VA 3L3KB 1CT8B 4OUUB 5FM5O 3C8DA 1E4KC 3C6LC 2NW2B 3H3PH 4HWZB 4HZ8A 2P5ED 4RE2A 4B3LA 3MV8B 3IF1A 2QLVB 4H1LH 5KSVB 4NN7C 3IETA 4PS4L 1PY4A 3W25A 5BXTA 1INDH 1V5JA 4RGND 5IIEA 2A6KB 3JV6A 4KY1H 2BVQB 2AJYL 3VXSD 4JFFA 5HDBE 3H9SD 2AK1L 1KIPA 4KK5D 2NW2A 4I5BA 1EEYA 5IB3B 4OQ1A 4N9OB 3THCA 3WMCA 5I30L 2FYVA 8FABA 5A6BD 3BD3A 2OSYA 4ATWA 4M3KB 5IVXF 1QNRA 1H15A 3GMRB 4X7TA 3GNOA 3QYCA 4PJAB 3S5LA 5C0NC 3PIQB 1SJHB 3MUGA 2F5BH 4NNXB 4S1RH 1CENA 3ULUH 1DBMH 1GC1L 4ERSL 1F45A 1ERNA 1B31A 3SKOA 1KN4L 1ZA6B 3LHPL 2HG5B 3VJ6B 1A3RH 4XNYL 3MTRA 1KTLA 2YL8A 3HZMB 5GSVA 3PQYD 2NY4B 1CFVH 4NQDE 3IU3A 4FQIH 3MRFA 1HH6B 4G8EB 4X7CC 3G6JE 5I8CA 3QB7C 1JGIA 5D7LE 5M94B 3GNRA 1OD0A 2KZ1B 5KANG 5ID1B 1ROWA 1HL8A 2AABH 1S7RB 1CXKA 1SMOA 4OF0A 3RGVA 2EH8L 2IH3B 1FIGL 2WP3T 3NZ8A 3IAGC 3W38A 3VPLA 3HG1D 4NQTA 4ZFMA 4I18A 4P4KC 1CD0A 4UB0H 5EB8A 1JZ5A 3ARGB 2NY5L 4L9LC 3FONA 4XVSL 1CFQA 4NSBA 3OKEA 2SEBA 2EKJA 2VZSA 2CDFA 2B5IB 5AZ2L 3SE4A 1YMMB 5DJYB 4KQ4H 3VWKA 4UT6L 3SN6N 3DXAA 5D96C 2DLTA 1X5JA 4JFFB 3MGOA 4JM4L 4O51B 5DJ8A 3PE9A 5F1SA 4XCEA 1S9YB 2XTLA 1RFDH 2H41A 2DBLL 4LDOB 1MJUL 2DQDH 4NQSA 1RZKH 3BKCH 3TYFA 5E4EC 1EEZA 4OCWL 4YQXH 3SCRA 1GC1C 1AGFB 3PNWB 4WFED 3DX8B 1UR8A 3V6OA 1KIPB 2HLFD 1SYSA 4IBLT 1X7QA 4QP0A 1E15A 4HH8A 4FNUA 3Q5TA 2AQ3A 1AR1C 5LGJB 3O2VH 3VFVA 3DIFB 4AZ6A 5DZNA 5DD3H 2WVVA 2QF8A 2WUBH 2D4FA 4PUBH 4F9DA 1X4ZA 4NQCB 1MI5E 5CS7A 5D2NA 5T1DL 4Q2ZA 2BNQD 3LD8C 2Y36L 5C0FB 1NJ9A 4FOMA 1W9BM 1AR1D 3HMXL 1YPZA 3U4BL 1QLRA 3WMBA 1OGAB 1GZQA 3ARDB 2X2HA 1F6LL 3QG7H 1MUJB 1J05B 4NN6C 5E8EB 1R3HA 2V2XB 3K2UL 4X0NA 3WS6A 3MOAL 1IAKA 1KLGB 1E1FA 1KJ2H 4AQ1B 3D3AA 5C0AD 2D2OA 5GIRA 4HKXA 5C0ND 4N90E 3THML 2F15A 1EGZA 4UNUA 1BQLL 4UCFA 3SGKC 3LKSA 4IMLA 2EPNA 3W9EB 2BVOA 2WP3O 3W4RA 2VUOA 1JYNA 4JFDD 2EDNA 4PLKC 1YNTB 3A24A 3QWRD 2DIEA 1FBIL 1U8QB 2CPCA 4GSDH 3N13A 3JZ7A 2M26A 4CU6A 4L1HA 1I9IH 1NAML 3IJ9A 3A6CH 