1EXBA

Structure of the cytoplasmic beta subunit-t1 assembly of voltage-dependent k channels
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the cytoplasmic beta subunit-T1 assembly of voltage-dependent K+ channels.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
molecule keywords KV BETA2 PROTEIN
total genus 123
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1exbA00
2PDXA 3DN5A 4YVXA 3LUTA 4PUWA 3LN3A 1Z3NA 3BUVA 2I16A 4PUUA 2PD9A 2HE8A 3GHUA 4YVPA 3EB3A 4L1WA 3RX3A 2IS7A 4IGSA 3FJNA 3Q67A 4IJCA 3UG8A 1AFSA 3DOPA 4FALA 3UZWA 1LQAA 1T41A 3O0KA 3S3GA 3UGRA 1US0A 4R9OA 5LIUX 1VBJA 3UYIA 1LWIA 2FZ9A 3UFYA 2IPJA 3COTA 4PR4A 3R94A 1QWKA 2QXWA 4Q3MA 4YVVA 2IQDA 2PDQA 1VP5A 1AZ1A 3LQGA 3R8HA 1AH0A 1Z9AA 2DV0A 2IKJA 2PDLA 2PDFA 3BCJA 3O3RA 5HNUA 2WZTA 4LB3A 3QKZA 4GA8A 4JQ2A 3V35A 3UP8A 2HV5A 1IHIA 2IKIA 5LIXX 2PDPA 3ONBA 5JH1A 4G5DA 4WDTA 3U2CA 3UWEA 2ALRA 4ZFCA 1S1PA 3MC5A 2ACUA 1SM9A 4DBSA 4XVEA 3R58A 1RALA 4FAMA 1C9WA 3VXGA 1ADSA 2ISFA 5HNTA 2BGQA 3GHTA 2HVOA 2F38A 4XZIA 4JTCA 4JQ4A 1X98A 4PRTA 2CLPA 4OTKA 3FX4A 4FZIA 3M4HA 1Q5MA 2IQ0A 4WEVX 4LAZA 1OG6A 3LENA 3GUGA 3ERPA 3R43A 4DZ5A 4F40A 2P5NA 3R7MA 4GQGA 1EL3A 3G5EA 4WDWA 3P2VA 2NVCA 2C91A 3N2TA 2HDJA 2VDGA 4QBXA 2IKHA 3RX2A 4PRRA 1PWLA 3WBWA 2PDHA 2PDIA 4EXBA 3RX4A 4ASTA 2PDGA 1MI3A 1YNQA 4JIHA 4JTRA 3F7JA 4GIEA 3G1RA 4YU1A 3CASA 4XK2A 4H7CA 3M0IA 3CV7A 3LQLA 2PDBA 3WG6A 1AH3A 2PDWA 1QRQA 5LIYX 3MB9A 4XZLX 4JIRA 3EAUA 1R38A 1YNPA 2NVDA 1X97A 2PDKA 2IPWA 4GACA 4YS1A 5AZ0A 4JTAA 4L1XA 3ONCA 2HVNA 3LZ5A 1XJBA 3WCZA 2PZNA 2INEA 3KRBA 2IPFA 2F2KA 1PZ1A 1GVEA 4LB4A 4ICCX 2PFHA 3BV7A 5DANA 4XZNX 3LNMA 2R9RA 3LZ3A 2BGSA 3N6QA 4IJRA 2PD5A 2IPGA 3H7UA 4WGHA 4FA3A 1RY0A 1PWMA 1AZ2A 3M64A 2R24A 3V0TA 4GCAA 3V0SA 1JEZA 1EXBA 4JTDA 4RPQA 2PF8A 2ACQA 5M2FX 4EXAA 1S2CA 4XAPA 4WRHA 2I17A 2FZDA 4JTQA 4QXIA 2ACSA 4QX4A 4JQAA 1XGDA 1PZ0A 3NTYA 4JQ1A 1YE4A 2BP1A 1RY8A 4HBKA 3B3DA 4LAUA 3WBYA 3CAQA 4I5XA 3R8GA 3BURA 1M9HA 2HEJA 2PDJA 2FVLA 3V0UA 3T42A 3CAVA 4Q7BA 1S1RA 2A79A 1ZUAX 1IEIA 2DUXA 1MRQA 1UR3M 1Q13A 2ACRA 4MHBA 3C3UA 1HW6A 5HA7A 3LBOA 4DBUA 4QR6A 1T40A 3LEPA 1S2AA 3CV6A 3R6IA 3UZYA 2FZ8A 3UZXA 4H8NA 1K8CA 4XO7A 3H7RA 1PYFA 4WDUA 3CMFA 5LIWX 5JH2A 2PDYA 2IKGA 4DBWA 5KETA 3H4GA 1X96A 3UZZA 3LD5A 4NKCA 4GABA 4AUBA 1MZRA 1YE6A 4JQ3A 2PEVA 5AZ1A 4HMNA 4XZMX 3D3FA 1J96A 5C7HA 3V36A 2J8TA 1HQTA 3WBXA 2PDNA 1Z89A 2PDCA 3GHRA 2PDMA 2HE5A 4LBRA 3EB4A 2FZBA 1Z8AA 2AGTA 3Q65A 1ZSXA 4XO6A 4XVDA 1EF3A 1EKOA 2DUZA 1XF0A 1ZGDA 4JIIX 2WZMA 2PDUA 2FGBA 3GHSA 4PMJA 4XZHA 4GQ0A 1A80A 2INZA 5LIKX 1FRBA 4WDXA 1AH4A 1ZQ5A 4LBSA
chains in the Genus database with same CATH superfamily
4MLJA 1DHKA 2NQJA 3V5CA 3ZSTA 4V1XA 1CENA 2VJXA 5HMDA 1E6RA 3UXIA 1UR8A 4TTUA 3W9ZA 3FOKA 1D8WA 4E3TA 1JQVA 2PD9A 3C5QA 4OIFA 3QQ1A 4QQUA 1EJWC 4D6IA 1XKYA 1RPXA 4FS9A 1VFFA 2GQ9A 2XZ9A 2CZVA 3TR9A 3J7HA 3SEPA 5H91A 1T41A 3NL6A 1GOKA 1OSEA 5CPMA 4R7JA 1QJWA 1GOOA 4R9OA 4M3PA 2X8RA 1O95A 3GU1A 4DWSA 3DI1A 3B8DA 4YVVA 6XIAA 2WKLA 2J77A 2IQDA 5FF4A 1AW1A 1MXSA 2FH8A 2DY3A 1OCNA 4S38A 3HGJA 3CT7A 1E1FA 5CC5A 3KZSA 2FVMA 1UWIA 2HK0A 2X7VA 3UJFA 1KCKA 2DV0A 5AHEA 1BVWA 1JXKA 5IDZA 3QY6A 3S1XA 1LT8A 4J5NA 2GJPA 3EXSA 3WN6A 1VJSA 4BI6A 4YYCA 1GTHA 4N9BA 3CZEA 5KZMA 1W9XA 5FESA 3N2XA 2FZMA 1B0IA 1V3IA 1R87A 3C56A 1XRSA 1GVOA 1MNZA 3WK0A 4DJFC 2X0YA 2R94A 4KERA 3KBVA 4IMEA 3VNIA 4HPXA 5L9FA 3W1TA 2J24A 4LVGA 4XX6A 3EMZA 1XBXA 2FVKA 1A5OC 3VXGA 3W82A 4D9PA 1K7FA 4K7VA 3MUXA 4JIEA 4WUIA 4N7QA 3UWZA 4S3CA 1C29A 3G8RA 2XWDA 2VQUA 2V67A 2EEXA 3IRDA 1FKWA 2GWNA 2Y61A 1VIWA 2OG9A 3TDFA 2NZLA 3GZAA 1JCXA 1DV7A 3T44A 3G3MA 4IPNB 4LV9A 3UG3A 3KOXA 1JUKA 3KX6A 2FB2A 4H9VA 3B0YA 4KRTA 5T8GA 3E38A 3QV6A 4GQGA 4HSOA 2Z25A 3G5EA 4E2OA 4F8XA 2RUSA 3EDFA 2P10A 1FWWA 2ZTJA 1QI0A 4KIEA 4FIRA 2E5CA 3WEOA 1VS1A 3KM8A 4C6BA 4HD5A 3ZJKA 3BLLA 3OBAA 1OWQA 1WX0A 1L6SA 2E8YA 3TVAA 3DHDA 3WJWA 3MUCA 1T7LA 1EDTA 3PFRA 1EB3A 3LLDA 5C2XA 1CGWA 3CASA 4Z1CA 4LQ1A 1M68A 5T91A 2P8CA 1FWAC 2E9BA 3Q4DA 1QASA 1RH9A 3PTQA 2VRJA 2VTFA 1QI4A 3OA3A 5AECA 1F6PA 4YTQA 1XDJA 1ZFJA 4HK6A 4GD0A 3LHZA 1JCJA 3FXGA 1HT6A 1DWFM 4IFKB 2ISSA 3VOJA 1D3CA 9RUBA 1KLYA 3RJXA 3HBLA 3C0LA 4LUJA 2FIQA 3WKZA 3BAYA 4JYEA 3BWWA 3V16A 1NF7A 3CXOA 3FFSA 3W6YA 1IF2A 4YJ5A 3QPEA 4H04A 1R47A 2UY5A 2ISWA 3CHVA 3C0QA 4KIRA 3EDEA 4AEEA 1XCXA 2MNRA 1OD8A 5FAJA 3WQGA 3ZR4A 3WH6A 3O07A 5BCAA 1EJUC 3MA8A 3BLEA 3MUAA 1JDDA 2PRHA 3L2IA 1W2PA 1E73M 3VMPA 3CPUA 4QM1A 2WNQA 4W86A 3K46A 5A8PA 3MMWA 3H2CA 1KGXA 3MSGA 3IJIA 4CU7A 4XAPA 3I6RA 2J47A 1K9EA 3GYCA 4Y6GA 2LLEA 3FYYA 3W27A 1YIXA 4YXGA 5HQLA 2WJDA 3H26A 4B5NA 1R30A 1IV8A 1CDGA 3P8IA 4YWSA 2C7FA 3CJPA 2NXHA 2BVDA 3B40A 1A5MC 3W07A 3V0UA 1HJSA 4EAYA 3CK5A 5I3GA 2Y5SA 3WQCA 1JF6A 1RK5A 1UD8A 5ABFA 3LRLA 4DWSB 4ICNA 4TMBA 4OV9A 3VU2A 2RDUA 1WAWA 4MHBA 5HA7A 4L4LA 2QW5A 5FEZA 3L0NA 4H6KA 4LUSA 1W9BM 3L12A 1KW1A 2H8XA 1KC7A 2QCEA 1H11A 1G4SA 1XS2A 3E12A 2UY3A 3E9AA 4GNVA 4BFAA 5LA0A 3REQB 4Q8TA 1TR9A 2WMFA 2YX0A 5AB3A 3KBJA 4HMNA 1WKYA 