3APGA

Crystal structure of hyperthermophilic beta-glucosidase from pyrococcus furiosus
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
471
structure length
471
Chain Sequence
AKFPKNFMFGYSWSGFQFEMGLPGSEVESDWWVWVHDKENIASGLVSGDLPENGPAYWHLYKQDHDIAEKLGMDCIRGGIEWARIFPKPTFDVKVDVEKDEEGNIISVDVPESTIKELEKIANMEALEHYRKIYSDWKERGKTFILNLYHWPLPLWIHDPIAVRKLGPDRAPAGWLDEKTVVEFVKFAAFVAYHLDDLVDMWSTMNEPNVVYNQGYINLRSGFPPGYLSFEAAEKAKFNLIQAHIGAYDAIKEYSEKSVGVIYAFAWHDPLAEEYKDEVEEIRKKDYEFVTILHSKGKLDWIGVNYYSRLVYGAKDGHLVPLPGYGFMSERGGFAKSGRPASDFGWEMYPEGLENLLKYLNNAYELPMIITENGMADAADRYRPHYLVSHLKAVYNAMKEGADVRGYLHWSLTDNYEWAQGFRMRFGLVYVDFETKKRYLRPSALVFREIATQKEIPEELAHLADLKFVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-glucosidase
publication title Crystal structure of hyperthermophilic beta-glucosidase from pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
total genus 184
structure length 471
sequence length 471
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3apgA00
5EBAA 3VPLA 4HMDA 3I3DA 1EH9A 3A3HA 4MB3A 1UD3A 4OKDA 1US3A 1MW2A 4HOWA 2YJQA 2QPUA 2FHFA 2OWXA 2XTKA 3K8KA 4LYRA 1W9UA 3CHEA 2Y4SA 1E1FA 4B3LA 3U5UA 2J75A 2GSJA 2UY2A 1CZ1A 3AS1A 1SYTA 1A3HA 3F5KA 3NDYA 3DHPA 3WH8A 3AI0A 1E6SM 1YQ2A 5ABEA 2VZTA 4EANA 1H4PA 2VVNA 4B9YA 1E6NA 3EMCA 4LPCA 4R5EA 2A3HA 5ABHA 1H3GA 5EFDA 2G3NA 1Y7VA 4J3SA 1E6PA 3PZVA 1ZU8A 5HXMA 3IJ7A 3ZR6A 2Y2WA 4X0NA 1KCLA 4JFVA 4W8BA 4FMVA 1ODZA 8CGTA 1XSIA 5A69A 3BAIA 3AIQA 3AHVA 3W82A 2CBJA 2WSKA 2JFEX 1CLXA 1HJWA 5A2BA 5IDIA 1FFQA 1OIMA 4YHEA 1K9DA 3TTYA 4PRWA 3WL0A 2V5DA 1W91A 1EDTA 2WZEA 1VJZA 1C7TA 3N9KA 3WBAA 3FW6A 1CXKA 4PTVA 2ESCA 4W7UA 4JFTA 2VR5A 3T0AA 1Q4NX 3CMJA 5D9MA 7CGTA 2OWWA 3ARTA 1WDSA 4P8WA 3IJ8A 2J25A 4DUXA 1E43A 2XWDA 3RJXA 1NP0A 1VB9A 2EO7A 3PHAA 1VIWA 2VT0A 4HA1A 4UOJA 5I5RA 1QI0A 2DSKA 3PZMA 4Z2GA 5EFFA 4ACYA 3ARXA 1EOMA 1PAMA 5CLWA 4PTWA 2VMFA 1U2YA 4XV0A 2GDVA 1UKTA 2DH3A 4JL2A 3W27A 4A3HA 2BY2A 1TG7A 2WMFA 3MV11 3ARZA 1WB0A 2XUCA 1BYAA 2V5CA 3K1DA 1GW1A 4UFMA 1HL8A 4TVUA 1OGGA 2JIWA 3U5YA 1RP8A 2CKRA 1HN1A 3W24A 3D3AA 2YDRA 5HNNA 1VEOA 1XYFA 3VMPA 3AMLA 3W53A 1EHNA 1M7XA 3WN6A 2XHYA 3WH9A 1JFHA 4TVCA 3RMEA 1WP6A 5C70A 4F79A 5GNZA 3AOFA 3M7SA 1AQHA 1OSEA 4W89A 2XFRA 5BROA 4M56A 2WM0A 4N42A 1XC6A 3VILA 4CU8A 2WHMA 2WZIA 1OD0A 3N18A 2JEQA 1UR9A 2D22A 3SCTA 4HU8A 4DM1A 4D6CA 2CXGA 3EBVA 2BXZA 1GQIA 4X9YA 4PMRA 4J3XA 2CHOA 1QOXA 1ZJAA 1GQJA 1HVQA 3CIVA 3PTQA 3TTOA 5IHRA 4UQAA 1ZBWA 2CBIA 3VM7A 4GI6A 2EQDA 2PWGA 3KE0A 1FH8A 3OLEA 2ZUNA 2ZX5A 2EXOA 1OM0A 3OLGA 4JHOA 3ZT5A 3IK2A 3AXHA 1SR0A 3VKKA 1XSKA 4AD2A 4D6FA 1R7AA 3CUHA 3BCDA 3FAXA 1W2PA 3MO4A 3NSMA 3KL0A 1N82A 1CXEA 3T0DA 4JZ5A 2OSXA 1GOOA 1KXTA 1HJXA 5A94A 1W3KA 2YBUA 3ZSSA 1M01A 4JKKA 4C7DA 5HBFA 1KQZA 1ISWA 4AZ6A 1RP9A 3UG5A 1H11A 1V3MA 2WCAA 1KXVA 2E40A 2WVTA 4AIEA 4TXEA 4S3KA 5IFTA 5A6KA 1UH4A 1H5VA 1OGSA 3LMYA 3ZO9A 1NQ6A 1UD4A 3WKZA 2GUYA 2XM2A 4PUEA 1PIGA 2ZICA 4CUCA 3EDKA 4MDOA 4FLSA 1E15A 1KWKA 1FA2A 1E3XA 1ZBCA 3WBEA 4HOZA 3W6LA 2WC7A 1PPIA 4AWEA 2J8GA 4QLLA 2C7FA 2D0HA 2X09A 2VURA 1ITXA 4H41A 2G3MA 1ECEA 4OUEA 4DM2A 3GBDA 1BYDA 1GVIA 4GI9A 2XIIA 1XRVA 3M6DA 2GJRA 1J0KA 1K9FA 3EDFA 3QHOA 1X6NA 5A8NA 1JYXA 1JF6A 5JBFA 1EHAA 3AIEA 1CENA 1TA3B 4PTMA 1VF8A 2NW0A 1Q6DA 2DEPA 3N15A 2W4XA 1WO2A 3DYMA 3ARRA 2VR4A 3WQ5A 2XFFA 1NWRA 4PYSA 1WE5A 1CXLA 3ZM8A 2QPSA 4V2XA 1O7AA 5CGMA 4DWSD 4WJXA 1BSIA 4ZEPA 3N1AA 4PSPA 1CGXA 2ZX7A 3L4ZA 1J12A 4YN5A 4LGXA 4CD8A 3WH7A 3VMOA 4D6GA 3VVGA 1JD9A 1JIBA 4HZ8A 1LL6A 3AYSA 1ISZA 1JF5A 3OLIA 3GNPA 4DWSC 2QLYA 2FDMA 1QW8A 4AZHA 1GNXA 1CLVA 4MJ4A 3W81A 2HISA 3W29A 3FAWA 2V3DA 3VD9A 1UZ4A 1Q6EA 2OLHA 1PZ2A 1RD6A 1TVPA 1E4IA 1J0JA 4PMNA 4M82A 5DEZA 1FHDA 1ZL1A 4Z2JA 2BNJA 2XSBA 5A6BA 3L4UA 1GOMA 1DWIM 1UYQA 4EKJA 2ZUUA 3AFBA 4W5ZA 2UWFA 1UWQA 3WNOA 5I77A 3MU7A 3PTKA 1JDAA 3TOPA 4GO8A 5M5DA 2X0HA 3WDQA 1MQQA 2ZX6A 2J74A 1OIFA 3AIVA 3AMGA 6CGTA 1GOIA 2JF6A 1KXHA 1UWRA 1E73M 1VBRA 3PZ9A 1E70M 4F9JA 4BF7A 2VVSA 3TONA 1UH2A 3A4WA 3OGVA 4D6JA 1KBBA 3EDDA 3O2LA 1P6WA 3UR7A 1JNEA 2WZHA 5M03A 1LG2A 5C8BB 1BAGA 2J77A 1XD0A 3WDHA 3WD2A 1D7FA 2VRKA 1UA7A 4TOQA 4AEEA 1PZ3A 2B31A 3ARPA 3NCOA 4QFUA 3HMCA 4J27A 4AEFA 3VGGA 1I1WA 1OBAA 4QDMA 2BXYA 4RE3A 1HJQA 3RM8A 1VFMA 4PSRA 3E1F1 4R27A 5JUVA 3BMVA 1GOKA 4A4AA 5JIWA 2VX5A 3EDEA 1XHGA 1ZS2A 4GKLA 2A3CA 1YHTA 3ZOAA 1JL8A 3POHA 2W66A 2X1IA 5FOOA 2Q8XA 3BSHA 5E6ZA 2DDXA 1EIBA 4KRTA 1OGBA 2D0GA 2WSPA 1UR2A 1NH6A 2GJXB 1HNYA 2VC9A 2CPUA 4H04A 1GVYA 2W91A 3N04A 1V0KA 1UD6A 2DSVA 3TA9A 1PX8A 1MVYA 1W2VA 3RILA 1HL9A 5AYIA 1E6XM 3ZT7A 5C71A 1JG9A 1BLIA 1L8NA 4D6EA 1HKMA 2VJXA 3CZLA 5D9PA 3IAQA 1H0IA 1UKOA 2J7DA 3UG3A 2XVGA 2ZIDA 3B8SA 1KGWA 3HU7A 3M46A 5I79A 5CQ1A 4MAZA 1BF2A 3RPMA 3WF4A 1DWFM 3DHUA 5ABFB 2BHZA 2EEXA 2YL6A 4HA4A 4UFHA 4CVWA 3EDJA 4J3VA 4BZYA 5DO8A 2CBVA 1MXGA 4FK9A 4WSKA 1PX4A 3CUGA 4DUWA 1FH9A 2WHJA 1B3WA 2YIHA 1MYRA 4H8UA 3FY1A 4AD4A 1BGGA 3W6MA 2WVVA 3LPFA 1M53A 2YL8A 2VRJA 1PX3A 4D1IA 2BVTA 1DWAM 1CGYA 1W3LA 4JFSA 4PEEA 1C8YA 1UZ1A 2CBUA 4W5UA 4W84A 1E71M 1UKSA 2WLZA 1DWHM 2ZXQA 3S2CA 3MUIA 3WD3A 1QNQA 3L4TA 1KCKA 3VM5A 