3ECBA 5F8QC 5IT2L 1PVHA 2OTUA 3GUTB 4DGVH 3ARFA 3WD5H 3V2AR 4JJ5B 5C0CD 3L4ZA 2CRMA 3FY1A 1B1YA 4FNQA 1XGQA 5IGXL 4UTAL 3TH4T 1V3HA 3MV7E 3BZDA 3D0LA 4XBGA 2B8OT 5F6HI 5ERWA 5JQHC 4IJ3C 5DUBB 2BP3A 5MEOA 2FR4A 3HPLA 1WTLA 2VRQA 3OHXA 4CADA 2P5EB 3SCUA 2ORBL 3MGTB 3O6ML 3DHUA 2VXUL 3LS4L 4N1EA 1CGWA 3NCMA 4UFLA 3NIGE 3P4MB 1A6TB 5DT7A 3PP3H 3GKZA 4H0GA 1QWUA 5BS0E 1Q9LB 1W9PA 1S5IH 4FQXD 4NQCA 1ZS8A 3OKMB 2F53B 5FOBB 1CLCA 3EJSA 3SCNA 3D25B 3KS0H 3WJLA 4B3KA 3R4DA 1YNLL 1A02N 3W6MA 4NRZB 3L2LA 3TPUA 4YIQA 3VXUD 1OD8A 1R3LB 5GISH 4Y1AA 2VDPH 5KS9A 4ZDHA 1S7SA 1J86A 4HIHA 3SDDB 3IS0X 3L3HB 5ABEA 3MLZH 4PY8I 4QRQA 1DEDA 4FQIL 2YKLL 2YLLA 1DLFH 4EUPA 1LL7A 1WNOA 1WE5A 1KEML 1JAEA 1O0VA 4MXQC 4WDIB 1H11A 1H8SA 2WMFA 4BK5A 2QL1A 4Y89A 5A2FA 1TQBC 1KCSH 4JCMA 4U5IA 4ISVA 3UBXG 3BMWA 4W6WB 3EDEA 5ICYB 2CBJA 4X6CA 4NKDB 1BX2B 3NTCL 4GUPA 1FNEA 1DSFH 1G84A 1N59B 5HYEA 2FEDC 2W9EL 1VGKA 3AXXA 2OJEA 5IHLB 3KLHD 2NY2B 4JPWH 2AV1B 1PFCA 2IADB 1CTOA 4ZODA 4PJCA 5IDIA 4LLYA 5CAYB 4O5LL 2WCSA 1ZWIA 5B3JF 5JOFA 3VXUB 4Q9RL 4HKBB 2FX8H 4UBDD 3S88H 3ALGA 2ZUTA 1FPTH 2CK2A 4CAGA 4EXPX 1I85A 1NBVL 4ODSL 4RFOH 1A21A 1FH7A 2JEPA 4S1QH 2J79A 4R4NC 4FP8L 2VR5A 3BP4A 4QCIA 5HHVL 3JTSA 5AYUL 5JQ6H 4GKSA 1JN6A 1GQIA 3ZR6A 3UTTD 3Q48A 2X42A 3KE0A 3VI3E 3A3HA 3MODL 3BKYL 1AGCA 3UYRH 3QFDA 5HVHB 4PRBA 1JHKH 4JPKL 3EDKA 5FV1L 1CXLA 5CQ1A 3WUEA 4QO1A 5DHYB 3NGBB 4M6NL 3HG4A 4IMKC 3SDDC 4XPHL 3HAEG 2J8OA 4GAJH 4V28A 5GZND 1PKQE 2EPOA 4R90L 1HIMH 1FCGA 3O45B 1TCRA 3FQRA 2CKBL 5I8EB 4BCEA 5A2LH 4LDLB 4P2OB 2NY6D 3IDGB 2EDDA 4RFNB 4P23C 1ODAA 3BN3B 2BVPB 1DEEB 1HEZB 4LEXH 1MW0A 1XGUA 1JBJA 3NDYA 1TJGH 3U4BH 1FFNB 1NDMB 5A3IC 1NGWA 4F33A 2Z31D 2NY1C 5DMGC 2Z93B 5IM7B 3VFTA 4G6MH 1W2PA 4JGMA 4DO4A 1F8TL 3FMGL 3HC3L 4K7PH 4QOKB 1ADQA 1JPST 2YUVA 4G7YL 1PPIA 2GFTA 5E94A 5IMMB 4YHPB 1M7IA 3OAYK 4PJHA 4UQ3A 5FM5M 4MX7A 5GGVY 2NR6D 2B1AH 4ATDA 3K2MC 5I1EL 