1EXBA

Structure of the cytoplasmic beta subunit-t1 assembly of voltage-dependent k channels
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the cytoplasmic beta subunit-T1 assembly of voltage-dependent K+ channels.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
molecule keywords KV BETA2 PROTEIN
total genus 123
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1exbA00
2R24A 4XVEA 4RPQA 4QBXA 4YU1A 5HNUA 2PDKA 3UYIA 3FX4A 1AH0A 1S1RA 1FRBA 1YE4A 2PDGA 1PWLA 3M0IA 4PRRA 3V0UA 1EL3A 2IPWA 4HMNA 2ACSA 3F7JA 2ACRA 4DBWA 4YVPA 3KRBA 1A80A 3R8GA 4WDUA 1R38A 3C3UA 4DBSA 3CMFA 2WZTA 3M4HA 4IJCA 4WGHA 4EXBA 2PDHA 3LQLA 4Q3MA 1YNQA 3UP8A 2FVLA 1AH4A 4Q7BA 2PDUA 4MHBA 3GHRA 4FA3A 1Z8AA 3UGRA 2PDNA 2P5NA 1XJBA 4WEVX 4JQAA 3O0KA 2IQDA 2PDBA 2IKIA 4JTCA 3LZ3A 1VBJA 5M2FX 3BCJA 4JQ1A 1C9WA 4GQGA 2PEVA 1AFSA 4H7CA 2BP1A 4NKCA 4GQ0A 2IPJA 4G5DA 3Q67A 4XK2A 3UWEA 3UFYA 1X96A 2FZ8A 3U2CA 4ZFCA 1Q5MA 1YNPA 1RY0A 3MB9A 2QXWA 3UG8A 3BV7A 3QKZA 4WDWA 4I5XA 3EB4A 2HEJA 2INZA 4LB4A 5JH1A 3CV7A 4JQ4A 4GACA 2PDFA 1JEZA 4JIHA 2HVNA 4PUUA 1Z3NA 1PZ0A 4XO7A 4LB3A 2PDMA 2PFHA 1AZ2A 4XZMX 2AGTA 2J8TA 1J96A 3EB3A 3N2TA 3ONBA 3UZXA 2PDPA 1PZ1A 3GUGA 4YS1A 5C7HA 1XGDA 1ZGDA 3CAVA 3D3FA 4ICCX 1RALA 4YVXA 5LIWX 4DZ5A 1T41A 3DOPA 1GVEA 3LQGA 4XZIA 2FGBA 2IKHA 2ALRA 2I17A 1S2AA 1PWMA 4XVDA 1MZRA 1T40A 1HW6A 2HVOA 3WBYA 4JTDA 3R7MA 3DN5A 3LUTA 4JTAA 3R94A 1S1PA 2DUZA 4JTQA 2PDYA 1ZQ5A 3V0TA 4H8NA 3GHTA 4IGSA 2HE8A 3G1RA 4XAPA 2DUXA 4LAUA 4ASTA 4GA8A 4JIIX 2HV5A 1XF0A 1K8CA 1YE6A 2A79A 2PDQA 1LWIA 3LZ5A 3RX4A 4EXAA 2PDLA 4WRHA 2IPFA 3LD5A 3R6IA 3GHUA 2C91A 1S2CA 2IKJA 2DV0A 4HBKA 3EAUA 1ZSXA 5DANA 1EF3A 3WBWA 2ACQA 2INEA 4L1WA 3H4GA 4IJRA 2PDCA 4DBUA 3UZZA 3M64A 2HE5A 2PDXA 4FAMA 2ACUA 1OG6A 3O3RA 2NVDA 1Q13A 1EXBA 2F38A 3V36A 1AZ1A 2HDJA 2WZMA 4XZHA 2F2KA 3CASA 4WDTA 1ADSA 2VDGA 3GHSA 4AUBA 2ISFA 4OTKA 1X97A 3LN3A 3N6QA 2FZBA 3CAQA 3FJNA 2PDJA 4JQ3A 2BGQA 2NVCA 4PUWA 4FALA 4F40A 4XZLX 1Z9AA 3WBXA 4LBSA 3ERPA 4WDXA 3P2VA 4R9OA 4GCAA 4L1XA 5HA7A 1IEIA 1EKOA 3V35A 2R9RA 3ONCA 5KETA 1QWKA 1MRQA 2PDWA 3LENA 3MC5A 3WCZA 4GABA 1X98A 2IPGA 3R58A 1Z89A 2IQ0A 3UZYA 5AZ0A 2PD9A 1UR3M 4QX4A 2CLPA 2FZ9A 3BURA 1HQTA 4LAZA 3R8HA 4QR6A 5HNTA 1US0A 5LIKX 4FZIA 4LBRA 1SM9A 4JQ2A 3G5EA 2FZDA 3H7UA 4JTRA 4XZNX 1M9HA 5JH2A 5AZ1A 2PF8A 3B3DA 3R43A 1LQAA 4PMJA 3RX3A 3WG6A 2IKGA 3UZWA 2PDIA 3LEPA 3V0SA 3H7RA 3BUVA 2PZNA 5LIYX 4QXIA 4XO6A 3LBOA 3Q65A 4YVVA 4PR4A 2I16A 3NTYA 3S3GA 1RY8A 4JIRA 4GIEA 1PYFA 2PD5A 1VP5A 1ZUAX 5LIUX 2BGSA 3RX2A 1IHIA 3T42A 3VXGA 3CV6A 1MI3A 1QRQA 1AH3A 2IS7A 3LNMA 5LIXX 3COTA 4PRTA
chains in the Genus database with same CATH superfamily
1QHZA 4PUJA 4LRTA 4RKAA 2Q01A 4UTTA 3G3DA 5FF4A 1XRTA 3W25A 2XM2A 3MV01 4GNKB 3VUSA 3OA5A 2OO0A 2PDGA 4RNFA 1RA0A 1ZJIA 4CUCA 1D3HA 5FJPA 3CL6A 3W81A 1EL3A 4X2PA 3E3HA 5F4XA 1AL7A 3F7JA 2O9RA 3VIOA 1E70M 3APGA 2GPTA 2QCCA 4OBRA 2YA0A 3PR2A 4OVXA 1EJWC 5D8WA 2FH8A 4LS2A 1L6GA 4GINA 4GC4A 3FAWA 3NQAA 4QRNA 1HG3A 1N8WA 2BG5A 2HS8A 1HJVA 3LOTA 3GU1A 1E6XM 1IEQA 3W6YA 3LRMA 1LF1A 2Z27A 1FXQA 1XJBA 1FWEC 4E3TA 4G9PA 3AS1A 1UZ4A 3KBWA 3G1AA 4X63A 2PDBA 3QPEA 5TAOA 1ZNNA 4L4OA 1W3LA 1X7IA 2R82A 2V5BA 5CZTA 4HB7A 3UETA 2E5BA 4GLEA 2HVMA 1H7NA 4MFDA 5FD0A 4K3ZA 1GVRA 2E8YA 1IR1A 3IIVA 4H9MA 3LCWA 2GVLA 1H50A 2BP1A 2AQWA 1TPB1 3NQ2A 1TX0A 1JI2A 4UQAA 2DT3A 3UWEA 5HUPA 4EK7A 1LJYA 4DLMA 5F2LA 3ARTA 1JPDX 4D6IA 3H2NA 1IEWA 3G77A 1R8LA 5G2IA 3VPLA 2QDGA 3T0BA 3VA8A 3UWZA 5CSSA 1EJRC 3GIYA 4LUJA 1NDWA 1KFEA 4NU7A 1THFD 1KR0A 2WZHA 4A2RA 2QCFA 3VNLA 3WKZA 3SI9A 3UY8A 5JQ9A 3IJLA 3QV6A 2H9AA 4IIHA 1IGWA 3UCDA 4UTWC 4UMCA 4H8HA 3I3EA 2J8TA 2QCDA 2EF9A 1IF2A 2JK2A 3P3BA 2FPVA 2RKXA 3NR0A 1DWIM 3WBAA 3UPBA 3QOMA 1LORA 1EEXA 1PZ1A 3GUGA 5DMYA 3CEUA 5K9DA 2YGYA 2B4GA 1TG7A 5BU9A 3W7LA 1W1A1 3KBMA 4DUXA 5AC4A 5K4XA 1FXPA 1R6WA 1XLHA 1OX6A 3KWSA 1XLAA 1TIWA 1FBAA 2PLKA 2FGBA 3OW1A 1WOBA 1Q6LA 3GQYA 3EB2A 3VDAA 3WX7A 4NNBA 3MKVA 1ZS2A 1EFZA 4TXEA 4UQ9A 1DJGA 1EO7A 1CW2A 1JDDA 2H8XA 3I4EA 3PB0A 3FW6A 2BVYA 1UKOA 4AWTA 2ODOA 2J75A 2GGEA 4HCDA 5JBFA 3VNZA 3P81A 2GJXA 3ZSTA 1PCKA 4XAPA 4C6EA 3EGJA 2BDQA 3PAJA 4IMCA 4ACZA 4R27A 2PDQA 1O1ZA 2FDSA 4H9XA 5MKGB 3P82A 3UT0A 4LF2A 2VGGA 2PDLA 3QY6A 3R6IA 4NRSA 2D2JA 4XUGA 1E43A 3PHAA 3MJYA 1TREA 4UFHA 4MYAA 1JZ6A 1MFVA 3AXKA 3WBWA 3BL3A 1VAHA 1GEHA 3D0CA 5DT5A 1SGJA 1ZCOA 2WVSA 1MWOA 4ZQCA 1QPNA 3DFPA 4FIRA 3RN6A 4GNVA 1POKA 3HG2A 2TMDA 2E3ZA 2VDGA 1VD6A 4NNAA 1A5CA 4N4QA 3KOFA 1GT8A 4ALDA 1REQA 5I06A 4H9UA 2WMHA 1E51A 3N3TA 2PDJA 2ZRUA 3LGEA 1JQXA 3U2OA 4X3ZA 4L6HA 1BYCA 4RW5A 2VEMA 4K8HA 2G4JA 2W9MA 3QQ0A 1LRQA 1V77A 2JGQA 2PU0A 4GCAA 1ODUA 3EDFA 3DCPA 3GTHA 1UBSA 1EBHA 2V9DA 2Y8UA 2R1PA 2BASA 1MEHA 1VZWA 1QWKA 2PDWA 2D3NA 4I3GA 1H60A 1CXHA 4N4PA 4B5XA 4WJEA 1TTQA 5DQPA 2IPGA 1OVDA 3WLOA 4OE7A 1U1UA 3RLHA 2J7HA 4MAVA 3ME3A 4NT0A 4A35A 2DZAA 1C8QA 4G56A 3W74A 4RNIA 2TRSA 4QR6A 1E73M 1XKYA 4LF1A 3RRXA 5EMYA 5FF0A 1BHGA 4ZL1A 4GZ7A 3W1QA 2J6XA 1S3TC 1EOMA 1OYCA 3ZLGA 4AVNA 4ZO9A 4QQUA 