3APGA

Crystal structure of hyperthermophilic beta-glucosidase from pyrococcus furiosus
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
471
structure length
471
Chain Sequence
AKFPKNFMFGYSWSGFQFEMGLPGSEVESDWWVWVHDKENIASGLVSGDLPENGPAYWHLYKQDHDIAEKLGMDCIRGGIEWARIFPKPTFDVKVDVEKDEEGNIISVDVPESTIKELEKIANMEALEHYRKIYSDWKERGKTFILNLYHWPLPLWIHDPIAVRKLGPDRAPAGWLDEKTVVEFVKFAAFVAYHLDDLVDMWSTMNEPNVVYNQGYINLRSGFPPGYLSFEAAEKAKFNLIQAHIGAYDAIKEYSEKSVGVIYAFAWHDPLAEEYKDEVEEIRKKDYEFVTILHSKGKLDWIGVNYYSRLVYGAKDGHLVPLPGYGFMSERGGFAKSGRPASDFGWEMYPEGLENLLKYLNNAYELPMIITENGMADAADRYRPHYLVSHLKAVYNAMKEGADVRGYLHWSLTDNYEWAQGFRMRFGLVYVDFETKKRYLRPSALVFREIATQKEIPEELAHLADLKFVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase
publication title Crystal structure of hyperthermophilic beta-glucosidase from pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 184
structure length 471
sequence length 471
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3apgA00
3SCPA 1PIFA 2B31A 3E1F1 1ZBCA 4UZUA 3K4DA 3VIIA 3VGHA 1UR0A 4W8BA 1ITCA 2CITA 3QHMA 2AOSA 5A2BA 3AHVA 3N11A 5GQBA 2CCRA 2WVVB 3N13A 4B3LA 3CHCA 5CLTA 1ZBKA 4X9YA 2PWHA 5M3WA 4F66A 2DSKA 4RE4A 3U5YA 5DEZA 3UG5A 3SCWA 4HZ7A 1NP2A 3WH8A 3NJ3A 4E4PA 2VMFA 5LA0A 1OT1A 4UFIA 1PIGA 3OGVA 1J9YA 1S46A 2BVTA 5A2AA 3W28A 3VNYA 3ZR5A 3N17A 1JYVA 4JFWA 4LYPA 3RIKA 5F7UA 3MSDA 1B3YA 4HZ6A 2W5FA 4H2CA 1WZMA 4UCFA 3BAXA 4OIFA 1G94A 3AIUA 4URIA 1UWRA 4LQ1A 3UG4A 3WH9A 2YL5A 5I79A 2V3GA 1JAKA 2WVTA 3N12A 3PHAA 1E0XA 1PBGA 1K6AA 4R5EA 3OLGA 4AZBA 4QLLA 1X6NA 3HU7A 4HMCA 1CXEA 3QHNA 1TCMA 1DWHM 3MKKA 2WBKA 1WZAA 3WFZA 4DWSB 5AYIA 1GOOA 2D0FA 1PX3A 1G1YA 4F8XA 2V5DA 3CMGA 3IANA 1NM9A 4D6FA 2YIHA 3POCA 1JF6A 3DHPA 2A3CA 1FP8A 2OSWA 4H8VA 3WQ4A 8A3HA 2VQTA 1CECA 2CKRA 2X09A 1E6QM 2YOCA 1UKQA 3RJYA 4HU0A 4AIOA 3W4RA 5D9OA 3MO4A 2XPKA 3DHUA 3ZJKA 1JD7A 2XVNA 3PBGA 3VDAA 2JEPA 3AHZA 3WF2A 3SCUA 4Z2IA 3UR7A 2QF8A 4HPGA 4HZ8A 3W6MA 1EH9A 1GUVA 1Q6DA 2W61A 3ARUA 1V02E 2C8NA 3A4AA 3WH5A 7A3HA 3UEQA 4IUGA 4PCSA 2XGBA 1M01A 3WMCA 1GOMA 2MANA 1TMQA 3CIVA 3G6LA 1GOQA 2DEPA 3ARRA 3GNPA 2FHBA 3VGDA 3MSGA 5E70A 2AAAA 2UY3A 4D6GA 3T2OA 3FAXA 5M5DA 2G3NA 4BZYA 2WMJA 4AY1A 4UFMA 2GVYA 4L4OA 1BVNP 1V08A 1CIUA 1TFVA 5A3HA 3ZT7A 3CHDA 4QAWA 2XFYA 3ZSSA 1H0IA 1V6UA 2OWXA 3AOFA 3WD3A 3PZIA 4FK9A 3WEOA 1KCKA 5LYRA 4TTUA 1E3ZA 4JFTA 1XGZA 4OOZA 3GXMA 4C7DA 2XIIA 5D4YA 5EFFA 3AHXA 1KXTA 4OUEA 1VIWA 4FMVA 1DWJM 1NWSA 2PBGA 1HXJA 4P8UA 1K9DA 1QOXA 1HJWA 2E9BA 2W63A 2XVKA 2PBOA 2X8RA 1JZ5A 1HN1A 4X0VA 5ABHA 1H09A 3VX1A 5FOOA 1I75A 4D6CA 4TUFA 2XUCA 4EK7A 7CGTA 1BQCA 1B3WA 2D1ZA 1LQ0A 1BTCA 2JE8A 2JFEX 2V3DA 5KEZA 4UQEA 1VFMA 1QI0A 3LPOA 2NW0A 2O9TA 2D0GA 2J7FA 1YQ2A 2VZSA 3ZQ9A 1OT2A 4AWEA 2WC3A 1A3HA 4MNMA 3K8KA 7TAAA 3THCA 3GH7A 4RE3A 4IPLA 3VX0A 2PWGA 3W26A 5CSYA 1RP8A 4AW7A 4J3UA 1GONA 1B30A 2CHOA 3CGTA 5I23A 1C8XA 1E4IA 2X0YA 3WNNA 1JNEA 4OKDA 4PTXA 5HBFA 4BQ5A 4WLCA 3L2LA 1W32A 4W8AA 3AXIA 5FKYA 5ABEA 4J3TA 1W3LA 1PAMA 4CD7A 4E8DA 3RMEA 1DEDA 2VURA 4MDPA 5IFPA 2CHNA 2WWDA 2PWFA 1B1YA 2RGMA 1JZ8A 2ZOXA 1CGYA 1JD9A 1G01A 2VZVA 1JXJA 4FLRA 4J28A 1ISYA 1XYZA 4CN4A 2DSUA 3AXHA 3WH6A 2GJXA 1E6RA 3WUBA 4NSBA 4HU8A 2ZX9A 1XRVA 1CPUA 2J75A 3AYRA 1KWKA 5EBAA 5E9AA 1BG9A 1G0CA 1F4AA 2EBNA 1HJXA 4M80A 1E55A 1JGIA 4D71A 3TTQA 2VRKA 1FFQA 2D2OA 1OGSA 2J8FA 3AHTA 3PZOA 1R7AA 3FN9A 4FLQA 3GBEA 4HOXA 3UR8A 3IK2A 1VENA 1H1NA 1GQKA 4LPCA 3VIOA 1IZJA 3AFBA 2C7FA 2ZUSA 4AXNA 3W27A 2WMFA 2GFTA 2DDXA 1E72M 2J7CA 1CDGA 3MV01 2DH2A 1W9VA 3SCOA 4PMOA 1UD4A 2DT1A 2VC9A 3AMKA 1I1WA 1GW1A 1HIZA 1EGZA 2DT3A 5E0FA 4BQ4A 1QW8A 2YA1A 1SYTA 4JAWA 5CGTA 4GPNA 1X6LA 3AISA 1CXLA 5E09A 1E6XM 1GVYA 2TAAA 2VZOA 2Y8KA 3NSXA 1MFVA 1WE5A 3VDBA 4OZOA 4ZXOA 1KFWA 4HA3A 1WB0A 3SCSA 1OB0A 3WF1A 1GOIA 3KEHA 1J0IA 3GDBA 2XM1A 3O9NA 3AMLA 1E6SM 2DH3A 5GPRA 2WB5A 3IJ7A 3WQ5A 4M24A 3VIHA 1BGGA 2BHZA 4P8VA 2D23A 3VIFA 4AEEA 4IISA 5D8WA 3AIQA 3WNOA 4EAMA 1V3MA 4PMRA 3ARWA 2WKGA 1CZ1A 1W3HA 2F61A 3B9DA 3CUGA 3NSNA 4BA0A 3BCFA 1VBUA 4EKJA 3WY1A 4UFKA 4GZIA 3K46A 5AY7A 3EBVA 3FNDA 1DWIM 3BMWA 1UD2A 4CD6A 2BHUA 3TOPA 1RD6A 4CU6A 1E0VA 2YLLA 2G4FA 3AROA 4M29A 4CD5A 4JKMA 1GNXA 4KWUA 4DUVA 4PMQA 1LG1A 1IZKA 1WDRA 2Y5EA 2NT1A 4UFLA 1CLVA 2YL8A 1CXHA 3EDEA 1CGWA 3T0DA 2X1IA 1B2YA 1ZBVA 3WEZA 3VPLA 4Z2JA 2AMGA 2UY5A 2ZUTA 3AZTA 1BYDA 1B3ZA 5C8BB 2VX7A 2E8ZA 1BPLB 4DWSC 1BYCA 1C8YA 1UWIA 3W82A 5A6KA 1GOKA 1HKJA 1OSEA 3OGSA 3OLEA 2ZWYA 2NT0A 1PX8A 4U2YA 2GJXB 3BCDA 1VAHA 3WD2A 3WNMA 1MW1A 2WVSA 1HVQA 1FP9A 1C90A 1UD5A 1WDQA 2ZXDA 3VD5A 5JBFA 1AMYA 2W66A 4V2XA 3WSUA 4P8WA 5I24A 1XCXA 3K4AA 4XUYA 3EMCA 3VILA 1QNOA 1VBRA 1KCLA 3KWXA 3UESA 1TVPA 3NSMA 3WDRA 5JBDA 2GDUA 4S3JA 3W25A 1EOKA 3BAWA 3W81A 1DWAM 1E40A 4WIWA 2E0PA 2RGLA 2VO5A 1HKKA 3WD0A 1JZ2A 1UD8A 4A4AA 2G3JA 4D1IA 1V6XA 3AQUA 2X05A 4MNLA 5DT7A 1Y7VA 4AMCA 1W2PA 1EDTA 1GQIA 1VF8A 5JUVA 4P7NA 5CPSA 2WYSA 1XYFA 3UETA 2ZX5A 1QI2A 2FH6A 3MUZ1 3VD7A 2Z1SA 3VTRA 2JF6A 2WLYA 1JZ7A 3ARPA 2BY3A 4JFUA 1GVIA 1V3IA 3QR3A 2WW5A 1UKTA 2QMJA 1U33A 1P6WA 5CPQA 5FIPA 1FH7A 4KH2A 3S2CA 3DECA 3B9EA 2VRJA 3K8MA 3L2MA 2VNCA 4W93A 