5JW5A 1P7QA 2G3NA 2QV4A 1RIUL 6A3HA 3BJ91 2IADA 4YBHA 3BCFA 1GUVA 2PCPB 1F02I 1AQDA 3TOPA 4AIZB 4NN5C 2X4QA 5CP3A 3VDAA 1Z32X 4JRYB 3QI9A 3PWJB 3CFIC 4KQ3H 1DN0A 4WW2F 3ZTJG 3IFPA 3GMNB 2VL5B 2DWDA 4JL2A 3V4VH 3VXSE 3GIVA 4PJ7B 4PMUA 4MXQD 3WUFA 1T66D 2NY0B 4HIJA 2F5AH 2PBOA 4JQVA 4W8AA 1LMKA 4QTHA 1U3YA 3V5DB 2YDSA 4Y16C 43C9A 4JFEB 4OD1H 2OSLB 4QRRD 3VOCA 4QT5B 5SWSB 1T0NB 1I7ZB 4YHEA 5CJXC 2DMBA 3MOQA 2FL5B 5BRZB 3OKYA 4W86A 2ERJC 2MHAA 3RKPA 3D5HA 5C0JA 1S9WB 4Y16D 2I60L 3GMMB 1BQSA 2XNAA 4Z95H 1A9EA 3H3KA 5EUOA 4OCNC 3AB0C 4DWSC 3VG0L 3LEYH 2V6HA 1U8OB 2OXHA 1I1XA 4GXVH 2H26B 5CIPB 3V6ZB 1MHEB 5GJSL 2VC9A 1TG7A 2DIBA 4UDTA 2D7MA 5FB8B 5IR1A 2XGIA 2ZICA 1CDUA 1HOCA 3OKLA 5DD6B 1C8QA 1DWAM 3M8OH 4NQEA 2QTEA 2V7NA 1AE6L 1CS6A 3I3BA 4DOHE 2DKUA 4JFFE 2DQIH 4LBEB 3C87A 4YHKL 5E8DH 1CZ8H 2MTPA 2AJZB 4Z7NF 4MB5A 1XHGA 4K3DH 1GOOA 4Z2KA 2DD8L 2MPAL 2X89D 1HJVA 1QNQA 5C08B 2EZ0C 4BZ2L 3UG3A 5I73C 1QI3A 4ELME 3PZNA 4APQB 2G2RA 3MUHL 4OLYH 4G6JH 12E8L 3UPCA 1S7QA 1FZKA 3RWFB 5L9DH 4G6FD 4Y16B 4K94C 1SVZA 3B2VH 2XVLA 3UEZA 4BSWA 5JORB 2Z8VC 3IDMA 5D1XC 4CW1A 3EYFA 5C09B 1SEBB 3TV8A 1AKJA 2FJHB 3MNZA 1EGJA 4JFED 3U36B 3WXVH 5EORH 4BFEA 5JIIA 2O5ZL 5E6YA 2B1HL 2X1OA 1KUMA 3RIAK 1TPXC 5T3XL 5JHLL 1N5YH 2VC2H 1GVIA 1BD2D 1QFWI 3BVNA 5F7EH 2OJZH 4X9BA 1E3ZA 1B3XA 1Q94B 3TVMC 5J9PA 5EO1B 3D5OF 1XGPB 2EDQA 1HKMA 1UWSA 3NPZB 1RZ8A 2Y8KA 3LPPA 3DYMA 4ZPTB 3TTYA 4R5EA 3MUAA 4WFHD 2WKLA 4G8GA 1G94A 5GS2H 3S6TA 1P84J 1J7VR 1Q0XH 1XZ0B 5F97E 3O6LH 1EAJA 1Q94A 2OI9B 3GSWA 3B5HA 4PTUB 1R3KA 4TVPH 1DSFL 1SM3L 2QQNH 4TUJA 3RUGB 3PZGA 1W0WB 4MHHI 2Z1KA 1NGXB 1K2DA 4G9FE 5IB2B 1CGTA 4DQOL 4GKZA 5GISL 4ZPVB 4LHJB 2FJGA 2NX5E 3K1DA 5FYJH 3LSOA 1TVBA 4JN1H 4EOWL 3MXVH 4UV4H 3JVGC 3RA7H 4JFDE 4P2OD 5E1AA 4ZFOB 3G9VA 3QDMD 3VFOA 1K4DA 1PKQA 1EO5A 1WGOA 1BGGA 4KPHL 4LVNB 3L2MA 2ADJB 4S1DD 5KVEH 2IMNA 4X7FC 2HP4A 4U1KA 3ECQA 4KRUA 3P3YA 3O8XC 