3WH5A 4IPNB 4H8HA 2D23A 5CPSA 4AY1A 1KB3A 3AS0A 1JZ5A 3AZRA 1TA3A 3VIOA 1HKJA 3AIRA 4GXPA 4UQDA 1KBKA 3SCOA 2IXVA 4D6DA 1JNDA 3WQWA 3SCPA 4BQ4A 1H41A 2YBTA 1LF1A 3MV01 1B3ZA 3VTRA 1XH2A 3SCWA 3ZQ9A 4M1RA 1XH1A 4ATWA 1TFVA 2O92A 3L4YA 1EA9C 1QNPA 2E4TA 1FH7A 1GONA 4Q7NA 5BXPA 2GVYA 1JZ8A 1B9ZA 2WB5A 2VTFA 1AQMA 2FH8A 1WZMA 2D1ZA 1QNRA 2AMGA 3BGAA 1H2JA 1A47A 4FLOA 1W9XA 2J7CA 2RGMA 4PMZA 2VZVA 5FL0A 4E2OA 3NDZA 3M07A 1OINA 2WW5A 4PCTA 4WLCA 5A6JA 1IZKA 4QP0A 1KXQA 3L2LA 1VEPA 5HOSA 1RPKA 3GBEA 2F2HA 2V38A 4UQCA 2XVPA 4W7VA 1W9DM 4TTUA 3B9DA 1TE1A 1BPLB 4CKQA 7A3HA 5A8QA 4A3YA 1JDCA 3N12A 5I6SA 4WKHA 3WNPA 3QGVA 4H7VA 1B0IA 3CZKA 3SCNA 3WMSA 1S46A 2G4FA 1XH0A 4JCMA 1HXJA 1J18A 1D2KA 2WANA 2GK1B 3MKKA 3ZJKA 4JFUA 1PBGA 4L4PA 4AZBA 1GJUA 4IUGA 3A4AA 3UCQA 2VX7A 4PTXA 3VGFA 1PIFA 1EO5A 1BFNA 3VIKA 1V6XA 2WK2A 2DQXA 3VIFA 3O6AA 5CGTA 2D2OA 2WXDM 2J7HA 2MANA 1ESWA 3GNRA 5D9OA 5GNXA 4JKMA 4JIEA 3J7HA 1ISVA 3PZIA 1Q6GA 2A3AA 5AC5A 1DWJM 3WUGA 3CZJA 2A3EA 2D0FA 1U30A 4M80A 1G5AA 2ZUSA 3F5JA 3W0KA 1UHVA 5CG0A 2ZXBA 4C7FA 5AC4A 3MSDA 2RGLA 1TZ7A 3EMZA 4BS0A 3WSUA 2CYGA 3VINA 1E72M 1NARA 3UG4A 2BV9A 2F61A 3SUWA 1CGVA 5I0DA 1DHKA 2E0PA 4AIUA 3SURA 2X2YA 4DWSA 4TVDA 4E8DA 2TAAA 4OOZA 4MB5A 2V3FA 1EO7A 3SUUA 2Y5EA 2E9LA 4J28A 1B90A 2WC4A 2WC3A 3GTNA 3GNOA 2HVMA 1E9LA 3I3BA 3ZSTA 4NRSA 1V3LA 1JAKA 2ZX8A 4ZXOA 1KGUA 2DIJA 3OLDA 3UESA 4KWUA 2GJXA 5I23A 4TUFA 3W25A 1HJUA 3ZT6A 4URIA 1SMDA 1E5NA 4WK9A 4AD3A 3AHXA 3AHZA 4DUVA 3T0BA 3WQVA 1E40A 2YL5A 3QOMA 1HJSA 3VDCA 3VDHA 4IPLA 2DPEA 3U7BA 2J8FA 1DTUA 2VQTA 3AMCA 1XCXA 4CD6A 3HJEA 1BGAA 4D1JA 4GIAA 3AIBA 4UR9A 3BMWA 4M24A 3WF0A 2G3IA 3DECA 1J0HA 3RCNA 2AOSA 3BAYA 4GQQA 1QNOA 3NSNA 3ARWA 1W9BM 3WDPP 1MWOA 3VIMA 1JZ3A 3THCA 5CZKA 4JHZA 3RM9A 3GXFA 4CD7A 1JAEA 2OYKA 2VOTA 4WIWA 3MMWA 1GOWA 3SUVA 1WZLA 4OBRA 2PWHA 2VUYA 3ZR5A 3IAPA 5BCAA 3VX1A 4AZIA 6TAAA 1J0ZA 3CO4A 3W37A 4Z2KA 1UWTA 4E4PA 2CITA 3N13A 2BY3A 4F9DA 1GOQA 3VIIA 3MMUA 1V02E 4ML4A 5BRQA 4PMXA 4JAWA 4UQEA 4N0RA 3DYOA 1WKYA 5A8MA 4D71A 1HVXA 3UERA 4ATDA 2V3EA 5GNYA 3QHMA 3CPUA 4RE4A 3VGBA 1HJVA 3SUSA 4J7RA 1R87A 3AIUA 1B3YA 3WEZA 4MDPA 1TR1A 1UR4A 4PN2A 3SIMA 3ALGA 2YLAA 5IFPA 2PWFA 5D4YA 4CD4A 3AXIA 2NT0A 3GM8A 2WWCA 3OB8A 3WF3A 4B3KA 1CXIA 4MNJA 2E9BA 4CD5A 4U5IA 4UCFA 1HX0A 1US2A 4P7QA 2IXUA 3A6OA 4AYSA 2CCRA 1JI2A 3HN3A 3QHNA 1JFXA 1C90A 3CGTA 1E0WA 4JFWA 4PMYA 3VGDA 2VCAA 3NIYA 1NP2A 2WMHA 1E6RA 1MXDA 4V28A 2EBNA 4J3WA 4RL3A 1QI3A 3WDJA 3LPOA 3WNMA 5ECUA 1MQPA 2V3GA 4GZIA 3AQUA 3EMQA 1B31A 3PZOA 3OZOA 5CSUA 2PC8A 1R7OA 4HMEA 2W67A 2ZX9A 2ZWZA 4W87A 1E1EA 3ARQA 3WDRA 4UTFA 5HPCA 1GHSA 2DSZA 4QCFA 5LA0A 2D24A 3MUAA 1XGZA 1I75A 3L4VA 4HTYA 5FIPA 4NSBA 2ZUVA 3G6LA 4P8VA 4LYQA 2GK1A 3UEQA 3VDBA 1LLOA 1TMQA 5A8PA 4MJ2A 1EGZA 1E55A 1W1YA 5DT7A 1QI4A 2AAAA 2WPGA 2WMIB 3BCFA 1JYWA 1H49A 4XZBA 3CHFA 4OJYA 4UFLA 1CXHA 3WDIA 2W92A 1W3JA 3WUBA 1V3IA 3RDKA 2X0YA 2ZOXA 3D5HA 2Y24A 1FP9A 3MMDA 1ISYA 4L4OA 3VGEA 1HKIA 3U57A 1HP5A 1F4HA 3VD4A 4AD5A 2BS9A 3GZAA 2EPOA 5DF0A 3WFLA 1R8LA 1V02A 2PBOA 1LWHA 1W9VA 4M29A 2BHUA 2WWDA 3WNNA 3BC9A 2BY1A 2ZUWA 5F7UA 1MW1A 3UETA 2CIPA 2OWCA 5A3HA 1WZAA 4JL1A 1DP0A 1C8QA 3WH6A 4IISA 5A6AA 3WMCA 5A8OA 3APGA 1VJSA 1MFVA 4ATLA 3AMKA 1CXFA 1Q6FA 2WCSA 3FHAA 2FGLA 2QMKA 3THDA 4HOXA 5HPOA 5D8ZA 3CH9A 4OZOA 1U33A 3ZJ8A 5I78A 2C0HA 4GZEA 2YL9A 4QLKA 3WEOA 2EPNA 3CLWA 2WNWA 4HU0A 2VZUA 5DMYA 2WKGA 1HIZA 4AIOA 2FHCA 6A3HA 3L2MA 1F4AA 2BVDA 1LG1A 2OYMA 3F4VA 2PWEA 1JYVA 5I3DA 1K9TA 2W5FA 1BG9A 2J47A 2VNCA 5LYRA 1VENA 2C8NA 2UY5A 1FP8A 2CERA 9CGTA 3UR8A 4AZCB 3PZUA 2VQUA 2YDQA 1B3XA 5A6BD 2A3BA 3MUZ1 3S6TA 3KEHA 4P7NA 3VD3A 4W8LA 3WELA 4CCCA 4B9ZA 1CDGA 2XVLA 2E8YA 3BH4A 3ECQA 4BQ3A 1CEOA 4GO9A 1HF6A 2J79A 4NF7A 1W32A 1EQPA 1J9YA 2WMKA 3WMBA 4HPGA 3MUY1 1G01A 1CECA 3PZNA 3VOCA 1BVZA 1HP4A 3G6MA 4UFKA 4OOUA 1H1NA 4D6HA 4AZ7A 1QBAA 5E09A 1KR1A 1KR0A 2XVKA 4PMVA 3ZJ7A 2WHLA 4GPNA 2WVUA 3FN9A 4CCDA 1PEZA 1SMAA 1ZBVA 3AISA 2DT0A 1UA3A 1UR8A 3AHTA 1GZJA 1ODUA 2VL4A 2YOCA 4ZE4A 2W63A 3W38A 3VUPA 1M03A 2CNCA 4XZWA 1UD2A 3OA5A 3ZMRA 4HZ7A 1V6VA 1JXKA 2YA0A 1UWUA 2UY3A 2OSWA 4NZCA 3VU2A 4D72A 1V08A 1XD1A 2CKSA 5E0FA 2XVNA 1NOUA 1M04A 1O6IA 5BYWA 1EXPA 4HA3A 3WFZA 1IV8A 1X1NA 2J7GA 2JIEA 1CGUA 2CHNA 2QHAA 4LXFA 5AY7A 4M8UA 2PBGA 2EJ1A 3BAWA 5KZ6A 1EDQA 5JBDA 1Q6CA 8A3HA 3K8MA 5BXSA 5FD0A 3NYDA 2X05A 4E8CA 4P7OA 3WF1A 3PZQA 1J11A 2XSAA 1GHRA 4NRRA 4TX6A 3AXXA 2FGZA 2YA2A 2O9RA 3OGSA 3AZSA 5E70A 2WMJA 1EDGA 1FOBA 4KGJA 3SCQA 4PUDA 4MAVA 1ISXA 2O9PA 3WNKA 1J0YA 3WQ6A 2EPMX 2JF7A 3CMGA 3VNZA 4UNIA 5JIPA 1BQCA 2WYSA 3AS3A 3T08A 1V3KA 3ARSA 1L0PA 5BWFA 4HZ6A 4PMQA 4HP5A 2XGIA 4CU7A 1DWGM 1JGIA 1V3HA 2E3ZA 4PCSA 5A6MA 1BYCA 4H2CA 5FCZA 1E4LA 3RIKA 4Z2HA 2XM1A 2ZXDA 1WAWA 5BRPA 1RH9A 2CEQA 2XPKA 2ZUMA 1QHPA 5JBEA 5CSYA 1V6UA 1BG4A 1JZ2A 3NJ3A 1G9HA 3VIGA 1TVNA 3WUEA 1GJWA 2J7FA 2BHYA 3CUJA 2E8ZA 4MADA 2WMIA 3GXDA 5CPTA 2YDSA 4EAMA 5I2UA 4MPKA 3N17A 3AZTA 4U5KA 4YPJA 3FXYA 3MSGA 5TD4A 4LQ1A 4U2ZA 4ACZB 4F8XA 3VD7A 5E9AA 1E6ZA 3POCA 5GQBA 5EMYA 1E4MM 3VDAA 4QAWA 3W28A 1LJYA 1UD8A 4AD1A 2J7EA 3BLKA 1C92A 3VO0A 1DEDA 