4XVDA

17beta-hsd5 in complex with 4-nitro-2-({4-[3-(trifluoromethyl)phenyl]piperazin-1-yl}methyl)phenol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
314
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 314
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xvdA00
4IJCA 2ACUA 4PMJA 2INEA 2I16A 4QXIA 1Q13A 4LAZA 1AZ2A 3GHTA 4YU1A 2PZNA 1M9HA 4JQAA 3V36A 4XO6A 2HEJA 4YVVA 3GUGA 4DZ5A 5HNTA 3ONBA 1XF0A 3Q65A 4LBSA 4JTAA 4GABA 1SM9A 4JTCA 2PDNA 2VDGA 3CAVA 3V0SA 2BP1A 2ACQA 3CASA 4GA8A 2F38A 4JIIX 2FZ9A 3WCZA 2FZ8A 1S2AA 4YS1A 2INZA 3UZZA 4LBRA 2NVDA 4IGSA 1S1PA 3S3GA 2IKJA 4XZNX 1PYFA 1HW6A 4LAUA 2PFHA 1LWIA 3BCJA 4DBSA 1QRQA 5HA7A 3M64A 5JH2A 3LQGA 5C7HA 1UR3M 3CMFA 4EXBA 3LBOA 1X97A 4QR6A 2WZMA 3LEPA 3UZWA 1Z3NA 3CV6A 5DANA 2IKIA 3R58A 3LZ3A 4XK2A 3BUVA 4ASTA 4DBUA 2HDJA 2DUZA 2WZTA 4YVXA 4RPQA 1ZQ5A 2HE5A 4WRHA 4XZIA 2F2KA 2PDXA 1AFSA 1ZGDA 5HNUA 3N2TA 4PR4A 3ONCA 3O3RA 2PDUA 2PDBA 2IPWA 2R24A 1RY8A 3DOPA 5LIUX 1YNQA 2FZDA 1X98A 2PDYA 1YNPA 2ACRA 4JTRA 1MI3A 3RX2A 4GCAA 4XO7A 4WDUA 4F40A 2PD9A 1HQTA 3H4GA 1YE6A 1Z8AA 1PWMA 3NTYA 2R9RA 4WDXA 3LN3A 4IJRA 4WEVX 1FRBA 1T40A 4YVPA 3UWEA 1XGDA 2PDLA 3DN5A 4JTQA 3LUTA 3H7RA 4PUWA 2PDCA 1PWLA 1EF3A 2PDFA 1EL3A 3M0IA 3T42A 1S2CA 4WDWA 3UP8A 1X96A 2IPFA 1EXBA 2PDMA 4GQGA 3QKZA 1JEZA 1YE4A 2IS7A 3LENA 3UG8A 1QWKA 3WBWA 3MB9A 1J96A 3UZYA 4XZMX 5AZ0A 1AH4A 3M4HA 1GVEA 2ISFA 1K8CA 3UFYA 4QX4A 3G1RA 4JIHA 4FAMA 3V35A 4JTDA 5LIXX 2PDPA 1T41A 2BGQA 4Q3MA 3KRBA 2PDIA 1ZSXA 5LIYX 4LB4A 2PEVA 2IPGA 4GQ0A 2QXWA 3R43A 3R7MA 1ZUAX 2DUXA 2IQDA 3F7JA 1MRQA 4GACA 4JQ2A 2C91A 2CLPA 2ACSA 4FZIA 2AGTA 2PDKA 3LQLA 3WG6A 5KETA 4XAPA 1OG6A 3LD5A 3Q67A 1AZ1A 1S1RA 4L1WA 3UYIA 4PUUA 1LQAA 4FALA 2PF8A 1Q5MA 3R8HA 2P5NA 3U2CA 4Q7BA 2PDQA 1R38A 3ERPA 4JQ4A 2HE8A 2PD5A 3BV7A 1Z89A 3MC5A 1XJBA 3LZ5A 3P2VA 3CV7A 4EXAA 1C9WA 3RX4A 2J8TA 3VXGA 4XZLX 3EB4A 3WBYA 3V0TA 2FVLA 2NVCA 3GHRA 4H8NA 3GHUA 1AH3A 4JQ1A 1IHIA 3R94A 4MHBA 2IPJA 4QBXA 3C3UA 4GIEA 3CAQA 1US0A 3COTA 1Z9AA 3GHSA 3V0UA 3EB3A 1ADSA 2BGSA 1RY0A 4NKCA 3O0KA 3R8GA 3UGRA 4JIRA 2IKHA 4HMNA 1A80A 4OTKA 2HVOA 2A79A 2PDHA 3B3DA 2FGBA 4HBKA 5AZ1A 2FZBA 3G5EA 3WBXA 4L1XA 4DBWA 4FA3A 1VBJA 4XVDA 5JH1A 3FJNA 4ICCX 2IKGA 3FX4A 1AH0A 4H7CA 5LIKX 4LB3A 3EAUA 3N6QA 4PRRA 1VP5A 4XVEA 4PRTA 4I5XA 2PDJA 2ALRA 1IEIA 1RALA 1MZRA 4WDTA 2IQ0A 3BURA 4R9OA 4XZHA 2PDGA 4AUBA 3RX3A 3D3FA 3LNMA 2HV5A 2HVNA 2I17A 1PZ0A 5M2FX 1EKOA 5LIWX 3UZXA 2PDWA 4JQ3A 3R6IA 2DV0A 3H7UA 1PZ1A 4WGHA 4ZFCA 4G5DA
