3APGA

Crystal structure of hyperthermophilic beta-glucosidase from pyrococcus furiosus
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
471
structure length
471
Chain Sequence
AKFPKNFMFGYSWSGFQFEMGLPGSEVESDWWVWVHDKENIASGLVSGDLPENGPAYWHLYKQDHDIAEKLGMDCIRGGIEWARIFPKPTFDVKVDVEKDEEGNIISVDVPESTIKELEKIANMEALEHYRKIYSDWKERGKTFILNLYHWPLPLWIHDPIAVRKLGPDRAPAGWLDEKTVVEFVKFAAFVAYHLDDLVDMWSTMNEPNVVYNQGYINLRSGFPPGYLSFEAAEKAKFNLIQAHIGAYDAIKEYSEKSVGVIYAFAWHDPLAEEYKDEVEEIRKKDYEFVTILHSKGKLDWIGVNYYSRLVYGAKDGHLVPLPGYGFMSERGGFAKSGRPASDFGWEMYPEGLENLLKYLNNAYELPMIITENGMADAADRYRPHYLVSHLKAVYNAMKEGADVRGYLHWSLTDNYEWAQGFRMRFGLVYVDFETKKRYLRPSALVFREIATQKEIPEELAHLADLKFVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of hyperthermophilic beta-glucosidase from pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Beta-glucosidase
total genus 184
structure length 471
sequence length 471
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3apgA00
3CMGA 1LG2A 2E0PA 2EJ1A 1B3WA 1WDRA 2XSAA 3KL3A 1H4PA 1W3HA 1WZAA 5A2CA 1UKOA 2EQDA 4XZWA 1QI2A 3UR7A 4HU8A 2Y24A 2WW5A 2XIIA 2YIHA 1F4HA 1VEOA 1U30A 2ZIDA 2J75A 3PZVA 3CUGA 3DYPA 1JD9A 1GOQA 3SCQA 3GBEA 2YL9A 5ABGA 1JXJA 1CBGA 1GW1A 1P6WA 2X05A 1XH1A 2FH6A 2YL8A 3GXFA 3RM4A 1VFUA 1J11A 4LYPA 2CHOA 1R8LA 4N0RA 6A3HA 1CGTA 6TAAA 2VX5A 4IPLA 1JYXA 5M5DA 2V5DA 4W7VA 5E6ZA 2O9PA 3GTNA 4AD2A 1ZU8A 4B3KA 1UKSA 4LYQA 4W8BA 1JF5A 3CZEA 3BLPX 2ZX8A 2AMGA 1ZBCA 1HJVA 1OGGA 3UR8A 5HPOA 1WCGA 3MMDA 1XRVA 4C7GA 2WBGA 5CPTA 1DWIM 2XGIA 3HN3A 4AD1A 2WBKA 1J0HA 3ARZA 4AIOA 1TA3A 2UWFA 2WC7A 2BHYA 5HXMA 4WK9A 2GSJA 3WDPP 1KCLA 1WDPA 2D3NA 2ZXBA 1TUXA 1MXGA 5HBFA 4H2CA 5HNNA 1G1YA 2WAGA 4UQBA 1E6QM 4C7DA 5A6JA 1HKMA 2DGAA 2VRKA 3WF3A 4KGJA 2XFRA 4HOWA 2E9BA 3N15A 3VIHA 3KZSA 3NSMA 1JDDA 3N13A 3A4WA 2YDRA 3ARVA 4S3JA 3T09A 2CESA 1V6VA 2WB5A 1JYWA 4P8XA 2YKKA 9CGTA 1E40A 2D2OA 4AEEA 2O92A 3AMCA 3WEMA 1K9TA 1ZBWA 1UUQA 4PMZA 3PZIA 4EK7A 4PMNA 1DWHM 1VEPA 2YJQA 2PWEA 3CZJA 4D6FA 4MB4A 4DM1A 2YLAA 1XYZA 1N82A 2W62A 2NSXA 3N9KA 4IUGA 4B15A 4U3AA 4HMCA 1V6WA 1ZBKA 2WKLA 2DT2A 2W4XA 3QGVA 2Y2WA 3BXWA 1JXKA 4CKQA 3AQUA 1HJXA 3WQ4A 2J7HA 1KWKA 4AIUA 2WZIA 4YPJA 2J7FA 2NT1A 5BYWA 2A3CA 1UHVA 4B9ZA 1LLOA 2VX4A 2ZXAA 5CLTA 2ZX5A 1W9XA 1ODUA 2O9RA 4MNJA 4CD8A 3I3DA 2WVVA 2BY1A 3AJ7A 3TP4A 3I3EA 7A3HA 2BHUA 3F5JA 4RE2A 5EB8A 2DPEA 1OGSA 1PAMA 1CNVA 1JF6A 5CLWA 5M17A 1NOFA 1V3LA 1WPCA 3AISA 1W1TA 1XYFA 5FL1A 1DTUA 3I3BA 4MJ4A 2J4GA 1UYQA 1QI0A 3KEHA 1NH6A 3VVGA 3W24A 5EMYA 5I23A 1H41A 4IPNB 4OIFA 5JIPA 2BNJA 4CD5A 2PWHA 1X1NA 3S2CA 3VIPA 1QPKA 4KMQA 1HP4A 4PN2A 4E4PA 2XVKA 4DM2A 2WWDA 1VENA 3MV11 3WNLA 2VURA 3WUGA 3AIEA 2EPOA 1LL4A 1HKIA 3NCOA 4P7NA 1QHZA 5FL0A 4DUWA 1B31A 4W7UA 1DWJM 4JHZA 2CXGA 1QHOA 1UR2A 5BROA 1AQ0A 2DQXA 2EO7A 2CETA 3OG2A 1JNEA 4JCLA 4ATLA 4MNLA 3OIHA 2OSWA 1W2VA 1KXTA 3CZLA 4OUEA 4OKDA 3IJ9A 4UFKA 4NSBA 3PZ9A 4PTVA 3CHDA 1E15A 1XH0A 2QMJA 4B9YA 2QMKA 1V03A 1FH8A 4N42A 2IXVA 3ARQA 4PCSA 2J7BA 4PYSA 1EDQA 1B2YA 3VGBA 3KWXA 3RM8A 3AIBA 3OLEA 3LPGA 2E9MA 1E3ZA 5A94A 4QP0A 3VDBA 3AS1A 4HA1A 1UR4A 1RP9A 3F4VA 4H8VA 1JL8A 4U3CA 1X6LA 2WZHA 4HA3A 1VEMA 4TVCA 1UKQA 3HU7A 1JI1A 3AXHA 4X9YA 4AZ5A 3SURA 3GXDA 2J62A 1HVQA 4M1RA 3PZGA 1UWTA 1KR0A 3APGA 4ACZB 1EHNA 3EMZA 2Y8VA 5CGTA 2V38A 1ZJAA 4AW7A 1KXHA 1FA2A 3QOKA 1DWAM 2ZUWA 3WNNA 1JFHA 1H11A 1B30A 5HDRA 1R7AA 2D23A 1CGYA 1B3VA 1J18A 1OT1A 2D20A 1FHLA 1E9LA 2E4TA 5JBEA 2FHBA 3PHAA 5HPCA 2QPUA 2A3AA 1R86A 2WHLA 3WQWA 1OINA 4H7VA 4WJXA 1ITCA 5LYRA 1PX4A 5I78A 4BF7A 4UQAA 2Y4SA 3ARPA 1J12A 1XCXA 1Q6DA 3N12A 4H8UA 3W6MA 4IISA 4HPHA 3TTYA 2VR4A 3MSGA 3AICA 5AYBA 1BLIA 3WNMA 5IHRA 1SR0A 2V3DA 1GJUA 4K68A 4GQQA 3MUY1 1UR1A 3CBWA 4WF7A 4QAWA 2XUCA 3RDKA 4GINA 4J3VA 2BY3A 1CXKA 2CNCA 3CZ8A 3LMYA 1CYGA 2WVTA 4M56A 5I0DA 1K9FA 4U5IA 2BHZA 4CN1A 1WB0A 3DHPA 2WLZA 4AWEA 4A3YA 4UTFA 3U7BA 2J8GA 3L2MA 1CEOA 3FHAA 3L4TA 3PBGA 1BVZA 3K8KA 4W86A 4W8LA 3A4XA 3GH7A 3VOCA 1J0ZA 1L8NA 3VTRA 4ZEPA 3ARYA 4W8AA 4ZFMA 3SUVA 3M07A 5ECUA 5CJ5A 2GFTA 4HZ7A 2J8FA 3IANA 4FLQA 2MANA 3ZJ8A 2FHCA 5A8OA 4S3KA 4CU7A 1KFWA 4W93A 4UNIA 3CO4A 4Z2KA 1UG6A 1MWOA 4YN5A 3SIMA 3VINA 1K9DA 1H09A 6CGTA 1LG1A 2E8ZA 1W9BM 4TX8A 1HVXA 1VJSA 1GQJA 4AZ6A 1IT0A 1WZKA 3NYDA 2WMJA 2VO5A 3B9AA 3TONA 1JZ2A 3ZJKA 1AMYA 1UQZA 4AISA 1VBRA 3ZOAA 4CUCA 4HP5A 4J3SA 3AIQA 1UD2A 4ZXOA 3UG4A 1ZBVA 4WSJA 4JAWA 5FIPA 4AZBA 2CEQA 3WMSA 1MXDA 3POCA 1UZ4A 1GOKA 2VT0A 5DEZA 4J3XA 1WNOA 5AC5A 3T08A 3WN6A 4OZOA 1VFMA 3CIVA 4R5EA 4TX6A 1JZ7A 1ISVA 3U7VA 2ZXQA 3N04A 4DWSD 3L2LA 5AC4A 4YHGA 1E1EA 4YHEA 2YDQA 3WF1A 1PPIA 1K9EA 3G6LA 2G3IA 3CZKA 1E4NA 1BQCA 4URIA 1NWSA 3G6MA 4JZ5A 4DUVA 4QLKA 2XWEA 3PZMA 1UH2A 4BQ5A 1KB3A 2JF6A 1JAEA 1JD7A 3W27A 2FHFA 3WUFA 4HOZA 5CZKA 1B9ZA 1CXLA 4KRTA 1QW9A 3OGVA 3FAWA 3OA5A 4E2OA 3WD0A 4QCFA 1VJZA 1QI3A 4LYRA 5A3HA 4AY1A 2VVSA 5CSUA 4F79A 1FOBA 1WKYA 3OGSA 2JIWA 5FOOA 3FHQA 1GQIA 3WQVA 5JUVA 3N17A 1W3JA 2XVLA 3VPLA 2EPMX 3WDHA 4V27A 3VM5A 3EDFA 1E5NA 1GUVA 1DP0A 1GOMA 3VIKA 1VB9A 2GVYA 2FGLA 2ZXDA 1G94A 1E4LA 1E6XM 2PWFA 5D9NA 3AZRA 1HF6A 1CENA 2VTFA 1UKTA 4PMYA 2DH2A 2DIJA 2VQUA 