4XVDA

17beta-hsd5 in complex with 4-nitro-2-({4-[3-(trifluoromethyl)phenyl]piperazin-1-yl}methyl)phenol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
314
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 314
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xvdA00
3V0TA 1PYFA 4WDWA 1XJBA 3MC5A 4ICCX 4OTKA 2IKHA 4XZHA 1Q5MA 2PEVA 3LQLA 4WDTA 2IKJA 5LIUX 3ONCA 4ASTA 1S1PA 3P2VA 2PDBA 4JQ4A 4JTDA 4QBXA 5HNTA 4XO7A 4YS1A 4GQ0A 4XAPA 3EB3A 1LWIA 1VP5A 3NTYA 3H4GA 2ALRA 1AZ2A 4WEVX 2PDJA 2HE8A 2WZMA 4FZIA 1QWKA 2CLPA 3EAUA 4QR6A 2PDHA 2FVLA 2F2KA 1GVEA 3BCJA 4QXIA 1RALA 3V35A 1SM9A 2PDWA 1RY8A 3UZYA 3QKZA 4ZFCA 2PDMA 4LBRA 4YVPA 4R9OA 3UZWA 5AZ0A 3C3UA 3O3RA 4JQ3A 4WGHA 3UZXA 2IPGA 2DUXA 4JQ1A 4JTCA 4H8NA 2IQ0A 4DBUA 4G5DA 5M2FX 2HV5A 3S3GA 1JEZA 3LEPA 4GA8A 4HBKA 5HNUA 3LD5A 4LAZA 1Q13A 2VDGA 4WRHA 3WBWA 3WBYA 3ERPA 4L1WA 4LBSA 3M4HA 3H7RA 4GACA 3CV7A 1MRQA 3R7MA 3CV6A 3EB4A 2BGQA 2PDKA 4IJRA 2AGTA 3O0KA 4DBSA 4WDUA 1EXBA 1YNQA 2ACSA 3V36A 4XK2A 3H7UA 3MB9A 4PUWA 3DN5A 1AFSA 4GABA 4JTRA 3M64A 3CAQA 4FALA 3R6IA 1EF3A 3WG6A 2NVCA 1UR3M 5LIXX 2ISFA 3UG8A 5KETA 3M0IA 2DUZA 2ACUA 1OG6A 1AH3A 3LZ5A 3BURA 4XO6A 2IPJA 2PDUA 3N6QA 1Z8AA 4YVVA 3UYIA 4EXAA 3Q67A 4XZLX 4QX4A 1IHIA 3UGRA 4FA3A 2FZ8A 5LIWX 4PR4A 3CMFA 3UFYA 3D3FA 4XZNX 4JQAA 1AH4A 5AZ1A 2PDIA 3R8HA 1S1RA 2HVOA 3LBOA 2HVNA 2PF8A 4PRRA 1ADSA 2BP1A 4FAMA 2C91A 3U2CA 2A79A 3DOPA 1YE6A 3LNMA 1X98A 2PDYA 2FZBA 2PDNA 3KRBA 2PDFA 4F40A 1Z9AA 5JH2A 3RX2A 4MHBA 4RPQA 4LB3A 3UZZA 1PZ0A 4H7CA 5DANA 4NKCA 3CAVA 3GUGA 4Q7BA 2DV0A 2HEJA 2PDXA 4LB4A 4EXBA 4XVDA 3UP8A 4GQGA 4XZMX 3GHSA 4YU1A 2ACRA 4AUBA 1Z89A 3T42A 1ZQ5A 5JH1A 5LIYX 4JIHA 1AZ1A 4IGSA 1RY0A 4JIRA 4JTAA 4PMJA 3CASA 2PDQA 1ZGDA 3RX3A 2IS7A 1PWMA 4GCAA 4DBWA 2PDLA 2PZNA 3RX4A 1T41A 1YE4A 4HMNA 1MI3A 4GIEA 3BV7A 1IEIA 3R43A 4LAUA 2P5NA 1HW6A 3FX4A 1US0A 3WCZA 1R38A 1ZUAX 2INZA 3GHUA 1J96A 2ACQA 2J8TA 4XZIA 2HE5A 4Q3MA 4XVEA 1XF0A 2R9RA 1K8CA 4L1XA 1X96A 1YNPA 3LUTA 4JIIX 3WBXA 2INEA 1VBJA 3VXGA 1PWLA 1HQTA 1Z3NA 2PDGA 2QXWA 3F7JA 3R58A 3V0SA 2IQDA 4IJCA 3R8GA 3N2TA 4I5XA 1T40A 1ZSXA 5HA7A 2NVDA 1XGDA 3LN3A 3COTA 1EL3A 2PDCA 3G5EA 1QRQA 2IKGA 3G1RA 2PFHA 2WZTA 2I16A 3BUVA 3UWEA 2PD9A 2IKIA 2FGBA 3GHTA 1S2AA 2R24A 1MZRA 3LZ3A 3FJNA 2PDPA 3LQGA 2FZDA 3ONBA 1EKOA 4JTQA 2PD5A 2IPWA 2FZ9A 2I17A 1PZ1A 1S2CA 3R94A 2IPFA 3Q65A 4JQ2A 3V0UA 1C9WA 4YVXA 1M9HA 4WDXA 5C7HA 3GHRA 4PUUA 2HDJA 3B3DA 3LENA 5LIKX 1X97A 4PRTA 4DZ5A 2F38A 1LQAA 2BGSA 1AH0A 1A80A 1FRBA
chains in the Genus database with same CATH superfamily
2JKPA 2XSBA 5BU6A 3THCA 4ZQNA 2WSQA 4REQA 1H09A 3UETA 3PANA 4RUBA 2PEVA 2WJEA 3W7OA 3WLLA 1EDGA 1X1NA 1XLKA 4ERAA 1TPWA 3MUCA 4JDYA 7ENLA 1TCDA 5LIUX 2V9DA 2XVGA 3AHTA 3SAZA 2XG9A 1AMYA 1ZB5A 3W25A 2VT0A 5GNXA 4Q8OA 3EB3A 1ZAJA 4CN1A 4L5ZA 1AZ2A 3STGA 4PFHA 3MW7A 2OMAA 5FA5A 2DEPA 1K8ZA 2QIWA 1V8EA 5E09A 4JDBA 4L9XA 4KKXA 4RZ5A 1FH9A 5I5RA 1F61A 4QXIA 4U28A 1S2UA 1RV8A 3UERA 3QBUA 2XSAA 4XD6A 3GYCA 3MHGA 2A7PA 2GQAA 3ALFA 5CPLA 4U2ZA 4IFKA 1BF6A 3N29A 3VAVA 3W22A 1P0NA 3EWUA 3LDVA 3UZXA 4XKYB 3IIVA 2ISVA 3GC4A 4NRRA 1ZJAA 1DWHM 1TWWA 2PC8A 4GC4A 3A47A 2D3LA 1R85A 1UCWA 3LOTA 1P6WA 3W02A 3W1XA 1V3JA 1PJ9A 2D73A 2ZVIA 4LFYA 2EKGA 4GLEA 2ZZ1A 1SO4A 1GQJA 1A0DA 3N4AA 4KW2A 3WLOA 3EKZA 2OT1A 3WBYA 2CESA 3I7QA 2QLYA 1LYXA 4AC7C 1LWJA 1SO6A 1JG9A 4JICA 3OTRA 2D2GA 5BOFA 5CC5A 1V3HA 1TWZA 1EDQA 2HCVA 2WC3A 3R7MA 2YDSA 1GZ1A 3IS4A 4A8LA 4AMAA 1ZAHA 2R14A 5AYBA 4KEUA 5DBTA 3IJ7A 1FWNA 2Z1BA 5A95A 2J4GA 4LU0A 3TW7A 2QZRA 4G7EB 1BF2A 1GVQA 4XK2A 3SB0A 3W6MA 1IIGA 1ZCOA 1H7OA 4WKAA 3FW6A 4JEJA 1HJSA 2C0AA 4H2HA 3MSGA 5EGRA 3B8UA 4BF9A 1GVIA 1E40A 2JEQA 2OZTA 4B5WA 3QOMA 4GNKB 1UA7A 4J7RA 2ZRZA 3WG6A 2W5FA 3E0LA 3GNXA 3S2JA 1UR3M 1DP0A 1V6TA 4CN4A 1AODA 2EQDA 3HF3A 1TR1A 1JUEA 4LAMA 1UASA 3TMLA 2D2JA 3UY8A 4YVVA 3GVVA 3G0UA 2QGYA 3WK2A 4AMCA 5I3HA 4GI6A 1OC6A 3CIWA 5DCEA 1FHLA 1Q7MA 1V4YA 4DYKA 1AQ0A 3L21A 3KS5A 3QPZA 3TYAA 1C90A 2PRLA 3P62A 3LYEA 4YPJA 4D8LA 1VIZA 2HVNA 4LAOA 3QHMA 4ML4A 3DFOA 4TQTA 1I1WA 1IXQA 1OZQA 3HB9A 4HMEA 3AIVA 5JU6A 1CXLA 4UMAA 1H1YA 4UTUA 4AX7A 2PBOA 3W7RA 3ITGA 3QC3A 4O1FA 4ACZA 1BGAA 3EWBX 1JQVA 1RZMA 3G6LA 5E9AA 4PEEA 2DT3A 3NZPA 2OOFA 1PZ0A 1U22A 1ICQA 5HJLA 3WF0A 3TIMA 2R8WA 3N2OA 2C71A 1XRFA 3CBWA 2PDXA 3N4EA 3SIMA 2WC7A 3MYOA 1YTDA 3DGBA 4AUBA 2WPGA 1VBGA 4FF5A 4NJGA 3VDCA 1F3EA 2RJHA 4A3YA 1J0ZA 1FDZA 1MVYA 1OT1A 3LXCA 4S3KA 3WD0A 2AKZA 3DG7A 3GNNA 4UOJA 3VM5A 4UCFA 5CZ0A 3P82A 2O56A 3UCDA 3VOCA 3S1UA 2PDQA 4FR1A 3CUZA 4MUZA 1GYMA 4HMDA 3GXNA 3GAYA 4A21A 5MKGB 1CGYA 1QI4A 4NXKA 4L6OA 4OOUA 2PZ0A 2X2YA 1JYWA 1JVNA 4KEZA 2YOCA 3HG2A 3VD3A 3XINA 1VRDA 3KVMA 2ZUWA 1TRDA 3MJYA 4OHQA 2XTKA 3BAXA 2HBXA 4ZL1A 4HHPA 4JGDA 4JTFA 5EFDA 1JNDA 2DVTA 3RDKA 4OV9A 5DF0A 3TLLA 5LNVA 3RLUA 1LL7A 2J7CA 4O8AA 2WQPA 2F61A 3FVMA 3F2BA 1HX0A 1GTHA 1GKPA 4K68A 4GJIA 3P81A 1YPIA 4L65A 1FCUA 3S9YA 1UMYA 2BOEX 3KHDA 3ZYZA 3QW4B 3ABSA 4B16A 3BW4A 2Y7DA 1R5YA 2QXWA 5G1YA 1V03A 3V0SA 4OZOA 3R8GA 