4XVDA

17beta-hsd5 in complex with 4-nitro-2-({4-[3-(trifluoromethyl)phenyl]piperazin-1-yl}methyl)phenol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
314
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 314
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xvdA00
2IPGA 2HE8A 3R58A 2PD5A 2HVOA 4XO7A 4DBSA 2INEA 1T41A 4G5DA 3ONCA 1MRQA 2F38A 4F40A 2ACRA 3EB4A 3UG8A 3UWEA 4FAMA 4RPQA 3LN3A 4XVDA 4WRHA 3R43A 4ZFCA 4LAZA 4XAPA 3V0UA 4YS1A 3R7MA 3RX2A 2HDJA 4JQ1A 2BP1A 3H7UA 3M0IA 3QKZA 5LIWX 2FVLA 3B3DA 1S1PA 3MB9A 4L1XA 3LBOA 1RALA 2PDHA 2R9RA 4JIRA 4FZIA 4I5XA 4JTAA 4JIIX 4LBRA 2HEJA 1US0A 3FX4A 2FGBA 1ADSA 3MC5A 2BGQA 4GCAA 1ZUAX 2CLPA 1PZ1A 3WBWA 1XF0A 2PEVA 3GHTA 2PDKA 2A79A 2DUXA 5HNUA 2I17A 2IPFA 1EKOA 4QR6A 1XJBA 4XZIA 4WDTA 2PD9A 2AGTA 3GHUA 3WBXA 1PWMA 1MI3A 3COTA 1ZSXA 1SM9A 2BGSA 2PDBA 1YNQA 2PF8A 3UZYA 2WZTA 4GACA 3UYIA 3G1RA 1Z3NA 2PDLA 4LB4A 1J96A 3LQGA 2NVDA 1VBJA 2QXWA 1MZRA 4OTKA 4LBSA 2FZBA 1IHIA 4GIEA 5C7HA 4WDXA 4XZLX 1IEIA 2FZ8A 1UR3M 2IQ0A 4HMNA 5JH2A 3M4HA 4IGSA 4DBUA 3RX3A 2IKGA 3LENA 1X98A 2PDQA 4WDUA 4IJRA 1R38A 1K8CA 5M2FX 2ACUA 2PDUA 3WCZA 3CMFA 3BUVA 3GUGA 2IPJA 2J8TA 1AFSA 1EXBA 4JQ3A 4AUBA 3DOPA 3CAVA 4JQAA 3UZWA 1QRQA 4Q3MA 5JH1A 1HW6A 1YNPA 4DBWA 1YE6A 4FALA 4PUWA 2PDWA 4LAUA 3CAQA 3V0TA 3R6IA 3H7RA 4R9OA 4XZHA 3Q67A 3UP8A 3BCJA 4PR4A 2HVNA 1FRBA 4JTDA 1X97A 3BV7A 3N2TA 4QX4A 5AZ0A 1M9HA 1ZGDA 4PRRA 4GQGA 2DV0A 1OG6A 3U2CA 2R24A 4LB3A 3DN5A 2PDCA 3GHSA 2ACQA 2PDIA 1EL3A 1AZ2A 4GABA 2ACSA 1X96A 3O0KA 3GHRA 3EAUA 3EB3A 4JTRA 2IPWA 3H4GA 3S3GA 2PFHA 4XK2A 2ALRA 1GVEA 4WGHA 3F7JA 4QXIA 3N6QA 2PDYA 3D3FA 2F2KA 4MHBA 4FA3A 1PZ0A 5LIUX 4NKCA 1T40A 2PDPA 3BURA 3LEPA 2PZNA 3M64A 4GQ0A 3CV6A 3C3UA 2PDMA 4YVVA 2IQDA 3CV7A 3V0SA 1Q5MA 1Z9AA 3KRBA 4IJCA 3UZXA 2FZDA 3LNMA 3O3RA 5AZ1A 1Q13A 1RY0A 1LQAA 4EXAA 4Q7BA 3UGRA 3R94A 3VXGA 4XO6A 4WEVX 2PDNA 3V35A 1PYFA 4YVPA 3P2VA 3R8HA 4EXBA 2IS7A 1ZQ5A 2C91A 1YE4A 2NVCA 4DZ5A 4PUUA 2IKJA 3NTYA 1Z89A 4H7CA 3LUTA 4XZNX 2IKHA 1EF3A 3Q65A 4YVXA 4JIHA 4JTQA 3V36A 3LQLA 4JQ4A 2P5NA 4HBKA 1AH3A 1AZ1A 2HV5A 1RY8A 4XVEA 1PWLA 3RX4A 4JTCA 3R8GA 1VP5A 4PMJA 4WDWA 4QBXA 3FJNA 1S2CA 5LIXX 2WZMA 3G5EA 1C9WA 1S1RA 2DUZA 3LZ3A 3CASA 2PDGA 2IKIA 4H8NA 1AH4A 1LWIA 3WBYA 5KETA 3LD5A 5LIKX 2PDXA 4PRTA 4ICCX 1A80A 4ASTA 2PDFA 3WG6A 2I16A 1JEZA 1Z8AA 3UZZA 5DANA 2INZA 2PDJA 4JQ2A 3ONBA 4GA8A 3UFYA 3LZ5A 4XZMX 2VDGA 3T42A 4L1WA 1AH0A 1QWKA 1S2AA 2HE5A 3ERPA 4YU1A 2ISFA 1HQTA 5HA7A 1XGDA 2FZ9A 5HNTA 5LIYX
chains in the Genus database with same CATH superfamily
4AB4A 4J3WA 1JCJA 3MMTA 3SRHA 4LW7A 1SFTA 3ZLFA 2ZX5A 2PTDA 4KF1A 4NSBA 1CLKA 1MRQA 5HWNA 2HZGA 3CZGA 4F40A 1JCTA 2ZIDA 2I5GA 2AMGA 1QPKA 4GY1A 3MHGA 1XIMA 5FEWA 5DQPA 2UY5A 2VX5A 1IEVA 1KFJA 1XDMA 1IYXA 1LQ0A 5FF2A 3VAVA 5BCAA 4GWEA 1WBHA 1EFZA 5MF5A 2EKGA 2Y8UA 3IVTA 3V0UA 1HG3A 3DECA 2WC7A 3P67A 2A0NA 1M3UA 3NQ6A 4F0RA 1VF8A 1LWHA 2BP1A 5C7VA 3WDJA 3EBVA 3W1XA 4WSKA 3SCRA 1U22A 4H8VA 4RZ5A 5CXPA 5AC8A 4O50A 4DXKA 4L1XA 3FA5A 1IZKA 3EMCA 3HTWA 1E4LA 3N2OA 5C54A 3GW3A 5D37A 3S1UA 4H04A 1CCWB 3QC0A 3BANA 1R3VA 4PFMA 1R3YA 4DZAA 4DWSA 1GKPA 1H7NA 3WUEA 2PMQA 1GVIA 4UB9A 3W7PA 2C16A 2D1ZA 2ZQ0A 4Q4SA 3UETA 1F7BA 1RA5A 3W76A 1YW1A 5BMWA 4GHRA 4HA4A 2FIQA 2PEVA 3LV5A 3KOZA 1W37A 2IPFA 2JF6A 5GPRA 3R79A 4K68A 2C1IA 3WQFA 5A2BA 1UWAA 2XSBA 1OG0A 3CC1A 3RJYA 3UZJA 2AL2A 3D46A 5E0KA 3QV8A 1FHLA 1KGWA 3ZT7A 1AUSL 3AU6A 1EOKA 4QG9A 3HQOA 3LPFA 3PN8A 5C9XA 1ADDA 4NNCA 3DXIA 3QXBA 3VD7A 2VUNA 3UW6A 2WM1A 1WYIA 3SUTA 2QXWA 2V38A 3VDBA 4OBSA 2V3EA 3ARPA 3O05A 4AD5A 1HKMA 4PB4A 1EGZA 3S5YA 3EEZA 4R53A 3GBDA 4WDXA 3W7HA 3M5YA 4N9CA 1F2JA 3WJSA 5AN7A 4AZHA 3BCFA 1GEQA 1Y65A 4HMNA 1W2VA 2TYSA 1TMQA 3ITVA 4LYRA 1I6NA 2DZBA 1WXJA 4TTGA 1GTEA 2PP3A 4K1WA 1CXLA 1R5YA 2NZLA 4JS3A 5EMMA 3L65A 2YFOA 2WHMA 3EXRA 2GVYA 2FYMA 1NELA 1BXCA 3R11A 6TAAA 3GKFA 3S6OA 3TYEA 3DOPA 3CAVA 4ACYA 2EEXA 4UC5A 2CC0A 4R7JA 4B9YA 4DI8A 1J5TA 3MMWA 4FO4A 1GHSA 1YE6A 3GDMA 3QMTA 5DXXA 5K9DA 3EWDA 3TMLA 1BQCA 1JDCA 4M7SA 1KFLA 3S46A 4J35A 5HAOA 1LP6A 3N2CA 4P5UA 1E1CB 2DV0A 3N12A 2GLKA 3TK7A 4EPBC 2R24A 4MWAD 3GYCA 2CLOA 3W7JA 4JFVA 4CU7A 3U7BA 3MVIA 1OBAA 3U6WA 2V0TA 5E70A 2ACSA 1RD5A 2P8BA 3WH8A 2ZXAA 3W81A 5G2IA 3ECQA 4D6HA 1LQ2A 1NY1A 2OO6A 3KHDA 3OLGA 4HNLA 1J5SA 4JIPA 2CKRA 2W62A 2BGNE 3CS2A 2ZTJA 1IR1A 1B54A 2PDYA 3G0UA 3W74A 1KRCC 1XLBA 1YNYA 4UTTC 4NRRA 3HQPA 3IGHX 4I6VA 3W70A 1GW9A 3W72A 3HMCA 2CLFA 3HG2A 3TYCA 1W3KA 3MPGA 2PDMA 4PEEA 4WY0A 1ZHAA 4P7OA 3G1DA 1A5AA 4PB3A 2ZRUA 5FKYA 3OLEA 5F2MA 3ITYA 5DN1A 5HQMA 3ZJ8A 1J11A 1HP5A 3L7RA 4PTXA 2FZDA 1DBTA 1KTNA 2YDSA 1POKA 2DSUA 4NASA 3LA4A 1BRLB 3G1HA 3PPFA 4LQ1A 2V5BA 4NVTA 3HPXA 3WQVA 3WNLA 8CGTA 2EO7A 3EPOA 2A3BA 2BLEA 5FF0A 3VM5A 4N0RA 2X1IA 4JR5A 4UNKA 2OGYA 4J3XA 3M0HA 4F0SA 1F6KA 1M41A 1JZ8A 1UQYA 1TQXA 3CQHA 4XZNX 1BQGA 3W24A 3DKLA 4UQEA 3ZFHA 1EO7A 1EHNA 3QMRA 4JICA 1FWFC 4AMCA 1QK2A 3SFWA 1C8QA 3MI3A 4FPSA 5DLCA 1IT8A 3F5LA 3DFNA 3LQLA 2VO5A 4WHBA 1JNDA 2OZ0A 2EG7A 