1MW3A 3CUFA 8CGTA 4MNMA 3CGTA 4FK9A 4D6HA 2X0HA 5A6BD 4GI9A 3WH8A 2XVNA 3AMGA 3J7HA 2Y5EA 1UA7A 2PWGA 1JZ5A 3AI0A 3ZT7A 2Z1KA 3WNOA 2WCSA 1VFOA 1G01A 4WKFA 3KL0A 3VD5A 3BSHA 4KWUA 5A6AA 2XJ7A 2E3ZA 2OWWA 2A3BA 4U2ZA 3WFZA 2TAAA 4CCEA 5GNZA 1CZ1A 2A3HA 8A3HA 1QNSA 1TCMA 3II1A 1EO7A 2XG9A 4UOQA 3EMQA 1TZ7A 3T2OA 2VMFA 2GDVA 5A8MA 1R85A 3W28A 1GJWA 4P7QA 1OIFA 5GNYA 4W85A 4UFLA 3NJ3A 1BF2A 1UR8A 2VL4A 3WF2A 2GJXA 4D6EA 4J3WA 1JNDA 1V08A 1UR9A 2RGMA 3RJYA 4XB3A 2O9TA 2W5FA 4F66A 5BXRA 3WDRA 5E0CA 4B16A 1ISXA 4MADA 4AD0A 1J0IA 1CIUA 1M7XA 3UG5A 1Q6EA 1GCYA 3WMBA 5BRPA 4BZYA 4CU8A 1ITXA 1EQPA 5GNXA 4PMDA 3T0BA 5JIWA 3SCSA 1XCWA 1IZKA 3WQ8A 3PZNA 1B3XA 2WWCA 3VIJA 2WVVB 1ESWA 2BXYA 2WK2A 3OZPA 5A6LA 2VZTA 5E6YA 3W37A 3WKZA 2WM0A 3PZOA 5FD0A 1GHSA 2VCBA 3WF4A 1ZS2A 3SUUA 1CLXA 5CSYA 3TOPA 4OBSA 1U33A 1EIBA 4GO9A 1JZ6A 2ZUNA 3O6AA 4NZCA 2B31A 4CCCA 1QBAA 4JKMA 1UWSA 1PIFA 4BQ2A 1FH7A 1LL6A 1EOKA 1E72M 4AD3A 3GM8A 1R7OA 2WMIB 2V5CA 1E3XA 4QFUA 1BPLB 1B1YA 5IFPA 5E0FA 3PZUA 4AZGA 3FN9A 2J7DA 2G4FA 1PX3A 1PBGA 3EBVA 4MAVA 1E6ZA 3PTMA 3WY1A 1D7FA 1W1YA 3RPMA 3LPFA 3AFBA 4PSRA 4A3HA 1MW0A 4PMOA 3ARWA 1E6SM 3VIIA 1Y7VA 3WENA 1V02E 3MANA 3OB8A 4ATDA 1VF8A 3VD9A 3AROA 5E70A 1QVBA 2BFGA 1MFVA 2D22A 4JIEA 4W5ZA 1GVIA 2WMKA 3MKKA 4AEFA 1D2KA 1LWJA 1ZB5A 1QW8A 1C8XA 3CLWA 4ATWA 1R87A 4B3LA 2GJRA 1A3HA 3K8MA 1O6IA 2YA1A 3PZTA 5DO8A 2XIBA 2EPLX 2FH8A 1JDCA 4KH2A 4TTUA 3RJXA 4A4AA 1NQ6A 1HL9A 3AIUA 5AY7A 1IV8A 3W53A 2WVSA 1I75A 4UOJA 1UA3A 3A4AA 2DIEA 2G3MA 2YDSA 3ZO9A 1UOKA 5IHSA 3UERA 1GZJA 3MSDA 2XVPA 2XTKA 3QHOA 1H0GA 2J7GA 1ECEA 4NI3A 1E55A 3NUKA 5CQ1A 3VIFA 1J0JA 2WXDM 1VIWA 1CECA 3T2PA 4GO8A 4JKKA 4MB5A 4QLLA 3BCFA 1W9PA 2XPKA 1TVNA 1U2YA 3LPOA 3AOFA 5DF0A 1HX0A 1KR1A 2EEXA 5D9PA 2W92A 2C0HA 3BC9A 4D1IA 3A6OA 4TXEA 1VFFA 1V3JA 5C71A 3UCQA 2X8RA 3GYCA 3SUSA 4AD4A 5D9MA 5I6SA 3BMWA 3W29A 2ZOXA 3RCNA 3VGEA 1GQLA 2CITA 1C92A 1FP8A 1S46A 2XSBA 3M46A 3IAQA 1NM9A 4U2YA 1V0LA 3ZSSA 1CDGA 2FDMA 3QOMA 1H0IA 1AQHA 4P7RA 1GOWA 5ABHA 3THDA 3WEOA 1BSIA 1FFQA 2W66A 1BG9A 1MQRA 1FP9A 1MW1A 1J10A 1OCQA 2UY3A 3F5LA 4GPNA 4D6GA 4P7LA 4GKLA 2VC9A 2X2YA 3IAPA 3L4VA 4D72A 4Z2JA 2CPUA 1TG7A 3ZT5A 1VRXA 1H2JA 1W32A 3L4YA 4UZUA 1G9HA 2D1ZA 2XFYA 3MUAA 4AMCA 3UESA 5TD4A 1V0MA 1OWQA 1K6AA 3VNZA 2JFEX 2DH3A 3AHYA 2VUYA 4IM4A 1HN1A 2WPGA 3KL5A 3VM7A 4BQ4A 4UQEA 1RH9A 3IK2A 1JYNA 3OGRA 3N18A 5DT5A 3WELA 3GNRA 2OWXA 5A95A 2F2HA 4XUYA 3VDAA 3T0AA 3WNPA 1ZJBA 3NDYA 1UH4A 2PBOA 1SMAA 3L4ZA 1PX8A 1M01A 2ZX9A 2XM2A 1XHGA 1CWYA 3UEQA 4PUDA 5A1AA 1GOOA 2HISA 1EHAA 2X09A 4J3UA 5I2UA 4X0NA 3EDEA 3BAKA 1US3A 2WMHA 1I1WA 3SUTA 2VRJA 4CD7A 2CBVA 3ARTA 1Q4NX 3BAWA 1CXFA 3ALGA 3OBAA 2XVGA 3WMCA 1VBUA 5F7UA 1M53A 3E1F1 2BY0A 3BGAA 3VGGA 3D3AA 2WSKA 3K4AA 1HKKA 1E43A 4NF7A 2PWDA 3U5YA 1C7SA 1G0CA 4V28A 1WDQA 2AOSA 5AYIA 2W63A 1KGWA 4PSPA 3HJEA 4CGTA 1W3LA 5M3WA 5C8BB 1YQ2A 4F8XA 1E6NA 2J79A 2IXUA 3K46A 3S6TA 3GNPA 2G3NA 4WKHA 4J27A 5LA0A 4GIAA 3MV01 4GZIA 5LA1A 3CUJA 4Z2LA 1GNXA 3T2QA 2DT3A 2CHNA 4ACZA 3AS2A 3M6DA 4E8DA 4MDOA 1L0PA 2PB1A 3VKKA 2CKRA 1WAWA 3W38A 5BRQA 3MU7A 1DHKA 4GQRA 3D5HA 3AS0A 3ZSTA 3BAYA 1CGVA 1PIGA 1BAGA 5KEZA 1KGXA 4L4PA 5A2AA 4PEEA 4UR9A 1VAHA 1QNOA 1TR1A 1EQCA 2OYLA 4CU6A 1CTNA 1CGXA 1ISZA 2WHJA 4D6IA 1GOIA 5DMYA 3VO0A 3AMDA 2VR5A 5ABEA 3GBDA 4J28A 3CPUA 3WDJA 1HT6A 1HP5A 3ZJ6A 3WF0A 3AHTA 3WEZA 4DWSC 3AIRA 4XX6A 1J0YA 1E0WA 2GUYA 4D1JA 1HNYA 1WZLA 1OB0A 4M29A 3IJ8A 4DWSA 2WMIA 2J47A 2XGBA 2D3LA 1GQKA 2WNWA 4Z2IA 3DECA 2WMFA 1BGAA 1NOWA 4QLJA 4UFIA 3MUZ1 2VOTA 3A47A 5BCAA 4XV0A 1H3GA 5I79A 4LQ1A 3WH6A 2QV4A 2ZWZA 4P8VA 4MTVA 2GK1A 4H8HA 1BYBA 2DSZA 1LQ0A 1UWIA 3BMVA 2DSVA 2DSKA 4MAZA 1JIBA 1JGIA 1TVPA 3DYOA 2YOCA 1HJQA 2VZVA 3PTKA 1KBBA 1W9VA 3M7SA 1D3CA 5CGMA 1CGWA 3AHXA 3QR3A 3GH4A 4ZE5A 3VUPA 2YL6A 2JEQA 3OLIA 3CHCA 2JE8A 3L4UA 4L4OA 4WLCA 1EO5A 3ZJ7A 1MVYA 3CMJA 1JZ3A 4R27A 3CH9A 1BTCA 3VILA 2D0HA 4GZEA 4HA4A 2ZUMA 3ZR5A 5D8WA 3TA9A 2WANA 1I1XA 1DEDA 5E9AA 3AXXA 4NRSA 1UR0A 1E1FA 4KRUA 4M81A 1E71M 2HVMA 4FLSA 3VD4A 4PTWA 2PF0A 3B9DA 1KQYA 4D6JA 2ZE0A 3PTQA 2PC8A 4Q22A 1QBBA 4F9DA 2WC4A 1KXQA 4PMVA 5I24A 5DT7A 2X1IA 3BAIA 1WE5A 4FLRA 1UWRA 3NSXA 3WFLA 4MJ2A 2WCAA 3DC0A 5M03A 3WIJA 5JBDA 1OBAA 2CCRA 1W91A 1Q6CA 2VVNA 3VNYA 3NIYA 1UD4A 1W9UA 2W91A 3RILA 2CERA 4E8CA 3F5KA 1OGBA 2YBTA 4EKJA 4UZSA 2WHMA 1W1VA 3BAXA 1CXHA 2WC3A 2C8NA 1O7AA 3VU2A 4UFHA 4ZENA 1C90A 5LA2A 3THCA 3EDDA 3SEPA 1PZ3A 1Z32X 2J78A 3ARXA 5GQBA 4JFUA 4PTXA 3WUEA 1HJUA 1BG4A 3GXMA 3MUIA 1XH2A 2BS9A 3W26A 4AZHA 2JIEA 1KBKA 3W25A 2VNCA 1IZJA 1EGZA 4GZJA 3FNDA 1SYTA 4UQDA 3ZMRA 4P8WA 4JL1A 3K1DA 3N1AA 3WQ6A 2VZSA 2XM1A 2BVTA 1UKPA 3WD3A 1NP2A 3VIMA 4AZ7A 1V0KA 4TVUA 1BYDA 1UWUA 3AZSA 4JFTA 5CG0A 1TA3B 4MNKA 4RE3A 2V3FA 4W87A 1RPKA 3TTQA 1J01A 3W0KA 3ZM8A 3B9EA 1HL8A 1RP8A 3SCWA 5A2BA 4Z2HA 3W82A 1MW2A 2D0FA 2YL5A 3CHFA 3WUBA 3U57A 2Q8XA 1OT2A 1UWQA 1V02A 1NARA 2UY5A 2WKGA 1E56A 2DEPA 4U5KA 4JFWA 3CHEA 4PUEA 3OLGA 1V3HA 1MFUA 1TMQA 2J77A 2VJXA 3ARUA 3POHA 4TUFA 3W4RA 1J9YA 4H04A 1E73M 4PTMA 3WL0A 1CLVA 4HPGA 4HZ8A 3ECQA 2NT0A 2NW0A 2J7CA 5BXSA 1PEZA 2UY4A 3AZTA 