3WUFA 1JYNA 2CYGA 3CZJA 1US3A 5DF0A 3GBDA 1OCQA 4B9ZA 1JI1A 1PZ3A 1ZJBA 1UZ1A 2J4GA 3AIBA 2E4TA 2VVNA 1GORA 1UD3A 2JIWA 1WAWA 3ARVA 1LWHA 3POHA 2J79A 3TTYA 2VX4A 2CBJA 2XSBA 4DUXA 3BAJA 2ZUMA 3AS1A 2BS9A 4MJ2A 1PPIA 2DPEA 3A4WA 4UTFA 3F5LA 3VINA 3T0AA 2HISA 2XSAA 4LGXA 2G3MA 3VDHA 1EO7A 2W67A 1RP9A 1KGUA 4P7LA 2G41A 3J7HA 1Z32X 4GQRA 1R85A 3NUKA 3BGAA 4UQCA 5A95A 1JG9A 5E0CA 1PEZA 4B9YA 1NOFA 4J3WA 3TTOA 1V0LA 2WMKA 4MNJA 1UWTA 3GM8A 4AC1X 3NDZA 2A3AA 4CVWA 4WJXA 3VO0A 2J25A 4CUCA 1E1FA 4YN5A 3FY1A 3IAPA 3PZ9A 2CESA 3VMPA 2ZX7A 2EPOA 4DM2A 4E2OA 1UKSA 2OLHA 5HPOA 2A3HA 1W9XA 3CUFA 5BXSA 1V02A 4AZIA 5FCZA 3QOKA 4MDOA 2VQUA 1C7SA 1LL6A 3KL5A 4D6DA 3W53A 3TONA 4BCEA 5A6BA 2VCBA 2WCGA 3HJEA 2VR5A 1FFRA 4W5UA 4CKQA 3AMGA 1KGWA 1MFUA 1OGBA 1CYGA 3WN6A 3A4XA 2VI0A 1KR1A 1FHLA 3CHFA 3OLIA 1E56A 1TVNA 2WZHA 3MU7A 3QOMA 1J10A 2DIEA 4CU8A 3PTMA 2J77A 1ESWA 1E6ZA 4GZJA 1R87A 5A8PA 2VUYA 2XWDA 4ATLA 4BQ2A 1ODZA 2E9MA 2EQDA 2D0HA 2BY1A 3AICA 2DSZA 1QW9A 5DFAA 1E4LA 3ARXA 1OIMA 2VL4A 4WSJA 2WAGA 3DYPA 3GTNA 5M03A 2YJQA 3AJ7A 2BHYA 2BNJA 2VR4A 3U57A 4DUWA 3OGRA 2WCAA 4TVUA 4D6JA 4NRSA 1B3VA 3BAKA 3A6OA 5IFTA 4YHEA 1KWGA 5CZKA 4PTWA 3CUHA 2YA0A 2WWCA 2CBVA 4YHGA 1WO2A 2QPUA 2VT0A 3WH7A 4LYQA 1ZS2A 2GDVA 5I5RA 3I3EA 3B9AA 1US2A 4J3SA 5CLWA 1JZ4A 1CXFA 2FGLA 4JZ5A 2WKLA 1C7TA 2YDQA 1D2KA 3SCQA 2WMGA 3PTQA 5GNYA 4ZENA 3BC9A 3U5UA 3CH9A 4NF7A 3I3DA 5IHRA 1CENA 3WDPP 3VKKA 5BYWA 5HPCA 3CZEA 3RO8A 4C7FA 4ZEPA 5D9PA 2Q8XA 3VIPA 3VM7A 3WFLA 2XYLA 4K68A 1TA3A 1FA2A 4ACYA 2XVGA 2V38A 1NWRA 2XGIA 2GK1A 1WPCA 2J7BA 3W29A 4CU7A 3M7SA 4PN2A 4F9JA 4U2ZA 3MV11 3PZQA 2QPSA 5FD0A 1LL7A 1K9FA 3SUVA 4UZSA 4UQAA 4QDMA 4PMNA 3FXYA 1HL9A 3KE0A 1D7FA 1JDDA 1VEOA 3SIMA 2OYMA 1UA7A 3GNRA 1E4NA 1MW3A 1GOWA 1QHOA 2J62A 3WUEA 3BSHA 4B16A 3N04A 1OD0A 2IUZA 1ZB5A 3ZR6A 1C91A 4H04A 2J7GA 3EMZA 1J0HA 2G3IA 4MB4A 3AYSA 3WMBA 1CLXA 1M04A 2EPKX 3N1AA 4FLOA 2JF7A 2DQXA 4P8XA 1XH0A 1XCWA 4JL2A 3BLKA 3WIJA 2PWDA 3RPMA 3PZUA 1UKPA 2XVLA 4DWSD 4OOUA 1AVAA 2VRQA 3VM5A 4PCTA 1V03A 2J47A 1J0YA 3FW6A 3W0KA 4W86A 4N42A 3VD9A 1NOUA 3CO4A 4PTMA 3WKZA 1E15A 2XM2A 2WANA 4JL1A 3UCQA 4MJ4A 5BRPA 3VIGA 3AMDA 2YBUA 1D3CA 1OD8A 4HP5A 5CXPA 1OGGA 3KL0A 1IV8A 4PMDA 4PUDA 4GI8A 3QHOA 3ZSTA 1ISWA 1XD1A 2WCSA 1MWOA 1E9LA 5AC5A 2A3EA 5DT5A 4QLJA 4CN1A 4W8LA 1I1XA 1BYBA 4JFSA 5BXTA 1E1EA 4KMQA 1W1YA 1GHSA 2BFGA 1BFNA 3ARYA 1E71M 2VTFA 1X1NA 4DM1A 5JIPA 4W7WA 2QHAA 5A1AA 2WZEA 4GI9A 1Q6FA 5A8QA 1H4PA 2X2YA 1TE1A 2JEQA 3TTSA 3VGGA 4OBSA 1JI2A 2NSXA 3HMCA 3IJ9A 2D3NA 1L0PA 1VJZA 2G8ZA 3GH4A 3WBAA 1H5VA 2E3ZA 4PYSA 1JXKA 4Z2KA 4HMEA 3NCOA 3CTTA 1MQPA 1GJWA 3ARTA 5C70A 4J3XA 3D5HA 1CEOA 1NQ6A 4LX4A 5I78A 3EDFA 4UNIA 3ARSA 2VZTA 1DHKA 1TA3B 1E43A 2OWWA 1EHNA 5FL1A 1MQQA 2DT2A 3HN3A 3JUGA 4IM4A 1B31A 2QLYA 3AIEA 4JIEA 3W38A 3T2PA 1BGAA 5A6AA 2XIBA 3SUUA 2WSKA 2YDRA 4AYSA 1O7AA 4X0NA 1HF6A 1QI4A 2WC7A 4EANA 2VZUA 3AZRA 3AMCA 3BAYA 4HOWA 1KXHA 5A6JA 1E3XA 3VU2A 4GXPA 1E0WA 1V0MA 1XH1A 1C8QA 1E5JA 2YL9A 4CD4A 1JNDA 4HOZA 1WNOA 4F9DA 4M8UA 3CZ8A 3AHYA 1HKMA 3NYDA 3BH4A 4M56A 4UOJA 2WHLA 1WKYA 1E5NA 3MS8A 4GINA 1XHGA 1ISVA 2BY0A 2EXOA 3WDJA 1VFUA 1H2JA 4W84A 1R86A 3WMSA 4AD4A 4XB3A 3O2LA 4MPKA 1EHAA 4GZEA 3CMJA 5HNNA 5IHSA 2ZX6A 2QMKA 3KZSA 2VX5A 1W9PA 3D3AA 1HX0A 2GUYA 5I6SA 3W37A 3GXDA 2IXUA 1J18A 3VVGA 3WQVA 1G9HA 1HJVA 1CGXA 1ZU8A 3WF4A 3DC0A 1UOKA 1BF2A 4F79A 1UH2A 2A3BA 1WZLA 3RJXA 1E6NA 2CNCA 1LJYA 6A3HA 1FH9A 5KZ6A 1ISXA 3WDIA 4AD1A 4JCLA 2ZUVA 3VIJA 1UH4A 1W1TA 3L4TA 2O9RA 1IT0A 2FDMA 3VD3A 1UA3A 3LPPA 2JALA 3OIHA 1ECEA 1QNPA 3M07A 1JDCA 1Q6EA 3N9KA 1H3GA 1KBBA 2Y24A 2GSJA 5A8NA 1AQHA 2WBGA 1GZJA 3T09A 3SCVA 4ZXLA 1K9EA 2YDSA 1EOMA 2O9PA 1V0KA 5I77A 3L4XA 5JBEA 1BHGA 4XZBA 4Y7EA 4P7QA 4PSPA 4ZFMA 4ACZA 5CPTA 1NWUA 2WM0A 2ZICA 4BS0A 4AD0A 4Z2LA 5A2CA 1M7XA 2ZXBA 3OB8A 5AYBA 1OINA 4TTGA 3VMNA 3ALFA 2XFRA 2OSYA 3AIRA 3MUY1 1U2YA 4AZHA 3QGVA 4TX8A 1HKIA 4AZ7A 1TR1A 1E6PA 1H11A 5CG0A 1ISZA 1OBAA 2ESCA 1KQYA 4S3KA 1A47A 3WQ6A 4B15A 4CD8A 4PBGA 8CGTA 4CGTA 1EIBA 3O6AA 1AQ0A 1GJUA 4V28A 1FHDA 4MB5A 3EDJA 2J74A 1OM0A 1G5AA 5I0DA 2OYKA 3THDA 5BXRA 1WZKA 1HJQA 4HA1A 4QCEA 3WBEA 1O6IA 1XD0A 5D9NA 3OA5A 3WEMA 1QPKA 1R8LA 2UY2A 1J01A 1JIBA 4BF7A 1BYAA 3K1DA 5A8MA 2YLAA 1QI3A 2YKKA 4UR9A 1UWUA 2OSXA 3UERA 2DSVA 1BAGA 1B3XA 4PUEA 1OWQA 4A3HA 3WF3A 4AD3A 4Z2HA 3L4VA 2CBIA 1KB3A 1W1PA 4GKLA 3U7BA 3OBAA 1QHZA 2WPGA 1H49A 1EQCA 1RH9A 4JCMA 5IXEA 4H8UA 3T0BA 1CWYA 1SMAA 3WNKA 3ARZA 5A69A 3BMVA 1V6YA 1QI5A 1KXVA 3VNZA 2XFFA 1QBAA 5LA2A 4PMUA 1J11A 3WD4A 3VGEA 1CGUA 1J0JA 4AD2A 3ZJ6A 3ZT5A 4WK9A 5CSUA 3APGA 4PMVA 4LXFA 3OZOA 1WDPA 2J78A 3SUWA 1UYQA 1QBBA 3AZSA 4RL3A 1JZ6A 3II1A 1VRXA 2CKSA 2FHCA 3PN8A 4XV0A 2EO7A 2BXZA 1WCGA 2DT0A 3MANA 2YL6A 5A8OA 5HDRA 4TXEA 5JIWA 2VX6A 1BLIA 3IJ8A 4W87A 4OBRA 2F8QA 3PZGA 4PMXA 1N82A 2XJ7A 1DP0A 2Y8VA 2O9OA 3F5KA 3VGBA 1E4MM 2BVDA 3AIWA 4AISA 2FHFA 4E8CA 1HP5A 2HVMA 4W5ZA 4EE9A 1UD6A 3W24A 1CNVA 3GYCA 2PC8A 5GNXA 4U33A 5ECUA 4WKHA 4YPJA 2X0HA 3CBWA 4PSRA 2J7EA 2V5CA 3KL3A 1LL4A 3RM8A 1HJUA 1UWSA 2ZXQA 4V27A 1ODUA 2PI6A 2DSWA 3RCNA 2CERA 3LMYA 2BY2A 4ACZB 4QCFA 