4XTDA

Structure of the covalent intermediate e-xmp* of the imp dehydrogenase of ashbya gossypii
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
408
structure length
377
Chain Sequence
TYRDAATALEHLATYAEKDGLSVEQLMGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRGKRLKTYRGMGSIDAMQKLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYERLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
source organism Ashbya gossypii (strain atcc 10895 / cbs 109.51 / fgsc 9923 / nrrl y-1056)
total genus 122
structure length 377
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xtdA00
1EB3A 2VEIA 1EWEA 3M1ZA 3Q58A 3IGXA 4L4LA 1TTQA 2Y7FA 1SZNA 4MPQA 3LHWA 1XI3A 1SZEA 3S42A 3QPZA 1L6YA 4IWWA 5CSRA 2Q3OA 3EKLA 1FCVA 3UWWA 1RD5A 3RK8A 1UUOA 4AEOA 3BVJA 3SECA 5D38A 2QCDA 4PC8A 3W70A 4QQ3A 2RDWA 3W7JA 3W73A 2VFHA 3GXTA 1FBAA 1EWDA 3G0UA 2XN2A 3W07A 3NNTA 4XWUA 2QR6A 8TIMA 4IPIA 5HULA 3IIPA 2B4GA 2VENA 3M7WA 3FA5A 1M5WA 4UMCA 3NO5A 4A22A 1CX9A 1KFEA 3OVRA 3UXDA 3RLVA 3FS2A 1JUBA 2R94A 4LY8A 6TIMA 2Y62A 5F4WA 4JY8A 3SZ8A 3TIMA 1A53A 2FPVA 2Y88A 5FEWA 1EP2A 3GLCA 4NJIA 2P10A 1OG0A 4N9BA 3ZFHA 4DBEA 3HGOA 1V5XA 4POCA 3B8DA 4CNOA 4NNCA 4P2VA 1YPIA 1K3UA 3NQ8A 5AYYA 5K4XA 3LB0A 2H3BA 4MZ1A 3GNNA 5A5WA 3ZS4A 2TPSA 5LNUA 3G8RA 4IPJA 2A4AA 1KTCA 2ZRZA 3R13A 4QISA 1X6UA 3LHZA 4LW7A 4TMBA 5CPMA 3N34A 5DN1A 1VR6A 4FEZA 4OT7A 1Q6OA 1O60A 3LBCA 3UYCA 1RPXA 2WQPA 4OHQA 4FHAA 1HO1A 3EX1A 1FUYA 1W5MA 3P8IA 2EAWA 5AHLA 2PRMA 3GDMA 2QF7A 4IGHA 4NNBA 1B4EA 2B0MA 5DBUA 1UB3A 4H3DA 3HMJG 3TU9A 4NT0A 3LHUA 3OHIA 1XCFA 2FDSA 4O8RA 3HGRA 4O4VA 2F7FA 2H6RA 2DORA 5CPOA 4E2DA 3MYPA 3P7YA 4J9JA 4BI6A 3A22A 3NQ7A 3L0GA 1DHPA 2ISSA 1TPH1 1VCVA 2Y70A 5F2LA 3W1QA 2PRHA 1ZJIA 1WQ5A 1QPRA 2F84A 2NV1A 3SW6A 2YR1A 5K9XA 4EVZA 1VCGA 3E9AA 2DJXA 1X1ZA 3W7MA 4JXCA 2VEMA 1SO5A 2FPYA 5I3HA 1RQEA 1FCBA 2A2IA 4CQAA 1KV8A 5LNRA 3NYZA 1L6WA 1S5TA 1B57A 2GQ9A 2GQAA 1FDYA 4DO4A 1TQJA 3HPSA 2QCEA 2YSWA 1ZAJA 2OMAA 4LRSA 3USBA 1C8VA 1K02A 4RXFA 1P0KA 3LTPA 3E12A 3JS3A 1MEIA 2DZPA 1OFOA 4Z1CA 5G1YA 3D0CA 4FO4A 5IBXA 5I3JA 3FIGA 1RVGA 2C16A 4ADTA 4QJ1A 4W9TA 3MBDA 4UMAA 4WZHA 3A23A 1DKWA 4O17A 4RKAA 5AHMA 3LI0A 4UIOA 4AF0A 1HG3A 3N9RA 3QW3A 1GVFA 2ZRUA 3S9YA 5EBUA 2PE4A 3TE9A 1ZY9A 3I7SA 4MZYA 1M7OA 4OV4A 3NQEA 3NQAA 4IXXA 1QOPA 6ALDA 4LRTA 2Z2UA 3U2OA 3O06A 4UNKA 2YDAA 3W83A 5D2TA 3PBWA 4MVAA 4WJEA 2EKCA 1EIXA 2VFFA 1XBYA 2E6FA 2RH9A 2VOMA 1X7FA 1EUNA 1V7YA 1ZAHA 4JDYA 4K8EA 3GDTA 2VELA 1GVQA 1WXJA 5D2XA 1G67A 3IGSA 4WOQA 1I45A 2XN0A 5EA9A 4ZQPA 3G1AA 1XBXA 4IMGA 2I1OA 4NJHA 3TCEA 4JYEA 1ICPA 5D02A 3IIZA 1PCWA 2G96A 3S1WA 4O10A 4JTEA 3RMJA 1YYAA 1YXYA 5F2IA 3TAKA 4JIPA 5AHEA 1A5AA 1O5XA 2RFGA 3KAOA 4WUIA 2ISVA 4EWND 1OFQA 2FFCA 4JX5A 2A0NA 4O1BA 4WD0A 1XM3A 3FOKA 1LYXA 3DH7A 2CLLA 2DZUA 1XBZA 3GIYA 3GKAA 4OU1A 1KFLA 1LLZA 3R8RA 1G69A 2JKPA 2ABAA 2VFIA 2QJIA 1OX4A 4K7VA 4I7VA 1ZHAA 3CWNA 3DFNA 1HTIA 5LSMA 1KW1A 4C1LA 3QH2A 3QMSA 3PR2A 1LOSA 3WJXA 2J88A 4HKPA 3KFTA 3VKJA 3C56A 4LVDA 1KTBA 3SJ3A 1FXPA 3EWWA 4K36A 4FF7A 3W7RA 1ZNNA 2YYUA 2V5LA 1THFD 3GAYA 3MYOA 1HUVA 3HB9A 4I7UA 5G2IA 1DL3A 3ANYA 3TW6A 5F2MA 3WK1A 5HUPA 4O12A 4E2BA 1TCDA 5H91A 1SO6A 4FIRA 4LUIA 2QCCA 1KLYA 3EEGA 2WJZA 3L67A 3QEZA 4IMEA 4O57A 3M0ZA 1YLVA 1OK6A 4KFNA 3W3OA 1TJRA 3S1XA 5CG7A 2ZRXA 3B0UX 1GZGA 1K03A 3C3NA 3IVUA 3STFA 3O1NA 4PEKA 2WV8A 4XBSA 1HO4A 3E0IA 3NGJA 5D37A 1F2JA 2V82A 4FXRA 3MHFA 3NQVA 3BLIA 1KFBA 3UWYA 1TRIA 4RZ6A 4YLWA 3TA6A 3GYEA 2CZEA 2Q8ZA 5K2ZA 1LDCA 1A50A 3WK0A 2ZZ4A 5AB3A 5GVJA 4YXGA 1H51A 3B0VC 2VFDA 1H60A 1H62A 3NZ1A 3LCIA 1M6JA 3G8EA 1JVNA 5D05A 2EF9A 2O7SA 1Z44A 4RK8A 3JRKA 4QAIA 1G4SA 4O1CA 4IUOA 1MO0A 4UCGA 4X9SA 1YDNA 3DFSA 1L2UA 4WY0A 1GG1A 1Y0EA 2RHGA 3TFCA 3IEBA 1T96A 2DJLA 5FF3A 1EUAA 1AW5A 1EA0A 3O05A 2A7NA 3GR8A 4FX8A 1KV5A 3EXSA 4AHPA 2FPTA 3IIVA 2W6RA 1O4UA 2QAFA 3EX4A 3LLFA 1KFCA 2BXVA 2X16A 1JRCA 3PY2A 1SUXA 3BPWA 3W2NA 3PBVA 3WK3A 1OFEA 3RNDA 3NPUA 3FJ6A 4RV8A 5DXXA 2CLHA 3KHJA 3GXPA 5DXYA 3HPXA 3PAJA 2QCLA 4LVBA 3CPRA 3EWXA 1IF2A 4OE7A 1XL9A 3DENA 4LC8A 3TQ0A 3BW2A 1FXQA 2VXNA 3BW3A 1FY6A 4I9AA 1DVJA 1C29A 3PB0A 1HL2A 3CHVA 5G2WA 4UTLA 3THAA 2AAMA 5CKSA 2YZRA 1T99A 1TPVA 4ZQOA 3TR2A 3CIXA 1NAL1 4Y6GA 1XDLA 3LCGA 1O5KA 1YXDA 3BW4A 3WJWA 4BFAA 1GVSA 1H1YA 3AO0A 3NOEA 1BTMA 5EMUA 1LLWA 2TSYA 1W54A 2NX1A 3F4NA 1TREA 4TIMA 2D73A 4QITA 4UTMA 3KRZA 4IQLA 1SQ7A 3W7OA 3UPBA 4NU7A 4DF1A 4YCOA 4NXSA 3O07A 4Y96A 3TFXA 2OCZA 4KWWA 2BTMA 3KVMA 3VI2A 3DFPA 4O54A 3PBUA 2C14A 4JS3A 5AYXA 1AL7A 4EF9A 4JDBA 1G4TA 4CCCA 1X8FA 3LOTA 5C55A 3ATZA 2NV2A 3STCA 3W1NA 5L9FA 5I3GA 5SWUA 1RV8A 2YCEA 3G1YA 2H90A 2J24A 1KBJA 1OABA 4N9CA 1AW2A 1YPFA 1ZALA 3QM3A 4JN6A 4BWLC 3EWZA 3GXNA 2C3ZA 4JX6A 4LV4A 3MW7A 3PBYA 1F7BA 1TPEA 3FEMA 3N2XA 4IJBA 5BMXA 4MY8A 1PHWA 1K8XA 5E93A 2RDUA 3T78A 2ZZ3A 5G5IA 3W1TA 2FIQA 3CTLA 2QDGA 2J9XA 4FXSA 3MO7A 5KINA 2ZDRA 5K4ZA 2YPIA 1JULA 3EX6A 3M5VA 5E0KA 1ZAIA 2QUTA 3VNDA 1ONRA 5A8GA 3SY5A 4FNQA 1QPOA 2NUXA 2DP3A 1KM4A 3QSRA 2CU0A 2ATSA 1D3GA 1GT8A 4ICNA 1QDSA 1P5BA 1H7OA 2CZDA 