1EXBA

Structure of the cytoplasmic beta subunit-t1 assembly of voltage-dependent k channels
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KV BETA2 PROTEIN
publication title Structure of the cytoplasmic beta subunit-T1 assembly of voltage-dependent K+ channels.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
total genus 123
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1exbA00
4JQ1A 2ISFA 4WGHA 4MHBA 1MZRA 1EF3A 1PZ0A 3RX3A 4FA3A 3VXGA 3C3UA 1IEIA 2PFHA 1ZSXA 3CV6A 4JQ3A 4DZ5A 2IKJA 4JTQA 4ICCX 3O3RA 4LBRA 4QX4A 3LQLA 2FGBA 3V36A 2ACSA 3R58A 1ZQ5A 3LQGA 4XZIA 3GUGA 2ACQA 4IJRA 2BGSA 4YVPA 2IKGA 4FZIA 1LQAA 2DUXA 4GCAA 1ADSA 3BUVA 3Q65A 4H7CA 4IJCA 1S1RA 3N2TA 4LBSA 2PDGA 1AH3A 3UG8A 1PWMA 2HVOA 2HEJA 2C91A 3GHSA 5LIKX 4AUBA 3H7UA 4JTAA 4XZNX 4WRHA 1LWIA 3ONBA 4LB3A 3R94A 3EB4A 2PDUA 4DBWA 1YE4A 1Z89A 1PWLA 3LZ5A 3V35A 1PZ1A 4WDTA 5LIUX 3UYIA 1AZ1A 1T41A 3U2CA 1QWKA 3EB3A 3MB9A 4R9OA 2J8TA 4XAPA 4XZLX 2HVNA 2PEVA 3MC5A 3CAQA 5HA7A 3GHRA 3CASA 4FAMA 1VBJA 1AZ2A 2DUZA 4DBUA 1YNQA 5C7HA 1XJBA 1XGDA 4GIEA 4LAZA 1S2AA 4JTDA 3S3GA 3B3DA 4PUWA 1ZUAX 2PDQA 1US0A 1EL3A 4F40A 4HMNA 2IPWA 2NVDA 2PDHA 2PDYA 1X96A 2WZMA 3CAVA 3DN5A 4YVXA 1QRQA 1HQTA 2PDJA 3N6QA 3DOPA 3LZ3A 4PR4A 5HNUA 4JTCA 3UFYA 3UZYA 2WZTA 2P5NA 2IPGA 3G5EA 4QBXA 4LB4A 3V0UA 1S2CA 2IQDA 4GA8A 1FRBA 2VDGA 5LIWX 1M9HA 1RY0A 4WEVX 3H7RA 2ACUA 3EAUA 2PDBA 4QXIA 4JQ2A 2CLPA 2IKIA 4JIHA 3WG6A 3UWEA 2IQ0A 2DV0A 3UZZA 4FALA 5AZ1A 4LAUA 3H4GA 2A79A 3CMFA 1K8CA 4PUUA 1IHIA 4XZHA 4XO6A 3LD5A 4QR6A 3WBYA 3F7JA 2PF8A 1VP5A 4XO7A 3FJNA 5LIXX 3Q67A 4WDUA 3G1RA 2FZDA 3QKZA 3FX4A 3D3FA 2I17A 4L1WA 2R9RA 1AH4A 1AH0A 1R38A 2IS7A 4XZMX 1T40A 1EKOA 3M4HA 2FZ9A 3UP8A 4GQGA 2F2KA 5JH2A 1OG6A 2ALRA 2NVCA 2PD9A 3BURA 4JQAA 3WCZA 1XF0A 4EXAA 3R8GA 2IPJA 3P2VA 3BCJA 3R6IA 2PDMA 2PDCA 3ERPA 1Z3NA 4Q3MA 4GQ0A 1Z9AA 1ZGDA 3RX4A 3LBOA 5LIYX 2HE8A 2HV5A 2ACRA 4DBSA 3UZXA 5KETA 3R43A 4EXBA 2BP1A 2IKHA 1GVEA 3T42A 3LEPA 1PYFA 2AGTA 1RALA 4JTRA 4HBKA 2F38A 3R8HA 3V0SA 2BGQA 4XVDA 1Q13A 4H8NA 5JH1A 4L1XA 3BV7A 2PDIA 1MRQA 1J96A 4JQ4A 2PDFA 1Z8AA 4YU1A 4IGSA 2FZBA 1MI3A 2FVLA 3O0KA 4PMJA 2PDPA 2PDLA 3ONCA 3LNMA 4XK2A 2QXWA 2IPFA 1C9WA 3R7MA 4JIIX 5HNTA 1AFSA 1YNPA 3WBWA 4YVVA 4JIRA 2PDXA 2HE5A 3M64A 1X97A 2PD5A 2HDJA 1EXBA 1X98A 1UR3M 3UGRA 3M0IA 3NTYA 1Q5MA 5DANA 2INZA 4WDXA 4I5XA 2I16A 2INEA 3V0TA 2PDNA 4WDWA 2PZNA 3WBXA 1SM9A 4RPQA 5AZ0A 3GHUA 4Q7BA 4PRRA 4PRTA 1JEZA 3COTA 1RY8A 3UZWA 4G5DA 1HW6A 3GHTA 4ASTA 3CV7A 3RX2A 3KRBA 3LN3A 1YE6A 4YS1A 2FZ8A 2R24A 4GACA 4NKCA 1S1PA 3LUTA 4ZFCA 4GABA 5M2FX 4OTKA 4XVEA 2PDWA 3LENA 1A80A 2PDKA
chains in the Genus database with same CATH superfamily
5AVHA 2F6UA 4Y9AA 1ZBCA 3FAXA 1UA3A 3FGCB 1I2PA 3C3UA 7A3HA 3LSCA 3EKLA 4PMYA 3RLUA 1CLXA 3FSUA 3WX7A 4UMAA 4RV8A 2IKJA 2P10A 1SZRA 3HPFA 1MFVA 4GOAA 3R58A 2FHBA 3GUGA 2ACQA 4X9SA 4Q8MA 4IX0A 4L6HA 1JD9A 4M6QA 4Q4OA 3QFEA 2BVDA 1XRFA 5CPOA 3W7QA 3O63A 3HN3A 4C6QA 2AQVA 1OT1A 4AZ5A 4MM1A 3FDKA 4QQ3A 3GVWA 3DBNA 1UCWA 2PWDA 2YW3A 4OV9A 3CWHA 1MQQA 1Q3NA 4LVFA 3GDLA 4DJED 1V3IA 4HYWA 3IUIA 1L8NA 4NX0A 3AYRA 3GS6A 3BGAA 4KRZA 1VPQA 1ME9A 3ZSSA 1GG0A 1RV8A 1W31A 2GWGA 4GUHA 2VKZG 1WV2A 3PUOA 2OU4A 5AHEA 3UY7A 4AC7C 1RPXA 4Z2JA 2XYLA 2QYGA 4KFOA 3HG4A 4WX2A 1UPPA 2VD8A 1F73A 4NZ4A 5E1QA 1HUVA 4HIBA 2I9EA 3MB9A 1IEXA 4IIBA 3PZMA 1UBSA 4AX6A 5I7GA 1P6BA 1R87A 2HVNA 1WX0A 4F2UA 4FK9A 3IIXA 5HA7A 2Y0FA 1OQFA 4DAIA 3HTWA 3SCRA 4HU0A 5DO8A 3JZUA 3IRSA 4C5YA 3RYSA 1BYCA 4NAEA 3P84A 1OM0A 1KFEA 2A3EA 4PMDA 3S4TA 3TSMA 3AXIA 3W29A 1EL3A 2UY3A 1OSEA 4QISA 1VFOA 3WH5A 1Q6GA 1J5TA 3M5VA 2I57A 4BEQA 4ACZB 1H5VA 4XISA 4C6LA 4H9XA 4MLRA 1AL7A 1DOSA 3H2AA 1R3SA 2Y70A 4UTJA 4B5UA 3U3HA 3UJFA 2V68A 3NGFA 2ACUA 4U4MA 3UQNA 1W3KA 3L0KA 3T8LA 4RE3A 4YCOA 3N13A 4L65A 4IPIA 2Z7GA 3N3TA 4FNPA 4QXIA 2Y7EA 4J2MA 4IWWA 1XX1A 3IEBA 2GQ8A 1BD0A 2IQ0A 3N34A 1XLHA 5FF3A 4US6A 3TAOA 3DZ1A 3B8SA 3FGCA 1A3WA 1FWDC 2VC5A 3E1F1 4OKDA 4WOQA 2XSXA 4W8LA 5CPQA 1OF6A 3GBDA 3TH6A 3FX4A 1SJDA 3ZFHA 1NAL1 3CK5A 3UBPC 4W89A 3MCNA 4ALDA 4HK5A 2V5LA 2F2KA 4O11A 5CJMA 4QS6A 5DCDA 1LM1A 4GCXA 2XIOA 4JCMA 1SPQA 4XAFA 3FVDA 2XGBA 5A6TC 4NJHA 2JKPA 1GZJA 2QJMA 4IPJA 1PHWA 4DJFD 3TA9A 2C1GA 2Q02A 2B81A 3OB8A 2WC4A 1UR0A 3SFKA 1NTHA 1DXEA 1HVQA 1JAKA 3UT0A 4MYAA 1UJPA 4ZMGA 2RH9A 1JDDA 2Z1XA 4YCPA 3W25A 1MQPA 3AMGA 4OQVA 4DBSA 3QGKC 3IJLA 2ZWYA 5C9RA 4UTHA 3E02A 1L6WA 3GU2A 1XIHA 2V5DA 1UWUA 2WM0A 2WQDA 4AWUA 3TYCA 1BG4A 3E74A 2VD9A 4ZTXA 1XYCA 1XLGA 3N12A 4GI9A 2XVNA 2XUCA 3EPMA 3HGOA 1A5NC 3R8HA 1KCXA 1PIGA 1Q2SA 1OC6A 1XIDA 4O19A 4OV4A 1YXCA 3UCCA 2P8BA 3GIPA 4GZJA 1D7KA 4IP7A 2YOCA 3LHYA 3QSTA 3IANA 2QDEA 4OUEA 3SRDA 1VBGA 2FZBA 3N15A 3W85A 1D8CA 1E5JA 2PDLA 4ACZA 5DCEA 2XWEA 4QM1A 1P1XA 4KIRA 2XN1A 1LJYA 1AFSA 6TIMA 4ILSA 4JXCA 2CXEA 2AQOA 2G4JA 3BW3A 3V75A 5BW6A 2HE5A 2NQHA 1D3CA 1CENA 1QNQA 4YTQA 1IIHA 2VUYA 1KFLA 1N7KA 3NSNA 2X2GA 3FHAA 2FH6A 1ONWA 2RJHA 3S6OA 4DO6A 3E0IA 3WDQA 4RPQA 3ARTA 2D24A 1J2WA 3VDCA 2ZOXA 2R1KA 4N4QA 1SZFA 3UZWA 