3APGA

Crystal structure of hyperthermophilic beta-glucosidase from pyrococcus furiosus
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
471
structure length
471
Chain Sequence
b'AKFPKNFMFGYSWSGFQFEMGLPGSEVESDWWVWVHDKENIASGLVSGDLPENGPAYWHLYKQDHDIAEKLGMDCIRGGIEWARIFPKPTFDVKVDVEKDEEGNIISVDVPESTIKELEKIANMEALEHYRKIYSDWKERGKTFILNLYHWPLPLWIHDPIAVRKLGPDRAPAGWLDEKTVVEFVKFAAFVAYHLDDLVDMWSTMNEPNVVYNQGYINLRSGFPPGYLSFEAAEKAKFNLIQAHIGAYDAIKEYSEKSVGVIYAFAWHDPLAEEYKDEVEEIRKKDYEFVTILHSKGKLDWIGVNYYSRLVYGAKDGHLVPLPGYGFMSERGGFAKSGRPASDFGWEMYPEGLENLLKYLNNAYELPMIITENGMADAADRYRPHYLVSHLKAVYNAMKEGADVRGYLHWSLTDNYEWAQGFRMRFGLVYVDFETKKRYLRPSALVFREIATQKEIPEELAHLADLKFVTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase
publication title Crystal structure of hyperthermophilic beta-glucosidase from pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 184
structure length 471
sequence length 471
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3apgA00
5I79A 4MTVA 1QBBA 4WSKA 4FLQA 4QDMA 2VCCA 5DT5A 1W3JA 2JIEA 4L4OA 1HKIA 2VI0A 3SCQA 2XM2A 4MPKA 3U57A 2WWDA 2ZUWA 1XD1A 1DWIM 1HP4A 4W84A 4HPGA 1HKMA 1M53A 1VF8A 3WMCA 3KL3A 1TCMA 1UKOA 3WNKA 2AOSA 3AZTA 1MW3A 3UG3A 3VKKA 1HVQA 3KE0A 5BWFA 4ACZB 3RDKA 4CCCA 3T0DA 5M5DA 3GXMA 3BCDA 2B31A 1HF6A 4LGXA 5I78A 1DWGM 1B0IA 2VZTA 2VR4A 3K1DA 4AZ7A 2GDUA 5KEZA 2WZEA 4XV0A 1OGSA 4UZSA 3J7HA 1H49A 1G5AA 2CEQA 4BS0A 2A3CA 3WD2A 1E15A 2WAGA 1JZ3A 3WEMA 2ZUMA 1V3JA 2J78A 1JYNA 2CKRA 4U31A 4CD6A 2J8GA 2OSXA 3L4VA 2VNCA 4BCEA 5HPCA 1E0WA 2WANA 4JKKA 4MB3A 3N9KA 4AZIA 3VIHA 4UQBA 3AHZA 4RE4A 5FIPA 4W5UA 2WKLA 2DSWA 4L4PA 2RGLA 4PMYA 2X0HA 2DDXA 3WKZA 1V08A 4OKDA 1Q6EA 4JCMA 3VD5A 5A8PA 2WNWA 4HA1A 4AIOA 3ZT6A 5A8MA 2D0HA 4JZ5A 3QHOA 2DH3A 3DECA 4JKLA 1LG1A 1Z32X 2ZOXA 4J3TA 2XVLA 3MMUA 5A6BD 5CZKA 1ODZA 1M01A 2PWEA 2CIPA 1HNYA 3I3DA 4Z2KA 5DF0A 4HOXA 2Y4SA 5AC5A 3MSGA 1E56A 2D0FA 2BY0A 3SUWA 3K4AA 3PZIA 1V0MA 3A47A 3CGTA 4U2ZA 3CO4A 1UKTA 4EK7A 1BGAA 1W2VA 4B3KA 4QCEA 4E8DA 3CZKA 1KR0A 2BHUA 1XH0A 5JIPA 2EPOA 4Z2GA 5IHSA 5JBDA 1WDPA 2QPUA 3T2PA 3MV01 5I77A 1C7SA 1MW0A 5CLTA 4AD0A 1H2JA 1ISVA 1BFNA 2J7GA 3SCNA 3ZSSA 1CNVA 1PIGA 3PTKA 3ZR6A 3HN3A 2GDVA 2XVGA 2WMFA 1JG9A 3G6MA 1CTNA 3HJEA 5EFDA 2J74A 3L4YA 4XB3A 1JZ4A 2CKSA 1CECA 1OM0A 2WLYA 3M46A 3ARTA 3VINA 1XV8A 3AIWA 1AQHA 1GONA 4J7RA 1EO7A 5GNXA 3BXWA 3WBEA 1V3LA 1FFQA 4GINA 4DWSB 3QOKA 4QCFA 4RE2A 3UG4A 3LPPA 3O9NA 2WYSA 3AMDA 1UD8A 1C3FA 1ZBVA 4P7QA 4Z2IA 4X9YA 1H5VA 1M7XA 1LG2A 1RP8A 2G8ZA 1CXHA 2XIBA 1E6QM 5F7UA 5A6AA 2Y8VA 1VEMA 3A6OA 1JD9A 3ARSA 3AS2A 3PZQA 3ARZA 2X1IA 4MB4A 4CVUA 1BG4A 1IZJA 1C92A 1ZJBA 3OGSA 3AXIA 2VQTA 2VT0A 4UZUA 4AZBA 3EDDA 3D3AA 1K9TA 3B9EA 1C8YA 3PZOA 2IXVA 4WIWA 1OBAA 3GXIA 1BGGA 5FKYA 2EPNA 3AMGA 3WQ5A 5DFAA 1D2KA 4HMDA 3CTTA 4PTXA 3ECQA 1P6WA 4B16A 3WH7A 3CIVA 1NQ6A 3VGFA 4HMCA 2WVUA 2A3BA 3A3HA 1OSEA 3WD4A 5BXRA 1O7AA 3OLIA 2EJ1A 1UQZA 5BXSA 1ISXA 4FLRA 4PSRA 4H04A 3NJ3A 3FAXA 2IXUA 2D23A 1LQ0A 5I24A 1E5JA 2CPUA 2MANA 4P7OA 1HT6A 2CITA 2G3IA 3ARQA 4S3JA 2ZUNA 3I3BA 3WQ8A 4TTGA 4W5ZA 4ZENA 1TE1A 1E4NA 1NWTA 3T09A 4HU0A 5AYBA 2CBJA 1VJSA 2G3NA 3WDHA 1C8XA 2VVSA 2YJQA 1KB3A 2JF7A 4NSBA 3RO8A 4AD5A 4V27A 2BVDA 3VDAA 3NDZA 5D8WA 2BS9A 1U2YA 1VFMA 2ZXQA 2HISA 2BY2A 1W1YA 3ZJ6A 1PEZA 4GI8A 1D7FA 4Y7EA 3GH5A 1KXTA 3VGHA 3FW6A 3M6DA 3SIMA 3WNNA 3W81A 1U30A 4PMOA 3VIMA 1IZKA 2DPEA 1JZ8A 1MVYA 2DEPA 3QR3A 1BYAA 1HVXA 3GH7A 3VDBA 1DEDA 1ZB5A 1IT0A 1OT2A 4AZGA 4F79A 4MNJA 1FHDA 2X8RA 4J3WA 1XSJA 2XIIA 2YDRA 3L4XA 1Q6CA 3THCA 2WC4A 1ZJAA 2J7DA 5ABEA 2GK1B 2D24A 4LYPA 3WL0A 1K9EA 2FHCA 4DWSD 3VM5A 4UFHA 3W25A 1BTCA 2V3GA 3VGGA 4P8XA 1EHAA 5GQBA 2G41A 1NOFA 3A4WA 3AS3A 1E6RA 2YA2A 1FP9A 3AYSA 2VQUA 2O9OA 4W7UA 1V3HA 5BRQA 3VD9A 2QMJA 3AMKA 3ARYA 3VDCA 1E3XA 4JFWA 3WMBA 1E6PA 3DYPA 1I75A 4OOUA 2ZX6A 4OOZA 2J7HA 1IV8A 1QI5A 1JFHA 2CERA 2PI6A 5CQ1A 3GNPA 3VPLA 5I23A 4JAWA 4H41A 3WQ6A 4QFUA 3PBGA 1J9YA 4PUEA 2VX5A 2PC8A 3CHCA 1UD3A 4HA4A 1HL8A 3F5LA 4W87A 4CGTA 1V3IA 2BNJA 1XSKA 3MO4A 2VO5A 1E6SM 3CPUA 1GQIA 5DMYA 2CXGA 3U5UA 2GJPA 3GH4A 4WJXA 1FH8A 3VIGA 3CUFA 3EDEA 3AHTA 4OZOA 1QNPA 4M1RA 3L4WA 4ATWA 4W7WA 1GVIA 1MWOA 5DO8A 3AXXA 2CBIA 4UOJA 4KMQA 3AHXA 1GOQA 3W0KA 1ESWA 5A6BA 2ZX8A 3ZM8A 4W8BA 2J75A 5DT7A 1HIZA 1BPLB 4JFUA 2EPKX 3BCFA 5EMYA 1EA9C 3IJ8A 4C7FA 2ZUTA 4UQEA 1WP6A 3K46A 3KZSA 2W5FA 4N42A 3U5YA 1RD6A 1W3KA 3GNRA 3GXFA 5C71A 1RP9A 4OJYA 1H11A 4V2XA 1CXFA 3CHEA 3N18A 2JEQA 2VRJA 4PUDA 4CD5A 4D6HA 2J62A 5A6LA 1HP5A 2WHLA 3GBDA 4OUEA 4D6GA 1UA3A 2Y2WA 1GHRA 3OA5A 4OBSA 2WHMA 1CENA 1JD7A 2ZUSA 1GOKA 1CZ1A 2D22A 5LA1A 3UEQA 4F8XA 1UOKA 3ZIZA 3MV11 1CYGA 2CNCA 1JYVA 1DHKA 1LJYA 2FDMA 2WSKA 2Y5EA 4GZEA 1CXIA 5CSUA 1HJQA 3EMZA 2UY2A 3OG2A 2YOCA 5D9MA 1E0XA 4JKMA 1LWHA 2CCRA 3VD7A 1ITXA 4M56A 3F4VA 2YBTA 3RCNA 4IPNB 2J47A 4CUCA 3AZRA 5FL1A 1E71M 1GQLA 3SCRA 1NOUA 1X1NA 2W92A 4JCLA 1US2A 4P7LA 4KRTA 1B3WA 1CGVA 1GVYA 4JL1A 2WCAA 2XJ7A 4WKFA 5E09A 3WF1A 2RGMA 3M07A 1J0KA 1JI2A 2WHKA 3FAWA 4XUYA 1VIWA 3U7VA 1V0LA 4UFLA 3OGVA 4AWEA 4M24A 2PB1A 3BSGA 3T2QA 2J7CA 4ACZA 1H09A 3AYRA 3N04A 3TTSA 2E9BA 1V02A 1UWIA 