1EXBA

Structure of the cytoplasmic beta subunit-t1 assembly of voltage-dependent k channels
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords KV BETA2 PROTEIN
publication title Structure of the cytoplasmic beta subunit-T1 assembly of voltage-dependent K+ channels.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 123
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1exbA00
4PMJA 2IPJA 2ACRA 3MB9A 3ERPA 2FVLA 2PDLA 1GVEA 3KRBA 1J96A 2PDQA 1SM9A 4IGSA 4IJCA 4HMNA 1RY0A 3GHRA 2IPGA 4JTRA 3M64A 2PDUA 1Z3NA 4JQ3A 5DANA 4JTQA 3ONBA 1RALA 2BGSA 1UR3M 4QBXA 3G5EA 2NVDA 3DOPA 3FX4A 2ACQA 4RPQA 4L1WA 3UFYA 3UZYA 2PDIA 4XK2A 2INEA 4YVPA 2PD9A 4QX4A 4JTAA 3CAQA 2PDWA 1OG6A 3R7MA 3C3UA 1LQAA 3M0IA 3S3GA 1RY8A 4DBWA 3BURA 4PRTA 4XVDA 1X98A 1PYFA 1S2CA 3BV7A 3N2TA 2R9RA 4JQ4A 3LN3A 3V35A 1A80A 2F38A 3EB4A 1VBJA 4H7CA 2PDGA 1EXBA 2DUXA 2FGBA 3LQLA 2I17A 4DBSA 1ZUAX 3B3DA 1M9HA 2HVOA 2CLPA 5C7HA 1ZQ5A 2ALRA 4GQ0A 1XGDA 3Q65A 2HEJA 4G5DA 1YNPA 1HW6A 1T40A 2PDJA 2PD5A 5KETA 4PUWA 4WEVX 2VDGA 4OTKA 2IPFA 2PDNA 2HE5A 1VP5A 2PDMA 2R24A 4ICCX 3V0UA 4JQ2A 1EL3A 1S1PA 1Z8AA 1LWIA 2IS7A 5HA7A 2PFHA 3UGRA 1US0A 3UZWA 3VXGA 1S1RA 4GIEA 4Q3MA 4R9OA 2PDHA 3LZ3A 3UP8A 2WZMA 1PZ0A 3CAVA 2NVCA 2BP1A 1T41A 1ADSA 4I5XA 4FZIA 3GHSA 3LZ5A 2ISFA 4WDUA 2INZA 3RX4A 4PR4A 1IHIA 4WDWA 5HNUA 4XZLX 3T42A 3UZZA 4GACA 3O0KA 4JQAA 4DBUA 3D3FA 3R8GA 3V36A 2PDXA 5HNTA 4H8NA 3WBYA 1MRQA 1Z89A 4WGHA 4YVVA 1AH0A 2IQ0A 2QXWA 2DUZA 4LBSA 2IPWA 2PDYA 1AFSA 1Q5MA 2PDCA 3R8HA 3ONCA 5AZ0A 3LENA 3CV6A 2WZTA 4LAUA 4JIRA 3GUGA 3O3RA 1X97A 4F40A 3M4HA 5LIXX 4QXIA 2PF8A 4EXAA 5AZ1A 4YS1A 3EB3A 1EF3A 4PRRA 2AGTA 2IKJA 3LQGA 1Z9AA 4IJRA 2BGQA 2HE8A 3WG6A 5JH2A 1AZ1A 3LD5A 4GABA 5LIUX 1HQTA 2IQDA 3RX2A 2HVNA 1XF0A 3LBOA 4HBKA 3CASA 4WDTA 3G1RA 1YE6A 2PEVA 2PDPA 4AUBA 2C91A 3R58A 4YVXA 1PWMA 3UZXA 3WCZA 4XO7A 4ZFCA 2PZNA 2PDKA 2FZDA 2FZ8A 2IKIA 3DN5A 1JEZA 3NTYA 4XZHA 3LUTA 4LB3A 4EXBA 4XZNX 4JTCA 3Q67A 2DV0A 3CMFA 3COTA 2HV5A 5LIKX 4LAZA 2P5NA 4JQ1A 4L1XA 1PWLA 1YE4A 3H7RA 1R38A 1K8CA 2IKHA 4JIIX 4XO6A 2ACSA 3R94A 2PDBA 5LIWX 2FZ9A 1QRQA 3UG8A 3P2VA 2A79A 4JTDA 2IKGA 1FRBA 4FA3A 5M2FX 2FZBA 1PZ1A 2F2KA 1EKOA 2PDFA 3RX3A 4XVEA 4ASTA 4LBRA 1AH3A 2HDJA 2ACUA 1XJBA 3BUVA 4XZMX 1YNQA 4QR6A 3WBXA 4WDXA 3N6QA 3U2CA 3R6IA 3H4GA 4XZIA 3WBWA 5LIYX 3LNMA 1C9WA 3F7JA 1AH4A 3H7UA 1MZRA 1Q13A 3QKZA 4NKCA 3R43A 4GQGA 4GA8A 4GCAA 3GHUA 4Q7BA 3UYIA 1AZ2A 1S2AA 4FALA 3V0SA 3EAUA 1ZSXA 2J8TA 4MHBA 4JIHA 3MC5A 3CV7A 4LB4A 1ZGDA 4XAPA 3BCJA 2I16A 4FAMA 3V0TA 1IEIA 3UWEA 4WRHA 3FJNA 1X96A 1MI3A 1QWKA 5JH1A 3LEPA 4PUUA 4DZ5A 4YU1A 3GHTA
chains in the Genus database with same CATH superfamily
1ZP4A 1OIFA 2DSUA 1HN1A 1A5KC 4P7LA 4N42A 1K4GA 3U2EA 6ALDA 3MI3A 3QV6A 2PDQA 3VMPA 5HBFA 2QVNA 3OQ8A 2JGYA 1Q8AA 3FHAA 2VL4A 3RM4A 2VRKA 2YXOA 1XRTA 3S46A 2DSWA 1AUSL 1K7XA 3BLKA 4PTMA 2Y88A 1O5XA 1FXQA 1DTNA 1GKPA 3BICA 2QJJA 3KWSA 3T0CA 4HJWA 3WQ5A 4L1WA 3ME3A 1QJWA 4S3DA 3H8AA 4MJ4A 3ARQA 1TJPA 1QK0A 4J2MA 4O28A 5DBUA 4E4FA 1E1FA 2PAJA 5IM51 2OYMA 1V7AA 3GR7A 2HZGA 3Q2DA 1EBHA 4KT2A 3OVGA 3BURA 4O8AA 4PMDA 1EZ2A 2R9RA 2RDWA 2PWGA 3EOUA 3BG5A 3R79A 1KXQA 4R88A 2FGBA 2DFAA 4MB5A 4RE3A 4CEXC 5CSRA 2E9LA 4UNKA 1VFHA 3N18A 4N2YA 3SQSA 2H3DA 1UWTA 1YDNA 3NQGA 9XIMA 1A3HA 5FF2A 5I3JA 2WPBA 1FWRA 4QDPA 4AY1A 3VNKA 3LHUA 3SECA 3SUUA 4BWLA 4KGLA 4FI4A 2HS6A 3TQPA 5HJYA 3JU2A 3V16A 2OWXA 1W37A 3DDMA 3TONA 2UZ9A 4Q4RA 1OC7A 2EPMX 3IV3A 8XIMA 4N9EA 2GOUA 1QPRA 4X22A 3BSHA 2R82A 2DH3A 1OGBA 3TK7A 3MSDA 2DVUA 2WLZA 2ZRVA 4WOZA 3K4AA 4S23A 4BEQA 4CCEA 4LVDA 2GK1B 2C0HA 5EFFA 1OC5A 1M53A 3RILA 2B4GA 4MPQA 4AC7C 5C54A 3AAMA 4MLRA 3VINA 4KFPA 5DXYA 1YTEA 1Z44A 3UZZA 4GACA 2CIPA 3C0LA 1AQ0A 3AMLA 3CZEA 4NAEA 3FKRA 3R8GA 5D8WA 5I24A 4NZCA 1LOQA 2A3LA 4KFNA 3OEXA 1CBGA 3S2NA 3AXHA 3U57A 1XBXA 4LYKA 3VIIA 3CB3A 3RFAA 1FOBA 2G96A 3TV8A 2Y1HA 3W1LA 1OGGA 3THDA 1MFVA 3ZWTA 5A8MA 1FKXA 2WZTA 3TN6A 1OFBA 3FIGA 2D20A 2D1ZA 4P8VA 4GXPA 1DXFA 2NX9A 1I2OA 1GT8A 3V5FA 1WOAA 2ZRXA 1XRFA 4EKJA 2GSHA 4G7FA 4AIOA 1SJCA 1A0DA 1O6IA 4KEVA 3BLPX 3PJTA 1XQLA 3L67A 4P2VA 3SZ8A 1SMDA 1EIXA 3BK0A 1XDLA 2YDAA 2ICSA 3APTA 1WNOA 1F2JA 4JTIA 5HATA 2V5CA 3U5YA 1RCQA 3FYPA 3PS7A 1EFZA 4JOMA 4AHPA 2YOCA 5LXXA 1NSJA 3SRKA 3ZSTA 4XX6A 4EE9A 3CASA 3CUJA 1W2PA 2QV5A 3NM3A 4GXWA 3N1AA 1L8NA 4I7VA 1OQFA 4NT0A 4XO7A 1OGSA 2Z1XA 3TYUA 3GO2A 2JBMA 2OQHA 2QMKA 3DN5A 4S3CA 1X1NA 4PRWA 1SZNA 1D2KA 4XB3A 3STFA 3K2GA 2A1YA 3EOLA 3ATZA 3UWZA 4TUFA 4JIQA 1KA9F 1U5HA 3CQKA 1GK8A 4O17A 4P5UA 3PUGA 4IFOA 4F3HA 1SJBA 2POZA 5IRPA 3H2CA 3QYSA 4F9JA 2X1SA 3R94A 4HPGA 3BGGA 5EMMA 5A95A 2ZTJA 1BLIA 3VNDA 4ZEPA 3IRDA 4WKHA 1RA5A 3JR2A 4JDBA 4IISA 1TA3B 4O8RA 1P6WA 3GFYA 4B90A 4PMNA 1UC4A 3VD4A 2VT0A 3W26A 5BU6A 2GVJA 4ATLA 3VKAA 2PDFA 1E0VA 3UYCA 4PFHA 2QCDA 4JFWA 1OABA 1EP3A 3IV8A 2XJ7A 4DWSA 4B5XA 1J0IA 4CQ8A 2FGLA 1WDDA 3HQNA 2XM2A 5SWUA 4JN6A 5DT5A 1C9DA 4LUYA 5FAJA 2GVGA 3IACA 1CGWA 1WXYA 1KLYA 3WO8A 3B8VA 1UWAA 4C6KA 3IWPA 3ITTA 4H9TA 4PUJA 1Z48A 5FEPA 4NNAA 