4XTDA

Structure of the covalent intermediate e-xmp* of the imp dehydrogenase of ashbya gossypii
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
408
structure length
377
Chain Sequence
b'TYRDAATALEHLATYAEKDGLSVEQLMGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRGKRLKTYRGMGSIDAMQKLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYERLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
source organism Ashbya gossypii (strain atcc 10895 / cbs 109.51 / fgsc 9923 / nrrl y-1056)
molecule tags Oxidoreductase
total genus 122
structure length 377
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xtdA00
1W3NA 3RK8A 5C6MA 5I3GA 1Q45A 3M43A 3W7KA 1YTEA 1SPQA 3W1MA 4R34A 3QH2A 1WX0A 3G3MA 4ZQRA 5AYYA 3JR2A 4LVBA 3SSJA 5D33A 3TQVA 3DFQA 4KWVA 1F76A 4RKAA 2OT1A 5E93A 1TPH1 4O15A 1TQJA 3W74A 3NZ1A 5TIMA 2HMCA 2I9EA 3QQ0A 2Y62A 5CPNA 1DKWA 1WQ5A 1OJXA 5F2LA 1I2OA 2CZFA 1EWEA 4Y6GA 1VH7A 3MYPA 2YGYA 2X1SA 1MXSA 2RFGA 3KRZA 2IQTA 3KVJA 3IV3A 3TMLA 1OK6A 1AK5A 1RPXA 1TJRA 1UUMA 2QEZA 3TFCA 4IXHA 3G18A 2Y7GA 2FB3A 4NNBA 4ZZ9A 3FKKA 4YL2A 3W1RA 5D2VA 1SSDA 1W56A 4TIMA 3LHUA 2YW3A 3QZEA 3NPWA 1Z42A 2QDHA 3H55A 3HIJA 4BI7A 3C8FA 2EKCA 3LXCA 4N9DA 5HUOA 1EP2A 3NL6A 3LCIA 1OABA 1XUZA 3W3OA 1B57A 3L0KA 1DQXA 1HO4A 1WBJA 3EX2A 1VCGA 3NQ2A 4AWUA 3EWBX 2A7RA 3C2RA 2CLFA 2X1RA 3NDOA 5L9FA 4O52A 4Q33A 2E5BA 4HNUA 4DO5A 2FQIA 4NUWA 1W5PA 4O4WA 3GKAA 2V8ZA 4FO4A 1QWGA 2HS8A 4RK8A 3UWUA 1XBVA 4Z0SA 3MO7A 1FWNA 4N9BA 2NUYA 4MOZA 2ABBA 2R94A 3R8RA 4TMBA 2LLEA 4PL1A 4RXGA 1G4EA 1BTMA 3P74A 1JULA 4NXSA 5LNSA 2HS6A 2QCNA 1W3TA 4HHPA 4IMCA 3L65A 2NV1A 3QPYA 4JICA 3OVQA 5K9DA 1JRBA 4UC5A 2Y85A 1I4NA 4IJBA 3PM6A 4Z1DA 5I3HA 1Q6LA 5C55A 3DKJA 2PRMA 4IMGA 3C52A 5HWNA 1NSJA 1W5QA 4KFOA 1SSGA 5EPDA 3VI2A 3NQ6A 4JYEA 1KFEA 5FEXA 3LLFA 1O94A 1OX4B 3CQ0A 3B4UA 4NX0A 3GK0A 1HO1A 4XKYA 2J88A 1J4EA 2QCLA 1H63A 4B5NA 2H90A 3EX3A 3G0UA 4K6AA 5DN1A 1XKYA 3GDLA 5F4SA 3D0CA 3A22A 4JDYA 4ONVA 4PCFA 4O18A 3PG9A 4AWTA 3MP5A 1OFQA 1PIIA 2CLKA 3HGSA 1R46A 4FHAA 4UFMA 1H7XA 4E2BA 1N8FA 5DBUA 1DBTA 3GYEA 4HPXA 4LS2A 3GXPA 5FEZA 2B7QA 4O57A 3MI2A 5HMSA 5LNWA 1K03A 4OT7A 2C16A 2ZYFA 4N02A 3CT7A 3LI0A 3M7WA 2X2GA 1KM2A 4IOTA 3WK0A 1TV8A 3CB8A 3L21A 5KZDA 3G1SA 3SIZA 2DZSA 3UYCA 1FCVA 3G1HA 3LX9A 4UCGA 4UMCA 4N9EA 5EY5A 1EEPA 1K8XA 2CLMA 3QJAA 1GWJA 4CQAA 2ZRZA 4S2BA 1K7EA 3MYOA 5G4EA 1OFEA 1B4KA 1YPIA 2Q8LA 1MSSA 4FX6M 1DVJA 4WOZA 3I7QA 3QRHA 3E49A 4JNMA 3SR7A 3O8AA 2E6AA 4NVTA 1OFPA 1RQEA 4JX5A 1QO2A 4UTUA 1WAUA 3ELFA 4PH6A 2H6RA 4JTJA 5LNUA 5HJLA 3HG3A 3HBLA 1XBYA 3UWZA 1QOPA 3N34A 4MZ8A 3QQ1A 1QPOA 4JTIA 1X7FA 2V30A 3GDRA 5KTLA 1GYLA 2GQAA 2Q3RA 3LHZA 4DO4A 2FB2A 3G1AA 4HN4A 4I7WA 1I2PA 4BF9A 3W7DA 4AMAA 2JGQA 2RHGA 2CLEA 3T44A 1XXXA 3B0VC 3NOEA 1YTKA 4A3UA 1KA9F 1GT8A 3W72A 4FB7A 5AC6A 3I65A 1TPC1 2G96A 2ZZ2A 2QCGA 4JR5A 1JJKA 3O6CA 1BEUA 1GTHA 3EKLA 2WSRA 3BV4A 1FXQA 3RLVA 3ZS4A 3PS7A 1DJQA 3C2FA 3MP4A 5LNRA 1IXPA 1QAPA 3DBPA 1VGAA 3MJYA 2A7NA 1FDYA 3BLFA 4MY1A 4YCOA 1R2SA 1MEWA 1T8XA 1W5NA 1TTQA 2V2HA 2Q3OA 4N4PA 2C18A 3G1VA 3M44A 3OHIA 1L2UA 3M0ZA 3UWYA 1E51A 1Q6QA 1IIHA 5KSWA 4O1BA 3C3NA 4M7SA 4PA8A 1DOSA 3B04A 4A2RA 5EMUA 3N9SA 1UASA 6ALDA 4K39A 2DZUA 2AAMA 2WV8A 1D3GA 5FEPA 4DBEA 3N2XA 3Q94A 5BMWA 3PBWA 3HG4A 2C19A 4NJJA 3W70A 2TSYA 2A7PA 2GVGA 3LXBA 1LBLA 3N73A 3S1UA 1L6SA 1QPNA 1M7OA 1TREA 4RZ4A 1UJPA 1B3OA 4GBUA 3NYZA 3NXFA 4UFKA 4YXGA 1HL2A 3DAQA 4O17A 4UTTA 4D2JA 2QKFA 1AL8A 4KKXA 3UXAA 2WNQA 1EX5A 2ZTKA 3B03A 3GAKA 3CM4A 4JXCA 3W7QA 1VHNA 1R30A 1G7UA 1JVNA 2NUXA 1JCMP 1FCUA 2ABAA 5D38A 4OBTA 4HT3A 3P5ZA 1KFJA 5AC8A 2WKJA 3TAOA 1OF6A 1J5TA 4AXKA 2QAPA 4MYXA 5G2WA 1DQWA 1ZFJA 4UTHA 3PBVA 4MFEA 3R13A 3WJWA 4OQVA 3LBMA 1ZHAA 3STEA 2GVJA 3U2OA 4NU7A 5G4WA 2WQPA 4QISA 4E2DA 4X3ZA 1DV7A 3KRSA 3HO8A 1WV2A 4RLIA 4UR7A 5E0KA 3CTLA 2J27A 1WBHA 1JCLA 4OV9A 3LRMA 3IEBA 1OVDA 3M47A 1W5OA 1W5MA 1TMHA 3ATZA 4MZ1A 4N2YA 3QW3A 3W88A 4FNQA 1GTEA 1TTPA 2CLIA 1THFD 2BXVA 3M5VA 5AHNA 3HG2A 4UNKA 3S9YA 2TPSA 1PCKA 3UD6A 2VENA 4LRTA 2ZQ0A 4KFNA 3V75A 2EHHA 2QCFA 1VYPX 2YYUA 3M6YA 1SR9A 3QSRA 4Q4KA 4I9AA 4TMCA 2WPBA 2JKPA 1F5ZA 3PUEA 1KM6A 1N55A 4BR1A 4DELA 4Z1AA 4WD0A 3IVTA 2Z1BA 2ZA2A 3B06A 4RXFA 3SGUA 1FX6A 5CPMA 2FDSA 3IIVA 3C61A 3F03K 3NG3A 1LRNA 3W23A 3GAYA 3NEVA 1TYGA 2X1TA 2A4AA 1H51A 2CLHA 4QSHA 1KBIA 1ADOA 2YYTA 1KTCA 1I8JA 4JY8A 4LUIA 3KAOA 3FEMA 3GDTA 1FDJA 1H7OA 3SI9A 3W84A 3NPVA 2VEKA 3EWUA 3NQVA 3OA3A 3VE9A 3KXQA 4DO6A 1ZAJA 2VFHA 2ZRVA 1P4CA 1XDLA 4K38A 1A5SA 3CIXA 2QJGA 3GZ3A 3I6RA 3DGRA 2DZPA 5L6UA 3SECA 4K36A 4CLMA 4J9JA 4FX8A 2BWGA 4K37A 3W7MA 2QJHA 5HUPA 1XFBA 1AW2A 3TXVA 3GR8A 5K2ZA 1SUXA 3GX9A 4YWIA 1SZFA 1YXYA 1W37A 1FWSA 1F6KA 4UTJA 4XTIA 2Y7DA 1IXOA 5EBUA 3W7LA 3NPXA 1PVNA 4UMAA 1HG3A 2FFCA 3DU0A 4IPJA 3TR2A 2O7QA 4ORMA 3A9IA 5DY3A 2XN0A 3P84A 3BO9A 3VKJA 3PAJA 1YDVA 5K4ZA 2GJNA 5CPLA 4E38A 1FXPA 3OG3A 2AQWA 5FF4A 3HJZA 3THAA 1XM3A 2Y70A 3W1PA 4O11A 3W7EA 5C5YA 3EX1A 2VFEA 1TB3A 5MHBA 1GG1A 3GIYA 2AGKA 3UPBA 4M6PA 2ZBTA 5HR6A 4WJEA 1VCVA 1MEHA 4R53A 2EF9A 3DFSA 