3CZ8A 3WD1A 1ZB5A 4F66A 2WLYA 1GQLA 1OT2A 3T2QA 3KL3A 2GJPA 2PB1A 1V3JA 1GQKA 2WCGA 1EOKA 5A95A 3A4XA 1UQYA 4UFJA 3B9EA 1ZBKA 5I24A 3BXWA 1BTCA 1UR1A 1XYZA 3CHDA 2UY4A 1VFFA 3VMNA 4U31A 4PBGA 1C3FA 2DH2A 5A6SA 5A2AA 2XWEA 4CGTA 2J4GA 2F8QA 4GI8A 2VRQA 3CTTA 3SUTA 1C93A 3MS8A 1WZKA 1J10A 3DYPA 3OZPA 4AZCA 3SCRA 1G0CA 3CZEA 1JZ6A 5A2CA 1X6LA 1E5JA 3MANA 1V6WA 4AD0A 4U3AA 4HPHA 3O9NA 3TTSA 5M17A 3K4AA 4TTGA 1ITCA 1MQRA 2XFYA 1BVNP 1G1YA 2WMGA 4UOZA 1OT1A 1K9EA 4CN1A 3II1A 3AMDA 1QI2A 2NSXA 1XSJA 1HKKA 4RE2A 3WD4A 2ZE0A 3L4XA 4WSJA 1UKQA 3I3EA 3AS2A 3IANA 2FH6A 4C7GA 3VGHA 3AIWA 1JZ4A 1MW3A 2DT3A 1C91A 4U2YA 1E0VA 1V6YA 2OSYA 2WAGA 5ABFA 5IHSA 3LPGA 4BQ2A 1NWTA 4KGLA 1KFWA 1WNOA 2VI0A 1B2YA 3ARYA 5D8WA 3WQ8A 2JALA 2VX4A 3FHQA 1LWJA 4K68A 2VZOA 3QR3A 1NWSA 4WKFA 1FHLA 3WIJA 3NUKA 1V0LA 3VX0A 3NSXA 1WPCA 5BXRA 3BSGA 1JYNA 4MNMA 2QV4A 4Z2LA 2DSWA 5A6LA 2E9MA 1VFUA 1D3CA 2D20A 4ZE5A 1NOFA 2J78A 1VAHA 5CJ5A 1HT6A 1I1XA 3ALFA 3SCSA 3WNLA 3GXIA 2XGBA 2XJ7A 3TTQA 1LL4A 2BY0A 3RM4A 4CCEA 2WHKA 4UZSA 4CVUA 1CWYA 1PJ9A 2WBKA 1QHZA 2WVVB 3LPPA 3B9AA 4UFIA 5LA1A 4P7LA 2EPKX 4MNLA 4NI3A 1OB0A 3WD0A 5AYBA 1UD5A 3F5LA 2DIEA 1NWUA 3CUIA 1GPFA 5FL1A 1UR0A 1CTNA 3AYRA 5HDRA 4UOQA 4P7RA 3W4RA 3ZIZA 1KQYA 3WL1A 1JXJA 3U7VA 3OG2A 3K4DA 1BYBA 1UOKA 2J7BA 2G8ZA 3VIHA 1MFUA 1V0NA 1XCWA 2G3JA 3AICA 4M81A 4CU6A 2Y8VA 1QBBA 2PF0A 1W1TA 5M3WA 5CLTA 1CYGA 4UZUA 1UKPA 4BCEA 1E4NA 4Q22A 5CPQA 3PZGA 5DT5A 4FLRA 5EB8A 4MTVA 1W9PA 2IUZA 4YHGA 3WEMA 2X8RA 3T09A 1E56A 1QI5A 4W93A 2DGAA 2W61A 3GYCA 1ZJBA 3QOKA 2D3NA 4ZFMA 2XYLA 1NOWA 2VO5A 1NM9A 4H8VA 1KGXA 3T2OA 4XB3A 1IT0A 4LX4A 4PMDA 4WF7A 1R86A 3ZJ6A 2WBGA 3BAKA 1KWGA 4MNKA 5KEZA 4EK7A 1V0MA 1UWSA 2Z1KA 2CESA 3K8LA 4IM4A 4U33A 4GINA 5E0CA 4ZXLA 4UQBA 4AXNA 1LL7A 3EYPA 4KRUA 3GDBA 3SCVA 1G94A 2DT2A 4GZJA 4ACZA 4FLQA 1K6AA 3W26A 1CGTA 4JKLA 4AW7A 4J3UA 4WKAA 1UUQA 2BVYA 1R85A 1IZJA 3AROA 3VD5A 1J01A 3WY1A 1WCGA 1QVBA 2DT1A 1UH3A 1W1PA 3AJ7A 1QW9A 5FKYA 3TP4A 1VBUA 2GFTA 4S3JA 4W7WA 3FNDA 4EE9A 1MW0A 4HMCA 2FHBA 1JI1A 5IXEA 4B16A 3PZTA 3OGRA 4PMUA 4B15A 2J62A 1J0IA 3CUFA 1AMYA 1BHGA 4LYPA 2YLLA 4KMQA 2YA1A 3K46A 1V03A 1W3HA 2EPLX 4AISA 1JD7A 2Y8KA 3WENA 4Z2IA 1UQZA 2JE8A 3AHYA 3PBGA 3CHCA 1W1VA 1CGWA 1B3VA 1TCMA 2O9TA 1WDRA 1H09A 2O9OA 1UWIA 4PMOA 5ABGA 3CZGA 1VEMA 5CXPA 4MB4A 4TX8A 4AZGA 1VRXA 3DC0A 2NT1A 2GDUA 2W62A 2Z1SA 2QMJA 2G41A 4P8UA 2DSUA 1OCQA 4U3CA 3VNYA 1E6QM 2VX6A 4JCLA 1B30A 1CIUA 5DFAA 1WDQA 4BQ5A 3ARUA 4OIFA 1CPUA 3SCUA 4J3TA 1XV8A 3PN8A 2ZUTA 1VFOA 2WKLA 2JEPA 3KZSA 4OBSA 3GH4A 3OIHA 5E6YA 1TUXA 4W88A 3ARVA 1E3ZA 4Y7EA 4CN6A 1QNSA 3WUFA 3KL5A 1AVAA 2PWDA 1GCYA 1B1YA 4DWSB 1AQ0A 4XX6A 4D6IA 5D9NA 3PTMA 2QF8A 3VIPA 3KWXA 2OYLA 1SFSA 1JDDA 4QLJA 1FFRA 4MB1A 1EQCA 2PI6A 3WQ4A 3GXMA 2VZSA 4KH2A 4QCEA 3GH7A 3L4WA 4W85A 3BLPX 3BAJA 4FF5A 4ZENA 1C8XA 3IJ9A 4BA0A 5GPRA 4UQ9A 1CBGA 2D3LA 4W86A 2BFGA 3RJYA 2ZWYA 1Z32X 4V27A 2CETA 4W8AA 1E0XA 3WF2A 3VIJA 4CN4A 7TAAA 4AMCA 1C7SA 4AZ5A 4P8XA 3BAXA 1GORA 2XIBA 3OBAA 5BXTA 5LA2A 2ZXAA 3CBWA 2VCCA 5A1AA 3RO8A 2XG9A 1H0GA 1OD8A 3JUGA 3T2PA 4X0VA 2WVSA 3GH5A 2VCBA 4GQRA 1WDPA 4AC1X 3N11A 2YKKA 3SEPA 3A47A 1GUVA 1OWQA 1JZ7A 1UG6A 1CNVA 1LQ0A 1QHOA 4XUYA 1QPKA
chains in the Genus database with same CATH superfamily
3ZVHB 3FYPA 3VPLA 4HMDA 3B8VA 1EH9A 1SO6A 3LRLA 1UD3A 2J6VA 3QV7A 1KFJA 1TPB1 4HOWA 4ZSUA 1P4CA 2QPUA 4N6FA 1TVLA 2Z6JA 1W9UA 4B3LA 4LVDA 4MG4A 3F5KA 4AEOA 4EANA 4B9YA 1E6NA 4WD0A 2A3HA 1H3GA 4AB4A 4AH7A 4UR8A 2ZZ5A 1MUMA 3PZVA 3TYUA 1SJCA 5HXMA 4WGHA 4JFVA 1ODZA 4BI5A 5G2HA 1F76A 2PEVA 3BW4A 4K8HA 1X97A 5A69A 3KVMA 3AIQA 4Q4OA 4DAFA 4F2UA 1FFQA 1OIMA 1K9DA 2PDMA 1THFD 4HYVA 1PS9A 1D8WA 1W91A 1QTWA 1IR1A 3QZAA 3QJAA 2Y7EA 1LBFA 4H9XA 1PL9A 1GG0A 3QGKC 3W7GA 3FX4A 3T0AA 4X22A 1IHIA 5I3IA 2VP8A 2OWWA 3W88A 1VFHA 3ARTA 3EWBX 4ZB2A 2OZ8A 4P8WA 1K8ZA 1DQUA 2J25A 1E43A 1EGMA 3S1XA 1W5NA 3RJXA 3W71A 1VB9A 1QASA 4LB3A 3PHAA 3IUDA 5KMYA 3CK5A 2ICSA 5I03A 3W85A 1XG3A 4RW5A 3TYCA 4UOJA 4TQTA 2W3ZA 1QI0A 2QJMA 4HJFA 4PRTA 4QEEA 5BMXA 3L5LA 1QOPA 2PWVA 5D2TA 2DSKA 3W1XA 5M2FX 2NVCA 3PZMA 1H51A 3EB2A 1I2NA 4YTTA 2NX3A 2GDVA 4H4IA 2DH3A 2A7RA 4R7OA 1WB0A 2V5CA 1GW1A 4GE8A 1YNQA 3VNLA 1XBYA 2F6UA 4Q8VA 3QVQA 3P5YA 1RP8A 4KWWA 3R11A 1HN1A 3W24A 2VHLA 3UBPC 1PHWA 1FDJA 3UY7A 3KTSA 1VEOA 3FFSA 2D2HA 2NX9A 4KRZA 4HSHA 3WN6A 1M7XA 1R5YA 4I90A 5FF4A 4M19A 3KCJA 1R9XA 3VCRA 3OVQA 1WP6A 4LRTA 3W6YA 3AOFA 3NL6A 1OSEA 3C0LA 2XGZA 2A85A 1BWLA 2WHMA 4V15A 2JEQA 1UR9A 3SCTA 3Q65A 2BXZA 3LCFA 1XIIA 3H7VA 2DFAA 5AYYA 2QAPA 4MY8A 1I6NA 2PMQA 2CBIA 3NURA 4GI6A 1ECQA 1RCQA 3QQ1A 3AC0A 4PULA 3K4WA 3GFZA 4ERAA 1OM0A 3BQ5A 1ZRQA 1IEIA 4L80A 2RJHA 3P0XA 1QNVA 4DBDA 3KBNA 1SR0A 2FTPA 2QCDA 4D6FA 4XSMA 1S3TC 5EMKA 3TCEA 1W2PA 3MO4A 2OFJA 1A5KC 3T0DA 4JZ5A 1GOOA 1DJHA 1HJXA 5A94A 2HV5A 1W3KA 3TR2A 2Z7KA 1M01A 1J8VA 4UTLA 1XLFA 4HMNA 4INFA 4C7DA 1TWWA 1ISWA 4AZ6A 7ENLA 1T6MA 2PD9A 3BLIA 4IIGA 3NVTA 2ISDA 2JKEA 2NUWA 2VDGA 4AU0A 5IFTA 3QH2A 1UH4A 3A24A 5K2ZA 4CQDA 3N29A 3ZO9A 1NQ6A 1PIGA 4CUCA 4MDOA 2NLYA 3ZS4A 4FLSA 1FA2A 3UJRA 4O19A 2WC7A 3H24A 5I3JA 3W7MA 5IDZA 