4XVDA

17beta-hsd5 in complex with 4-nitro-2-({4-[3-(trifluoromethyl)phenyl]piperazin-1-yl}methyl)phenol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
314
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 314
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xvdA00
2IPGA 4XZIA 4Q7BA 4H8NA 2PDJA 4LAZA 4JIIX 2R24A 1AZ2A 4XO6A 4FA3A 3VXGA 4AUBA 1MI3A 3LZ5A 2HEJA 1AZ1A 4GA8A 4PRTA 3C3UA 1EL3A 3MB9A 3ONCA 4LBRA 1IEIA 1T41A 4XZLX 1EXBA 4JQ1A 4JTCA 2PDMA 3BCJA 1RY8A 3UYIA 2F38A 2ACSA 3M64A 4FZIA 1AFSA 2CLPA 3CMFA 1LWIA 1PWLA 2BP1A 1Q5MA 2PF8A 4LBSA 3QKZA 4MHBA 4IGSA 1Z3NA 1ADSA 2IPFA 3LD5A 3BURA 1ZUAX 4YS1A 4XAPA 3F7JA 4IJCA 3S3GA 4LAUA 4GQ0A 1AH4A 1Z8AA 2HVNA 2FZ9A 2R9RA 3MC5A 3N2TA 3WCZA 3UFYA 4IJRA 3M4HA 4G5DA 2INEA 2FVLA 3R43A 3LENA 3R8HA 4NKCA 1RALA 1FRBA 2PFHA 3B3DA 1MZRA 2PDXA 1X97A 2IKGA 4XZNX 3DOPA 3NTYA 4XVEA 1UR3M 4L1XA 4JQ4A 4JQ2A 1QRQA 2ACQA 3V36A 4ICCX 4Q3MA 3H7UA 3LQGA 4DZ5A 1VP5A 4GCAA 4YVXA 2PDBA 4JTDA 2PDLA 2NVCA 4I5XA 4R9OA 4YU1A 2ACUA 4PUWA 3R58A 5LIWX 3U2CA 3UZWA 2ACRA 3V0TA 2PDIA 1QWKA 2PDUA 3Q67A 3CAVA 3RX3A 1C9WA 2WZMA 1YNPA 1M9HA 1IHIA 3LZ3A 2PDPA 2I16A 3WG6A 4GIEA 1Q13A 1US0A 3ONBA 5C7HA 3UZYA 2HDJA 1RY0A 2IKHA 3ERPA 4FAMA 3D3FA 4JQ3A 3RX2A 3LQLA 2A79A 2IQDA 4ASTA 2J8TA 3BV7A 3GUGA 1HQTA 5HA7A 1S1RA 1GVEA 4EXAA 1K8CA 2IPJA 3LEPA 3GHTA 5AZ1A 1Z89A 1X98A 2IKIA 4EXBA 4PRRA 3LN3A 1A80A 2DUXA 4WDUA 4PUUA 5AZ0A 4DBWA 5LIKX 4H7CA 1S2AA 1EKOA 2DUZA 4LB3A 2FZ8A 2HV5A 1AH3A 2NVDA 2IKJA 4DBSA 4JTRA 3UP8A 2IQ0A 2P5NA 2FZBA 2FGBA 1T40A 2IPWA 4QX4A 2PEVA 4XK2A 4GACA 2QXWA 4HBKA 3CV7A 2F2KA 3WBXA 3COTA 2HE8A 4QBXA 4OTKA 2PDNA 4PR4A 2HVOA 3LBOA 4PMJA 4GABA 2VDGA 1MRQA 2PDKA 3G1RA 4WDWA 1YE4A 3DN5A 3CAQA 4WGHA 4GQGA 3V0SA 3GHUA 4QR6A 5JH2A 1YE6A 4WEVX 3UZXA 3CV6A 2PD5A 2PDGA 3FX4A 3WBWA 4QXIA 4RPQA 3UZZA 2AGTA 2PDWA 5LIXX 2PDQA 3RX4A 3G5EA 5LIYX 3O3RA 2BGQA 5M2FX 3EB3A 2PDHA 3CASA 1ZQ5A 3V35A 2ISFA 3BUVA 4JIHA 2WZTA 4JQAA 1Z9AA 3GHRA 1LQAA 5JH1A 1X96A 3LUTA 3H7RA 2INZA 4FALA 3T42A 3LNMA 2BGSA 1PWMA 4ZFCA 1ZGDA 2DV0A 1ZSXA 4XZMX 4JTAA 2IS7A 1SM9A 4WDTA 1PZ1A 4JIRA 3N6QA 4HMNA 3V0UA 3Q65A 3R94A 2PD9A 3EAUA 2FZDA 1JEZA 1J96A 1VBJA 5KETA 4DBUA 3M0IA 1OG6A 4YVVA 1XF0A 3R8GA 1PZ0A 4WRHA 3KRBA 4JTQA 5LIUX 4YVPA 1AH0A 3R7MA 3O0KA 4L1WA 3WBYA 5HNTA 1XJBA 3H4GA 2I17A 1R38A 1HW6A 3FJNA 3EB4A 2PZNA 4XZHA 2C91A 2ALRA 4F40A 2PDYA 3UWEA 2PDFA 3R6IA 3UG8A 4XO7A 4LB4A 4WDXA 2HE5A 1PYFA 2PDCA 5HNUA 3GHSA 1EF3A 5DANA 3UGRA 1YNQA 4XVDA 1S2CA 3P2VA 1S1PA 1XGDA
chains in the Genus database with same CATH superfamily
1KCXA 2X7WA 4BS0A 3THQA 4KFPA 1A5SA 3S5YA 3LNPA 4HPGA 2I14A 3N13A 4J3SA 2GGGA 2JK2A 4Y9PA 4DO4A 4IM4A 2PBGA 3PJTA 1P0KA 4C6IA 2TYSA 2ATMA 3N1AA 1RCQA 5C9ZA 2WHKA 1YHTA 4O4WA 3MB9A 1BXNA 1A5CA 1T41A 1V3HA 1EXBA 1IGSA 4IG2B 1E15A 2A1YA 2XWEA 3UYIA 4G1NA 5FCZA 1R2TA 3S5OA 4J2PA 2CKSA 5CZSA 1PWLA 3TUUA 4DIAA 2BP1A 3JZUA 5J04A 3A21A 1SO4A 3H23A 2CKRA 1JAKA 3GFZA 1LZOA 1P6CA 5JBDA 1Z3NA 3DFSA 2OGJA 3UERA 5EMLA 3M0ZA 3SN4A 1TJRA 4Y96A 1W1TA 1UJQA 3UJSA 4BQ5A 2XN2A 5HMEA 2ZX8A 3UJRA 4MFDA 3C2RA 4MIMA 2GL5A 3TFXA 3G8EA 3VOJA 3WIJA 5C9UA 1OFDA 4LNCA 1WP6A 2E6FA 2BS9A 1PIIA 4G2DA 3TOPA 3BLFA 3OA3A 1PCKA 3CMJA 3GIYA 5BOFA 2A3BA 4MJ4A 5FAJA 5AYXA 3B04A 1JZ7A 1LROA 5TNVA 2IKGA 1YX1A 2EG8A 3CXOA 3DG7A 2FVKA 4YWSA 3UY8A 4L1XA 1VENA 4B3LA 1FWTA 4JQ2A 4HHPA 1DXFA 4JX4A 4IGMA 1CDGA 3OU8A 1US2A 4H8HA 3N9KA 3T7VA 1GUVA 4JTKA 4H7VA 3PTKA 3BJFA 3SFKA 3EXRA 3B8VA 4I5RA 4L6HA 4XTDA 4WJ8A 4L6OA 1UIPA 1W9PA 1YPIA 1CGWA 1ZALA 7PTDA 1U1HA 3ZXWA 3LSCA 1Q2SA 1UA3A 3WD4A 5LXXA 2QF7A 5IDIA 3LZ3A 1LT7A 4DJFA 2PE4A 1OIMA 3UPWA 4H9MA 5DCBA 3L21A 4NXKA 4EOUA 3SQSA 4AG0A 1US0A 4DYJA 1UD3A 3ONBA 2BTMA 2Q01A 2E5CA 1DWJM 1O6IA 1V51A 3USZA 2J74A 4FAMA 3PZNA 2VM8A 2OEJA 4KS0A 4WKHA 2J75A 2BXZA 4CUCA 2RH9A 5TIMA 1ZPTA 1VEMA 4HTYA 4UQAA 4YTSA 1GVEA 4Q33A 1WDQA 1CGXA 1SYTA 4PRRA 1GOIA 1C91A 3HMCA 1IZCA 4A3HA 1K4HA 2KAUC 1JRBA 3C2VA 4GYPA 1JYWA 2ZUVA 3BW4A 2Y85A 2HCVA 3KL3A 1WXJA 1DHKA 1CI1A 3QXBA 1J4EA 4GIAA 2V69A 1FHUA 3VA8A 2F6XA 4I90A 3G0SA 3KBMA 4EKJA 4E4FA 2QXWA 4PMRA 1IZKA 4CU8A 4R7OA 3LPGA 5M5DA 3EXSA 3KWSA 2NW0A 3BCFA 4UR7A 4WXZA 3SN0A 5ECUA 4MUPA 1SZEA 1XG3A 2DH3A 3G1RA 3GY1A 5AC5A 1W5MA 2CERA 2ZCGA 2RGMA 3LXCA 2OODA 1ONRA 2CBUA 5K4ZA 2C0HA 7TAAA 4Q4QA 1O5QA 2XFRA 2ZZ4A 3KRUA 1OYCA 3WH5A 2Z0IA 4U10A 3FN9A 2WNNA 3LTPA 4ZO7A 1L6SA 1X39A 4S3AA 1YQ2A 4ZB2A 1X1OA 1HUVA 5BWAA 5I79A 5AYIA 1V3IA 4P2VA 4DAFA 4FLRA 3N4EA 1IEXA 5U7SA 3WLHA 2GDQA 1FP8A 3IJLA 1K4GA 4AU0A 3WQWA 1CX9A 1UR4A 3UU0A 4HPXA 3M1ZA 2J7HA 3HGOA 1PIGA 3WEZA 3P80A 7REQB 1EC8A 1Z9AA 2NT1A 1X96A 1EQCA 3E5PA 4M29A 5KZMA 3T09A 5HDRA 1H50A 1GKQA 2ZTJA 4AZ5A 1QU4A 3OHIA 3WQEA 4N9DA 3PZOA 4MY9A 4HSOA 1OVDA 1ME7A 2QCMA 3RU8X 1SW3A 1JUKA 3STEA 4MAZA 6TIMA 4G8TA 3REQB 2IW0A 3WFAA 1UROA 1ZGDA 1Y5XA 4Z0SA 3RM8A 4DJDD 2DT1A 1JGIA 4O11A 5ABTA 1PHQA 1SM9A 4HN4A 1B3VA 2PWVA 4MB5A 1OGGA 1BKSA 2GUYA 4JIRA 1VFHA 2GGJA 2GGHA 5D05A 2XVLA 4UQCA 1FWAC 3TC6A 1SJBA 2BB0A 3WNMA 2P3ZA 2DZXA 