3PF3A 3VE7A 1KM1A 4DF0A 3P61A 2VELA 2WNZA 3EX6A 5I3JA 2ZZ1A 3S5NA 1EPXA 3G8EA 1VQTA 3U6WA 3W7GA 2YFNA 3M16A 5C2XA 1JUKA 1LOSA 2JKAA 4UTTC 1JCXA 1SW0A 3TSBA 4UUIA 4NNCA 1EIXA 2V5LA 3PBYA 2NV2A 1SQ7A 3W2UA 3FOKA 4XTDA 4MY9A 1KFKA 5E1QA 3LHVA 1TPWA 3CWOX 4O8RA 4HSOA 4EVZA 3IGSA 2YSWA 4O53A 2FPVA 4XQ6A 2OZ0A 3WJZA 2NZLA 1VR6A 5DCDA 3NQMA 4W9TA 4ZQCA 4ADTA 4AHOA 5H2ZA 5KINA 1OX6A 1CI1A 4MVAA 2G97A 2YCEA 3BW2A 3UY7A 3B0PA 3AO0A 1SFLA 3HPSA 4NT0A 1UB3A 3DENA 4LT9A 5HWMA 1FQ0A 3NL5A 3G22A 1VHCA 1IXQA 1A5CA 2Y89A 1F2JA 3LI1A 1FCQA 1FDZA 3FYPA 2Z6JA 3A5VA 3C6CA 2ATMA 3PULA 1PE1A 1ME8A 4JTFA 1WYIA 5CZTA 2C6QA 1VCFA 1M7PA 1SO3A 3QMSA 1JQXA 4K8EA 3TXZA 3UWVA 3LV5A 1PHWA 2OCZA 1WXJA 1QPQA 3LGEA 4WY0A 3PY2A 3HOJA 1K7FA 4YMZA 3HGRA 5BW6A 2W0UA 2C15A 3P80A 3UWWA 3INPA 4CQ9A 3QC3A 4X9SA 1B4EA 2QCEA 3P81A 1EUNA 4MYAA 1G67A 3TC6A 1A53A 3G1FA 3T4CA 1FY6A 4WY0B 2ZRUA 1H1YA 3YPIA 4JD4A 4UMBA 1TO3A 5J5DA 1VZWA 3UZJA 3T55A 1Q6RA 3NQFA 3W2LA 4O1DA 1TCDA 1NFBA 2Z6IA 5HULA 3PBUA 2RDWA 4Z0JA 5TQLA 4NNAA 4ZL1A 2DZTA 3IVSA 1C9DA 5IBXA 2A85A 4HNVA 3C2OA 1KM0A 4QNWA 1PCWA 1KM3A 3G1XA 4O50A 3R89A 3LCGA 3TV8A 3ATYA 3LRKA 4I7VA 3TU9A 3A5FA 2PURA 4ZQMA 4M19A 5EL1A 3DFOA 1H5YA 4OU1A 3O05A 1VPXA 1QR7A 3M9YA 1VRDA 4Y96A 4HNTA 2CFFA 4CQ8A 1FCBA 2W6RA 4U4MA 2QCDA 5EA9A 3Q2DA 2P0OA 3W1QA 3W1NA 3E12A 4IUOA 4GUJA 1RV8A 3NQ7A 2VKZG 2XN1A 5D2YA 1OYCA 2JK2A 4O28A 3W7JA 3NL3A 1K8YA 4LNYA 4GXMA 2D73A 4GFSA 1SO6A 2E6FA 1R2TA 4N6EA 3S0CA 4CNPA 1R47A 3W7IA 4HKPA 1GYNA 2A5HA 5BOOA 3G24A 4FX7A 4TX9A 1TPB1 3O06A 3LTPA 3DFPA 2X16A 3EWYA 3DFTA 2WSYA 4XKYB 3HB9A 1LBFA 4TR9A 4AHPA 1ZAHA 2UV8G 1PS9A 4JTEA 1V5XA 2QUUA 3I7SA 4MUZA 3DZ1A 3U8GA 6TIMA 2TYSA 2WNNA 3M5ZA 5AYZA 2B7PA 3NQDA 1BKSA 5CGQA 1TSIA 1S5VA 4DF2A 1ZCOA 2Z2UA 4P2VA 4O54A 3LTYA 3W7OA 1H7WA 5HQEA 3ZWSA 3BK0A 5CZSA 4MZYA 3W76A 3OVRA 1O5KA 2NXGA 3RMJA 4GUIA 3EXRA 5BMXA 3ABQA 1GQNA 1TTIA 3N2MA 4BK9A 2R14A 5LHEA 1KTBA 4GWEA 1NF0A 1HTIA 3NZRA 1YXDA 1Z48A 3VFLA 2FLIA 4JTGA 4L4MA 1XDMA 1H50A 3MUXA 1NF7A 5I3IA 4Z1BA 1O5XA 1TPUA 4IX2A 3G1DA 2A21A 4GNJA 1SW7A 4O16A 1YLVA 3MBFA 4LW7A 5D30A 3S6DA 3PUDA 1G7VA 2YXGA 3L67A 3GB6A 3N9RA 5K9XA 3E0IA 1K8ZA 1MO0A 1DJNA 2E68A 4XBSA 1A5BA 3BW3A 3TNOA 1FUYA 2ZZ5A 2W79A 3LB0A 2OX1A 1DORA 1LCOA 2C0AA 1IF2A 1TQXA 3Q37A 4QAIA 4UTWA 2VFGA 2J9ZA 2PCQA 2V82A 2Y61A 4FIQA 4BI6A 3IIPA 1VS1A 5AHFA 1C29A 3EWWA 3W75A 1SU5A 4WXZA 5LZLA 1ZENA 2B7OA 1QOQA 4N6FA 1Q6OA 5CPOA 2VEMA 5CZJA 4XBKA 1K3UA 3BARA 2E5CA 1TPFA 3QEZA 3FA5A 4E0CA 3GVGA 4GUHA 2FIQA 2HSAA 3CLMA 2RDUA 1LROA 3L0GA 1JCNA 3STFA 4UFIA 2A6NA 2CW6A 3B0UX 2V0TA 1GPWA 1GOXA 2C13A 3NA8A 4Y9AA 3PSWA 2DORA 3KX6A 4LVAA 4MFDA 5LGXA 5AHMA 3WJSA 3MP3A 1LDCA 3O6DA 4O19A 3PR2A 4JTKA 3TA6A 1ZY9A 3IGUA 5IBXC 5D05A 4AWSA 1WOAA 5U7SA 3TC7A 4X2RA 1W3IA 2PRHA 4ZQOA 2ZRWA 3LCFA 1KFCA 3G1YA 3LERA 4LWWA 5AHLA 4LC6A 4JS3A 3VNDA 3UWQA 3LHYA 3E02A 3G0SA 4DPQA 1H7PA 4UTLA 3TMQA 3CIWA 4RCXA 4QJ1A 3L2IA 2I1OA 3ZR4A 1PHQA 3P62A 2OT0A 1J2WA 5GVJA 2NWRA 1TJPA 5I3KA 4R33A 4S1FA 3H53A 2ZDRA 4HNNA 1EP3A 3W1XA 5HWJA 1AMKA 4FNPA 4NX5A 1OK4A 1SO4A 3PC0A 5ABTA 4RR4A 1SZNA 2BSLA 2B4GA 3B8DA 1KFBA 4UR8A 5HNRA 5C54A 3EWZA 5D2TA 4IGHA 1A50A 3W7PA 4DBDA 3KRUA 3TW7A 4LS1A 1GJPA 2YZRA 3DXIA 4FIRA 5LSMA 4GRSA 2H3BA 1Q3NA 5J5RA 5D32A 3UXDA 3FLUA 1KTNA 2RH9A 2F84A 3Q58A 3H54A 1BWKA 2ZRYA 3F4WA 5DY2A 3FYOA 2FJKA 4OWGA 5D2WA 2R8WA 3BW4A 3NL2A 1GVOA 5F2MA 3T7VA 4FEZA 2Y88A 5DXXA 4K7YA 3GDMA 1TPVA 4QNEA 2ISWA 3UNDA 2R91A 3MBDA 5FEWA 2E6YA 3F4NA 5D03A 3QF0A 2NXHA 3L68A 4O13A 3L5MA 5KZMA 5HINA 1QCWA 3ANYA 1ONRA 4ZVJA 3TDFA 1YDOA 3LHTA 2X30A 5H91A 3MI6A 4JGDA 1WDWA 1G4TA 1D9EA 4MLJA 4ORIA 2QF7A 5D04C 1ALDA 3TJLA 1JRCA 3V1PA 3KVKA 3DH7A 3NR0A 4WOQA 4MKNA 1S3HA 1CW2A 2ISVA 2TMDA 2QR6A 1TTJA 4LVGA 4AHQA 1OYBA 4PODA 2CLOA 4CNNA 2NX1A 3RNDA 4UFHA 4M6QA 5AB3A 4LC8A 5U4NA 3TW6A 1GVSA 4UTWC 4PTNA 3IGXA 1W1ZA 4H3DA 3HQ1A 3S5OA 1RD5A 2DJLA 1DL3A 2PC4A 2EAWA 3PB0A 4LVFA 2OMAA 5AYXA 2G95A 2V81A 3CC1A 1YPFA 2E6DA 3TJXA 4NJKA 3ABOA 3NGJA 3L5LA 2GUUA 3NAVA 3NO5A 3W86A 4DPPA 3W7HA 4A2SA 4CCEA 3JRKA 4H6KA 2A2IA 4M6VA 3HPZA 1PL9A 3WK3A 3QSTA 4PFMA 1TV5A 4YLWA 4DQWA 5CG7A 5K4XA 3C2VA 5K9CA 5LGZA 3TUUA 4BWLA 2CZEA 1KV5A 1RQHA 1XI3A 3NQGA 4P61A 1F74A 4WX2A 2BX7A 3OEXA 4ADUA 2Y7EA 1SZGA 4LS0A 4JYDA 5FF0A 2GJLA 1LRTA 3RF9A 1WOBA 4KFPA 1F6PA 4WXYA 2CLLA 1KLZA 1LRQA 4FF7A 4PC8A 1OYAA 1M5WA 3EB2A 2ZTJA 4MPQA 2QCCA 2ZA3A 3EEGA 2JBMA 4JN6A 5AC7A 3JS3A 4TU1A 3I7RA 5I3FA 4LUJA 2TRSA 1SO5A 1VJIA 2O7SA 3LBCA 3M5YA 1YXCA 1FWWA 1L6WA 4RV8A 1OX5A 3W2MA 2DP3A 3FJ6A 5DELA 3CPRA 1ICSA 1MEIA 1D3HA 2F7FA 3MHFA 1P0NA 2E5DA 3GNNA 3GDKA 2H8ZA 4JTTA 4UIOA 3NM1A 1CX9A 3UQNA 4AH7A 3GNDA 1FBAA 3MHGA 3SJ3A 3S1WA 4UXDA 4CCCA 4OE7A 2Z0IA 2XFWA 3BLIA 4JTSA 3FS2A 5FESA 2V2CA 3TQKA 1YADA 3L0NA 1ME9A 1A5AA 3BG9A 1XBXA 4OHQA 1XL9A 2CWNA 2H8XA 3IIXA 3STCA 4IPIA 3TROA 4LVDA 4FNRA 5DCBA 1H7NA 3TQ0A 3W6YA 4N9CA 1QFEA 4Q32A 4O1AA 4FNTA 5K7JA 4NZJA 1SW3A 2ZZ7A 4O12A 3W7CA 1GG0A 2VOMA 4POCA 5KZEA 1W0MA 1G4PA 2Y7FA 4WY0F 3M41A 3IIZA 4AEOA 3CHVA 3S5ZA 1QPRA 4C1LA 4WUIA 3C2EA 2ATSA 