3MW7A 1SZFA 3NQGA 1ITXA 8TIMA 1NTHA 3GBDA 1GVIA 5FA5A 4YYFA 1K9FA 2ACRA 3QHOA 5A8NA 1X6NA 2B0MA 1EBGA 2DEPA 1NELA 4NHVA 2ZYFA 1H1YA 2VENA 3HTWA 4GGHA 4FNSA 4RPQA 3S2NA 3PULA 4RNHA 1ALDA 4HU3A 1NWRA 6PTDA 4WVXA 3KCLA 2XU2A 4C6QA 3S0CA 2QPSA 4V2XA 4QHRA 4DWSD 4WJXA 3N1AA 2FGBA 2ZX7A 4XTDA 1Y5XA 3NQ2A 9XIMA 3WH7A 5BZAA 1AH3A 3VVGA 1PTAA 1JIBA 2TMDA 4HZ8A 3AYSA 1ISZA 3OLIA 2PDNA 3GNPA 1WA3A 3CU2A 4DWSC 4HHPA 2P3EA 2QLYA 1QW8A 5H8UA 4WOQA 3QZEA 3FVDA 5F4SA 4YWIA 1J6OA 3W81A 4JX6A 3FAWA 3NPWA 4H3DA 4IQLA 4JNMA 4DBUA 1S5NA 2H8ZA 2BNJA 3IVUA 4Z2JA 2XSBA 1DWIM 3PY2A 3SGGA 4CQ8A 3LU2A 3AFBA 3H2NA 5I77A 4NYYA 3PTKA 5I07A 1JDAA 5CKSA 1O5XA 2X0HA 3WDQA 1NF7A 1KBJA 4C1LA 2J74A 3AIVA 5HWJA 1P0BA 2JF6A 2OR2A 2QF7A 4H7ZA 3PZ9A 4F9JA 4O4WA 3MP4A 2VVSA 3TONA 1OABA 3A4WA 3O8AA 4NXSA 1KBBA 3LHUA 2ZRVA 4A2SA 4LB4A 1PIIA 3UA3A 3WDHA 4EPBC 2V2CA 3PFRA 2Y0FA 3E3HA 4HJWA 2DU2A 3NQVA 1OX6A 1K8CA 2HSAA 3GNDA 1TV2A 4J9JA 3R6IA 2ZZ7A 5T91A 3S6OA 1MDLA 1RZMA 4D9PA 3G24A 3W2NA 3GXTA 1VFMA 3E1F1 4RXFA 4A4AA 4I5UA 2NQHA 3W84A 1ZS2A 3M43A 5LNSA 1YHTA 4ZODA 2XIMA 5C7HA 2QVNA 3ZOAA 3P61A 4ZQNA 2X1IA 5FOOA 3LUTA 1M1BA 1OY0A 4KRTA 4WDTA 1SW7A 4UNKA 2NUXA 1QFEA 2CPUA 4H04A 5LSMA 1PUDA 2WQPA 3TA9A 1MVYA 3RILA 4XZLX 3TJIA 3ZT7A 2VJXA 3CZLA 2OO0A 3LZ3A 4LCRA 1SSDA 3C86A 3UG3A 4GH3A 3WLPA 3M46A 1LOQA 5CQ1A 3W7EA 3RPMA 1IEVA 3XINA 1K1DA 5FJUA 3GVVA 1FRBA 3URBA 2YL6A 3P7YA 4CVWA 4BZYA 4B91A 3DI0A 5DO8A 1A0EA 3V7PA 3FSUA 4FK9A 4NZ5A 3SRDA 1FH9A 1EC7A 1B3WA 2YIHA 4IGSA 2ZRWA 2E1WA 4DF0A 2VRJA 2YCIX 1PX3A 1Y5VA 4JR5A 4K38A 3VUSA 3LNMA 1FY6A 1DWAM 3LXCA 5CSSA 4PEEA 3PB0A 3W1AA 3M7WA 3OQ8A 2Z1VA 1POJA 4W84A 3MMTA 1DQWA 1DWHM 2ZXQA 4DIAA 3WD3A 4S3FA 1KCKA 3NL3A 1XKYA 2G5WA 3GZ3A 2YDAA 5CPSA 1DXFA 1QT1A 4AAJA 1BSLA 1H7WA 1R6WA 3NM1A 3HF3A 5T9BG 1TA3A 4UQDA 1WKFA 1VYRA 4D6DA 2REQA 2PDWA 3SRHA 3SCPA 3M0HA 3MV01 5J5RA 3SCWA 3DX5A 3MYPA 4QJ5B 2O92A 4NT0A 3TSBA 4AF0A 2E4TA 4Y8FA 1GONA 1S2WA 1FWNA 1OF8A 2PDIA 3M0ZA 2V67A 3HGJA 1B9ZA 3DZ1A 2R1PA 2VTFA 1AQMA 1WZMA 3RPDA 4C6LA 1WXZA 3QN3A 3NDZA 2WW5A 1KLZA 3PBUA 4IGHA 3W07A 2ACUA 3L2LA 5AYXA 3NNTA 1RPKA 2F2HA 4ML9A 3QKZA 3PB2A 4DZ5A 1A3XA 4H9TA 4GYPC 1EYWA 4A3YA 4KIRA 4BI7A 5HJYA 1IWBA 1LROA 3T8QA 1B0IA 3SCNA 4L6HA 2G4FA 4O10A 5U4NA 1XH0A 4JCMA 3NO3A 2I16A 6ALDA 1J18A 4G8TA 1I4NA 3MKKA 2FB2A 1TJ0A 4G56A 3T81A 4IUGA 3A4AA 3UCQA 1R3YA 4PB3A 2VX7A 2CZEA 5T9CE 3G1DA 3W7CA 2PTXA 4F4RA 2FIQA 3W3OA 2QIIA 2DQXA 2VGFA 2D2OA 3N14A 2WXDM 1FKXA 2J7HA 3BG3A 5I3FA 2MANA 2VC6A 4I7WA 5GNXA 4GUGA 4H9YA 1RD5A 1ISVA 4B90A 4Y9NA 3WUGA 3HGRA 3LZ5A 3B40A 1G5AA 2PU1A 2ZUSA 4M1BA 3W0KA 2Z1BA 4C7FA 2FTYA 4IMAA 3EMZA 1EP3A 2O7QA 4BS0A 4O54A 1T5AA 2CYGA 3VINA 4JTQA 3S1VA 4ZCWA 3UG4A 1VFTA 2HK0A 1PKMA 5I0DA 3PPCA 3C0QA 5G5IA 1O66A 2H90A 3HA1A 3SURA 1G6CA 4TVDA 5CPMA 2TAAA 4E8DA 3OZMA 2V3FA 3LMZA 2Y5EA 5B80A 4J28A 3FK4A 1EX1A 3M5ZA 4ZFCA 4IGMA 3I3BA 3LQGA 4NRSA 1V3LA 4ZXOA 3VK5A 1KGUA 1Q6QA 3BLLA 2EKCA 4TUFA 4JTLA 3H8AA 2ZRYA 3TC3A 1SMDA 1E5NA 3AHZA 4DUVA 2Y7GA 2ZBTA 2YL5A 4AHQA 3GVQA 3KW3A 3IVSA 3VDCA 4GVGA 5HQLA 3OA3A 3G0SA 3TDFA 1ZJHA 4AVNA 3MYOA 4CD6A 3OG3A 4GIAA 3QGAC 1WUEA 4UBPC 3UA4A 4KEMA 4LUSA 3EPOA 4NAFA 3RCNA 2AOSA 4HK5A 1IIHA 3BAYA 4GQQA 3P5ZA 4O1CA 3W2JA 3K30A 2FDSA 3B8TA 1MWOA 1ZENA 3RM9A 3KVJA 4IFKB 1VCGA 1YADA 2O7SA 3W73A 3TW6A 2AAMA 1VKFA 2Y85A 2O4MA 4H6QA 5AFDA 4PBFA 3FDGA 1GOWA 3SUVA 3E02A 4CQ9A 4MJZA 4LAKA 3VKAA 3W37A 1UWTA 3N13A 3TE9A 1Q6RA 1TV5A 4ML4A 4NX5A 4JAWA 3CV2A 4LF2A 1WKYA 4ZA0A 5A8MA 1W0MA 2J88A 4B5TA 1RR2A 3MZ2A 1J5SA 1HJVA 3SUSA 3N3MA 3KDNA 3BLOA 3N2TA 4RZ6A 4K7VA 4NXKA 2VD9A 2HNHA 3WBWA 1O5RA 1QMLA 3A64A 2DVTA 3A9BA 3WF3A 4H01A 3HJZA 5LIYX 3ANUA 1OYCA 1W1ZA 1DXIA 2PUZA 1OFPA 4IXXA 3VNMA 3SGUA 3A21A 3MVTA 2E9BA 3GTFA 4NZ4A 1QAPA 1US2A 3WQOA 2CCRA 1LORA 3HN3A 2R1MA 2AGTA 1C90A 2IPGA 3NIYA 1NP2A 4RV8A 2XH2A 4TV5A 5K7JA 1Z48A 1E6RA 1KFBA 1CCWB 3AQUA 1B31A 1WKEA 3OZOA 2ZWZA 3HIJA 4W87A 3V0SA 3C8NA 5HPCA 3C2VA 2DSZA 5LA0A 3EXSA 4NQ1A 4WY0B 3R89A 2ZUVA 4S2BA 4LAZA 1OC6A 4P8VA 4RW3A 4FX8A 3UEQA 3SY1A 1TMQA 1XPYA 1W1YA 1QI4A 3URAA 1JYWA 5AVHA 3UCCA 1H49A 3A3WA 3NR0A 3CHFA 3WDIA 1P43A 2X30A 4Y9OA 2Z4GA 3D5HA 3S2LA 2Y24A 1FP9A 3VCCA 3VGEA 4DJDD 1JRCA 1F4HA 3KS6A 2CW6A 3T07A 2BS9A 3GZAA 2EPOA 3WFLA 4ZB5A 4FS9A 2PF8A 1W9VA 2V0TA 2BHUA 3M5YA 3BC9A 2G97A 3LI0A 2OWCA 1SFTA 1WZAA 4S23A 2XN0A 1YLVA 3QFEA 3R0UA 4US6A 3KOXA 4KFOA 3DFOA 1X98A 1MFVA 1FDZA 1CXFA 1XS2A 3RNDA 1Q6FA 1T0OA 4J2MA 3WK2A 4UMBA 2ZRXA 3THDA 5H8PA 1GZ1A 4KWVA 5D8ZA 4KFNA 1VPXA 4C60A 4KERA 4A8NA 4I9JA 3IV8A 2VZUA 2WKGA 2GOUA 3L2MA 1TQJA 2BVDA 1LG1A 3F4VA 3L5MA 5KSWA 4GJJA 4AUBA 4KCVA 3SI9A 3IUHA 3WQPA 2FLIA 2F9RA 1VENA 3UY8A 4AWSA 4TV6A 2UY5A 1KM4A 2DJLA 2R14A 3U4FA 1BF6A 5T26A 1VYSX 2C3ZA 2A5HA 1FTXA 3L9CA 4P7NA 3NPUA 3KBJA 1EUNA 4W8LA 2VEPA 1CDGA 3BH4A 4YWSA 4GO9A 2J79A 3AYVA 1P1MA 2WMKA 1JQVA 1M65A 1C9DA 3MUY1 4HPGA 4OECA 2VEGA 1L6YA 4BF9A 4B2DA 2R8WA 3LI1A 2FJKA 3G6MA 3T44A 3TTEA 5E09A 3W1QA 1KR0A 2XVKA 4PMVA 2WVUA 2CXEA 4JIRA 5A5WA 3PC0A 3FN9A 4GCXA 1PEZA 1SMAA 1ZBVA 3AISA 3TN4A 4NP7A 1UOZA 4DO4A 3VUPA 4XZMX 4J35A 1UD2A 4H9MA 3NZPA 3OA5A 3ZMRA 