3DYOA 3ZJ7A 5A8OA 2EPLX 2GFTA 2WSPA 3B9DA 1JL8A 3W28A 4D6IA 1UWRA 1ODUA 4AEEA 4P8VA 5A3HA 5CSYA 1J0YA 2XM1A 1GOIA 3HU7A 1I1XA 1CLXA 1UKSA 1C8QA 1VJZA 2E0PA 4U3AA 2V5DA 5HPOA 1UH4A 4DWSC 2GJXB 1KWKA 1RH9A 3BAKA 4U2YA 2XFFA 5CXPA 3VVGA 2VJXA 4AC1X 1E6NA 1UR1A 4JL2A 4M81A 2WB5A 4AZHA 3K4DA 1HX0A 3WEOA 3N12A 4TUFA 2Y24A 5JUVA 1TG7A 1LLOA 5AYIA 2WC7A 2J77A 3WUBA 3WELA 3VD4A 1A3HA 1XCWA 6TAAA 1J18A 2W67A 4NZCA 4R5EA 3SCSA 3T08A 3ZMRA 3DYMA 1J10A 1MW1A 3ZT7A 1EDGA 4YPJA 1C93A 8CGTA 3POCA 4WKHA 4MAVA 3BAYA 5KZ6A 3KL5A 3VIKA 2DH2A 2FHBA 1OD0A 1UD2A 4CCEA 3BSHA 1WZLA 7TAAA 1QVBA 1E72M 3WDPP 3RIKA 2WWCA 4IPLA 3UG5A 3THDA 4MAZA 4F9DA 1JI1A 3N11A 3VGDA 1HKKA 2V3EA 1UG6A 1DWFM 3II1A 1NOWA 1VAHA 1XH1A 3HMCA 4M29A 2WMKA 3UR7A 1V6UA 4RL3A 2YL9A 1EOKA 2X05A 5LA0A 3K8MA 2VX4A 3W4RA 3VTRA 1PX3A 5IXEA 3GM8A 5E0FA 1KCKA 3CUJA 3WDQA 1OIFA 1M03A 4ZFMA 2J7EA 1E4IA 1AMYA 4RE3A 1B1YA 4HZ6A 5A69A 4H8UA 2D3NA 4WKAA 5HXMA 3VDHA 3VU2A 4AZCB 2FH6A 1KCLA 5BRPA 2FGLA 1Q6GA 2QV4A 2ZXDA 1NWRA 1V0NA 4W7VA 2ZXBA 2OLHA 1WZKA 2CHOA 3AIQA 1PZ2A 5FL0A 1GNXA 4DWSA 5A6KA 3GTNA 4UFIA 3CZGA 3D5HA 3EMCA 4HOZA 3BLKA 4PMUA 2J4GA 1V03A 2BHYA 1OINA 4UFKA 4QLKA 3AIBA 5BROA 2C7FA 2G3JA 1E9LA 3BMVA 3SCTA 2WBKA 4FK9A 4KGLA 4EANA 1E43A 2Y8KA 4JFVA 4IUGA 4W8LA 4H8HA 4C7DA 1OT1A 1WDQA 1QI3A 2E8ZA 1B9ZA 3AHVA 3AXHA 5A2CA 4QLLA 3FY1A 3NDYA 4AYSA 4JFTA 3VO0A 1ISYA 4E4PA 4PMDA 2XYLA 3O2LA 1E4MM 1O6IA 4MNLA 2E9MA 3CUGA 4U33A 1QPKA 3CZJA 2VMFA 5A8QA 4X0VA 8A3HA 1B3ZA 1HL9A 1G01A 3NSNA 1B30A 2QMKA 1GQJA 1BQCA 4D72A 1EDTA 4Z2HA 1F4AA 1G94A 1XD0A 5CPQA 2DT0A 1J01A 4BA0A 2VZUA 2Q8XA 1CWYA 4D6DA 3S2CA 4BQ4A 4J3VA 2ZX5A 1PX4A 4P8WA 5EFFA 3ZR5A 1TVNA 4AZ5A 4CN6A 1WZAA 1W9XA 3B9AA 4GZJA 5TD4A 2OYMA 2WBGA 2ZUVA 1MYRA 4P7NA 1JZ7A 2WCSA 3AI0A 4LPCA 1FHLA 3FN9A 1V3MA 2WW5A 4FF5A 1UWUA 2EQDA 1R8LA 3K8LA 3AS1A 3SCPA 4BZYA 4WLCA 1ITCA 1UD4A 3EDFA 1KR1A 4AZ6A 3K8KA 3W29A 3GXDA 1I1WA 4UOZA 4TVUA 2XVKA 1V02E 4C7GA 2GUYA 5A1AA 2XPKA 5A8NA 4U5KA 3OLDA 2VCAA 1MFUA 1V0KA 2XGBA 2PF0A 3WD0A 2E4TA 3CUHA 4EKJA 3KWXA 3FXYA 2XG9A 3A4XA 3AFBA 2EO7A 1TMQA 1GUVA 1B3XA 1MQRA 1B31A 2XGIA 4AEFA 3CMJA 2F8QA 4W8AA 3MUAA 3ZSTA 3ARPA 2VURA 1YQ2A 2Z1SA 1UR2A 5ABFB 1G9HA 3W27A 1QHPA 1W1VA 1GORA 1JDCA 4HTYA 3UCQA 3W24A 2XSAA 1SMAA 3SCOA 4ATLA 3VMPA 3EYPA 1H41A 2F2HA 3VIJA 2E3ZA 2DIEA 1H1NA 4CVWA 3LMYA 4PYSA 4AISA 2YBUA 5A94A 4JHOA 4R27A 2WMJA 5HOSA 4D1IA 4GIAA 3RPMA 4MNMA 4D6FA 4MB1A 2GK1A 4B9YA 5I2UA 1CBGA 3NUKA 3QHMA 2WMHA 2V3DA 4J27A 5ABHA 1EXPA 1KFWA 3BC9A 5A2AA 1LF1A 3VIOA 4UQCA 2NT1A 2VCBA 3VIPA 4H2CA 1J0HA 3W53A 4GZIA 4AY1A 4E2OA 2WKGA 3WY1A 3VNYA 3PZVA 4NRSA 4URIA 1VEOA 2O9TA 4GO8A 3TTOA 3BLPX 2XSBA 4GI6A 5M3WA 1XCXA 1EDQA 1CGUA 3MUIA 3T2OA 1NP0A 1WO2A 1BYCA 3VX0A 3OBAA 3TP4A 3W26A 1JFXA 4GO9A 3WUGA 1EQCA 1TVPA 2XVPA 3AS0A 3L2MA 4EAMA 3I3EA 3BAIA 4NI3A 3SEPA 5E6ZA 1FP8A 1Y7VA 5M17A 1OGGA 1V6VA 2VTFA 2GVYA 5A95A 1TA3B 4B3LA 1Q6DA 2A3HA 3AIEA 1OGBA 1JNDA 1U33A 2JEPA 1UUQA 1V3KA 2XHYA 5JBFA 3AIUA 3WNOA 2CHNA 3L4ZA 1HN1A 4S3KA 4TX8A 1CDGA 2YDSA 1FOBA 1VRXA 3PTQA 4QP0A 1VFUA 4F66A 2BXYA 2EPMX 1KBKA 1UWQA 2ZX7A 1X6NA 3WH6A 4BQ2A 3U7BA 4WK9A 3WNPA 1DWJM 5LA2A 1VEPA 4AIUA 4UFMA 3OIHA 2YL8A 1HJSA 3OZPA 3DHPA 2J7BA 4PTVA 4GI9A 1ZL1A 1MXDA 2J79A 1E1EA 2CETA 1CGXA 3BH4A 3WUEA 4CU6A 1XRVA 4GXPA 3AQUA 2XFYA 5D8ZA 5ECUA 3AIVA 1G1YA 4TOQA 3IJ7A 1QI0A 4XX6A 3ZO9A 1EHNA 3M7SA 3MANA 1D3CA 1GQKA 2CBVA 2Z1KA 2XVNA 1WZMA 3OLEA 1JXKA 2D3LA 2O9RA 1W1PA 3QHNA 2VL4A 4E8CA 4W88A 4UTFA 3ZJKA 4ML4A 1VBRA 4XZWA 1EH9A 3L4TA 3AISA 1KQZA 5HDRA 2ZUUA 2QLYA 1SR0A 1V6YA 4Q22A 4PBGA 1NWUA 3EDJA 2D20A 1HKJA 2QHAA 2WMIB 4AD2A 4F9JA 1GJUA 2PWGA 2DSVA 3MKKA 1FH9A 4AD3A 4D6CA 1UWTA 3UR8A 3SCUA 1E70M 3F5JA 5A6SA 2E9LA 4FLSA 3RJYA 2UY4A 3SCVA 4OIFA 1E1FA 2VX6A 1XYFA 2BY1A 1QNSA 1E40A 1QW8A 1OD8A 1CGTA 1W9BM 4UNIA 5M03A 4PCTA 4BF7A 2XTKA 4KWUA 2NT0A 4A4AA 2WVVB 2BFGA 1CPUA 2VOTA 4HPHA 3VX1A 3FNDA 3VGEA 3TA9A 4LYQA 3VGBA 1C91A 1J0JA 1WPCA 1JXJA 3PZUA 3BAXA 3VUPA 1SYTA 1CEOA 3VMOA 1JF6A 3WF2A 2WVTA 3CHFA 4FMVA 5ABGA 2BVTA 3WDJA 1ZBKA 3ZJ8A 1US3A 3WBAA 1EOMA 5E70A 3CLWA 3APGA 3VILA 3ZT5A 1QHOA 4DM2A 2J8FA 1DWHM 4UQDA 3AMLA 1FH7A 1W9DM 1HXJA 2VX7A 2PBOA 2YLLA 1UWSA 3NSXA 2V38A 1EGZA 2D2OA 1ZS2A 1GPFA 4IM4A 2GJXA 2ZICA 4W85A 4PRWA 4LYRA 2YDQA 2DSKA 5D4YA 1W91A 4PTMA 1TFVA 3ARVA 3UETA 2ZXAA 1Q6FA 2OYKA 1QNOA 4PSPA 1B3YA 1E55A 3PN8A 4N0RA 4UQAA 5A6MA 4B15A 4U3CA 4MNKA 2VRKA 2PBGA 5A2BA 2AMGA 1JAEA 4DM1A 1KGUA 3ARUA 4UR9A 1W3LA 4UOQA 3KEHA 1BVNP 2DQXA 5FOOA 1UD5A 3SCWA 4PMQA 1KGWA 2W4XA 2X2YA 3A4AA 2HVMA 1JYXA 2V5CA 3IANA 2E8YA 2ZIDA 2OYLA 3WN6A 4HA3A 4M80A 3WFLA 5AY7A 3BAWA 2D0GA 3WD1A 3WH9A 3GZAA 3WNLA 1W3HA 1BG9A 2WMGA 3FHQA 5IFPA 4IISA 2YA1A 4P7RA 4NF7A 1MXGA 2D1ZA 3N13A 1BVZA 4H8VA 2PWDA 2VR5A 1NH6A 2AAAA 2WC3A 5CJ5A 1JZ5A 1FFRA 4M8UA 3SUTA 4PEEA 3G6LA 3ZQ9A 2W61A 2QF8A 1ISWA 3MUZ1 2OSWA 2UWFA 4NRRA 3CZEA 3N17A 1LWJA 4TTUA 1QW9A 4QLJA 1R87A 5D9PA 4CCDA 1XC6A 4FLOA 4TVCA 4PMVA 1E6ZA 5I6SA 9CGTA 2CBUA 3MUY1 1TR1A 1AVAA 1H0GA 1UR9A 1V6XA 1WE5A 4UCFA 4CN4A 3RM4A 3VIIA 1XYZA 4UQ9A 4HZ8A 4AZCA 3WQWA 4U5IA 1M04A 1QOXA 1G0CA 1EIBA 1CXKA 