3LDVA 1H60A 2B0MA 2ZA1A 3MMTA 3ABSA 1G4SA 4KWWA 4O0ZA 5BRBA 2HTMA 2A1YA 3EXTA 4GUFA 4NZFA 1AW5A 2JGYA 5DBTA 3W87A 5CSRA 1ME7A 1SFJA 2P10A 3TSDA 4LU0A 4DXVA 1S5WA 3B05A 3WFAA 5G2HA 1HFBA 1OFRA 3MWAA 3L66A 1MZHA 1LOQA 1GZGA 1LM1A 1VYSX 3W2NA 3O1NA 4QITA 2XN2A 1UUOA 5HR7A 3N19B 2ZRXA 4EF8A 1JCYA 3TAKA 3SY5A 3WK1A 3MHUA 1LZOA 3P8JA 5F1VA 3TIMA 3LTSA 3M1ZA 1QMLA 4IMFA 4JYFA 1IIGA 3TKFA 3LOTA 3L9CA 4GUGA 4JX4A 4RZ6A 3UPWA 4MY8A 2PRLA 4AB4A 3LCWA 3W1LA 5G2IA 3BGJA 5F1UA 3ZWTA 3P5YA 3LCLA 3NM3A 4FNSA 3C56A 3WJYA 5CSSA 3F1QA 2J6XA 4R7JA 5FF7A 3TCEA 1OX4A 3PB2A 3M5XA 5LHFA 4JIPA 5EYWA 5FF2A 1T96A 1LBMA 3K30A 4NXKA 1LORA 1S5TA 1V7YA 5D37A 4MJMA 1NEYA 5T26A 2VXNA 3CU2A 1FWRA 4JY9A 2B7NA 3I68A 4G1KA 2QCDB 1I45A 4ALDA 4O14A 1VLWA 3S8HA 1KFLA 2ZZ6A 3PSVA 1JUEA 4NQ1A 2JKEA 1UCWA 4BWLC 3LLDA 5SWUA 3C0JA 1YTDA 2VC6A 2VEIA 3BPWA 2EGZA 3O16A 1KW1A 3HGOA 4GJ1A 4UFLA 3GXNA 5K3VA 1I2NA 1T99A 5CKSA 5IM51 2GOUA 1VC4A 4ADSA 1IGSA 1XCFA 3HPXA 4Z08A 4TO8A 1ICPA 3LM7A 1UBSA 4H4IA 1EWDA 4FXRA 5AOUA 1RZMA 4GE8A 3W1TA 4Y90A 1OFDA 1JCJA 4EIVA 3N14A 3W9ZA 4LY8A 2V5BA 5G1TA 5F4XA 3QMTA 1F73A 1DHPA 7TIMA 3WK2A 2BLEA 1ZALA 4O4VA 2J24A 2Q8ZA 1ZNNA 4X22A 2E77A 4QIUA 2NXIA 3WJXA 1T0OA 1IXNA 1TPEA 1XC4A 4FXSA 1X6UA 3NPUA 2YR1A 1BWLA 3QW4B 1Z41A 3S5YA 1NAL1 3CEPA 2J9XA 1F7BA 2RDTA 1OHLA 2WO5A 3PUOA 1H7RA 3DI1A 4EWND 3W71A 4JTHA 3LV6A 2OJPA 1X1OA 3O6YX 1OF8A 4I7UA 4A29A 1H1ZA 1K02A 2CZDA 1U5JA 5FI8A 3P8IA 4UNLA 3KFTA 5AFDA 2YFOA 2YDAA 4IX0A 4ML9A 3ZFHA 4UTIA 3S42A 3HF3A 3BG3A 4MIMA 2GPTA 5AN7A 5D2XA 1LOLA 4A22A 3QPZA 2YX0A 3FFSA 2CZ5A 1FWTA 3PWAA 1GVFA 3SW6A 3P82A 2Y63A 3KVLA 2ZFAA 3NQEA 3W1UA 1AW1A 4OGZA 1JQVA 1M6JA 3R5EA 1N7KA 4CCDA 1LYXA 3W2KA 3IIOA 3A21A 1KM5A 1O95A 2QUTA 3W73A 4O1CA 3NNTA 1KLYA 1GEQA 2ISSA 4IMEA 3RU6A 3E9AA 1RR2A 4IWWA 1NVMA 4IMDA 3EWXA 1TRDA 3T40A 3P60A 1LLWA 3DKLA 1L6YA 3HGJA 4HPJA 5AHEA 5KITA 1H61A 1OG0A 4NJIA 3W1AA 2V2DA 4M5PA 2QCHA 5DXYA 3W07A 1JR1A 3DHDA 1OFOA 4N4QA 3LCHA 4RJEA 3TK7A 1H62A 3EXSA 4K7VA 5F2IA 3P67A 4ZQPA 1RQBA 1I2QA 3MI3A 4RZ5A 1EUAA 5A8GA 3QFEA 2QJIA 3UZ5A 3FKRA 2G5WA 2A0NA 3GXTA 3G3DA 2RKXA 3PG8A 3O15A 3NQAA 4M7TA 3N3MA 3PVFA 1YYAA 4UTMA 1QDSA 3A23A 3O07A 2NX9A 3A24A 5AHIA 4RX0A 2NLIA 3THQA 4O0KA 3LXAA 3FJLA 1LLZA 3LHWA 3VCRA 1U83A 1ZJIA 2GQ8A 2C3ZA 3P7YA 1QNVA 4ICNA 5G5IA 1ML1A 4C1KA 3GLCA 1TIMA 3CWNA 5LNVA 3SGZA 1R2RA 2FPTA 4BI5A 2NX3A 3HG5A 1KV8A 2BZNA 1G6CA 3EX4A 3GKFA 1K7XA 4U28A 3USBA 3G0XA 4LV9A 4JIQA 1W54A 3SZ8A 3RFAA 4MLRA 1GVQA 2H3DA 3KOFA 2J9YA 2ZZ4A 2EPHA 3W7RA 1JUBA 3TE9A 4O10A 2QCMA 1LTDA 4ZQNA 3GR7A 3IVUA 4GC4A 2NUWA 5DCEA 2VFDA 3ABRA 3DI0A 4XWUA 2GVLA 4A21A 4NJHA 4QQ3A 4ZMGA 3RLUA 1KM4A 2P1FA 3R2GA 2VEPA 3KHJA 3W83A 3STGA 4WZHA 3TSMA 3TX9A 3NVTA 2ZCGA 4AVFA 1O60A 3R12A 4K8HA 5FF3A 1I2RA 5KMYA 3W22A 4MJZA 1TV7A 1VLIA 2GQ9A 5A5WA 8TIMA 4YCPA 5D02A 2WSQA 1ZAIA 5BNKA 2VFFA 4LOCA 5DLCA 4JDBA 1TRIA 4PL2A 1XBZA 5D09A 4OV4A 4AF0A 1HUVA 3AJXA 2DU2A 2DJXA 2Y6ZA 4LV4A 1PV8A 1SZEA 2WJZA 4PEKA 5LKYA 1W8SA 3L5AA 1OFBA 2QAFA 3BGGA 1XUUA 2CU0A 4LTSA 5G1YA 4QM1A 3W85A 3OIXA 1TPDA 4JTLA 4BFAA 1G69A 2ALDA 4L4LA 4FNUA 1OFAA 4AF0B 2I14A 2YPIA 1C8VA 4HIBA 2E1DA 4XUGA 2QDGA 3S1VA 5F4WA 2E09A 3QMRA 3BG5A 3TFXA 3DFNA 1W31A 1X1ZA 2PE4A 4IXXA 4XZ9A 3W2JA 1RVGA 1KBJA 2YW4A 2FTPA 4DF1A 3MW7A 2A6LA 5CZ0A 4EOUA 2NWSA 3QYQA 4IQLA 5EKYA 4NJGA 1F05A 1GVRA 2DZXA 2ZZ3A 1EB3A 3OVPA 1VYRA 2WOQA 3OBKA 3T78A 4JEQA 4UFJA 5TBOA 1Y0EA 1L9WA 3NQ8A 1AG1O 3DHFA 3FIGA 2KZHA 4DEFA 4LRSA 2DZWA 3C4UA 2DZVA 4JTUA 3W7NA 3E96A 3LRLA 2X1UA 1QO5A 5F2GA 1AL7A 3IRDA 2QUVA 3LCXA 1B9BA 4JX6A 1EP1A 3NQCA 4CNOA 3UY8A 2C1HA 1P5BA 3G8RA 1LP6A 1EA0A 2FPYA 3EKZA 2BTMA 1Z44A 4S2CA 3SFKA 2C14A 1P0KA 3CEUA 3KVMA 1YDNA 1O4UA 3HMJG 1WA3A 4Y8FA 3QM3A 4HSNA 3TH6A 2V9DA 2VFIA 3BVJA 4WQ6A 4Z1CA 3O63A 3BLEA 4EF9A 1P1XA 4AAJA 1ICQA 1X8FA 4UTKA 3S1XA
chains in the Genus database with same CATH superfamily
1Q45A 3M43A 2XVGA 1D8WA 2INZA 3CH0A 4K1WA 1A5NC 3SSJA 5D33A 5E0FA 3BMVA 4CUCA 4DI9A 1VBJA 4IQDA 5E93A 2YXOA 1TQJA 4IIDA 2FHBA 4GNVA 4H1ZA 3NZ1A 5TIMA 1A5OC 2XJ7A 4DLFA 5CPNA 1WQ5A 5I5RA 3QY7A 1EWEA 5LIKX 5CJ5A 3VGHA 3S83A 2YGYA 1GOKA 2X1SA 4D6CA 3KRZA 3KVJA 3SEPA 4XSLA 1OK6A 3DG3A 5IHSA 3TFCA 1OB0A 2NLYA 1V3JA 2Y7GA 3N04A 4A8RA 2ONEA 1SSDA 4TIMA 1RK5A 4GZ7A 3HIJA 4N9DA 2EKCA 2Q01A 3LXCA 5HUOA 3RITA 4LANA 1XUZA 1L8NA 3CMJA 3IWPA 1WKEA 1T6MA 1IT7A 2OO0A 3IGHX 5BXSA 4PULA 2AL2A 3SN0A 1J79A 1FHDA 1KWKA 1UD5A 4LPCA 1UMLA 4Q33A 3FAXA 2HVOA 3VGDA 1W5PA 4O4WA 2V8ZA 3CL8A 4XAZA 1FWNA 3ZM8A 4YVPA 3R8GA 3NCOA 4TMBA 3WUGA 5C7HA 1UKTA 1JULA 2QCNA 3HN3A 2PWDA 4P8WA 3NJ3A 3VOHA 2RJGA 3ZR5A 4UC5A 3BJTA 3VZYA 2IXUA 1H09A 1DJXA 3C86A 1VFTA 1UWRA 2PRMA 3CUGA 1FWCC 5XIMA 3C52A 4PB3A 3LQLA 4WK9A 5C9XA 3H2AA 4Q4PA 5FJRA 1KFEA 4O8AA 1TG7A 2O0TA 4NX0A 1KR0A 4XKYA 2J88A 1J4EA 3EA2A 1GOOA 4GIYA 5AKQA 3V16A 3NSNA 1V6YA 3D0CA 1EXBA 4WEVX 4PCFA 3NURA 3MP5A 1OFQA 1PIIA 1DP0A 2F2KA 1ONEA 1TWSA 2DY3A 4FHAA 5PTDA 4E2BA 3QHMA 1SVDA 2ADAA 4I9JA 1DBTA 4HPXA 3RX2A 3GXPA 2WHKA 4QG6A 5FEZA 1ZCCA 4IFKA 3MI2A 5A8QA 2WXDM 3K2GA 