1W9PA 3NPUA 5I24A 3TYUA 3U2EA 1H3GA 2E5BA 1E51A 4G9PA 3ISIX 4GNJA 2VOTA 3LUTA 4DAFA 4CNSA 5E09A 3K1GA 4YHEA 3NZQA 2DIEA 4JIQA 2Y63A 1EUAA 2ISFA 4UTLA 4WGHA 4D8AA 1XIGA 2I5QA 2V69A 4RZ6A 2JBMA 4AY7A 4I3GA 3CV6A 3VZYA 3JZEA 4GQQA 5TQLA 1HJQA 1O4UA 4IMAA 4C6NA 2BVTA 4UXDA 4CQ9A 2J27A 2Z1WA 4DB7A 5I6SA 4FOJA 1JYVA 3AU2A 5I23A 4M5PA 1KXVA 3NYZA 3CZKA 2BXZA 3LCHA 1EX5A 4FZIA 2OGJA 2INFA 1LTDA 1VLWA 5G1YA 5HOSA 5AC6A 2OG9A 4CN6A 4GKTA 3N4EA 4MTVA 3W72A 4C6IA 3ZT6A 3KTSA 3N2TA 1FKWA 4JTUA 5E0KA 3RPTA 5A3HA 1RK6A 1ZJAA 5EU9A 1QHZA 1D3HA 2ZC8A 3DXIA 5HWNA 3UR7A 1SZNA 4NJIA 1OK4A 3SJNA 1R3TA 3F4DA 3WMSA 2CWNA 1E71M 4Z2KA 3CMGA 4PGLA 1RQBA 3WLLA 3NQMA 4DJDC 1XYLA 1PTAA 1AZ1A 2PU0A 4OECA 2W3ZA 4OBTA 2H9AB 5TF0A 1D9EA 2PGFA 4B92A 2YW4A 1PVNA 4UFIA 1AVAA 3GHRA 4FAMA 1P7TB 1NARA 1AZ2A 3QRHA 2ZA3A 4MADA 1JDAA 1GCYA 2O9OA 3PTMA 4NI3A 3DG6A 4K37A 4DUOA 3W7GA 1R2RA 4PUWA 3C0SA 1GHSA 3BQ5A 2OEJA 2V63A 1X6NA 2OQLA 4F3HA 3M0JA 1SJBA 2EPHA 1W1TA 3PZUA 4DN1A 3DC8A 1OFEA 2WSQA 1GQIA 4AHOA 2WZMA 3ARVA 5CZJA 5FF2A 3AMKA 5FAGA 4Y8EA 1RLDA 4MY9A 3ZM8A 3M44A 4H7VA 4A05A 1V6TA 5F4WA 4TTGA 1NQKA 2QMKA 2J47A 1ITUA 2F84A 3K4WA 3G5EA 4CNNA 1PUDA 2A6NA 1S38A 5CBBA 1BXNA 1YXYA 3CO4A 4QSFA 2QR6A 4FX7A 2WZIA 4MWAD 4UNIA 3G1XA 4C7DA 4MNJA 2OTDA 4L9XA 1QPKA 1YXDA 1P43A 2A4AA 1ONRA 4XD4A 3W7HA 1C7TA 1AW1A 2VMFA 1AW2A 4JFSA 1XRTA 4KPLA 1WYIA 2A3LA 4ORIA 4JTJA 1BKSA 2Q3OA 4REQB 2DV0A 2BG5A 1R9XA 3N4AA 4JR5A 2QW5A 2P53A 2WOQA 3A4JA 3SAZA 1PE1A 3MV01 4C7GA 3E3HA 4M29A 2B7OA 1NIUA 1SFJA 3QR3A 2QV5A 4N9DA 4XO7A 1ZAJA 1UWSA 3R89A 2L5HA 3G1RA 3E96A 4CU8A 3CIXA 3HB9A 2WPGA 1M65A 5C8BB 3PZOA 2NX3A 3KOWA 5BMWA 5A69A 2ZZ2A 4KCUA 4LH8A 1VJSA 3WL1A 1GOMA 3I10A 1MYRA 4AH7A 1DWJM 3VOFA 2J25A 4HT3A 3IGUA 4UC5A 1KQZA 3T0CA 4V1XA 3R8GA 4LVBA 3OA3A 5DQPA 3W1TA 4C65A 1MW2A 1YPIA 3I3DA 4H04A 2A3CA 3U7BA 5F2LA 2Q3RA 5A6KA 1ZTVA 1SMDA 8TIMA 2GJNA 5FJRA 2CHNA 3WF2A 4LCQA 1S2TA 2ZICA 1E4IA 3NQFA 1P48A 2WMFA 3TJLA 3U4FA 1D2KA 1Q65A 3CT7A 5BOOA 4HU3A 3UZXA 2H9AA 3MZNA 2VDIA 1SSGA 1O5XA 3W1PA 4XSLA 2OOFA 2I7GA 4Q4MA 1WXZA 3NQEA 3A5FA 1NOUA 3BGJA 1UC4A 2QS8A 1P7TA 5C2CA 1RD5A 1DE6A 3WLPA 5K4XA 4J4KA 2F38A 3USBA 5A94A 3B0UX 2BGQA 1GJPA 5AVNA 4GNKB 3WUBA 2Y88A 4QCEA 1EC9A 4M3PA 3GC2A 3L0NA 3K8LA 4LEQA 1GEQA 1Q6DA 1UP0A 5AC7A 4KWVA 4Q4KA 1MUCA 1AW5A 2E5CA 4C6MA 3IRDA 2GVJA 3AIRA 2OQHA 3QY8A 3EKZA 3ELFA 3WK2A 2OR2A 3WELA 2EJAA 4RZ4A 4W84A 1PIIA 4EAMA 3VPLA 1QU4A 3HV9A 4YN5A 3OIHA 5F2IA 1IQ8A 1C29A 2QUVA 1WBHA 3E5BA 3APTA 1JDEA 3POHA 1FWHC 3NQBA 3F2BA 2E3ZA 5AECA 1MFUA 1V3JA 1KGWA 4GXMA 2I16A 4REQA 2VUNA 4H2CA 3RJYA 3LRKA 2PDNA 4MUZA 4OFCA 5CAKA 3A9IA 1P0EA 4ZODA 4TX9A 2WKLA 4D1IA 3TOPA 2NVAA 3KZPA 1GOOA 5C70A 4XKYA 3IWPA 4I5UA 4FHAA 1JZ2A 4WLCA 4PODA 3MKVA 1AQFA 2GUBA 2ZRUA 2R24A 3OVGA 3NQ7A 3GXDA 4UTIA 1F4HA 3LM7A 2JK2A 5IRPA 3ZJKA 1B9ZA 1FHVA 8XIAA 3CV2A 2WVTA 3LENA 1FXQA 4E2OA 1A0CA 3ZLGA 3GR8A 1F2JA 3SCQA 4FXJA 2D23A 2V0TA 3RNDA 2PZ0A 5DELA 2DT1A 2G3JA 2XIJA 3VZXA 4W93A 4O1AA 4JTQA 1MEIA 4B3KA 2BX7A 3CNYA 3GKFA 5EMJA 2KAUC 3P7YA 1RJPA 4N7QA 3W23A 3DI1A 3LBMA 3TW6A 2XH0A 4AZCB 3M16A 5ECVA 1S5NA 2VWSA 3IUHA 3CU2A 2REQB 3PNZA 1WXYA 1CGUA 4KESA 5AHFA 3O8AA 5HATA 1W1VA 4KW2A 5IHRA 3T40A 1OY0A 3E49A 1PWMA 1JQVA 1XH0A 5J04A 4TMBA 3CTLA 4Z17A 2JEPA 3ONBA 3EB4A 1ML1A 2Y8KA 1KM6A 1V0NA 3SY5A 1K7EA 4L80A 3LGDA 1ZFJA 4RL3A 3WD2A 2VC7A 3L5LA 2D3LA 3M0HA 1CZ1A 1VRXA 3C4UA 3VKAA 1I2OA 3SDOA 2AKMA 2NSOA 3MSDA 3AS1A 4XAPA 3VGEA 1KW1A 4W7VA 4DNMA 2XIBA 1UKSA 4QRNA 3MJYA 3MC5A 5IFTA 1KGUA 4HA3A 1FBAA 3C61A 4BY3A 1PTDA 2Q8ZA 4KFNA 4JTDA 2J78A 4GC3A 2OZ3A 1XLFA 3MCOA 4A4AA 1O95A 2PGWA 4NNCA 4DUWA 1PCKA 1U22A 1X96A 5DRIA 4AHPA 4HD5A 1W3LA 4PMZA 3HURA 4GZ7A 2PLJA 1QRQA 4KIEA 4MLJA 1DIOA 4NYYA 4DY1A 1BYBA 4FXFA 2DSWA 3HIJA 1MUMA 4CD4A 2Y4SA 3KBNA 4HA4A 4OGZA 2E9BA 3V0UA 3S47A 3G22A 1O68A 2WMHA 2ICSA 3BXWA 3WF3A 2VDGA 4DF0A 3GH5A 3WFLA 3W82A 2VEPA 5G2IA 4JTHA 1GQNA 1G4TA 1OZMA 4XX6A 3HF3A 3IJDA 1J4EA 1U1HA 2ZA2A 2V2HA 3PBWA 1JULA 2OOGA 1X7FA 3QF0A 1V0KA 3OBAA 3B4YA 1GVSA 1DWAM 4J40A 4L7ZA 3LCLA 2VGBA 1ZALA 1R8LA 5GPRA 1KTNA 4D6CA 1Y65A 1PX4A 3R8RA 3JU2A 3TW9A 4MZYA 5JBFA 3OVQA 3R79A 2DIKA 4DVOA 4AMAA 2WNZA 4XZHA 1W1YA 1CTNA 3TTEA 4UFHA 3ZWSA 2O9PA 4RK8A 3H2NA 1TV2A 4GGHA 3WQ5A 4UMBA 4IXHA 1LRTA 4AZCA 4GVHA 3ZS4A 4DQWA 2WLYA 5HPCA 4M80A 1XSIA 2PRHA 3M0YA 3O0FA 2R8WA 2REQA 3WQOA 2NW0A 4DELA 3G1HA 4OZOA 2NVCA 4CNOA 4WKAA 1M04A 4YXGA 1D7FA 2V67A 3S1GA 1XSJA 4L9ZA 4J3SA 2W66A 3TONA 3WJWA 2QJGA 2HCVA 5K9XA 2G50A 3AI0A 3NZPA 1TJ1A 4P7RA 4UMCA 1XH2A 3O6YX 2V5JA 3ZR5A 3UWUA 1RR2A 1E6PA 2CNCA 1DV7A 2OELA 3RX4A 5FL0A 4H6QA 3TNOA 4UR8A 1M53A 3GVRA 3LHTA 2DW7A 1E0WA 4NY2A 5CG7A 2PI6A 3W70A 3I6EA 1W54A 5KETA 1DJNA 5K3VA 1MDRA 2X1SA 2ZZ1A 2XWDA 3CEUA 3WUEA 3U2ZA 3W7CA 5LYRA 1KXHA 4HA1A 4ORMA 1SVDA 3P5YA 5F7UA 3KX6A 3ANVA 4NRRA 5BOFA 4PRWA 4CGTA 1CW2A 4HSOA 4XVDA 1OFQA 4WUIA 3BANA 1I6NA 2UBPC 3AS2A 3IVUA 4H6KA 3W0KA 1MSSA 3F4CA 1DEDA 2VRKA 3NZ1A 2VWTA 2Y7FA 2WK2A 1PAMA 4I6KA 1QNOA 2ZRXA 2CFFA 4PTXA 4XTDA 4HCDA 1KBKA 1YPFA 3KS5A 