1E43A 4I48B 4DWHA 4J6RH 1BGAA 1AXIB 1RUML 4JFXA 2X10A 2QSCH 2JIEA 3N1AA 3HRZB 4UQ2B 3VGBA 5E1AB 1RH9A 2X4TB 3G5VB 1UC6A 2IANA 5FGCE 4P8UA 5HPOA 3UTZA 3ARRA 1RU9H 1ISXA 1LO4H 1J11A 4LSSH 2QEJA 4LRIC 2DQHL 4HWBH 4D3CL 5JR1H 3WFEH 2JCCF 3ABZA 2DSWA 3B9KC 3U7YH 2FB4L 4U0QB 2ZSVA 2R0KL 3BE1L 2VSDA 4KHXL 4IRZH 2R69H 1B0RA 4XI5D 5KEZA 3RM4A 4M02A 1A7OL 3RO8A 3VGEA 1G9NH 1XF4A 1G7IA 2MQCA 3MROB 3SDCD 4D6DA 3T1WA 1MCEA 4Y8AA 1F6AB 5JHDD 4U7SA 3VDBA 5EWIH 5C2UB 2BX5A 4XCCL 3S96B 3MODH 1IAOA 2J8UF 4HSQA 3NCOA 4PJ7E 1RZ8B 2Z8WC 4HTYA 1DCLA 3RTQC 1E0OB 1OAXL 4MA3A 3ZMRA 1MAKA 3C5SA 5CILH 5L6YH 3VFWA 4W81A 1S78C 3WEXB 3WJLC 4Z2IA 1VENA 3RWIA 3IDJA 4U49A 1LP9F 5EUOE 4LVNC 1WFOA 1NGPH 1B0WA 1KCRH 1E6XM 3QIUD 3RWGA 3CHDA 2GITB 3G6AA 3L1OL 1VCAA 5KG9A 5MHSE 3OZ9H 3VIGA 3ZSSA 3DMMC 3BP7B 4RWYH 4HBCL 4YX2L 5DJ6A 2BNRA 4GQQA 3G08A 2FHBA 2J78A 4DUVA 4GRMA 2RR3A 4CVZB 4YHKH 5E8DL 4GZIA 1GAFH 4EI5A 4CDHA 1ZSDA 1UXSB 2H2SC 2B5IC 2AGJL 3IAPA 2OL3A 3RRQA 3LRMA 1GIGH 1DWHM 4QGYA 1OIFA 2XJ7A 5D9PA 4ZG1A 3QIUA 1R3LA 1O7VA 1KG0B 2J88H 5DEZA 1M7XA 4LCWD 4PP1D 3QULB 5KJRL 1FFRA 1J0ZA 2EABA 4PV8B 1BP3B 1HHHA 1NWRA 5T3ZH 4KH2A 5JNYB 3LB6C 1EH9A 3G5ZB 4PG2C 3BGFB 3CFDA 1Q6GA 4EAMA 3ARFD 3WS3A 2FATL 3DVGB 4HUXA 3SCOA 4M9PA 3MJ9L 5DRZB 5JW4Q 3FRUB 2P44B 5CGYC 4XUYA 5C0FA 3KPSB 2H9GA 5JPNB 1B0IA 3LMYA 4ONGL 4PGBA 3HI6H 1HN1A 4YPGB 3ARUA 3CUGA 1I9RL 3JWOH 1T1YA 3QG6B 3UBXA 2WNGA 1UJ3C 4OCSH 3HZVA 4M81A 3QXAB 4M6OH 5J0BA 3ILPA 3HC0B 4P48A 3UMTA 1CFSA 1VESA 1JPTL 5D7IE 2I60H 4IOIA 1DQLH 2GITA 5KG9B 4ZS7L 4G9FA 4DK3A 4PS4H 1I1RA 3IGAB 3BOVA 1NAKL 1JUFB 1GCYA 1VBRA 1FNFA 3CMOH 4YNYB 2DQCL 2VLRB 1T80A 3CZFB 5ITFB 1F3DH 5FGRA 1U91B 3KPRD 2CD0A 2ICWB 3NIDE 4PRHB 3M7SA 4UDUB 4C58B 2JEQA 4OZIF 4PSPA 2MKLC 4A2LA 1KXTA 1VFMA 1NOUA 5TE6H 2R4RL 1TVHA 3IGAA 4NHUB 5J1AA 2YFNA 1A7RH 2WM0A 1EEQA 1E4WH 1HP4A 4Y8DC 3SE9H 4LSSL 1LL6A 4W6XB 1T0PB 3B8YA 5IBUG 4MD0B 3T2PA 