3RDKA 4XX6A 1EDQA 3AXXA 4PMZA 1CGTA 2XTKA 3EDKA 3MMWA 2PF0A 6CGTA 4FF5A 2YA2A 5E6YA 4D72A 4IPNB 3RM4A 3GXFA 2CIPA 3OLDA 3WNLA 4WKFA 3AS3A 4M82A 4HMDA 2WC4A 4PTVA 4OJYA 1J0KA 5CGMA 4UQDA 1V3HA 1W9BM 3F4VA 4KGJA 3SURA 1W2VA 5AC4A 3ECQA 4CCDA 1W9UA 3GNOA 4ATWA 1KXQA 3EMQA 1GHRA 4JFVA 2V3FA 4TVDA 1UR2A 3BSGA 1KR0A 3CPUA 1MXDA 4A3YA 3M6DA 1F4HA 4UFJA 3LPFA 4AZCA 1NH6A 1W91A 1KQZA 1ZBWA 2VOTA 2UWFA 4AIEA 2ZUUA 4WKAA 4GO9A 2DIJA 4M81A 2XHYA 3VGFA 4UOQA 2XG9A 1MXGA 4P7RA 3T2QA 3S6TA 3WQWA 3ARQA 1E73M 5A6SA 1UWQA 1Q6GA 5GNZA 4Q7NA 3TA9A 1Q4NX 5EB8A 3LPGA 4FLSA 1CGVA 5D9MA 2WMIA 3N15A 1TZ7A 1UKOA 1EXPA 4P7OA 3PTKA 3ZJ8A 4UFHA 4M1RA 2E8YA 4W89A 1SFSA 2BVYA 1UR9A 1QVBA 1J0ZA 3WNPA 1H41A 4TVCA 3VD4A 4CVUA 4GI6A 2D3LA 2CBUA 4WSKA 1YHTA 5ABFA 4H41A 3SUTA 2XVPA 3GXIA 4MTVA 1EA9C 3L4ZA 1K9TA 4KRTA 5EMYA 1JYXA 3PZTA 4U3AA 3A47A 2CXGA 3BLPX 3FAWA 3MMUA 5CQ1A 1AQMA 3CZGA 2WSPA 3EDDA 3SCTA 5BWFA 1BSIA 3WDHA 3PZMA 1W9DM 1QNQA 3MMDA 2ZUNA 3A3HA 3WL0A 5D8ZA 1XV8A 1L8NA 2EPNA 3CZKA 3F5JA 2FH8A 2OYLA 1XSKA 3FHQA 1JZ3A 1C3FA 1OIFA 3BAIA 5BRQA 4D6EA 1JDAA 1WDSA 5BROA 5M17A 4W88A 2JIEA 3L4UA 1CBGA 3VUPA 3TP4A 2J7DA 2W62A 4JKKA 4MB1A 2Y4SA 4AEFA 1NWTA 5BXPA 3ZO9A 1V6VA 1LG2A 2UY4A 4QP0A 1J12A 3VOCA 4HA4A 2D20A 1GQJA 2ZWZA 4KGLA 1NARA 4KRUA 1JFXA 4AZ6A 4D6HA 2VVSA 2E9LA 3K8LA 1HT6A 3AI0A 1VB9A 1EO5A 2OWCA 1UR1A 3AIVA 1MYRA 3WUGA 3G6MA 3ZM8A 4AZGA 5CJ5A 1KGXA 4W85A 2EPMX 4NRRA 2QV4A 4AZ5A 3B8SA 1UZ4A 3GZAA 4H8HA 3WENA 3ZT6A 5I3DA 2BV9A 1PX4A 2ZE0A 5FL0A 3ZMRA 1WP6A 1E70M 1ITXA 2WHKA 4MADA 3AS0A 3W6LA 4C7GA 4AZCB 1EQPA 1FOBA 1QNRA 4TOQA 4U3CA 4AIUA 1JYWA 2WHMA 1CXKA 3NIYA 1HNYA 9CGTA 4ML4A 2XWEA 3VIMA 3UG3A 1XC6A 1QNSA 4XZWA 4GQQA 4HTYA 4H7VA 3CUIA 2CETA 3ALGA 3VMOA 3WD1A 2GK1B 3EYPA 3ZOAA 1LLOA 1VFOA 2ZXAA 3T08A 1HVXA 4Q22A 5DO8A 1KBKA 1ZL1A 2WLZA 3OG2A 3SEPA 5IDIA 1V3JA 3L4YA 4QFUA 3DYMA 1NP0A 1BVZA 1NOWA 2O92A 2WMIB 3U7VA 2ZUWA 3WDQA 3M46A 4NZCA 1JF5A 1EDGA 1XSIA 4MB3A 2VCAA 4L4PA 1VFFA 2IXVA 1PJ9A 1SR0A 4J27A 4RE2A 3CHEA 1LF1A 2J8GA 1UR4A 4U31A 4CCEA 2WZIA 5A94A 1GQLA 1MW2A 4N0RA 3RM9A 5ABFB 1UH3A 3CLWA 3VIKA 1UHVA 4GIAA 1UR8A 1ZJAA 3WF0A 3FHAA 1LWJA 4JHZA 2WVVA 3VDCA 3ZIZA 1XSJA 4PRWA 3I3BA 2D24A 1TUXA 5A6BD 4UOZA 4U5IA 4D1JA 1UUQA 4LYRA 1HL8A 5C71A 1XH2A 3SCRA 2F2HA 1QHPA 1VJSA 2WHJA 1VEPA 2W4XA 1B0IA 4TX6A 1JAEA 2GJRA 1UQYA 1FH8A 2D22A 1V0NA 3IAQA 1PZ2A 2W92A 3CUJA 2ZX8A 1VEMA 4ZE5A 4UQBA 2EPLX 2ZIDA 5E6ZA 3CZLA 2FGZA 1V3LA 2DGAA 1B90A 1CTNA 2PWEA 3DYOA 1DTUA 2CPUA 1CXIA 3AS2A 1MQRA 1C93A 2EEXA 5TD4A 3SUSA 5I2UA 2WMHA 4W7VA 5LA1A 2EJ1A 3SCNA 3PZNA 1M03A 4D6IA 4W7UA 4ATDA 4DWSA 2PB1A 4UQ9A 3GH5A 4PMYA 5ABGA 4QLKA 1C92A 1GPFA 1M53A 1JFHA 3ZJ7A 1TG7A 3OZPA 5A6LA 4JHOA 4NI3A 1BG4A 3WQ8A 1V6WA 5EFDA 4B3KA 4J7RA 3WL1A 4AD5A 2WNWA 1DWGM 2VJXA 1HP4A 1R7OA 1UG6A 1U30A 3BXWA 2BXYA 4U5KA 2C0HA 2WK2A 3PZVA 4PEEA 2V3EA 2Z1KA 4GO8A 2VCCA 5HXMA 4MAVA 4CN6A 3NDYA 4WF7A 5DMYA 3L4WA 4BQ3A 1UQZA 2CEQA 3MUAA 1W1VA 4JKLA 1MW0A 5A6MA 2YBTA 6TAAA 1JL8A 1GCYA 1V3KA 4CCCA 1RPKA 1H0GA 1MVYA 1W3JA 1DWFM 2W91A 2E40A 2Y2WA 4MNKA 3WELA 4MAZA 4ZE4A 2WVUA 4HPHA 2WXDM 1Q6CA 4J3VA 1B9ZA 5BCAA 4Z2GA 1W3KA 5HOSA 1HJSA 3MUIA 1SMDA 3RILA 3N18A 2GJPA 2J7HA 4R27A
chains in the Genus database with same CATH superfamily
3T8LA 4Y96A 4JN8A 3L0KA 4UZUA 1XDLA 4W8BA 4RNIA 3KP1A 4RZ5A 3FFSA 3S0CA 4FOUA 4N6EA 1TTJA 2AOSA 3AHVA 4NNCA 2HJPA 3N11A 2A4AA 1KBLA 1NY1A 2WVVB 3N13A 1H1ZA 1N55A 2ZQ0A 1SO5A 3RFAA 5M3WA 3DKLA 3S5NA 2ZTKA 1O60A 3GU1A 4HZ7A 1NP2A 5LA0A 1OT1A 4WOZA 1OYAA 3BW4A 1OX6A 3BJSA 1J9YA 5A2AA 3QV6A 4UR7A 3BW2A 4R3UA 4US5A 3ATYA 2V2CA 3K4WA 3TYAA 2QUTA 4NHVA 2EF9A 4ZQOA 4QEHA 2W5FA 3QR0A 1XINA 2QGYA 2A21A 2CC0A 3N14A 2WKJA 4QDPA 3NL2A 1UWRA 5C9WA 2E6FA 2P0OA 1JAKA 4C6IA 3N12A 3U0HA 3DFHA 4LVGA 2ALRA 4R5EA 5DX7A 4PCPA 4KFPA 4QLLA 1TCMA 1RCOB 3TSMA 2WBKA 3GX9A 3WFZA 3W7JA 1PX3A 4KCTA 2V5DA 2RDUA 4D6FA 1Z89A 4H8NA 4GWEA 1JF6A 5JVLA 2X41A 2A3CA 3SN0A 2RDXA 4FXSA 3P7YA 3EB2A 4E38A 2VQTA 1CECA 4IMFA 2CKRA 4JD4A 3HQNA 1KTCA 3DHDA 5D9OA 3MO4A 3DHUA 2XVNA 3VDAA 1Q65A 4NVTA 4AX7A 2JEPA 1ZCOA 5C2CA 3WF2A 3SCUA 4HZ8A 3W6MA 1EH9A 1GUVA 1TPDA 1O12A 3ARUA 2VFDA 2C8NA 2QJGA 4GX8A 2DZAA 3WH5A 7A3HA 5LZLA 3UEQA 4PCSA 1RVGA 4WR3A 2PGEA 1ZFJA 3OTRA 1TMQA 3CIVA 2DEPA 3GNPA 3T0TA 2UY3A 1BQGA 2FMNA 2PDLA 3DDMA 1XLDA 2ON3A 4BZYA 1Q8JA 3MJYA 2O4QA 1KA9F 4XWUA 3FJNA 1W54A 1TFVA 3W86A 3MP3A 1RA5A 2EAWA 1PUDA 2OWXA 4ZB5A 3WEOA 4DO5A 5HMSA 2V9DA 4ZA0A 5CAKA 4IQLA 1FWTA 1KRBC 4WGHA 3S9IA 4IFKA 5D4YA 4GD0A 5EFFA 4OUEA 2C91A 4RW5A 4DZAA 2PBGA 1TVLA 2XDFA 4JQ4A 3C0QA 1HN1A 5ABHA 1UIPA 5FOOA 1YXDA 4TUFA 3G1VA 1B3WA 6REQB 3R25A 4GHRA 1PXGA 1M1BA 2JFEX 4UQEA 1Q5MA 2B7OA 1QO2A 1VFMA 3TX9A 4PB5A 3LPOA 2NW0A 3A3XA 2D0GA 1FWSA 1FXPA 3S1XA 2VDIA 1OT2A 3DI0A 3GFYA 2J6VA 4NNBA 4JNMA 4DBUA 1A5BA 4Q8OA 3BO9A 3W7OA 5CH9A 3VX0A 4D2JA 4AW7A 1GONA 1Y8BA 3QZAA 4IJCA 1C8XA 1SW0A 2C13A 4O1CA 1D9EA 4H6EA 2HXTA 5ABEA 4PMJA 3QYSA 4KKXA 1W3LA 3W72A 1IE7C 4K1GA 3RMEA 3H8AA 5IFPA 2WWDA 2RGMA 2Z28A 4K8EA 2F84A 1JZ8A 2ZOXA 3LS9A 2QCCA 1JD9A 1JXJA 2DSUA 1VYPX 4FNSA 3TMLA 3FJ4A 3WUBA 5HJLA 5K9CA 1RXOB 4KFOA 