chains in the Genus database with same CATH superfamily
1P1MA 2Y1HA 3W01A 1E40A 1UR1A 4HPGA 4BCEA 3U6WA 2QHAA 1W9PA 1L6WA 3NM1A 5GJNA 3LTYA 3CHVA 4LAZA 4A35A 3NOYA 1GVIA 1XINA 3YPIA 3DENA 4NSBA 4AD2A 1JIBA 3NQ7A 4AYSA 3TN4A 3KS6A 4LCRA 4H9MA 3ANVA 1QBBA 3MKKA 2B7OA 3MKVA 3ARSA 3VU2A 1OT2A 1QI4A 2XGZA 1AL7A 1YIXA 2PDNA 3UF9A 1UD4A 1OZMA 1WP6A 4PCNA 1RCQA 3A64A 5KSWA 1I0DA 2D0FA 2I9EA 4I7WA 4Y9NA 3RHGA 3U48A 1UOKA 3MDUA 1O5RA 4LUJA 3L4VA 2BVTA 2FZ8A 1HL8A 4KRZA 3LV6A 4Z1BA 3O05A 5JBEA 1TWDA 4LH8A 4J3ZA 4V15A 3TCSA 2WQPA 2J78A 4UB9A 5J5DA 3KCOA 3MP3A 2WJZA 1K9DA 3PTDA 1SFTA 3LQGA 5C7HA 5M5DA 2OXNA 2VL4A 5CC3A 1UA3A 2VD8A 1EGVA 3QLLA 4H01A 2ONEA 1MEHA 2OGYA 4F0SA 3ZLHA 2WJDA 3BG9A 3SBFA 5DCBA 4YLWA 4HQVA 1ZQ5A 4AEFA 3ZMRA 4MY8A 3APTA 1MZHA 1K7FA 4BQ2A 2OZ3A 2GFTA 2F2KA 2PWHA 3FGCA 4D6DA 4QCFA 4B5NA 1GZ1A 4XB3A 2VZUA 5BROA 1IEVA 4PZVA 1D3CA 3FYOA 3O3RA 1DIDA 3TONA 3MW7A 4JYFA 5GPRA 5I5RA 3CNYA 2CYGA 3U2EA 3W2JA 4DJFA 4DF1A 1QXLA 4QGCA 4F40A 1TPVA 3MMWA 1KFLA 3CUHA 1N8WA 4UNIA 2VHLA 3IV8A 1HKVA 3LUTA 1XIEA 1EUNA 4PUWA 3NGFA 1RZMA 4H9UA 5FJRA 4Z2KA 3T42A 3SCVA 2XVKA 3MANA 2XZ7A 4F66A 4R5EA 1BGGA 1EJTC 3CIWA 1WOAA 4ORIA 3DXIA 2J74A 2IPFA 4HN8A 1ZTVA 3CHFA 4GQGA 4LGXA 1JEZA 3QH2A 4GJJA 1J9YA 4WSHA 4XZMX 1BXNA 2BB0A 3VVGA 2QKFA 4ZO6A 3GXIA 3P74A 3WD4A 2WB5A 3APYA 1FFQA 3WQ5A 3F2BA 4CUCA 1PKMA 1ZBVA 4QAWA 4YXGA 4YCOA 1T99A 2E8ZA 3WLMA 1ITUA 2ISVA 3RMJA 1YPIA 2FTYA 1UR0A 4JL2A 1X7FA 1FX6A 4CCDA 4DIAA 2VEKA 4W7VA 1W54A 5A8NA 4CQDA 3K4WA 3QY8A 3PWIA 2HS8A 4ADTA 4JQ2A 3EWWA 4AWUA 5AYBA 3T44A 2OJPA 3FVMA 3B9EA 1ZLPA 3K5XA 4A2SA 2QJHA 1NDVA 2DZXA 3EKLA 5FJTA 4B16A 4FX6M 4MOZA 2X16A 3IJ7A 1TJRA 4TUFA 5CAKA 2DSWA 2JIEA 1G0CA 3IIXA 3IRDA 4NZFA 4GH1A 4CD4A 4H4IA 4EE9A 4CCZA 1MSSA 3W6LA 4IPLA 3CLMA 3EOSA 4NIRA 1GJUA 2EF9A 2ZRVA 5FOOA 1YDVA 3QF0A 4UFJA 5DBUA 4YHEA 4FO4A 3LLDA 4C1NA 2WVVA 3CZLA 3I6RA 1XLGA 5U7SA 1T96A 4EWND 2YBUA 4UTHA 1FVPA 4S3AA 5FJJA 1WPCA 3CQIA 4NX0A 1R9ZA 3N3TA 1FWJC 4PB3A 2DJXA 3GHRA 3MSDA 8RUCA 5F2IA 1XL9A 3CMJA 1AH3A 5T91A 3AS2A 3GTFA 