3FLUA 3MC5A 3ALFA 3GWQA 1MUMA 3P74A 5CGQA 4WK9A 2XINA 3V0TA 4FOJA 3BTNA 1HKKA 4GVIA 3EKLA 4HCLA 4N9CA 4TV6A 5E09A 4MLJA 4KBXA 1Q8JA 4C60A 3WEOA 3GYCA 3T4CA 4GO9A 3CZJA 2ZUSA 4E4UA 4TIMA 3RRAA 4HYWA 2PDLA 2I14A 3E6EA 5E70A 2Y7GA 4PC8A 2WMHA 3GVGA 4HSHA 5GQBA 4E2OA 2CLLA 4UWMA 5G4WA 2VKZG 3IGHX 4C1NB 2E1DA 3AJ7A 4IFRA 1VENA 4U4MA 1TPWA 3DOPA 4IFKA 4ZTXA 2ISDA 1EUNA 3KTSA 3VKDA 2FPTA 1V0KA 2WSYA 4J3UA 2J7DA 4W88A 2PDIA 5BWFA 2QNEA 4YVPA 3WH8A 5A3HA 4DF1A 1FY6A 1VB9A 1GTEA 3TU9A 1TR9A 4EWND 1EB3A 3M0MA 2YKKA 2CBIA 3NQFA 2GDVA 2I57A 3EX4A 2F7FA 2OO6A 3W71A 4LWWA 5EU9A 1BPLB 1K70A 4D72A 4MDPA 3VIOA 5ABTA 5DFAA 1W3TA 1YW1A 3E5PA 2VEPA 4GZIA 1R85A 3JVAA 1FDYA 1I2NA 2R91A 4LYQA 1DIOA 1P7TB 3K46A 1ME7A 2QLYA 1M9HA 3RCYA 5C7HA 3ARYA 4G1NA 1XGDA 3GC2A 5M3WA 2OX4A 2BVYA 3OA5A 5IFPA 5F2LA 3NM1A 3RK8A 5A8GA 1RSCA 3E2SA 1KM5A 3ZR6A 1LDCA 3F2CA 5K9DA 1PVNA 2HRWA 2CC0A 1HJSA 4E38A 3TQ0A 3THQA 2VCCA 2V3DA 3QPYA 1WAUA 4M81A 5J5DA 4Z2IA 1VR6A 2R24A 3E2VA 2CKRA 1LL7A 4C7GA 1Z8AA 5K9XA 2X16A 2QKFA 5HANA 4GQBA 1E0UA 5D02A 1P6CA 1DTUA 2WW5A 4MSSA 1F6PA 4ZB2A 4EPBC 4LTSA 3EGJA 4EIVA 1XIIA 2P0IA 2ZWYA 4UFLA 4J3SA 3E0VA 4LJ3A 3FGCB 1TE6A 1W91A 1ISYA 4DJFA 1QO5A 2ISFA 1CTNA 2XTKA 4B5TA 3WLKX 1JUBA 2V81A 3G3DA 3S9IA 2O9PA 4A22A 3I6RA 4L64A 4XZLX 3FY1A 4TXEA 5HJXA 4Q22A 3C8NA 1CXEA 4B5WA 4IUGA 3WH9A 3WD0A 2NV1A 3B0VC 2ZE0A 4QDWA 2J88A 5G1MA 1DIDA 4RXGA 1A5SA 3VZXA 4WIWA 5IBXC 2G3MA 2OKOA 3SCTA 1X8CA 1E5NA 4FXRA 1UZHA 4FLQA 2RUSA 3TYZA 4QJ1A 3HURA 3GXFA 2FDMA 3L4WA 4Q4PA 2GQ9A 4BR1A 1UZ4A 4U2ZA 3CV6A 4L4MA 4IL0A 4NYYA 3RU6A 4JIRA 4UTUA 3RMEA 3H2NA 3VIJA 2WKGA 2ESCA 2DVXA 3P6LA 3DH7A 3VGGA 5EMYA 1KFCA 3MV11 1GOKA 1FHVA 3ANUA 4B2DD 1FCVA 3AHYA 4XQ6A 3C0JA 3TYEA 1AL8A 4IJRA 2A3CA 2JK2A 3CL7A 3OLDA 4MZYA 3XISA 3VCNA 1UD5A 3VZZA 4K2SA 4TVDA 3AUJA 1PTGA 1PL9A 4Y9OA 5CZSA 1H3GA 2OLSA 3KWXA 4IIEA 4FPSA 4HBKA 2ZZ1A 5TAOA 3S2MA 4MUPA 2YL6A 2FFCA 1WUFA 4U31A 4DX3A 2VZTA 3UZXA 5E9XA 4M19A 1PHWA 3CUHA 3UZJA 4BFAA 3L2MA 2V5BA 1E4IA 3N14A 5LA0A 2CHNA 2BODX 1TUXA 3LSCA 1UB3A 3T78A 3ZJ6A 1KTBA 3L4YA 1Q6LA 3R4IA 4H01A 4KQNA 1E6SM 1S46A 3FYOA 3COTA 3MMUA 4WSHA 4R7OA 3DZ1A 1OFDA 3HPFA 1HJQA 3WQ4A 2NWRA 3DERA 3KL3A 1WKFA 4RV8A 1QNSA 4IG2B 3GNXA 1TTIA 1EP2A 3CO4A 3GTNA 1XKYA 5DCDA 4ZCWA 4NF7A 3F4NA 1V3HA 2Q3RA 4DUWA 1JZ2A 3UNTA 1UP2A 1U1JA 1TRDA 1FDZA 4E0CA 2FZNA 3BAXA 4XKMA 2QDEA 2TSYA 3PPFA 4GQQA 1B30A 3SUVA 3WD3A 1HKMA 4H9MA 3VX1A 1E55A 1L6SA 3W1UA 1NFGA 3CV2A 3PUDA 4H4IA 1XCXA 2IKGA 3MMDA 2HK0A 4X60A 3JS3A 5FI8A 5M5DA 4IQLA 2J79A 4LC6A 2O92A 4GQRA 5MKGA 3GNRA 8XIAA 4A3QA 1DJXA 4JKLA 3MMTA 2WZEA 6REQA 3BL3A 3PZTA 4IP4A 4EF8A 3ABOA 3ITOA 2I56A 4ZQNA 1O95A 1OYBA 2WJFA 1UH3A 3LHZA 2WVSA 3LNMA 2WNNA 4WY0F 3I3BA 2VDIA 5D2VA 4LU0A 4FX7A 1K8YA 4IMGA 3L5AA 5DBTA 5XINA 4HZ7A 3ZT5A 1AZ2A 1PDYA 3E2RA 1RUSA 2EKGA 3OYXA 1ZSXA 4KESA 4RCXA 4WXYA 1S5TA 3F4VA 3CV7A 3DBNA 9XIAA 2UBPC 2J78A 1KGXA 1XIDA 1S5NA 4ZTYA 4AWSA 1GJPA 2C0AA 1BQCA 4WRHA 4XD4A 5D9OA 2OPJA 3WBAA 4A2SA 3BLOA 3LEPA 1UWSA 1XG4A 5BNKA 5I77A 2ACRA 1BYBA 3W24A 3CHDA 2ZDRA 5XIMA 1FCBA 3QQWA 3EKZA 3OW1A 2BY1A 3TAOA 4XTIA 1FWFC 1W3LA 4UR8A 4OIFA 1YNYA 2X42A 3KOYA 4K39A 1UR1A 4L9YA 3M0ZA 2YA1A 3RR4A 3SY1A 1CEOA 3MZ2A 1UR3M 4AD2A 3MUAA 4AVNA 2DW6A 3THCA 1RPXA 2CW6A 1GVOA 4DYEA 2BVDA 2JIEA 3OVRA 4DN1A 3S83A 1ICPA 2NQ5A 1XSIA 1OG6A 4KEZA 4HHMA 3S3GA 5A8NA 1JD9A 1VCGA 1ZHAA 1I45A 1PTAA 3SUSA 3M0XA 1A80A 2NXIA 5HNRA 1XCFA 4LV4A 3TWBA 2QAPA 1TPB1 3VOHA 4WZHA 4P7NA 3CIWA 4CU7A 3AU6A 4UMAA 2E6YA 1KM6A 3GNPA 2X0SA 5C70A 3BLEA 4TMCA 3SY5A 3LRLA 2W0UA 1W56A 4AMAA 1SO3A 1B9ZA 1XL9A 3K5XA 1FFQA 4A29A 2CBJA 1P7TA 3KP1A 4US5A 4OTKA 2P1FA 3DGRA 2VFDA 2DIKA 1T8XA 1JG9A 5HUPA 1ONRA 3VDAA 5E9AA 2XZ7A 3PN8A 2J9XA 1Q4WA 3V3WA 1MMFA 3LGEA 2WQPA 4GHRA 5C8BB 2VJXA 3H22A 3AISA 5GNXA 3VGFA 2BOGX 4Y2WA 3WLHA 5AHIA 2BB0A 3WD1A 3L2IA 2AGKA 2PDHA 4WJXA 5FJIA 3RNDA 2A0NA 5LNVA 2WZMA 3G6LA 1R3YA 4GYPA 1DHKA 3ARSA 2J47A 4H00A 2Z28A 4QLJA 4S3FA 5HMFA 2XVGA 1TJRA 2G3NA 1R6WA 2A85A 4HK6A 4QLLA 2BXVA 5CBBA 1YKWA 2RH9A 2AL1A 4PUKA 3AHTA 1W1YA 4ZB0A 3EMCA 1VAHA 1XH2A 3GQYA 4AY7A 1A3WA 2WVVB 5LYRA 1NJJA 1ZCOA 3STGA 3C2YA 3HIJA 1JULA 1O94A 4LBSA 2W9MA 3U4FA 5D9MA 4XTDA 3H23A 3VVGA 4F2TA 5IFTA 1D3HA 1E1CB 3FAXA 3XINA 3O7UA 1M7PA 3ONCA 4ZXOA 1SUXA 4PEEA 3HJZA 3VIMA 5I79A 4RNHA 1RBAA 3GUGA 3O3RA 2DPEA 4GJJA 1MWOA 4JTFA 4MZ8A 3T81A 2XISA 3A4XA 2X40A 3P60A 2IKJA 1EEXA 1DKWA 1U2YA 1RPKA 3WG6A 4M6UA 1WQ5A 1TV5A 5I3DA 2PRHA 1XF0A 4PCFA 4RNIA 3QFEA 1MO0A 3TFXA 1ISXA 4HYRA 2DZUA 5CSSA 3INPA 1VLIA 1LWHA 4QROA 3SIZA 2VURA 5RUBA 1OBAA 2QJGA 1A5LC 5HQLA 4OUIA 1Y5WA 1C90A 4FXFA 1TV3A 3ZJKA 1DQXA 3M0YA 4NI3A 1QHOA 1GQKA 1F3WA 4NXSA 1Z41A 5B80A 2A6LA 2PZNA 3PNZA 4HTYA 3KCJA 3Q37A 4AD5A 2CLOA 1W3KA 3HV8A 2OGJA 2CFFA 1Q7QA 1G5AA 7TAAA 4MNMA 4PODA 4UFIA 3DAQA 2XFRA 1FX6A 3M5XA 4LQ1A 3WLOA 4BJHA 3FVMA 3DI1A 5J5RA 2Q09A 3NIYA 3UXKA 3KVLA 2H9AB 5LIKX 1TV4A 3NPXA 1RVGA 4DI8A 3TP4A 3H7RA 5HR7A 1UJQA 3B0YA 2A21A 1EDTA 4JTTA 1Q85A 1OB0A 1GYMA 3POCA 4LRSA 1W9PA 1X7IA 3ATYA 3B8UA 4TX9A 