5G1MA 4PMJA 1L8PA 1EJ7L 4KFNA 2V3GA 2XFFA 2ZX5A 3MVIA 2D0GA 3IANA 1UWAA 3LLDA 3DDMA 3KHDA 1L6SA 4NZ5A 4NRRA 2CLEA 5LXEA 3GDRA 3SIMA 1ISXA 3B0PA 5HJXA 3UXKA 3VM5A 1I2PA 3S1WA 3GIQA 3IVUA 5AN7A 2GWGA 1VQTA 1REQB 3OODA 4JHZA 3DFHA 2PODA 5LIUX 4DUOA 4OFCA 2XH2A 3CV6A 3OJGA 3RPDA 3NL2A 2F9RA 1MI3A 2Y0FA 1LWJA 3WY1A 3PJUA 3U7BA 4ZSTA 3TNOA 4XG1A 3L2MA 1HJWA 3N2CA 3N2MA 5BYWA 5C9RA 2D2HA 4BF9A 5FEPA 4WOZA 2IXUA 1F3EA 4MZYA 1QOQA 3T2QA 4Y6GA 1H3GA 4LEQA 1V4YA 1UA3A 4NJIA 4REQA 3GYEA 3W3OA 3FJ6A 3LX9A 4DBWA 1PKMA 3IARA 4LV4A 4WR3A 1Z6KA 2P0IA 2ZXQA 1RZMA 4AEFA 3M16A 2Z6JA 4Z2LA 4I7VA 4EXQA 1N2VA 1UH3A 1R30A 3S5ZA 4ZSUA 1KCLA 3MUCA 4FNQA 3OOQA 4DUVA 3K4WA 2E6DA 3UGRA 4UFLA 1XYLA 3B9AA 1KM4A 4Y8FA 3WELA 1CXIA 2EPMX 3AROA 4AEEA 3B0UX 3WH6A 1VFHA 1WUFA 2X41A 4GRSA 2PTYA 3N4EA 3CV1A 5CSUA 1F2JA 1E15A 1F61A 2V63A 4HU8A 3EOSA 4GWEA 2ZICA 2VFEA 4NAFB 3VKAA 3Q94A 4PODA 4UOQA 3N9SA 3A21A 5KZEA 4QDPA 2J27A 2B7PA 4LCSA 4FNUA 3THAA 4GYKA 4Z17A 2YPIA 3VGFA 3ANUA 1JF5A 3O63A 3PZNA 1JG9A 1KBKA 3VILA 1X8CA 2ZC8A 1YDOA 3TAKA 2YDAA 2VVNA 1AJZA 4E2VA 5J5RA 2EGZA 4GC3A 3LHTA 4I5XA 1CGWA 1RVGA 3MKKA 4MIMA 4GACA 4Z1DA 2ZRZA 3GAYA 3KTXA 5D2TA 2QEZA 2D1ZA 4GVGA 1DJIA 1O68A 2POTA 1PKYA 1AZ2A 3BGJA 5GNZA 2AL2A 3W23A 5FAGA 1KQZA 3O6DA 2A1YA 3ONBA 2QT3A 1O5KA 3RNDA 3PBMA 2AMGA 5LKYA 1V0LA 4WJXA 3RJXA 1BWVA 3AC0A 5DRIA 1DWGM 2JE8A 5LIWX 3OG3A 4PFHA 1KWGA 1T41A 4M24A 4JDBA 3MU7A 1HL2A 2GDUA 1VIZA 1E4IA 3O7UA 2WMGA 4JHMA 2R1KA 4QJ1A 1E6PA 3UXDA 4E38A 1IR2A 2HVOA 1KGUA 4CCCA 2W27A 2ABAA 3DN5A 2PTDA 3QHOA 4NASA 3WQFA 4KH2A 3QJAA 3T0DA 4EAMA 3EDDA 3EKLA 3F2DA 4OKDA 2ZIDA 2B7QA 1XLEA 1HZYA 4MLRA 3LXCA 4DPPA 1V3JA 3L4TA 2Y7FA 1U5VA 2WHKA 3GVRA 4AY7A 4O11A 2WM1A 2XIQA 3GNRA 3QHMA 3A4XA 1Y0EA 3E02A 1SO3A 3EYPA 1V6XA 3RILA 1O4UA 4UMBA 2H8ZA 3MCNA 4H6RA 4AZGA 3VAVA 3FS2A 3FYOA 5KEZA 3HPFA 2X05A 2GSJA 4S39A 4NF7A 4DJEC 2PA6A 3TFXA 2WHMA 3G6LA 3BDKA 8XIMA 3URQA 2W62A 1XW8A 3IK4A 1Q6QA 2ZX6A 5HWNA 1KC7A 1Q13A 1XIHA 3JUGA 4W4QA 2NUYA 1JULA 3EX2A 2XU2A 4GQBA 1EC8A 2AKMA 4UCGA 1E6SM 2OLHA 5D8ZA 4MZ1A 1DIKA 1B2YA 4X22A 4J9JA 4RK8A 1YYAA 4HTBA 3OQ8A 4AF0A 3CK5A 1AQFA 3W1LA 4UC5A 5REQA 1CWYA 3F4DA 5U4NA 4PBGA 2C7FA 3WBXA 4DJFA 3HV8A 1OC7A 3WQ5A 3VIJA 4HHMA 1CYGA 1TMHA 3ZJ6A 4MGGA 3R25A 3ONCA 4O1AA 4ZA0A 3O8AA 1XG3A 3NQ7A 2EXOA 3LENA 4RXFA 1I1XA 3BK0A 3MC5A 3BC9A 2G8ZA 1EP1A 1EWEA 3PC0A 4UTTC 4DM1A 2PD9A 2VC5A 2Y63A 2B7OA 3DG6A 4LYQA 2V6AA 1HQTA 2WM0A 1XUUA 1TV8A 2VVSA 1M7XA 4IMGA 1QI4A 3L66A 4QLJA 3VGHA 3RRAA 2FZDA 3NURA 1ELSA 4W8AA 4Z2IA 1XDLA 1H41A 2VX4A 9RUBA 1IEXA 1C8XA 2NSXA 1BG9A 1E56A 3OVQA 4ZEPA 4GGHA 5I3GA 4HK6A 1UOKA 4H4IA 1XLGA 4Y9PA 1ME8A 1VRDA 1SZFA 2J6VA 2NUXA 4BQ5A 1Q4NX 4M6QA 2VUNA 1EGMA 3TUUA 3HGRA 3UCQA 1VGAA 4FIQA 4TQTA 4KPLA 4HPNA 4I6KA 4JIRA 1XLLA 2OQYA 1M3UA 3SN1A 3VNMA 3HG3A 1TV5A 3SCSA 4WD0A 1A5SA 1YPIA 3VIFA 1YX1A 1R7OA 3THQA 2E1WA 3WQDA 1J93A 3WJSA 3T2PA 4KWSA 5LGZA 5I07A 4XIAA 2DZPA 1G1YA 3QH2A 3TQ0A 2JBMA 3GR8A 4FX7A 3RDKA 4RE3A 1EDTA 2FHBA 2DSZA 3LPOA 2ZA3A 2PWEA 2ZVIA 1SFJA 4E8GA 1TJ1A 1EEPA 3MW7A 3TZNA 3RHGA 1A0EA 1VBGA 1PZ3A 4HK5A 1W5PA 3AU6A 3TA6A 4UBPC 1M41A 3VKJA 4TU1A 1KXTA 2IPWA 1Q6DA 1MUCA 3UY7A 3WNMA 3UCCA 3BSHA 1XIBA 3BWWA 3KCOA 4B92A 1GOKA 1K8YA 4IX0A 1BGGA 3U48A 4AMAA 3W87A 5B80A 3VCRA 5A6LA 4BQ2A 1TPC1 4JX6A 2XN1A 3VGBA 2V3FA 2B81A 1VLWA 4L61A 4HPHA 3EWZA 1SO5A 4J4KA 2IQDA 5E9AA 1K7EA 5H91A 4UMAA 3EWYA 2WNNA 1KCXA 7REQB 1PSCA 1ZBCA 4DJFD 1TA3B 4KEZA 3TYBA 3O9NA 3WQ4A 2QDHA 1PB0A 1H62A 2OSXA 1TPEA 3VX1A 1QUMA 1UQYA 3VDGA 1TZ9A 3T8QA 4MB4A 2P76A 2XN0A 5BXTA 2HRWA 3U4FA 4AD5A 3K4DA 1I2QA 1AW2A 2Z1BA 4NZFA 2XIBA 1X96A 4C7GA 1OF8A 1TV4A 2J24A 5CC3A 1YNYA 2VFGA 3ALFA 2WVVB 1MDRA 2DZTA 4MUPA 3EA3A 3BOFA 2J7EA 3KRZA 3PTQA 1DL3A 4H19A 1BAGA 4EVZA 4PTDA 3IJ8A 4PTWA 3F5JA 1V51A 3C8NA 5JU6A 2F6UA 2TYSA 2DZBA 1PZ0A 3TU9A 2VFHA 3KRUA 3CO8A 1FX6A 1ONRA 3EMZA 3U5UA 2Y70A 4FLQA 4OJYA 4X9YA 4S2CA 3GDLA 3N19B 2QJGA 4WGXA 1H2JA 5KITA 1BRLB 3W7KA 3EB3A 4ATDA 2E0PA 2UWFA 4C6FA 5G1TA 1H1NA 3MP5A 1GEQA 4F0HA 4BF7A 1XGDA 4XD3A 3QRHA 2C13A 2VDHA 5H8PA 4GKTA 3VKKA 2WVTA 4UFJA 3OIXA 3UXIA 1EA9C 5DBTA 5L9FA 3W7IA 3LPGA 1B3WA 3GKFA 2BXYA 1TA3A 1QAPA 3SFWA 1XLBA 2W0UA 3DFYA 7A3HA 4QNWA 1ISVA 4E8DA 2EPNA 2ZFAA 2NQLA 1W9BM 1GW9A 1XICA 3WDHA 4JKKA 5M1TA 2BHUA 1EJSC 3CYJA 4LUSA 3PUGA 1F74A 2E1DA 3W2KA 5DX7A 1VR6A 3GG0A 2A21A 2DUXA 5A6MA 1K9EA 1IQ8A 3SGGA 1XGEA 1Y5XA 2RH9A 4NZJA 1E6RA 1VEMA 1JPKA 4ZQRA 4AIOA 2TSYA 3E0FA 4RDVA 3AI0A 2P3ZA 3NOEA 1PS9A 4CQ8A 4HBKA 2E4TA 2FFIA 2VX6A 1EF3A 2UV8G 1KTBA 2WKLA 3VIIA 4GE8A 5ENLA 4UFMA 3OEXA 3BOXA 5K7JA 2UY2A 5I3JA 2E6YA 4FR1A 1NTHA 1H0GA 5GNYA 3W7PA 3QFEA 3W2MA 1GPWA 4HU4A 2HDJA 3AICA 2F2KA 1GQLA 1H0IA 4ZXLA 2YXXA 2DW6A 5HWMA 4IIBA 2I14A 1LLZA 4GVFA 4Y9NA 3CQJA 2Y61A 2X30A 5CEWA 2HNEA 3CH0A 3CB3A 2BGQA 3WDRA 1DKWA 2ASHA 1FWTA 1IIGA 3VE7A 4JICA 3WH5A 5C55A 2PCEA 3EMQA 5EFFA 1EDQA 3QR3A 2OKOA 3WL1A 1EUAA 1RSCA 2CU0A 1IEIA 1LL4A 2OFJA 3I7QA 4PMQA 1O7AA 2I5GA 1J0JA 3T6CA 3NQVA 1NFBA 1RBOB 1XBXA 4M1RA 4PB4A 4B3KA 2EEXA 4ZE5A 