4UQAA 1LBFA 4PULA 4CN4A 3KVKA 3VX1A 1IWAA 2ZKMX 2D2HA 1G94A 3C2RA 2GZXA 1AJ0A 2X40A 3MI6A 4GJIA 4W8AA 4QG6A 1VS1A 5C8BB 4ZMGA 4ZSUA 1TZ7A 1UH4A 1EJXC 4P8UA 5LIXX 3LHZA 1FWDC 2D20A 4M5PA 3TJIA 5ABFB 1LRQA 1JFXA 4TU1A 1TIMA 2WXDM 1P7TB 4H4IA 3G1XA 2CZDA 1JULA 2UBPC 1W56A 2NQLA 3LD5A 2PDXA 2VFHA 2YCJA 3K1DA 5HMDA 3SECA 3ZT6A 4H7VA 4J3UA 4QSHA 1E55A 3KTXA 4JTGA 1UBPC 1EIXA 1KBJA 3VYLA 3WLOA 4FMVA 5SWUA 4LS2A 3I4KA 2QCFA 4D71A 4UFHA 3H2NA 3QLDA 1BWLA 5DELA 3PP7A 5G1TA 3UCCA 4ZOBA 1PTAA 2V67A 1F73A 1ZAHA 2HS8A 1QHOA 2YSWA 3UG5A 4GVGA 3RAOA 1PKMA 2XFYA 4Y8FA 1TPEA 4ZB5A 2VVNA 1OWQA 1CDGA 3MQTA 1TKKA 4XBSA 1XISA 1H5YA 1HP4A 2ZZ5A 1QAPA 4UTUA 3T4CA 1ECQA 1MUCA 1S2TA 4QTGA 1UWQA 1R7OA 3W2KA 3T2OA 2BXZA 1TTIA 1XH1A 4IQJA 4QITA 2XU2A 1UW9A 4NZ1A 1FBAA 3R7MA 4OKDA 5I3FA 3NQMA 4UWMA 2NV9A 2PSNA 3NEVA 5K9CA 3AWOA 1OX4A 4S3CA 3PK7A 3CZKA 2B7QA 2YDAA 1QNQA 3GDLA 4XWUA 3GSMA 2X0YA 1EDQA 2YJQA 4GQBA 4CNTA 2V3GA 4HA0A 3GDTA 3NL6A 1MVYA 2ISDA 2BNJA 3FV9A 3W85A 3PZ9A 3RCMA 1RALA 3GTNA 3HJZA 3O6YX 5D2WA 4DF0A 1GOXA 4Y6GA 1XLJA 4I9JA 5KZEA 4GO9A 4GX8A 3BH4A 3UA4A 2J8GA 2BMBA 4LYKA 2JBMA 2AMXA 1QMLA 4LTSA 3V75A 1TTJA 1ZUAX 4KWSA 4ORMA 1GEHA 3WL0A 5IDZA 2WKJA 3IGXA 1DJGA 5D05A 1H1YA 1ONXA 1WAUA 2VTFA 3SGGA 4NIRA 4AZCB 5F1VA 3G77A 3MTWA 2DFAA 2RFGA 2VCBA 2ZZ7A 2R94A 3LX9A 1M01A 1V6TA 3LGGA 3AWNA 2NW0A 2JGYA 1QPNA 2WVVA 3YPIA 5C5YA 4G7FA 1WZKA 4S3BA 1V93A 4HN4A 1FDJA 2E5DA 2Z28A 1A5BA 2JIWA 1D3CA 3OA3A 4LUTA 1NOUA 4KGLA 4EVZA 3S5SA 1VFMA 4LFYA 2WSYA 1A5UA 4LU0A 5KSWA 1EHAA 2VR4A 1XP3A 3AXHA 1R2SA 3C5QA 2YL6A 4FB7A 3KL0A 4AY8A 3VPLA 2J6XA 1QPRA 4CEUC 4WDUA 2VENA 4DVOA 3C2EA 5XIAA 4IG2A 2CHRA 3PANA 3GUGA 2E5BA 1WNOA 2ADAA 4A05A 4DO4A 3G1SA 1QRQA 1TJ2A 4K3ZA 2WSRA 2BODX 4HPNA 3UBPC 2YXOA 4QHRA 1FCUA 5A94A 1RVKA 4KRTA 3FJLA 4CD4A 4W4QA 1W31A 3AHYA 3W7IA 3CAQA 4RLIA 1NWUA 3B06A 2G4FA 3LHYA 1BGAA 1ZALA 1UKSA 4E0CA 1BKHA 3SCSA 1TV2A 1R3WA 1BLIA 4DO6A 1OG6A 1W1A1 3NQEA 3OJGA 4Z2KA 1OX6A 5KZ6A 3WY1A 1E3ZA 3VNYA 4RJEA 1PEZA 3EMQA 3H6OA 4XAYA 4E3TA 1G7VA 3A6OA 1G7UA 4QJ4B 1GOIA 5HXMA 4QQUA 4GNKB 4B15A 3BSHA 1FHVA 2IPWA 1EA9C 4F79A 4UMBA 1QFEA 1FWBC 4IP7A 2VELA 2ALRA 1U5VA 3NSNA 1GZ1A 3DFHA 1D8CA 5LIUX 2J88A 1W1VA 1ZBKA 4O12A 1L6SA 2PZNA 2R1NA 4JFWA 4IIEA 4HYWA 2NV2A 1XYCA 1W5OA 4KERA 4LY8A 3KRBA 1W1PA 5EFDA 1EIBA 4Q33A 3WLJA 3WQ4A 1HXJA 5LA2A 5C9ZA 2GOKA 5AVNA 3IGUA 1Q13A 3RR1A 3EXSA 4FS9A 1VPYA 2GSEA 3F2CA 4S2BA 3W75A 3WD3A 2OZTA 3EDKA 1Q66A 2WO5A 2Y70A 1KM6A 4Q8TA 3GTFA 4PFHA 5I5RA 3M0XA 4U5IA 1B3WA 3R8HA 3WH5A 4N42A 2BHUA 1R87A 1JFHA 2OX1A 2BY0A 4Y9AA 4XSLA 1FWGC 1WOBA 1S5TA 3ARZA 5GNXA 5AC4A 3PTKA 3PC0A 3HPAA 1BYAA 2W0UA 2OMAA 4XZBA 3OA5A 4YXGA 4FX7A 2GGIA 1B5TA 4ZE5A 4B92A 4NUWA 1EF3A 3Q65A 4O17A 4C6JA 4XTIA 3C52A 2WPGA 5D2XA 4PUMA 3PSVA 3TR2A 1SUXA 5EBAA 3PWGA 1ZS2A 5H6HA 4XV0A 5BW6A 3TYDA 2EXOA 3LERA 7A3HA 5A69A 3N04A 3MUAA 5I2UA 2GQAA 2X2YA 1G4SA 2F7FA 3NEHA 2TAAA 3T44A 4JKMA 1JPMA 2FFCA 2XIIA 4JFSA 4LEFA 4A8LA 4YL2A 3C0LA 4FXJA 4DJDA 1N8FA 4JYFA 4F2BA 3H2EA 5FJUA 3WDIA 5HMFA 3W87A 4UUIA 3IANA 2C1HA 2XWEA 3MSGA 5FEPA 4W93A 4DWSB 3VIIA 4GQRA 1NDZA 5AHNA 3AHTA 1B3XA 2QDHA 4DYJA 2XIOA 3UXIA 5K4ZA 4FXFA 3SDOA 3LZ5A 2YXGA 4AIBA 2REQA 4HKPA 2ESCA 2H6RA 3L5LA 3O7UA 3TTEA 5I24A 4UOZA 2O55A 1UP2A 3K2GA 4IFRA 5IBXC 3BLPX 2P8CA 1H5VA 2VWSA 5BYWA 3DAQA 4Z1BA 1DOSA 5EMKA 3TFCA 5H2ZA 3DFOA 5TF0A 1KFBA 1BWVA 2CWXA 3BAJA 4HHMA 2YX0A 1BHGA 2QR6A 3AIEA 1MXGA 2DIKA 3KHJA 4M6QA 4XO7A 4ECLA 2AQVA 1XM3A 3WLTA 5B7ZA 4JHZA 3U7VA 1LOSA 2FVMA 2AAAA 4RKAA 1TWZA 1VH7A 1G01A 4A29A 3VOGA 3QVQA 3UWEA 4FAMA 5CC6A 2OG9A 3EX3A 3W22A 4ZEPA 3JRKA 3WJXA 3LBCA 3HGSA 4TVDA 3KP1A 1R8LA 3ANYA 3C2YA 5GVJA 5GNYA 2C7FA 3R43A 4JNZA 4P8XA 4E8DA 4LPCA 4O1FA 3CH0A 3RLVA 5CSSA 1S2WA 2JIEA 1FWIC 4IXXA 1J9YA 3O06A 3IAQA 4HNCA 1VFTA 1I45A 3VNZA 1KFEA 1BFNA 3T2QA 1LUCA 1EH9A 3RR4A 3BG3A 3GW0A 2PP1A 3KTCA 1DJQA 3CEPA 2Z00A 5JMUA 4TV5A 2QV4A 3I4EA 3QV6A 3E3HA 1AK5A 1BG4A 1OYCA 1AA1B 2I56A 3ABRA 2BDQA 5FSDC 1V7AA 2W63A 2BGQA 2B7OA 4UIOA 5CSRA 3KVJA 1WCGA 4HZ6A 2PC8A 2OLHA 1Q6OA 5HNUA 2AAMA 3QR1A 5BRPA 4QJ1A 4WDTA 1AL7A 3WQCA 3GHUA 1J79A 4CKQA 1W3TA 2PWGA 4KCWA 4D8ZA 3W1MA 1I2RA 1E1EA 2WC4A 3APGA 4H8UA 4ZO9A 2PDBA 1NSJA 1WDRA 5DCEA 3BVJA 4JTIA 1VAHA 3BZJA 4B4FA 1DP0A 4WY0B 1QASA 1WBJA 3QFEA 4IP4A 1TJPA 3G1AA 4JTUA 2WVSA 1FHUA 1IHIA 1UH2A 4GIEA 3K8MA 4KETA 4Y9MA 4W89A 3SADA 1JCLA 3VCNA 1RH9A 3VNJA 4M51A 5CPMA 1K9TA 4C5ZA 4DJFC 3CWHA 3O1NA 5CC7A 2VGGA 2XISA 4Y90A 3E2SA 4N6FA 3S5OA 1K6AA 4GNVA 2WOQA 4PCSA 4DWSC 3Q94A 1EP1A 2W61A 2WZHA 4C6OA 4IJRA 4N9EA 3A3XA 5AYBA 5DT7A 4XKYA 3MVTA 1Z7AA 5H8UA 4YLWA 3LLFA 1H0GA 2WK2A 3UCQA 4GYKA 5ABHA 5IOBA 1UBSA 4D6EA 3HPZA 1K8YA 3R4IA 3SQLA 3RLGA 4E2BA 5A6LA 3HOJA 1VD6A 2Z1SA 4QE5A 1R9ZA 4EIVA 3A13A 2NWRA 1AW5A 5HQLA 1GORA 3LLXA 4PR4A 2HVNA 1X97A 3S6DA 3N3MA 3M5XA 3CV1A 1M9HA 3NXLA 3O0FA 1P5BA 1ZCCA 3KP0A 4OBTA 4YN5A 3WF3A 4LX4A 3FKRA 3UNDA 3D6NA 1X96A 3UVAA 1DJZA 3UVIA 1FWCC 2B7PA 1AMKA 1XS2A 2RDXA 4XK2A 4A2SA 1M7PA 3BJSA 1RPXA 1C8VA 1E71M 2EG6A 