5LIWX 4Z2JA 3HG2A 1DJGA 1PIGA 4FNPA 5D9NA 3IJQA 2DVTA 4DM1A 4IG2A 1Z69A 3TE9A 2P0OA 2QJNA 2Y0FA 1R8LA 1SW3A 1UQZA 4OU1A 2C13A 1LROA 1VPYA 3I4KA 3ARPA 1IR2A 1HX0A 2I9UA 1XLEA 2OZTA 3M6YA 2HROA 3DHPA 2DP3A 4DEFA 3WLNA 4NVTA 3NPWA 1B3XA 1QPQA 3R6IA 2NLIA 3ISIX 4YXGA 4DZAA 3R10A 1BXCA 2Y8KA 4EXQA 3TH6A 1UJPA 1C9WA 1XSJA 3PTMA 3WQCA 1W5OA 3CH0A 4YIWA 4CQDA 4NKCA 4Z1DA 5HMSA 5CEWA 3WNLA 1G0CA 2VX7A 1JCYA 2ISWA 4ORMA 4JIHA 4MJZA 4GY0A 3W7IA 2CBUA 4C5YA 1SU5A 2OWCA 3HOJA 1D9EA 3SQLA 3VMNA 4AAJA 3VZYA 2KX9A 1KV8A 4YTSA 3RM8A 3A64A 5AOUA 1C8VA 3I6EA 5JVLA 3V4BA 1ISZA 4NU7A 1OX6A 4QNEA 1J96A 2ALDA 1Q63A 3RUBL 1EDGA 4IJCA 1OVDA 3BSGA 3UCQA 1NQKA 2WBGA 1JDAA 4HNUA 2A2IA 3QR1A 3W83A 5ENLA 1TX0A 1D8CA 3IGXA 3N11A 5CLTA 3S2JA 5DANA 2ZXBA 4S3KA 3W9ZA 4Z08A 1QW8A 3MBDA 3VOCA 4NQ1A 2XFYA 3T6CA 1XR2A 3VU2A 2GGIA 2XSAA 1PS9A 5ABFA 1SMAA 4E5TA 4JN8A 2XGZA 1H51A 4DM2A 3TW6A 4Z2GA 5D2TA 1XG3A 1OWQA 1WZMA 1J6OA 3B0PA 3KXQA 2E67A 4HMEA 5DX7A 2ZFAA 5HNNA 3IVUA 4JEJA 4QIUA 1GGOA 4QNWA 3H6OA 1ZFJA 2X7WA 4C6QA 3PJWA 4KH2A 2J4GA 3CMJA 3C61A 4NYUA 2QPXA 4PTXA 2X0YA 3I7SA 1PXGA 1EA9C 2WWCA 2ZZ6A 3N25A 2VR4A 2NUWA 3S47A 3LSBA 3W1MA 1ELSA 4ERIA 2XIMA 1QOPA 1B1YA 1QR7A 2YB1A 1XBZA 2PWHA 3AIRA 3R13A 4UMBA 3JZUA 2PD5A 5I09A 3TOPA 3TXVA 1C3FA 2HQAA 2GQ8A 4OGZA 4F0HA 5KETA 4U3AA 2W92A 4H6RA 3URBA 4C6FA 2YLLA 1ZPTA 4RZ5A 3C52A 4Z1AA 3W81A 2PCQA 3QGKC 4JTJA 1O66A 2ZA3A 4CNPA 4FXJA 3N12A 1H7XA 3NQ6A 4Y9NA 2VHLA 3RLGA 3CZKA 1VFOA 1BSIA 3E5BA 3UZWA 1Y0EA 3ZR4A 3PWGA 4MPKA 1FP8A 4JTUA 3WBEA 3WEMA 1E9IA 2BXYA 3Q94A 4L56A 2XH2A 1HF6A 1EWEA 1AQFA 4P7QA 5DCEA 2BP1A 1A5CA 1M7XA 4MWAA 4ZSTA 2YGYA 3ANYA 4M80A 4H6EA 4G7EB 4CVWA 5HNUA 3WDRA 1CPUA 1TKKA 5T26A 4S3EA 1O68A 1VZWA 1PIFA 1DXEA 1CX9A 4ML9A 4GXMA 1C8YA 1MFUA 2FDSA 1KBBA 1ZJHA 1M3UA 5FJPA 1VEPA 1UD3A 4QDMA 1U1UA 2FVKA 2OZ8A 3GU1A 5HQMA 5D38A 4JKKA 4RJEA 4O1DA 1GCYA 5CG0A 3N9KA 2NUYA 3GNNA 1FXPA 4Q6XA 3PAOA 4O18A 4DUOA 1JYVA 2WVVA 2QVHA 3EPOA 1QFEA 4GUGA 1JFHA 4M6QA 1NEYA 1TX2A 2H8XA 4S2CA 4V1XA 3HQPA 2XH4A 4E4PA 1DXIA 1U33A 2V69A 4HIBA 3W02A 1XYMA 1ITUA 4Z1CA 1EF3A 3UWQA 1O12A 1Z9AA 4A4AA 6XIMA 4B5UA 2F6XA 3IAQA 1BFNA 4MGGA 3OYZA 4R27A 1CGYA 4GE8A 4O1FA 1QI5A 2JALA 2QPSA 1KV5A 1J12A 1Q7ZA 3AHZA 3SADA 3BXWA 1O4UA 3KM8A 3P7YA 1UWRA 2Z7GA 5IBXA 3IPWA 3VTRA 5D2XA 2OXNA 3IEBA 4Q33A 4DVOA 1W1A1 3B9EA 3NQAA 2IXUA 2OX1A 2C91A 4P7RA 1BXBA 2GZXA 6A3HA 1FFRA 1VJSA 3PBYA 2PC4A 3N2MA 4AIEA 4CVUA 3I7QA 2FGZA 4DJDD 3F5LA 3WFLA 1CGTA 2X41A 4ZENA 4AFYA 1LF1A 2Z1SA 3G0UA 4XZHA 4A05A 4C6CA 1OFRA 4XSMA 4AX6A 3FFSA 3AO0A 3CLWA 3B8DA 5CPSA 1QHPA 3CMFA 2VVNA 5C9ZA 3SN4A 4OBRA 4HKPA 1XIFA 4A2RA 4LVAA 5F2GA 1V6VA 3TSBA 3NAVA 1M65A 2PDBA 2V6AA 1LT8A 1EQPA 1Q2SA 1A4MA 3EZ4A 2AOSA 5CG7A 2B31A 2DZTA 2XIBA 2WMIA 1IXOA 1VIZA 2XVLA 5CJNA 1EWDA 3FV9A 3GIYA 1BYCA 4LAMA 1S39A 4OJYA 1PZ1A 4A8RA 3RF9A 3MU7A 4EPKA 2J7GA 4TVCA 3VABA 3LCFA 4WJEA 1X6UA 3R2GA 5DEZA 4Z42C 3MZNA 2GOKA 3WQOA 1M03A 4AU0A 4BCEA 4UQ9A 3T44A 1DEDA 4Q4OA 3GVQA 1TVNA 1N7KA 2WHMA 2YCJA 1NDVA 4GIYA 4ZOEA 3V7PA 4A8LA 3QMRA 3QC0A 2PURA 4IPLA 4Q4SA 2BXZA 1W1B1 5AC8A 4ENLA 3AS1A 3W70A 4LB4A 3E38A 4LV9A 1F9CA 1IEIA 3DHFA 1BG4A 3UWEA 2MNRA 4MYXA 4Y8FA 2J25A 2CZFA 4LCSA 1XBYA 4YU1A 2WWDA 1FHDA 3TLLA 4AH7A 1SZGA 4XKYA 2FVLA 3EDKA 1XLLA 4F2BA 1JRCA 3FDKA 2E8ZA 3W7DA 1EHAA 2BY3A 1NWRA 4HMNA 1A4LA 1XYLA 3GX9A 3IUHA 1W31A 2NLYA 1UA3A 3KOXA 1MRAA 1H61A 1OJXA 2VEGA 4LUSB 1QO2A 1W1IE 1X6NA 4Z1YA 5BMXA 2GSJA 4U5IA 4K8HA 1UOKA 5FA5A 2GYIA 5LGZA 3TQVA 1Z42A 1QNPA 3GFXA 3MKVA 3LPOA 3E0FA 1SSGA 4B9YA 2XIQA 4DO5A 4J3WA 2DGAA 1HO4A 3JUGA 2QEZA 4MTVA 3AFBA 3ZJ7A 3ARUA 4JNZA 2BY2A 2VO5A 1GVQA 3TUUA 4CQ9A 5BU9A 2OT0A 4QSFA 5JBDA 3EB4A 1VBJA 3W1QA 4HA3A 2VC6A 1YDYA 4BKNA 4LUTB 1SYTA 3B3DA 4BF9A 3M07A 3M6DA 1Q6QA 3VKKA 1WDRA 3TMQA 3AWNA 4R34A 3BO9A 4G5DA 3I6TA 3CHVA 1BEUA 4H9XA 5C9UA 1ZZMA 2JEPA 3LHYA 1MUCA 3NVTA 3RYSA 2C8NA 2OQYA 1NF0A 4REQB 3ZWSA 4Y90A 4H8HA 4Q32A 3MVTA 1IEQA 3PUOA 4KCUA 2XSXA 3GYEA 3W37A 1R3RA 2O7SA 2OEKA 5L9FA 3CTTA 4JQ2A 2C3ZA 3KEHA 3G1XA 1A0CA 2IS7A 4HOZA 3QR3A 3BQ6A 1FKWA 4PL2A 1E9YB 1NP2A 3ZYZA 3T8LA 2GQ3A 4BQ2A 1TPEA 3U2ZA 4S39A 2J62A 3KVJA 5I03A 1PKMA 4GK8A 4ACZB 4Q3MA 1W9DM 3PZUA 1TPDA 4UQDA 5FJOA 4GH1A 2VEIA 3VNZA 1XRVA 2O4MA 1ECEA 2X05A 4GZEA 3S5YA 4MKVA 3CUFA 4YL2A 4AIUA 2POTA 5F1UA 4PR4A 2HXTA 3SM0A 1KKRA 2D2HA 3LTPA 3GH5A 2V2HA 4WX2A 4CGTA 3I68A 3KX6A 5A1AA 1PX4A 3XIMA 4IICA 2P8CA 4G8TA 3WNPA 4UTWC 1GTHA 3BWWA 2ZBTA 2PZ0A 1J9YA 1AQMA 3NZQA 1Z89A 4LNCA 4IQDA 3W7QA 2OEJA 1FBAA 1JUKA 3QV7A 3T0DA 5H8UA 2ZYFA 3W07A 3W72A 1A5OC 3W4RA 1JZ6A 3BQ5A 4JNYA 5G1TA 2RDUA 2JEQA 1V79A 2H8ZA 1F8IA 1L0PA 5EA9A 1S3HA 3T0TA 4NZJA 3GC5A 1K6WA 3C5QA 2DEPA 2I1OA 4INFA 3GRIA 3KE0A 3EB3A 4FR1A 4DO4A 1W3HA 2XM1A 1E3ZA 4GWEA 4GC4A 3RMJA 1XD0A 2VD8A 6TAAA 3T40A 1HG3A 4LYRA 2J7EA 3DHDA 3QSTA 4DY1A 4YLWA 5A6LA 5JH2A 3A12A 2G97A 1EJTC 3VNIA 1XS2A 1ITXA 1XDMA 5LA2A 2PWFA 1S2UA 4G1KA 4ZOBA 1D8WA 4CD4A 4IGMA 4O57A 2QF8A 3U8GA 1MYRA 1CXKA 3QGAC 1YDOA 2X1RA 4FLSA 5C6MA 4YVXA 1VHCA 5E0CA 3BDKA 3L4TA 3B0XA 3NZPA 