3KBSA 4DO5A 3SADA 4HP5A 5JUVA 4HSNA 5REQA 1UZDA 2QIIA 2PDNA 7TAAA 4PTWA 3OVQA 3WK3A 3FA4A 3O15A 5A6TC 1TZZA 3NSNA 4V15A 3S83A 3W7HA 4OKDA 3ZJ8A 4Z1AA 3VDBA 3GX9A 4QLKA 4FOKA 1L9WA 2AL2B 2XIQA 1EA9C 4AY1A 4Q8PA 1B90A 1R9XA 4GUHA 3M0VA 4O8RA 3H53A 1TPB1 2WM0A 1FRBA 3GDLA 2WNZA 2RAGA 4S39A 2VGIA 3LM3A 4XZ9A 1UOZA 1Q6QA 1C7TA 2VGBA 3BAXA 3NQVA 2WZHA 3AOFA 1Z3NA 4FNPA 1WBJA 1TWWA 2L5HA 5E93A 3KOFA 3OODA 2A4AA 3UYCA 1WCGA 3EOUA 2OXNA 5BU9A 4UR9A 1GVIA 4DO4A 2GOKA 3LCIA 4S3EA 3QGAC 3S3GA 1UKPA 3OZMA 3RN6A 1NTHA 2PZ0A 2YOCA 1CECA 4AH7A 4CN4A 1OFQA 2QLYA 3VKDA 1KM6A 1V7AA 1L2UA 2ALDA 3AC0A 5E0FA 4AZCB 1QPNA 2VUYA 2EPLX 3UJSA 1XFCA 3MCMA 3TOPA 5K4ZA 3KXQA 4MG4A 2VEFA 3N2OA 5G1YA 3CNYA 3T07A 3LNPA 1IZJA 2XDFA 5HNUA 5FL0A 4OT7A 3MP4A 3LERA 1W2VA 2FPVA 4MVAA 3M0XA 6REQA 1E4LA 3BLFA 2C3ZA 2PSNA 4PFMA 1W1A1 3OZOA 3RU6A 1WA3A 3S5NA 2XIJA 2WW5A 3W73A 2EPHA 3SGGA 5AC7A 3SB0A 3RMEA 4E2VA 1V08A 5D2TA 4HJFA 1DQXA 3M41A 4GINA 1VF8A 3VA8A 1G4TA 3AROA 1F5ZA 3KL3A 3RCMA 1QI3A 3GFZA 1N2VA 3GHTA 3LGDA 4P7OA 3WLIA 1B3OA 4XB3A 1P6WA 3STPA 1E71M 1Q6RA 3FX4A 4FZIA 4WSHA 3M4HA 1Q5MA 3L5AA 2I1OA 2VFFA 2DZWA 4Q8WA 4OHQA 2BY1A 3LOTA 3R43A 1JG9A 1I60A 4F40A 1IWPA 4PMDA 3UPBA 3HPSA 2GOUA 4CN6A 2RJGA 3MT1A 4Z2GA 5A6SA 4N9CA 2OO0A 3LXBA 3H70A 3O2LA 4S3DA 1JNDA 1XLBA 5A6LA 3ABXA 5HATA 4BF9A 1HUVA 1TJRA 3QLLA 4MAZA 5GJMA 2A85A 2WZEA 4FK9A 4I9TA 2FDMA 3RPDA 3CS2A 5FF7A 1E6NA 3BW3A 4JTGA 1PHQA 4NILA 1PKLA 2FDSA 4LY8A 1ISZA 1OX4B 3M0IA 3MMDA 4L9YA 1J4EA 5D2WA 4Q8UA 4XTDA 3GC5A 1QHPA 5AFDA 2HCVA 4P8VA 2G3NA 1ECEA 1ZP4A 4GRSA 2OSWA 4GBUA 1C8XA 3MKVA 4JN8A 4OOZA 1V7YA 4IX2A 1I2OA 5FJRA 3LPPA 2GPTA 3KP0A 4F79A 2WANA 1WUFA 4O10A 3C2FA 1XRFA 2C18A 3PB0A 2BY3A 3OJGA 1J18A 5EPDA 3DFOA 3R0KA 4GYKA 4NZ4A 4F0MA 2Y2WA 3S2JA 2FKPA 3CQJA 1YKWA 2CCRA 2NXIA 1PXGA 4QTGA 3GK0A 3TTSA 3H7UA 2RKXA 4V27A 1FHVA 1X6UA 4GZJA 2Z1VA 5G1TA 2WMKA 1FWTA 1REQB 2VM8A 2HS6A 3V0SA 4D72A 1XIGA 3QC3A 4JTDA 4CGTA 1XL9A 3VAVA 1Q7ZA 1FHUA 1XHGA 3HJZA 1QWGA 1WDPA 3G24A 2KZHA 3R79A 1WDDA 1W9PA 1WZAA 3P14A 3MQTA 4PMQA 2YDQA 3MJMA 3MYPA 2WLYA 3ME3A 2AQOA 1BD0A 2VGGA 2BP1A 4M24A 1IIGA 2E7FA 2G37A 4IFOA 3B3DA 3GKFA 1XISA 2V2DA 3CAQA 4JD4A 4G7EA 2Q6ZA 2ICSA 5DMMA 2VO5A 4PB3A 2RGMA 3EX6A 2JKEA 4A3RA 1JZ8A 4NAEB 2DUXA 5HAOA 1FTXA 3TYUA 5A6JA 3NSMA 3LBOA 4Q7NA 4GIRA 1FWBC 5CSYA 2YYTA 3QKEA 2EG7A 3W7NA 1GOWA 2WPBA 2WKJA 3L4TA 1QMLA 4QQ3A 3GVVA 4ZQOA 4AZ5A 5AC8A 2OEMA 2ZVIA 5C8BB 4IL2A 4DBWA 4BKNA 1HKWA 3O16A 2TODA 4NVTA 1QU4A 5C0QA 4MWAB 1MUCA 4S2CA 4N42A 1R9ZA 1FVPA 3F03K 4KRZA 3EWDA 4F9JA 4XZBA 1ZB5A 1BXCA 3FJLA 2PPGA 1OFPA 4QG6A 4ZMGA 2V68A 4HVXA 4WVXA 3WBEA 4B4HA 3L5MA 3EB4A 2GL5A 3AMLA 2ZUUA 2AGTA 4JTKA 4REQA 2HPIA 1FDJA 4MY1A 2F7FA 1JD9A 2DUZA 3TYEA 2NT0A 4EE9A 2WV8A 3CAKA 2NT1A 4WD0A 5PTDA 4GI8A 4UNKA 2VZSA 3NO3A 5AC4A 2PDUA 1RQEA 1ISXA 4FR1A 1G7VA 1GZJA 4QS5A 2QJGA 5G4WA 4X9SA 4UFIA 1GG0A 4A4AA 3PZOA 1N8IA 2QUTA 1EGZA 4EP8C 1US3A 3OB8A 3W7RA 2Q02A 2QUVA 4EPKA 2V5JA 4FR6A 4GCXA 1X8FA 1S5MA 3LN3A 3WY1A 4MKNA 5KZEA 4DXXA 4W7UA 3ARZA 4FXFA 2EBNA 2W3ZA 4CVWA 4KWUA 2VC7A 2BVTA 2OLAA 2J88A 1HKKA 1VRDA 4AD3A 4GVGA 1ICQA 2W4XA 4GKTA 4LS0A 4GY7A 5JVLA 4H2HA 4QLJA 1PKNA 2QAFA 1B30A 3GR7A 4HGXA 3W1LA 2DQXA 1TV8A 1AL8A 1PV8A 2DJXA 1MUMA 3NQMA 1OEPA 5TQLA 3E2SA 3V3WA 4UFHA 2VEGA 3LBCA 3A3WA 2GJXB 1BXBA 4LVAA 4M6UA 3EEZA 3KW3A 4IP5A 1KGWA 2ZIDA 1QOQA 5ABFB 2V5LA 5A94A 4K8HA 1W1PA 4EPBC 3TA9A 1NWSA 3GZ3A 2ZRZA 4CN1A 1W3TA 3BCJA 3ZO9A 3UT0A 3ENLA 3VGEA 3W1PA 3DH7A 4J7RA 2GGJA 4PTNA 3WEMA 3T08A 5AYZA 1JI1A 1AD1A 3SRHA 5D9MA 3DHFA 4L1GA 1OINA 4JFSA 1GOXA 4JN6A 5I79A 4EK7A 3QJAA 4W7VA 3O9NA 4XISA 2ACUA 2XFWA 3KCOA 4ZQNA 3W84A 3CQKA 3BOLA 4ORMA 1TTIA 1JUEA 4IGMA 4IWWA 1SSGA 3UBPC 4CCEA 4WX2A 3VTRA 4GVIA 2CLPA 3SSZA 1SW3A 4OTKA 4LCSA 3R10A 4H6EA 1F05A 1ML1A 3POCA 4DZ5A 2DIJA 5CPTA 5EBAA 1W37A 4UCFA 4AZCA 1JGIA 2H9AB 2ZE0A 3IAQA 3N3TA 3KRSA 1WDSA 5I09A 2GSEA 5A8QA 3W76A 1UH3A 1WBHA 1O1ZA 4P2VA 4NY2A 3L21A 1ZNNA 3OP2A 1XP3A 4JTJA 2OX1A 2F6XA 5LHEA 2FHCA 1ONEA 3APTA 3N1AA 3ZXWA 1KTCA 2XIMA 1JZ5A 2B7OA 4LPCA 2NQ9A 4Z2JA 3H22A 3OZYA 3WQ6A 4UZSA 1Q4NX 1BVZA 1AH3A 3TQ0A 3MB9A 9XIMA 4XZLX 2XM1A 2OKTA 4W5ZA 4W5UA 3BG5A 5CSUA 3EWWA 4PBGA 1IWBA 3E0VA 4ZVJA 3CYJA 1FOBA 1OBAA 1ZJBA 3T6CA 3WK2A 4IH3A 2E09A 1J0HA 3OHIA 1ONXA 3T0AA 4X63A 1UUMA 4C7DA 1GVEA 2X1SA 1LLWA 1S5TA 3AS3A 2HJPA 1F3TA 4XIAA 3C2VA 3WL1A 2YKKA 3W1UA 2A2IA 3LNMA 2E6YA 5FIPA 5BOOA 3ABRA 5A8MA 1RQBA 3LBMA 1P6BA 1XSKA 5M5DA 1UC5A 2ZDRA 2ZBTA 3Q45A 3D6NA 3ABOA 3I7QA 1OG0A 4UFLA 3GH5A 1EEXA 1F8IA 2D23A 1ITCA 3GB6A 4PMVA 3ARUA 1L2QA 1W1YA 2QHAA 3WQ5A 1QI5A 4ZQPA 2H6RA 4QDWA 3TSDA 2ACQA 4AVNA 4UBPC 1UH2A 1LL4A 2WZIA 3TTEA 4F66A 1BVNP 1GG1A 2ZZ5A 4JKMA 4P7LA 4IP7A 2WBGA 1US2A 1Q66A 1K9TA 1F4HA 5JU6A 1Y8BA 5T26A 3GVRA 4I9JA 1VFTA 2XHYA 3GXFA 1EF2A 3MPGA 1YE4A 2Z1SA 1FA2A 4Z2KA 1C8YA 1XYBA 3IANA 1TPWA 3FXYA 4KBXA 2D2JA 3MCNA 2B81A 3DG3A 1EOMA 3VZXA 2HMCA 3L4YA 5E9AA 2BY0A 1OGBA 4GQQA 4JNYA 3VNZA 1MWOA 2ACRA 3WFAA 5I3IA 3AJXA 3EDJA 3PBYA 5SWUA 2FB3A 1JIBA 5DXYA 2Q8XA 4W88A 