1DWFM 5AC8A 3EAUA 5T9BG 4MVAA 3W1LA 2EPNA 1A47A 3QMRA 4Z0JA 1EGZA 4C91A 4B3ZA 3R8GA 2HZGA 1MYRA 3SUTA 2TRSA 1GOWA 4WKAA 3KCOA 4YVPA 2PWDA 1XLCA 3GIPA 4OHQA 4F2TA 2E67A 1J9YA 3NA8A 1H49A 3UBPC 4BI7A 4NL1A 4C6DA 3IK2A 4L61A 1TMHA 1JXKA 3EEGA 3FJNA 3PFRA 1EJWC 3BXWA 2R94A 3EDDA 3CHVA 1WDPA 2X16A 4X2RA 2XUCA 3W70A 1I8JA 1POKA 3W27A 3R10A 1F8MA 2PDFA 1IR1A 4RDZA 1A5AA 2CWNA 3F2BA 3PZQA 4OJYA 5BRBA 3ZJ6A 3VZZA 4IPJA 2VELA 3EOSA 3W6YA 4CD8A 1TA3A 5AHEA 3PG9A 4Z1AA 2D23A 3GHSA 3FGCA 5J8LA 3HURA 3WJXA 1R46A 4AW7A 3PUGA 1IGWA 4XIMA 3GVQA 3NUKA 3W1RA 4N9BA 2XJ7A 5LNWA 4C90A 2Z4GA 2YCLB 4F66A 3GBDA 1FHLA 2E8ZA 3EWBX 3MO7A 2HXUA 4DWSB 4V1XA 1MW3A 3SRFA 3G8RA 2D0HA 2C15A 4XSMA 3ITGA 1UD5A 2D20A 1W17A 3QHMA 3WELA 1I4NA 3V3WA 1TVNA 2WLYA 1HTIA 1QJWA 1E40A 1WXYA 1AZ1A 2FJKA 1JDAA 4LU0A 4HGXA 3G1SA 1O94A 4KERA 2OB3A 1RY8A 1XBVA 2JGYA 2FYMA 4MUZA 3HM7A 3OBKA 3DI1A 3OVPA 2MANA 4MY8A 3TYUA 1E4NA 4PTXA 2RUSA 3QBUA 4YS1A 3GXIA 1KM4A 3T44A 2DVUA 3L0GA 3GVRA 3MUIA 3WDJA 1R3RA 2PGRA 4GQ0A 1VYSX 1DIEA 2HVNA 4S2CA 4AEFA 3DFQA 4LYKA 4W89A 4Y2WA 3T9PA 4ROPA 3FCPA 5CJNA 2XN0A 1CCWB 4GYKA 3WDIA 3SECA 1P1MA 3LGDA 2CESA 1KW1A 3VDBA 1OSEA 4IIGA 4CU7A 1JDDA 3KVLA 1KKOA 4HT3A 5E93A 1PBGA 4W9TA 2BBFA 3V36A 3C0QA 5CG0A 4FLSA 2ZIDA 1OINA 4OWGA 4XZBA 1FWBC 5E5CA 4JTHA 1ZU8A 3WQ6A 1PJ9A 2ZZ6A 4KIRA 5EKYA 4R88A 1B5TA 4I8DA 3ZO9A 4DO6A 3AICA 3VGEA 3LDVA 2ESCA 2VZSA 4E8GA 4GFSA 4GJIA 3Q67A 1PKNA 1C92A 1E0TA 5CQ1A 1GQLA 2W66A 2YFNA 2E28A 2XM1A 4HMCA 4B91A 5C71A 4D6GA 4ZO8A 4G1KA 4C6JA 4TX8A 1GQIA 1PHWA 4LNYA 3DFOA 2WWCA 1S5NA 1WV2A 3GK0A 4ML4A 1CXKA 4IQJA 1V6UA 4XD3A 5A6JA 2Z7GA 3BAJA 1R8LA 3MI3A 3FKKA 1FA2A 1KRCC 1NDYA 3GUGA 1IQ8A 5G2HA 1K8CA 4F4RA 2YL9A 2A2IA 1HFBA 4DN1A 4GIYA 5BZAA 3C0SA 4AX6A 1IT8A 4IHCA 3A4JA 3GIQA 3NG3A 4I3GA 1Q4NX 2A6LA 3KOFA 1HKIA 3IIXA 5CPTA 1AQHA 3INPA 5HAOA 3AIVA 3E5BA 3R2GA 3S6TA 4UTFA 1UD8A 4JTEA 3ITXA 4E2BA 3CV2A 3TJIA 1E0WA 4NU7A 1J0KA 1V3JA 4TV5A 3MP3A 1XLKA 5C9RA 2F2KA 3COTA 3D5HA 3W7RA 3PP7A 1XFCA 5G2WA 1WDRA 2PDNA 2HVOA 3VD3A 3C2OA 1KBJA 2VX7A 1QI0A 2ZRXA 4WGHA 1HJUA 1TMLA 4K2SA 1I2QA 4JCMA 2QIWA 3CPGA 4XD5A 1U5JA 3BL3A 3OVQA 3ARPA 2BHZA 1AQ0A 3H2MA 3GTNA 3SZ8A 4AHOA 2O9PA 3IARA 4Y9MA 4WR3A 2BVTA 4ZB0A 3WQDA 2J27A 3WNNA 4HPJA 3URAA 5XIMA 3STGA 1LTDA 2PP3A 2DJXA 1B31A 2ISFA 2CNCA 4CN4A 4ONVA 3GHRA 1RA0A 3T08A 2WNZA 2J66A 2ZZ7A 5F2GA 7A3HA 4JS3A 3GLCA 3IAQA 3OHMB 3B8WA 1RH9A 3LXBA 3UCQA 3S1XA 4LVDA 2XZ9A 4KWVA 3QGKC 3G3MA 3EA2A 1F61A 1S5TA 2HWGA 4UFKA 1UWUA 4ZMGA 1J01A 3GWQA 1J6OA 5AHLA 1J2WA 1W1PA 3SB0A 3FAXA 2IS7A 2Y8KA 1QFEA 1VD6A 3TA9A 4GHRA 4FXSA 4O8AA 1M65A 1D7KA 3N6QA 3IAPA 2YYUA 1SO3A 1NU5A 1P7TB 5EMMA 1HN1A 2HRWA 1Z32X 1JEZA 1J96A 3CWOX 4RV3A 5LKYA 2J77A 1BQCA 3FKRA 4XAFA 3KP0A 2ZICA 3ZJ8A 4YTRA 5DBTA 3UESA 3WBYA 3A24A 5CZKA 4I9JA 2R1NA 1WYIA 2GK1B 3MCOA 3J7HA 2NWRA 4GQRA 4S3CA 4NZCA 5DELA 2GPTA 3IUHA 1V3KA 1JNDA 5HQEA 3UXDA 2CU0A 2ATSA 4AVOA 4CQDA 4J1OA 4C5YA 3M9YA 1XR2A 4XO7A 1QPRA 4FIRA 4MWAC 1FDYA 3TR2A 3UEQA 1R6WA 2PDCA 1JCJA 2NZLA 4E4PA 3CQJA 4JD4A 1S2VA 2A21A 3PTQA 1RXOB 4PULA 4BHYA 1XGDA 3P61A 1VLIA 3B9DA 1C7TA 3I6TA 4H04A 1T96A 4NP7A 2PDJA 4N0RA 3QQWA 2QV5A 4QG9A 2DU2A 1PB0A 1R3WA 4UFHA 4AUBA 1LL7A 2OT1A 1SZNA 2V38A 5CPOA 5KSWA 2QNEA 1XH2A 3II1A 1MDRA 2ZWYA 4MADA 3AQUA 4MLJA 2ACSA 1UUMA 3HIJA 5JMUA 3H70A 2WVVB 4S23A 1JCTA 3CHFA 4PMVA 3CUJA 3I4KA 4JTLA 2VX5A 4GISA 1TV4A 3LPPA 1SW0A 4CQ8A 1XBXA 4QDMA 4I8YA 2QJHA 1F6YA 2XN1A 5FACA 1GOQA 2H9AB 3DG3A 4RZBA 5G5IA 3AIWA 1K9FA 1A5UA 3UFYA 1ZLPA 2PAJA 1QBBA 4K8GA 3P81A 3PN8A 3MDWA 3V4BA 5E1QA 1XYCA 3C8NA 3K30A 5A8MA 1FCBA 3EMQA 2X2GA 3MDUA 2WOQA 1QRQA 4FLQA 3RCYA 3DENA 2DUAA 4KW2A 3TIMA 4WF7A 2IQTA 1DJXA 4JTDA 3R25A 5C5YA 2WC3A 4NG3A 3EBVA 4V2XA 4XX6A 5G4HC 3VI2A 2YBVA 4YU1A 1KM0A 1E6SM 4PSRA 3UA3A 5F1VA 3CIWA 2OKTA 4EPBC 4MB4A 1WB0A 3K8LA 3PBWA 1YTKA 3UR8A 4J2MA 1IF2A 3KXQA 1Y8BA 2XVPA 4RNFA 5EMKA 4E3VA 3SO7A 1F3XA 4UWMA 4DF1A 3TJXA 4LC8A 4DHGA 5CLWA 1VS1A 1XGZA 4IL0A 4UZUA 3LXAA 3NO1A 5C9WA 3IIOA 3ERPA 3NFUA 3OO2A 3IRDA 2ZVIA 3ARWA 1TVLA 3W3OA 3ORWA 1KC7A 5CKSA 3QC0A 3D3FA 2XSXA 3MSYA 3SEPA 3L67A 1TELA 3P8IA 4R53A 4GJJA 2D3NA 2IPJA 1FWDC 3BSHA 4N42A 3VDGA 1Z89A 4PMQA 3ABSA 4WDUA 4HK7A 2Y1HA 1FWCC 4FXRA 5BXSA 2NQHA 4DBWA 3VMNA 5G1TA 1BF6A 2JFEX 2VVSA 3TJ4A 1E4LA 3RU6A 4PTNA 1J0ZA 2YXXA 4FNQA 4O0KA 5HMSA 3NSMA 4FPSA 4GYFA 1DKWA 4PBEA 4PTDA 4ZOAA 4MY1A 4HNLA 4PRWA 1XD0A 1Q6EA 3AWNA 3IK4A 3OVRA 3RJXA 4JDYA 3WBXA 1W1B1 4QBXA 4M0XA 4MYXA 3DC8A 2PGFA 3CIXA 2ZRUA 3N4AA 1F8IA 3KBNA 3MKVA 5LA1A 2VDGA 3HA1A 1M3UA 1OFOA 1RQHA 1AA1B 3ZR6A 3SRKA 1TCMA 3W9ZA 3R4IA 2VCAA 3IPWA 3K8KA 5ABGA 3H24A 4PL2A 3A3WA 2FKPA 4B5SA 3VDCA 1SZFA 4PUEA 1IZJA 3L12A 4I7UA 4F0MA 2NSXA 2CETA 1F6KA 3DHFA 3F4DA 1VFLA 4ACZB 3QLDA 3W76A 1OX6A 5LSMA 1FDZA 5CC3A 4N4PA 5AYZA 1GZ1A 3W88A 1VPXA 1BVNP 3YPIA 1P6BA 5CSRA 4KWWA 4OGZA 4CD5A 2WZTA 2ZUWA 3DAQA 4QJ1A 2EXOA 1UWTA 5KMYA 4GOAA 1NQ6A 4YWIA 4UTKA 1XUUA 4C7DA 2HISA 3PS7A 3OBAA 1W9BM 1VKFA 1PAMA 1WKYA 1YPFA 2WKLA 3KVJA 4D6JA 4O1BA 3WLNA 