1Y5XA 4GYKA 3HPSA 2W3ZA 5CPMA 2PDKA 3QMTA 3HG4A 4QITA 2OOGA 4MF4A 2GJXA 1LUCB 1JCLA 4AHOA 4G9PA 4FLOA 2Z27A 2PPGA 2V68A 4M1BA 2PSNA 4RR4A 3IVSA 1GZJA 3IVTA 4KCWA 3B4UA 2Z4GA 3NWRA 4MYAA 1FWTA 3BW2A 2OKTA 2Y6ZA 3IANA 1N8IA 5EPDA 2IKHA 5FD0A 3MYPA 1G7VA 3L23A 3CQHA 4JX4A 2JKEA 3DFQA 1IEVA 1V02E 3NO5A 3PPHA 3KCOA 2R1LA 1T7LA 3FXGA 2G95A 3B97A 2PWUA 4UFHA 2OSXA 5LHFA 1ISVA 4JFVA 2VMFA 3BCDA 2F2KA 4AEFA 3JRKA 4L6DA 3GW3A 5HMEA 1FWJC 2C16A 1QTWA 1IWAA 3DEQA 4I6KA 6ENLA 4QCEA 4GLEA 1EPXA 3G6MA 4O4VA 4PBGA 4YN5A 1HGWA 4DZHA 4AD3A 2E09A 1MZRA 3QOMA 4JTLA 1BF6A 2EHHA 2NVAA 4CUCA 2NSXA 5T9CE 2J24A 3UXIA 4WUIA 1E71M 3A13A 4AVFA 5MHBA 1GONA 3WFZA 2NUXA 2QV4A 4IIFA 4Z2LA 2J7CA 2BFGA 1OFPA 1W9BM 2HWGA 3VAVA 3WH5A 2E5BA 4K68A 3SN1A 1VRXA 4U33A 1ZCCA 4HNLA 4NIRA 5HR6A 3GUWA 4KCVA 4PMUA 4UQBA 2BMBA 2VEKA 3OG2A 4IGSA 2DZAA 4AWTA 2Q8XA 2J13A 5HQEA 1K9DA 1GJWA 3C4UA 3HMCA 4US6A 3U4AA 1JXKA 3GG7A 3RO8A 1J5SA 1CCWB 3OZMA 3URAA 4UQCA 1BAGA 5CH9A 1E15A 1GORA 2FH6A 2D0HA 2NVDA 4M29A 4C6DA 4QGCA 1GW9A 4DWSD 3GXDA 4ZB5A 1KXTA 4FF5A 3ABSA 1UP3A 3B8TA 2I7GA 3ZQ9A 1OY0A 3PJUA 3CEUA 3VKBA 4FNQA 2PD9A 2HCVA 4GD0A 4K6AA 1KM2A 1Z7AA 4B91A 2ZZ2A 1DWGM 1AJ0A 4JZ5A 3QKEA 4GG9A 2E6FA 2KZHA 1RJQA 5GJMA 2VGIA 2GUUA 1EJ7L 5T8GA 2WJZA 1YHTA 1OFAA 3N3MA 1EC9A 1RY8A 4FXSA 1U83A 5JQ9A 3TTEA 3LLXA 3FYYA 3VM7A 3F4DA 3N2TA 1JUEA 1XV8A 3RLHA 4PGLA 1FWGC 3QEZA 3WUGA 4V28A 3PZGA 3W6MA 3K30A 1FH7A 3W1TA 2I17A 4PL1A 2YDRA 5LXEA 3UERA 2C6QA 4IMDA 2B7OA 1TIMA 1HFBA 4D8LA 4ZQPA 3VILA 5CXPA 3T2PA 1M5WA 2F6UA 4Z1BA 2YYTA 1IZCA 3A4AA 1DBTA 2FTYA 1V51A 2Y24A 1GEQA 3VK5A 1KFEA 3NA8A 4AVOA 1IIHA 3GTIA 3IK2A 4WD0A 1MW3A 1VYSX 1E73M 4ICCX 3CU2A 3DFNA 3EWWA 4PFMA 3FDGA 5CCZA 5HA7A 1SR0A 3P3BA 3DENA 3BVJA 2V82A 5DMMA 3WLPA 2NXHA 3N2CA 2V2DA 4REQA 1TWIA 3E2QA 5BRQA 1S2WA 3M7SA 3UP8A 4EVZA 4G6CA 4MDOA 5I5RA 3M7WA 4FNTA 4I5XA 5DRIA 4L6OA 4NNCA 3LZ5A 4IX2A 4RE0A 2AKMA 1H63A 1KBJA 1K02A 2I5QA 1UPMB 1SO5A 4P8XA 1EOKA 5FL1A 3M5YA 5AECA 3TNBA 4ACZA 4FO4A 2BHYA 1CGUA 1UKPA 4IMCA 3VDGA 3IJLA 1ESWA 3VNLA 1YYAA 4FR6A 2ZXQA 1NDZA 3F4CA 5HNTA 1NELA 2YSWA 3UPMA 1GOWA 2PU0A 4S3BA 3TYAA 4Q8TA 1KKOA 1R9XA 4KKXA 2J27A 3DYPA 4KF1A 3UR2A 3A4JA 2PS2A 3DFSA 4ZO7A 2CHOA 2V8ZA 1GYLA 3EPMA 1MXDA 2DQXA 1E0XA 3SCSA 3K8KA 3L9CA 2PF0A 2FMOA 1UR8A 1JQVA 4XV0A 5A94A 3BAYA 2PA6A 1YDVA 4G56A 3KDNA 2P8BA 3ARRA 1KXHA 2UV8G 1REQB 2AL2B 3WUFA 3WLSA 1K9TA 4HU0A 1MW2A 1SZRA 1CXFA 4AMCA 5AZ1A 2YDSA 2DZWA 5EMLA 4IWWA 2YA2A 1QATA 6XIAA 4B15A 2QMJA 4M8UA 4B5SA 4N4PA 3B9AA 5LA1A 3RO6A 3SR7A 5LIUX 4C6OA 1O1ZA 4DO6A 2G50A 1WXJA 3EOSA 4DJFD 4FP1A 3CM4A 1M01A 5ABGA 2OMAA 3ITLA 2NW0A 2YBVA 1NDYA 3IUIA 3W28A 3WUBA 4I5UA 3FSTA 3S4TA 1XINA 4AIBA 1S38A 1EYWA 3NQ8A 4UCFA 3LHTA 2GVYA 1TWDA 3APYA 4ATDA 1UYQA 3OLEA 2YW3A 4R5EA 5TNVA 3TZNA 4HU3A 1CZ1A 2VUYA 3ES8A 1L6YA 1M6JA 2P53A 2VOTA 1VHNA 4KETA 2QDHA 2WOQA 3N2BA 4TX8A 5K4XA 1V3LA 1LBMA 2F2HA 5AKQA 2W27A 3KL0A 4U2YA 2G41A 4O11A 5U4NA 2WSRA 1UHVA 5I3HA 4FMVA 1LRNA 4JIIX 2OEMA 1UW9A 4C5ZA 1YPIA 4PUMA 1RJRA 3HB9A 3OU8A 2NSOA 1V4YA 2X30A 2EBNA 4JTDA 4Q8OA 5D09A 4Y9AA 3VOFA 3R0UA 4W8BA 4FOUA 4IPPA 2H3BA 1X38A 2ZE3A 2RJGA 4ZOAA 4R9XA 1OZQA 2ZRWA 3U7VA 3MUCA 1TMHA 2CZ5A 1POKA 3FA5A 1NARA 1AMYA 2CETA 4WSJA 1XLDA 3N13A 3L12A 3QYQA 4XZMX 5E5CA 3PAJA 2Q8ZA 2YJQA 1O5QA 4E6MA 1V08A 4UTTA 1TB3A 4GI4A 1TPUA 3W27A 1WBJA 3UXAA 1TZ7A 4LALA 1K9FA 2TAAA 2WJEA 4O15A 3A22A 1SVDA 4L1GA 2YCLB 2Q71A 3GTXA 3T55A 2PWVA 1VJZA 2G4FA 2GJRA 1TZZA 3RG6A 3N2XA 5HAOA 5BOFA 3EWBX 4UB9A 2IQTA 4DBEA 1T5AA 4K1WA 4LVBA 1NP0A 4C7DA 3P5YA 1AVAA 4A3UA 4E2VA 5FF4A 1ZBVA 2IPJA 3CWHA 3BMXA 5CSYA 3KFTA 3UT0A 3I3DA 3NZRA 4A8IA 2WLYA 3BOLA 2OZ3A 3G1SA 4LEQA 3BOXA 2ZA1A 3KTXA 6PTDA 3SCQA 1VCVA 1XICA 2ZXDA 2OGYA 2OLHA 3NSMA 1BTCA 2CHRA 2PDUA 3EOOA 3LV5A 2EJ1A 2IUZA 4I90A 4R33A 3WQEA 3T8QA 5CBIA 1IT7A 1QPKA 1KRAC 4W85A 3TTOA 3V75A 2VQUA 4MB1A 2JQXA 1HL8A 3WQWA 4N7QA 2HNEA 5G2WA 1HKWA 1PO9A 3BAWA 3C2FA 4XK2A 4JTAA 4GNVA 2CCRA 3N4FA 1PZ2A 1V02A 3CH9A 2BY0A 1EP1A 3NPUA 2FYMA 1DJNA 3M0IA 4Y9PA 3UA3A 1GVSA 1H60A 4OUEA 3RLUA 3OG3A 3FEQA 3G1FA 2QJIA 2OO0A 2VX6A 4JQ4A 1FWDC 1TTJA 3TW7A 4EOUA 5B7ZA 1W32A 4JICA 1RQEA 2HBXA 1EO5A 1J79A 3NQ7A 5H2ZA 1KFJA 4H2CA 2PE4A 3R12A 3HN3A 5K2ZA 4KRTA 1JQXA 1G4PA 4XIMA 5IXEA 1N2VA 1HW6A 2X8RA 1QHZA 2V0TA 1GVIA 5EYWA 1ZL1A 2XYLA 7TIMA 2VDGA 3GNOA 3ARVA 2PTYA 2PDNA 4DPPA 3PWAA 2G4JA 3CK5A 1OEPA 4IL2A 4OWGA 1LWIA 2FB3A 1OHLA 3VM5A 4KRZA 2EJAA 1UWIA 4PA8A 3HMJG 1KLZA 4DZIA 1TQJA 1QNVA 2ZVIA 3GKAA 2ZZ3A 2OYKA 4GIEA 1G9HA 4JTSA 2JIWA 2J66A 1BRLB 2QZRA 5FEXA 5KTLA 1TJ0A 4TTGA 1DJQA 1S2VA 4FZIA 7ODCA 1KTCA 4UXDA 5C2CA 4D9PA 1RBLA 1FWEC 3JW7A 2PODA 3UR8A 3WY1A 1CLVA 4V33A 1FHUA 4HVXA 4LF2A 3KZSA 3UPWA 1TZ9A 1JR1A 1F4HA 2V5KA 1EF2A 1E9LA 1YRRA 3RM9A 1A5AA 3WN6A 4UTHA 2IPWA 2F6KA 4RNJA 3AIBA 4QS5A 4JTHA 4QFUA 3QM3A 4M6VA 4CCZA 4HMCA 4E3TA 4J4KA 3A3XA 1F76A 4US5D 7REQB 5AZ0A 5EMKA 4UUIA 1KM4A 4DWSB 5HWMA 3NL3A 5FSDC 4YWSA 1XIMA 1EBGA 3TA9A 3T4WA 3R8RA 1JCNA 1BYAA 2Y5SA 4PMVA 4JXCA 3NJ3A 2IW0A 3O63A 3M0JA 1J5TA 1CGVA 