1Q6GA 1B90A 2GK1B 3ZR6A 5BXPA 1XV8A 2D0GA 4NRRA 1V3KA 1UD3A 1CPUA 2BVYA 3DYMA 1NWUA 3N11A 3EDKA 4JFSA 3SUWA 2QF8A 1HJWA 2CBJA 4CD4A 1C7TA 2ZICA 4DUXA 5I5RA 1LL7A 3UG3A 7CGTA 3L4XA 3VD7A 2OYMA 4D6DA 2EPKX 3VIGA 3WD2A 2D24A 4MDPA 3FXYA 2XWDA 2WVUA 2V3GA 1QHPA 3O9NA 4DWSB 1JZ4A 4CD6A 3TTSA 1E4IA 1FFRA 1H49A 1LF1A 3OLDA 4ZE4A 1MYRA 2EBNA 3NDZA 2DT1A 3MMWA 4BA0A 4MB3A 5KZ6A 1E6PA 4FF5A 2OWCA 4ML4A 2PI6A 1HJSA 2CBUA 2JEPA 2ZUSA 1SMDA 2EXOA 4LGXA 4XZBA 4PMRA 3HMCA 3SCRA 2Y8KA 1CXIA 4AXNA 4M82A 1C3FA 4TOQA 2YA0A 1WO2A 2CIPA 4PCTA 2OSXA 3UETA 1YHTA 1ISWA 1Q6FA 4CCDA 1XD1A 2AAAA 2VRQA 3CUHA 4UQCA 1HXJA 3WH9A 2DSUA 1UQYA 2G8ZA 1UH3A 1W3KA 1NWRA 1JZ8A 4M80A 2G41A 3RMEA 1X6NA 2WYSA 3JUGA 3AMLA 3AYRA 4JL2A 4FLOA 3AHVA 4HU0A 3GDBA 1GPFA 1WDSA 4AD5A 4AYSA 2XYLA 1OM0A 4D71A 2A3EA 4WIWA 4PRWA 2IUZA 2J74A 5I3DA 3AYSA 2RGLA 1QNQA 2GJXB 5ABFA 5A8PA 1B0IA 1OIMA 1C8YA 1JI2A 4W7WA 4CVUA 5A6KA 1E4MM 2DT0A 1FHDA 1NWTA 1ZL1A 1G5AA 2ZWYA 1KWGA 2BV9A 3PZQA 4HZ6A 2QLYA 5IXEA 3U5UA 3W6LA 1UD5A 2W61A 3VIOA 1JFXA 1E0XA 2VQTA 4D6CA 3WD1A 1V3IA 2O9OA 1J0KA 1HKJA 1RD6A 3AIVA 1C93A 4AZCA 1DWFM 4PMUA 2DSWA 3CUIA 2OLHA 3WBAA 2ZUTA 3AIWA 4HMDA 5A8QA 4TVDA 1TE1A 1BVNP 2FGZA 1BFNA 3GZAA 3VGDA 3AS3A 2WHKA 3QHNA 4AZIA 4UFMA 5IDIA 4U33A 1EDGA 2CBIA 4W89A 3SCTA 3WQ5A 1V6XA 1E0VA 4BCEA 2W67A 4OBRA 2ZUVA 3VD3A 1WP6A 3RM9A 1EH9A 4OOUA 1PZ2A 1V0NA 3AHZA 2Z1SA 1JAKA 2QPSA 3MMUA 4Q7NA 1UD6A 5BXTA 1B3YA 1XSIA 3VGFA 2J25A 2OYKA 3W81A 2YLLA 3RO8A 1XC6A 3FY1A 1EDTA 1MQQA 3RIKA 1CGUA 3B8SA 3OZOA 3BLKA 2VI0A 3VMPA 1H1NA 4ZXLA 3MS8A 2YA2A 2WZEA 4QDMA 4P7OA 1GHRA 1QNPA 1GONA 4GI8A 3O2LA 3VDCA 1JDAA 1V6UA 4X0VA 1BYCA 4V2XA 5CXPA 2X0YA 5FKYA 3AXIA 3SCNA 3NSNA 4EANA 3T0DA 2GJPA 5EFFA 2E9LA 1A47A 3VMOA 1W2PA 2YBUA 3CZGA 3BCDA 3VMNA 1KXVA 3WBEA 5GPRA 2EPNA 1M03A 2WCGA 4GXPA 4RL3A 5D4YA 4P8UA 5A6MA 3SCUA 3SCOA 4F9JA 5A6SA 1H5VA 1LJYA 3DHUA 4KGLA 2BXZA 4QCEA 1KQZA 3BAJA 4M24A 4BQ3A 1AVAA 1NOUA 2E8YA 3VX1A 1JYVA 1XSKA 5JBFA 1E70M 3VDHA 3WH5A 2BY2A 1GORA 3FAXA 3WDIA 4PBGA 2PBGA 5CPQA 4WKAA 3EDJA 4FMVA 2C7FA 3MO4A 4AC1X 2VZOA 1EXPA 4WSKA 5C70A 2ESCA 2QHAA 3EYPA 1F4AA 3CTTA 2CYGA 2DDXA 5EFDA 4C7FA 1UD8A 1UZ1A 2VX6A 4AZCB 1OD8A 4CN4A 2J7EA 1NP0A 2JALA 1C8QA 2UY2A 3BH4A 2F8QA 1FH9A 4Z2GA 4UOZA 4W84A 4W5UA 5I77A 3LPPA 1C91A 1XSJA 2WMGA 7TAAA 4UCFA 5D9OA 2VCAA 2V3EA 3SCPA 4JKLA 5CPSA 5DFAA 1LWHA 2VCCA 3ARSA 1ODZA 5ABFB 5BWFA 3K4DA 3WDQA 3WSUA 2WLYA 1QNRA 1OSEA 3SCVA 5A8NA 1KGUA 4J7RA 3ZQ9A 1EOMA 3L4WA 4U31A 4BS0A 2ZX7A 4UQ9A 3BSGA 2BVDA 3FW6A 3WH7A 1W9DM 4ACYA 4MPKA 1US2A 1BHGA 1QOXA 5E09A 1MQPA 1DWGM 3A3HA 4OOZA 4MB1A 5D8ZA 4JHOA 3TTOA 3GH5A 2OSYA 1E5JA 1KCKA 1SFSA 4H41A 5A69A 5EBAA 4EAMA 3WD4A 4HOXA 2ZUUA 2VZUA 4M8UA 2G3JA 3K8LA 1W1PA 3EMCA 3KE0A 3AMKA 4JCMA 3ZT6A 4RE4A 1XGZA 4UFJA 2ZX6A 4PMQA 5IFTA 1E6RA 4HTYA 1AQMA 1QI5A 3PN8A 1OD0A 4JFVA 2XHYA 2JF7A 2WSPA 4EE9A 3ZIZA 3IJ7A 4Y7EA 4HMEA 4PMXA 5A6BA 1GVYA 3GXIA 1BGGA 4LXFA 4GI6A 2CKSA 4CVWA 4CN6A 2GDUA 4AIEA 1JG9A 3VGHA 1B3ZA 3QHMA 1PJ9A 2F61A 1BYAA 2E40A 1M04A 4J3TA 1V3MA 4W88A 1XD0A 3GNOA 4LX4A 3ALFA 3WNKA 3ARRA 1V6YA 1WZMA 4TTGA 5HOSA 5FCZA 3WL1A 1ISYA 4LPCA 2VX7A 2XFFA 1TFVA 3VX0A 1HIZA 1CXEA 1EA9C 4OJYA 1QI4A
chains in the Genus database with same CATH superfamily
2E0PA 2NXHA 5FESA 2ABAA 3CB8A 5I3IA 1I45A 1WDRA 4O8AA 3UWEA 1RCQA 2EQDA 3GTIA 1M5WA 2C79A 4HU8A 5BOOA 1F4HA 1VEOA 4RDZA 5HMSA 2R1MA 4S2BA 3DYPA 1PKMA 5ABGA 1GW1A 1U5VA 1W1IE 2OEKA 4DBUA 3GXFA 3RM4A 3IV3A 4LYPA 4O53A 1QOPA 2VX5A 5FEPA 5HULA 2NUYA 4KCTA 3GTNA 4WOQA 4RW3A 1ZU8A 4IIDA 1WOAA 4QSFA 1XKYA 4HT3A 1UIOA 2DVXA 3EXSA 1JF5A 1ZBCA 1HJVA 2VEMA 4C7GA 2XGIA 3OBEA 1RBAA 1AZ2A 2BHYA 4JNMA 2ZVIA 5HXMA 2GSJA 1QU4A 4NJHA 6PTDA 1WDPA 4NAEA 2ZXBA 1TUXA 5HBFA 2Y7DA 2J13A 4Y9AA 4UQBA 2IKGA 4WR3A 5A6JA 3AXKA 3MUXA 1OX6A 1IWBA 3Q67A 3NQAA 3BMXA 1JDDA 1E1CB 1S2WA 3H24A 2WJEA 4QQUA 4XAPA 3T09A 2CESA 3K13A 2A1YA 1JYWA 2BDQA 3PNUA 4L56A 4QR6A 3NPVA 3QGAC 3LHVA 4NU7A 3RAOA 1L6SA 1UUQA 3GQYA 4PMZA 3MI3A 2QXWA 4TU1A 4JN7A 2YB4A 2VYOA 3DXIA 4D6FA 1QPOA 5TNVA 3M0YA 1QFEA 4AX6A 3DKLA 3UYCA 3H4WA 3N9KA 4D8LA 5HJLA 1OC7A 2OT1A 4CCZA 1V6WA 2I17A 5BOEA 4A05A 1PWMA 1XLCA 3WZ0E 3R0DA 1R3QA 3NL3A 2Y2WA 4IMGA 1J2BA 1W56A 4FB7A 4YPJA 2J7FA 3O8AA 4JY9A 5BYWA 4B9ZA 3CMFA 1J5SA 4ZOCA 2ZX5A 1MRAA 5I3HA 2WVVA 1G67A 3NQVA 1AODA 2GWNA 4J4KA 3E02A 2DPEA 3LM3A 1OGSA 4ICMA 3NYZA 5XIMA 4JTQA 4C6DA 1V3LA 1WPCA 3HG5A 2H90A 4JTUA 3WK1A 3LMZA 1UYQA 3EGJA 3VVGA 3W24A 4KW2A 2Z24A 5AYZA 4OIFA 4CD5A 1NU5A 3S2CA 3SB0A 4GXMA 1OEPA 3MWCA 2Z1VA 4IGMA 1HP4A 4KMQA 3Q2DA 4PN2A 2XVKA 3SIZA 4KEUA 1TV3A 3MV11 5LNUA 2NUXA 4QEEA 1LL4A 3U6WA 3NCOA 4JN6A 4FXJA 1RK6A 1OFAA 3S5NA 4AYGA 4JHZA 5BROA 5D38A 4JX6A 3HJZA 2EO7A 2CETA 1EYWA 3OOQA 1K03A 4XD5A 1ZRQA 4UFKA 3BWWA 4NSBA 2ZZ3A 5LNVA 1E15A 2QMJA 1TJPA 3G1XA 5EY5A 2P88A 3WCZA 3OLEA 2PDBA 3LPGA 3MUCA 1E3ZA 3MBFA 3MDUA 4QP0A 3HQOA 4X60A 1XLDA 1RP9A 3F4VA 3N2CA 3BPWA 4U3CA 1A5NC 2Y8UA 3LGEA 4HA3A 4E2DA 5A6TC 3DFTA 3HU7A 1D8CA 4AZ5A 1OYCA 3V5FA 4M1RA 1KR0A 1JRBA 1EHNA 2AGKA 2QV5A 5CGTA 1EX1A 1Q3NA 1KXHA 1FA2A 1H7NA 3G8RA 1DWAM 2ZUWA 3QOKA 1H11A 2EJAA 2YCEA 1J18A 