1XQLA 2JKPA 5H8MA 2QPXA 4LRSA 4DPQA 4AWTA 2X0SA 2CLEA 4US6A 2NQ5A 1AL7A 4QG6A 3FJLA 1OGSA 2J8FA 3DEQA 3LERA 4UMBA 3FN9A 1VR6A 2DORA 1G7VA 1GQKA 1XIFA 3FA4A 1RV8A 3VIOA 1TV2A 3GIQA 1Q3NA 3QZEA 1YXCA 1K03A 3W27A 1F76A 2DDXA 4ASTA 3DOPA 1CDGA 3MV01 1KTNA 1NFBA 3N4EA 5M1TA 3EXTA 2DT1A 2VC9A 1I1WA 4ZOAA 2DT3A 5E0FA 2GJLA 1A5LC 2YA1A 3MVTA 5CJNA 1X6LA 3WK2A 3D6NA 4O1AA 4QR6A 4WGXA 1GVYA 2TAAA 4AC7C 3LCGA 4GI4A 4DBWA 3KVJA 1MFVA 3LI1A 2OODA 4ZXOA 1E1CA 4HA3A 5C9RA 3SCSA 1OB0A 3WF1A 2E68A 2VC5A 3KW3A 4NYUA 3W1PA 3NQEA 3TA6A 2XINA 2HNEA 3M0XA 4BFAA 5GPRA 1EJXC 1YIXA 3E49A 3WQ5A 1X7IA 1GQNA 3VIHA 1BGGA 4HHPA 4J2MA 3RLGA 2ISFA 4H9UA 4AEEA 1RLDA 5C2XA 4JNZA 4DNMA 4GQ0A 4PMRA 2CZDA 2WKGA 1TWWA 2WO5A 2QAPA 2VC7A 3B9DA 3NSNA 4BA0A 3BCFA 2ZADA 1VBUA 4EKJA 7XIMA 4UB9A 1MUMA 4HNLA 3WY1A 4GZIA 1QOQA 3K46A 5AY7A 4XKYA 5G2HA 4FXJA 3R2GA 2BHUA 4GBDA 2OEJA 3FSTA 3ITVA 3BJFA 1E0VA 3KVLA 2YLLA 4CD5A 1QPQA 4DUVA 3FK4A 1LG1A 4O1FA 3PVFA 2NT1A 4JEJA 2Q02A 4QSFA 4NIRA 3WEZA 2B7PA 3VPLA 4H00A 3B05A 3B9NA 3BLDA 1XLIA 1BPLB 1UWIA 1GOKA 2FVLA 3OLEA 3BCDA 3LMZA 1VAHA 4YVVA 2QUMA 1SJBA 1CT5A 3QPZA 1G6CA 1TX2A 1BVWA 1EEPA 1IXQA 4IIEA 1XCXA 3TLQA 1XQKA 4ZZ9A 3EGJA 1XUUA 2REQB 4ZOBA 3WCZA 3ELFA 4S3JA 3W25A 2QUVA 3EX4A 1RALA 2V69A 3B8VA 2G3JA 3V3WA 4D1IA 1V6XA 4MNLA 5JUVA 4ZO9A 4P7NA 1VRDA 1XYFA 3USZA 1QI2A 4L6HA 2FH6A 1PDZA 1MDLA 3MUZ1 1X97A 1L6SA 4D8ZA 4KF1A 2HBVA 3DC8A 1FCVA 1GKRA 3LGEA 1DIEA 3VE9A 4FIQA 1EFZA 3CL7A 4O53A 1KFCA 7REQA 4F2UA 3MP5A 2J88A 2VNCA 1JYNA 2CYGA 3B0XA 4FB7A 4R85A 3GBDA 3M1ZA 1PZ3A 1ZJBA 2J4GA 1AK5A 3AIBA 5HINA 1J93A 2VVNA 1WAWA 3POHA 1EUNA 2YSWA 4HSHA 2RDTA 3W87A 4DUXA 1R5YA 1L6YA 3IWPA 1QWGA 1PPIA 1B4EA 2DPEA 5LNRA 3MDUA 4DRSA 3GHTA 3F5LA 2FZ8A 3VINA 3T0AA 2HISA 3OIXA 1PTDA 3WLTA 4H4IA 3VE7A 1FY6A 1HO4A 3ISIX 3PANA 5C6MA 2PC4A 1H61A 3L0GA 4UQCA 3P0XA 2PA6A 4FEZA 1NOFA 3D3FA 4HMNA 1EJ7L 4JQ2A 1UWTA 3GM8A 3MVIA 4AC1X 3NDZA 2A3AA 4LF2A 2OGJA 1K1DA 2J25A 3D47A 4MPQA 4B2DD 3FY1A 1VFLA 2CESA 3NVDA 2INFA 1QRQA 4RX0A 3PFRA 3KLLA 2B4GA 3HV9A 1W9XA 3CUFA 2NV2A 3MCNA 3H2AA 5BZAA 1Q6LA 5FCZA 4E4UA 3N29A 2P88A 1EBHA 4MZ1A 3VKBA 1H7XA 3IIVA 3CUXA 2EHHA 2V8ZA 2GOKA 3KTCA 2HPMA 2VCBA 5E0KA 2ZA2A 3WLNA 4M19A 1SJDA 5JH1A 1DYSA 3T07A 2V82A 1ZPTA 5FJUA 4S2BA 4FIRA 3RGTA 3C2VA 3CQJA 1JCJA 1D8CA 1SFLA 4ROPA 1P48A 3MKCA 5TIMA 2QCDB 2E9MA 4H6QA 3W00A 1KFBA 5DFAA 3WBWA 1OIMA 2VL4A 1ZCCA 3C2YA 5M03A 2RDWA 3AJ7A 2BHYA 2VR4A 4WDTA 1F2JA 2HE5A 2Z1WA 2WCAA 2B7QA 4HPNA 4TVUA 4ZGYA 4JN7A 2FGBA 1S1RA 4Q4PA 3ABQA 2WNQA 1PWLA 4HSOA 3CUHA 3JZUA 3VNMA 4YHGA 5G4EA 2DZVA 4JDYA 3WH7A 4IOTA 3PC0A 1P0BA 1ZS2A 1A5SA 5BWAA 4ECLA 3UZJA 3I3EA 1PWMA 1ME7A 1S2UA 4LBRA 3B9AA 1UZHA 1K7EA 2R6OA 2HRWA 4JZ5A 3PBMA 5GNYA 4ZENA 3BC9A 1EA0A 1TJ2A 4GXMA 2O0TA 3VKKA 5LNSA 3RO8A 1MEHA 4G1KA 5D9PA 1A3XA 2Q8XA 3WFLA 3SRFA 3ZR4A 2XGIA 2GK1A 2J7BA 1HTIA 3MUXA 4E2DA 3SGUA 1KKOA 1KBIA 2QPSA 3CQ0A 1DJYA 1LL7A 1K9FA 1SUXA 1TRDA 4AIBA 1B5TA 1JRBA 1YNYA 1PZ1A 4Y8FA 1UC4A 1EX1A 1D7FA 1JDDA 3LN3A 2OYMA 3O6DA 4JYFA 5TNVA 2YCJA 1A5CA 3PJTA 5F1UA 4C5YA 3U8GA 3BSHA 2OQYA 3N04A 3U6WA 2IUZA 2GVGA 1N8IA 3ZR6A 1SZGA 1CLXA 1LUCA 2DQXA 4DO4A 3F2BA 1BEUA 3PZUA 1UKPA 2XVLA 2NZLA 3W23A 1AVAA 3LX9A 1QK2A 1V03A 3FW6A 1O5KA 5I03A 5D38A 2PRLA 1NOUA 2XIMA 1PTAA 1RSCA 4RZ4A 5KZDA 4GUHA 3PJWA 6XIAA 2Y85A 4JX5A 5BRPA 3W88A 5LGXA 2YBUA 1D3CA 3KUMA 1OD8A 5FSDC 5CXPA 3KL0A 4ZSTA 1R6WA 3WLLA 4KW2A 4K7VA 2E77A 1E9LA 1MWOA 2XIOA 3HG5A 1XW8A 3P62A 1VGAA 5K9DA 4OUIA 4JFSA 5C9XA 4H6KA 4QBXA 2V30A 1P5BA 3FVDA 1BFNA 2QCFA 5DXYA 2VTFA 3BJTA 3TE9A 3L12A 4DM1A 2QHAA 2WZEA 4DUOA 2I57A 3LSBA 4GI9A 1TE1A 3W7PA 1JI2A 1GPWA 1Q85A 1VCFA 1DXFA 1VFSA 3CB3A 3GH4A 3W1QA 2E3ZA 1XBZA 3H70A 5LIUX 4Z2KA 3CTTA 3DFNA 1YPFA 1V51A 2X7WA 4AWSA 2IS7A 1NQ6A 4Z08A 4L9XA 4LX4A 4OWGA 5I78A 1KFJA 3ARSA 1DHKA 1TA3B 3BOFA 1E51A 1EHNA 1MQQA 3WK0A 3JZEA 3OO2A 2OVLA 3W2UA 2QLYA 2PCEA 3E0FA 2F6XA 2XIBA 4AYSA 3FV9A 1O7AA 1RY8A 1VYRA 2BVWA 4LJ3A 2WC7A 5EBUA 2VZUA 4HOWA 1R47A 4GXPA 5BOFA 1V0MA 1XH1A 3CC1A 1E5JA 4YYCA 1JNDA 4NJHA 2YZ5A 4Z1AA 5FF3A 3H21A 1WKYA 1E5NA 3C0LA 2VGBA 4GINA 2QDHA 4HA0A 1H2JA 3APYA 1OFAA 4MKVA 4AD4A 3OYZA 1VP5A 1PCWA 1EHAA 1W37A 2X30A 2V5BA 1I9CB 4QNEA 4IP5A 1NDWA 3V75A 2ZX6A 1JJKA 1W3NA 2VX5A 4CEUC 1JGMA 2GUYA 5T8GA 1HJVA 3F1QA 1ZU8A 3KFTA 1VC4A 4WY0B 3DC0A 4F79A 1R30A 3RJXA 3LCFA 3A13A 6A3HA 1FH9A 3KBMA 3KXQA 1M9HA 1XISA 3WDIA 4EPEC 1UH4A 3L4TA 4DXVA 4N6FA 5AHNA 1C8VA 4AWUA 1UA3A 3M07A 4P5UA 2E09A 2XH2A 4OECA 5EY5A 1F6YA 5GJPA 1DKWA 3N6JA 1GZJA 1FWBC 3Q58A 3BGGA 4PE8A 1EOMA 1V0KA 1BSLA 3E2SA 1SZNA 4YS1A 4O13A 2XU2A 5HJYA 5JXQA 3VZZA 1XRSA 1J5TA 1XFBA 2O55A 4P7QA 3B40A 3EWXA 4ACZA 1E9YB 2QJHA 3OB8A 5G1MA 4UTTA 3W70A 4LC6A 1SO4A 4TX8A 1RBLA 2F9RA 4OFCA 1OFOA 2PDQA 3HG4A 2E5DA 1ADDA 2JGQA 4LY4A 4N2YA 1FX6A 2IQ0A 1WUFA 1EIBA 4R9OA 2INZA 1GJUA 1NF7A 1FHDA 2HSAA 6TIMA 3PG9A 4JBRA 1OM0A 2QXWA 1G5AA 4S39A 1UJQA 2VUNA 4LCQA 4QCEA 1TUFA 1NDVA 4XAFA 1QPKA 1R8LA 4D8AA 4BF7A 3A4JA 1BYAA 1C9DA 2HK0A 1R3TA 1D7KA 3UJSA 3UERA 4S3GA 1BAGA 5XINA 4GC4A 1B3XA 3O63A 3G24A 2OZTA 1LT7A 1P43A 2CBIA 1W1PA 3UNDA 4E5TA 1QHZA 3HPSA 5LGZA 1QOPA 