1A5BA 2ZRWA 3GH7A 3WCZA 3L5LA 3A4JA 4JFSA 3UWWA 1JIBA 5CLWA 4QX4A 3KBNA 4J2PA 4KF1A 2QULA 2NWSA 4N9EA 4TVUA 3PSWA 3VC5A 3HG5A 1QO2A 1ZP3A 2Z25A 2DU2A 2GGGA 3OBAA 3G5EA 1ZB5A 3DBPA 2WAGA 2YBTA 4HNUA 3WMBA 3M0MA 3PF3A 2VGBA 3PZQA 4H9YA 3RAOA 3SRDA 2GL5A 1E6NA 1BKSA 4IIEA 3E0VA 3WG6A 4LCRA 3H21A 4ZXOA 5CZKA 3V3WA 4EPKA 1K3UA 1CIUA 1JPHA 5LHEA 4D9PA 1K03A 3LI0A 3NL5A 1TELA 5AHEA 2MANA 5CC6A 2AQOA 3NTYA 4B2DD 1GNXA 2DSWA 4JIPA 4KIEA 4GIEA 5IOBA 3LTSA 3S6DA 3V5OA 2TODA 2OX4A 3WYZA 3PB2A 2BGSA 3PBGA 4D8ZA 3BAYA 1W8GA 5G4EA 1GKQA 4K38A 4D1JA 4ZQNA 2PRHA 4AWSA 3C2YA 1VJSA 3WQVA 3K5XA 3SCWA 5AHMA 4NYYA 3QLDA 4CD7A 2QV5A 3DYOA 3C56A 3GBDA 1N8IA 4QBXA 1FCQA 2I5QA 1NEYA 1S46A 5KZMA 3KCJA 1BGAA 4KW2A 3AMDA 3BQ5A 2L5HA 3PTDA 5AVHA 4KRTA 5G1YA 3FVMA 4JFWA 3ARSA 3WLHA 3H26A 3W7OA 4ZTYA 1QHPA 3CQ0A 4F2UA 1P5BA 3L4UA 1HGYA 3CZKA 4Q4MA 3A5VA 2PWVA 2X0HA 4DAIA 4DBSA 4XAYA 3CLWA 3K30A 1UWTA 3L0NA 3AYTA 2F61A 2PDHA 4QEHA 2GVGA 4LQ1A 4AWUA 3W1TA 2FVLA 2XVGA 3TK7A 5HDRA 1HKKA 2D23A 1NDVA 2PDUA 3L9CA 1TJPA 3WMCA 1XM3A 1QT1A 5T26A 1DHKA 1B3VA 1Q6EA 5BWFA 5D32A 1BYBA 5JIWA 3UA3A 1ZJAA 3LPPA 8XIAA 2ZE3A 1V7AA 3ZLFA 3ITYA 3W37A 1F5ZA 1G4SA 4JQ1A 1QI2A 3TVAA 4IISA 4S38A 2DZSA 4PUNA 3W2JA 4V2XA 3T09A 3S2LA 1KBBA 2X2GA 3L21A 2X8RA 2D24A 5H8MA 4FPSA 1S38A 1FWIC 1MNSA 2BZNA 4Y8EA 4HPXA 4OECA 3SW6A 1BQGA 2OZTA 3IIZA 1TWWA 3S5SA 1W9UA 2V8ZA 5B7YA 2I56A 2CFFA 3G1SA 2INZA 3EKZA 1UROA 4DM2A 4PBEA 4PE8A 5RUBA 1X8FA 2PPGA 4XO7A 4NIRA 4P7QA 2Q8LA 1IXNA 2J62A 3C2FA 1HKIA 3M0HA 2RDWA 1J96A 4JTJA 3U9IA 2VNCA 3LK6A 3W6LA 1CNVA 2QF8A 1FUYA 3GH4A 4O54A 2VGFA 3N73A 3RCNA 1GZ1A 3UERA 1DJYA 2DZWA 1UH2A 4HN8A 1CLXA 4FHAA 3LHZA 3Q58A 3ABZA 1PBGA 4OHQA 1W31A 2GJXB 3HJEA 4XZIA 2EKGA 5EKYA 4HHLA 2QJNA 1JFHA 1DE5A 1MZRA 4AC7C 1OC6A 4S3BA 1VS1A 3R7MA 1F73A 1O60A 2XM1A 2WW5A 3P7YA 4PYSA 2NUWA 3M5YA 1YW1A 4Q8TA 3R94A 1B54A 2KAUC 1FDYA 4M29A 3LS9A 2VDIA 3S2NA 1PIGA 2QCHA 1T6MA 1W8SA 4FS9A 2BVWA 4LAUA 1V3IA 4XBJA 2A3EA 4QROA 4WOQA 1W9DM 4P5UA 3AFBA 2A79A 4MTVA 2QUMA 3RX4A 5FIPA 1WDDA 4XSMA 4YTUA 2QF7A 4YYCA 3A12A 3GHUA 3B40A 2OX1A 2FH6A 2FFCA 2FJUB 1FWWA 3JZEA 4GYFA 2I57A 4JTTA 5AVNA 2NX9A 3GSMA 2ACQA 1B3XA 1L6FA 3KOYA 2E77A 4FXSA 2GZXA 3TN3A 2OO6A 4FXFA 2E9MA 5AYBA 4A3HA 3NFUA 5IFTA 2VD8A 4WDTA 2YW4A 2JEPA 2OEJA 1WUEA 3N3MA 3NQGA 4NL1A 1TZ7A 1X97A 1XINA 2QCMA 3G0SA 4LCQA 1EX5A 3WSUA 1ZHAA 1XQKA 3KS5A 4MB3A 5IRPA 3HG4A 4ACYA 1E3ZA 1QNQA 1A4MA 3PZIA 3NWRA 1Z9AA 1RV8A 1KB3A 3G6MA 1FCVA 5D38A 1UWQA 3CC1A 5E9XA 5CG0A 2VC9A 3IJ7A 1SZEA 4DEFA 4Z2GA 2J8FA 4C6NA 4JN7A 2WNZA 1PAMA 2YCKX 2D69A 3S1UA 1J0ZA 1XCFA 3AIRA 3B05A 2C18A 4EF8A 3UZYA 5CBBA 1FWBC 1SJBA 2BX7A 5C54A 2NLIA 2EHHA 3WDJA 4LVBA 2OMAA 5HNNA 4PMYA 3KWXA 4DRSA 1BF2A 3A24A 1XV8A 4UQCA 4I5RA 3LCLA 3A3XA 3QQWA 4IMDA 3V75A 1OM0A 4Q4RA 3BLPX 1VYRA 2QKFA 2Z0IA 2GSHA 1G4EA 4Y7EA 3NA8A 3PZOA 1EGVA 1JYVA 5AOUA 4FNPA 1U33A 4FLSA 3BUVA 1HTIA 1PYMA 5CPOA 3O1NA 1E4LA 4XO6A 1KR1A 3DFNA 4UTLA 3E12A 3TDFA 3WZ0E 1X6LA 4B5VA 1FA2A 2OLSA 3N9RA 5EFDA 1K8ZA 5DY3A 3VCCA 4D71A 4F0MA 1BFNA 1VJIA 2YCJA 1WZKA 1XCWA 1F4HA 1BXCA 4ORMA 2J7DA 2V5LA 1R2TA 2FDMA 3NNTA 1R2SA 4HSOA 3DU0A 4GVIA 1CGVA 3M0YA 4X0VA 3COTA 4D72A 1W3IA 2Z28A 1E71M 3ZT5A 3F4WA 4WY0B 3MUZ1 3FGCA 4B3ZA 4E3VA 4LUYA 3DG7A 4IPJA 3NL3A 1XSIA 4N9BA 1JCJA 2G97A 1SO4A 1V6WA 3LYEA 4I5UA 3APYA 5F1UA 7REQA 1KRCC 5CAKA 3TNBA 1P0NA 2VFDA 4ES4A 3PZUA 4J3WA 3WLMA 1P1MA 3VZXA 1GOOA 2CXGA 4WDUA 3M0XA 5CCZA 3ARRA 3PTKA 2OVLA 3EDKA 4W8LA 1OZMA 4XKYB 3AXXA 3O2LA 6XIMA 2ZUSA 3CJPA 4US5D 1UD4A 1SSGA 1Z8AA 1WKYA 1W3HA 3ABSA 3VMOA 3URNA 5BW6A 4PUMA 2WB5A 2QJHA 4H1ZA 2YB1A 4YTTA 4Q8WA 4W5ZA 4DIAA 1C7TA 2QIWA 3YPIA 5CPLA 2EKCA 3TV8A 1LT8A 1G4TA 3W1UA 5TQLA 5JXQA 1QPQA 3N34A 1KQYA 1ML1A 1PIIA 3QY7A 2PEVA 1MO0A 5I24A 1WBHA 1J4EA 1HFBA 1LWHA 3SCQA 4W87A 1NAL1 2BS9A 2ON3A 2PRLA 3WDPP 1J2BA 2UY5A 4IZGA 3NQ8A 4JL2A 2PI6A 3CTTA 2PWFA 3SBFA 4H8UA 4GXMA 2XH4A 2FZ8A 1Y5VA 3FY1A 1EHAA 4MKSA 1GJUA 1PO9A 3SJ3A 4J28A 4GI4A 3EDEA 4XKMA 4ZQPA 2X16A 3W7RA 5FESA 3M0LA 1ZP4A 2YL8A 4HSHA 4XB3A 1DWHM 2J8GA 3QGAC 1TV7A 3TYUA 1V03A 1HKMA 4PFMA 4US6A 3G3MA 3OB8A 1OGBA 4DYJA 4IH3A 5LNUA 2JKEA 5J8LA 3SFKA 3UG3A 4AQLA 3BJFA 2G37A 4K39A 1T5AA 5JBEA 1FFRA 4E4PA 3MHGA 3THCA 4FNTA 1C8VA 1QATA 4YCOA 4O1EA 2Y5SA 5I5RA 3B9EA 3DGRA 3UZXA 1HN1A 2QJJA 5I7GA 1XLKA 3DHDA 5HK4A 4NILA 3WQCA 2ZZ4A 1KLYA 1K4HA 5HOSA 1SJAA 3SZ8A 2CERA 4LAOA 5F7UA 4YXGA 3W27A 1UBPC 3PZ9A 1HGWA 5G4WA 4RZBA 3NVTA 5D2VA 4R33A 1UR1A 2I17A 3TW9A 2VWTA 1R2RA 4MJ2A 2QW5A 1F8IA 1M6JA 1RJPA 4IMEA 1CGUA 1F6KA 2XISA 4JTAA 2PLCA 1XGZA 5CZSA 1IE7C 5H2ZA 2DDXA 2RDUA 1TPUA 2I5IA 2CZFA 3LHWA 4QCFA 1TE6A 4DLFA 3IEBA 2TAAA 2QDDA 3WJXA 3GE7A 3BGAA 5JBDA 4XAGA 2OCZA 4IMFA 3R79A 3DERA 4BA0A 3GDTA 3IK2A 4GX8A 4WVXA 1OK4A 1J8VA 1TTIA 2PDCA 1IXOA 1NDYA 2I9UA 4P2VA 3V5FA 4EKJA 5BXRA 1DIEA 4MWAC 4FAMA 3IPWA 1SPQA 1M68A 4M7TA 2HK0A 3BAIA 3R1ZA 1LOQA 3S42A 3N11A 2BY2A 1VFFA 2FPYA 2Z1SA 4CN6A 3UR2A 4B9ZA 4HGXA 1E1EA 3OTRA 2YL9A 4DUWA 3E1F1 4U3CA 1VENA 1YMYA 5ABGA 4X61A 3T07A 4GBUA 1B9ZA 2VQTA 