4XTDA

Structure of the covalent intermediate e-xmp* of the imp dehydrogenase of ashbya gossypii
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
408
structure length
377
Chain Sequence
TYRDAATALEHLATYAEKDGLSVEQLMGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRGKRLKTYRGMGSIDAMQKLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYERLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
source organism Ashbya gossypii (strain atcc 10895 / cbs 109.51 / fgsc 9923 / nrrl y-1056)
molecule tags Oxidoreductase
total genus 122
structure length 377
sequence length 408
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xtdA00
3M44A 3H53A 2DZVA 3L9CA 4UFIA 3W87A 2G96A 5FF7A 5E0KA 3I7SA 2DU2A 2PCQA 2RFGA 1PHWA 1FWTA 4HKPA 3W76A 4K6AA 4O16A 2OJPA 3ATZA 4GUJA 1FDYA 4C1KA 4CLMA 3KRUA 5DBTA 3GDTA 4LOCA 3ABQA 1QR7A 3TX9A 3B04A 4TMCA 1F6KA 5AFDA 2OZ0A 3R5EA 1UUMA 1LBLA 3LI0A 3W7HA 4O15A 3UY7A 2Z6JA 2H90A 2ISSA 3EXTA 2O7QA 1O95A 3FIGA 4Y90A 1ME7A 4OV4A 4UIOA 4J9JA 4HN4A 3PY2A 3G1VA 4FO4A 3NM3A 3HG4A 5BW6A 1S5WA 3QF0A 5FEWA 3GVGA 1WXJA 3F03K 1G4SA 3TCEA 2PE4A 4OT7A 4Q33A 4NXKA 5LZLA 4RKAA 2EHHA 2E09A 5DBUA 5D30A 1L6SA 1WYIA 3FLUA 1CX9A 3NQDA 2VEMA 1XC4A 2C15A 3TR2A 3QC3A 2QR6A 1K7EA 2WSQA 1T96A 1O5XA 1VPXA 4R7JA 2WOQA 2Y6ZA 4HSOA 1F73A 4FNTA 3TSBA 4DO6A 1K8XA 3L21A 3SY5A 2QUTA 4HT3A 3C56A 4BF9A 4FX8A 2QCNA 1VRDA 5HULA 4JY9A 2GJNA 1HL2A 1SFJA 4EIVA 3DFPA 3QW3A 2X1TA 3PULA 4N6FA 2VFFA 2TYSA 4QITA 1LOLA 3MW7A 2YPIA 3I7QA 2RH9A 1OF6A 4MY8A 4K8EA 2DJXA 1JULA 3FKKA 4HPJA 3MHGA 1ZFJA 2VFIA 3IRDA 3PBWA 1C8VA 3CB8A 2PRLA 3PS7A 4UTWA 3LHWA 1N8FA 3U8GA 1YTEA 3T44A 2QUUA 1KM5A 2G97A 1FQ0A 2AAMA 2P10A 3UPBA 2YYTA 3QQ0A 1S3HA 1YYAA 5DCDA 5L9FA 2WPBA 3N14A 3OHIA 1FWNA 1JCXA 1T99A 2QCEA 1ZENA 5G2IA 1KLZA 4NUWA 5AOUA 1SU5A 3SR7A 4Z1BA 1OF8A 2QCDB 4PODA 1SZFA 3M16A 2Y89A 3LCLA 4AXKA 3W86A 3BGGA 3THQA 1NF0A 1W5NA 4DPQA 4IOTA 3M5VA 4EOUA 3LBCA 5CKSA 4A22A 1TPWA 3U2OA 1UASA 2NWSA 1W5OA 2V82A 5G1YA 4OQVA 2FQIA 3LTPA 4WXZA 5TQLA 4IPJA 4ZQRA 4K8HA 2LLEA 4QIUA 2I14A 3WJSA 3YPIA 4WY0B 3GXTA 3A5VA 2NUWA 2P0OA 2B7PA 4NZJA 1BTMA 1VH7A 1FX6A 1GWJA 5FI8A 2Z1BA 1WAUA 1KFLA 4ONVA 3LCWA 3O15A 1WBHA 2J9ZA 3QZEA 2QDHA 5LHEA 2FPVA 3CC1A 3UXAA 1CI1A 4O1AA 5D02A 3ELFA 1TQXA 1J4EA 3G1SA 1BKSA 1LCOA 1TPFA 4UTTC 2GQAA 3KX6A 1IXOA 5F2MA 4E0CA 2ZBTA 2GQ8A 2RDUA 3ZS4A 4LTSA 4K36A 1PV8A 3AJXA 1H60A 5FF0A 3GDMA 4PCFA 3VNDA 3NZ1A 3M5XA 4RX0A 2EAWA 4RXGA 1PCKA 3O6DA 3PAJA 5EYWA 1TTPA 1IXPA 2PURA 1G4TA 2C6QA 1M5WA 1M6JA 1A50A 1KM2A 2CLOA 2WQPA 1ME9A 3O06A 5H91A 3GR7A 3R2GA 4O10A 3TW6A 1EIXA 4RK8A 5K9XA 4IMFA 3W84A 3QSTA 3STEA 3N9RA 2QF7A 2FLIA 1QCWA 4EVZA 3NA8A 5AYYA 3Q37A 3NPWA 3MHFA 2NV2A 3TH6A 1RR2A 1D3HA 1DQWA 1RQEA 1XBZA 1XKYA 3P80A 5KTLA 3TQKA 4GNJA 2YSWA 4K37A 4WXYA 1JCMP 3NZRA 2VOMA 4XBKA 4O54A 3G1XA 4LVBA 2YFOA 1OYCA 4UTHA 1DL3A 1SFLA 3DENA 2R91A 3KRSA 1SO6A 4JTTA 1YTDA 4BI5A 3DFTA 2NUYA 3LHVA 1O60A 2FB2A 3O05A 4K7VA 3HG2A 3UWYA 1SUXA 3P8JA 4S2BA 4PC8A 5LSMA 2VC6A 1L6WA 4K7YA 4UR7A 2H8ZA 4WD0A 2ZZ1A 2W0UA 5F2GA 4O14A 1HO1A 3TV8A 4NJHA 3QRHA 5D04C 1H50A 3GB6A 1W1ZA 1TJPA 1W54A 2CLMA 4MYAA 3LI1A 2Z2UA 2GVGA 1K03A 1KFBA 1KA9F 2DORA 4Z1CA 3LGEA 1VCFA 5F1VA 3HB9A 1KTNA 3STFA 1LOQA 3AO0A 5D32A 4O52A 1V5XA 2DZPA 1FDZA 4UTIA 2J27A 5HR6A 3PVFA 5FF2A 1I2PA 1TV5A 2A5HA 2G5WA 3KFTA 3F4WA 3E96A 3IGXA 3O6YX 3QPYA 1YPFA 2DZWA 4O11A 4XTIA 1FUYA 3NGJA 4JR5A 3W6YA 3USBA 1YPIA 3IGUA 5C55A 3UZ5A 4LV4A 3C3NA 1W5PA 2NXHA 1OFBA 1I2NA 1YXCA 3TJXA 1G7UA 4DELA 5J5RA 2YZRA 1B4EA 1F74A 3GK0A 1XFBA 1OYAA 3EX2A 4FIRA 4MJMA 4ALDA 3RLUA 2ZZ3A 3MJYA 4N4PA 2ISWA 1NVMA 4WX2A 5IBXC 2NLIA 1ZALA 4LU0A 1E51A 3P67A 4MLRA 2NUXA 1GJPA 5D33A 1H7OA 1AW2A 3TC7A 5AC8A 2JGQA 3HG3A 4GUGA 2V8ZA 5U7SA 4GBUA 4GE8A 3O16A 3W1TA 2X1UA 1Z42A 4DPPA 3NQMA 3CPRA 1K7XA 1VGAA 4BK9A 2ZZ7A 4ZL1A 5F4WA 3IIZA 3M6YA 3B4UA 2NWRA 1XDLA 3BLFA 2A7PA 4LRTA 4WY0F 3G1HA 4O50A 4I7UA 2ZRUA 3HG5A 4DQWA 2O7SA 3TROA 2QAFA 1R30A 1TB3A 2X1RA 3C61A 5AYXA 1YXYA 2R8WA 4YCPA 1J2WA 3LTSA 1DV7A 1GEQA 4GC4A 4XKYB 3ANYA 4Y6GA 1KV5A 1EA0A 3UZJA 3IIPA 1PS9A 3TKFA 3LCFA 4NT0A 2CFFA 3S5OA 1FY6A 2VKZG 3VKJA 3ABRA 3S8HA 3EX6A 1GG1A 3W9ZA 1RPXA 1RV8A 4O0ZA 1X6UA 3P60A 1IF2A 1Q6RA 2V9DA 5HMSA 4IXHA 2VEKA 4UMCA 3W72A 2V81A 1DORA 1K8YA 4PFMA 2NZLA 4TO8A 4N9EA 4HNVA 2QJGA 2WV8A 1MSSA 4IQLA 5AHFA 3UWWA 3DI0A 3IVUA 3LHYA 4FIQA 3C4UA 2Y85A 4FXSA 2ZA1A 2IQTA 1FWRA 1JQVA 1ZAIA 3TMQA 5T26A 2YDAA 5FEPA 5K7JA 1OFOA 1OFEA 4NX0A 1SSGA 4PTNA 5E1QA 3E9AA 4CNPA 1G7VA 3LDVA 3EEGA 4B5NA 4FEZA 5EL1A 4IMDA 5MHBA 3GXPA 3OA3A 3PB2A 3L65A 1OFAA 4H4IA 3S5NA 2JKAA 1B9BA 6TIMA 4ZQPA 2E6FA 5FESA 3WFAA 1DJNA 3BW3A 4ZQMA 1B4KA 3R13A 2QUVA 3VE9A 4UFLA 1JVNA 4ZQOA 1JCYA 1VYRA 4MPQA 5LGXA 5HWJA 1W5MA 3LBMA 4UMAA 3GLCA 4DBDA 1JRCA 4OGZA 2ZDRA 1S5TA 3EKLA 4N9CA 1A5CA 2A4AA 4OU1A 3EWUA 4L4LA 4KKXA 3QH2A 3IIXA 3L67A 4Q32A 4QAIA 4AVFA 4IX0A 2BX7A 1KV8A 3M43A 4AF0A 1SQ7A 2VEIA 5AC7A 5G2HA 3SECA 3BW4A 5BMWA 3IIVA 3P8IA 1IXNA 2HTMA 3PG8A 3PR2A 3SGZA 1YTKA 3IVTA 4FX6M 1XBVA 1D9EA 1Q6LA 3KRZA 1JCLA 3QW4B 1Z41A 2YX0A 