3LYEA 3QN3A 4Z1CA 3VNZA 2XFFA 1WOAA 1XC4A 1TV4A 4RDYA 4FOJA 3EWZA 4BJHA 4DX3A 2Z6JA 4IPJA 1BF6A 3APTA 3KX6A 3ZJ6A 4GGBA 4WK9A 4UTWA 1F05A 5AVNA 4PMVA 4DJED 5AZ1A 3OZOA 2J78A 2WZMA 3SUWA 4GLEA 1XFCA 3NFUA 4ORIA 1RCXB 4AQLA 1FCUA 1W6TA 5EKYA 3WLHA 4O52A 5AVHA 2ZC8A 5HR7A 4E3TA 3NEVA 3HBLA 1B9BA 2CKSA 2FHCA 4RXGA 3VOJA 3VXGA 7ODCA 2P53A 1A5NC 4NXKA 4XV0A 3B0YA 3P61A 4MWAE 2DT0A 2YL6A 3CU2A 1IWAA 4TXEA 3IJ8A 3OU8A 1ZALA 4YYFA 4PMXA 1ADSA 2O9OA 2ZYFA 3KS6A 4DI8A 4KWWA 3HJZA 4JTCA 2FHFA 1S2TA 2Q6ZA 1HP5A 2DFAA 3E0LA 4NJKA 1FWCC 2PC8A 4C6QA 1A4MA 2V5KA 1CW2A 1EWDA 1T0OA 3EOSA 4S3FA 4PSRA 3DI1A 5E9XA 1LL4A 1MO0A 3EZ4A 1FUYA 1PYFA 4IUOA 4LRTA 2DSWA 1W5OA 3XISA 3RCNA 2CERA 3LMYA 2BY2A 2OXNA 3UZ5A 4K8HA 1EDQA 2C15A 2I16A 3Q67A 1L2UA 3UXLA 3TW7A 4FF5A 1OFDA 1O4UA 3IK4A 4O8AA 3GXFA 3ENLA 1IWPA 1EP3A 3OVRA 4HMDA 4OJYA 4NAEA 4PULA 4UQDA 1V3HA 3F4VA 3ZVHA 3SURA 1W2VA 4CCDA 4TQTA 5CKSA 4E2VA 3IJIA 4XZIA 2O56A 3VNIA 4IG2A 1KR0A 4IF2A 1PSCA 3LOTA 1MXDA 4DAFA 1O68A 3KZPA 3LPFA 1NH6A 1I8JA 2Q71A 1W91A 4ZO6A 4ZVJA 2FPVA 4B4FA 3U4FA 4H9XA 4AIEA 3HB9A 1WXZA 3B8DA 1J2WA 3B4YA 4N4QA 4UOQA 2ASHA 1YLVA 2BODX 3T2QA 3S6TA 1WKFA 1X38A 3UG8A 3WQWA 3QBUA 3ZXWA 3HPXA 1FHUA 3RR1A 5A6SA 4FXFA 1QNVA 4ZB0A 4L56A 1O66A 1UP0A 1S3TC 1GVSA 5D9MA 2WMIA 5KZMA 3MPGA 2V68A 4P7OA 4XAYA 4B5NA 2W9MA 2BVYA 2NQZA 2KAUC 3VZYA 1EYEA 1HKVA 1AUSL 2EPHA 1GVFA 4CVUA 2ISDA 5T9BG 4LUTA 1SJCA 1DJWA 4IJRA 4F0RA 4H41A 3ZWSA 5HJXA 2PDPA 4IMCA 1K9TA 3W2JA 4GYPC 4Z1DA 2CXGA 3MMUA 3BTNA 5CQ1A 3G1SA 3EKZA 3EDDA 1P0NA 3TWAA 3I7SA 4IFRA 5BWFA 3UPBA 3T0CA 3WDHA 1EP1A 3PZMA 4I9MA 4QTGA 3RX4A 3H7VA 3UXIA 3WL0A 1XR2A 3QGAC 1KM2A 3ITOA 5D8ZA 1F8MA 1YNQA 5CZ0A 3AUJA 4NZ4A 4ZOEA 3EKLA 3FS2A 2FH8A 2OYLA 3T8QA 1JZ3A 4S38A 3VFCA 2GSHA 1IHIA 2QIIA 3DCPA 5BRQA 1WDSA 4QJ5B 3DG6A 4W88A 2HVOA 5CPMA 1CBGA 2DJXA 1H62A 3NDOA 4M1BA 3TP4A 1TQXA 4MB1A 3N3MA 4J35A 5BXPA 3UWEA 1DIKA 1I60A 4IMAA 2VP8A 3CEUA 2ZWZA 4KGLA 3QQWA 2PDUA 3L21A 1LWIA 4KRUA 1JFXA 2PGRA 3DFPA 4H9YA 3KTXA 1VB9A 3H6OA 4YCOA 3VCNA 1UR1A 3QM3A 2IKHA 4MZ8A 3WUGA 1PDYA 4C6OA 2NV9A 3VKDA 3BMXA 1S5MA 4EWND 2UV8G 3C0SA 4MVAA 3G6MA 4XIMA 5FJOA 4IIHA 1QR7A 3ZM8A 1T8XA 4AZGA 2REQA 1R3WA 1Z3NA 1FWFC 3EX6A 4LOCA 3ZLGA 3PNUA 3KM8A 4AZ5A 3N25A 2ISWA 3TQVA 4I6VA 4LBSA 4NXSA 5FL0A 1XGEA 1I0DA 4QQUA 3CUZA 3FJ6A 4MADA 4Q4RA 4C7GA 3GYEA 4AZCB 1OCJA 4TOQA 1K3UA 4XK2A 4XD3A 4F3HA 1K4HA 1QNSA 1OABA 4XZWA 3A24A 4MY1A 3CUIA 2CETA 3SFWA 1TREA 3WD1A 4EACA 4PR4A 3ZOAA 3UYIA 2ZXAA 1HVXA 1KBKA 2F2KA 2OEKA 1DL3A 5IDIA 5HNUA 4Q4QA 3QMTA 3IIZA 3PNZA 3U7VA 2EG8A 2ZUWA 1JF5A 3LCLA 3IJDA 3QFWA 3ZVIA 1E0TA 1VFFA 1RD5A 3S4TA 3MB9A 1PJ9A 4J27A 4OV9A 2DUAA 4DLFA 2RAGA 3E12A 1UR4A 1XIDA 3TEVA 1KLZA 1P0DA 1MW2A 4N0RA 1Q6QA 1UASA 1UH3A 1KFLA 3U2CA 1YDYA 1LBLA 1ZJAA 4EXAA 1JCLA 3GG7A 3P8IA 4AF0B 1LWJA 5FAJA 5G1YA 4LY8A 1ZUAX 3HZ3A 3M64A 5CG7A 2ACQA 3UQNA 3I3BA 9XIMA 4MHBA 1MUWA 1IZCA 3LV5A 3QPEA 4D1JA 4EVZA 1GKQA 4LYRA 2EGZA 5C71A 1JPDX 3OODA 1JR1A 4QS6A 2F2HA 1Q7ZA 1QHPA 4LB4A 2WHJA 2C79A 1VEPA 2IQTA 1VPYA 3M7WA 1IEIA 1W17A 3TYEA 2GJRA 1V0NA 2ISVA 1PYMA 4O28A 3CUJA 3O15A 3N4FA 4ZO8A 3A21A 4HBKA 3IVTA 4H7ZA 2Z1VA 5E6ZA 3NZGA 3CZLA 3UJEA 1V3LA 2DGAA 4YVXA 2BGNE 1CXIA 3SUSA 5HA7A 5LA1A 5TD4A 3G1HA 1XL9A 4REQB 3SCNA 4G7EB 1NELA 4RDWA 1SZRA 4GY7A 4D6IA 4W7UA 1LORA 3C52A 2Y5SA 4PUUA 4DWSA 5FA5A 4UQ9A 3GH5A 2C1HA 1GJPA 3TC3A 1EKOA 5REQB 1Q2RA 1M53A 3SJNA 3NM1A 3UCCA 3W7IA 2YXXA 4JHOA 1ZAJA 1BG4A 2I56A 3WQ8A 3PB0A 1DXIA 2PDWA 2VDGA 4H01A 1NF0A 1OFQA 1V93A 3BXWA 4HNVA 1MXSA 2QCGA 3TKFA 2BXYA 3FIGA 2PU1A 4HZMA 1IYXA 1ALDA 4PEEA 4LUIA 2V3EA 3RRXA 3N9RA 3DGRA 4GH3A 2VCCA 5HXMA 4WF7A 3L4WA 1UQZA 1KM6A 4GY1A 4BF5A 1V3KA 4CCCA 2W91A 4F4RA 2Y2WA 2PDNA 3V0TA 3WELA 3L5MA 1DJXA 3KOXA 5FF2A 1Q6CA 3VNKA 4Z2GA 1K77A 5HOSA 3MUIA 3T40A 1F74A 3CAKA 5HWJA 4FXRA 1VJIA 4GX9A 2J7HA 4R27A 1UC5A 1PIFA 3E1F1 3WLRA 3IVSA 3K4DA 3V36A 1U5HA 2DV0A 1OFPA 5CZSA 3WQFA 1UR0A 1XYBA 2ZE3A 3IUHA 1ITCA 3N3TA 3GUWA 1FWAC 4GYJA 3B8IA 4EXBA 1XLLA 1EC9A 1LOQA 4XO7A 3P5ZA 2NX9A 3CHCA 3WQPA 1ZBKA 4L1GA 3TNBA 2IKIA 4X9YA 3PP7A 2PDYA 3U5YA 5DEZA 4IXHA 3UG5A 3SI9A 3NJ3A 1UW9A 4E4PA 2VMFA 3K5XA 3IVUA 3OGVA 1S46A 2Z7KA 3SM0A 3VNYA 3ZR5A 3RIKA 4DZHA 3LTSA 5F7UA 3MSDA 1B3YA 3FX4A 4H2CA 8RUCA 3BAXA 3F4NA 4TV5A 3GNNA 4OIFA 2QZRA 2PD9A 1LYXA 4URIA 4LQ1A 3WH9A 2YL5A 5I79A 1FWHC 4GVHA 4ZCWA 1E0XA 1PBGA 4A29A 1K6AA 1P1MA 3RAOA 4AZBA 1JUBA 1O5RA 2BASA 4A8NA 4HMCA 3C56A 3QHNA 4H9ZA 1DWHM 4YTQA 1WZAA 4ADTA 1REQB 5AYIA 2PRHA 2FFCA 1G1YA 4F8XA 4FI4A 5HANA 4IMDA 4KWVA 1K7XA 3ATZA 5GVJA 5KTLA 3DHPA 2AL2B 2AQOA 3KRZA 4UXDA 1KCZA 4HYRA 2OSWA 4H8VA 3UNTA 4A2SA 3MHGA 3U48A 1E6QM 1TMHA 4AIOA 4DXKA 3SAZA 3W4RA 1MRAA 3ZJKA 3PBGA 3KP0A 1M68A 1A80A 3AHZA 2YCLA 4Z2IA 4OBTA 1TWIA 2QF8A 1Q6DA 2W61A 3A4AA 4RZ6A 1TE6A 1GOMA 1KW1A 5GJMA 1GOQA 4K7YA 3VGDA 4XIAA 3T2OA 5M5DA 1TPEA 5A8GA 1IIGA 4UFMA 2INEA 5A3HA 4MWAB 3ZT7A 3TC6A 3CHDA 4QAWA 3PY2A 4GNVA 2XZ9A 2XFYA 3ZSSA 2VD8A 2EG6A 4Q8NA 1QJWA 1J79A 3HGOA 4PFMA 4TTUA 3W1LA 3H53A 2PP0A 1XGZA 2QCLA 4OOZA 3TJ4A 4AY8A 4IGNA 2XIIA 4R53A 3VZXA 4KT2A 3CV1A 6ALDA 4B90A 1VIWA 2O7QA 1NWSA 4AB4A 