1OCJA 2WWCA 4JYDA 1PTAA 1A3HA 3TIMA 1HJSA 1W6TA 3BLLA 2POZA 1M03A 3FDKA 4HA1A 3W1MA 3NZQA 5LNWA 4HPJA 3G0UA 1MRQA 1PTGA 3HO8A 1VJZA 2GK1B 4XBKA 1JYNA 4AXNA 5ECVA 2WNWA 1DJQA 1VKFA 1TIMA 4UNKA 3PBVA 3R58A 3I68A 3AIUA 2XVKA 2HXTA 1PHQA 1M7OA 4JX4A 3TOPA 1OGSA 2W4XA 2FZMA 4J3XA 3MI2A 4O1CA 5BOEA 1VYPX 4V33A 1OT2A 1GTHA 1GVQA 5A2BA 4REQB 5JH2A 4KFOA 3KFTA 2WJEA 3BICA 3NXFA 2YYUA 3W2LA 1LRNA 3HQOA 4L6OA 1BYAA 4ERAA 1KV8A 4DJDD 4M51A 1RLDA 4JTEA 3UZWA 3UR5A 4U28A 3FA5A 3TLQA 4HJWA 5LIYX 4U33A 3W7CA 1DBTA 2I1OA 5IBXC 2JKAA 3MKCA 4G7EB 5CGQA 4Q8VA 6TAAA 3W1NA 1R5YA 3HA1A 3WNKA 3CPUA 2XYLA 1F4AA 4I8DA 1UPPA 1UIPA 4F2BA 4IMAA 1VP5A 4DJEA 1VFLA 4UR9A 3SCVA 1FWFC 5DRCA 1GVYA 3RO6A 3IIOA 2XG9A 3VDBA 1P1XA 1VPXA 3PJWA 1EWDA 2IS7A 3ABXA 4P8UA 2EJ1A 3SUVA 1X39A 2Y6ZA 1JCMP 2EO7A 1EJVC 4MF4A 2EPHA 2NW0A 1KW1A 2HISA 4XD4A 2JGYA 2QCDB 4LTSA 1EOKA 1O1HA 2CLLA 4QJ5B 3GM8A 3AZRA 4YU1A 5KZ6A 1W1TA 4BHYA 3H2CA 1FHUA 1P43A 1YE4A 4UUIA 3WQOA 2VR2A 3GXMA 2WPBA 3M0IA 4QHRA 3EX1A 2BODX 3GUWA 1LBFA 2E5DA 2H90A 1FHLA 1WA3A 1RP8A 2W92A 1LROA 3K46A 1TWZA 3VOIA 5D2YA 5E6ZA 4Q22A 3S6TA 3M6DA 3P6LA 3SRHA 2AGKA 1OSEA 4JAWA 2Z6IA 3FVDA 4OV9A 4AMCA 1C91A 4UTFA 1MUWA 4AX7A 4ZB2A 2V82A 2Y5JA 4ADTA 4LUTA 3TWAA 8TIMA 1WE5A 3B9DA 3P80A 4FXRA 1ECEA 4JQAA 1CXLA 1Q4WA 3SN0A 1W32A 3OIHA 1QOPA 3RG6A 1WAUA 4OZOA 5AB3A 3AMCA 2JALA 3EX3A 2W63A 1E0UA 1XG4A 3V1PA 4BWLA 1VBJA 3MZ2A 1E1CA 4QE1A 3BCJA 1NJJA 3CHEA 4HTYA 3UD6A 1XC6A 3T81A 1J10A 3CUHA 3PUEA 1JCNA 4KWWA 2ZTKA 1E1FA 5BOOA 2V67A 3M7WA 1UUQA 3EDJA 1MNZA 3C52A 3MO4A 5AYYA 4JY8A 2P3EA 1LBLA 5F1VA 3MB9A 2RFGA 1Q6RA 1GZGA 1RQHA 2X40A 2ZWYA 3VVGA 5F4WA 4LY8A 2Z1WA 1R9YA 2OOGA 4GZIA 3ARUA 3IV8A 3M0VA 5DELA 1VCFA 4PN2A 3WLLA 4UWMA 1OD8A 1Z3NA 4PTNA 4AZ6A 4DO5A 1OGGA 5TD4A 4AG0A 1HXJA 1A5AA 3EXRA 2VJXA 5H1WA 1F3TA 3S47A 1B3OA 3GFYA 1NOUA 4JGDA 4PRWA 2Y88A 3C2RA 3GNXA 3GVWA 3WLQA 1P6CA 1E4NA 2XIMA 5IDIA 4KWOA 4HNTA 3VKDA 3ITTA 4CQCA 4IPLA 3D3FA 3QR0A 3FAXA 3FEQA 2DIKA 3VK5A 1S2WA 3UPMA 1C9DA 2SFPA 3QZ6A 3VNKA 2Y24A 2EG6A 5A2AA 2IKHA 2PP3A 4IP4A 4UNLA 2ALRA 4ERIA 3GU2A 1BXBA 1C92A 3R11A 4CNPA 3KAOA 1UYQA 1QW9A 5EY5A 3RJYA 4JKLA 4A2SA 3ZQ9A 4F9JA 3LUTA 1SW3A 3WH9A 1BXNA 1UIOA 3EXSA 3MO7A 4QAWA 1XYZA 2V2CA 4EPBC 3EWBX 4CNOA 3P67A 1A5OC 4F48A 2BVDA 1NWSA 3U6WA 3H2FA 3SO7A 3LLFA 3MSDA 3RLVA 4DO4A 2V5JA 5LZLA 4C65A 4QCEA 2Y5EA 1LWIA 2YDQA 3PP7A 3KVKA 3L68A 2AL2B 3RK8A 4NZ3A 3V1HA 1SZGA 3OLDA 2VEFA 1XIMA 4E2DA 1RPXA 3CM4A 3UR8A 3C0LA 1TQXA 4S3KA 5HINA 4UTHA 2CZVA 3SUTA 3H4GA 4MUZA 5FAJA 1GOXA 3GC4A 2Q3OA 1J79A 1O12A 4W7UA 5LSMA 3V36A 1JZ8A 4EF9A 4DZIA 3B0VC 2OPJA 3GHSA 2ZA2A 2ISFA 1TMQA 3NPXA 4JEQA 4WKFA 2Q8XA 1TV2A 4LJ3A 3THDA 6TIMA 4J7RA 1F9CA 1R3TA 4YIWA 3ZLHA 5DCDA 3ZOAA 3TMQA 4I9TA 5HNRA 2Z29A 1JRCA 1V3LA 1UWIA 2VZVA 2BXZA 4MKVA 2C0HA 2XVLA 1P0EA 2R9RA 3G1FA 1F05A 1TMLA 3GD6A 1H11A 4Q32A 1QK0A 2BY1A 1NFGA 2E68A 3QEZA 3W7DA 4U5IA 1XC4A 5FJJA 1UKTA 1YRRA 5AZ0A 3P84A 4MM1A 4MSSA 1FWHC 1V7YA 4ZQMA 3MHFA 3W83A 2GGHA 3FSUA 4KCTA 1H1YA 5LIKX 3P5ZA 4P8WA 3GNDA 3GTNA 1E6ZA 5AZ1A 1BKHA 2P10A 2QUUA 4R34A 3RX3A 2F84A 3GY1A 3VFCA 2G50A 3QC3A 3NZRA 1UA7A 1MQQA 3A64A 1KBJA 1J12A 3AZTA 3WDQA 3NDOA 2RHGA 3ITGA 4QXIA 4DWDA 4R7WA 5KTLA 3IAPA 2XHYA 3ABOA 4EX4A 2XGZA 4GOAA 4LVDA 1G7UA 2WC7A 4DPQA 2DSKA 5D9PA 3USBA 1I0DA 2X1SA 5IHRA 4GIRA 2VI0A 1JGMA 2C71A 4JCLA 4Q4PA 1KKRA 3STEA 3VOHA 1RXOB 2VEPA 3MBDA 3WQ6A 1QRQA 2XVNA 4YTRA 3N4AA 2EBNA 3QTGA 4PRTA 2VRKA 3EOOA 1OFEA 4KIRA 5F2IA 4CKQA 2CWXA 3UYIA 3GH5A 1PDYA 2QV4A 1AH0A 3W7JA 1OFOA 1XHGA 5DEZA 2G41A 1AJ2A 4K1WA 3SCPA 4DBEA 1NP2A 5C71A 2NV9A 1VFSA 2DIEA 1XUZA 2ZADA 4NAEB 1Z7AA 5CGTA 3AISA 4IPPA 2D2GA 3AIWA 2ZDRA 4GYPA 3GXIA 4PCSA 1UR0A 5AFDA 3CMFA 2RJGA 2WZTA 3CIVA 3H54A 1WX0A 3KBJA 3N25A 4O17A 1ISWA 3W02A 4FA3A 3NEVA 1NFPA 5CC5A 4LYRA 2WBKA 2Q09A 1QOXA 3OGRA 5E5CA 3KOZA 3WFAA 1FWJC 3F4CA 1KCKA 4IXHA 4ZMGA 3GW3A 3RYSA 1Q45A 1I1WA 6A3HA 4HMEA 2IUZA 4FO4A 1VFMA 4WSHA 5C0QA 1AUSL 2J78A 2QJMA 4N9DA 1QPKA 4JYFA 4GZEA 4GI8A 4LFYA 3BLDA 2QMKA 1J6PA 3DH7A 2IPJA 3MSYA 1D3GA 3TQPA 1JL8A 1N82A 3CPRA 3VFLA 4D6CA 1VPQA 4TX9A 3C2VA 1VB9A 3BAXA 3QY8A 3CB8A 4MZ8A 4B5TA 2QXWA 3N15A 5KZDA 4IFKA 4NJGA 1B0IA 4G1KA 1EJTC 1UZ1A 4QE5A 2CHRA 3WD3A 3U3HA 3G8EA 3UVIA 2R1NA 3JS3A 4X2RA 5EPDA 2A3LA 5CPSA 3TA9A 2OGJA 4C6QA 3B03A 4KEMA 5EBUA 4ZFMA 2OWCA 3BZGA 4JR5A 4RCXA 4YLWA 4WLCA 4P8XA 5FJRA 4B16A 1B30A 2W67A 4BQ3A 4AD3A 3W4RA 1VCGA 2DJLA 4AZCB 1W3KA 2A7RA 1MSSA 3ITXA 1ZU8A 2VOMA 3ID7A 2YA1A 2GVYA 5AC8A 3SEPA 3S0CA 1GQIA 1FWNA 3MVTA 3HF3A 1KTCA 5JUVA 4NUWA 1G0CA 1YPFA 1M7PA 2QDEA 3QLLA 4O53A 5SWUA 4O8AA 4HVXA 8RUCA 3C6CA 2HSAA 2H3BA 5AKQA 5XIAA 3MMTA 5C2CA 5DLCA 4M82A 1LTDA 3ZR5A 4DWSA 4DO7A 2PC8A 4WX2A 1LYXA 3NUKA 2VR4A 4YWSA 3TTYA 3J7HA 1KBLA 3NSXA 4FLRA 4ASTA 1XYMA 4JFTA 4CU8A 2OXNA 3PUOA 2Z4GA 3WENA 1SSDA 5A69A 3PULA 1M1BA 1K8CA 3T0CA 3TYEA 2QPXA 4MMWA 3EZ4A 5EMKA 4RJEA 4F4RA 1OINA 5F4SA 2DJXA 4EANA 1EBGA 3FNDA 2VENA 4G7FA 4GPNA 1WB0A 4YL2A 3VKBA 5A8QA 1V6VA 2WLYA 5I79A 1V02E 2C91A 5AC7A 1I60A 1FP8A 4KEUA 5LA0A 