1UMLA 4BS0A 3W72A 1VR6A 3HQNA 4AH7A 3I6RA 4O12A 1B2YA 1TR9A 2YXXA 3HIJA 3ZMRA 3FXYA 4JKLA 3NG3A 5FAGA 3O6YX 3SR7A 1XYBA 3R4IA 2DIKA 3FK4A 3N6JA 1RK6A 3DBPA 1B4KA 3GVQA 4K3ZA 1QK0A 1BD0A 1WV2A 4DXVA 2Y1HA 3ZXWA 4GGBA 4MADA 4C6MA 6XIAA 1AJ2A 1H0GA 1LRNA 4MY8A 3FLUA 3MI2A 1MO0A 3ITXA 3LPOA 4JTKA 4LOCA 4JTQA 5I3IA 1ZPTA 1NU5A 3OQEA 5FEPA 3R10A 3D47A 3ARTA 1RK5A 1I75A 4MNKA 4MNJA 3E0IA 1XH0A 4LUSA 1Q45A 5LGZA 4PUUA 4IFOA 5I02A 5JBFA 3EMCA 3IJ6A 1DEDA 1JZ4A 5FAJA 5AECA 4Y9AA 3PWIA 5HAOA 3MKCA 3TLQA 1RBLA 3PJWA 4HT3A 1E6QM 3C0SA 1FH8A 4FLSA 4RW3A 4LT9A 4H41A 8TIMA 5M03A 3NA8A 4K1GA 3VGDA 1G6CA 3MC5A 4IJBA 4TX9A 4L61A 2WOQA 1W9VA 4XZHA 1JZ2A 1T7LA 3BTNA 3BLOA 4X63A 4KS0A 3MP5A 3WJWA 3HOJA 1IYXA 1BYCA 3S6TA 3TW6A 4KIEA 2QKFA 3I3BA 3AALA 1H41A 1BXCA 1NQKA 3QQ1A 4MVAA 1S3TC 4PMZA 1DYSA 1ONXA 1DQUA 3MQTA 1DJGA 3UBPC 1Y0EA 2ZZ2A 3DC0A 2YX0A 1PKYA 4AD1A 3LCIA 4Q4MA 3STEA 3KBVA 1GUVA 1VFTA 2PB1A 3DUGA 5ABFA 4ZFMA 2W3ZA 5I3JA 4KCWA 3EWCA 2VEGA 2EPLX 3W7DA 4J28A 4Z08A 2ZUNA 1JXKA 4D72A 3LCLA 3O3RA 1KXHA 4JIPA 4W5UA 4B4HA 5A8MA 5BW6A 1XCWA 2O4QA 1TZ9A 5I3DA 3E5PA 1UQYA 3CB8A 5CQ1A 3SCRA 1XH1A 2YFNA 4O8RA 3ZZ1A 1UD6A 4FX7A 4F4RA 3ALGA 3K13A 4W8LA 3RCYA 1WA3A 3VOJA 2QDDA 3NDYA 2CKRA 1XSJA 3WBWA 2X1TA 2W79A 3H26A 4KFNA 4L1WA 3ZR4A 3WDIA 3VZYA 5AB3A 3IJ9A 1XLMA 1WXYA 3EX4A 4PN2A 3CM4A 2YDQA 2WANA 1F74A 3DYMA 4ICMA 2J66A 4UQDA 3UVAA 4JKMA 2AGTA 5FF2A 3GNOA 4WXZA 1GGOA 1K6WA 2OOGA 2NUYA 4A8IA 3VOIA 1E9IA 2NXGA 3MHUA 4AVOA 1NF0A 5TAOA 4RL3A 4ZO9A 4S3GA 1WB0A 4KRTA 1KBKA 1LOSA 2I57A 1SMAA 3A4AA 3TCSA 4BY3A 3SRFA 3TAOA 2CLLA 4PCSA 1D7FA 1SJDA 2UY2A 2B81A 3U2EA 1UR9A 2W6RA 1GEHA 4HHLA 3E0WA 4NUWA 5HMFA 3PSVA 3HU7A 3NQDA 1AJZA 2Y24A 3BAJA 5DELA 4MGGA 4Q4SA 1JULA 2H6RA 2OX4A 1FWBC 3D5HA 1GHRA 2W67A 1R9YA 3GVRA 1TA3A 3OBKA 3TX9A 2HSAA 2KX9A 4B5NA 2GOUA 3WK0A 4HN8A 1X8FA 4M81A 1LP6A 2B0MA 2DUAA 4X9SA 3AISA 1WZAA 4L80A 5CKSA 1A50A 4I7WA 3RFAA 3NO3A 1RBOB 3GXFA 1OFEA 5I09A 1Z9AA 3PG9A 4QFUA 2ZCGA 4RPQA 4U31A 5G5IA 1WDRA 2DZBA 4GISA 2EKCA 2NV9A 4Z2KA 3CHCA 3EA1A 1W3IA 2CW6A 4GFIA 1CPUA 2QJHA 3DHDA 1O6IA 1EJSC 1YDNA 2H9AA 5JUVA 3PNUA 7PTDA 1VBUA 3ZLGA 4A3RA 1CWYA 1A5MC 2E3ZA 4K37A 4ORIA 2PAJA 3A5FA 4Y9NA 3SDOA 1QFEA 4QSFA 4EPBC 2Z2AA 3NCOA 4NF7A 5H8PA 1CXEA 1MUWA 1CI1A 3NL3A 1W2VA 1JGIA 1VFUA 2XH0A 4G7FA 3H53A 1KR1A 1WP6A 4C6NA 1WCGA 5DCDA 4GIEA 2YB1A 5I24A 3FX4A 1R3QA 1SFJA 4QAWA 3SSZA 3FA4A 4FNQA 1EH9A 3CEUA 3KHJA 3W83A 5EMUA 3NAVA 3T0CA 4LVBA 1DJQA 3T55A 1KBIA 2E9MA 1WUEA 1GKQA 4L1XA 3KWXA 3UESA 1V93A 1EHNA 1OC5A 3N14A 3GTNA 3CHFA 3L68A 2JIWA 4GVIA 1KQZA 5CCZA 3NQCA 4B92A 1B9ZA 1DE6A 1P5BA 1XGEA 2WC4A 2EG7A 5AN7A 4WLCA 1XGDA 4NYUA 3B0XA 4MYAA 3UXIA 5HWMA 3BC9A 1W1VA 5KMYA 2W0UA 3HGOA 1OCQA 1G69A 1TX2A 3KX6A 3RGTA 1XIDA 3MUY1 3CZEA 2OLSA 3RCMA 5AYYA 4WHBA 3BUVA 4DQWA 3ANUA 1DJYA 2VL4A 4WVXA 3VGHA 5H8UA 1K6AA 2PBGA 4N6EA 3V16A 4WJ8A 4H9VA 4RV8A 5G4HC 4KCUA 3OA3A 3AMKA 2NVAA 3AS0A 1GJUA 3TW9A 5D04C 1XYMA 3AJ7A 1NTHA 1UJPA 3BVJA 1W3JA 3VD4A 3WMCA 4CKQA 4PTMA 4HVXA 3VFCA 5F7UA 3F2DA 3NURA 2HVMA 2CLMA 4UR8A 3TQPA 3GO2A 3KBJA 1XQLA 2ZXQA 3WKZA 3W2KA 4ADSA 4GXWA 2Z25A 1EX1A 5FF0A 3IJLA 3MUZ1 3T9PA 4LYRA 2FTWA 3BW3A 2VEPA 3TN5A 1A80A 4HOXA 3L2IA 3PZMA 3N2XA 4MKSA 3UR5A 3CL7A 4CD4A 1S46A 4YTTA 4OTKA 3SM0A 5F2LA 4PBGA 3SCWA 2WJFA 3KP0A 4JR5A 3GZ3A 1NSJA 4PCNA 4NNCA 1DV7A 1SZNA 2KZHA 5HQEA 2I5GA 1AW2A 4HHMA 1XXXA 3WL0A 1Q6QA 4QEEA 2Z00A 4S1FA 2HE8A 4FZIA 3J7HA 1SGJA 1XLCA 5HJXA 4S39A 4QR6A 3BQ5A 2W61A 1I4NA 5K9DA 2NXHA 5K4ZA 1TV5A 2ZX9A 4NJIA 5AVHA 4CQ8A 5A3HA 2NQZA 2WMFA 2X30A 2BY0A 3R89A 4G2DA 3WQDA 5IHRA 3VIGA 4CQCA 2XM1A 5HR6A 1UQZA 4WJEA 4HA0A 3UJSA 3CQ0A 4I9AA 1GG1A 4ICNA 1ITCA 3PBUA 3WD2A 3M0VA 1KM3A 3KRSA 2WZHA 3AU6A 3TXZA 4YJ5A 2WSKA 3S1VA 4Z1DA 4EIVA 4E4PA 1QHPA 4BQ2A 4E8DA 1WDSA 3CH0A 1E15A 4N9CA 1W8GA 5I07A 5LNRA 1KA9F 3A22A 1PYMA 2GWGA 1F7BA 2ZDRA 4JL2A 1EJWC 4N7QA 2VDGA 3RF9A 4OECA 4C6DA 3IGXA 4HSNA 1WZMA 3B9OA 1QHOA 1EBHA 2V3EA 3HJEA 3DAQA 4AF0B 3VCCA 4BWLC 4MWAD 3BG9A 4JNYA 1E6XM 3JZEA 3EB4A 4BF7A 3GRIA 3W76A 4MFEA 2E9LA 3O2LA 4US6A 1OHLA 1RLCL 4MFDA 5M3WA 2UY5A 1IR2A 1YEYA 2GJPA 1VLWA 4PTXA 3MB9A 1UHVA 1M3UA 3VZZA 4JTRA 3M64A 3W7PA 1EA0A 4JTSA 4FALA 4AWUA 4UTTA 2XIIA 3A13A 3MWAA 3VD9A 3A4XA 4S3FA 1HUVA 3LGDA 4C90A 1N7KA 3NPUA 3GM8A 3SY5A 5A6KA 3PN8A 1CNVA 5LIXX 3L0KA 1M1BA 3K1DA 1JPHA 1JDDA 3FAWA 5FL1A 3CZGA 1WKEA 3UYIA 3LXBA 1BVZA 1OC7A 4HNVA 1XLLA 4OT7A 5G2WA 4M1RA 1UZ1A 2AAMA 1BEUA 3W38A 2QPSA 1IEVA 1AH4A 2GGGA 2O7QA 5EMMA 1VIWA 2VEFA 2DY3A 3B8WA 4C7FA 4DN1A 3OLDA 4CNNA 1L6WA 3VZXA 1BKSA 3O06A 3IPWA 3VMPA 2A79A 4B5TA 8XIMA 2PDNA 3KRBA 4CNUA 3LB0A 1P4CA 3HO8A 1KCLA 5ABHA 3WENA 4WF7A 3LG3A 1XLEA 1C8QA 3HN3A 1MQPA 2A7NA 3S5SA 3T4CA 3GUGA 3G1HA 2X1RA 4IISA 1YHTA 2O9OA 1BYBA 3RLHA 3UWQA 3IJIA 2PGRA 2WNNA 3ITVA 4UOZA 5FEZA 1FFQA 3STCA 2A3CA 4I6KA 1GZGA 3WD1A 1RY0A 4IP4A 2P88A 4J3UA 4JTAA 2XZ7A 3GR7A 4CD8A 1V79A 1NAL1 3PWGA 3T2OA 1JCMP 4AFYA 4WSJA 2VEMA 5A6JA 3MTWA 4Q8QA 4UOQA 1RHCA 3KTXA 1UC5A 4WKHA 1VFOA 3OYZA 5KITA 1UP0A 