3AYVA 3KS6A 2HE8A 3KAOA 1Y5VA 2J8FA 3PZ9A 2D73A 3LG3A 2FHBA 1EHNA 1XWYA 3EWCA 1VQTA 3F5KA 4D6EA 3TVAA 1BGGA 1UROA 3SFWA 3G1RA 4O14A 2PDPA 2Y85A 4LS2A 4C1KA 4HPNA 1TPH1 4AX7A 3P8JA 4IQJA 1V3JA 2Z1VA 1ICSA 2Q02A 3G24A 5FSEC 2X7VA 1WP6A 1IYXA 4F48A 3OO2A 1I0BA 3WZ0E 3SSZA 1AMKA 4JTGA 3C6CA 1QASA 4IFKB 4GYJA 1BHGA 3WQPA 5KEZA 1O60A 4W8LA 1SFTA 3RDKA 4EX4A 5FL0A 4NXKA 5BCAA 4FB7A 1YE4A 3AJXA 1UUMA 4I9JA 4JKMA 3WJWA 2CLKA 1EH9A 4H2HA 4KIEA 5C55A 2ACSA 4AZCB 4DRSA 2DZXA 4XBKA 4Q7NA 3VCCA 4JEQA 5HPCA 4LVGA 1KGUA 4PMXA 4KWWA 2WC3A 1J93A 3A5FA 1J0KA 4Q8MA 1YXCA 5KZEA 3SJ3A 1L6GA 2XFWA 2VELA 5HXMA 1Y7VA 3TOYA 3KOZA 3CYJA 4KEMA 3SGZA 2W91A 4GCXA 4O0KA 3UETA 2HDJA 4RW5A 1PV8A 4B16A 3BUVA 1XJBA 1E6ZA 2WVTA 1W3JA 3M41A 4O13A 1H7PA 4F79A 5HJLA 3S1UA 3GW0A 2J9ZA 2E6AA 2DW7A 2D23A 2R1NA 5GNYA 5LIYX 3S8HA 3NL2A 3GY1A 1X1OA 3WF0A 3SCVA 2G8ZA 1SW0A 3KBWA 4GQGA 3KP0A 1E43A 1XFCA 2E1WA 4KPLA 5JIWA 1QOXA 3PZIA 9CGTA 4K7YA 2BZNA 2Y7DA 2Q01A 4ERGA 3BCJA 3WLQA 4MAVA 2GJNA 3OODA 4UQAA 2HJPA 1G69A 2R14A 3PWIA 1ZJBA 1VS1A 5E1QA 2Z2UA 3PG8A 1DWJM 2YCLA 1UR9A 5G2HA 1FCUA 1V8EA 4C91A 5DQPA 5C7VA 3O2LA 1WOBA 3W74A 1THFD 1H4PA 2YL8A 3OGRA 3UG4A 4GX8A 5AYZA 4PUEA 3KRBA 3O06A 4QE5A 3N3TA 1LG2A 3QHNA 4QRNA 3NDOA 2QYGA 3HGSA 4D6CA 1KQZA 3K1DA 3QVQA 3TSMA 2VZOA 1VFLA 3M0LA 1Z3NA 4QEEA 1UH4A 1U30A 4FF7A 3SCOA 5C71A 3LXAA 4IQEA 1EC8A 4ZVJA 3A4WA 3STCA 4AG0A 3LX9A 4YYFA 2BSLA 4WVXA 2WCGA 3H53A 3WD4A 1LYXA 4MY8A 4IPIA 3W84A 3D47A 2EPLX 2VDHA 3G8RA 2L5HA 4HP5A 2REQA 3MDWA 3SEPA 3QHOA 3NZGA 1OK6A 3DHUA 2Q6ZA 4B9ZA 1KXVA 3OJGA 4MIMA 1FH8A 3K13A 2FJUB 1VIWA 2ZADA 1DL3A 1IXQA 1PYFA 3WQDA 2YXXA 5K3VA 4HCHA 1U5VA 4I7UA 2HTMA 1H41A 1EXBA 3LCLA 3NNTA 1W5MA 1PE1A 3H2EA 4QE4A 1I1XA 3OIXA 3VC6A 3P82A 1ISWA 1JCTA 1ZUAX 4IXXA 3WK1A 1UKQA 2BX7A 3UJFA 1J0ZA 3DC8A 3GAYA 1XLGA 3TZFA 1S5WA 1GQNA 1JF5A 1XYBA 3QXBA 2PRLA 1R9ZA 3HGJA 3L2LA 1N8WA 2IPFA 3AI0A 1IWBA 2EQDA 3A24A 3MP4A 1K8ZA 4Y6GA 1L6WA 2AKZA 4PYSA 3ABRA 3CT7A 4J3VA 2QUUA 4E8GA 1TE1A 2VGBA 2O7QA 1O7AA 3CEPA 4N6FA 1RR2A 2YL5A 2IXVA 3O6DA 1OSEA 5G2IA 1SW7A 2WO5A 2Z0IA 1W8SA 4XIAA 3TYDA 5K9CA 4NY2A 2FHCA 1PUDA 3ARXA 3ZR5A 1IHIA 1QDSA 4CNNA 4TU1A 3WJYA 3GDRA 4W93A 4BWLC 3S9YA 4L4OA 2YR1A 3WUEA 1BRLA 3PTQA 5DMYA 3PB2A 4QQUA 5A6TC 5HDRA 2DDXA 2F8QA 2O9OA 3W2NA 4B4HA 1OINA 1SSDA 3WF1A 4C90A 2GQAA 5CKSA 4AZIA 2INFA 2VZVA 1V7YA 3S1GA 3L5MA 2VWSA 5MKGB 2CLFA 1Q5MA 2PDCA 1JXJA 6REQB 4S1FA 3U7BA 2ZUTA 1ZENA 1XX1A 3GH4A 3MUY1 4A3HA 2Y4SA 1JFXA 3TYBA 2HK1A 3PBMA 3EEZA 3UVIA 5CC7A 5PTDA 5AYXA 2PF8A 4F0LA 2OG9A 3OZYA 7REQA 4HU4A 3LQGA 5A69A 4D6IA 1NIUA 5CAKA 2DT0A 3CL6A 2NT0A 3HZ3A 1NTHA 4Z0SA 1DVJA 4MWAD 3CBWA 2V38A 1HQTA 1EX5A 4HNOA 4ADTA 3E1F1 2E5DA 1IGSA 3KVKA 3L68A 4KWUA 4W4QA 1HJXA 3PTKA 3D3AA 5LZLA 1RP9A 1YPXA 3QR0A 4WKFA 2A7RA 1OZMA 4IOTA 1KFBA 4RZBA 1V3IA 3W1PA 1OIMA 2XIIA 3JZEA 4DIAA 2XN1A 4AEOA 5FCZA 1A47A 4BY3A 4BQ4A 3WCZA 4ZFCA 5H91A 4BK9A 2OTDA 4L4PA 3G0SA 4WXZA 2IKIA 3NTYA 4EAYA 4JS3A 2W4XA 4DNMA 2XGIA 2BVWA 1E72M 1TVLA 4XZNX 3WNNA 4IJBA 3EA1A 3GR8A 4O1AA 4LAZA 2FH8A 3TN4A 4CLMA 4YTUA 4URIA 4XD6A 3DYOA 3PVFA 4O19A 4V2XA 4DQWA 1QI2A 4ICNA 1CWYA 2E9MA 1WB0A 2WSQA 8RUCA 3O1NA 4ROQA 3N4AA 1SGJA 1JCMP 4FNRA 5BOOA 4RE2A 3UG8A 1YXDA 1YPFA 2FVMA 4MADA 2EAWA 3D0CA 3QW3A 4XAYA 4Q4KA 3ID7A 1GKRA 1KCLA 2XHYA 3UGVA 4S3GA 4FA3A 3M47A 4AZCA 5H1WA 4ZQCA 3UA4A 2Y7EA 2OYLA 1L2UA 4RE4A 4UMCA 1XP3A 4WDXA 2WNQA 3LPFA 5T9BG 1MDRA 4JAWA 2PTDA 3NG3A 2V9DA 3SUWA 3OIHA 3E3HA 2VCAA 4NZ1A 4DO7A 1AH4A 3CT2A 3ITCA 4U10A 3B9NA 1AW1A 2GVEA 4JHOA 3KS5A 4AEEA 4GA8A 2WMFA 3E0WA 3EMZA 2E68A 4ZMGA 2VENA 3QZAA 5HMDA 3PF3A 1OX4B 2DUAA 3G2GA 2OFJA 1XYFA 2AAAA 2P88A 4FAMA 4KERA 3BAKA 3QRHA 3DFHA 1PCKA 5CLWA 4PTVA 1B3WA 4FX6M 1CXIA 3FS2A 2RFGA 1W1ZA 1V6YA 2CZDA 3S9ZA 5D2YA 4C6NA 1EGVA 2Y8UA 4N02A 1SM9A 1RY0A 2PCEA 3TR9A 4ZXLA 2D69A 1CW2A 1HVXA 2IPGA 4YTRA 4EF9A 2ZUNA 3CQJA 2ZVRA 3O6YX 4DNHA 2BGSA 3ES7A 2J8GA 4PMRA 1NM9A 1DE5A 4HNCA 2ACQA 2QJHA 2PGEA 1XLHA 3VNYA 3LGGA 1TIWA 3WKZA 1GG1A 4IIGA 2CEQA 4CNOA 2RGMA 4JGDA 2ZZ7A 3GXNA 3QSRA 4NAFB 3O15A 3WQGA 4CCCA 3MDUA 3VMOA 1R86A 3FJ4A 3N9SA 2PDWA 3AHVA 3TR2A 2C1GA 4G2DA 4LANA 4L61A 1LQAA 3GTFA 1UC5A 4CQBA 4NX0A 4XAFA 3CUGA 4CN1A 3AZSA 3BV7A 4UFKA 1NVMA 3LN3A 3WLTA 2BTMA 4HSOA 2EG8A 3TIMA 1MXSA 5TF0A 3TFCA 2WXDM 1HL2A 3B4YA 3U9IA 2X1UA 2R1PA 4LUIA 3DGBA 3SY8A 1VJIA 4K8GA 3NQBA 2VCBA 4XZ9A 2PBGA 4ZQRA 3QPEA 3LCXA 2WPGA 3MV01 2NV2A 1LL4A 1DPMA 2CZVA 1QI3A 4AZ5A 1B3YA 1OFOA 5A6BA 3LERA 1XHGA 3MP5A 3SO7A 2PU1A 1L9WA 4JIPA 4EANA 1S1PA 3L7RA 1X1ZA 2NX3A 4TR9A 3VDHA 4F2UA 3NOEA 4FEZA 3EBVA 4I9MA 1OM0A 3QW4B 3RPMA 1VPQA 3WLMA 3PPGA 1W5PA 1S1RA 1XXXA 5FF7A 1V0LA 1RAKA 4NG3A 4LS1A 1ECQA 1ADSA 1TPFA 4PCTA 5AYBA 2X2YA 3UWUA 3W01A 3EXSA 4NZ3A 2RKXA 1PJ9A 1HT6A 3NYDA 1TPVA 1PAMA 4W7VA 4Q8VA 3BAIA 1U5JA 1ZAJA 4Y9MA 5BRPA 3GVVA 4V1YA 3KHJA 2QIIA 4HNVA 8CGTA 1BD0A 4HZ8A 5AN7A 1AW5A 3RIKA 3WLLA 3S5OA 4H8NA 1NDWA 2E3ZA 1OFQA 4MMWA 3Q4DA 3W1RA 3FAWA 1MUWA 4I8YA 3OBKA 2PDYA 1G6CA 3BJTA 4U5KA 1AFSA 1DWHM 3PG9A 1DQWA 1JIBA 1I75A 2O9TA 