4O17A 1H1ZA 1GG0A 3G0XA 4M7TA 5F1UA 5AHEA 1X1OA 3E0IA 3GDKA 2I9EA 4DXVA 4IPIA 2Q8ZA 3LTYA 5G2WA 3W2KA 5I3GA 4XZ9A 3TFCA 3TNOA 3DFQA 1Q6QA 5I3JA 4E38A 2NXIA 3EKZA 4O1CA 2B4GA 2W79A 4E2DA 4O57A 4TR9A 1F05A 3CT7A 2GVLA 2EF9A 3CQ0A 3L68A 5BRBA 1LOSA 2RHGA 4X22A 4AMAA 2QCCA 3GYEA 3NQVA 4PL1A 1X1ZA 3SSJA 5G4WA 1H61A 3JS3A 3GXNA 5CSSA 1LRTA 1G67A 2VENA 1TTIA 3P7YA 4UFHA 3LRMA 3NDOA 4X9SA 5AHLA 3G1YA 4K39A 3W2UA 3MP5A 2QCMA 1K7FA 1KFKA 4IWWA 4RXFA 4O12A 2DJLA 3WJXA 3W1AA 3CLMA 3W2MA 1F7BA 3L0NA 3WK0A 3IIOA 3RNDA 3W7CA 3PUDA 6ALDA 1CW2A 5K4XA 3LCIA 2BZNA 4RV8A 5D38A 3A9IA 4LVFA 1KLYA 4Y9AA 1GVFA 1RZMA 3N2XA 1G4PA 1ICSA 3TSDA 1LTDA 4FB7A 3W7EA 3O6CA 4DO4A 4MLJA 3N34A 3KVMA 2C13A 1SZNA 5E93A 5DXYA 1THFD 2BLEA 3SIZA 4O1BA 1QNVA 4UTWC 1LROA 2QEZA 4BI7A 3LXBA 3DU0A 4JYDA 5KSWA 4LVGA 3OVRA 2E6DA 2Q3RA 1I4NA 5LNWA 3LCXA 4BWLA 3QM3A 4GUIA 4JTGA 3PB0A 4PL2A 3MYOA 2DP3A 3I65A 3RK8A 5I3HA 3A24A 3BARA 2Y7GA 3GDRA 4LS1A 1I45A 3NXFA 3K30A 1ICPA 5LHFA 2E68A 3MBFA 1QPRA 4AWTA 4DBEA 3UNDA 4UNLA 3KVJA 2GPTA 4O53A 2E1DA 4U28A 1EWEA 3HPXA 3VE7A 1RQBA 5K3VA 3OG3A 4JEQA 1Q6OA 1ML1A 5HWMA 3WJWA 2J9YA 2TPSA 4JNMA 2ABBA 2PC4A 5D2XA 1A5BA 3N3MA 4K38A 3MO7A 1TPVA 1FCBA 8TIMA 3O07A 1P0NA 5TIMA 1NFBA 1FWWA 3FS2A 3KVKA 4IX2A 3GR8A 4ORIA 4A2SA 1C29A 4JTHA 2PRMA 4WOQA 5TBOA 3TUUA 1SR9A 3LHUA 3S9YA 2C14A 4JX4A 3KXQA 3LHZA 2NX3A 2KZHA 3GNDA 3DH7A 1M7OA 2OT0A 3NPUA 3TQ0A 3MMTA 2B0MA 4HHPA 1T8XA 3FJLA 4JN6A 5HJLA 4MFDA 1WV2A 2WO5A 3A21A 1TV7A 4CCCA 3L5AA 5ABTA 3S5YA 4ICNA 3EXSA 4ZZ9A 1TIMA 5D2YA 4H3DA 1WOBA 4O4WA 1QWGA 3HMJG 1OK4A 3L0GA 4JX6A 3C8FA 4UR8A 3L66A 4AB4A 1Q45A 3W83A 1GVOA 2YFNA 4XWUA 4EF8A 1JQXA 3RLVA 1XDMA 2XN0A 2CWNA 3DKJA 4I7VA 3THAA 1EPXA 1H63A 3W7QA 1YLVA 3P62A 4RZ5A 3NQ8A 1I2QA 1F5ZA 1H1YA 1XBXA 3G18A 5CPNA 1SPQA 3S1WA 2JGYA 3W07A 4O8RA 1H5YA 4NJJA 3W74A 1DJQA 3BLIA 4O18A 2OX1A 4BR1A 3M5ZA 4JTUA 4QQ3A 4UTLA 1TPH1 1W5QA 1L9WA 1W8SA 1HO4A 4UC5A 3G22A 1W3TA 1OVDA 7TIMA 2QCFA 1TPB1 4POCA 5A5WA 4AF0B 1ME8A 2B7OA 4LS2A 5D37A 4LNYA 5EA9A 3CIXA 3FYPA 3PBUA 4OWGA 4MUZA 3W73A 3KAOA 1IXQA 3BG3A 2WKJA 1B57A 2NX9A 3W1QA 5D2TA 1GYNA 1KBJA 4U4MA 3TJLA 1WQ5A 1SO5A 2FPTA 3PC0A 3CEPA 3OVQA 3W7NA 4CCEA 3G8EA 5FEZA 1FDJA 1MXSA 3S1UA 5H2ZA 3BG5A 4PEKA 3TQVA 3W3OA 3G24A 1ICQA 1PIIA 2CLFA 3QJAA 4ORMA 4YL2A 1JUKA 4RJEA 4UNKA 3SW6A 2ZRXA 3HBLA 3INPA 1XL9A 2D73A 2HS6A 3MHUA 4LVDA 1XBYA 2VFEA 2YYUA 3B0VC 5AHIA 1QPOA 2W6RA 4N6EA 1A5AA 1FCVA 4MVAA 4QNWA 2CLIA 2I1OA 4NXSA 4XUGA 2Y88A 3NQ6A 3BVJA 3P84A 1XUUA 5CZ0A 1W31A 4H6KA 4LV9A 3TFXA 3B8DA 2Y62A 5AHMA 2FIQA 1G69A 2BXVA 3G0UA 5J5DA 4NX5A 5CZTA 3WJZA 1K8ZA 5SWUA 1QOPA 2QJIA 3T7VA 3LLFA 2EPHA 4JS3A 1VHCA 4N2YA 1D3GA 1AK5A 1KBIA 5AB3A 2VEPA 4S2CA 1W56A 2H6RA 5KMYA 3TU9A 3NQFA 3W7MA 3P5YA 4WQ6A 2WJZA 3NL5A 4AWUA 3NR0A 3MUXA 4R34A 4AHQA 4JTLA 3O8AA 2E6YA 4O0KA 3PM6A 3MBDA 2X16A 1GQNA 1F2JA 3L5MA 3T40A 1H7WA 4FNUA 1VHNA 2J88A 3M47A 4MZ1A 5D05A 1KM1A 2H3BA 4WZHA 1P5BA 3OBKA 3CWNA 5DLCA 3DFNA 3UWZA 1H62A 1KTBA 1U5JA 1RQHA 4IMEA 4N02A 2OCZA 1OHLA 3QMTA 1XXXA 2QJHA 2CLEA 2GUUA 3DI1A 1PCWA 2NXGA 4ZQNA 3B0UX 2ZRZA 2EKCA 3QMSA 3BO9A 2JKPA 2E5BA 5AN7A 3W7KA 3NL3A 4AEOA 1ZJIA 4UMBA 2GVJA 2J9XA 4DF1A 1UB3A 2GQ9A 3W7JA 2VFHA 1VYPX 2RDTA 5CSRA 3STGA 2Y7EA 3N2MA 3HJZA 1DQXA 3QPZA 2CZFA 5HUPA 3QYQA 4MY9A 4KWWA 2GJLA 2V5LA 3L2IA 1TRDA 2UV8G 3FFSA 4UUIA 4NNCA 2ZZ5A 3MYPA 1NSJA 3BPWA 4XTDA 3W1NA 4M6PA 1OYBA 4JTFA 2QDGA 4LUIA 4NVTA 3VCRA 2X2GA 3PUOA 3W1RA 4NZFA 3KOFA 4O19A 1JRBA 4FNRA 1P1XA 3KHJA 4PA8A 3TIMA 3ABOA 1TJRA 1VCVA 2QCGA 1AG1O 2QKFA 4NU7A 3UWUA 3NL6A 5HQEA 2RKXA 3MI6A 5G1TA 5DCBA 5K9CA 3DAQA 4CNOA 1EUNA 1QFEA 2A7RA 2CZEA 1HG3A 4Z0JA 1DVJA 3O1NA 2CW6A 1VYSX 1PL9A 4HNUA 1MEIA 2X30A 3NVTA 3NQAA 3IVSA 5DY2A 1JUBA 1C9DA 3FJ6A 3P82A 3C2RA 1Y0EA 3T78A 4BI6A 3NPXA 1H7RA 4P2VA 4A3UA 1TSIA 4FNQA 3EXRA 3M5YA 3W7RA 3HIJA 4ADSA 3LHTA 4UXDA 4O4VA 3W7DA 1SSDA 4UTUA 4NJIA 4LUJA 1GYLA 4IMGA 4LC6A 3W7OA 5BMXA 2NX1A 3H54A 4HNTA 5DXXA 1GZGA 1TPC1 3F1QA 3W7GA 4JTSA 2YCEA 1GPWA 1K02A 3RF9A 3TXVA 3GAYA 4S1FA 3W7PA 1LM1A 4JDBA 1NAL1 4CQAA 3HO8A 3G1FA 3UWQA 2V0TA 1ZNNA 3A23A 3GIYA 1L2UA 3L0KA 3V1PA 2VFGA 1LP6A 1XCFA 4Z0SA 3OIXA 1WDWA 4PH6A 3JR2A 3G8RA 3IV3A 3EX3A 3M1ZA 3LX9A 4M6QA 4MKNA 4FHAA 2AQWA 4CCDA 3OVPA 3ATYA 5LNSA 5C6MA 4ZQCA 3UD6A 2WNNA 4LRSA 4IUOA 4XQ6A 3QEZA 3R8RA 3HPZA 3LCGA 3MI2A 3GZ3A 5AC6A 3BLEA 1UJPA 5C5YA 1JCNA 2B7NA 2C18A 4LS0A 2EGZA 3W88A 3O63A 3C2OA 1KM0A 4JY8A 3MP3A 5CGQA 2ZA3A 1YDOA 3PBVA 3WK1A 3VI2A 1VS1A 4WJEA 1TO3A 1ALDA 2ZRYA 4TMBA 1L6YA 1FCUA 4TX9A 3UPWA 2DZUA 1FBAA 2XN2A 2YGYA 3C2EA 1AL7A 1TTJA 1UBSA 4P61A 2P1FA 4NQ1A 1LBFA 1MO0A 5G5IA 1Z48A 5EBUA 4Y96A 1WOAA 3QFEA 5F2IA 5F4SA 2ZCGA 5DY3A 1HTIA 1G4EA 1TYGA 3W1XA 5EPDA 3PG9A 4UTMA 2A21A 2WSYA 3ZWTA 5FEXA 3P81A 3NOEA 5BOOA 2ZTKA 2DZTA 3TC6A 1W3IA 1R2RA 1W0MA 4O1DA 1GOXA 3TE9A 1O94A 1XM3A 1Z44A 4A29A 3S5ZA 2G95A 2CLHA 1F76A 1QDSA 1WBJA 5I3KA 1U83A 3DHFA 1VJIA 3QMRA 4AHOA 1KFCA 1TPUA 2YR1A 4XBSA 2Y63A 3WJYA 1DKWA 1EUAA 4NJKA 1Q3NA 4QISA 2A6LA 1NEYA 4OE7A 2A7NA 3G3DA 4N9DA 5KITA 3M0ZA 3UXDA 3TSMA 4DEFA 