3CHDA 4CD7A 2GSJA 1MQPA 4V28A 2J7FA 1PJ9A 3LPGA 5I0DA 3W38A 4HZ7A 5CPTA 3KL0A 4D6EA 1JYWA 3W82A 3S6TA 1XGZA 1LL6A 4LQ1A 4LXFA 4WSJA 1B3VA 4Z2JA 1NARA 5I5RA 1MFVA 3QGVA 1JAKA 3ALFA 3SURA 1X6LA 3MMWA 4ACYA 1F4HA 1VFOA 2IUZA 3MS8A 1NM9A 4DUVA 1JDDA 3AHYA 4HOWA 3LPFA 1BYDA 1CIUA 2X0YA 4BQ3A 4D71A 5IHRA 2W91A 1BHGA 5GNYA 4PN2A 3GYCA 1VFFA 2CYGA 4OBRA 3TONA 2EBNA 2YLAA 3N1AA 4B9ZA 3W6MA 1WNOA 3WUFA 2JE8A 3O6AA 1TUXA 4A3YA 2WPGA 2FGZA 4J3XA 5BYWA 3RM8A 3ALGA 2NSXA 1SFSA 2OWCA 3ARRA 4AW7A 1JDAA 1C90A 2DGAA 4MB5A 1HJUA 4P8UA 2ZX9A 4MDOA 3WD3A 1L0PA 2EEXA 1QBAA 1W9VA 2W62A 1CGWA 2VZVA 4MDPA 3AJ7A 1ECEA 1QNQA 3AROA 3MSDA 3WF3A 1UH2A 2DSZA 5IFTA 3SUUA 4CD4A 4PTWA 1QHZA 2ZWYA 5E0CA 5IDIA 4Z2LA 1KGXA 2BHZA 2FHFA 5CGTA 1KXQA 1GZJA 1E3ZA 1WKYA 3WFZA 3SUSA 1VBUA 2DT3A 1VENA 1FA2A 1K9DA 3TTYA 3PTMA 4MADA 2WXDM 5AC4A 5CGMA 3TOPA 3ARWA 1DP0A 4UFJA 1OB0A 4QAWA 4K68A 3AICA 3AMCA 2WZHA 4HU8A 3TTQA 2O9PA 3POHA 5BXTA 3OZOA 1BF2A 2JFEX 1UQYA 4KH2A 4BQ5A 5DEZA 3EMQA 3CMGA 3VOCA 3IK2A 3WMSA 1C7TA 1KQYA 3WH5A 2A3EA 3MU7A 4XZBA 4W93A 1GOWA 2NW0A 3WL1A 3QOMA 4JFSA 1UKQA 2DT2A 1CLVA 1E4LA 1PBGA 3AIRA 1PZ3A 5ABFA 3VMNA 5I3DA 3PZMA 1QI2A 3WSUA 1R86A 2VUYA 1ZBCA 3UERA 1WB0A 2EXOA 1R85A 1KXHA 4CU8A 2DIJA 3N15A 1WAWA 5CG0A 1OCQA 2JIWA 2W63A 1A47A 2VZSA 2W66A 1J12A 4GKLA 4J3UA 4CKQA 4YHEA 3WQVA 1GCYA 5C8BB 1NP2A 1GOMA 3FHAA 3BMWA 1AQMA 5E9AA 4DUWA 4GQRA 1PX8A 4WF7A 2YA0A 3BGAA 2WZIA 2DT1A 3PHAA 1YHTA 5D9NA 4EE9A 1HJVA 3F5KA 4YHGA 5EB8A 4JIEA 1GJWA 7CGTA 2J25A 3JUGA 4M82A 2G4FA 2WHJA 4Q7NA 2XFRA 5CLWA 3GNOA 1ISZA 3WF4A 2E40A 3GDBA 4CN1A 1GW1A 3BAJA 4MJ4A 4YN5A 3NSMA 3L2LA 1J0ZA 1CXEA 3IJ9A 2UY5A 5LYRA 1UR8A 1J0IA 1KBBA 4PMRA 3MMDA 2GJRA 3RJXA 2TAAA 1UYQA 6A3HA 3WF0A 1BSIA 5HBFA 3B8SA 5CPSA 1N82A 4HP5A 4X0NA 1E0VA 1E5NA 2VRQA 1E6XM 3SUVA 1BYBA 3VNZA 2ZE0A 2BXZA 1UD6A 3VM7A 3CZ8A 3UESA 3ARXA 4GQQA 3AZSA 2VZOA 4AXNA 1TA3A 1ZU8A 2C0HA 3IAPA 1LL7A 3OB8A 2ESCA 5GNZA 3PZ9A 3NCOA 5A6JA 1MW2A 1JZ2A 3WIJA 1LL4A 3CH9A 3DHUA 1B90A 1HJXA 1OIMA 1UZ4A 4JHZA 1XH2A 4PMNA 4ZXOA 3WENA 2YIHA 3WEZA 1UZ1A 4MJ2A 4ZE5A 5FCZA 1VB9A 2FH8A 3ZOAA 1WDRA 1JNEA 1SMDA 2JF6A 4A3HA 1W32A 1AQ0A 2VC9A 2BY3A 1PPIA 2VVNA 2X09A 4AD1A 1JF5A 3NYDA 4AMCA 1JGIA 1RPKA 2OWXA 5D9OA 3RM9A 2WLZA 4J28A 4D1JA 3T0BA 1UA7A 2F61A 3EDKA 1EQPA 4KRUA 1L8NA 4ZXLA 3W37A 1S46A 2WM0A 1UKPA 1PAMA 1ZBWA 1W2PA 1DTUA 2DSUA 2QPSA 3CZLA 2BV9A 6CGTA 4PCSA 1H4PA 5JBEA 2XWDA 3PZTA 5FD0A 4DUXA 4W89A 2YKKA 3PZGA 1CXLA 1UR0A 4PMZA 1V6WA 1W9UA 1KWGA 1DWAM 4TVDA 2PWHA 2G3MA 1R7AA 1W1TA 3OGRA 1GOOA 5GPRA 3OLGA 3RILA 2JALA 3AOFA 2WMIA 1PIFA 1W9PA 2UY3A 3PZNA 1JZ6A 5HNNA 1TZ7A 1H3GA 1NWSA 4AD4A 4GPNA 3WH8A 2ZWZA 3LPOA 2WK2A 1GHSA 3VD3A 3EBVA 2WCGA 2PWFA 2YL6A 4CU7A 3W6LA 1BAGA 2XUCA 1XHGA 4ATDA 2OSYA 2C8NA 2XWEA 2BVYA 2CESA 5JIWA 1WDSA 1R7OA 2WVVA 3RMEA 1UH3A 4H7VA 3VIFA 3WQ4A 1WCGA 1QNRA 5E6YA 4CD8A 2A3AA 4HMEA 2O92A 1UHVA 5BCAA 1H0IA 1BLIA 5EBAA 1XSIA 4W86A 3CBWA 1MQQA 1J11A 4AIEA 4ZEPA 1UR4A 4J3SA 1JIBA 4KGJA 4TXEA 3WNMA 1B2YA 1K9FA 3DC0A 3WDRA 2V3FA 1KXVA 3NIYA 3T0AA 1E73M 4PMXA 1OWQA 4ZE4A 5C70A 1K6AA 1HJWA 4D6JA 4LX4A 4TX6A 2WVSA 1EO5A 5BXPA 2OWWA 3GBEA 3CUIA 3WDIA 1CGYA 1QI4A 2YL5A 3E1F1 7A3HA 1Q4NX 3IAQA 3L4UA
chains in the Genus database with same CATH superfamily
1J4EA 4FS9A 4GUIA 5EGRA 3NZRA 1YEYA 3BOFA 2VCCA 1SVDA 4A2RA 1Q63A 4AYGA 4BEQA 4DXXA 3U57A 1C9WA 3KRUA 3MP5A 1VF8A 2FFCA 3E2QA 2CU0A 3KL3A 3H4XA 3GLCA 3VFCA 1ZJIA 3UG3A 2D2JA 3VKKA 1KNWA 1TV3A 1AA1B 3RDKA 3F4DA 3V1HA 1CB2A 3RX2A 1JJKA 3NPUA 5I78A 2VZTA 1RXOB 4ZODA 3JVAA 4JQ3A 2WZEA 3KRSA 3C86A 1TIWA 3N6JA 1O5KA 4FOJA 4XD4A 2A3CA 2JGYA 1E15A 3K13A 1WDWA 1K03A 5J8LA 4ADUA 3LCIA 3LHVA 2G5WA 2DZXA 1WX0A 3MI2A 2QUMA 3THQA 2VNCA 2DV0A 1TX0A 3N9KA 4AZIA 5AZ0A 2DJXA 4L4PA 2RGLA 2X0HA 2DDXA 4OKDA 1VS1A 3STFA 3TYBA 2PDHA 3P74A 1ZSXA 2XVLA 3NZQA 5A6BD 4L7ZA 1DQXA 1ODZA 2CIPA 4Z2KA 4GE8A 2WNNA 5E5CA 2OKTA 4ZOEA 4PCPA 3WG6A 2ZRYA 3BVJA 1H63A 1EP2A 1I9CB 2D0FA 3EWDA 2BY0A 3SUWA 4Q8VA 3BV4A 3K4AA 3A47A 2VUNA 3NTYA 4CCZA 3CO4A 1N55A 5BNKA 1F3TA 4B3KA 4QCEA 4E8DA 2BHUA 5JIPA 5E93A 1JCMP 1NIUA 3V75A 4OV9A 3MV01 4Q8NA 3T2PA 2DUXA 2ATMA 2BGNE 1MEWA 5CLTA 4IMGA 1TWDA 4GA8A 5KMYA 3LK6A 3NNTA 5HMFA 5G2HA 1CNVA 4N2YA 3FFSA 4R7WA 1H5YA 3UR5A 2GDVA 4HU4A 1TVLA 3G6MA 1R3TA 5EFDA 2Y8UA 2YCLA 4I7WA 2B7QA 2EGZA 3IEBA 4GJJA 4HK7A 4UB9A 1CECA 5BOFA 3ARTA 3FYOA 1X7IA 3VINA 1YADA 1XV8A 1AQHA 3UA4A 1XBZA 1GONA 4UMBA 1OF6A 3NEVA 1KV8A 1YNQA 4BHYA 5T9BG 3QOKA 3C0SA 3LPPA 4YCOA 2XZ7A 4B2DA 1KCXA 1UD8A 3SW6A 3A3XA 3SRFA 4H4IA 5G4HC 1M7XA 1RP8A 4KEUA 2G8ZA 2XIBA 3SGGA 3K1GA 3LDVA 1RA5A 3O8AA 3T0CA 4YTRA 5F7UA 1F74A 4LF1A 2V8ZA 2J24A 3A6OA 3A5VA 3ARSA 4L6DA 7ODCA 3NZGA 3GIQA 3DUGA 1RBOB 4C6JA 1YPIA 3ANUA 4ZA0A 4XD6A 3IRSA 3OGSA 2VT0A 3SGUA 3P62A 3PZOA 1DIKA 2IXVA 4WIWA 2ABAA 4XZMX 2EPNA 5DFAA 1D2KA 3LI1A 1ZY9A 3CV2A 4GVHA 1QO5A 1P6WA 1EP3A 4QQUA 2PZ0A 4IUOA 3G1XA 1KM5A 1VIZA 3OQEA 5L9FA 3A3HA 5BXRA 5D05A 1QRQA 3OTRA 2RDWA 2W27A 3GG0A 4PSRA 3TA6A 1H62A 1HTIA 4A3UA 4DO7A 4C90A 2R1MA 1HT6A 2G3IA 3LTYA 3UPMA 3GYEA 3FGCB 4A3QA 2EHHA 3GHSA 3HG3A 4JNMA 1NWTA 4C6PA 1UBPC 3A22A 4GXMA 