4HHPA 5EPDA 3BGJA 3W84A 3QMRA 3H55A 3SGZA 3LCXA 4O1AA 3N14A 1GYLA 2H8XA 3NPVA 3ABSA 1CI1A 2NWSA 1MEHA 2CFFA 4M19A 1S5VA 1H1ZA 4N6EA 2CLKA 4AMAA 3PF3A 4R53A 3STGA 2YYTA 3NL5A 5FF7A 5LHEA 1R30A 4JR5A 3DGRA 1OX6A 3IIXA 3DI0A 4DEFA 1ALDA 1SFLA 3O8AA 1I8JA 4S2CA 1SR9A 1TV7A 1EX5A 5D03A 4O50A 2LLEA 3GNDA 2VEPA 1TPB1 2ZA3A 4NVTA 1OVDA 1F6PA 4JNMA 1I2NA 3KXQA 4HNUA 3DKLA 3HBLA 3NXFA 3PUDA 3HPZA 1T0OA 1TRDA 4ZQNA 2VEKA 3DHFA 1QPNA 4U4MA 4KFPA 3F03K 4Q33A 5K3VA 5EY5A 1K7EA 4O0ZA 1H61A 3C2EA 4BI7A 2A6NA 1OFBA 1I2QA 3L5LA 2C0AA 4M7TA 1SSDA 3GK0A 1WAUA 5E1QA 1KM2A 3ZWTA 1JRBA 4ZQMA 1JR1A 1GYNA 3BG5A 4K39A 5HNRA 1B3OA 3FLUA 2CZFA 3STEA 1ME8A 2J9YA 1AL8A 2HSAA 1KBIA 4DPPA 3TXVA 1AK5A 2B7OA 2BWGA 3PB2A 3QJAA 5CPNA 4IX0A 5DCBA 2YW4A 3I65A 3DZ1A 4ORMA 3P81A 4M6QA 4QNEA 1JCMP 2X1UA 4JTKA 4ONVA 4JD4A 3LX9A 1K8YA 1H7PA 4S1FA 1QAPA 2ZQ0A 1JCYA 3EKZA 3E49A 3NL6A 4BR1A 5FESA 1H5YA 4O13A 1OYCA 2JGQA 1UJPA 3GVGA 5KZEA 3MI3A 3QMTA 2DZTA 2FB2A 3HG3A 4MUZA 1Q3NA 1IIGA 4O15A 1IXPA 4WXZA 4RZ4A 1QCWA 3F1QA 5CZJA 4XKYA 1VJIA 2WNQA 4FNRA 3NQMA 3G0XA 4JTHA 5EYWA 3PC0A 3PUOA 2H3DA 3B04A 3NQ6A 1H7NA 4X2RA 2G95A 3ABOA 1OHLA 1B4KA 1OFPA 3L65A 1VQTA 2YFOA 2E1DA 4CCDA 1OX5A 2CLEA 3LHTA 4UTJA 4AWTA 1EP3A 3MHUA 2HS6A 3MP4A 2E68A 2GVGA 3P5YA 4NNAA 1RQBA 4K37A 4ZQRA 3SFKA 5HWMA 2I14A 1QPQA 2V81A 4JYDA 2ZZ1A 4Q32A 5D2WA 3CC1A 3T7VA 2CLIA 4RX0A 2P0OA 4K6AA 4BK9A 1NF0A 3W1XA 3A5VA 3TX9A 2E77A 3HO8A 5F4SA 3E02A 2E5BA 1A5CA 3GAKA 2R14A 1W56A 5FEPA 1DQWA 4O19A 5U4NA 4O0KA 4AH7A 2GQ8A 1F5ZA 3DXIA 3PUEA 1A5BA 3KVKA 4IMDA 1F6KA 1SO3A 4CNNA 4Y8FA 4FIQA 3S5NA 1FWTA 4DBDA 1LBLA 2A21A 4N2YA 4TMCA 2GVJA 1TPFA 1TTPA 3ZR4A 5DCDA 4UFIA 2ZBTA 2QCDB 4UFLA 5CZ0A 3C2VA 2E5DA 1H7XA 2CLMA 4PH6A 4X22A 3FJLA 2DU2A 3CB8A 3LTYA 1W5QA 1YDOA 3INPA 4NJGA 4UFKA 3SSJA 4Q4KA 3T55A 1DJQA 3W88A 3W2LA 2NX3A 1SSGA 4H4IA 1TTJA 4LUJA 4JX4A 2Y89A 4N02A 3V1PA 2NXGA 4ZL1A 1SW3A 5KZMA 1GJPA 1XUUA 5AC6A 4O14A 3CEPA 2QAPA 1QO5A 2Y85A 2VKZG 1VC4A 5TQLA 4BI5A 1SFJA 4UC5A 4NZFA 4BWLA 3LCLA 2NUWA 2WO5A 4P61A 5FF2A 2DZXA 5FEXA 1W5NA 2C19A 4TO8A 3S1UA 1SO4A 2UV8G 2QCGA 3PG9A 4DO5A 2Z1BA 4LVFA 3QQ0A 3ZWSA 1BEUA 5FF0A 2Y7DA 1OJXA 4FNUA 4ML9A 3LRKA 1EPXA 3CU2A 1LRNA 3W7QA 4JICA 1W3NA 4DELA 2B7NA 1TSIA 2TRSA 2X1RA 5KSWA 1JCLA 3NG3A 1IIHA 3OA3A 3SR7A 4DPQA 2EGZA 2NWRA 2FLIA 3MHGA 4JGDA 3U6WA 3GKFA 5LHFA 2B7QA 3NM1A 5D09A 4AAJA 1TJPA 3NEVA 2XN1A 3QPYA 2GJNA 3O16A 5IM51 3I68A 1J2WA 3G1VA 5DLCA 2W0UA 4ALDA 1G4EA 3ATYA 4YMZA 4CCEA 2GUUA 3P61A 4WQ6A 4H6KA 1GG0A 2EPHA 5KZDA 2QJGA 4HNTA 1TB3A 4N4PA 4A3UA 1KFJA 5AYZA 3LHYA 3M5YA 4NX5A 1TIMA 3EX3A 4C1KA 4D2JA 7TIMA 3LRMA 4UFJA 3E96A 4K7YA 4DF0A 2GPTA 3WK2A 3T44A 1ME7A 1UBSA 3MBFA 5C2XA 1Z42A 3HG5A 4DXVA 5LNSA 5EL1A 3W1LA 1OF6A 2OT0A 4ZZ9A 1DBTA 3W7CA 2A1YA 2QCMA 3WJYA 3OIXA 3KOFA 5AHIA 1F74A 1L9WA 3NQGA 1JCJA 3GDLA 4GNJA 3W2JA 1YTKA 1QWGA 2Y7GA 3EWUA 4JTIA 4DQWA 1QOQA 3W23A 2E6AA 4HT3A 3TC6A 3SI9A 1GWJA 1VS1A 3O6DA 2VFGA 3M5ZA 5K9CA 3GX9A 3QC3A 2WNZA 3GB6A 4X3ZA 3PSWA 3UY7A 2JK2A 1G7VA 4GXMA 3C8FA 3R12A 4XUGA 5AN7A 3CT7A 2C18A 5HWJA 1NVMA 3RFAA 4PL2A 4WOZA 1D9EA 1XKYA 1BKSA 3FKKA 4PA8A 2HTMA 2X2GA 2G97A 4WX2A 3T4CA 3W7DA 4AHQA 5LNWA 4GUGA 1W0MA 2ATMA 3CM4A 4KWVA 1VCFA 4LTSA 2IQTA 4NJKA 2J27A 4O1DA 4AF0B 1TV8A 1F05A 1WDWA 3TV8A 3V75A 3BG3A 3LGEA 1LOLA 2QUVA 5DELA 4I7WA 3W74A 4E0CA 3NPXA 3MUXA 3HOJA 3L66A 2OX1A 5H2ZA 2OZ0A 2W79A 2CLFA 5LGXA 3I7QA 4UTTC 1J5TA 3M41A 3OEXA 4ORIA 4MOZA 2ZTJA 4HIBA 1DQXA 4IXHA 3DFTA 4FB7A 4GC4A 5LNVA 3LCWA 1L6SA 3M9YA 2QEZA 4Z0SA 3G1DA 4RCXA 3G1FA 1SPQA 1LRTA 1PL9A 3ELFA 2A7RA 2FQIA 1OFDA 3LCHA 3WJSA 4CNPA 1S3HA 1BWKA 3TUUA 1H63A 5LKYA 1TTIA 5TIMA 3W87A 5C5YA 1K8ZA 2E6DA 3L21A 2BZNA 5BRBA 3NR0A 2CW6A 1NSJA 3R5EA 3YPIA 2J9ZA 3DI1A 5FEZA 3Q94A 4GUHA 4MY1A 5D04C 1W37A 5F1UA 5J5DA 4NX0A 1JQXA 3C2OA 4IMCA 4N6FA 3Q2DA 5D30A 2GVLA 2NXIA 1TYGA 5DY2A 1WYIA 1I2RA 4O11A 1CW2A 1DOSA 4GBUA 4XZ9A 4JTSA 1ICSA 3P67A 4M6VA 2HMCA 4MIMA 5I3FA 1Q45A 1UASA 2ZRYA 2EHHA 3P80A 4UUIA 3DBPA 1FWRA 3DU0A 3KRSA 1VHNA 4UMBA 1OFRA 1LM1A 1A5SA 3BG9A 3UWVA 1FDJA 1OX4B 1H50A 1GPWA 1ZCOA 4IMFA 3S5OA 2BSLA 1T8XA 3BK0A 5HINA 1TO3A 1U5JA 3C2FA 4UR8A 5HQEA 4WXYA 3UY8A 3JR2A 2C13A 3L5MA 2ISWA 3LLDA 1KM0A 4OGZA 1SZGA 3TJXA 3W7LA 2PC4A 3KVLA 1PHQA 2JBMA 2TMDA 3TK7A 2ZZ6A 4KFOA 3ABQA 4A21A 3IV3A 4GJ1A 3W71A 1JUEA 5KITA 3BO9A 5D33A 1VYRA 4RJEA 3N3MA 1NFBA 1ADOA 1SZFA 4NZJA 4HPJA 3MP5A 1S5WA 3BLEA 4UTWC 3M16A 4OV9A 3EXRA 2FTPA 1I2PA 3PULA 1LROA 5DY3A 3A24A 2ZYFA 2B7PA 3N2MA 2PRLA 2YW3A 3A21A 2Z6IA 4MFDA 2X1TA 2WPBA 1XC4A 3WFAA 1LOQA 2Q3RA 4FNSA 3LDVA 4JTTA 1YTEA 2X30A 3AJXA 1H7WA 4UNLA 3CIWA 2WKJA 2V9DA 2JGYA 5G4EA 1DJNA 2Z0IA 2ZTKA 3W85A 1LCOA 1PIIA 3LERA 3B4UA 4AXKA 1GOXA 4Z1AA 4JEQA 3TNOA 3EWBX 5HR6A 4CQ9A 2FB3A 3LV5A 1LZOA 3N19B 4NUWA 1FCUA 1LBFA 2RKXA 4RR4A 3C6CA 1XUZA 4WY0B 4EF8A 4UFMA 1QMLA 1EEPA 2YX0A 3G3MA 4O52A 3W1AA 5AFDA 2DZVA 3W6YA 3W1MA 4HNNA 1WBJA 3LBMA 3UXAA 1WOBA 4JYFA 4YCPA 4AWUA 3W7IA 4A2SA 2NX9A 1B9BA 2Y63A 3TMLA 3PVFA 3NL3A 3VFLA 4S2BA 4AVFA 4LU0A 2I9EA 1ICQA 3NQDA 5T26A 3G22A 3NVTA 