2WM0A 2ZRWA 2HPIA 1NWSA 2ZWZA 3LEPA 5EYWA 4Q22A 5HMEA 4C6MA 4C7GA 1W9PA 2WWDA 1H7WA 1YXCA 2A21A 2ZZ6A 3GY1A 4I7UA 2OX4A 1UIPA 1JPIA 3GU9A 1Q5MA 1Z48A 4CGTA 3EDFA 3H4WA 3AJXA 2R91A 3UZXA 3QRHA 3TZNA 3FYPA 3IWPA 1UR4A 1U2YA 3WK3A 1QK0A 1JAEA 4ALDA 4Q7BA 4CUCA 3LPGA 4DJDD 4QSFA 4B2DA 1UASA 2Y62A 1PUDA 3MCNA 4J4KA 5M5DA 2NQJA 3NG3A 1JDFA 2C91A 1UD2A 3VIGA 2PE4A 1YE4A 3SZ8A 4AY1A 1XWYA 1FWNA 3L9CA 3CUHA 4YVXA 1X7IA 4E8GA 3NO5A 3QLLA 1AD4A 3WJZA 1P0NA 2DH3A 4M19A 4OFCA 4MY1A 4DY1A 2QLYA 4A3UA 3NR0A 1AZ1A 1UD8A 2YOCA 4O57A 3CH9A 3LTSA 2WMJA 3GNOA 2QEZA 5HBFA 5DX7A 4C91A 4UTFA 1OC5A 1DIEA 1XIFA 3KFTA 4PMXA 3KXQA 1C9WA 5CKSA 4RDZA 4FNRA 1MZHA 1A5KC 2TRSA 5JIPA 4IL2A 1UA7A 2W4XA 3FIGA 1NOFA 2VC5A 3T40A 2UY4A 1UR2A 2V5KA 3QW4B 1OF6A 5G2HA 4S39A 4XZMX 1OCJA 1UMLA 2A3CA 3AXKA 5AC7A 4PUNA 3H2CA 1V0MA 1BEUA 5GJPA 5CBBA 1OZQA 5I06A 2AL1A 3CV2A 4QDMA 1IIGA 1TPC1 1O5RA 3AQUA 3TSDA 3WMCA 2POZA 3D47A 3WL1A 3BAXA 2B81A 5BXPA 5HANA 2V5JA 2HXTA 3F4NA 2J13A 4PN2A 3NQBA 1RQHA 1C91A 1MW2A 1YDNA 1YIXA 1MW1A 4F8XA 3VTRA 1QBAA 2VGIA 1R9XA 2A2IA 3T08A 1H1NA 1XIIA 1SZNA 1WAWA 4IFKB 3N73A 3HM7A 5ECVA 1E73M 1BTMA 5DBTA 4IL0A 4JY9A 1LORA 1E4IA 3MV01 2QJGA 3JS3A 2V5CA 4Z1YA 1GQNA 2PDHA 3S1WA 1R47A 2A3AA 1PKYA 1KKOA 1SO4A 3R10A 1YXYA 3J7HA 4TQTA 4HPJA 1EZWA 2VURA 3M16A 4Q4KA 2F6XA 2VEKA 4FHAA 4AQLA 3ABXA 3POHA 3DFSA 1L9WA 3SCWA 1EO5A 4QR6A 3ARVA 4XZIA 4RNJA 1TCDA 1NOWA 3CHCA 3NNTA 3S2MA 1G4PA 3I3DA 3MI2A 3LU2A 1ZJBA 3IK2A 5EB8A 3IIOA 1VRDA 1DYSA 3KE0A 2W67A 1PX8A 4WX2A 1SU5A 4AXNA 1OJXA 2VEPA 1B4EA 3JU2A 5CSUA 4NJKA 1EPVA 3MJMA 4O8AA 1KFCA 3ZS4A 3GXTA 2E09A 5I7GA 5K4XA 1UR0A 4AX6A 3GH5A 1OT2A 3E9AA 2EPMX 1XYZA 1TPDA 2NUYA 1YPFA 3U2OA 4DRSA 4RNIA 3PZUA 1LOQA 2HS6A 3CUGA 1XIJA 5K3VA 3ATZA 3UQNA 2CLIA 4Y8EA 1NJJA 3M4HA 1UH3A 1IXQA 4Q8OA 1DJYA 1M7OA 2PDQA 3AO0A 3THDA 2QJMA 1SW7A 3KTSA 5EMUA 1AFSA 2GQ8A 1A50A 4WLCA 4AUBA 4FEZA 3GVQA 4LUJA 3L4TA 3QHMA 3TDFA 2WJZA 1NF7A 1TE6A 3LV6A 5HNNA 2VOTA 1JUBA 4DQWA 4YCOA 1YBQB 4AXKA 3R0KA 2PDWA 3PFMA 3TP4A 5IFTA 4C6QA 4YWSA 1O7AA 2AKMA 4B2DD 3TN4A 4J3SA 1OC7A 3ANVA 3UNTA 1KA9F 1SFJA 3DYOA 1A3WA 1HKKA 1H09A 4B4HA 2OB3A 3AIRA 2GVGA 5C2CA 1W5NA 4C6KA 2PAJA 1K9FA 3U4FA 2A6LA 3I7SA 2Z26A 1XCWA 2BOGX 4KGJA 1ONEA 4HJWA 3WLMA 5JIWA 1KXQA 3W1AA 3K1GA 3U5UA 3AS0A 3CWOX 3RM4A 2XH0A 4NAEA 2UY3A 4PUKA 4QXIA 2VZSA 1D7FA 1PZ0A 1RUSA 1VLWA 1ZLPA 2G3JA 3CLMA 2WWCA 4LEQA 3TMQA 2DZWA 3CV6A 3L4UA 3B04A 3KL3A 3WJYA 4PA8A 4DJFD 3BW2A 3T0CA 2ZUTA 1F3EA 2QCLA 4NNBA 2AGKA 1U30A 2P88A 1ZB5A 1GJUA 3O3RA 5U7SA 4NQ1A 4TVUA 3QTGA 1LQAA 4GG9A 4YIWA 4E8CA 4PTWA 1ESWA 1DPMA 2C79A 3UU0A 2QAPA 2HJPA 4OQVA 1SR9A 1E1FA 1CW2A 1DWFM 3ZVHA 1S46A 9XIAA 5HPOA 4FOUA 4KFPA 1XIGA 2IS7A 3LCLA 5DCDA 3ENLA 5D30A 3KDOA 2YBVA 3MO7A 1PKNA 3RXZA 3T0BA 4C65A 2OKOA 3NTYA 4QJ5B 4R3UA 3GXDA 1DTUA 4WY0F 2H8XA 1R85A 3WJWA 1A3HA 1IIHA 1TV5A 1ZAIA 4B5VA 1H50A 1HF6A 2C6QA 1US3A 4JTQA 4B5SA 7REQA 1SJCA 1XR2A 2ZX6A 2QMKA 3W2LA 2P5NA 3NL5A 2YA0A 1GOWA 3W01A 2JALA 1B0IA 2Y85A 3BOLA 5CPSA 1GVYA 2HK0A 4F0LA 3KRUA 3TWBA 3MWCA 1JQXA 1OIFA 3O16A 4CN6A 1UKTA 4U28A 1TB3A 2O4MA 1LUCB 3EX1A 4D1IA 2GSHA 4JIEA 3OBKA 3L5AA 3S2CA 5I3DA 3ZR4A 1VZWA 3AYTA 1TRIA 1CXEA 2Y5JA 2XGBA 1TWSA 1W5MA 3S9YA 4Z2HA 3VINA 4HU8A 4Q6XA 2YYUA 5E0CA 3U48A 5F2IA 2HTMA 2INZA 2PDJA 4JQ2A 4JDYA 4RV8A 4UQBA 1AQ0A 4HOXA 5A2AA 1W3IA 4BCEA 4A6GA 1W32A 3CIVA 5BOOA 4CD5A 1S39A 1RSCA 5D8WA 3BE7A 4UTMA 3E0FA 4X9SA 1OYBA 1YQ2A 2OPJA 4JCMA 2DQWA 1QI5A 4ERAA 3W7QA 1ISXA 5LNUA 2OSXA 4HTBA 2PS2A 3GXMA 3W25A 2NQ9A 1JJKA 2P0IA 3G3DA 5DMLA 2HSAA 3HN3A 4ZA0A 4XISA 3T2PA 3MSDA 2QZRA 3ARYA 4J3VA 3VDHA 1B3VA 3D3AA 3O8AA 1TWIA 4F0KA 2YDRA 3WK1A 3NQ8A 4AHOA 3KBWA 3GK0A 1JUEA 1RQEA 1XGZA 4GUIA 4O53A 5J5DA 1V6UA 1N82A 1LT7A 1E9ZB 2GGJA 3M6DA 1FH9A 4XKYB 3BLIA 4RZBA 5GNZA 2Z25A 4TMBA 2FHBA 3R8RA 3QKZA 3A4AA 3SJ3A 2GWNA 3WK0A 4CN1A 3RHGA 5FD0A 3MY9A 4DEFA 3AUOA 3T4WA 4ATDA 4C1KA 4DO7A 3N14A 4JIRA 1KTBA 2Z24A 2WVTA 1JVNA 1T8XA 3GVGA 1QI4A 3OODA 4WIWA 1KM4A 3WLNA 4UFLA 4FNQA 1GZJA 2J66A 4H6RA 1L6FA 3FJ6A 2A79A 3WZ0E 4XD3A 2UY2A 3PZMA 3G0SA 3OHIA 2PD9A 1BSIA 2NT0A 2A7NA 4J5NA 1S38A 2HK1A 4GXMA 1TX2A 1TCMA 4LUSA 3POCA 3N6JA 5C2XA 3QHNA 9XIMA 1DQXA 4LVDA 4U2ZA 3RGTA 2WJEA 1QNVA 2CFFA 2P10A 5D2TA 1MZRA 4OTKA 3STEA 4W7UA 1S5WA 4AIOA 2WMIA 2WAGA 3HPSA 2CBJA 4OZOA 3WEZA 4KBXA 1MXDA 4B16A 4TV6A 2FZNA 3BZGA 3S47A 1KLYA 2GJLA 1JXKA 3NM1A 1JYWA 3HJEA 4DM1A 1RJRA 3VD3A 4EOUA 1V6VA 1K8CA 4AWTA 1ODUA 2PDUA 3OQ8A 2XGIA 3HB9A 2ODOA 4O13A 2DVUA 3TW7A 4H9YA 4JQ3A 5B7YA 2Y8VA 1GVQA 2XINA 1KB3A 1CI1A 1ZU8A 4PMRA 4DUWA 4S1FA 4ZOEA 5F4SA 3TTOA 1FA2A 2O9PA 3QQWA 1XLCA 1OGSA 2CBIA 3TE9A 4NHVA 2DEPA 4YJ5A 1MWOA 1KV8A 2J7FA 3B9EA 3EOOA 5T9CE 2VVSA 2OEMA 1LT8A 4K7VA 2DIEA 4LS1A 2CITA 3VOIA 4UTHA 1VFUA 3GG1A 8XIMA 3ABZA 2MANA 3TIMA 3W28A 1OFAA 1QU4A 4JXCA 5EPDA 3F7JA 4MPKA 3PZIA 3EA2A 1YTKA 3EEGA 3SB0A 5H1WA 2QUTA 3C2FA 1T40A 4C6EA 4Q32A 1P1MA 2GUUA 3PZOA 1JGMA 3BO9A 3VC5A 3SURA 1GKRA 1SJBA 3OB8A 1GPWA 4G2DA 2WNZA 3C8FA 4J28A 4IIHA 2J4GA 1R3SA 1A5LC 