2C13A 2YL5A 3A9IA 3DYOA 2IPJA 2WM0A 4AF0A 4C65A 3NL3A 3M5ZA 3WJWA 3NG3A 3T2PA 3EDFA 2KZHA 1L6YA 3W81A 2AKMA 3O0KA 1JYNA 4GCXA 1L6GA 3DGBA 5F2LA 2Z1VA 3TOYA 2DY3A 2JK2A 3NVTA 2WVUA 2A79A 4BEQA 4D72A 3S9IA 4L6HA 2E1DA 4MNMA 3AIEA 1T5AA 3EOOA 3ITOA 2Q3OA 3QMRA 2OLSA 3H2FA 4RLIA 2NX9A 4AZCA 2J47A 5G5IA 5CPQA 4AMCA 4JIPA 3BLEA 3O63A 1Q85A 4W4QA 1F5ZA 2BXYA 1ZJBA 2CHNA 1VP5A 1XSJA 3UBPC 1PKNA 3KTSA 2DFAA 1RALA 4WDTA 2GLKA 1W1IE 3L0NA 2CLHA 2FVMA 3GW0A 3W75A 2DZPA 1WO2A 4AH7A 2VZSA 2HVNA 4XZBA 3WH7A 3BGJA 5RUBA 1E0TA 4H6EA 1BWVA 3EWBX 3MA8A 1J8VA 4TU1A 4IUOA 4RKAA 3P0WA 3W2LA 4LF1A 3B97A 1W1ZA 2PTYA 3PZGA 4K6AA 2GGIA 1KV8A 4DPQA 5C5YA 2PWGA 1F73A 3PZUA 2L5HA 4NJJA 3AO0A 1Q4WA 1ZENA 4A29A 4ZFMA 4CKQA 1TJPA 3TLLA 4KESA 3SJNA 6CGTA 3QZAA 5DXYA 3GTHA 2ASHA 2JEPA 2ABAA 3WL1A 5IDIA 4J3XA 2C15A 3WKZA 2E5BA 1VYPX 3K46A 2Y4SA 1UD6A 2C16A 4N4PA 1THFD 1SW7A 1BQGA 1ISVA 3SUWA 3SW6A 3QW4B 3W1TA 4I5RA 4TR9A 3S5ZA 4GGHA 3IJQA 3N14A 2QV4A 3ANUA 1BKSA 4WY0A 2IKJA 4RV8A 3PBGA 5EBUA 2QJNA 4GJIA 1W3NA 3TMLA 3EKZA 1FHLA 3KM8A 3BQ6A 3SN1A 3LCGA 1YPXA 3O0FA 1LRNA 4DJED 3PUDA 3P82A 4N9BA 2MANA 2DZSA 5DCEA 3SCOA 4GO8A 3AZTA 1BLIA 1H1NA 3CUJA 4FLSA 4FNQA 4M6VA 3BARA 1PO9A 3CV6A 3T4CA 1RQBA 5A5WA 2G96A 3IUDA 5HNRA 1Z48A 3VC5A 5H1WA 2PS2A 3QY7A 4C90A 4QIUA 2HE5A 1KFJA 3VFCA 2EO7A 2TYSA 1JD7A 3D46A 3PM6A 1DTNA 1JUEA 3CL7A 2YCEA 3WF4A 4D6FA 4F3HA 2B31A 2A3BA 3DOPA 1ZJIA 4W8BA 1XLFA 1JULA 4MPQA 2YB4A 1UZ4A 4W8AA 3EPOA 4KPLA 3HQ1A 1J0KA 4WDUA 1Q6DA 3I3DA 4W5UA 2ZZ5A 1W3TA 4WEVX 2X7VA 3R2GA 1XYCA 3DN5A 2Q3RA 2VZOA 3AMCA 3DH7A 4TX9A 2VP8A 2RDTA 2OLAA 3MBDA 2PDFA 1E1FA 4BFAA 4JTTA 1Z42A 1MW3A 3WQ6A 2ZXDA 3OTRA 4JX5A 2XDFA 3URAA 5G2IA 3C2EA 1UMYA 5FACA 1QPNA 3N12A 1FQ0A 5HAOA 3BOXA 1ICPA 5F1VA 1I1XA 5DX7A 3L0KA 4QM1A 3ABOA 3BK0A 2E8YA 1JCXA 2ISFA 2XM1A 3SURA 1H09A 1KWGA 5KINA 4HCHA 1VENA 2FPTA 2YOCA 4J7RA 1PX8A 4FAMA 3GNPA 4HNCA 2W4XA 1RP9A 1GWJA 1H63A 4FNUA 3MUXA 4F79A 1D9EA 3D47A 3PFRA 3SCNA 1A0DA 5I3GA 1NIUA 4N9DA 3WLKX 1VBGA 2FGZA 2J79A 2G97A 4QS5A 1EP2A 1MRQA 1DEDA 4J2MA 5MKGB 1MXDA 1FWTA 4FP1A 2F7FA 4U2YA 4DQWA 5ENLA 4NJKA 1S2TA 1MUCA 3VE7A 5E0FA 4UTLA 3AU2A 4O57A 3NJ3A 4OUIA 2ZRYA 2VFHA 3RJYA 2VX7A 2EJ1A 3VD3A 1JGIA 4JL1A 1H50A 2EGZA 4JTIA 1R38A 3R11A 3TYAA 1KM6A 4H00A 2WSPA 2PD5A 