2W79A 3LNMA 4PMQA 1SFTA 4K1WA 1XI3A 4CEUC 3S0CA 5CC3A 1OWQA 4OJYA 4TV6A 4XTIA 2D73A 3TP4A 2VT0A 4H2HA 4F48A 5FJTA 2W4XA 4GO9A 2HK0A 3B8TA 4QGCA 3BAKA 2PDXA 1VRDA 1XLCA 4EAYA 1UR3M 3W88A 1TQJA 3N2CA 3TN3A 2GVLA 2XH2A 3GU1A 2EXOA 1TRIA 3I6TA 1K8YA 3CZLA 1JZ4A 4CU6A 3NAVA 1CGYA 2PSNA 1EH9A 1TWSA 4WDWA 1QMLA 1X8FA 4DNHA 1U30A 3HPZA 1YIXA 2DORA 3GFYA 1E6NA 5A2AA 1UR8A 2CERA 3MHUA 3S83A 3SIZA 1JEZA 4QEHA 4D6IA 1ZU8A 3GHTA 3L0GA 2O0TA 1GQJA 1A5CA 4K7VA 2FZ8A 4IP5A 1ZP4A 4JHZA 3DFSA 3BVJA 1ODZA 4H00A 4UTFA 4MHBA 3OOQA 1I1WA 4JGDA 2EAWA 4HJWA 3DFPA 3MWCA 3V7PA 2XJ7A 5CGMA 1ZSXA 3T08A 4S3CA 4ZOAA 2VCBA 1QASA 4AB4A 2ZZ6A 3BLIA 4TR9A 4QJ4B 2FQIA 4FS9A 4IMEA 3VK5A 3PP7A 4HNNA 5E5CA 1Q6CA 3TC6A 2XH7A 3GC5A 4ZSUA 4EF8A 5A6AA 4RUBA 4LU0A 1QO2A 8XIMA 3LCXA 1NH6A 1LOLA 2Z29A 4H19A 2VFHA 3II1A 4MB3A 4GCAA 3EPNA 1S1RA 4C7FA 1X1NA 2X09A 3S5NA 2CZDA 4FLQA 5A8OA 3Q37A 4G1NA 4JKLA 3R0KA 5J8LA 4UQEA 1TSIA 1OGBA 5FA5A 4AIEA 1FWIC 3I3BA 2I56A 4WRHA 4FNUA 2DSUA 3R94A 4U2ZA 4U5IA 3M6YA 6REQA 3P62A 4UTTC 2WAGA 3WF1A 5RUBA 5FF0A 5IBXC 2PP1A 4W85A 3ABOA 3NEVA 3MUY1 5TNVA 4HNUA 3OYXA 1EDGA 1A5MC 2YIHA 3WO8A 4R9OA 3WYZA 2QCFA 1NOFA 2G97A 3KHDA 2W67A 4I7UA 3RIKA 2YR1A 1UC5A 5M03A 5DLCA 1GOWA 3MANA 1ZNNA 3VIKA 3CASA 4HSHA 3F4NA 2X7WA 1QAPA 1X1ZA 1Z69A 2ADAA 1XJBA 3EX1A 1TPB1 4LAZA 3WH9A 1NF0A 4M6UA 4U28A 3N17A 3VZZA 3IIVA 2YKKA 2PPGA 1FWCC 2A2IA 2X7VA 4YVXA 3CEPA 4NF7A 4H83A 3MCMA 1XDJA 3PPFA 3MVTA 1D3GA 2P5NA 1EEPA 2UY4A 1EA9C 1FWTA 4HPJA 3ARZA 4K38A 1KBBA 1S2CA 3B0VC 1FDZA 5ABEA 4GA8A 4LGXA 3PAOA 1E6QM 3T2OA 1I9CB 3M5XA 3MUCA 1CGVA 3V1PA 3NGJA 5I09A 6A3HA 1RH9A 1H0IA 3KRUA 4JN8A 3DCPA 1E43A 1JXJA 1OG0A 1KLZA 2GOKA 2MUCA 5CC5A 2O9RA 3KLKA 4DZAA 3L67A 3LY0A 4DWSC 4MF4A 4DM1A 3FS2A 1DHPA 3AAMA 3W6MA 3IVSA 3OW1A 3SUTA 4G1KA 1F9CA 3SUVA 3EA1A 3LD5A 3WBYA 3W6LA 5BCAA 2DT0A 3ALGA 1KGXA 3VIHA 1L6GA 4LEFA 1J18A 2EHHA 5BZAA 5U4NA 1AH4A 4PL2A 3FNDA 1MMFA 1ZY9A 4LVDA 3G0SA 3L4YA 1R5YA 3VC5A 4GQGA 4P61A 4MY1A 2Y5SA 3FA4A 3NDZA 5I02A 1KA9F 1R30A 4MZ1A 3VIMA 3NCOA 3LPOA 3BLKA 1A5SA 1E4MM 4RNHA 2GYIA 4I90A 2KX9A 2PTYA 1PBGA 4FF5A 1TPVA 3MUAA 1TIWA 3M0XA 1YTDA 3HQNA 1ADDA 1JGIA 1I1XA 1Y8BA 4EK7A 1GG1A 4GXPA 4AD4A 1L9WA 3VIOA 2WKGA 1IR1A 3M7SA 3LPPA 5MF5A 5I77A 3SN0A 4KKXA 3B8IA 2VGIA 4EVZA 2HE8A 3ALFA 3C86A 3PTDA 5K4ZA 4IICA 1IXOA 3SUSA 3WEMA 3M0LA 5FAJA 4CQCA 3GYEA 4GJIA 1G4SA 1V51A 3HFYA 1P0DA 5D2XA 4ERGA 3QLLA 1FCUA 3TXZA 1QW8A 5J5DA 4S3AA 5EFDA 1I2NA 3URAA 2V2DA 4F8XA 4JX6A 3C2RA 3W7RA 2DEPA 1DORA 2XU2A 4JFWA 3BZJA 3W7KA 4QP0A 1RQEA 3RMEA 1KNWA 4H8NA 3TLQA 1HO1A 5HMFA 1LCOA 3UR8A 1F7BA 4YNGA 4L4MA 1OFAA 1EBHA 1HZYA 2OYLA 1PPIA 3WNNA 3I4KA 2VP8A 3VNJA 4DLFA 1P0NA 5CJ5A 3LLFA 4O12A 3O0KA 4GXWA 4PMJA 1W9VA 4M7TA 1HXJA 4JEJA 4RW3A 2X42A 3W2UA 2WC3A 1V3KA 5E93A 1FY6A 2GL5A 2FFCA 1UQZA 2Z00A 3PNUA 3UYCA 3CXOA 2A21A 4MIMA 1KQYA 1E6SM 3UWVA 4HZ7A 4X61A 4NL1A 4IQJA 1NU5A 3JR2A 2C7FA 3SRFA 1J12A 1TIMA 2BBFA 2V6AA 3NDOA 2C71A 3PF3A 4ACYA 3IUDA 4WDXA 2YA2A 3LLDA 1POJA 2R94A 5LXXA 3CZ8A 3V0TA 1Y5XA 1J01A 3FY1A 2PWUA 3UF9A 1JCJA 1LG1A 1AD1A 2ZZ5A 3AU6A 1O94A 1OVDA 1ITCA 3BH4A 3BLFA 2CEQA 4IUOA 3AUOA 1S5MA 3NL6A 4GISA 2B31A 2PCEA 1CT5A 3MQTA 3RF9A 4H3DA 4YPJA 2XN0A 1S2UA 4XVEA 1O7AA 2PDWA 2YB1A 1AQMA 4JX4A 2EPKX 2FHFA 5L6UA 1WE5A 2CIPA 4FR6A 1LP6A 3A24A 5I3FA 5C9ZA 1E3XA 3ZJ7A 3CYJA 3CAKA 4ZSTA 1FWWA 2XGZA 3PC0A 4IX2A 3GTNA 1OIFA 2E1WA 4QX4A 3LQLA 1ZQ5A 2FVMA 3PBVA 4GQRA 2PGRA 3PFRA 1SJAA 3TTSA 2IKGA 3PBYA 2VVNA 5AFDA 2G4FA 2J7BA 1GT8A 1K6AA 3Q65A 2WB5A 2PU1A 4IJCA 4AZHA 4PUEA 4UIOA 4Q8OA 7ODCA 1VYSX 4I7VA 4MB4A 2R1MA 3THCA 4GVFA 5D03A 3BL3A 2OLAA 2VFIA 3AWNA 3GX9A 4UQAA 3LB0A 2QJIA 4B91A 3PAJA 1YDNA 5CZ0A 5I78A 4UQBA 3CHFA 5F2MA 1SU5A 4S38A 1LQ2A 2QVNA 3UJRA 1JI1A 1UYQA 1SR9A 2ZDSA 1FCVA 1EJ7L 1UASA 1MW3A 1BFNA 2ZFAA 1WZAA 3N29A 1ZCCA 5BWFA 4MB5A 4C6KA 4OWGA 5EFFA 5I0DA 1SO6A 1TJRA 3QHNA 1JCXA 1KR1A 3LLXA 1EEXA 1J6PA 3UGVA 1S5TA 3MT1A 1YPXA 2VR5A 5AYIA 1DWIM 3VD5A 4AIBA 1LL6A 5C6MA 3S46A 2Z25A 4NZ5A 4LX4A 2PODA 5A95A 1P6CA 4K2SA 3S3GA 3EDKA 3VD9A 4K1GA 4JL2A 3Q2DA 6TAAA 2PDHA 1NY1A 4UZSA 1G69A 5D2WA 4MYXA 3H70A 4KERA 2B4GA 3K1DA 2DY3A 3FKRA 2P3EA 2ZC1A 1JI2A 4BR1A 4DJEC 5L9FA 3N6QA 3LZ3A 4CNUA 3ITTA 1UQYA 4AFYA 1DJIA 3AHYA 4FSAA 3CLMA 4BWLA 1TWZA 4A3QA 5CPNA 4AVFA 2WW5A 5GJMA 2GPTA 1R3VA 5E0CA 1M9HA 3STGA 3BSHA 3L5AA 1E70M 5LNUA 4I9JA 1H7PA 4MNLA 4JFTA 1HFBA 2GUUA 3VVGA 4ZO9A 3NSXA 2X2YA 5D4YA 1EGZA 2SFPA 3S9IA 3UVAA 3ATZA 2HISA 1OBAA 3CM4A 3ZMRA 3VNYA 3EDEA 5A2CA 3W1NA 4GYJA 3RO6A 1VQTA 3WDIA 5E0FA 3KBMA 1W1ZA 2H3BA 2X16A 3NOEA 1EF2A 2TYSA 4AEFA 1TWDA 4QE1A 2OSWA 5JIWA 3F7JA 4LS0A 1QXLA 4WD0A 3OPSA 4UTUA 3F5LA 4FR1A 4TMCA 5C55A 1Z7AA 3BOXA 2IS7A 3SY8A 4Z0SA 4HYRA 1YDVA 1UHVA 3BAYA 1MVYA 3ZXWA 1MNZA 3KL0A 5CGTA 1WKFA 1G0CA 2HXUA 1JXKA 4GPNA 3OP2A 3G18A 2WVUA 4KEMA 3UU0A 3UWWA 3AIBA 1PL9A 4TXEA 2OXNA 3M43A 5M5DA 1IXQA 2YA0A 4GC4A 3W75A 3BCJA 3STEA 1CPUA 3CH9A 1R3YA 2C8NA 4GQ0A 3OZPA 2DVXA 1GGOA 3SY1A 2CLKA 2Q6ZA 1FWSA 4PTNA 5FEXA 4PULA 3VE9A 4F0SA 4H01A 3SGZA 5GJPA 4N02A 