4OWGA 4GY0A 3C0SA 1PTDA 3KXQA 1YPFA 4D72A 1B54A 4H6RA 2CKSA 4NAEA 5I00A 3IIZA 1EXPA 1XYBA 2J7GA 1VQTA 2JIEA 4ROQA 4DXVA 5CC3A 4OQVA 4QJ1A 4S3DA 3PP7A 1F8IA 4B92A 2OLSA 3S1WA 3TA6A 2HPMA 3BK0A 2ZCGA 4DPPA 2X05A 4P7OA 3UXKA 1MRAA 3A23A 1KM2A 2FGZA 4Q32A 3AZSA 1FQ0A 2WMJA 2JKAA 2ZDRA 2EPMX 2JF7A 3CMGA 4S39A 3T05A 1LBMA 1BQCA 4PEKA 3UGVA 2WYSA 2D2JA 4PL2A 4MLJA 1EWDA 1K7EA 5M1TA 3HQPA 1KFEA 3W00A 2QS8A 2XGIA 3PJWA 4CU7A 1DWGM 1V3HA 2XH0A 1BYCA 2RH9A 3F2DA 1FBAA 2ON3A 1EWEA 1MNSA 5H91A 1FWJC 3M0VA 2ZXDA 3V1HA 2CEQA 5JBEA 3UP8A 2G96A 4LEFA 4US5D 2FZMA 1G9HA 3PJUA 3NPVA 3C0JA 2C0AA 2PODA 2BHYA 4QQ3A 3H4GA 1W1B1 2GPTA 4H7CA 1SM9A 3A9IA 3T78A 3FXYA 2YSWA 3MSGA 2C15A 5TD4A 3R0DA 2Z2BA 3VD7A 5E9AA 1E6ZA 3NOYA 3QXBA 2ANUA 3LHVA 3VDAA 2R91A 4TMBA 4AD1A 4MZ1A 3H22A 1ZB5A 1NAL1 3XISA 3ELFA 4UTKA 3HQ1A 3RO6A 2WLYA 1XIFA 2CLHA 4HN8A 5TF0A 3T2QA 3KL3A 4F0HA 3LX9A 4MOZA 4YS1A 2PB1A 2MUCA 1GW9A 3TLLA 1IE7C 4WHBA 4U10A 2OQHA 2GGIA 3OZYA 1IGSA 3B9EA 3KTCA 5I24A 4GIYA 4GA8A 1UR1A 5B7ZA 1LP6A 4A3RA 5CZSA 2QDEA 2UY4A 2C14A 3P93A 2JGYA 1C3FA 1EJRC 2DH2A 4Q4RA 2XWEA 2GWNA 2TYSA 4BK9A 4GMEA 1B4KA 4S3GA 3OZPA 3S4TA 2XDFA 4I7UA 3CTLA 3LD5A 1B5TA 4DZIA 2ZA1A 4QJ3B 1VBHA 4N9CA 3CAQA 5FACA 5A2CA 4XSLA 1K7XA 1QU4A 4TTGA 2F38A 3QW4B 1G1YA 3C3NA 3NQAA 2DIKA 3UXLA 4HIBA 3RX2A 1QI2A 4E5TA 1N8WA 2H8XA 3LLDA 2ZRUA 4GC3A 1KC7A 1RQBA 3I3EA 3L65A 2VM8A 2X1UA 4LALA 2CZFA 3TWAA 1JZ4A 1E0VA 2WAGA 4OBTA 2BB0A 3I10A 4Q3MA 4NJJA 3VFCA 1LUCB 1WNOA 3ARYA 4LYKA 1VFLA 3GSMA 3FHQA 1NF0A 3QR3A 4X2PA 3WIJA 4ZL1A 3H55A 3VX0A 3NSXA 4KKXA 3BSGA 4MNMA 2QV4A 3NGFA 2XIQA 2QDDA 4E2BA 3B8UA 5CJ5A 1HO4A 3OTRA 3GLCA 3SCSA 3OO2A 2C1IA 4CQAA 3KOZA 4MHBA 4GUIA 3TR9A 4J2PA 3RM4A 1SFJA 3AU2A 1PKYA 2PZ0A 2ODOA 2WVVB 3LPPA 1LLWA 5DBUA 1TB3A 4EOUA 4KT2A 4UFIA 1W17A 4MNLA 1OB0A 1I0DA 1TV3A 1UD5A 3F5LA 3R8GA 1SSGA 1FHUA 3V75A 3PUDA 4DX3A 4W9TA 3U7VA 3K4DA 4ADTA 1V0NA 2A2IA 3WJSA 4CU6A 1W1TA 2C16A 2W27A 1CYGA 4QDPA 1UZDA 4UZUA 3HGSA 1YBQB 2ZTJA 3EWUA 5DT5A 2BOEX 3R43A 2GVEA 2X8RA 3T09A 4ZOBA 4PA8A 2XYLA 4JD4A 1PE1A 4H8VA 3SB0A 1IIGA 5AB3A 2BG5A 1PWMA 4KQNA 4XISA 4XB3A 4PZVA 4WF7A 4QRNA 4JYEA 1L6WA 1RK5A 1RJQA 2BASA 1FCQA 1TSIA 4XD6A 4EK7A 1UWSA 1Q6LA 4UTIA 4KCUA 1LL7A 4LS2A 4DUOA 2BZNA 4ORIA 3TSDA 1G94A 3EWDA 2DT2A 3L12A 1V6TA 3W26A 1CGTA 4AW7A 3E2VA 4LTSA 1JDEA 2BVYA 2VDHA 1R85A 3ISIX 3VD5A 2Z00A 2HNEA 3WY1A 4L64A 1WCGA 1QVBA 2DT1A 1UH3A 1IXOA 2NV1A 2Y61A 3WFAA 1WV2A 2YFOA 5IXEA 4B16A 4QR6A 2DZXA 5LZLA 2J62A 4Y9AA 2HVOA 1V03A 2EPLX 3GAKA 3H7UA 1TIWA 4H9ZA 1UQZA 5HNUA 2FPYA 4IX2A 3PBGA 2YCJA 3CHCA 3P67A 1OK6A 1W1VA 4IQDA 1B3VA 4E4UA 1WDRA 3S5YA 4ZTYA 4L9ZA 2Q8LA 2J9XA 2QMJA 4ZVJA 1OCQA 3UYCA 4JCLA 4G5DA 1B30A 1WDQA 2F84A 4OIFA 1UJPA 2E09A 3SCUA 3T40A 4A8IA 2ZUTA 4QEHA 3M64A 2WKLA 3KZSA 3ES8A 3GH4A 5E6YA 1RA0A 1R3SA 1TUXA 4W88A 3ARVA 2OVLA 3OODA 2A3LA 3B8DA 1QNSA 3W7RA 2QCHA 1XYMA 1AVAA 1FUYA 3TWBA 4R53A 4DWSB 4XBJA 4Y96A 1AQ0A 4IXHA 1Q7ZA 2QF8A 5EMUA 2B7QA 3VIPA 3ERPA 1XWYA 1YXCA 5D09A 5FJJA 1BRLB 4AVFA 4W85A 4ZENA 1C8XA 5H8MA 4DQWA 1X38A 3JW7A 3QPZA 2BFGA 5EMLA 4PUWA 5EY5A 1Z32X 1DJYA 1E0XA 1LRTA 3WF2A 1J4EA 2QCEA 4CN4A 1H1ZA 3RLGA 4QM1A 1VZWA 1EFZA 5CC6A 7TAAA 3SSZA 1TMHA 7XIMA 4NVTA 4B5SA 3VOGA 2E67A 4P8XA 2RDTA 3JZUA 3BAXA 3OP2A 3TMQA 3W2MA 2VCCA 3P81A 5FF2A 1UUMA 3MCNA 3RO8A 3W7JA 5HR6A 5I7GA 1H0GA 2OJPA 1SZGA 5REQB 3T2PA 1LTDA 1UP2A 1B57A 3WX7A 2VCBA 1L6GA 3ITTA 2DUXA 3W1RA 1FXQA 1GUVA 1OYAA 1OWQA 3CPGA 1LQ0A 1QPKA 3RU8X 5EBAA 4WJ8A 5D30A 3I3DA 3S42A 3A3HA 4OKDA 5CPLA 3CIXA 3AU6A 2VFFA 4V1YA 3K8KA 4XD4A 3IJQA 2OMAA 1W3TA 2IKGA 3U5UA 2J75A 2GSJA 4E3TA 2JKPA 1CZ1A 3VNIA 3NDYA 2Y62A 3WH8A 2PA6A 5FESA 1YQ2A 2HS8A 5ABEA 2VZTA 1P0EA 4UTJA 3WK3A 2Z1WA 4R5EA 1HUVA 3VNJA 1XFBA 4K39A 1Y7VA 2H6RA 3IGSA 3IJ7A 1XI3A 3KFTA 2PWUA 4W8BA 4RZBA 3NQCA 1P7TB 2PFHA 2QAFA 3BAIA 2ZRZA 3W82A 2HBVA 2WSKA 5A2BA 2FVLA 1OFEA 4S38A 1IWAA 1NQKA 2FZ9A 1VJZA 1C7TA 6XIAA 2PDHA 3FW6A 4DJEA 2WZMA 3DFSA 3GY1A 4O4VA 1M68A 2NUYA 3DFNA 1KCXA 1PCWA 3W76A 1XINA 5D9MA 4DN1A 3V1PA 5BRBA 7CGTA 1XIBA 1WDSA 3IJ8A 3E0VA 4PUUA 3KHJA 4QS5A 1NP0A 1A49A 1TPFA 5F1UA 1BEUA 1FX6A 4WDUA 3UPBA 4Z1DA 4O16A 1VRDA 1VIWA 1LYXA 1Q45A 2BGNE 3H2CA 4BEQA 4J1OA 3FJLA 4Y6GA 2VFGA 5EFFA 3F4CA 4ACYA 1EOMA 1PAMA 4HN4A 5CLWA 1OZQA 4IFRA 3M0YA 4LH8A 4LS1A 1VJIA 4RKAA 4DHGA 1Z7AA 2VGGA 2BY2A 2FZ8A 3P8IA 1UC4A 2POZA 3ARZA 3ITGA 4GD0A 3K1DA 4UFMA 5FF0A 2EJAA 1RY0A 1K8XA 5HNNA 1GKQA 4OHQA 1WUFA 1KV5A 3TXVA 3A13A 3K2GA 1EHNA 1G7UA 4GUHA 2I1OA 2XHYA 3WH9A 4LWWA 1M5WA 2ZE3A 1JFHA 1DV7A 3L0KA 4TVCA 3CQHA 4IG2B 3AXMA 1IXQA 5GNZA 1LQ2A 2GLKA 3LENA 3TJLA 2F7FA 3DOPA 3VILA 4CU8A 4O1AA 2RJGA 3R7MA 3H2MA 5K9CA 2XSXA 1CB7B 1VS1A 1DVJA 2ASHA 1GVFA 2OKOA 2B7OA 4O0QA 4XKYB 2Z29A 3I6EA 3W7HA 1XLKA 1GQIA 3IV3A 3W9ZA 1QOXA 1ZJAA 3UQNA 1KFKA 3CIVA 3LLXA 3GU1A 4FOUA 1ZBWA 1MZHA 1TJ2A 4G1KA 5CPNA 3C2OA 3KE0A 5FJOA 1Z44A 5LNRA 3OLEA 2ZX5A 2NQLA 1RA5A 1JULA 2VXNA 1W56A 3OLGA 2F2KA 1JCMP 1J93A 3CIWA 4JHOA 2O0TA 4CLMA 4UXDA 3CUHA 4LT9A 3BCDA 4FP1A 2OOGA 3KL0A 3LTYA 1E1CB 2YBVA 4MWAA 4OV9A 3UWYA 3MJMA 4MF4A 1KXTA 4WUIA 4H6KA 4XZ9A 2YBUA 3ZSSA 4ROPA 1MXSA 4S2CA 