4XZWA 1QOPA 3SSZA 4PUJA 6TIMA 2I5QA 1ZP4A 4P7QA 4V1YA 5LNSA 3T0BA 3FXGA 3CV2A 3S1UA 1XLCA 2WMJA 4AIBA 4KWSA 1QHOA 2YDRA 3BMVA 4MJ2A 1EQPA 5F4XA 5DT7A 3IANA 3EX4A 5LNVA 3WYZA 2VX6A 2KAUC 4YCPA 4ZOCA 3WX7A 4L65A 1IHIA 3BAWA 2EPHA 3EPMA 3CAQA 4AVFA 4PB4A 2QLYA 2ZKMX 3G0UA 2RJHA 3EB3A 1ADSA 1VCFA 3GKAA 1CIUA 2YYTA 3WEOA 1W9XA 4E4UA 1SPQA 2WOQA 5AKQA 1FHDA 2QDHA 4AD5A 1UC4A 2QEZA 1WV2A 3IVSA 3PPCA 4C6LA 5C2XA 1ZAJA 3OVGA 4L1XA 5IDZA 5FF2A 4E4PA 2IKGA 2X2GA 3WQDA 1QW7A 3W7JA 1JYXA 4OHQA 1H61A 4S39A 5FJPA 4GI4A 5BOOA 3N6QA 4NU7A 4JFUA 1HVXA 3L7RA 3UCQA 4I5XA 2EG8A 2GK1B 2WMGA 1NU5A 3LTPA 3GXDA 2A1YA 4OT7A 4LPCA 1EH9A 5JQ9A 3N2OA 1XBZA 2CPUA 3D3AA 3MZNA 1PX4A 3W37A 1F3TA 1IT8A 3RX3A 5H8UA 1GVFA 4O1BA 2XN0A 4F2BA 4NI3A 4AEEA 2CZVA 4CNTA 3OP2A 3VKAA 1DP0A 3FXYA 2YPIA 4IQEA 3R79A 1UA7A 3HZ3A 5M3WA 4PCFA 3DFQA 1CXHA 3G8EA 2IMRA 3IK2A 3NSMA 1NFPA 2F61A 3FV9A 2GOUA 4L4MA 2VC6A 1T7LA 3EMZA 5F2MA 3TQVA 5H8PA 5J04A 5HJLA 2PUZA 3W4RA 3NNTA 1OBAA 1PIFA 4QG8A 1VS1A 3KP1A 5H91A 3N04A 1LJYA 4UQDA 4PCPA 3FIGA 4YVVA 3BLLA 4NHVA 3GUGA 1BRLB 1OD0A 4AMAA 4NXKA 1UW9A 2P10A 2G5WA 1D3HA 1UQZA 4HPXA 2FMNA 1POKA 3L12A 3CUZA 4LYQA 1Y0EA 3ZO9A 4PMQA 1EOMA 1XSKA 2PRHA 3MYOA 4KIRA 1S2AA 3BJFA 4HYVA 3SFWA 1JPMA 2VRJA 5LA2A 1A53A 1LRQA 4Z08A 3VX0A 1DWJM 1ZAIA 1HW6A 3VKDA 4C6EA 1R3VA 2PP1A 2QCCA 4Z0SA 4LY4A 2OODA 4MJMA 1V51A 3D5HA 3QHMA 3U3HA 3DG3A 4E2DA 5LGXA 2OMAA 3MTWA 1YTDA 1A5CA 1K8XA 3IJ6A 3FDGA 2J75A 3UJFA 4QG9A 1AK5A 2QVHA 2BVDA 4XK2A 7ENLA 5DF0A 4CQCA 3LCXA 2BXVA 4HPHA 4TMBA 1Q6QA 4Z2LA 4JGDA 3VNDA 3QOKA 2QT3A 2PB1A 3TQKA 1J11A 3TTOA 4LVDA 1FXQA 4LUTA 3EDJA 3QGKC 3IIOA 4UC5A 5I3IA 3ONCA 4F2UA 4REQB 1F3WA 3VNYA 4GHRA 1PHWA 2X41A 1N2VA 3MP4A 2G8ZA 3VCRA 3LU2A 1GQJA 1ZJAA 2QAFA 4C6CA 4PSPA 3M41A 4ALDA 2PP0A 3W23A 1R0MA 4C6PA 2JKEA 1H1YA 1L0PA 4QISA 4Q4OA 3MSGA 1Z44A 3S2CA 4JFWA 2C1HA 1NELA 4HD5A 3TSBA 2ZWYA 5HBFA 1EF2A 2CWNA 4KCVA 3NCOA 2PC4A 3HOJA 1W1YA 2X0SA 4DI9A 2WANA 3TR9A 4I8DA 3E49A 3WNLA 2FFCA 2Y8KA 3QGAC 4JTUA 4HHLA 8CGTA 1DL3A 1I1WA 2DW7A 1K77A 1AH4A 1A5NC 3WJSA 5HMFA 2XISA 1QVBA 2POZA 3HBLA 4O15A 2ZUVA 3PBUA 3UFYA 1AL8A 1E0WA 5CKSA 1RXOB 1YNYA 4AZ7A 4UFLA 1S39A 4JTDA 4U5KA 3LPPA 1BVZA 5I06A 1WKEA 3HMJG 2BV9A 3SO7A 5AHEA 4DO5A 4ZO8A 5XINA 3IWPA 2J66A 3ZVHB 1E56A 3QFWA 