4GVGA 2D20A 2HK1A 1FHLA 4RK8A 5C2CA 2E4TA 2D2JA 1CT5A 2R1NA 4F4RA 1G4EA 4LCQA 2QPUA 4C1NA 3TA6A 4H7VA 4PZVA 4I3GA 4JIPA 3DEQA 4I9AA 1VPQA 2CLFA 1QO5A 4S3DA 4ZOBA 3DC8A 1XCXA 3MP5A 2Q02A 3N12A 2J9XA 3PWGA 5LIXX 2UBPC 3G0SA 3FKKA 3MSGA 3N4EA 4R7OA 1XLIA 3SN4A 4AU0A 1VGAA 3WNMA 4GQQA 4YYFA 3CBWA 3MDWA 4QAWA 5AC7A 2XUCA 1CXKA 2CNCA 1O60A 3UQNA 3QH2A 2BHZA 2A6LA 3DHPA 2E6AA 4AWEA 3DGRA 1CEOA 2D2HA 2PURA 3PBGA 1BVZA 2ISVA 1FX6A 3EKGA 3GY1A 3VTRA 3W72A 4DPQA 2G4JA 2YW3A 1JULA 3BDKA 5JH1A 3QSTA 3V35A 4IMEA 1OC5A 4FI4A 3A3WA 3EX1A 1QAPA 5EL1A 4HSNA 3EPNA 4DZIA 3LYEA 4Q4QA 1KFWA 4UNIA 4WSHA 4Z2KA 1UG6A 3OZYA 1TPH1 2AKZA 3ELFA 3TFCA 5CSRA 4MFDA 6CGTA 4Z17A 4HPJA 4ZB0A 3LU2A 1IT0A 1WZKA 4LJ3A 5FF4A 4QISA 1XIBA 3Q45A 4S3GA 6REQB 3NOYA 4C6FA 1U5JA 3GDKA 2A7PA 1A3WA 1DOSA 4ZXOA 1LT7A 1ZBVA 2A6NA 3UU0A 5FIPA 1RQHA 3WMSA 3E2VA 5FA5A 1PCWA 4TIMA 3UJEA 1UZ4A 1V7YA 2PDCA 4K3ZA 3BICA 4HYRA 3TTEA 3HG2A 3GYEA 4XIAA 3T08A 1JPDX 4IJCA 1XGEA 1VFMA 3BOFA 4TX6A 4NILA 1ISVA 2INFA 2PEVA 4FOJA 3L2LA 1NIUA 5C54A 1E1EA 1P6BA 3WQPA 2C71A 5CPMA 3Q4DA 3TX9A 3WF1A 1IXQA 1PPIA 3PG8A 2G3IA 3S1GA 3CZKA 1LRQA 1BQCA 4URIA 1N7KA 2PDMA 4QLKA 3PJXA 2JF6A 1YBQA 1DV7A 4XKYA 1JAEA 4LTSA 1I0BA 3KS6A 1GYLA 4L9ZA 1F3WA 2HNHA 3RLHA 3OGVA 1Z69A 5A3HA 1KRMA 1THFD 2VVSA 2R1PA 1M7JA 2QR6A 3CWNA 3E2SA 1GQIA 3WQVA 1W3JA 3VPLA 3H2NA 3PUDA 5J5RA 3VM5A 4GQGA 2QUMA 1GUVA 1O5KA 1GOMA 3THAA 3S9ZA 3O07A 1G94A 2CC0A 3ES8A 1E4LA 1E6XM 2E5CA 2PWFA 2X41A 5LNSA 1HF6A 4ZQNA 5J5DA 5BW6A 1UKTA 1ZHAA 2JBMA 2O55A 4PMYA 4U28A 2DH2A 3PY2A 1MW3A 3BZJA 1XGDA 3R1ZA 8CGTA 3WK3A 4UBPC 2JKPA 4GI9A 4MVAA 3AMGA 2CLHA 2NSOA 2HK0A 4Q4SA 4BI6A 1MMFA 4Y96A 5F1VA 1G01A 3UT0A 1VPXA 4AQLA 4AHQA 2AQWA 3BSHA 1FDYA 2OWWA 4U2ZA 3WFZA 1XIHA 4FO4A 2V81A 4RR4A 1OX4A 2VGFA 3QR1A 1SZEA 2DJXA 3Q94A 3FEQA 1EZ2A 1TZ7A 3T2OA 1R85A 3WLJA 1B54A 1OIFA 1A3XA 5GNYA 2B7PA 3PANA 3NJ3A 1WOBA 4XVDA 1H62A 2KX9A 2CLMA 3UW6A 3SQSA 4XB3A 1EC7A 4F66A 5E0CA 4MADA 3W87A 4ERAA 1M7XA 3ABOA 3UG5A 2F84A 3R6IA 4AC7C 2ZA3A 1GCYA 3LNMA 4DF0A 4CU8A 3UVIA 1K8ZA 5HQLA 4ZQOA 4LANA 4H9YA 3NFUA 3NQ6A 3L0KA 1EPXA 4Z1CA 1W3TA 4UTWA 1TTJA 3M64A 4AAJA 4UTTA 3BTNA 1O5QA 2WVVB 1ESWA 2WK2A 3OZPA 2ZTJA 3QZEA 2PDLA 3OYXA 1RLCL 4M6UA 3W37A 4K6AA 3WKZA 3BANA 5FD0A 5AZ0A 1Q85A 3WF4A 1CLXA 2V5KA 4OBSA 5L6UA 4GO9A 3BJFA 2ZUNA 4PBFA 4J1OA 4FNTA 4JKMA 1UWSA 5H2ZA 1EOKA 3S6OA 4AD3A 4IGNA 1R7OA 3WQEA 2V5CA 4FXFA 1B1YA 1SFTA 2HROA 3BL3A 3PZUA 3FN9A 3R8GA 1PX3A 2XISA 1PBGA 3EBVA 4MAVA 3BQ5A 2C6QA 3V16A 1FWNA 4WRHA 3RPMA 4HPXA 4ICCX 4QQ3A 2NX9A 3P14A 1OK6A 5LZLA 1H7XA 5ECVA 3OB8A 4ATDA 1VF8A 2GJNA 6REQA 5E70A 3I68A 1QVBA 1E1CA 5L9FA 4W5ZA 1GVIA 3W2JA 1TQXA 3WQOA 1RY8A 4B5UA 5AFDA 1LUCA 1EEPA 4PFMA 3V4BA 1Y0EA 2OELA 1ZENA 3BOLA 3ITYA 5ABTA 2DV0A 1C8XA 2DW6A 3CLWA 4UTUA 3C0QA 2ZE3A 3MC5A 5DO8A 3PZTA 4KH2A 3RJXA 2A21A 3RR4A 4A4AA 4KIEA 1HL9A 2PUZA 1IV8A 4K7VA 3W53A 4JTCA 1HGWA 2G3MA 2YDSA 3LBCA 4AHPA 5IHSA 1XBVA 5EMKA 1S3TC 3MSDA 1YW1A 2XVPA 4XKYB 3SZ8A 2XTKA 4QS5A 2J7GA 4JTHA 1DQXA 1PKYA 4FAMA 1YNQA 1XYAA 5CQ1A 3VIFA 1J0JA 1FWSA 4RCXA 1NAL1 5LGZA 5AVHA 4BWLA 1CECA 4AIBA 4MB5A 4FEZA 3ZYZA 2OGJA 2C15A 1YXCA 1TVNA 2XPKA 2GOKA 2WSRA 3AOFA 4HVXA 5DF0A 2BLEA 5AHLA 2O7SA 2XIQA 1JEZA 5D9PA 1US0A 2ICSA 2W92A 4ZB5A 1EP2A 3UP8A 1MZHA 1FWDC 3QEZA 4FOKA 2FYMA 3A22A 5I6SA 3NDOA 1G4PA 1AL7A 4LUSB 2ZOXA 3K5XA 3RCNA 5D2VA 2CITA 1QWKA 5PTDA 3IAQA 1V0LA 1CDGA 3E0VA 3WQFA 5CC3A 1W54A 3RX2A 2FDMA 2QAPA 2TODA 1KM1A 3I65A 1AQHA 3JR2A 3FSUA 3WEOA 4OECA 4AB4A 4EF9A 4JTRA 2W66A 3GDTA 4ZR8A 4PB3A 3E2RA 3VKAA 2PA6A 4D6GA 4P7LA 2AKMA 2HXUA 2EG8A 3HOJA 4QJ3B 3PM6A 4A8IA 1VRXA 2VC7A 4WY0A 3SJNA 3IGHX 4UZUA 3B40A 3UESA 3NA8A 1XYBA 2VUYA 1CW2A 3TR9A 2WPGA 3VABA 3VM7A 3MT1A 4S1FA 4QBXA 3C2OA 3G2GA 4UQEA 1RH9A 3QTGA 3IK2A 4HYWA 3MZ2A 1JUBA 3TXZA 5DELA 1MSSA 3T05A 2J9YA 1FRBA 1UASA 2PBOA 1DKWA 5FSDC 4Q8QA 3H12A 3EDEA 4MJZA 4FX6M 1US3A 2WMHA 2VRJA 2CBVA 4LY8A 4BHYA 1Q4NX 1IWAA 4H01A 2LLEA 2VP8A 3KOYA 4LF2A 3OHIA 1UJPA 2INZA 4AVOA 1PKNA 3BGAA 3S4TA 1XPGA 2WSKA 3KXQA 3V75A 3UZJA 1E43A 2FFCA 4NF7A 1DJXA 3EB4A 5DCBA 3U5YA 3KBNA 3FOKA 2WO5A 4KEVA 1S5MA 3R11A 5AYIA 4PSPA 3V0TA 3LHTA 4ROPA 5CJMA 5M3WA 3LCHA 1AZ1A 3N4FA 1X1ZA 4F8XA 1XLHA 5AHNA 4DEFA 4WKHA 5LA0A 3W7GA 5LA1A 4CNNA 2HZGA 3T2QA 3QPZA 5FAGA 3QYQA 1XC4A 3WLOA 1FWJC 2Z7KA 1AH4A 1DL3A 3THUA 2ZZ4A 4TMBA 1OFPA 4N6FA 3CYJA 3VXGA 4OQVA 4LCRA 4KETA 3SADA 4NG3A 4GQRA 2E68A 1CGVA 5FF2A 1BAGA 8RUCA 1KGXA 4L4PA 3L68A 1A4MA 2R82A 4MSSA 4D6IA 4C90A 2RAGA 5ABEA 1HT6A 5F4WA 1P6CA 4LF1A 3KRUA 3SI9A 1WKFA 3WEZA 1SJCA 1BRLB 4GIRA 1E0TA 1HNYA 1WZLA 1R5YA 1IT8A 3FX4A 2BVWA 2XGBA 3FDGA 4XKMA 2WMFA 4IP5A 2GJLA 2QT3A 4UFIA 3MCOA 5LXEA 4MYAA 3M16A 1UOZA 3LLFA 4DY1A 3GXPA 3WH6A 2ZWZA 4EWJA 4M1BA 4P8VA 3GU2A 4KS0A 3C61A 2P53A 1HKVA 4MTVA 2B81A 2GK1A 2DSZA 3BUVA 3NVDA 1TVPA 4WHBA 3F4WA 3MP3A 2YOCA 3PTKA 1KBBA 1F07A 4GQBA 1D3CA 1CGWA 3GH4A 1D3HA 3CEPA 4CQBA 3T1GA 1BWLA 1S2AA 1JGMA 2JE8A 3L4UA 1SGJA 1EO5A 1MVYA 3STFA 4R27A 3CH9A 2V67A 4PGLA 5D30A 3SY1A 3URBA 4N6EA 3KCOA 5TF0A 1LBLA 4N2YA 3VILA 4GCXA 4BJHA 2ZUMA 1UMYA 2YXGA 1SVDA 2CWNA 3TA9A 4L1XA 4DJFC 