3N6JA 2VHLA 1AMYA 4KGJA 1H61A 1DTNA 1QI5A 3PZTA 3MHUA 4AXNA 3ITVA 3P62A 4LW7A 1GPFA 5E0KA 1X7IA 1GZGA 4O12A 5CC6A 2DQWA 2NQ5A 1SUXA 1D9EA 2X2YA 4LJ3A 4ZE5A 2VP8A 3N3TA 5D38A 5E70A 5H6HA 3L4WA 2AKZA 4HMNA 3VNZA 4EIVA 3W24A 1TJ2A 2XSAA 3MV11 2C3ZA 1Q45A 3MV01 2DT3A 3VZXA 5H2ZA 2OEMA 3N34A 3QZ6A 1UZ1A 4QS6A 3EWDA 5AHIA 2GJPA 2GVYA 3PWAA 1OG6A 4QNEA 1PDZA 1TPVA 3TN5A 1EDQA 4WRHA 3PPHA 3AZRA 3CU2A 2Z27A 4HNOA 1G67A 4F0SA 1ZFJA 2A3EA 2B81A 1R38A 1GYMA 1O4UA 4IF2A 3CC1A 3W73A 2PLMA 2J13A 3SCNA 4F40A 2GJLA 3B8IA 3UXLA 4O18A 4D6FA 3LTSA 2WLZA 4OV4A 3CQ0A 4B3KA 5D8ZA 4WOQA 3GH7A 4Y8FA 3VIKA 1FHDA 1NARA 1YDVA 1EF3A 1TV3A 3N73A 1B3OA 2CFFA 5DMNA 4ZENA 3PZGA 1S1PA 1KO0A 2ICSA 3TX9A 3WDRA 3CNYA 4UQEA 2QCHA 4Q8QA 2QMKA 1EO7A 4GE8A 1OC7A 4DZIA 4NJKA 1AODA 4PB5A 1NFGA 2DIJA 3G0UA 1DP0A 3BGJA 4MWAD 3UNTA 1MI3A 1X6NA 2CZ5A 1B1YA 1HVXA 4ZQRA 1DTUA 2HNEA 2OO6A 1QPKA 3C3UA 2QVNA 1G4SA 1EEPA 3AI0A 1K03A 3CUFA 1FX6A 2POTA 2GSHA 2YFOA 1V6XA 3GNDA 4LAKA 2WJZA 4NILA 4BQ2A 3VD7A 9CGTA 3QQ1A 2FHBA 1AQMA 1ZL1A 3CMFA 4HA0A 3RPMA 3AC0A 3EWUA 1Q5MA 1CYGA 4MHBA 3MUY1 4ADUA 3KZSA 1QW8A 3K46A 4HMEA 3HG3A 5M1TA 3M0VA 3KRZA 3W01A 2HS8A 5LHEA 3DFHA 2QDHA 4LXFA 1Q7ZA 1PSCA 4G5DA 4UC5A 2G96A 5I3JA 2HK0A 2FPYA 4Q6XA 5HK4A 3W7GA 1H60A 2ZX5A 3BOXA 2OX1A 2DP3A 4JTUA 3T0CA 3KFTA 1K8YA 2D73A 4DUVA 1FRBA 1JQVA 1DHPA 2PDXA 3EEZA 1A5NC 1A4MA 1XLLA 2B4GA 2OR2A 3M44A 2X0HA 5PTDA 1E9YB 3FHQA 3W84A 2XIIA 1XDLA 1LUCB 4YVXA 3WJYA 5CPNA 3M7SA 4O19A 4LRSA 3IS4A 1G7VA 4QJ5B 4Z2KA 1J8VA 4AH7A 2JGQA 3BSMA 4H6EA 4J7RA 4A29A 5D2TA 5FEXA 3NEVA 4MKVA 1QT1A 2ZUSA 4ICNA 2OVLA 1VCVA 1A5MC 2QW5A 3KS6A 4LCRA 5A3HA 3VD5A 3WN6A 4BKNA 9XIAA 1VQTA 5EB8A 4J3TA 1RP9A 4JTJA 3UXKA 5C7HA 5FIPA 5A5WA 3QV6A 4K37A 2PC8A 3FW6A 3NVTA 3KLLA 3LRLA 5FI8A 3B4YA 2E77A 2QUVA 3H2NA 2ZUUA 5CPSA 4JR5A 3TK7A 1S5WA 3ENLA 3W7QA 4FXFA 1NAL1 3EX1A 1D2KA 2ZZ2A 4AEEA 3IJ9A 3DHPA 4X60A 4E4UA 1O7AA 2VWSA 5I3IA 1H7NA 3SDOA 1KB3A 4GUGA 1NFBA 3T05A 4MPQA 1ICSA 1L6WA 1K9DA 1LL6A 4QP0A 2PZ0A 3PSVA 5ENLA 3LEPA 2Y6ZA 3W1PA 3WMCA 4DF2A 1KM3A 4AB4A 1MMFA 5L6UA 4LCSA 2VDHA 2YB4A 3S1UA 1E0XA 2DUZA 2NSOA 4LB3A 4DO7A 3QJAA 3W2LA 3CLWA 2BY2A 3N12A 1GJPA 1KWGA 1WKDA 4GBDA 1TPEA 2Z2AA 3TSMA 2C18A 1W8GA 1KGUA 3A3XA 2FGBA 3OLGA 2Y8UA 1BEUA 2GJRA 3TAOA 4DAIA 4HZ8A 4FLOA 2EPOA 3CQHA 3FJ6A 2UY2A 1TJ0A 2MNRA 4NSBA 3W87A 4NYUA 2CHOA 1OHLA 4HSNA 4O54A 3C8FA 3UWUA 1HVQA 2J7GA 3LBOA 1KRMA 1FWGC 1VRDA 5K9XA 1KFLA 3MKCA 2C1HA 4IFKA 1JRCA 5HWNA 2WHMA 1UP3A 3F4NA 1GKPA 3PNZA 2QV4A 4OFCA 3TW7A 4GPNA 4S3KA 1VFMA 2R91A 3WNLA 4NYYA 2RDXA 3FXYA 4JXCA 3RR4A 5D2YA 1Q6OA 3LHZA 1OQFA 1H09A 5JH2A 4FMVA 1YE6A 4NJJA 2VTFA 4PCSA 1KQZA 3TAKA 2A7RA 1KFBA 3TNBA 5DFAA 4O0QA 3DERA 5GNYA 4K38A 2BGQA 4I6VA 1CLXA 5M2FX 4YHGA 3TVAA 1EYEA 3P5ZA 3H26A 2QCFA 1GHRA 3V35A 4IOTA 5JH1A 1LQ0A 3G24A 1A5LC 4L4LA 1RD5A 2J7BA 3T4CA 5JBEA 1Y0EA 1LLWA 2WJFA 2Q3RA 3P93A 2YW3A 3NJ3A 4MZ8A 3APTA 1TUXA 3CB3A 3PUEA 1JZ3A 2GSJA 3VIFA 5IHSA 4F79A 1MRAA 4QQUA 3SCPA 1RQEA 3SR7A 4DY1A 4H9UA 3LERA 4F2BA 4W7VA 4UXDA 3WQVA 4XD6A 5REQA 2XVKA 3L0KA 2VC9A 2D3LA 1EBGA 3UWZA 2WMKA 1TWSA 1K9TA 2J62A 1ALDA 2JIWA 2YZRA 4LUTA 3V0UA 4WY0F 1EJ7L 1UC5A 4GKTA 4C1LA 3L9CA 3GBEA 2I5GA 4Q4KA 1VBJA 3OQ8A 4O13A 2WW5A 1BTCA 1OF6A 5DEZA 3UR5A 5BYWA 1J10A 2GVJA 1P1XA 1V7YA 4I9MA 3PBUA 4FI4A 2V5DA 2YLAA 2CYGA 2F7FA 4MKNA 3C4UA 3AHVA 2Y2WA 3G1XA 1XINA 1J5SA 2V5JA 3F4VA 4QNWA 1MFVA 4J3WA 1VLWA 4NHVA 4HCHA 5B7ZA 4E8DA 4H8UA 4RE4A 3BPWA 4FF5A 3WH8A 1E56A 1I1XA 3NSXA 1XLHA 3TDFA 1CWYA 1TREA 4ZSTA 4ERAA 2XG9A 4RPPA 3IVTA 1MO0A 2V63A 1LRTA 2AAMA 4LAZA 2EHHA 1J0IA 1M04A 2CZDA 1BVWA 1DBTA 5T8GA 4ZEPA 1NWUA 3BMVA 2QCDB 2C7FA 3CAKA 4MOZA 2TPSA 1YXYA 2GQ8A 2QUNA 2X1TA 4UTWA 5CGMA 4F0RA 1VBHA 5IBXA 1FUYA 3JS3A 2BASA 5T91A 2VR2A 3ICJA 4H6KA 4H2HA 3A22A 3M64A 4QCFA 1AFSA 3AXHA 3UVAA 5I78A 1K70A 3SCQA 5I09A 2ZRWA 2BHUA 1Y5WA 4LUYA 5I6SA 2DZSA 1QCWA 3HGRA 2AQVA 3ISIX 4LYPA 1KCKA 3NOYA 2OKOA 4FSAA 1IIGA 3ZVHA 4E6MA 1Q7MA 4HCLA 4B5VA 2BG5A 1UP2A 2XINA 2VEPA 3AHTA 3APYA 5D09A 1XI3A 3PUOA 2J47A 2G5WA 3PFMA 2WM0A 1GEQA 5FJRA 1UMLA 2DQXA 3LENA 4AWUA 2JKEA 3SW6A 4O1AA 4O1EA 2D24A 5FKYA 5IXEA 1MZRA 4M56A 2NQLA 3IGXA 4CN6A 5D9NA 4YCPA 1LQ2A 2YCEA 3ZLHA 1LF1A 1EJUC 1KFEA 2GJXA 4JX5A 4MWAB 2BVYA 4PUNA 2GSEA 3BV4A 4DUWA 4DZ5A 1B4KA 3M41A 1UW9A 3BW3A 5EPDA 4I9TA 2NVCA 4UB9A 2BZNA 3NZRA 2WV8A 1T8QA 3QR0A 2VUNA 5BCAA 1SFTA 3CL6A 3ABZA 2OWXA 1TKKA 4NJGA 4B5NA 3AZSA 4MKSA 4JX6A 3I7SA 3FEMA 1B9ZA 1QWKA 2X09A 3SCWA 3CH9A 2EG7A 3RX3A 1YNPA 1BTMA 1MQPA 2VRKA 3FHAA 1TPWA 1OZMA 3RN6A 2P88A 1MZHA 1UBSA 1Q13A 3PTMA 4PB4A 3TONA 1RVGA 2WSPA 4A4AA 3K1GA 3MUXA 2B0MA 4O1CA 5FD0A 3AXXA 4FOKA 3OA5A 2FIQA 2SFPA 4KRTA 4O57A 1O5XA 1QOXA 1CBGA 3KCJA 3ARUA 1RBAA 4JKLA 4GUIA 2ZWZA 3BANA 3TSBA 3E3HA 2NX9A 1HQTA 5HA7A 3KX6A 4IWWA 1XRFA 4YL2A 3MVIA 3NVDA 2Z26A 4EXBA 1A80A 4WGXA 6CGTA 1DJNA 4L4PA 1OK4A 4TQTA 4KWOA 2VFFA 3W07A 1EKOA 1PKYA 3IGUA 1B9BA 4PMXA 4O1DA 3H12A 4LGXA 2C79A 1EUNA 2FJUB 3KCLA 4LTSA 2X8RA 2QR6A 3GFXA 3HOJA 3FS2A 3OZPA 3MI2A 2IPWA 