4P8VA 4P7LA 3OLIA 2VZOA 4KH2A 3EOUA 3RIKA 2PTZA 2UWFA 1Z41A 4ACZA 1TTPA 4O0QA 4GKLA 4D6JA 2E5CA 4OIFA 2OQYA 4ZODA 5C0QA 3E96A 1CXFA 4WEVX 3OYZA 3S42A 2PDNA 2P1FA 4D6IA 1K8ZA 3KS5A 2FH8A 4PMOA 2Z27A 1MYRA 2XVPA 4O19A 3UXLA 5CZJA 3JVAA 3ZJ7A 1UPPA 1EJRC 2QCMA 3MT1A 5IHSA 3S5ZA 1JZ5A 2VFGA 3IVUA 3LTYA 1VHNA 1J01A 2V6AA 3ZO9A 2V68A 2WNQA 4NI8A 1FX6A 1YYAA 4AMAA 3TAKA 3HIJA 4US5A 1ISWA 1AQMA 2YCKX 4WJEA 3LXAA 5L6UA 2X05A 3WFZA 5CSYA 5FIPA 4L4MA 4JEJA 4AH7A 2Y7EA 4ES4A 2I1OA 1CXIA 4NXSA 1CPUA 1E0UA 1AJZA 3NPWA 4ATLA 4UQ9A 3QPEA 4AX7A 1ZNNA 2WQDA 2PLCA 5HJLA 3PG9A 4AWSA 1E9LA 3FFSA 4XBJA 4ZXOA 1V08A 2ZUWA 4K8GA 4PL2A 3FJNA 1S2CA 5JXQA 2BHYA 1MEIA 1JPDX 4BJHA 4I5RA 2F8QA 4NZJA 3FNDA 4GKTA 1TR1A 2WBGA 4DJEA 1PE1A 2QPSA 5A8PA 2FLIA 2ZUVA 3AIVA 4MM1A 4Q4RA 4IPJA 1VENA 1W2PA 3VGFA 3C8NA 3NQ7A 4K6AA 1V3LA 3UZ5A 2J9YA 3CAKA 1V3IA 4QG8A 3W71A 4L1GA 2ZX9A 3ONBA 4WKHA 3A64A 1CLXA 4H8HA 3UEQA 3STCA 3B0VC 3H21A 5AYZA 4MLRA 3SAZA 4H6KA 3NYDA 3B0UX 1QWKA 5I02A 3CLWA 2VFFA 3WEMA 1R6WA 3RYSA 5DMYA 2DDXA 2NX1A 5E09A 2X1RA 2CPUA 4XD6A 1XGDA 1CGTA 3B8DA 1THFD 1MXSA 4CNOA 4UZUA 1Z42A 4OOZA 1GG0A 4ONVA 3AS3A 1XH2A 1MUMA 4G6CA 2XIJA 3PWAA 4PBFA 1NFGA 5FJRA 3AS2A 4NL1A 1V77A 1V02E 1R3QA 1KNWA 1CZ1A 4C6BA 3EOEA 2Z6IA 4O4VA 1W8GA 3SIMA 1KM0A 2ZUSA 3GDKA 4LT9A 1IXOA 3V3WA 5TIMA 3AMGA 3QZEA 4MZ8A 2XSAA 2CZEA 3C4UA 1HJXA 1OT1A 2NLIA 1Q45A 2C0AA 2BSLA 1PCWA 3VILA 5C6MA 5A3HA 6XIMA 3GNRA 1OGGA 5T91A 3LBOA 4BI7A 3WD4A 1RBOB 5AKQA 3QJAA 2A3HA 4HNNA 1E5JA 2XDFA 2POTA 1Q63A 1QOQA 1XYMA 3VIPA 3QQ1A 1XUZA 1ADSA 3FVMA 4KCTA 3EWUA 3H12A 2WYSA 4H19A 1VFOA 2BFGA 3PUEA 3O2LA 3IRDA 2ZZ4A 1VYRA 1KM1A 1GYMA 3B8WA 2PWEA 3WBWA 3ARRA 1CENA 3BOXA 3DEQA 3TXZA 3WQEA 3K8LA 1AMYA 3LS9A 3VIKA 4X2PA 3O9NA 1PDYA 1ME8A 1SW3A 2ZVIA 1TG7A 5FESA 3FSUA 1LWJA 1X8FA 4C6PA 3UZYA 4O28A 4GACA 2PDLA 4B91A 3NQ2A 1GYLA 3LNPA 2WMKA 4PTMA 3PZNA 1L6GA 4LV4A 5AYXA 3BMVA 3GVRA 1CGWA 1BVWA 2E8YA 4PCPA 3ES8A 2A7RA 2WB5A 3VZZA 4H7ZA 2QGHA 5EBUA 3OIXA 4JNMA 3UR7A 2FZ8A 3WENA 4J7RA 4QFUA 4IMCA 1V0KA 3EPNA 4E2VA 2FJUB 3ZVHB 2WV8A 1RK6A 1CGYA 2BVTA 3ITTA 1UB3A 3GNXA 1MNZA 1Q2SA 3M0VA 4AF0A 3CMFA 3SCUA 4YTSA 4D9PA 1W9UA 1EC9A 1YMYA 3ZLHA 2GGGA 5FOOA 2IXUA 2VQTA 1F6YA 4ZOCA 3QHOA 2GQ3A 3VGHA 2C71A 4UXDA 6ENLA 3AIUA 1JYXA 3HA1A 4JHMA 4U4MA 4ZO7A 4MLJA 4WCJA 4JL1A 3FY1A 6REQA 1XI3A 2X41A 2GL5A 1TX0A 4A3YA 2HNHA 3NDOA 1VYSX 1ZZMA 3ITXA 3U2CA 1IXNA 2FVKA 2IXVA 4HMDA 2Q6ZA 6CGTA 3GC2A 1S5NA 4HU4A 1PIFA 1TVLA 1KCLA 2AOSA 3N2XA 3RNDA 3U4AA 2VGFA 4MVAA 3GR8A 3GRIA 4JDBA 3WQ8A 1GQJA 1OQFA 1Y5WA 2XM1A 1XLGA 3FDGA 4WGHA 4XSMA 4LF2A 2PWDA 4MKSA 2F2KA 2Z2AA 3DC0A 4US5D 2PDPA 1JNEA 2I9EA 4H6QA 5HUPA 4AD0A 4HK6A 1G69A 3V0SA 4AHQA 7TIMA 4IQDA 3GG0A 1U1HA 3GWQA 3GE7A 1YEYA 1HGWA 1N8IA 5REQA 4YTTA 3FSTA 4RXGA 4LUIA 5AZ1A 1UQZA 1MQRA 4PE8A 1P48A 3R94A 2Y7FA 1QI3A 1TIWA 3Q45A 1QNRA 5DY2A 3G0XA 4DJED 4GGHA 4W85A 3P2VA 4NG3A 3IIZA 2J74A 2XPKA 2Z6JA 3KUMA 1UHVA 4FXSA 4LGXA 4UMCA 4JPGA 5BRQA 1MSSA 3W7EA 3STPA 2IKJA 1RR2A 4IIFA 2XFRA 4H7CA 2I5QA 3VU2A 3EWYA 1SMAA 3R13A 2VUYA 3NVTA 2V2HA 3DG6A 3ANUA 5A1AA 3N4EA 1MFUA 4PZVA 4HYRA 2Z29A 3MUCA 4QJ3B 1K4GA 4MB5A 2OZ3A 3W6MA 2WJDA 2OEKA 1R86A 4YYFA 2WCAA 5T26A 1F3XA 3CHFA 1F3WA 1BPLB 1JR1A 1GVFA 3L4YA 4AC1X 3R8GA 3ARSA 2WNNA 1VBUA 3UWQA 3CYVA 4QAIA 3RUBL 1QCWA 4UTIA 3PUDA 4BWLC 1KFWA 3EA3A 1BYDA 1XICA 4BKNA 4Q8NA 3KZPA 5LA1A 3BSGA 1L8PA 4F9DA 1VB9A 4ASTA 2QT3A 3M0MA 3B4UA 1VEOA 1J93A 5CCZA 3RRAA 3NURA 1SW0A 5CBJA 3TA6A 1UOKA 3E0WA 1FKXA 4HYVA 1BWKA 4HGXA 2CZ5A 4OUIA 1NM9A 2P50A 1ZP3A 1ZENA 2G0WA 2Z1WA 2Z2BA 2XGZA 4UQCA 3B9OA 3PJXA 1DWAM 4JTEA 1XV8A 4S3AA 1I9CB 5T9BG 3GM8A 2VOMA 3B9NA 2G97A 5HNTA 1S5MA 3PTMA 2QV5A 4G1NA 4GZEA 4TIMA 1Q8AA 2BXVA 2WLZA 1UR9A 3TZFA 3GR7A 3KEHA 3P84A 1IZJA 3W1QA 1M53A 2YW4A 4GYJA 3CPRA 4B5XA 5A6KA 4IXHA 1PAMA 4PODA 2DZUA 4GRSA 4E3VA 1P0DA 2BOFX 4GBUA 5BNKA 4P2VA 3MWAA 3LRMA 4HNUA 4WF7A 2QPUA 3BTNA 3N19B 1M5WA 1E6QM 1D9EA 2YLLA 5H8PA 1H7XA 2FVLA 1W5QA 3B4YA 3N15A 3GZ3A 1XLLA 1OFPA 1JXJA 3NFUA 8TIMA 1LYXA 2FH6A 2GJRA 3S5NA 1E0TA 1QI2A 4NZ4A 4FZIA 3FEQA 3OVQA 1TELA 4JTAA 2E1DA 4NJHA 3CJPA 4LXFA 3E2VA 5LHFA 1PS9A 1MEHA 1EBHA 4K39A 2JFEX 3VZXA 3F2DA 4IPIA 1KBKA 3GAYA 5EL1A 4QNWA 3QBUA 3AUJA 1FWEC 1W1B1 1QDSA 2WZEA 3F5JA 4Q4PA 3A21A 2DQXA 1DXFA 4PGLA 3RPTA 4JN8A 1XSIA 3MANA 3R1ZA 1XIEA 1LBLA 2AGTA 1LCOA 2E25A 4JX4A 2V2DA 4BEQA 3IRSA 2VEGA 4HNTA 2PRHA 4FOKA 4K7YA 4NAFA 2VCAA 5G4EA 1MI3A 3H55A 3M47A 1V6WA 4H9UA 3VABA 1H1ZA 1PXGA 2NX9A 3G1RA 3ITOA 3BAIA 4ENLA 2O0TA 3K46A 2F61A 1J96A 3LQGA 1W9DM 4XKMA 3ZYZA 2X0SA 4UFIA 4CQCA 1L6WA 2J7HA 5HPCA 1G6CA 3BDKA 5A8OA 2I5IA 1TMHA 2DZXA 4DXVA 4REQB 2XVGA 3UGVA 4O4WA 3N17A 5HQEA 4ML9A 3OPSA 1Q4NX 4CLMA 1S2VA 2VRQA 4LVFA 2J7EA 4X3ZA 4U3CA 2CBUA 3L12A 4HNOA 3VE7A 5DEZA 3RX3A 4DI9A 3AI0A 1GGOA 3CT2A 3L0KA 3TCSA 2ZYFA 2ACUA 2WW5A 4JN7A 4R7WA 1EXBA 4X22A 3IPWA 3NZPA 3WF2A 5FL0A 3GX9A 2NSOA 4O15A 1WKFA 3BJTA 2H9AA 4R9XA 2CWNA 1LG2A 1KW1A 3R6IA 3U3HA 2VWTA 5AFDA 4FXRA 2DVTA 2ZX8A 1SR0A 4ZXLA 1FRBA 1DJWA 1MFVA 