3MDWA 4UTUA 1UKSA 4XO7A 4GZ7A 5D2XA 3L9CA 1K9DA 3CMFA 2A3AA 4ZOEA 3T2PA 2C6QA 2RJHA 3LLXA 1F6KA 5LXXA 5CBBA 3TV8A 3URAA 4JFUA 3EOLA 1NH6A 1E3XA 3W75A 4DAFA 1ZY9A 3THAA 1GCYA 1V02A 3MUIA 2CYGA 4IIEA 1NY1A 4AHPA 2ONEA 3IEBA 2Z27A 4TVDA 1UZ1A 2J7EA 4Q6XA 1HL9A 5HQEA 1H5YA 4FNSA 1CXFA 1GW9A 1Q6LA 1VBRA 2WJEA 3AYTA 4XSMA 1LOSA 3WD1A 4LSBA 1LYXA 4DLFA 3W26A 4XVDA 1W3NA 3BOFA 4A29A 2Y7EA 2A6LA 7CGTA 3FY1A 1F76A 4GVFA 1MMFA 4N02A 1SFJA 3OLDA 4I8DA 3MSRA 3VKJA 1IEVA 4G6CA 1M7OA 4EOUA 4O1BA 3VD3A 1A5CA 3GSMA 4GYPC 3WO8A 2I5GA 3PZIA 2JIWA 1TUFA 4E5TA 4PUWA 5CPLA 4ZL1A 3UJEA 4Y90A 1V6YA 3SURA 4X3ZA 3FEQA 1OABA 3W1AA 4DJFA 2DSKA 3SUVA 3N2BA 1Q6FA 3W24A 1M5WA 3TJLA 4D71A 4IIFA 3SZ8A 5FKYA 1KV8A 3N12A 3Q67A 2BFGA 2PTDA 3B0PA 1ISYA 3KP1A 4MOZA 3AIQA 4D1IA 2OT1A 3AZRA 1EOKA 1NDVA 1IGSA 5H6HA 2QJMA 2J6XA 2XFYA 3DYMA 4GVHA 1TPDA 1ELSA 2C1IA 4A8RA 2MUCA 1O6IA 3RXZA 5D9NA 1YXYA 3UCCA 7REQA 3O6YX 2NW0A 3GXPA 5C7VA 2XH7A 2GUUA 4CNUA 3GUWA 3UEQA 4NI3A 3VFCA 1IEXA 2C16A 4LBUA 3SUUA 4BI5A 4IPLA 2DZXA 3CO8A 2VEKA 3H55A 4WLCA 5BOEA 1ZHAA 4LB3A 1XI3A 3LTPA 3DFTA 2ZTKA 2AAMA 4N2YA 3AIVA 4JKKA 1OYCA 4B5WA 2CHOA 4I7WA 3WLMA 1OC5A 4JHMA 1N82A 2NX1A 1HKIA 4LYRA 3U2CA 1DKWA 4Q8MA 1Z41A 4AZ6A 2D3LA 2FH6A 4MIMA 3M5VA 1IXQA 4AIEA 3TAKA 1DE6A 1VFOA 4FAMA 4W7WA 1XW8A 1R9YA 2E1DA 4IOTA 1NM9A 3WLJA 2XJ7A 4O4VA 3WDRA 3C0JA 1FFRA 3MHFA 3E0LA 3TSBA 3RU8X 2YCKX 3BSGA 4JYFA 4ES4A 4Z0JA 2ZRUA 4KESA 2DGAA 4DI8A 1PAMA 3PHAA 2AKMA 4DNMA 1A3WA 3R13A 1E1CA 1I4NA 2AMXA 1EC7A 2EPNA 4UOJA 5T9BG 1CIUA 4UCGA 1A4LA 1EA0A 4QRNA 4L61A 4CCCA 2NWSA 5C9ZA 1PZ2A 2I9EA 2HDJA 2ZA3A 1E9ZB 1HNYA 1I2PA 4O1FA 1PX8A 2ESCA 3UWUA 3RX4A 1KCLA 2GVGA 2J25A 4JL1A 3A4XA 4GI4A 3RLGA 3TA6A 1U1UA 3RLVA 3T4WA 3VD9A 1OB0A 3V7PA 4O1AA 1XH2A 3WLHA 1IXNA 2GUYA 2PDKA 2IPWA 2J9YA 5AZ0A 1EFZA 5C9RA 1UG6A 2QCDA 5D04C 1CZ1A 2FMOA 3N25A 2GK1B 3F4DA 2BOEX 3HFYA 4ATWA 1S39A 1I2RA 2R9RA 3ZJ7A 3S6TA 4GUJA 2E25A 3DFNA 4PUJA 1QK0A 3HQ1A 4RNHA 1KXHA 3RG6A 2GDVA 1HKMA 3XIMA 4TIMA 4FXRA 1GGOA 4J3XA 2J9ZA 2J62A 4GGHA 3S5OA 3S6OA 3M16A 1RD5A 1TUXA 1DL3A 3VX0A 4O14A 1D8CA 1WUEA 4YWIA 3NL5A 1M41A 1I6NA 2QDEA 2YL6A 5GQBA 4EXAA 1FCVA 4MJZA 3C2YA 1TCMA 2V81A 4IUOA 5A6MA 1XX1A 3VZYA 1KGUA 5DRCA 2O4MA 3SFWA 3NDZA 1KR0A 1TELA 3AUJA 5A6KA 4C6JA 4U3CA 1SO5A 1QO5A 4WKFA 3VGFA 4NJJA 1OADA 3PUDA 1SFLA 1CGTA 1J79A 3VDCA 4JHOA 3UWWA 4RE0A 1MSSA 1ZAJA 3KUMA 5BNKA 1FBAA 1UR2A 2CZEA 1Q13A 3NUKA 3DG6A 4S1FA 1VZWA 3GYEA 3ATZA 3R6IA 3PBVA 4PBEA 4Q4KA 2ZQ0A 4A05A 1BWLA 5B7YA 1CBGA 5D9OA 1EP3A 5AHNA 3GD6A 4HU8A 1JCMP 3CQHA 5CGMA 4OVXA 5DRIA 2PGRA 4V2XA 4GFSA 2JKPA 2E40A 3SRFA 2FJKA 3W85A 2YW4A 2NX9A 1PKMA 4ZO8A 3D3AA 1XINA 5AZ1A 1DYSA 1O12A 3TROA 4J2PA 1TE1A 1V0LA 3A5VA 3WBXA 3W2NA 4HPJA 2D22A 2ZZ4A 3TU9A 3QMTA 5HR6A 2Z1BA 3P62A 1JCLA 1KM2A 4O54A 4Z17A 1XLGA 1DP0A 4GLEA 4JXCA 3N9RA 1Z44A 4LX4A 4UXDA 4DM1A 3TCEA 1KFWA 2VGFA 3LHVA 3RILA 1XYAA 1BYCA 1U33A 1VFSA 3W02A 3QV8A 4F0HA 2JEQA 3N9KA 4DI9A 1LWJA 2GVJA 1X1OA 2HVMA 2PP0A 3GHSA 3WH9A 1TJ0A 5H1WA 5DO8A 5BU6A 2Y1HA 2NWRA 5LA2A 5LIKX 2I5IA 4LAOA 3U48A 3MZ2A 3B97A 4XD6A 3EMQA 4G56A 1KO0A 3QMSA 1H62A 4YVXA 3S2CA 3CO4A 2Y8VA 3VD4A 2UY4A 1ZBVA 5HINA 1OFEA 3BUVA 2Z7KA 3IGSA 2Z28A 1EJTC 3MI2A 4DYKA 2ZE3A 3TQVA 3PWIA 4IGNA 1LT7A 3T7VA 4RZ4A 2BV9A 2BX7A 1XLEA 3W22A 3S47A 3DOPA 2WC3A 4WY0B 3STFA 3O0KA 4KCUA 1YX1A 3ZLGA 3BMVA 1OJXA 5KSWA 5F2MA 1VKFA 4ROPA 3SBFA 4LALA 5CXPA 1GEQA 3OBEA 5AY7A 3LPFA 3IACA 1V0MA 2PGWA 3K1DA 1Q6EA 4BQ3A 4NG3A 1FWDC 4QITA 1H7OA 4XKYB 1D2KA 1SJCA 4UUIA 3PK7A 3QSRA 1PCWA 3R8HA 1Q4WA 4DVOA 1U2YA 1DXFA 3M7SA 1OC7A 2PDLA 2PDFA 1DPMA 5G2WA 2JIEA 4DELA 3E0IA 2ZZ7A 4GA8A 4POCA 4IIGA 1V3JA 4XG1A 4IIBA 4PZVA 4A8NA 3I7SA 3L4VA 5LIXX 3THCA 6CGTA 4WDTA 4B4FA 4LH8A 1BSLA 4P7NA 4B5SA 3OVPA 2CKRA 1CCWB 1SM9A 4H9TA 2A3HA 2XG9A 5FJJA 3QHOA 3LV5A 5REQB 1FWRA 2DIKA 5KINA 3L7RA 3B4UA 2XVPA 3SJ3A 4ICMA 1LRNA 2YBTA 3QY7A 4O50A 2V38A 1W8GA 4GOAA 2OGJA 2IW0A 4PRTA 3OLGA 5JMUA 4Q6JA 2YCIX 4RE2A 1IIHA 1YADA 1YTDA 1A47A 1XIBA 4F0SA 1CB7B 2PCQA 2CFFA 7A3HA 2W63A 3DKJA 3NQ6A 3C8NA 2B7PA 4ZB5A 7REQB 1POKA 1NF0A 3KLKA 2YL8A 2ASHA 1OK6A 2HWGA 4Q8OA 3C61A 2I14A 4KWWA 2XINA 1XLDA 4QBXA 3FK4A 2E4TA 3RX2A 4PRRA 3I7RA 2XYLA 4S3AA 1BF6A 2VFIA 1PKYA 1BYAA 5HOSA 3PJWA 3ARQA 3W86A 3CTLA 4JTRA 4JX4A 4NP7A 1TV5A 4XD4A 1FWIC 3NYDA 4A2RA 2P3EA 3ITXA 1WNOA 2X0HA 3WH7A 2WOQA 3NM1A 1T8XA 4HB7A 4MF4A 4GNJA 4GY1A 4N4PA 2NSXA 1Z7AA 3EBVA 2ZXAA 2UY2A 2VI0A 2HISA 3LGGA 4S3JA 3RLHA 3WSUA 1F7BA 3ZT6A 1F3EA 3B4YA 3SGUA 1XJBA 2WC4A 2EHHA 5G4EA 4S23A 3LV6A 1BKHA 1F9CA 1A5AA 1SVDA 1R3VA 2CC0A 3A9IA 4C1NB 3PFMA 3PB2A 1E9LA 3LDVA 2NUYA 3HPFA 4F3HA 4KKXA 3B8TA 3N6QA 4FXJA 1SMDA 1EBHA 1AZ2A 1A5KC 3AHVA 1FWGC 4AD1A 2PWDA 1Y5WA 2E0PA 3EWYA 3L66A 2EPOA 3II1A 3A21A 2VT0A 2V8ZA 2QPSA 1H7NA 4O4WA 2CW6A 1LUCA 5C2GA 5BRBA 2DSVA 3QYSA 3ALFA 1YW1A 2WQDA 2QPUA 2GQ3A 2EQDA 3BAWA 2YBUA 2Y5EA 1K7XA 1UB3A 1YPXA 4PMYA 3AHYA 2ZADA 4NYYA 4JQ1A 2CZDA 7ODCA 1RUSA 3W1XA 5DQPA 4D6EA 1GTEA 1UIPA 5D05A 3WBYA 1O68A 1M9HA 3UETA 3PBUA 3TQPA 3W1NA 1MW3A 3T05A 