4GUJA 4MDPA 1OT2A 3WK2A 5LNUA 4K6AA 4GGBA 3C6CA 5BRPA 3H53A 2IMRA 2ZZ3A 3TYEA 3ARXA 1C8VA 3LSBA 3GW0A 3H2EA 3D46A 3CUIA 5HNNA 3VIPA 4H6RA 3KHDA 2F6UA 3NCOA 3BLEA 4E0CA 3I3EA 2G3IA 2ABBA 1W9UA 3OTRA 3VM7A 3V0SA 4A3UA 4ORIA 4R9XA 3AIBA 3GR7A 4OOZA 2PA6A 4EK7A 3MSDA 3LHUA 1TV8A 2F8QA 4POCA 4FXJA 2G3FA 3UZZA 3RX4A 3AWOA 1V8EA 2V5CA 5DXXA 3JVAA 3U4AA 3EPMA 1JZ4A 5I5RA 2UBPC 3FV9A 4PCTA 3PPFA 4ZOBA 1XW8A 1XUZA 4US5D 4O17A 4MMWA 4IIEA 2W0UA 2WKGA 3ID7A 2ADAA 1EHNA 1SR9A 4MDOA 3BZJA 4ZR8A 4OECA 1KFCA 1HIZA 3DFYA 3THUA 2VCCA 4J27A 4JDBA 1UG6A 4DI8A 4KEZA 1VH7A 3O0FA 1I2RA 1DWGM 2E68A 3WJSA 3HPZA 2W79A 3DC0A 4GQBA 4BF9A 4KESA 1HT6A 3MP5A 3VZYA 4JNMA 4MB3A 2DIKA 5EA9A 4KRUA 3ITOA 2HSAA 1FWSA 4CVWA 1E72M 1I0BA 3VD4A 2PRHA 5AHFA 3OG2A 4UIOA 2BDQA 3UPMA 2DSVA 4OOUA 1XL9A 4JN7A 4IH3A 1BSIA 4KETA 3NQ6A 3HO8A 2NQZA 1J18A 3S83A 2XIOA 3PVFA 2WHJA 3AHYA 3O6YX 2I17A 5FJPA 1EJVC 1XFBA 1I60A 1V03A 3TC3A 4MWAE 9RUBA 4NF7A 3EB4A 3W00A 5G2IA 4XZHA 2VD8A 3F4WA 3CUZA 5SWUA 1CGYA 1ME8A 1RJPA 1WX0A 1FDJA 3UNDA 3RUBL 5HNUA 3TH6A 1Q6FA 1NSJA 2Y7DA 3D47A 3GC4A 3SSZA 3BOFA 2OSXA 3CQIA 1G5AA 4Z2GA 2UV8G 4CNNA 4ERIA 2V2CA 3IUDA 2CLEA 3WX7A 4F2UA 1KM1A 1F3WA 4BK9A 4L9XA 4H8NA 4G56A 3NGFA 3CWHA 4K68A 8TIMA 3MSRA 3MPGA 3F5KA 1SMDA 1UPMB 4RXGA 3WLOA 3H2CA 3MVTA 4AZHA 4BA0A 4YCOA 3CT2A 4CD4A 3JZEA 3WDPP 3UZ5A 4CD6A 4P8UA 3AHZA 3NPVA 5ABHA 2JEQA 2CLIA 2E40A 2EEXA 3CEPA 3WL0A 3DX5A 3URBA 2YCIX 1A5KC 3WLQA 1RLDA 2QCEA 3UXAA 1EJTC 5D8WA 3D0CA 3HQOA 2HBXA 3RR1A 1F6PA 4LSBA 2E5BA 2BLEA 2XVNA 1TPH1 3NSNA 4LAUA 4A2SA 4MTVA 1JULA 3N17A 1KTBA 4LY8A 1DQUA 4IJRA 1DIKA 1GTHA 2FVLA 1W6TA 3GNOA 4AMAA 1R3VA 3TTQA 4NKCA 4ZA0A 4PYSA 4U33A 3W7PA 2PFHA 4B2DA 3MCNA 3WLSA 2X1UA 5G4EA 3W2MA 4F0HA 2PUZA 4L56A 4C6QA 5ABEA 1LT8A 1ZAHA 3T8LA 5TAOA 4QROA 2WYSA 2WPGA 2Y61A 4MM1A 5DLCA 4A22A 4C5ZA 4YHEA 3ZSTA 3CB8A 3PSWA 3A64A 3H2AA 3DBNA 5CAHA 2G50A 2ACUA 3BC9A 3EWWA 3EX3A 4HU8A 2J24A 1JI1A 2J9XA 4Q8NA 2JEPA 1TA3B 2XYLA 4HYVA 1MVYA 5XINA 1JYXA 3FGCB 3AYSA 2PDIA 2FTWA 2FFCA 4M81A 1TYGA 4PC8A 5EU9A 4ZL1A 1R9YA 3M7WA 2Z1VA 4NZFA 1OK6A 2OQLA 5HR7A 3LOTA 3ZLFA 2ZA3A 4L9ZA 4BFAA 3IEBA 1GTEA 1HKJA 2OQHA 2IKHA 1QO5A 4RZ4A 2VZTA 3BQ6A 4CCCA 2A79A 2IQDA 3L5AA 1S1RA 4P8WA 4O8RA 5DBUA 2VD9A 6ALDA 4XWUA 1B54A 4ZFMA 1DVJA 3WFLA 1C8YA 3T2PA 1EPVA 1BYBA 3QHNA 4H7CA 1ISWA 4K3ZA 4CCDA 4WJXA 3HJEA 2B7NA 1DJIA 5HOSA 4JPGA 5E0FA 1VHCA 3MMWA 1QHPA 2OZ0A 6TAAA 2DW7A 1SO5A 1W9DM 4D8LA 3VIHA 4EX4A 3JR2A 3TEVA 2Z1SA 4XISA 2EPMX 3QV9A 1YXCA 2PSNA 5KZEA 4Q8OA 4EWJA 1PKLA 2POZA 3GNNA 3E02A 3HV8A 4D6CA 3VILA 3DZ1A 1YDOA 1XHGA 1THFD 4K1GA 3W02A 3WO8A 3CH0A 1QUMA 1TE6A 1J5TA 4S3BA 4CEUC 1DWAM 1WDDA 4LBUA 1V5XA 5FL1A 5MHBA 3ARQA 2FTYA 4QTGA 2V67A 5F4SA 3NOEA 2OWWA 2QCCA 1K9EA 4QXIA 1R2RA 5U4NA 3N2XA 3UQNA 1TJ1A 4QAIA 1EJSC 4PH6A 4LVBA 1Z48A 1ZNNA 3QSTA 3A23A 4BF5A 4AZIA 4JNZA 1W1IE 2ONEA 5I77A 2PB1A 3GZ3A 1XLBA 5D2VA 3PZ9A 5BW6A 1IWAA 2C71A 2XH4A 3PZVA 1LQAA 6ENLA 1D7FA 2Q8LA 8RUCA 3PHAA 3TOYA 3ZWTA 3ARZA 3T42A 1L8PA 4S3JA 3M0HA 4P7OA 1N82A 4Q8UA 1NIUA 1R3TA 1W3NA 1SR0A 1MW2A 2ZUMA 4B15A 5A2CA 3B05A 4M3PA 5AB3A 1QW7A 1FCUA 5RUBA 2R1KA 4RV8A 4DQWA 3KZPA 4GWEA 4KKXA 8XIMA 3CTLA 2C8NA 3RO6A 4ATWA 3VINA 1S3HA 3IGHX 2Y24A 3USBA 1T0OA 1E3ZA 4E5TA 4HK6A 3IIVA 1KM5A 1LG1A 2PWGA 3O0KA 3KM8A 3MO4A 4IGNA 2V3FA 1GVSA 3R1ZA 3M5VA 4JIPA 2YKKA 1ZBVA 2JALA 2OFJA 2TSYA 4JICA 4Z1BA 5A6AA 4IQDA 3GXDA 1EXPA 1UB3A 3T0TA 3DG6A 3QPEA 4L9YA 3R6IA 3S6DA 2QJNA 3DCPA 1EC9A 5EYWA 2DZBA 3CZGA 4KWSA 5T9CE 3ZOAA 1I2PA 3TQPA 4QJ4B 1MUMA 1YNQA 1TG7A 4X0VA 7ODCA 2OEKA 1HG3A 3W71A 1B3XA 3P14A 1LYXA 1ZBKA 1TPC1 3TC7A 1VFSA 4PZVA 2CXGA 3KBWA 2ZZ5A 4U2YA 1R87A 1XLFA 4QE1A 2V2DA 3W2JA 3EA3A 1M7XA 4CNTA 3QTGA 3TTEA 3QW3A 4NY2A 5D30A 4NIRA 1OB0A 1G94A 1UJPA 1MSSA 4HYRA 4NAEA 2ZA2A 1QTWA 1FWWA 3L4XA 2BXYA 1IR2A 3RCNA 4NJHA 3KOWA 6XIAA 2CLPA 1V4YA 2CLFA 1FQ0A 1OC6A 3RMEA 2EJAA 1G01A 6XIMA 4UTWC 2YPIA 4KBXA 4BF7A 5IBXC 1RSCA 1U1UA 3WF4A 3BURA 1MXDA 3BJSA 2ZDSA 3GDMA 3O6DA 3SADA 4IJCA 2WQDA 5F2MA 1EEXA 2PTXA 2ALDA 2WMJA 3S9YA 1PDYA 4US6A 1KNWA 1REQB 1FFQA 1EJRC 3R8HA 1W56A 3AS1A 2FH6A 4GO9A 4HU3A 1W37A 4R7JA 4NUWA 4D6IA 4BR1A 4B90A 3UY7A 5A2BA 2OZTA 3SGUA 1E9LA 1NTHA 4KFNA 2XTKA 4LF2A 3SIZA 5FJTA 1ZBCA 3SBFA 1LL4A 4OT7A 4HJWA 1UH2A 1QNPA 3LK6A 3NXLA 4B9ZA 2AL1A 4R9OA 7TIMA 4QIUA 1ITUA 4H00A 2PCQA 3RK8A 2ZUNA 1ZRQA 2E9LA 2ISSA 3U2CA 3M0MA 1QK0A 2QCLA 3UZWA 2ACRA 2E1DA 3V0TA 1TX2A 5EMJA 5H8PA 3VIMA 3I6EA 4YMZA 2ZUTA 1M9HA 3N2OA 1E5NA 1ENUA 3SCOA 2W4XA 3SY1A 1UQZA 3WH9A 4G6CA 3MU7A 4MZ1A 1D8CA 2C14A 4ZZ9A 2V82A 4PMZA 2A4AA 4YTTA 3TQKA 4L64A 3KTCA 4QLLA 1ZCOA 2VGFA 1BQGA 4P7LA 4YTQA 3VIJA 4IMGA 5BU9A 4C6OA 5AC6A 2ZXAA 3NQMA 5D33A 2W92A 5AFDA 1NDZA 3A6OA 1QOQA 3WQCA 1X98A 4GRSA 4WCJA 1UR8A 4H9YA 4UTJA 4UNLA 4IIFA 2C6QA 4L1GA 2WVTA 1QHZA 2VC7A 3RPTA 3WH7A 2PGWA 2REQA 1GVYA 1AH3A 2WZEA 3FSUA 1V77A 4AYGA 2X41A 3WMSA 3GDRA 4LWWA 4OUIA 3CYVA 2GGIA 2BOEX 4EPKA 1EC7A 2PEVA 4QX4A 4ZOCA 1VYPX 3TW6A 3MT1A 3T0BA 3RLHA 3CV7A 4HB7A 3GDTA 3GE7A 5JBFA 2O9OA 