1HXJA 1X7FA 4GH1A 2X8RA 1JZ5A 4X0VA 3MO7A 1XLGA 4DN1A 4EK7A 5I3KA 3A5FA 1BQCA 2D1ZA 1BTCA 4QJ1A 2PDGA 4F0HA 2DU2A 3BV7A 1DJQA 3GVWA 3LGDA 4GGHA 5KEZA 3B0PA 1QI0A 1U83A 1K8XA 2Y1HA 4YVPA 3KOZA 3S46A 3BW3A 2WC3A 3GU9A 3LCHA 1A0DA 3QR1A 4MNMA 3K8KA 4C6EA 1O1HA 3QY7A 3TH6A 3BDKA 2NXGA 2BWGA 5CSYA 1RP8A 4Y9AA 5FEWA 3H2NA 3CGTA 5I23A 3UY8A 3WNNA 3F4CA 3NYZA 3M0JA 4BQ5A 3L2LA 1X8CA 1UP3A 9RUBA 3NL5A 1PAMA 3O1NA 4DY1A 4E8DA 3NURA 2VURA 2Y89A 3T42A 4LALA 2PWFA 3EXSA 1Q6RA 3HQOA 3IUDA 3GS6A 1B1YA 1IEQA 1SZEA 2OZ0A 3LHUA 4GYFA 2BDQA 1WKDA 1KCXA 2POTA 1XYMA 3SQSA 4C6NA 4W9TA 3S6OA 3AXHA 4RZBA 1H7NA 2B7NA 2GJXA 1E6RA 1R2TA 2PTWA 5AC8A 4Q3MA 2ADAA 1JCYA 3W7RA 4DJDD 1KWKA 4OE7A 1G0CA 3LCWA 1F4AA 4XD5A 5SWUA 3EWCA 1QWKA 3TTQA 2VRKA 1FFQA 2D2OA 3PSWA 1R7AA 3W7GA 5G2IA 4EP8C 3A3WA 1H1NA 1ZNNA 4LPCA 1Y5WA 3AFBA 5D2TA 1ZY9A 4NZ1A 4ZQPA 2G3FA 2WMFA 2GFTA 1Z7AA 4HKPA 4RPQA 5LHFA 3VKCA 4TX9A 4DLMA 3BLEA 3DG3A 1GW1A 1EGZA 4H1ZA 2HVNA 1GTEA 3BLIA 1E6XM 2YCIX 3R12A 2VZOA 1OC5A 1KV5A 3NSXA 5U7SA 4KS0A 1KFWA 3CL8A 1WB0A 2GSEA 1GOIA 2ZC1A 5FJTA 4IFKB 3GDBA 3HG3A 3I6EA 2FZDA 4DEFA 2Z26A 4JTUA 3W7QA 3URAA 1Z69A 2BHZA 4P8VA 2D23A 3VIFA 2X40A 1VHNA 3WNOA 1V3MA 3KRBA 3ARWA 1SSGA 2PLKA 3BLFA 1W3HA 2R1LA 4DYKA 3RLVA 4UFKA 4XZ9A 3KOFA 3B3DA 1H51A 3EBVA 3FNDA 3M5ZA 3BMWA 2FB3A 1R3YA 5HWMA 3ABOA 2A1YA 1M7JA 3TOPA 4P2VA 4CU6A 1UWAA 4J4KA 2G4FA 1TCDA 1YEYA 4C1KA 4CNTA 4PUNA 1OG6A 1L9WA 4XZLX 1GVEA 1QUMA 1CLVA 4K39A 2YL8A 1FCQA 1CGWA 4FR1A 1W5QA 3TYZA 3CXOA 4Z2JA 2AMGA 1ONEA 4YJ5A 2Y0FA 1O5XA 2QVNA 4MGGA 1GVRA 4ICNA 1BYCA 3EWBX 4LAMA 3AYVA 1R9XA 5AHIA 1HKJA 3QF0A 2R8WA 2ZBTA 3OGSA 2C1GA 4U2YA 1PX8A 4JXCA 1BRLA 2WNNA 3WNMA 3EEGA 4K2SA 5U4NA 3RPDA 1FP9A 1NFGA 4LF1A 4O50A 1UD5A 1GYLA 3Q2DA 4P8WA 1UIOA 5CPOA 5I24A 4WD0A 3EMCA 4NZ5A 2YBVA 1QNOA 1VBRA 4CQDA 3HMJG 1TPH1 3NSMA 3GVRA 3WDRA 1XLJA 3W81A 3BAWA 1E40A 3G8RA 3LDVA 3S42A 3WLPA 3WG6A 1J8VA 4FNQA 4KCUA 3H4WA 3VNLA 3O6YX 4AMCA 1GQIA 3QC0A 5CPSA 3W76A 3TFCA 5FF7A 1RK6A 1HGYA 2Z1SA 4GUJA 3EWWA 2BY3A 4JFUA 1V3IA 4EWJA 2J27A 4XAGA 1SO3A 4MLJA 3WO8A 2QMJA 1EJUC 5CPQA 2GUBA 4ONVA 5FIPA 1E1CB 2DUXA 3DECA 1OFEA 4FNPA 3B9EA 3WLIA 2VRJA 1DHPA 3K8MA 1F9CA 2I9EA 3L2MA 3SJ3A 4ZTXA 2VEKA 3CZJA 5DF0A 3S9ZA 4XSLA 5T9CE 2CHRA 5BRBA 1EGMA 1KM3A 2E4TA 4RUBA 1AJ2A 3G1AA 3NOYA 4DB7A 3FOKA 1GORA 1LWHA 5FJJA 3TTYA 3H22A 4KRZA 5RUBA 3B8WA 4PFHA 5CC3A 2QKFA 3CS2A 1TJPA 4GJJA 4MJ2A 3A4WA 4G5DA 3TR2A 2XSAA 3HGRA 4MG4A 4YIWA 5G1TA 4FOKA 1KTBA 4XKYB 4KESA 2OG9A 1EO7A 1KGUA 2Z2AA 1Z32X 2FLIA 3NUKA 3BGAA 5T26A 1HZYA 5A95A 1JG9A 5E0CA 1ZLPA 4JIIX 1LDCA 1XYLA 3H54A 1ICSA 3VO0A 1GW9A 1KM1A 3NNTA 4K37A 3W7NA 3S6DA 3NR0A 3SBFA 2EPOA 3TROA 3CLMA 1ONRA 3DBPA 3IEBA 5BXSA 1V02A 4AZIA 3TZNA 3A23A 3G0XA 2TRSA 1R0MA 1C7SA 3E2VA 3KL5A 4D6DA 4UUIA 3LLXA 3TONA 3FEMA 4MF4A 3TJXA 4BCEA 2HCVA 3TNOA 2WCGA 3RR4A 1FFRA 4W5UA 1KGWA 4AFYA 1OGBA 1S5TA 1BXBA 2IW0A 2VI0A 5AHMA 3CHFA 3OLIA 4O4VA 3DGBA 1TVNA 2WZHA 3NO1A 2DIEA 2QT3A 3PUGA 1NFPA 1ESWA 3VKJA 3DHFA 1YBQA 4GZJA 4GKTA 1AW5A 2VUYA 4ALDA 1F3EA 5LHEA 4BQ2A 3PR2A 3M0HA 2BY1A 3NXLA 2DSZA 3W1UA 4AH7A 3ARXA 5KETA 4JTAA 3DYPA 4JYEA 2BNJA 1ZTVA 4BWLA 3OGRA 3T78A 2R91A 3ITYA 4NRSA 4D6JA 1B3VA 1W31A 3BAKA 3IGUA 2TYSA 3AC0A 2GQ9A 4E8GA 2XN0A 3PUOA 2OLAA 2YA0A 3S1GA 1JDFA 1ME9A 2G5WA 4LYQA 5J5RA 4F2TA 1I2PA 1T99A 3SN1A 1M41A 3N4AA 4J3SA 5AFDA 5CLWA 4GXWA 4S3EA 2YDQA 4ZMGA 1T6MA 1D2KA 3BQ6A 4U4MA 4RNHA 5CJMA 3CH9A 5IHRA 3I3DA 1XIBA 3W07A 3FVMA 1FWDC 2F38A 4C7FA 4ZEPA 2OO0A 5D33A 3L68A 1K02A 4K68A 3KVMA 4RV8A 4BF9A 4LVFA 4PTNA 3SFKA 1XKJA 3PBYA 1QASA 4C6BA 1WPCA 3QMSA 2WSYA 3W29A 4CU7A 3M7SA 3GE7A 4LV4A 1IT8A 3I4KA 4O11A 5AHLA 4U2ZA 3MV11 1XIEA 4MOZA 3JR2A 3SECA 3UWVA 4UZSA 3DG7A 4HK7A 4MYXA 4PMNA 3FXYA 4IGSA 4NJJA 3KE0A 2WSRA 3OBEA 1G67A 1UA7A 5KSWA 3GNRA 2Q09A 4DJEC 2AGKA 1YMYA 2HROA 2RFGA 1D8WA 1OD0A 3LRMA 1ZB5A 1RJQA 1C91A 1EJWC 3UPMA 1J0HA 4MB4A 2EPKX 3FA5A 3GWQA 2CLLA 2OKOA 4FSAA 4A3UA 3KWSA 3LLDA 4FX7A 4M6VA 3TXVA 1RCQA 3BLKA 3WIJA 4IQEA 5A6TC 3BLLA 1EJVC 5MKGA 4LV9A 5CZTA 4JTTA 4GIRA 4PCTA 1XWYA 2J47A 3AAMA 1YW1A 4N42A 2YZRA 3CO4A 5FACA 2X1TA 2XM2A 2PLCA 5IBXC 4H19A 2WANA 4FF7A 4MJ4A 3W73A 1XYAA 3R11A 3VIGA 5ENLA 3AMDA 3SN4A 4H83A 1OGGA 3QTGA 4S23A 4REQA 3RCYA 4ZBCA 1LOLA 4PUDA 2DQWA 1XD1A 1J2BA 2A3EA 4X63A 4QLJA 1BTMA 1BYBA 4WOQA 1W1YA 1GHSA 1JQXA 4WCJA 1VCVA 1E71M 3CEPA 4HJWA 2WQPA 5CEWA 5A1AA 4O1DA 1XLKA 2ZRZA 2VFEA 5A8QA 1H4PA 3OHMB 4OBSA 1TX0A 2Z00A 3R6IA 4ADSA 3IJ9A 1T96A 2D3NA 1R46A 4NT0A 3DAQA 4MWAD 1L0PA 1VJZA 3WBAA 3DZ1A 4PYSA 5HWNA 1JXKA 2FB2A 3LNPA 1DV7A 4HMEA 4XG1A 3PG8A 2BOGX 3ARTA 4I90A 4J3XA 3TN6A 1CEOA 4DJFA 1V5XA 3L9CA 3NPVA 2ACRA 1EUAA 2D2GA 4L9YA 1VPXA 1R3VA 3LBCA 3AIEA 4WDWA 1TPFA 3T2PA 1BGAA 5JU6A 3LM3A 2YDRA 4GVFA 4K1WA 3AMCA 3RXZA 4CQBA 3VU2A 3HIJA 1FWIC 2YL9A 2C3ZA 4CD4A 4HOZA 2Z1XA 1THFD 4AY7A 5LNUA 1SPQA 2F6KA 2YX0A 2NQ9A 1HKMA 3NL3A 1TJ0A 2XISA 1S3HA 3ANUA 3Q94A 4I3GA 3STCA 2X42A 4LUSA 4GZEA 1XS2A 2DY3A 3CMJA 3HOJA 3ID7A 2NQJA 5HNNA 3USBA 5IHSA 2CLHA 2P1FA 2QMKA 3C2FA 1DJHA 1LUCB 3HA1A 1W9PA 5AYXA 3KBNA 4C6DA 1P6CA 2XH7A 5I6SA 3GXDA 2QEZA 2Y8UA 2IXUA 3VVGA 