4HVXA 1B4KA 1CGWA 2HROA 1F8MA 3ME3A 4NYUA 3K5XA 5BRPA 1XV8A 3BZGA 2EKGA 3UG5A 3VDBA 1VYPX 4B2DA 3PWGA 4GUIA 3VYLA 5IXEA 2HS8A 4TVDA 1TB3A 4X3ZA 5EBUA 2BZNA 2J6VA 4UFMA 2GVYA 1JCLA 3A9BA 1DKWA 3XISA 3WQDA 2YPIA 3UNDA 3GDTA 2ZE0A 1FP8A 3OQEA 1U5HA 3VUSA 1R7OA 3KXQA 3TW7A 1GVYA 4QCFA 4NP7A 1MRQA 1J2BA 4GH3A 4A2RA 2WXDM 4YU1A 4ZENA 4WOZA 3KFTA 4HNTA 4JL1A 1TMLA 5EGRA 1UB3A 2VEGA 3AIQA 4Y9OA 3B8DA 4N9CA 3O6DA 3ZOAA 1C9WA 1XBZA 2TMDA 1FUYA 4PB5A 1T7LA 3L4WA 4ECLA 2ZUNA 3GVGA 5I3HA 5I3GA 5BXTA 1WP6A 3CIWA 3VKKA 4AZ7A 1W9BM 3KS6A 2VX7A 1Q5MA 2F7FA 1V3LA 4HYVA 2HXTA 4E8CA 4YMZA 2PWFA 4KQNA 1TR1A 1XM3A 4FNQA 2NWSA 3W01A 1DQWA 2NT0A 3GXNA 4AZGA 3WK1A 4PRRA 2Y7GA 4JCLA 2E09A 1E40A 3LXBA 3M0VA 4AAJA 3NWRA 3ABXA 3G1FA 4RNIA 3TWAA 4IHCA 3SCNA 1H63A 1KO0A 1W17A 3EX3A 1Q6FA 1EDQA 3M5ZA 1VENA 4I9AA 1WO2A 4UOJA 3BCDA 3F03K 3PBMA 1W56A 3RITA 4XZ9A 3GTIA 3CPRA 1MZRA 2GJPA 3WQCA 3WQ8A 4US5A 3LSBA 1W32A 1PZ0A 5FESA 3LK6A 5I00A 2VEFA 1R6WA 1M5WA 1YBQB 4ICCX 5JUVA 1E73M 3QM3A 1WBJA 3NVTA 3OTRA 1IT8A 1EDTA 2BB0A 3ARYA 1J5SA 1R85A 1H4PA 3SEPA 1LQAA 1VR6A 4B4HA 3LM3A 4PB3A 3P60A 2HNEA 2BVWA 4ZO7A 2VRJA 3GK0A 1QHPA 3VDHA 4IPLA 3UG8A 2W6RA 2QULA 3GHSA 3FJLA 2BXYA 3AQUA 3NURA 2E25A 4M6VA 3SCPA 2NT1A 3W1AA 2FVKA 3CT2A 4CCDA 1A47A 3UESA 5EA9A 2OSYA 3DENA 1TTQA 1EXPA 1GOKA 4LCRA 3QTGA 4QJ5B 1E0VA 1QWKA 2R82A 1A5BA 4E8GA 3WY1A 2DH3A 1H50A 4HJFA 4JZ5A 1YQ2A 1HJXA 1IIGA 5I2UA 3M07A 1YMYA 1H61A 3AXKA 4GZIA 3JRKA 4HTYA 4R33A 5KMYA 3T2QA 3EDJA 4JTEA 4PUKA 2FDSA 2I14A 2PF0A 1WAUA 1WDSA 5BXSA 1A49A 3W2MA 2Y2WA 2C1IA 2CETA 2E6DA 2J7CA 2QCEA 2J8GA 3ANYA 3B9DA 4LNCA 2E8YA 1JRBA 3OO2A 1KFJA 1KFKA 2GOUA 1EGVA 2JKAA 1JZ6A 1P0BA 1TPH1 1B31A 4PMNA 3AS0A 3PY2A 1QOXA 4ZE4A 2BS9A 2PDJA 3T05A 3DOPA 1XIMA 3I7SA 3G8RA 3C5QA 4O0ZA 4O1DA 4PB4A 4NZ1A 1JCNA 2EG8A 1XLKA 3NQGA 1YDYA 3EX2A 1X39A 4H8VA 3N11A 3N6HA 4D72A 5LIWX 3UXAA 3EX4A 1F07A 1G7UA 3HJEA 3VTRA 3NJ3A 1F3WA 3PUGA 2CBJA 2J7GA 2NV2A 4KWUA 1PZ2A 3FEMA 3WLIA 1TTJA 5A6MA 1F3XA 2GDQA 3RAOA 4I6VA 4H8UA 2ZA1A 2PRLA 1BXBA 4YIWA 1GVQA 2IKIA 3WG6A 3FKKA 3LGEA 1M01A 3OQ8A 4GZEA 5AZ1A 3T55A 2WWDA 5DXXA 3DIPA 1CWYA 3VGHA 4MY8A 1JZ5A 1IHIA 3QTPA 4DO4A 3OHIA 2ZWZA 1YBQA 3WMLA 4MJMA 4I9MA 4QFUA 2AAMA 2ESCA 3WK3A 2EQDA 1TPC1 5IOBA 1JPKA 2V3EA 2RJGA 3W07A 1T40A 3WNKA 4P7QA 2Q09A 1A5OC 5C9XA 2ZRWA 1WZLA 2ALRA 1E9IA 3BURA 5LXEA 3Q58A 4QDMA 3EOLA 2WHJA 3DFOA 1TO3A 3CUIA 3EWZA 5FI8A 3DFQA 3RK8A 3H12A 2BASA 7TIMA 1SR0A 1ZBWA 4PUNA 3MSGA 1OT2A 4H9UA 1Z3NA 1U1JA 2ON3A 3VNDA 4BHYA 4QNWA 2OWWA 1F5ZA 1EUNA 3QMSA 3UZ5A 3D46A 2O4QA 1F61A 3CWNA 2QLYA 2CBVA 5MKGB 3VGBA 1CCWB 2VFDA 2JF6A 1VS1A 3T0TA 2E68A 4WSKA 1RLCL 3GD6A 3M46A 1ZHAA 2ZXQA 5EPDA 2CZ5A 3HPSA 1O60A 5CBJA 2BP1A 1GVEA 3QXBA 4WZHA 1IXNA 2FHCA 1VAHA 3VO0A 1UD4A 2VZTA 2J75A 1XGZA 2F2HA 2W62A 3VNIA 4PUMA 4UQDA 3B06A 2G41A 4H7ZA 3SCVA 2YCLB 1W9DM 1LL4A 3AXMA 2W63A 3CBWA 1W5MA 4JKKA 3PTKA 4TQTA 3S9ZA 1W1PA 3QW3A 4A2SA 3GZAA 1C9DA 3UG4A 2BY3A 2VXNA 2WHKA 3RPMA 1E15A 1UR1A 4A35A 1VIWA 2X1RA 4X2RA 4GJJA 1JZ3A 1EJVC 3P67A 3NXFA 4GI4A 1H7OA 2B0MA 3L12A 3NYDA 1W2VA 2XVGA 5HNTA 1TPUA 3NZGA 2NX9A 3WLOA 4HB7A 5FJPA 3DAQA 4US5D 2QUTA 3DFHA 3W28A 4KEVA 3HZ3A 3FYYA 2XIMA 5E9XA 3ATYA 5D32A 3MHGA 1XBYA 4FIQA 2D2OA 3KZSA 4I8DA 1LOQA 1SO4A 1XBVA 1KM1A 3DEQA 4X63A 1U5JA 4XD6A 2DSVA 1Q66A 3DG7A 5ABFB 4DPQA 4S3BA 3WQPA 8CGTA 3W81A 1NP0A 4PTDA 1SUXA 2KZHA 3C3NA 4GY7A 2ISWA 2A85A 5C2XA 1XLDA 3EMQA 1DJZA 2GSJA 1C90A 1KD0A 4XKMA 1VD6A 5HUPA 5KITA 2DSZA 3GW0A 3BAIA 4JTSA 3OBEA 1W3TA 3VOIA 4JQ1A 1SW0A 5A6SA 3GNNA 4LWWA 2TSYA 4IXXA 3HU7A 2I9UA 3UCQA 1IZCA 1PKYA 2QCDB 3I68A 4ICNA 5BRQA 5I3IA 4LXFA 5DBUA 3U48A 3LGGA 4DZ5A 4B90A 1J9YA 2QCHA 3O15A 3LCIA 2Z2BA 3CQ0A 3PB0A 1CX9A 3MUXA 2XM2A 3RUBL 4NJGA 3MSYA 3NO5A 1XYFA 1SSDA 5D2VA 5MKGA 4L56A 4LFYA 3BTNA 1SZGA 2ZDRA 4IIEA 1BGAA 4AYGA 5AYBA 4DBDA 3R1ZA 3KBJA 3P8IA 2Z1KA 3H7UA 2X0YA 3TC7A 4F0RA 3CB3A 3UXKA 3TK7A 1MNSA 4EWJA 2PAJA 1PWLA 3KVJA 8A3HA 1FH8A 2HPIA 2YCLA 1LQ0A 1EO5A 2WSRA 3HA1A 2PURA 3TR9A 4IIFA 3F5JA 1BSLA 1G01A 4RZBA 5LIUX 4PL1A 4KBXA 4CCEA 4NNAA 3EB3A 2PMQA 4UB9A 1PXGA 2X40A 3W83A 1G5AA 1TV5A 2ALDA 1XCXA 2DZBA 3FN9A 3CAQA 4J35A 1GYMA 2FGLA 4W8AA 2OEMA 5DFAA 1UKOA 2CW6A 2EPMX 1WKEA 3CV1A 1LT7A 2AMGA 3DERA 2FTPA 4JS3A 4XBJA 3BDKA 4U3CA 3G77A 5C7HA 3PN8A 4PUJA 4V33A 5EB8A 3E5PA 3TQPA 1T5AA 4PYSA 4PCFA 3AYVA 5ECUA 4MDOA 3BGGA 3WEZA 1NFPA 1EA0A 2WPBA 4LANA 2ZVIA 3SN1A 2ZTJA 4Q33A 4LY8A 4DEFA 4GFSA 1HKWA 1DJWA 3TYDA 3FJ4A 4D6JA 4Q8PA 1W5PA 2WZTA 3BO9A 4ATLA 3WZ0E 2BXVA 1VKFA 4Z2IA 1SFSA 5ABFA 4NXSA 4XD3A 4HMCA 3P93A 2QJHA 5E70A 1IWBA 4UCGA 3MO7A 1WOAA 4KT2A 1UWQA 4LV9A 5CH9A 5C9WA 1PJ9A 4I9TA 2HQAA 3AISA 4UZUA 1OD0A 2AGKA 4KCTA 5ABTA 1VFTA 2CBIA 1Y7VA 5DN1A 3UZZA 4DJFA 3W1QA 4HNVA 4W7WA 1EC8A 2YLLA 3AZRA 4X0NA 3KDNA 3MDWA 1E6ZA 4O14A 4E4PA 4BF9A 1FVPA 4A3UA 3R2GA 2QCDA 1IEQA 2YL9A 2QDDA 2WSYA 3VGDA 3MYPA 3LBCA 4NUWA 4FXSA 3FJNA 4H8HA 5H6HA 5CJNA 2ATMA 5HULA 3BMXA 2OT1A 4NAEB 3T4WA 1YRRA 1PTGA 3VIGA 1CXKA 1VC4A 3NPXA 1Q6RA 4Z0JA 5C7VA 3THUA 2VENA 3W24A 3E2VA 