1YDNA 3CTLA 2H3DA 3GAKA 4JTEA 5U4NA 2E77A 4Q4KA 3N9SA 3D0CA 1OX4A 3SJ3A 3L5LA 1LYXA 4WOZA 3HQ1A 1QO5A 3MP4A 2TRSA 4RCXA 1RD5A 4FX7A 4ZVJA 2V2HA 4IJBA 1P4CA 3LERA 3R89A 1MEWA 1AW1A 2V30A 4JYFA 2PRHA 4OV9A 4GXMA 4OBTA 1LRQA 3SZ8A 3C2VA 3CEUA 3U6WA 2CZ5A 4LVAA 4BFAA 1DBTA 4DF2A 3FYOA 3CU2A 4ML9A 3TXZA 2Y61A 5KINA 4AWSA 2FTPA 1SO4A 1N7KA 5CPMA 1ZCOA 5HINA 4BWLC 3DFOA 4JTKA 4UFJA 5LKYA 3BG9A 3WK3A 4YCOA 1H7PA 1LZOA 3EWYA 3ZWSA 5EMUA 1OFQA 1OABA 4JTJA 1ZAJA 5CZSA 5LNUA 3HOJA 2ZRVA 3W2JA 1K3UA 1W37A 4FNPA 3FA5A 1VLWA 3E12A 4NNBA 3LCHA 4I7WA 4LWWA 2WSRA 3FOKA 3HF3A 4R53A 3TAKA 1GVRA 2ABAA 3S1XA 3SI9A 2BSLA 2H8XA 1SZGA 1BWLA 2C0AA 4O28A 1UCWA 5LNVA 3B05A 3P74A 1TV8A 4TIMA 4QSHA 2WNZA 1EP2A 1SO3A 5EKYA 5D03A 1A53A 3DGRA 3PSVA 4UFMA 1A5SA 4MIMA 3WK2A 4A2RA 3Q2DA 1OX5A 3TW7A 4RLIA 3HGRA 5HNRA 4JTIA 1OX6A 3RU6A 3GDLA 4LT9A 5FF3A 3W7IA 3C6CA 3DXIA 4RR4A 2FDSA 1OK6A 1IIGA 3NQ7A 3NAVA 3S42A 3UYCA 4LC8A 3LXAA 5K2ZA 4XKYA 2NV1A 5L6UA 4CQ9A 3TK7A 5C54A 4UTJA 4ADTA 1EEPA 2R94A 3PWAA 2HSAA 1SW3A 3NQGA 4EWND 1W3NA 3W22A 4KWVA 3RMJA 2ZZ6A 1ADOA 4KFPA 4HIBA 3LXCA 3T4CA 3HGOA 3STCA 3G1DA 1MEHA 4R33A 3E02A 3W1LA 2QCLA 4M7SA 1LRNA 4JXCA 2FPYA 3G1AA 4HNNA 1QMLA 3EWBX 5CPOA 4JYEA 1EWDA 2CU0A 2HMCA 3M9YA 3S6DA 3W70A 4CQ8A 3NQCA 1F6PA 2Y70A 5DN1A 4MZYA 4LY8A 2A0NA 3N73A 4I9AA 1HFBA 1KM4A 3SFKA 3Q94A 1OFPA 4UTTA 2V5BA 1FWSA 3W2NA 4JGDA 1DHPA 1VR6A 3C52A 2RDWA 4A21A 4MFEA 3NEVA 3W1PA 3B03A 1YADA 4QM1A 2C19A 3IEBA 5D2VA 5KZMA 2TMDA 1SW7A 1XI3A 1ONRA 1QPNA 2ALDA 3MI3A 2Q8LA 3S0CA 1R46A 2Y7DA 1H7XA 1LLWA 1HUVA 5A8GA 1TREA 3C0JA 1FXQA 1KW1A 2DZXA 4JX5A 1JR1A 3GX9A 3G0SA 1OG0A 1TRIA 1J5TA 1N55A 3W1MA 2VFDA 1OFDA 5BNKA 1R2TA 3QSRA 2YW4A 3DFSA 4GWEA 3ABSA 5C2XA 3W75A 3NO5A 2ATSA 1H51A 4QJ1A 2B7QA 2ZTJA 1I2OA 5K4ZA 1WX0A 2QCHA 1KM6A 3R12A 4IGHA 5HUOA 1O5KA 3EX1A 3LLDA 1UUOA 5HR7A 4GUFA 4YXGA 3GKAA 4JIQA 1PVNA 2JK2A 1GVQA 3LB0A 1R2SA 3LV5A 2XFWA 5EY5A 3EX4A 3QQ1A 5LNRA 1FCQA 4X2RA 1LBMA 4GFSA 1VQTA 4L4MA 3LRLA 3W2LA 3LM7A 2C1HA 4IMCA 1QPQA 3M7WA 2E6AA 2BTMA 2Z6IA 5KZEA 5I3IA 4HPXA 4UTKA 2YW3A 2DZSA 3E49A 3UWVA 3W1UA 4MOZA 5IM51 3EB2A 5G4EA 1V7YA 1OX4B 2Z0IA 2J6XA 1AL8A 3N19B 1QAPA 2VELA 4Z1DA 3FKRA 2A2IA 2A6NA 4JD4A 2JKEA 4MJZA 4RZ6A 4X3ZA 4TU1A 3RFAA 4NNAA 1BEUA 4FF7A 3LOTA 2XN1A 5D2WA 3TAOA 3ZR4A 3DHDA 2GOUA 2OMAA 4C1LA 1XUZA 1EP3A 4JIPA 3P61A 1LORA 3LRKA 2ZYFA 3EWXA 4LW7A 3BK0A 3DBPA 2C16A 4FXRA 1AMKA 3JRKA 3NPVA 1G6CA 1RVGA 2FB3A 1GVSA 3PF3A 2ZA2A 1O4UA 4WUIA 1ZHAA 3SGUA 5HWNA 5LGZA 3I68A 2VXNA 4YLWA 2Q3OA 3GKFA 4G1KA 1NF7A 3NG3A 2CLKA 2OT1A 2ZZ2A 4Z1AA 3CIWA 1SZEA 2ATMA 1EX5A 4AHPA 1ZY9A 3CHVA 3FEMA 2WNQA 5D09A 2V2DA 3W23A 3F4NA 4DO5A 5IBXA 2F7FA 5GVJA 4ADUA 4MZ8A 4W9TA 2FJKA 3NQEA 5CG7A 1VZWA 1DOSA 4GRSA 3DZ1A 1ZAHA 3W7LA 3I7RA 1OFRA 3V75A 3W71A 4HSNA 5AHNA 1TMHA 1QOQA 1JUEA 1TCDA 3ZFHA 3C2FA 1IGSA 3EWWA 3HGSA 2C3ZA 3TA6A 4M6VA 1YXDA 2ZQ0A 2E5DA 2BWGA 1VC4A 3B06A 1S5VA 4QNEA 4KFOA 4OHQA 3PBYA 1GTEA 1B3OA 4AH7A 2A1YA 5F4XA 3HPSA 3NYZA 2CLLA 1H7NA 3Q58A 3A5FA 1KFEA 4M5PA 4YMZA 2ZFAA 2V2CA 3NQ2A 3DKLA 3CWOX 2QCDA 4ZMGA 1P0KA 4Z08A 2QAPA 1GTHA 1WA3A 2Y7FA 5CZJA 4JICA 4D2JA 1BWKA 2E5CA 5CPLA 5KZDA 4M19A 3LV6A 4E2BA 4MY1A 3UQNA 3P5ZA 1JCJA 1TPDA 1MZHA 5K9DA 3B0PA 4UCGA 3PUEA 2A85A 2ZZ4A 2ISVA 3H55A 1KM3A 1T0OA 1VLIA 4YWIA 1I8JA 4AAJA 1OJXA 2X1SA 4WY0A 4N9BA 1PHQA 1PE1A 2YXGA 1IIHA 3M41A 3VFLA 3PSWA 2HS8A 4GUHA 1KFJA 3CM4A 1EB3A 3KVLA 2TSYA 4RZ4A 3NL2A 4GJ1A 3GNNA 1TTQA 1SW0A 3NM1A 3TMLA 1EP1A 1VCGA 4N4QA 1FXPA 3UY8A 1I2RA 3A22A 3BGJA 1KTCA 4MYXA 3TDFA 3NNTA 3HGJA 2CZDA 1JJKA 4CNNA 5DELA 1X8FA 2R14A 4IXXA 2F84A 2JBMA 4Y8FA 1X7FA 3G3MA 4EF9A 3T55A 2AGKA 2J24A 3EWZA 3W85A 4UFKA 1AW5A 1TPEA 2ZRWA 2FFCA 3OEXA 1YDVA 4KFNA 1LLZA 1TQJA 5FF4A 1R47A 4O13A 3MWAA 5F2LA 5AYZA 1M7PA 1LDCA 4NJGA 5I3FA 4JDYA 4DF0A 4FNSA 3S1VA 3BV4A 1GT8A 5DCEA 3IGSA 1QO2A 3BW2A 3I6RA
chains in the Genus database with same CATH superfamily
4JIIX 3V0UA 4UFIA 1UC4A 2EG6A 5ECVA 3DESA 5FF7A 4F0SA 1PHWA 1FWTA 4ZFCA 4HKPA 3KTSA 2QMKA 1C7TA 1W9XA 3ATZA 1VFOA 3QOKA 4CLMA 5IXEA 2Z28A 1XPYA 4F4RA 3GDTA 4LOCA 1R3RA 1V6VA 4QHRA 2YA1A 3JVAA 2A3AA 3T9PA 1QJWA 4G7EB 3UXIA 1XLFA 3CH9A 2WMGA 2EEXA 3W7HA 4IJCA 4JQAA 4ECLA 4Y90A 5G1MA 4OV4A 3KZSA 4KIEA 3VOJA 1JAKA 4D8AA 3G1VA 1MUMA 1CENA 2G4FA 5MF5A 3UJEA 3FY1A 1V3KA 3QF0A 4R27A 1A5LC 4BJHA 2RUSA 2D0HA 3TCEA 1P6WA 2PE4A 2OODA 4OT7A 4NXKA 4RKAA 4QFUA 2PP0A 3G2GA 4GHRA 5DBUA 5D30A 2J78A 1WYIA 4GKTA 3TR2A 1O5XA 3LNPA 2WOQA 2CIPA 4HSOA 3CQJA 1R3VA 1F73A 2RDXA 2I5GA 2ZX6A 4WDUA 3L21A 2QUTA 3CIVA 1Q6DA 4FX8A 4BQ5A 3AIQA 2PLCA 4QX4A 2GJNA 4EIVA 2Q71A 3VABA 4HYVA 3PULA 4V27A 3ARPA 2Z00A 4YTUA 1LOLA 3VIMA 2YPIA 3I7QA 3U5YA 3CO8A 1I1XA 1KO0A 2PP1A 2DJXA 4K8EA 1OC7A 1VFUA 5CGTA 2PRLA 3NSMA 3PS7A 4Q8WA 4UTWA 1AD4A 2HXTA 3T44A 4ZB0A 2O9PA 1G01A 2ALRA 5LYRA 1H09A 3B8TA 4PTWA 2AAMA 2VX7A 3PJUA 4NYYA 1DXEA 4AZ7A 3GG1A 5DCDA 1VPQA 3TNBA 2WPBA 3N14A 4FOJA 3AIWA 1JCXA 2QCEA 2XGIA 3AHZA 1ZENA 3DG7A 1IR1A 5G2IA 5AOUA 5I3DA 1C92A 1ZS2A 1OF8A 2POTA 2RJGA 4PODA 3UCQA 2DV0A 3M16A 1J5SA 2Y89A 4JNZA 1W5NA 