2QVHA 4A8IA 3QH2A 2BGNE 2C19A 2V30A 3B0UX 4KEZA 4HNNA 1E6XM 1IEIA 3NZQA 3SY1A 1E1CB 1H51A 3S2MA 4UOQA 3AU6A 3OGVA 3Q94A 1IT0A 1I1XA 2OLSA 1GPFA 1S2AA 3CV6A 1IYXA 3BC9A 3NPVA 3UZXA 3URNA 4JYDA 3RUBL 3OO2A 5I6SA 3LCGA 3MV01 3AUOA 3V75A 2PDYA 3PBMA 1I2QA 3L67A 2J7CA 2CBJA 4GABA 5KTLA 2J8FA 4IX0A 1EGVA 2CLFA 3ORWA 1GNXA 4DO6A 2R82A 3IVUA 1ITQA 3WDQA 3KHDA 2QUNA 1J5SA 1SR9A 4JX5A 5C5YA 5HQMA 3OYZA 4LW7A 4E6MA 4KH2A 1LP6A 3QPZA 4H41A 3CIWA 4N4QA 4EF9A 4F48A 1DE5A 3Q37A 3UR8A 4LBRA 3NURA 3QQ0A 2PU1A 2BHZA 2Y0FA 1E9IA 4PC8A 1B9ZA 4HMEA 3JR2A 4X60A 4J3ZA 1K02A 1X8CA 4AD5A 4YNGA 4MFDA 1HGYA 4W8BA 1JGMA 3QEZA 4PMJA 2BB0A 1FH9A 1BSIA 4QDMA 4B3ZA 1FFQA 3QSTA 1KKOA 4JY9A 4W8AA 3JUGA 3SCNA 3LCFA 1UOKA 2QJJA 5T9CE 4NQ1A 1E1EA 2QIWA 3VNYA 3K4AA 2GSJA 1MW2A 2GJNA 3DN5A 4LAKA 4YL2A 3UY8A 3PZTA 3H4XA 4Z2LA 1NWTA 4U3AA 3A4WA 3CQ0A 2FHFA 5FL1A 3NJ3A 3OPSA 3BE7A 3S5YA 3AMKA 5I78A 2CITA 3N3MA 2PTZA 2RH9A 5LNVA 4V1YA 3GHUA 4TOQA 3CM4A 4L1WA 3L65A 5EBUA 5JBDA 1TE6A 2ZZ2A 4D6DA 5A6AA 3IS4A 3BANA 2G3MA 4MDOA 4M6QA 5IHRA 3EWUA 3KL0A 3T8LA 5TBOA 5I5RA 3T2QA 4OECA 1ZS2A 3GVGA 1TMQA 2YYUA 3UWVA 3WDJA 1SU5A 3EPNA 3RAOA 1Q2SA 3LSBA 1Y5VA 2D69A 4O19A 4PB4A 4TU1A 3UVAA 4GXWA 3PC0A 2VOMA 4TQTA 4L56A 3NPWA 4RZ5A 2HTMA 3HURA 1HTIA 4I5UA 1E4IA 4A21A 2QUUA 3ZS4A 2DVXA 3H2FA 1OT2A 1XG3A 1IR1A 2WLZA 3HG2A 2TYSA 3FW6A 3DI0A 4FLSA 1HF6A 2FZNA 2REQB 3M47A 3MI3A 4C6MA 4CNNA 4XAZA 3NQAA 3L4WA 5DX7A 2VX7A 3TN5A 4TV5A 3VX1A 2J7GA 4DBSA 4DY1A 1UYQA 1XC6A 1J9YA 1TV7A 1M7XA 5LNSA 2A3CA 1DWJM 2BLEA 2NLIA 3G1XA 2HVOA 4XZIA 2PURA 3RFAA 1F07A 2OLHA 2ZUSA 2XFFA 5CPSA 1NWUA 4Z2HA 2XSBA 4R27A 2WHMA 3WMSA 3LENA 3B8UA 4LC6A 1S46A 3QFWA 1GONA 2XH2A 2NLYA 3DYOA 2CXEA 1JAKA 1W9UA 2G4FA 3G6MA 1IZKA 3IIPA 1LCOA 1B2YA 1TTQA 3I65A 2Y8UA 3I10A 4AIOA 4M6VA 1V3HA 3OYXA 3LXCA 4NIRA 1DJWA 1TIWA 2VCBA 4EXBA 3SFKA 4DPQA 2PA6A 4JGDA 3G1RA 1E5JA 4UB9A 4E4PA 2V5CA 3AIWA 3IIOA 1A5NC 3PZNA 1TO3A 3H2OA 2AAAA 3LPOA 4N6FA 1VFHA 4L6HA 1ZCCA 2Q3RA 4FNQA 2E67A 2Y4SA 5CJ5A 3G18A 3HG3A 2E1WA 2XIIA 3QY8A 4ACZA 4YS1A 4MZ1A 1VENA 3P8JA 4HK5A 2QT3A 2OYKA 3WMCA 1PTGA 4JR5A 1WOBA 4MYXA 5ABEA 2VEPA 2YCLA 1AQ0A 1VD6A 3WLLA 4BK9A 5C55A 3M46A 4HIBA 1I0DA 3B04A 3W3OA 4H00A 5JIWA 3W70A 2YDSA 4ZGYA 4HPGA 4MWAC 3KVJA 4RZBA 2DP3A 2IPGA 4FA3A 1RY0A 4TMCA 3EOEA 1ZL1A 4X0VA 3PSWA 3V0TA 3WQDA 3TK7A 3FGCA 1AD4A 5I3DA 3GXNA 4M1RA 5D4YA 1KXVA 2VDHA 2ZOXA 5M2FX 3FV9A 2G3FA 2ZZ1A 3VE7A 2VOTA 4MUPA 4PCNA 1TJ1A 4DO7A 4D6GA 4UTTA 4RDYA 4ERAA 3KOZA 3NTYA 5MKGB 2CESA 1I0BA 5C70A 4ZQCA 1XSJA 1W1ZA 3R0DA 2ZUWA 1ISVA 1YTEA 3WUGA 3DFHA 3GH7A 1U30A 1DXIA 1KTNA 2NVAA 4NNBA 3VCCA 2H9AA 3N4AA 3ARRA 1QNOA 4M6PA 1MRQA 4M82A 4ACYA 3TW7A 4S3FA 1VJIA 4QR6A 4IL0A 1RJQA 1T40A 1Q2RA 2XVLA 5F4XA 4GIYA 3AHTA 1C7SA 3R12A 4NZ1A 2C15A 3WH8A 3H7RA 2VEMA 4WDUA 4RJEA 3TXZA 4Z1DA 1TSIA 3UGVA 5KETA 3H4GA 5HDRA 5LGXA 3UZZA 2GJLA 2JFEX 5H8PA 3DHUA 4WXYA 4O15A 5F7UA 4PL2A 4GZIA 5B80A 4C1KA 4R33A 3PPCA 4XUYA 4AF0A 3ZM8A 5G5IA 1BYBA 1ECQA 5C7HA 2J7HA 3SQMA 4HPHA 1HQTA 4AISA 2DORA 4AVFA 1MQPA 2V63A 2E6FA 4ZXOA 1R3WA 1P0EA 4MMWA 4DF1A 2XIOA 1W3KA 5AVNA 1XIFA 4CU6A 4XO6A 2H3DA 2QV5A 1OFRA 3IWPA 2R1NA 1JL8A 1QOXA 1M03A 1V8EA 4D6JA 3WD0A 3WZ0E 2KAUC 3ITGA 4IQDA 3DAQA 1H41A 2FGBA 3JZUA 4PTDA 2AOSA 3LU2A 1TPEA 5K3VA 4EAMA 3C2OA 3N04A 1A80A 1C92A 1QI2A 4H7ZA 4NXSA 5HR7A 4I6VA 3PAOA 1P43A 2JEPA 1VIZA 4FNRA 2X1UA 4HT3A 2F6UA 4HNTA 3BOXA 1ADOA 4NAFB 4DZHA 4C6DA 1HO1A 1K6WA 1FXQA 1H09A 2V3FA 4J3WA 1U5HA 3I4EA 5CG7A 4LCQA 1RA5A 4F0LA 4YHEA 3RX3A 1ISWA 1LBMA 4KGJA 1EIXA 2DZTA 3LXAA 5IOBA 4A2SA 1EUNA 3QR0A 4UTWA 1J01A 2B0MA 6PTDA 1XUUA 5G2HA 5FJUA 2RFGA 3UYIA 4C6FA 1R3SA 5EU9A 1FHDA 2Q8ZA 3T1GA 1BWKA 1G69A 5C54A 3ARTA 2I57A 3VOGA 2F2HA 1OYBA 2ZX5A 3AIUA 1RA0A 1VP5A 4WJ8A 1DHPA 4ERGA 1QBBA 4YMZA 3GXIA 1AH0A 3PS7A 1R5YA 4ZCWA 2E3ZA 2YLAA 1T99A 5A3HA 4QEEA 2X42A 4XQ6A 4GJIA 4XKMA 1KFJA 1XGZA 4QISA 2OU4A 3AQUA 3S9ZA 4RW3A 5CSSA 4MTVA 3JW7A 2HQAA 3GO2A 1RVGA 3VILA 4DWDA 2EAWA 4H6RA 4C6CA 3W71A 1HXJA 2W92A 1F6YA 1GYLA 4C6LA 3G1HA 1LDCA 2CIPA 4FB7A 4XAFA 2OJPA 1IQ8A 4DXKA 1A5UA 2PB1A 3PANA 3UPWA 3NQEA 3EZ4A 3DGBA 1CNVA 3W6MA 1DWIM 1W91A 4YCOA 2V9DA 1A0EA 3ZLFA 3VIJA 4MNLA 2OOFA 3NCOA 1PTDA 4PMNA 4J1OA 2IQ0A 2OFJA 3T09A 3GTXA 3W25A 4W4QA 2EKGA 3BGGA 3KL5A 1VCFA 3S9IA 1LTDA 1VFMA 2AGKA 4RKAA 2PC4A 1EL3A 1B9BA 3F4NA 4MKVA 1R6WA 3LA4A 5HUOA 2VMFA 1CXLA 1FWFC 3VKKA 5F2LA 2Y85A 1WOAA 3EKLA 2GQAA 3GR8A 4ZO7A 2G0WA 4GJJA 3LHUA 2PDGA 1MI3A 4Z2IA 1M3UA 1R2TA 1OK4A 3ZOAA 1VLWA 4C6QA 1RCXB 1K8YA 2CBUA 1S5NA 2DZAA 1E40A 3DERA 2CLHA 3RR1A 1AQHA 1BXNA 3LX9A 4OUEA 1BWVA 4HZ6A 2X2YA 4GPNA 5EMJA 1KQZA 3U5YA 5FF0A 2NVDA 4JFWA 1E9YB 2C8NA 3ATYA 4JTAA 4UOZA 1E0XA 2O9RA 1KM5A 3E49A 1JI2A 1O5QA 3FA5A 4R34A 3KE0A 1UKTA 1RP8A 1PUDA 1XBYA 1EJVC 3NXLA 4UMBA 3VGDA 1OF8A 2WSQA 1DOSA 1GYMA 1HN1A 4M81A 3WQFA 3S8HA 4TX6A 1RSCA 2ZWYA 4J40A 1CGYA 4Y9OA 3BZJA 1S5VA 6XIMA 3GG8A 4IGHA 1NAL1 1XRTA 4AEFA 5BXPA 4WIWA 3UR7A 4QJ3B 1I8JA 1KRCC 4C6KA 4CNPA 3QV9A 3M9YA 4B15A 4WHBA 2PWVA 1FY6A 2GZXA 3ITYA 3JRKA 2QQ6A 3CZJA 