2D2GA 4MFDA 1OCNA 4OU1A 4BF7A 4H9XA 4IH3A 2HPMA 4LCQA 1EYEA 3GHSA 5D8ZA 3PG8A 1B3ZA 4KESA 2XH4A 4RL3A 2XHYA 1AZ2A 2W79A 3P82A 5FAGA 3KW3A 3KWXA 2RHGA 2GJXA 1KRAC 5EKYA 4CVUA 4DHGA 2QJNA 5HATA 4KIEA 4QCEA 4S23A 5A6AA 4IMFA 4MPQA 4IIGA 1RPKA 5XIMA 4IICA 3UXDA 2VX4A 2QJJA 1FTXA 5CPQA 2WSKA 3MMUA 4YVVA 2OWWA 2V69A 1E70M 1WX0A 2Y7GA 3CV7A 3CL6A 3A9IA 2E68A 1REQA 3VUSA 2E6AA 4GC4A 4WXYA 1FHDA 4I8YA 4R85A 4QLLA 3HBLA 1WXYA 4GYPA 3SY5A 1KFKA 1JF6A 4LCRA 3OU8A 4UCFA 4AD2A 3WD2A 1VIWA 3B0YA 4EF8A 2E6YA 1G1YA 2Q3OA 1YXDA 4P7RA 3QOMA 1HTIA 4IGNA 3KOXA 2D0GA 4ZTYA 4LAOA 3LCIA 2V3FA 3ZQ9A 1W9VA 3T55A 5EA9A 4JD4A 3E6EA 3WFAA 2EQDA 3F4VA 3G8EA 3KOYA 4B3KA 3H70A 3PJWA 1E6RA 3HG5A 3GIYA 3SUSA 3M46A 2XFFA 3C0QA 4JL2A 4CCCA 1DL3A 3P80A 2X09A 3E2RA 3V36A 2FMNA 3LCHA 5HDRA 1M7XA 4HP5A 3S2LA 3NIYA 3PAOA 1J2WA 1Z69A 2BVDA 3FLUA 3RX4A 1FWTA 2BWGA 3N6HA 3USBA 1JI2A 4M81A 3TXVA 2E8ZA 2WZMA 2ZBTA 1HJUA 1JPHA 1KXTA 3W7DA 3I3BA 2NLYA 4TR9A 3LDVA 1X1ZA 2FDSA 2DUAA 4C6CA 1SSGA 2EBNA 3EKZA 1NAL1 4S3FA 3XINA 2E77A 3WF1A 4DN1A 2GFTA 3DBNA 3WNPA 4A3HA 3ZR6A 1SGJA 3WQ5A 3ALGA 1JDDA 7TAAA 1HUVA 4O18A 5J04A 3W1TA 4GA8A 1SO5A 1BTCA 2QCNA 4UQDA 4H9VA 4MB1A 1Z32X 2QHAA 2RKXA 3UD6A 4XZ9A 3GKAA 1B30A 1W6TA 3O6CA 3WLPA 4O1DA 4KWOA 1EEPA 2DT1A 3GXFA 4GISA 1E6SM 5KTLA 1K7EA 3DX5A 1PZ3A 1UP3A 5ENLA 5LXXA 4GZ7A 5HA7A 5LIYX 1GQIA 3VGBA 3CZ8A 2BTMA 3NQDA 3NGFA 5EFFA 3OGVA 2G3NA 1XYFA 1K3UA 1WXZA 3UY7A 3FN9A 4N9BA 3FXGA 5CBIA 1YDYA 2J9ZA 4Y96A 2E67A 2ZXQA 3BW4A 4C6DA 3QMSA 3TQKA 4ZZ9A 4EAYA 1FVPA 1DIKA 2WMGA 3EWBX 5C70A 2XIQA 3SJNA 4GH1A 4WRHA 4WJXA 4IM4A 1OFQA 1KBIA 3BAWA 5E1QA 3UXKA 4MSSA 3WUGA 3M5VA 1Q2RA 5FJIA 2HCVA 3DC8A 2G3IA 2HISA 1UROA 3EKLA 1EJ7L 1WOAA 4JAWA 3WDQA 3FXYA 2C14A 3KBMA 4UOJA 4GOAA 3VOFA 3P0XA 4ZQRA 3CQJA 2R9RA 1ISYA 1K6WA 2X7WA 1RZMA 3BJFA 1TPFA 3LRLA 3F5KA 3MYOA 1Q7QA 2PTYA 2HEJA 4CEXC 1NEYA 3AZSA 1UZ4A 2Q8XA 2L5HA 1VJZA 3D0CA 2HQAA 3NQVA 3N13A 2YCEA 4N4PA 2SFPA 2ALDA 3JUGA 3PB0A 3LHVA 3W83A 3PAJA 4AZ5A 4C1NA 1XG4A 2QJHA 1FCQA 1TFVA 4W7WA 3MP5A 3OO2A 3SFKA 2ZX7A 4N02A 1F6PA 1D2KA 2NWSA 1QVBA 3COTA 1SM9A 3DCPA 4TTUA 2P0OA 4IF2A 4MTVA 4JTFA 2FGLA 4Z17A 1WA3A 2PTWA 2CESA 3ES7A 4HSOA 3EOSA 4X2RA 5REQB 3MBFA 2YCIX 3KVMA 3E02A 4NXKA 3QY6A 2D73A 4WK9A 1IF2A 3NGJA 4O1BA 3IUIA 3OBEA 4QRNA 2QDDA 2R1KA 4YTUA 4M29A 4Q4MA 3O63A 5A6SA 3A4JA 4LUYA 5F2GA 4ZGYA 2D24A 3UG4A 5A8QA 1SYTA 2HNEA 1F74A 4NJIA 4IFOA 5F4WA 1XLAA 2Y88A 3BUVA 1QHZA 3DYPA 4GVFA 4CQ9A 1FWWA 1V0LA 3UZWA 3BGJA 4JOMA 3RLUA 4ML4A 2GJNA 2RDUA 2CLLA 4MZYA 2PGRA 4OGZA 3RU8X 1XGEA 3EXTA 3MHUA 3GU1A 1GJPA 2VRJA 3HURA 3SN0A 2ZE0A 3H7RA 4R9OA 4IPLA 1ZP4A 3T8QA 3R25A 1XYBA 2DJXA 1KO0A 2YBUA 3BSMA 1V02A 3PHAA 1NDWA 4UBPC 1PO9A 4LVAA 1ITXA 4DPPA 3ZMRA 1EL3A 5HR7A 3L67A 2FKPA 4IGMA 2CZFA 5A95A 3FEMA 3KDNA 5C9WA 4JTRA 1ZAJA 4A35A 1AG1O 1I0BA 3IAPA 5A2CA 2O92A 3UR5A 1TV4A 3ABQA 3RITA 4FA3A 3TTYA 3LHWA 2Y5EA 3F4CA 2E9BA 3HGRA 3M7SA 4H01A 3TN5A 3W0KA 3TYUA 3SW6A 4FOJA 1Z9AA 4X60A 3K30A 3UYCA 2QS8A 4PRWA 3TLQA 1FUYA 1E72M 2OVLA 2DVXA 3IJ9A 1UCWA 1QNSA 4IHCA 4AD4A 1FCVA 5E6YA 2E7FA 4XG1A 4H6EA 2O9OA 4GJJA 3E74A 1ITQA 3NOYA 5FAJA 3S6TA 5MKGA 4HOZA 4HZ8A 1A3XA 4EXBA 2D3LA 4GXWA 4UTTA 4IMAA 1DWIM 1G4TA 3H7VA 3HV9A 3BCDA 3T6CA 3KRSA 3S83A 3ZJ6A 4A22A 1F61A 4HSHA 1TR9A 5CG7A 1XH0A 2ISWA 3PZGA 2EPLX 4FLOA 3P62A 4JIHA 3E0IA 2QVHA 4IOTA 1XYLA 4DX3A 1MW3A 1XINA 2R82A 1DHKA 1IR2A 2ZZ3A 4XVEA 1Y8BA 3MJYA 3VKJA 1PWLA 2PLKA 5D38A 1VP5A 5F1UA 3MCMA 1QW8A 4GCXA 4F48A 2E4TA 3H2AA 3WF0A 1AL8A 3LI1A 1NTHA 1WB0A 3PPCA 1E0XA 1P43A 4GMEA 3LZ3A 4M8UA 3CASA 5AOUA 3ITGA 5H91A 2QNEA 1XLDA 2GGHA 7PTDA 3LM3A 4ICCX 4O1EA 1K7FA 3VD5A 1RP8A 5LA0A 4JIQA 1MDRA 3XISA 2OQLA 4QDWA 1JEZA 3DIPA 2VCCA 3GDBA 2CIPA 5EMLA 3N4AA 3CYJA 3RJXA 3BGGA 3WQWA 4C7FA 2LLEA 5BU6A 3U2ZA 5BRBA 1FWRA 4LBUA 1PTDA 4NAFB 4V33A 3PB2A 3BARA 1TQJA 2GQ9A 3TONA 1A4LA 3H2OA 3BLFA 2E40A 3TOPA 4QAWA 5T8GA 1ZTVA 4AVOA 4NZ3A 4PMVA 2R1PA 1BD0A 1HQTA 4PC8A 2OEJA 3W7LA 2EJAA 5IXEA 1T41A 5C55A 4S2CA 3NAVA 1Y5XA 3ONCA 3P7YA 5CZKA 1AVAA 3HG4A 4KWWA 1WZLA 1I2PA 2G3FA 4NJJA 3ITCA 1NDVA 4HA1A 3VDAA 2G41A 3DFYA 2J7GA 4MWAB 1IWPA 4LRTA 2I57A 5D4YA 4GYFA 1XRFA 3GFZA 1E4MM 3RX2A 3UR2A 2O7QA 1E1CA 2H3BA 3AAMA 5CAKA 1SO3A 5HR6A 1S1PA 1DXIA 3MB9A 5I77A 3E0VA 2BOEX 1P6BA 2PRLA 3MS8A 2PPGA 3SCPA 2W27A 3H23A 2PWFA 3AYSA 1E3XA 4JIIX 4K36A 1KD0A 4XBKA 3RCYA 2Y1HA 5DRCA 4W9TA 1HX0A 3KVLA 5FEZA 1TPUA 3CL7A 2JEPA 1MQQA 4K38A 2PLJA 4EAMA 2YXXA 3QSRA 1DQUA 2OYMA 5CGQA 3S8HA 3EX4A 3V1PA 1F05A 3S4TA 4EPEC 4AEEA 1G9HA 3GXPA 4ZB2A 1PWMA 2RJHA 3GS6A 3CBWA 4DNHA 2XZ7A 3MSYA 3LHUA 1RP9A 1GG1A 1W1TA 3LXBA 3SSZA 2GUYA 3TSBA 4C7DA 3N9SA 4TOQA 3UYIA 3BMWA 4K37A 3MCOA 4AVFA 2QCDB 3FYYA 1Q6EA 1BRLA 3WFLA 4MJMA 2XWDA 1VBJA 5LZLA 2CLEA 1OFOA 3LPOA 1FWAC 4TX6A 4AIUA 1VC4A 3GNDA 1REQB 1KGUA 3HGJA 2VZUA 4C6IA 4AU0A 2YZ5A 4JNYA 7ENLA 2WMFA 2O9TA 4HSNA 4GLEA 3SM0A 1GOOA 2IQ0A 1JZ4A 3M0ZA 4WVXA 1EGMA 2DY3A 2HBXA 4QNEA 3P0WA 4I5UA 4TVCA 5DCBA 4Q8PA 3ALFA 3UPBA 1PKLA 4HK5A 4D72A 3WCZA 3VO0A 4NT0A 5LGZA 