5LYRA 3T0TA 1W1YA 1OJXA 4H83A 3NQCA 1ZSXA 2X42A 2DH2A 1Z69A 4AHOA 4JN6A 3N6JA 1NVMA 5DBUA 1RP9A 4DBUA 4HZ7A 3NPVA 3UZZA 1H7RA 2CESA 4MPKA 1US3A 4DVOA 2HE5A 4PTXA 3ZWSA 4Z1CA 3VYLA 3WBEA 2O9PA 2GUBA 4MWAD 4CEXC 3NQBA 1B9BA 2PS2A 1T96A 4H9ZA 3XINA 1U1HA 2YFNA 4OTKA 1JNEA 2QUNA 2VEGA 2OOFA 4HN4A 4RNHA 1Q66A 1QI3A 2VCAA 1TVPA 1DIDA 3SUWA 5A2CA 1B3ZA 2NVCA 1AW5A 2H3DA 1FVPA 3DFTA 1XH1A 3D47A 4UR7A 3CWHA 1JAKA 3TC7A 2V3DA 2ZUNA 3W72A 4IUGA 4I7WA 3UESA 3B8DA 4PUDA 3P2VA 5D09A 4KERA 4GQQA 1M04A 1ADDA 3TYDA 3VOJA 5D2XA 1OFPA 4E4FA 4LWWA 1FWAC 2WMJA 1C3FA 1ZAIA 2PP0A 3G1XA 3KW3A 3IGHX 2WZEA 3DAQA 2OYMA 1LG2A 2OU4A 4A3RA 4Q8PA 3EWXA 4Q8QA 3WK2A 1WDQA 4DF1A 3O15A 2XWEA 3KM8A 1EIXA 4A8LA 2OLAA 3HTWA 2FZ9A 2GGJA 2FHCA 3EBVA 4MVAA 4LAZA 4GX9A 1L2QA 3RO8A 1K1DA 4XKYA 2WANA 1PV8A 5HJLA 2VFIA 4KS0A 2Z2UA 4ML9A 5E0KA 1KFWA 4FNSA 1J11A 1OYAA 3ZMRA 4H41A 4L65A 3SUSA 2DT0A 1MXGA 2O7SA 3LEPA 1IIHA 1QMLA 3GDMA 2QCGA 4O12A 3PY2A 2OG9A 4H6EA 3N2XA 2WZIA 3GTIA 3IVTA 2C0AA 3G1HA 3PPCA 3CZLA 3G0XA 4JZ5A 3AAMA 2OSWA 2H6RA 1LDCA 2ABBA 3W7HA 3TAOA 1LT7A 2QYGA 1RY8A 4M8UA 4B5UA 4QSHA 4NI8A 1NM9A 2CITA 3R13A 4DNMA 3HQ1A 1IHIA 9XIAA 2XSAA 4Q7IA 4IIGA 2ZZ5A 1L8NA 3PBUA 4AF0B 4LXFA 4PSRA 5CKSA 3LNMA 4DJDA 5LIXX 2YXGA 1HO4A 2A6LA 1K70A 4J2MA 1A0CA 3ZJKA 1SJCA 2PTWA 3P5YA 1VEPA 2PE4A 4WKAA 4D6FA 1FOBA 4AAJA 1S3HA 2OTDA 1HL8A 1ODZA 3AJ7A 1XSKA 4RPQA 5HNUA 2PTZA 1UD3A 3A5FA 1E9IA 3BG5A 3HFTA 3M6YA 1LBMA 1F8MA 1VFUA 1LG1A 3ZT7A 5AECA 3T55A 1GYMA 4I90A 3JW7A 4CEUC 4GIYA 3WFLA 1DYSA 2Y8KA 1WAWA 4DWSB 2CLFA 3UJ2A 4YVPA 1XLIA 4KESA 8A3HA 3WF3A 5I77A 1A80A 5D04C 5BXPA 2J79A 1KRMA 4DZHA 3CTLA 4Q3MA 5FEWA 3R10A 1IZJA 2VCCA 2CLIA 3G8RA 1R9XA 3WEMA 3D6NA 1F3XA 1JXJA 3FYYA 4FK9A 4GMEA 4E5TA 3LCXA 1O95A 2C1IA 3S5YA 3QMTA 3VD9A 1KGXA 1FH7A 3ZYZA 4RV8A 1EH9A 4ZOBA 3RLGA 1T0OA 1XLDA 2NLYA 4IICA 4LSBA 3R0KA 1MW1A 3CT2A 4W93A 4JEJA 3OYZA 5CZ0A 1UD8A 1SUXA 3WFZA 3PFMA 1J01A 2GYIA 2V68A 1YLVA 1WNOA 3IIPA 1SW7A 3F2CA 4F2TA 3E0LA 4CNSA 2ZTJA 2NQ5A 3T8LA 1ZZMA 3TOYA 2PSNA 2XGBA 3BMVA 1YTEA 2ZUMA 1OFDA 3BAKA 1HUVA 1TPH1 2PF0A 3QSRA 3TN6A 4U3AA 1F6YA 4HOWA 3DX5A 1FY6A 2XN2A 4Y96A 3N4FA 4ZO8A 1YPXA 1S5NA 5FJIA 3NO3A 4NXSA 4C6BA 3F03K 3CQIA 2C3ZA 4JQ4A 1CEOA 3HURA 3H55A 2BV9A 1R3YA 2ATSA 1VRXA 1ZALA 5FSDC 3G1VA 5FF2A 2ZRXA 3S8HA 3AHYA 5IDZA 5CSRA 2O0TA 1B31A 1GTEA 4HD5A 4MPQA 2AGTA 1HJUA 4JD4A 1A5KC 3CV2A 1H49A 2ISWA 3KVJA 4B5WA 3DESA 4O18A 4QIUA 5C2XA 4O0QA 1DJZA 2GOKA 4QITA 1B4KA 1XLJA 4K2SA 4EP8C 5EMLA 4CNUA 1E5JA 5AY7A 1OYBA 3IVSA 3WLSA 2IXVA 4NAFA 3APTA 1I2RA 3TP4A 4YCPA 1I8JA 3ABQA 1V6UA 4HYWA 3I4KA 4ONVA 4P7OA 1VBRA 4AD1A 4WJ8A 3KZSA 3HPAA 4J3UA 5K9CA 4JFVA 1R0MA 3UF9A 5MHBA 1SU5A 3VD4A 3E49A 1KLZA 1WYIA 2F6KA 3HZ3A 1TSIA 4XISA 5ABFB 3LZ5A 1A3XA 1WKDA 5A8OA 3B04A 4JL1A 3W9ZA 4PA8A 4W9TA 3N18A 1K9FA 1IYXA 1K02A 2DGAA 3RUBL 1CT5A 2BY0A 5M5DA 1L6YA 1J0IA 4GHRA 3TJLA 4NNCA 2ZRVA 5BNKA 2YZRA 2XINA 4LAKA 4K7YA 4IIDA 3OGVA 4U4MA 3VZZA 3O3RA 4L9ZA 2BLEA 2E8ZA 1Z44A 4Q6JA 4XZHA 3NZGA 4MADA 1E0TA 1WV2A 2VX5A 3VIKA 2RJHA 1H5YA 1W17A 3INPA 4G2DA 3H24A 3LN3A 2XIJA 1CPUA 2DT2A 3RM8A 4XSLA 1IT8A 2WYSA 4RL3A 4QE4A 3PAOA 3CZGA 4A3YA 3GR4A 2QUVA 1EYEA 4ZO6A 3A23A 3EX6A 4WDXA 2YXOA 4Z08A 1WDSA 3SSZA 3EOEA 5FF7A 1S5MA 3GFXA 2OQLA 3MMWA 4IHCA 3MSRA 2E9BA 4JFUA 1UJPA 1QI0A 2CWNA 5KETA 1E4MM 4QJ4B 3ISIX 4GH1A 3SADA 5HR6A 4GABA 4C6PA 2G0WA 4PCTA 3KS6A 4JTHA 4S3EA 3OHMB 3N04A 3LBCA 1H51A 4U31A 9CGTA 1XIEA 2FYMA 3GU9A 4UCFA 4U5KA 4LBRA 2J7CA 4H2CA 1ONEA 4DY1A 4HNVA 4JTRA 4XZNX 1W1IE 4GIAA 4JNMA 3LLXA 2NXHA 4C6LA 1ZJHA 3GXPA 3GDKA 1ZBWA 4ML4A 1QTWA 1RR2A 1W1B1 4KCWA 3GIPA 1WO2A 3NZ1A 1XBZA 3G1YA 2PDIA 1BPLB 3WF1A 1DWAM 2WCSA 3WH7A 2PZNA 1OCBA 1VBHA 4LS1A 1NARA 4XQ6A 3GO2A 3Q65A 4US5A 2A5HA 4OU1A 1WDWA 2JIWA 4PR4A 4WZHA 3KEHA 2BBFA 1QW7A 4ILSA 1Q2SA 5BWAA 2GLKA 2O56A 1E5NA 4GI6A 6REQA 4IQDA 4LNCA 1ADOA 4AIBA 3Q45A 2NQJA 4K37A 3GYCA 4HNLA 2DZUA 4D6DA 5JIPA 3I65A 3QPYA 2WVUA 3TCEA 4AZ5A 3BQ6A 3W82A 5CZJA 4XVEA 4AFYA 3C5QA 3LRLA 3MMUA 3TTSA 3RXZA 2PLMA 3TQVA 4TO8A 5HJYA 1V8EA 3LHUA 3NEHA 1M7JA 4IUOA 3LCGA 1OFQA 3C0JA 3QBUA 4S1FA 3LRKA 2CLKA 4YJ5A 2DY3A 4HU0A 3B8SA 4LS0A 1CX9A 5TF0A 2Z1XA 1I6NA 1L0PA 4KGJA 3OVGA 4WGHA 2E40A 2CXEA 3POCA 1DXIA 3VTRA 1FWDC 3GAKA 4MHBA 6PTDA 3FLUA 4S3CA 1TJ0A 3AALA 2ZKMX 3FOKA 3UU0A 1CBGA 2P5NA 3ELFA 4IFKB 1IT0A 3EEGA 3UNDA 4AD4A 1KWKA 4CCDA 3S2CA 1SR9A 3AWNA 4Y9MA 2NWRA 1FDJA 3RIKA 3BVJA 1C93A 1W1VA 3K8MA 4AB4A 2VT0A 4PL1A 1K9TA 1C9WA 1UD6A 1WBJA 2O4QA 4E2OA 1I9CB 3KUMA 4P7LA 1JNDA 1OG0A 2VEIA 4XX6A 5A6BA 3UFYA 1CDGA 1NF0A 4ZFCA 3SUUA 1OCNA 3AMGA 5DF0A 1EZWA 2Y7EA 4DWSC 3WLTA 3MY9A 4UTUA 4K1GA 3MTWA 1W2PA 4JCMA 3BV7A 1X1OA 1G67A 4S2BA 1XL9A 3WJZA 4LB4A 3H4XA 3FXGA 1DOSA 2ZWZA 2A2IA 1YXYA 4RZ6A 3ARYA 1R3QA 3SRFA 5HQMA 5KSWA 4JIHA 3QOKA 4ZBCA 3MCMA 4MJMA 4DHGA 5C8BB 1KV5A 3IRSA 3H6OA 3UBPC 1SZNA 2XIOA 1JXKA 3M0KA 2ZE0A 4ZGYA 5CBIA 1L6WA 3TJ4A 4LVFA 2DQXA 3SGZA 1FQ0A 5K4ZA 3ECQA 1H7XA 4ICCX 4AY1A 4C7DA 2I9EA 4DZ5A 1GOMA 3DOPA 3QKEA 4DQWA 2WKGA 3B97A 5D05A 1PTDA 2PU1A 4ATWA 