3VZZA 1V02A 1QNRA 4J3SA 5HK4A 5CPSA 3GH7A 4L64A 4DX3A 4DJEA 1ZBKA 2WSKA 2FQIA 4UQ9A 4CU7A 3C2FA 3E9AA 2DZUA 3M47A 3PUOA 3D6NA 3TK7A 2PWEA 2D0HA 3LD5A 4B2DD 2OWWA 4CCCA 5JIPA 2Y2WA 3WLHA 5G1MA 3AOFA 4WR3A 4HK5A 2PA6A 3R1ZA 2C6QA 4Q7NA 3VMNA 4ILSA 2I7GA 1QO5A 5XIMA 4V28A 3AU6A 4WKAA 3ARXA 1M7OA 3OA3A 2ZX7A 5FF0A 1VYSX 4DXVA 1TRIA 1XLMA 4FMVA 3LZ5A 4PA8A 2YDQA 1MDLA 1VGAA 4HCLA 3PJUA 3MUAA 5FEXA 1SO5A 4YHGA 1U1JA 3MUCA 4FI4A 4Q8VA 4CN1A 5ECUA 1H7RA 1FDYA 2GUUA 1GORA 2GJNA 3F4WA 3BANA 2QCMA 1UUMA 3EX6A 1Q6GA 2HZGA 1SJDA 4DWDA 4GXMA 1W9DM 1UBPC 4KRUA 3T6CA 1KTNA 5K3VA 3SQMA 3PZ9A 1K6AA 1DJZA 2XU2A 1W31A 1U30A 3B3DA 4IM4A 3PG8A 4QCEA 4WOQA 3F03K 2D2GA 1JDCA 2J4GA 5IM51 2VC5A 3CQHA 3PZTA 4NUWA 1OSEA 5LHEA 1H0GA 3LYEA 3DI1A 1WNOA 1IXPA 3MPGA 4EOUA 4QHRA 1ISXA 1OADA 3LK6A 3TE9A 5CSYA 3S83A 3KRSA 3HGRA 3W7IA 1B5TA 1E6RA 2X1TA 4A8RA 2ZUTA 4HU0A 1FWCC 1EXPA 1XG4A 3DBPA 2J88A 5A8MA 3RG6A 4ICNA 4HHPA 4FEZA 4AUBA 3UR8A 2IW0A 2CLLA 4HK7A 3AISA 5DQPA 4JHOA 4JY8A 4ECLA 3S4TA 3NQ6A 3G6MA 2Q71A 2QCNA 4UTWA 2TSYA 1B2YA 3BOFA 1OFEA 5ABEA 3T09A 2E5CA 5F1UA 4WZHA 2D3LA 2HXTA 4JFTA 1CT5A 5AHMA 2XIOA 1VBRA 5MKGA 3N2CA 4L6DA 3OGVA 2H6RA 4K8HA 3WLQA 1TFVA 4PMZA 2VOMA 2R6OA 2VGGA 4MWAB 1RK6A 3B04A 4G6CA 1DWHM 2GJPA 3V16A 2CLIA 3C2VA 4L1GA 1V6XA 4HSNA 3JU2A 3NQ2A 2PTDA 1E4LA 5HNTA 4HP5A 1DXFA 4U2ZA 3CJPA 2QCHA 4JTCA 2VDGA 3GYEA 1XISA 3CAVA 1P6BA 4FIQA 5HQEA 3NGJA 4WX2A 5IXEA 2QUTA 4PEEA 1CXIA 1KRMA 5HMEA 2BASA 4XSMA 4GYJA 4NNCA 1E6SM 2V81A 3UERA 4UMBA 4KEZA 1R87A 2CBVA 1E5JA 5EB8A 3STFA 4XKYB 4RK8A 1UJPA 3S3GA 2CLOA 1DPMA 1PYFA 1YQ2A 3UA4A 3U7BA 3ARYA 4PMRA 2O56A 4KH2A 4HTBA 1R46A 4C6FA 4P7RA 4DEFA 4P5UA 3LCIA 2Z2UA 3M9YA 3M44A 5CCZA 4D6CA 3BAXA 5CBIA 3C0QA 1IZJA 1LOQA 1A5AA 1VLIA 3M0JA 3F4DA 1K8YA 2WZTA 1I2PA 4QEHA 5AFDA 2Y5SA 1S2VA 2R1NA 3BQ5A 4O19A 5LA1A 3N2TA 3CK5A 3MUZ1 3WNNA 3M0ZA 4MWAC 4HOWA 1WZKA 4X61A 2VVSA 4GYPA 4KRTA 2PDUA 5BW6A 1OT1A 3HA1A 1CGXA 1YNQA 4G56A 1IT0A 4R7WA 4AD3A 4LBUA 5HOSA 1QOXA 3DECA 3S1WA 3ICJA 5M1TA 4CQBA 4FXJA 1Q6EA 3O6AA 4X0VA 3FVDA 4D6GA 4JDYA 3PBYA 4PE8A 4IIFA 1HTIA 3ITTA 1EZWA 1T40A 3WMSA 3CBWA 3FA5A 1E73M 3II1A 3FSUA 1K9FA 2YLAA 4S1FA 3W29A 3VILA 6A3HA 1CGVA 1SFLA 3LM7A 1E3ZA 1CB2A 2E6FA 3GNDA 1U1UA 4XUGA 2HJPA 2TAAA 3AI0A 4JFSA 3QV7A 3UP8A 3H4XA 