3T0AA 4UIKL 4B9ZA 3ZT5A 1JD9A 2W65A 3U7YL 2H2PD 5FCSH 1G1CA 5GRUH 1E4XI 4ZQKB 3DV4A 3CFDB 5DRXA 4GG8B 1I7TB 3DSFH 2NY1B 4FQ1H 4HH9A 1KPVA 4UT7L 3S5LB 4QNPE 1YYMH 2K7QA 4PBGA 3AHTA 5A2AA 3U0WH 3UG4A 3OB0K 5HYSA 4MNGA 5GHWH 5CEYB 1M71B 2XKNA 2DD8H 5A6BA 3O6FB 2L7UA 1T1YB 5CSZA 5H35A 3V0VB 5HGGS 3SCMD 4AEFA 1XSKA 3QUXC 2OYKA 1LO5B 1ZBCA 5D7IF 4MA1C 4HHAB 2VZUA 1FLRL 1UQSB 4XZBA 5EC1A 1BQUA 5CD5C 4NHCH 3U6RA 5IB4A 2EDHA 1YDPB 2BXYA 4F58H 4M5ZH 4KPHH 4PJEA 1Z0MA 4MJIB 4OZ4A 4V1DD 3PHQA 4UV7H 2HN7A 5IVXA 5E56A 1FP8A 2YL9A 1ETZA 3W26A 5HVGB 3SGDH 4PRAB 2AJVL 2UWEA 5ACMA 4KKCC 4Z78A 2G4FA 4GKNA 4HHAA 4E41A 4MAYA 4X5LA 4DJMA 1I4FA 4CD4A 1US2A 4HJ0D 2VRKA 3W0WB 3ZYJA 3PDGA 4HULB 3DVNA 1WC7A 2WAHA 2WYSA 2Y8VA 5LWYH 2GJPA 3N18A 1QI5A 4YEFA 2NT0A 4AZ7A 3MOBL 1MRFL 1IL1A 3MGAA 1FRGL 1DVFA 2YPLA 3II1A 1JI1A 4R8WH 1E6RA 3WF4A 1DTUA 3L9RB 3DXAB 2VCCA 3S36H 5CD5D 3IT8D 5GS0C 3U0TB 4I3SH 2ZXDA 2F54D 2EDKA 3SGEH 1RPKA 5B38B 5C7XL 2E6PA 2NCMA 3GSNL 1IM9A 2JJTA 3H6JA 2JB6A 5DO2C 3V4PL 1ZGLP 2D7TL 2XQBH 2IALA 1ZLVK 5GSRA 2AABL 5IXEA 3VWKD 3FQUB 4HJ0C 3RVVC 5GZNC 2OCFD 3CUPB 5HPCA 1J0IA 4LSRL 3X11A 3WBDA 5IJKA 2Q1EA 1XIWC 1P6AB 1PW3A 4PGEA 1JD7A 3TO4B 3N9GL 5I19H 3O3DA 2P1YA 4R0LB 3REWA 3FB7A 4BZ1H 2QADC 1HNGA 1DWJM 3LRLA 5K9OB 3F7VA 1GGTA 3UTPE 5T3ZL 5CWSA 5CUSL 4PUBL 5IW3A 4OZHA 3KZSA 2AXGA 5J4MA 2VABA 4Z0XA 1ECEA 1Z3GH 1B3JA 1V6VA 1X9QA 4RFEB 3VXMD 4XVTH 4PUEA 3DURB 4F57H 5C08A 5I8EA 2F58H 5KSBA 3MMDA 4QHKJ 4NXKA 5TDNA 1NLBH 1ZB5A 1KOAA 3D6GA 1J5OH 4ZOCA 1CXEA 3EJYD 3KHQA 1QBML 2DQTH 1DBKL 2VITB 4NUGH 3JWNC 1FO0L 3P4OA 5J12C 1R75A 2WCGA 2FDBP 3KJ6L 3TZVD 1VIWA 5E2TL 1P2CB 5CKGA 3P0YH 4YK4B 3WFZA 1TPXB 1NCNA 1TFHA 2YRPA 2F19L 5D6DC 1KBBA 1EXPA 1V0MA 1ED3B 1LP9E 1PD6A 4N8VB 1W8NA 5FHBH 4EKXA 3GNML 3D51A 3FB8B 2XWTA 5EPMA 2PR4H 1A7BA 3OF6D 5T1KA 1BQHG 2CO7B 3RJXA 3MA7A 1D5IL 1BZQK 4MLSA 3PJSB 4FZEL 2BFVL 3SDXE 4WUUB 4OB5H 3GMQB 1W0VB 