1P0BA 1B31A 1G0CA 4L6DA 3PM6A 1VH7A 2YCJA 4UQCA 1JQXA 2Z6JA 1NWTA 2E5DA 3VU2A 2QUVA 4Q22A 3O15A 3TNOA 1SVDA 1FWTA 2R9RA 3FHQA 3W71A 1BG4A 2V30A 4CNPA 2NX3A 4G1KA 3KFTA 5HULA 1EF2A 1DJIA 3GAKA 2QIIA 1XLGA 2ZBTA 3C56A 3TR9A 2CETA 1TPB1 4GY1A 1TB3A 3KDNA 1UW9A 3W84A 4JIQA 2Z26A 4ZQMA 2X7VA 3PWAA 4DWSD 3A12A 1MFUA 4G1NA 1FVPA 5DO8A 5JIWA 1H4PA 1Q4NX 1GNXA 2D23A 2FHBA 2FVMA 1FXPA 2OB3A 4DNHA 1EX5A 4L4MA 4WJXA 3WIJA 3WLNA 1WDDA 4YYCA 2J74A 4RDZA 4JFVA 5D4YA 5HWJA 1LRTA 1E0TA 2FH6A 3SN4A 1CENA 1S5MA 4LAKA 2OLHA 4U33A 5IFTA 1UIPA 4ACYA 1W91A 2ANUA 4PYSA 3AOFA 2DT1A 4AB4A 2R1NA 1MZRA 4M3PA 4AQLA 4WOZA 2W66A 2BVWA 3N1AA 3LQGA 2E6AA 3G22A 4GRSA 2INFA 3OP2A 4GQRA 1SFLA 4CQ9A 2BHZA 4GKLA 1OX4A 2G5WA 2X0YA 1PIIA 3FJLA 1QO2A 1K3UA 1KTNA 2XVLA 4L4OA 1KNWA 4Q4KA 3B3DA 3LENA 3P0XA 4GYKA 3VILA 1KCZA 3RPTA 2QF8A 4EE9A 1YXDA 4QG6A 3F4VA 3APTA 4GI9A 3A23A 1LF1A 2QCFA 2TODA 2GYIA 2CBIA 2Y5JA 4LTSA 1F5ZA 2EF9A 3NVDA 3LQLA 3W37A 2R1LA 3VDBA 3F03K 3T78A 4YCPA 3GU9A 2IQTA 4Z0JA 4MB5A 3LCWA 3W86A 3NQ7A 1MEIA 2FGLA 5HMSA 3MCMA 2XZ9A 4IIGA 1VJSA 2DZPA 1QK2A 1LBLA 1B5TA 2DSUA 4WK9A 3REQA 1EOMA 3WQ4A 2VNCA 2NXIA 3TZFA 5FKYA 4H8VA 3AC0A 2GPTA 4DYEA 5IFPA 4ML9A 1OGSA 3VI2A 1R8LA 3NDOA 5IOBA 3H4WA 2PWHA 1XUUA 2O92A 1JGMA 4GUJA 3ANYA 4I5UA 3H21A 3OQ8A 2YPIA 2DUXA 1S5TA 5T9CE 5CJNA 5FL0A 1ISZA 3MVTA 3ZJKA 8XIAA 3EKGA 3RIKA 2E9BA 2OJPA 2VQUA 3AXIA 3L4TA 3SGZA 3VNDA 5H91A 1CZ1A 1B3YA 3M0HA 4GJJA 5ABTA 4WSKA 3WELA 3PZUA 4DF1A 4NILA 3DKLA 5K4XA 2GDQA 4F0MA 5U7SA 3P67A 4D6DA 5D8WA 2QJNA 2XHYA 1W1TA 4LALA 2P53A 1K7FA 3LHUA 2PTWA 3U2ZA 3TUUA 4ZVJA 1DXEA 1E5JA 2WHMA 4ZCWA 3CV6A 2VMFA 3RXZA 1TUXA 3UEQA 2YCLA 4L56A 1WDPA 3QFEA 1B3ZA 1A0EA 4ZO6A 4PMQA 4XSLA 2UWFA 4HU8A 2XWDA 1JYNA 4PULA 2D2OA 3MT1A 1KFWA 4J3VA 5CZJA 1R87A 4XIAA 1CGXA 5I7GA 3BAIA 4CVUA 3N17A 3SUWA 3LI0A 2FMNA 3LM7A 1YMYA 3KDOA 5FEWA 3NR0A 3TQVA 1KWKA 3AHYA 2OSXA 1GOXA 4XUYA 1P0EA 4DBEA 1VFHA 5DMMA 1AH3A 4XO6A 3I4EA 4M82A 3N6QA 4B5SA 2J27A 4O1AA 1QDSA 4RR4A 3S6DA 3SUSA 1C93A 3ARRA 4K1WA 3K5XA 3WLHA 2FJKA 5AOUA 1YDVA 5LIWX 3L5LA 4QG9A 4QGCA 3RRAA 3WUGA 1KGUA 2CWNA 5RUBA 1Z32X 2V6AA 1POJA 4Q4OA 4X60A 3DC8A 2VFEA 2CU0A 3ZT6A 4QG8A 3N15A 1GVSA 1M5WA 2OWCA 1QW9A 4O17A 3UXLA 4H04A 1R7OA 2ZX5A 4FNRA 3BSHA 4AZ7A 3G24A 3HPAA 3GG0A 4Q8WA 4UQBA 2CITA 3G0XA 7REQB 1OGGA 2Z1VA 4MWAA 4HNNA 3H24A 2HEJA 4P2VA 2WV8A 3PZ9A 2Y8KA 1DQXA 1WNOA 2J79A 2F6KA 3QR0A 3NYZA 3KAOA 4NNAA 4AZIA 2WMIB 2QCEA 3S1WA 1R3YA 4UCGA 5EFFA 1A5UA 4JX5A 2VELA 3RCNA 1AZ1A 1TZZA 3R25A 3VKJA 1QXLA 1UOZA 4Z1AA 4E4UA 1VS1A 3QGKC 2CHRA 3KS6A 5EBUA 3VTRA 2C18A 3EEZA 2XN0A 2HZGA 1T0OA 2YDRA 4E3TA 3VMOA 4XBSA 3NM3A 4J2MA 2Z24A 1JI1A 1EJRC 2Z2BA 3VNMA 5CZKA 1PX4A 3NXFA 5LZLA 4REQB 3WNLA 1MNSA 1J96A 2ACQA 2PLJA 3BANA 3FGCA 5KZDA 3RMJA 4B9ZA 2J8TA 2Y85A 3FHAA 1H7XA 1XYFA 2DZXA 3GIYA 1B30A 2XIBA 2W92A 5KTLA 1ZP3A 1ISXA 3UR7A 2WO5A 4KWVA 5EB8A 2V63A 1JJKA 3G1DA 1FP8A 4C1LA 3TNBA 4PUNA 5XIAA 4M0XA 5CBJA 1UD3A 1TWSA 4N0RA 1EZ2A 5AHIA 4Z2JA 1W5QA 4O54A 4AIEA 3UG5A 4I5XA 4TU1A 3EWXA 2OYLA 4U3CA 5ENLA 1FDJA 4O52A 2X7WA 3WQ6A 3EOEA 1US2A 4GYPC 1RVGA 1GVOA 4DPQA 1OD8A 4B5VA 4IFKB 4JBRA 2C0HA 2G97A 2ISWA 4CCDA 2Y7EA 2RFGA 3CHDA 2ZUVA 4LUTA 4F48A 5BZAA 3V1HA 1BYAA 3DFTA 5KZ6A 1XLDA 3IJQA 4EX4A 3CTTA 4HCDA 5AYXA 3WQEA 4DWDA 4RZ6A 3AHZA 5L6UA 1CGTA 2WHLA 2WKLA 5C5YA 3HG5A 2C1HA 3LX9A 5G1TA 2O9PA 3NZGA 1VFLA 2PU0A 5A6LA 1HO1A 4FEZA 1X6UA 1T99A 1J0IA 4AEEA 5A6TC 2DFAA 4YVXA 1E4MM 3SFKA 5C7HA 4O53A 4LY8A 1X97A 4A35A 1IWAA 5D2TA 3W7CA 1NIUA 4UFMA 1FWHC 4HPGA 3EZ4A 1H2JA 1V6YA 3PPFA 5CBBA 3MWCA 4XAZA 2X1SA 5MF5A 1TPFA 2A3HA 4BQ5A 3PPHA 2J25A 1NELA 3V5FA 4IH3A 4GX9A 4XZBA 1ICPA 5IDZA 4DHGA 4UTJA 4PUKA 4DWSA 4PMYA 2A2IA 4RNJA 4DY1A 4NP7A 2BXZA 1R30A 5D9OA 4ECLA 2WSYA 3VIFA 3CZKA 4F8XA 2RUSA 4L64A 3Q94A 5FESA 2IXUA 1C8YA 3EMZA 1CLVA 2E7FA 2DIJA 1OFRA 3BCJA 3TFXA 4GCXA 2RHGA 4QS5A 2ZWYA 5DXYA 4UNIA 1QMLA 3B03A 3WMBA 1AD1A 2GJNA 1NP2A 4YVPA 1JCNA 1OK4A 3TSDA 1SW0A 2BZNA 1V02E 1J18A 1XIEA 4HZMA 5A6AA 3KLKA 1X1ZA 1XC6A 2RGMA 1BTCA 1I0BA 2QJJA 2VZTA 4ACZB 1UUOA 2J8GA 3HV8A 4RLIA 2PSNA 4DBUA 1XDJA 2XGZA 3OO2A 4W88A 1E4IA 1T8QA 5BOOA 1ZP4A 3TVAA 2GJRA 4QNEA 5C8BB 2QHAA 3QR1A 4QM1A 4LCRA 4Q8PA 2VO5A 3CAKA 3P8IA 3PBMA 1UWIA 3FVDA 2J78A 4UB9A 5K2ZA 3AAMA 1JI2A 2CWXA 4GUIA 4C6JA 4GQQA 2ZC1A 1W9DM 4V15A 5ABEA 4C6OA 3O0KA 1W1ZA 2CLIA 2XH7A 1Q2SA 4U3AA 4HPNA 1TMLA 1QO5A 2E8YA 4PUWA 3TYUA 3LERA 1AFSA 4LS1A 4GABA 4IGHA 4LY4A 1F4HA 1XCFA 3W7QA 2ZOXA 1J6OA 3THUA 4JFTA 3EWYA 1NF7A 2A3AA 4ZENA 4Z2HA 3URBA 4C7GA 3WLKX 4XISA 2TAAA 2PLKA 3WNOA 1JPDX 3TE9A 3UQNA 3FXGA 4IFRA 3QTPA 5HNRA 3GVWA 4FS9A 6PTDA 4DXXA 4O1BA 1U1HA 3KXQA 4MG4A 4QX4A 6CGTA 2HBVA 1E73M 2FDMA 4MAVA 3B8SA 3VNLA 3N9KA 1UZ4A 1WE5A 3EX2A 4DLFA 2XFRA 2QCLA 1KFBA 1JDCA 2IUZA 3VIOA 3SY8A 1H62A 1QNVA 1VCFA 1M41A 4W7WA 4JHOA 1UA3A 4NJHA 1E5NA 1KGWA 3WEOA 2VGGA 3AUJA 2AMXA 4S3DA 3EYPA 4DF0A 4KMQA 2PRMA 1XIHA 2DV0A 3ZR6A 3R12A 3VKBA 1MXDA 2VQTA 3MHFA 1CLKA 1RQEA 2X09A 3WUBA 2ACRA 1XM3A 5F4SA 1W2PA 2J88A 1U1JA 1QNPA 