1IEQA 1KQZA 4LU0A 3CUZA 1TQXA 4JTAA 3LCHA 1KFCA 2LLEA 1H11A 2WVTA 5JQ9A 2HCVA 1NDVA 5G1TA 5DLCA 4ZB0A 2PC4A 1OGSA 1W31A 3LMYA 3O15A 4C6IA 4X9SA 1KM0A 2GUYA 4GJIA 4PUEA 1AJ2A 2QJJA 2HTMA 5I3KA 4JTTA 4AX7A 1E3XA 1ZBCA 3W6LA 1HW6A 4PC8A 1XDMA 2D0HA 3BOXA 3WLMA 2G3MA 1ECEA 4DM2A 4PRRA 1NDWA 2CFFA 1XICA 2XIIA 4GI9A 1XRVA 2BGSA 3M6DA 4X3ZA 3SW6A 4AXKA 1QDSA 1A0CA 3EX2A 2YR1A 1OCBA 3AIEA 4GY7A 3LYEA 1F07A 1VF8A 2NW0A 5D2VA 3H7RA 1Q6DA 3N15A 1AD4A 3DYMA 1GK8A 2VR4A 1R9ZA 2QQ6A 2XFFA 4PYSA 3LCIA 5A6TC 3N2OA 1TJRA 3ZM8A 5EGRA 1MEIA 2X42A 1OX4B 3W1MA 2DV0A 4ZEPA 1CGXA 2FFIA 1YMYA 4DWDA 3WLRA 4CD8A 3VMOA 2OLAA 3QW3A 4ZMGA 1JD9A 4FI4A 3UWWA 1G4TA 3I6RA 8XIMA 1LL6A 1JF5A 1EGVA 2BSLA 3OYXA 3PR2A 2OQLA 4TMCA 1GNXA 3DN5A 4MJ4A 5PTDA 5XIAA 2G50A 2V3DA 3OHMB 1PZ2A 1TVPA 2DW6A 5G1YA 3H70A 5A6BA 1GOMA 2PLCA 1A53A 3QF0A 2ZUUA 4W5ZA 1UWQA 1UROA 5DCEA 3KCOA 5AOUA 2W0UA 5M5DA 4C6JA 3PS7A 1F6PA 2ZX6A 1OIFA 4EXQA 3AMGA 1EJUC 2OU4A 2NVDA 1UWRA 1XLAA 2OZ0A 1Q63A 1Z9AA 1E70M 1M6JA 2OO6A 3GUGA 3WBXA 3LLFA 1DJQA 1O1ZA 3CQKA 1XLGA 4D6JA 1XIMA 3UR7A 1I9CB 5EYWA 2WZHA 1W1IE 3B0YA 5C8BB 2QGHA 3G1FA 4TOQA 1A50A 3E5BA 1KKRA 1X1OA 2I57A 1PZ3A 2B31A 2E28A 3ARPA 4IICA 2FMNA 5BU6A 4QFUA 4H00A 3KBWA 1XX1A 3FA4A 1S2CA 3IK4A 3JS3A 3CHVA 4J27A 5LGXA 2NQJA 1OBAA 1UIOA 5I3GA 4Z1YA 5HR7A 3M0KA 1VLWA 3C56A 1PVNA 3RM8A 1WQ5A 3BMVA 1GOKA 4E38A 3U6WA 1ITUA 4A8LA 4M5PA 2A3CA 1GVEA 2NX1A 4XUGA 3UR2A 4RCXA 2W66A 5C2XA 3BSHA 1XGDA 4LV4A 5HAOA 1JUKA 3VOHA 1EIBA 1N2VA 4Q8TA 5MKGB 3RCMA 2PURA 4O0ZA 1YIXA 4AIBA 1L9WA 1NH6A 2GJXB 2ACSA 1HNYA 4IPIA 2W91A 4YMZA 1LUCA 2DSVA 1HL9A 1NEYA 2P76A 5C71A 1BLIA 1L8NA 3CB3A 1HKMA 1REQA 2V5JA 1H62A 3IAQA 1H0IA 2OZ3A 1UKOA 2QKFA 2C91A 1VCFA 2XVGA 4J40A 1PDZA 4WSHA 2PLJA 4N9EA 4MAZA 3FYOA 3WF4A 3LEPA 1XISA 4G6CA 1AW2A 3DHUA 4Z0SA 2EEXA 1ICQA 4HA4A 4UFHA 2VEKA 3EDJA 4J3VA 2CBVA 1MXGA 3V5OA 4I3GA 3CPRA 3WLLA 1PX4A 3CUGA 2WJEA 4DUWA 1QO5A 2DW7A 3W6MA 3C6CA 2WVVA 1TZZA 1M53A 2WM1A 2YL8A 4JQ2A 4D1IA 4DO5A 1O60A 4JFSA 1C8YA 1X96A 2CBUA 1E71M 2PP1A 2AKZA 1QK0A 4F48A 3MUIA 3GQYA 3IJLA 2DP3A 4IPNB 3BJSA 3PBVA 1W6TA 4FXSA 3E2SA 4MZYA 4NIRA 1IF2A 4JYDA 2GSEA 1JZ5A 4XZIA 5LNUA 4GXPA 4E2DA 1JNDA 3WQWA 4LAMA 4REQA 1T7LA 1LF1A 4LNYA 3LDVA 3VTRA 1ICPA 4M1RA 4KEUA 4ATWA 3CV7A 5FI8A 3HQOA 4RZ5A 4E4FA 1POKA 1JZ8A 4BFAA 4XD5A 3TQVA 1Q5MA 3LHZA 4EPEC 3BICA 3TW9A 2J7CA 2RGMA 4PMZA 2GUBA 1P6BA 2PGWA 3C4UA 3RN6A 4PCTA 5A6JA 3QY8A 4I6VA 3GIPA 2P8BA 5HOSA 3GBEA 1EA0A 2V38A 1HKVA 1W9DM 4TTUA 4ECLA 1F6YA 1BPLB 3CV6A 1XM3A 4CKQA 1KKOA 1JDCA 1XLIA 3WNPA 3QGVA 3N19B 5TNVA 3NQBA 4NZ1A 3O3RA 3GFYA 3GDTA 1S46A 1W5PA 4IUOA 1TYGA 1T96A 3DCPA 5FJTA 3HBLA 2QEZA 3BQ6A 5EBUA 4IHCA 4UTWA 3ZJKA 1O94A 2HE5A 4V1XA 4L4PA 4MWAE 1GJUA 2OEMA 3H6OA 4PTXA 1S2AA 3VGFA 1TMLA 1UB3A 4Q8OA 1BFNA 3VIKA 4NL1A 1DTNA 1XDJA 2DZBA 2ISVA 5F4XA 4O12A 3EZ4A 4CNSA 1ESWA 1PYMA 2QNEA 1WOAA 1EJWC 4JKMA 2WOQA 1Q6GA 1KRBC 4ICMA 2A3AA 5AC5A 5KTLA 5IOBA 1DWJM 2H3DA 4GBDA 2A3EA 2G4JA 3TYAA 4UTHA 4M80A 5MHBA 3N3TA 2PCEA 5DELA 3GFXA 2ZXBA 3MSDA 2RGLA 2OB3A 1ONEA 4B5XA 3D46A 2C6QA 2PGRA 4G1NA 1CGVA 3IACA 1LRQA 4FAMA 4AIUA 4DWSA 2CLKA 1IEXA 4R3UA 3GR4A 2E9LA 3MZNA 4HU4A 2WC3A 3GTNA 4O18A 4LF1A 4MMWA 3U3HA 1JAKA 1EB3A 2ADAA 5C6MA 4MY1A 4LVAA 4URIA 1XLEA 3W86A 1BXCA 1TPH1 3T0BA 2CWXA 3BG5A 4YXGA 2IQ0A 3QOMA 2PLMA 1HJSA 4IPLA 2DPEA 3U7BA 3CWHA 2J8FA 1TPWA 4GABA 2DQWA 3EWZA 2F6XA 3SN0A 4D1JA 4JICA 2R6OA 4LVGA 1TWIA 3TK7A 4ZZ9A 4O8RA 2GGGA 3E96A 2YZRA 4NZ3A 3OPSA 2I9UA 1NIUA 2PRMA 3WDPP 1Q4WA 3MTWA 4JHZA 3MSRA 3U8GA 4CD7A 1YX1A 1GYNA 3I65A 3DEQA 4WIWA 2HS6A 3ITLA 4OBRA 2HK1A 1ZTVA 2PWHA 3ZR5A 1AH0A 4GH1A 4PCNA 1TPUA 3IAPA 5BCAA 3CH0A 3VX1A 3TSMA 4AZIA 4E4PA 1V7YA 2BY3A 2RKXA 1JCTA 1GOQA 3V35A 3VIIA 1V02E 4N0RA 1T41A 2SFPA 1HVXA 3UERA 4ATDA 4ZO8A 3RRAA 3KTXA 3CPUA 2ZZ1A 3NYZA 3WMLA 3F03K 1TV7A 3VGBA 1YNYA 4J7RA 4M6UA 1R87A 3AIUA 4E8GA 3WEZA 3RGTA 3IRDA 4A8RA 1LM1A 5CSRA 1TTIA 1J5TA 5DQPA 2YLAA 2Z2UA 2J8TA 5IFPA 4CD4A 2IPFA 4N4PA 3OB8A 3DAQA 2Z7GA 3UW6A 4E0CA 3MHGA 4P7QA 3ABRA 3WLIA 4C1NA 1JI2A 3QHNA 1JFXA 3CGTA 1E0WA 2VCAA 1H50A 4DJFA 3DFPA 4DY1A 3L21A 1QI3A 3WDJA 4C65A 5ECUA 2DZTA 3FV9A 3MBFA 5HJXA 2BOFX 2V3GA 3B97A 3S83A 4GZIA 4B3ZA 1Q7QA 4HMEA 1FDYA 2ZX9A 1I2OA 4GQGA 4G7EA 1TUFA 4CEUC 4JNZA 2D24A 5FIPA 3L4VA 4NSBA 3VE7A 4LYQA 2GK1A 4M6PA 3F2BA 2JK2A 3AUJA 5A8PA 2Z1XA 2V30A 5DT7A 4M0XA 2WMIB 1U5HA 4H2HA 1SJDA 1CXHA 4ZQRA 3OBEA 1JCJA 5L9FA 1V3IA 1ELSA 1ZPTA 2A1YA 4L4OA 1HKIA 5KZEA 1K3UA 1HP5A 2FJUB 2Y8UA 4AD5A 2PLKA 5DF0A 3TEVA 1R8LA 1E0TA 3W70A 4BEUA 1GVOA 2WWDA 3WNNA 3V16A 2BY1A 5GJPA 2A4AA 3UETA 1OK4A 2PTWA 4JL1A 1O4UA 2PDKA 1C8QA 3WH6A 3WZ0E 3COTA 1TZ9A 2E5DA 2BDQA 1VGAA 3APGA 4IG2A 1VJSA 4XO7A 3FHAA 2WCSA 2WKJA 1EEXA 2QMKA 2Q8ZA 5GJMA 4GOAA 3CH9A 3BDKA 4OZOA 1U33A 3BV7A 1H7XA 4PCFA 4QLKA 4JIHA 3CLWA 4PFHA 1DIOA 3QPEA 1RV8A 1HIZA 4AIOA 1X8FA 3WQFA 3GKAA 5G4EA 3IVTA 4IT1A 1OFBA 1GKPA 2W5FA 2VNCA 1VBGA 1FP8A 2CERA 3SO7A 3UVAA 3WK0A 1Q2RA 1GPWA 1RBAA 4XKMA 4AZCB 3PZUA 4JN7A 2VQUA 5K9DA 3BLDA 3WLOA 3W87A 3MUZ1 3S6TA 3MDUA 1K4GA 2J9ZA 3GVWA 3VD3A 1HO1A 4CCCA 5JXQA 4L65A 2E8YA 2OEKA 4JN8A 4L1WA 