3ITOA 3DU0A 2PDHA 1I1XA 5E9AA 4O0QA 4US5D 4DYEA 3RO6A 1E1FA 4K37A 2FDSA 3UPMA 4M81A 3FCPA 4DHGA 4MJMA 1E71M 3MVIA 1YEYA 4GC3A 2PF0A 1OADA 3B8VA 3E5BA 1DXEA 1R0MA 3PTQA 2IMRA 1OX4B 1M3UA 5DT7A 4WXZA 1AK5A 1WE5A 3HF3A 1A53A 4MJ2A 2WCAA 1JVNA 5JBDA 5M03A 1OBAA 3QY6A 3IJQA 1EIXA 1O5XA 2GVJA 4HJFA 3L5AA 1V6TA 3RILA 3N29A 3A3XA 4E8CA 4UZSA 1CXHA 4ORIA 2BMBA 3CU2A 4XZHA 1L2UA 2Y70A 4AUBA 3H22A 3W1TA 4IPJA 4ZENA 1XUZA 1TYGA 3B9NA 1PZ3A 1A5BA 1Z32X 2V2DA 4P61A 5GQBA 1J2WA 3ARXA 4JFUA 4PTXA 3WUEA 1XPYA 3GXMA 2Z7GA 1PHQA 1XH2A 3PSWA 2BS9A 3W26A 1XYLA 2GDQA 2AMXA 2JIEA 2VNCA 1IZJA 2ABBA 3N1AA 1TELA 3WQ6A 4EWND 3ZVIA 1VKFA 4HCDA 1HO1A 4F0LA 3LD5A 5K9XA 5CG0A 2V3FA 4W87A 1J01A 4NNCA 3ZM8A 4L1WA 1HL8A 3LGDA 3SCWA 2ZZ7A 1MW2A 2D0FA 3CM4A 3CHFA 2NVDA 1LTDA 1QMLA 1QXLA 1NARA 1YDNA 1Y65A 3ITTA 3I7SA 4U5KA 1S2CA 4YTTA 1JR1A 1MFUA 1FWCC 2VJXA 3RITA 1IE7C 3ARUA 4TUFA 1I2PA 4ZZ9A 4H04A 2PODA 1KFLA 3RXZA 4Q6JA 2J9ZA 5RUBA 4FXRA 5CCZA 3WL0A 1GJPA 1XW8A 1XRFA 1B90A 2PDFA 4Z1AA 5REQA 2BVYA 3EB3A 3A9IA 5EMJA 3KDNA 3HG4A 5F2MA 3UG3A 2B4GA 4POCA 4L4LA 1GKQA 3VIGA 3NQGA 3DFPA 2D24A 3O63A 3C2YA 2PF8A 1A5CA 3O9NA 4DWSB 1JZ4A 3QSRA 4GG9A 1TVLA 1XL9A 1XWYA 3WK2A 2EBNA 4DI9A 4BA0A 5KZ6A 1J5TA 1SJDA 2OWCA 4ERIA 3O3RA 5BNKA 3ANUA 1SMDA 1LRTA 3CQJA 2OGYA 4ZQMA 4PMRA 4RPPA 4MWAA 3HA1A 1CXIA 5AYYA 1YTKA 4M82A 3P6LA 2YA0A 4PC8A 4M6QA 4PCTA 2PGFA 3UETA 1XD1A 3TCEA 2AAAA 2VRQA 4M51A 1ZPTA 4BWLC 1XIEA 3OVPA 4XSLA 4NYYA 3RMEA 3FA3A 1LP6A 4A8NA 4UMAA 2E67A 3FA4A 4AYSA 2D69A 4JIHA 3KBJA 2WNZA 2IUZA 2J74A 2OQYA 4CNOA 2RGLA 3QM3A 2GJXB 4X9SA 1H50A 1OIMA 1LM1A 3W7HA 1HO4A 1JI2A 2OMAA 3TAOA 2AAMA 3CQIA 1NWTA 1G5AA 4AMAA 4HK7A 1KWGA 3G24A 4UTIA 4HZ6A 3R7MA 2QLYA 3U5UA 4XAGA 2XDFA 4RNHA 3WO8A 1J0KA 1HKJA 1R3TA 1C93A 1XG3A 4H2HA 2RJGA 3CUIA 5K4ZA 4FNPA 3SFKA 2C16A 3ANVA 4HMDA 4N7QA 3REQB 2ZTKA 4C6PA 2Z2UA 3GZ3A 1DORA 1GTHA 1I6NA 3G1VA 3VGDA 4JTIA 3GDMA 4AZIA 3AJXA 2GUBA 3O6CA 4NHVA 3RLVA 2W67A 3C8FA 3U4AA 1WP6A 1EH9A 4LVGA 1PZ2A 1V0NA 2QAFA 3ABQA 4S2CA 4C5ZA 2V6AA 4IX0A 1JAKA 3GKAA 1UD6A 3I10A 2YPIA 1B3YA 3VGFA 3DFOA 4KFNA 3KOZA 3OU8A 5AB3A 5K9CA 2JQXA 4HK6A 3RIKA 1Q8AA 2X2GA 2DU2A 3B8SA 2VI0A 4D8AA 4R34A 2OQLA 4XO7A 3APTA 3NEHA 5AHIA 1O66A 4GI8A 1PUDA 3VDCA 1Z89A 1IHIA 1V6UA 2XFWA 3NXLA 3WLQA 1BYCA 4V2XA 1TJ2A 1XYCA 4EANA 2GJPA 5EFFA 1A47A 2J66A 3R79A 2YBUA 3WLPA 3GAYA 3H8AA 3VMNA 3NZPA 3R58A 1FY6A 4RL3A 5MF5A 1N8WA 3W1RA 1ZP4A 4P8UA 4L7ZA 1J8VA 4UWMA 3SCUA 4H4IA 4F9JA 5A6SA 1F6PA 1LJYA 3DHUA 4KGLA 7REQB 1T5AA 4UTLA 2H9AA 4IF2A 2BXZA 4QCEA 4O4VA 1AUSL 2EKCA 3MVTA 1EB3A 2DW7A 4X2PA 4C6BA 4BKNA 1E70M 3WH5A 1VH7A 4JTKA 3FAXA 4D2JA 3F2CA 4L61A 4HA0A 3WDIA 3MHFA 3LSBA 4PBGA 5C9XA 3RYSA 4HB7A 3MO7A 2YFNA 4ECLA 1ZCCA 1R3WA 3BG5A 4C5YA 4AC1X 2VZOA 4QAIA 2ESCA 2NQHA 1Y8BA 2DDXA 3G1SA 4C7FA 2VX6A 1JPMA 3HGSA 3FDKA 2ISDA 1C8QA 4H8NA 1REQB 4GNJA 1TWWA 3GD6A 3EWWA 1OYAA 3VNLA 2EHHA 3S47A 4UTWC 1EP3A 4V33A 4W5UA 1C91A 1W5QA 4UCFA 1A5LC 5D9OA 4KPLA 1IEQA 4JKLA 3GW0A 7PTDA 5I07A 3DDMA 1F8MA 1ODZA 1DQUA 5BWFA 3WDQA 5HNUA 4DF2A 2QW5A 4O18A 3WSUA 3SRFA 3UXKA 2GGHA 1WUEA 3NOEA 1IGWA 1H1YA 4U31A 3LEPA 4BS0A 2G37A 3SGZA 4B2DA 2BVDA 3CPGA 5T8GA 3FW6A 5G2HA 3GVWA 1H1ZA 3VKDA 1BTMA 4Z0JA 1IEWA 1AW5A 2G50A 4MB1A 1SQ7A 4JHOA 1FTXA 1CB2A 3TTOA 4CQ8A 3SRDA 2OXNA 2PGRA 1FCBA 1SFSA 4H41A 4B5WA 1K4GA 2VZUA 4DBWA 4M8UA 1XLMA 1W1PA 3W7DA 3CEUA 3EMCA 4GISA 3CV6A 1NDVA 4RE4A 3RNDA 3PNZA 2BGSA 4GYKA 1EC8A 2ZX6A 3B04A 3B0PA 5BZAA 1Q5MA 4BFAA 4FXSA 1TO3A 3ZIZA 4Y7EA 2Q01A 3GXIA 2NLIA 3PTDA 2PRLA 3SRKA 3M0XA 4CN6A 4AIEA 1SFJA 1JG9A 3GG1A 1AW2A 2OPJA 3EX4A 2E40A 2AQVA 2PDKA 2PLMA 3GTFA 4TTGA 1WZMA 2QCFA 4YVXA 4C1LA 4QRNA 1BSLA 3O15A 4RNIA 3F1QA 3NZQA 2VX7A 3VX0A 2ACRA 3CMGA 3GC4A 2X1TA 4GIEA 1A5UA 2PS2A 2X30A 4CNPA 3KL3A 1H4PA 1WZAA 5A2CA 3NVTA 1O4UA 3RN6A 4WOZA 2Y24A 4L9YA 2XIIA 5HWMA 5HINA 3WK0A 1F3EA 3IGUA 3UR2A 3CUGA 2I1OA 3SCQA 2O0TA 2YL9A 1CBGA 1PTGA 1GYNA 3PUGA 2FH6A 1VFUA 2CHOA 3TYZA 3ZLGA 1I2RA 4IPLA 1JYXA 5M5DA 2V5DA 4W7VA 5E6ZA 3MPGA 3C86A 1UKSA 3OP2A 3FK4A 4MMWA 3CZEA 3BLPX 3CAKA 4GY0A 4J2MA 3W75A 2AMGA 4I9MA 4IMAA 2ISWA 2PWVA 3RU6A 5EMLA 5G4HC 1ZLPA 4AIOA 2UWFA 2VUNA 5LXXA 3Q65A 4WK9A 3WDPP 2PDGA 3E12A 3IS4A 3RRXA 2D3NA 4GFSA 5HMDA 3P3BA 1BQGA 3EOEA 3OG3A 4H2CA 4NX0A 5EU9A 1YRRA 2Y5SA 5HNRA 1Y5XA 4I7VA 3M5YA 3GB6A 4E4FA 1DYSA 1H63A 1RPXA 4NY2A 1T99A 4IMDA 1VLWA 1OC6A 2DGAA 3WF3A 4KGJA 3V0UA 2XFRA 3MYOA 4HOWA 2E9BA 2OU4A 4LC6A 4WJ8A 3KZSA 4B2DD 3NSMA 5JQ9A 2ZQ0A 2YDRA 3ZVHA 1XDJA 5HMEA 2WB5A 3KZPA 4P8XA 4EXAA 9CGTA 1Q7MA 4G56A 3IPWA 2O92A 3HURA 1K9TA 6ALDA 4EK7A 1CX9A 4E0CA 1KCXA 1N8IA 4DM1A 5GVJA 2P8CA 1XYZA 4IUGA 4B15A 1WBHA 4U3AA 2NV2A 4HNTA 3MI2A 2DT2A 2W4XA 4Q32A 3KLKA 1KTBA 1JXKA 4CKQA 1HJXA 1JRCA 1Z48A 3E6EA 3G8EA 1Z3NA 3PAJA 3LI1A 4H9MA 3QV8A 1GTEA 4Y9NA 2GGIA 1UHVA 1YNPA 2ZXAA 4UMBA 4ZSUA 3KLLA 2X1SA 1W9XA 3ATZA 2PDPA 4CD8A 1MEHA 3I3DA 2PDQA 2BY1A 1B4EA 3W74A 2BHUA 3F5JA 4RE2A 5EB8A 3T55A 2Z2BA 3LNPA 3H6OA 3DFQA 3N73A 1KRAC 5KTLA 4JTLA 3L12A 4H9ZA 2QCEA 1NEYA 5FL1A 2VXNA 3QLDA 1DTUA 5G1MA 4S3EA 1SO4A 1VRDA 2B0MA 1QI0A 2XH4A 3CJPA 2FKPA 5I23A 1EUNA 5DY3A 2V68A 