3OLDA 1H7XA 3N04A 1QNRA 2QUTA 1TZ7A 1JUBA 4XKMA 2WSRA 4CU6A 4PR4A 1JPIA 1LCOA 1IXOA 1MRQA 1TTPA 3BCDA 4UR8A 3L5LA 5CG7A 4Z1YA 1QK2A 4TU1A 3AAMA 2DGAA 1R2SA 3DKJA 3QRHA 3OIHA 4GMEA 2QCNA 5C55A 5DO8A 1XLMA 1Q6RA 2DSKA 5LGZA 3QGAC 1UKQA 4U3CA 1IIHA 4EPDC 1VB9A 3G5EA 5L9FA 4IL2A 1PZ3A 1JDCA 3EB3A 2GQ9A 1T5AA 3QFWA 3W29A 4C6LA 2VGIA 4ALDA 4OKDA 1KA9F 2Y8VA 3GG8A 2Z6IA 4Y8EA 2AMGA 3LG3A 3W7NA 4HCDA 3AIEA 2HS6A 1JAEA 2J7FA 2WMGA 5AC7A 1M5WA 5FJJA 5BOEA 3G1VA 3MP4A 3WLPA 1TB3A 4IXXA 4RKAA 4KGLA 4W84A 1QPOA 4ZO6A 5TBOA 4JTGA 4QG8A 4EXQA 5A8QA 4NT0A 1FTXA 5DMLA 3HG2A 1R5YA 3PPGA 1V6VA 5F4XA 4HKPA 1VBGA 3S1VA 3W1UA 4A05A 1B57A 1JZ8A 3ITYA 5DMYA 4DM2A 4EAYA 1QASA 4WDTA 3GH4A 3NZGA 2GVEA 3E49A 1AVAA 4PTMA 3GU9A 4AISA 1BSLA 3W7OA 4ZCWA 1BKHA 3M0IA 1LWHA 4M7TA 4WXYA 4UTUA 3M6YA 1UKTA 1OG0A 3KRBA 3KTSA 5LIUX 2EPLX 1OCNA 1KXVA 1RJQA 3C61A 4L1WA 3UYCA 1BRLB 1HKVA 1BFNA 4DUOA 3PM6A 4LY4A 4KEVA 4ZQMA 4QE5A 1IXNA 1ZZMA 5C2CA 2EG6A 4ADTA 3EDEA 3GXFA 1VEPA 3VMOA 1J0HA 1WOAA 2YA2A 1E9IA 3ME3A 5I3KA 1W9XA 3BGGA 1EP2A 4HIBA 3S5ZA 2X0YA 3C2YA 3FA4A 3W1TA 1ML1A 2DIEA 2HE5A 2PP0A 2FB2A 3CTTA 2VFIA 2XH0A 3OGSA 3BAYA 4HNCA 4XVDA 1HJXA 3AS0A 5DCEA 4D71A 1TRIA 1XIDA 4M51A 3VOHA 1XBZA 4QHRA 4DPPA 3IIZA 3SAZA 1K6WA 1UH4A 5A6SA 1HO4A 3JU2A 1F73A 2R24A 1US3A 1CB7B 1GOKA 3UWVA 3BMXA 4DO5A 2R1LA 5LA2A 4FA3A 1V93A 2GJNA 3G6MA 3PK7A 3RHGA 3VOGA 1A0DA 4L7ZA 3H4XA 3MHFA 1QNOA 4K1WA 1O5RA 1JCLA 4GA8A 3T2OA 2G37A 3L2LA 3M0JA 3W86A 1GONA 1A0EA 4IFOA 2CBJA 3MY9A 2QCGA 1BWLA 1VFFA 2VZUA 4ATLA 1EWDA 1JR1A 3VIIA 5J5RA 3O05A 5I00A 5A6KA 1X1ZA 1R3SA 1GG0A 1Q3NA 3STFA 3BAKA 3HFYA 3MQTA 1IT0A 4ZGYA 1NM9A 1PTDA 3POHA 4PUMA 4FNSA 2BFGA 1E4MM 4AF0A 3MMTA 4GY1A 1OADA 3LV5A 1XM3A 1A5OC 3N2TA 1JCXA 3U9IA 2ABAA 3U2EA 2PWFA 2INEA 5LZLA 3WBAA 3R43A 1JNEA 1WQ5A 4C6BA 1YLVA 4KIEA 1H7OA 4UTLA 4G7EA 4FX8A 4DXXA 3F1QA 3SUUA 1U2YA 3ZFHA 4TX9A 4DBEA 2H3BA 1E6RA 1XLJA 3WFZA 5A1AA 3ALFA 3T1GA 3V75A 2YXOA 3ZQ9A 1W3TA 5AC4A 4IT1A 3DYPA 2AKMA 3NZPA 2DW6A 4GFIA 2YLLA 1K02A 1S2WA 3KAOA 4S2BA 4YN5A 1W5PA 2Y89A 1ZCCA 3ABQA 4F9DA 3QZAA 3B9AA 3VKDA 2YJQA 2G3MA 5FEPA 2Y62A 1R3YA 5E9XA 3B0PA 1EP3A 4Q8TA 1JD9A 1AD4A 1WXZA 1J93A 1W31A 2WJEA 3ANYA 5M17A 4UCFA 3TMQA 4JYFA 1BXCA 4L65A 5HJXA 1OEPA 2PTWA 3P7YA 4JYDA 4AZGA 1OX4A 3ITLA 4XUGA 3UW6A 3MW7A 1OT1A 4W87A 4GZIA 1XLIA 5GQBA 4F0LA 4GCXA 3RRXA 1G4PA 1G7UA 1TCDA 3RX2A 3M0KA 3FYPA 2PLJA 3EKGA 4TVDA 1E6XM 4GO8A 2HXTA 3VGBA 3C0LA 1VYRA 2D2OA 5AZ1A 3ABOA 5TQLA 5LHFA 1QWGA 5AOUA 3PF3A 5AZ0A 1VFUA 2G8ZA 3I3BA 4UQ9A 3UPBA 5A6BA 1DE6A 2NLIA 3W28A 3TYDA 1ECQA 1UWSA 3QLLA 3HTWA 2XIBA 3APGA 1LLOA 2WJDA 3C2EA 3W7KA 4IIBA 5LGXA 1CPUA 4PTVA 1WAUA 4IFRA 1PX8A 5JU6A 2PU0A 3B9EA 2DZVA 5HQMA 3RLVA 3E96A 4R34A 1KM2A 4XZ9A 3P3BA 4EAMA 3GW3A 1TRDA 3MHGA 3H2FA 5I06A 1TUFA 5FF3A 2WSQA 1YE4A 4W8BA 2ZOXA 1A3WA 3O2LA 4LX4A 3PB0A 1JG9A 1R85A 1XV8A 1WBJA 3K2GA 1DWIM 3CV6A 1XYBA 3OP2A 4YYFA 3QZEA 3LCWA 4RPQA 4HNVA 2PC4A 2AGTA 4O4VA 2PDQA 1H1YA 1RD6A 2CBIA 1PCWA 3O3RA 2YA1A 4X9SA 3AXKA 5HR6A 4UFMA 2CZVA 3BO9A 1SPQA 3S2CA 1ZQ5A 2J7CA 1K8XA 2D2JA 5DRCA 3W7DA 3N25A 4PE8A 1CXLA 3MS8A 1NWSA 3A12A 4X61A 2QVHA 5K9DA 1GJUA 3EPNA 4W5ZA 1B3WA 3MWAA 3S2NA 2AL2A 3NZQA 4MNKA 3FK4A 3T07A 2PRLA 1KR1A 3O9NA 3VC5A 1R47A 1K1DA 4GX9A 5CZTA 1UWQA 1AJ0A 2X1RA 1OGSA 2VC6A 1GVIA 1GVRA 3QSRA 1L2QA 4I6KA 2P0OA 3WD1A 3DESA 2Y88A 1OC5A 1RAKA 1XP3A 3W7EA 2ZDRA 5D9OA 2AQOA 3NDYA 5F2IA 3QPZA 2BODX 3Q65A 1AL7A 1XWYA 1JXJA 1VC4A 2VRQA 4UOJA 3QF0A 1EJXC 4DF0A 2OOGA 2ZFAA 3ZLGA 1MWOA 1AUSL 1ICQA 4OBSA 3XIMA 3SY8A 4H9XA 4GH3A 5C0QA 2W9MA 1KBKA 1JD7A 5AVHA 1KTCA 3IV3A 3EMZA 3O16A 2RHGA 4M7SA 3TMLA 4GGHA 3A4WA 5HULA 5GNZA 2NQ9A 4IFKB 5B80A 1W1VA 4OV9A 4HHHA 1ZTVA 3C0JA 3H54A 5HUOA 4E8CA 1N55A 2BOGX 1XIMA 4DWDA 3UG8A 1TO3A 1FH7A 3QTPA 3VAVA 4FX6M 3LM3A 3SCUA 4CKQA 4QFUA 1TR1A 5JIWA 1TVPA 4AZBA 1SGJA 5A6TC 4A6GA 4RX0A 2XGIA 5BRQA 1GWJA 4GH1A 1UKPA 4HP5A 3T8QA 4U31A 3TCSA 1LRQA 5HATA 4RNIA 3SUWA 1D3HA 2C1GA 4KWUA 3W7MA 2VT0A 4GXPA 4QRNA 2O56A 2Y7GA 1FBAA 1H5VA 3VXGA 1UD4A 4U3AA 2DVXA 4JZ5A 1XCXA 3HPSA 3CMGA 3GG0A 2VCBA 3PG8A 2VWTA 4EP8C 4LBRA 1Q6LA 1A4LA 1NVMA 4UFJA 1TPFA 3RM4A 4LYRA 2EAWA 3AS2A 3WJWA 3LLDA 5H8UA 3THDA 4CEXC 2VR5A 1UUQA 4N6FA 4X9YA 2F38A 6REQA 1V3MA 4GNKB 3P60A 4LVFA 4IIDA 1WOBA 1JZ6A 3RNDA 3O63A 4TOQA 2VL4A 1R3QA 1O12A 1XS2A 4LS1A 3PC0A 1JGMA 3PR2A 4ZBCA 5REQB 1ADDA 1ADSA 3MWCA 3ANUA 1ZUAX 3WMLA 2C0AA 2JE8A 3FYOA 3WK0A 2OQYA 2OYMA 1DXIA 4W5UA 3EDKA 1E70M 2NX1A 4LUTB 2EBNA 1K8ZA 4FK9A 2J8GA 5KTLA 4BY3A 1AQFA 5KZ6A 4HVXA 3TN4A 3FJLA 2F2HA 3BLIA 1ONXA 1W91A 5CSSA 3B03A 1PE1A 2WC4A 1UR9A 1RV8A 5MKGA 1FXPA 4H4IA 2RDUA 3VC6A 4US5A 3S46A 3CAWA 1W54A 2VQTA 5GVJA 4PA8A 4ICCX 1M7OA 4AZCA 1DL3A 3ES7A 5JVLA 3W0KA 2VURA 3N2CA 3CBWA 1IEVA 1UD2A 1JI2A 3DIPA 1RCXB 1WZMA 1QW9A 4E2VA 2PLCA 2J78A 1Q63A 1XYLA 4CQCA 4L6DA 4P7NA 3IVSA 3W37A 3FA5A 4GG9A 1FFRA 1YDYA 1IV8A 4HNNA 4JAWA 4MGGA 1B2YA 2Z2UA 1P0DA 4QAWA 5HINA 1KRBC 2NWSA 4K39A 1OBAA 3EOLA 3CLMA 2VZOA 4AIEA 4AMCA 3L4UA 2VEGA 5CZJA 1K77A 3S8HA 