4M1RA 4PUDA 1TVNA 3DECA 1I0BA 4FIRA 4JQAA 3T4CA 1KM3A 2O92A 1BKHA 4ENLA 4HK6A 4L4LA 5BWAA 3DKLA 3GWQA 3BMWA 2OX4A 4OBRA 1OFPA 1CLVA 3QQ1A 1V6XA 1LL7A 1JNEA 2CITA 4JNMA 1EBGA 4LUYA 3L4ZA 2X8RA 4L1GA 2J7DA 1MDLA 2C0HA 3QV7A 1ZP3A 4C6BA 3KL5A 5C54A 1GQLA 1QW7A 1ISZA 2OGYA 3SUWA 4HNLA 1TV8A 1VFFA 3HGJA 5F1VA 3RJXA 5EMUA 1ZENA 3DHFA 4LW7A 3WQVA 3MJMA 4LVAA 3S5OA 5E6ZA 1MO0A 3L4UA 3LTSA 1TZ9A 1KRMA 2DZWA 4NJKA 2I5GA 4ZOBA 1DIKA 3S2LA 4ERAA 4KFPA 1H5YA 3SURA 4UFLA 3KWSA 3RU6A 4JTGA 2ZQ0A 3O1NA 4GWEA 5FACA 4RNFA 1VJZA 3T78A 1RCQA 2VEIA 4AD3A 1QNPA 4HBKA 2CXGA 1H7XA 1Q6OA 2ZBTA 5CXPA 3FCPA 4MJZA 2P0OA 4JFVA 4EX4A 3CL6A 3N2BA 1EJSC 2OQYA 3IJIA 5D2TA 3QV8A 1A5UA 2G96A 3OLGA 3PJTA 1TELA 4QE5A 4CCCA 3ITXA 1MI3A 1TFVA 2FVLA 5LA0A 3KHJA 4LRSA 4MWAB 3B04A 1BQCA 4L4OA 3L68A 4H9MA 2ZRZA 2ABAA 3LCWA 3UWZA 1WNOA 1WDPA 4M1BA 3CWOX 2IPFA 5AY7A 3CHCA 1XLMA 3OGRA 3RHGA 2O56A 3KVMA 4H9YA 4IZGA 4O1CA 5FSDC 1EGMA 1GTHA 3HG5A 5T91A 1DBTA 2QHAA 5LZLA 3UETA 5K9CA 3M47A 3U4AA 1AODA 5DY3A 2ASHA 1WDRA 4EACA 2OZ0A 4QAIA 2FTYA 2EEXA 1DWFM 4PE8A 3TROA 2FIQA 1VEMA 2ANUA 2WVVB 3TFCA 3M41A 2NUXA 1BTCA 3LN3A 1UIPA 3GG1A 4NKCA 1PZ3A 2A3AA 2EF9A 5M2FX 4KWOA 2YXOA 1TV4A 4JNYA 1W0MA 3G2GA 1TKKA 2CWXA 5AC4A 4ADUA 4MDPA 3LYEA 1QPQA 3W7LA 1XG3A 4DF1A 2XGIA 1Q2RA 3DU0A 3QSRA 1ENUA 1LWJA 2J7EA 1V7YA 4NQ1A 2FGBA 1XCWA 3ARXA 5AOUA 4XZIA 1TV3A 4YVPA 1E9ZB 1JD7A 4X9YA 4B16A 4LVGA 2ZRYA 4Q4RA 5HINA 5AHLA 3U6WA 3L2IA 3E0FA 2E77A 4H9VA 2YXXA 2RUSA 1JF5A 3OVRA 4N42A 1TJ0A 3ZJ6A 1ZJHA 2FYMA 4IQDA 1ISWA 2HVOA 2HEJA 4FNRA 3NO1A 1XSKA 3MKKA 3BAXA 3LX9A 3P0XA 4YTUA 2G3IA 1NSJA 3JS3A 2J9ZA 3B03A 1Q45A 2FPTA 5CPTA 3BWWA 4IMFA 3WL0A 3UERA 4A3RA 1E3ZA 2BFGA 2CLOA 3GBEA 4HHPA 2OJPA 5LGZA 5KZDA 4B15A 2O4MA 4FX6M 5HK4A 4XWUA 2P50A 1UZ1A 4PSPA 3W9ZA 4YYFA 1B3ZA 1IT0A 1E6RA 1UUOA 4MKVA 1BGGA 4MWAA 2C6QA 1VBRA 4PSRA 2DVTA 4AYSA 1F05A 5CQ1A 2ZYFA 4S3GA 3IGXA 1B54A 1US3A 2FDMA 1O1HA 2V9DA 4DXKA 3HMJG 2C3ZA 4R9XA 4A3HA 1QFEA 1F6PA 1JCTA 3LV6A 4UQ9A 1XYBA 1CBGA 2Z2AA 2QJNA 4RX0A 1XUUA 2IMRA 4AHQA 1Q4WA 3P74A 3CAVA 3W1XA 1KM0A 1R3WA 3UG3A 3QFWA 3U2OA 4JPGA 4TU1A 3EYPA 1EOKA 1W3NA 3KVLA 4HK7A 2YCIX 5CSSA 2JIWA 1S5WA 3K30A 1E4NA 4TO8A 4GX9A 4ICMA 4ML9A 2VHLA 3CAWA 3V1HA 1FXPA 4NVTA 2PLMA 3H7RA 9XIMA 2IXVA 2WVVA 3FJ6A 3NO3A 3GXFA 1HGYA 3L4VA 3NA8A 4U3AA 4UCFA 1TVLA 1MUWA 5EMKA 4JIPA 4Q7IA 4JIHA 3ECQA 1UR2A 3THDA 1WXJA 4AVNA 2BDQA 3HBLA 3L9CA 4K39A 1LWHA 2XSAA 3VD3A 3KOXA 1KXTA 4Q6JA 1F74A 1DJYA 4IUGA 4CNTA 3KOFA 4XBKA 4U2YA 3UNTA 5LNVA 3G8EA 1OX5A 4GYFA 4KWWA 3MUIA 1F3EA 1K7XA 2V2CA 1R38A 3W87A 3C0LA 1QI5A 3ZLFA 2YX0A 1MEWA 3KCLA 5JVLA 1B2YA 4ZXLA 2QGYA 1P0KA 4DYEA 4ZBCA 1XIBA 1R46A 1H1ZA 2J9XA 3D0CA 2GGEA 3NQDA 4JYDA 2CZVA 4R27A 1Q7QA 4WF7A 3CUXA 3EKGA 4HN4A 4QITA 3I7RA 4KCWA 5A6BA 4Y90A 2IPJA 4PCSA 4S2CA 1OJXA 2FJKA 3L21A 3GY1A 5MHBA 1GK8A 1HL8A 2E6FA 3A47A 3TN5A 1M7JA 1XISA 5EMMA 1FHDA 1R3RA 3AMCA 5DXYA 1H51A 1EHNA 4I5RA 5CGQA 4NRSA 3W27A 3OLEA 5HNNA 3DUGA 3W7PA 3EB2A 1FWRA 1PIFA 4UTWA 3AIUA 5M3WA 3W38A 3L2LA 2FPYA 1RHCA 1OCJA 5G2WA 3PZQA 3WF4A 2W92A 4IGHA 5FIPA 3DC0A 5LA2A 2B7NA 1UKPA 6CGTA 1EYEA 3SRHA 2HZGA 3W26A 4PMXA 3WLNA 3RN6A 1HKJA 3DI0A 4CEXC 3SRKA 3H6OA 1W9UA 2PCQA 3C2OA 1LUCB 4D6EA 5G5IA 1OC7A 1SYTA 2BOFX 3WLJA 1XYMA 1BLIA 1JZ7A 5DEZA 1ZL1A 4M56A 4PTWA 5I3JA 2QCMA 5BNKA 1K7FA 1O66A 1PDYA 3LTPA 2NSXA 4C6CA 4DYJA 2ZUWA 4JQ4A 4BF5A 3HQ1A 2FLIA 5A8GA 1XH1A 1LRNA 2NWRA 4IP4A 2XISA 4N6EA 6XIAA 2QXWA 3WD0A 1UIOA 2PWEA 1IGSA 3QPZA 4GRSA 3T2PA 3WMBA 3EWCA 4IMGA 3HOJA 3PWAA 1Q63A 2JGQA 4AWSA 4Z08A 3R4IA 4FX8A 1JNDA 2O55A 3HMCA 1VFLA 3WDHA 3DGRA 5T9CE 2HDJA 4Q8TA 3UGRA 2PUZA 5I03A 1KFCA 2VVSA 4RDVA 1CXHA 4UWMA 5DANA 3GAYA 3H4WA 1AA1B 3PZIA 2D22A 2X30A 5LKYA 1K8ZA 1QPOA 1AL8A 1UP2A 1XRVA 2Z1VA 4GUFA 2ATSA 3OEXA 5LSMA 3PZVA 3R11A 2X05A 2FPVA 3TN6A 3DHPA 2QNEA 2ZXBA 2E67A 4IPPA 4OOUA 4F0MA 1JUKA 2XFYA 4NT0A 2HS6A 2PTWA 4GD0A 3MBFA 6PTDA 2V38A 1H49A 3GVVA 3I65A 3BLDA 1FQ0A 3UA4A 4RE2A 1B30A 1A5LC 3MA8A 2P88A 1A80A 4JIEA 4ZB0A 3CUFA 4NXKA 3U5UA 3S9YA 4WY0B 4PMVA 3CQHA 4G2DA 4EPBC 4JDBA 1UG6A 1UMLA 2GFTA 5FCZA 1P5BA 5G2HA 4KRTA 1S2WA 1VB9A 1NM9A 1QWGA 3DYMA 3WLSA 3A4WA 1E1FA 3S1UA 3U5YA 1A5AA 2X1UA 3R5EA 5HBFA 1MW1A 3P80A 2OFJA 3WBEA 3AHVA 4AIUA 5AB3A 1TUXA 2CLEA 1DHKA 1UZDA 2WKJA 4GVGA 1JIBA 1V5XA 3W2JA 2WYSA 1EYWA 3A3HA 3BUVA 4E2VA 1HGWA 4Y96A 3RG6A 2JEQA 1KFWA 1BEUA 1RXOB 1AH3A 2PDGA 3GKAA 3PUEA 1HF6A 3A4XA 3UY8A 2RDTA 2JE8A 1T6MA 2YBTA 4BZYA 4DIAA 4AUBA 4WQ6A 4ZZ9A 3W2LA 4U33A 2WVSA 1LUCA 4MKSA 4A8NA 1RA0A 2FMOA 3GG7A 3C8FA 1VPYA 5T9BG 1AQHA 5A6LA 2HNHA 1QT1A 1GYNA 1V93A 4XKYB 4ROQA 3V35A 1XD1A 2GVGA 3FAWA 1QPRA 3B9EA 2WJEA 4G7FA 2UZ9A 2IUZA 4FPSA 3UEQA 2G5WA 5HPOA 5FF4A 4AWTA 4A8LA 1UWAA 4F9JA 2BHZA 2BWGA 1LG2A 4PTVA 1QVBA 1W3HA 2PEVA 2W5FA 4GX8A 3WQFA 4UNKA 2P8CA 1NVMA 5I79A 4HZMA 3THAA 3NR0A 4BQ5A 3M9YA 1K6WA 1T96A 2XG9A 4D6GA 1OD8A 2Z0IA 5FOOA 4LF2A 5H2ZA 4TUFA 1C93A 3IIPA 4FI4A 4MG4A 4M6PA 3REQB 4X60A 4C1LA 1V6YA 3VKCA 1ZUAX 4G7EB 1US0A 4F40A 5I3DA 4HMNA 3USZA 3HO8A 2BHYA 3HFTA 3KRZA 