1CT5A 2J8TA 1A0EA 4JQAA 2OWCA 2W5FA 4KIRA 3E5BA 3NPUA 3AYVA 2YCLA 4M6PA 2J77A 5JH1A 4GQQA 3NA8A 5JVLA 1WKYA 1ADOA 2UZ9A 5FA5A 4CQBA 1OM0A 4LAUA 1O12A 4XAGA 1P0EA 2F84A 3VNIA 5IM51 3U2EA 3BV7A 1WDQA 5AZ0A 1Q3NA 3HQNA 5A8NA 3THAA 2BG5A 3F03K 4RDYA 2PDIA 3MUIA 2Y61A 2GJPA 4DZHA 3F4WA 4W7VA 1P0KA 1W1ZA 3PUGA 1YHTA 3EB3A 1XIBA 2ZWYA 3NUKA 2VMFA 1JCYA 2W9MA 1XRSA 4MWAC 2OR2A 1IQ8A 5ABGA 4PCNA 2V2CA 1DV7A 3DBPA 3GVWA 4NKCA 4IJBA 2OXNA 2ABBA 4IMDA 3OVRA 2OCZA 1ZL1A 2ZVRA 4H3DA 3STGA 3PBMA 4AZIA 1GCYA 2C3ZA 1EJWC 3I65A 2BVYA 2X8RA 4R33A 1HKVA 2Y63A 4N6EA 3OG3A 3GNNA 2H3DA 2AL2B 4D8LA 4EXAA 3H2MA 3IJ7A 4DAFA 4UCGA 3LSCA 4CD6A 3OQEA 3IIPA 3CT7A 3S0CA 2BY2A 2A1YA 1O1ZA 3LLDA 3VX0A 4X63A 4GJ1A 1EDGA 5I09A 1J0HA 3H24A 1VPQA 3NM3A 1ZQ5A 2WPBA 3OTRA 2ISSA 1B31A 3MZNA 3HQ1A 2PI6A 2ZRXA 2NVCA 1I2QA 4DZ5A 5I78A 3KCLA 3G22A 1I60A 2EPKX 3BL3A 3RPMA 1VEPA 3K8KA 3VC6A 3CUZA 1GTHA 2QUVA 1N8WA 1FKWA 3ZXWA 3W2JA 3K4AA 2DP3A 2J79A 1BXNA 3H2FA 4I8DA 2QDGA 4ORIA 2ZOXA 2QAFA 3B9DA 2R8WA 2YFNA 1VYPX 2R6OA 2V30A 5FL1A 3GBEA 4EXQA 2HV5A 1DJIA 1TPWA 4KS0A 3W73A 2FJKA 1RY8A 4M82A 3UWWA 3QR3A 3O6DA 4CD7A 3FYOA 2V5LA 4LANA 4FLSA 2VZVA 2W6RA 1TPH1 1FWSA 5PTDA 1QXLA 1RQBA 2G8ZA 1V3HA 3N1AA 4JFUA 1V3KA 5CAHA 3UJFA 1TYGA 3GVVA 1LL6A 4KEUA 1C29A 5KETA 2B0MA 2PDFA 3IS4A 5A8GA 1W54A 3AICA 3KRZA 2E3ZA 1QHPA 1IT0A 1Q65A 5DANA 3NQCA 1DWJM 3DGBA 1XUUA 1E0WA 4DF1A 4IUOA 1UD3A 1K9DA 3BQ6A 1KCXA 2WLYA 1AH0A 4GE8A 4E5TA 1TTQA 4F3HA 4KRUA 6ALDA 1C90A 3VIHA 4HNVA 2D69A 1J0JA 1A47A 1OZMA 1R7AA 3HG3A 3R58A 2WANA 1BG9A 3VM7A 1PVNA 4Q8MA 2Q01A 1WQ5A 2ACRA 1HNYA 4LNCA 4GI8A 2E6DA 1W1YA 3N3TA 1BVNP 3VNMA 2MUCA 1ZFJA 4ZCWA 1ENUA 4TUFA 2OWXA 1XDLA 1V3MA 3GH7A 1C7TA 4RNHA 4AISA 2Y0FA 3OIHA 1LZOA 1FXPA 5ABTA 5IBXA 2Z1BA 5GJMA 3N29A 3ZM8A 1R3RA 5E93A 2G96A 3W07A 1D8WA 4WQ6A 3TYBA 1UWIA 4J27A 1ODZA 3TQPA 1EJVC 2H8ZA 3MDWA 1UC4A 1AW2A 4KQNA 4PMDA 2OKTA 1FWHC 1G67A 2DPEA 5FCZA 4XQ6A 2F6KA 3IV3A 2GDQA 4LBRA 1HKIA 5I6SA 3EWWA 3BC9A 4FSAA 4RK8A 3RF9A 4Q8UA 1Q6LA 1I1XA 5CZ0A 4JBRA 4H9ZA 3SEPA 2G4JA 1ZJHA 4U31A 4L80A 1BYCA 4GCAA 4LAMA 3M7WA 3QGVA 5I23A 2HROA 3BLEA 2Y8KA 1TA3A 4C6NA 4UTWA 1GOMA 4CCZA 3KWSA 1IEWA 4H41A 1TSIA 3M43A 3DGRA 2RGLA 2PGEA 3QQ0A 2QCEA 4ZOAA 3W2NA 4PB5A 5I3HA 3CMJA 1H62A 3UG3A 3A3WA 4L7ZA 1E15A 1O68A 2WZTA 4DYKA 1Z3NA 4FNUA 3IJQA 3UR8A 5AYIA 4NILA 8XIAA 3CPUA 1RV8A 1AODA 3WBAA 3VCRA 2BASA 3OP2A 1W3LA 3Q4DA 3HF3A 1XQKA 3N9RA 3AFBA 2CNCA 3WMSA 5KMYA 1JQVA 4DBUA 1U33A 2ANUA 3WLRA 4LVBA 3SRKA 3DI0A 3T05A 5MKGB 3WKZA 2PWVA 3DKJA 1UR8A 4QCFA 1EPXA 2PF0A 4I3GA 1XHGA 2QIWA 3G2GA 1OK6A 1R3TA 4F2UA 1JAKA 1PB0A 4OE7A 1X39A 2C15A 1GQLA 3URAA 3TR9A 1HKWA 5LYRA 3WQ6A 4ERIA 2I7GA 1IEXA 1F3TA 4GVIA 2YL5A 4DJFA 4GQGA 3HPFA 3FS2A 1OX4B 1WP6A 3L2LA 1EB3A 3B8SA 4LB3A 1EXPA 4KWUA 3S1GA 2FZMA 3ZT5A 3M0YA 3NQAA 4AVNA 2OQHA 2EKCA 4WXZA 4NZCA 1K03A 4AWEA 3R12A 1LM1A 4JGDA 4BR1A 4GI4A 4ZSTA 3EAUA 3L2IA 4FP1A 1EF2A 1JDAA 2PFHA 5C9UA 1NH6A 3ARTA 4JCLA 3D3FA 3C6CA 4NP7A 1H61A 2FFIA 3B8TA 4UNLA 5K9XA 2VC6A 4HHHA 1XRVA 2W3ZA 4GQ0A 4E4PA 1JYNA 2VEMA 4MUPA 4LAKA 4IWWA 1DIOA 3EDEA 4GO8A 1GJWA 2XN1A 8A3HA 4CNNA 3SGZA 2JE8A 3MYPA 1KGXA 4C60A 4L64A 3BWWA 5LSMA 1E6PA 2RAGA 3MUZ1 4FX8A 4FIQA 3NXFA 2P3ZA 3ARQA 2Z7GA 4MZ1A 3QF0A 4UZSA 1F8IA 2WVVB 3WNNA 1YTDA 4RE2A 3P14A 3FOKA 1Q7MA 3OGRA 2IUZA 1I0DA 4RUBA 4M24A 4XO6A 3LCGA 3MKVA 4MNLA 3GZAA 4LUTB 1PYFA 4L5ZA 1GNXA 3OLDA 2C19A 5D02A 4GGBA 4YTQA 1R30A 4H9TA 5FF7A 3A3HA 4RW5A 3ARUA 2VYOA 5D9NA 4M3PA 5JUVA 2Z1VA 4GIYA 3RM8A 1DEDA 3ID7A 4QROA 3DHDA 3WK2A 3WH6A 3BLLA 4Z1DA 1XLMA 5EY5A 1O95A 3W7NA 2XN0A 3CK5A 2WKGA 4D8AA 2E9LA 3F4DA 4F0HA 2A85A 4IG2B 5DT5A 1HO4A 5I00A 3U9IA 1ICPA 1JCNA 4C90A 4MY9A 3RPDA 5CPOA 1A0CA 3T9PA 3EWCA 4O0ZA 3HGOA 4OV4A 4JTCA 3MMDA 2VHLA 3UJEA 5L9FA 5A5WA 1W3JA 1M68A 3CU2A 1V0NA 2VEFA 1BAGA 3FJ4A 1FFRA 2WBKA 1S1RA 3W7MA 4H2HA 2CLKA 3UERA 4J2MA 4M0XA 5EMYA 3T0TA 1S3HA 3TN6A 1SVDA 2JK2A 4BZYA 3VOCA 4UTJA 5LNRA 3WG6A 3B8IA 1R9YA 4GXPA 4LY4A 4TX9A 4OOUA 1XG3A 3GFXA 3G8RA 2Z1KA 4DELA 3LCFA 3LXCA 1JIBA 4HVXA 2CEQA 3DHUA 2VZTA 1J0ZA 4IIBA 2HWGA 4U2YA 3TFXA 3M0LA 1POJA 1OD8A 2DU2A 4DB7A 2J7BA 3OZMA 3N4FA 3WQDA 4B5NA 3A9BA 3G18A 4GD0A 3CQKA 1WZMA 3WD1A 1TJ0A 2Q02A 3ZR5A 4O16A 5FJJA 5CGMA 2E28A 1PPIA 2INEA 3G3MA 1KR1A 3KM8A 4JKLA 4RE3A 3M0JA 1MEWA 2QGYA 1OEPA 2UV8G 3EB4A 4PBEA 4XD4A 3UG8A 4GBDA 1QNPA 5LNVA 4M1RA 3W1PA 2CETA 1JPKA 4KFNA 3URNA 4DLFA 3C0SA 3QR0A 2PA6A 2VR5A 5ECUA 2VX7A 4I90A 1KRMA 3OZPA 3A5VA 4PMUA 4CQAA 5D03A 3M5ZA 4MOZA 2BBFA 3RM9A 2GWGA 3V5FA 3RMEA 3JR2A 2YCLB 3M0IA 2VR2A 2DSWA 4B3LA 1J10A 4FNPA 3SY8A 3AALA 3G24A 6TIMA 1V6YA 2PB1A 3OW1A 1VEMA 5CPLA 3H4XA 4O54A 1D3HA 1OIMA 5DXYA 1US0A 3A24A 4X9YA 4UTKA 3PJTA 2FB2A 3OGSA 5I3GA 3PPGA 3RO6A 4MMWA 2QF7A 2XH2A 1LROA 2PZ0A 2RJGA 2QF8A 2TODA 4C6LA 1XF0A 3GHTA 2PDKA 5IFPA 4GFSA 1EKOA 3MBDA 4JTLA 4BFAA 3VIFA 4EF9A 4D6FA 2A3EA 1CTNA 2D2OA 5AHEA 1VCFA 1JZ3A 3TA9A 1W0MA 3GG8A 5HJXA 3UJ2A 1SFLA 3QGAC 1YNQA 2PF8A 4M1BA 5BU9A 4D6CA 3W6YA 3B8VA 4LB4A 2QUNA 3I10A 3TU9A 2KZHA 