2RAGA 4EPBC 3WDHA 4LC8A 1UJQA 1OC6A 1KB3A 3RRAA 1XX1A 2JF7A 3IIOA 2ZRWA 4MZ1A 3VDAA 1U2YA 1VFMA 4PL1A 4RNFA 3DESA 5G4EA 1MZRA 2YW3A 3NGJA 3ZJ6A 1KLYA 3GH5A 1OZMA 4O8AA 1PO9A 3M6DA 3W81A 6ENLA 5AC6A 5LNSA 1U30A 2Z27A 1P7TB 1JUKA 3U4AA 1RJRA 1JZ8A 3KTCA 1SZFA 4L9ZA 3GR8A 3WLIA 2PAJA 3JZUA 4Y9PA 1IT0A 1OT2A 3ZLFA 1TTQA 4K6AA 1FHDA 3TSDA 5EMKA 1Q6CA 2WC4A 3FJ4A 4DNMA 2PZNA 2GK1B 1JCNA 4LCRA 4LYPA 2H3BA 3SSZA 4EPKA 2R24A 1K9EA 2FHCA 3PFMA 4DWSD 1SUXA 3VM5A 3W25A 1BTCA 1AUSL 3EWXA 1EHAA 3UPWA 1O1HA 1IIGA 1ICQA 4IF2A 1EB3A 3AS3A 3BDKA 5I09A 1QPOA 2PDIA 3KCJA 1V3HA 3RR4A 5BRQA 1AD4A 3NL3A 2CZDA 4OOZA 1RY8A 1JFHA 3M0XA 3UXIA 2AGKA 3GNPA 4O0QA 3W1UA 4QTGA 4OE7A 2VELA 3N6HA 4Z17A 4C1LA 4QFUA 2Z29A 1J9YA 3GNXA 5HWMA 2J27A 1TV5A 4L6OA 2O7SA 3OP2A 4HA4A 1IGWA 1K4GA 3R4IA 4W87A 4CGTA 1V3IA 1XSKA 2FFIA 5K9DA 2VO5A 3SY5A 3EA2A 5K4ZA 4WEVX 3KBMA 3GH4A 4NAFB 4WJXA 1FH8A 3GU2A 3WLQA 4OZOA 4M1RA 4ZQOA 5B7ZA 1R6WA 3AALA 5DO8A 5DRIA 2CBIA 3CIWA 4HMNA 5A6BA 4JTTA 3AJXA 3TN5A 4W8BA 5DT7A 5H8PA 2EPKX 2OFJA 4K3ZA 4BI6A 1EA9C 3IJ8A 2DORA 4MY8A 2PMQA 4R9XA 2R14A 3WLPA 4NYYA 1XLMA 3U5YA 1W3KA 1H11A 3HJZA 4X2PA 4J5NA 3CC1A 3CHEA 3N18A 4FP1A 4WY0A 1Q65A 4PUDA 3KOYA 4O28A 5A6LA 2WHLA 5HWJA 4H9ZA 1CZ1A 2D22A 3M5VA 3I65A 3B0XA 5LGXA 4F8XA 1SPQA 1UOKA 2ISDA 3ZIZA 3MV11 2CNCA 1JYVA 2QUTA 1DHKA 4CLMA 2IPGA 1W56A 2Y5EA 4QJ3B 1EJUC 5F4WA 1CXIA 5CSUA 2UY2A 4F0SA 4LB4A 1E0XA 4JKMA 4RNIA 4IXHA 1TKKA 2E09A 3PPCA 4M56A 3W1MA 3W7CA 1E71M 1GQLA 1EX1A 2HE5A 1NOUA 3W73A 1UPMB 3H2NA 1QPRA 2XJ7A 4YS1A 3M07A 2VD8A 3FAWA 3GUGA 4JICA 3B9NA 3T6CA 1L6SA 3U7VA 2V9DA 4J35A 5FJJA 1IEQA 1V0LA 4LC6A 1VPYA 3OGVA 4M24A 1ONWA 1BXBA 3BSGA 4FNSA 4JHMA 3KDNA 1D9EA 5CBIA 2NQ5A 1IXOA 1UWIA 4PE8A 3WQOA 5I3IA 4GUGA 3B9DA 2J9XA 4A8LA 5CSYA 4AF0B 1LORA 2NSOA 3EOOA 2XM1A 5CCZA 3QFWA 1F8IA 1NU5A 4IZGA 1C8QA 3EB4A 2QVNA 4U3AA 4HNLA 4PFHA 3HV8A 4A8RA 4G2DA 3BAKA 4KRZA 4CQAA 3NQBA 2F6XA 2RDTA 1YXYA 1E6NA 1N8FA 4M81A 2WB5A 1HL2A 4YTTA 3LGEA 4MG4A 1FCVA 1DIDA 2P53A 3APYA 4LJ3A 4DXVA 5JUVA 1TG7A 3Q67A 2Y7DA 1TWIA 2J77A 1QK2A 2FTWA 2W67A 3SCSA 1WQ5A 3T08A 3DYMA 1EDGA 1PVNA 3POCA 1A50A 5LHFA 4QS5A 2PF8A 2YGYA 3BAYA 1DJIA 4QEHA 2NUWA 2DH2A 1OD0A 1M68A 3BSHA 1FWCC 7TAAA 1NDYA 1RLDA 2GUBA 3ISIX 3WDPP 3RIKA 1XDMA 4IPLA 4NASA 2PDFA 1XC4A 5D2YA 3TSMA 3M6YA 3HIJA 4G7EA 4DBUA 3B8WA 1UG6A 3KLLA 2V2CA 4ZZ9A 1NOWA 1AW1A 3T42A 1TPC1 4M29A 3UR7A 3GVRA 4IOTA 2YXGA 1EOKA 4MYAA 2X05A 4A35A 4QEEA 3K8MA 2PTWA 4HJWA 4DUOA 5IXEA 3GM8A 1SJAA 1MEIA 5LSMA 3CL7A 1R38A 3LCGA 1QDSA 4NXSA 2HE8A 1K70A 3PJWA 4HZ6A 3H23A 3R7MA 4JNYA 4WKAA 4K7YA 3VDHA 3VU2A 1AH3A 4AZCB 3KOFA 1KCLA 2C1GA 4XAGA 1Q6GA 4W7VA 1SO6A 1V0NA 3T81A 5AHIA 2BB0A 3AIQA 4O4VA 1GNXA 4DWSA 3CZGA 3CO8A 3OJGA 3EMCA 4Q6XA 4C1NA 3AYTA 4RDYA 4H2HA 5LNVA 4UFKA 4QLKA 3NPVA 1EP1A 3IIZA 1GWJA 3T7VA 2JQXA 3TZNA 2F6UA 4B5SA 1SR9A 2GZXA 4O57A 2Y8KA 4HHMA 1OT1A 1QI3A 4AX7A 4GMEA 3M0ZA 3F1QA 5I07A 4IG2B 4IGNA 3AXHA 2VDGA 1G4TA 1RD5A 2BASA 2BXVA 3Q2DA 3NDYA 1Y5WA 1FXQA 4MWAD 3MWCA 4E4PA 3W85A 3STPA 2PTYA 1O6IA 3STEA 2VMFA 3HPSA 1OX5A 2FZDA 4H6KA 4O12A 3T40A 3LHYA 1B30A 1RA0A 4MIMA 3L5MA 1EDTA 3MCMA 5HAOA 3V1PA 1XD0A 1FWNA 3LBOA 2FJUB 4UXDA 2YX0A 3C0JA 2Z7GA 1PX4A 4QBXA 1WZAA 3S47A 4ILSA 1W9XA 3S83A 1JRCA 4L1XA 4GZJA 2OYMA 2ZUVA 2CFFA 2QXWA 1X6UA 2WCSA 4CQ8A 3CEPA 4LPCA 3O0KA 1FHLA 5MKGA 3LI0A 4FF5A 1LZOA 4NVTA 3SCPA 5TNVA 4WLCA 3Q45A 3TAKA 3GB6A 1LUCA 1I1WA 1LLWA 4C7GA 3BG9A 3BG3A 1XFCA 2XPKA 1H51A 3OLDA 1MFUA 2PF0A 1XBYA 2E4TA 2BX7A 3BQ5A 1MQRA 1B31A 2EG8A 4X3ZA 4EVZA 2PDCA 2F8QA 4IIDA 3TH6A 2GLKA 2AMXA 3ARPA 2VURA 1S1RA 1G9HA 1MXSA 3P8JA 3N2BA 1X98A 4HTYA 3CUZA 2OMAA 3WFAA 2F2HA 3PWIA 2YPIA 2DIEA 1H1NA 2DJLA 3H54A 2PLJA 4MYXA 5CH9A 2ZRZA 4AISA 3HGOA 4R27A 1UBSA 4GIAA 3RPMA 4MNMA 2QJMA 5G2IA 3W01A 2NQ9A 4MB1A 1CBGA 4O1BA 3QHMA 2WMHA 4J27A 1IWAA 4BWLC 4H9MA 4DYKA 3QTPA 4UQCA 4ICMA 2H8XA 4UTUA 3VNDA 4GZIA 1XISA 1P0EA 1FRBA 3VNYA 3L2IA 3RYSA 1GVSA 2E1WA 1F05A 1VEOA 1RCXB 2O9TA 4JYFA 3A5FA 1BKSA 2WZMA 4I9MA 2Y7GA 2OX4A 4GJIA 2H9AB 3ANYA 1KBLA 1CGUA 3MUIA 4B5VA 1BYCA 2IPWA 3VX0A 3BV7A 2WNZA 3GG1A 2FZMA 3R79A 3W26A 1N8IA 1FY6A 1EQCA 3I7QA 2OTDA 3AS0A 3LRMA 3BAIA 4UNLA 1NELA 5EKYA 3SEPA 1ZENA 3DFYA 1W8SA 1Y7VA 5M17A 3B0YA 1V6VA 5A95A 1TZ9A 3UZYA 1TA3B 4B3LA 1PHQA 3ERPA 1T96A 2G3FA 4MKSA 2ACRA 1O94A 2VC6A 3VCRA 1Z44A 2JEPA 3IGXA 4LFYA 3CWHA 4S38A 5JBFA 3WNOA 1O4UA 1XLJA 1FOBA 1H7NA 4BF5A 1DJNA 4QSHA 1UWQA 1ICSA 4BQ2A 3U7BA 1DWJM 1AL8A 1VEPA 1CCWB 2A6NA 1VBHA 3I68A 5BOEA 2YL8A 3S1VA 3ITVA 1ZL1A 4ZB0A 3LLFA 1CGXA 1XRVA 2FJKA 3LXAA 3AQUA 5ECUA 3IJ7A 9XIAA 4ADSA 1Z9AA 3W7LA 2CBVA 4E6MA 5HQLA 3OLEA 4I9AA 4F0KA 5D02A 2Y85A 3ZJKA 3LBMA 1RLCL 1VBRA 3W7IA 1IEIA 2WJDA 1S3TC 4NI8A 4JTAA 4XWUA 3KDOA 4Q22A 3BG5A 4EAYA 3TYCA 1AW2A 4DJED 3WJYA 1TJ0A 4AD2A 1GYLA 3NA8A 2OB3A 3MKKA 4GCXA 2PRLA 1FH9A 4AD3A 3PBWA 2Y7EA 2Y62A 3SCUA 3TLQA 4JTIA 4RE0A 5A6SA 3RJYA 3E74A 4OIFA 1T41A 1XLLA 1VC4A 2BY1A 1E40A 1OD8A 1VQTA 4UTTA 3LN3A 4M6QA 1Q6QA 5M03A 4O18A 4PCTA 4BF7A 3RO6A 1XINA 4RPQA 3FA4A 4QX4A 5C9UA 2Z28A 3VGEA 1YW1A 2QGYA 5K4XA 5IOBA 3LRKA 2PWUA 4UNKA 3VGBA 3F03K 5AFDA 5I02A 