1C93A 1SQ7A 2I9EA 1WPCA 4XBSA 5F2IA 2CPUA 1OADA 1K7FA 4UIOA 4HA0A 2FLIA 1KD0A 4CN6A 3IJ8A 3W53A 3HPAA 3BCFA 3U5UA 3MY9A 3AU2A 1UBSA 1TYGA 3LBCA 2XDFA 1KTNA 4NJIA 1V6TA 2VZUA 4RKAA 4JPGA 4NP7A 4FHAA 4UZUA 1MEIA 4RZ6A 1XH0A 4R3UA 5E93A 4YWIA 2FTWA 4RX0A 3UXDA 3LTSA 5AC6A 2IQDA 3LCWA 2Z25A 1LLZA 2ZA2A 1UR4A 1LRTA 3CUZA 3CYVA 1W9UA 1E3XA 4GH3A 4YJ5A 2AQOA 1PPIA 4K37A 2WV8A 3OVPA 4PB5A 2VP8A 3TSDA 4QJ3B 3LHVA 4EAMA 3ABXA 2HISA 4K3ZA 2BV9A 2GUBA 1Q6CA 1ODUA 2QCEA 4WR3A 3L0GA 1L2QA 1K3UA 1U1HA 4J7RA 4IT1A 3ZFHA 3CLMA 3LUTA 4GY7A 4EXBA 4OVXA 3LXCA 5ABFB 1VFUA 4MWAE 5HWNA 3ZMRA 1OG0A 4MOZA 2DT2A 1GJUA 3NSNA 2EG6A 4GGHA 3DESA 4WQ6A 1XLIA 3SCRA 4CCDA 1FWBC 2FHFA 3IRSA 4H8UA 1H0GA 1RA0A 4PMZA 2VOMA 5J8LA 3TC3A 1WE5A 2JKAA 1K8CA 1KFKA 2WMKA 3S6TA 1R9YA 4XO6A 3NQEA 2OLAA 1W5NA 4GRSA 1JVNA 3LDVA 5J04A 4IP5A 1NFPA 1AW2A 1QRQA 3W7JA 1JDEA 3S6DA 2PTXA 5A6SA 4TX6A 3MJMA 4AD4A 5TIMA 4CQCA 3PANA 2E5CA 3W00A 3RX3A 1HTIA 4I9TA 3WK0A 1SPQA 4QG6A 2Q8LA 4MFEA 1NOUA 3GDMA 3WJZA 4JIEA 2PLCA 3DXIA 2ACUA 1YNQA 4H8VA 4D1IA 2CU0A 5AVNA 3BSMA 2VC5A 4X3ZA 3TCEA 1OCNA 3TA6A 2J77A 2JF7A 1DJYA 4V27A 4AF0B 3D46A 3PULA 4KRUA 5LKYA 1SO6A 1V6XA 5CAHA 3QOKA 4QEHA 3QKZA 1K6AA 3R43A 1CNVA 1JJKA 1EX1A 3CZGA 3V0SA 4Z2KA 3SCPA 3CL8A 2VNCA 3EB2A 2GDUA 1FA2A 2G0WA 5H8PA 2QF7A 1DJHA 3GIPA 3MO7A 2XWDA 1VPXA 1AD4A 2EEXA 5KINA 1GOQA 4NJGA 1X96A 4OFCA 1V93A 2VD9A 3G1YA 4CD5A 3E0IA 3L21A 4MWAB 2ZZ4A 1VEMA 4D6GA 2QDGA 1OX4A 5DLCA 1ZTVA 2EO7A 4UQEA 3GDBA 5DMLA 3SCUA 4GUFA 3NQ2A 4RPPA 3MUZ1 1QI4A 4J1OA 3ZVIA 4J3TA 2D3NA 1BWKA 2NV9A 4ZE5A 4AQLA 1E6NA 1H5YA 3ALGA 3PZQA 1XRSA 1R3SA 2V5LA 4BQ5A 5FF0A 3G77A 3FXYA 1FWNA 2DZSA 1G01A 4H9VA 3IGSA 4AZHA 4XBJA 2GUYA 4WHBA 1JGMA 2WMGA 2C71A 1RK6A 1NWUA 2XVPA 1KWGA 3CIVA 1JDCA 3RR1A 1YADA 2ANUA 3CAKA 2Z1WA 4A35A 2CWXA 1YMYA 3WEZA 1ICQA 1PIIA 1GVYA 3O05A 3C3UA 3OLIA 1FWHC 4HZMA 3MCMA 4XVDA 5CPNA 4ZSUA 1JPHA 3N6HA 4DJEC 3AXXA 3C2RA 5FACA 3VD7A 1H1NA 4C6PA 2F38A 4QM1A 4NAFA 1Q65A 4M7SA 4LVFA 1TPC1 4O0ZA 1MVYA 4N4QA 1CIUA 3MANA 7A3HA 2ZXAA 4N9BA 2CXGA 1JAKA 1QBBA 4NRSA 3ITVA 3A23A 3VFCA 1HIZA 3FEMA 2WKJA 5I06A 4L80A 1DJIA 1UP0A 2X1TA 3GIQA 1MNZA 4BHYA 3MHFA 4YTTA 1CXLA 3MW7A 2Z2BA 1FQ0A 1MW1A 1KBLA 3UG5A 1LG1A 3UVAA 1IEXA 5FJTA 3NFUA 1T0OA 2WSKA 2WHKA 3QHMA 4PB4A 3UY8A 3NXLA 1LZOA 5LGXA 3W7CA 1YBQA 2FFIA 3NEHA 3UEQA 3HQ1A 4NX5A 1TJ2A 4QP0A 4PB3A 2DSKA 4Z17A 3B06A 3PK7A 1BVWA 5JMUA 2ZX8A 4ECLA 3QLDA 3VIFA 1XBVA 3CHFA 4JCLA 4E8DA 1E4NA 1E40A 3PUEA 3RX4A 2EGZA 3A47A 2C15A 3O0KA 1T96A 3IIVA 1B57A 1EOMA 1ME8A 3U6WA 5LNWA 1UIOA 4FX8A 5D04C 1XFBA 1BF2A 3TN5A 4E3VA 3WBYA 5A2CA 2WMIB 2Z29A 1PYMA 2XU2A 4AXKA 2VYOA 3QZEA 1TCDA 1HJWA 4HJFA 2QDDA 2ATSA 3N19B 3QV8A 3N6JA 3VDCA 1G4TA 1UMYA 1H7NA 4LW7A 1TJ1A 1U22A 1BKSA 2EG7A 4GYPC 3KLKA 5FESA 4BS0A 3GXTA 1FHLA 2W66A 1X97A 3MHUA 1OX5A 3NOYA 3F4WA 3QGVA 2ZOXA 4HK7A 4F40A 3S2LA 1EA0A 4XD5A 2VGFA 2E9BA 1NH6A 3W2UA 4DXKA 3OZOA 1XCWA 1Y65A 3WMCA 3GDKA 4M3PA 2WYSA 3ZVHA 2OODA 2ASHA 3RX2A 3VX0A 4F66A 2HVNA 1ADDA 1GEHA 1ZNNA 4JTKA 2WK2A 1R2SA 5JXQA 4J40A 5BW6A 3KLLA 3PB0A 2CLHA 1OC6A 4R7JA 1J8VA 1Q4NX 2XGBA 2DU2A 1DIEA 4XKYB 1GVFA 3FKKA 4ALDA 5KZ6A 1DP0A 3DYMA 1JYNA 2V63A 4A6GA 4JYDA 1RP8A 3ZJ8A 4GGBA 3OGSA 1AG1O 4IPNB 2C18A 2FZMA 3OOQA 4OQVA 3OQEA 4ZBCA 1NF7A 3B8SA 3HU7A 1RK5A 4LB3A 1ONWA 3W3OA 1R2TA 3SGUA 4HA4A 5H6HA 1QPOA 2XSBA 2EXOA 3NQMA 4BI7A 3UJSA 5AY7A 4GKTA 1KM0A 2UWFA 3QBUA 4L1XA 5ECUA 3E74A 2Q3OA 1KNWA 1M68A 3VD9A 3H2FA 4D6JA 1MXGA 5C9XA 5H8MA 3SRHA 4Q6JA 3PC0A 2BWGA 1J2WA 2XH7A 4GVGA 3R25A 3WJSA 3GXPA 3L4UA 1GUVA 3W29A 5D2WA 2ZZ5A 1H62A 2P3ZA 1F6KA 1YX1A 4UOQA 2FZ9A 3NR0A 4ZO9A 1J4EA 4HPHA 3MTWA 1CXHA 3P2VA 4LPCA 3WELA 1KRCC 3WQ6A 2WQDA 2WVUA 4RDZA 4Q4MA 3A9BA 2R8WA 3CC1A 1XLCA 1K7EA 4LCRA 4KFOA 1XPGA 5FOOA 4QCFA 3W38A 1PX8A 1ALDA 3MPGA 4POCA 4QR6A 3KVMA 3VOJA 1LQ2A 5HUOA 3EMQA 2VRJA 1EJRC 4WY0A 4XZIA 2A7PA 1UD4A 2D0GA 5DT7A 3HV9A 4KWSA 3W7LA 1IF2A 4DYJA 3N15A 4GCAA 3UYIA 4W8AA 4W9TA 4NL1A 2J8TA 1CECA 3MYOA 4GUHA 1G94A 4IPJA 4AF0A 1F61A 4DXXA 3RN6A 4I7WA 3UD6A 2CERA 3EA3A 4GVHA 1W17A 1HNYA 2ADAA 3OZPA 3M46A 4PMJA 2O55A 2VR5A 3LPGA 4B3KA 3CO8A 4RNFA 3H2MA 5BROA 4F0MA 3A9IA 5FIPA 4LRTA 3SURA 5JIPA 3C0SA 1UWUA 3STEA 3VOGA 4JFTA 1Q45A 3EKGA 3WQFA 5EB8A 2PWDA 1BG9A 1C7SA 3TTYA 2QR6A 1XLFA 5CGTA 1KRMA 2QW5A 3G5EA 4J2PA 1GKQA 4B5NA 3GD6A 3DUGA 5C2XA 1K1DA 1AL7A 1JNEA 2OVLA 2XUCA 3AXMA 3EX6A 1UPPA 1XIBA 2WANA 4PMYA 4LAOA 3IIOA 1BQGA 4LGXA 2XN2A 4HA1A 2YL9A 3W75A 4ZQMA 3CMGA 1I60A 4Y8EA 4PEKA 3BARA 1IV8A 2DJXA 3E96A 5BRBA 4AHQA 1EYEA 1R3VA 1AD1A 1NU5A 1X98A 3NDYA 2Y63A 1GWJA 5KITA 1FWAC 1S2CA 2FB2A 4C6BA 2WHLA 1I2QA 4XG1A 3N17A 4BI6A 1H5VA 2DUXA 3F5JA 1E4MM 3GVWA 1C92A 2HBVA 3IAPA 4DBSA 3SDOA 5GJNA 1LBLA 2C79A 3LCGA 3KBVA 2CLPA 2R1MA 1A0EA 3BLDA 3FA4A 3OB8A 4O10A 1W0MA 2PP1A 4AD0A 3W2LA 1WDQA 1KFLA 4JX6A 5CC5A 1GQLA 2ISSA 1JAEA 1R3QA 1X8FA 3RXZA 7CGTA 2X09A 3AHXA 2NQZA 4CU6A 3TEVA 1XPYA 2CITA 4HHPA 4M24A 4W5UA 3GTHA 3AS3A 2GJXB 1V6WA 1RLCL 2V5DA 3W7KA 3QC3A 2WZIA 4AISA 3LLFA 1P6BA 3G1DA 1OYCA 4HT3A 4Q8WA 