4W5UA 2REQB 4DWSD 4AZ6A 4KEZA 2CXEA 2G5WA 5C7HA 2VDHA 4XZLX 1VR6A 2HMCA 1YTEA 2ZXDA 1XQLA 4GZIA 4UNIA 3WUBA 3VCCA 4K8HA 1KM5A 2NX3A 4URIA 5M3WA 3KAOA 2YL8A 2CKSA 4P7QA 3UPMA 3CUXA 1BYBA 4DIAA 1CGVA 3TTQA 9CGTA 2YA1A 2D3NA 5DMMA 1W5PA 2O4QA 1QI0A 3LSBA 1U1JA 3QYQA 2NUWA 1N7KA 4FIRA 1KKRA 2XIBA 1K02A 2ZE3A 3C61A 3CAWA 4DBWA 3ORWA 2G37A 1V03A 5CZSA 1XBXA 4QE1A 1ME9A 3QM3A 1Z6KA 3BCJA 3TUUA 3CZLA 1KCZA 1E6XM 4MFEA 4A8RA 4GVHA 3STFA 5G4HC 1MW0A 2PC4A 4PRRA 4IZGA 3SUVA 1OCQA 4YWIA 2OOGA 3FA3A 3IJLA 4RX0A 5EGRA 2Z2UA 4POCA 4P7NA 1VQTA 1JUKA 1EUNA 3M9YA 2Q71A 3IUDA 1Q6DA 1VBGA 3O0KA 3HO8A 3SQMA 1E40A 4N7QA 1E4NA 1TV3A 3RILA 1XD0A 3RO8A 4M56A 1U83A 1OB0A 4AYGA 4LJ3A 4WSHA 3QH2A 4HHLA 4MHBA 3UESA 3CNYA 1IXPA 1O5QA 2ZC1A 3VK5A 3GUWA 1WDDA 3H53A 5D2YA 1RCQA 4AFYA 1A5SA 1RLDA 3TN3A 5HK4A 4XIAA 3UPWA 4W84A 4B5WA 5C2GA 1GOKA 3E1F1 3VKDA 1GWJA 4RDVA 1UOZA 4XAZA 4OVXA 2VX6A 3EA1A 4L4OA 4BQ3A 3WBEA 3DFTA 4HIBA 1H7OA 4GIAA 4RW3A 5AC5A 1EGVA 3UGRA 1LRTA 1TMLA 3ABSA 2KAUC 4RNFA 4IPPA 1X7FA 1DE5A 3B9AA 3V5OA 1XCFA 3JZUA 4UMAA 4V15A 3V35A 4LWWA 1X6UA 2RH9A 3KS6A 3TROA 2NV1A 1JDEA 4JTJA 1NFBA 1G4EA 2JKEA 1XBVA 4YMZA 3PBVA 3BK0A 4IFKA 3TNBA 2E9MA 4D6GA 3OZYA 4O11A 1TJRA 4DJDC 4AC7C 4P61A 1UZ1A 2O9RA 4F9JA 5HWJA 5A8MA 1NQ6A 1UWSA 4QLKA 1J2BA 4EK7A 4ADTA 3CL8A 4US6A 1GT8A 2QCHA 2DJLA 2WNWA 3AHVA 1M03A 1FCBA 4DLMA 3FGCA 1EC7A 3QEZA 2DGAA 3W84A 2X30A 1K1DA 4HB7A 3LPPA 3AMLA 1UPMB 3TJLA 1U5HA 3NZ1A 5D2VA 4QBXA 3C56A 3FKKA 1GZGA 3RMJA 3K13A 1OFBA 3FDKA 1HKJA 2PP0A 1EZ2A 1IZCA 1I75A 1NDYA 4H8NA 3DU0A 4U10A 4U33A 4PRTA 4B5TA 1NVMA 4RE0A 3A4WA 1ECEA 1GQKA 2VEIA 3BLOA 3DENA 4MKNA 1BGGA 4OBRA 3BW3A 4I9AA 2WC3A 1QT1A 2WCGA 1HJWA 5FJPA 1KWGA 3E2QA 1TA3B 5EU9A 4KCUA 1F07A 1MUWA 2J6VA 1RLCL 4AIEA 3NYZA 2VDGA 1VFHA 3T42A 4NZ5A 3PS7A 3FW6A 2A4AA 2ZA2A 1OADA 3NZQA 3OBAA 4O1CA 5CJ5A 4MJ4A 1E9YB 4ZQCA 3W7OA 2HE8A 5U4NA 2HVOA 5BXTA 2Y89A 1F4AA 4DBSA 4PMNA 5DRIA 4Z2IA 4V1YA 1C7SA 2V82A 5HNRA 4QISA 1X38A 2R1MA 2GVEA 1YBQA 4Z08A 2J7DA 4Q6JA 5FJOA 2YW3A 4HZMA 3TC7A 3W2MA 4OJYA 4UTLA 3CO4A 3NQGA 4XD5A 1XC4A 4HU0A 5BXSA 2BVWA 3L0NA 4JQ1A 1K77A 2QYGA 1PYMA 1EJTC 3CHEA 3H7UA 4YYCA 4LS0A 5LIWX 1BKSA 1P1XA 4G7EA 4LNYA 3WDHA 3GQYA 2VC7A 3BPWA 3M41A 4JX5A 4HN8A 3Q58A 3NJ3A 2DZVA 4OWGA 1VCVA 4UR9A 3IK4A 3WIJA 4QIUA 3O6AA 4JKKA 3MC5A 4DWDA 1QO5A 4DAIA 1BXBA 1HFBA 4MKVA 7CGTA 3E49A 2PGWA 1WKDA 4UR8A 4N9DA 2DORA 1XBYA 3QFWA 5CGTA 3VNLA 5FF3A 4DZIA 1DIDA 2I17A 3S1VA 1XJBA 4BEUA 3DFPA 4PUDA 3BG5A 3WBXA 1BF2A 2YZRA 2X42A 1YPXA 4KWVA 2WCSA 1YPIA 4DBEA 3S9ZA 3GU2A 1WUFA 1XPGA 4O52A 1Q8JA 1EEXA 5M03A 2WMHA 4KPLA 1C3FA 3VIJA 2D22A 1H3GA 1FY6A 3WELA 1WUEA 3H22A 3WH9A 4JTTA 1FH8A 1SSDA 3RRXA 3G6MA 2EHHA 3CTTA 4AD1A 1QUMA 4HHPA 3V18A 1F76A 2Z0IA 1LRNA 4ADSA 2V81A 1PHWA 2ZDRA 1M1BA 3QYSA 3ZSTA 4F0MA 1X98A 4CNUA 3LOTA 1OYAA 4KEVA 1UKPA 1A53A 5EMJA 4NRSA 2OLAA 4YCPA 2IPJA 4UTWC 2YLAA 4V27A 4BI5A 2QCCA 3A5FA 4Y7EA 3U57A 4NU7A 1DKWA 3IIXA 4GUGA 1TPVA 5A6BA 1VBHA 3B0PA 3L4XA 3WSUA 2PGFA 2INFA 5E0FA 1H7PA 1Q6CA 3W1NA 1E43A 5G5IA 1KM2A 4XZHA 3A47A 4HA3A 5LNSA 4LH8A 4QX4A 4PTDA 2FMOA 1O66A 4KMQA 5AECA 4BF9A 2CERA 5E6ZA 2BX7A 4DYEA 2QJIA 4HPXA 4EX4A 4XB3A 1JRBA 3CHVA 4IP5A 3LY0A 4QS5A 1SZRA 4BQ4A 2PTXA 3GHRA 1O6IA 1OD0A 3ELFA 5HUOA 3AJ7A 3H4GA 1X1NA 1E6NA 1QNOA 1XLHA 4MDOA 3WN6A 1O5XA 1WDSA 1KRBC 3PBYA 3RK8A 3BURA 3PY2A 3APTA 4MYXA 3NDYA 2QULA 2OJPA 1PTGA 3HMJG 2J62A 4X0NA 4A8IA 3WNMA 1SZFA 2OZ8A 1O1HA 3L66A 4XUYA 3AIQA 2XVNA 3GNPA 3P5ZA 4L9XA 4AZGA 3IVSA 2YA2A 2FGZA 1RJPA 1DORA 3ZWSA 5DFAA 2OT1A 3N2BA 3WO8A 5AHLA 2GK1A 1F5ZA 3W00A 4Q8QA 2NSXA 1UD5A 1L2UA 3AHZA 2XG9A 1MMFA 3DG3A 4XTDA 1A5OC 1SJDA 3WNKA 4CCDA 1B2YA 4HT3A 4MNMA 3VZYA 4Y9PA 5A6JA 3BV4A 5CZTA 2X0HA 5DMNA 1W9XA 1E9IA 1OSEA 2IKHA 2Q8LA 1QO2A 4Q4QA 2VP8A 3N9KA 4ZENA 1XD1A 1QPOA 3W88A 3KCOA 4B9ZA 1IV8A 2OU4A 1QWGA 4ZB0A 2DT3A 2CYGA 1RJQA 4UFJA 2OYLA 2V9DA 1O94A 3M1ZA 2PURA 3T0AA 3VKBA 2B31A 1JF5A 2YKKA 4QM1A 2IQTA 3W38A 4J1OA 2ZRVA 3IEBA 1UD4A 3UWZA 1OC6A 3I6TA 3SQSA 3THQA 1J0KA 3WX7A 5BXRA 1AQHA 3K5XA 3PTQA 3SY1A 3TNOA 1JZ6A 1KC7A 1I2NA 4ZO6A 2J7CA 4V2XA 1Z8AA 1GHRA 3W29A 3GXIA 3AXIA 1KCKA 3OYXA 1Y5VA 2GVJA 4LC8A 4HK7A 1EWDA 4NAEB 4W87A 4ZQNA 4LV9A 4BQ2A 3SN4A 4NF7A 3TOYA 3NQFA 1B3OA 3FAXA 3TV8A 1DHPA 3ZOAA 1SJAA 1A5MC 1T96A 3HFYA 4LSBA 3PPHA 2P3EA 2FZ9A 4UFMA 4WSJA 3RCNA 1ME7A 1YADA 2W92A 1P4CA 2XSXA 4RDWA 4HJFA 1GYNA 1VJSA 3H54A 3Q2DA 3WEOA 1ISVA 4WOZA 5I3KA 1EX1A 4RPQA 3QN3A 2ISVA 3CIWA 3CIXA 3OEXA 5HOSA 4UOQA 3WDPP 2ZA1A 1J6PA 4WOQA 1EX5A 1C8YA 3SO7A 4IISA 3EDDA 3VI2A 2DH2A 3MUY1 3VE9A 1AQFA 1BSLA 3S1XA 3MA8A 3TTSA 3SUWA 3K4WA 1Q85A 3II1A 3FCPA 2RDWA 2I9UA 3THUA 3GO2A 2FPTA 4RZ6A 3CHDA 3R0UA 3B3DA 1KV5A 4WZHA 4B90A 3HU7A 4MB4A 7REQB 1PJ9A 4Z42C 1OX5A 4DO5A 4I5XA 4Y9OA 4NZFA 4S3GA 2ZC8A 3FX4A 3U8GA 1R46A 1VBRA 1C93A 2IW0A 3V7PA 2BV9A 3K4DA 4MADA 2CLPA 1PZ1A 3LGEA 3Q37A 3W9ZA 3QV7A 5D32A 2DIJA 4GNJA 1LBMA 4Y9NA 2E0PA 2OFJA 2DUXA 2WQPA 1SZGA 1V4YA 3EKGA 1PL9A 5A6BD 3BG9A 4MUZA 1LLWA 1WZAA 2Y5SA 3LMYA 1XBZA 3W7CA 