2NT0A 2MUCA 2A4AA 4B2DA 1OF6A 3UR7A 2A3AA 1TPWA 3NO5A 3SURA 1BVNP 4F0SA 1UB3A 2OZ3A 1E9LA 1HKWA 2GOUA 2Q6ZA 4L80A 4WKHA 2IW0A 1XIJA 4IGSA 3KOWA 5FEZA 5HMFA 5XINA 3F4NA 3DFSA 5GQBA 4EAYA 4XD5A 3TTEA 2W3ZA 1I75A 3OZPA 1X7FA 4YN5A 2Y4SA 3OHIA 2WQPA 2IKJA 2J47A 3LV5A 9XIMA 4QP0A 2E6AA 5D9NA 3PN8A 3WQGA 1UP3A 3ZR6A 3IUDA 4PEKA 3TEVA 2WSYA 3OGSA 2PDXA 4JTUA 1ICSA 5AYXA 2ACUA 1OG6A 1AVAA 2X7VA 4L56A 2AMXA 4J3VA 3CASA 1VIWA 1JUEA 1J0HA 3K13A 3W75A 3WJWA 4AUBA 4HK7A 4DJDC 5IFPA 1NIUA 1FKWA 3ZM8A 1QW8A 4PTMA 3WF4A 1R47A 4PCFA 2QCEA 2V81A 4A29A 3TZFA 5CPTA 2C15A 3W7NA 2J25A 3HJZA 2J9YA 2Z24A 2YR1A 3I10A 1WQ5A 4AVFA 4JOMA 4GO9A 1BSIA 1DJNA 5D2WA 1GVFA 3T7VA 4YYFA 4FX6M 1W5NA 3VD5A 1WDRA 1QNRA 4UFIA 2DIJA 4H8VA 3PBWA 3IJ9A 3TN4A 4QLLA 1U5JA 3A9IA 1CI1A 1XX1A 1ONWA 1ZBKA 3ARWA 1XRSA 4NJKA 3R12A 5HULA 3C2OA 4JTFA 5CXPA 1ME9A 4CNTA 1LLOA 2CCRA 3LG3A 4GZJA 2YCIX 5CLTA 3AO0A 3PK7A 5DT7A 4I9JA 3AMLA 4FX8A 5CGMA 4DBDA 3GG8A 3M47A 2DH3A 3B3DA 4KRZA 1LQAA 4O1DA 1GG0A 1KFBA 1Q7QA 4JTGA 5I23A 1MYRA 5M3WA 3TROA 1K9DA 2Q02A 2HK1A 4DI9A 4GBDA 3T4WA 1RJRA 2HBVA 4LUTB 2D3LA 3HQPA 3S3GA 6ALDA 1FDZA 4PMNA 2FGZA 4I8YA 5I09A 4RZ5A 3RX2A 1C8YA 1WXZA 1FWCC 1EX1A 4Q4QA 4PEEA 1E1CB 4OUIA 2QMJA 1UQZA 1K7XA 1ECQA 3CAWA 1ZLPA 1Q6GA 4O4VA 5HMEA 1DIOA 3PS7A 3NSNA 1NOFA 2GQ9A 3FX4A 3FA3A 4JPGA 1AD1A 1ITCA 1PWLA 2A6NA 1F76A 3GC5A 1GKRA 3S9IA 3VO0A 3MANA 2XFWA 3GC2A 5I3FA 3KTCA 1TPVA 4HMNA 3QM3A 3S83A 1TFVA 1PL9A 3I7SA 4GO8A 1OZQA 3FN9A 2NV1A 2WMIA 1KM2A 4HMCA 1RUSA 1YNQA 4NY2A 1NWUA 4M0XA 2VKZG 5C9UA 2FIQA 4PMZA 2DP3A 1D3CA 3GNPA 2V0TA 5K2ZA 1GQKA 2A3CA 3AXHA 4CCEA 2CHOA 1WXYA 2WHLA 5EMMA 1J5SA 2IMRA 1OD0A 5D4YA 2DVXA 3DFQA 2YW3A 2VURA 1H7PA 1OY0A 3NM3A 1FKXA 1PKLA 3EPOA 2R8WA 2QLYA 2E6FA 4HZ8A 3DZ1A 5EA9A 3GNOA 2W5FA 5I78A 3S5OA 4GQGA 4H6KA 4Y90A 4NKCA 4BFAA 1OFBA 6CGTA 3EWCA 3HMJG 2HROA 3JU2A 4G5DA 3VMPA 3LNPA 1YKWA 3W01A 4JKMA 1Q5MA 4O16A 4MDOA 3QMSA 5T9CE 1AODA 1X1NA 2FLIA 1UW9A 2VMFA 3FCPA 4IFRA 4C1NB 1ZENA 4H7VA 1RHCA 4CN4A 3AHZA 5BMXA 1EYWA 2R91A 2WMIB 1JCYA 2O7QA 4LB3A 2PDMA 3DENA 2XH7A 3MPGA 4WSJA 2CW6A 2OKTA 3VM7A 1OIMA 2W79A 5FKYA 4MYXA 3O06A 2ALDA 5L6UA 1R85A 2DFAA 1IT7A 3A6OA 3WQWA 1PDZA 4YS1A 2D0HA 4O1FA 3ARPA 2B0MA 3UXLA 4OV4A 4DAFA 1ZGDA 3CAVA 1VLIA 1CLKA 3TW7A 2W66A 2HS6A 3UWUA 2HJPA 3TTOA 4A22A 5DFAA 1AD4A 4CNNA 3PJXA 3W7GA 1G5AA 4BS0A 4BI7A 1XR2A 4FOUA 1BYDA 3S1GA 5FI8A 3SQSA 3R4IA 1FH9A 4GUHA 2FMOA 5DXXA 3GDBA 5I3DA 1D8WA 4V28A 2VD9A 2V5DA 3IJDA 4JTDA 3BAWA 5A8PA 3WO8A 1JZ3A 1DV7A 3ALGA 4V1XA 4LBUA 4GFSA 1CXEA 5G2WA 2J66A 4HMDA 1KFLA 4TOQA 4W7VA 1Y65A 2DUZA 4O57A 3MQTA 3MUIA 5IBXA 4HA3A 3ABRA 5DCEA 3G1DA 3QW3A 2E09A 3CUJA 3H4WA 3T4CA 2J7GA 3G1RA 3WD1A 4S3JA 2DZVA 3HOJA 5HPCA 1GYNA 1KGWA 5D30A 1XF0A 2G4FA 3NL6A 1EF2A 3Q4DA 1CGXA 4HHPA 2WSPA 3LD5A 3M1ZA 3F5LA 3A3WA 3AIEA 3PPHA 2YJQA 5BRPA 5HPOA 1BEUA 4GQRA 1GORA 1GK8A 2A7NA 4H01A 4AISA 2BHYA 1V3MA 3PFRA 2PC4A 2QS8A 1H7OA 3AS0A 4YHEA 5E93A 3BJSA 2OELA 1AMKA 4GI9A 4C60A 4HCLA 1IXQA 1RBAA 3Q37A 2GWNA 3UW6A 4F0RA 4ERGA 2DVTA 2BSLA 1GVOA 1GG1A 3FHAA 4PMUA 4W89A 3PWAA 5A95A 3B8VA 2GVEA 2VEKA 3DI1A 3O6AA 3SB0A 3NQDA 3FJNA 1UMYA 3TTQA 1P4CA 1G01A 2ZUTA 4GY0A 4DZAA 1ISYA 1H7WA 5E1QA 1JDAA 4H7ZA 4R9OA 3IUIA 2FB3A 1DJHA 3VDCA 4F0LA 1RA5A 3QGVA 5HA7A 3WD4A 3EOUA 4GCXA 1ZY9A 1H63A 3AMKA 1Y8BA 4HA0A 3M43A 4QLKA 1XLFA 5DXYA 4AW7A 5A6JA 3XIMA 3F1QA 3MHUA 1W54A 1IZKA 2VTFA 1XH0A 4LUSB 1UR3M 3GXDA 2GQ8A 1UZDA 3CUFA 3R8HA 3VNJA 4J35A 4HSNA 1HJXA 3HPZA 4NJJA 1HIZA 2XIIA 1YTKA 3WNLA 2QGYA 3MWAA 2XUCA 2UZ9A 4IG2A 3BLOA 1UG6A 3T9PA 1M9HA 2XWDA 4JYEA 3L5MA 3BSMA 2PWUA 1H09A 3WD0A 2YLAA 3ZIZA 1P0BA 1DWJM 3KDNA 3H2MA 1XSJA 3MBFA 5A5WA 3VZYA 1K77A 3DHFA 3EWWA 1TE1A 4C90A 1RQEA 3LTYA 2WMKA 4PMDA 4L1GA 2BGNE 1TPFA 5CC7A 4IL0A 2V38A 4IPNB 4P8VA 1BLIA 1E55A 2ADAA 1RH9A 3I6RA 2DZXA 1PYFA 4FP1A 1XI3A 3WK1A 4RR4A 1V3KA 4R7JA 3PVFA 3QHNA 4OIFA 2J88A 3HFYA 3O07A 4JIEA 4UTJA 2V2HA 2G95A 3EA2A 3OBEA 1SZRA 1RLCL 2R24A 4KCVA 4Q4KA 2X0YA 1MZHA 6XIAA 3OZYA 1QPRA 4PB5A 4GYPC 1XH2A 3K1DA 4AIUA 3P14A 3I7RA 3UGVA 1UR9A 2PB1A 4MOZA 1OX4A 4AYSA 1UP0A 4AHPA 1ISZA 1WZLA 1XIFA 3PM6A 3WF0A 2V30A 2GVJA 1FP9A 3C4UA 3KRBA 3R8GA 1RD6A 4AD2A 1R38A 1XDJA 4Q8NA 2Z26A 1UKPA 1UH4A 2HMCA 4K36A 1JUBA 3VU2A 3LQLA 1Y7VA 2DQWA 2ZOXA 3E0WA 3T44A 1HF6A 1GONA 4IPIA 3L4WA 2P50A 1UP2A 3DG3A 4J3ZA 5CPNA 4C6OA 2YZ5A 1BF6A 4WEVX 3R89A 3E96A 5KINA 3O0KA 2NQZA 1GQJA 3NAVA 3BMXA 1A5NC 2ZRYA 1EDGA 1MXSA 3HMCA 2XFRA 4JTCA 4B90A 3TX9A 3U57A 2Q71A 4NSBA 3OG2A 2R14A 1Q63A 3WQPA 2ANUA 1KFKA 4F3HA 2X09A 2ZXAA 1UD5A 1RK5A 5D02A 4GQ0A 1OHLA 5C6MA 3ITVA 3H70A 1WKEA 3U2CA 2PBOA 1D8CA 4U10A 4UZUA 4Q8UA 3BLKA 4LYPA 2R1MA 3WLPA 1DHPA 2QIIA 3VIHA 1Z48A 3SCUA 1U2YA 2BVTA 3RPMA 4LVGA 2B31A 4FI4A 1P48A 3TYCA 4CD8A 3LM3A 2DEPA 2AL1A 4GK8A 1JEZA 4QTGA 1N8FA 1LCOA 4HJFA 3RCMA 2HPMA 1PCWA 1P6BA 1BTCA 1JPMA 1QWGA 2CNCA 5DO8A 3BCDA 4XZMX 3ZS4A 4WCJA 4H2HA 2ATMA 5C2GA 2V3EA 7CGTA 4B4HA 1PX8A 3H2EA 4GXPA 4JX5A 5C7HA 4NP7A 5LGXA 4C1LA 5T91A 2W6RA 5MKGA 2C79A 3WLJA 1TYGA 3N12A 4YVXA 3GBEA 