3VXGA 3MQTA 1TV7A 3H55A 1PSCA 3UNDA 1FWWA 1JPIA 1PZ0A 3GZAA 3TJXA 1T41A 1WO2A 2OT1A 4TVUA 3U48A 5AC4A 1HVQA 5K4ZA 3VE9A 4LBUA 5XIAA 2C14A 4O52A 4LY4A 1UASA 5BXRA 4ML4A 3S6OA 1AODA 3STPA 2ATMA 2WAGA 4D2JA 4M1RA 3W7EA 1Q3NA 3VOIA 4MM1A 4DF0A 1E51A 5C9RA 1JZ4A 3KBSA 1WXZA 3W85A 1PDZA 3LGDA 4O50A 4IIBA 3HPZA 5I3GA 4XZBA 3P67A 3HGRA 2GWGA 4GY1A 2VX4A 4BF5A 2QIWA 4MWAC 5AB3A 4OHQA 3H12A 1OF8A 2BHUA 4ONVA 1LOSA 1TCMA 7PTDA 5LIXX 4HN8A 2YW4A 1XM3A 4DYKA 5A5WA 3FHQA 3K4WA 3CHCA 4XISA 3W86A 1B3VA 3GR4A 2GPTA 3W1AA 2A3HA 3GE7A 3WH7A 4RZ4A 1TMLA 1V6UA 3VIPA 4K7VA 1DJWA 5BXPA 3ZLFA 4L4LA 3WLJA 4J3ZA 4H9YA 2R94A 3S42A 4QAIA 3M5ZA 4IMAA 3CUIA 1UWQA 1M1BA 1TSIA 3E12A 4PSPA 1YE6A 3T9PA 3BZJA 3LK6A 4MVAA 4DWDA 1PWMA 2PMQA 1J18A 2EF9A 2PGFA 3FK4A 4LFYA 1R87A 1A50A 3MWAA 3GFZA 3B05A 2DY3A 4Y7EA 1OT2A 5T91A 3OGVA 2GL5A 4JD4A 3P0WA 3UESA 1N8FA 3WMSA 4OE7A 3S1WA 3PFMA 1I4NA 4JY8A 1MEHA 2GGEA 2DV0A 1MW0A 4V15A 1EJWC 1G67A 1XDJA 2HV5A 4PSRA 3LTYA 4YMZA 1W1TA 2P5NA 4QTGA 4DLFA 1R7OA 5DO8A 2GK1A 2TYSA 1PX3A 1KO0A 1R38A 1K9EA 4J28A 2WNWA 3MSRA 1ZY9A 4FNUA 2D2JA 3LM3A 5CPQA 3M44A 1WKYA 3NL5A 3N29A 1DE6A 2BGNE 4MY9A 5DCBA 2YA0A 4D6FA 2A79A 2ZX5A 1QW7A 4OT7A 1Y8BA 5M1TA 2QUNA 1XUUA 4MB3A 1VFMA 1EKOA 3LRKA 3HA1A 2VM8A 1P0DA 1J6PA 4RLIA 3PZMA 3HM7A 4ZOCA 2QCLA 3N6QA 1KRBC 3O6AA 1KR0A 3QTPA 4H9ZA 4HK5A 3FSUA 3UY7A 1GG0A 1CGXA 3B8WA 1Q6GA 3F7JA 4RUBA 1S5MA 4NZ5A 5AYIA 1JDFA 4KWOA 3GB6A 3AQUA 2PP0A 3TC7A 4AZ7A 4Q7BA 1W8GA 3S0CA 3GAKA 4FALA 4IX0A 3EAUA 2P76A 1NOFA 1HO1A 3Q58A 2QCHA 3LMZA 2G3JA 5C5YA 2YBTA 1JZ8A 1D7KA 3VFLA 1F3XA 2QUMA 4H9UA 3V5OA 2FKPA 3WNKA 3GZ3A 1QWKA 1KFWA 5D33A 3EDJA 1MQRA 1O1HA 1QNQA 4FOKA 3EX1A 1VBGA 4RW3A 1MQQA 3I7RA 3EWXA 3AROA 3SCNA 4UTIA 1E6QM 4YYCA 5A8QA 1QNOA 3IJ9A 4ZFMA 1A53A 3QV9A 3S5NA 3CPGA 3AWOA 3R5EA 3RPDA 1FWCC 3PP7A 3CAWA 3E9AA 4JTQA 4WCJA 1HZYA 1TR1A 4UZSA 3GH7A 1UD6A 2CBVA 3AIWA 1J11A 1E6RA 4AZ6A 3J7HA 1TO3A 2J7BA 4C6EA 2JKPA 1E0TA 4IGHA 2YX0A 3NGFA 4N9DA 1V77A 1OF6A 4GUJA 1VFTA 1UIPA 2INEA 4WOQA 2F61A 4Q8PA 1JGIA 1VYPX 1CT5A 5CZJA 4ZQOA 3PZNA 3EYPA 4CNUA 2ZUUA 5DRCA 2NWSA 2JF6A 4AWUA 4DHGA 1C8QA 1TMQA 3T05A 4ZODA 3WNOA 1WZKA 2BOFX 4OV9A 1T6MA 4MKSA 1TA3A 2VXNA 1HP4A 2KAUC 5I6SA 3GG8A 3I3EA 5D03A 3W0KA 2DT3A 1ZQ5A 2ALRA 2G5WA 5I3FA 5FAGA 3VI2A 1WZLA 4IMEA 1BKHA 2XFFA 2IMRA 3TXZA 1H09A 2OSWA 3MWCA 1T40A 4OZOA 1PTDA 4M6PA 3LU2A 4H19A 2Y70A 4WEVX 3THUA 1POJA 3O6CA 3II1A 1HKIA 1QWGA 3ELFA 4JYFA 1SFSA 2NQ9A 3NQDA 3KOWA 3W7OA 1XLAA 3NZ1A 4D6DA 1VD6A 4AD1A 2C1IA 5BMWA 3S5ZA 3WMBA 2Z1BA 2G3FA 3MKCA 3VDBA 3WFAA 1TWWA 4GI6A 3UGRA 1I6NA 1US0A 2ISVA 2G37A 3IIZA 3FCPA 4DJEA 1UZ1A 2GWNA 2RDTA 3PZVA 4AY8A 5CPOA 1QBAA 1F4AA 4BA0A 1JRBA 5AHMA 3MHGA 2ZKMX 4XD3A 5F4XA 3UZ5A 3NQVA 3V1HA 4UNIA 5CGMA 3UF9A 3W23A 2O56A 4JHZA 8A3HA 3TAKA 4HQVA 4DPQA 1C7TA 3FJLA 1ITCA 3SRFA 4XUYA 3UR7A 3IUDA 4C1NA 4TOQA 3KRUA 2CWNA 3S1VA 1LCOA 3P93A 4WGHA 2DIJA 3B0UX 3AUOA 1EC7A 4GZ7A 3LM7A 4PCSA 5FJJA 3AYSA 5A8PA 2HNHA 3AMCA 5LHEA 3APGA 1QOQA 5CJMA 3H54A 1HL9A 5F4WA 3RGTA 2X1IA 4GX9A 2YLAA 2VEMA 1QNRA 3CXOA 3WDHA 3UPBA 4JDYA 3T08A 3FW6A 4NRRA 3MKKA 3MP3A 2D2GA 3P81A 1ZLPA 1HGYA 3R89A 3CUXA 5CPTA 3O0FA 3WIJA 1IXNA 4GVFA 2OCZA 1XQKA 3NQCA 1CENA 2RAGA 5AHLA 3VIGA 3SGGA 3T2OA 2VUNA 1LOLA 5BXTA 3NCOA 3DC0A 1LM1A 5LNSA 3ZXWA 3EWZA 4WLCA 5HULA 1GQJA 3N9RA 3IS4A 2PP3A 4XAGA 3DG6A 3ANVA 4WDTA 3R1ZA 2BG5A 2YDQA 4IP7A 2PEVA 4AUBA 2ZRZA 3TJLA 1DWFM 3GC4A 4JBRA 4E2DA 1VFSA 4LT9A 1RH9A 1IEWA 2XN0A 4M56A 1KW1A 1XGZA 1LLOA 1NWTA 1V0NA 3HFTA 4C6IA 1E6XM 4K38A 1UKOA 1CYGA 2WM0A 2GJPA 3DFYA 5KZDA 1M41A 3GXIA 1JI2A 2QCFA 4L9ZA 4XWUA 3SN0A 2VZSA 3TROA 1UH2A 2EPNA 4C7FA 1VEOA 4JTCA 2VC7A 3G1VA 1QUMA 3H24A 1QMLA 4HNTA 3V5CA 3OLGA 1TV2A 3FGCA 3MI2A 1XYZA 4H04A 3V18A 2EPKX 4F8XA 4RDVA 1Q6EA 3GLCA 1OD0A 4F0SA 3TJ4A 1EDQA 3SRDA 3G0XA 3ZIZA 2OB3A 3H2AA 5AVHA 1EGZA 5HOSA 1AK5A 1UZDA 1GOXA 3AALA 3NGJA 4LAKA 3LMYA 2Z2AA 4NJJA 1EPVA 3WDJA 5M2FX 3W7RA 3FOKA 5DY2A 4XVEA 2YIHA 1B31A 4AW7A 4LBRA 2MUCA 2CYGA 3HJEA 3U2CA 5G5IA 3GSMA 1T99A 3W7MA 3TWAA 4IIDA 2DZVA 3WBWA 1B9BA 4Q7IA 1I8JA 3RAOA 4QS6A 3TNOA 1DQUA 4X0NA 1Q13A 2DH2A 1FVPA 1UUOA 3GU2A 4I5RA 3WL0A 5AC7A 1DIKA 1AA1B 4K36A 1S2AA 3LXBA 5DXXA 2XH0A 1CLXA 3NVDA 2ZX6A 4JNMA 4Z0JA 1YIXA 4JX5A 5IHRA 1W54A 1AJZA 3SQMA 4MAZA 3HTWA 1Q6OA 3URNA 1MI3A 3UR5A 5AHEA 2PRMA 5BOEA 1P1XA 3LLDA 4HB7A 1GHSA 2ABBA 3M5VA 1UR0A 4DXVA 5KSWA 5EFDA 2W6RA 3VKJA 3QLLA 3A21A 2GJLA 5EY5A 2J75A 2EPOA 2CLIA 1F07A 1UUQA 2BS9A 5CC3A 1MEWA 2ZRUA 4YTQA 1GYNA 2I5IA 3AMDA 3M64A 2QGHA 4AXNA 5U7SA 1QK2A 4PZVA 2QAFA 3ONBA 2CZEA 3BGJA 1F5ZA 1SR9A 2WM1A 2RDXA 4P8WA 4ADSA 1JZ5A 3ZSSA 1EGMA 4A8NA 2QCMA 3URQA 3W7PA 4QX4A 4GI9A 3CAQA 1FTXA 2PC8A 4UTFA 4WKAA 3OBAA 4TO8A 3BZGA 2ODOA 3BMWA 4HHHA 1H2JA 3MJYA 4IGNA 2DJLA 3R7MA 1IXPA 3F2BA 3MA8A 1JF6A 3PSWA 4PRTA 3KHDA 1V03A 1W6TA 1R30A 1YQ2A 3ECQA 4TMBA 4LEFA 1W2VA 3QY6A 4H7CA 2A6NA 3ZM8A 2ZRYA 1M7OA 4I6VA 4NUWA 2WJDA 1XYAA 3HO8A 4NASA 4QG9A 4GIRA 4HGXA 1GW1A 2ZICA 1IR1A 4LXFA 1UOZA 8TIMA 3VO0A 3NYZA 1GQIA 1VKFA 4NNBA 4MB4A 5FF3A 