2NUYA 1NEYA 4R33A 4JTUA 4GRSA 1MZHA 3M5XA 2QCNA 1U83A 5D2VA 1YADA 5U7SA 4HN4A 4LS0A 1F76A 5F2GA 3BLFA 3CEUA 5F4XA 5HWNA 4QSHA 3W1UA 1QNVA 3W7EA 4DF2A 3FYOA 3P82A 5BNKA 1IGSA 2TYSA 3S6DA 4Y90A 1WA3A 3UWQA 1K7XA 1Z48A 2ZA1A 3GZ3A 1OYBA 1RQHA 4TX9A 3T40A 2YGYA 1AW1A 3PG8A 2Y61A 3W75A 1TPDA 3UZJA 3NZRA 1NF7A 4ZQCA 4LS2A 3G1HA 1EP1A 3KRUA 4TU1A 4JY9A 2CWNA 5HUOA 4U28A 5CPLA 4YWIA 4AB4A 2ZA2A 2A85A 5BMWA 4IOTA 1JUKA 3P60A 1KFKA 2E09A 1RR2A 3W1PA 3W9ZA 4GWEA 1J4EA 5TBOA 1N7KA 2ZZ2A 3HG4A 1WOAA 4R34A 3G1SA 3P62A 3LV6A 3IVSA 2NLIA 4HSNA 1TV5A 3W2KA 2ZZ7A 2R91A 4N9EA 4LT9A 3F4WA 3C0JA 2PURA 2Y7EA 1TPUA 5ABTA 1OK4A 2JKAA 4FX6M 4LVGA 3W2UA 3IVTA 4UTTA 1K7FA 4O18A 3BGGA 1UUMA 2BLEA 1W5OA 1IXNA 3HQ1A 4XQ6A 2GJLA 3IRDA 1W3TA 3QFEA 1XXXA 5BW6A 1R2RA 3UWUA 1GVOA 4NJJA 4MJMA 1O94A 3S1VA 3RLUA 2WSQA 2Z6JA 4O4WA 1H7RA 1LP6A 2WSRA 1X1OA 1WBHA 1XBVA 3L2IA 1TPC1 3LM7A 1TMHA 2QUUA 1FWSA 3NA8A 3UD6A 3W22A 3N73A 3S0CA 2BX7A 3B06A 4GE8A 4ZVJA 2P1FA 5CZSA 4ADSA 4UTIA 5K9DA 1R47A 1KM3A 3QF0A 3W7PA 2OT1A 5D2YA 1GQNA 1G6CA 3C52A 3L9CA 1LRQA 4JTGA 4CQ8A 1VGAA 4UXDA 3UZ5A 4JTJA 1P4CA 4MZ8A 5CZTA 1N55A 4A2RA 1SW0A 3TH6A 3PM6A 3QQ1A 4B5NA 5HJLA 1I2OA 2A7PA 3P84A 1FX6A 2GOUA 5CGQA 4LWWA 1OYAA 1MSSA 3I6RA 1BWLA 3M44A 2FJKA 3A5FA 1R2TA 3LXBA 4LV9A 5C54A 3PS7A 4Z08A 1LBMA 4PL1A 3W1RA 1FCQA 2WOQA 3EWYA 2Q8LA 4G1KA 3SIZA 1W31A 2A6LA 3ABRA 4GUIA 4PTNA 4GUFA 3TSBA 2ZFAA 4GUJA 4O28A 4RLIA 4NXKA 3EX2A 3DHDA 1R46A 1UCWA 1GTHA 2H8ZA 3TMQA 3W7KA 1R2SA 1DV7A 1O95A 4Z0JA 3TSDA 4M5PA 5MHBA 1VLWA 2V8ZA 1Q6RA 1PE1A 1OFAA 2QKFA 3U8GA 3W76A 4UTKA 3VE9A 2PCQA 4UTWA 1VRDA 3TAOA 3L68A 1GEQA 4A29A 4JTLA 1QFEA 2VFEA 3IGUA 3LXCA 4MKNA 5G4WA 3C2RA 5AHFA 2XFWA 3FFSA 3DKJA 3S5YA 3H53A 3HIJA 1KM5A 1IXOA 4KKXA 1KTNA 3TROA 3W72A 1W5PA 2ZRVA 3M47A 3K30A 3C61A 2G5WA 3HJZA 2CZ5A 2ABBA 1TQXA 3QZEA 4Y9AA 1ML1A 3MWAA 3P5ZA 4K8HA 2NZLA 2ZRWA 4LOCA 3B03A 4O53A 3NAVA 3QSTA 3G24A 2X1SA 4EOUA 1XFBA 3EB2A 1DORA 3LXAA 3KVJA 1PCKA 3HG2A 5DBTA 4XKYB 4EIVA 3KX6A 3P74A 4GFSA 4RZ5A 3G18A 3UPWA 3UNDA 3NL2A 1I4NA 3S5ZA 3HF3A 3M43A 3NQ2A 3UWZA 4MLRA 5J5RA 3W7HA 2VC6A 5FF4A 3H54A 2YFNA 1W3IA 3NQFA 2AQWA 2V2CA 3LHVA 4E38A 2CLOA 1Z41A 5AC7A 1VYPX 4YL2A 3TKFA 1VPXA 2QDHA 5C6MA 1FWNA 1LTDA 3LRLA 5AHNA 5I3IA 5KMYA 3PWAA 3DFOA 3TDFA 1P0NA 3TQKA 1D3HA 1P1XA 4LS1A 1ZFJA 2OJPA 5I3KA 3G3DA 2J6XA 3W7GA 3I7RA 4MFEA 1LORA 5DCEA 1SU5A 1VHCA 1JJKA 5F1VA 3TSMA 1F73A 3NDOA 3VCRA 4QNWA 2ZCGA 1MEWA 2V2HA 3L0NA 1JQVA 3HGJA 1Q6LA 1TPWA 3L5AA 1VYSX 1QR7A 3CLMA 4FX7A 4RXGA 4HSOA 3GDKA 3HGSA 5CSSA 2C15A 2WSYA 4PODA 2Y6ZA 3C4UA 3N9SA 3QYQA 3L0KA 3NQCA 1PVNA 3IIOA 3CWOX 3LTSA 4PFMA 4FNTA 4M7SA 5AOUA 2YXGA 4O16A 4QIUA 3A9IA 3P8JA 2DZWA 3B0PA 4K38A 1FQ0A 2JKEA 3EXTA 1E51A 4MJZA 1ZENA 1FWWA 2A5HA 2O7QA 3MP3A 4LNYA 3W2MA 1WX0A 3G1XA 1KA9F 2ALDA 1GTEA 3TC7A 1VLIA 4UR7A 5LGZA 1YTDA 3O63A 4IX2A 1JCXA 2QCHA 3MMTA 1IXQA 1KM6A 4LVAA 3CQ0A 4NQ1A 3QW4B 1YDVA 4WY0F 3LCFA 2V5BA 3WJZA 3FYPA 5K7JA 5HR7A 5HMSA 3O15A 2C1HA 4MYXA 2V30A 4N4QA 4UTUA 1Q6QA 3FKRA 3O6YX 3VE7A 5LZLA 3R89A 3GR7A 3TW7A 2AGKA 1PS9A 2NXHA 1RZMA 3S8HA 4JIQA 4LC6A 4Z1BA 3SGUA 1JCNA 1MXSA 3MI2A 4FNPA 3DAQA 4OBTA 2QJHA 5EKYA 3UQNA 3THQA 1SW7A 4UFHA 4XBKA 5AC8A 5IBXC 3W7NA 1KLZA 3TXZA 1G7UA 4OQVA 5FI8A 3GDRA 1QO2A 3NM3A 3O6CA 1WV2A 3B05A 3OBKA 3DFQA 3W86A 1G4PA 1M7PA 1AG1O 3BARA 4Z1DA 5BOOA 1KM1A 4MLJA 2KZHA 3OVPA 3RU6A 1HFBA 2C6QA 2ZZ5A 2R8WA 1GVRA 4JTFA 2V2DA 3MI6A 4XTIA 4ZMGA 1C9DA 2E6YA 4UTHA 3Q37A 2DZSA 1W1ZA 3R2GA 2HS8A 3TJLA 2V0TA 2QCFA 4R7JA 3M6YA 1W8SA 1YXCA 4CLMA 4HNVA 4BF9A 1AMKA 3BV4A 4OWGA 3RF9A 2WNNA 3MJYA 4AHOA 3QRHA 4AWSA 3OG3A 4QM1A 5L6UA 3G0SA 4ADUA 4PCFA 5D32A 2E5CA 5G2HA 4TR9A 1PV8A 3TQVA 3OVQA 1FDZA 4MY9A 4XTDA 1OF8A 4HPXA 4DO6A 5G1TA 3LI1A 4L4MA 1VZWA 4MYAA 3NPWA 1N8FA 5KTLA 4N9DA 2RDTA 1ME9A 1VH7A 1XDMA 4M6PA 3PSVA
chains in the Genus database with same CATH superfamily
1EB3A 1DJZA 1XRTA 2QDEA 5T8GA 3VKBA 1M7XA 3IGXA 4L4LA 5HATA 1IZKA 3QPZA 3UZXA 2DSUA 1OIMA 1A3HA 2Q3OA 1JDCA 2EPMX 3T07A 4NYUA 1KWKA 4AEOA 2FTWA 2GGIA 2YA2A 1NDWA 4DAIA 4HU0A 4PC8A 1H1NA 4FK9A 4QQ3A 2RDWA 1UQZA 1JZ6A 1FBAA 1EWDA 3CAWA 3CL8A 3I4KA 4HVXA 3W07A 8TIMA 5DMMA 2VENA 3SUTA 4C60A 3M7WA 3FA5A 4A22A 1CX9A 1KFEA 3UXDA 1X97A 3FS2A 1JUBA 3KTSA 2MUCA 3GYCA 2X42A 3E0FA 1A53A 2CBJA 1B30A 1JFXA 1BWVA 1EBHA 2EKGA 4S3GA 1V7AA 4UQ9A 4AIUA 4D6FA 4NJIA 3VNZA 5C70A 1EF2A 3HGOA 1V5XA 1EO5A 4FI4A 2ZX6A 2DT2A 5AYYA 2OYKA 3A12A 4L9XA 4MZ1A 1NQ6A 3POHA 3DERA 4S3KA 4G7EB 4JFUA 2ZRZA 1X6UA 3M46A 3N2CA 3LHZA 4LW7A 4TMBA 3ALGA 3FSUA 4MWAB 1V79A 5LYRA 1VR6A 3VIIA 1Q6OA 3LBCA 1RPXA 2WQPA 2Z1WA 3WNNA 3EX1A 3P8IA 5HXMA 3VCNA 1XLKA 1XD1A 4IGHA 1UB3A 4H3DA 3CLWA 1ZRQA 3IV8A 5GNXA 1CLXA 4NT0A 3OHIA 4AZHA 4O8RA 1FKWA 3HGRA 4O4VA 3VIFA 2H6RA 2OPJA 2YDSA 4ZR8A 3A3WA 3H2AA 1EZ2A 3NQ7A 1ZP3A 4QLLA 1MW3A 3K4WA 3PPGA 5F2LA 2W3ZA 1KCZA 1PKLA 3PZVA 1QPRA 4C6NA 4AZ5A 4Q22A 3WFLA 4E8DA 5REQB 1MNZA 2PDWA 2QZRA 2DJXA 3WLIA 2ESCA 4W7WA 1FCBA 3R4IA 1NM9A 1DE6A 3CZ8A 4U31A 2PI6A 5LNRA 1L6WA 1LL7A 2BVYA 3HPSA 2R1LA 1ZAJA 1YX1A 3EPNA 1CBGA 1WNOA 2DZPA 