1N7KA 3GFZA 3CL7A 2YSWA 1UR2A 3WIJA 3LQGA 1D7KA 3VKCA 1J0YA 4CN1A 3HIJA 4U2ZA 4LRSA 1BVZA 1TCMA 2VWSA 4TTUA 3W22A 4O4WA 4IM4A 1J2WA 2YIHA 1UWUA 4F9DA 1TUXA 4G8TA 3NSMA 3F5KA 1EC7A 1EP3A 4FNRA 3V0TA 4H8NA 1NU5A 4PZVA 2OYKA 1G94A 3PJTA 5HATA 4HNOA 5C9WA 5FA5A 4BF5A 3UWQA 1QASA 1WPCA 4OUEA 3BJTA 3STFA 3LHVA 3C0QA 2QR6A 2YFOA 1P0DA 2PRMA 4PC8A 5H6HA 4F0KA 3MJMA 3SCRA 4MNJA 4RUBA 4F66A 4RZ4A 3AIBA 3TXZA 4HOZA 2J9XA 2QUTA 2QQ6A 3GTFA 1S5WA 2DVUA 4UB9A 5DANA 1W0MA 2AAMA 3M44A 2INEA 4W88A 1L2UA 3A4AA 3CZ8A 3KRSA 3ATZA 4C6CA 3M64A 2A7PA 1Q6CA 2XH0A 1V93A 2VZTA 2F38A 3AQUA 4NZ4A 4LAMA 4QQ3A 1RCQA 4TVCA 1XLMA 3TWBA 4CGTA 3SQMA 3R8RA 4HYRA 2FZBA 1QK2A 4WXZA 1EP2A 1KFJA 4JDYA 4MJ4A 3WLIA 4JBRA 3RU8X 1GJWA 3IJIA 5E0CA 4XZBA 3GR7A 4GY7A 3LGGA 2O9TA 2PZ0A 3M7SA 3V16A 2VZUA 2JQXA 4LNYA 4W85A 4KEVA 4ZODA 3UWVA 1EKOA 1AK5A 4OOUA 3DBNA 3P62A 1RCXB 3NPUA 3BMWA 3LY0A 4AXKA 1XDMA 3HGOA 1Z89A 2D2OA 1UZHA 4E0CA 4MWAE 3ZWTA 3WUEA 2GJRA 3VNIA 3CQKA 5U7SA 4GG9A 1DQWA 3W70A 2A85A 2OT0A 4FZIA 2J7BA 3PG8A 1ZFJA 3KP1A 4R9XA 4FOJA 4ROQA 1FHVA 1MEIA 4UNIA 5JMUA 2FGLA 4PTVA 3W85A 2RGMA 4N6EA 4L5ZA 3TKFA 3RM9A 2VX7A 1RBLA 3CBWA 4OBSA 4YHGA 3WNOA 3L4ZA 3GTXA 3BGGA 1HP5A 4B9YA 3EEZA 4DYKA 1I4NA 1TJ2A 1ENUA 3L2IA 4C91A 4LUIA 4KT2A 4O52A 4XZWA 2EAWA 4XAZA 4YTSA 4YVVA 1QR7A 2VO5A 3RPTA 4LC6A 1J6OA 1NELA 3KBSA 5TIMA 1RK6A 1W9PA 2ZXDA 3E9AA 1Q6OA 4IFOA 3KCLA 2I7GA 3W26A 2R1LA 2HTMA 4NYUA 5EMUA 2FMNA 3ENLA 2OZ0A 3NGFA 3VIGA 5K3VA 5BRQA 1DVJA 1GPFA 4XAFA 3SCNA 1AL8A 5BRBA 3EA1A 4Q8OA 5A6KA 4MG4A 2GSEA 2PDKA 3E38A 1H61A 4QG6A 4GYJA 4IF2A 5DCBA 3ZSSA 3FYPA 4DI8A 1AQ0A 1XFCA 4A05A 4DJED 3OLIA 3S2JA 5AC6A 3CMJA 1UWRA 2F2HA 2P1FA 4C6MA 3C2EA 1VH7A 2V69A 4PSPA 1P7TA 1BRLA 4KCUA 4M6PA 5HANA 2UBPC 3JZUA 3GG1A 3NZPA 3CHCA 1KBIA 4IJCA 3BG9A 1HKJA 5G2HA 3VUPA 1W5MA 3LXBA 2J4GA 3MV11 3GHRA 1U5HA 4N9CA 4LW7A 1XISA 1R86A 3VCNA 1TTPA 3FKRA 4JIQA 2ZX9A 3ZZ1A 4X60A 3OVPA 2OGYA 1I2NA 4XD6A 3GRIA 1KM6A 2C16A 3CEPA 2A0NA 4LEFA 4IGMA 2VR5A 3LZ3A 3ES8A 3W1AA 1X6NA 3VNDA 3GXTA 2HCVA 1GHSA 1UUMA 1XKJA 5HMSA 3W2NA 1NP0A 1AFSA 4H7CA 3DYPA 3REQB 2HZGA 1ZAHA 2VCBA 1OFRA 5CPQA 2NVAA 2GJLA 4D6HA 4XK2A 3IWPA 4XTIA 4AEOA 1FH8A 4L7ZA 2R6OA 3GVQA 4AY8A 1PUDA 2GDQA 1NWTA 1YNPA 1RY0A 1TQJA 4ICMA 3NXLA 3TCSA 3BLFA 3UWYA 3QKZA 4WDWA 1FWGC 4MJZA 1CENA 3NM1A 3TH6A 1MRAA 2X1UA 2HEJA 2CZ5A 3FGCB 4QAIA 1BWLA 1FFQA 4CU6A 4N2YA 3A3HA 4M19A 2JF6A 2HVNA 4PUUA 1MVYA 3HQNA 3BLEA 3N2BA 3W28A 3E5PA 4QG8A 3KOXA 4O1BA 1S39A 1XYAA 4UOJA 4O0ZA 1BG4A 2GK1A 3GW0A 1B4EA 3HV9A 4CD5A 4E2BA 3IACA 2VZSA 4S3AA 1HL9A 4DXVA 2VRQA 4M3PA 5C70A 2PWGA 4RDWA 1PIFA 2P88A 4BEQA 1RD5A 4DXKA 1MW0A 5DMNA 2GQAA 4Z1BA 4JTLA 4EOUA 4L9XA 1POJA 4HZMA 1RALA 4ZOEA 4QISA 3B8TA 1A47A 4D8LA 3NQMA 3MA8A 4AWEA 2CETA 4BKNA 3C8FA 5EL1A 3SGUA 1LQ0A 2VHLA 3IAQA 4GY1A 5DY2A 3GS6A 4PUEA 1HW6A 3PZVA 1TPDA 4IXXA 3CGTA 4DF0A 1QXLA 2G3JA 3E2SA 2CKRA 1ITQA 3K4AA 3P93A 1JUKA 2X7WA 1S1PA 4A6GA 4TIMA 2W91A 2C8NA 3BOLA 3CHFA 2HNHA 5A6TC 1D2KA 3GHTA 4NQ1A 4MWAB 2BFGA 4ZB0A 4BWLC 2GJPA 4W86A 3OA3A 1V6TA 2DW7A 3DUGA 1JF6A 2GDVA 3WUFA 4KWUA 2WO5A 1JDCA 1MDLA 1G69A 3T78A 4URIA 2QJIA 3BZJA 4LYKA 3LERA 1JFXA 1GOIA 3TYZA 2VM8A 2WWDA 2RGLA 3UJFA 4MNLA 4A8IA 4B15A 4IL2A 3BE7A 2VFFA 3NCOA 2FKPA 3PANA 4YTQA 3S4TA 3TQKA 4I7UA 3WK3A 3NO1A 1WDPA 5G4HC 3U0HA 3QQ1A 1KTNA 3MYPA 2NVDA 3SY1A 3W00A 4E6MA 3AIQA 3LCFA 3QZAA 1EHNA 4O14A 3KE0A 4PB3A 4A8RA 4GUFA 2ZUVA 3AXMA 5GJNA 2OYLA 3SSJA 3NJ3A 3QV9A 3CAQA 3IJQA 1MQRA 1UPMB 3AYRA 3BCFA 1XRVA 4RE4A 5LHFA 2NSOA 1MUMA 5PTDA 3BAJA 2QAPA 3W71A 2ZZ2A 4F40A 3H8AA 4IOTA 3N9KA 5I3KA 3TR2A 3FV9A 3SCOA 5I02A 3L12A 5I2UA 3DC8A 3B8WA 1KA9F 3MUY1 4J27A 4E8CA 1D9EA 3EWDA 1OABA 4UTWA 3IUHA 2GUUA 3QFWA 5ABFA 4S3FA 1A53A 4PH6A 5I6SA 4K68A 1WXJA 1V0MA 4J40A 3CMGA 4NZCA 1JCXA 1TB3A 1JDFA 3E0IA 1SO6A 1ALDA 2ZDSA 3WL0A 3JRKA 4DNHA 2ZX8A 3N17A 4M1BA 3REQA 3MMDA 3IGUA 3W73A 4R53A 1XBVA 1SM9A 2ISDA 2FZNA 2E5CA 2ZBTA 3W7QA 1KO0A 5FCZA 2PF8A 3A22A 1SMDA 3ZT6A 1NH6A 1A50A 2PWDA 3BPWA 1V79A 4DELA 3OLEA 3XISA 2DPEA 3V0SA 2O55A 3PBYA 4MDPA 3WEZA 3UZJA 1OIFA 1XD0A 1VBUA 3I6EA 1SFSA 4R5EA 3IGSA 1ITUA 3CH9A 4C6JA 4XUYA 1YHTA 3STGA 1WZAA 4Z2JA 4S3GA 3UJSA 2EG7A 4ZZ9A 1SFLA 5FJUA 2D20A 4O15A 3MT1A 2YX0A 3SJNA 1GZJA 2EQDA 3MUXA 2LLEA 3C3NA 3AS3A 4H04A 3RMJA 4RW3A 1W56A 3RGTA 3S9YA 1DTNA 1A4LA 2CZDA 4GKLA 3P0WA 2JIEA 1VEOA 4ZOCA 1V5XA 1PKNA 2WVVA 4H9TA 1VHNA 3QVQA 4A3UA 5CSYA 2Y62A 3TE9A 1EPVA 3ARVA 4XZ9A 1IEVA 4PULA 2BOGX 1EXPA 1OB0A 4PRRA 2ACSA 1AG1O 3AWOA 3FEMA 5JVLA 4UR8A 3QC0A 1VF8A 2YL6A 3VGEA 2YOCA 3C3UA 4NHVA 2CLMA 2VZOA 3GZAA 3K8KA 3K8LA 4KRUA 4EXBA 3ITOA 1V02A 4Q7BA 4U2YA 1IWAA 1OCQA 4WHBA 1PPIA 2PDNA 3WQEA 5FJTA 5FEXA 2JKPA 3GNNA 4J3SA 5K9XA 2XFYA 2WK2A 5E09A 1H5VA 2NZLA 4QM1A 4QJ3B 3UZ5A 4Z1YA 5A94A 3CQHA 3V4BA 2WBGA 3LB0A 4MNMA 3EMCA 1BD0A 2DORA 1YIXA 2ZUUA 3ZR4A 4Z2HA 1EO5A 4GUGA 3RR4A 4CU7A 1I0BA 5D9OA 4G6CA 3A47A 1WZMA 1W9XA 2QAFA 2JF7A 4LT9A 4ZVJA 3P0XA 5A6AA 1OADA 1UHVA 4MFEA 3PPGA 1NQ6A 4L4MA 3A4WA 4C5YA 3D5HA 4JNZA 3I3BA 1OFAA 1Q8JA 2REQB 2V2DA 