2GQ8A 1TPH1 3VNZA 1DWIM 1H63A 3NVTA 6REQA 2WLZA 3NFUA 2B7NA 4YTUA 4LUSB 3RX3A 3NQMA 2VHLA 2Y8VA 2WK2A 3G3MA 3BZGA 2IMRA 1HGWA 3GIQA 5AHMA 3TEVA 2QT3A 2P5NA 4K2SA 5DBUA 5KSWA 4M7SA 4NSBA 3VNYA 3T05A 2L5HA 3PZNA 1QOXA 4EXQA 4J3WA 4AG0A 2OCZA 2BX7A 4JYFA 1XF0A 3T6CA 4GWEA 4C6FA 2Y0FA 4O0KA 4PUJA 1BYDA 5AC6A 3PK7A 1UOKA 1HL9A 5CGMA 3WJSA 3SGGA 1E1CB 6TIMA 1PZ2A 2JF6A 5FD0A 1J2WA 2UBPC 3A4JA 4HSHA 2VFHA 2I9UA 4FMVA 9XIAA 1J2BA 1RAKA 1SZFA 3N12A 3PBVA 1XP3A 4BQ3A 5CBIA 1TV3A 3IUIA 5DX7A 4O57A 1E6RA 1W1PA 2OODA 3OBAA 3IANA 4G9PA 3W2JA 2F6XA 4WR3A 3SI9A 1ZJHA 2PCQA 3H23A 2R94A 3M07A 1UH3A 1GVRA 3S5YA 4W7UA 3E49A 3QQWA 4GGHA 1EUNA 3KL3A 2J7FA 2DSWA 5A8QA 3P5YA 1TVPA 4FX6M 2V82A 4FP1A 3MO7A 4GNJA 1EWEA 4OWGA 1TELA 2BS9A 3WH6A 4I3GA 3KL0A 2OQYA 3ZIZA 2WZEA 2G3NA 1NOFA 1FWIC 2XVPA 1HP4A 3LTPA 3V18A 3LSBA 1XUZA 1GG0A 1V51A 2O0TA 4HJFA 4E2OA 2FZ9A 3B0YA 1H1NA 1FKXA 1O95A 1XDMA 4DJED 1PL9A 1G01A 3W1LA 4YL2A 2NLYA 5E9XA 4JTGA 2ZA2A 4F0LA 5JBEA 3PUDA 4WGXA 4NYYA 3L66A 3JZUA 2BGSA 4QSHA 1J01A 3N2MA 4QJ4B 1E6NA 4NI3A 3ZLHA 3BLFA 3MS8A 4WDWA 3WDQA 5D8ZA 3QLLA 5CPSA 3H2AA 1YBQA 1RA5A 1O1ZA 5LXEA 2VEKA 4GOAA 2QEZA 4LV4A 4AD2A 5LSMA 1EP1A 4NX0A 2BWGA 3CXOA 3I7SA 2ODOA 1HKIA 3CUHA 4QLKA 3WL1A 2QNEA 2RKXA 4XAPA 2ZXAA 1KFEA 2AAAA 1XRTA 2EPOA 3B9DA 4BKNA 5A8PA 1XYLA 2PDJA 4GD0A 1OY0A 3N6HA 2TSYA 4UUIA 5BRQA 1WXZA 1IT8A 4K7YA 3JW7A 2F2KA 1N55A 7TAAA 4AD4A 2VGBA 5GJMA 2QUNA 1TA3B 1JZ7A 5IM51 1IV8A 4R34A 3O63A 5FJOA 4C6PA 1UR1A 5AZ0A 3SRDA 2GUYA 4ENLA 3TYEA 3IUHA 4BI6A 2GWNA 1N8WA 3H55A 4JQ1A 4KWSA 4EP8C 4RXFA 3PTMA 3PAOA 1GWJA 2CC0A 3S5OA 3WBAA 1UIOA 1RCQA 3BAKA 5M17A 1PE1A 3F4WA 2WKGA 5C9XA 1SPQA 3TSBA 4IM4A 5K3VA 9RUBA 4CNSA 2V81A 3UXKA 4WUIA 2PWGA 4JOMA 4HBKA 3A4WA 2VX4A 3MI6A 2H9AB 4EACA 4GH3A 4DVOA 1XIMA 2E6DA 4HPJA 3W29A 4GNVA 3M5YA 3KL5A 3VKDA 3CV7A 2JFEX 1BVWA 2Y2WA 4C1NA 1XKJA 2O7SA 1Q6GA 3ZJ6A 4I8YA 3A6OA 2PDKA 2GL5A 3F5KA 2ZZ3A 1Y65A 3CHEA 2WAGA 3GE7A 1AMKA 2GGEA 4IIBA 4P7QA 3CO4A 4HA4A 3WMSA 3DZ1A 1KM5A 3VC6A 4ZOEA 5CZTA 3S4TA 4CQDA 1VHNA 3S2MA 1UWQA 3JR2A 3WNPA 4UFIA 3W23A 2D20A 1C7TA 3VNJA 5D9PA 1QPKA 1KTCA 3SN1A 5E93A 3M6YA 4GYFA 2V5BA 4B4FA 2DUZA 4DO6A 1TTIA 2A1YA 2PDUA 4UMCA 1FH7A 1TPEA 3VM7A 5E0FA 1VQTA 1Q66A 5GNZA 2Y63A 5BXTA 3OIHA 3E1F1 1KD0A 3HJZA 2AMGA 3WF3A 4ZSUA 2C3ZA 3M41A 3N9SA 1QBAA 2VTFA 4KPLA 4ZOBA 2WSPA 4C5ZA 5E6YA 3ZWTA 1NDWA 1MW1A 3P7YA 4ATWA 4HPHA 3B8DA 4PMXA 3L4ZA 3DOPA 4Y2WA 2EBNA 3T4WA 3TXVA 1CGWA 3DG3A 4H83A 4C6KA 2HXUA 4GI4A 2J75A 3P3BA 3I10A 1D7KA 1EJTC 1WKDA 1S39A 3W7LA 4AAJA 1V5XA 4NKCA 4P8VA 2OEJA 3STFA 2Z1XA 4XUGA 1F3TA 4LQ1A 4Q7BA 3AQUA 1E4NA 1FX6A 1G4TA 3DH7A 3H70A 2V2DA 3W1RA 2YL9A 3OGRA 4C60A 4PFMA 5GVJA 4AW7A 3C5QA 2BXVA 3OZOA 3GG8A 4AD0A 4WSHA 3QV7A 3NPWA 1KFCA 4AY1A 1DE5A 4W85A 4MUPA 3VX0A 2H8XA 5GQBA 4BK9A 2ZXDA 1T41A 4HMNA 4DBDA 3BV7A 3DKJA 4M6PA 1NFPA 3PTDA 3QV9A 4FOUA 3GDMA 4X2PA 3WCZA 1ZUAX 4FXJA 1KM2A 4MJ4A 2A6NA 4L1GA 4UMBA 2DH2A 1OYAA 1ZLPA 5A5WA 2P50A 4HOZA 4AWEA 3FAXA 1K8CA 1FP9A 1XSKA 3T0BA 3ENLA 4ZOAA 1X96A 4RV3A 1VCGA 5CC6A 2F6UA 4O18A 4QLJA 1DHKA 3KOFA 5ECUA 4H9ZA 2ICSA 3G2GA 4KRUA 3N73A 4J9JA 4O0QA 4RPPA 2GJXA 3OLGA 2FDSA 2E0PA 1K7EA 1DOSA 1T40A 2DJLA 1LZOA 1HL2A 1IE7C 3HGJA 3SW6A 3W73A 1W1B1 1H50A 1CGUA 5I3KA 1VKFA 3N2CA 3RITA 2IKGA 3G1RA 1ZFJA 2WQDA 4YCOA 1B3VA 1ZJBA 1RCXB 1K1DA 5BMWA 3BQ6A 3GU2A 3S42A 3C3NA 4JX6A 3KOWA 3N34A 5C71A 4JYEA 3AWNA 1OFAA 3S2NA 3TK7A 2FZDA 3VKAA 2NW0A 2JQXA 2NSXA 2D0HA 4W84A 3B8VA 3MV11 3NZQA 1PZ1A 3A3WA 1AUSL 3ZVHA 5A69A 1VD6A 2V67A 1GW9A 2W62A 1X6NA 1BKHA 1X6LA 2VC9A 3ARWA 3N2BA 1LQAA 3QKEA 2GQ9A 4H6RA 1OFOA 2FGZA 1EDTA 2QVHA 4B90A 1AW5A 3OPSA 4ICCX 1V7AA 1Q5MA 1X7FA 4NRSA 1XHGA 1NWSA 4GZJA 2G3IA 1W5MA 5AHEA 5M1TA 1XICA 2FB3A 3V75A 2B7OA 2O9TA 2WCGA 3CUFA 4IICA 1HN1A 3C0LA 4B5XA 1KC7A 4QBXA 2ISSA 3MJMA 2VWTA 1FA2A 4CCEA 3HGRA 1GPFA 1H51A 7ODCA 1EQCA 3ZM8A 4KFPA 5D05A 1ICSA 2X1UA 1BGGA 2VVNA 4IPNB 1FTXA 4X22A 6ALDA 5BYWA 3FA5A 1A5CA 1TPUA 4G56A 1T8XA 4ZE5A 1F3WA 2W27A 2PDMA 4GBUA 3WEMA 1FHVA 4BWLA 3IJDA 3WQPA 3TC6A 1PV8A 4AD3A 5I77A 4HA3A 3C3UA 4IPPA 1LQ2A 4JQ3A 5D2VA 5EPDA 2D22A 2X42A 4ERGA 3CPRA 4MB3A 1BLIA 2Z6IA 5CSUA 5M2FX 4A05A 1XKYA 3S3GA 4ZEPA 4NL1A 2ZRWA 3AIQA 1JEZA 3E38A 3VIMA 4GY7A 4K38A 2OU4A 3OZYA 1Z42A 4JHZA 3CEPA 2AKMA 4PC8A 1T5AA 3M0JA 5HNUA 1LBMA 4EF9A 4UWMA 4XAGA 1RR2A 3M43A 3TDFA 2D3NA 1GYLA 3RU6A 1A5OC 1AQHA 3G8EA 4HZ7A 3A3XA 3BOLA 1MNZA 1O60A 1PZ3A 1MRQA 1XINA 2XJ7A 1VEOA 4O4WA 1Q8JA 1XD0A 3PZVA 2DSKA 3QOKA 4UFJA 3C61A 1H7WA 3SQMA 2FIQA 4NZ3A 1I45A 2HPMA 3WQCA 2HK0A 4E2DA 5DCBA 1CIUA 1VENA 4MWAC 1REQA 4HIBA 4IP5A 1UUMA 2YJQA 3LXAA 4Q8TA 1BPLB 3GTFA 5CLTA 1KO0A 1KRCC 1IR1A 3F4NA 5KETA 3JS3A 2I5QA 4N2YA 4FNSA 1R3WA 2IPJA 1NM9A 4ZQPA 5A2AA 2Q01A 3QR3A 1TYGA 1WKYA 3AXXA 3KCLA 1CXKA 1QPOA 3UFYA 1VF8A 3CMJA 3SQSA 2GLKA 3IRDA 3O6DA 1I2RA 3E0VA 1ITXA 2YCEA 3QEZA 3UR8A 3WSUA 3JUGA 2FKPA 3WF2A 4H6EA 3G6MA 2EJAA 2PDYA 3VK5A 1VEMA 2POZA 4DF2A 4UZSA 1CXIA 2YDAA 2C1IA 4NZ4A 1SZEA 3B0VC 4FLRA 3W88A 2YCIX 1RJPA 1R9ZA 4XAYA 