3B9DA 4ZSTA 4PMNA 3WDHA 4C65A 4QCEA 3L4TA 1UR8A 4O17A 2OSYA 4RKAA 5AHMA 3WMSA 4UIOA 1W32A 4IFRA 5EBUA 2PE4A 2PD5A 3CZLA 3I7SA 1J11A 4MZYA 5M2FX 4IXXA 1S46A 1QOPA 2WK2A 1PEZA 3U2OA 3VD9A 3W83A 4HCDA 4H9VA 2EKCA 1EIXA 3WNKA 4KCWA 1F3TA 3I3EA 3MMDA 1EJUC 4F0LA 4I5RA 5CBBA 2XWEA 4MKSA 3F2CA 3CQJA 3BQ5A 4CQDA 1IGWA 3GH4A 3G1AA 2I1OA 1HKJA 1TJ0A 4LAKA 3IIZA 1PCWA 3S1WA 4O10A 4JTEA 5A6LA 4KIEA 1XGEA 4JIPA 5AHEA 3UF9A 1O5XA 4JL1A 2RFGA 3K8KA 3KAOA 3RILA 1XD0A 4HU8A 3APGA 1EA9C 3HURA 2PDFA 4O1BA 4WEVX 1J0JA 2CLLA 1W2VA 3SO7A 1LLZA 3R8RA 4HCLA 4CEXC 1FH7A 1ZHAA 3RU8X 3U48A 4PSPA 1LOSA 4YS1A 2ONEA 2OGYA 4D1JA 3DN5A 4YTSA 3DFYA 1FXPA 3EWWA 3QY8A 4FF7A 2V5LA 4I7UA 3HB9A 3WF1A 4HHHA 1DL3A 3TW6A 4KT2A 3LQLA 5HUPA 4E2BA 1TCDA 5H91A 1SO6A 1ZJHA 2YLLA 1LWJA 2QCCA 3EEGA 1X7IA 1TWSA 4O57A 4KFNA 1F3WA 5DMNA 3STFA 3O1NA 1QBAA 1HO4A 3F7JA 2OQLA 4RE0A 3M0LA 5D37A 3OP2A 1XLCA 3PZUA 4GZJA 3BLIA 4RZ6A 5F7UA 4YLWA 1CGYA 2CXEA 1REQA 1PKMA 1ADDA 1UKQA 1E72M 3GYEA 2CZEA 2Q8ZA 1LDCA 3WK0A 2YL6A 2ZZ4A 4YVVA 4FALA 2VFDA 1EC9A 1GW1A 2E3ZA 1H60A 2FGLA 1JZ8A 4I90A 4HCHA 5I79A 3WUBA 1M6JA 3K5XA 1PKNA 2POZA 2O7SA 3QKZA 4O1CA 1M03A 2OSXA 3DFSA 3R94A 4XAZA 4RPPA 2E8ZA 2QT3A 1T96A 3GH7A 5FF3A 5DT7A 2GSJA 2VZTA 1RCXB 1EA0A 2A7NA 2OGJA 3GR8A 3ANVA 3EXSA 4AHPA 1B54A 4ASTA 1JRCA 1RLDA 1SUXA 3BDKA 1KR0A 3W2NA 1PTGA 3RNDA 3NPUA 3IJ7A 4LXFA 4KS0A 3KHJA 4GH3A 3GXPA 5DXYA 3HPXA 2QCLA 1XRFA 3SCNA 3CH0A 4HYRA 3QTGA 1FXQA 1E6ZA 4F9DA 3BW3A 2HVMA 1FY6A 7REQA 3VCCA 1C29A 4IQEA 1HL2A 3CHVA 3HA1A 4UTLA 2XWDA 5CKSA 5H1WA 2YZRA 3BLOA 2VZUA 3BMXA 2E7FA 1XIBA 3W38A 4Y6GA 3UCDA 4DYKA 4GJJA 1KNWA 3BGAA 4DJFA 3ALFA 3R10A 4OJYA 3AO0A 3NOEA 2YCLB 1IR1A 1LLWA 2XDFA 4KH2A 4RW5A 3KP0A 1TREA 3RCNA 1Z89A 4IZGA 3TEVA 1Q6EA 2ZUVA 4NU7A 1W2PA 4Y96A 3TFXA 1JYNA 1BFNA 3WQDA 2WC7A 1UD4A 3VI2A 3RCMA 1CDGA 2QXWA 3PBUA 4PRWA 2C14A 5AYXA 4EF9A 1AL7A 4JDBA 2CWXA 1G4TA 2J7DA 1V77A 2Y1HA 5C55A 4I9JA 3OIHA 3HJEA 2DSWA 1WO2A 4RPQA 3KP1A 4BJHA 3ARZA 2JEQA 1CNVA 1DIOA 4IJBA 2YDRA 3CYVA 2POTA 4AX7A 2ZZ3A 4LUYA 4FXSA 3MO7A 2A3CA 4Q3MA 2C71A 1Q5MA 4WDUA 1V3IA 1JULA 3EX6A 2QUTA 1ONRA 4FNQA 2NUXA 2DP3A 2XSAA 5I0DA 1QDSA 1B5TA 1P5BA 1MUWA 3GUWA 1P6CA 4MAZA 3ARRA 4XZWA 1JFHA 3SGZA 5BXSA 4DN1A 4ZE4A 1GYLA 2H8XA 3ZO9A 3ABSA 4NAFB 1ZSXA 1CI1A 3H22A 4C1NA 4H9TA 2CFFA 1ECQA 1B1YA 1H1ZA 1K77A 3PF3A 2YYTA 2NT1A 1R30A 4P7RA 3DI0A 1DP0A 3O8AA 1I8JA 3K1DA 4JTCA 4S2CA 1TV7A 1UMLA 3GNDA 1KQYA 1F6PA 3NXFA 1CXKA 3PUDA 2P53A 1J0IA 3PPCA 4HB7A 4KFPA 3F03K 2ZXDA 1BG4A 2PDBA 3E74A 2QF8A 1EJWC 1GVEA 1QOXA 1PWLA 2FZNA 4US5D 3IK2A 1WAUA 2W63A 5E1QA 3V35A 2AOSA 1DXIA 5CGMA 4NF7A 2CZFA 1ME8A 2BOGX 4WCJA 1WZMA 4DJDD 1TX0A 2E25A 4DPPA 3UXIA 4ERAA 1AK5A 3QJAA 5CPNA 2YW4A 4ORMA 4YN5A 4QNEA 3LX9A 1K8YA 1H7PA 3S3GA 2WSPA 4F4RA 1UROA 1JCYA 4AY1A 3JU2A 3NL6A 1H5YA 3FW6A 3EDEA 1LT7A 2GYIA 3ARSA 3CV6A 3GVGA 2WJDA 3MCNA 4P8WA 3W81A 3HG3A 4GCAA 4MUZA 4AD1A 1QCWA 5CZJA 1C90A 4XKYA 1R3RA 3LM3A 2DIEA 5DANA 4PMVA 4B5UA 3R7MA 4HHMA 2H9AA 4A3RA 3VIOA 1OC6A 4KEVA 3B04A 1L6FA 2OYMA 4LANA 3SCUA 4X2RA 4N42A 2PCEA 3ABOA 1V3MA 4HK5A 2Z27A 3PFMA 3GHUA 4CNTA 2YFOA 3KBMA 1DJXA 2YOCA 2CLEA 2W62A 3MHUA 3BZJA 3MP4A 4NNAA 3P5YA 1Q8JA 1RQBA 4GZ7A 4FOKA 2I14A 3WQWA 4Q32A 2ACQA 3T7VA 5GNYA 1M01A 1W1IE 2CEQA 4BK9A 3V5FA 1NF0A 3W1XA 3TX9A 4S3CA 3E02A 1Q8AA 3BAYA 3FNDA 1KRCC 3LGDA 1EYEA 2R14A 1TVPA 5FEPA 3NYDA 1JZ7A 3GVRA 4M56A 1ZBWA 4O0KA 4AH7A 1TVLA 2Q71A 2OU4A 1P43A 3DXIA 3KVKA 4IMDA 4G5DA 4YTTA 1FWTA 1ADSA 4TMCA 1FOBA 5G4HC 1TTPA 2ZBTA 4C7DA 2E5DA 4PH6A 1S5MA 1UKSA 3FJLA 1SJCA 3KOWA 3CB8A 1UR3M 3SSJA 1DYSA 2NX3A 3ZR5A 2A3BA 2I5QA 2Y89A 4N02A 1O12A 4ZL1A 4XAFA 1GJPA 2FZ9A 2XM1A 2XFYA 1VAHA 1KQZA 4ML4A 4QHRA 4RDVA 3ZXWA 5AC6A 4D72A 2QAPA 3KM8A 1UPMB 1OGBA 3GH5A 2GOKA 1VC4A 4BI5A 1Z32X 3LLXA 3VAVA 3GM8A 4C6JA 1BYCA 5B7YA 4H8NA 2Y24A 2VYOA 4B5VA 3V4BA 2XIQA 4TO8A 4LVFA 1UWRA 3QQ0A 2I57A 1LRNA 3KRBA 4GIEA 3W7QA 2YJQA 4DELA 4P5UA 4KCUA 1JZ2A 2X1RA 1W9PA 1M1BA 4JQ3A 1H0IA 1JCLA 1PXGA 4TX6A 3W82A 1A3WA 1RA0A 2EGZA 2NWRA 1SR0A 3ITGA 1FP9A 3U6WA 1XPYA 4C5YA 2J7CA 4KRZA 2CESA 4HMDA 3I68A 2GVYA 4B3KA 3ATYA 1GOWA 3KL3A 1B3ZA 2PDKA 5GNZA 3NQBA 2GUUA 4WQ6A 3UA3A 1DJGA 1IR2A 4CN6A 4DIAA 2Z00A 4N4PA 1KFJA 5AYZA 3LHYA 2I7GA 4NX5A 3CTTA 2P3ZA 3V5OA 4D2JA 2E28A 7TIMA 4K7YA 3WK2A 4KEZA 1ME7A 1UBSA 3WNLA 2HK1A 1S2TA 4UQDA 4C6OA 4LAOA 3HG5A 4NYYA 5LNSA 1JCTA 3ZSSA 1R9YA 3OZMA 1JD7A 3W7CA 2HZGA 3TN6A 1VENA 2QCMA 3DG6A 3XISA 1F74A 3NQGA 1JCJA 3P3BA 2BMBA 4S3BA 3EWUA 2YCJA 2Z1SA 4U10A 4U3CA 5ABFA 4KRTA 4MDPA 4L65A 2PD9A 4LYPA 3GTHA 1QJWA 1V3HA 2VFGA 3M5ZA 3OG2A 5A8OA 6TAAA 3F5KA 3OOQA 3H2FA 3O3RA 3R12A 3CT7A 5HWJA 1NVMA 4GYKA 4CQBA 3V1HA 4MKVA 2HTMA 1M3UA 4Q4SA 3W24A 2ATMA 4KWVA 1VCFA 5E9AA 4B91A 1TV8A 3GG1A 1BPLB 1WDWA 3TV8A 3REQA 3V75A 4Y2WA 2VEGA 1H41A 4XIMA 3M6DA 3AS2A 2YLAA 1A5KC 5LGXA 4B92A 1A49A 1J5TA 1VFHA 5EBAA 2R1KA 4MOZA 2ZTJA 4AD4A 4P8XA 3DFTA 3L2LA 3NJ3A 1ISZA 3Q45A 2VDGA 3M9YA 4ZGYA 3BL3A 2WMKA 3H2CA 1B3XA 3ELFA 3T0DA 2A7RA 2FQIA 2XVLA 1YHTA 2BDQA 4CNPA 3M7SA 1TTIA 3IGHX 3DOPA 5C5YA 5BRBA 