4RL3A 4DPQA 5HBFA 3M5VA 1QI3A 5CKSA 3CB3A 4CD4A 4A22A 3AFBA 1PUDA 3DYPA 3L4YA 1UASA 2NWSA 3TN5A 1XYBA 2OSXA 1V3HA 1V6XA 1FFQA 5TQLA 3LTPA 4IPJA 2X05A 1XIHA 3WEOA 3R7MA 4ZQRA 1PBGA 2D0GA 4IF2A 2DT2A 4K8HA 2VRKA 4M80A 3YPIA 4WY0B 3A5VA 2XGBA 2ICSA 2B7PA 1VH7A 1FX6A 1GWJA 1R9YA 2Z1BA 2OX4A 3RM8A 1KFLA 3ZO9A 4OECA 3CMJA 2FPVA 1CI1A 1DXIA 2OYKA 3ELFA 5D02A 2YDSA 2E4TA 4CD5A 1TPFA 1YE4A 4S23A 1IXOA 1YX1A 1VD6A 4E0CA 3WUFA 3M0MA 3TA9A 1OINA 2A79A 4K36A 1PV8A 2VEFA 1H60A 2XIIA 5FF0A 1W1PA 3GDMA 3HV8A 2V38A 3VFCA 3L7RA 1V6TA 1HX0A 1TTPA 1IXPA 2VRQA 2C6QA 2ZVRA 3RAOA 1M6JA 4P5UA 2P5NA 2CLOA 2WQPA 1H4PA 3OODA 5G4HC 3LPGA 3O06A 2X09A 5H91A 1RD6A 3GR7A 2J4GA 4O10A 1EFZA 4JQ2A 5K9XA 2I5QA 2VZTA 2QF7A 1TIWA 4LPCA 2HZGA 5AYYA 1T5AA 3WLHA 2CKSA 1T7LA 4GNJA 4K37A 4HPHA 4XBKA 4O54A 1SFTA 3OVGA 4LVBA 2YFOA 3MZ2A 3CHCA 3IJ6A 3N6HA 4JTTA 1GHRA 1UR3M 3CASA 3DFTA 4WKAA 2WZEA 4GYPC 3HG2A 3K1DA 3RLGA 3AUJA 4W7VA 3WH9A 4S2BA 5BWAA 1TWIA 4KRZA 3BTNA 2BOGX 3URNA 2ZZ1A 4IGNA 2W0UA 4B90A 2OO0A 4O14A 1IWAA 1HO1A 3IK4A 4NJHA 3PK7A 3GR4A 4LALA 5D04C 3E0VA 4Y9PA 3ES7A 2P50A 2CLMA 1MW0A 5BU9A 5DQPA 1K03A 1KA9F 2QUMA 2DORA 3K4DA 4DZIA 1PPIA 2NLYA 1KBBA 4UTIA 1WDQA 3SDOA 8CGTA 3TCSA 2D2GA 4PUMA 4WGXA 1TV5A 1I2PA 2FHBA 4IGSA 3D47A 5A6MA 3F4WA 3E96A 1XLIA 3RUBL 1DWIM 1EDGA 5B80A 1VF8A 3KDNA 1CXHA 4DLMA 2OLHA 3R0UA 3PZNA 1G94A 3MA8A 3WLQA 1YXCA 4F9DA 4PCTA 4A3QA 5J5RA 3IJ9A 2YZRA 1F74A 3GK0A 1OYAA 5J8LA 2HBXA 3ECQA 2PDYA 1J9YA 1IT0A 3EWDA 3RLUA 4MKVA 2ISWA 4GY1A 4IIHA 2OG9A 2NLIA 3RITA 3ZT7A 3NFUA 1XWYA 2PDUA 1F61A 2NUXA 1I75A 3AIVA 5BXRA 4W89A 2JGQA 3WD0A 4GI6A 5D8WA 1JZ4A 5U7SA 3T0TA 6REQA 4HA4A 3W1TA 2ZXAA 2X7WA 2G41A 4C6IA 2PTDA 3PBMA 4GINA 3IUHA 3GFZA 2XPKA 3F2DA 3AUOA 3T05A 3NTYA 1ZCCA 1XDLA 3PJTA 3EOUA 4ZOCA 4DQWA 3TROA 1GJUA 3PZOA 3R4IA 5HJYA 3E0LA 3RR4A 3S6TA 4HSHA 3AAMA 1YXYA 2R8WA 4I6KA 4YCPA 3LTSA 1DV7A 1XGZA 2GVEA 3AIUA 2QMJA 1PS9A 3H7RA 3TKFA 3SCSA 5C9XA 3WEZA 3U4AA 4NT0A 3WLTA 1FY6A 1B30A 3T42A 3CZLA 3ABRA 3T0CA 3EX6A 1GG1A 4KESA 3TOYA 1RV8A 4O0ZA 3BANA 5CCZA 3QV6A 1EC8A 4N42A 3UR8A 4RE2A 2FTWA 1EJRC 2NZLA 3FGCB 1ZJAA 3LN3A 1M03A 3GBDA 3DI0A 1E70M 4QS5A 3C4UA 1P7TA 4XAGA 1QW8A 1KBLA 3TVAA 4KEMA 2DSUA 2ZUTA 4UBPC 2ZA1A 2JF6A 2GJXA 3AU6A 3RJYA 1SSGA 2IKIA 1XRSA 1G7VA 1W1VA 2OGYA 4FEZA 1W9VA 3GVQA 3OA3A 2QT3A 5IDIA 1HQTA 1H41A 2ACSA 2F61A 4ZQPA 3WFAA 1ODUA 3BW3A 3CZEA 3VE9A 3CZGA 4DRSA 1F3EA 4YTQA 1W5MA 3E2QA 4UMAA 2ANUA 2PDXA 2DPEA 4OGZA 3LD5A 4OU1A 4JFWA 3EWUA 1OC5A 3S5SA 3L67A 4Q32A 4QAIA 3CUGA 3RX3A 4QJ5B 1ISXA 4PCNA 1KV8A 5C8BB 2PS2A 4GIAA 3IIVA 3R1ZA 4J7RA 3ZYZA 1KGWA 1XBVA 1D9EA 1JCLA 5B7YA 1H1ZA 4M7TA 4XSMA 5F1UA 4HPNA 5AHEA 1X1OA 3E0IA 3GDKA 1J18A 2ISFA 4DXVA 4C5ZA 3LTYA 3H23A 4X61A 3SN0A 5CPSA 4XZ9A 2BB0A 1WZKA 4E38A 4O1CA 4CU6A 2B4GA 4IT1A 4BQ2A 4TR9A 1UQYA 3CT7A 1HF6A 1JNEA 4B5WA 2DT0A 4ZB2A 4E4FA 3CQ0A 3L68A 1U1JA 3HPAA 3URBA 4X22A 4CNUA 4AMAA 3O6AA 3NQVA 4PL1A 3SSJA 5G4WA 3R0DA 4MB3A 1C8YA 5CSSA 1VEMA 1G67A 1HXJA 2VENA 2BOFX 3GTIA 3NDOA 3MP5A 4GGBA 1KFKA 4RXFA 3AS1A 3PPCA 1H0IA 3WJXA 4UR9A 3FEQA 1OIMA 3W2MA 1HKMA 3L0NA 5CPQA 4A4AA 1CW2A 3N4EA 1ECQA 4GISA 4IQDA 4TVCA 1XLLA 2A3LA 2W4XA 2GUBA 3TZNA 1NJJA 2FFIA 1G4PA 4AISA 2ZX5A 1LTDA 1B90A 4EAYA 3MJMA 2C13A 3CAKA 2XH4A 1B31A 1LROA 2OOGA 1HIZA 3N04A 2EPNA 3OVRA 2E6DA 5LNWA 2GSEA 4PL2A 4FXJA 4QLKA 5I3HA 1NARA 3A24A 2OYMA 2Y7GA 3N2CA 2WCSA 1I45A 6XIAA 4WEVX 2PP3A 2E68A 5EBAA 3UNDA 2GPTA 2XIJA 3BOFA 4O53A 1DTUA 4U28A 1EWEA 3HPXA 4KBXA 1ML1A 3TLLA 4DWSA 1KQYA 4EE9A 3AHYA 1EQCA 4YHEA 4QJ3B 5C9UA 4MWAC 4JNMA 1YE6A 4S3KA 5D2XA 1A5BA 1EJ7L 1AH3A 4IZGA 2YXXA 2UZ9A 4CQCA 3F4DA 3O07A 4Z2IA 3AYTA 1P0NA 4US6A 1FWWA 3IJ7A 2IKHA 3GR8A 1TR1A 4ORIA 2OEJA 4WOQA 3GS6A 3ALGA 3S9YA 3PZIA 3AHTA 5FSDC 4MSSA 3I4EA 1M7OA 4PSPA 3NPUA 2F2KA 4Y9OA 4A8NA 4CGTA 4AVOA 4PMDA 4MFDA 4F66A 3L5AA 3S5YA 4ICNA 3EXSA 4ZZ9A 1AJZA 1TMLA 5D2YA 5E0CA 4O4WA 3L0GA 4JX6A 1OCJA 4UR8A 4AB4A 1XJBA 1EH9A 1EBGA 1JQXA 3AU2A 3B40A 3WBAA 1EPXA 3NQ8A 4ZODA 1LG2A 1F5ZA 1H1YA 4PRTA 1SPQA 4FOKA 4TVDA 1V6WA 2OX1A 4Q4RA 4NZ5A 4EKJA 3M5ZA 1XIBA 1L9WA 1R87A 2XYLA 4HQVA 4IICA 4UC5A 3WSUA 1KBKA 5EMYA 2VOTA 1TPB1 1G9HA 4AF0B 2XSAA 3F4VA 5IRPA 2B7OA 4LS2A 5EA9A 4DJFD 4OWGA 1JF5A 4UB9A 1B57A 2XUCA 3I6EA 1UWIA 5D2TA 3TYEA 2VDGA 1WQ5A 3PC0A 1IQ8A 3VD7A 1VB9A 3OVQA 4GGHA 3W7NA 3G8EA 5FEZA 4H9VA 1MXSA 2GGGA 1E1CB 3BG5A 4FF5A 1YW1A 4ORMA 4UNKA 5HXMA 2Q01A 3F2BA 3ALFA 1EJWC 2D73A 2HS6A 4LVDA 5E09A 1XBYA 2XHYA 1QPOA 1QT1A 2W6RA 2PGWA 1A5AA 4GH1A 3FW6A 5HQLA 1LWIA 1E71M 1EJXC 1UP2A 1XUUA 3TFXA 5AHMA 5C2GA 3QR1A 3U57A 4CNTA 3VIJA 4KETA 1K1DA 3WJZA 3CMGA 5SWUA 2QJIA 1OT1A 3VU2A 1VHCA 4N2YA 4LX4A 4CCZA 2Y24A 1W56A 1UQZA 3H26A 1XLDA 3W7MA 2WJZA 3NL5A 1XIJA 1Y5WA 4RW5A 4AHQA 4JTLA 5I79A 1LQ2A 3G1RA 1QBAA 4I6VA 3ZJKA 1F2JA 1GVIA 3GSMA 4IQJA 2E1WA 3ICJA 3QKZA 4KCTA 3M47A 4MZ1A 1GNXA 2VZSA 2H3BA 2R9RA 1KR0A 5LXEA 2E9MA 2ZUWA 5BOEA 3DFNA 1KTBA 4CN4A 1J6OA 1W3JA 3EB4A 2OCZA 4AD5A 2C7FA 4ZBCA 3VGHA 2X1IA 2NXGA 4ZR8A 4ZQNA 2EKCA 3BO9A 2JKPA 1UH3A 3NL3A 3EMZA 3HFTA 6A3HA 1UB3A 1R0MA 2VFHA 5BZAA 