3OVPA 1NELA 4MWAE 4O8AA 1X38A 2OODA 5K9DA 1W2PA 4GJ1A 3BG3A 1ONEA 1VIZA 1QPNA 2FH8A 2P76A 3BLPX 3LERA 2VX6A 4LAMA 3UZYA 1PS9A 1NOWA 2ZKMX 4MZ8A 3WNPA 4KWSA 3W7DA 4IQLA 3WD3A 3W1RA 4O15A 2AKZA 3CC1A 1EO7A 1OIMA 5C2GA 3ZIZA 3E12A 4MFDA 2GK1A 3C8NA 1UUQA 2G3FA 1FDYA 4HOWA 3QBUA 2D2HA 2XVLA 5A6BD 3GSMA 3GM8A 1O1ZA 2GGJA 3SECA 4NHVA 1Q7MA 4NG3A 2VX5A 3UWEA 4WY0A 3GG8A 1BF2A 2JF7A 1G6CA 3BSGA 3TX9A 4KETA 3ITLA 3VNLA 4IISA 3LCGA 1UD6A 1RVKA 1B57A 3VFLA 3LPFA 2QQ6A 3HG3A 4UFJA 5G1TA 4IG2B 4NSBA 4WDUA 4E5TA 3DYPA 2EJ1A 4GYPA 4WR3A 3AALA 3ZQ9A 5AYXA 4GI8A 2OMAA 4XZBA 1IT7A 4NNBA 3A13A 5IDIA 4ZR8A 3QYSA 1YKWA 1BWKA 3VMPA 4KS0A 5JH2A 2GGHA 2WO5A 3GXIA 2I5IA 3WCZA 2DZXA 2NXHA 1LBLA 3N1AA 4TVCA 4R7JA 2A3BA 4O18A 3PSVA 4BI6A 4DWSD 4JNZA 3WNMA 2PDMA 3ERPA 3KOYA 1LROA 1XIJA 2G3MA 1N8IA 1JDCA 2QPSA 3AXXA 3HG2A 3F2DA 1HL9A 4IGMA 4NZ3A 3A22A 3HPXA 4L9YA 1V7AA 2RHGA 1B0IA 4E2DA 1QJWA 2YL6A 1OEPA 1BXCA 4Q8WA 3PM6A 2VEKA 4Z2GA 3GXPA 3LG3A 3MP4A 5AC5A 2OYKA 4JTKA 1RSCA 1FCQA 3RCNA 3H23A 4IT1A 2F8QA 3T42A 2V8ZA 1EIBA 1GUVA 1ZB5A 4PCPA 3RMJA 1XDMA 1BSIA 1RQHA 3G0UA 3QEZA 4JTRA 3LI1A 3MPGA 3REQA 4ZQOA 4FLOA 4BQ2A 2WLZA 4ZGYA 4G7EA 3G1AA 3WBAA 1OK6A 2AOSA 2Y61A 3WJSA 4IIHA 2ODOA 4P8UA 3E0WA 4Q8UA 2WMGA 4GLEA 1AD4A 3ONCA 1UJQA 5BXPA 4FF7A 3WLMA 3GG0A 2QDGA 5GVJA 4XUGA 1B1YA 4S39A 2QT3A 4BI5A 1K3UA 2WSKA 1OGGA 2CLMA 3YPIA 4RXGA 3K13A 3W53A 4C6PA 1M7PA 3EBVA 3KWXA 4XIAA 1B5TA 1FTXA 4IIDA 1EXBA 4Z1CA 4LYKA 4AD2A 5CSRA 1DJHA 3M0IA 5IM51 1WA3A 1Q8AA 1AMYA 1TTIA 3TZFA 3ENLA 3UJEA 1UMYA 1R9ZA 4RLIA 5G4HC 2QUUA 1W1B1 1HJWA 4P2VA 4JTLA 4PN2A 4DRSA 2Z24A 5D2YA 3JVAA 4QNEA 2CLFA 3PZNA 3H55A 3RXZA 3VGFA 2BY2A 2HTMA 4OU1A 4CQAA 1K03A 2GLKA 4AQLA 4JD4A 2YA1A 3MMWA 1BWVA 2NXGA 4IG2A 2EPLX 1VEOA 3G6LA 4MUPA 3OIXA 5IHSA 1LYXA 3ZVIA 1UH2A 3VUPA 4GACA 1LT8A 2D1ZA 2FMNA 3BAJA 5CCZA 4G56A 4OTKA 1HJVA 4J28A 2PDKA 3BJFA 3FYOA 4JOMA 3GNOA 3QQ0A 4BQ4A 1XXXA 2GSEA 1SW3A 4FA3A 3VKJA 2P0IA 3GYCA 4LNYA 1IEIA 1CECA 3B0YA 1ISVA 3JUGA 2W0UA 4BQ3A 3LNPA 1EFZA 3N73A 4QG8A 4IJBA 2X0HA 4MMWA 1EIXA 3PBUA 1KBJA 3H53A 3DHDA 2NQ5A 4BS0A 1HL2A 4A21A 1B9BA 1VF8A 5AKQA 3OGVA 2H8XA 1GZ1A 3BJSA 1E0UA 3BOFA 5HNRA 3SCTA 1EP3A 2ZX9A 2C91A 1J0IA 2YCJA 4F0HA 1RP9A 4Z2LA 3WFZA 1GVIA 4JTAA 3SM0A 2WJZA 1JF6A 4HU8A 1MQRA 3G0XA 2BLEA 1Z89A 4H6RA 3AMDA 3H2OA 3KL3A 4C1KA 3D5HA 3S1XA 4MJ2A 2W61A 1UP3A 2OCZA 3KP0A 1OZQA 2XIIA 5CLTA 1ODUA 4M8UA 1CXEA 3NZRA 5CPLA 5D37A 1HO4A 3PR2A 3EPOA 1DJGA 1VBJA 3INPA 1A3XA 1ADOA 1C91A 1XGDA 3CL8A 3S2NA 4ZB5A 3B8VA 1W3IA 3B3DA 3PPHA 2PDQA 2CZFA 3BG5A 2Z7KA 3AO0A 3VMNA 2XVKA 3NQVA 3N04A 3ZSTA 4FNTA 2ZZ3A 4P7NA 1W5OA 1Q4NX 4NZCA 3RO8A 2FFIA 2ZUTA 1EWDA 5KZEA 2DQWA 3S5SA 3EX6A 4C91A 3RM8A 1IGWA 2Q01A 3ICJA 4GBUA 4BWLC 1JFXA 4ZOEA 2OKTA 1NWRA 4FOKA 3S8HA 3GR4A 2PS2A 5CSUA 1FRBA 1OADA 2XFRA 3EA3A 1AUSL 2OWCA 3DDMA 3HQOA 2DP3A 2PDBA 1JZ8A 6REQB 3S42A 4R5EA 4C6DA 2ISSA 5DMYA 4WJEA 4HPGA 2YBUA 1IE7C 3T9PA 5A5WA 5J5RA 1LORA 1JR1A 1QR7A 1CB2A 1NFGA 2C18A 1WOBA 3AC0A 3TDFA 4HMEA 1XG4A 5IFPA 3H4GA 3M1ZA 3CMFA 1RZMA 4O4VA 1SO3A 4ZQNA 1K8CA 3QLDA 3QMTA 4ZB2A 5D33A 4B3LA 2OEKA 2Z27A 1ZZMA 5BMXA 1NDZA 2PF8A 3STPA 3C2VA 2I17A 3MI2A 1AH0A 1KXQA 3TKFA 2Z6IA 4Q8QA 3SZ8A 1EKOA 1I2RA 3W37A 3AFBA 5FJJA 3IIOA 1PKNA 1KBIA 2R6OA 4LC6A 3NL3A 5C0QA 2GSHA 4Z1DA 3N2MA 5JBDA 1J11A 4ES4A 3M0ZA 2ZE3A 3PTQA 5I06A 3NXLA 2VX4A 5FJIA 4C1NB 1E0TA 2O7QA 1QI4A 1ZRQA 1YADA 2VJXA 2XFWA 3B8UA 3FA5A 4N2YA 4WK9A 1Z48A 1GJUA 3BW4A 3S2MA 4QG6A 3TJXA 3QGVA 3CGTA 2OT0A 3EOSA 5D09A 3IJQA 3TWBA 5LIYX 1B3WA 3T44A 2B7QA 1GEHA 2E7FA 4LUSB 3NQ6A 2J9YA 4LJ3A 4ZTYA 1F6KA 3F4VA 1UKTA 2W91A 3R43A 4QJ3B 3IV3A 1GZGA 1WZMA 2IKHA 3AUJA 3VAVA 1C7SA 3QQWA 1M7XA 1LBFA 2AGTA 3N2XA 1PX8A 1VEPA 2VNCA 3W6YA 4RZ5A 3RGTA 1XWYA 4YTRA 3AZSA 1YW1A 1JL8A 5DBTA 4AY8A 3VIJA 4LUTB 5JH1A 4L1XA 4A6GA 1HKVA 1V6UA 5I3KA 2WANA 2Y24A 3DGBA 4IOTA 2RKXA 2EO7A 1L2QA 1V79A 3IAPA 1RJQA 1JYXA 3WDJA 2ZVRA 3RFAA 1FCBA 3FV9A 1DIDA 3EOOA 3E2SA 3MKCA 4XK2A 4EPEC 2DU2A 1YYAA 2TODA 1BQGA 2OSXA 4YWSA 2FB3A 3MYOA 3BPWA 2DPEA 2YBVA 1YTEA 1MW0A 2Z26A 3GIYA 3F1QA 3BARA 1JPMA 1ZLPA 2YZRA 4QS5A 1CGXA 1DE5A 1DP0A 3AJ7A 2PD5A 3SQSA 2BTMA 1G1YA 3DG3A 2HJPA 3NTYA 2UY2A 2ZUSA 4EE9A 1KKOA 1EX1A 3L65A 4L61A 2YJQA 3GE7A 1GORA 1K4HA 1GYLA 4Z42C 3APGA 5HUOA 4HN8A 4POCA 1VCGA 3D47A 4P8WA 2LLEA 3TQKA 3GXMA 2VFFA 4Q7BA 1J0HA 2YYUA 3AROA 1UUMA 2DZVA 3NL2A 4W86A 5F2GA 1QBAA 1L6SA 4G5DA 3IVTA 2VCAA 4HGXA 4H6EA 2WCGA 4YS1A 5B7YA 4OIFA 2BSLA 1JYNA 7REQB 2GQ9A 1TG7A 4W8BA 3L4XA 2YCKX 2POTA 1N2VA 1ZBVA 1W6TA 2YFNA 3ITYA 1N8WA 1XDLA 1XIIA 1XLAA 4JQ3A 3MDUA 1ITQA 2D3NA 4C1NA 3N9SA 3B97A 2ZRVA 1B3YA 1ISYA 2ZX5A 2R14A 4D6FA 1XRSA 3ZVHB 4FEZA 3UWYA 1A3HA 3O6CA 3G1YA 2AQWA 3W3OA 4R3UA 4DI8A 3WH7A 3K2GA 1H2JA 1GOXA 2DUXA 1E9YB 1S39A 3H22A 4RW5A 4MB1A 4LUSA 1TPEA 4CU7A 1VJIA 1V8EA 3RRXA 2HBVA 2AL1A 3CUGA 1E55A 4HCHA 5M17A 4J7RA 3GRIA 5DMMA 3HQPA 2QCLA 1QUMA 5FEZA 2PTZA 3TYZA 1CXFA 4LB3A 3TYEA 1RP8A 1BRLB 1SFLA 3UXDA 1A0EA 4WXYA 3C2YA 1XCFA 2POZA 1NEYA 1TQXA 4LUTA 2NQZA 4D9PA 2HRWA 3G6MA 4OOZA 