1JZ4A 2CW6A 1HGWA 4E4PA 4R9XA 3DI1A 3EOOA 4LB3A 4MY1A 2Y5JA 5F1UA 5J5DA 4NX0A 1JQXA 3T8LA 3KCOA 1V8EA 3Q2DA 5D30A 1S39A 4QX4A 5DY2A 1R8LA 1TWZA 1I2RA 4O11A 4MDOA 2HE8A 1UR9A 2GVEA 4MIMA 4W4QA 5CPSA 3QN3A 3VZYA 3EEZA 2EHHA 1GORA 1PZ0A 1VHNA 4UMBA 1LM1A 4PTDA 3UWVA 4E8CA 4NI8A 3WEMA 1FDJA 2OKOA 5FSDC 4DBWA 1H50A 1IEWA 1IWBA 3CK5A 4FZIA 1ISVA 6ENLA 2G41A 3BK0A 3C2FA 5A6BD 4WXYA 3UY8A 2C13A 4IIEA 5AZ0A 3VNJA 2J8GA 3WF3A 3TJXA 3W7LA 2PC4A 3BTNA 1E56A 2JBMA 3CH9A 1NIUA 1ZTVA 4IFKA 1FKXA 4H6RA 4KCTA 1KC7A 1XIMA 1ADOA 4UTWC 4ILSA 5EMYA 1UPPA 2YDQA 2BY0A 1YNPA 3HQPA 5AC4A 4I8YA 1R3QA 5EMJA 3W6MA 1ITXA 2QIIA 1Z8AA 2YW3A 1NU5A 1D7KA 3IRSA 2X1TA 4HJWA 3U2EA 1AH0A 4JTTA 1YTEA 3AJXA 1REQB 1RK5A 4UNLA 3CIWA 1E73M 5HJYA 4W7UA 5E0CA 2O56A 3B4UA 4UQCA 1GOXA 4EKJA 5DEZA 4JEQA 4ZB5A 2EJ1A 3TYDA 2ZADA 1FCUA 3DBNA 1GHRA 3URNA 3AIUA 1Q13A 4O52A 4FOJA 1E71M 2QV4A 5AFDA 1RY0A 4GX9A 2V3FA 2INFA 3N9KA 3WQGA 1F8IA 3SCVA 4AWUA 1HT6A 3EGJA 1EJXC 3RYSA 2NX9A 3LPGA 2V6AA 4WR3A 5C2CA 3VIMA 3VGBA 3VFLA 4S2BA 1L0PA 3SQLA 2FH6A 3NQDA 2FZ8A 3O0FA 4WHBA 3G22A 4H2HA 5HAOA 3WIJA 1NEYA 4GRSA 2W9MA 3SY8A 5DMLA 5D2VA 5U7SA 3IWPA 3GE7A 3MUAA 4LS0A 7REQB 1F76A 1A5UA 3BLFA 3NDYA 4QSHA 2WMGA 3W1UA 3H2MA 4DF2A 2DY3A 2TYSA 2E8YA 3UWQA 1K7XA 3H2EA 3UEQA 2Y8KA 1UP2A 1RQHA 2WC4A 1OINA 2YGYA 4QG8A 3KTCA 2R1MA 1K4GA 3W75A 4A8NA 2VMFA 1M68A 4UB9A 1YEYA 3GU9A 1AH4A 3NZRA 3WD4A 3SY1A 1NF7A 4LS2A 3G1HA 1FHDA 4LX4A 2DT0A 3H4GA 3OBEA 3RPTA 5HUOA 1BXCA 4YWIA 2YL8A 4F0KA 4IOTA 2PDLA 4GWEA 2PWVA 2AL1A 1J4EA 3BLLA 4E6MA 4H6EA 1WOAA 3RJXA 4R34A 2VTFA 4Z17A 3LV6A 4HSNA 4DRSA 4Q8QA 2OYLA 2GDUA 2Y7EA 4QTGA 2WCGA 2FHBA 4HD5A 4FX6M 1Y7VA 1EKOA 3IVTA 4GNKB 2PDCA 3BGGA 3CUJA 4NHVA 1UUMA 5EMLA 1JXKA 2GJXA 2GJLA 2D0FA 1TV4A 1R3VA 2Y2WA 3S6TA 1XXXA 3NCOA 1R2RA 2V5DA 2W27A 5TAOA 3UWUA 1BXBA 1E6RA 2X1IA 3H6OA 3WD3A 1G9HA 4D9PA 5ECVA 2QMJA 2BS9A 4UZUA 5T9CE 3L2IA 1TMHA 3W22A 3OZPA 1WCGA 2BX7A 3B06A 1O1ZA 3CL6A 4HJFA 4M8UA 2GGJA 2PDGA 2TODA 1AD4A 1J8VA 2JQXA 1R47A 2VVNA 5D2YA 3PPHA 3SQMA 4AVNA 3T42A 3VM5A 4C1NB 3L9CA 3I10A 2JIEA 1LRQA 2W91A 3NUKA 4JTGA 2P88A 4DY1A 4B2DD 3UZ5A 4JTJA 3AZTA 2PLCA 2NQLA 4A2RA 3UW6A 5T9BG 1SW0A 1PIGA 3TH6A 3QQ1A 1I2OA 2A7PA 1J2BA 3P84A 4NASA 5E5CA 4HK7A 4HQVA 1AJ2A 4CVWA 3WLMA 4LV9A 1R2TA 5C54A 1VEOA 3PS7A 4Z08A 1LBMA 1BXNA 3QLLA 4PL1A 4YIWA 4GQ0A 1W9XA 2WOQA 4KWOA 3EWYA 2Q8LA 3SCTA 3SIZA 4NP7A 5I78A 1AFSA 4GUJA 4J3UA 5FJIA 4GA8A 3ONCA 1R2SA 1BLIA 2DSKA 2IPWA 1VLWA 2EJAA 4QE4A 1OFAA 3FYYA 3W76A 2WW5A 4B3ZA 1Z9AA 2PCQA 3PJTA 2NW0A 4ZXLA 4A29A 3IGUA 3LXCA 3ICJA 5LXEA 3C2RA 2XFWA 3A4WA 3TTSA 4KKXA 3F4VA 5IXEA 3AI0A 3T2OA 2PBGA 3C61A 4GMEA 2O0TA 2J13A 2J8FA 2HV5A 1TQXA 3TLLA 2VHLA 3P5ZA 4K8HA 2ZRWA 3S2MA 2Y0FA 3QSTA 4IGSA 2WAGA 2YIHA 3NIYA 3MMUA 5BXTA 3AAMA 2VC5A 3LBOA 4XKYB 1KD0A 4GFSA 2J74A 4M24A 1C8YA 3G18A 3U2CA 4HTBA 4QJ5B 3MSRA 1XYZA 3S2JA 2H9AB 3AMKA 4K1GA 1W3IA 3PTKA 1F3XA 2FVMA 3NQFA 4ECLA 4KQNA 1O1HA 2V2CA 2X0YA 4E38A 2YKKA 3RPMA 2O9OA 3B9EA 2QDHA 3WF2A 4Q7IA 5AHNA 3PWAA 2CERA 2INEA 4Q8TA 1XRVA 4EK7A 3TQKA 3T2QA 4M1BA 1ZCCA 4LS1A 3W7GA 3VIKA 1W1PA 3BCJA 2EBNA 5HOSA 1RVKA 4J5NA 1B3YA 3CASA 3DG7A 3N04A 1HL9A 4P7OA 3IUHA 4MNJA 1TPWA 4H8UA 4S3DA 3L5AA 1VYSX 5CJ5A 3CLMA 2BVWA 2QNEA 5IDIA 4Y9NA 2HPIA 3IUIA 4RXGA 1E9IA 4LYKA 4Q4OA 4PODA 2XFFA 3T9PA 4XSMA 3AHZA 3NQCA 3LTSA 4FNTA 3H4XA 3THUA 4G8TA 4CD6A 4QIUA 5IFPA 3P8JA 1ISWA 3B0PA 1EC8A 5G1MA 1UIOA 4ATDA 1GJUA 3CUIA 2EPKX 2JKEA 3AZRA 4H9MA 4C6MA 1OSEA 1WX0A 3G1XA 1Y65A 3SM0A 1GTEA 4JFTA 3OPSA 3TC7A 1UKPA 4AEEA 4DWSA 1JCXA 2DUZA 3MMTA 3CQ0A 4NQ1A 3A64A 3HPFA 4G2DA 5I24A 3FX4A 3FYPA 2V67A 3WMCA 5C9UA 4RNFA 1XYCA 4MYXA 4N4QA 1Q6QA 3VE7A 3VKAA 4JKKA 3BJFA 6REQA 3TW7A 3GNOA 1VB9A 1XLFA 4Z2LA 3VO0A 1RZMA 2PP1A 2PTWA 2XSBA 4LC6A 1MXSA 4FNPA 3ZSTA 5FA5A 4CEUC 3PWIA 3WL0A 4UQAA 4O1EA 3TXZA 1Q7QA 1OY0A 1RJPA 1U30A 3WLLA 4UCFA 1W1YA 3B05A 3ENLA 1G4PA 4MLJA 3VDCA 2AKMA 2C6QA 2ZZ5A 2A3EA 2R8WA 4O1FA 3SBFA 4PMZA 2OO6A 3MI6A 3OTRA 1JPMA 4GH1A 4XTIA 3WH7A 3TVAA 2J4GA 2D3LA 4R7JA 4G7FA 4J2PA 4QXIA 2VX5A 1O5QA 2L5HA 1YXCA 3BCFA 4HNVA 1AMKA 2HCVA 2CBUA 2JEPA 1CGXA 2C7FA 2WMJA 1JYVA 4ADUA 4PCFA 4MB5A 3CO4A 4H01A 2AQOA 5G2HA 4ERIA 4TR9A 4MUPA 2VNCA 3OVQA 1JNDA 4C6LA 5ABFB 1OF8A 2Q09A 3FVDA 4HPXA 4DO6A 1ELSA 3A4AA 5G1TA 3ARXA 5GJPA 1VZWA 4HPGA 4MYAA 3S2LA 3LNPA 3V0TA 1UR2A 3QHNA 3NURA 1AD1A 3IARA 3PTDA 4GIYA 3S2CA 2CIPA 2VEIA 1EWEA 3VC5A 5A69A 4RE4A 1C8QA 2UY3A 2J7FA 2DUXA 3WLQA 1SZNA 4LBRA 2GUBA 1XI3A 3S42A 3RLHA 4PGLA 1EL3A 1Z7AA 3HV9A 3EKLA 3REQB 2VR2A 2PU0A 3UWWA 1RD5A 4FP1A 3NGFA 3AWOA 1SGJA 3F2DA 1KR1A 3BVJA 4LUSB 3SECA 3AROA 1GUVA 5D38A 3TNBA 2PEVA 2QHAA 3W7JA 1IT7A 3GXTA 1AUSL 3BV7A 2XN2A 2CBIA 5LIWX 3NSMA 2QR6A 4KBXA 5HULA 3N4FA 3AICA 4J4KA 2B4GA 3CQKA 3PK7A 3OVRA 2VGGA 2G3IA 1NJJA 2R94A 4H9YA 2X09A 5F4WA 3TIMA 3UGVA 3WDJA 4TQTA 1KKOA 1S2WA 3AC0A 1S5NA 1GCYA 4X0NA 1QNPA 2GJRA 1XJBA 3GLCA 4AZIA 2P10A 1OG0A 1XLJA 3GG7A 3ZFHA 1TA3A 1Z3NA 2BB0A 4POCA 3OBAA 3B8DA 4S39A 4CNOA 1XSIA 1ZUAX 1YPIA 1JAEA 3F5LA 2WJEA 1K3UA 3NQ8A 4URIA 2HVNA 1BSIA 1YW1A 