3HGJA 3M47A 3GVVA 2IKIA 1LCOA 1A0CA 1SYTA 1EWEA 1F07A 3C2VA 1EZ2A 3WF2A 3E2RA 3BOXA 4ROQA 3NAVA 1QHOA 3YPIA 1XUZA 1FH7A 3PAJA 1HXJA 1HO1A 3QGAC 3WLMA 2CXEA 3EXTA 2O55A 1RBLA 3QKZA 2CWNA 1ZS2A 2ZTJA 5CZTA 4GXWA 1FDZA 2XGZA 2DSKA 4AX6A 5D4YA 4CNTA 1W91A 4GFIA 4PTMA 2WQPA 2HBXA 1Q6FA 3CH0A 1TR9A 3FK4A 1U1JA 1QNOA 1B3YA 1QMLA 3PN8A 1C8VA 4REQB 3R8RA 4UQAA 2ZA2A 1TV7A 4B15A 4U3CA 4FXSA 3BJTA 1MNSA 4WJ8A 5A2BA 4GYFA 5H6HA 5FOOA 2HRWA 4L1WA 3SCWA 1GT8A 1XQKA 3GTHA 1KGWA 4GI4A 2E1DA 3A4AA 3W02A 2IQ0A 4TO8A 1JYXA 4IP4A 4YWSA 2ZIDA 1X97A 1KFKA 4CQCA 1FQ0A 2QCMA 4HA3A 3AU6A 4HQVA 5HQMA 3WNLA 3Q4DA 3R0DA 4XAPA 5IFPA 2PDLA 4IISA 4P7RA 4PUMA 4Y2WA 3S1XA 3HFTA 2D1ZA 3N13A 3ZLHA 1XYCA 1TPUA 3GXNA 1NH6A 1JZ5A 3KBJA 5CJ5A 1FFRA 2E25A 2PDGA 3CWOX 4PEEA 5FAGA 5KITA 3G6LA 3M9YA 2OSWA 2UWFA 4NRRA 1H1YA 1LWJA 3UD6A 5D37A 5BZAA 3P67A 4LVDA 4CCDA 4JDBA 2ISVA 1R3WA 4MHBA 9CGTA 2CBUA 3MUY1 4O10A 1TR1A 4KWWA 4LW7A 1K7FA 1AVAA 2DZVA 1WE5A 3L7RA 4UCFA 5AYXA 1BXCA 4UQ9A 5C7HA 3A4JA 1M04A 1LP6A 4JBRA 3H6OA 3EKGA 2GSJA 1J5TA 3ITLA 3UY8A 2Y1HA 5I0DA 1WXZA 1JYWA 1NDWA 4DLMA 3B06A 3S6TA 3TXZA 4LXFA 2ICSA 2FB2A 3CM4A 3MA8A 3L65A 1F3EA 1JAKA 1SSGA 1WUEA 3MMWA 4ACYA 3UVAA 4GX8A 5FEPA 4FALA 1VFOA 3MS8A 1V77A 2HMCA 3QV7A 4KCTA 2V30A 4R53A 4HOWA 1BYDA 3LXBA 4EPEC 2X0YA 4GACA 4D71A 5JVLA 1SFTA 5IHRA 1LQ2A 2W91A 5FESA 1FXPA 3TONA 2YLAA 4IPJA 4B9ZA 3W6MA 3WUFA 3IIVA 4F3HA 1UOZA 4RR4A 2FGZA 4J3XA 3ALGA 4YYFA 1SFSA 3UGVA 3P60A 1K3UA 3B05A 1HJUA 1JPKA 4L4LA 2O7QA 4C6DA 4XVDA 1W9VA 3TXVA 3R10A 3IVSA 3AJ7A 3IRDA 3MSDA 5BWAA 2F2KA 1DJYA 3GC4A 2ZWYA 3HO8A 5E0CA 3S5ZA 2QW5A 3AXMA 2BHZA 2DFAA 4DB7A 3COTA 1KXQA 3SFWA 1GZJA 1DXIA 4WDTA 1KRBC 1IE7C 3UWWA 3WFZA 4AWTA 1VLWA 1U5JA 1VENA 1S2WA 3TTYA 2VGIA 3IJDA 3RRXA 3EGJA 1JCTA 5CGMA 3CQHA 3G0XA 3UU0A 5ENLA 1DL3A 1K8XA 5KTLA 3GNDA 1UMYA 3GVGA 3POHA 3OZOA 4U4MA 2OU4A 1UQYA 1W37A 4BQ5A 2WSRA 3VXGA 3M0JA 3WH5A 3H4WA 3C56A 4DJEA 3S1GA 3NURA 3TV8A 4Q8TA 4L9XA 1UW9A 2DT2A 4G1KA 3L5AA 2I56A 4L9YA 2VM8A 4AXKA 3WSUA 3UERA 1ZBCA 1CW2A 4WDXA 1XYMA 4QE5A 1BWKA 2EXOA 2DIJA 1AQFA 3N15A 4L56A 4LUTA 3MI3A 5HINA 5CG0A 1GPWA 4GQ0A 4O0KA 2W63A 1POJA 2DW7A 3RPDA 4CNPA 3WQVA 5C8BB 2QUUA 2EG7A 3PBMA 1GOMA 2W3ZA 3O15A 1AQMA 3E3HA 1PX8A 4E0CA 3BGAA 2WZIA 3FXGA 1YHTA 3C2OA 4KWVA 4TMCA 2PTXA 4N9CA 4OECA 1W3TA 3S8HA 1W54A 3JUGA 3GDLA 2X1UA 5IDZA 4V33A 5CLWA 3T55A 1VJIA 5FF4A 3GDBA 4CN1A 4MJ4A 2CZEA 2CLMA 2CHRA 5LYRA 2E6YA 3TQ0A 2FKPA 1H60A 3U9IA 1BSIA 3IK4A 1VH7A 3B8SA 3HA1A 5CPSA 4HP5A 4NIRA 3QY6A 1ZRQA 3KP0A 4Z42C 4ADTA 1OK6A 4Z08A 1QO2A 1YIXA 1UD6A 4B4HA 1D7KA 3TKFA 3ARXA 3S9ZA 2YR1A 1A5AA 4BK9A 4RXFA 2DW6A 1T7LA 2ESCA 3O1NA 4S3BA 3MUCA 1F2JA 1MW2A 3QH2A 4HN4A 1UR3M 3WENA 2YIHA 4CQBA 3WEZA 1UZ1A 3WJXA 3S1WA 1Q5MA 1VB9A 5HANA 3G18A 4DJDC 3ZOAA 1EJXC 1WDRA 3T9PA 1W32A 1MZHA 2VC9A 2BY3A 3FEMA 2X09A 4NYUA 4IFRA 4KPLA 2OWXA 4DAFA 1YBQA 2F61A 4B5TA 3VC5A 1EQPA 4ZXLA 3PPHA 1SFLA 5GJPA 1PAMA 1ZBWA 3EKLA 1XIHA 3CZLA 4PCSA 1BWLA 1FWHC 4KETA 4H6EA 2CLOA 3PZGA 2VD9A 4H9YA 4PMZA 2C91A 3VFLA 3GR4A 1W9UA 3CLMA 2G3MA 1FVPA 1Q85A 1QCWA 1O1ZA 5C9ZA 4GBDA 2V69A 1SZRA 1PIFA 1W9PA 3PZNA 4M0XA 3B0VC 1JPMA 3HGSA 2QCFA 1V7YA 3B8IA 4XK2A 1TPH1 5G1MA 3TUUA 3EBVA 1BAGA 8XIAA 3FX4A 2OSYA 2C8NA 2XWEA 2CESA 5AC8A 3GIPA 4C91A 4GY1A 4GCAA 4H7VA 3IGHX 5LHEA 3VIFA 1O5XA 1YTDA 4CD8A 3M5XA 2O92A 5BCAA 1BLIA 1U1HA 4OVXA 4Q4SA 5EBAA 2PP1A 3CMFA 4ZEPA 1PKLA 2X7VA 1R2SA 4IHCA 1JIBA 4TXEA 4TR9A 1B2YA 2ZZ2A 1I60A 1K9FA 2HPMA 3DC0A 1XLEA 3VNIA 1PL9A 3NIYA 4PMXA 3LCXA 4GG9A 5HMSA 2R82A 1KTCA 3BZJA 4XTIA 4ZE4A 3VOFA 5C70A 3FOKA 3N2OA 3RK8A 1KM2A 2WVSA 3LM7A 3T05A 1W17A 4KWOA 2G96A 2FIQA 1CGYA 2YL5A 2VEPA 1DOSA 1Q4NX 3U6WA 4OV4A 3GQYA 1YYAA 5I79A 1O95A 2Y63A 3UR2A 2V82A 4FB7A 4WSKA 4QDMA 4KERA 1W3JA 5DT5A 2ISFA 4GH1A 2Z6IA 2YSWA 2A4AA 3EOLA 1IR1A 4U10A 1XKJA 1F5ZA 3HB9A 3ABXA 1XD1A 4O15A 1DWIM 4W84A 1Q2SA 5AECA 3K5XA 3WMCA 1UKOA 3WNKA 2YFOA 5J5DA 3LGGA 1EBHA 3KE0A 1BQGA 2XH4A 4CCCA 2QQ6A 3ABOA 1IF2A 4RZ5A 1BVWA 2OLAA 3GXMA 3LQLA 3BCDA 3MTWA 1G4EA 1XW8A 2VR4A 1OGSA 3DOPA 4ZQPA 3CTLA 3EWBX 3GC5A 4BS0A 2WAGA 1UUMA 1JZ3A 4B5XA 2ZUMA 2J78A 5GVJA 4C6NA 2CKRA 4ZSUA 4CD6A 3O6CA 2OSXA 4UC5A 4DZIA 1BRLA 3EWYA 4BCEA 5HPCA 1E0WA 4JKKA 4RX0A 3G1AA 2TYSA 4KBXA 5CEWA 2AL2B 3MB9A 2WKLA 3W1PA 5LIKX 5TAOA 1TJPA 1DJZA 4E5TA 1Q6EA 4JCMA 3VI2A 4AIOA 2ZRVA 2D0HA 3SRKA 4RKAA 4JKLA 5KSWA 1EPXA 1SZEA 3CASA 2VEGA 1S5MA 4J3TA 1PCWA 1OHLA 2QV5A 5CZKA 1WUFA 1M01A 2UZ9A 5HMEA 4MJMA 3GSMA 5C7VA 5DF0A 4BF9A 2XZ9A 4NJGA 2EPHA 3TJXA 3MSGA 2PDWA 1RHCA 4Y9NA 1MDRA 4PEKA 5D32A 3BE7A 4HNNA 4G7FA 3E5BA 2PA6A 1KR0A 1XH0A 1S2TA 5IHSA 5JBDA 1A5BA 4JOMA 3GZ3A 4WZHA 2QPUA 4PB4A 1C7SA 1RVGA 3KVKA 4US5D 1TPVA 2OODA 2QULA 1H2JA 1ISVA 3H4GA 3WMLA 2Z4GA 1IXQA 3SCNA 2GDQA 3UPBA 1MUMA 1A5KC 3MYPA 2WMFA 1JG9A 1A80A 4UMCA 3HJEA 3L0KA 3DFQA 1V4YA 2J74A 4R33A 1OADA 2ONEA 1OM0A 1OX4A 2Q3OA 2E5CA 3AIWA 1UC4A 4DPPA 3B97A 3LCHA 2DUZA 3WBYA 2NV9A 4FEZA 3RX4A 4RE2A 4I5XA 3TNOA 3UG4A 4KQNA 3C2RA 2WYSA 2YW4A 1KBIA 3GDKA 3LUTA 1L8PA 3KZPA 2GWGA 3E96A 4V1YA 1QK0A 1CXHA 4FXRA 3BARA 1IWPA 4TU1A 5A6AA 2Y8VA 1ONEA 2FZ9A 1EC8A 1VEMA 2FMOA 