1X96A 1PKLA 3P8IA 1NFBA 2NQ9A 4IP7A 2J7GA 3UG8A 3UZYA 4LCQA 2XFFA 3EZ4A 5D30A 4BR1A 3DHPA 5IHRA 3HQOA 2NSXA 1MMFA 1E9LA 2VM8A 1XRFA 3BLOA 3NZPA 1ZALA 2G37A 1WZMA 4LEFA 2XN1A 3GAYA 1V6YA 1I2OA 1KBBA 2QDDA 1CCWB 3VD7A 3AHYA 1W8GA 2VZTA 4AY7A 1QPRA 1NOFA 3GVRA 1J2BA 1GVYA 1PKYA 2Z29A 5D2XA 2GQ8A 2WNQA 3CWHA 2CU0A 3AMKA 3Q58A 4WSJA 4LANA 3GU1A 3QPYA 4QTGA 1G5AA 4JTEA 1FH9A 2B7QA 5DN1A 2BOFX 2Y62A 3QZ6A 2P3ZA 1KCZA 1O1HA 5A6SA 4H9TA 4WJEA 2ZUWA 4ZA0A 1B9BA 3GQYA 1P7TB 1EP1A 4PUUA 4UQAA 3P5YA 4A3QA 4JBRA 1ZRQA 3B03A 3WLLA 1DQXA 3KOZA 1V0MA 3L4YA 1BPLB 3ERPA 1JQXA 2GVGA 4A6GA 1YHTA 3SRHA 1XFCA 3UZJA 3RO8A 2VMFA 3GAKA 2ZICA 1HXJA 3WMBA 8TIMA 5EMKA 3TN6A 5IOBA 3RR4A 3HPFA 2NX3A 4KBXA 1JCTA 4WVXA 1QNQA 5C8BB 2ZCGA 1P0NA 1HO1A 1ZBWA 2NVCA 3CB3A 5D9PA 3K2GA 4IZGA 4CGTA 4REQA 1SSGA 5I0DA 2NT0A 1XIBA 3KTCA 2WV8A 1O12A 2B7PA 3K1DA 1GOMA 4IGMA 1OINA 1XS2A 4AVNA 3VA8A 1ECEA 5I24A 4G7EA 1EJWC 4J3VA 3VAVA 2ZRUA 3MWAA 1Y8BA 2YBTA 3USZA 2J7CA 5CAHA 3UGRA 1BVWA 4KF1A 2ZOXA 3LPFA 2EKCA 3GXNA 5AC4A 3VNKA 4UTIA 1MUMA 1J12A 1XLBA 3VGDA 3ARQA 4C6JA 4ZBCA 3WLSA 5JBFA 4ICCX 4MJZA 1H49A 3G77A 1B3ZA 5G2WA 1W6TA 1B3YA 2FZNA 2YSWA 4IQDA 5G2HA 1LROA 4DELA 4B5TA 2PDJA 3BW3A 1GHRA 1M3UA 3IS4A 1MZRA 4PCSA 3DUGA 4MNLA 4NX5A 3RJXA 1BTMA 3EWXA 1TTPA 4G1NA 1XFBA 3WLOA 3WLPA 2WWCA 3NM3A 1JNDA 4K68A 4K3ZA 3TW6A 4O8RA 3URBA 4NXSA 2OYLA 2YKKA 2ZTJA 1IYXA 1S5TA 4B2DA 1C91A 4DLMA 1V02E 3RGTA 3TZFA 4HPJA 1GOXA 3W7OA 1SMDA 1JXJA 3POCA 3NWRA 5AN7A 1UPMB 1SVDA 2ZZ3A 4JTFA 2E9LA 3BG3A 2BSLA 1IEWA 1IWAA 2PZNA 3E74A 3H55A 3BAIA 4O16A 2HEJA 3EWDA 3NXFA 3RYSA 5D9MA 2OSXA 4AHPA 1W1PA 1RJQA 5DXXA 3L5MA 1NWUA 4D1JA 1VPQA 2IQTA 2WKJA 2OLHA 1AW5A 2G0WA 2NT1A 3W38A 1HL2A 1G7UA 4PN2A 4W9TA 2ACQA 3CASA 4GA8A 4W5ZA 2F38A 2OEMA 2O4MA 1PZ3A 1UR4A 3AZRA 4BI5A 4LWWA 4BF9A 1NWRA 1C7SA 3L67A 2PFHA 5DT5A 3CAWA 4MKSA 1I45A 1M03A 4FK9A 4XBKA 1EWDA 1QRQA 2GGHA 4YTUA 2A7RA 3ZWSA 1A0CA 3M0HA 4HK6A 3THCA 5JH2A 2PWUA 3L0GA 4JTLA 2XFRA 2A3EA 2NQHA 4RNHA 2A3AA 3TP4A 3VINA 2I5GA 5AYXA 4QROA 3TXVA 3MV01 4INFA 2DPEA 3MU7A 4XD5A 2ZC8A 1RBOB 2G3NA 4BS0A 1X6LA 3UEQA 2VOTA 2CITA 1XDLA 2VEMA 3B8IA 4JDBA 5LNWA 1ONRA 1B3VA 2ZX9A 3CMGA 4U31A 5TF0A 3T05A 3JUGA 2D0GA 4MYXA 3LCFA 3BL3A 2R24A 3LGEA 4HZ8A 4KCUA 3W28A 3W02A 5E93A 3CH0A 3H2MA 