2YBVA 3GM8A 1GQIA 4JNMA 2DT2A 1K4HA 3CYVA 1S2UA 3P5YA 5I03A 4JHZA 3GW3A 3KTCA 2EF9A 5ABGA 4WRHA 1E5NA 5I2UA 1XGDA 3MV11 3RM4A 3PSVA 1WXZA 1SW0A 3N13A 2OOGA 4ZOCA 1QATA 3DEQA 5E0KA 1FCBA 1XDLA 1C8QA 3NO1A 4C7GA 3ALGA 7ENLA 4ZB2A 4L6DA 1YBQA 4U2ZA 3BVJA 5DN1A 4EPDC 2ZX6A 3FAXA 3UVIA 3H12A 2AMGA 4EWND 1AODA 2Y7FA 5IBXC 1TVNA 4H8NA 1KKRA 4MNJA 1FUYA 4Q33A 4R53A 3KBWA 1PYFA 2UBPC 4GXMA 5FAGA 4RX0A 2ZXQA 5I00A 5LZLA 2IKGA 4QIUA 1H4PA 8XIMA 3CHDA 4RDVA 4N9DA 2ZCGA 3UXKA 5I06A 4BCEA 5IFPA 1RD6A 8RUCA 4AX6A 2WSPA 3L2MA 3T40A 1Q7QA 3K30A 3P81A 1CGXA 3R0UA 1HIZA 4S3KA 4DUOA 4DEFA 2PE4A 3RR4A 4P8XA 4RV3A 3LM7A 3STCA 5LSMA 2YCJA 1L6WA 1P5BA 3WUEA 4Z08A 2WMHA 1ITXA 3GR4A 1TFVA 4RE3A 3WLRA 1W1TA 3A6OA 2IXUA 1ME7A 1XF0A 3ABQA 3DDMA 5DELA 2ZX8A 2WZMA 4CEUC 5HWMA 5FEWA 1NU5A 1DWHM 1UD3A 1RXOB 1UUQA 3GIYA 2J4GA 1KV5A 3W7KA 1MXGA 2GDUA 3MTWA 2HNEA 1I1WA 2ISVA 4IHCA 2IQTA 3FKKA 4W89A 5HJYA 2WHKA 3WD4A 3GH4A 1VYRA 3LUTA 3PBGA 3BQ6A 2B7NA 3T8QA 1SFTA 5G2IA 3TLQA 3A4AA 4YVPA 4GQBA 3LPGA 1VEPA 3WNOA 1J8VA 2ZVRA 1G4PA 3SECA 4C1LA 4UTFA 3ZMRA 3P3BA 3H23A 1WQ5A 3S2NA 4AHQA 3MUY1 4F9DA 1EP2A 3GRIA 2YZ5A 4QAIA 2PBOA 5E6ZA 3NO5A 1W32A 4I7VA 3BLIA 4NRSA 4GH1A 5FSEC 1ODZA 4MJMA 2XTKA 2X2GA 1JPDX 1OFAA 1W1B1 2WMIB 2IPJA 4NAEA 1YTKA 2CLIA 3HQNA 1QWKA 2QXWA 1B3WA 4J3VA 4ZZ9A 3MSYA 2WCAA 2CLOA 3LQGA 3AO0A 2HBVA 3NFUA 3NPXA 1TX2A 4C5YA 1V6WA 1S2VA 1Q85A 2Q09A 2ZUVA 3B9EA 1Q63A 3N18A 2OQYA 2EGZA 4YLWA 4IMAA 4LWWA 3CWOX 4GYJA 5FJOA 2PUZA 3QKZA 2FPTA 1XR2A 4IG2B 4JQ2A 1E0VA 4OBTA 4FOUA 1GVYA 2CZ5A 3NA8A 4NUWA 3FCPA 3IVTA 4PMRA 3A12A 4NASA 1UR0A 1QW7A 4FX6M 3UWEA 4NZ5A 5HNRA 3WELA 3VDGA 3KWSA 3S5SA 2O7SA 1V5XA 3E2RA 2V3DA 2JBMA 1TJPA 4GUIA 1GHRA 2EPKX 5EL1A 3IUDA 1WAUA 3FAWA 4OQVA 3KRUA 4WJEA 1JR1A 3PJXA 1VBUA 4KFPA 2BGQA 4RCXA 2CLMA 3LCLA 4EWJA 2GJRA 1JQXA 1G1YA 2CLEA 3R1ZA 1F8MA 3UQNA 3F4WA 4DJDA 4CCZA 4RE4A 1OT1A 2W66A 4BF5A 1EZWA 3PF3A 1M7JA 1LOQA 3ARWA 3DGRA 2DZPA 1E6QM 2QZRA 2QYGA 5BXSA 3ZJ6A 4EACA 4IMGA 3F5LA 4WDWA 3STEA 2BXYA 4JICA 1E72M 1J0YA 1NDZA 2XN1A 4QGCA 4M5PA 1LG1A 2EKCA 1EDGA 3SUWA 3V5OA 2OELA 2AKZA 4ENLA 4RL3A 2E6AA 2O56A 4ASTA 4B5XA 1S38A 4UQDA 3H21A 1UCWA 3O6CA 3P5ZA 3ZVHA 3TW9A 2QCFA 1YPIA 3F4CA 4QCEA 3ISIX 1U1HA 3B03A 2BG5A 3PN8A 3JZEA 1ZZMA 1B4KA 3K8KA 3F2DA 2TPSA 3ARYA 3CUHA 1XV8A 4Y9PA 4TR9A 3BAIA 4IJBA 3NVTA 3VC6A 1W17A 2WAGA 1K9FA 3WCZA 3WQEA 4ZFMA 2ZZ6A 3CUXA 3PUEA 4IPIA 4WSJA 1VPXA 3GAKA 4AC1X 1X1NA 3W29A 3KCJA 1H1YA 3ANVA 1KCXA 3AS0A 1ADDA 5CLWA 1P1XA 3GXMA 1G67A 1EJXC 4I7UA 4CQDA 4PCFA 5DCBA 5GNXA 4UR8A 3SCUA 4JX6A 1PO9A 5AOUA 2WPGA 3G1SA 3TN6A 4G2DA 1H1NA 2VC9A 3EX4A 3SCTA 1PIFA 3B05A 3S0CA 3D47A 1WKFA 4WGHA 3AYRA 1LG2A 3W1MA 1NSJA 3UR2A 2GSHA 3ZSSA 5DY2A 1JZ7A 3W7MA 4C6NA 2PTYA 3H54A 1P0DA 4KWVA 3N4EA 1XIDA 3UY7A 1REQA 1X39A 2QEZA 4RDWA 3GS6A 4MGGA 4HCDA 5H2ZA 1LZOA 1S2CA 1LQ2A 3TJIA 3VKBA 1CPUA 2DW6A 4OUIA 1L0PA 2C71A 4JTQA 1WP6A 4P61A 4JQAA 1W3LA 3CH9A 3WJXA 1YRRA 2Z29A 1G94A 1MW1A 3NVDA 1CWYA 3G77A 2ON3A 3ZIZA 2QV4A 1VH7A 5EMYA 3N73A 4D6HA 3N11A 4AD4A 1JRCA 3M6YA 1ONWA 3LHTA 4LRSA 3AIRA 3UR5A 4HNCA 1LLZA 2OX4A 1Q8JA 3T55A 2QF7A 3VFLA 5I23A 1GVRA 5HMSA 4JFTA 4PFHA 2FZ8A 4EIVA 3DG7A 3KTXA 4E4UA 4CD8A 2XVGA 3O06A 4N9EA 3U2ZA 5K9CA 1A53A 4PYSA 5D33A 1HP4A 4JCLA 1R7OA 4AUBA 4MFEA 2JK2A 1EIBA 3B9DA 2CEQA 1V03A 3HFTA 3EX2A 2CBVA 1TMLA 2EJ1A 2NUWA 3W7GA 3UF9A 1PTAA 3OHMB 4CNOA 5C9XA 1L8NA 3A3XA 4XD3A 3OGRA 3W7EA 2YIHA 3WJSA 4JTHA 3PTKA 2JKAA 2VZVA 2VP8A 3LY0A 3EGJA 2J9XA 3CL8A 1EF3A 1QHZA 3RCNA 3INPA 1HG3A 4KETA 1J0KA 4J28A 2F84A 1N8WA 2PCEA 3UXAA 3T81A 3P7YA 4GQ0A 3MVTA 2WCSA 3UNDA 1SZNA 4U33A 3P93A 4WDXA 1PZ3A 2G4JA 4Z42C 1UIOA 3G22A 1ZQ5A 2TSYA 4W9TA 2YXGA 4Y9NA 3QC0A 1AW2A 4LEQA 2PDXA 4HU3A 1EEPA 4OFCA 1KM3A 1XD1A 3N29A 3MYOA 3WF4A 1AQMA 2D73A 1WDWA 5CC7A 1O66A 1RCOB 2A3BA 2I16A 4NX5A 1H2JA 3E5PA 4UWMA 3VIHA 2HE8A 1XCWA 2QKFA 3LGEA 4NNCA 3QV7A 3VINA 3BJTA 1E0WA 3VGBA 4IJCA 4HN4A 3I3BA 2VCAA 4JPGA 1AFSA 4MAVA 3EB2A 1PX4A 4F4RA 4ZO9A 3G1YA 1P7TB 2JQXA 1VEOA 4QCFA 3AXMA 1AMKA 3VCRA 5M17A 3GXDA 4Y8EA 5BW6A 1A5SA 1LWHA 2QGYA 4PSRA 5D38A 3UFYA 1HO4A 4X0NA 3OZPA 4I90A 3W2JA 3O8AA 1EYEA 3ZWSA 4C65A 1KFEA 2A7RA 3SRDA 4HK7A 4UQ9A 1X7IA 2PDQA 1QPKA 5C9WA 2QMKA 4TX9A 1XXXA 3C86A 1QCWA 2E8ZA 3OLIA 3QLDA 4KQNA 3SCRA 2EPMX 1HP5A 3THUA 1BQCA 1YDOA 4LT9A 3OLEA 3AHZA 4C6OA 1CW2A 1OZMA 3VI2A 2HV5A 2ZX9A 3KS5A 1XYZA 3W1QA 1VEMA 2GFTA 5F4WA 3AFBA 3ONBA 3MMTA 3MSDA 3RNDA 4IPJA 1E3ZA 3ITLA 5J04A 3BGJA 3STGA 3IPWA 3ZQ9A 1T8QA 1BQGA 1RBOB 4DHGA 3O1NA 3MC5A 4E4FA 3ELFA 1OGSA 3WUBA 3E02A 1MZHA 4AD0A 4JTFA 2YJQA 5H8UA 3UA3A 2OODA 1SZFA 5FF3A 1ZPTA 1L8PA 3EEGA 1LJYA 1ALDA 1XLIA 3CEUA 4PUMA 2D3NA 5D8WA 3EYPA 2XH4A 1E0TA 1X98A 2P88A 5EMMA 4ACZB 3E6EA 4C5ZA 5XIAA 3F5KA 1VHNA 7TIMA 4B2DD 1YYAA 4JTEA 4O1EA 3FSTA 2WB5A 4NZJA 2P5NA 4P8UA 4JTIA 3U3HA 3URBA 2GGEA 1U83A 2V69A 2YGYA 1AG1O 3CV1A 1IXPA 4ADTA 3NDOA 3AISA 3B9NA 1JJKA 1UPPA 3AS1A 2YXOA 3SY8A 1O5KA 4ZTYA 1OM0A 3BLOA 1JRBA 1T6MA 4UNLA 1UD2A 2IKHA 2XFRA 1JDAA 2QJIA 3P0XA 1S2TA 1RCQA 3VDHA 2REQA 3K4DA 