5FJTA 4N02A 3CT7A 3KDOA 2FHFA 4H00A 4GY7A 1TV8A 3L21A 2XWEA 1PZ3A 2VVNA 5HNTA 3SIZA 3SURA 3UYCA 4M6UA 1HW6A 4DM2A 2WAGA 4OTKA 5HQMA 2P8CA 5IFPA 2JF7A 4YN5A 5EY5A 3N11A 1QOXA 2CLMA 4W85A 4CQAA 4HK6A 2ZRZA 1K7EA 5G4EA 5BRQA 2Q8LA 2J8TA 4FX6M 1DVJA 4JNMA 1C93A 1RP8A 4QE5A 2CWXA 4DJFD 3FA3A 5LNUA 1R0MA 5HJLA 3VIPA 3AYRA 1M7XA 1QOPA 1UWUA 3SCSA 3QQ1A 4E4PA 4JTIA 1XYMA 3WKZA 5HOSA 4S3GA 1GGOA 4I7WA 4S38A 3W7DA 3T44A 1XXXA 4KEVA 3NOEA 2QPUA 2C1IA 4A3UA 3W25A 5AC6A 3W72A 3E0LA 1TPC1 3TYEA 4EWJA 4TVCA 5D9MA 2X09A 1EBHA 3U7VA 9XIMA 1MDLA 4PCNA 1DJQA 3MP4A 5LNRA 3GTXA 1QAPA 4LB4A 1HL8A 3BLFA 4MY1A 4AZ7A 1TTQA 4LSBA 2Q8XA 4GXPA 1XDJA 3CZGA 2G8ZA 1V3IA 2OU4A 3G1RA 3M44A 4KQNA 3S2NA 1P43A 4ERGA 3PTDA 2A3BA 4I9MA 1IIHA 4M7SA 1UUQA 3WLNA 3VIOA 5M3WA 1AODA 5LA1A 4A2RA 3VMOA 3CUHA 2FKPA 2OEMA 3H22A 4Q8WA 4Y7EA 4QDWA 5A8OA 3VNIA 4PUDA 3TP4A 5BYWA 4LB3A 4PRWA 3AIQA 2A7PA 3RYSA 5I09A 4AD5A 3LXBA 4GQBA 2O9RA 3N73A 2PWHA 4JHZA 3PWIA 1TREA 3NWRA 1B3OA 2AKMA 4LEQA 3NXFA 1IHIA 3UZZA 5A2CA 4ACYA 4UTTA 1ENUA 1M03A 1AL8A 4KKXA 3UXAA 3CZEA 1UH4A 1UZ1A 2ZTKA 3ITYA 4HGXA 1R30A 1G7UA 1JVNA 2WVVB 2ABAA 3MV11 1FH7A 4JTDA 4I5XA 2Z24A 3VNKA 3TAOA 2XGIA 1OF6A 2XDFA 3WDJA 2J25A 3OBEA 3WJWA 3LBMA 1ZHAA 4B2DD 2PGFA 2BV9A 4UZSA 3WN6A 5HPOA 4E2DA 4GYPA 3HO8A 3RGTA 4JFWA 1VFOA 4GBDA 4IMAA 1OZMA 5E0KA 2DW7A 2UY3A 1XSIA 1EIBA 3THUA 1YNYA 4OUIA 3T9PA 3ATZA 2VCBA 1O5RA 2OQLA 3M5VA 2TPSA 2BY3A 3TN5A 4HMEA 2PDGA 4S3KA 3N4AA 2ON3A 2ZQ0A 2X42A 2EHHA 5E5CA 2XGZA 3M6YA 4GVHA 1F3EA 3A3XA 2REQB 3IVTA 2G3FA 2VDHA 4Q8VA 4QDPA 4QXIA 2ZA2A 3B06A 4NZCA 3UZXA 3NG3A 4URIA 3ARPA 5HXMA 4KETA 1TYGA 5I3DA 3FW6A 3MV01 3EOSA 1XIDA 3GG7A 1KTCA 3VNJA 1W3KA 3GDTA 1HP4A 4QHRA 2GDUA 1E9IA 1AQFA 3NQVA 3VE9A 4FR1A 3CZJA 4XSMA 3KXQA 2J6VA 2VFHA 2XFYA 1RJQA 4F9JA 1M04A 3RO6A 1JG9A 3SECA 4K36A 3R0DA 4LGXA 4J9JA 1L6GA 3W7MA 1K9EA 2QJHA 3B3DA 4YHGA 5A6BA 3OODA 3TXVA 1RY8A 1SZFA 2R1MA 5AY7A 3II1A 1UR4A 4GNKB 4V1XA 1FWSA 1IXOA 2J78A 3W7LA 1MW3A 3NPXA 5DF0A 5C2GA 4UMAA 4IPJA 4KWUA 4P7NA 4B5WA 3FNDA 1BFNA 2O7QA 4ORMA 4D6HA 3P0WA 5DY3A 5E6ZA 3ITTA 4ZTYA 1MXDA 3APYA 3BAXA 3ZVIA 5K4ZA 2GJNA 2BHYA 2XH0A 2FGLA 4E38A 1FXPA 3BJSA 3CMFA 3PTMA 4ICMA 4WDTA 1DIKA 3THAA 1XM3A 3VFCA 2Y70A 4AIEA 3B9OA 4XG1A 4ILSA 3GFYA 2XM1A 4DB7A 3EDJA 3V35A 2QIIA 1X38A 1MW1A 3UPBA 2ZBTA 4WJEA 1LUCA 1HNYA 3GC2A 2ESCA 4R53A 2WANA 4DF0A 4JOMA 1RJRA 3S5NA 2G3IA 4QE1A 1ISYA 3W7GA 4CD6A 5C2XA 4UTTC 3GRIA 2DZAA 4GQQA 1WXYA 1SQ7A 4C6IA 4XTDA 3FN9A 1FFRA 1J93A 3I10A 2V67A 4O8RA 3QTPA 4S3CA 1REQA 3QGVA 4ZE5A 4QR6A 4CD8A 4O53A 5EMYA 3OGSA 4CN4A 2QW5A 1P6WA 5HJYA 4ROQA 4GXWA 4DYJA 1E6NA 3BOXA 4UB9A 3VX1A 4ADTA 1KKRA 4GYPC 3VD9A 3UY7A 3AO0A 1SFLA 4NT0A 4LT9A 1FQ0A 4NSBA 4B90A 1FDZA 2DH2A 3FYPA 3SADA 2IKHA 2NV9A 5DANA 3AS0A 1MXGA 3JZUA 4DBWA 3L4XA 3ID7A 1SJDA 1SO3A 4L9YA 1HQTA 4I6KA 3LV5A 3C0SA 1PHWA 2FH8A 3WG6A 4XD5A 1TR9A 4HOZA 4H9YA 2W0UA 3CAVA 4MF4A 3INPA 4ZOCA 4X9SA 1B4EA 4E3TA 3PJTA 4TQTA 1W9PA 3WD2A 1G67A 5FD0A 2PTZA 3CV2A 2DDXA 4PBEA 4YU1A 3T0DA 4NILA 4WY0B 4F0MA 5J5DA 1TO3A 5I00A 4GACA 3TYBA 1G0CA 4QSFA 3OGVA 5CEWA 4M3PA 1Q6RA 3UXIA 3PZGA 2ASHA 3R58A 2Z6IA 5TQLA 2Z4GA 2QPSA 5IBXA 2A85A 1QUMA 3C2OA 1R8LA 3VOCA 1KM0A 3CUIA 1IR2A 4IFRA 3E0FA 4NZ3A 4O50A 2ZXAA 4R7WA 4JQ1A 4I7VA 4ZQMA 3WQGA 4BQ2A 1UW9A 1ZJAA 5EL1A 3SCWA 1H5YA 4OOZA 3FVDA 1AQMA 5TF0A 3UR2A 2CFFA 2W6RA 3BCDA 1QHOA 4KEUA 4A8LA 3E12A 1UBPC 3AXXA 4BQ3A 2TAAA 3NQ7A 5CBIA 1WDPA 4O28A 5JXQA 3AALA 4ERIA 1SO6A 2E6FA 5IFTA 3P3BA 2BB0A 3S0CA 5T91A 4XBJA 4J27A 4JQ4A 1RCXB 1W1VA 2VX5A 4GQRA 2A5HA 4NI3A 1QT1A 5F7UA 4W87A 5DFAA 3O06A 1UC5A 5BOFA 4L64A 1QBBA 1IT0A 4LUTA 2VZSA 5A6SA 1EYEA 1U1HA 1PS9A 2YOCA 1W17A 4IZGA 2BY0A 6TIMA 2TYSA 3M5ZA 1W9BM 1ZPTA 1BKSA 1TSIA 2Z2UA 4O54A 3LTYA 3BK0A 1PO9A 1BYDA 2HJPA 4QCEA 4MJ2A 1GQNA 3NEHA 5IDZA 5IRPA 1HTIA 3NZRA 1YXDA 3DYPA 1XG4A 3WUFA 2PU1A 2PP0A 3BSGA 3L23A 2WB5A 4L4MA 4KPLA 4DJEA 3MUXA 4IL2A 4CQDA 4GNJA 1SW7A 3FDKA 1CEOA 5A6LA 4LW7A 1B5TA 1G7VA 1WKFA 2YXGA 5C9ZA 1VFSA 1V3HA 1K8ZA 1MO0A 1SJBA 4HBKA 2JIEA 3DBNA 2VEFA 2ZZ5A 4INFA 3WLQA 1HKJA 1JI1A 4GO9A 1LCOA 1A0DA 2C0AA 1IF2A 4KRTA 5M5DA 4QAIA 3VDGA 4FALA 4UTWA 5LIXX 2PDHA 2V82A 2Y61A 4N0RA 2GGJA 3ZSSA 4Q7BA 3EWWA 1OGSA 3AUJA 1SU5A 4WXZA 3TTYA 4JAWA 2B7OA 4DVOA 1PKMA 1NARA 2VEMA 5CZJA 3H2OA 2EPMX 2PDWA 3BARA 3RILA 4H9TA 4EPDC 1D7KA 3FA5A 1G5AA 3UT0A 4H8VA 3L0GA 3STFA 3B0UX 2MNRA 1DHKA 3P2VA 4GQ0A 1MUMA 2GUYA 1RAKA 3TA6A 1YBQB 1ZY9A 3IGUA 5IBXC 5HK4A 2VQUA 4XZMX 3WFZA 2WCAA 5U7SA 2W3ZA 3PNUA 3TC7A 2PRHA 3KWXA 1OC7A 3KBNA 4LWWA 2ACRA 4UCFA 4JS3A 4ZO6A 4L4OA 1WNOA 3VNDA 3LHYA 3G0SA 2ZX9A 3TMQA 1YE4A 4KH2A 4QJ1A 1PHQA 1A49A 3RM8A 3RCYA 1GOMA 1TJPA 1TE1A 1BSIA 2ZDRA 3TOPA 4HNNA 3W4RA 2D3NA 1XH2A 2W4XA 3W1XA 3I3DA 1XSJA 1JYWA 2PP1A 4FSAA 3B8DA 1KFBA 4Y9PA 1NU5A 3IJ8A 4K1GA 5C54A 3EWZA 4YVVA 1X6LA 2XU2A 1A50A 3KRUA 3M0KA 4D6EA 3H7VA 3TW7A 2J7BA 3RM4A 4KWOA 4I5RA 2YZRA 2GWGA 2PDMA 2VC7A 4GVFA 1XFCA 3UXDA 1UH2A 4PB5A 4EANA 2VDIA 3Q58A 2NW0A 2ZRYA 1Y5XA 2IQ0A 1I1WA 4W7UA 3HFTA 1HKWA 2R8WA 1GYMA 3WLIA 5F2MA 3L2MA 1KCLA 1TPVA 