5D03A 2EJ1A 1QT1A 1EHAA 3B40A 3AIBA 4F0HA 4R7WA 3L0GA 4V33A 4WQ6A 3TYCA 1NP0A 1U5JA 3WH5A 3PHAA 3W7KA 2BMBA 1EZWA 2EPHA 2WM1A 4CU7A 1M04A 3RO8A 3GKAA 1UKPA 1EYWA 5D33A 4LXFA 3CIVA 3CQIA 1OX4B 3AXMA 1TTJA 2VR4A 5I00A 1H49A 4CQBA 1RPXA 1YYAA 2OGYA 3LSCA 2DZAA 2Y88A 2NZLA 3ABZA 1EJUC 4R7OA 1DTNA 1UKTA 1K4GA 2VKZG 2QUUA 4HJWA 1OFDA 1XRSA 2ZDSA 1JNEA 3KP1A 3TN3A 3Q2DA 3FYOA 3IV3A 1SR9A 3CMGA 1AJ0A 2J7GA 2E25A 1HW6A 3R5EA 3AIWA 3Q58A 4CVWA 2PF0A 1QASA 2J9XA 2QULA 4UQEA 3TJ4A 4D6GA 4UTWA 5D2YA 1H3GA 1SZGA 2P3EA 3B8IA 4F0SA 3EOUA 3TA6A 3MDUA 2LLEA 3QFWA 4MLRA 2F7FA 3MSRA 4AZBA 4D8ZA 3VDHA 1V77A 4AHPA 1UC4A 3ORWA 1W3LA 5T91A 3ISIX 1NARA 1XBXA 4CCCA 1MSSA 2QS8A 1W32A 4JTEA 1KTBA 4UTIA 1LG2A 5T9BG 1MDRA 5BWFA 1SSGA 2Y70A 3H2OA 5FJTA 3PP7A 4IP7A 1TRIA 3BE7A 3REQB 2IQDA 3VMNA 4XD3A 1MRAA 1K9FA 1KB3A 4J27A 4DZIA 4BEUA 2X16A 1E6PA 1DJZA 4GHRA 4F0KA 1DORA 3ITCA 5GNYA 3I7RA 2WZTA 1XIGA 3EDKA 1FQ0A 4IIHA 2Z1WA 8CGTA 1IT7A 2CBVA 4M6VA 2IKIA 5EA9A 3ARZA 3I3EA 1L2QA 2JEPA 3NO5A 3L0NA 4DWSC 1XBZA 2R24A 1B4EA 3FKKA 4AZGA 3BV4A 3OEXA 4TVDA 3P6LA 2G50A 4DM2A 5C70A 4UFHA 4WCJA 1RPKA 1A5SA 3W0KA 4D71A 4IPJA 4IQDA 2XIJA 5AC4A 5HUOA 2GVGA 1YLVA 4ERIA 5A8GA 1EJVC 4HYRA 1TCMA 5JMUA 4S3CA 4V1XA 4KWUA 2YCLB 5G2HA 2DT0A 3TTSA 4PUDA 1W17A 3V0TA 2G4FA 1HJVA 1XJBA 2A3LA 4JTHA 3AWOA 5A6BD 4BF5A 5HBFA 4E38A 2W4XA 3EB2A 5FJUA 5FSEC 3TKFA 3VIHA 2V5KA 4HK5A 4AZHA 3A9BA 3HV9A 2ZX8A 4RNFA 3IUDA 5A8OA 2YBUA 2C79A 5DEZA 2O4MA 3SCPA 3RUBL 2Z7KA 1OG0A 5C7VA 1RP9A 2PDHA 1UBPC 2FVLA 4OOZA 5EKYA 3L4YA 4W7VA 4PB5A 5T26A 3VO0A 3OA5A 4Y90A 3HPZA 4UTLA 4QE5A 5B80A 1I6NA 3SCTA 1WDWA 5CG7A 5DFAA 3K8KA 3RHGA 4KETA 4CD5A 3PZTA 4H9TA 4PCPA 4XTIA 1TIWA 3RMEA 1FWAC 3WEZA 3ARUA 4X9YA 2IPGA 2G3MA 2I5IA 3SO7A 2UY4A 3GNDA 2GSEA 4JTCA 3GDLA 3FV9A 1W1A1 5BMXA 3RN6A 5HJYA 1DBTA 4Q6JA 3AXHA 2P76A 1IEQA 5I3GA 4MWAB 1CW2A 2JKAA 3NEVA 3PB0A 2VC7A 3FSTA 2PA6A 4KEVA 1J10A 5B7YA 4JFUA 2GOKA 4JXCA 2YLAA 4JY9A 2V3GA 5CG0A 4DRSA 1FUYA 5HNNA 4QIUA 2CXGA 1IXOA 1K03A 3ZFHA 3PJXA 1WAWA 3MBFA 1L6YA 4HQVA 3W7NA 3AO0A 3QZ6A 5A2BA 1EIBA 4XBKA 3S8HA 2ZRVA 4WDUA 1EXBA 3F5LA 3E02A 5LA2A 3VNIA 4URIA 3FNDA 4UC5A 1FKWA 4H7VA 4JD4A 3T1GA 2WB5A 3FGCB 4H7ZA 4W87A 4OFCA 3N04A 4JTLA 3GTIA 3FSUA 4Z17A 3WYZA 1PXGA 1V0LA 2ISFA 5FI8A 3ZSSA 1G7UA 4C6BA 3BURA 3CZJA 2FTYA 1R2SA 3KOZA 2A6LA 4MNMA 2QCHA 1K8XA 2WNZA 3Q67A 3HM7A 3PZGA 3QXBA 4RW5A 1MUMA 3TC7A 3VDAA 2PURA 3Q45A 4GX8A 4JQAA 3CT2A 4MY9A 1XV8A 1VFSA 3FA3A 3NOEA 3F1QA 2WCSA 1YTEA 3L12A 4J4KA 1V6WA 2WM0A 4ZB0A 4JAWA 2I9EA 2E5CA 2BY2A 4NAEA 5CLWA 2VFGA 2PODA 2CHNA 4H8UA 1H5VA 2QDEA 4LB3A 3UY7A 4LUTB 1TVNA 4CLMA 1Q6CA 3IAPA 2VX6A 3A5VA 5C2CA 4QJ5B 5D2XA 4ES4A 2J7EA 3TTYA 2ZE3A 1OJXA 1P0DA 3DERA 1J5TA 3U4AA 4KBXA 3PUEA 3SCUA 3TMQA 3T40A 2P1FA 1CECA 3VABA 3SECA 3H2FA 5CPQA 3HPSA 3DENA 4ZODA 3KEHA 1WDQA 3V1PA 2XDFA 3B05A 4PMJA 5U4NA 3PPCA 2JKEA 4WZHA 1EOKA 4PCFA 1VJZA 2OKTA 1MMFA 2WJZA 1UD4A 2PZNA 1LCOA 1W1YA 4YTQA 1E70M 2XFWA 2VDIA 4GYPA 4NAFA 4IQLA 1R38A 4FPSA 4JN6A 3R13A 1ISVA 4GVFA 1BVNP 4WKFA 1ZAIA 4GQBA 4XZIA 1TJPA 3BZJA 3QTGA 3PF3A 3ARPA 3WN6A 1K02A 4CCZA 4O1CA 4DWSB 3A24A 3G0SA 1W3KA 4MAZA 3DESA 1X38A 3BSGA 1E1CA 2EEXA 4A8NA 2ZZ7A 4ZBCA 1RUSA 2YW4A 3VOHA 4W89A 3GH4A 1HIZA 1A4LA 1JPKA 2P10A 3IRSA 3G1YA 2P8BA 3ECQA 1I8JA 4H6QA 2NVDA 4R27A 3WQGA 3CUIA 1DIKA 2X40A 1FBAA 4H00A 2TMDA 4NNBA 1JF5A 1JDEA 4KRZA 3VD7A 4LNCA 2YBTA 2GVEA 4V1YA 3WQOA 4ADTA 3QY6A 4PUMA 3W7EA 1DIOA 1WOAA 4X3ZA 3EBVA 3BARA 1R3SA 4C1KA 1Z69A 4FI4A 4E3VA 1ISWA 4HU4A 2FPTA 4AZCA 1P6BA 5MHBA 4O15A 2J8FA 4TIMA 4JPGA 3OBEA 4MZ8A 4ONVA 2WBKA 2Z1KA 1A3HA 3PBWA 4AIUA 1Q7ZA 3NJ3A 2X0HA 3GX9A 4Y9PA 2QPUA 3GG7A 1PTAA 2PTXA 3C86A 1QNRA 3V5OA 5HQMA 3QJAA 1D9EA 3UU0A 1XYAA 1UKOA 1QTWA 3JVAA 1C9WA 1GYNA 4GE8A 4O19A 1OCJA 1IZKA 3KRZA 4WDXA 3W85A 1IF2A 5E70A 4N4QA 3BMXA 1V02A 3P84A 4F2BA 2J7DA 1KRMA 3KBNA 1WZLA 1TE1A 1EGZA 4X2RA 5LNWA 5IDIA 1CTNA 2GDUA 4QRNA 1IWBA 3WUFA 3U48A 3NOYA 3PC0A 2ZKMX 4MB4A 2IKHA 1QNOA 1TV8A 3WJYA 1HZYA 2ASHA 3W7MA 5KEZA 1ODZA 1ME9A 3P5ZA 2VRJA 4NXSA 3ONCA 2VZVA 2AL2A 3RPDA 5LHFA 1F07A 2CNCA 4JTDA 3LU2A 5A6MA 4YS1A 3BLKA 2HTMA 2YYUA 1VP5A 4I9TA 1O5KA 2G8ZA 3M0ZA 2F84A 2TRSA 1Q6LA 3GVGA 3LPGA 4S3AA 1HVQA 4BI7A 3LY0A 4R9XA 1XLBA 3UZJA 4MKNA 3V35A 2WHKA 2PDWA 1XYCA 3UZYA 1FWWA 4GVHA 2XN2A 4ZFCA 3TSMA 3VGGA 1VYRA 1ONEA 1NJJA 2VOTA 4H6KA 3BDKA 4FX8A 4IHCA 2IW0A 1R2TA 1QPRA 1YKWA 1CXHA 1ENUA 3B4UA 3ZT7A 3UPMA 3IARA 1LDCA 1XIFA 1HKMA 4PB3A 3CZ8A 4KQNA 1TVLA 2E68A 2AQOA 3OJGA 3E2QA 2J47A 3CNYA 3ITLA 3WF4A 4PGLA 2X05A 3B0PA 5LGXA 1YIXA 4DUWA 4XQ6A 2OPJA 3UD6A 4D6FA 3KTSA 1QJWA 4AIOA 1F3XA 3AYSA 5J04A 3TC3A 1TJ1A 4CD6A 4K8GA 1TV4A 3H7RA 2E1DA 1GT8A 2NQLA 3N3TA 6REQB 5A6BA 3OVPA 4IL0A 4PMRA 2JE8A 2NX1A 2R1KA 3P14A 3F2CA 1SR0A 4KFOA 1CCWB 1QI3A 2AQWA 1NDZA 1PTGA 5I2UA 1JD7A 3TOYA 3V4BA 4LC6A 2E1WA 4PTDA 1K7XA 7A3HA 3QMTA 3CU2A 1JIBA 4QTGA 1NVMA 4O1EA 1B90A 1B57A 1EF3A 2WPBA 4S2CA 1HFBA 1UWSA 3L2LA 4DYJA 1M65A 1QVBA 4Y7EA 3LZ5A 3O6AA 3ZR5A 3KVKA 3TTEA 4J3TA 4Y6GA 3FY1A 1JRBA 