1S3HA 1S1RA 1G01A 1CECA 3VOCA 2CWNA 4JYFA 3G1XA 3UPMA 3E9AA 1JPHA 3A4JA 3LNPA 1TPVA 2HBXA 4U4MA 4QGCA 1QBAA 1MZRA 4C6MA 5HNTA 1XRTA 4C6EA 4B5VA 3HB9A 2VEMA 2DT0A 3AHTA 3GHSA 1NDYA 4IMEA 3CV1A 3IWPA 2YOCA 3P82A 1UMLA 1M03A 4HVXA 3W74A 2PGFA 1V6VA 4N6EA 4IIDA 2AQVA 1D7KA 4F0KA 5BOOA 2X16A 3F1QA 1V08A 2FPTA 1XD1A 2PDGA 2OTDA 4GFSA 4IL0A 3MI6A 2IPJA 3RRXA 1NOUA 1M04A 1SFLA 2QYGA 2VC5A 3KOWA 4AC7C 3EOEA 1IV8A 3PG8A 3ATYA 4LXFA 2C1HA 3GTIA 2PBGA 2B81A 3SJNA 4IX0A 2R94A 3TMLA 4OT7A 5JBDA 8A3HA 1FWAC 3W02A 5BXSA 3ZYZA 5FD0A 3HG3A 3QC0A 4JIPA 2WSYA 3PZQA 3RLHA 4NRRA 1GHRA 4JTUA 3AXXA 2PRLA 4IP5A 3P80A 4ZOCA 2GVLA 2HMCA 5KZMA 4JTEA 3IJDA 4FXFA 1EDGA 5CZTA 3MQTA 1FOBA 4KWSA 3SCQA 3ATZA 4MAVA 2QIWA 4MM1A 3WQ6A 1OX4A 3O63A 3OBKA 1V3KA 3CL8A 2ZADA 3E0IA 1RVKA 4GVHA 4PMQA 3CQIA 3CB8A 2G3FA 2E3ZA 2BMBA 3ITVA 3UZWA 4H2CA 4C6CA 5AN7A 5L6UA 5FF7A 5EA9A 4F40A 1IWPA 2XM1A 4NYUA 1WAWA 1KTBA 1RH9A 3SFWA 1XBXA 2B7PA 3LOTA 7REQA 2VEIA 3NJ3A 3VIGA 2GWGA 1I45A 3WUEA 1GJWA 1PYFA 4LFYA 4XAZA 1YW1A 1O5KA 3GXDA 5CPTA 3A5VA 4Y8EA 4C6NA 1ZGDA 1F3EA 5I2UA 2QZRA 3E2RA 4O1DA 4ACZB 4U2ZA 5AKQA 3VABA 4F8XA 3W7PA 3N34A 3POCA 4OFCA 3H4WA 5F1VA 4O53A 1TTPA 3QZ6A 4QAWA 3W01A 2J7EA 3BLKA 4B5UA 1DEDA 3FCPA 3GC5A 4K7YA 1GZGA 2E77A 3BOFA 4ZQMA 3G8EA 1S5WA 4HNOA 2XZ9A 1GQKA 3KUMA 3LQLA 2WCGA 1M7PA 4RR4A 2I17A 2AL1A 2DZVA 2DZWA 3W22A 3SJ3A 1ZBKA 2QJIA 1BTCA 1XYZA 2YCLB 1R2TA 3CHDA 3EB4A 1UUOA 3W83A 1WX0A 2VR2A 4GGBA 4LNCA 1EZWA 1V77A 3LSCA 3GAYA 3TAKA 3FJ6A 4NUWA 3CTTA 3DYPA 2JQXA 2OT1A 1JPMA 3P14A 3SCRA 3STPA 5H2ZA 5FEWA 1NJJA 4AD0A 2YPIA 3DH7A 1G7VA 1OG6A 3RUBL 1WOBA 3Q2DA 3O9NA 4XIAA 1CT5A 3K4AA 1MQRA 4MZ8A 2FPVA 1L8PA 2WMGA 4UOZA 5C2GA 1K9EA 3II1A 2DZSA 3PAOA 2GJNA 3LTSA 2NSXA 3MWCA 4Q8MA 1XSJA 1HKKA 2ZE0A 3L4XA 3VDGA 4H6EA 3QQWA 3AS2A 2PD5A 3IANA 4C7GA 5BW6A 2QGYA 5HUPA 1ME7A 1PKLA 3THQA 2AL2B 4BWLA 1V6YA 1TELA 3VOFA 1IXPA 1PV8A 3LPGA 1KM5A 3N2CA 1NWTA 3CASA 1EIXA 1TV4A 4JTGA 1PXGA 5D8WA 3WQ8A 3F4DA 2JALA 4DJDA 2VX4A 1LWJA 3MVIA 4WKFA 5CAHA 1FHLA 2XIOA 3NUKA 3ES7A 3ZXWA 1CI1A 1WPCA 1XYAA 4Q4SA 4AY8A 1HKWA 3KZPA 4GUFA 1T99A 4Z2LA 2PDUA 3EAUA 5BNKA 1ZSXA 1DORA 4KF1A 3CJPA 3GC2A 4MKNA 3T7VA 1NOFA 4FPSA 2J78A 4EWJA 1HT6A 1JQXA 1EPVA 4HHMA 2XGBA 3TTQA 5CZ0A 1ZY9A 4CCEA 2P10A 4UZSA 5HATA 3QQ0A 1QHZA 4BF5A 3IPWA 5LA1A 4P7LA 3WD0A 2P50A 5G2IA 5AYBA 4H9VA 1MEWA 1NWUA 3CUIA 5DRCA 1GPFA 1DIKA 3AYRA 4DBEA 3L7RA 4P7RA 4UOQA 3W4RA 3ZIZA 2GQAA 1RY8A 1BYBA 2V5LA 3CQJA 3A12A 4R7JA 3RXZA 3VIHA 1XCWA 1ITQA 3SDOA 3AICA 4GUJA 4YU1A 3ZWSA 1VLIA 3G1VA 1SZNA 1RJRA 4JTKA 5IBXA 5BWAA 4NY2A 1DJGA 3H2AA 4FA3A 4Q22A 3MC5A 1QOQA 5EB8A 5FSDC 4YHGA 1VCVA 2YB1A 1QI5A 3QSTA 4QIUA 5EMMA 4KPLA 4UTMA 3GYCA 3CL7A 3HGOA 1MEHA 1V5XA 1NOWA 4MVAA 3H12A 4AWTA 1NM9A 3W2LA 4CQCA 1E9IA 1P6CA 1IT0A 4GI4A 4GNKB 4LX4A 2POTA 1TTQA 1O5QA 1Y0EA 1R86A 5AHEA 2VELA 4EXBA 2Y88A 3B4UA 3BURA 4M6QA 3BAKA 3BARA 1DKWA 4MNKA 3VKJA 3MA8A 3EOLA 3UJFA 3ID7A 3IGUA 2CESA 3K8LA 4IM4A 3S2JA 1OC7A 3EYPA 4KRUA 3SCVA 3UCDA 4GNVA 1GTEA 1JRBA 3DI1A 4GZJA 1KM6A 4FLQA 3ABQA 2PCQA 4JKLA 3GR8A 3C61A 3NM3A 4J3UA 4PTDA 3L66A 3P6LA 4WKAA 3B03A 5AHMA 1UUQA 1KNWA 1I2RA 1E0UA 2HXUA 1DJIA 1J01A 4WEVX 2HPIA 3Q4DA 4A3QA 3AJ7A 4WDXA 3PANA 4R34A 4OE7A 5TAOA 3G1AA 3QKEA 1QW9A 5D2XA 4K36A 3TP4A 3R5EA 1I60A 1VBUA 4W7WA 1EF3A 2BP1A 2FHBA 3C5QA 3GYEA 3U0HA 3PZTA 4H19A 2XISA 2OG9A 2YLLA 2NWRA 1JD7A 2CU0A 3WENA 2CZDA 4Z2IA 2JE8A 3AHYA 3A5FA 2Y7FA 2WJFA 3URNA 4L5ZA 6REQB 3B8IA 3XIMA 4YYCA 3UXIA 2CC0A 1VEMA 2ALRA 4L9XA 4MB4A 1VRXA 4QTGA 2VX6A 3V5CA 2R1LA 5DFAA 4BQ5A 3UJSA 3SY8A 3E49A 4J3TA 3DENA 2FZDA 3PN8A 4KIEA 2Y70A 3TYZA 1EUAA 4B4FA 3OIHA 3UZ5A 5I09A 4LUTA 5C9WA 1KM1A 4FIQA 3VA8A 3KL5A 2PWDA 4LW7A 4XX6A 3N2XA 5D9NA 4OVXA 3PTMA 2PDLA 1MUWA 3H26A 1P0NA 3ITOA 4A2RA 4MB1A 2PI6A 3Q67A 4KH2A 3BAJA 2ZZ4A 1RJPA 5GPRA 4UQ9A 1CBGA 1UIPA 1XQLA 3BSMA 4Y9PA 4O15A 3RMJA 1K6WA 3VIJA 2QCDB 4AMCA 4MUZA 3RLVA 4S3AA 3G8RA 1ZHAA 5TQLA 1SO4A 4QG8A 4ICNA 2BVWA 2GVJA 2VKZG 1A5UA 2XG9A 2CLFA 8XIAA 4RDWA 1OD8A 3JUGA 3T6CA 6XIMA 3BO9A 2WVSA 3GH5A 3QV9A 2OEJA 2YKKA 3REQA 1NU5A 1NSJA 4R7WA 3KX6A 4FNQA 3TNBA 2DUAA 4MB3A 1US3A 1GKRA 1MW2A 3EX3A 2YJQA 2AGKA 1TJ1A 2FVKA 2FHFA 5AZ1A 1YEYA 4CNPA 4FEZA 1H61A 1SW0A 3BMXA 1E1FA 3L0GA 3GXPA 1QWGA 3CNYA 3H2FA 3AS1A 1SYTA 3MJYA 1A3HA 1WBHA 3QR1A 3EMCA 2QUUA 5EFDA 2G3NA 1IT7A 4GC4A 4MKSA 1FWCC 4J3SA 1Z42A 1ZU8A 3AWNA 4DVOA 3ZR6A 1DHPA 4Q8WA 2Y2WA 4OGZA 1R9YA 4IGNA 4FMVA 3VCNA 4LY4A 4Q7IA 1LDCA 3GE7A 4NNCA 1E9ZB 1W3NA 1S2UA 3Q58A 3AHVA 2CBJA 3HFTA 2JFEX 1CLXA 1HJWA 5IDIA 2A0NA 4YHEA 3QTGA 4YJ5A 4ZSTA 3TTYA 3WL0A 2V5DA 2XINA 4XD3A 1CXKA 4ALDA 4W7UA 3MP3A 4JFTA 3PJXA 2VR5A 3ABXA 2RDXA 1Q4NX 3O16A 3WJWA 3P62A 2WNZA 3O6YX 2XWDA 4HB7A 1AQFA 4KBXA 4JTHA 3TLQA 4PODA 2VT0A 4HA1A 1YXYA 4HKPA 5I5RA 1QPNA 2GDQA 3F4NA 3ZR4A 2J9YA 1WBJA 3WQCA 4Z2GA 4PTWA 1OFQA 2WJZA 1U2YA 4HPNA 2WNNA 4XV0A 2YYUA 3NQEA 4JL2A 3W27A 4IQEA 4A3HA 1TG7A 3LN3A 2XH4A 2I56A 4DB7A 2GSHA 3QMTA 1NFPA 1OGGA 2QCLA 3TFCA 3U5YA 3TIMA 3LCWA 3U48A 3C8FA 2CKRA 3D3AA 1AD1A 4O1EA 3KP1A 3N4FA 1XYFA 1NY1A 3FGCA 2NQ9A 3TV8A 1MUCA 3W53A 4JTFA 2AQOA 2HJPA 4ZQPA 2NXHA 4RNIA 