1WWWX 1U8JA 3JVGA 4LRNH 3O9WD 4RZCA 4MQ7B 3INUH 3GXIA 1N2RB 1INEL 3TVMA 4FQJH 4ODBD 5DRWB 4G6AC 1FFOB 3LRHA 5ABFB 1MPAH 1FNGB 3GSVA 3AMGA 5DS8A 1G6RH 1AVAA 1VGEH 4U5KA 1NGPL 4JZJA 5F8RC 4TTDD 3OZPA 1YMMD 1KIUA 3B9KD 3GMQA 1S7XA 1S5HA 3APGA 3VXMA 3LVEA 3LMJH 3QUKA 1FLRH 3D9AL 1AGDA 1ORSA 1MW2A 4EUPG 3P4LA 4Z7WE 2YN3A 4H8WH 1CN4A 5HOSA 3QFJB 1TIUA 2Z31C 1Z5LB 1UA6L 3VH8B 1R33A 3KNBA 5DSCA 2M2DA 5BVJB 1M4KA 5HDBF 4QKXB 5CMAA 3MREB 4PJ5B 3N11A 4LCCA 1OWRM 5JOPE 4KUZL 2UWEE 2V5YA 4FQCH 1I9JH 4PJBB 2FGWH 1TJIL 4PJEE 3FJTA 2Y06H 2GFBA 4U7MA 2GQHA 3ZKXB 2ZUMA 2HG5A 3VJ6A 4DTGH 4QRPB 4Y4HD 3WNMA 1NFKA 3BUYB 2NT1A 2Q20A 2W9DH 1UJ3B 2V5DA 1QG3A 3L5WA 4M5YH 3HZMA 5GSVB 1FZOA 4F15B 1C5DA 3QPXL 4HFWA 3T0EA 3MRIB 2HWZH 3RP1A 4MCYB 4P23D 1YN7A 3TVMD 1V02A 4RAVA 1IC4H 3O2WH 3WQ8A 1U8HA 2ZKHL 3EFDL 2IPKA 3V0AC 4Y19D 4WIQA 1FN4A 1GRWA 3WNOA 2X4OA 5FYLL 1X5KA 5J1SC 4ACZA 1RZFH 2PETA 2FSEB 4YO0A 1SEBA 5FXCH 4Q9CA 2JIXA 3I6KB 5IW1B 3PQYB 3KLAB 1NANI 5EMYA 2WHLA 2HJLA 2R4RH 1HJSA 5D8ZA 1FORH 1XH2A 4QCIB 3BHBB 1X6NA 5EOQL 3VO0A 1NMBH 4AWEA 3FHAA 3MLTA 4NQVB 1PG7W 3QZWA 1YEKL 1U92B 4D6GA 1N4XH 2BZDA 4MJ6B 4OUUA 2B2XL 5F89A 3LKQB 4KMTL 4YO0B 2F18A 2E3ZA 1W3JA 3TJHD 5IROC 3DGGA 4NGHL 1OAZL 3BT2H 4ZNCD 3WHXB 3AMKA 2AJZA 2Q8XA 3QI9C 1HILB 1S8DA 4WTZG 3WFDL 2PO6D 5GHWL 1I8MA 2JF7A 4N0UE 1IGMH 1YY8B 2YSSA 4XPAH 4JRXD 3W0WD 3O8XD 2HFEA 2X70B 4JHAL 3N1FC 4MAZA 3VA2C 2CLZA 2G2RB 3X14B 5C9KA 3QIWC 4R90H 4RAUB 4LF3B 3KPRA 4R2GC 3VFRB 4Y5XA 4P46A 3VFNA 3FFDA 4PJ7F 3WSQH 2WVVB 1MRCH 5E1HB 5FEBA 4OZFB 3MSPA 5C6PB 4XBPA 4WK9A 4I0KA 2ZCKL 4KRPB 1TVBB 5GNZA 3U0WL 2WIIB 2VKXA 5CP7A 4X98B 1KEMH 1FHLA 3U36A 1JPGB 3UYRL 2XVNA 4OFPA 4PJHB 4UQ3B 4JFSA 3LKPA 3MRRB 4HA3A 2X05A 2A3HA 3MRKB 4W89A 3AZSA 2X7LA 1UKPA 1M7DA 3PP3K 2V5MA 3G6DL 2BNUB 5GNXA 4D6IA 3EYSL 4X99B 4KHTL 3KLKA 3TONA 3MUZ1 4OSUL 2AP2A 3V7AE 1C12A 1UT9A 5CCKL 2WQ8A 3C6SA 1T2XA 1REIA 3GRWH 2X5PA 