2NQ5A 2EG6A 3F4VA 4GHRA 3UNDA 2R91A 2HRWA 3WNNA 3F4NA 2NXHA 1DEDA 4LYRA 3ANYA 1D7FA 1ONRA 1EC7A 2E7FA 4GKLA 1E72M 3TDFA 4DJEC 2VJXA 3LHTA 4ZOEA 3MI6A 4JGDA 4XAFA 1JI2A 2WK2A 3KOWA 5HMEA 3QGAC 3WF0A 1C8QA 4FOKA 3VIIA 3EAUA 3KVKA 3B8WA 1S3HA 1JCTA 4DAFA 2DIKA 2DQXA 4NAFB 2AMGA 2CEQA 1L6FA 4PMVA 3E2SA 3DN5A 1TWDA 4M6QA 4LC8A 4UTWC 2DZBA 5E9XA 2J8GA 4H3DA 1RD5A 4ZA0A 1MNZA 3PB0A 1MW2A 2OMAA 5AYXA 1YPFA 4DUWA 3NO1A 4DJDC 3NAVA 4FLQA 1E56A 1DIEA 3W7HA 2GVEA 3E2RA 3U57A 2QUMA 4CU7A 1PL9A 3U9IA 4JFTA 2GLKA 4YLWA 4ZO7A 4NZ1A 3AJ7A 3WCZA 4C6PA 3SRHA 3G77A 4AD3A 2PZ0A 4QROA 4CN6A 1KV5A 1XI3A 2X40A 3KOZA 3OEXA 1E0TA 2OFJA 2Y7EA 2JALA 4LS0A 5ENLA 1TKKA 1XYZA 1LRTA 2VURA 4L61A 3AIEA 4UZUA 4KFPA 2AL1A 4PC8A 4HHMA 3EB2A 4MPQA 4Q4QA 1Q8JA 3K1GA 4JN6A 2O7SA 1V6VA 1XRVA 1XISA 3ZT6A 1YXCA 4QAWA 2DP3A 3A13A 3AU2A 2FDMA 1KRAC 2GQ3A 3I4EA 1TWWA 4RNJA 3VTRA 3VDHA 3GDKA 3TC3A 4JTTA 1F3XA 3AIUA 1QNPA 3W38A 4AH7A 1FBAA 1MQPA 3S1WA 4UXDA 2R1PA 2AAAA 3L4ZA 4OE7A 2XFWA 1FH9A 3FS2A 1ISVA 3ISIX 1YADA 1ME9A 1CT5A 1BVZA 4OHQA 4J2MA 3QFWA 3TQ0A 4NHVA 1QFEA 4AIUA 1RBOB 5K7JA 2HEJA 4OBRA 1GG0A 1DWFM 1W0MA 4MB1A 3RU8X 2Y7FA 3M41A 3IIZA 8CGTA 5MF5A 3UVIA 3C2EA 2B0MA 1V08A 1KCKA 1G4SA 1GZJA 3QGKC 4O0ZA 5BRBA 1E55A 2XIQA 1ISWA 3W87A 5AVHA 3AS1A 1ME7A 1SFJA 3N1AA 2P10A 4DXVA 1S5WA 3B05A 2G3MA 2WKGA 2I16A 4NKCA 1HFBA 1NFPA 3OQ8A 1GZGA 1LM1A 1PIGA 4QITA 1S38A 5T9BG 2F2HA 2ZRXA 2NQLA 3TAKA 4FLRA 3WK1A 3M64A 3MHUA 1B3YA 1R5YA 3P8JA 3N2CA 2C8NA 3LTSA 3SUVA 1RVKA 1IIGA 5ABFA 1OG6A 3SFWA 4RZ6A 4JX4A 4MY8A 4R27A 1DJGA 4MNJA 2PRLA 4QJ3B 1NH6A 1Q7MA 1Q4WA 2PBGA 1I9CB 5G2IA 5F1UA 3ZWTA 3LCLA 3TYCA 4PB4A 4QS5A 5FF7A 3PZ9A 4DIAA 1T96A 1LBMA 2VR4A 3CL7A 4NXKA 3V0SA 3QR3A 4J3TA 1G01A 4GZIA 3KHDA 4W86A 2VT0A 4IIEA 2PDIA 3LBOA 4G1KA 2PDKA 3L4YA 1TUFA 1W1TA 1KFLA 2ZZ6A 4H8UA 3EDFA 3PPHA 4NQ1A 2JKEA 1UCWA 3VCCA 5AC5A 2VC6A 3D3FA 2WM0A 4DWDA 3HURA 4OUEA 3K8LA 2XHYA 2Y0FA 4AEEA 4UFLA 4BF5A 1OEPA 4KF1A 1I2NA 3ARVA 5IM51 4B5UA 1FKWA 2J7CA 4US5D 4J5NA 4ADSA 2VCAA 1XCFA 3ONBA 1AA1B 4H4IA 2A3AA 3VA8A 1AQHA 2IS7A 3W1TA 1IEQA 2RUSA 3B9NA 4Y90A 5M03A 5JBDA 2OB3A 1JCJA 4EIVA 3MANA 3W9ZA 5G1TA 2XIBA 3ES8A 3MY9A 4I8YA 2J66A 4V33A 1I60A 2EJ1A 4OIFA 5DMNA 4A3RA 1K6WA 4H83A 4R7OA 1XLLA 1ZJHA 3M0XA 1X6UA 3NPUA 1BWLA 3S5YA 1Z41A 1NAL1 4YTRA 2ALRA 2J9XA 1H7RA 4JTHA 2VZVA 4TXEA 2QVHA 1OF8A 4KEZA 2Z25A 2WZEA 1V6XA 4AZ5A 2GWNA 3KFTA 1J0ZA 3NTYA 3IJDA 3GU9A 1YKWA 3GHUA 2PP3A 3S42A 1J6OA 1NQ6A 3TYAA 2VRQA 3ALGA 3BG3A 4BQ5A 3CK5A 5BU6A 5D2XA 3GTHA 3M0VA 2Z1WA 2YX0A 1FWTA 4D8LA 1P7TB 1GVFA 3SW6A 2Y63A 3W1UA 1AW1A 4OGZA 2PLCA 1JQVA 2I57A 4CCDA 2F61A 2YDRA 3DESA 3VKDA 1GOWA 1LYXA 3IIOA 3A21A 1Q66A 3OLGA 3UP8A 4DBSA 3NNTA 2VOTA 2FGZA 3RU6A 4IWWA 3AHVA 1TRDA 4XIAA 3DKLA 3U3HA 1L6YA 5G1MA 2VZUA 3S2LA 5JBEA 5AHEA 3LPGA 1JIBA 2EEXA 1EF2A 2V2DA 2ACSA 3V1HA 1YHTA 3VMPA 5H1WA 3N29A 4MADA 1V8EA 3H2CA 1OFOA 1JAEA 2XZ9A 1H62A 3DC0A 3EXSA 1M7JA 4K7VA 3STPA 4EXQA 4HPNA 1KB3A 1P48A 4ZQPA 4DBUA 4Q3MA 2YA1A 1I2QA 3MI3A 1LQ0A 2R1NA 4RZ5A 1EUAA 4U2YA 5ABHA 4JIIX 5A8GA 7REQA 3FKRA 2ZXBA 5MKGB 2Z7KA 4K2SA 3NUKA 1C7TA 3PVFA 3AHTA 4RW3A 2EG8A 1N2VA 3SCUA 2Z1SA 3BSHA 4RX0A 1AQ0A 2XSBA 3LHWA 2W63A 3VCRA 1JEZA 3R79A 5I77A 2AOSA 2X05A 2GQ8A 3P7YA 1JZ7A 2ZX5A 1QNVA 4ICNA 2JEQA 1W91A 1M68A 4M1BA 5CLWA 3SGZA 1R2RA 2FPTA 2BBFA 3W01A 3CV1A 2MANA 3SB0A 3TTQA 3NDZA 2POZA 3USBA 1FH8A 3JZEA 1GVQA 1I0DA 4MLRA 3WF1A 3F5LA 2CXGA 1TVNA 3UCQA 1DQUA 3BQ6A 1J5SA 1JUBA 1QI0A 2C7FA 5TNVA 4DWSD 2OR2A 4PBGA 3SJNA 3UR7A 1HN1A 2AMXA 1F07A 3IK4A 1W6TA 1Z89A 3M0LA 3R6IA 2O56A 4ZMGA 3RLUA 3URNA 4Z2HA 3W83A 3STGA 1XRFA 1EJRC 3A4WA 4Z17A 6REQB 4S39A 4AVFA 1TVLA 4BQ4A 2WSKA 5KMYA 5JMUA 4TX8A 4IG2B 2CBIA 1HJSA 2X7WA 7A3HA 3SY1A 3M46A 4PCSA 5A5WA 2WSQA 3W24A 1XYBA 5ECUA 1XLBA 2UWFA 1ZAIA 2G4FA 3OA5A 4LOCA 5DLCA 2BMBA 4A6GA 1H11A 1B31A 4OV4A 1BG4A 1BVNP 1E9ZB 1HGYA 1RK6A 2DJXA 2Y6ZA 1C90A 4LV4A 3PJWA 3OHMB 4PEKA 1W8SA 3WD0A 3H6OA 1OFBA 1EJUC 4YIWA 4LTSA 1EH9A 4HMNA 4QM1A 5CCZA 1YMYA 2ALDA 2D20A 3ZSTA 2WNWA 2YPIA 4HIBA 2YL6A 4LUSB 3TYDA 3GFXA 2QYGA 2E1DA 4ASTA 3EKGA 3PZQA 3QMRA 4A8NA 1BRLB 1QI5A 1VPYA 3DFNA 1X1ZA 4AD4A 3ITCA 5BROA 3S6TA 3FEQA 4XZ9A 2Y1HA 1YW1A 4C1NA 5CPQA 3THCA 3WDIA 2YW4A 2FTPA 4REQA 2VRJA 1F05A 2I17A 3A9BA 2R82A 2WOQA 4HA4A 3OBKA 4JEQA 3HZ3A 4HYRA 4UFJA 3NQ8A 2WVSA 1AG1O 3FIGA 3REQA 5JH2A 4J3UA 1BPLB 1TIWA 3E96A 4HYVA 3LRLA 4ML4A 4F48A 4DWSB 2QUVA 1NWRA 1EP1A 1UR1A 2AGTA 3BQ5A 1LP6A 3EKZA 4S2CA 5CSYA 3TWBA 4YTSA 1ZP3A 2C14A 5C70A 1YDNA 1M53A 1BD0A 3VIGA 4HSNA 4BY3A 4ZOAA 2VFIA 1JZ5A 3TJIA 2KAUC 3OLIA 3O63A 3GG8A 4UR9A 3BLEA 3UCDA 4EF9A 5C9WA 1P1XA 1PDZA 2FZ9A 3VGEA 4MKSA 2Z28A 4QGCA 2MUCA 2QGHA 5I3GA 5C6MA 3S2MA 3W7KA 4R34A 3QH2A 4ZQRA 5TD4A 2XM2A 1C91A 1HJQA 3ZVHB 4J7RA 3DFQA 4KWVA 1F76A 4XZIA 4MNKA 2BS9A 3AMCA 3U2ZA 3L4UA 3CAWA 5CJNA 2I9EA 3QQ0A 5F2LA 2QJNA 2CZFA 3NXLA 3VUPA 2FTWA 1XYCA 2RFGA 2IQTA 1AK5A 1RPXA 1TJRA 4AG0A 2YBUA 1EOMA 2V3DA 2UY4A 4YL2A 2ZUVA 2PWVA 2NVDA 2OOGA 1W56A 3QZEA 3NPWA 3C8FA 3P6LA 1EP2A 4AY8A 3LCIA 1XV8A 3GFZA 1FWGC 1JDEA 1DQXA 3GC5A 1RCQA 