1GJWA 1DIDA 1S3HA 4D1JA 4RE0A 4FIQA 1UWUA 2BOGX 2J77A 3UGRA 1ONRA 1CLXA 1LROA 1CXFA 1Q7QA 3QW3A 3LCHA 3R8HA 3VX1A 2PWVA 1V08A 2YXGA 3LBOA 2NSOA 2VENA 3W3OA 1LRQA 2AOSA 2BHYA 1F4AA 1M01A 4OUEA 1YE6A 3U8GA 3LNMA 4MY1A 1NQ6A 3WQWA 1Z48A 2OEKA 2PDFA 2V0TA 4Z42C 3TV8A 2A21A 1YRRA 2OG9A 3RLVA 5C9ZA 1XCXA 3O05A 1KKRA 4YTRA 1O5XA 1TUFA 5C54A 3UP8A 1EYEA 1UH4A 2V5DA 3I65A 2VI0A 3I3DA 1TFVA 4C6EA 3CQHA 3T42A 1XSIA 3AZRA 3ZT5A 1L6SA 2PWUA 2DVUA 2V5JA 3WFLA 1YNYA 2ZVRA 3NL5A 4I90A 2XIQA 1KCXA 4QE1A 1EPVA 3PB2A 4UFLA 1V7YA 4IMDA 3W00A 3W1MA 3WZ0E 4IMFA 4Q4RA 2E5BA 3UVIA 4MTVA 1F6KA 2I1OA 4KERA 1JZ3A 1CDGA 1PHQA 2Y5EA 4F2UA 2Y89A 3ZJ8A 1W3NA 2FZMA 1O5RA 1TREA 4EPKA 4S23A 4YWSA 2BVTA 3IVTA 2BG5A 2FLIA 3EDEA 3QQ0A 1K4HA 2VR5A 5DMLA 4TVUA 2Q3OA 1MQQA 4PTVA 1YBQB 4D6CA 3M7SA 5BXSA 2FFCA 5HMEA 5IXEA 5J5DA 1ZALA 5CGTA 4I8DA 4QNWA 6XIMA 4CQAA 5C55A 1HTIA 1A49A 1GOMA 4AYSA 1DJXA 6TAAA 3LUTA 3URNA 2Q3RA 3WBXA 5FEXA 2INEA 1NOUA 1W5OA 1EP3A 3BCFA 2R6OA 5D9MA 2Z2UA 3DI0A 4AYGA 4J3XA 2DZTA 3RK8A 1P6CA 2ZA3A 3OVGA 4P5UA 2V5CA 1P48A 1H61A 4MOZA 4JFWA 3WLTA 3MY9A 1UD8A 3ABRA 3NGFA 3P61A 1TMHA 5TF0A 1QRQA 3QVQA 3B97A 1DTUA 3LCXA 1WBJA 4DJDD 3MA8A 3SJNA 5HPOA 2WBGA 4PCTA 1KLZA 3E6EA 3UXDA 3TTOA 1OEPA 4DELA 4P7RA 3S46A 3BLLA 4Y8FA 5BCAA 1HVXA 4TX8A 1KM4A 3FKRA 2F2HA 3DEQA 3THQA 4H9MA 2Z29A 1PSCA 4I7VA 4KIRA 4EOUA 3AJXA 1XFBA 3NSXA 4DZAA 2QR6A 2I56A 4FO4A 5B7ZA 2E6FA 1VPYA 1UPPA 1C9DA 3YPIA 5A8NA 3VKKA 4HPXA 3ZSTA 4Q8NA 2QDHA 1LLOA 1XDLA 3KVJA 4OBTA 2HMCA 3SRKA 4YTSA 1JDAA 3BGAA 4H9UA 4C1NB 1JAEA 4DAFA 4EAMA 2X2GA 1H7RA 1V6VA 3TZNA 4BR1A 2OX1A 4U5KA 4DUVA 3N9RA 1FRBA 4TOQA 5EMLA 1CBGA 2PPGA 2WNQA 1CGVA 1W9BM 3AFBA 3MUXA 5H1WA 1V6UA 3NSNA 4UTFA 3GFZA 2EPKX 3GZAA 3WJXA 4LUIA 4DJEC 1FWCC 3CJPA 3CWOX 1EJXC 1P0KA 3POHA 2YR1A 4A3HA 1J0YA 2CLHA 1S1PA 3P2VA 1M7JA 3N25A 3BLDA 5IRPA 4RK8A 4LYPA 1J93A 1CB7B 4KWWA 4IGMA 1OIMA 4WX2A 2VFFA 3DFPA 4Q7IA 3T0AA 3W1PA 2XPKA 2BY3A 4HCLA 5EYWA 4YHGA 4PBEA 2HS8A 3EAUA 1M7OA 3ITTA 3FS2A 6ENLA 4DUOA 1Q6RA 1BQGA 2NLIA 3AXKA 2HWGA 3XISA 3CB3A 3MDWA 5D02A 1GVYA 3WQFA 3O9NA 4GZIA 4MLJA 1MW0A 4U10A 4AC1X 2RGLA 3OHMB 2OEMA 3BAYA 3RM9A 4HHHA 3WNNA 4KCVA 3WLPA 1VPXA 2ONEA 3MP4A 4HK6A 3KBMA 1LBFA 2DZVA 2OWXA 3GH7A 2B31A 1O7AA 4FLQA 1R86A 4K8EA 2P0IA 1B3XA 3T0DA 5C9UA 4RDWA 2OGJA 1EBGA 5FJRA 3ABXA 1YW1A 2HS6A 3UNTA 2Z1SA 4M1BA 5LKYA 1OVDA 4GA8A 1GORA 3LD5A 1Q13A 1KM0A 1AQMA 3K8MA 4ZO8A 4AZ5A 1TJ2A 2CHOA 5FIPA 4GACA 1L2UA 1BHGA 4A6GA 3H8AA 4LVDA 2PUZA 1OGBA 1LT8A 1SJCA 1YDOA 4JEQA 3G8RA 4HU0A 3A64A 3CZLA 3O0FA 2DGAA 1G9HA 1FOBA 3QGVA 4A29A 1N82A 2FH8A 2F9RA 2PCEA 2ATMA 3CAQA 1Q6EA 4FF7A 3URAA 1DWGM 3QRHA 3U7VA 4RDYA 5CC3A 2ACUA 3A21A 1EP2A 2PP0A 2ZFAA 1L6FA 1GCYA 3UWWA 3CYJA 1OX5A 1ZU8A 3WLJA 1IHIA 2FZ8A 4HNUA 4PR4A 4M24A 3CMFA 2OWWA 2Y4SA 4XZNX 2GJXB 1OB0A 2OZ3A 2PDIA 3BMVA 5KINA 4AWTA 3QSTA 1W0MA 2ZA1A 3WLIA 5BXPA 1RA0A 4PRRA 3VUPA 2BP1A 3TJIA 4XD5A 3OHIA 4J40A 1CT5A 1H7PA 3LK6A 4UTWC 3W2LA 5G4WA 3K4WA 1UROA 4ZTXA 1W8SA 3VC5A 1PKNA 3FJ6A 4XBJA 1XW8A 4QISA 4H7CA 5DANA 4IT1A 1Y8BA 3GW0A 4LGXA 1TPC1 1XL9A 3SUVA 4X61A 3C0QA 1HKVA 2YYTA 4GQGA 1ZY9A 2GFTA 3GHSA 4YU1A 3WY1A 3OB8A 2ZUMA 4DLMA 1LWHA 1NEYA 3LTYA 1FWDC 3MYPA 3W6LA 1ZQ5A 4R5EA 4MPQA 2KAUC 5JH1A 3ZWSA 5PTDA 1EB3A 2JF7A 5F4XA 2DSZA 3ZVHB 3MZNA 1ZGDA 1WZKA 4TMCA 1GKRA 2WXDM 2DH3A 2YZ5A 3VCRA 1O4UA 4GXMA 4N9EA 3GDRA 2B7PA 4DBWA 3GXPA 4GH1A 4ROQA 3CLMA 4JTJA 1MI3A 1VFMA 1K77A 3GXMA 1EQPA 3QMSA 4LAUA 3VOGA 3SBFA 3WK1A 3FYPA 3G1FA 2X41A 5A1AA 1QI0A 3LBMA 3VKCA 4J3ZA 2HE5A 3W7HA 4CEXC 1TTQA 3ATZA 3BK0A 3U9IA 3NO1A 5DT7A 4US5D 2ALDA 3RJYA 3QV6A 1F05A 5IBXC 3S5ZA 3D0CA 3LBCA 3N19B 1EUAA 1XI3A 1VBJA 4HNOA 1IGWA 2OTDA 4GO8A 2UY3A 2PDGA 1WPCA 3UJEA 1LJYA 1ZHAA 3R58A 1JUBA 3LN3A 3B0UX 4CU6A 3COTA 3BOXA 1IXNA 3SCQA 3G5EA 1ZBKA 2ESCA 3EDFA 1Z7AA 1O68A 3UF9A 1G1YA 1D3CA 3W1UA 1H11A 3VA8A 1Y7VA 3APGA 1MW2A 2G41A 4N4PA 3OW1A 5GPRA 2Y5SA 3EKLA 3SY1A 3TONA 2QCNA 3AS2A 4XV0A 3ID7A 2OT0A 4LVAA 2VC5A 1VLIA 1SJBA 1ZRQA 2YA2A 4B3KA 1X7IA 3G77A 1AVAA 4WY0F 3W75A 2CFFA 5CJMA 2E6YA 3L4WA 5DRIA 3CUGA 2QMKA 5HXMA 2BVYA 3R94A 5CAHA 2ZUSA 2RDWA 4NZCA 1E51A 1A5LC 4KT2A 5E0KA 3OVQA 4BI5A 1W37A 3BW2A 1UUQA 3QN3A 4YXGA 3ARYA 4CNTA 2VGIA 4H1ZA 1OABA 3T44A 3NQAA 1FXQA 4GO9A 3GLCA 1BWKA 3GFYA 4IZGA 1MUCA 3BL3A 3M6DA 5ABGA 3VFLA 3LV6A 4ZQCA 4B9YA 1TV2A 1REQB 3ARSA 4B91A 2J6XA 2JALA 1S5VA 4IIFA 2BHUA 4U4MA 2Z4GA 4GQ0A 3Q37A 4QLLA 3H4GA 1MWOA 3NL6A 3FN9A 3DFSA 1NDYA 3UG4A 3GWQA 2CLPA 4P7NA 3O6CA 3M1ZA 3WLMA 4DJDA 3VYLA 1OFBA 3K8LA 4FHAA 3W2NA 2FPVA 3ES7A 3NM1A 4GXPA 1RALA 2FTPA 2FYMA 3WO8A 3AYVA 2VOMA 3GY1A 4JIEA 1YADA 3GBEA 3M5VA 4LW7A 3DCPA 1GW1A 3WUEA 1ZS2A 1RJQA 3HFTA 2XUCA 4FNTA 4TTGA 4J3SA 1QW7A 3DHFA 1PTDA 1HJQA 4C6QA 1BWLA 1GQLA 2V68A 4H8NA 1OD0A 4HU3A 3GUWA 3NZ1A 1C7SA 3AMCA 3M5ZA 4QS6A 3UGVA 1KM1A 1UD2A 2OELA 3EX6A 1DQWA 4OBRA 4B3LA 5BRPA 1ISYA 2QJIA 3C8FA 4LEFA 3IACA 4CD7A 3WBEA 3MI3A 3LCGA 4ZA0A 1GOKA 1QCWA 4D6EA 1SJAA 3K4AA 1UR4A 3T7VA 3FEMA 1F8IA 1M7XA 4W8BA 3WDPP 1SO5A 1IEXA 2PWFA 