5EYWA 3CUXA 1UKQA 2XDFA 4JNYA 4WXYA 3RR1A 4AVOA 3FK4A 2C6QA 4KQNA 2YB4A 3S1VA 1JZ5A 3KHJA 2G3NA 3BSGA 1NSJA 4LV9A 2PDFA 1TCDA 1PVNA 1TWDA 1W3NA 1ZAJA 4IGNA 3KLKA 3IIXA 3UJEA 5CAHA 3B8UA 4Z42C 1X38A 5LA2A 4W5UA 2VUYA 4INFA 3EXTA 2PP1A 5LNVA 4C1KA 5CJNA 4EWJA 1FCBA 1AJ0A 4DYEA 4WK9A 4Q33A 3S5NA 1IGSA 1CGTA 2VXNA 4N0RA 3UYCA 2YCEA 3WF2A 2RAGA 5A6BD 2J74A 3BXWA 5T8GA 4HT3A 4GNJA 1RPKA 1LOLA 3DFOA 4MWAA 1LZOA 1F07A 3HPSA 2YLLA 4AX6A 1TRIA 3T2OA 4C6IA 4XVDA 1XD1A 3BARA 1N55A 1FHDA 2OQHA 4Q8MA 5GNXA 1T40A 5IXEA 1CB7B 4GJJA 3MZNA 4O28A 4ORIA 2J77A 2PMQA 3P8JA 3B9NA 1I2OA 3NG3A 4B3LA 2G3FA 3CUIA 1DQXA 3WNPA 2JEQA 2HE8A 4GXWA 1R7AA 1XIGA 3VC6A 4PUKA 7TAAA 2PLJA 2NT1A 2RDTA 2HV5A 3HN3A 3OLGA 4EPEC 1F6PA 4EIVA 2Y8VA 1E9YB 4WRHA 4IIFA 2IPFA 3N29A 3DGBA 1S2CA 5ABHA 3OU8A 4D6GA 1IV8A 4LGXA 1XWYA 2E25A 1XBYA 3RM4A 4NX0A 4DXXA 5FSEC 2HQAA 1FWRA 2OZ8A 1E0WA 4IWWA 1EIBA 1MQPA 3QPZA 2X0SA 2PGEA 3UJRA 3C61A 4PMVA 1QNVA 2XZ7A 2OWXA 1V0KA 4V15A 1W5QA 4WIWA 3T0AA 4PMRA 1DTUA 4L64A 3GWQA 2ZUWA 3CUGA 3G2GA 4AZCA 2IQTA 1R87A 1JI1A 5CPMA 3L23A 3N6QA 2ESCA 3MUAA 4BJHA 4D2JA 2OSYA 3M46A 1LOSA 3CUZA 1SVDA 3ZVHB 1KFCA 2ZZ3A 1KM1A 5A3HA 1QCWA 3GKAA 5D33A 3BH4A 1R3SA 3UXAA 3DHUA 4M80A 2E67A 7ODCA 4IQLA 1C7SA 3OBKA 4L1XA 1UC4A 4XV0A 4GVHA 2CBVA 4R88A 1XRFA 3GXFA 1XFBA 1TTJA 1UD2A 3LSBA 2NX1A 2EPLX 3OZMA 2X1IA 2V5CA 3NDZA 3V5CA 3ZFHA 2VRJA 2ICSA 5E0FA 3MS8A 1A49A 5BROA 2V5KA 1X98A 4RXGA 2ZZ6A 3FHQA 3PWIA 3S9ZA 3ARXA 3JR2A 2C1HA 2BNJA 2F7FA 4O13A 2CLPA 3BURA 1GVSA 2WLZA 3SAZA 5HNTA 1PE1A 1Q3NA 3B0YA 1CCWB 2WHJA 4JQ2A 2CKSA 4UTMA 3DC0A 3B8IA 3O6YX 4LC8A 4R3UA 3KTSA 3TW6A 4B4FA 2CZEA 1R46A 3HBLA 1P6WA 3IGXA 2PCQA 3R0UA 2FJKA 4UTIA 1WP6A 3TJIA 2QCNA 1UOZA 2IKGA 3HPXA 3QF0A 3W0KA 2X1RA 4ATLA 1NOWA 3DKLA 3H7RA 3C86A 5CJMA 2J13A 4X9SA 2OT1A 1Q85A 3G22A 1KKOA 4Z1AA 3TC6A 3M9YA 2BB0A 4LALA 4JHOA 4BI6A 4DX3A 3UPWA 5BOFA 3EPMA 1XIIA 3AU2A 4H6QA 1JZ4A 4MB1A 2PGFA 1JAEA 4RX0A 4G1NA 1T8XA 3VINA 1BWKA 2H9AB 1AH3A 4HPGA 3CAKA 1LL6A 4I6VA 3CIXA 3W53A 3WEOA 3L2LA 2Y2WA 1JYXA 2CEQA 4BCEA 3S2MA 2FTPA 4RDYA 1RVKA 4A8NA 5A6SA 1OEPA 2ZC1A 3N1AA 3KBVA 1JZ7A 5C9ZA 3S1XA 3SQLA 1SYTA 3PPFA 4FLOA 3PZTA 4O19A 3URBA 4L6DA 3SRKA 4O10A 4TMBA 1M65A 4IP7A 4PL2A 3W1XA 1IZCA 3IV3A 4CCZA 4Q7NA 4FR6A 1BVWA 4M7SA 4IGHA 3AHTA 5GJPA 3UQNA 2VC7A 3LV6A 4OT7A 2NV2A 5FJOA 3U4AA 1XYFA 4DF2A 3ZJ7A 1R3WA 1ZBVA 4HCHA 4K8GA 3T08A 1ZTVA 4KKXA 4CQDA 2NQHA 4OQVA 2X2YA 2YBUA 4NG3A 4AH7A 2EG8A 2CBJA 1OC5A 3DIPA 1TUFA 4OBTA 5IM51 4UXDA 2CHNA 1I45A 1CECA 1VYSX 2JFEX 1LUCA 5M2FX 1DEDA 1JCTA 3MCOA 4IG2B 2HXUA 5C9XA 3M5XA 1LM1A 7ENLA 1ME7A 2WSQA 4QFUA 1EGZA 1DORA 1O5RA 5I3HA 3ANVA 1UR8A 3EOLA 2ZCGA 1YADA 1Z41A 3AIVA 4HNNA 5FF3A 2FHFA 1EC9A 1JD9A 3TN5A 1G6CA 1G7VA 3L7RA 3UG8A 3LMYA 3BANA 5GJMA 1G4PA 4N02A 4MY9A 3EB4A 4TVDA 3W1PA 3W6MA 5CH9A 2WC3A 5DMLA 1PXGA 3FJ4A 3K1GA 3RLUA 4AZBA 2PUZA 2HPIA 1KM5A 3BV4A 4MY8A 1QFEA 4NX5A 2P8CA 1OBAA 2CIPA 2VP8A 2WC4A 3ITCA 5B7ZA 4QS5A 3L65A 5I00A 2Y7GA 3ATYA 1QI5A 5A8NA 1E3XA 3N2TA 2QVHA 2PDPA 1KD0A 2Z2AA 1VFTA 4L9YA 1R3RA 2GUYA 4O0KA 3U7VA 2NXGA 3VNYA 4AIEA 1LP6A 4HZ6A 4W84A 3AUOA 3N13A 2G96A 2BXVA 3GXNA 3PZGA 5AHIA 3VOGA 1M5WA 4RV3A 3W84A 1E9ZB 2EPKX 3H12A 5AHLA 4C1NA 3PWGA 3FFSA 3AHXA 3UEQA 1XXXA 1HKVA 4E4UA 5CBJA 3MI3A 1VC4A 1DXFA 3MP3A 4MNKA 3NYDA 1JR1A 3ARZA 3USZA 2NX3A 1HX0A 5I3IA 1EZ2A 4KBXA 1TWSA 4JTKA 2P8BA 2WV8A 5HAOA 3HU7A 1T8QA 3PUDA 4C7FA 3SCTA 3TLLA 3OP2A 3NQ6A 4B5NA 8CGTA 2D73A 1T7LA 1A5MC 2C19A 3LSCA 1QVBA 2CLOA 2ISVA 2ZZ1A 2BY3A 1NDZA 1B90A 4B5SA 4Y9AA 1O5QA 3CIWA 4KMQA 2BMBA 4ZCWA 4NJHA 1GUVA 4AZIA 1E40A 3PG9A 1W9VA 3DECA 4WF7A 3TSDA 5H8UA 1PHWA 3M5VA 1S2TA 4HNCA 3T1GA 1UASA 1EUNA 1EXBA 2WZMA 4BK9A 4UFKA 1JRBA 2VYOA 4D8AA 1NQKA 3RFAA 1S5TA 5KMYA 4GFIA 1TJRA 4GJ1A 3A9BA 1W37A 5BXSA 4HYVA 4D6JA 1UKSA 3TR9A 1TKKA 4OWGA 1ICPA 4JN8A 3HGSA 4WQ6A 1QNPA 5I03A 2E9LA 1V6YA 4PUWA 2C14A 5CQ1A 4FALA 3RMEA 1TV3A 2XGIA 4M6UA 3Q2DA 2ONEA 4LBSA 3SECA 6REQB 4UOZA 1QNSA 4PGLA 1EQCA 7TIMA 1MW2A 2DT1A 1XPYA 2DUAA 3PNUA 4UIOA 3FJLA 3WUBA 3CWNA 3FIGA 1JD7A 2P53A 1O66A 2CBUA 1GYLA 1GQNA 1ICQA 1DJWA 4NI3A 1QO5A 2Q8ZA 1P7TB 4ZE4A 5FOOA 2Q3RA 2HBXA 2Z00A 3DEQA 2TPSA 4QG9A 1YXCA 5BU6A 3B06A 1XP3A 5A8MA 1PX3A 3KL5A 3QV7A 5IHSA 1S2VA 1FTXA 4AD0A 2WSRA 2EPOA 3W1RA 4MAZA 1V0NA 4S23A 4C6KA 5EU9A 4MLJA 1TRDA 1OWQA 3QR1A 4WY0A 4POCA 2F8QA 1MW3A 3CWOX 3WJYA 4AZHA 4F8XA 3IS4A 4LOCA 1LUCB 4WSKA 3PZMA 4Q4OA 3CXOA 1Q7MA 2WKJA 3AJXA 4RE0A 3RU6A 3HGJA 3S46A 5CG7A 1YDYA 4W7WA 1JQVA 1KRBC 1KM0A 1ZRQA 3FKKA 2AKZA 3T42A 1RAKA 5FL1A 1FCUA 2WJFA 2YA2A 3SIZA 3L5AA 3GVVA 4LPCA 1PEZA 1SFTA 3W24A 2WXDM 5HR7A 1E0VA 1ONXA 4GUIA 4Z2KA 1LLWA 3W2UA 3G18A 2Z7GA 1W2VA 1A3WA 1ZJBA 2QGHA 5GVJA 1H4PA 5EMJA 2OEMA 2AAAA 2FVMA 2Z2BA 3SR7A 1UUOA 2OWWA 4YNGA 3GZ3A 3CPGA 1FRBA 4UQBA 5HWJA 4YMZA 3U5YA 3G24A 1YTDA 2BOFX 1SJDA 4PBFA 4EWND 2A3HA 3THUA 2AOSA 3SM0A 1EJUC 3NOYA 4M5PA 3LCIA 3O16A 2PAJA 3N2OA 1U22A 3LXAA 4ZB5A 2OEKA 1WKFA 5D03A 3UP8A 3W86A 4TR9A 2QHAA 3WMLA 4A3QA 2WSKA 2VELA 3R2GA 3O0FA 3ARQA 1DJXA 3WUGA 3CNYA