1BSLA 4F0MA 4P5UA 4IIFA 2X1IA 5D2VA 1ZJBA 5AVHA 3C6CA 3OZMA 3EDDA 3D3AA 3W84A 1C8YA 3MDWA 1XLFA 2PODA 3LNPA 1BGGA 3V7PA 5FKYA 2R6OA 3AMGA 3WQ5A 4HMDA 4N9DA 1D8WA 1ZQ5A 3VGFA 2PDXA 1TE6A 4K36A 4HMCA 1KO0A 3ZZ1A 1XGDA 1LWIA 2WVUA 4RZ6A 1O7AA 3OLIA 4NUWA 4XO7A 4FLRA 3APTA 2OT1A 1E5JA 4GBUA 1KM1A 1F3XA 2MANA 4P7OA 3QC3A 2CC0A 3ARQA 3CV1A 4H9UA 3KUMA 4LF2A 4S3JA 3RN6A 1K1DA 1TE1A 2AGTA 4ORMA 1E4NA 4TIMA 2QJGA 4E2BA 1LTDA 1TUFA 1ALDA 2Y5SA 1VJSA 2BOEX 4C6MA 4J2MA 1C29A 4HHLA 2VVSA 3PSVA 2YJQA 3OYXA 2X42A 3DI1A 2G50A 3LNMA 4UR7A 3GNNA 4HHHA 2BVDA 3PWAA 1XPGA 1G4SA 4JQAA 3IWPA 1TMHA 3SAZA 1W1YA 4UBPC 1PEZA 4C6EA 4PCNA 1KXTA 3U2ZA 1YXCA 1DORA 3WNNA 1GG1A 1N8WA 1ONXA 2VFDA 1IZKA 3TWBA 4ZB5A 2XINA 1DJXA 3W7GA 9RUBA 3QR3A 1HVXA 2PP0A 2VKZG 4Q8UA 1IZCA 1JULA 4KIRA 2DVXA 2X8RA 3PUOA 4J3WA 1O5RA 5ABEA 4OU1A 4IFOA 2D24A 4KEZA 2ACQA 1UIOA 2V3GA 3VGGA 3Q94A 4RW3A 5EMUA 4H7CA 1WKEA 5HA7A 1NOFA 2GGIA 2PDQA 2YA2A 3GE7A 3NDOA 1FP9A 2Y5JA 3AYSA 4C65A 4ZL1A 4W7UA 2WJZA 1I4NA 1F6YA 2HS8A 2QMJA 2V67A 4GK8A 4JFWA 3DYPA 4LAZA 5JH1A 1EJSC 2P0IA 3O63A 3VPLA 5F4XA 1EC7A 4M5PA 3GX9A 5C2GA 4PUEA 1UD3A 4Q4RA 1HL8A 1B9BA 1Q8JA 4FSAA 1NJJA 1L9WA 4AVOA 3REQA 3W76A 2YZ5A 2OX1A 3GDMA 4LBUA 3U5UA 4JYDA 3V16A 1W6TA 3NQMA 3AHTA 4QG8A 1KKRA 2ZDRA 4RDVA 4WDWA 3MPGA 4GC3A 1PKNA 2E7FA 1VP5A 3CB3A 3AHXA 4UOJA 1ESWA 1MNZA 3KBVA 3TW6A 5HWNA 1TTPA 1XM3A 4LV9A 2HPIA 4C7FA 2ZUTA 4H19A 5L6UA 2O56A 1RD6A 1RP9A 4OJYA 1VCGA 1A5LC 2E6FA 1CXFA 2JEQA 4BKNA 4EF9A 1HP5A 4HTBA 3A3WA 3QV8A 3GBDA 4KW2A 4MGGA 4IX2A 2QCNA 2WZTA 1JD7A 5IBXA 3KXQA 3UZWA 1OEPA 2Q6ZA 3LLDA 3EA1A 2AAMA 4US5A 2CZ5A 1Q7ZA 3TOYA 4GWEA 4NY2A 4YNGA 2XISA 2WSKA 2J9YA 3V36A 4GZEA 3TWAA 2OQLA 5AN7A 3OG2A 3THUA 4D2JA 5D9MA 4YTSA 3F4VA 2YBTA 3RCNA 3L0GA 4IPNB 4MUPA 4GNKB 1A3WA 5FL1A 4J40A 3S2NA 3WQGA 1XG3A 2W92A 4KRTA 2OXNA 3CV7A 4JL1A 3W6YA 4EWJA 2OT0A 3WF1A 3FYYA 1J0KA 1JI2A 1XPYA 2WHKA 2OZ8A 4XUYA 1S39A 1VIWA 4LUSA 4I6KA 2FB3A 1NDVA 2PB1A 2J7CA 3HQ1A 1KLZA 3AYRA 3TTSA 4LS2A 4L64A 5A8OA 2W0UA 4DF1A 1XIIA 2EPLX 1JL8A 2ZRUA 1V6TA 1OY0A 2HK0A 1I1XA 3SFKA 3W2KA 1EJVC 1VFHA 2V5DA 1F73A 1UH4A 4DWSC 4P61A 4QGCA 3LBCA 2ON3A 3R43A 1LOLA 3UCDA 3SN4A 4JX6A 3QVQA 2XFFA 3VVGA 4FAMA 1UR1A 4JL2A 1HX0A 3AUJA 3JW7A 3ONCA 3WEOA 5T8GA 1AZ2A 2C16A 1HGYA 4TUFA 1F6PA 5FF3A 1WYIA 1M1BA 1W5PA 1O68A 4RK8A 5AYIA 3SRDA 3W07A 2QCDA 3WELA 3C2YA 3VD4A 1A3HA 6TAAA 1J18A 4R5EA 1MW1A 3M0IA 1CX9A 3ZT7A 1V7AA 1M6JA 3EZ4A 4WKHA 3MZ2A 4N6FA 4D8LA 4BI7A 1K77A 5KZ6A 2PURA 2FHBA 2PD9A 1TELA 3UJFA 2CW6A 1E72M 3P61A 4D8ZA 4B90A 4GYPA 3THDA 2PU1A 1I6NA 1TO3A 2X40A 1JI1A 1PB0A 2JGQA 3VA8A 3VGDA 1DWFM 1A5UA 5LZLA 3DKJA 1CT5A 3II1A 3WLKX 3R2GA 1LT7A 1VAHA 3PBVA 2NV1A 4LTSA 4QNWA 2WMKA 4GYKA 4Z1BA 4LH8A 1V6UA 2H8ZA 1GTEA 1F7BA 2Z24A 4G7EB 3W7RA 2VX4A 2F7FA 3VTRA 5C55A 1KCKA 4LVFA 3WDQA 4ZFMA 2J7EA 3FLUA 1E4IA 1B1YA 5A69A 1Q6LA 2D3NA 3PUDA 1XRSA 2FH6A 1G69A 2ZXDA 1NWRA 4KIEA 1EEXA 3C5QA 2ZXBA 4O1CA 2O4QA 5FL0A 3S42A 4UFIA 1EZWA 2Y88A 3TIMA 4HOZA 4JN8A 3PNUA 4JN6A 1YE4A 2BHYA 3HURA 4HT3A 3EPNA 4LCSA 2C7FA 1ZPTA 2ZYFA 3ZXWA 2RH9A 5JU6A 2NVAA 4GYJA 1IHIA 1E43A 4OHQA 4H8HA 4EF8A 1WDQA 1B9ZA 4YIWA 4F0RA 3AHVA 4A6GA 4HSOA 1QATA 5A2CA 1PYFA 4AYSA 5HNTA 3LCLA 2XYLA 3WJSA 3F2DA 5GJNA 4RCXA 4Q8QA 1W1B1 4M6VA 3CUGA 1W31A 3IV3A 8A3HA 2A2IA 4OUIA 1W8GA 3NSNA 3TR2A 1M9HA 4ZO9A 2QMKA 3GAKA 3QQ1A 4RDZA 1HZYA 1MMFA 3M16A 8XIMA 4D9PA 3DENA 2ZFAA 5CPQA 4JD4A 3LD5A 1J01A 3N2CA 3W2LA 3MO7A 2Q8XA 1Q7MA 4HYWA 3S2CA 2NX9A 4BQ4A 3P3BA 5AHEA 4J3VA 2ZX5A 3ZR5A 2V5JA 2JKAA 5LIWX 3P93A 1NFBA 1GVEA 1R30A 4I6VA 2XH2A 3B9AA 5TD4A 1S5NA 2AKMA 2NXHA 4FX6M 1B4KA 3AI0A 3UFYA 4K1GA 2WW5A 5T91A 2EQDA 2G4JA 4XSMA 3FGCA 3K8LA 3LTPA 3AS1A 2Z25A 1OX6A 4ML9A 3EDFA 2B7OA 3V0SA 2FVMA 1TPWA 4IIHA 5C9RA 4TVUA 4DZHA 2QJIA 1QFEA 3PAOA 3TCEA 2GUYA 5FAJA 3FVMA 1OFQA 4YL2A 2D2GA 3WD0A 2QCHA 4CNUA 3TVAA 3A4XA 3T0TA 1KCZA 1KM0A 2ZC8A 1GUVA 5T26A 2XGIA 4AEFA 3WQEA 3DFHA 1BKHA 4XIAA 4W8AA 3KP1A 3ZSTA 1V79A 1AODA 2E5BA 3MMTA 1P7TA 2Z1SA 5ABFB 1GORA 4FIQA 3BK0A 3IIPA 3TYEA 3URNA 3UCQA 7ENLA 3LA4A 2XSAA 3SCOA 3WLHA 8RUCA 1Z8AA 2E6AA 3EYPA 3VAVA 3KBWA 3LMYA 3QMRA 4PYSA 1H7OA 3FSUA 4B4FA 4JHOA 3N73A 4FNQA 4E38A 3G1DA 5HOSA 4IICA 3HPXA 3NOEA 1G4PA 1XG4A 4D6FA 1QW7A 2GK1A 5I2UA 4H3DA 1X1ZA 3GO2A 5D03A 2EF9A 3KOWA 4MZYA 2HXTA 4HNTA 2NT1A 3DFTA 3SZ8A 1MO0A 2GVJA 4HK5A 1J0HA 4AY1A 4W9TA 3MSRA 3WY1A 3VKAA 3PZVA 1FBAA 1DHPA 2QDGA 3RGTA 4GO8A 7REQB 3BLPX 1DQWA 3VCCA 4UTTC 3AWOA 1OQFA 4BJHA 3KVJA 3TP4A 1XLDA 3H2FA 3WUGA 4EAMA 1RVKA 3D46A 4AHQA 3N34A 4NI3A 3M0YA 4L5ZA 1FP8A 2GVYA 3FKKA 4ALDA 2DZUA 3DC8A 4R88A 2A3HA 1U33A 1UUQA 5GJMA 2XHYA 2OPJA 3NVDA 1WBJA 2EKCA 3AIUA 4KFPA 2CHNA 3W3OA 1CDGA 2YDSA 4JTSA 3WZ0E 1PTGA 3DIPA 1VR6A 1QAPA 4QP0A 2RJGA 2OLSA 4F66A 2BXYA 2EPMX 1KBKA 2ZX7A 2VXNA 1X6NA 1MUWA 4Q4QA 4WK9A 3WNPA 5LA2A 2Z6JA 1B5TA 1M7JA 5M1TA 4UFMA 3OIHA 1HJSA 2REQB 3TQVA 3OZPA 3G24A 3DHPA 3S46A 2J7BA 3O16A 1XBVA 4IMDA 3G1SA 3QZEA 2CETA 3BH4A 4CU6A 2XFYA 5D8ZA 4NZ4A 3LZ3A 2NWRA 4XX6A 4NZJA 1XDJA 1U5VA 4LEQA 3DHDA 1GQKA 2XVNA 3QHNA 2VL4A 4ML4A 1EH9A 1VHNA 1KKOA 4JTLA 4PFMA 2QLYA 1SR0A 4EWND 4PBGA 