2X1RA 3TNBA 5JIPA 2BNJA 4IIHA 3VIPA 5AHEA 1QPKA 4E4PA 4NYUA 4YCOA 4DM2A 2WWDA 1VENA 6XIMA 1QPQA 3WNLA 3QMSA 4H00A 3G18A 2VURA 4JHMA 2AGTA 1HKIA 4P7NA 3VOHA 1GZGA 3LQLA 2FFIA 1ZAHA 2PGWA 1QHZA 2FMNA 5JMUA 4L6HA 1VD6A 1V8EA 3QV6A 1B31A 1DWJM 1AW1A 2CXGA 3KVKA 4YCPA 1AQ0A 1YPIA 1XIMA 2YCLB 1XLGA 4QXIA 3OG2A 1JNEA 1TTQA 4ATLA 4MNLA 3W7MA 5G4EA 1YXYA 3L2IA 1W2VA 3M47A 1KXTA 1SUXA 3DI0A 4PE8A 3TJ4A 2PDUA 1PZ1A 5D2XA 1L6GA 2Q3RA 3CK5A 4B9YA 2YR1A 4PYSA 3KTXA 5I3JA 1IT7A 1PO9A 2PDXA 3RPTA 3AXMA 2F6UA 5IM51 5LHEA 1X6LA 2WZHA 4EACA 1R2RA 5FF0A 4TVCA 3E3HA 4PUWA 5T9CE 3T7VA 3YPIA 4C65A 2C19A 3AXHA 1OG0A 1U5HA 5AOUA 1HKWA 3SURA 1E0UA 2VKZG 3Q37A 4DBDA 4JIIX 1XDMA 4F0HA 3KVMA 3EMZA 2Q3OA 2V38A 1FHVA 1ZUAX 3KUMA 4FX8A 4IL2A 3WNNA 1PZ0A 1B30A 1R7AA 1KA9F 1LLWA 2YDAA 3HGOA 2E25A 4IWWA 5JBEA 1MI3A 3PHAA 4UNLA 1A0EA 1ITCA 4HJWA 1PX4A 3T0CA 4BF7A 4UQAA 3ARPA 2ACSA 3LRLA 4LUIA 3WLIA 1J12A 1R9YA 4IISA 4H6RA 4ZVJA 5LIKX 3AICA 5AYBA 1SR0A 4GNKB 2V3DA 4DUOA 1GJUA 5ENLA 2V63A 4HNNA 4XD3A 2RH9A 2OLSA 3RDKA 1LQAA 1W5OA 2BY3A 3KHDA 3FXGA 3LMYA 2QJNA 3M7WA 2WVTA 4GJIA 3TSDA 4M56A 4YNGA 4CN1A 1WB0A 3N2BA 4A3YA 2J8GA 1W3IA 3ZLHA 1VP5A 5K9DA 3T0TA 1TPUA 4PBEA 4OBTA 4DYJA 3V7PA 1LOSA 1J0ZA 4DJFD 1XF0A 3COTA 1AA1B 3ARYA 4W8AA 3ITLA 5EKYA 3FKRA 1V51A 5ECUA 4REQA 4NNAA 4HZ7A 5BU9A 3UWZA 4YXGA 3ZVHB 3GG7A 2REQA 4S3KA 3DI1A 4W93A 3NQBA 3F4NA 1AFSA 1MWOA 1N55A 5BU6A 4B90A 3PSVA 3VINA 1H09A 1XLFA 1HVXA 5DBTA 4ZB2A 4AZ6A 2ZC8A 3R8RA 3R89A 3NYDA 3C4UA 2WMJA 1DXIA 2VO5A 1UQZA 4J3SA 3TMLA 1VBHA 3W1QA 1TJRA 1TPVA 4XAYA 4AZBA 4S3BA 3OQ8A 3UVAA 3POCA 4ZSTA 4XD6A 3WQDA 2ZADA 3E74A 5DEZA 1S39A 5AC5A 1TV2A 3SO7A 4OZOA 3U7VA 3N04A 3BVJA 4A35A 5AC4A 2PCQA 4BK9A 3QMTA 2PLCA 1K9EA 2ZC1A 1KLZA 1NWSA 3SGUA 4QROA 1XG4A 2XU2A 1KTNA 4GGHA 1UH2A 3SSZA 3UWQA 3W27A 4HOZA 3NO5A 2VD8A 1TMLA 5CZKA 1E9ZB 1B9ZA 1CXLA 2F9RA 4KRTA 1QW9A 4XAFA 3BG9A 2YX0A 4ILSA 3EA1A 3U4FA 1RR2A 3GAKA 5CSUA 4E3VA 1FOBA 1WKYA 1G7VA 3VFCA 3I7RA 3C2RA 2JIWA 1ECQA 2L5HA 2PRHA 1DIEA 3FHQA 5JUVA 2VM8A 3N17A 4JEJA 4QNWA 3WDHA 2HQAA 3EDFA 3PG9A 1E5NA 1NDYA 1DP0A 2JKEA 2VFFA 3G1FA 5D9NA 1KD0A 3N6QA 3AZRA 1CENA 1ME7A 3H2CA 1J6OA 2ZYFA 1FKWA 2R91A 4REQB 3GVQA 3MBDA 4DAIA 3W23A 2E1WA 3EWCA 4FK9A 2OO0A 2FTYA 4IG2B 5A6BD 3LY0A 3EX6A 2XVNA 3J7HA 1K4HA 2Y5EA 4Q8TA 2A7NA 1JZ5A 3AI0A 3S0CA 3WNOA 4FSAA 2WCSA 3KL0A 1LBMA 3UGVA 1EX5A 3PB0A 2C3ZA 3SECA 1EJVC 3MA8A 4DJDC 1XDLA 4OT7A 4CLMA 5GNZA 1CZ1A 4Y2WA 5G2IA 8A3HA 2XG9A 4UOQA 3EMQA 3RLUA 3NO1A 1AG1O 1DJIA 2GDVA 4Q7IA 1IIGA 4GX8A 2FTWA 2PTYA 1KNWA 1BF2A 1UR8A 2VL4A 4J3WA 3GTHA 2C0AA 2W5FA 1DJQA 3ONBA 5BXRA 4B16A 1AD4A 1ISXA 1EZWA 3CB3A 3KDOA 5KINA 2XH0A 3P82A 1PYMA 3TWAA 1CIUA 1XM3A 1YLVA 4O0ZA 2GUUA 3WMBA 3NQEA 3KOXA 3QV7A 1EQPA 3C3NA 4PL1A 3LCIA 3GIPA 1A5OC 3GUGA 3LV5A 5JIWA 3SCSA 3GFYA 3ABXA 3P60A 1GVOA 3PZNA 1B3XA 4KCVA 1FWFC 2BXYA 4Q3MA 4GK8A 5IBXA 3SBFA 4A3UA 4QJ4B 1M68A 1XFCA 1OY0A 4U4MA 3TSBA 2NLYA 4HU3A 2D73A 5CSYA 1E9YB 4JR5A 3VNIA 1U33A 1X7IA 3M9YA 4O4WA 3ZS4A 4GHRA 1QBAA 2NWRA 4O16A 4H19A 1FH7A 3LQGA 3NZGA 2VGGA 6XIAA 2PCEA 1E3XA 4QFUA 2WOQA 3N9RA 5IFPA 4MKSA 5E0FA 4AZGA 3OZMA 2J7DA 3CQHA 4WUIA 3PTMA 3WY1A 5DQPA 3WG6A 1W1YA 3GG0A 2BP1A 4A3HA 3VIIA 1C29A 1E6SM 3N6JA 1Y7VA 3WENA 1V02E 1G4TA 1EPVA 3PAOA 3MANA 1A0CA 1H7WA 3VD9A 4E2BA 2BFGA 3L7RA 2HVOA 3PC0A 5FJOA 3CYVA 3H55A 3RK8A 1XLJA 2WMKA 3MKKA 2YYUA 4UR8A 1LWJA 1ZB5A 1QW8A 4JX5A 1YTDA 1EGMA 3N2MA 4EXBA 4IFKA 4ATWA 4I7UA 1A3HA 1EFZA 2FZ8A 5LIWX 3WBXA 3K8MA 3F7JA 4CQ9A 4GOAA 2XIBA 2BASA 1VLIA 1JDCA 4TTUA 1FWAC 4ENLA 3USBA 1I75A 2RJHA 4YMZA 4K7YA 1Q6OA 3C2FA 1M9HA 1EJWC 3FGCA 4JTGA 2EG7A 1GZJA 1K1DA 4Y8EA 5FJTA 3TN3A 3IIPA 1M1BA 1X8FA 3REQA 2GGGA 4JTDA 1VIWA 3IUIA 1KCZA 4JKKA 4O8RA 4QLLA 1U2YA 1GVSA 3JZUA 1S3HA 4I8DA 3GU1A 3EWYA 1ICSA 1HX0A 3LGGA 1D9EA 2TRSA 4OUIA 3EWXA 2C0HA 3W7IA 3BC9A 4D1IA 3VC6A 4TXEA 1KTCA 2V82A 3UCQA 3TNOA 4AD4A 3BMWA 4MLJA 1S5WA 1XXXA 3VGEA 3P0XA 1GQLA 1FP8A 1VC4A 3HBLA 1NM9A 1ONWA 4U2YA 3ZSSA 5AHMA 1GOWA 2QJIA 3THDA 1A4LA 2P1FA 3D0CA 3CPRA 2XIJA 3QVQA 1FFQA 4J9JA 5CJNA 1MW1A 5D32A 3FFSA 1RVGA 1GT8A 4N9EA 4GKLA 2VC9A 4I5RA 4RZ5A 4A2RA 1U1HA 4D72A 2CPUA 3ZT5A 5TIMA 5CEWA 1G9HA 2D1ZA 4H3DA 1QK2A 3R5EA 4GIYA 3EX2A 2JFEX 3LXCA 4QSHA 3QKEA 2F2KA 3KL5A 3UCCA 3QQ1A 3EPOA 4KFOA 1TIWA 2F2HA 3VDAA 1EWEA 1KM5A 1ZJBA 3IV8A 2DQWA 1SJBA 1LBFA 4Q8OA 1DHPA 1M01A 3MCNA 4N9DA 3W7CA 2ZX9A 2Q8LA 1X97A 3UEQA 2YZRA 5A1AA 2X09A 4X0NA 4C91A 3BAKA 1I1WA 3SUTA 1S2UA 3DHDA 3N25A 2WQPA 2XVGA 3WMCA 3N2TA 2OCZA 3E1F1 4PMJA 1IF2A 4HYVA 2ZVRA 3CQ0A 1TWIA 3NZ1A 5BRBA 4UMCA 1Q6QA 3E9AA 3L23A 3NEVA 1H7RA 4NAFB 2AOSA 5C7HA 1KGWA 3HJEA 4H7ZA 4CGTA 3L5LA 3MW7A 4O1BA 3K46A 2IXUA 2CLPA 3S6TA 4JTTA 2WJDA 2G3NA 3AU6A 4LAOA 4J27A 4WVXA 1AL8A 2YB1A 3MV01 3CUJA 5E93A 1VFSA 2PE4A 3C6CA 4UTJA 5KZMA 2ODOA 4ACZA 1KW1A 1TPFA 2YCJA 3TZFA 3M6DA 1JUKA 4FOUA 4V15A 1TPB1 4XTIA 2OTDA 5HWNA 3ZSTA 3BAYA 4FA3A 1DJGA 2DZXA 5KEZA 2BODX 6ENLA 4KCWA 2V8ZA 1QNOA 1TR1A 2I57A 2OYLA 4CU6A 4ZO8A 3ZZ1A 1CGXA 1ISZA 2WHJA 5I3KA 1KM0A 4GQ0A 3AMDA 2VR5A 4J28A 4DJDD 3ZJ6A 4CQDA 4HN4A 3AIRA 4JTJA 4XX6A 1J0YA 2JGYA 3NL2A 2DIKA 2GUYA 