1YX1A 3EX2A 1VCGA 4AWUA 1UZHA 4J3XA 3C2RA 2ZKMX 1LL6A 4Z2JA 3IK2A 4QP0A 1V6TA 5L9FA 2E67A 2FQIA 1Y65A 2D23A 4H7CA 3AUOA 4GLEA 1UOKA 3VGGA 3GKAA 4RK8A 2HS8A 3UWUA 4CVUA 4Z0SA 3MO7A 3PJUA 3M07A 2NUYA 1VAHA 3MZNA 2R94A 4HZ7A 3R8RA 1P1MA 4LF1A 1G4EA 3P74A 3GYCA 3RPDA 5LNSA 1Q85A 1W3TA 4HHPA 4IMCA 4U3AA 2NV1A 3QPYA 1MUCA 1PTGA 4JICA 1IV8A 3OVQA 1JRBA 1JXJA 1XIEA 3ITVA 1XH1A 4IJBA 4HNCA 3CQIA 4G7FA 3TZFA 5I3HA 5IHRA 3LG3A 4IMGA 3QHNA 4WDUA 4C6JA 3LUTA 3VI2A 1J10A 1R3VA 4RUBA 1OX4B 1XLIA 3APGA 3CQ0A 3B4UA 2QCLA 3EX3A 3T0BA 2Y5EA 5DN1A 3MUCA 3HQNA 3K8KA 4O18A 4FS9A 3I6TA 3B9EA 2PZNA 1R46A 4CQBA 4B9ZA 1H7XA 2C71A 3VD7A 1TVPA 4W8LA 3TTEA 3GYEA 1R9XA 2PWFA 4LS2A 4NI8A 2XWDA 3V5OA 2PTYA 3COTA 1AH0A 5I6SA 3V18A 5HMSA 5LNWA 1JDDA 3PZVA 3B8SA 2BVWA 3VABA 3KWSA 3SQSA 1B1YA 3WK0A 4IOTA 5AYIA 3CB8A 1ISXA 4ACZB 1UWSA 1YEYA 4DNMA 2HISA 4UMCA 3GNRA 4FP1A 5RUBA 4S23A 1V4YA 1EEPA 1GWJA 3WBYA 3HQOA 1VD6A 1OFEA 1YPIA 3DYOA 4CN1A 4WOZA 3MB9A 3VU2A 3SR7A 3EOEA 1RQEA 2WC7A 1WAUA 3ELFA 4PH6A 2AQVA 3TQPA 3C3UA 3HBLA 1XBYA 1I75A 3TNBA 3N34A 2DT1A 4DZIA 2DVTA 5KTLA 1GYLA 2GQAA 3SCVA 2VCCA 4DO4A 2C91A 3GBEA 1E1CB 3GNXA 3W26A 4QG9A 3RXZA 4H2HA 4BF9A 2R1LA 4EPEC 2JGQA 6XIMA 1YTKA 3BMXA 1XGEA 2G96A 3ZJ8A 3DIPA 2INEA 4MAVA 4M80A 2YCIX 1BEUA 1GTHA 3RUBL 3ZS4A 3UJRA 4LXFA 2VRKA 1C92A 1FDYA 3CGTA 1R2SA 1MEWA 3E0WA 3S9IA 5D9OA 3M0JA 4B15A 5H8PA 3UWYA 3WMLA 1E51A 1CTNA 3OLEA 2FZMA 3WSUA 3GG0A 4O1BA 4PA8A 1SZRA 5EMUA 2OOFA 3N9SA 4H9XA 3ITGA 4BCEA 4K39A 2DZUA 1D3GA 4HK5A 1QWKA 2VGFA 3Q94A 4D6GA 5JIWA 4QLLA 4KW2A 4R88A 2C19A 5CGTA 5I23A 3W70A 2TSYA 3KTSA 3B8UA 2GVGA 1NWSA 4Q4MA 1LBLA 3GBDA 3W02A 3S1UA 1TX0A 4IP7A 1VIWA 4RL3A 4UQDA 3NYZA 4YXGA 1HL2A 1YNPA 3T1GA 2QKFA 2WNQA 3CTTA 5HDRA 4JXCA 3W7QA 3CM4A 1PYMA 1XINA 1JCMP 2F8QA 4P8UA 3P5ZA 3G2GA 2WKJA 4F0HA 3WF4A 3W37A 4MYXA 5G2WA 4H2CA 1DQWA 1ZFJA 3PBVA 3VKCA 3SN4A 3U2OA 4NU7A 1BYAA 4X3ZA 1DV7A 3B0XA 1ODUA 3RJYA 1GEHA 3BURA 4MUPA 4YS1A 3CTLA 2J27A 3IEBA 1OVDA 2REQA 1W5MA 4MZ1A 3ZLFA 3W88A 1Y5WA 1TTPA 3BDKA 3VVGA 1M01A 2CLIA 2WCGA 4E4FA 1D3CA 1H49A 3UVAA 2OKOA 5HMFA 3S2JA 1R7AA 4LRTA 2A79A 3V75A 4YHEA 4Q4KA 4XK2A 3DHUA 2WPBA 2JKPA 3GUGA 3Q45A 1KM6A 4BR1A 4DELA 2Z1BA 4XVDA 5E9AA 4GI6A 4LX4A 1Y7VA 4RXFA 3FGCA 1FFQA 3VIHA 1J0IA 4TOQA 2FHCA 2J74A 3WLMA 3POHA 3W23A 4EXBA 2X1TA 3IJIA 2NQHA 6A3HA 4QSHA 3ES7A 2QVNA 4GCXA 4ZO8A 1UMYA 1I8JA 3M0YA 3FEMA 3D6NA 3SI9A 4B5TA 3W84A 2CHRA 3N2TA 1W3JA 1VEMA 5LA0A 2ISDA 1ZAJA 3SGGA 4KESA 1BWVA 4K38A 2PEVA 2PC8A 1A5SA 2W91A 3PZIA 3GZ3A 1GNXA 3DGRA 1JZ8A 2ZUTA 1B0IA 1NOWA 1BYBA 3R11A 3MPGA 2BWGA 1VFHA 2PGWA 5HUPA 2XVLA 2CKRA 1AW2A 3RRXA 1EJXC 4GABA 1YXYA 4W7VA 1F6KA 5EBUA 3OYXA 4BS0A 1HG3A 2FFCA 3DU0A 5A94A 3NQBA 3VGBA 4U5KA 2BOEX 2XN0A 3HPFA 3VKJA 1UKOA 3PAJA 4GGHA 1KRCC 4KT2A 5AYBA 3SUSA 3SCNA 2NSOA 1OM0A 2QLYA 4KRZA 2WPGA 1J11A 4JTRA 3CWHA 3W7EA 5C5YA 1ZL1A 1KBKA 4DYKA 2Z1XA 3GM8A 2GJXA 2YZ5A 1V79A 4D8ZA 3P14A 2AGKA 1MEHA 4HNOA 3H7RA 3QHOA 2EF9A 3DFSA 3PF3A 3VE7A 4HD5A 3KOXA 2WNZA 4Q7IA 2ZZ1A 1MW0A 4IICA 1TELA 1XD0A 1EX1A 3Q67A 1LOSA 2WMHA 3HV9A 4JN7A 3ZOAA 2VZTA 1SW0A 3TSBA 1XLMA 1XPYA 4LYQA 1PSCA 1W9VA 3EA1A 2QDEA 2WC4A 4W88A 3TWAA 4HSOA 3IUDA 4EVZA 3W0KA 1UD2A 4G7EA 2VWTA 2OZ0A 2WKLA 3WJZA 1VR6A 3NQMA 4W9TA 3CBWA 1E15A 4ZQCA 4C6MA 1CI1A 2OTDA 3BW2A 2OEKA 3B0PA 3HPSA 5GNZA 1O1ZA 1XRTA 4FLSA 3VOGA 3FSUA 2HBXA 1K70A 4WDWA 1BF2A 3BOLA 1ITUA 3C6CA 3PULA 4IGNA 2ZXQA 4JTFA 2R24A 5FL0A 3HM7A 5LIUX 1HKIA 4AMCA 9RUBA 3UW6A 4D6FA 3VM5A 1WXJA 2WCSA 4WY0A 4FF5A 3HTWA 4AC7C 1K7FA 2VX4A 1WZMA 1GW9A 2XINA 4CQ9A 3QC3A 2FTYA 3WQVA 4IISA 4HYWA 1XLJA 2V6AA 1UHVA 2VVSA 3VIFA 3CQHA 4KIRA 3MMUA 4Q6XA 1N82A 1FY6A 1H1YA 2G41A 3CZKA 3YPIA 1RCOB 2VM8A 3EDEA 1NWTA 3WLKX 3AMGA 3UZJA 2AKZA 5CAKA 3NQFA 2E9MA 4PRTA 4O1DA 1TCDA 5HNNA 1NFBA 3QOMA 3PBUA 2X7VA 4Z0JA 4ZL1A 3IVSA 1C9DA 2D3LA 4AZHA 1EHNA 4ERAA 5EMMA 3WQ5A 1KM3A 1O5QA 4JPGA 2QV4A 1U1UA 3R89A 3LCGA 3O2LA 4E3VA 3LRKA 4GYJA 4KCWA 3A5FA 2PURA 4LCQA 4M19A 2BGQA 3OW1A 4AYGA 3N17A 1HIZA 4Q8OA 2WMGA 2Y8KA 1O12A 1FCBA 3ZO9A 4U4MA 2D2OA 2PB1A 2QCDA 2BY2A 1WB0A 2IW0A 3W1QA 4MDOA 4IUOA 3I4KA 1OCJA 4GUJA 2OO6A 3GIPA 4WJXA 3W7JA 3PHAA 3NL3A 4Y9NA 4LNYA 4RV3A 4YYCA 4GXMA 1HKKA 2D73A 4N6EA 1R47A 3W7IA 1JD9A 4C6CA 4DUVA 3QBUA 3MKVA 2HE5A 3N25A 2A3HA 4FX7A 4TX9A 1TPB1 1E6PA 3LTPA 1DWAM 3ZJ6A 3DFTA 4XKYB 5H8MA 6ENLA 3O0FA 4LBSA 1LBFA 3MSRA 4AHPA 3KDNA 5GPRA 4JTEA 1V5XA 3I7SA 3DZ1A 3U8GA 4O0QA 4EACA 3TJ4A 3FA4A 2B7PA 3WLLA 4Q6JA 1SFTA 6TAAA 2DSZA 3CS2A 2CLPA 4WSJA 2R14A 4S3AA 1KTBA 2UY2A 1NF0A 4HHHA 1VFUA 1YDYA 3CAKA 4FZIA 3U5UA 1YPXA 4TV6A 3GSMA 1NF7A 4Z1BA 5D9NA 1TPUA 4IX2A 1XIIA 1R3YA 1XWYA 4AY1A 1UA7A 1QI3A 4CD4A 2RJHA 3BZJA 1YLVA 5D30A 3U4AA 1Q13A 3OB8A 1ZBWA 3L67A 4IUGA 1UJQA 1PTAA 1LL4A 5K9XA 3E0IA 1DJNA 4M56A 4XBSA 3BW3A 1FUYA 1EDQA 4LFYA 3KBSA 4MWAA 1DORA 1DWIM 1QU4A 3OLDA 2VFGA 4FIQA 3LMZA 4BI6A 3IIPA 1OC5A 1C29A 3I3BA 3R43A 3W75A 3R0KA 2CHOA 2DFAA 2J79A 2WMIA 2YJQA 5LZLA 1ZENA 3AZSA 1QOQA 4N6FA 5CPOA 2OG9A 2EBNA 2E5CA 1YBQA 3BSMA 1QNOA 2RDUA 1LROA 1JCNA 4UFIA 3CLWA 3N3TA 1JGMA 