1IEXA 1JEZA 3STGA 3ANUA 2TODA 2ZUUA 1MUWA 2QXWA 5HUPA 1JZ6A 1CLVA 1MW3A 3L2IA 4AY8A 1TRDA 3VKDA 1PDYA 4JKMA 4QLLA 3QPEA 3OYZA 4L1WA 4GH3A 1NSJA 4XTDA 4JTFA 2QDGA 4LUIA 1DWJM 1M7JA 3PUOA 4J3VA 4NZFA 4O19A 4QROA 1HJUA 4WGHA 1PZ0A 2QCGA 3NL6A 2BVWA 4BA0A 4CNOA 1EUNA 2BGSA 4PUKA 3EWCA 2NT0A 1E0UA 2NVDA 1OD8A 4QSFA 4HNUA 4FXFA 5XIAA 3IVSA 1DWFM 4MB5A 2WAGA 2XJ7A 3IJLA 1MRAA 1TSIA 4OTKA 3UWEA 4ADSA 3VDCA 4UXDA 2J13A 1V02E 4O4VA 3A13A 4IMGA 3W7OA 5AYIA 1E6RA 2NX1A 1YNQA 2PSNA 4HNTA 5DXXA 3F1QA 3W7GA 4XAFA 4MAZA 1DJYA 2YCEA 1GPWA 3RF9A 3GVRA 4DI9A 3GAYA 4AZ6A 4S1FA 4FR1A 1N82A 2R24A 5I07A 3DERA 3AMKA 4Z0SA 1XG4A 3WF4A 1EF3A 4PH6A 1ZU8A 3RM4A 4M6UA 4LAOA 5JBFA 3M1ZA 3BLOA 4MKNA 1I0BA 1W17A 3OVPA 1MXDA 3CPGA 1R5YA 5C6MA 4ZQCA 1IEWA 3DX5A 3PAOA 2QV5A 4IUOA 4GI8A 1O7AA 2Z24A 1RCXB 4C6FA 5C5YA 3VNKA 3M46A 1ISZA 1GKQA 4WJ8A 3SCUA 2J7GA 4JY8A 1LJYA 5A6BD 3PBVA 4WJEA 3W27A 4PRWA 1TO3A 1KCLA 3CYVA 3GDBA 2Q8XA 3UVIA 2PDPA 1KCZA 2VURA 3LU2A 2YGYA 2IQ0A 3VGDA 3PP7A 1UBSA 2P1FA 2WW5A 1J0ZA 2YB4A 5EPDA 2VR5A 4QCEA 3V5OA 2DZTA 4ZO8A 1FWCC 1W3IA 1R2RA 1W0MA 4QE4A 4GO9A 1QATA 2G95A 5CQ1A 3H4GA 2EQDA 1U83A 1YIXA 4JIEA 2ESCA 2D20A 3XIMA 2XVLA 4AHOA 2AMXA 1ITUA 3WH6A 4XBSA 3U3HA 2Y63A 3WUEA 3ITVA 4CU7A 1EUAA 4L7ZA 4CN1A 2Y2WA 2OEMA 2A6LA 1FH8A 1UW9A 1JPMA 2WMIA 2A7NA 3G3DA 5GJMA 4L80A 4N9DA 5FD0A 3M0ZA 1CGUA 3TSMA 4DEFA 1YDNA 2RGLA 1HNYA 3VOFA 4C6JA 2E77A 3WH8A 1K9TA 1WUFA 3D0CA 5CAKA 1BXNA 1TJ2A 3HQ1A 4MNJA 3MP4A 2TRSA 4UQEA 1F4AA 4FX7A 4W5ZA 1O1HA 2V2HA 3KBSA 3PN8A 4DI8A 1P4CA 3LERA 2JF7A 2V30A 1RA5A 3C0LA 3A12A 4OBTA 2OTDA 1MW1A 1XH0A 3A6OA 3IJQA 3LMYA 3QFWA 1DBTA 2O92A 3GZAA 3E5PA 2BBFA 2FTPA 4Q6JA 1DJXA 2HDJA 4JTKA 1UZDA 5LKYA 1Q7ZA 2XM1A 3BG9A 3UETA 3WK3A 4XISA 1LWJA 3AZSA 1E9LA 1Q13A 3F5LA 1OABA 3F7JA 3GIPA 4Z2LA 2ZADA 3QOMA 4NNBA 1VIWA 1RCQA 3FOKA 4QDPA 2ABAA 2BSLA 4GG9A 2C0AA 4YYCA 3B05A 3P74A 2VL4A 3H4WA 1NOUA 1QBBA 2VGFA 2WNZA 1SO3A 1A53A 3VIKA 4CQBA 1DJHA 4RZBA 4QDMA 3QGAC 3MMWA 3BICA 1XCWA 1RP9A 1OX5A 3PNUA 4RLIA 5HNUA 4E8GA 4ZENA 4JTIA 2DVTA 4KIRA 4GOAA 3WFLA 3THDA 1TKKA 1OK6A 1H0GA 2VGIA 3S42A 3WLPA 5I0DA 3AJ7A 3AWNA 5L6UA 4BF5A 3PJWA 2F8QA 1CXKA 1DQUA 4KH2A 2V3GA 4DJFA 2G0WA 2KAUC 1JZ7A 4HP5A 4AIOA 1ADOA 2CC0A 3LXCA 3QKEA 1JYNA 3HGOA 3G1DA 3QQWA 1BFNA 4XZHA 1XYAA 4M7SA 3JU2A 3GTXA 3DYMA 4IG2B 1BLIA 3EWBX 3HZ3A 2D3NA 1XIGA 3S6DA 4CQ8A 5DN1A 2Y70A 4MZYA 4LUTB 2VP8A 3SFKA 3WLOA 1XRTA 1VJSA 1OFPA 4UTTA 1FWSA 5AC4A 3C52A 2RDWA 1NU5A 3W1PA 3B03A 3UXLA 4CVUA 5KZMA 1SW7A 1KXQA 1XI3A 4AY1A 4QCFA 1UBPC 2Q8LA 5JXQA 4E3TA 1LLWA 2GGHA 1HUVA 5A8GA 1TREA 1YRRA 1DXFA 3EYPA 4AZ5A 4E2VA 3CNYA 1OG0A 1HZYA 5ABFA 2VFDA 5BNKA 1R2TA 3BV7A 1W9PA 1B3XA 3B0YA 3O7UA 1RBLA 4JN7A 1C93A 2ATSA 2ZTJA 1I2OA 1Z89A 1WX0A 4IGHA 3R12A 3QBUA 3W00A 2B31A 3LGDA 1CNVA 1PVNA 1R2SA 2J7FA 3LV5A 3QQ1A 2DFAA 3EZ4A 4L4MA 4X0VA 3CL7A 3SUVA 3LM7A 1J8VA 1WZAA 2FZNA 1XIIA 1GOWA 2E6AA 3SAZA 5I3IA 2ZUNA 4JFSA 2YW3A 4PMXA 4GVFA 3E49A 3SCRA 4MOZA 3UG8A 5IM51 1XISA 3DG3A 3K1GA 2XWDA 4HHMA 2Z0IA 1E9ZB 2J6XA 2Y5JA 3U9IA 3B3DA 4PTXA 4P8VA 4G7EA 3TYAA 2VELA 1EBHA 2WZTA 4Z1DA 2W66A 4E8DA 2XSXA 1AODA 4GZEA 4X3ZA 1MW2A 4F0RA 1BEUA 1E0TA 2XN1A 3BZGA 3ZR4A 4O0QA 1XUZA 3L23A 2YDRA 1LORA 2O56A 3JRKA 3MSDA 1GVSA 2W27A 1O5QA 4GY7A 5LGZA 2D1ZA 4P7NA 2VXNA 3FVDA 3GKFA 1UIOA 3VOGA 3IWPA 2CLKA 2CESA 2ZZ2A 3CIWA 5DO8A 3B8VA 1ZY9A 3CHVA 3MUZ1 5E0FA 3UJ2A 4GIYA 1MMFA 3IK2A 5C0QA 4UCFA 2A3EA 3G77A 2E8YA 2V2DA 3W23A 3BLKA 4DO5A 1X7IA 4B5VA 3EOEA 5IBXA 2F7FA 4AWEA 4ADUA 2FKPA 4J27A 5EU9A 3B8IA 3VNJA 1DOSA 2OQHA 2XFFA 1ZAHA 1HJSA 2G3IA 5HANA 3V75A 3W71A 2R82A 4HSNA 1HKWA 3EMQA 3QHOA 3VDAA 3ZFHA 2W9MA 3EWWA 2VC7A 3TA6A 5HJXA 3WLLA 2E5DA 2BWGA 4EPKA 1CIUA 3B06A 3W37A 5JQ9A 2W3ZA 4OHQA 1FHVA 4QBXA 1TA3A 1E56A 2PD9A 1TWZA 2A1YA 3KTCA 5A6KA 3WIJA 2CLLA 4ICMA 3LZ5A 1KFEA 4M5PA 5BRPA 2Z7KA 4YMZA 3P93A 5AYBA 3CWOX 1QUMA 3ZLHA 4W86A 1F07A 2Y7FA 2ZXQA 3VUSA 4NP7A 1XYCA 1A0CA 3VNMA 4E2BA 4MY1A 4NASA 5LXXA 3UQNA 1E4IA 3U7VA 4JKLA 3P5ZA 3KLLA 5K9DA 4PZVA 3V18A 4LEFA 2AGTA 1GW9A 4BQ4A 3KL5A 4WY0A 3VD3A 3P2VA 1IIHA 3VFLA 1HW6A 2O0TA 3PSWA 1SGJA 1S2VA 4GLEA 1UD8A 3UCCA 3CM4A 3BWWA 2Z2BA 3OGRA 3M64A 2UBPC 1E6QM 1XLAA 3GC5A 4GJ1A 3GNNA 1EJSC 1JDAA 3BSMA 1JG9A 2BGNE 4TV5A 4HTBA 3M6DA 1IZJA 4Q3MA 1UWTA 4GQQA 5PTDA 2FGLA 4MYXA 1BVZA 4W7UA 3RU8X 4DJEC 4HMNA 2JBMA 3R10A 3G3MA 3QR0A 3T55A 2AGKA 3GUWA 1AW5A 3U2ZA 3E5BA 1W2VA 3TZFA 4Y2WA 4ZCWA 1YDVA 4KFNA 3ZJ8A 1P0DA 1N8IA 4O13A 5AYZA 2WC3A 4J35A 1UD5A 4NJGA 4BEQA 4JL1A 3B8UA 1EF2A 3BV4A 1MQPA 2C71A 3IGSA 3DDMA 1FWAC 2H6RA 1ISVA 3QLLA 2G96A 2WVUA 5FJJA 5E0KA 4PTDA 2DU2A 3GHUA 3CQIA 2FMNA 4D6JA 3W76A 3VGEA 2A3CA 2X8RA 3GNRA 1Q6EA 4W85A 5IHSA 4WDTA 1KWKA 3TX9A 3B04A 2BV9A 4MF4A 3W81A 2OZ0A 3R5EA 4JTQA 1UUMA 4FK9A 1LBLA 3LI0A 3MKCA 3UY7A 1R38A 3VGBA 4J5NA 2XZ9A 3EXTA 2O7QA 1EEXA 2DZBA 1ME7A 2GWNA 1KKRA 3VDHA 4HN4A 3PZMA 1QHPA 3PY2A 1V3LA 4FO4A 3NM3A 1S5WA 4GIEA 2ZWZA 1VP5A 3GVGA 1SR0A 1TG7A 3F03K 1FWBC 4AZCB 4DAIA 3V0TA 4UQ9A 4MPKA 2P76A 3FLUA 2PWUA 1ZRQA 1XC4A 3QC3A 2WC4A 1Q65A 1K7EA 5D8ZA 1T96A 4QP0A 