3VIMA 2A7PA 2R1LA 4RE4A 4CVWA 4O0KA 1LG1A 1MNSA 3GFYA 4WJ8A 4CNSA 4EPDC 1PSCA 3EDJA 4L9YA 2NQHA 2OYKA 3UCDA 1XLEA 1NU5A 3HZ3A 4KRZA 5BROA 2I14A 2FZBA 5HWMA 4ZL1A 3I6RA 4NJGA 4PCFA 4B5UA 2DW7A 1ZRQA 2A5HA 3EPMA 3AMCA 3QC3A 3CB3A 1H51A 5D9OA 4IGSA 4BA0A 1O4UA 2EAWA 1B4KA 4F4RA 1H11A 1VIZA 2ZDSA 1VJIA 1CGUA 5TAOA 5JU6A 2YYTA 4S3EA 4ICMA 4HMCA 4DBDA 2O7SA 1SFSA 1H63A 1XRTA 4XZWA 4P8WA 3BAKA 2PUZA 5CC5A 4I6KA 1HW6A 1YNPA 1XC6A 4LALA 4J3TA 4J2PA 2BS9A 1TVNA 3AZRA 3T81A 1NWRA 2VQUA 1F8MA 1HIZA 3W86A 1PX4A 4Y2WA 2YB1A 2OOFA 1WE5A 4L65A 4JTDA 4IT1A 2GGEA 3FGCB 1ZGDA 5K2ZA 3SCNA 4D1JA 3DI1A 1UKOA 1FXQA 3ZZ1A 3I3EA 1ISZA 2C13A 3TW9A 1RAKA 1FP8A 3CUIA 3M07A 2QUMA 4GABA 2CHOA 4YPJA 3P5YA 5IHRA 4I9MA 1Q6RA 3T09A 2DT0A 1B1YA 3ME3A 1GVEA 3VMPA 5I03A 3FVDA 3N6QA 4JX6A 3CO8A 1LL4A 3EB2A 3W1UA 2B7NA 1ITUA 4ZR8A 7XIMA 1HL9A 5I0DA 3M64A 2Q3RA 3QY8A 1GKQA 2NXHA 4ZQPA 5DY3A 2OSWA 3CB8A 1HVXA 2DW6A 3DFQA 3NVDA 1Q6GA 4IJCA 4A3RA 5AHIA 1V51A 1V8EA 2ICSA 4LUSB 2XYLA 2Y7DA 5KINA 1RY0A 4AEOA 1VFLA 5IRPA 5CJMA 1A5CA 1HVQA 2FQIA 2VFDA 3QPZA 1FP9A 3MUXA 3P81A 4I9TA 4BK9A 1RA0A 4YVPA 1T99A 1RCXB 4KEMA 2BHZA 3LI0A 4NYUA 4GINA 3XIMA 3OVPA 2WMIB 3SN1A 1ELSA 3PBUA 3A4XA 1WPCA 5B80A 1JD9A 1E51A 4EACA 3OG2A 1DJHA 5FEXA 5LKYA 2E6FA 9RUBA 3SRDA 2XTKA 3WUFA 3TJ4A 1IGWA 3V1HA 2OLSA 4DF2A 2ASHA 4G56A 4OUEA 2VD9A 1EC8A 1DJXA 4JQ4A 3CQIA 3RN6A 3TYAA 4YHEA 1QOPA 2EJ1A 1VFSA 4TXEA 2GOUA 1I4NA 1CNVA 4LOCA 1ZBVA 4RCXA 3QY7A 4E4FA 2EPOA 1XIHA 3WYZA 4G7EB 4PMJA 4N2YA 3P8IA 2ATMA 4ZBCA 4L9ZA 4QEHA 4X0VA 3PNUA 4MAVA 4Q8WA 3KOFA 2MNRA 2PDGA 2IKIA 3P6LA 3P3BA 1OCBA 2Q8ZA 3G1VA 3VIOA 3EX2A 1YKWA 3GC5A 1TE1A 4AEFA 1GW1A 4ZQOA 1VPXA 3WLIA 1P0BA 1B9ZA 1N55A 1KXVA 4E2OA 4NYYA 3UZZA 1D3GA 2J24A 1Q6FA 2V5DA 5M1TA 1UWUA 1OABA 3TJXA 1PV8A 3OVGA 1UIOA 1EDTA 1TWWA 4WKFA 5I79A 2NXIA 1R0MA 1KWKA 4Z2GA 1G5AA 2ZUMA 4MNJA 3PZTA 2HE5A 3W2UA 1AW1A 1JRCA 3NO3A 1HL8A 2Z7KA 3ERPA 3BQ5A 4YU1A 4ZTXA 1EQCA 5KEZA 4K8EA 4Z1CA 3URBA 1CGXA 2VJXA 1IWBA 4BWLA 2PD5A 1EP2A 4FR1A 4QP0A 1YDVA 3RDKA 4ACZB 3MHFA 2J47A 1H41A 1OHLA 4GPNA 3WLSA 5AC6A 4FK9A 4M6UA 4GI9A 4FF5A 3TWAA 2FDMA 4PSRA 7ODCA 1T5AA 1JZ2A 3CGTA 2RUSA 3UY8A 3WQGA 4ATWA 3KOWA 4G1KA 2YIHA 4ZFCA 2PWHA 1P6WA 2C1GA 2FTWA 3QGKC 1J6OA 1TV7A 2ZCGA 3TQ0A 3F1QA 1OINA 1CECA 4EWJA 1MQPA 3ARWA 1UR1A 2ONEA 3P74A 2ZFAA 4RZ4A 2D23A 4DUOA 2ZUNA 5FI8A 4R7OA 5H8MA 3GG7A 2CZVA 3PNZA 4L4PA 4U3AA 3SIZA 2WZIA 1PCKA 4FF7A 2DZPA 3BOFA 3CUJA 1CLVA 4JTKA 2EPHA 1TRDA 2VXNA 1X6LA 1HJVA 1OF8A 4MB3A 3V16A 3ZVIA 3L23A 4HPHA 2FGBA 3QSTA 4NX5A 4QEEA 3UWYA 1MO0A 3BLKA 3LCXA 4HCLA 3W1LA 1B3YA 3UWUA 4PCTA 4HOWA 1KTCA 3VKCA 3L21A 3GXNA 1RXOB 2X2GA 3LYEA 4MWAE 1DWHM 4LRSA 1GUVA 3RU6A 3V5CA 2JEQA 1S5VA 4Z0JA 1ZSXA 2J9XA 4J40A 4V28A 3R2GA 3L2MA 3IGSA 1HJSA 3GR4A 4PSPA 2NVDA 1SPQA 2NVAA 3SR7A 3LHTA 3SCTA 4UFKA 2X7VA 2X1SA 2D0HA 1TPB1 3N2MA 5TBOA 3I6EA 4HPGA 5G1MA 4OECA 1X6NA 3WMBA 3NDZA 5JH2A 2GK1B 3E5PA 1GPFA 2ZXBA 1HO1A 4TX8A 2IKGA 4MAZA 4S3DA 1KXHA 2VGBA 4F66A 4WD0A 4D2JA 1N2VA 2Q09A 4MDPA 2HRWA 1W9BM 1M04A 4OHQA 3GYEA 2QIIA 3D5HA 2PLMA 3S2NA 4Q3MA 1ICSA 5G1YA 3DHFA 2PBGA 1W1IE 4PUWA 1CXHA 2OSYA 4W5ZA 3TC3A 1Q6QA 3Q67A 1UWTA 5BOFA 4KW2A 1EA0A 2OO0A 4NY2A 1YLVA 2ZTKA 1VHCA 8RUCA 4K2SA 1TWDA 4S38A 1E56A 3PUOA 3SCVA 5FF4A 1CXKA 4KCVA 1K70A 2ZADA 1HGYA 5J5RA 2TMDA 1YDOA 4JFTA 3WLHA 5TNVA 5LGXA 3S3GA 4JY8A 1VGAA 4ROPA 3LK6A 1UP0A 1CBGA 3B97A 4H1ZA 3KBNA 1JYVA 1B9BA 2CXGA 3F2BA 4PBGA 5F2LA 3B8UA 1A49A 1JCMP 3MKKA 1SQ7A 3EX6A 3PM6A 4WR3A 1C9DA 2J27A 2XJ7A 3DERA 2QDEA 3B0XA 3E38A 1TUFA 3PBGA 3VMOA 3W7RA 3APYA 5D9MA 2VC9A 3DESA 3S2JA 3T78A 5XINA 3NSMA 1UUOA 3LNMA 3A23A 5DF0A 1HJQA 2Z4GA 1VKFA 4GZJA 1OFRA 3M6YA 4NI3A 3P8JA 1UJPA 3U5YA 5TQLA 5GQBA 5J8LA 4DXXA 3QW3A 2VM8A 1ML1A 3UXAA 3U0HA 5HJYA 3LRKA 2QUUA 5C71A 3L4WA 3USZA 4LCSA 1KQZA 4EWND 1O60A 3W23A 2C18A 5F7UA 4MIMA 3DG7A 1VCGA 3SBFA 3ZIZA 3VGDA 3NWRA 1XYAA 5BMXA 4FNSA 3QZAA 3W27A 2QCGA 3TX9A 4DJEC 2FPVA 1T6MA 4DUVA 4PYSA 1DVJA 3TC6A 4AWUA 4BHYA 1EUAA 3AROA 4X61A 4CU8A 2YBTA 2PCEA 2O56A 5D33A 4QE4A 2EF9A 2G95A 4WUIA 4AF0B 2EPNA 3QPYA 2WSPA 1Y7VA 3AIWA 2BZNA 3LB0A 3T0DA 4ADUA 3VFCA 4PTNA 1IT7A 3NSXA 3LM7A 5LXEA 4TMCA 3W53A 4ZO8A 3CPGA 3OZOA 1QATA 1A0DA 3LGDA 2FHFA 2ZA3A 3H8AA 1QW9A 3HV8A 2GDVA 4A3QA 1QPQA 5CG0A 3PTDA 2B4GA 4QLJA 1CEOA 5F4XA 3EGJA 3W82A 3ZLGA 3OHMB 3AMKA 1QW7A 4Q7IA 3SRFA 4W8BA 3G5EA 5CPTA 3WLKX 1P6CA 3ZSSA 2CCRA 2WVUA 4ROQA 4XIMA 6REQB 1RHCA 2JF7A 2PCQA 1H2JA 1FOBA 1AH4A 2TPSA 3E12A 1LWIA 1J12A 5LIKX 3AYRA 1A80A 5I3JA 2XIMA 4FLRA 2DZTA 2BY1A 1KBLA 3REQA 4J9JA 3RFAA 2Y6ZA 2XFWA 2YB4A 4IMGA 3W26A 1GONA 3UF9A 5E9XA 3FHAA 4DNMA 1PZ2A 4GUFA 4LYQA 1GVSA 4REQA 4L1WA 1CB2A 4E6MA 1S2AA 5I3IA 5A6MA 1T7LA 2ISFA 2GYIA 1I1WA 2IPGA 3SCOA 4G5DA 2KX9A 4WGXA 2QPXA 4M7TA 4AHPA 1CIUA 5KZDA 1AD1A 3TKFA 2D0FA 4QS6A 4B3ZA 2XUCA 3P60A 3AU2A 2C0HA 3LN3A 3T7VA 5D09A 4JZ5A 3PJUA 2ZICA 1ZJAA 3MZ2A 2JKPA 5BWAA 1XLFA 1FWJC 2OT0A 4KFOA 4LAZA 4L6HA 2QQ6A 3FHQA 3VD4A 3NO1A 4YS1A 2DZSA 4I7VA 2J25A 1RVGA 1TZZA 2HDJA 1QTWA 4JEQA