3TONA 3A47A 1K4GA 4NYUA 1ZRQA 3HTWA 5D37A 1KBKA 1UMYA 3SM0A 2YA2A 3LQLA 1AW5A 1GWJA 2QCGA 3F4VA 1EQPA 3QZAA 1GQKA 1V0NA 3C2EA 4JTTA 1RR2A 4NZCA 3QHMA 2D2OA 1JNEA 1X97A 1XLAA 4GACA 4MZ8A 3FJ6A 2ZX7A 3ONCA 4HNVA 5J5RA 9CGTA 1W54A 5E1QA 1H7XA 4UTIA 1MQRA 4YTSA 3ZYZA 5KITA 1VCGA 5FI8A 1XYFA 2E6DA 3KRZA 1HKVA 1T96A 2F8QA 4LV4A 6TIMA 1OFOA 1QBAA 4MB5A 3LTSA 3PG9A 2W62A 6TAAA 4LGXA 1KBLA 5M03A 2A1YA 1LORA 4QNEA 3NOYA 3BW2A 3SCQA 1YHTA 4EXQA 1EXBA 1O1HA 2INFA 3FVMA 2EO7A 3WYZA 1MEIA 2V82A 3BARA 3LS9A 3RMJA 1GJPA 2NQLA 2CHRA 5G4HC 3K8LA 3ZVHB 1V93A 4FMVA 1L6FA 2VFEA 4NXKA 4M19A 1V6UA 3G8EA 3UXDA 1MW0A 3EDKA 2V3GA 4RUBA 4L6OA 5BWAA 4XBKA 1UBPC 2FVLA 4O0KA 3PJTA 2YA1A 3GDBA 3XINA 5JIPA 3ABZA 4JEQA 3VO0A 4D2JA 4DBUA 4OBRA 1BHGA 4ILSA 5AYXA 4AQLA 3QOMA 3B0XA 5EMKA 3NQBA 5CEWA 2Y70A 1WXYA 1V3LA 3BLKA 3S5ZA 2NUXA 1C93A 3DESA 2DW7A 3KVLA 4Z1BA 4AEOA 1BG4A 3G6LA 1VPQA 3S1UA 2ZWZA 3OIHA 2HBXA 3CUZA 1R2RA 2ZDSA 3RRXA 2NSOA 3KDNA 2HNHA 1CXEA 3JS3A 1J96A 3CUIA 3T0BA 1OX4A 4WR3A 1TCDA 1QVBA 3WLNA 4NJKA 2DZSA 3MHGA 1K8XA 2E5DA 2O0TA 2HE5A 1EO5A 5LXEA 3GC2A 1A50A 2WYSA 3U57A 3A5FA 4R7WA 3Q65A 4KCTA 4AWEA 3UJ2A 4C7FA 1YNYA 1ZGDA 3AHXA 2GUBA 2HK1A 2JALA 4NZFA 4V28A 4ATLA 1L6GA 4PMZA 2G96A 3IV8A 1PIIA 1JAEA 4JY8A 4HSHA 1JUBA 5A6BD 3BV4A 2YW3A 2J75A 4LUIA 1E15A 5GPRA 2X40A 4QJ1A 4C60A 1XLLA 1XSIA 4HPNA 4NX0A 3RYSA 3WX7A 3TYDA 1DJXA 5DY3A 3PPFA 1XIMA 3FIGA 3KZPA 1OY0A 2JF7A 2E9MA 3TC7A 3UWYA 2G41A 4HTBA 1DJZA 4US5D 1TQXA 3M5XA 1JDEA 3BAKA 4PCSA 4WSKA 1XRVA 2J66A 3PZMA 1ZJAA 1N55A 3CL6A 2X41A 5EYWA 3UG8A 6A3HA 5CH9A 4FX7A 1DTNA 5TIMA 4IIDA 1L6YA 1X6NA 3S1WA 2YA0A 2YPIA 2WSRA 5CPQA 3GDKA 3L68A 4ZE4A 3UU0A 3WLSA 2I56A 2ATSA 3GDTA 3OA5A 4RNJA 5DMLA 1JCTA 4Q3MA 4JCMA 1J0IA 1NP0A 3EA1A 1TTJA 4BF7A 3LRMA 1V4YA 2V6AA 4X9YA 4JN7A 2VR5A 3F5JA 4K37A 3CIXA 3DFQA 3NYZA 1UR4A 4U4MA 3W87A 3SSJA 3S2LA 3SCOA 3HIJA 2VRQA 5J8LA 3TE9A 4GWEA 2X7WA 3U2EA 3UESA 4I5RA 2I5QA 2W91A 5FACA 5KZDA 5L6UA 3NGFA 1GOQA 3A3HA 2BVWA 2POTA 1H60A 4GY0A 1R3YA 4K1GA 4RLIA 3WNPA 2BODX 1M1BA 4ZFCA 5U7SA 2VR2A 3CC1A 1XFBA 3R58A 5I7GA 4KFOA 4QNWA 2P76A 4C90A 4UZUA 4XV0A 3N15A 3RO6A 4YYFA 5HNTA 3GAYA 2F6KA 3CHCA 4MDPA 3MDUA 3W2UA 2OCZA 4LANA 1WDQA 4U2YA 4DJEA 4JTCA 4IF2A 1GKQA 4PEEA 3MP5A 4M7SA 5I3KA 4YTTA 5KMYA 4E38A 3AXIA 3EWXA 1HJVA 4LAZA 3GU9A 5ABTA 3SN0A 2CETA 3T0DA 2CHNA 4DAIA 3WMBA 3GNOA 3LHWA 5ENLA 1XPYA 2W27A 2J7BA 1MFUA 3M0MA 5DCDA 5BOFA 2PP3A 3I4KA 3N2TA 4DUXA 1T0OA 2WHJA 4MJ2A 3THDA 3VNDA 3W7IA 2PLMA 3WBWA 1V02E 5FEPA 1O60A 3RM8A 4JIHA 3GLCA 3F7JA 3REQA 3MWAA 2HXTA 3IJQA 5CQ1A 3W00A 3S4TA 2ABAA 1Y65A 3EXRA 4GIAA 2P50A 4H7CA 3K8MA 1XLHA 3HG5A 3NL2A 4Q32A 3KOWA 5DMNA 9XIAA 3WF3A 1UWRA 1IGWA 1XIHA 4US6A 3BAJA 4M80A 2OO6A 3L0GA 2J7DA 4JBRA 1JDFA 3U0HA 4ALDA 2PP1A 1QO2A 1AQFA 1QW8A 4U10A 3T78A 3M0ZA 3VGGA 3BL3A 1YBQB 1RVKA 3CIVA 4XWUA 3WDHA 4ZQRA 8A3HA 3AYVA 3BICA 1Q6GA 5IBXA 1EHAA 5KZ6A 2X1RA 1UC4A 1EPVA 2WJZA 3HGOA 4IJRA 3IK4A 3XISA 3NM3A 1BPLB 3SY5A 2DSUA 2J7FA 3M64A 2IXVA 4Q4SA 1DEDA 3P6LA 4HYVA 2CXGA 1KQYA 1A3XA 3APGA 1A5BA 3PPGA 3VOHA 4XBSA 5TAOA 3N17A 3WDIA 3G1FA 3PZGA 3VIIA 2NQ5A 1UJQA 2RGLA 1QK2A 4MKSA 3VIFA 2PRMA 4MM1A 3ZR6A 3EMCA 5D2VA 4O28A 3VOIA 3VIOA 4TVCA 3GNRA 2TAAA 2ACSA 4H9YA 3B0VC 2XGBA 3MKCA 3WQPA 5IRPA 4J3SA 1ONRA 3CL7A 4LAUA 3BQ5A 2C0AA 3BURA 2HEJA 2QCMA 3TZFA 4DF0A 1H49A 2PDJA 3EX3A 3W2KA 4UQCA 3U6WA 4BR1A 3LLFA 1PCKA 1ZUAX 4N0RA 1P6CA 2DZBA 2QF8A 2CWXA 4ROQA 3SDOA 2B4GA 2BS9A 2XVKA 4PMOA 1K1DA 1KRBC 2FGZA 3NL3A 4GUGA 3TEVA 2WBKA 4H7VA 5TD4A 3VM7A 2O9TA 4CLMA 6REQB 3O7UA 5E9XA 1PIGA 1VCVA 1NFPA 1DXEA 1V3MA 4GZEA 1XH1A 3WD3A 3T0TA 2H90A 4B5VA 4Y2WA 2F9RA 4GJ1A 3W53A 2Y8KA 3R89A 1PJ9A 1FQ0A 1PVNA 1EPXA 2WVUA 3O63A 3IJ9A 1QNSA 4FO4A 4JIPA 1E4NA 2BVYA 3VNJA 2V2CA 3IJ6A 4H9XA 4QSFA 5CZSA 3LYEA 1DJIA 2BXVA 1R86A 3GHRA 4TUFA 2R14A 3O05A 1U1JA 2VHLA 2VCCA 2X16A 2FZBA 4MADA 2G95A 5CGTA 4A35A 1KA9F 3PP7A 5ECUA 1OC6A 5EFFA 4JZ5A 1GEHA 5D02A 2H3BA 1W5QA 3K5XA 4JIQA 2XH0A 1JPKA 2VQTA 3TXVA 1R0MA 2Z24A 1H7PA 1UA7A 3IJ7A 4FNTA 1M7PA 4HOXA 3VNMA 4FX8A 3HA1A 4O18A 3SIZA 3PPHA 4ZXLA 3QYQA 4C6EA 1VC4A 4IG2A 2VDIA 3CWHA 3VDAA 3UG4A 4KF1A 1ZAHA 1D7FA 2GQ8A 5KEZA 4PUUA 2VRKA 3O6AA 3W38A 1E6ZA 4DWSD 4YTRA 2RDXA 5TF0A 1KM4A 1PDZA 1ZBCA 3NWRA 3EB3A 2J78A 4QP0A 5DEZA 2OQLA 3UD6A 2D2GA 2QJHA 3O6DA 4AX7A 3NQGA 4NF7A 3NXFA 4FALA 2OGYA 1TMHA 1TZ9A 5AC6A 1DJYA 1Q7MA 4WXZA 5I3FA 5CJNA 4DJEC 1UP3A 2FZ9A 4MYAA 3W74A 3HB9A 4FXSA 2XGZA 4H9MA 3ITTA 4JEJA 1Z32X 2BNJA 1UWUA 3UG5A 4I9MA 1I45A 2FJUB 4INFA 4GHRA 4PBFA 1PPIA 2BBFA 3KVKA 2QCDB 3RGTA 2YL9A 4GX9A 2FTPA 2OTDA 4MWAE 4C6PA 3NEHA 3MJYA 1DIEA 4KFNA 1BRLA 4Q4MA 1ZLPA 2R1MA 4WOQA 1EC8A 1W1IE 2WCGA 5FJPA 3HOJA 4AU0A 4CD4A 1OZQA 3F1QA 1IHIA 1A5LC 1EWEA 1KCZA 4FOJA 4LS1A 2BXZA 2XIBA 1QNRA 1W56A 4LXFA 3M0HA 5TNVA 4GC3A 2ALRA 1TA3B 3KDOA 4NU7A 2PODA 4H9UA 3UXLA 1S3HA 1H1ZA 5CLTA 4N6EA 1S1PA 1HL2A 4WJXA 2CLLA 4IMFA 3JVAA 2QJNA 3IRSA 1OCQA 1KR1A 3K2GA 4CD5A 3BDKA 4XUGA 3PZUA 3N19B 2NV2A 4GXPA 3E3HA 1YDNA 2R91A 4WOZA 3LMYA 2PAJA 5CZKA 1BTCA 4JQ4A 