4ALDA 1EBHA 3LXAA 4RDVA 3WQGA 2A4AA 1GQKA 4PTNA 4Z2IA 1CCWB 1QK0A 2HPMA 3HV9A 4LUYA 3KOFA 1RSCA 3NAVA 2VOTA 1AJ2A 2HE5A 4IOTA 3DN5A 5BCAA 2BZNA 1YDVA 3JS3A 1BYBA 4XZ9A 4B5NA 1GQNA 2DSVA 4Y9OA 4O12A 3SDOA 1KFCA 1M6JA 2X7WA 1OQFA 3W01A 3NZRA 2VZVA 4EXQA 3DUGA 1W9VA 3AHXA 3CWOX 3QR3A 4ZE5A 4GA8A 1YPXA 1O12A 4R85A 5H8UA 1CI1A 3CAQA 4HN8A 4WLCA 1IEVA 1JZ3A 5AKQA 1LYXA 3ERPA 3WLTA 4A3RA 3HV8A 2D0HA 3UZZA 4DNHA 4HIBA 4KEMA 4L64A 4NZ5A 1ZTVA 1VFTA 3AXXA 4NRSA 1K02A 4O10A 2NQZA 5DMMA 2PTDA 4TMCA 2HVMA 3VD4A 4O28A 3WJYA 4PTWA 3TLQA 3B9DA 4XSMA 3V18A 4D6JA 2DZWA 2ZE0A 4Q22A 4B5TA 2OEJA 2WC4A 1KXQA 3MCMA 1WXJA 3FS2A 4PMVA 1OVDA 1G4SA 2X1IA 3BAIA 3IUDA 7REQA 3XINA 4MWAC 4LB4A 4JS3A 4GE8A 1K7FA 5CH9A 1LZOA 1VBGA 1W91A 4NX5A 2DP3A 3EEZA 1C9DA 1S5TA 3QLLA 1FWRA 1VYRA 1ZGDA 3NIYA 4FIQA 3UNDA 1I0DA 2EF9A 4JQ1A 1R38A 2YBTA 2ONEA 3BAXA 4XZMX 2PZ0A 1KRBC 3P62A 2DY3A 4O57A 2QCMA 4ZTXA 2DZAA 3ES7A 3ZXWA 1B3OA 1C90A 2WV8A 2Q09A 3UCDA 2NQ5A 1LLZA 1I8JA 2DZUA 3GS6A 1HJUA 3EOSA 2CLKA 5G5IA 4JPGA 5F2GA 4JD4A 4I90A 1EGZA 4GZJA 4K38A 1XLEA 1SYTA 1ZFJA 2DUZA 4UQDA 3ZMRA 2FZNA 4P8WA 4PB5A 1W8SA 3KHJA 2BVTA 1UKPA 3WD3A 1NP2A 4TVUA 4RPQA 1UWUA 4JFTA 1GVQA 1TA3B 1RPKA 3TTQA 1F2JA 5FJJA 2QZRA 4X3ZA 4GH1A 2QIWA 3A5VA 2POZA 3BZGA 2R24A 1FWGC 3PJUA 4GNVA 1WDWA 4J2PA 1HL2A 2FGBA 2PPGA 2UY5A 2WKGA 3GIQA 3TQVA 1E56A 2WZMA 1Y5VA 2R1KA 3F2BA 2EG6A 3I6EA 4PUEA 1NDZA 3PFMA 3RX3A 2H9AB 3UXAA 1D3GA 1J9YA 1ICPA 4G2DA 4GABA 2DZBA 2ATSA 3CUZA 3ORWA 4LUJA 3LTSA 4HPGA 3TJLA 4K8EA 3AAMA 2VDHA 4IL0A 2J7CA 3D6NA 3IJ6A 5BXSA 1PEZA 3AZTA 1Q6GA 1G6CA 4GKTA 3ZR6A 3B8TA 4HHPA 3KBWA 1XQLA 3E2QA 5BXPA 2OZ8A 1J6PA 1CPUA 3EDKA 3SUWA 1HJWA 4CD4A 1OCNA 3NR0A 2ZICA 3S2MA 4YWSA 1HGYA 2GOUA 3FA5A 2HE8A 1YADA 7CGTA 3GR4A 4D6DA 2CZEA 3UG8A 4I6VA 3SY8A 1BVWA 4NZ1A 2FPYA 4K8HA 2V3GA 1QHPA 1T40A 4LUTA 1GOXA 4QIUA 4CD6A 3TTSA 3CT7A 1FFRA 1LF1A 4KQNA 1UR3M 3A23A 4A29A 1XINA 1OFRA 5CGQA 1TR9A 2WNNA 3ENLA 2PI6A 1DTNA 2JEPA 3MI6A 2ZUSA 4Q8WA 4EPDC 4N02A 4TQTA 2QJHA 4C60A 5F2IA 4DJEC 2Y8KA 5I00A 4E6MA 4TOQA 1RK5A 3M0HA 1W1B1 4O54A 3CH0A 2CIPA 2ZZ6A 2IKIA 4J40A 1LT8A 4CCDA 3VZXA 4UQCA 2DSUA 1BKSA 1UQYA 1HTIA 4YTQA 3LX9A 1JZ8A 5D09A 2G41A 2H3BA 3AMLA 3USZA 4LWWA 4JNZA 4LFYA 4AD5A 3FJLA 1OM0A 4D71A 2NV9A 1K77A 3P2VA 4JYFA 4I8YA 5I3DA 1W5PA 2VEFA 2I9EA 2Z29A 2ZDRA 4F2UA 5T26A 5E0KA 3SGGA 1B0IA 4AVNA 1Q7QA 1RJRA 1C8YA 4RDWA 4CVUA 5A6KA 2DT0A 1ZL1A 2VFGA 5IXEA 3LCFA 1UD5A 4BEQA 2VQTA 1E0XA 1V3IA 1RD6A 4FALA 3XIMA 5EGRA 1DWFM 1HW6A 4XK2A 2DSWA 5I03A 3G1DA 3VK5A 3WBAA 4M3PA 5A8QA 2WNQA 4NJKA 4TVDA 4O15A 1TE1A 1Q7ZA 1WXZA 3T9PA 3GZAA 1UUMA 3AS3A 2Z1XA 1RV8A 3T8LA 4U33A 1B57A 4GVHA 2CBIA 4F2BA 4W89A 5C5YA 3IIXA 4NQ1A 2V5JA 3S2NA 4M19A 4OBRA 4XBJA 1JUEA 4OOUA 2J27A 2CZ5A 3BQ6A 3EOUA 2Z1SA 2TMDA 2VENA 3GLCA 4Q7NA 3QYSA 1XSIA 3W88A 4ZQRA 1J96A 2J25A 4ZA0A 1X8CA 3RO8A 1TRIA 4H1ZA 3OVGA 3BLKA 3OZOA 3QRHA 3VMPA 1H1NA 2HMCA 3V5OA 2YA2A 1PKLA 4JIRA 3TUUA 1GONA 3EKZA 1L9WA 1TSIA 2X0YA 3AXIA 3TJXA 4WDUA 2E9LA 2NV1A 3DZ1A 4JY8A 3TW7A 1UROA 3CZGA 3PWAA 1Q13A 1UB3A 1M7OA 2CLEA 2EPNA 3EPMA 2WCGA 4GXPA 2IQTA 3LBMA 1RY0A 2QCCA 4ORMA 3S5OA 3TN4A 3M0JA 1QCWA 4BQ3A 1AVAA 1NOUA 3VX1A 5JBFA 1RQBA 4LRTA 4QX4A 4DXVA 2Y7FA 3VDHA 4DPPA 2F6XA 1GORA 5FEZA 1TWZA 2QVHA 3NURA 3Q58A 3TAKA 3EDJA 2F7FA 4QNEA 3URNA 2C7FA 4LYKA 3MO4A 1EXPA 4WSKA 2OQHA 3WLHA 1F4AA 3VCCA 3UR5A 5EFDA 1YTEA 4O1AA 1UD8A 1UZ1A 4AZCB 1OD8A 4C6JA 4CN4A 3CUXA 3E96A 1NP0A 2BOEX 3C0JA 3ABSA 1FH9A 4DJFA 2NUWA 2ZRVA 1LDCA 2W6RA 1XSJA 2X7VA 2WMGA 3S1WA 3F4DA 3URQA 3PBMA 2BXVA 1F76A 1JCMP 4AF0B 5DFAA 3A24A 4L1GA 4N4PA 5ABFB 2O56A 4FR1A 5H8PA 5IBXC 3U2OA 3KP0A 3SCVA 1KGUA 3RFAA 1TTIA 3L4WA 2GQ8A 1KFJA 4YYCA 4UQ9A 3UWYA 3BJSA 1X6UA 3UJRA 4AH7A 2PDYA 3M44A 4Q8PA 1SW7A 5LGXA 5E09A 4OOZA 1FXQA 2MUCA 4QTGA 3ITVA 1UC4A 1O94A 1ME8A 2REQB 3GTXA 4GVFA 5C55A 5EBAA 4EAMA 4HOXA 2ZUUA 4P5UA 2ATMA 1Z8AA 4K1WA 3KE0A 3AMKA 3ZT6A 1DJZA 3LLDA 1IEXA 2G96A 7TIMA 3GXTA 4HTYA 1M65A 1LCOA 3R12A 4JFVA 3AALA 4DN1A 3M1ZA 1T41A 4X63A 3RF9A 1ADDA 2FZDA 3KW3A 4HMEA 4PMXA 1W1ZA 1GVYA 4LXFA 4IHCA 2NVCA 3QHMA 1W31A 2FZMA 4G7EA 2F61A 3R8HA 4YTRA 4J3TA 4PULA 4FHAA 4NI8A 1V3MA 4W88A 1XD0A 3GNOA 1BEUA 1QWGA 2JKAA 5H91A 4KT2A 3ABZA 3GVVA 2ZCGA 4NL1A 1YMYA 1EA9C 4OJYA 1POKA 4AG0A 5HQMA 2EJ1A 1PSCA 4U10A 1B3WA 2Z27A 3W1PA 2XSAA 3BO9A 3G3DA 2C1HA 1W3HA 1UKOA 4XZWA 7ODCA 1QI2A 3M5XA 2WW5A 3W85A 1EC9A 2YIHA 4Q8VA 2B7OA 4GYPC 2ZIDA 2J75A 4IQLA 3HPSA 4ZOEA 3PZVA 4Q33A 1W37A 4UTHA 8TIMA 1JD9A 4ZODA 1GOQA 4HGXA 3GBEA 1P6WA 4JEQA 1W17A 3STPA 2PWUA 3U2CA 1GVEA 1R8LA 4N0RA 6A3HA 4GD0A 1RVKA 6TAAA 3NQ8A 2O9PA 3CAWA 1K6WA 3IIOA 1FHUA 3G1AA 3S3GA 3MHGA 4GYJA 4AD2A 5CKSA 3UZYA 2ZRXA 3LBOA 3TSMA 2ZX8A 3EAUA 1WCGA 3MMDA 2WBGA 5CPTA 3DX5A 4IH3A 4L65A 1KO0A 2WBKA 3ARZA 2WC7A 3ICJA 1KCLA 4CEUC 4LS0A 1QPNA 3U48A 3VNJA 5HNNA 4XZNX 3AC0A 4GJ1A 1TMHA 4C7DA 2Z6IA 4GCAA 1HKMA 1OJXA 3ZR4A 3FJNA 1VHNA 2E77A 3N15A 3A4WA 4Q4OA 3W2MA 3ARVA 4JOMA 4O50A 1V6VA 4IXXA 5GJPA 3SSJA 3ZLFA 5HAOA 1J79A 1NELA 1UBSA 5I3FA 2D2OA 1V4YA 4AEEA 4IZGA 2G0WA 4QDPA 3WEMA 4LAUA 1ZBWA 2BSLA 2DORA 4JGDA 1BRLA 4PMNA 1DWHM 4N9BA 3VZYA 