2X7WA 3H2EA 3DHDA 3S9ZA 3GO2A 3S1GA 1P48A 5BROA 4M56A 3QC3A 5A8GA 3ABSA 4N42A 1X8CA 1XC6A 3SSJA 3GTXA 4JQ3A 1GVQA 1C9WA 3VFLA 2WZIA 3N18A 2D22A 2X40A 3G1HA 5GVJA 3I7RA 3EBVA 1S5VA 4PMRA 1A5BA 3BOLA 3NO5A 1GQJA 3IIPA 5IHRA 3TTOA 2GYIA 4HCLA 4GLEA 4L4MA 4PGLA 4IMDA 2ZVIA 5D03A 3FSTA 3VM7A 4E6MA 1A80A 1ZJIA 3PSWA 1S2VA 2CLOA 2PDQA 1FH8A 2ZUNA 3M5VA 4O13A 3N9RA 2EXOA 2V6AA 1Y5WA 4K37A 4DYKA 1PHQA 4GQ0A 3GG1A 1ENUA 2I9EA 3IK2A 5DY3A 1GTHA 1XSKA 4DJED 4O8AA 3H23A 1XF0A 3R4IA 5F2MA 3DFTA 3L68A 4IMGA 1N82A 3HV9A 5JMUA 2OSXA 4KETA 4RNJA 4DJEC 4JKKA 4UCGA 4NILA 2P1FA 4XBKA 3OU8A 3C3UA 2WCAA 3LV5A 4AIEA 3ZVHA 4MYAA 3PM6A 2NXIA 3CM4A 5A6KA 4OU1A 3STCA 4IPPA 1H5VA 1WXYA 2V9DA 1UD4A 2DORA 3WKZA 2R1NA 2XM2A 4YVVA 4UTUA 2YW4A 3S5SA 3UFYA 4LY8A 1KWKA 1ZZMA 2I7GA 3WBEA 2C71A 3NFUA 3JVAA 3GC4A 1PPIA 2VC7A 4AWEA 2J8GA 4QLLA 4O52A 2C7FA 2NXGA 3GR7A 3GHUA 1EC8A 4WR3A 3KVKA 4JIIX 3WJXA 1BYDA 2QUVA 4LUIA 4IIEA 2GJRA 4GVFA 1ME8A 1YDVA 3MHUA 3KBMA 4KFPA 1J0KA 3ZLHA 3EDFA 3NGJA 4DI8A 3EWCA 1ADOA 1W5QA 4HQVA 1CENA 1TA3B 1DIDA 4MUPA 3V18A 2V2HA 2PDCA 4JTJA 2REQB 3FYYA 4YCPA 2W4XA 1OG0A 1WO2A 4LS0A 3B0VC 3PJTA 3W7QA 4A35A 3WQ5A 3EWWA 4N02A 3C2EA 4I9AA 3U2CA 1FWHC 4JIQA 1AL8A 5HMSA 2AQWA 1BSIA 3HOJA 3FXGA 4PSPA 3S47A 4JEQA 3GHTA 1J12A 3NPXA 3EX4A 4RX0A 3GDRA 3HM7A 1SGJA 3WLNA 3NA8A 5FAGA 1YRRA 3O06A 1KCZA 1SPQA 2W9MA 1ADSA 3SR7A 2C79A 1WYIA 3MI2A 4AZHA 5SWUA 3MKVA 1CLVA 4O0KA 3W29A 1UC5A 2G0WA 2OLHA 1RD6A 1M41A 1E4IA 3D3FA 3PBMA 3RAOA 4M82A 5DEZA 1FHDA 5HMEA 2OGJA 2BXVA 3KP0A 5D37A 4MWAD 1UYQA 4EKJA 2PDJA 2UWFA 3MU7A 3R94A 3BZJA 3TOPA 4GVIA 4GO8A 3TYEA 5FSEC 5DXYA 4PR4A 3B9OA 4AX6A 4WX2A 1VIZA 1KXHA 4MWAC 3QV8A 5KINA 3M6YA 4YCOA 1WAUA 4ZOAA 4RNFA 2A7PA 5CBBA 5AHLA 4BF7A 1FWSA 5T8GA 4N7QA 3O2LA 1P6WA 5GJNA 1JNEA 1GVRA 4HA0A 3NG3A 4Y90A 1XD0A 2VOMA 1UA7A 4AEEA 1X7IA 1VPYA 3FKKA 1U1HA 4NG3A 5D2WA 4XK2A 4IP7A 4AEFA 1IEWA 5FJRA 3VGGA 4HT3A 3G3DA 2EAWA 1BKSA 2Y6ZA 4RE3A 1HJQA 4YL2A 4PSRA 4YLWA 5JUVA 2FQIA 4ORMA 5JIWA 2VX5A 4XTIA 4GKLA 4KCWA 2E68A 3QM3A 3SN4A 3NZ1A 4FOJA 4PUJA 3POHA 3PUEA 1DQXA 4JPGA 2NSOA 4A3UA 4O11A 1XW8A 2Q01A 1OGBA 2D0GA 4GIEA 4LV9A 2VC9A 1GVYA 4BJHA 1UD6A 1M9HA 4NJKA 1ML1A 4IWWA 1PX8A 3TW7A 1W2VA 1E6XM 2DUZA 4Q6JA 5D9PA 3I6TA 2YGYA 4K6AA 4X63A 2J7DA 4H1ZA 1UASA 3MY9A 4L56A 2Q09A 2ZIDA 3B8SA 3HU7A 1XRFA 5F2LA 4JEJA 3HURA 2OGYA 1BF2A 5ABFB 2DZUA 2J27A 4EF8A 4LUSB 1VFSA 3EPNA 1US0A 3FOKA 1Z41A 4I9TA 4NAFB 1OQFA 2P88A 4JY8A 4NJIA 1LBLA 1QJWA 1XUZA 1MYRA 3FY1A 4AD4A 3WG6A 4F3HA 3PWGA 3QR0A 3A3XA 1G69A 1GYLA 2BVTA 1C29A 2CLLA 1CGYA 1W3LA 4Z1AA 2FYMA 4L9YA 2GUUA 1UKSA 2WLZA 4DZHA 1DJNA 4PMJA 1AW1A 3OYZA 1HQTA 4UTTA 1AL7A 1QNQA 3L4TA 1ZALA 3VM5A 4LBUA 2D23A 1WDDA 1YPIA 3BE7A 1B9BA 2Q71A 1EXBA 4PE8A 3AS0A 3GIYA 3AZRA 3VIOA 5EPDA 1KBKA 5AHFA 3SCOA 4EPDC 3NO1A 4XWUA 4BQ4A 3RLUA 1XH2A 3ZQ9A 1XH1A 1TFVA 3L4YA 3VZYA 1EA9C 1QNPA 1FH7A 1XRSA 3W1NA 4FB7A 2GVYA 3R2GA 3ZFHA 4RDVA 3TUUA 2FH8A 2XIJA 2RHGA 1OYBA 2AMGA 3BGAA 1XIEA 2VZVA 4HNCA 1OINA 5CPOA 4QP0A 3DFHA 3KHDA 1VEPA 3GDKA 4HSOA 1Z8AA 1G4SA 3TQPA 4BHYA 4UQCA 2E6AA 1OF6A 2XVPA 1RBOB 4W7VA 3NEHA 3B9DA 1TE1A 2Y89A 4I5RA 3TCSA 5A8QA 3N12A 3B3DA 3T55A 2NV9A 1QPOA 3SADA 2OQYA 4H7VA 3TU9A 4QXIA 1JGMA 1LOLA 4JXCA 1F3XA 2HWGA 3V0UA 1D2KA 1DJZA 1FWBC 2WANA 3ANYA 1AA1B 4JFUA 1RCXB 1E9YB 3GTHA 1ONRA 4C6PA 2OX4A 3QFWA 1PIFA 2UZ9A 1EO5A 1VPQA 1PWLA 4EF9A 3KRZA 3QEZA 3UJ2A 2R1KA 3PUOA 1ZUAX 5D2YA 1U83A 3VIFA 3S5ZA 3K1GA 3O0KA 3TC7A 1DE6A 5AC7A 2AKMA 3Q45A 4M51A 1N8IA 3FA5A 3ITYA 6REQA 4G9PA 3UVIA 5ENLA 4R33A 3V0TA 3J7HA 1RUSA 3N4EA 3LBOA 5D38A 1Q13A 3CZJA 5DXXA 2D0FA 1MMFA 3OOQA 4UUIA 1H7OA 1XL9A 5DMMA 3F5JA 1B3OA 1OFRA 2ZKMX 1UHVA 3HPZA 4TO8A 1UW9A 1TZ7A 2Z27A 1O95A 3WSUA 1F7BA 2GGJA 4LUYA 5HINA 5HA7A 1NARA 4B5WA 3NQ7A 3NTYA 1OADA 2IPWA 2F61A 1NFGA 3SUWA 3ITXA 2E0PA 3I7SA 1KD0A 4WGXA 1F3WA 3UYIA 4MB5A 3HPAA 1EO7A 3IUIA 3SUUA 9XIAA 2Z26A 2CLPA 5LKYA 1B90A 4X61A 3W1LA 1E9LA 3ZSTA 3GNNA 2GQ3A 4ZO6A 4ERIA 5LIUX 2X0SA 3I68A 2DIJA 3OLDA 3UESA 3APTA 4KWUA 3UR5A 3IIOA 1YKWA 3W25A 1HJUA 3LRMA 3ZT6A 1OC5A 4AD3A 3DIPA 3OVPA 3WQVA 3P2VA 2C19A 2IKIA 1RALA 2NV2A 3G5EA 2QW5A 4YVXA 4DO7A 9RUBA 2ZZ3A 4DPQA 1XIJA 3EKZA 1P0KA 3HJEA 1I2PA 1OFOA 2RUSA 4MYXA 3IRSA 3AIBA 3W72A 4UR9A 4M24A 3KBSA 3WF0A 3OIXA 4WZHA 4L6OA 1JCLA 1IR2A 3DECA 4FR1A 3RHGA 3ARWA 1W9BM 1XKJA 3KM8A 3UZZA 5CZKA 2XH7A 3GXFA 1HTIA 2OYKA 1FWEC 4M3PA 3F7JA 1XLMA 4A6GA 2OZTA 3ZLGA 4WRHA 1J0ZA 3CO4A 4Z2KA 3GDMA 2CITA 4NAEB 3MMUA 5BRQA 4UTWC 3GX9A 4K2SA 3BZGA 3DKJA 2ONEA 4D71A 1BXBA 2V3EA 1A5SA 3PBYA 3P3BA 4AMAA 1FKWA 5D05A 4AHOA 4RE4A 1W37A 1EP1A 4GZ7A 1TR9A 3NQDA 3V4BA 1B3YA 4MDPA 4AWUA 3VC6A 1UR4A 4PN2A 1U1UA 3SIMA 3ALGA 4S3EA 3GKFA 2PWFA 3AXIA 2ZDSA 3GM8A 2HE8A 4N2YA 3DGRA 3DU0A 3GHRA 3WO8A 4O1FA 3H53A 4MNJA 3BWWA 4U5IA 4UCFA 4QNWA 5JH2A 3A6OA 1YTKA 4DYJA 1XBZA 4Q4QA 2Y7DA 4JFWA 4YTQA 4PMYA 2RDWA 4IIFA 4L61A 4ERGA 3DG6A 2F6KA 1BXNA 2GL5A 1TPDA 1XR2A 2V63A 2E6YA 1MQPA 5CH9A 3GW0A 1KRMA 3N6QA 1U1JA 2PC8A 1R7OA 2W67A 5DY2A 1S1PA 3ARQA 4UTFA 4ASTA 1YDOA 4JDYA 3B8WA 1FWIC 1RPXA 1XGZA 1I75A 4V33A 3G6LA 3NQ8A 1ONWA 3G18A 4I5XA 1VR6A 1JJKA 1E55