1VPXA 2YLLA 5DMMA 1IT8A 1N2VA 4DO6A 1K8XA 1HKJA 4LAKA 3SY5A 2FH8A 4ERGA 1LQAA 4PMQA 1M04A 2QCNA 5I5RA 4QTGA 4JY9A 3I3DA 2NW0A 1PKMA 2X1TA 4AD2A 1S1RA 2DW7A 4QITA 2QULA 3LBOA 2GL5A 2WHLA 4E8CA 2WJFA 4HPJA 3MHGA 5HK4A 2X0YA 3IRDA 3TWBA 2JQXA 4HNLA 3LMZA 2PDJA 3CB8A 4D6CA 1N8FA 1R3TA 1GOMA 4LYQA 2DSWA 2QUUA 1BPLB 2G97A 3NOYA 3Q67A 1FQ0A 3P0XA 2VYOA 3QQ0A 2CLPA 5CSUA 1XGEA 1YYAA 2QUNA 4J2PA 3P3BA 3OYXA 3ITLA 1T99A 4NUWA 1SU5A 5AVHA 4Z1BA 2QCDB 2ZXBA 2G3MA 9CGTA 1TUXA 4YYFA 1PJ9A 3N2BA 3LCLA 3BGGA 3THQA 2WQDA 4PN2A 4XO6A 3SQMA 2GUYA 4H41A 4IOTA 1CDGA 2VR2A 3RIKA 3LBCA 1NTHA 1UKSA 3SQSA 3U2OA 1W5OA 1KQZA 2V82A 3LS9A 3SCWA 2FQIA 4GYKA 4WXZA 4RUBA 3AMLA 4IIGA 3WJSA 2I14A 3I3BA 3OIHA 3KBMA 1BTMA 5CAHA 2DUXA 3U2CA 1JNDA 4QAWA 1JIBA 1W2PA 1GJWA 4NILA 1DEDA 3LCWA 5ECUA 2J9ZA 3QZEA 4XZLX 3R79A 3O9NA 2BS9A 2WWCA 3F5JA 3G1SA 3TLQA 2VX5A 1WB0A 2GQAA 4IP7A 4Y8EA 2WKGA 3N2TA 3KUMA 1J96A 3NZPA 3AJXA 4XIAA 1F3WA 3NZ1A 6CGTA 4BHYA 2QF8A 1PCKA 3O6DA 1FWFC 1PYFA 5EYWA 1ZUAX 3VINA 1M5WA 3QHNA 2IPFA 1DE6A 2G3JA 1BYBA 1B3ZA 3H21A 4PULA 4IMFA 4FP1A 3H2NA 5M2FX 4PMRA 4HHLA 3QSTA 3STEA 1A49A 1QCWA 4EVZA 1U1HA 4YIWA 3MHFA 2ON3A 4KT2A 3AWOA 3TH6A 1D3HA 2GFTA 5KTLA 1N8WA 4WXYA 1JCMP 3NZRA 2VOMA 3S3GA 3G1XA 3AXIA 3MVIA 4UTHA 3QY6A 3BJTA 2J7HA 1TWWA 3KRSA 1YTDA 1YBQB 2FB2A 3WD2A 4Q8OA 4L56A 4C6PA 1SUXA 3P8JA 4HN8A 4LANA 2VR4A 1WKDA 2WBKA 4PC8A 2VC6A 3K8KA 5JIPA 6XIMA 4HU0A 1ZL1A 1BXBA 2CXGA 3TV8A 3QRHA 2E0PA 2CERA 5GNZA 2IXUA 3SCVA 1QU4A 3LI1A 4MYAA 2FHCA 1KFBA 4Z1CA 1VCFA 5F1VA 3CJPA 1KTNA 2OVLA 1MDRA 3AO0A 5D32A 3UZZA 4O52A 1XW8A 4PB5A 1V5XA 1TE1A 3W29A 1FDZA 1Z3NA 3QHMA 1K6WA 1DJGA 1XRFA 1E40A 2J27A 4XO7A 1WDSA 4G9PA 5HR6A 2V67A 4ROQA 4UOZA 1EA9C 2A5HA 3RO6A 4EPBC 3MB9A 2D24A 2FHFA 3QPYA 1FUYA 4G7FA 1UD2A 3EPOA 1WDPA 3USBA 3MCMA 4BY3A 4XAZA 4LV4A 3UZ5A 1W5PA 2NXHA 1OFBA 1GHSA 4FA3A 3ZSTA 4DELA 3EX2A 5BOFA 5C71A 4FIRA 4ALDA 4HMEA 3MJYA 3FN9A 3XISA 1GOQA 5M17A 1NVMA 1C91A 4WX2A 1YDYA 4LU0A 4RE4A 3M0VA 1GJPA 3PFMA 3N25A 3G6LA 3PPGA 5E6ZA 3MPGA 2BHZA 2WSPA 5ABEA 1FWHC 2CHRA 2YBTA 3T8QA 3L4UA 4D1IA 3GY1A 1JAEA 3CMFA 4J3SA 2V8ZA 1UH4A 3GW3A 4GVGA 4GE8A 4MNKA 3TYCA 3ZR6A 3BAYA 5AZ1A 3NQMA 2DIJA 3GHTA 4BK9A 2QQ6A 3GBEA 1D2KA 3REQA 1PDZA 3CTTA 4KQNA 3BLFA 3HPFA 2A7PA 4LRTA 4C6LA 1PAMA 3G1HA 4O50A 1WPCA 4JL2A 2O7SA 1ZBWA 3WENA 2QAFA 1R30A 1K70A 4JTAA 2X1RA 4TV6A 2CITA 5AYXA 4B16A 5EFDA 3WQEA 1FFRA 4PMJA 1J2WA 4AD1A 1V0NA 4XKYB 4M56A 3ANYA 1KV5A 4WSKA 1EA0A 4LXFA 4MWAB 3OZPA 4W87A 1QWKA 3UJFA 4C7GA 2H9AB 3LCFA 4UZSA 1V0KA 4P7QA 3S5OA 4JKKA 2VKZG 4D6FA 3W53A 3VKJA 3SFWA 3V1HA 1W9BM 1EDQA 3ARYA 2QNEA 1IF2A 2V9DA 4UNIA 5HMSA 3TYDA 3N4FA 4UMCA 3W72A 2V81A 3LEPA 4AW7A 4MMWA 3RRXA 4N9EA 3TYUA 3FAWA 3GO2A 4YWSA 3BE7A 5JVLA 4CVWA 2D22A 1MXGA 5AHFA 4FIQA 3DFHA 2Y85A 4FXSA 4OBRA 3WF2A 1FWRA 1JQVA 1ZAIA 3SCTA 4O1EA 5FEPA 4EXBA 4IFOA 4CNPA 1K9EA 1B3WA 1GZ1A 3EEGA 1FHDA 3RILA 1JGMA 5MHBA 2DT3A 1V7AA 3PB2A 4GNKB 4U5IA 3MKVA 4DN1A 3S5NA 7ODCA 2YXOA 4ZQMA 5E9AA 1JVNA 3BGAA 1JCYA 4MPQA 1I9CB 4JNYA 2Q02A 3GLCA 1GKPA 3BMVA 4IPPA 1JRCA 4DBDA 5BXPA 3B0XA 3R25A 2ZDRA 2Z27A 2YKKA 1S5TA 3EKLA 3QZAA 4LB4A 3QH2A 4U10A 3ARQA 1EZWA 3R6IA 1PZ1A 1FOBA 2BX7A 3M43A 1GPFA 4AF0A 7ENLA 2IPWA 2VEIA 1WXZA 3BW4A 2EG7A 1O68A 1YTKA 1DIEA 5CPTA 1Q6LA 2PDGA 4WVXA 3MWCA 1UH2A 4O17A 4H01A 3VMNA 2IKGA 3R0KA 2BXZA 1E1CA 4QDWA 2I9EA 4R3UA 3GH4A 3BCJA 4IPIA 2V5KA 4US5D 4L4OA 1WCGA 3NEHA 3BCFA 3TNOA 5I3JA 2DZAA 2NXIA 3COTA 3GTFA 3SY1A 1JI2A 4RPPA 3T2PA 5MKGB 4O57A 3TWAA 3RCYA 4TX6A 1JXKA 1LOSA 2QCCA 3GYEA 1H61A 1PTGA 1LRTA 5T9CE 2VX4A 3WLJA 4H8HA 5CGMA 1TTIA 4L9XA 4PMUA 4X9SA 4DNMA 3T0BA 3WQPA 1K7FA 3N4AA 4O12A 4RDYA 2VD9A 3WNMA 1H3GA 1LWHA 3S6OA 3OZYA 4HU3A 4H8VA 4A35A 3CLMA 2XH7A 1FKWA 3PUDA 3GD6A 4K2SA 3W28A 2XZ7A 1GONA 5CBBA 6TAAA 5D38A 4V33A 4LVFA 1RZMA 2J62A 1BSIA 3TSDA 3VX1A 4XB3A 4MLJA 3N34A 1SZNA 4H6QA 5E93A 5DXYA 1THFD 2DUAA 2PA6A 3SIZA 3VZXA 2HNEA 1OZMA 4PMYA 4E4UA 2QEZA 3DECA 4CEXC 3DU0A 2VCCA 3AS3A 1I4NA 4BWLA 4RE3A 3MYOA 2DP3A 3I65A 1XV8A 3ZJ7A 1UWRA 3BARA 5LHFA 3O3RA 2VUNA 2X41A 3MBFA 1RLCL 1A5OC 2VC9A 4AWTA 3WQ4A 3VE7A 3MV01 2OQLA 5K3VA 1DIKA 5JH2A 3OG3A 4RPQA 5HWMA 1FKXA 3WJWA 4OOUA 3VOCA 1Q8JA 2QGHA 3VOHA 1UPMB 1UKQA 1TPVA 1FCBA 4JQ4A 4KWUA 4L9YA 5TIMA 1KWGA 1NFBA 4GMEA 3FS2A 4PUUA 4IX2A 3M7SA 1MQRA 3WDPP 2PRMA 1Z9AA 1HKIA 3L2MA 4ENLA 3VC6A 1SR9A 2WZHA 2C14A 1AVAA 3LHZA 1RUSA 2NX3A 2BMBA 3RDKA 2OT0A 3H2FA 2VI0A 4DLFA 3TQ0A 4INFA 3LPOA 3LQGA 4HHPA 4AX6A 3FJLA 3GHSA 4R9OA 2PD5A 4R9XA 3CZ8A 4I5XA 2PTWA 4GA8A 1TIMA 5REQB 1WOBA 3HMJG 1NWUA 2IQDA 3EGJA 3WNLA 3T1GA 3QGKC 1Q45A 3UR7A 4EF8A 3AZRA 3RLVA 1XDMA 4GPNA 2XN0A 3DKJA 1H63A 5HAOA 1E43A 1LQ0A 1DJZA 4WK9A 3UGRA 1D3CA 5CPNA 3S83A 3S1WA 2JGYA 3W07A 4O8RA 1H5YA 1Z6KA 4NJJA 4HBKA 7A3HA 4C91A 4FAMA 5CG0A 1W8GA 4S3JA 4ASTA 4L64A 4G6CA 3VO0A 2R6OA 4H19A 3K5XA 2QVHA 1W3TA 3SM0A 2DQWA 3T07A 1OVDA 4V15A 1IGWA 3GFXA 2XISA 5BWFA 4MUZA 1BQCA 3KAOA 1GOKA 5LIXX 3MDWA 2WKJA 4MHBA 5D9PA 3W1QA 4H83A 4W8AA 4HCHA 4U4MA 3TJLA 2CNCA 4FSAA 2G3NA 1YMYA 3S1UA 3W3OA 3QJAA 5DMNA 4RJEA 3VZZA 