1E6QM 3ROLA 3FO2A 2VDKL 3GIVB 4BQ8A 4OOZA 2VAJA 1YJDL 4W7VA 2WUCL 5ISZE 4XP4L 1A6PA 4NSKB 4UOW0 4LRNL 5ANMB 5GNYA 5F3HA 5BRZE 3QO1A 5I76A 3FT2A 5E1QA 5T1LA 2ZP0T 5IJKC 4NNYA 4UIMB 2OTWB 1IKNC 1KT2B 3MBEA 1P5UA 3BHBA 2X4PA 3B6SA 3QCVH 5GJTH 1G6RL 2HT3D 1FO0H 4LLVB 3RGVB 2F8VA 1QFWH 2IPUK 4YHNA 3KLDA 1IT0A 4PRHA 4XCYB 3UTTA 3W81A 3RHWK 35C8H 2A2QT 3X14A 3U79A 2EDWA 4Y4FC 5HYJD 2XIIA 1TZGL 1GGBL 1RURH 5EU6E 1OAYH 1P6FA 4Y4KA 1GOKA 4YDLC 4RX4D 1ZLUK 3RWIB 4UDTB 4JREC 4EN3C 2ZCHL 1UR9A 4OIFA 1P7HL 5E0FA 1NMAL 3P0GB 3BAWA 5D9OA 4G42A 4OT1H 4IM4A 4KMLB 2C7FA 1NOFA 1JPGA 4LOUD 5EULV 4LF3A 2I5YL 4OZGA 5J6GA 2QQLH 4FK9A 1U8MB 2P8LB 2X41A 5HYJA 4FXLA 2HLFC 1UWIA 1W72B 4ZD3H 5JXEA 3SKNB 4POYA 1RJLA 4M62H 4HD9A 1ORQA 3MRCA 2OZ4H 2ZUVA 4E41D 5FO9B 2QSTA 5KVFL 1FHDA 1EXUA 3OKDA 4O2CB 1TQCC 1LWRA 3FRPA 4XNQB 5E8NA 2F2HA 2Y6SD 5DR5H 4PTMA 5SX5K 4OFVA 4Q7NA 2P8LA 4ZUWA 2OR8A 2WMGA 4R4ND 5T1LD 3IFOA 5I1IH 5C09A 2VVSA 4K7PX 2JCCA 4X6DB 2GCYB 3C2SA 5ELIA 2VCBA 2QJDA 2C1OB 5E9DD 2Y5TB 4BKLB 3N1MC 3CSPA 4P4KA 3FO1B 2BSSA 1OB0A 1ZVSB 3T2OA 4G7VL 3MJ7B 4BQ4A 1UZ4A 3NIFE 2XZQH 4JM2A 2CIPA 1KJVB 2GW5A 1HKLL 3LS5L 2J8UA 4HG4K 3H9HA 3CDGB 2ADFL 2AEPH 1GJIA 5D6CA 2JELL 2NX5A 4DVRL 1A3LH 3AQUA 3HRPA 1NP0A 4JPIA 4HW6A 5C70A 1ZT4A 4F7EA 3IDIB 5HBBA 1M53A 3HKFA 4J8RA 4YPJA 1UR2A 2VLJA 3PUCA 1W32A 4M1GH 3RY4A 5C6WH 5K59F 1A3RL 1F4XL 1F2QA 1KTRL 5INDA 1C5CH 5HJ3B 4BSJA 5F96H 1QI2A 1GHFL 2CBVA 4F9PA 5DEGA 1MVFA 3ZM8A 2H2SD 3VXRB 1G7MA 1XGQB 4XB7A 2WW5A 5A6LA 4DGIL 3QR3A 3CZFA 5M7QA 3CXHJ 2A77H 3N06B 4YGAB 4QYOA 2C9AA 3VA6A 4QFUA 3VXOA 3EGSA 2DQIL 5FKAA 3T0VA 3QGVA 1AH1A 4PV8A 4TTGA 4OZGB 1XF3A 1Y18A 2XWDA 4JKWA 4R9HA 2W9DL 2D22A 1MUJA 4KI5D 2WWKT 1TR1A 4WHDA 5A6JA 1ZA3B 1X5LA 4OTXL 2N56A 1SYTA 4HIEB 2JF6A 2VDLL 5SWZB 3OJVC 1BWWA 2D03L 4W4OA 5KVEL 3M1BA 3C5ZB 5CBAB 3HUJB 3ZO0A 2YPKA 1MCWW 1WSST 5C0EB 2DT1A 3AUVA 3UJJL 3CMJA 3MXWL 3HB3C 5DFVC 1QR1A 