3DESA 3KEHA 3GH4A 2D2JA 3U2CA 1C8XA 1G4PA 1M03A 1QTWA 1JUEA 5HANA 1JPHA 3VIIA 3URQA 5LNWA 4XZLX 1FOBA 2MANA 3VIFA 1Y5WA 1DJXA 3F2CA 4IIGA 3E6EA 3I4EA 5HMEA 3VKBA 3SIMA 4W9TA 2EGZA 2PDYA 2E9MA 3E2RA 1E1CB 2IXUA 3RM9A 4YWIA 4EF9A 1XUZA 1DJQA 2QCNA 4LPCA 3UFYA 2IPGA 3IK4A 4DXXA 4O1FA 3POCA 1F8IA 3Q4DA 4RV3A 1HX0A 1OYCA 4ADTA 2JGYA 4GNVA 1OFRA 1Q85A 3OG2A 4HQVA 5D04C 2VZOA 1C8YA 4LBUA 3PG9A 1XQLA 1GKRA 4S23A 2CESA 3S5ZA 7REQA 3FLUA 5CC6A 1H1YA 2VDHA 2EPOA 1XLJA 4UOZA 2CKSA 4O52A 2NUYA 1WZKA 1XW8A 4D2JA 3SSJA 1K1DA 5FEWA 5AHIA 2D69A 1GW9A 5HR6A 1VFMA 1W5QA 3ZVHA 2HBXA 4KH2A 3T07A 4FOUA 1JFHA 4MNMA 3T81A 3QY7A 4GI6A 5DF0A 3NOYA 4JHOA 4L4PA 3N4FA 1HKIA 5DY2A 3BOLA 1FFRA 1E9LA 5FEPA 4ZQRA 2BGNE 2WJDA 1CYGA 2PB1A 3KE0A 1V6WA 4O1EA 3DH7A 5FKYA 4MAVA 4DBEA 1TPDA 3S2CA 4PFHA 1HIZA 1OF8A 3MWAA 4E3TA 4F0KA 4YL2A 4NIRA 1AJ0A 1F76A 3NG3A 3MI6A 1BRLA 2WBGA 2PWGA 1TVPA 2A7NA 1QBBA 1WCGA 4C6OA 3TE9A 4EKJA 3Q45A 3A4AA 3WLQA 3LHZA 1FWAC 4AZBA 4QG9A 1SGJA 1QNRA 1PB0A 4RCXA 3WNOA 4OUIA 2VZUA 2ACRA 3L2MA 2FZMA 3W1MA 3BV4A 3GLCA 2PBGA 2YLAA 5D9MA 5GQBA 4K8GA 4KGLA 3TR2A 2V30A 1UH4A 4M81A 1P4CA 3SBFA 2NQ9A 4ML4A 2NQLA 2CLLA 4IFKB 1B90A 3BICA 2XDFA 2NX1A 4XV0A 3L66A 1TE1A 2DZUA 2QKFA 3WQWA 2WWCA 3KTCA 5I5RA 1JRCA 1R9YA 1G7VA 2HWGA 4FLRA 4AEOA 3LA4A 2YSWA 3BV7A 9XIAA 3F5KA 4QLKA 2G95A 1H62A 3W84A 1HP5A 4AIOA 1BPLB 1BVZA 3W7IA 2PTDA 1E1CA 1XQKA 3MP3A 2VCCA 3KW3A 1UH3A 1B4EA 1TX0A 1VGAA 3M5YA 3B8WA 4GMEA 1RBOB 5G1MA 2YFOA 2I1OA 3SQMA 2JFEX 3R13A 1FWNA 2R1NA 1X6LA 3IAQA 4Z1AA 4B9ZA 3WQEA 2WZEA 1ITXA 1KKRA 1A50A 2BHUA 2INZA 3ARUA 4B3ZA 3TUUA 3VX0A 2DSKA 3EMCA 4IGNA 2VURA 3U57A 4MPQA 4UR9A 3SADA 4LSBA 3LRMA 3ARSA 5H8MA 3R0UA 3C52A 5CZSA 3HGSA 5K2ZA 2XM1A 2E28A 3EMZA 3H4XA 4PMRA 1XLIA 1K9EA 4K7YA 1TR9A 1YTKA 3QV9A 2Y89A 3GR7A 1H09A 1WQ5A 1LDCA 1XHGA 2Z6JA 1UD5A 3UR5A 4WSJA 5BRBA 2J77A 5JIPA 3FK4A 3I6RA 3R12A 4TIMA 2E40A 2YL8A 1EF3A 2VGFA 2X1TA 4A8IA 3TQVA 2VC6A 2XINA 2YL5A 3XINA 3PS7A 3WD1A 3CUHA 3O3RA 4LBRA 5A8MA 2QF8A 3C0JA 3K46A 2BY0A 4DZIA 1XFCA 3OZOA 1FHUA 3ZYZA 1HVXA 1KV8A 2QJJA 3UW6A 4AVOA 1DTNA 1JG9A 2VYOA 3GDRA 4HHMA 3LI0A 2RFGA 4F9DA 2C79A 1A53A 3OLDA 1ADSA 3LXCA 1B3OA 3KM8A 1AK5A 1QO5A 2ZADA 1ZJBA 4LBSA 2PLKA 3EWUA 4W87A 3OGSA 4AISA 3PANA 5LIKX 2ZIDA 4J3UA 2CYGA 4XZNX 2A7PA 4IFKA 3WLTA 2DJLA 4RR4A 5BROA 3NQAA 4YJ5A 4EXQA 3VM5A 1W1A1 1H0GA 1G94A 3VNZA 1RVGA 3CHVA 1AG1O 2Y85A 4QQUA 3TU9A 4PC8A 2YCEA 4U10A 2E1DA 2TRSA 3N14A 1QNSA 4UUIA 4Q7NA 5ABHA 4MOZA 3UVIA 1O5QA 6XIMA 4JTIA 2Y7DA 4Y9MA 4E2BA 3NPVA 4P8VA 3C6CA 2HVMA 3B0PA 1SO5A 2BOEX 3T8QA 3CQIA 3VFCA 2GWNA 4AZ6A 1GKPA 1IEWA 4Y9NA 1Q8JA 1UKQA 3QW4B 3RR4A 4Y2WA 1N82A 4LAKA 3MTWA 3P61A 3WNLA 3C2FA 4LYQA 3QV6A 4QHRA 4XIMA 1E6XM 4XBSA 2ZUVA 1R0MA 3QR0A 1NWTA 3T0AA 1AMKA 4AWEA 4PCTA 4PR4A 5KZ6A 3W00A 5HNUA 3BC9A 4JTCA 3WF0A 4M0XA 5REQB 4BFAA 3VA8A 4CD8A 5FSEC 2IQDA 2GJRA 3A21A 2XZ7A 2JALA 1A4LA 5JXQA 4HPXA 1VFSA 1BG9A 1VFUA 1AJ2A 4MPKA 3GU9A 1I45A 3GQYA 1FKXA 2OLHA 1GQKA 2PRMA 3GDKA 4K68A 1DVJA 1MZHA 1V77A 4Q4SA 1C3FA 3TSDA 3H2FA 4LUJA 1WDWA 2Z28A 4CKQA 4MAZA 3V18A 5CC7A 4FALA 3B9NA 4DJFC 4AZIA 4H1ZA 4LAUA 4LY4A 5B80A 2RGMA 4LF1A 1K8XA 4GG9A 1J10A 3D3AA 5AYZA 5GNXA 2E9LA 4IFOA 4C6EA 3O6AA 2RDWA 3MSRA 4D1JA 1OINA 1O12A 1VP5A 1Z41A 2F6XA 3Q67A 1KM5A 3P6LA 3LU2A 7CGTA 5XIAA 4ZA0A 3PJUA 2GDUA 4R88A 2QZRA 2XHYA 5EKYA 4XZMX 2VR2A 3NIYA 4QLLA 4KMQA 1K70A 3NVDA 3B0XA 5CEWA 2WMIB 4TX8A 5CSYA 3VCNA 5BU9A 1M3UA 4WKHA 2Z1BA 3O05A 1MXGA 1GVOA 5F4SA 2J7FA 4K8EA 2VQUA 2EG7A 1IR2A 3IJ7A 3DFYA 2GQAA 3QC0A 1RD6A 3DX5A 3KRSA 3HGRA 3SB0A 3RR1A 2VFGA 3TC3A 1US2A 1FH9A 3OODA 5HQEA 4NI8A 2IW0A 3R0DA 5LHFA 2PC8A 3G1VA 2QEZA 4V1YA 3MY9A 1HN1A 2ISDA 2TAAA 1DPMA 2GGIA 1GTEA 4Q6XA 2CBUA 5CAHA 3H26A 1X6UA 1UZHA 2F61A 3LTYA 4GIRA 3LEPA 3I7QA 4LOCA 1XR2A 1PYFA 4ERIA 1LBMA 2D0GA 4M19A 1WAWA 1RALA 1QNVA 1FDJA 3ES8A 1VCVA 4S3KA 1ISXA 1WDQA 2FB2A 4LAOA 1BF6A 2VZSA 3AS3A 5FJOA 3LV5A 1TE6A 1W5NA 2PDIA 5DMLA 3O2LA 1EJTC 1H41A 1YEYA 4I8YA 3URNA 1VBUA 3BAWA 4NU7A 1H11A 5BOEA 2JIEA 5CZTA 4FP1A 4WJ8A 2BOGX 2D20A 2J88A 2PDPA 2V3FA 5FD0A 5REQA 1KWGA 1KC7A 5LNRA 3R25A 4J3ZA 4M51A 3OZMA 1JJKA 3QPYA 3FSTA 3ES7A 3K8MA 3EXTA 4QTGA 3S6TA 1TWIA 1DYSA 1PX3A 3PPGA 3UJ2A 3BMVA 1J93A 1Y0EA 3PB2A 4D8ZA 3M64A 2E6AA 3KAOA 2P3ZA 3EEZA 2VI0A 4NX5A 3EXSA 4WKFA 2H6RA 4CD5A 4GE8A 4D8LA 2D0FA 2YB4A 1V02A 3BE7A 1REQB 1SM9A 4HA0A 5AZ0A 1TMHA 4PEKA 3KVKA 3GHUA 3H7VA 4M24A 3C0QA 4CLMA 1QATA 2NLYA 4UBPC 4AG0A 4ASTA 3FDGA 2A7RA 3RX2A 1FA2A 3KRBA 2C14A 2A0NA 1GPWA 5D05A 1TZZA 4ROPA 4J2PA 3O7UA 4ZFCA 3GFZA 4TTUA 2WMIA 1DWGM 1E0XA 1Q6QA 3KCJA 1EP2A 2ZXAA 5F4XA 4C6JA 1I60A 2F9RA 4JTTA 1DXFA 2WM1A 1Z32X 4P7OA 1TJ2A 2V82A 3PWIA 3K4DA 4A22A 5DT7A 5GNZA 4C6FA 2J62A 5CPMA 1JCYA 4PA8A 1H7WA 1RA5A 3CZGA 3HV8A 1DTUA 4TX6A 2ZUUA 3QOKA 4CQDA 4JHMA 5T8GA 1Z6KA 3RRAA 1UR9A 4EPDC 4O57A 3QVQA 4Q8VA 3SCUA 1WDDA 5D9NA 2JQXA 4YLWA 4J5NA 3A3XA 1YHTA 4DLMA 3KDOA 4UTKA 1NWSA 4ZE5A 3TZNA 1JUBA 1XIEA 4E8DA 2Y1HA 3MO4A 2BNJA 3AIVA 3C2EA 7TAAA 2XTKA 1YE4A 4P7LA 3W7OA 2DT2A 1XD0A 4JKMA 1TCDA 