1JZ2A 5M03A 4GCAA 3VK5A 4WKHA 3MHUA 4YN5A 5HDRA 4KMQA 4IJRA 4N6EA 4W84A 1FCVA 1CCWB 4QNWA 3BVJA 3ZVHB 4GZ7A 4PMNA 3NWRA 5CZ0A 4LV9A 4FLQA 4AC7C 1WUEA 3G0UA 4NX5A 2JIWA 2Y5SA 8A3HA 5DT7A 1EGVA 3BJSA 4ERIA 1QOPA 2NT1A 3T7VA 4JS3A 1DIOA 5IDZA 1D3GA 4A05A 3B9NA 2VEPA 1U33A 4S2CA 4ZGYA 1PIGA 3TU9A 4PR4A 4H04A 2J7CA 1KR1A 3GWQA 3NR0A 3RG6A 4R34A 1OD0A 2E6YA 1FHUA 3PM6A 2ZDSA 1UZ1A 2X16A 4XD3A 1F9CA 2OXNA 2FH6A 3T40A 2P3EA 3K8LA 2J88A 2AQVA 3WY1A 1KM1A 1L8NA 2ZC8A 2YBVA 3TONA 4WHBA 1JD7A 4J3ZA 1H62A 4QE5A 4V1XA 1RQHA 4IMEA 4H7ZA 4NRSA 4N02A 4IQEA 3LPFA 4I8DA 3CPUA 4FLOA 4B4FA 2QJHA 2PWGA 1PCWA 3BURA 2ZRZA 2E5BA 5EGRA 3WH5A 1ZJIA 3PPFA 2J9XA 1J12A 1VFTA 2X0HA 4MKSA 1LF1A 2EBNA 1VYPX 4LEQA 4IGMA 1NWRA 4LYKA 2RDTA 1O5RA 3LZ3A 2CZFA 4XZMX 1RK5A 1FWEC 2HRWA 1A5MC 3R8GA 2GK1B 1SVDA 2HVMA 4XZNX 2ZZ5A 1VFFA 3BPWA 3W1NA 2VEGA 4NVTA 4PMVA 2I17A 3W1RA 1OG6A 1BF6A 2CXEA 3KOFA 3QV9A 3TIMA 3ABOA 1TJRA 4H9UA 3WDQA 1VCVA 3W4RA 1AG1O 2QKFA 4IFRA 5HQEA 3ARTA 2RKXA 5K9CA 1QFEA 2A7RA 1UROA 4HB7A 4Q6XA 1HG3A 5A1AA 3ME3A 2CW6A 1VYSX 1PL9A 1NM9A 4HYRA 2X30A 3NVTA 3NQAA 4FZIA 1C9DA 2ZUMA 5HMEA 4TVUA 3T78A 2OU4A 3WUBA 5H8MA 1DPMA 3NPXA 1JPIA 2EPLX 4U3AA 3EXRA 2J47A 4Q8PA 3UJRA 3LHTA 1YKWA 2VC5A 3R43A 2XIOA 3GVWA 4D8ZA 4LUJA 4PUWA 1OWQA 1TPC1 4JTSA 4NAFB 3JW7A 3TXVA 1JF6A 4WSHA 2VVSA 3IUDA 5GJNA 1C3FA 1NAL1 4CQAA 3HO8A 3G1FA 3UWQA 3EAUA 2PPGA 2V68A 3GIYA 3LPPA 4DM2A 1L2UA 3LA4A 1LP6A 1XCFA 4B2DD 3EX3A 4US5A 3ABZA 3TQPA 4FHAA 4CQDA 4IG2A 4JOMA 2NV9A 1BF2A 1E6SM 4LRSA 1XQKA 4AD4A 4BEUA 3QEZA 3MI2A 3GZ3A 4DYKA 1JCNA 2PDBA 3N15A 3W88A 2EGZA 3MO4A 3S46A 3C2OA 3R8HA 3IS4A 3IACA 2ZA3A 1QRQA 1YDOA 3WK1A 2PTXA 5E6YA 2WPGA 5CJ5A 1FCUA 4TX9A 3UPWA 3WDRA 3AXKA 1OC6A 2XN2A 4YTSA 4NQ1A 5C70A 5G5IA 2XM2A 3QFEA 1H1NA 5A2BA 1HTIA 3FJ4A 4UTMA 1QNQA 1GVEA 3IAQA 4PB3A 1ZQ5A 3P81A 5BOOA 1JDFA 1V8EA 3W02A 1OEPA 1E4MM 3GFYA 1OT2A 3W0KA 1O94A 4HK5A 1Z44A 4M51A 3S5ZA 5I3KA 1F76A 3H2EA 4B5UA 3WFZA 1W6TA 3W6LA 4GKLA 1KFCA 3HM7A 2YR1A 3CAVA 1GK8A 4FMVA 2FGZA 4UWMA 1E5JA 4AQLA 4H9TA 5EB8A 1ZP3A 3LYEA 1NEYA 4OE7A 4ATWA 5CEWA 3R58A 4ZE5A 4DJDD 2OEKA 5U4NA 3KL0A 2ZE0A 3N9SA 3MANA 3SJ3A 2QIIA 2EPOA 1V03A 2R1PA 1SYTA 1RD5A 1BGGA 4HU4A 3R89A 4Q7IA 1MEWA 5ABGA 4OV9A 2PRHA 3VILA 4TX8A 4GXMA 1UOZA 2PWHA 4Q8VA 3UFYA 4G5DA 3HMCA 4ZOBA 1R3YA 5C9ZA 1XD1A 3VDGA 3CV6A 3QR3A 4P8XA 5KINA 4Q8UA 1PWLA 5T91A 3VVGA 3DFOA 3T6CA 4UFJA 3RCNA 4MNLA 4YCOA 3DHPA 3EWYA 4ROPA 1U5HA 3ZWSA 5CXPA 1OM0A 4JTJA 3C86A 2Q09A 1XIDA 4GVHA 1FP8A 1XLEA 1J01A 2UY3A 1RP8A 4IISA 3FA5A 3B8WA 3SCOA 2FZ8A 4I7WA 3OOQA 1E1FA 1VEOA 2XFRA 1GVRA 4IUGA 4O28A 1BWLA 1EDTA 1UCWA 3BAIA 3MV11 5M3WA 4MADA 3HN3A 1EP2A 4M24A 2J75A 4S38A 3B4YA 1GCYA 2X40A 3PSVA 4UFMA 3BDKA 4MIMA 2J79A 1P1MA 3TW7A 1S5MA 3TYBA 4OBSA 1XYMA 4KCWA 2BVYA 1S2TA 3VOIA 4B5SA 2PBGA 4ICCX 3NAVA 1ZBCA 3BH4A 3LXAA 3WLRA 2PDLA 3LGGA 4IH3A 5C54A 3OLIA 4H2HA 4M81A 3PWAA 4J4KA 4MTVA 2HSAA 2O55A 4IPLA 3FCPA 4D72A 5XINA 2QPXA 3KOZA 1R7AA 4B9YA 1YQ2A 2YL8A 1QK2A 2ZZ6A 3AIRA 5HMDA 1A47A 2J8FA 4HCDA 3DFYA 4G2DA 2GSHA 3PJXA 3E74A 3VC5A 1LRNA 2GGEA 1E9IA 4W7WA 2J66A 3E38A 1HP5A 3G6MA 5CPOA 3NYDA 4H00A 4JYEA 4NAEB 2CU0A 8XIAA 4TUFA 1AD1A 4DWSD 3NQCA 4ATDA 1QW9A 5JBEA 2A0NA 1FH9A 1IE7C 3PZUA 2DDXA 2V5BA 3W2NA 5A69A 2IPJA 2VO5A 2R1NA 2GGIA 1ZTVA 2Z1WA 4A21A 4MWAD 1NWTA 2C19A 4DVOA 4JHOA 5D2VA 1PZ3A 4AZGA 1ONRA 3B9OA 3KE0A 4PE8A 2Y7DA 1WO2A 1V6UA 1A5KC 3C0JA 4Q8TA 1KW1A 3K46A 3UNTA 1ISYA 2BVTA 4GJJA 5HATA 1NWSA 4JTDA 1J5TA 3GM8A 3W1MA 4GQBA 1OFDA 3ARUA 4F9JA 3QSRA 2YW4A 3V35A 4GWEA 3EDDA 2D2OA 1H51A 4PBGA 5K4ZA 4HOZA 2WYSA 2QCHA 1KM6A 1UR1A 1P6BA 3LLDA 1TJ1A 4JIQA 1MRQA 2JK2A 1GVQA 3OHMB 2XFWA 3WKZA 1FTXA 3EX4A 3BZJA 3WQDA 5LNRA 5FAJA 1LBMA 2PGFA 4GFSA 1DYSA 4GYPA 2VJXA 3W2LA 5DMLA 1U5VA 2BTMA 2Z6IA 4PRRA 3LM3A 5KZEA 3TEVA 4HPXA 2DZSA 1JFXA 1YNPA 3H7VA 3UWVA 3W1UA 1AJ2A 1OX4B 2OR2A 1ELSA 2ASHA 2C91A 2HXUA 4D6HA 1QAPA 3S2JA 2OQYA 1E0WA 3MS8A 2P8BA 3GNXA 1D7KA 2JKEA 3PTMA 3WMBA 2VUYA 4B3KA 5A6TC 3SRKA 1TELA 1UP3A 4JIPA 1S2UA 3LRKA 4HYWA 1AMKA 3NPVA 1G6CA 1JD9A 3A64A 4AZCA 1XFCA 2VQTA 3PF3A 4BS0A 2ZA2A 3PZ9A 1ZHAA 2V3DA 3SGUA 2CBVA 1T8QA 2VD8A 3I68A 1B3VA 4WLCA 1EIBA 2Q3OA 1JYVA 2DEPA 1QK0A 4G1KA 1TR9A 1I6NA 4AVNA 2ATMA 1EX5A 4AHPA 3FEMA 2QPSA 3NZGA 4DXXA 4M3PA 3F4NA 1GQKA 4F0MA 4W9TA 2FJKA 3AHXA 3NQEA 3PZQA 1VZWA 1T41A 1TV4A 3I7RA 4DZHA 3O0KA 1DTNA 1KXHA 1QOQA 3QN3A 4WDWA 3T2QA 1VC4A 1OSEA 4ZEPA 3A3XA 1UJQA 4B2DA 1S5VA 3FK4A 4KFOA 1GTEA 1B3OA 5GPRA 3NVDA 5F4XA 3HPSA 3NIYA 4P7OA 3A5FA 1VAHA 2WCAA 3CZKA 2X2YA 1V51A 2V2CA 3ID7A 3NQ2A 4JIRA 1EO5A 2QCDA 1P0KA 4Z08A 1GTHA 3AI0A 2F9RA 5FSEC 4JICA 3MT1A 4U5KA 4D2JA 5KZDA 2OYLA 3APYA 1BG9A 3AYVA 3LV6A 4M19A 4Z1YA 1KFWA 2WLYA 3WDHA 4W8BA 3SO7A 1WXYA 2A85A 1AQFA 3URAA 4NYUA 3L2LA 4CN6A 4QG8A 1MFUA 3RX2A 4AAJA 2PI6A 4N9BA 3NDYA 3U48A 2F6UA 4HOWA 2PCEA 2HS8A 3AQUA 3MUY1 2PDWA 4GUHA 5DRCA 4G56A 1QW7A 3PWIA 5J04A 1UMLA 3WYZA 2TSYA 4A8IA 3NL2A 1WDDA 3VZYA 3KLKA 3ABXA 5EFFA 1REQB 4LF2A 1ZJBA 3BAJA 5FKYA 2XIBA 2QS8A 1ZBKA 5BROA 1FXPA 1XR2A 3WLIA 1I2RA 3A22A 3CAWA 3VKKA 