2CGRH 3VG9B 3Q6GH 3LKOB 4PCTA 5I78A 5GS1B 3TGXA 3BPOC 4LCUB 4NM4H 3QO0A 5LA1A 3P9MB 4OIIH 1BHGA 5BMFH 3REVB 5K9QG 4X7SL 3AHXA 4QXTB 1LILA 4LLWB 4EQ2A 3BWUC 4LLUB 1NCCH 4YDKH 2BY3A 4OQTL 5ABGA 3IDNB 3RPMA 4PIRF 4BH8A 1IC4L 1QYGH 2MANA 1FFPA 1N7ML 4N0FB 4H26B 4GPNA 3AAZB 3GSNA 3ZQ9A 4DZ8A 5F7KC 1FNLA 1XGYL 5DD1H 5FA3A 3KL0A 2YMXL 2GUYA 4W7WA 4JFHD 1MI5B 2NXZD 1FNAA 2V7HB 3IDIA 5L6YL 3OB8A 3LKRA 4S3JA 4LHQB 5GS0D 5D7KE 2QQKH 4TSBL 1SMDA 3OGOE 4RGNB 3RWHA 4IRJB 2ZUSA 2A1WL 1JDCA 1GOGA 4H25A 4HV8B 5FL1A 1BZ7A 3W0WA 2Y5EA 3L1OH 4TUOB 4BQCA 2H32H 4Y4KC 2R0KH 3PWNA 3RL1B 2DQJL 4M1CD 3MRQA 5M17A 4JM2C 4ORGA 4S0TD 4WTWA 5F1NB 5F6IC 3RIAF 4FQXC 1GOWA 3IJHA 1DQJA 1T1XB 4AH2B 1INQA 2YZ1A 3P9WB 4TX6A 4PJGF 4PJDA 5FB8A 2WB5A 5J57B 2EEBA 1EO8H 5CJ8A 3QFDB 1JNLH 3I3EA 4R7NB 4K3JL 4CJ1A 5CP3H 1U8IB 4AZ5A 1FL3A 4JJHA 5EZLA 1CD1A 1RUKH 2YBTA 4TUKL 5F7FA 3HG3A 5C0BA 4A6YB 1OLLA 3FZUD 2GJ6E 4DVBB 5D70L 4EANA 4HT1H 5D1ZA 1KGCD 3BZ4A 4F7MA 3KXFE 2Z93A 4IRSA 4HIIB 1MIEH 3PG2A 3QUYC 4KDTA 3D18A 3LD8B 3QEGH 1RURL 1QSFB 5CPQA 3PWUA 4G6FB 4WO4B 4M1GL 1GXEA 3QNYB 4X5WB 4AENB 4KDTC 3UTOA 1AQKL 4JHBA 1BBDH 2CESA 3LDBC 4J1UB 3OZOA 4PGBB 2MCPH 1MCCA 1NC2D 3OF6A 3MV11 5LAXA 3DRQB 4LLWA 4MLIA 3WN5C 1TJHH 3QHTC 3ZJKA 2D7PA 3L3OA 2FBJH 1GIGL 4JANA 2EKSA 2MQ3A 1RZKL 1MCBA 5TE7H 3H55A 5F70A 4P2QE 3DWTA 4FG6D 3QXTA 4DFHA 4YHOL 4KRNA 2VX5A 3MZTA 3HUJF 2HA1A 1MWAA 2VDNL 5JBEA 5L2JB 3OBAA 5IBUB 4KJWD 1YEJH 4P57A 4DKFL 4UAOC 4KXZH 5JIWA 1KEGH 2DI7A 5DK2A 3CVHA 5BW7A 3HPJB 3MBXL 3M17B 1D5BB 1KCRL 1UWEH 3EO0B 1FA2A 4RRPA 5CPTA 1W72L 1S9VB 1F90L 1AD9B 1Q6DA 1ZBWA 4JHWL 1UM4L 1VA9A 3C2AH 5FOOA 3GEWB 5FYKE 3ARBC 3JBG7 3VXRD 1ZT1B 2XUCA 1NC4B 4R7NA 3V7AG 2BHUA 1FAIL 2VQUA 4IPNB 4AC1X 5SWSA 1EQCA 1AFVH 3BH9B 3D52A 5IROA 3U9PH 5E2WL 2J8UE 1F42A 1OM3L 4GXUM 1JPSH 4OKVA 3U4AA 4O5LH 4M29A 2WZHA 4LSUL 3CSYA 4AD4A 1OAUH 3GB7A 4ZO6A 4GI6A 1ZHNB 4WI7A 2XTJC 3O81A 2B31A