2CYGA 1PX3A 3ZO9A 2QV5A 2BGQA 3CGTA 1G4PA 3E5BA 3N3MA 1S2WA 2QF7A 3ZQ9A 2YL5A 1G67A 1ME7A 2V2CA 4J2PA 2TYSA 4DBSA 3H2EA 2ACSA 4ZB2A 1YPFA 2GK1A 4LYKA 3E2RA 3DN5A 3HPFA 3N13A 2E8ZA 1J4EA 2OR2A 3UA4A 2YL8A 3NZRA 4UNLA 4YLWA 3SCSA 4M80A 1P43A 3CV1A 1PAMA 1J0HA 3HQPA 3C2EA 3M0IA 3S1GA 4BFAA 4EPDC 3MCNA 3SJ3A 2ADAA 3WMLA 4CUCA 1FWRA 4AVFA 2V3DA 3MUAA 3UT0A 2WWCA 3UZ5A 3ZOAA 1HKJA 1YDYA 2OYMA 5AZ1A 4MF4A 1B9BA 4YHEA 4UTKA 2CBJA 2PP1A 1BQCA 3C6CA 2PF8A 1BRLA 2XIOA 3F4DA 1TSIA 3E12A 4LX4A 1UZDA 4N02A 3OIXA 1ADSA 4OU1A 5G4EA 4PE8A 1XIJA 4E8GA 3C2VA 2AQVA 1DHPA 1DPMA 3PZQA 3AS3A 2VFIA 4Z0SA 1R3TA 1AL7A 2R1MA 5JH2A 1Q65A 1JXJA 3FCPA 4UBPC 5EBAA 4A22A 4H19A 3UA3A 1AQFA 5C6MA 3UR2A 1G94A 5D9NA 3AI0A 1K8YA 4EXBA 4DJFD 5E5CA 2F8QA 4JCLA 4QE4A 1FCBA 3SUTA 3WH8A 1Z89A 4HNTA 4Q33A 4V28A 2D24A 3T0TA 1KBLA 3BO9A 2PC4A 2PLMA 2YIHA 1VCVA 1OYCA 3QY8A 4NX5A 5LA1A 4AWSA 2G37A 2YW3A 4E8CA 4Z1CA 2NWRA 4FR6A 4XKMA 1PWMA 3EGJA 5EU9A 1C92A 2PS2A 3OZMA 4DAIA 1TWIA 4IX2A 2NT1A 2RDXA 3WFZA 3WH7A 3M0MA 5REQA 1E43A 3GHUA 1XLAA 3IIZA 3S0CA 3EOLA 3GH5A 3IIOA 3KVLA 1KKOA 3URQA 4KCTA 4UQ9A 1VYSX 5HR7A 1R0MA 2YB4A 2YL6A 1NFGA 4INFA 3ARQA 5LHEA 3ITYA 3TP4A 7TIMA 1R7AA 2OQLA 5AHLA 3SCVA 2DW7A 3QHNA 4XZ9A 1AW1A 5A6SA 2BBFA 1XPGA 5AYIA 3SZ8A 3F7JA 2WLYA 3VVGA 1YX1A 4FB7A 1ZSXA 1ITQA 1EC7A 3FYYA 3CS2A 3TJLA 3IGUA 4JZ5A 1V3MA 2PDCA 2CZFA 3QLDA 4NASA 4A4AA 1QUMA 3WQVA 2GQ3A 2OFJA 2EG6A 3VGEA 4JN8A 3ABOA 4GYJA 3KRUA 2B7QA 2NV2A 3W82A 1BXBA 2XN1A 4HZ8A 4W8AA 3GR8A 3DXIA 1FWSA 3MMDA 5LNSA 1QPNA 3W9ZA 3ATYA 3F4CA 3M16A 5DY2A 4NIRA 4F2TA 2PGWA 4ATDA 3AROA 4Y96A 5EL1A 4AHQA 1OWQA 3E9AA 1E6SM 1VPQA 4N6FA 2QGHA 2OO0A 3CH9A 3QC0A 2B4GA 2PD5A 3GDBA 2P3ZA 4QDPA 3EDJA 2EXOA 1OF6A 1PS9A 2Q8LA 1WKFA 5E0CA 1JCTA 4EVZA 4F66A 3Q65A 1YPXA 4JQ2A 3RM4A 3M9YA 2DQWA 5FSDC 2HNHA 3LPPA 3PS7A 3U4FA 2VJXA 1YXYA 5DMNA 4M7TA 3DFYA 1SO3A 3V3WA 2BNJA 5FF7A 1KXQA 4MSSA 2QYGA 4US5A 4HGXA 2WVSA 3EMQA 1WBHA 4S3JA 3LHTA 3IVSA 1FWJC 2C1GA 4M8UA 2ZWZA 3GSMA 3TYBA 4ASTA 1KQYA 4BA0A 1C8XA 3UPBA 3C2OA 1UP3A 2H3DA 3M0LA 4XSMA 1UJQA 4GIYA 4I9MA 1DXFA 1MYRA 4IF2A 3LGEA 1OBAA 2A0NA 1QW8A 2REQA 3M46A 3XIMA 4OVXA 4MZYA 3UJFA 4ZXOA 4GBDA 2DZUA 2VCBA 1BTMA 3H6OA 3WFAA 4NZ1A 2WJDA 3IVUA 2DW6A 1Z44A 1W6TA 2G0WA 2DVXA 1Q6OA 1P7TA 3RU8X 3GW3A 4R9OA 1FWFC 1RD5A 2EO7A 3ZJ7A 3VINA 2GGJA 1JPMA 4NAEB 3U57A 4FOKA 1KXVA 4EKJA 1B0IA 2IXVA 2E09A 4PTWA 4HB7A 1GZJA 4DI8A 1T6MA 4YNGA 2MUCA 3W53A 4P8UA 3PJTA 2C13A 5EMKA 2GSJA 2YCKX 4R53A 3DFNA 1G5AA 1VB9A 1LLZA 3PY2A 4UR9A 4YMZA 2C15A 2BTMA 1BSLA 4W4QA 5BU9A 5EY5A 4CEUC 1H7NA 1PDZA 1TZ7A 4C6IA 3P80A 3M4HA 4TUFA 2V8ZA 3W87A 4JHMA 5H8MA 2FMOA 3DIPA 4DZHA 1RJRA 3RLGA 4KH2A 3UCQA 7XIMA 4GINA 1DWFM 1MZHA 4LS2A 4O50A 5KZEA 3TQKA 2ON3A 1YNQA 3V36A 2VGFA 3ICJA 3H7UA 4Z1YA 3M47A 8RUCA 4F3HA 1G4SA 4NAFB 3PR2A 3S2LA 2VFDA 1YTKA 3WF1A 2J7HA 4MNLA 3USZA 3W7GA 1TPDA 1VC4A 4D2JA 5CC7A 4GC3A 3P93A 1L0PA 2OKOA 3HQ1A 4F0RA 2OO6A 3T2QA 2QVNA 3BG5A 2CZEA 2QAPA 4D8AA 1XRVA 1C3FA 5JBDA 3TN4A 3CWNA 5AY7A 4KF1A 1Z8AA 4C5YA 3FIGA 3PVFA 4O11A 5HUPA 2DQXA 3VE7A 1M68A 3D6NA 1TKKA 1JCXA 2ZE0A 8A3HA 3U3HA 1SW7A 3GQYA 4GUHA 1A47A 3BWWA 3D3FA 3DI1A 1VBRA 1HKWA 1S1RA 3WX7A 4PMUA 5TBOA 1J0JA 1IZCA 3N11A 1QBBA 2JGQA 4N9DA 2G95A 3LLDA 2C91A 4TMBA 3GR4A 1ADDA 3W27A 2ZYFA 3EXRA 3S47A 2VD8A 1X98A 2CKSA 5SWUA 1I2PA 1TG7A 2BFGA 2X8RA 2YBVA 4FK9A 3W2UA 4IMCA 1WUFA 1UR8A 3CAVA 3GDKA 4AZCB 3G18A 4JNMA 3BSMA 4LB4A 3VDGA 4R88A 2MANA 4XZMX 4MZ1A 3DBNA 2OZ0A 3TOPA 2XISA 2E4TA 4FSAA 4IG2A 4W93A 3GNPA 5I0DA 2ZRYA 2VURA 2WMKA 3MKKA 4PH6A 4IXHA 1EFZA 2VUNA 1XGZA 3JRKA 1PVNA 1L9WA 3EWZA 4IGNA 4PMVA 3I4KA 3K1GA 4KGJA 3LM3A 4IGSA 1EJ7L 2R82A 2ABAA 2BSLA 3CYVA 1Q6FA 4M5PA 5TD4A 1MXGA 1I2NA 3S2CA 4K7VA 3W1TA 4IL2A 3R2GA 1U5HA 2PDLA 3QGAC 3RX4A 1GOQA 3H54A 3BJTA 1L8NA 1FCQA 4YN5A 1LM1A 1U33A 3GTHA 1JUKA 3CO8A 3LA4A 1F6PA 1ZJIA 2W91A 4YWIA 4JNZA 3S1XA 2DZSA 4IPLA 1IXPA 3MU7A 1J5SA 2AL2B 4NQ1A 3UYCA 2E77A 2Z7GA 3FDGA 4HP5A 1QNSA 4GUFA 1XWYA 4X0VA 1OSEA 3L7RA 1E0UA 3OOQA 4JIIX 3MVIA 2BASA 2BGNE 1O12A 1N8FA 5CPNA 3KCJA 4IQJA 1MEWA 1SYTA 3EPNA 4WY0A 5CPOA 5HMDA 3TFCA 1OIFA 3KCOA 4DEFA 1TX0A 4P8XA 5FOOA 5TNVA 4PL2A 3WJZA 1E6ZA 3U5YA 1PX8A 1RVKA 4O1DA 1ME8A 4DJFA 3UWYA 1OYBA 1GPWA 1XG4A 4C91A 1HT6A 2PMQA 1W5NA 2WKJA 4RZBA 3VNKA 1ZBVA 1TE6A 4NU7A 4UXDA 3LZ3A 1YQ2A 1EXPA 1E9YB 3CTLA 1CX9A 2DORA 3LRMA 1E9LA 1PEZA 3UCCA 4CNOA 3ONBA 1G7VA 3IV8A 2BOFX 3RNDA 5D2WA 4UQAA 2HNEA 3I6EA 2IPWA 1RLDA 4TR9A 4HNCA 2E28A 4LH8A 3GU1A 1JFHA 3EPMA 2XU2A 3DX5A 5CSSA 2ZTJA 4JS3A 2VM8A 1ECQA 4E6MA 3IEBA 4PRTA 3PAJA 4ORMA 1SU5A 3LMZA 1OADA 2BLEA 3CQKA 4JKKA 1XLFA 1VJIA 1K9EA 2JK2A 3PTQA 1LUCA 2QV4A 3ES8A 4G6CA 3IIXA 2VXNA 1DJWA 3OZPA 3PG8A 2DDXA 2Z28A 3C2FA 2PLCA 1QPQA 1DVJA 1B54A 4LF1A 2VUYA 1LLWA 4Q4QA 4WIWA 3E74A 3KWSA 4WDTA 2XIMA 3DHUA 3W7JA 2QUTA 2X1IA 4XX6A 1XLHA 3TJXA 3K2GA 1UWRA 1XFCA 4W5ZA 5TQLA 3L4VA 1V0MA 2VX5A 3AMDA 3MSDA 4XO7A 1X8CA 5F4WA 1EGMA 9XIMA 2Q8XA 1LL4A 5I78A 2ZXBA 3EOSA 1L8PA 1C91A 4DPPA 4K39A 1GVEA 1LOQA 3PULA 3S83A 