2VFHA 3H8AA 5C6MA 3MVTA 1TWWA 4FNUA 4XZLX 3EDJA 1HKJA 2WMIB 1Z6KA 3TC7A 4RZBA 2PWGA 1W5NA 3SO7A 5IM51 1S5VA 4HA0A 3RFAA 4D6CA 1PS9A 4FXJA 3UR8A 1E70M 4FLSA 2UY4A 3DBPA 3R13A 4DBDA 1UWAA 1V51A 1QNSA 1QW8A 1KFJA 1CGTA 4LRTA 4XG1A 2OZ0A 4UNIA 1EFZA 1UP2A 1BF6A 3UF9A 1ZFJA 3HF3A 2NT0A 1PWLA 2D2HA 2VOTA 3S5NA 3VX1A 3UNDA 5CAHA 4HBKA 3WCZA 1S38A 4DJFD 1QOQA 1ADDA 4UR8A 1C91A 1DKWA 3QJAA 4QNEA 2GGEA 2QAFA 1UB3A 4NX0A 3PZUA 3VE9A 3OOQA 3VMOA 1JF6A 2WVTA 4KEMA 3WDJA 1ZBKA 2ZBTA 4LANA 1US3A 5E70A 2AKZA 2J8FA 1DWHM 3AMLA 4AF0A 2BDQA 2QCCA 1T0OA 1J5SA 2VWSA 3NSXA 2V38A 2AQWA 1ZLPA 4XUGA 1P6BA 1GPFA 1K4HA 3G3MA 3VNJA 2ZICA 4W85A 3NL5A 4FZIA 2OEMA 1SJBA 3T1GA 3NQGA 1NF7A 1THFD 1UZHA 2QGHA 5CC6A 2ZXAA 4MWAB 1EKOA 4WSHA 2OYKA 3FA5A 2Y7FA 1TSIA 1DIEA 1QWGA 3USBA 4N0RA 3THAA 2V6AA 3OIXA 3W1LA 3TC3A 5A6MA 3F2BA 4GY0A 3TSBA 5AYYA 1U83A 3B8TA 1KGUA 3OVGA 3ARUA 4UR9A 2F38A 4DX3A 4UOQA 1BVNP 4Y9MA 2WJFA 4A05A 4RV8A 4PMQA 1JQVA 2W4XA 1K7XA 3IARA 2HVMA 3LHZA 3IANA 3DGRA 1XJBA 1F8MA 3N4EA 3WN6A 1S5WA 3OPSA 1OG0A 3NQ8A 3WFLA 3MT1A 4NKCA 2WMGA 3R1ZA 1GW9A 4PTNA 1WXYA 2E67A 4NT0A 5H8MA 3W7NA 4NF7A 1MXGA 3G3DA 4H8VA 1RAKA 2PWDA 2VR5A 4S3GA 3ABSA 3SUTA 4KFOA 3KS5A 6REQB 3ZQ9A 4Y6GA 2PD5A 2PLKA 3KOZA 1R9ZA 3MUZ1 1YMYA 3ME3A 3G0SA 3ZYZA 3N17A 3KVMA 1Q66A 1QW9A 1K8YA 4QLJA 2KX9A 5D9PA 4JY8A 3TK7A 3R8HA 2YB4A 4JTFA 4QG6A 4TVCA 2OGYA 1UMLA 2YYUA 3PPFA 4HYVA 4ORIA 3IVTA 3RM4A 2L5HA 1XYZA 2P76A 4HZ8A 4AZCA 2VENA 2V5KA 1B4EA 9XIMA 1MQPA 2HTMA 2W6RA 1PJ9A 5DXXA 5MHBA 4DJEC 4K38A 4N02A 2Z1WA 4DBWA 3ITYA 1XGZA 1XYAA 4XAZA 2HWGA 2ZA3A 3G1HA 3STCA 5I5RA 2OQYA 4GISA 4RUBA 1NDZA 4Q4KA 3ZLGA 1AZ1A 1F4HA 3O7UA 2ZZ4A 1CI1A 2NUYA 3OODA 4GUJA 4JGDA 1X8FA 3LPFA 4PODA 5HQEA 2QDDA 5DCBA 5G5IA 1BHGA 4PN2A 3RCMA 1SZNA 4GC4A 4OBRA 4XSLA 4E3VA 2EBNA 3N1AA 4S2BA 3CT7A 5EPDA 1UZDA 2JE8A 1TUXA 2WPGA 4MKNA 4ZOBA 3S5YA 3CU2A 2BP1A 2NSXA 4GVGA 4AY8A 3RLVA 2PTZA 2YCKX 1JDAA 4DI8A 3R0KA 1TMLA 3S4TA 3VOGA 3PM6A 1RCQA 4TV6A 1ZCCA 3XIMA 1QBAA 1ME8A 2G37A 2P3EA 3P7YA 3MI6A 1ZP4A 1ECEA 3AROA 1DE6A 5U4NA 2E6DA 4PTWA 3WK3A 5CGTA 3F4CA 3LCWA 4CQDA 1VBGA 1E3ZA 2P5NA 5HUOA 2DT3A 4PTDA 1FA2A 3PTMA 1RK5A 1OG6A 3TYAA 4AAJA 2Z0IA 3VKJA 2PLMA 2WNQA 3G1YA 1DP0A 2GL5A 1OB0A 4R9OA 2J6XA 4K68A 2J6VA 4QJ1A 3AMCA 2WZHA 3FJLA 4HU8A 5DBUA 1UCWA 5K3VA 1EC9A 4LAMA 1L6WA 4LEFA 4O1DA 3SR7A 1Z69A 5C2XA 3GUWA 3W23A 3MBFA 4AFYA 3S9IA 3IV8A 1P0DA 4MWAE 3MU7A 4JFSA 2VWTA 5FJTA 3KRBA 4RXGA 2NUXA 4S3DA 4B3ZA 3VMNA 1SM9A 5CSRA 3NZPA 3QY8A 2VUYA 4Q4MA 4JR5A 4H7ZA 3ZVHB 2X41A 3V35A 4IWWA 4DXKA 1IGSA 2PDPA 1OCQA 2W66A 1J12A 4GKLA 4CKQA 4YHEA 5FEWA 1GCYA 1NP2A 4DJFA 3BMWA 4ZCWA 2FYMA 3NXLA 4GQRA 4WF7A 1LQAA 2YA0A 1EWDA 4K8EA 3PHAA 2Q8ZA 1OFRA 4MY9A 4EE9A 3F5KA 4L80A 4DRSA 4JIEA 4NG3A 7CGTA 2VFFA 4M82A 2G4FA 3VOHA 2WHJA 2TMDA 3WF4A 2QKFA 4ZQNA 4H01A 1GW1A 3BAJA 2A7RA 3GDRA 4HZMA 3VNMA 2H9AA 3GY1A 1ENUA 1CXEA 4QIUA 1UR8A 1J0IA 1KBBA 2GJRA 1Z42A 3WF0A 3E49A 2DP3A 3LGDA 3EWWA 1E0VA 4HCLA 4HPXA 1E5NA 4MPQA 5F2MA 3VNZA 1K6WA 2ZE0A 3EKZA 3RUBL 3MCOA 2BXZA 1L6YA 4UTIA 3CZ8A 4TQTA 4IPIA 4ERAA 4GQQA 5MF5A 3UZJA 1TA3A 3OB8A 3PZ9A 3NCOA 4S3FA 2DVUA 3RU6A 2X1SA 4OWGA 4WX2A 3PG9A 1HJXA 1OIMA 4JHZA 1J6OA 3CL6A 4ZE5A 2GVGA 5T9CE 1GZ1A 2NQHA 5F1UA 2ZZ3A 3CYJA 1T40A 1WOAA 2JF6A 5AHMA 4KF1A 3UXDA 1AQ0A 4YVPA 2SFPA 1EYWA 4AD1A 3NYDA 3RU8X 5D9OA 4D1JA 3RM9A 2WLZA 3T0BA 2PCQA 4Z1YA 1R3YA 2VOMA 4WQ6A 3BLEA 4B5UA 1UKPA 3ZWTA 2QPSA 2DVTA 4TV5A 3PZTA 1IIHA 3H2AA 4W89A 3P80A 4OQVA 1UR0A 4Q4PA 1X1OA 1KWGA 4TVDA 5EYWA 2PWHA 4RNHA 1KTNA 3A13A 4KKXA 1GOOA 1UUOA 4WGHA 3OLGA 2UY3A 1JZ6A 5HJYA 2NQJA 4FPSA 5HNNA 4YU1A 1TZ7A 4IL0A 5JQ9A 1ZZMA 3LPOA 2XH7A 2WCGA 4ROPA 1Y65A 3P82A 2GGJA 2Q09A 4F0LA 4Q3MA 5ABTA 4ATDA 4G6CA 3BGGA 3ZWSA 2BVYA 1TPFA 1R7OA 3RMEA 1OCJA 1UH3A 5FEXA 3EPMA 3F7JA 4O1EA 3WQ4A 3C0QA 1WCGA 4MF4A 1QNRA 1C9DA 3G1RA 1LRQA 3CAKA 2RFGA 3KTXA 3QLLA 1HGWA 4X60A 1YPFA 4Y8FA 4AIEA 4J3SA 1Z7AA 4DZ5A 4DELA 4KGJA 1IEXA 3ITOA 4GVFA 4IP5A 5H8UA 4E8GA 2F84A 4IXXA 5K2ZA 2OZ3A 3WLSA 1KXVA 3T0AA 1FKXA 4HVXA 5U7SA 3T78A 3C61A 5HMDA 1M65A 3C8NA 3TEVA 3S5OA 1OFAA 4BI5A 1HJWA 4FX8A 2DZWA 3ITGA 3SSJA 5BXPA 2BODX 4FOKA 3GBEA 3CUIA 3W1RA 4CQ9A 2RUSA 4CEUC 2C1IA 3RMJA 2Y89A 3E1F1 3SECA 3IAQA 4LWWA 4GY7A 1QBBA 1XF0A 1KM4A 3P6LA 1XQLA 1DBTA 4FLQA 1LYXA 3KRZA 4PRTA 2VEKA 4EXBA 2JIEA 4PRRA 1DXEA 1LBFA 1JCLA 3QRHA 4REQA 1KFBA 1HKIA 2ZVIA 2VI0A 2XM2A 4MPKA 1U5HA 1P1MA 2WWDA 5C54A 4HPGA 1HKMA 1M53A 3E9AA 3OBKA 3LXCA 1WDDA 3LSBA 1TCMA 4LUJA 7PTDA 1MW3A 3UWZA 1EGMA 4S3EA 1T5AA 4X61A 3AXKA 1KM6A 3BANA 2OR2A 1EX5A 4ACZB 1BTMA 1RSCA 4LCQA 3T0DA 1IQ8A 2PDMA 2J13A 2B31A 4LGXA 3LMZA 3NL6A 3T8LA 3R8GA 3GG8A 1DWGM 4WXZA 3I10A 4XBSA 2BOFX 1B0IA 4EIVA 1TWSA 3K1DA 2GDUA 4XV0A 4KS0A 4UZSA 3CUXA 2QDEA 3J7HA 2IPJA 1G5AA 2CLEA 1EUNA 1NTHA 3KOXA 3WD2A 3NR0A 4AC7C 4IJBA 3QQWA 4NAEB 3NQ2A 2J8GA 3L4VA 1XICA 1PDZA 4QISA 1YTEA 2ALDA 4LVBA 4GGHA 1AW5A 3VIHA 3TFCA 1E9IA 3W00A 4Z0JA 3CAVA 2VFEA 2QUNA 4AHPA 3VD5A 5A8PA 1GYMA 3SQSA 5LNUA 4XBKA 4JZ5A 2DH3A 3DECA 3IJ6A 2HEJA 3ES8A 1LG1A 1Z32X 2I16A 3W7MA 3Q65A 2A7NA 3TN3A 2PWEA 3I3DA 4WCJA 4NZ5A 4J9JA 3WYZA 1PHWA 5B80A 