1XC6A 1JIBA 3TQ0A 2QDGA 3ITCA 3L4TA 3FLUA 2YCKX 1QPNA 4B2DD 3P8JA 3TFCA 3PNUA 2QJJA 3VKAA 2YL8A 1UZ4A 2Z6JA 4NJIA 5I2UA 1VBUA 4RLIA 1BVZA 1LOQA 3L4ZA 2I57A 4A8LA 4GNVA 4JQ3A 2OLHA 5FSEC 4CNOA 1DJZA 4AHQA 4LAMA 1M7PA 3SURA 2B7QA 4EXAA 1M68A 2G4FA 3S42A 3AIRA 1W1ZA 2IKIA 1XRTA 5I02A 3ARYA 2C13A 2DUXA 2NLYA 3SGGA 1WZLA 3E2SA 2P53A 5LIKX 1Q4WA 4PFHA 1CGUA 1HL2A 2FZ8A 4ZQNA 1NELA 4DUXA 4MZYA 3GYCA 1DOSA 2Z29A 1QATA 3ZVHB 3IUIA 3OPSA 2P5NA 3MBFA 4W88A 1T40A 4IMFA 3HBLA 4DNMA 4QCEA 4IMAA 3NQVA 2X05A 4FS9A 3QOKA 3FXGA 2EF9A 3EDJA 1W0MA 1XIFA 4P7RA 4R33A 2AGKA 5HMFA 1ZP3A 4Q4RA 4PMJA 5BXTA 2WHLA 4HOXA 2P8BA 2PDKA 2ZRVA 2GJXB 2XGZA 1OCBA 4LF1A 3VABA 3W2NA 4UNIA 1H0GA 4H9ZA 3ZVIA 3RILA 4AXKA 3M0YA 4PMDA 4A35A 4QR6A 2CBVA 1ISZA 4PMNA 3O6CA 1M6JA 4G7FA 2WVUA 3W72A 2VNCA 2ZXDA 2PDWA 2F61A 3SI9A 4L4MA 3KOZA 2UWFA 1BAGA 3NQBA 3DECA 1OX5A 3QC3A 4LRTA 2H3DA 3TZFA 3N6HA 2PI6A 1MW0A 1G9HA 3PBYA 2VVNA 4JQAA 4LYQA 3KOXA 5A8GA 1CXEA 3W25A 3ATYA 3P82A 1JDEA 3TYBA 1B0IA 1TWWA 3B0YA 3WDHA 3CM4A 3BG5A 1KXQA 5C2GA 1MEHA 2OLSA 3QMSA 3LNMA 1P0NA 5K7JA 4P8VA 2X40A 2GDUA 5D02A 3T78A 1W5OA 1EGVA 1EOMA 4OBRA 1R0MA 4I5UA 3VCCA 3HPFA 5GJNA 3WH6A 2DZTA 4REQA 2W6RA 4M1BA 3MCMA 1YADA 2E25A 5AHMA 1RK5A 3PBVA 2IXVA 1HJVA 1PZ1A 1XISA 4G9PA 1ICPA 2DFAA 4M5PA 4RDWA 1FWNA 2VGBA 2PWUA 1E0VA 4W4QA 4XB3A 1FWEC 1QI2A 4AVNA 3LHTA 3NL2A 3PB2A 1OJXA 1OFBA 3V18A 4R27A 1UH3A 1QMLA 5IFTA 2OZ8A 2IUZA 4LANA 1W3KA 1AW2A 2BXVA 1UMYA 4CCEA 3QYQA 3AMLA 4M80A 1PUDA 1HNYA 3FIGA 1AMKA 3H2OA 3WF1A 5DY3A 3BSGA 5IHRA 1O95A 1VPQA 2NVAA 2FGLA 2V0TA 1LORA 3OW1A 4J3UA 3UWEA 4S38A 4YXGA 1XDJA 3ARSA 1J79A 3UVIA 1E5JA 3CWNA 3W1AA 2V2HA 1XLDA 2J6VA 1LP6A 5C54A 3T2QA 4C7GA 3BDKA 3WSUA 1L8NA 3GD6A 2WVSA 3BLKA 5CGQA 5CPMA 1P4CA 3QR3A 4H83A 2Y4SA 2ISWA 1RZMA 4DYKA 4HHMA 2I5QA 2J25A 2IPGA 2NXIA 1ISXA 2OJPA 2HK1A 3QW4B 4WD0A 3FNDA 2O4QA 2P8CA 4FR6A 4NX0A 3OODA 3SN1A 1DJWA 1ZJAA 3SIMA 3E2QA 3I4EA 2XM2A 3M5YA 1EDTA 1GVOA 4PBGA 2NV1A 3S5SA 3WF2A 2HVMA 4K36A 3F2CA 3AROA 2VDIA 2XGBA 3KW3A 3CQKA 2B7OA 3KLKA 4OE7A 1U1JA 4FB7A 4B5WA 1LWIA 2FB3A 3AFBA 2WCAA 3M07A 3GTFA 4UMCA 3LCXA 2FGZA 3NM3A 5AKQA 1GOOA 2PBOA 2C19A 4FHAA 1H2JA 4OQVA 4M6PA 3KBVA 4Z2IA 4NRRA 1XKJA 2FZ9A 5FEZA 2XFWA 4HNTA 4WZHA 3WCZA 1XIHA 4GI8A 4GD0A 3MBDA 3M4HA 5A2AA 3IJ6A 3TYCA 1EP1A 3M0XA 3DBPA 4HYWA 4O52A 1BG4A 1YPXA 3WUFA 1NJJA 5I3DA 4WSHA 3B3DA 1H41A 3N11A 3KDNA 3LCGA 4D1IA 4RR4A 3BK0A 2NUWA 1UC4A 3LHVA 2ZQ0A 3ZJ7A 3LBMA 5CPLA 1WE5A 3E6EA 1XYFA 2P76A 4JKKA 1KM6A 4ZO9A 3HQNA 3OOQA 4I5XA 3VX1A 4JFUA 2Y7FA 4QITA 4BEQA 1NF7A 1SMAA 5LIWX 1O5KA 5HXMA 1A50A 2Y0FA 4D8AA 5KITA 2ZX7A 3KUMA 4NI8A 3U2ZA 2OSYA 1L6FA 1UKSA 3VGDA 4JYEA 2G97A 1HL8A 4J35A 2PDUA 4DJEC 3T81A 1C9WA 2WZMA 3U6WA 4C1KA 4LCQA 1IXQA 1VJIA 2G0WA 2PDPA 2V30A 5J5DA 3OG3A 2I16A 5EY5A 3GDBA 3BLOA 3L68A 1WUEA 4KEUA 4ROQA 4JFWA 1G69A 4S3DA 4S3FA 1I2OA 3GM8A 3JW7A 3P0WA 3TN3A 4OU1A 4HZ6A 2J8TA 2WC7A 4MJMA 4JTSA 1KTNA 2VX6A 3PY2A 1Q8AA 3HMJG 1M03A 5CBIA 1VZWA 4A8IA 4BQ3A 3UCDA 2Z1XA 4UTTA 3LN3A 4DYEA 3ELFA 1FKWA 1WO2A 4PUUA 1S46A 1OABA 2V5BA 1GNXA 3GAYA 1W32A 3AIUA 5EMYA 2VFGA 1E43A 2P10A 4JTRA 3UP8A 2NUYA 3Q2DA 3A9BA 5XIAA 1JCYA 2QJIA 1CLVA 2FQIA 3MUAA 2G3NA 1PTGA 1UR0A 3CGTA 3OQEA 4ZXLA 2QKFA 2DZWA 4LUSA 4PUKA 1H11A 1SZRA 3EXTA 1PVNA 3BAIA 3Q45A 1RHCA 3LLFA 2XSBA 3GU2A 2FMNA 5AYYA 2DDXA 4QSFA 1F76A 2WNQA 1E1EA 1YNYA 3U8GA 1EBHA 3GVWA 4GJ1A 1UIOA 3N15A 1TV5A 4WEVX 4WSJA 2YL5A 2OYLA 2X0SA 1D3GA 1F05A 1AJ2A 1CW2A 5LNRA 4IJBA 1H7PA 1POJA 4F3HA 3FX4A 2B31A 5TF0A 1UA7A 1E6PA 3TQVA 2YGYA 1KCZA 4C6FA 2XWDA 4GNJA 1ISYA 3UR2A 3TU9A 4K7VA 3NURA 4GK8A 2A85A 1PPIA 3B8TA 4LALA 2PTZA 3TROA 2VX4A 5BXPA 3CHDA 4U5KA 3B0UX 3PAOA 2FPTA 3CZ8A 3STPA 3RFAA 3WEOA 4JNYA 4DVOA 3W7JA 3CO4A 5AN7A 3AOFA 3LGGA 1NOWA 3AYVA 3W22A 2XFYA 1XC4A 4JKMA 1TE1A 3IANA 4RE3A 2Y5SA 3I65A 1H7WA 4YYCA 4PBFA 4DM1A 3K5XA 8A3HA 4YJ5A 3GTIA 2ZYFA 3MZ2A 3RM9A 1EO5A 4EPEC 1GOMA 3VU2A 4WJEA 4FNRA 3U57A 3RF9A 1B30A 2PD9A 4DX3A 2ZVRA 1OWQA 2FZDA 3NDOA 4GC3A 2CITA 1YYAA 4GX8A 1F07A 3WD0A 4DBUA 3BICA 2HMCA 1V0MA 3AIQA 4INFA 1YRRA 1E71M 4RW5A 4RNHA 3S2JA 3MYPA 4LH8A 3POCA 5D2WA 2E6YA 4UTMA 3SFWA 4PN2A 2AOSA 3KS5A 3GKAA 2XIMA 5G4WA 4GI4A 4AY8A 1TIWA 3KE0A 1TTIA 3W7HA 4TVCA 2VJXA 2ZA1A 2CWXA 2IXUA 2I56A 2V68A 3IRSA 4WDXA 3N14A 3FVMA 4WK9A 1Z41A 2DORA 3GTXA 1M7JA 4TXEA 1O68A 3A3HA 3FVDA 5D04C 1MFUA 4HQVA 1C8XA 3K1DA 3BQ5A 1PZ2A 1VFOA 2WMHA 2OMAA 1W3HA 2YCJA 3F5LA 2RFGA 1E0UA 3OGVA 2XU2A 4IPIA 1YMYA 3R0DA 1LBFA 1SVDA 3UWYA 4IMDA 4XO6A 3H22A 2FDSA 6A3HA 4FNTA 2Q6ZA 1D3CA 1ZS2A 4JHZA 1F2JA 4PRTA 4D2JA 4CCZA 3W85A 1F5ZA 1IEIA 1DQXA 2I9UA 4CNSA 3AS3A 4IUOA 4JTCA 3BCJA 1HGYA 1LG2A 2V3EA 4E38A 2GOKA 1LWJA 2W5FA 5D32A 3A47A 4FOJA 2D2GA 2PF8A 4GQQA 2JF6A 3QKZA 1W3JA 2IPFA 1J2BA 1MUWA 5C9XA 4K8HA 1ZJIA 4BI5A 1JPHA 1S5MA 3PUDA 4A8NA 3CHCA 3MC5A 2E8YA 3AISA 2WCGA 4WLCA 4XAGA 3HPAA 3NQDA 1NFPA 2YSWA 3MI6A 4JHMA 1J12A 5JUVA 1OFRA 1MXSA 4J3ZA 1DQWA 3IWPA 3PJXA 1KWKA 5GPRA 3DOPA 1FOBA 2OSWA 4PGLA 3VKBA 4UCGA 4Y7EA 3N29A 2OOFA 1MEWA 