1V79A 1BTCA 3NNTA 2GDUA 3MU7A 1JJKA 1X8FA 3KBJA 4JFUA 4KGLA 4V1YA 4J3UA 4EF9A 2VQUA 4DJDA 1EO7A 4UFKA 2WMFA 4Z42C 2BOEX 4DNHA 2WNWA 1Z8AA 3S2MA 3N6QA 4L1GA 4DYJA 3VD5A 3RRAA 1LDCA 1BKHA 3GE7A 5I3FA 2G3FA 3S1VA 3MZNA 1FHLA 1TVLA 4EK7A 2NQHA 4M0XA 2DZVA 3L9CA 3W87A 4Q7NA 1XHGA 4X0NA 1OCNA 3I7SA 2RFGA 3QV8A 3CGTA 5D9OA 1FP9A 4K6AA 2OJPA 4K3ZA 4P7LA 4GUJA 1FDYA 4C1KA 5A6JA 3FXYA 4TTUA 3L12A 4ZXOA 4LCSA 1UWUA 5I00A 1VENA 1KRCC 1IWPA 1AQ0A 1BG4A 1UKPA 1QR7A 5FL0A 4TMCA 3V4BA 2YBUA 1F6KA 4AXNA 2POZA 4O15A 2Z6JA 1AH4A 2H90A 2ISSA 1O95A 3FIGA 4E6MA 4J9JA 1O1ZA 1CXIA 4H6EA 4XAYA 2O9OA 4M82A 4LUYA 1WXJA 3T0DA 5IFTA 4Q33A 5LZLA 1MQQA 4CU8A 3MCOA 4CD7A 5FJOA 1KD0A 1L6SA 1CX9A 3NQDA 2C15A 3D3AA 2QR6A 4HVXA 2WSQA 4R7JA 4HZMA 1VBJA 3IJ8A 2FVLA 3H12A 1ISWA 4XX6A 5IOBA 1E0XA 4GZIA 4HT3A 1OB0A 3C56A 4BF9A 2NQ9A 5HULA 4U31A 3WQOA 1A4MA 1HL2A 2WKLA 1XSJA 5HPOA 3DFPA 1RK6A 4GABA 3QW3A 5BCAA 4N6FA 2BNJA 2WB5A 2VFFA 2HE8A 1BYDA 2RH9A 4MY8A 4E4PA 1JULA 3KBVA 1ZFJA 2VFIA 1IZCA 4LGXA 1ITXA 1ZPTA 1FWGC 1YTEA 1J0HA 4I5RA 2I5IA 3H6OA 2P10A 5A2AA 2YYTA 4GO8A 1S3HA 4H7CA 5L9FA 4H9XA 3OHIA 3SSZA 4F8XA 1FWNA 3MC5A 1OCQA 4DY1A 2ZUVA 3UR5A 4L9ZA 1CXEA 3W86A 1WAWA 1OBAA 1ONXA 1NF0A 2OFJA 1F4HA 4MJ2A 5KEZA 1I0DA 4EOUA 4MWAA 1S2WA 1TPWA 1C8QA 3KP1A 5G1YA 2HPMA 1XLHA 1EXBA 4GC3A 2P0OA 4YTTA 1A0DA 5FI8A 1EC7A 1WAUA 4XUYA 3T4WA 1KXTA 1MNZA 3O15A 1WBHA 1NY1A 3L4WA 2QDHA 5LHEA 1IT7A 4DBSA 1M3UA 3V5FA 4O1AA 1GQJA 1UC5A 2Z1XA 3SCPA 5GQBA 4LYRA 1TQXA 1J4EA 4OZOA 1BKSA 1XH2A 1LCOA 5AZ0A 1W32A 3WEMA 1PTDA 2BY3A 3FSUA 5F2MA 1HL8A 2ZBTA 2GQ8A 2RDUA 4LTSA 1UWAA 5I03A 1BVNP 2XSBA 3MVTA 3VNDA 3I4KA 2EAWA 4RXGA 3PAJA 4GX8A 3B97A 2PURA 1G4TA 3TN3A 1IWBA 5IFPA 1X8CA 2WMHA 1A50A 5I7GA 2J77A 1UP0A 4H6RA 2DQXA 1ME9A 3NCOA 5EMJA 2VDIA 3TW6A 4B5TA 2F38A 2QIWA 1XF0A 2HPIA 3N9RA 2FZ9A 2V3EA 3UBPC 1GQIA 4EANA 1Q7QA 2IMRA 2NV2A 3UEQA 3EDFA 1X97A 1DQWA 1RQEA 1SZRA 1K9FA 5C2CA 4DZ5A 2GGJA 2WHKA 1PX8A 4OJYA 1J0YA 1OYCA 1E73M 1SFLA 3DENA 2R91A 3EKGA 1MUCA 3ARWA 4BI5A 3LHVA 1O60A 3VCNA 4K7VA 2IUZA 2QJMA 1EPVA 5LSMA 2EJ1A 4J3XA 4PUDA 2I9UA 2AQOA 3KS6A 2H8ZA 4WD0A 4JHMA 5F2GA 2VT0A 3W38A 4RNJA 3GB6A 2WCGA 1TJPA 1S5NA 3LGEA 4WDXA 4X2PA 1LOQA 3UERA 4YS1A 5MKGA 1BRLA 3W82A 1UWQA 3EPMA 2E9LA 3IJDA 4D9PA 1MVYA 4GQGA 1JDEA 3PVFA 2BY2A 4HZ7A 5FF2A 2G5WA 4UQBA 3KFTA 3IGXA 4C60A 1AZ1A 4XTIA 3NGJA 4JR5A 2WVTA 1XSKA 3W6YA 5C55A 1I2NA 2WVVB 2PF8A 1J11A 1B4EA 1ZBVA 1XFBA 3ZQ9A 1XLCA 4NF7A 4N4PA 4DZAA 3T8LA 5I24A 2J7BA 3WBWA 3P67A 1J0IA 4MLRA 3WQWA 1RCOB 1F8MA 3VKBA 5D33A 5AC8A 4PGLA 4QXIA 3HG3A 1XYLA 4HA1A 3ZIZA 1T40A 4W4QA 2ZX7A 2AL2B 2CHOA 3O16A 4AD3A 2X1UA 1Z42A 1CB7B 3CUHA 4DPPA 1X6NA 1HKVA 1HN1A 3NO3A 3QV7A 2G50A 5F4WA 2E7FA 1UD3A 3M6YA 1MNSA 1K8CA 2ZRUA 2XVKA 1AUSL 2L5HA 3OQEA 2OLAA 1BGAA 2WXDM 2W67A 4DYEA 1R8LA 2VM8A 1DWAM 2GDVA 4AYSA 1GEQA 4GC4A 3OZMA 4Y6GA 3WCZA 4ZE4A 1L6FA 3UZJA 3IIPA 3NSXA 4C6QA 1QOXA 2YLAA 3FXGA 4GBDA 1YNYA 5M1TA 2VZUA 3FAXA 4IIBA 3S8HA 2RGMA 3UG3A 3W9ZA 1RPXA 3RMEA 3W26A 3P60A 4S3AA 1Q6RA 4XKMA 4PBEA 2VEKA 1K6AA 2OWCA 1DORA 1K8YA 4PFMA 2OSWA 1XRVA 3TOPA 1HKKA 2GDQA 2QJGA 2J8TA 3IVUA 3LHYA 4PTVA 3WQGA 4Q22A 2W5FA 2RJHA 3OLEA 3LQLA 4PUEA 5T26A 2YDAA 1OFEA 4UOQA 3E9AA 4NZ1A 4HPGA 3LDVA 4CUCA 5REQA 4C5YA 5BXTA 3GXPA 4IIFA 1ODZA 4QRNA 2GVYA 4UQCA 4H4IA 3V5CA 1B9BA 6TIMA 4C6NA 2E6FA 5I2UA 4U33A 4HTYA 1XDJA 1DJNA 2IW0A 1B4KA 2QUVA 3RCMA 4DB7A 1W91A 1VYRA 4ACZB 3VGFA 3WF0A 4IL0A 4F79A 4P8WA 4H8UA 2JIEA 2UY2A 4N9CA 4JZ5A 3GG8A 1Y5XA 4IX0A 2ZIDA 1B1YA 5AC7A 5G2HA 5IHRA 4YVXA 1IXNA 2HTMA 5A6SA 3PR2A 3LUTA 1L6GA 3SGZA 4FX6M 3RPTA 3KRZA 3TYZA 3ORWA 1RVKA 3B9AA 1EYEA 3G0XA 3VIHA 3SGGA 4YJ5A 1FWDC 3WD4A 2Q8ZA 2YB1A 3OZOA 4F2UA 1XS2A 1P0EA 5I3GA 3TFCA 1POKA 1XKJA 3BQ6A 3DFQA 3TC3A 1Q6QA 5FACA 2WVSA 3D6NA 2ZUSA 3AXXA 4L6HA 1Q7MA 4OVXA 4AG0A 3W6MA 1PKNA 2GVLA 3ZVHA 2EF9A 5BRBA 1PKYA 2RHGA 1X1ZA 3N9KA 3N17A 3GVVA 1AQHA 1EJUC 4UFHA 4E5TA 5AHLA 3DN5A 1Q4WA 2Z1KA 3LSBA 4IWWA 1CBGA 2PBOA 3ARZA 3XINA 3DC8A 2DJLA 4DJED 3W1AA 2ONEA 3R11A 4F40A 3WK0A 3AOFA 3WQCA 3IIOA 3W7CA 6ALDA 3OLDA 1RA0A 1M65A 2HJPA 3ZXWA 1MZRA 3A9IA 4Y9AA 1BQGA 1GVFA 3VIPA 3N2XA 3STPA 1JL8A 1ICSA 1Z69A 2V5DA 3W7EA 1JI1A 2Z4GA 4WRHA 3KVMA 2BLEA 4O1BA 2VDHA 1QNVA 4PBFA 3MUCA 4UTWC 2VCAA 2C79A 4JYDA 4HK7A 5KSWA 4LVGA 2P8CA 1XLBA 3LCXA 3QM3A 3PB0A 1CEOA 5CZKA 1Q6CA 1NIUA 1TV2A 3EMCA 3GDRA 4H9YA 1E0VA 3AIEA 3K30A 4PEEA 4GVIA 1TA3B 3GXFA 4QGCA 4TQTA 3UVAA 2E1DA 3FYYA 1RQBA 4PYSA 3SRFA 3ISIX 1ZLPA 2V5JA 2CZVA 1MFVA 4D71A 1QHOA 2GK1A 4C1NB 1PKLA 3WG6A 2PC4A 3C0QA 1TVNA 3ZSSA 2QDEA 3THUA 4C90A 5XIMA 3LNMA 4K38A 1MDLA 3MO7A 4AZHA 2CETA 4EWJA 1S1PA 1XQLA 4KGJA 4GY0A 4FI4A 3KVKA 1SJCA 1TVPA 2YL6A 4A2SA 4JTHA 5TBOA 3GC4A 2PLMA 1SFSA 3RFAA 4GI9A 3LHUA 3KXQA 2X0SA 1IYXA 2Z25A 2KZHA 3ENLA 3GNDA 3DH7A 2JEQA 1UA7A 3POHA 3PTKA 3MMTA 1NP0A 2XIQA 3VNIA 4DUOA 4W93A 1P48A 2WO5A 3A21A 2A3HA 1IEVA 1EZ2A 3OBAA 3Q4DA 5RUBA 1QWGA 1KB3A 5FJTA 2DVXA 4LUSB 4NAFA 1GVOA 2FZDA 2ZE3A 2CWNA 4I7VA 3THAA 8RUCA 3FJNA 3M0YA 3HURA 1R6WA 3P62A 2C8NA 5C7VA 3SUTA 1EOKA 4NHVA 3WN6A 1XBXA 3D5HA