3DDMA 4IPJA 3GG8A 5I77A 3CYJA 1MYRA 5HQMA 1FWGC 1C7TA 3R13A 3GC4A 5CC7A 4AXNA 1H0GA 5DN1A 4IT1A 1CENA 1O60A 4FHAA 1HO1A 1KBKA 1FUYA 3QQWA 2J7EA 2YBUA 2X40A 1TMQA 2XH2A 3GDMA 3PAOA 2QF7A 3ABZA 3D46A 4NNBA 5CPTA 2B0MA 5DBUA 4KF1A 1E4MM 3TU9A 1S38A 3LHUA 1XCFA 3RGTA 4IFKB 1MXGA 2V3DA 5M5DA 2F7FA 2JE8A 1IE7C 3LENA 3P7YA 4BI6A 4LCSA 2I16A 1E0WA 2P3EA 1P1MA 3OHMB 4C6BA 1ZBKA 1ZJIA 3EOSA 2YR1A 5CSUA 3E9AA 4PBEA 1X1ZA 4JXCA 5TF0A 1SO5A 2X7VA 2VWSA 4CN1A 4LFYA 1KV8A 1EC7A 1IZJA 8XIMA 4F8XA 4HSHA 1S5TA 2BV9A 1EO7A 3WG6A 1SMDA 1TQJA 2ZXBA 2XTKA 2NVCA 4GY0A 1UQYA 3USBA 3PZOA 3U3HA 2XZ9A 4PUMA 4Z1CA 3U2ZA 3D0CA 1DJHA 2OQYA 4B16A 3K1GA 4QJ1A 5C71A 4F2UA 4QE5A 4WZHA 4UMAA 3A23A 5BROA 3AHYA 1HG3A 4L56A 2ZRUA 5JH1A 1NY1A 2XJ7A 4AZCA 1U5HA 1CTNA 4L5ZA 4Q8VA 3ES7A 4PRRA 3NQEA 2UY2A 3NQAA 1IEIA 3R0UA 1PAMA 3VOJA 2WMIB 1CT5A 4B9YA 6ALDA 4LRTA 4L4OA 5JIWA 3E38A 2YDAA 5D2TA 2ZWYA 4IHCA 3WMBA 4B2DA 1LL4A 4D6IA 1XLLA 2OEJA 3WDRA 1S2AA 2VOMA 1EUNA 1QRQA 4JDYA 4K8EA 1JDFA 3ZT7A 2V68A 2YXXA 5E6YA 5D2XA 1WXJA 4ATLA 4XV0A 1RALA 2DT3A 3CBWA 3FCPA 1XBXA 4IMGA 3WELA 3TCEA 1V6YA 4X2PA 1VFLA 4IICA 1R3YA 3ORWA 1YYAA 4PMXA 4U5KA 3SUUA 3TAKA 4FAMA 4KPLA 1RAKA 3BH4A 5CLTA 4WUIA 2ISVA 4EWND 4AZGA 2VC7A 1OT1A 1WDRA 2A0NA 3MUZ1 2BXYA 4Q6XA 1LYXA 2PPGA 4XAGA 3GIYA 1XBZA 3GKAA 3MQTA 3ME3A 4E2VA 2BOFX 1G69A 2ABAA 2VFIA 4K7VA 1TUXA 1V3JA 3CWNA 1HTIA 4GK8A 4H83A 4C1LA 3QH2A 3PR2A 3N4EA 1YE6A 3ZVHA 4HKPA 4F2TA 4MNMA 3VKJA 4PRTA 2GJPA 3LK6A 4K36A 1GW9A 4LUTA 1HUVA 1I75A 4AU0A 2VDIA 3DGBA 3B40A 2D2HA 2GJXB 4FIRA 3KLLA 4PCSA 1UP0A 2FKPA 2XVKA 2G50A 1KLYA 2GWNA 1P0DA 1AJZA 3KTXA 4Q7NA 3QEZA 2C0HA 4IMEA 5I7GA 3W3OA 3N4AA 3JZUA 1GZGA 3C3NA 3IVUA 2G4FA 3OW1A 3E0IA 1EYWA 2V82A 4YTRA 3MHFA 5M1TA 3S4TA 4HOZA 4XD3A 1F07A 3VKCA 2YBVA 5K2ZA 2FDMA 1A50A 3TA9A 5GVJA 1H51A 5JBDA 3NZ1A 3WUGA 3LCIA 1J93A 1LUCA 1JVNA 1FH8A 3G8EA 1XX1A 5DX7A 1Z44A 2XH4A 4Q4RA 4YNGA 3CUXA 3V0SA 1LL6A 1A0DA 4X9SA 1YDNA 2WZIA 3UG4A 1GG1A 1POJA 2RHGA 2DH3A 3IEBA 4JQ4A 4WSKA 3CQHA 3L7RA 4ZFMA 2Y8UA 4HA3A 1KV5A 1TV2A 2FPTA 3IIVA 4S3JA 3KWSA 2W6RA 3FJNA 3EX4A 1A47A 2BXVA 4I6VA 2ZWZA 2QPSA 3L4XA 3LPOA 1XC6A 3UZZA 3BXWA 1V4YA 2ZUTA 3GNRA 3DENA 3BAWA 3TQ0A 1F8MA 3BW2A 3HZ3A 2A3HA 2YA1A 1GZ1A 3KCLA 1RHCA 1HP5A 4BF7A 1PPIA 5G2WA 2E9MA 3VGGA 1E55A 3AXHA 3THAA 2FGBA 1OD0A 5DQPA 3GXMA 1XLAA 1UHVA 1XDLA 4IJRA 3HPAA 4FLOA 1YXDA 1OEPA 3BW4A 4BFAA 1IT8A 1OGSA 1BTMA 2F6XA 4ACZA 3SUWA 2D73A 4QITA 4UTMA 2ISFA 2YA0A 3ITLA 3W7OA 2ZC8A 4DF1A 4YCOA 4U33A 2OCZA 5TNVA 4PTVA 4YVPA 5DRCA 3IAQA 3ZLGA 3DFPA 4O54A 1OCQA 1PTDA 2PLJA 4LSBA 1V3LA 1DWGM 2DFAA 1QUMA 5L9FA 4WDXA 1HJQA 3CMJA 3G1YA 4Q8NA 3AHTA 2H90A 4D6CA 3GVQA 1OABA 4PUJA 1AW2A 3QM3A 4JN6A 1ZALA 3L4WA 3KZPA 4LV4A 3MCOA 2OKTA 1F7BA 3FEMA 3MKCA 3H70A 1XV8A 1PHWA 1XYBA 1WUFA 2RDUA 2FIQA 5FIPA 3CTLA 4U2ZA 4IIDA 2PODA 4J3TA 6XIMA 2BGSA 3VM7A 5E0KA 3TYUA 4GKLA 3U5UA 4EPKA 1QPOA 1KM4A 1D3GA 4HPHA 1TE1A 2CZDA 5EPDA 3A3HA 4G1NA 2C8NA 2EG6A 2ZUSA 3LCXA 3APYA 1HKMA 4HBKA 1KBBA 2VOTA 3AU6A 1X39A 1MEHA 1E4LA 1K6AA 2ZIDA 1HXJA 2CLKA 3NL5A 1PX3A 5FF7A 4DXXA 3E2VA 4AMCA 1IZCA 4C90A 4FLRA 4DEFA 4Z2JA 1ALDA 3AS3A 2CYGA 1SFLA 1GK8A 1HP4A 2WHMA 4EAYA 2YCIX 2NV9A 4NVTA 4JNMA 3ZLHA 4J3XA 1I2NA 4FR6A 1QWKA 2WCAA 3DKLA 2IMRA 3HBLA 4DWSB 3KLKA 3HPZA 2WZEA 1TRDA 4ZQNA 4WRHA 2WB5A 3WQ4A 4NIRA 1W1TA 3WF4A 5EY5A 1PUDA 1H5VA 2E67A 1H61A 3C2EA 3VGFA 4F0MA 1I2QA 2WMHA 6REQB 4X0VA 3ZWTA 4AD3A 2AL2A 4ZQMA 3N6JA 1CECA 3BG5A 3ARYA 4K39A 1B3OA 2WWCA 2DVTA 1E5NA 5CPQA 4IP4A 1KBIA 3TXVA 4D6DA 3IUDA 4FXFA 3VMOA 3WNPA 3DZ1A 1AMYA 4W8LA 3VDAA 4MADA 3P81A 3LZ3A 4M6QA 4PB5A 1XSKA 2X1UA 4ONVA 4JD4A 1QAPA 5FCZA 1DIKA 3WF0A 5EMMA 4BEUA 1MDLA 3E49A 5FESA 2VZSA 3PJWA 3RAOA 4O13A 4KW2A 4KERA 4MB1A 5KZEA 2XYLA 4H6QA 1E1FA 1UOKA 4ZENA 1Q3NA 1IIGA 2ANUA 1IXPA 4C5ZA 1AZ2A 2ZKMX 3WMLA 4HNLA 4XZNX 4FLSA 1VJIA 2OR2A 2ACRA 1OZQA 4ENLA 4UQBA 4FNRA 3NQMA 3ITVA 4H04A 2REQA 2DIKA 3PUOA 4Q8PA 3K4DA 1SZRA 1H7NA 2HQAA 3NQ6A 1N8IA 1I1WA 2OLHA 2G95A 1OHLA 1B4KA 5A8NA 2VX7A 3L65A 1VQTA 3BLKA 2QDDA 2E1DA 3UR7A 4CCDA 3C86A 1OX5A 4ZXOA 1JGMA 1EP3A 4ZOCA 1SJBA 4GYFA 4HU3A 3RM4A 1JDEA 3U7VA 4ZQRA 1XCWA 3AALA 2PFHA 3B8UA 4BY3A 2CLIA 1HN1A 3WH9A 4X61A 4K6AA 1WPCA 4H7CA 1OG6A 2Y4SA 3EOUA 2E77A 3LPFA 5BU9A 5F4SA 2PBOA 2E5BA 1ISXA 4CD5A 3GAKA 4L80A 1J0YA 1DQWA 2Y5EA 5U4NA 4C91A 4ZOBA 4RNHA 1W1A1 1F5ZA 1A5BA 3KOXA 1SO3A 4Y8FA 3T4WA 2A21A 4N2YA 4J1OA 4UFLA 4EXQA 5CZ0A 2CLMA 5A3HA 1XYMA 2EQDA 3MJMA 4L61A 3LTYA 4QDWA 3AUJA 2UY4A 4UFKA 2GSEA 4Q4KA 4AZ6A 1DJQA 3QV7A 4H4IA 2NXGA 3H12A 1SW3A 3BLPX 4C6IA 4AEFA 3EB4A 2GK1A 1XUUA 3EKGA 2VGBA 4O14A 2WLZA 3CEPA 4ACYA 2WPGA 1QO5A 2Y85A 5TQLA 3CAKA 4NZFA 1JIBA 1CXEA 3GFYA 3MZ2A 2DZXA 2P8CA 3UPMA 1OGGA 1W5NA 2UV8G 3GHSA 3CHDA 4EAMA 4DO5A 3MY9A 3VOFA 2ZX7A 4MG4A 3V7PA 2YL5A 1OJXA 4J3SA 5C8BB 4BCEA 1EPXA 3UU0A 2OZ8A 1QHOA 4JICA 2WQDA 3UP8A 4GPNA 2X7WA 3BCDA 3AU2A 5KSWA 1YQ2A 1AODA 2B31A 2FLIA 4TV6A 3GKFA 2B7QA 3NM1A 4JIEA 5D09A 1TJPA 3NEVA 4MB4A 4J3WA 5IM51 5GQBA 4K68A 3ZJ7A 3G1VA 5DLCA 4A3QA 4ALDA 1G4EA 3MV01 5FAGA 4OVXA 4XK2A 3VDGA 