2R14A 2PWEA 3CZJA 4OTKA 4ES4A 2P76A 1N82A 5IOBA 3LCXA 2QF7A 3BW4A 4ADUA 3QF0A 3FIGA 4HMCA 1ZBKA 2WKLA 3FVMA 2QUVA 3CL8A 3L9CA 2QCNA 3UGRA 3AWNA 3BXWA 2WJFA 4KFPA 2FVKA 3GX9A 3DBNA 3WQ4A 3H23A 1KWKA 2WZIA 2PP3A 4C6OA 4IICA 3B8IA 2NT1A 3CV7A 3HFTA 2VX4A 5CLTA 4Q8UA 1ODUA 1UUOA 2O9RA 3P8JA 4ZTYA 1XYMA 2P8BA 3LRMA 3AJ7A 3TFXA 7A3HA 3GNXA 2VC5A 1GZ1A 4HK5A 5FSEC 1I9CB 1PAMA 3XISA 1NOFA 1NFBA 3AISA 1W1TA 1XYFA 2PRMA 3QFWA 4MJ4A 5D05A 2CZVA 4E8GA 3NNTA 1NH6A 3VDGA 2BX7A 2QULA 4IPNB 3V36A 2PWHA 5K2ZA 4UIOA 1X1NA 2B7QA 3VFLA 1QUMA 4MPQA 3NQMA 1Q6LA 1IXOA 5I3GA 4C6NA 4US6A 5C2GA 4LS2A 3WUGA 3H21A 1P7TA 5LHFA 4HBKA 2RKXA 3TIMA 2A3LA 4JX4A 3MZNA 3NL5A 3TWBA 3GHTA 3WJSA 3BLFA 4IX2A 1QHOA 1UR2A 4Q4MA 2PP0A 2DQXA 3U3HA 3BOXA 1P1XA 4ICNA 4MZYA 3OIHA 3VC5A 2OSWA 3UA4A 2QGHA 4A8RA 4OUEA 4OKDA 3LZ5A 3IJ9A 3PZ9A 4Q6XA 1FCVA 3LDVA 1XH0A 4S3AA 2KAUC 4IJRA 4N42A 1V03A 1FH8A 3ARQA 3TH6A 3P7YA 4I9JA 4JYDA 3KWXA 4FR6A 4CQAA 1UW9A 5CBIA 4G1KA 2E9MA 2DUXA 3LOTA 3AS1A 1L8PA 2V2CA 4HA1A 1UR4A 3H7VA 4H8VA 1TB3A 2Y0FA 4UB9A 1ADSA 4DLFA 1JI1A 1SPQA 4X9YA 2FB2A 3GXDA 1HVQA 3PZGA 4M0XA 1UWTA 3APGA 2ZFAA 5CC6A 2Y8VA 4IIEA 5B80A 1SW0A 8XIAA 4AW7A 4C6EA 3ID7A 1R46A 3ITCA 4IG2A 1JFHA 3UA3A 5HDRA 1CGYA 1B3VA 2VEKA 2ZKMX 1OT1A 1Z42A 5DCDA 5KETA 1P43A 1E9LA 5HQEA 5C9ZA 2FHBA 2A3AA 4WY0F 2WHLA 3WQWA 5BMXA 4HTBA 4WJXA 2XIOA 5LYRA 4IFOA 2RFGA 1HFBA 3EA2A 5AYXA 1OF8A 1YNYA 3TZNA 3W6MA 4HPHA 3TTYA 3AWOA 4A22A 2H6RA 4RUBA 4TV6A 2BBFA 2TPSA 1IGSA 2AL1A 3WLMA 3L0GA 2PLKA 4IP4A 4IT1A 1VIZA 3A21A 3B9OA 3W1NA 4DQWA 4GINA 4J3VA 2OX1A 2CU0A 3CZ8A 3PUEA 3NQ7A 3NGFA 5I0DA 2IKHA 4DNMA 4U5IA 4EX4A 4UTFA 3EWBX 3U7BA 3QW3A 3L2MA 3UWVA 1GWJA 1S2VA 3DCPA 1PIIA 3W7LA 4W86A 1V5XA 4W8LA 3B0UX 3A4XA 3GH7A 1L8NA 4GJJA 1Q8JA 1K8YA 4TX9A 2OR2A 3KVLA 3VUSA 4WD0A 5CJ5A 2GFTA 2J8FA 3TN6A 4FLQA 3ZJ8A 3W76A 2FHCA 2OODA 5A8OA 4NUWA 5HWJA 4NT0A 3FYOA 4W4QA 4YN5A 3SIMA 2GYIA 3EOOA 2QPXA 4S23A 1W9BM 1VJSA 1S1PA 2PTZA 2ACQA 3DESA 4QM1A 4Z1DA 1TTPA 3HGJA 1ZALA 1RCOB 4O19A 2HCVA 3B9AA 5BOFA 3CAVA 1AMYA 1VBRA 1ZZMA 4CUCA 4HP5A 3JZEA 3AIQA 1UD2A 1DIDA 2NX3A 1KM2A 1MRQA 3GVRA 5F1UA 4L80A 5HJXA 2CEQA 1TPWA 4LY4A 5D2YA 1MXDA 3B8WA 1XLLA 4WXYA 4ZGYA 1AJ0A 3RHGA 2J24A 1GOKA 2PC4A 2VT0A 3CTLA 1EKOA 3SN1A 2VFHA 3WN6A 1XCFA 3HPZA 2ZXQA 2YSWA 3ZFHA 4YHGA 3PUOA 1XLAA 3G6LA 1QTWA 1DXFA 2P0IA 3MSRA 1E4NA 5HUPA 4YTUA 2PDNA 4MLRA 4JZ5A 4DAFA 2XWEA 3DG3A 2Q8ZA 2VWTA 4BQ5A 1KB3A 1NY1A 4YS1A 3GK0A 3LG3A 3T8QA 4DF1A 1L6YA 1XICA 4O1EA 5FAJA 4E2OA 4PCFA 1QI3A 1PE1A 1F74A 3UXLA 4AY1A 1OK4A 1P7TB 2CHRA 2I14A 5CZSA 2Y88A 3OPSA 1F3TA 4ZOAA 1BXCA 3W7QA 2EPMX 4QITA 2CW6A 1XKJA 3BW3A 3VIKA 1VB9A 2GVYA 4OU1A 2FGLA 4BI7A 2ZXDA 3MSYA 3VOGA 5FJPA 4M7TA 5AC6A 2P5NA 3U2EA 1VFLA 3GDRA 3E0WA 2D2GA 4RDYA 2DIJA 1OG6A 3ABRA 2IW0A 2VQUA 4MNMA 4YWIA 3CGTA 4LVBA 1HZYA 3M0IA 4D6HA 4HCHA 4HKPA 2X0HA 3P84A 3WH8A 1HG3A 2PWGA 3HQ1A 5D37A 2Z1KA 4K8GA 1PTAA 1VFOA 4WKFA 4HNVA 4MY1A 4DBEA 5HNTA 4A6GA 1ONRA 4KWUA 3KM8A 5A6AA 1JDFA 2E3ZA 2XJ7A 3LCGA 4RX0A 2TAAA 3TOYA 2A3HA 3FLUA 1NF7A 3M0ZA 1QNSA 3IIVA 3II1A 1P0NA 2P10A 3B4YA 3O7UA 4AX7A 2VMFA 3E38A 4LV9A 2FQIA 5A8MA 1LOQA 4KF1A 4MKNA 4W85A 5DMNA 2PAJA 3GC2A 3T78A 4Y9MA 4H9TA 1VJIA 2IPFA 3OO2A 1UR9A 2O9TA 4IMFA 2NZLA 4FP1A 3TVAA 4WY0B 4AD0A 2OFJA 3C56A 1Q6EA 2E28A 4UTKA 3OJGA 2R1LA 1ITXA 2IQDA 1A5SA 3R2GA 5I06A 4HPNA 3WJWA 4PMDA 3PWIA 1IZKA 2ZRYA 1TV8A 4FS9A 5TBOA 4GGBA 1JPIA 3G1YA 4ZFCA 5LNRA 2R94A 3MKCA 4GWEA 1IIHA 3URAA 4O0KA 5A6LA 3BLOA 3RCMA 4FX7A 3PZOA 1GHSA 1ZS2A 2H8XA 4QS6A 1TJ1A 2RDTA 3FJ4A 1JZ6A 1TPEA 3CXOA 3O6AA 4NZCA 2B31A 1TV5A 3B0VC 3KX6A 5TAOA 1XUUA 4M5PA 4AVFA 4JXCA 1LL6A 1E72M 3B0YA 3GM8A 2WMIB 3P80A 3N3MA 3N2XA 4F0RA 4LOCA 2XZ7A 5CBJA 3IARA 1E6ZA 2RHGA 4B4FA 1GVFA 1EJRC 4FIRA 2QJGA 3DHFA 3LPFA 3AFBA 1Q4WA 2NXGA 3S83A 3U8GA 1RA0A 3R4IA 3AROA 2PMQA 2QDGA 1MFVA 1XLKA 4MYXA 4EP8C 5HR6A 3B4UA 4JIEA 2RDXA 4AEFA 4R53A 1KFKA 1D2KA 3LB0A 1O1ZA 1S38A 1R87A 4B3LA 3HFYA 1PHWA 1KBJA 1R3YA 4GYFA 1O6IA 2YA1A 5GJMA 4Q8MA 1FDZA 2EPLX 1NQ6A 3AIUA 1FXPA 4B5VA 1IR2A 2WVSA 3GUWA 1EL3A 1HQTA 4UOJA 2PZNA 4PEKA 1UA3A 1SFLA 3TQPA 4KWOA 1UOKA 3ZO9A 6TIMA 2VFDA 3S5ZA 3UERA 3QMRA 1SSGA 2XN0A 5T91A 1A5MC 4ZCWA 1H0GA 1ONEA 3A4JA 3KOWA 2FTPA 3STCA 4NI3A 1X39A 1E55A 3NUKA 3RLGA 2WXDM 4XTDA 3JVAA 4GO8A 4IIFA 1Q2SA 2DVTA 1W9PA 4G1NA 3C8NA 4A2SA 3LPOA 2R9RA 2OG9A 5DXYA 3L0NA 4R33A 3A6OA 4QE5A 2OOGA 1V3JA 4MKVA 5B7ZA 2NVAA 2ON3A 3GYCA 4K1GA 1XLBA 3BGJA 5D9MA 2XN1A 3FYYA 3W29A 4ROQA 5TQLA 4A21A 3HQNA 3CC1A 3GFXA 1B9BA 3P0WA 4PCPA 1AH3A 4P7RA 1CLKA 3VNMA 1Q45A 2IS7A 1F05A 1W1A1 4ML9A 4PB4A 3PP7A 1BSIA 1BD0A 1BG9A 1MQRA 1FP9A 1EA0A 1J10A 2O7QA 4WDWA 4B92A 3THQA 4JBRA 4YLWA 3SQMA 4FNUA 3R94A 2X2YA 3IAPA 4Z2JA 2W9MA 1TG7A 1H2JA 3L4YA 2DVUA 1Q63A 3MUAA 3V1PA 2C91A 4PUNA 4AMCA 4DZAA 4Z08A 2DZVA 1VQTA 1BXNA 3OIXA 2DH3A 1OX5A 4IM4A 1HN1A 4NP7A 5DCEA 3HIJA 3G22A 2Y89A 5JVLA 1XIIA 4BQ4A 4JTFA 4LAMA 3CO8A 2H8ZA 4GY1A 3N18A 2BGQA 1GKRA 1C9WA 3WELA 3GNRA 1JCXA 5A95A 4XUYA 2NQ9A 3N2OA 3T0AA 3GE7A 1IYXA 3CL6A 5G1TA 1UH4A 4Q4KA 1SMAA 2C14A 1XS2A 3L4ZA 2XH2A 3PR2A 2HVNA 4K2SA 3V1HA 1XHGA 1CWYA 3W1XA 4PUDA