5GJMA 5LYRA 5HANA 1FWFC 3TXZA 1IWPA 3NQFA 1U22A 3CUHA 3AJ7A 4JCLA 4QJ3B 5FF7A 4FIQA 3VDAA 3N19B 1SW7A 2PDLA 4OIFA 3NL6A 2QQ6A 4J28A 3GZAA 4AY7A 4YTUA 4ZB5A 5E0CA 3AXMA 3LA4A 2WZHA 3N9RA 3R58A 1JPDX 5FF2A 2CXEA 4KPLA 4FF7A 2YDSA 3WDQA 4E2OA 4RDYA 3HGJA 3ARRA 1WKFA 3STCA 1H51A 3S5NA 2GQ3A 2DSUA 3C86A 1TZ9A 2VQUA 3E12A 3EWCA 3WNKA 3VE7A 4GIEA 3GH5A 4C7FA 4RZ6A 1V6TA 1JPKA 4J3VA 2DJLA 4KQNA 2CLMA 1FCVA 4JIEA 3MA8A 4O15A 2ASHA 4WY0A 3RRAA 3SM0A 1Y7VA 1I0DA 3F03K 3E0IA 5BMXA 3ABRA 1Q8JA 2A7PA 4BWLC 7XIMA 3LQLA 4NAEB 1TQJA 2PRMA 4J9JA 5DMMA 4DJED 3GR8A 4AZ6A 2G41A 2Z1KA 2E7FA 4Q8MA 4UTHA 3WK3A 3SCTA 4DZAA 2GYIA 2CEQA 2VO5A 3V1HA 2I9EA 2CC0A 4RL3A 2KX9A 3U4FA 3L2MA 4ZQPA 4PEEA 1JZ2A 3GC2A 2FVMA 2R6OA 2OPJA 4HNUA 4KCWA 1T99A 3ZWSA 2WNWA 3DDMA 3JRKA 1Q2RA 3VGGA 5A8OA 4O28A 4AAJA 1EGMA 3TWBA 4KH2A 1Q6GA 4DNHA 2QS8A 1GORA 2QF8A 4HBKA 3N18A 1VJSA 3QPYA 2WANA 3VPLA 4C60A 1XLAA 4OTKA 5LXEA 3GTHA 4NX5A 1OZQA 3G1AA 4AIUA 1Q6QA 1ISVA 4WDWA 5KEZA 1S2UA 1XLEA 1GPWA 4GZ7A 3QQ0A 3VKKA 3VMPA 4GQGA 5I07A 3H55A 3GX9A 4R7WA 2YOCA 2G95A 1OFAA 1MDLA 2ZTKA 5A6BD 2MUCA 1FVPA 2BNJA 1CXIA 2A3HA 3LCHA 1UQYA 4GXWA 2HBVA 2E9BA 2X30A 3K4AA 4V1YA 3CEUA 5AHNA 3BJTA 3GG7A 2PDHA 4QDWA 1V02E 2VC5A 2YDRA 5CBJA 3FEQA 2QPUA 4NZ1A 3RDKA 1K7FA 1C8QA 4JIHA 4W8AA 4RUBA 2V3GA 2TAAA 4AD4A 4C65A 3T0DA 1P0BA 3RJYA 1Z69A 4N9EA 1A53A 2INZA 2WWDA 4FALA 4KCUA 3VDHA 5BWFA 4PTWA 2W91A 3VYLA 1GEHA 4U2ZA 3BE7A 2UY3A 3TYAA 1JCMP 4NZ4A 3MUZ1 3UD6A 1DJGA 4C1NA 1P0EA 4RW3A 3WLKX 4ZFCA 3T6CA 2DV0A 3I6RA 1FCQA 1JVNA 3EWYA 1I1WA 4GUHA 1YBQA 1YW1A 3N9SA 2REQB 3W7IA 3VE9A 1SFSA 4W93A 3CPRA 4AD5A 4EF8A 1WDWA 3ZS4A 1S5VA 3TNOA 1K6AA 1QR7A 4P61A 2WXDM 3B9NA 5EMUA 4A21A 3R0UA 3DYMA 3LRMA 4WX2A 2DVTA 5ABFA 1HX0A 1BWKA 4QM1A 1B90A 2EJ1A 3CZLA 4YVVA 3BLPX 4O16A 3V7PA 2C16A 3PJUA 1WKEA 3IGSA 3HPXA 2Q71A 1UR2A 3ZJKA 1I6NA 3IACA 1EA9C 1HW6A 4X22A 2GUUA 3WMBA 5IOBA 2NV2A 2ALRA 4GINA 4BJHA 1PXGA 2NX3A 4M6UA 3G1FA 1NOUA 1VR6A 2WMIA 4MAVA 5C2XA 3UGRA 2VRJA 4JFVA 2DY3A 3PBGA 3RG6A 1A3HA 1V0KA 3C3NA 1EZWA 2ZC1A 4Q8PA 1DE5A 3UF9A 4Q7IA 3B9OA 4XZIA 1E1CB 1KXTA 3WUGA 2PS2A 3MANA 2E1WA 2FZMA 3RGTA 3QKEA 2JKPA 1AZ2A 2WM1A 4BEUA 3GDLA 1BHGA 3HQ1A 3NQCA 2GWGA 4XUYA 1CEOA 4O14A 4JQ1A 2F84A 1OYBA 1ZJBA 4FZIA 1V08A 1RPKA 4NAFA 3S9IA 3SRDA 4K8EA 1GG1A 3WZ0E 3M46A 5AECA 2F6KA 3LHYA 2YB1A 3IVUA 5HUPA 3WLTA 1N8WA 2WAGA 3WQ5A 4XAPA 3EGJA 1V3LA 1REQA 4PMUA 2I1OA 2EPKX 2CHNA 2D2HA 5A6LA 5HJYA 1MW1A 1LRNA 1UZHA 3CL8A 4N7QA 3G2GA 4QS5A 2A0NA 3WLLA 1HXJA 4RE2A 3NO3A 1SFJA 4JEQA 3NDZA 3LU2A 1I9CB 3AXIA 2QAPA 4ZQOA 1X97A 4XZNX 2FFIA 3LCIA 2WO5A 4O0ZA 3VKJA 3S1WA 3U3HA 4UQBA 5EGRA 1XPYA 3TW9A 1IEWA 4L4OA 3H7UA 1NP2A 3PWGA 4Q4MA 1TV7A 4Z17A 2X7VA 1OFQA 4PUWA 3WLIA 3VNMA 3BZGA 2QUUA 1F3EA 2D69A 3FJ4A 3G77A 4CQBA 3TLQA 1EHAA 4WIWA 3CZKA 2DZAA 2BMBA 3CAVA 4M24A 3ES8A 5F1UA 1NQKA 3U48A 5T26A 3SQLA 5K3VA 4FP1A 1PTAA 2WBKA 4RZ5A 1SSGA 4JOMA 2HJPA 4XKYA 3KHJA 3DI0A 3WD3A 3M16A 2E3ZA 3EX4A 4WUIA 1RQBA 4K7YA 2Y5EA 2OTDA 3AUJA 1TSIA 1ITXA 1U5VA 2RJHA 4Q4OA 1OF8A 2FZNA 1GT8A 1Y65A 4AD3A 3PJWA 3KRSA 2Z1BA 3KWXA 4UOZA 3C52A 5DY2A 2J9ZA 4NQ1A 3W23A 4IP5A 1OCJA 4EVZA 1GQJA 1RP8A 4O1FA 5K9CA 2QJMA 3LI1A 1MNZA 2RDTA 4AF0B 2E6DA 2CLHA 2IKJA 4ZXOA 3VVGA 4HD5A 5I3GA 3G6LA 3F5JA 1UUOA 5FA5A 2XH7A 4LQ1A 1Z6KA 2FZBA 4UTTC 3MJYA 2YR1A 1LJYA 4DEFA 1X38A 2VEMA 2GWNA 3LRKA 9XIMA 3IV8A 3M5XA 1CIUA 2ZXQA 2HE8A 4TR9A 3ZYZA 3EKZA 5C7VA 3GS6A 4G7EB 4Q32A 4V15A 3FY1A 3ALGA 3AO0A 1HJWA 1WCGA 1NEYA 3TTOA 4Y9OA 2QEZA 4AWSA 4X63A 2HQAA 3VIGA 1H62A 3RYSA 1XG4A 1ADOA 1Q7QA 1OCQA 1VFTA 3UZXA 5DT7A 3NQ7A 1KV5A 4Q8WA 3V5OA 1GW1A 2PD5A 4CVUA 1AL8A 4MB1A 2QUMA 1H7RA 3GXMA 2XVGA 3GAKA 5LIXX 2A5HA 2QPSA 5HBFA 1TX0A 1RBLA 3E0FA 5CEWA 3MKKA 1VCFA 3TR9A 2P1FA 3O8AA 4KRZA 3BOLA 1CNVA 2XFFA 3W1MA 1VIWA 3CASA 2QHAA 1XQLA 3OZYA 3RLGA 3R79A 2GOUA 1MQQA 1RBOB 4GIRA 1EOKA 5HJLA 1HP4A 1OX4B 4Z2LA 4DJFC 4DBDA 2VOMA 3R11A 3LMZA 4IG2A 1V79A 1QBAA 2Z00A 4H6QA 1GGOA 4C6KA 3U0HA 4IMEA 3VNYA 1XBYA 5E6ZA 1NOFA 1ITCA 3A13A 2YW4A 1M41A 5F2LA 4MFEA 2GFTA 4JTAA 4ZQCA 1CTNA 4C6PA 3W53A 5GJPA 3GNXA 3C2FA 3W38A 2RKXA 2FPVA 2PURA 3PULA 1V6WA 2ZX6A 4QQ3A 3GUWA 5EL1A 5I7GA 4HZ7A 1TJPA 3ARVA 4GYPC 1BRLA 3QOMA 1XH0A 2HTMA 4X3ZA 2A3AA 2QGHA 1JL8A 5I3HA 1TPDA 1FKXA 1AJZA 1PZ0A 1UZDA 1BGAA 3RXZA 3R7MA 4AWTA 2YXGA 2VEKA 5FESA 2EO7A 1XJBA 3V5CA 3F2DA 3TZNA 2FDMA 3UCCA 4JN8A 3VX0A 3ARTA 3CS2A 1TQXA 4IX0A 1FWJC 2J9YA 5BOOA 2PZNA 3GC5A 5I24A 4UZSA 5JXQA 2PDYA 3BTNA 3UWQA 4HU0A 3XINA 1PKMA 2OX4A 4XIAA 3CO8A 3S4TA 3GDKA 3KTXA 4JTTA 1PYFA 1ITQA 3AMGA 2CLOA 3TA6A 1GQNA 3NL3A 3SUVA 3ZT5A 4D1JA 3D6NA 4H2CA 3F4CA 1TR9A 1S2CA 4Y90A 3NEHA 3M0LA 3P2VA 1UOZA 3OIXA 4J3XA 5D9PA 1VF8A 1TPB1 3UA4A 1WDSA 2CPUA 3BLDA 2O4MA 1F7BA 3PANA 4JIIX 2ZRZA 4AZ7A 4CQAA 1N8IA 4TX6A 3P5YA 5EBAA 1RPXA 2Q8ZA 3BG3A 4GVHA 2E4TA 3LV6A 3BARA 2PMQA 3W1XA 2BOFX 4X2PA 1EL3A 1T6MA 1WA3A 3V16A 4XZLX 3UZJA 1MXGA 1R9XA 1B4EA 4IZGA 2AL2B 4AYSA 2ZBTA 4WQ6A 1A3XA 5A8NA 4JL1A 4FO4A 3EYPA 3NQAA 1XRVA 4A8RA 4GVIA 5DRIA 1L0PA 2GUBA 