3O16A 2J74A 4GUIA 3R0KA 1TUFA 2OZ0A 5A6KA 4LH8A 4S38A 3V0UA 1RV8A 1EL3A 3FJ6A 4RDWA 3NXFA 4C6JA 4YNGA 1KCKA 4ES4A 4JL2A 4NILA 1B54A 3AMGA 3DX5A 1JZ7A 3BV4A 2EKCA 3DECA 1B4EA 2HXUA 2VTFA 3MI6A 3CAVA 1TTPA 2NVCA 5HINA 3GBDA 3GHSA 4PBFA 1MQPA 3C3NA 4J35A 4H6QA 1IT0A 5AHFA 2Y5JA 3BAJA 1B3OA 2OR2A 4IUOA 1F73A 3GXMA 4GFIA 2WZHA 3QY8A 1JCJA 4D1JA 4EWJA 3F2DA 3CZ8A 3IGUA 3KRZA 4L5ZA 4F9DA 4HSNA 4ZO6A 4YHEA 5D37A 4EP8C 3F03K 1MRQA 5EBUA 3DU0A 4YVVA 1AH0A 3MT1A 1EXPA 3DFTA 3IIPA 4FIRA 4YPJA 3TX9A 4Y96A 4HYVA 3Q45A 3GVRA 4XUGA 5A6BD 2ZDSA 3BMVA 1B2YA 3LENA 4B3LA 2D24A 2BBFA 2ZC8A 1O5KA 3NL6A 4WGXA 5KMYA 3GDTA 1UR2A 1CLKA 1GPFA 4TQTA 3C56A 2ZX9A 3GS6A 3YPIA 5CZ0A 1JYWA 3H7VA 3VGHA 1YXYA 4QG8A 1TWZA 2X2GA 2V5JA 4BEUA 2HPMA 4IH3A 2XPKA 3HQOA 3NO1A 3PSVA 5LNUA 4E8CA 2FMNA 1F7BA 1BSLA 1PBGA 1HJUA 1QT1A 3ABZA 1L8PA 4DUXA 2UY4A 3DI0A 1X7FA 1JPKA 1HP5A 1EQCA 2PLJA 3UBPC 3W1NA 3EXRA 1YTDA 1DYSA 4MY1A 5F7UA 1TREA 1I1WA 2YCEA 4HU8A 4R7WA 3W6LA 5A6AA 3EWUA 3VUSA 4PTDA 3T1GA 1XUZA 3ZLHA 5I02A 2FZDA 3PBGA 2FZ8A 4PBEA 2FTPA 7XIMA 1XYCA 1X39A 1Z32X 1MNSA 5BWAA 3W73A 4RV3A 1XC6A 4B5VA 3B8IA 1SJAA 3AMKA 4AC1X 1J0HA 1R0MA 4NZ4A 3FNDA 4WSKA 1P0BA 4JQ1A 2YFOA 3W87A 5I07A 4ZL1A 1JZ3A 2REQB 3K1GA 5CJ5A 4W87A 1JL8A 3R0DA 1NY1A 4BZYA 3VGBA 5F1VA 3GDLA 2GGGA 2VFEA 2PUZA 3EWYA 5GPRA 1H11A 3HPXA 1ZRQA 2SFPA 1GOOA 2C1HA 4W84A 3AICA 3B04A 2DSVA 3W88A 5JU6A 3WL1A 2FIQA 1YLVA 2QS8A 1IQ8A 1TFVA 3EPNA 1DORA 1SZFA 5I78A 2B7QA 4HPXA 4F0RA 1I2PA 1NAL1 1A5BA 3KDOA 4TV5A 4AYSA 1G4SA 1TVPA 3DFPA 3KOFA 4OOZA 4U28A 1UBPC 1E1CA 4Q8QA 4X63A 3P84A 3MS8A 4C6MA 3A3HA 5TQLA 3HGOA 3H4GA 3T2QA 4R85A 2HPIA 4HNNA 1FDJA 4LUJA 1F74A 3D6NA 1F3TA 3G18A 2OU4A 4OBTA 4OBSA 5REQB 1UG6A 3GHUA 4AWEA 1B3ZA 3VD3A 3E02A 4DI9A 3A5VA 4B92A 3S2CA 4MHBA 3WX7A 1ZGDA 4HD5A 5D8ZA 1H49A 1TV8A 4Q4QA 4A21A 4PMQA 4PTNA 2ZCGA 4MKNA 2TMDA 5JH1A 3L4XA 4DZ5A 1VBRA 3GHTA 4GO8A 2ZUWA 1MSSA 1E4LA 2YZRA 1H7WA 4IXHA 3ERPA 4UTTC 4A3RA 2R6OA 1I9CB 2BLEA 2GVLA 2BDQA 4Z2HA 1MZHA 3K8LA 3OP2A 3EEGA 2JGQA 4LOCA 4ZE4A 1Q2RA 4M51A 2Y5EA 2YXGA 2QGYA 3GHRA 2XWEA 1XISA 4JTRA 1H7OA 3NUKA 4ROPA 1WA3A 4B4FA 3RCMA 1P4CA 3H2OA 3E0LA 1W3NA 2CESA 4LSBA 1ZAHA 2E25A 1N82A 1BWVA 3UZYA 1TG7A 2H9AA 2VVSA 1QI0A 1RJPA 3LA4A 1OCQA 2H6RA 1LWJA 3QY7A 1ZAIA 1PKNA 1JD7A 1W9XA 1ZBKA 3CJPA 1OCBA 1EUAA 3BGAA 4Q8NA 3LNPA 4DBWA 1M7JA 5M03A 2EPHA 3QN3A 2BVTA 2QUVA 4CEUC 4GBDA 4GINA 4PCPA 3CPRA 1BVZA 3CPUA 4ZO8A 2PGWA 1Q6DA 1UA7A 4L7ZA 1HUVA 4GMEA 3WNMA 5CQ1A 4ADUA 3LQLA 3AXIA 3U0HA 2ZUVA 5D32A 4QE1A 4UFJA 2DIEA 9RUBA 2W63A 2ZUMA 3Q65A 5L6UA 1YNPA 3NEVA 1E1EA 2DORA 3RPTA 4PUWA 1DJZA 2QPUA 1R3TA 4O53A 3G3MA 1RQBA 3ITGA 4PN2A 1R47A 4DJDC 2D3LA 4UTWA 3UWWA 4I8DA 2VGGA 3VA8A 2PFHA 3UG3A 3BH4A 4B2DA 1ZB5A 4QAWA 5A8OA 3GKFA 3IJ6A 3USBA 4ICMA 3GU9A 4OOUA 1JI1A 2ZC1A 1O5RA 2WCAA 4RL3A 4I3GA 3U3HA 3CNYA 1F6YA 1GVRA 4LYPA 2RGLA 2YYUA 1UKSA 4DBDA 4W7WA 4JQAA 1WCGA 4MJ2A 4GFSA 3DG3A 2QULA 4Q8UA 3TCSA 2XIJA 2B81A 2V3GA 1V3KA 5E6YA 1RVKA 2PDXA 4PUNA 5BYWA 3IJDA 3K8MA 3TN3A 4GNKB 5AHNA 2IQ0A 5I7GA 2ONEA 3OHIA 5A6MA 3M1ZA 3LRMA 3SSJA 4RK8A 5C0QA 1KWKA 3L66A 2DQWA 1F8MA 3EOEA 3GG1A 1IZKA 1BYDA 1DWIM 2D0FA 4UCGA 3UCCA 3KBNA 1ONXA 4CD6A 4NJHA 3HF3A 2E8YA 4H7VA 1Z6KA 3WMLA 4HCDA 1EJXC 5AC5A 3WSUA 2A3AA 4GPNA 4AZBA 3VD5A 2YB4A 2AQVA 3E49A 1VCFA 4EXAA 3PPCA 3P61A 3FN9A 2VEFA 2AGTA 1K4HA 2VX5A 2PTWA 3T09A 3PY2A 5EMJA 2WNZA 1WKDA 3P14A 1AZ1A 3H26A 2MANA 3WH6A 3N04A 4UOZA 1XD1A 3S5SA 5IDIA 3CIXA 3WF2A 2OJPA 2VWTA 1W5QA 2X0HA 3HFYA 3LBOA 2WC7A 2XVKA 3TMLA 1EEPA 4P7OA 3VKCA 3HG5A 1PCWA 2BHZA 3QJAA 3R58A 1B5TA 1ONEA 2B7NA 5C2GA 4E2BA 2W67A 3B9OA 2Z1KA 1KB3A 4LX4A 3R11A 3W2JA 2CLMA 4UC5A 3M0KA 1HKJA 2FPVA 2WSPA 3ZOAA 1E9ZB 1JEZA 2DT1A 1LTDA 1J0YA 1RD5A 5EL1A 4RXFA 2Y62A 3NDZA 1Q6RA 4GZJA 3A3WA 3UU0A 2NZLA 2QJMA 4DB7A 5KZMA 3Q67A 1FCQA 2B0MA 1H1ZA 3MCOA 5TD4A 1KR1A 3VNMA 3O07A 2W62A 1P0NA 2A3BA 1AQHA 4HTBA 5FJUA 2Z7KA 3IIXA 4QJ5B 5EKYA 3KTCA 4ERAA 5B7YA 3AZRA 4G7EA 4H1ZA 4GOAA 4H83A 5TBOA 3VYLA 4KMQA 3KZPA 1IWPA 2V2CA 3LBMA 4NSBA 2WBKA 1BVNP 3W7HA 3UJRA 5GJPA 3TYCA 3CQ0A 1NQ6A 3UQNA 2V3EA 2ZTKA 5G4EA 4ORIA 3B40A 3BLFA 3T0AA 1EJSC 1A5MC 3AS0A 4O54A 1I0DA 1E0WA 3EX3A 1FRBA 2A3EA 6TIMA 3CHEA 5A2BA 1ENUA 4GYFA 3M43A 1A5NC 3MBFA 4RDYA 1QU4A 3QF0A 1KC7A 4NJKA 3W6YA 3DIPA 2HSAA 3W1XA 1JCXA 3VIKA 2XG9A 1FP9A 1UCWA 3WDIA 3GK0A 1OD8A 2NQLA 3L0NA 1PB0A 5IOBA 1DOSA 1B4KA 3AYRA 1RCOB 1YTKA 5CPLA 4ZZ9A 2HVMA 1VLWA 1KQYA 3BLIA 4HN4A 1BGAA 3AIUA 3C0QA 4LY8A 3GM8A 1R7AA 4M5PA 2VFIA 3F1QA 2PLKA 5HWJA 1WDWA 2NX1A 2VC9A 5REQA 1BXNA 3LCHA 4H3DA 1D7FA 4W89A 1FH9A 4ZR8A 4PUUA 3OBEA 3QZ6A 1AJ2A 2VFFA 2OELA 3FVDA 4M0XA 3LYEA 1XLJA 2ABAA 1GPWA 2UY3A 3IK4A 3EDFA 4B3ZA 3RITA 1UMLA 3O9NA 4QHRA 7ENLA 4EPEC 1SO4A 1CDGA 4UFMA 1LRQA 2B7PA 1KCXA 4H6KA 2J6XA 3ZT7A 3DBPA 4KGJA 4TTUA 2UY2A 2ON3A 3C2EA 1RALA 5D4YA 1ML1A 3WDPP 4W5ZA 2PTZA 1C29A 1M04A 5F2MA 2D2OA 3UFYA 2VR2A 3LB0A 3REQB 1WYIA 2YCIX 5I3IA 2WMJA 1GZ1A 1E56A 4J5NA 4CD8A 5DN1A 3KBJA 4KCTA 2OWWA 3MUXA 4HOXA 2JFEX 3MCNA 2NQJA 3EX2A 5AFDA 3G1AA 4X0VA