3WF4A 3VUSA 1UH2A 2J66A 1WZLA 3SRKA 2CNCA 1AH4A 3A64A 3CK5A 3CWHA 1DXEA 3TC7A 3T1GA 4A8IA 5KZ6A 4AD1A 3L66A 3IIOA 4JCLA 4RPPA 1VFTA 4M6QA 3LPPA 1QNPA 3CPGA 1Q6EA 1JUKA 1H3GA 1KBBA 4XBSA 3G5EA 4UBPC 3G2GA 3WQCA 1EWEA 5A8NA 3TW9A 4G1NA 3T09A 3HPAA 1Z6KA 1UBPC 1K9EA 2O9PA 3QKZA 5I77A 2W0UA 3EPMA 4DNHA 5H2ZA 5CPTA 1G7UA 1NWUA 4O15A 4BS0A 2ZXBA 5AYBA 1OINA 3BE7A 3M43A 5LIXX 2XFRA 2BOFX 3TYCA 3AIRA 3MUY1 1YTDA 1E6PA 2GGEA 5CG0A 4ZSUA 1LP6A 4HU3A 4B15A 4CD8A 4QG8A 2HNHA 1MDRA 4V28A 4FP1A 2YW4A 2PLMA 3SY8A 4I7WA 3PBWA 1HG3A 3EDJA 2J74A 2A6NA 4J9JA 1MNSA 4Q8TA 3WBEA 3CV6A 1QMLA 3UGRA 4PC8A 4I9JA 3B97A 1JIBA 1YTKA 3D0CA 3WLSA 1W8SA 1VLWA 1NTHA 5A8MA 2YLAA 1QI3A 1QATA 4UR9A 3M47A 3W7HA 2DSVA 4A3HA 3FGCA 4AD3A 3H12A 1YKWA 2JKEA 1UCWA 1KB3A 4GKLA 3VFLA 1EQCA 2BGSA 4JCMA 4Z17A 1J96A 2JK2A 1CWYA 1SMAA 2VFFA 4QG9A 4HD5A 1OX5A 3RU6A 1QI5A 3W1XA 2A7PA 4L5ZA 3V16A 1QBAA 1QPNA 4PMUA 3WD4A 5I3GA 3I10A 3VGEA 4Q8UA 3UPWA 1CGUA 4C1NA 2BTMA 2EJAA 3GQYA 3G3MA 3APGA 1Y5XA 5GJNA 1UYQA 1BD0A 3NAVA 4JGDA 3IARA 3AZSA 3W7LA 4MY8A 4PTDA 4RL3A 3II1A 4PODA 3M0VA 2DZUA 1EJTC 2I5QA 2EO7A 3M0LA 1FDZA 3MANA 5A8OA 5HDRA 5JIWA 1BLIA 3V5CA 4W87A 3PZGA 4WXZA 2XJ7A 2ZDSA 1TKKA 2Y8VA 5G2WA 3H2EA 3F5KA 1PV8A 3GDTA 3SW6A 3AIWA 4AISA 3H2MA 4C5ZA 4R33A 5E1QA 4A35A 1TRIA 1F3XA 3PTDA 2ABBA 1UD6A 5GNXA 3W85A 2Q8ZA 4WKHA 4YPJA 3NTYA 1W3TA 3CBWA 1R38A 1D3GA 4H6RA 2V5CA 3GG0A 3IS4A 3KL3A 3B0UX 4JEQA 2Z2BA 3LLFA 2XFWA 5BW6A 2ATMA 2Y63A 4ACZB 3GC2A 2XTKA 3MMWA 3T55A 2DW6A 4F0MA 2CZFA 2PF0A 3TYDA 4K36A 4G9PA 5E6YA 4D72A 4IPNB 3RM4A 3GLCA 2GOUA 1UMYA 3WYZA 3OLDA 3WNLA 3KOWA 3I68A 4M82A 3BV4A 2WC4A 2UZ9A 4MYAA 4LBUA 3RLHA 4KGJA 5AC4A 3ECQA 3UA4A 2MNRA 1KXQA 5CBBA 1GHRA 2GQ3A 3C6CA 3S1WA 3GD6A 3LZ5A 4IMEA 3BSGA 4TO8A 2YB1A 3PULA 1Q4WA 3BICA 4JN6A 3REQA 3CMFA 3I7QA 4FS9A 2ZUUA 2ZRUA 4AVNA 4GO9A 1H7OA 3DU0A 4G2DA 3BWWA 4M81A 2XHYA 3CT7A 1EZWA 1FDJA 4P7RA 4FO4A 5DMNA 3TYUA 4PEKA 4DELA 1L2QA 3FXGA 1E73M 1Q6GA 4JTEA 4QHRA 3TYBA 3TA9A 3CL6A 3S2NA 4IX2A 3GTXA 3LPGA 1DBTA 3N15A 1EXPA 1Z42A 3PTKA 2BXVA 4AHOA 3ZJ8A 4W89A 1QVBA 1J0ZA 4QS5A 4AAJA 2D2HA 1OF6A 4TVCA 1A53A 3PWAA 4YTTA 2CBUA 1YHTA 2JGYA 2G95A 3PBUA 1ZZMA 5ABFA 4NY2A 4Q8QA 3GSMA 3UWYA 1NIUA 3GXIA 3GZ3A 1EA9C 1W1B1 3R10A 5C7HA 4KRTA 4TV6A 3A47A 1ZHAA 1VD6A 2QCMA 3C2RA 3CZGA 2DVXA 4JR5A 4BK9A 3QH2A 1BSIA 1FDYA 3MYPA 3GFXA 3U2EA 3MI2A 2O4MA 1W9DM 1QNQA 3MMDA 4MFDA 4I8DA 4LSBA 2NVCA 1XV8A 3DBNA 1L8NA 2NXHA 3FHQA 3WQOA 4Q4MA 5HNRA 1C3FA 5BMWA 2ABAA 4M51A 3R0UA 3L4UA 3VUPA 4O8RA 4HCHA 1TV3A 4A05A 2W62A 3P60A 4JKKA 4AEFA 1GKPA 1DIDA 5T91A 2UY4A 4QP0A 2ACSA 2D20A 1GQJA 4IGHA 4Y9MA 3AI0A 4NJGA 2OOFA 1EO5A 3AIVA 1K8YA 1MYRA 1CB2A 4Y9PA 3V7PA 3A22A 4S3CA 4IGMA 5IDZA 1KGXA 4NAEB 3IIPA 3ZVHB 5DLCA 2WJZA 5C55A 3BARA 2FZMA 4U10A 2D73A 3H23A 3LHWA 4IG2B 3GZAA 1SFJA 4H9VA 4PUWA 5F4WA 5I3DA 1WP6A 4IXXA 2E28A 1ITXA 2WHKA 2L5HA 3V5OA 3ITGA 1EQPA 4PCFA 2RHGA 5D2XA 4A2RA 4AIUA 1JYWA 1RUSA 1GWJA 3NIYA 1HNYA 2GVEA 4ML4A 2XWEA 3VIMA 3DERA 3L2IA 4OV4A 3KBWA 3VOIA 2YYUA 4HQVA 4R7OA 3VMOA 1F07A 3EYPA 2Z2UA 3T08A 3LD5A 1DJGA 4Q22A 1ZGDA 1GG0A 3T81A 3OG2A 1VIZA 3W22A 4QFUA 2QIWA 1BVZA 2O92A 2WMIB 4LNCA 3WDQA 1ITUA 2V5LA 3M46A 4NZCA 4LUYA 1WDDA 3HURA 3THQA 2IXVA 1XPYA 2YCEA 3CHEA 1LF1A 2H8ZA 2J8GA 4LW7A 1HGWA 4NX5A 2GVJA 3VOFA 1OYCA 4Q8PA 4LUTB 1F3TA 3RM9A 3TFXA 1TPVA 3CLWA 1UR3M 1UR8A 2FTYA 4YL2A 4NQ1A 3IACA 1WBJA 2HK1A 4JQ1A 1EL3A 4C1LA 4Q8MA 2HWGA 4IIBA 2D24A 4QJ3B 4FZIA 4NZJA 4UOZA 4U5IA 5CBJA 2KZHA 4PBEA 4O12A 4CNOA 3QFEA 3SCRA 1BXNA 2WV8A 4N4PA 8TIMA 1XX1A 1H5YA 4C90A 2OLSA 4C6MA 3BCJA 4EAYA 2UBPC 4XD6A 3KHJA 4UQBA 2BX7A 2PWUA 3DYOA 1YDNA 2R82A 5AECA 2AAMA 2EEXA 4JICA 4W7VA 2OU4A 5F1VA 3VOGA 3AO0A 1VH7A 1TV8A 1TZ9A 4R88A 1M03A 4Y9NA 4DJDC 3P3BA 1SJAA 3N2XA 5EMLA 5AZ0A 3VOHA 5ABGA 4QLKA 1C92A 3MYOA 1OC7A 3SR7A 1IR2A 5K7JA 1JFHA 1QPOA 3LGGA 3ZJ7A 4PRTA 1TG7A 5A6LA 4Y8EA 4Q7BA 3JS3A 3NL6A 1J6PA 4NI3A 3UVIA 3TJIA 3WL1A 4MUPA 3UWQA 1DPMA 4AD5A 3I7RA 1U30A 3NA8A 2Z25A 2VFHA 5JMUA 2NVDA 2C0HA 1WA3A 3C3NA 2OQHA 1LROA 2R1KA 4V1YA 4XZHA 4MLRA 1LCOA 3P5YA 2B0MA 2OX1A 4Z0SA 5DMYA 3KVKA 5LIKX 2OX4A 2CEQA 1W8GA 4KIEA 3BOLA 1W1VA 4JKLA 1NDZA 2FDSA 4TR9A 2H3DA 5HAOA 3MI3A 1TV5A 4UMCA 1RPKA 1W3JA 2PTZA 3K2GA 4QE4A 1YDVA 2V81A 3KTSA 1L6FA 2WVUA 4X9SA 4HPHA 3PFMA 5K3VA 4I7UA 2PD5A 2VOMA 3LSCA 2YFNA 3DFYA 1HUVA 1EJSC 2WJDA 3GIPA 3TOYA 1S5NA 3P14A 3ABXA 3GR4A 4PUJA 4L6OA 1ZBCA 5DRCA 1QCWA 4W4QA 3W9ZA 3VIIA 1GYMA 3VGHA 4JNYA 1FKWA 1OFRA 2XN2A 4JDBA 3UWWA 3UR2A 1EIXA 5A2BA 5BU6A 5L9FA 1FTXA 4B3LA 2DVUA 3LXAA 4CNPA 5BU9A 4F66A 4RE4A 4O10A 4V1XA 3SCWA 3STEA 3W1TA 3PAJA 4UFIA 3T4CA 2PU0A 3PWIA 1V7YA 2BVTA 2Z4GA 3W28A 3N17A 1UUMA 1JYVA 3R94A 4LYPA 1LRQA 5E5CA 4HZ6A 2R14A 1WZMA 4UCFA 4IL0A 3AIUA 2VM8A 4RW3A 2VEIA 4S1FA 4DXXA 2PZ0A 5IM51 1EXBA 1KM0A 1HL2A 2Q3OA 4YMZA 3AWNA 1X6NA 3HU7A 5LXXA 1CXEA 3GDLA 1FWWA 3MKKA 1PKYA 5FESA 4DWSB 1XI3A 2JBMA 2WM1A 1GOOA 2D0FA 1NM9A 1YTEA 2YIHA 4GYKA 3POCA 3WQ4A 8A3HA 1LBMA 2YOCA 1UKQA 3RJYA 4K3ZA 1OFBA 2XPKA 3E74A 4EF9A 3CH0A 2DIKA 4L1WA 1ML1A 4HSNA 4HPGA 2Y88A 3R0KA 4L65A 1POJA 3EA2A 1V02E 2DUZA 3E9AA 3L65A 5TBOA 4Z1BA 