1C3FA 1EIXA 3PTDA 1OGBA 2W61A 3GQYA 4ATDA 4NNCA 3EX2A 4QEHA 5F4WA 4AD0A 3MYOA 1Q66A 3TWAA 3LX9A 4O10A 4BI6A 1Z8AA 2R9RA 2CZFA 4FOUA 2RAGA 4PCFA 1PX4A 1WBHA 3W7LA 1KCLA 3UJFA 1VEOA 2W3ZA 4MG4A 1P5BA 4R5EA 1XYMA 4NZ3A 1GKRA 1VIZA 2QDDA 2CLLA 2ACQA 3NPXA 4A3YA 3QYSA 3DEQA 5DXYA 4M19A 5DF0A 1HKMA 4GCAA 5A8PA 1OFEA 8CGTA 3FYYA 4L5ZA 3WK1A 2R8WA 1XLGA 5CAKA 3M43A 4MNMA 2WPBA 2GDVA 4KCTA 3EOEA 4F8XA 4O50A 1TTQA 4NXSA 2PU1A 5E6YA 1QNSA 3DFPA 4RE0A 3IJ7A 3CZEA 3FA3A 5CSYA 3OEXA 4V27A 5JIPA 2VFHA 3UG4A 3VUPA 4AD2A 1ESWA 1HKWA 1EA0A 2QT3A 1V6YA 3FSTA 3TXVA 1V02A 3NGJA 2QIIA 2GGEA 4LEFA 4XV0A 3WG6A 3OBEA 1W2PA 1EPXA 4M1RA 7REQA 5HPOA 2XDFA 4AHPA 4TO8A 3UZYA 4XBSA 1XH1A 4LV9A 1RY0A 3TJLA 3L0NA 1N7KA 4ZVJA 1QVBA 1OY0A 5IFPA 4GI6A 1DEDA 1U30A 4D6EA 4B5UA 3LCLA 1EZ2A 4ASTA 3REQA 4JTIA 3P74A 1W5QA 3G1YA 1E73M 1XCFA 3BVJA 3EDFA 5F7UA 1RVKA 1X7FA 6REQB 5C8BB 1KFJA 5A94A 4PFMA 1KBLA 1QNQA 2DSZA 3VCRA 1U5HA 2A7NA 3OLIA 4UMAA 2UZ9A 1LOLA 1SSDA 4ADSA 2HV5A 2ISVA 2H90A 5I0DA 4CGTA 2NVDA 1ZBWA 1NP0A 4DBSA 1PYMA 3B06A 3WY1A 1XKYA 3KBJA 5AYBA 2IQ0A 4I9AA 1ZAIA 2D1ZA 1HJSA 1UYQA 1LM1A 3TE9A 1ZENA 2ZADA 4ILSA 2ZE0A 3OGRA 4IGHA 1RUSA 1VPYA 5CCZA 2A3LA 4AEOA 1Q65A 2DH2A 2W62A 4IPLA 2DZUA 3WQOA 2ZRYA 3DYOA 4MJZA 5MKGB 2V5LA 5CC5A 2WQPA 2EGZA 2VEIA 3T40A 3L65A 4PL1A 3DN5A 1L6GA 3QMTA 4AZCB 3VNDA 3R5EA 3OB8A 4N02A 4M82A 4B4HA 4ERGA 1CLKA 2HROA 3A4XA 7CGTA 4H8VA 1RK6A 4RNJA 2YCLA 1FH8A 3GXNA 1TPUA 1CXHA 4PMYA 2WSYA 1EYWA 1G1YA 4DWSA 2F9RA 2BWGA 4HU4A 3ZM8A 4GYJA 2OU4A 3ATZA 2YBTA 3BAXA 1O66A 1HGWA 3HFTA 4DELA 4N2YA 3URNA 4Z08A 1XIGA 3CUGA 4JTFA 4GY7A 2VZVA 3LGEA 3AU2A 3TKFA 1TMQA 5FSDC 3E0LA 4QG6A 4HOWA 3DFNA 5D9MA 3W83A 3HV9A 3SUSA 1RCOB 1NWRA 4YNGA 1CXFA 2BGSA 4LC6A 4D6DA 3UR7A 1ZSXA 4QE4A 4XZMX 1AW5A 3GYEA 3VM5A 2G3JA 2XH2A 3E2RA 1JF6A 4HHLA 3D3AA 3ZMRA 1P43A 3A4AA 3N3MA 4DJFD 3U5YA 1XDMA 3VO0A 1XRSA 1NY1A 4TTGA 4RDVA 1EIBA 4EWND 4HA3A 2HPMA 1C93A 4OVXA 3MMDA 1NH6A 5KETA 4GUFA 1LBMA 4LUIA 4H01A 5C6MA 4QEEA 1XCWA 3NL5A 3I68A 4P8XA 1SO6A 3UETA 3SCRA 1MQRA 2V81A 3H4GA 3I7QA 1JF5A 1VJZA 4DXVA 1QHOA 3O06A 4Z42C 1ECEA 3P0XA 3ECQA 3O07A 4CN1A 4IX2A 1E55A 4Q4SA 4I7WA 2DT2A 4RK8A 2YDQA 3DKLA 2QJGA 2QDEA 3N4FA 4CLMA 3AZTA 3W81A 1HO1A 4HMDA 1L9WA 2L5HA 4TTUA 3UJ2A 4Z1DA 3GB6A 4GKLA 4LUJA 3RCMA 1OYAA 3S6OA 2PGEA 1N2VA 2FLIA 3KDOA 4Q7BA 2JKAA 1X8CA 1XIIA 3IJDA 3RPDA 2J6XA 2W67A 2WK2A 1YXDA 1P6WA 1W3LA 4LV4A 4IP7A 1ZHAA 3LM7A 2P50A 2H8ZA 5FF4A 3AU6A 4OZOA 4U28A 1BPLB 2H6RA 3S2MA 3SQMA 1QOPA 2Q3OA 4JN6A 3I10A 2PDMA 1XSJA 4B5XA 2OCZA 4Y9AA 1FY6A 7ENLA 1WZAA 4QISA 4EANA 1O1HA 2P0IA 4REQB 1RJRA 3GRIA 1M1BA 1W2VA 4U4MA 1HKKA 3F7JA 3GU1A 1XD1A 3E0WA 2VENA 2BX7A 4ZTYA 3C56A 3M5ZA 3LTYA 4TV6A 2FH8A 2ANUA 4UQDA 4W7UA 4HZMA 5HPCA 1C7SA 3MMUA 5DX7A 5CBBA 2AQWA 1IXPA 1TV2A 2PLKA 4H9TA 3ZR4A 2CZEA 3AMDA 5BNKA 5IDZA 1ZJHA 3NTYA 3T4WA 1UR3M 1HP5A 1B3ZA 3M6DA 3PZIA 4IPPA 3NNTA 5HMDA 3BH4A 2OWCA 1L6YA 3EA1A 3LQGA 1Q85A 4MJ2A 3ZIZA 2OXNA 2PDBA 4H41A 2RGLA 1Z42A 4FNPA 4LPCA 3HGSA 2XIQA 2RDWA 3B0XA 1I45A 3HG5A 4B9YA 5HNRA 1I2NA 4HJFA 3LY0A 1CENA 4EF9A 2V9DA 4WHBA 5EFDA 2Z25A 2O9RA 5CGTA 1VCGA 4GBUA 3CIVA 1JUEA 4EE9A 2WMFA 2PTYA 2QLYA 4H7ZA 4N9CA 3GNRA 4XAZA 1PV8A 2NQJA 4B5TA 5BXRA 3RIKA 4E3TA 4XTIA 3VIOA 4XD4A 3NPUA 3O15A 2H8XA 3A5FA 4WKFA 3NIYA 2I7GA 4ES4A 3PBMA 1EH9A 3BV7A 4JY8A 5LNVA 4ACYA 3DGBA 2ON3A 3Q58A 4I7VA 1KBBA 1QO2A 3HJZA 4LAOA 5A95A 3EMCA 1PX3A 3MTWA 3QHOA 4QLJA 3QY6A 1ME9A 1PL9A 4S3GA 1OIFA 1P48A 2NXHA 2E0PA 5LA0A 1M01A 4PCPA 1LOSA 3Q4DA 3RLUA 1M53A 3SSJA 3W1NA 3NPWA 2VXNA 3RO8A 1P7TA 3E2VA 2AAAA 2VMFA 1S39A 3E9AA 5FF0A 2Z28A 2CW6A 4HTBA 3NM1A 3LCFA 3MZNA 1EWEA 5CXPA 3KL0A 1TTJA 3HU7A 1A49A 1BYAA 3LBCA 3U5UA 3P6LA 3HB9A 1YTEA 3PPCA 3VNKA 1UCWA 1EFZA 3S0CA 2XPKA 1XYAA 2PF0A 2DZPA 3H8AA 4DB7A 4W85A 2J4GA 3SY5A 4ZOEA 2GK1A 3NZ1A 3FAWA 3OJGA 3BWWA 4XZWA 5FOOA 2YYTA 4JHOA 4Q4PA 1K7XA 3W26A 3CAQA 2QZRA 1SQ7A 3Q94A 1YDNA 3FDGA 3QV8A 2HPIA 3GHUA 3VK5A 5I23A 1EUAA 3W6LA 3EWZA 5CLTA 4TMCA 4DJDA 1H4PA 2NXGA 1KGXA 1OD0A 3LPFA 4LEQA 2OLAA 4TMBA 3NAVA 1UWIA 2W27A 2BVDA 2AMXA 5LIYX 3N2MA 1CZ1A 1GOXA 4YPJA 1RLCL 4IISA 4J5NA 2NUXA 3TLLA 1R7OA 3V1PA 3VOIA 4A3RA 4XQ6A 1FWRA 4C6EA 3QH2A 2VKZG 5CJ5A 1XIEA 1O1ZA 4S1FA 1Z44A 5D2XA 4MYAA 4GVFA 1XPGA 3WBEA 2OYKA 1KQYA 5IRPA 2QULA 4A2RA 3VGFA 4AQLA 3KL5A 2GVLA 2WVVA 5DQPA 2BSLA 1XQKA 2J8FA 4Z1CA 2ZC8A 2WKJA 1SFLA 3R89A 3EOUA 1KGWA 1PIFA 3WQFA 4KFOA 2CLKA 2JQXA 1U33A 4NI3A 1F4HA 2H9AA 3DGRA 5H8MA 3R12A 5G1YA 3MUCA 3I7RA 2DSWA 5FJIA 1S3TC 5M03A 3CUXA 2BY0A 3BMWA 1DV7A 4GLEA 3BLLA 3KVMA 4KF1A 1YEYA 1NDWA 3GG1A 1LBLA 1FP9A 2JIEA 1U83A 1GJWA 4GXMA 5HWMA 1X8FA 1F9CA 5K2ZA 1HL9A 4AD1A 1C90A 1AH0A 4UR9A 2FHFA 4ZSUA 5CSUA 5DT5A 4LUSB 1DORA 1JFHA 1R7AA 3P67A 2BVWA 4HK5A 1W9VA 4FEZA 4M6VA 4DRSA 5D37A 4DJEA 4LB4A 1GQKA 1FH9A 3LI0A 1JZ5A 1JDFA 1F4AA 1ZB5A 4IIHA 3TCEA 3WL1A 4PSPA 2Q02A 5DANA 5GNXA 4P5UA 3MSGA 3H4WA 4UUIA 4PODA 1T8XA 4IUGA 3ZZ1A 3THAA 1KFKA 4BCEA 4QLKA 2RJGA 4BQ4A 1W1A1 4C6MA 4D72A 3NQ2A 3VCNA 4OUEA 3PZUA 1HZYA 5BROA