1MXSA 3PZVA 3GG7A 4Z1CA 3MCMA 2PF0A 4KCTA 2FPYA 4Z2IA 4EANA 5BRQA 1RA0A 1XSIA 2W79A 3PS7A 1UCWA 1KV5A 1DYSA 1AD1A 1PWMA 3HB9A 2PDLA 2OGJA 3W1QA 1PZ2A 1E1CA 1MW0A 1PWLA 3VNZA 3REQB 5EMUA 4FLRA 4Q6JA 4W7UA 4D71A 4C6QA 1XG3A 2VT0A 3BMXA 1C7TA 2XSBA 1XQLA 1S2CA 1OFAA 2HPIA 2PCEA 1GJWA 3SCUA 2MNRA 3GDRA 3H53A 3FOKA 3KRZA 4GZIA 1PX3A 4ZB2A 1YE4A 1UP2A 1OX4B 1Y5VA 2O4QA 2QCFA 1VEMA 2V68A 4RZ5A 2X40A 1LWJA 4K7YA 2TRSA 2Y88A 3SIMA 2C0HA 9XIAA 1JXKA 4PL2A 3K1GA 3T0DA 4Y8FA 4X3ZA 2W63A 3NZRA 3TFXA 4JIHA 3K4AA 2E6YA 3VIOA 3P67A 2PWVA 3DG7A 1QI3A 3U2ZA 3VIIA 4DWSB 1DHPA 1REQB 4AD4A 1GVSA 3M07A 1T41A 3HFTA 1Q6CA 3GC5A 1BWKA 2BGQA 1W5PA 3N6HA 1ENUA 3AAMA 1ZSXA 1F8IA 5FCZA 5LIYX 1VFUA 2GPTA 4DWSD 4Q4KA 4X22A 2VGFA 4ZTXA 3LRKA 1UOZA 1GQIA 1HZYA 2ACSA 4WJXA 3NQGA 4ML4A 1XD0A 3W7HA 3B0XA 3OBEA 4E5TA 3N9SA 4LJ3A 1TQXA 3C8NA 4L1WA 3MUIA 5REQB 3AALA 2PLMA 3O6DA 3U9IA 1E5NA 1L6SA 3T78A 3W7EA 4ZSTA 1IEXA 3WSUA 1RV8A 4Q22A 1G4SA 4IOTA 3N18A 1Z89A 3Q94A 3UPBA 4HMCA 2X1SA 1QBAA 1W0MA 4QLKA 4K38A 3RM9A 5A3HA 3O15A 3RX4A 1G69A 1HG3A 2J8FA 4KWVA 2J27A 5DBTA 2NV9A 2CZEA 3AC0A 4GNVA 3QOMA 1L2UA 3KW3A 4DWSC 1EA9C 4IIDA 4PEKA 2CCRA 3W1MA 3IGSA 1OYBA 3ARUA 4RDZA 3COTA 1Z9AA 3ZJ7A 4U5IA 1M7JA 2D1ZA 2Y8UA 4V2XA 3IEBA 3O16A 1H51A 1R7AA 5JUVA 1OGSA 1QATA 2UY4A 2FH6A 2BG5A 2FJUB 4HMNA 3OHIA 4DUVA 2WQDA 3PTKA 1MUWA 1GTHA 2FZBA 4O8AA 1PDZA 2BTMA 1Y5WA 5FL1A 2XM2A 1XIFA 2QUUA 2EEXA 1SZFA 4RPPA 1ADDA 3SM0A 4Z1DA 1AH0A 1ME8A 2QJMA 4GH3A 3WLNA 4BZYA 1CTNA 4PRRA 1F7BA 3O6CA 2IUZA 2W66A 3R10A 4N0RA 5C9WA 5FESA 3NDZA 4UNKA 4UCGA 4YWIA 1YADA 4C6IA 1EIBA 3M6DA 4BQ3A 1IR1A 1AA1B 1IEQA 3UXDA 4GISA 2Q8ZA 1XPGA 4J3UA 2VR4A 2DP3A 3H2NA 1H3GA 2PI6A 2A3LA 3EOUA 3S2NA 3WUBA 1V3KA 4RCXA 1TYGA 3UZXA 5D02A 2GL5A 5AVNA 3SRFA 5HMDA 4G1KA 2ZXAA 3FAXA 2DV0A 5HDRA 1NTHA 5D2VA 2GQ3A 1LUCA 2VDHA 4J28A 4R33A 2ZDSA 3KL0A 5KITA 2ACUA 4TV5A 4ZXOA 4N9EA 4OU1A 3RLHA 3W70A 5KZ6A 2I16A 3R0DA 4D9PA 4GXPA 1KFCA 1AW1A 3C56A 4KETA 1VB9A 4UTTC 1Q13A 3GYCA 1AZ2A 3R0UA 4JN8A 1JL8A 2QMJA 5GNYA 2JEQA 5E0CA 2NQZA 1RQEA 2YZRA 2YA2A 1EGMA 1JR1A 2P0IA 1BTCA 5G1TA 4FNTA 4DAFA 3N4FA 3WJXA 3IIPA 3B9DA 2V30A 3R4IA 1JCNA 3PY2A 1VJIA 3WEZA 2NX1A 2BZNA 2ALDA 1UWQA 3CZEA 3VOCA 4I5UA 1SM9A 1SJCA 1SFJA 1DBTA 1AJ0A 1RD5A 2E28A 1KO0A 2ATMA 5LSMA 