3VTRA 4CCEA 1QNQA 4H6KA 1GG0A 2EPHA 5KZDA 3N11A 4EE9A 1E9ZB 4RDZA 3BSHA 1TIMA 3EX3A 4FSAA 5HPCA 1ZLPA 2WHJA 4UFJA 4F9JA 2GPTA 1SFSA 3PUGA 1D8WA 3T44A 2JIWA 3PNUA 3MTWA 1C8XA 1VBUA 3NO1A 4GQBA 4I9TA 5EL1A 1G1YA 3W1LA 5FOOA 4ZZ9A 5D4YA 5AYBA 3VILA 1ONEA 2IPGA 3OIXA 3HQOA 3CHFA 2Z2AA 3HMCA 4M3PA 3W2JA 1OC5A 3BSGA 1EJSC 4FPSA 2Y7GA 2XIBA 1QOQA 3EB3A 1OCNA 3W23A 1KRAC 1EHAA 3TC6A 4O0QA 3G5EA 1GWJA 1VS1A 1J01A 4O8AA 3WD1A 3GX9A 1XLEA 1S2UA 2WNZA 5JMUA 4CNSA 4IG2A 3UY7A 3C8FA 1XDJA 1GVYA 2C18A 1D9EA 1XKYA 3FKKA 1ONXA 3U57A 2X2GA 2G97A 4ES4A 1W0MA 3CM4A 5A6TC 4LTSA 3AIEA 2IQTA 4D6JA 4GFIA 4WSHA 1F05A 2WWDA 2E9BA 2QUVA 5DELA 3NPXA 2XH7A 4LAUA 3L66A 3PTMA 4DI9A 1XIGA 4PBFA 2OZ0A 2CLFA 2W79A 4AZCB 3VIGA 3I7QA 4A6GA 1XLMA 2CHOA 1WZLA 4ORIA 3K46A 3M41A 3B8SA 4ATWA 4FB7A 4GC4A 5LNVA 3LCWA 1L6SA 4Z0SA 3G1DA 4RCXA 3G1FA 3TYEA 3ISIX 4ZSUA 1LRTA 4K2SA 4KRUA 1PX4A 1S3HA 1H63A 3UETA 4IJCA 3EOEA 2R1PA 3L21A 1NSJA 3R5EA 3YPIA 2J9ZA 3GC2A 4L64A 4MWAD 5FEZA 3T05A 4GUHA 3TTEA 4J3VA 2OOGA 1UWQA 1W17A 3C2OA 2QS8A 1B90A 4PMOA 1CWYA 2GVLA 2NXIA 1WYIA 5E0FA 2QPUA 3UG5A 4JTSA 3P67A 2CHNA 2HMCA 4BS0A 4HMNA 4DBSA 1Q45A 4V15A 1SJAA 1UASA 2ZRYA 2XVPA 4XIAA 2QW5A 3P80A 2PDPA 1A5LC 1HL8A 2XIOA 3KRSA 2FJUB 1D3CA 3BG9A 2F6UA 4NZ4A 4IPPA 3TJIA 3PWGA 4IP5A 1GPWA 4Q4PA 1ZCOA 4JFWA 1QW8A 1FWFC 3BOFA 4FMVA 1T8XA 3CMGA 4IUGA 4UR8A 5IHSA 4GQQA 3ITXA 1UD3A 3L5MA 2ISWA 4WJXA 2Q6ZA 5FL1A 1HKWA 3LLDA 1SZGA 4LUTB 1PHQA 4AD2A 3AIRA 5M17A 2J6VA 3VOIA 4A21A 3IV3A 1PTAA 5C7HA 3T0TA 5KITA 5LIUX 3BO9A 5D33A 4RJEA 4EP8C 4CKQA 3C0SA 3N3MA 1NFBA 4HPJA 3RO6A 5LA0A 3VINA 4OV9A 3W0KA 1K6WA 1I2PA 3IJDA 3QV9A 1BRLA 1TV3A 4KMQA 3N2MA 2PRLA 1WDSA 3A21A 2Z6IA 1UOZA 4HA4A 3NFUA 2BBFA 2DGAA 4FNSA 2RDXA 2X30A 1Q63A 1E3ZA 2EEXA 2JGYA 4GX8A 1SFTA 3P2VA 1DJNA 4UOJA 3W85A 4GJIA 1LCOA 4OOZA 1PIIA 3RHGA 2VR5A 4AXKA 4IP7A 1BSLA 4Z1AA 3UJRA 5I3DA 5HR6A 4CQ9A 2FB3A 3LV5A 1LBFA 5H6HA 2RKXA 1A3XA 3C6CA 3O6AA 1XUZA 3BJSA 4P7QA 1GOMA 3M64A 1QMLA 1EEPA 4JOMA 3G3MA 3W1AA 1TFVA 3DX5A 2DZVA 4Z2GA 2NQJA 1V51A 2IW0A 3W1MA 3LBMA 3LY0A 4CGTA 4QG6A 4F48A 3W7IA 5A6AA 1LG1A 2FFIA 3CV1A 3U4AA 2V63A 4OUIA 4DNHA 1O5RA 4RW3A 5CJMA 1X1NA 3NL3A 3VGDA 3QPEA 1MFVA 4PEEA 3IJ6A 4LU0A 2I9EA 2PDIA 1DQUA 3U7BA 4LBUA 1SJDA 1FFQA 3FJ4A 2NUYA 3CHCA 4R33A 2QCNA 1DWFM 2XIMA 3P6LA 1NFGA 1YADA 3VX0A 4CU6A 3GTNA 1XGDA 1H09A 5J04A 1RBLA 3CZEA 3FYOA 3VD3A 5BNKA 1IGSA 3TTYA 5I09A 4Z2HA 3S6DA 2PTYA 1XIHA 4W85A 4Y90A 3WBWA 1Z48A 2ZA1A 4JQ1A 3CZJA 5D9PA 4TX9A 5ABEA 3MO4A 2AMGA 3PG8A 3WENA 4BQ5A 4ACZB 4JHZA 3BLDA 4NL1A 1EQCA 4F0RA 3KRUA 4TU1A 4JY9A 2CWNA 2Z26A 2O92A 2WM1A 3POCA 1TZ9A 2BP1A 4PTWA 4E4FA 2ZA2A 1JI1A 1GOKA 3CXOA 1JUKA 3P60A 2E09A 3RMEA 1DTNA 3HG4A 4DWSC 3M0HA 3VVGA 3P62A 1IHIA 2NLIA 3EDFA 1TZZA 1TV5A 2FTYA 3KS5A 4WSJA 1HQTA 2JKAA 4UTTA 1K7FA 3F5JA 1LF1A 2QJNA 3GXIA 2NQ9A 2BLEA 1W5OA 1IXNA 3IRDA 1W3TA 3QFEA 3EDKA 2PTZA 2G8ZA 4MAVA 4NJJA 4MJMA 1UIPA 3TN5A 1O94A 1ODUA 2WSQA 2Z6JA 4IGMA 4TVCA 4P8VA 5FACA 1LP6A 6XIAA 5D9NA 1X1OA 2PB1A 4GI4A 1XBVA 3LD5A 1TPC1 4X9YA 3LM7A 2QUUA 1FWSA 3U9IA 1UKOA 2FZDA 3Q67A 3FAXA 1MNSA 4GE8A 4XX6A 3SIMA 1CB2A 3F4CA 5CZSA 3FGCA 1PYFA 1KM3A 2HXUA 3W7PA 3PZ9A 3S2NA 4LJ3A 1CGWA 4FOUA 1FWIC 1WZKA 1MQRA 3WSUA 4ROQA 1PZ2A 4MJ4A 4MZ8A 1XICA 1OCJA 2VCCA 3II1A 1JG9A 3PM6A 2KX9A 1IWAA 1RA5A 3GVWA 5CGQA 4FXJA 4LWWA 1MSSA 4X63A 3DYMA 3I6RA 1BWLA 3M44A 1TR9A 3A5FA 1Z69A 5HMEA 4GBDA 3W1RA 1XHGA 2DW7A 3WBAA 5CC6A 4G1KA 4JQ2A 3H2NA 4RLIA 3B8VA 4EXAA 5CCZA 1GTHA 4Z0JA 1DV7A 4L6HA 4B9ZA 4OBSA 2V8ZA 1RJQA 3W00A 1PE1A 2QKFA 1VPQA 1EEXA 4GYJA 2AL2B 1VBGA 4LGXA 1GHSA 3TJ4A 1GEQA 3H24A 1ZBVA 3S46A 4RE3A 1M04A 3HIJA 1KM5A 4GXWA 1IXOA 3MUIA 3UBPC 3TROA 5C9ZA 4GLEA 3A13A 3W72A 3WBEA 2ZVRA 4C6QA 3KBVA 1ZJAA 4LY4A 1L8PA 4HA0A 2ABBA 3LYEA 3WH5A 3QZEA 1ML1A 3KL5A 4LOCA 4O53A 5FJTA 7TAAA 1ITUA 3G24A 1VJSA 2FMOA 3AYSA 4W86A 4IQDA 1DEDA 5DBTA 4EIVA 3VZZA 3UPWA 2PGFA 3STPA 3NL2A 1WXZA 4REQA 3S5ZA 3NQ2A 3TP4A 3GFXA 4GIRA 5J5RA 2VC6A 5FF4A 4WGHA 3MCMA 3MA8A 2REQB 3H26A 4GINA 2KAUC 4CVUA 4ZOEA 1AH3A 1XH0A 2CLOA 1Z41A 3AHVA 3ZZ1A 3TKFA 1GQJA 4V28A 5C6MA 2PA6A 1LTDA 5I3IA 1U5VA 3TDFA 1P0NA 3WN6A 1UR1A 2VJXA 1P1XA 1ZFJA 5I3KA 4Z1YA 3AS0A 1LORA 5DCEA 3ZIZA 1SU5A 1JZ5A 1JJKA 1JF5A 2XFRA 2PAJA 3VGEA 3NDOA 5CSYA 1JPKA 2QYGA 3UCCA 5D8WA 3KOYA 1KXQA 3SCRA 1P0EA 3B8TA 3L0NA 1JQVA 1PBGA 3N2OA 4YJ5A 4OZOA 1QR7A 4UQEA 1TWDA 3RITA 3GDKA 2OODA 2CZVA 4B90A 3DHUA 2PDJA 2CNCA 3N9SA 3QYQA 3WFZA 3L0KA 4DJEA 3CWOX 4LAMA 2VQUA 5AOUA 3SUVA 4O16A 3A9IA 3GHRA 5E09A 2AGTA 3EXTA 4DB7A 3GBEA 4NY2A 3UT0A 2ALDA 1AQMA 1NELA 1UH3A 1NOWA 4V1XA 2F61A 5LGZA 2ASHA 3MSDA 1YTDA 3LUTA 5I23A 3L4YA 3UR8A 1XISA 3RG6A 4XAPA 3UZWA 2AMXA 3WJZA 3BSMA 1B3WA 2VUNA 1I60A 4HZ6A 2V5CA 5HMSA 3NSNA 3GO2A 2C1HA 2JALA 4DZAA 2NQ5A 8A3HA 1DJIA 3GR7A 1V0LA 3WH8A 1FWHC 2GLKA 4GIAA 2XHYA 1PX8A 2WZTA 3AIBA 4Z1BA 4MWAE 1JCNA 3MV11 2QJHA 4ZOAA 3THQA 3PJUA 5C2GA 1MUMA 4UFHA 4XBKA 1VPYA 1BKHA 1KXVA 5EFFA 5HNTA 1XFCA 4G7EA 4WVXA 1G7UA 4YYFA 5C9RA 5FI8A 3Q4DA 4M29A 7CGTA 2HRWA 2G4JA 3O6CA 4IPLA 3ARUA 4MWAA 3MZNA 