2C6QA 1ELSA 1RY8A 1UWTA 1HL8A 2PU1A 4M6UA 5BXRA 5DRCA 3EXTA 3P0WA 3CV2A 1ITUA 1E0VA 1J79A 1XBYA 4F9JA 2CZDA 2G3FA 3W26A 2WMGA 5HANA 3ANVA 3AMGA 3PZOA 4WGHA 3BLIA 3MV01 3UG3A 1N8IA 1C8VA 1LG1A 4HYWA 3QM3A 2BXYA 4W9TA 4OUIA 3P74A 3ITOA 3CL8A 3KOYA 2I14A 3BLEA 3RR4A 2QW5A 2GUBA 3IK4A 3LEPA 1E56A 4O28A 3AYTA 1JPIA 2QCDA 3NIYA 4E2VA 2JGYA 3U5UA 1HJWA 2V5LA 2CLEA 5AYZA 3ERPA 3V5CA 4B3ZA 1XPYA 1UWAA 1BWVA 4V27A 2ZC8A 2J24A 4GI8A 3IGSA 4RDVA 1Q85A 2NUXA 1XLJA 3H2CA 2VVSA 2ZUUA 4OGZA 3WNMA 3MMWA 4OQVA 4AIBA 4H01A 1DXIA 2CZVA 4ZOCA 3AIRA 2HQAA 1A5AA 4TO8A 3QV8A 2VP8A 4PUEA 1ESWA 2E40A 2ZRXA 2VZSA 2ZUTA 3UG8A 4HCHA 4L6HA 3N4FA 4Q8MA 2Q71A 2A7RA 5I79A 3KUMA 3C0JA 3L2MA 1JCJA 3HBLA 4H2CA 1WAUA 2C16A 4HA1A 2QPXA 4UR7A 1JZ8A 1VZWA 5AC5A 1H5YA 2VWSA 1FFRA 1ZCCA 3MANA 1UBSA 5HQLA 1HF6A 5HDRA 2OQHA 3VE9A 3VD5A 1HXJA 1F8MA 3U2CA 1GQKA 1JR1A 4JCMA 1OCBA 4XKYA 5J8LA 2Q09A 2J9YA 5L9FA 4GIRA 4PTNA 3WDJA 4AD5A 3UZZA 3LGGA 4A2SA 4B2DD 5DMYA 3C52A 3WK3A 2VCCA 3STPA 3L65A 2Y6ZA 4XVDA 3MZ2A 4LCSA 1M7PA 1JRCA 1P1XA 3KLLA 4FXRA 2WHJA 3S9IA 4P8WA 2DZWA 3CWHA 4B15A 6A3HA 3TROA 3NQ6A 4Q4PA 5LIYX 1OF8A 4F9DA 4DB7A 1UB3A 1ODUA 4CGTA 3ME3A 1QI2A 4POCA 5FCZA 1TMQA 1TWDA 3BJSA 2VC6A 4JIRA 3INPA 4HMCA 5M5DA 1J8VA 1PKLA 1D8WA 3MMTA 3QPYA 4A2RA 2OYKA 4QQUA 5FF3A 1E55A 4G7EA 1DWJM 4M19A 3TA9A 3RPMA 3QHOA 4GK8A 2ZRUA 3OU8A 3EDDA 4FNPA 3NYDA 3BMWA 3GS6A 3GK0A 1S2TA 1AG1O 1Q3NA 1QATA 1S38A 3OG3A 1ZBWA 2SFPA 3DFQA 5GJPA 2D69A 5CXPA 1JYXA 3NEHA 3KZPA 3U6WA 2PTZA 3RYSA 1FHDA 4XIMA 5HINA 3GG1A 5AKQA 3WQ8A 4L9YA 1CEOA 4LSBA 3PJUA 1KWGA 3AIEA 4Y9MA 3B9EA 3E0FA 4NZFA 2JIEA 4MJ2A 1HQTA 4ZR8A 1Z3NA 2YKKA 4E0CA 3T8QA 3SCNA 2DIEA 1M6JA 4IJCA 2RDTA 5IHSA 4D9PA 4UIOA 4R85A 1W5PA 1EL3A 4OV4A 2H3BA 2XH4A 2RDUA 1KLYA 4O13A 3L4XA 4QCFA 2WVVB 3USBA 1P1MA 3FFSA 4RJEA 1LOLA 2GDVA 4MKVA 2NUWA 4M6QA 4E2BA 2G3JA 4S2BA 5BOEA 2CCRA 5T8GA 3C4UA 4JL1A 3SQLA 3BOFA 3LV5A 3PBYA 1GK8A 4GKTA 4IMGA 4PMDA 4MB1A 1RP8A 2PDPA 4DJEA 1IIHA 3WD4A 1A5NC 1OK6A 3AMLA 3LLXA 1WX0A 1U5VA 2TPSA 3NPXA 1EKOA 1KCKA 3M0YA 4QP0A 4DJDC 1PDYA 2QCCA 2FB2A 4LEQA 3G1AA 4IX0A 3TYZA 1RCOB 3CAWA 3ELFA 2PRHA 4LVFA 2CIPA 3VIKA 3AU2A 1R2RA 4B5UA 1J6PA 3RO6A 2ZX6A 5AFDA 3S9ZA 1KGXA 3W74A 1HGYA 1ZBCA 1AH0A 5MKGA 2CERA 1V3KA 1UR0A 2Y62A 1IWPA 1PYFA 1QWGA 1OX6A 4ZTYA 4MDOA 1NWUA 2VRKA 3M0KA 2POTA 2GZXA 1WOBA 1AL8A 4NY2A 5FJIA 3G1SA 2XGIA 2IKJA 4J1OA 4RCXA 3NQEA 1ZZMA 3BGJA 4XG1A 3EOOA 1RD6A 2NX9A 5HNTA 1THFD 1EIXA 1GOIA 3BXWA 3II1A 4DIAA 1KBBA 3NTYA 1KV5A 1PPIA 1MEHA 4WEVX 1WO2A 3UWZA 2Q8ZA 5C2GA 1Q8AA 4HTYA 4ILSA 2QCMA 5I23A 4R7JA 1D3GA 3M5XA 1VFFA 3GKFA 2WWDA 4HNLA 2PTDA 5D38A 3H12A 3GTXA 2PWEA 3IGHX 1QNQA 2XINA 3NSMA 3NUKA 3WD3A 4BCEA 2Q02A 4QQ3A 3L5AA 5CGQA 4FLOA 2CLFA 2C8NA 3M44A 4J5NA 1YXCA 1KFLA 1LT7A 4GY0A 4Z2LA 3QPEA 1UP2A 4HYVA 4O16A 1RBAA 1E0XA 1SFTA 1TQXA 3OODA 4XWUA 2WYSA 4O10A 2VCAA 1XH2A 1RH9A 3GXTA 1EEXA 1GJPA 3HMCA 2OVLA 3AHXA 2EPNA 4TX6A 2XH2A 4LS0A 1E72M 1MFVA 2Z0IA 2HROA 4WRHA 2DSVA 2WMJA 3WH9A 2WZIA 3RG6A 3TH6A 5K7JA 4OE7A 3TWAA 4LBSA 4D6HA 1IEWA 5D32A 3SCOA 4EANA 2H8ZA 2G4JA 3GD6A 3MCOA 3UWUA 4X0NA 1V3IA 1XYZA 5FF4A 5JXQA 2J13A 4ZB5A 1IGSA 1R9XA 1DJNA 1RSCA 3CLWA 2ISDA 1BG9A 1UKSA 4NT0A 4NZ5A 4RNHA 4DUXA 4DO7A 3R6IA 4J35A 4RNIA 1D8CA 1MW3A 2ZZ4A 3PUGA 1JFXA 4O4VA 2NVCA 3M7WA 1ADOA 1B1YA 1E71M 1R47A 1VEPA 4XAFA 1VYPX 3BH4A 3O07A 5D09A 3CL6A 2VEIA 1JZ6A 3L67A 2YXOA 2ZICA 3H22A 4K8HA 2NQJA 4JY8A 3T2PA 1UYQA 4LBUA 3WLSA 5DXXA 3HPXA 2YFOA 3N18A 4H9YA 2DPEA 1FWGC 3EXSA 3W70A 1AK5A 2OSYA 4Q6XA 4P7OA 4PA8A 1EA9C 1A5BA 4LRSA 1V0KA 2NT0A 4NJKA 2DT2A 3RAOA 5XINA 4GZEA 2FZBA 1X39A 2HXTA 3BG3A 3C8NA 2WCAA 4QITA 3UXAA 3QYQA 3LHVA 4JN7A 1M53A 1PBGA 4AY8A 4EAYA 5K9CA 1W9PA 3C2YA 1NY1A 3CUXA 4D6IA 3O7UA 4EPEC 4U2YA 3MPGA 3O1NA 3AYRA 3BCDA 1PB0A 1FDYA 2V3FA 3L9CA 4ZSTA 3LCFA 1RQHA 5BRBA 1XLIA 3G3DA 4RKAA 1UG6A 2A85A 3O8AA 4JIHA 1DIEA 1OCNA 1K70A 5IBXA 3O16A 1R46A 3WDHA 3D3AA 4AU0A 1SFSA 1XISA 3POCA 1JYVA 2GVYA 2Y8UA 2CXEA 1QOPA 1H0IA 3C2RA 2ZIDA 3T09A 2OLAA 3VUSA 1F73A 2VD9A 3W07A 1X1OA 2I7GA 4BZYA 3TTQA 1IEIA 3KE0A 3R43A 4TTUA 3RILA 3DDMA 2CLKA 1K9TA 1US0A 5F1VA 2RJGA 2RAGA 1TJ0A 2ZTKA 1M03A 2FFIA 1W3TA 5E6ZA 3V7PA 4XVEA 3W6YA 3OGSA 4K6AA 4WOQA 3MKVA 3W24A 1NWRA 2YA0A 3U2OA 2GGHA 1YNPA 3NQVA 4PBFA 4HN4A 1DKWA 3P8JA 3EX1A 3BPWA 4HD5A 4S3EA 3W1NA 1PWLA 5KZMA 1H1ZA 1W1IE 3DECA 1F76A 4LANA 2GVLA 4IIDA 2HRWA 3SIZA 3NQFA 4Q32A 1O94A 3QYSA 1PIFA 4GVGA 4B2DA 2WSRA 1SQ7A 4A3UA 3VGBA 1NDVA 1EPXA 4R33A 3TYDA 3SURA 3R1ZA 3IWPA 4GFSA 3UWEA 3LMYA 3SN0A 1GONA 1A3XA 3RM8A 4A8RA 2VX7A 3NQBA 2J62A 4QJ1A 4Z1BA 1O1HA 5DQPA 3AUOA 2FGBA 2XVKA 3DFHA 3UJ2A 3CIXA 4H8HA 1ZNNA 1E3ZA 1Y5VA 3AZTA 4ADUA 2D1ZA 1QOQA 4CU8A 3LHWA 5HK4A 3PUOA 3PFMA 2XWEA 4MJZA 2NWSA 4AXNA 4DM1A 5CSRA 2IPFA 1Z41A 3APYA 1E9ZB 3B8TA 3NQGA 3EPOA 5DT5A 5LIKX 2BVDA 4DZ5A 1PHWA 1FHUA 4K36A 4LYQA 1L6GA 4FXSA 2HISA 3UNDA 4Q8UA 4E4FA 3VOFA 4EWJA 3G1VA 2PI6A 5AC7A 5K9XA 5CH9A 3H2NA 1ZTVA 1GOOA 2GK1B 3KBWA 1Y5XA 1J11A 3W28A 1GQIA 3EA3A 5F2IA 1GQNA 1K9DA 1UR2A