3LSCA 3IVSA 1M01A 5FSDC 3GC4A 4UIOA 2ABBA 4MB4A 3GBDA 1KXTA 2VC6A 4PCPA 1UD4A 1VYSX 4B90A 4LUTA 1SYTA 4IM4A 4HMCA 5LNUA 3WUFA 2ISDA 3I6EA 4ERIA 5EY5A 3QTGA 4ATDA 4TTGA 1GT8A 2Y89A 4JDYA 4ZE5A 3G1VA 3KTSA 1H5VA 1QPQA 4DXVA 3GY1A 3BCDA 1SPQA 1CEOA 1Z69A 2O7QA 3OG2A 1W3IA 3C6CA 1JYXA 2WC7A 1GVSA 2PU0A 4BY3A 4J2MA 1G0CA 5AHMA 4MJ4A 3IGUA 4M8UA 4L4MA 1K3UA 1DQWA 2FTWA 4PUKA 1ICSA 3IARA 3SQLA 2B7QA 4ZENA 1R46A 4ZOBA 3E0WA 5CSRA 1ZJIA 4KEMA 1OVDA 4AMAA 2V0TA 3WG6A 1OHLA 5ECVA 5RUBA 2R1KA 4QE1A 1JCNA 1RPKA 3NG3A 2DU2A 3SUSA 5AHIA 4J35A 1JZ3A 5CAHA 4QE5A 2Z4GA 5D30A 3MCOA 3NQCA 2A5HA 2Z6IA 3DYPA 2PWEA 4ZBCA 2WVSA 2INEA 3OTRA 3DFPA 4NSBA 3HPAA 3SO7A 3SW6A 1DWGM 4L80A 1HVXA 2UWFA 1NP2A 2ZFAA 2V5KA 1HX0A 4O11A 3GNDA 4Y9AA 2C13A 3OBKA 1Y7VA 3W4RA 3TTOA 3WF0A 4UTTC 2EG8A 3T9PA 2QVNA 2PD5A 3LTYA 3CZGA 1K77A 2P8BA 4RNIA 3CT2A 1G6CA 3VVGA 3A24A 1UKOA 4O1CA 1VLIA 4RPPA 4HA0A 2YB4A 3FKRA 5E0CA 5AYIA 1XYMA 1C91A 4GK8A 2PTXA 3MZNA 2R8WA 3E2VA 1RJPA 1SZGA 5MF5A 5CZJA 3QMRA 3AS2A 3M0LA 2V2HA 1LUCB 3CHFA 4LY4A 2VWTA 3IIVA 3CZ8A 4E8CA 3OVRA 4BA0A 2OB3A 1XUZA 3M0KA 3RLUA 1NQ6A 5CAKA 3NZRA 3R5EA 4V33A 2GJXA 4I5XA 3W83A 4LEFA 1E6SM 3T42A 2QR6A 4QFUA 1E51A 3VKCA 5I24A 1LM1A 2A79A 4AWTA 1YPFA 4L4PA 3EWCA 3HU7A 4WKAA 3NIYA 2EJAA 1WZKA 1AA1B 1FDYA 4AZHA 3UZYA 1EHNA 4NL1A 1J0ZA 1K8CA 3AMGA 4KW2A 5LIWX 4AYGA 5HMFA 3QZEA 4B5UA 4HOZA 2QPXA 3GVQA 4W85A 1W31A 3U7VA 4OWGA 4LS2A 4X61A 1SGJA 3BTNA 3QXBA 4XAYA 3Q2DA 2QULA 3WQWA 4WF7A 1TA3A 2BDQA 2J8TA 4NNAA 1G9HA 3HV8A 1VR6A 1QXLA 3U4FA 3WFZA 3NOEA 5DBUA 1F3XA 4AZBA 3QBUA 3QF0A 3AXHA 3OVGA 3CGTA 2A21A 4NJGA 1Q6DA 3PBWA 4LVDA 3HQPA 2VNCA 3S42A 3RDKA 1XC4A 1YQ2A 1TWDA 1ZBKA 4L9XA 4GO9A 1TV3A 2OWXA 3D46A 2XN0A 4QJ4B 3A13A 5FOOA 4CQ9A 4O0ZA 1KLZA 3BLPX 5DMYA 1GQLA 1AJZA 1FHLA 1G7UA 3LCXA 3TX9A 1U5JA 5DT7A 1M65A 2FFCA 2PTWA 3W7LA 2UZ9A 1BGGA 1HZYA 2Z0IA 3BCFA 3BJSA 5CPNA 5IXEA 4ZOAA 1TIMA 1OQFA 5H8MA 4F0RA 1E6PA 1KRAC 3UZWA 2WMGA 2WMIA 4MPKA 1FWSA 5I07A 1YXCA 1CXHA 4RDZA 2J8GA 4E2DA 3QOKA 1ODUA 4G7EB 3COTA 3NEVA 3R94A 4MWAD 5D09A 1GPWA 1JVNA 1QUMA 2J79A 4YCPA 4LRTA 3AZTA 4YHGA 4ZSTA 3M7WA 4PH6A 1W0MA 4HKPA 3W88A 3WDPP 3MANA 4JKLA 1BEUA 1Z9AA 1XLJA 3CUFA 1R3QA 1PSCA 1H0GA 1FWEC 3LCWA 1Q8AA 2GGHA 3IJ8A 4GH3A 2ZC1A 3V35A 2IKIA 2WVVA 3DC8A 1F73A 3FDGA 4ECLA 2EG6A 4G5DA 2GDQA 4R7OA 2PI6A 3THQA 3SIMA 1RV8A 1SZEA 5EB8A 3P74A 1Y5XA 5CGQA 5C71A 3UNTA 4K1WA 3IJDA 3QVQA 4HYRA 5EMUA 1CX9A 3WNLA 1SO6A 4GI9A 3FVDA 3TIMA 1NJJA 3GG0A 4UMCA 3W1RA 1UPMB 2P1FA 2OR2A 1NFGA 1XD0A 1GZ1A 2OZ8A 4OU1A 2Y63A 1B3YA 1RALA 3PUOA 1Y0EA 2Z1KA 1ICPA 4KRUA 4IQLA 3HN3A 2VWSA 3VC5A 2W67A 1IWAA 3H2MA 3FLUA 1KFKA 1OIFA 3D0CA 4UNIA 4H9ZA 2PC8A 2Z6JA 2J13A 1DORA 1J10A 4DYJA 2X30A 3GNXA 3RM9A 4JS3A 3P2VA 4HA4A 1KRMA 2H8ZA 2D24A 1CLXA 3MO4A 4O1DA 1OF6A 1PE1A 1ZBWA 2PS2A 4I9AA 2D2HA 2XM2A 2ZXDA 2PDHA 5DBTA 4E8GA 1J2WA 1OIMA 1FP8A 1OCJA 1YNQA 2DT3A 3R25A 4LNYA 4NJIA 1R3RA 5CZTA 3B8SA 1XM3A 5F2GA 3V5FA 1OFBA 5ABHA 4H19A 3HPXA 4DBDA 3FHQA 3CAWA 1EQCA 4KCWA 4WY0F 1VFLA 4A3QA 4IT1A 5LIYX 3LK6A 3TJ4A 4CU8A 2QCLA 3B8VA 2G97A 1F2JA 3U8GA 3AAMA 3FHAA 1W9VA 4DPPA 4H3DA 4RW5A 2F2KA 5DFAA 5EMLA 1UR9A 5E70A 3MI6A 3A4JA 5HPCA 1UD6A 2WQPA 2PFHA 3WJZA 3GG7A 3K13A 1EJRC 4KMQA 4XZNX 1K03A 1UP0A 4WGXA 3Q58A 3NZGA 3CLMA 5GNZA 1WYIA 4HHMA 1OGGA 1NOUA 2X1TA 3KVMA 1A3HA 3W0KA 2R1LA 3TCSA 3ECQA 2VX6A 4IZGA 4AD2A 1V0KA 3QTPA 1ZTVA 4R88A 2I9UA 1JZ2A 4AWSA 5JBEA 4LYQA 4XTIA 4PUNA 4PA8A 8CGTA 1MUWA 1BYDA 1BAGA 4ADSA 2DSZA 3PZVA 4PL1A 5CBIA 2XSAA 3FNDA 4H83A 3FA3A 3R2GA 1R8LA 3AMDA 2JGYA 2Q01A 1CB2A 2ZICA 3A23A 5FF2A 1EH9A 2GLKA 4F2TA 5BXRA 1SJBA 3W7PA 4CNTA 5IDIA 1GVQA 4AF0B 1RY8A 2FTYA 1QAPA 2BZNA 2GVLA 3R8GA 2YCEA 3H7VA 4BI7A 3S46A 3R8RA 1S5WA 5CZ0A 4CUCA 2OKOA 2A7PA 3N9SA 1I9CB 3MKKA 4LU0A 4Y8FA 3RRAA 4M29A 3WBAA 3CAVA 4LF1A 1PHWA 1QHOA 1S1RA 2YFNA 3ARPA 2MANA 4UFKA 2Z2BA 4PUEA 2OZ3A 2GVEA 2XISA 5A1AA 3KFTA 1Q65A 1P0BA 4D8LA 1ENUA 2IUZA 4TV6A 3GFXA 2YDRA 1DJHA 2XGIA 1HJXA 5DT5A 1C3FA 4UTWC 2NV9A 3DFSA 3BZGA 4MWAA 1JFHA 4RK8A 3VNKA 3NPUA 5A69A 5I77A 4HZ8A 3M0YA 1J6PA 1GHSA 1KBJA 4UQEA 4QSHA 3U7BA 4U31A 1KXQA 2CU0A 3HGRA 2XWEA 4NAFA 2WVVB 4JQ3A 5FCZA 2DIEA 1KBIA 4O0QA 1AL7A 2QMJA 1UUOA 2KX9A 1OYAA 5CPOA 3TZNA 1Z89A 2ZRVA 3WNNA 5DXXA 2PDMA 4PSPA 3MWCA 4B91A 1KNWA 1VRXA 2OT0A 3ITOA 3PJUA 4AAJA 4FLRA 3HGSA 1V6XA 1KBBA 1KFBA 4HTYA 5IHSA 1EKOA 3QHNA 3IK2A 2O4QA 4HHHA 2YFOA 5HWNA 3NQFA 4JTSA 2VENA 5A2BA 1SFSA 2A7NA 1DBTA 2YSWA 1F61A 3WJYA 3FDKA 5IFTA 1XIEA 4MUZA 4M0XA 3POHA 1RJRA 3ARVA 3VUPA 4LNCA 1VHCA 2C14A 4ZO6A 4LBSA 4A3YA 4IPPA 1TRIA 5D2YA 1KWGA 1SQ7A 3P80A 3GQYA 1LLOA 5CKSA 2XU2A 4RXGA 1XLCA 1I75A 3TTQA 2IS7A 3SCVA 3HZ3A 3FJNA 2GVYA 4TO8A 2WM1A 5XINA 1EWDA 4B2DA 1LOLA 5GVJA 3ZVIA 2P53A 1GQNA 4REQB 5HWJA 4NHVA 4EX4A 3UGRA 3EOOA 1VGAA 1SR0A 3FYOA 3MU7A 2VUNA 4GYFA 2ATMA 1VBHA 4J9JA 1TWSA 3U9IA 4PR4A 1X1ZA 4GFIA 3VNLA 3EKGA 5FD0A 4ZQMA 2QCHA 4QEHA 1DIOA 1B3VA 4D8ZA 1RBLA 1H7RA 2AL2A 5A8GA 4TX8A 3RIKA 5I0DA 1NDWA 1HVQA 3S1VA 1CGVA 4EPEC 4PMXA 3O3RA 4JAWA 1W5NA 3B8IA 4Z0SA 5HANA 