4HOXA 5XIMA 1SO4A 1SJDA 4PZVA 4GHRA 3UT0A 2VEMA 2NVDA 4KCWA 4L4MA 4U2ZA 3N4FA 4GH3A 1KBJA 1BGAA 4NZFA 1XBXA 1GTHA 3INPA 4BEUA 2EPOA 1WDPA 1GEHA 4R3UA 5BOOA 3BOLA 3O06A 3VCNA 1MW0A 4AD0A 5F2GA 3GR7A 1BFNA 4A3RA 4HPNA 3ZSSA 3QYSA 1TWZA 3RF9A 6ALDA 1PIGA 3ZR6A 2XDFA 2F9RA 2XVGA 2PS2A 3C2EA 3GC2A 2ZKMX 5FEZA 3UQNA 4XB3A 2WLYA 4C6OA 2FVKA 2VHLA 1QXLA 4MM1A 1YNYA 4G1NA 1K7EA 4PBFA 4DQWA 1EO7A 4MFEA 1FFQA 5LKYA 1ICPA 4RW5A 5AHFA 3WK0A 3O9NA 1E1CA 1RPXA 4DO5A 3AMDA 4LSBA 3SB0A 1HQTA 3N14A 1TPDA 2QZRA 4P7QA 4Z2IA 4X9YA 1DJWA 1LG2A 2NZLA 4FO4A 1EA0A 1A5MC 4H83A 3CAQA 1E6QM 5A6TC 1XLCA 2IKJA 1PZ1A 2P50A 1JD9A 2Z2AA 1BXNA 1ZJHA 3ARZA 4CVUA 1BG4A 1F61A 1IZJA 2C79A 1C92A 3KLKA 3WLNA 3VKDA 1VFSA 1EL3A 3AXIA 1XIBA 3QSTA 1QPQA 4LYKA 3GXIA 1XP3A 5IRPA 3CTTA 4HN8A 4NX5A 1DV7A 3H2EA 4PTXA 3ECQA 4B16A 4K8HA 3WH7A 3NQ6A 5F1VA 3CIVA 1ADOA 2HJPA 2R91A 1JUBA 2IPFA 3LOTA 1OSEA 3WLOA 1XRTA 4IT1A 2RKXA 1IT7A 3VKBA 2QIIA 2WSYA 5DY2A 1ISXA 3QPZA 3OEXA 3NJ3A 2FZBA 2IXUA 1AK5A 1T8QA 2CPUA 1DJGA 5C2CA 3KAOA 4YMZA 2ZUNA 3I3BA 3S6OA 3GFXA 4XTDA 3B40A 3U0HA 3KVLA 4X2RA 2G3NA 3QM3A 1OVDA 3V0TA 3GIYA 1I45A 4F2BA 4NSBA 3RO8A 2NXIA 5JXQA 4V27A 4DIAA 3GS6A 3NDZA 5D8WA 8TIMA 2ZXQA 3DGBA 3E0FA 4A29A 4N4QA 2HISA 1GVFA 3H22A 3DG6A 2OCZA 1ZAIA 4LOCA 3GTXA 4PUKA 2INEA 4FA3A 2P88A 3A24A 3VIMA 1Q7QA 3VZZA 2DPEA 5FJUA 1MVYA 5TF0A 2DEPA 4PC8A 1BYAA 1LT8A 2INZA 4AUBA 2D73A 3GH7A 1DEDA 1ZB5A 4MNJA 1S2CA 1XSJA 2XIIA 5J5RA 5BMWA 3L4XA 2MNRA 3PVFA 3THCA 1XLIA 5IBXC 1ZJAA 2J7DA 3ABZA 3R6IA 3WL0A 1WKDA 1X8CA 5CZJA 3TR9A 1QUMA 4UFHA 3KBNA 2P8BA 5HNUA 4TMBA 1VCVA 5GQBA 3MKCA 1OFPA 3A4WA 2PDJA 4A2SA 3QN3A 4DO4A 3WX7A 4ZFCA 2ADAA 3VD9A 4MLRA 3AMKA 1XIGA 3N9RA 3VDCA 5HR7A 3WMBA 1I75A 2J7HA 2KAUC 1IV8A 1QI5A 4GRSA 2CERA 2ZZ5A 2HNEA 2FLIA 2V63A 5CQ1A 5BU9A 3ITXA 3LLXA 5I23A 3W75A 4JAWA 1L6FA 5I3FA 1P1XA 3WQ6A 4IIEA 3U4FA 3PBGA 2QJJA 4PL2A 1G6CA 2VX5A 4FR1A 2PC8A 3CHCA 2VP8A 3GTIA 1WA3A 2G0WA 3NQFA 2BNJA 3MO4A 2TODA 3NQDA 2IQTA 3WK2A 2EJAA 3BW3A 3M5ZA 4NILA 3VNKA 4XAYA 2CXGA 3OG3A 2GJPA 3PFRA 4JQ2A 3ZR4A 3VIGA 3CUFA 3EDEA 2ZCGA 3ZS4A 1A49A 1QNPA 3ES7A 3KCLA 4ZO7A 4W7WA 3MHGA 3WQDA 1MWOA 3S3GA 4PUWA 3AXXA 1RQBA 1TREA 3CK5A 2J75A 2Q3RA 4JFUA 3L68A 4YYCA 3BCFA 1XRFA 1Y5VA 1Y5XA 3M41A 1WOBA 4QJ4B 1Q6OA 3K46A 3KZSA 4N42A 3GNRA 3GXFA 5AHNA 3M1ZA 5C71A 1RJPA 1KA9F 4V2XA 4RPPA 4DVOA 2VRJA 4EXAA 4CD5A 4D6HA 3GDTA 3EOSA 3IGSA 3QW3A 4K8GA 4OUEA 3K2GA 4D6GA 2Y2WA 3GVQA 1M5WA 1YXDA 4OBSA 2ZUSA 5LA1A 2J88A 2XFWA 4JQ1A 4ECLA 2PDBA 2Q02A 4C5YA 1R46A 4AG0A 1LJYA 3BL3A 3OZYA 1A5SA 2FDMA 1BEUA 3EX3A 2YOCA 4GYPC 4H8NA 3V5FA 3CWNA 2CCRA 3VD7A 5XIAA 4GIYA 4P2VA 2J47A 4CUCA 1M41A 3AZRA 2PGWA 3W2JA 1X1NA 4IQDA 4P7LA 1JPHA 1GVYA 1R3QA 1K8CA 3PJTA 1D3GA 3DEQA 3CEUA 2RGMA 1VHCA 4V1XA 4L65A 2VFGA 3T44A 2V0TA 1B54A 3FDGA 4KESA 3MCNA 3PS7A 4GFSA 3W87A 2E9BA 1V02A 2OZTA 4A22A 2GFTA 1I2PA 4D6IA 1UWRA 3C8FA 4AEEA 4LUSB 4P8VA 5A3HA 1MRQA 3PK7A 4RLIA 1J0YA 2CLKA 1IYXA 1UKSA 1QASA 2HDJA 3SJ3A 3NPXA 2EKGA 4X9SA 3MHFA 4QJ5B 5D09A 1AJ2A 1V93A 2GJXB 1KWKA 2FQIA 5CXPA 3PP7A 2VJXA 4AC1X 1MEHA 2Y24A 3FSTA 1Z89A 3L0NA 4L6HA 1SW0A 1X7FA 2A0NA 3LM3A 2AL2A 1YLVA 1REQB 4RV3A 3ATYA 2BG5A 4AVFA 1I2NA 4HKPA 3ZMRA 1J10A 4YPJA 4F40A 4FHAA 1C93A 8CGTA 2ISWA 1YX1A 4MAVA 5CAKA 3GFZA 1X39A 1I0DA 2QCDB 5FJPA 4Z1DA 3TC6A 1UD2A 4X63A 3ENLA 4CCEA 1LOQA 4I8YA 4DN1A 2FDSA 3EXSA 3TZFA 3BLDA 5HJXA 2VEIA 2WWCA 3OA3A 3FS2A 3UG5A 1XCFA 4MAZA 4F9DA 1U1UA 2QYGA 4EOUA 1W1ZA 1SSDA 2I57A 2I17A 2R9RA 5F2LA 4UUIA 1AL7A 3HG2A 1XH1A 3TDFA 5CPLA 3SJNA 3GTFA 4RL3A 3BW4A 1VYRA 2B7PA 1QJWA 2PEVA 4WY0F 2ZZ1A 4MFDA 3W4RA 2PGFA 2YYTA 1ZAHA 1TZZA 3TTEA 3IGUA 4MY1A 3BO9A 4QDWA 3PB2A 1FWIC 5F4SA 2YBVA 1F9CA 1HW6A 4RE3A 1FWAC 5K9XA 3EWUA 1S5TA 5HXMA 1X96A 2QV4A 2BOGX 2OLHA 3OBEA 5F2IA 2CHOA 1GGOA 4J3ZA 1ZALA 4Q8PA 3DZ1A 2RDXA 2FPYA 3AAMA 1W3IA 3OO2A 3PR2A 3BLKA 1V03A 2KZHA 1T99A 3QMTA 1GKPA 3UZ5A 4S39A 3AIBA 5DCDA 1E9LA 1KW1A 3M43A 1XUUA 4FK9A 6XIMA 4EANA 1TYGA 1S2UA 4IUGA 1NF0A 2PRHA 4ERGA 4C7DA 3PB0A 4QLLA 3GWQA 4JS3A 4JFTA 3VO0A 4PMDA 3O2LA 4JTGA 3GU1A 4MNLA 4PB3A 1T8XA 4U33A 1QPKA 4S3CA 5A8QA 4X0VA 4NJKA 1XIDA 2ZZ6A 1G01A 2YB1A 4NNAA 4WDUA 1F3WA 1TJ2A 1PTDA 1BQCA 1KFEA 3URAA 4D72A 1OCNA 4H9TA 2PPGA 4A8NA 1G94A 4O1AA 1R9XA 4W4QA 5REQB 1UPPA 2VZUA 4XZ9A 4D6DA 4V15A 1XYBA 2X1RA 1AG1O 3DG7A 4CN6A 4AZ5A 2HQAA 5LXEA 2NWSA 3DH7A 4GQBA 2WBGA 2OOFA 4P7NA 3WO8A 1JZ7A 1FWDC 1IEVA 3HPZA 3F2CA 1XIMA 3QR0A 1KC7A 1R8LA 4WHBA 4M7SA 3W2NA 4JTCA 3CS2A 1ITCA 1UD4A 1KR1A 4AZ6A 3NQEA 3QTGA 3R25A 4O0ZA 3JS3A 3G8RA 4QM1A 1ADSA 5A1AA 3LRLA 4LUYA 2C13A 2E5DA 2VCAA 5HNRA 1V0KA 2BTMA 4EKJA 3FXYA 2XG9A 4NZ3A 4IPPA 2EO7A 1TMQA 2YZRA 1B3XA 4MUZA 3SBFA 3C0LA 3TFXA 3W9ZA 3WQPA 4F48A 3IVUA 3VUSA 3L66A 3SN0A 4Y8EA 1VLIA 4NP7A 3W27A 1W1VA 2PGEA 4US6A 1AFSA 4LS1A 4INFA 4ATLA 1A5OC 1J6PA 2Z00A 2C18A 2E3ZA 4JNZA 4HSNA 1PKYA 3VIJA 1YDYA 3H70A 2OKOA 2GGGA 5RUBA 2VGFA 4AWUA 2YBUA 1PYMA 5A94A 3LB0A 2C3ZA 3NUKA 2V3DA 2EAWA 5ABHA 3BC9A 3BLOA 4NNCA 5A2AA 4Y90A 4HSHA 1LF1A 3VIOA 1JCJA 4UTKA 2VCBA 3EAUA 3VIPA 3TCSA 4H2CA 1LROA 4HNCA 2WKGA 3O6DA 3DXIA 1YRRA 3NQCA 5H2ZA 1Q2RA 3JZEA 3GXTA