4IUGA 3CYJA 3RCMA 4ES4A 2V5JA 3WMCA 1XKYA 4TU1A 3G6LA 2D2JA 2OEMA 3ARRA 3GNDA 3UT0A 5FEZA 5E70A 4D6GA 3NQ7A 3FAXA 4BR1A 3W7CA 2DZBA 5FSEC 4AY1A 2X2GA 5G4HC 4J1OA 2GVYA 4L4OA 1BVNP 3D46A 4I6KA 1F7BA 2DZXA 1H0IA 3WD3A 2Z1BA 4FK9A 4BI7A 1TWDA 1SGJA 1KCKA 5LYRA 1OK6A 4JFTA 4BEUA 2QW5A 4HNCA 3SY5A 3UYCA 3GXMA 4FMVA 5BOEA 3HO8A 4P8UA 2YGYA 3EA3A 4NAFA 2E9BA 3GIYA 1OG0A 3I4EA 1H09A 3VX1A 4D6CA 2BOEX 3M16A 1IEWA 2XUCA 7CGTA 1ZAHA 2JE8A 4GBUA 1ME8A 3LV6A 8XIAA 3N9SA 3ITLA 1EGVA 2J7FA 1IGWA 3KAOA 1A3HA 4IL2A 7TAAA 3P2VA 4C6JA 3FLUA 1DORA 3GH7A 4RE3A 3URQA 4GMEA 3P84A 3MSRA 4IPLA 4K38A 1A5MC 4IWWA 3KBJA 1E4IA 2X0YA 5HNTA 2NWSA 3T4WA 4PTXA 5HBFA 2ZZ7A 1W0MA 4LAUA 4W8AA 3AXIA 5FKYA 6XIMA 4J3TA 4WXYA 1N8WA 3N2MA 4HNOA 4JIHA 4MDPA 1R2SA 2O7SA 1V7AA 5J8LA 4NASA 5F2GA 1XIIA 2Z6IA 3P81A 2A79A 1W1ZA 5D2WA 4FLRA 1I2QA 3S2JA 4J28A 1XYCA 4PRRA 3DN5A 3V1HA 4NSBA 4Q4SA 5XIMA 3W01A 4E4FA 4HU8A 3U9IA 2X1SA 2ZX9A 1PZ0A 1XRVA 1CPUA 2J75A 5HMFA 3RYSA 5H1WA 2YCKX 3MY9A 2AGTA 3QW3A 1QXLA 4M80A 1HJXA 6ENLA 1E55A 2H6RA 1JCMP 1JGIA 2R1MA 2H90A 1N2VA 5TAOA 4RDVA 2YCLB 2P5NA 5DMMA 1D3HA 4HOXA 3IK2A 3M9YA 4PL1A 1IZJA 4DJFC 4MIMA 2NX3A 1E72M 2HS8A 5LNVA 3LB0A 2HE8A 5B7YA 1XDMA 2OELA 3BURA 2GQAA 3AMKA 3E2RA 2NUXA 1HIZA 4NZ3A 4EX4A 4BQ4A 1QW8A 1SYTA 1VKFA 2VWTA 4GPNA 3AISA 4GUFA 5E09A 1KKRA 3PBVA 3GXNA 2GJNA 2V0TA 4CNNA 3VDBA 4OZOA 3W1AA 1OYBA 5FI8A 3VCRA 4JPGA 2J8TA 3UZWA 3B4UA 3V4BA 5AHEA 2C16A 3KEHA 3ZLHA 1IEXA 3RPTA 4IIFA 1EJRC 4X2RA 3CYVA 3QXBA 1E6SM 2DH3A 2XIJA 1X1ZA 3NQAA 5CBIA 2GGGA 1YYAA 4IISA 5D8WA 3AIQA 4JHMA 4DI9A 1CZ1A 2F61A 3ZYZA 3CTLA 1XRTA 3EWUA 5LNWA 3O06A 4ZR8A 5D03A 1UD2A 3GU2A 1RD6A 4HN4A 1PVNA 3AROA 4JKMA 1GNXA 4PMQA 1IZKA 1WDRA 1TMLA 4WVXA 5LXEA 3EDEA 3AWOA 4ZQCA 1GVQA 1WOBA 1B2YA 1FVPA 2PDCA 4JQAA 4PUKA 2D69A 3T0DA 3GVVA 1EB3A 2UY5A 4KFNA 3FYYA 2V6AA 4X3ZA 3AZTA 3LI0A 1BYDA 5E93A 5C8BB 4QITA 1C8YA 4WY0F 2JKAA 3W82A 5A6KA 4QX4A 4FX6M 3E5PA 5CGQA 3PUDA 4NYYA 1XUZA 4MM1A 2NT0A 3HPFA 1R2RA 2GJXB 3HTWA 2HTMA 1MW1A 3VNDA 1A5OC 4I7VA 3CB8A 3NQBA 1C90A 3AU2A 5JBFA 1AMYA 2W66A 2I1OA 4H2HA 4V2XA 5BNKA 5C2GA 3VILA 3LY0A 1SR9A 4UTIA 1TVPA 1ICPA 5JBDA 1DOSA 3O3RA 1KM5A 4WIWA 2E0PA 4G7FA 2VO5A 1HKKA 5D37A 1JZ2A 2X05A 1Y7VA 1MSSA 1W2PA 2PUZA 4N9BA 4OU1A 2WYSA 3C8FA 4KEVA 1I2RA 2ZX5A 1UBSA 2CLIA 5EYWA 3VD7A 2PPGA 3MBFA 3NO5A 1A5AA 1X96A 4MWAC 1JZ7A 3ARPA 1GVIA 3UY7A 3V35A 5C7VA 2G97A 1UOZA 3QR3A 3IRDA 1U33A 1QFEA 1FH7A 1YPXA 4KH2A 5A5WA 3KRUA 4U28A 3NPWA 5DBTA 4ZFCA 4W93A 3N2TA 3H55A 4AVFA 1US3A 4Y6GA 1OCQA 1L8PA 4B9ZA 1JI1A 2QDGA 2ZTJA 4GK8A 3IJLA 4GUGA 1IR1A 1W5PA 1UD3A 1DTNA 2JIWA 2J79A 2PE4A 3GAYA 1PS9A 2Y70A 2CBJA 2C71A 3EKGA 3STFA 3URNA 3R7MA 4G6CA 1ICQA 3RITA 3BAJA 3AS1A 3HFTA 4HYVA 3LNMA 3P82A 3IPWA 1WKEA 2GQ8A 3VA8A 5FEXA 3VDHA 3KCJA 1X6UA 3NG3A 1YRRA 1RP9A 4QE1A 4P7LA 4H9MA 2G41A 3JVAA 3PB2A 3W3OA 3J7HA 3U2OA 4HGXA 4IQJA 2GZXA 5D32A 1R85A 2J13A 2FTPA 3G0UA 3MQTA 4J3WA 1QAPA 4HHHA 3TTOA 3GNXA 2WMKA 4MNJA 4RJEA 4CVWA 4I9AA 4CUCA 3CWNA 3NM3A 4YN5A 3IAPA 3PZ9A 1M7OA 3OBKA 3E2QA 2I7GA 2E6AA 3MZNA 1PIIA 2OLHA 5HPOA 2A3HA 2FVKA 5DXXA 1LLZA 4ERIA 4MDOA 1UUOA 1LL6A 3EEZA 2ZRWA 5I07A 1RLCL 3W53A 3NQGA 5A6BA 4CQAA 5CPNA 2E1WA 1BRLB 2VR5A 4HNTA 4CKQA 5CC5A 4LCSA 1MFUA 3SADA 1PKMA 4E2BA 3HPZA 2FFIA 3A4XA 4Y2WA 3TQ0A 3M5VA 1E56A 1ZJIA 3PPCA 2PDIA 5FF4A 4O17A 4CU8A 2J77A 3NQVA 4HU4A 5A8PA 2XWDA 4Q6JA 3TWBA 4JTKA 2EQDA 4CNUA 1SM9A 1TTPA 2BZNA 3T9PA 5FJIA 4QISA 4KWSA 3LRLA 3ITTA 1E4LA 3EOLA 4WSJA 2WAGA 2YJQA 4H7CA 4CCZA 4Z42C 3QRHA 4DUWA 4HJFA 3S1VA 1M7PA 4MY9A 3PPFA 3UXAA 3A6OA 5IFTA 1RBAA 3CIXA 4V33A 4P61A 2VGFA 1F73A 3FKRA 2CBVA 1WO2A 2QPUA 1LTDA 1TTIA 3S47A 1SW3A 4DO6A 2VYOA 4C91A 5D2VA 2FZNA 2GWGA 1US2A 2Q8LA 3T44A 5FEPA 3A5VA 5CC7A 2FGLA 4RCXA 1C7TA 1SW7A 2WMGA 3PTQA 3U5UA 4TMCA 2A3LA 2XN1A 4NF7A 1MRQA 1CENA 2A5HA 2NQHA 3M5YA 2QR6A 1KBJA 3LHZA 3VIPA 3UCDA 3VM7A 1WQ5A 1HKWA 3B03A 3TDFA 4PH6A 1YE4A 2V38A 1B57A 1NWRA 4EPBC 1I4NA 4PN2A 3H24A 2BBFA 3QEZA 2PF8A 1FWRA 1TELA 4F9JA 1OK4A 2G4JA 5FD0A 3HQ1A 3S5YA 4HNNA 4BY3A 4B5WA 2PDHA 3SUVA 2P76A 1HL9A 3F4WA 2PCQA 4YWSA 3FYOA 2PWVA 2ZDRA 1E4NA 1MW3A 1GOWA 3W2NA 4B5TA 1QHOA 3GUGA 2DVTA 3WUEA 3SQLA 1I6NA 3IIXA 4RDZA 3LM7A 4MUZA 3ZWTA 1P4CA 3LENA 4ZL1A 4WZHA 3EMZA 2G3IA 3AYSA 2QAFA 2TMDA 2Z29A 2J24A 4GISA 4ML9A 4JL2A 3MW7A 3LTYA 2PWDA 3RPMA 1KV8A 1H1YA 3LG3A 4GYPA 1QU4A 3GHSA 1TR9A 4DWSD 4OOUA 1OF8A 2VRQA 4XZNX 7PTDA 1RY0A 1J0YA 5EPDA 3W7EA 1YBQB 4W86A 1LZOA 3VD9A 1MMFA 4JL1A 4DYEA 4IFOA 1ZAIA 1H7RA 3E6EA 3Q45A 4ZQMA 3NZPA 2CLPA 1J5SA 4CEXC 4HHMA 4C60A 1FRBA 2WCSA 3UP8A 5AC5A 1TWSA 4M7TA 5DT5A 4CN1A 4W8LA 5BXTA 1VYSX 1E1EA 2BG5A 1IT7A 1LOSA 1MZHA 3EX1A 5I09A 3DFQA 1X1NA 2TODA 2AQVA 5JIPA 4W7WA 2I9UA 1P6BA 3VABA 2P8CA 2VD9A 1Q6FA 4MFEA 2X2YA 2VFIA 3HV8A 4ERAA 4JTDA 5CPLA 3HMCA 2V2HA 5AKQA 1K8CA 2G8ZA 1ZRQA 3EOOA 1G69A 3R58A 2YPIA 4PB4A 1J4EA 2PLJA 5C70A 4XBJA 5HUPA 3EDFA 4UNIA 4NILA 5B7ZA 2VZTA 4PGLA 1E43A 1XIMA 3JUGA 2DT2A 3HN3A 3QMRA 3NQ6A 3W1MA 3OQEA 4IM4A 1B31A 6PTDA 4JIEA 3W38A 4QGCA 2FKPA 3BANA 4QRNA 2AMXA 4A21A 4X0NA 1JPMA 3R79A 1QI4A 1RZMA 1C9WA 3AZRA 3BAYA 4MSSA 5DN1A 1KXHA