3U7BA 4A3YA 1GPWA 1N8WA 2C13A 2WVTA 4Y9AA 3PSWA 4WKAA 1SR0A 1O6IA 3EOUA 1PKNA 3MP3A 3S2CA 3F5KA 3M7SA 3PR2A 3WO8A 2G37A 1AD4A 3RCNA 1KFCA 1LWHA 3UF9A 4GI8A 1AFSA 1ZS2A 3Q65A 3MTWA 2WC3A 1HZYA 1H7PA 2H9AB 2Y8VA 4UTLA 5A8MA 3L2IA 4HU0A 4X9YA 3B9DA 1J2WA 4H6RA 1GUVA 2J13A 1TWZA 3T8LA 1UIPA 1EP3A 1WCGA 4CEUC 4AZBA 5JUVA 4RR4A 1SZNA 2BSLA 4Q4SA 4UR8A 4ROPA 1XLKA 2PD9A 2VP8A 3AYVA 4DBDA 1NOUA 4B16A 4ZCWA 4Z1YA 4BHYA 1GJPA 3DXIA 1IR1A 4A05A 5LSMA 3RR4A 1CGTA 4AUBA 2FFIA 1CGXA 3FLUA 2RH9A 1QHZA 3LS9A 5CC3A 3H54A 4Q8NA 2IXVA 2FJKA 3MUIA 4D6DA 1XIBA 2OWXA 3BW4A 4C6LA 4QNEA 1UR3M 2ISWA 5GNXA 1W8GA 3AMKA 4O13A 1EKOA 5KZMA 4J3ZA 5DMYA 3KL5A 4NAFA 1YDOA 4NZ5A 1IEXA 2X30A 3W53A 3MDWA 1WDWA 1G4TA 1D9EA 3DHPA 4PMZA 3DH7A 3QQWA 4MKNA 4G2DA 2QR6A 1R3RA 4AHQA 2FYMA 3FXGA 3LA4A 4MWAC 4NAEA 2FVLA 1EYWA 4PTNA 2Z29A 2B81A 1W1ZA 3APTA 3UXLA 3RX4A 4LVFA 3BAJA 2G95A 2V81A 3TJXA 1R7OA 3ABOA 4Q8MA 2GUUA 3SDOA 3URAA 4OJYA 2XFRA 3W86A 3BV7A 3ARSA 3K13A 1X98A 3UR5A 3VO0A 4C6EA 4JEJA 1NDZA 3JU2A 3JRKA 4GH3A 1Z32X 1OT1A 1UP0A 4PFMA 1TV5A 1Z9AA 5CG7A 2ODOA 3T0TA 3C2VA 4KS0A 5K9CA 4Y9MA 5LGZA 4NP7A 3AQUA 2OELA 3IJQA 1UKSA 2CZEA 3QZAA 1R3TA 3WEZA 1E70M 1F74A 5FSEC 2BX7A 1BQCA 1A3HA 9XIAA 3H26A 2IPJA 4GY1A 4ADUA 5CH9A 1IGWA 5FF0A 4HA0A 3WNLA 1LRQA 2DH3A 3K5XA 4FF7A 1FP9A 1M5WA 3WLTA 2G0WA 3EEGA 2B31A 4TU1A 3I7RA 1LQ2A 2TRSA 1JNEA 1LUCB 2QIWA 4LCRA 3M5YA 4J3WA 1F6YA 3W2MA 1VBGA 3FJ6A 2DVXA 1SMDA 1MEIA 1XKJA 1D3HA 1DWGM 4E4UA 2GGHA 2ZUUA 1P0NA 1MQQA 4UIOA 1CX9A 4QG8A 1W9XA 1TMQA 3T2PA 3CO8A 5LXEA 2ZADA 1CPUA 2J77A 3E0VA 4RNIA 6CGTA 1S46A 1WAWA 1REQB 2Z0IA 3BLIA 4WIWA 4AY7A 1UPPA 5FESA 1Y8BA 3SUUA 4NL1A 3L0NA 2PDJA 3BG9A 1XBXA 2CBUA 1XL9A 2H8XA 3EOLA 4DM1A 4D8AA 1XH0A 3WH5A 4FNRA 5DCBA 3MKKA 1OQFA 4V27A 4JL1A 1DXFA 1M9HA 3WD3A 1DJZA 3PFMA 4O1AA 4FNTA 4AD1A 3W7CA 4RE4A 5KZEA 3FK4A 4WY0F 3RLGA 5C8BB 3CHVA 3S5ZA 1QPRA 2XFFA 3O9NA 1S2WA 2ATSA 2OWWA 1H60A 3WH7A 3C0QA 4PMQA 3RX3A 3HQPA 4GX9A 3EXTA 4GUFA 3GDBA 2Z1KA 1AW5A 1NTHA 4PMXA 3UBPC 2XH7A 3N6QA 3KUMA 5GJNA 3WBWA 3RM9A 4LU0A 2AQOA 3WFAA 5G2HA 1MZHA 1LOQA 4HCDA 3W2NA 4PCTA 4RE0A 4I6VA 1CYGA 2BASA 4EF8A 1JCYA 1ZLPA 3FXYA 1LZOA 2YLLA 5F1VA 4ATWA 1DXIA 4D72A 3AYTA 3TCSA 1QMLA 3NFUA 3AXKA 3EEZA 4DJED 3LOTA 2CXEA 1E9LA 2W5FA 3AHYA 4GPNA 5A8NA 5D9PA 3LCWA 2OODA 1ZBCA 4FNSA 2OXNA 3F1QA 1VRXA 2QF8A 3PB2A 5EYWA 5FF2A 4HPGA 1FHUA 4S3EA 5D37A 1HXJA 4XUYA 1NEYA 5HANA 4JY9A 5CC5A 3I68A 2HK1A 4O14A 1VLWA 3PSVA 3UG5A 1B30A 3LGDA 1JUEA 4MM1A 3AZRA 2YBVA 2VEIA 3BPWA 3NO3A 4DJDD 4IT1A 3O16A 4AVOA 4MWAE 1EEXA 4WLCA 4PUEA 3HGOA 3GXNA 2PDBA 5K3VA 5CKSA 5LA2A 1IE7C 2GOUA 2VGIA 2E0PA 3HPXA 4Z08A 4PBFA 3VIJA 1ICPA 4UNIA 1UBSA 1RZMA 4RNHA 3UEQA 3OPSA 4LUTB 3PBMA 4DZ5A 3QKEA 4LY8A 3G6MA 4PUWA 2I5GA 2Q8ZA 4KIEA 3ZMRA 4MKVA 2E77A 1E4MM 3PP7A 3WJXA 2WHLA 1T0OA 2Z2BA 4CKQA 1TPEA 5CQ1A 4FXSA 1B3VA 2YR1A 3QW4B 4XIMA 4C90A 2RDTA 1OHLA 3W71A 3AIBA 4MG4A 4OFCA 2GK1A 4V15A 2J62A 4UQEA 1K02A 2CZDA 3AXIA 4HCHA 1U5JA 3SM0A 1W1IE 1ONXA 3OQEA 1P7TA 1J2BA 1R3SA 4UNLA 1Q4NX 5AFDA 2QMJA 2YDAA 5BWFA 2NT1A 1QW8A 1OY0A 5A2AA 2GPTA 3AI0A 4ZO9A 2J7HA 2YL8A 1UWQA 2OEJA 3QPZA 3ARYA 1ZU8A 3FFSA 3JW7A 4PMNA 3PWAA 1BHGA 3P82A 2ZFAA 2C79A 4EP8C 1Q2RA 5I0DA 1M6JA 1N7KA 5J8LA 4L6HA 1E4IA 3W2KA 5I78A 3WF3A 2W27A 2QUTA 4O1CA 1D8CA 2PMQA 4IMEA 5REQB 3GHRA 1NVMA 3EWXA 3T40A 3WH9A 1BG9A 2PDQA 4D6JA 3DG7A 3I3EA 3QV9A 5KITA 3A64A 4M5PA 2VWSA 1JR1A 3DHDA 5MKGA 3LCHA 3VGFA 2OYLA 1NDYA 4BKNA 3TK7A 2WJDA 1JYXA 4CCZA 3WQ6A 2KX9A 1TZ7A 5F2IA 1B90A 4H9ZA 4PE8A 2OSYA 3KBMA 3KBJA 3P67A 4L1GA 3M0IA 2WHJA 1RQBA 1H3GA 1RBAA 2F6KA 1UQZA 2QJIA 3GVRA 3B8IA 1JZ6A 3GXTA 3G3DA 3PG8A 1KRBC 4BA0A 3O15A 3NQAA 4HCLA 3UJSA 3P0XA 4M81A 1WDSA 3FHQA 3A23A 1TR1A 2NX9A 4IPNB 1HL9A 1JFXA 2HCVA 2NT0A 3FJLA 1GORA 2ZUSA 3T0AA 3GZAA 4ZFMA 3W28A 1HX0A 3B97A 4C1KA 3XINA 3IACA 1TIMA 5LNVA 3VDAA 1JGIA 3HG5A 1K1DA 4KCVA 1NELA 3RCMA 4IF2A 4N7QA 3GKFA 4OECA 3ZT7A 4GA8A 3AS2A 4HZ8A 4JIQA 4WF7A 3SZ8A 5EFFA 1RSCA 3RFAA 1KCXA 2J9YA 1YNQA 2EPHA 1TFVA 1VP5A 4ATLA 3TE9A 4O10A 1E4LA 3VZZA 4ZQNA 3WNMA 3IVUA 1XG3A 2NUWA 4EX4A 4AYSA 5DCEA 1WZLA 3M4HA 3KRBA 1QXLA 2BXYA 2GVLA 3EYPA 4NJHA 3M0HA 4IP5A 5HJXA 1KM4A 2P1FA 3R2GA 3CUFA 3KHJA 2GGEA 4WZHA 3A3WA 3SRDA 3PPGA 4F2TA 2PWGA 3NVTA 4PTXA 5FF3A 3KCLA 3OVGA 5A6KA 1MVYA 1TV7A 2GQ9A 8TIMA 3SCPA 3QR1A 4WDXA 3N2OA 4QE4A 5BRPA 4PMRA 1TRIA 1ZP4A 3CHEA 5CGMA 3PFRA 1OINA 2DU2A 2IKIA 2FMNA 3LNPA 1SZEA 5LKYA 1XGDA 3KE0A 2V5KA 5CAHA 5JVLA 2QAFA 3VMNA 4GIEA 2CU0A 5G1YA 4AX7A 3ZLHA 3ANVA 4JTLA 1TPDA 1DWJM 2Y2WA 2P3ZA 4AF0B 2I14A 4JCLA 4AZCA 1TA3A 3S1VA 3BG5A 1G9HA 3TFXA 3FDGA 1Q6FA 1W31A 3E5PA 2PLMA 2PE4A 1RA5A 4IXXA 1JD7A 3V0TA 1ITCA 2GYIA 2NWSA 2P0IA 3R25A 1A3WA 2DZXA 4JIHA 3OVPA 1PX4A 1VYRA 2JIWA 5TBOA 3S1GA 1Y0EA 4YTUA 3TLQA 4GMEA 2KZHA 3DOPA 3PUGA 4DXKA 1X1NA 4XO7A 4KGLA 1GOIA 2X1UA 4TTGA 5F2GA 1A5LC 4OZOA 1V51A 1B9BA 4CNOA 3UY8A 1EBGA 4L9ZA 3QVQA 1P5BA 3LENA 1RD6A 3URBA 3SFKA 2OLHA 2W61A 4Q8PA 5ABGA 3KVMA 1O4UA 1WA3A 3GU1A 3TH6A 2V9DA 1SFSA 4XZWA 1NM9A 3GW3A 1TUXA 2O9PA 4AAJA 3AMLA 2VTFA 3KZPA 3S1XA 