2ADAA 5BOOA 3VIHA 3DUGA 4AIOA 2KZHA 1FWDC 3RU6A 3BAIA 1ZGDA 1UKTA 3QTPA 3H7VA 4WKAA 4PUNA 4JTFA 1CLVA 1LQ0A 4AYSA 4QGCA 3VPLA 3QR3A 3GTXA 2E6YA 4UTHA 1W1ZA 2HS8A 3WX7A 5DFAA 2QCFA 1JI2A 2WSKA 1E5JA 2GGGA 3RF9A 4QM1A 1Q2SA 5L6UA 5I07A 3VKDA 1UH4A 4PULA 4JCMA 4AYGA 1PV8A 3RN6A 4MY9A 4B5XA 3AISA 2FYMA 4XTDA 4AX6A 3W28A 4L4MA 3NPWA 1JYWA 3BWWA 3PPFA 3I3DA 3WLTA 3ZT6A 3AMGA 4XD5A 1E1CA 4LYQA 2IXUA 3M1ZA 3PHAA 4ZFCA 3VD5A 1OT2A 3T08A 6A3HA 1TTQA 2Y7FA 4XG1A 3C8NA 1K9FA 3LHWA 4JEJA 1SZEA 4E4UA 1L6YA 2Q01A 1NH6A 4OTKA 3GQYA 1B2YA 2B81A 1J96A 4HOWA 5HANA 4RV3A 2QCDA 1U1HA 1DTUA 2J62A 4TVDA 4JPGA 5EGRA 4LBSA 1GKRA 2DQWA 4MSSA 4INFA 2FHCA 3MDUA 3RUBL 3CUZA 5I6SA 3FAWA 3NO5A 4JIHA 4H8VA 3RLVA 4LY8A 4JN8A 2Y62A 1W1VA 1P48A 3SZ8A 4F79A 1UW9A 2EO7A 2D0HA 1VFMA 4Q6JA 2PWUA 1UC5A 3E5BA 3LZ5A 3RM8A 3GY1A 4N9BA 4G9PA 4DBEA 4QQUA 1E6SM 4P2VA 4C7FA 1UR4A 4RDWA 3LB0A 4L1WA 4LCRA 2NLYA 2H3BA 3GNNA 5A5WA 1W8GA 2F9RA 4LF2A 3T81A 1OC7A 3CQIA 2A4AA 3SGGA 4CN4A 3E3HA 3CAQA 1VEPA 3N34A 1FA2A 1DXFA 3UYCA 1R0MA 4OHQA 2J77A 3SB0A 1W5MA 5IRPA 2PDHA 4PMJA 1E70M 3WY1A 2PRMA 5GJNA 1K9DA 1X8CA 1GONA 3VUSA 1B4EA 1ZS2A 4PUKA 4ZA0A 3HMJG 3LMZA 4CUCA 2DDXA 2FDSA 1LWHA 1C9WA 3B9AA 3SCSA 1MMFA 1BD0A 1DHPA 1TPH1 1UD5A 1VCVA 2Y70A 3S9ZA 2PRHA 5BXRA 1BRLB 2D69A 2XU2A 5K9XA 4EVZA 1VCGA 4KWUA 2CXGA 3U4FA 2ZVIA 1XLGA 3B9OA 4XO7A 5D8ZA 2FPYA 1RQEA 2A2IA 4CQAA 1BVNP 1CXLA 4XZIA 4HK6A 2BHYA 1R9XA 4PFHA 2GQ9A 4Y8EA 4DUXA 3LA4A 1CEOA 1FDYA 4ICCX 2QCEA 2YSWA 2GZXA 2OMAA 4LRSA 2HXTA 3WQFA 2X8RA 3LTPA 2V38A 3JS3A 4ZCWA 1Y8BA 1OFOA 5G1YA 3G6MA 2VRQA 1XLIA 3K4AA 4FO4A 5IBXA 3N6HA 4G56A 3FIGA 5I3JA 4LCQA 1RVGA 4ADTA 1RXOB 3ZT5A 3MBDA 5A8MA 1DKWA 2D2JA 1OZMA 3N9RA 3VABA 3UXKA 1ZP4A 1ZY9A 2CLPA 3LNMA 3QOMA 4JIRA 1NWTA 1C91A 2EPOA 1M7OA 4UR9A 1XWYA 2Z2UA 3KCJA 3O06A 3KEHA 2W5FA 3AJ7A 4H9UA 3PBWA 1WB0A 4WJEA 1GNXA 3N12A 2E6FA 1X7FA 1ZAHA 4S3FA 1X38A 3GS6A 2G0WA 3GDTA 4HOXA 1EOKA 3IGSA 3UWEA 5BWAA 1BF6A 2D20A 4ZQPA 3W27A 3JVAA 3VDHA 2IKHA 4NJHA 4JYEA 3WLOA 1DWJM 3DESA 3MSGA 1OBAA 2XIIA 3R8GA 2DEPA 3OGSA 3QVQA 2P50A 3MVTA 3GUGA 5CH9A 5F2IA 4DAFA 1A5AA 1Y5XA 4MHBA 2F8QA 3JUGA 1OFQA 3CMFA 4JX5A 4WD0A 3H2OA 4AFYA 3IJ9A 4OU1A 2GWGA 2BG5A 2Z29A 2JKPA 3QY6A 3OU8A 1E43A 2JF7A 3TYCA 3DFNA 5LSMA 4PCNA 3T0AA 2ZUWA 3QMSA 3MT1A 3W02A 5EU9A 2J88A 3KFTA 2TAAA 4R88A 3C56A 4LVDA 1KTBA 3SJ3A 3UGRA 2OOFA 3SRHA 1ZNNA 2YYUA 3GAYA 3MYOA 3CNYA 4QRNA 5G2IA 3ANYA 5F2MA 3QOKA 3WDQA 3WK1A 3NDZA 1F61A 3GBDA 4O12A 4KGJA 2V3EA 2XUCA 2WKLA 4M0XA 2HJPA 1JYXA 2WJZA 4LH8A 2CC0A 4R7OA 2RGLA 1MW2A 2WBGA 3DYOA 2C1IA 3M0ZA 1KBLA 1OK6A 1TJRA 4XZLX 1K03A 1V6TA 1BYDA 4PEKA 2WV8A 1ITCA 4XBSA 4I5XA 3UJFA 4D1IA 3NGJA 3BQ6A 3ARWA 3R6IA 4JKMA 2MNRA 3NQVA 4A3HA 1KGXA 1KFBA 3M0JA 3UWYA 1TRIA 3TA6A 2GDVA 3FGCB 3VX1A 3PZMA 3N18A 2W92A 1QT1A 1EOMA 3LGGA 1WDPA 5AB3A 4YXGA 9XIAA 2Z4GA 4V33A 4OIFA 2O9PA 1H62A 5HDRA 4PMYA 2YZ5A 4KEUA 3JRKA 4RK8A 1W1B1 1G4SA 4UCGA 4WY0A 1L2UA 4DO7A 4GHRA 2ON3A 1ESWA 3OZYA 3TFCA 1I0DA 1EUAA 1AW5A 3O05A 1RLCL 3PNZA 4FX8A 3R1ZA 1UZHA 2QAFA 3LLFA 2X05A 3PBGA 2PU1A 5I2UA 2I56A 1A0EA 3BPWA 3PBVA 3FJ6A 1MQQA 1W3KA 2CLHA 3HV8A 3PAJA 4LVBA 5LIYX 3CPRA 1IF2A 1XL9A 3UESA 4I9AA 1DVJA 1RPKA 2XIJA 3PB0A 1GOQA 2AAMA 4A35A 4JAWA 3KE0A 3TR2A 3ZM8A 2CHRA 4AWEA 4NSBA 1O5KA 3GU2A 3WJWA 4DUVA 1VBHA 1H1YA 5EMUA 2TSYA 3F4NA 4IISA 4TIMA 1NDVA 2Z25A 3KRZA 4IQLA 4UBPC 1XP3A 3TCSA 1A80A 3UPBA 1UJQA 2HNEA 2QPXA 5E6ZA 1NWRA 1DPMA 4KWWA 4JTDA 2BTMA 2ODOA 3KVMA 1WKYA 2HWGA 1ZBCA 1YPXA 1US3A 1NWUA 4JS3A 4QEEA 4CCCA 4OUEA 4EPDC 5BRQA 3EZ4A 3ITOA 3ATZA 2NV2A 3STCA 3UJSA 5SWUA 4GOAA 2PGWA 4GABA 3B9NA 1RV8A 4H7VA 2PP0A 1UG6A 1F3EA 2J24A 1KBJA 2BODX 4N9CA 2XVGA 1YPFA 3O0KA 3N17A 1VBJA 1XS2A 3EWZA 2C3ZA 3WBYA 1AQHA 3BICA 2ZC1A 3MW7A 4L9YA 3GC5A 1JDDA 2J75A 4XBJA 4MY8A 5E93A 3S6OA 4DLFA 3W1TA 1D2KA 2QDGA 2J9XA 4GACA 3BMWA 2QMKA 2P76A 4J35A 4GI9A 5K4ZA 2YPIA 2ZXAA 1NTHA 3WNMA 3M5VA 3MSYA 3ITCA 3VNDA 3SY5A 3QSRA 2CU0A 2ATSA 3ECQA 4KWSA 4C6KA 1Q7MA 4V27A 4DI8A 2PDQA 3BGJA 3TYAA 3WLRA 5CQ1A 1OQFA 3QMRA 1TVNA 5JQ9A 3H55A 4AD5A 3E0WA 3N14A 3NPVA 3L4UA 3HTWA 1MW0A 4OBRA 1S5VA 2VDHA 3OGRA 3ZQ9A 5BWFA 3A4XA 2PWFA 4R53A 3AIWA 1DWIM 4JR5A 3DGRA 4BEQA 1LJYA 1FHUA 1ZB5A 4I5UA 4A8IA 2DIJA 3QGKC 1EX5A 5D03A 2LLEA 4FR1A 2VEPA 3E5PA 1OVDA 4LPCA 1E6QM 3KXQA 4HNUA 1E1EA 5BU6A 1QW9A 1QNRA 2VEKA 2VZOA 4J3ZA 1Q2RA 5K3VA 1K7EA 2W67A 4O0ZA 1PIFA 4BI7A 2C0AA 1LLOA 1KFWA 4M7TA 3V36A 3G77A 3GK0A 1JRBA 1JR1A 1GYNA 2FVKA 4RUBA 3FHQA 2VR4A 1F9CA 5FSEC 1RCOB 2HSAA 3TN4A 2B7OA 2BWGA 3PB2A 2VUYA 1TE6A 4IX0A 4I8DA 3I65A 2RGMA 1JCMP 4JTKA 3OYZA 2ZQ0A 4JFVA 3EKZA 1GQLA 4US5A 3UVIA 1UMYA 2RJGA 2VC9A 2WLYA 3QMTA 2DZTA 3RX2A 1BQGA 2FB2A 3OLGA 4RZBA 4DJDA 4MGGA 3QV6A 2WKGA 4QROA 4D71A 3SCPA 1TG7A 2WNQA 3G0XA 1WZAA 3RM9A 2YXOA 2H3DA 4PUEA 5AZ1A 1OFPA 1I6NA 3TOYA 4Q8MA 4DLMA 3LHTA 3I6EA 4UTJA 4AWTA 3EMCA 1R85A 2GVGA 1XQKA 4H7ZA 3SFKA 1XCXA 5HWMA 2RAGA 1QPQA 4JYDA 2UWFA 5D2WA 3CC1A 4KESA 2P0OA 1E1CB 2G3MA 3VZXA 3MANA 3A5VA 3AXKA 3KWXA 4XUYA 3EWCA 2XGIA 3U5YA 2GQ3A 4M51A 1ZJBA 4TX8A 4AY7A 2ZUMA 4GQGA