3UP8A 3KBNA 3L5LA 1TR1A 4LUYA 3IUIA 4OGZA 1O7AA 3EKZA 2W61A 3QW3A 3WQOA 4HU4A 1M53A 4AW7A 2O9PA 4H2CA 1VB9A 3G0UA 3C0SA 5F2IA 3KBMA 3DENA 3PWAA 1DTUA 2JGQA 4LOCA 2D20A 1CYGA 1QNPA 4XSLA 4O17A 3VMOA 3W7JA 3EPMA 2Y6ZA 1UASA 5F4SA 1EC9A 4Q4PA 3P84A 1B31A 1QNQA 5LGZA 4K3ZA 3LRKA 1GORA 3AYSA 3UCDA 1HKJA 1VPYA 2F38A 5MKGA 1WV2A 5A2AA 2BHYA 1I2NA 3ARSA 2BOGX 4WEVX 4B92A 3CB3A 4UQAA 1QT1A 1JPIA 4AY7A 8TIMA 4GO8A 3ES8A 3AZSA 2NQZA 2ZUMA 1LL6A 4PMUA 2Y5JA 1K7EA 3QQWA 5A8OA 4P5UA 4Q22A 1D7KA 5LNWA 2XUCA 4DB7A 1XLKA 4HJWA 2VC5A 4F2BA 1EX1A 3V1HA 3LCHA 3SR7A 4H01A 3VCNA 4AXNA 3AWOA 1EYWA 4ZA0A 1TJ2A 2QCCA 1BKSA 3OG3A 1MXDA 4R5EA 2C79A 3TC3A 2VYOA 4GIEA 2ZRXA 2V3EA 2XPKA 4XK2A 5K7JA 3V1PA 4HZ7A 1EBGA 1KM0A 5AHFA 2BMBA 1WB0A 2VZTA 4UFMA 1UJPA 1EUAA 4CNSA 1RLCL 1XYCA 4GMEA 1GKRA 2JF6A 1UWTA 4DQWA 1BTMA 4DWSC 4H8VA 4KWSA 4JL2A 1R3TA 1XWYA 5K2ZA 1KWKA 1M6JA 1GYNA 1AUSL 2OEKA 3KRBA 2A3LA 1NARA 4IFKA 1FWCC 3L4XA 1PBGA 2VURA 4AY8A 1WO2A 4HCHA 2XSXA 1RQHA 4DJDC 2G8ZA 3AI0A 3WD2A 5I3HA 2OYLA 3C4UA 4E8DA 4PEKA 5K9DA 1UWSA 3TUUA 3W7DA 3MW7A 3K1GA 1P48A 3V18A 2VFDA 3LZ3A 3PWGA 3IUHA 4UFJA 1J12A 3BMWA 4CCDA 2R24A 4U5IA 2HSAA 1R85A 3WQVA 3NGJA 3GDMA 1ZJHA 4BEUA 1JEZA 4RPQA 1A0CA 4HOWA 2WKGA 4PB5A 5BZAA 5HK4A 1GKPA 3RHGA 2VX4A 3ZT5A 3OQ8A 4Y96A 4L9ZA 4K6AA 1T5AA 4LVBA 1O5RA 4QS6A 4GUFA 1H7WA 3QGVA 2D1ZA 4ZSUA 1D9EA 3RITA 1DWAM 1POJA 3HMCA 1CXKA 4Q4RA 1WPCA 1H0IA 4MNKA 3VABA 3EPOA 1IEQA 4DIAA 4PUDA 3WQ4A 4XKYA 3B8WA 1ZAIA 1XYLA 3CHEA 1H63A 3ZT7A 2BWGA 4Q7BA 1D3GA 1JFXA 3UERA 3VIGA 1H50A 3OEXA 4UR7A 1UR3M 5A6BA 1W3JA 2G3JA 2WMJA 3GKAA 3LEPA 2BTMA 4Q8VA 1UP2A 1NQKA 3PTMA 3TFXA 2A6NA 3CBWA 3LG3A 3S6DA 3ITCA 3WF2A 3F2BA 1W5MA 1YMYA 3CH0A 5I3JA 1AJ0A 1H3GA 1R7AA 1X96A 3LD5A 4JTUA 4NKCA 4ZB0A 1MZRA 3RPMA 3EX1A 4B9ZA 3AXXA 4WCJA 2PEVA 3TNBA 4RNFA 3F2CA 3R11A 3DZ1A 4PRWA 1Q3NA 3V36A 2YR1A 3AICA 4GGBA 5E6YA 3CZLA 1AK5A 4QG9A 3BH4A 4LJ3A 2PWGA 3SCSA 1S3TC 4AC7C 1RBAA 3IAPA 1EXPA 3C3NA 3VE9A 2C0HA 1IT7A 2OYMA 5A5WA 3M6DA 5LKYA 3EOSA 4YN5A 2TRSA 3ANUA 3CPRA 3H2AA 3WMLA 3USZA 1F74A 3HF3A 3PM6A 1PX3A 3VZZA 4XZHA 3HMJG 3L0KA 3WLTA 4FLQA 4AVOA 1WXJA 3MY9A 3WFLA 2POZA 3C8FA 2FPYA 4DLMA 2Z1WA 1MEWA 3M43A 1B5TA 2VD9A 4HA1A 1SMAA 4G8TA 3QPYA 4UQBA 2BASA 4PCTA 5AVHA 3PG8A 1AVAA 4IXXA 5LNRA 3PUGA 3AIBA 4YTUA 3TQKA 2WJFA 4IGSA 2HXUA 2J27A 5HNNA 4DJED 1HJUA 3PAJA 3TYAA 5G1MA 1GJUA 1LQAA 3G2GA 1US0A 1UWQA 4FHAA 1VBJA 1LWIA 3DX5A 4BWLC 4IUGA 4NRRA 2OZTA 3TYBA 5FA5A 4A6GA 3CPGA 4IFRA 2WHLA 1EJ7L 4Q8NA 1FXPA 1NOFA 3BSHA 2V5BA 3ZWTA 1AZ1A 1SUXA 1EP1A 3PULA 2G50A 4M51A 5HUPA 2WWCA 4XZWA 3DIPA 3W28A 3APYA 1RHCA 4URIA 3UZ5A 5CG0A 1R2SA 2P3ZA 1U5VA 1W3HA 5BRPA 3GTNA 5DCEA 2WSYA 5J5DA 3KEHA 4NJHA 2PDPA 3TLLA 5JH1A 2X09A 1G01A 1F3WA 5GJNA 3N2CA 4AB4A 2YB1A 4J4KA 1JZ6A 2Z2UA 1YDVA 3GWQA 1TPH1 4HNOA 4Y7EA 1QNVA 2BSLA 5JQ9A 3ARXA 2E77A 4BS0A 1TREA 2PWUA 2WO5A 3LMZA 6ENLA 1DJGA 1TZ7A 1C9WA 1THFD 2ISFA 3AJ7A 2UV8G 2D0HA 2F61A 1UD5A 3WLPA 3PNUA 1C90A 3AMCA 5JBFA 3E0FA 4W84A 3H2NA 3TYCA 2G3IA 1QW9A 3A9BA 3MP3A 3WIJA 2G5WA 3KAOA 2D0FA 4DX3A 1BFNA 3T2OA 4ZR8A 3DC0A 1NFBA 3TW6A 4B9YA 1LRQA 2OWCA 1BF2A 3MBDA 4BQ2A 4ZEPA 3PTDA 4DUWA 3U4AA 2TMDA 2FFIA 2XN2A 2VVSA 3NNTA 5FJIA 1MNSA 3KCLA 4GI6A 4GC4A 3W7QA 3B9AA 2PDIA 3MMUA 1MFVA 2FMNA 3TSMA 3VYLA 2GGIA 5HXMA 4DYEA 3G1AA 1SSDA 5EA9A 1B4EA 1WKEA 3VD7A 3TTYA 3P82A 3DU0A 4OE7A 5JXQA 1IEWA 4DF2A 1MRAA 4ADUA 2PDBA 3BPWA 1YDYA 2PDWA 4FPSA 2NV1A 4JIRA 3EAUA 3URQA 1R38A 4DZAA 2ZZ3A 3BLDA 4U28A 3CUGA 4JOMA 4LCRA 4KEVA 2HVNA 4AYSA 3IJLA 4RXFA 2FYMA 2VVNA 2P0OA 4DNHA 5A8NA 4LB4A 3VD5A 5LHFA 4A3HA 4K7YA 1RP9A 4K8GA 3SCPA 1UR1A 4OOUA 3TAOA 2W0UA 2FGLA 1ESWA 2BGSA 4I6KA 4AFYA 1E0UA 3AU2A 4LUSB 3VIKA 3TR2A 4ZTXA 1TVPA 4M7TA 1TTPA 1GK8A 4GCAA 3G3DA 1XGEA 8XIAA 5AN7A 3W37A 3VIPA 4H8HA 3VK5A 1D3HA 5HBFA 2PF8A 3GW0A 3E2QA 5HMEA 2C1GA 4UTJA 3N6JA 1JDCA 3PR2A 2QGHA 2VKZG 4GISA 4UTHA 1Q6CA 5M1TA 1TWZA 5HULA 4LVFA 2I17A 1IE7C 1DJNA 2QUMA 3AIEA 3VIMA 3ZLHA 4PULA 1RZMA 4XBJA 5HJLA 1XQLA 4BZYA 3IGHX 4LUTB 1SO3A 3NQ7A 2WNWA 3HV9A 2YL5A 4OV4A 1AJ2A 4AMCA 3TH6A 5K4XA 4A8LA 1A0DA 5C2CA 1J93A 1Q6OA 1W5OA 2PWFA 1BG9A 1JF5A 3BMXA 3OW1A 1PEZA 3C3UA 1TPFA 3A64A 3TKFA 4AIBA 4L65A 2QDDA 5HPOA 3P61A 5D8ZA 3WF1A 2AL1A 1RLDA 2R1PA 1UZ4A 3RK8A 3E5BA 1FH8A 4E3VA 3BGAA 1DIDA 1YE6A 3KS6A 3VPLA 2YDAA 3S1GA 3TYZA 7PTDA 3H8AA 4XZMX 1V77A 3D3FA 4IICA 2A0NA 3NZPA 4CQBA 4Y9MA 3LI0A 4HA3A 5CCZA 2OVLA 4KCVA 4O57A 3OGSA 4BEQA 1V6TA 3JU2A 3EXTA 4CQAA 3CMGA 4A3UA 2SFPA 1LBLA 3ZFHA 4HU0A 1KTBA 3N34A 3WQ8A 4DJFD 1Z8AA 4B3LA 2Z2AA 1TV2A 2FLIA 4MNMA 2VZUA 4E0CA 1V6VA 2YLLA 1P7TA 5BMXA 2NQHA 4DRSA 3NSXA 4HQVA 4FF5A 1DJQA 4L7ZA 3KWXA 4FIQA 2BHUA 5U4NA 3C2RA 4EANA 3FSUA 1CLKA 2GGGA 4O8AA 4FSAA 1NDYA 4IIHA 3GTHA 1C9DA 3HG4A 2Z26A 1WE5A 1QTWA 2VL4A 2WVTA 4HCLA 2INZA 5E09A 3I3EA 1MQQA 3ICJA 5AYYA 1JPHA 1NELA 4HN8A 1WZMA 1E4MM 3WNMA 4WK9A 1XLFA 4F2UA 1XBVA 3DECA 3BG3A 3M5ZA 1VFUA 1YEYA 4LC8A 4AZIA 3RO8A 2HRWA 4UTLA 5BXTA 3PVFA 3TOYA 3CQIA 1JCYA 3BSMA 3NQ8A 5GNYA 4BQ5A 2PWHA 2ZYFA 3BW4A 1FH7A 2WSKA 2OSYA