1BVWA 1G4EA 4EOUA 4LCSA 3WIJA 4G8TA 4DJDA 3RU8X 2WCAA 3SCWA 1S3TC 1LOSA 1KRCC 3TJ4A 1FWJC 1FX6A 4MWAC 2GJLA 3VDAA 4F0LA 4X22A 3AJXA 1YLVA 3CLWA 4AW7A 4F79A 3K4AA 4DM2A 3LDVA 2DUZA 3W7NA 2H8ZA 2CCRA 1EJUC 3AZTA 2BMBA 3PFMA 4FLSA 4XD5A 3ITGA 2TPSA 1GOQA 5H1WA 1GJWA 2PWHA 4RDWA 3ZZ1A 1F6YA 2J66A 3EWDA 2NVDA 3CHEA 4CQBA 4FNSA 3D6NA 3N6JA 5A8NA 3DN5A 1MEHA 7XIMA 3PG8A 4F2BA 3QY6A 3FXYA 2GZXA 1REQA 4IM4A 3BLOA 1SW7A 3KOZA 3GB6A 4B5WA 4IFRA 1K9FA 1GONA 1ICPA 4BF7A 3EXRA 1KCLA 1N55A 2XIQA 3SR7A 2O9TA 3UR2A 3MV11 3TTYA 1OB0A 3IJ9A 1V4YA 5B7ZA 1V08A 3GC4A 4R7OA 4AU0A 1C8VA 3WKZA 2A1YA 4RE0A 3IACA 1EZ2A 2WNWA 3W86A 2WZHA 1ELSA 1T0OA 1J79A 2VM8A 4HTBA 4BCEA 3STCA 1ZAIA 4XO6A 3OLIA 2FJUB 1U83A 1TWWA 3KUMA 5LIXX 1JYWA 3SSZA 3QKZA 3D3FA 3TSBA 4WCJA 1PDZA 5D30A 3CO8A 1KFBA 3M4HA 1OX4B 4OBSA 1B3XA 4JBRA 3AHTA 1XIFA 1XPGA 4IH3A 2HMCA 2W9MA 1ZBKA 1UOKA 2Y8VA 1W9XA 1R86A 1XF0A 1RJRA 5D02A 2OPJA 4O16A 1CB7B 1RBLA 4UFKA 3BG9A 3W22A 3MZ2A 5CG0A 2CZEA 3TFXA 3DYOA 5TD4A 5SWUA 2R1LA 4PBGA 4Q3MA 1M7OA 3SO7A 4ZCWA 2DGAA 1ESWA 4I7WA 2ZX7A 3WSUA 3TLLA 4BKNA 1EWEA 2YYTA 1CXIA 3IS4A 4UTWC 1H7RA 1H7NA 3WUGA 3MP5A 4HP5A 1YX1A 2Q8XA 4BEUA 9CGTA 3TA6A 3THQA 2E5DA 3HJZA 3TAKA 1V6VA 2ZZ7A 4K3ZA 4HPNA 3FVMA 1KV5A 1X7IA 3VC6A 1Q13A 5FJUA 4S1FA 1Q7ZA 1WPCA 9RUBA 4JY9A 3WJYA 4HMDA 4RDZA 2NZLA 2Y5JA 3QH2A 1IWAA 1KTBA 1Z8AA 2PP0A 3CPUA 1UWRA 2QPUA 3W73A 4UR7A 2J7HA 3G24A 3STFA 5EL1A 2FGZA 3SQLA 3UXLA 3E2QA 2V5KA 3VM7A 4ZQCA 3KP1A 3CMJA 2YDAA 4JIIX 4AD0A 4IMCA 1L6YA 3NSMA 1RPKA 4GK8A 2GDVA 1J0YA 1WKDA 1XLLA 5AHMA 4YVVA 1KRAC 4AY1A 2C1HA 2ZCGA 5HQMA 3VABA 3VOGA 1X98A 4V27A 1UROA 2AL2B 3PJWA 4W4QA 1KB3A 4QJ1A 3WENA 3AICA 4E0CA 4I5XA 1U2YA 3VIPA 1O5RA 3BK0A 5BXRA 4N9EA 3TIMA 2YGYA 3KLLA 3C56A 3QC3A 1V3HA 2D0HA 1G67A 4LRTA 3EDFA 4DWDA 3O9NA 1NP2A 3MMTA 4WXZA 1RY8A 4WJXA 3KBVA 3U0HA 1BHGA 2BY1A 3B40A 3VILA 1KCZA 1NQ6A 3QOMA 1UWTA 2DJXA 3PHAA 4AF0B 5DX7A 3LS9A 3ORWA 1YE6A 5A8PA 1XYAA 3VD4A 4HU4A 1RAKA 1JCMP 1V02E 3E9AA 1UD3A 2OO0A 1OX4A 2GUYA 1CDGA 3RM4A 1GNXA 3NFUA 1VLIA 1R7AA 1VCFA 3T0DA 3DFTA 3J7HA 3VXGA 3L4TA 4PEEA 4DJDD 1XFBA 2NLIA 4O1BA 3H54A 5A8QA 2ACSA 4A3YA 4RJEA 3AOFA 4IJRA 2BGSA 3TQ0A 4DZHA 4F66A 1SQ7A 4UNLA 3U7VA 2DZPA 3OJGA 3VD7A 4NZJA 3MHFA 4H7CA 2ONEA 4NAFB 3QZ6A 2H3DA 5D38A 4DI9A 2WV8A 2J6XA 4XZWA 2NV1A 2E6YA 2V5BA 4X2PA 3LPGA 2X1IA 4E4FA 4IMDA 3LMYA 3GNRA 3VDGA 4P5UA 4BJHA 4B9YA 1TZ7A 5XINA 1UPMB 4TV5A 1LWIA 1FP9A 4GFIA 1T8XA 4WIWA 2PDUA 4R7WA 3PVFA 3TCSA 5H8UA 1AQ0A 4W7UA 4N6FA 1H60A 2B7PA 3LZ5A 1UD2A 4J3VA 3NQCA 3AHZA 2R1PA 1PZ1A 2C15A 1TYGA 4WDTA 3GTXA 1KTCA 3UYIA 4NJJA 3ITCA 4CCZA 4FMVA 4E6MA 3GDMA 3EWXA 3TYBA 4CN1A 2J8TA 3IV8A 2ZTKA 3VI2A 2ZXDA 3A5VA 4HHHA 4EPKA 4Y7EA 1KRBC 4XAYA 3W4RA 3XIMA 1M1BA 3RLVA 2QUNA 1FH7A 1YNQA 2PLCA 2WMJA 1MRAA 3IARA 1K9DA 4GIEA 1S2AA 4DO7A 1S3HA 1VH7A 4S3JA 4AD1A 1RUSA 1X8CA 3WFAA 2AL2A 2UY5A 4QSHA 3P5ZA 4ZO8A 4O13A 1EZWA 1HQTA 3NQ8A 3N9RA 4UQCA 1C92A 3DHUA 3P14A 3TN4A 4QBXA 3ZT5A 4QE4A 3FIGA 3IIZA 3FXGA 5KINA 3PZTA 1PCWA 4AC1X 1E72M 3S1WA 2YDRA 4WY0F 6ENLA 3CPGA 4WEVX 5H8PA 4JYEA 5I07A 5ENLA 4AF0A 3DBPA 4KF1A 3CS2A 3P3BA 1U33A 1UR4A 1TRDA 4ZXOA 3WH8A 4P8XA 4PZVA 3T7VA 4JQ2A 1S2VA 2CLPA 5H91A 1K4GA 1KM4A 2DH2A 3W02A 3QYQA 1F4AA 3CUZA 2RGLA 1GW1A 3EDDA 3ABQA 3V16A 3QZAA 3H8AA 1UOZA 4V15A 2Z2UA 4JX5A 1I2QA 3BSMA 4LUIA 5IDZA 4GYPC 5TBOA 2J24A 3PSWA 1HP4A 3KCOA 1XC4A 1ONXA 4JTFA 2OYMA 1WKYA 2FZ9A 3VGGA 4LC8A 3PJXA 3TV8A 2G37A 3NEHA 5HAOA 4L6DA 4NAFA 1JVNA 2YDSA 2VOMA 1EJRC 3OYZA 4YTTA 3DKJA 3ABZA 4PTMA 2DZTA 1J8VA 1HJUA 1M6JA 4JICA 4IF2A 4XAZA 3PZGA 2ISVA 1EQPA 4O54A 4A8RA 1Z9AA 4ZOCA 5CLWA 4J1OA 1GHRA 2C16A 3E0LA 1IV8A 2EKCA 2BVYA 1HG3A 4J3TA 4UTMA 1UWIA 1BWLA 2HV5A 1A0DA 2J4GA 2OKOA 1PO9A 3KTXA 2RAGA 2PC4A 3VOCA 5HDRA 3VMOA 3UWQA 1SZEA 1EPVA 1TUFA 3M7WA 2QF7A 4BK9A 2WMKA 3TVAA 3B05A 3W76A 3CJPA 3RILA 3MBDA 3SGGA 5AYYA 4NZFA 2BODX 1IWPA 1ICQA 1TPWA 5HXMA 5D8ZA 3N19B 4ZEPA 5BU6A 4O0QA 3ZR6A 3SJ3A 4XB3A 1GWJA 2V5CA 1I4NA 4O10A 3G1DA 1XKJA 4HSNA 4S3DA 1J96A 1O6IA 4HPHA 2PDFA 1CI1A 4C90A 3W7EA 1KLYA 1L0PA 1W91A 4IGSA 2X0SA 2CHRA 1J0JA 4HZ6A 1NFBA 1W3JA 2H90A 2OB3A 2G3NA 2PBOA 4OE7A 2FKPA 4GVIA 4GIAA 5U7SA 2QAFA 1K02A 4J9JA 1N8FA 1THFD 5DT5A 3WJZA 3N3MA 1OABA 2QIWA 4KEUA 2A3HA 5ABGA 3BLEA 3W7JA 4AXKA 2OZTA 4LALA 4GY1A 3MUZ1 3R10A 1LZOA 1I0DA 1V0MA 3IJ8A 4NILA 1X97A 3RPDA 5A1AA 4MFEA 4GUJA 3GNXA 1QCWA 2XZ9A 3CH0A 4N0RA 1CIUA 5AC8A 3WLHA 3AHXA 4K36A 1OCQA 4PCNA 1OFDA 4AEEA 2F6KA 2RDXA 2INEA 5JU6A 3PBGA 3GH7A 2PZNA 3RDKA 2GQ3A 2HPMA 1ZJIA 1P6WA 4U31A 4PRTA 3COTA 4R85A 4ZQPA 4Q4PA 3GO2A 3V5OA 2DZAA 1ECQA 1HW6A 4DO5A 1RCXB 4D71A 3PPCA 2WHLA 1IZJA 1JGMA 3QJAA 4ZL1A 3OZYA 3EWYA 2QAPA 3ZT7A 3BW2A 2DZSA 1FWGC 1XC6A 4CVUA 1PKLA 2VFEA 4DWSB 4QDWA 5XIMA 3WH6A 1ZAHA 1OHLA 1IXPA 2PGEA 3RX3A 4Q32A 1EOMA 1OFOA 2J74A 3JW7A 4IL0A 4A29A 2PFHA 3DFNA 2VZVA 3WEOA 4CVWA 1WB0A 3WUFA 1U5VA 4S3EA 3V3WA 3NDYA 1KCKA 3GUWA 1JQXA 1GVFA 2OWXA 1MWOA 4JAWA 2CU0A 1XYZA 2Q8LA 3OU8A 5EMLA 5CZKA 2NUWA 4GBDA 4IL2A 5LHEA 3ZWTA 4MVAA 4WVXA 4DXVA 3AYSA 1QOQA