4MB3A 1YTEA 3U4FA 1WX0A 5AYYA 4XD3A 3R7MA 1ZJBA 3RDKA 1JPKA 3TQVA 4RKAA 3BE7A 4WKHA 1W9UA 5D8ZA 1GQJA 4O15A 1UD4A 1GQLA 3W74A 2OLAA 2Y62A 2IUZA 4HK7A 4HZ6A 2GJPA 4M82A 1XLDA 4QJ5B 5CC7A 3GQYA 3MYPA 3W29A 5I03A 3TMLA 2QEZA 2PCEA 1UUMA 3SRKA 3W00A 2FB3A 4NNBA 4ZZ9A 3FKKA 3W1RA 5D2VA 2WMJA 3LHUA 4PFHA 2YCLA 2YW3A 3N6JA 1PWLA 2QDHA 4BI7A 3GE7A 3NL6A 2YB1A 5AC4A 3AIVA 3W3OA 4AD0A 3E2VA 1B57A 4RW5A 1HO4A 1WBJA 2CPUA 3K4AA 4KWSA 5C0QA 3AYSA 3EWBX 1RXOB 2CLFA 2X1RA 3T6CA 3CV7A 3NDOA 4O52A 2E5BA 2WWDA 1S3TC 4QTGA 2YA0A 4B3KA 4FO4A 2Q6ZA 3QY8A 1MNSA 4JKMA 2YDQA 3H21A 4MOZA 2ABBA 3DX5A 4L4PA 3EDKA 3T2QA 3CUZA 3OG2A 1BTMA 4NXSA 4ENLA 1QATA 5H6HA 1YQ2A 4MAZA 1UWAA 2CERA 4GJIA 3WY1A 5GJPA 1NIUA 1FTXA 2PAJA 4JTQA 3LY0A 3H2FA 1EC8A 3GC4A 1U5VA 4DUXA 2Y85A 4JN8A 2GGIA 1I4NA 2XSAA 5ABFB 1DJIA 1Q6LA 3DKJA 5C55A 2A3CA 4DLMA 1J18A 4AVNA 3GXFA 1MWOA 1P0BA 1NSJA 3BLDA 1PX8A 5H8UA 4KFOA 5EPDA 3FYYA 3NQ6A 5BZAA 1J0HA 4JYEA 3N2BA 5FEXA 3RJXA 1QPKA 3LLFA 1O94A 4XO6A 1E3ZA 4PN2A 1SGJA 2UY5A 1X96A 4B5NA 3VCNA 8XIAA 2QS8A 3G0UA 2G3NA 1W1B1 2BVYA 1XKYA 3GDLA 5F4SA 2GL5A 3M6DA 3PG9A 4AWTA 5AZ1A 5FKYA 3HGSA 1GCYA 1HKVA 1N8FA 5DBUA 3TN4A 2B7QA 3MZ2A 1XIMA 4W5UA 1K03A 1HVQA 4OT7A 3Q4DA 2ZYFA 1O1HA 4ZOBA 1KM2A 2XH4A 2V3GA 4M1RA 3T2OA 4WVXA 4ZE4A 3OOQA 2DZSA 4M8UA 4C7DA 2VQTA 3EB3A 1UD6A 1X7IA 2PD5A 3G1HA 3LX9A 4UCGA 5JIPA 3D47A 4LAMA 4YWSA 4IHCA 1JF6A 1B4KA 2J75A 3VDBA 3I7QA 3OTRA 4J40A 1ECEA 1BKHA 2GVYA 3O8AA 3DC8A 4NVTA 1OFPA 1MRAA 2Y5SA 4JX5A 1QO2A 3OIHA 2WZMA 2DSVA 3A6OA 3HG3A 1LT7A 4RNFA 3WBAA 1QPOA 3CHFA 2V30A 3HMCA 4O1EA 1IT8A 1PKYA 1CXIA 1V03A 2RHGA 1B9ZA 3VNMA 1JNDA 4FB7A 4JR5A 2W92A 2DPEA 2OSWA 1JJKA 5GJMA 3AAMA 1IXPA 1MFVA 3DBPA 1VGAA 2A7NA 1T8XA 4QJ4B 3MSGA 1WKDA 1XLHA 4N4PA 2WM1A 4J28A 3G1VA 3OHIA 4GZEA 1L2UA 4ZBCA 3OBAA 2BODX 1XP3A 1EGMA 3C3NA 1DOSA 1US3A 3B04A 3WQEA 3WD4A 2D24A 2RDXA 1UASA 6ALDA 2AAMA 3WLSA 2WV8A 5FEPA 1A5UA 3H2NA 1SJAA 1V02A 3F2DA 5BWAA 1NWUA 1UG6A 3DDMA 3H70A 2ICSA 5HQLA 1J9YA 1KQZA 3GHTA 1DPMA 4GC3A 1L6SA 2Q71A 1CXLA 4UFKA 2ZWYA 1BLIA 3W81A 3DAQA 4O17A 3MWCA 3WFLA 3H8AA 3KS5A 4E8GA 1E6ZA 1AJ0A 3B03A 3GAKA 1VHNA 2NUXA 5BCAA 3F2CA 1E4NA 5D38A 7REQB 1Y5VA 2NQZA 1OCNA 4HT3A 3B4YA 3ICJA 5AC8A 2GUBA 1IZCA 4I8DA 4E2VA 2QAPA 1CIUA 3LPPA 1IEVA 5I06A 3R13A 4OQVA 4FLOA 2F9RA 1W1YA 5G4WA 2WQPA 3ORWA 2QDDA 2ZX7A 5I07A 1WBHA 1JCLA 4OV9A 1WO2A 3LRMA 3GVVA 3M47A 3H2MA 1W5OA 3EMZA 5FJIA 4D71A 1O66A 2VHLA 4N2YA 3QW3A 1GTEA 1MMFA 3S9ZA 3W27A 1THFD 2BXVA 5FIPA 3UGVA 1WE5A 2D0HA 3CNYA 4Z2IA 3S9YA 1K4HA 1RH9A 2OQYA 2WHMA 2YYUA 3QSRA 1DTUA 1SR9A 4I9AA 3TN6A 1F5ZA 1GJUA 1M41A 1N55A 1F4AA 2W67A 4WD0A 4Y9OA 1UR8A 2V5CA 1XD1A 1UD8A 2Y4SA 1KGUA 1FX6A 3OYZA 2FGBA 3F03K 4C65A 2BFGA 1H1NA 7XIMA 1UOZA 3CJPA 1AH4A 1KBIA 4LBRA 1B3XA 4JY8A 4LUIA 3A4AA 3KAOA 1H7OA 1TMLA 1V0LA 4WSHA 2VEKA 3EWUA 3TZNA 3VYLA 3OA3A 4CU6A 5JBFA 4DO6A 1V3KA 2I9UA 1H5VA 4GI9A 3WENA 2ZRVA 4EPKA 3H2EA 2QJGA 4Q4RA 4CLMA 4FX8A 4H6QA 4K37A 1HKMA 1ZQ5A 1XFBA 1UP3A 4RPPA 3GR8A 5K2ZA 4G9PA 1SUXA 1VPQA 4H7ZA 1W1A1 1XLCA 5EMKA 4YWIA 3PZMA 1W37A 1TV3A 2HNEA 1QI2A 5BOEA 1JPIA 1RP9A 5HATA 4XZHA 4IM4A 1PVNA 3KS6A 3EPMA 2WZIA 4JCMA 2BHUA 1LJYA 4TTUA 5B80A 3P84A 1E73M 3BO9A 3OZMA 3KOYA 1YDVA 4H8NA 1QNQA 1WPCA 3WMCA 4H9UA 1J0JA 5CPLA 3BLPX 4F0LA 2HPMA 3OG3A 2AQWA 5FF4A 3HJZA 1AD1A 1EO7A 4S3FA 3W1PA 3CIVA 2ISFA 4O11A 3THDA 1POJA 4C1NB 3U48A 3EX1A 1KXTA 3UERA 4B3LA 3ARZA 5FAGA 4REQB 1TB3A 1V3MA 5MHBA 2J4GA 3EA3A 3GIYA 1Z3NA 1EZWA 4M6PA 4M24A 1VF8A 1VCVA 4EK7A 2ANUA 5A6MA 4QFUA 3REQB 3WUBA 2VELA 5I3JA 4A35A 3IAQA 1EPXA 3G8EA 1VQTA 1HGWA 4XV0A 4U3CA 4HU3A 4D1JA 1TJ1A 4NZ4A 1CBGA 2D22A 4UUIA 1W3LA 4NNCA 1EIXA 4AZGA 2NV2A 4MY9A 1KFKA 3PTQA 2W66A 3MUAA 1TPWA 5FJUA 1OIFA 3CWOX 1R87A 5T8GA 3IGSA 1MYRA 2YSWA 1TCMA 2FPVA 4RDVA 3QZ6A 3S3GA 3PZTA 4XQ6A 2Q09A 4I9TA 2OKTA 1ADDA 3DYMA 1PTDA 5H2ZA 4AHOA 5KINA 3V7PA 4MB4A 4QEEA 2G97A 2YCEA 4WR3A 1UB3A 5T9CE 4Q8QA 5G4HC 1IXQA 2W62A 1A5CA 3KCJA 2X0YA 2Y89A 5A6JA 1F2JA 3LI1A 3OZYA 2CIPA 4XD4A 2ATMA 1ME8A 1WYIA 2C6QA 3G5EA 1EJTC 1M7PA 2XPKA 4Z2KA 1ELSA 1NP2A 1AJ2A 5FJOA 2OCZA 3LGEA 4B91A 3PY2A 4GG9A 3CPUA 3HOJA 2P50A 1W2PA 2C15A 1QNRA 3UWWA 4XISA 3VPLA 2WQDA 4F0RA 1EUNA 3QC0A 4Y2WA 4W8AA 1X8CA 5HNUA 3TC6A 1A53A 1IWAA 2HXTA 3T4CA 2ZRUA 1JYNA 4UMBA 1BGAA 3JUGA 3TA9A 4KCUA 5HBFA 3RMEA 1U33A 3W2LA 4NRRA 1J0YA 4RDYA 5HULA 2RDWA 4NNAA 2DZTA 2BOFX 3I6EA 3VD5A 1P6CA 3MS8A 4BEUA 4QNWA 3RR1A 1PCWA 3G1XA 1QRQA 3ATYA 1E0WA 4X2PA 5FA5A 1XLAA 3N15A 4GKTA 1FOBA 4H04A 3DFOA 4OU1A 3O05A 4XB3A 3M9YA 1VRDA 3KLLA 1PAMA 1HP5A 4C6KA 4HNTA 5DMLA 1XC6A 1S2TA 2VX7A 1KGXA 4UOQA 2E9LA 2P0OA 3POCA 4HOXA 2BG5A 3TYUA 3R94A 2CC0A 5D2YA 2JK2A 2QJJA 2XVKA 3PPCA 3O7UA 5C9RA 4C6FA 1R2TA 2WJFA 4YYFA 2HXUA 3WF2A 4C60A 1E5NA 4HKPA 1XQLA 1GYNA 3AROA 1B54A 3L4VA 1DWHM 2X16A 2WSYA 1RHCA 2O92A 4JQ3A 3EWDA 3UZYA 3HB9A 1DIDA 1HF6A 4TR9A 2PLKA 3MCNA 2QUUA 4QBXA 3WQ4A 5AYZA 3PWGA 2Z1VA 1S2VA 3NQDA 2VUNA 1GZ1A 1B3ZA 3CHDA 2E40A 3W7OA 1H7WA 5HQEA 2PFHA 3W76A 5BXRA 2NXGA 1UR2A 3RMJA 5KETA 1E1FA 3EXRA 2I5QA 3N2MA 2PTXA 2XZ7A 3WQDA