3GH5A 4DHGA 4YS1A 3CPUA 4B3LA 5TAOA 3FJ4A 1XH2A 3E2QA 4XG1A 4CU8A 1EJ7L 1RK5A 4FXSA 4WCJA 1W3LA 1OYCA 5I07A 4F0LA 1Z7AA 4AWSA 1WE5A 2ISDA 3LBOA 2CWXA 4S3JA 1P0KA 4H9XA 3P81A 3ZJ8A 1XYMA 3EDKA 3SUUA 1YTKA 4AD1A 2GWGA 1X39A 3UWYA 1MVYA 3DEQA 4ZXLA 3T4WA 2WZHA 4DBUA 3UXKA 1TB3A 3FW6A 4UCFA 4LALA 2V3FA 1Q66A 1E71M 2DSKA 4LT9A 1YXCA 1WKDA 3M5VA 3UG4A 3ITGA 1H7NA 1FWHC 5TBOA 4F9DA 4MTVA 1YDYA 1HGWA 4AIEA 3LXBA 4K8GA 4DXXA 4OWGA 4R88A 1PUDA 3A47A 2ZA2A 1DJHA 1LBFA 1O5KA 4PMYA 5LKYA 2NZLA 1J5TA 1EEPA 2VELA 2QV5A 4UTMA 3TIMA 2BVWA 1UC5A 3LHYA 1FRBA 4S2CA 4LUIA 2V3DA 1S5VA 1UR2A 1J0JA 5TQLA 3FA3A 1FWFC 1KRAC 1G9HA 3M0IA 3GW3A 3W1UA 1Q6RA 3BSGA 1P0EA 3AS0A 4PUEA 1RPXA 1HNYA 3L4XA 1OD8A 1R3SA 3N13A 2Q8LA 1MW2A 2VCBA 4JOMA 3TW9A 1H2JA 2Z6IA 3DFOA 3U7VA 3WNPA 4D1IA 3OGRA 2I1OA 4Q4QA 4HJFA 4ZCWA 4GY0A 5E6ZA 3UETA 3NPXA 1R3YA 2ISSA 4FOJA 3Q45A 5DLCA 2D73A 1GQKA 3VIHA 1SQ7A 2RGLA 1K03A 1NP0A 5LIXX 1PTDA 1VCGA 1J5SA 1OM0A 3V75A 1R9YA 4US5D 4B3KA 3I3EA 1N82A 2PRLA 2VFFA 2IPGA 4IQJA 2ZVRA 2HS6A 1RVKA 3WY1A 3P6LA 4HA0A 3QGVA 1BF2A 4C5ZA 5I79A 3G22A 3RMEA 2FB3A 1E9YB 3IGHX 3SCRA 1KRBC 3GFYA 4YTSA 2A3CA 5DFAA 2PGEA 3SB0A 3S46A 2PU1A 1OG6A 1OVDA 4NRSA 1V03A 2XH2A 1QNVA 5XIAA 3MBFA 1JG9A 1FOBA 1PVNA 2QJJA 1WKFA 2OG9A 1MEWA 4XAGA 4DLFA 2OPJA 3G18A 4PYSA 3KOYA 4PBEA 1ONWA 4DZHA 3ZYZA 3TJLA 3IGUA 2HE8A 3W25A 3AXHA 4G2DA 4NASA 1K7EA 1DORA 1ISWA 1XCFA 1PL9A 4FB7A 1EJUC 2CBIA 4QE5A 1ITCA 1EX5A 5CSRA 1EBGA 4QNWA 3NL5A 2WNNA 3BLFA 4QE4A 4DPPA 2PZ0A 3G1DA 3UG5A 1A5SA 1EP3A 1E6XM 3VXGA 1LQ2A 5FEWA 1KR1A 3EB4A 1P6CA 3PJWA 3AMLA 2FHFA 2FVLA 5CBBA 2JKPA 1GK8A 4RUBA 2P8BA 3W76A 2IXVA 5EU9A 2V2CA 3W7RA 4GIYA 2C18A 3WLRA 1JZ2A 2BOGX 1Y65A 2OT1A 1V7YA 5HPOA 3GG8A 4ZODA 1IE7C 3IVTA 3S1XA 5IBXC 2D2HA 3CEPA 5HNNA 4K36A 1JPKA 4BF5A 1F8MA 3VNJA 2IKHA 2WCSA 2ZA3A 2V69A 1A5MC 3R13A 5E0KA 2WW5A 2Z2BA 3WBXA 2Y85A 5JH1A 4P8VA 2GDVA 1CYGA 2DZVA 2Q8XA 2Z1XA 3GBDA 2G3JA 8XIMA 3ES8A 3VTRA 2WMIB 4HNOA 3T81A 4DYEA 2ODOA 1P0BA 4XV0A 1K9EA 1TWIA 1TVLA 5A8GA 2EG7A 3VD5A 3OG2A 5EGRA 3H8AA 4PRWA 4DYKA 3H7VA 1QT1A 4H6RA 1FH7A 4XAFA 2YYUA 1TSIA 2AL2B 3BH4A 1H11A 3XINA 3QEZA 3CV1A 4DWSA 1REQA 4Y7EA 2XFWA 2V2HA 3LPOA 4QNEA 3LHZA 3V18A 5DMNA 1JAKA 2W92A 2YFOA 1A3HA 4FLQA 4C91A 1FWRA 1RSCA 3GTXA 2VNCA 3H21A 3W1AA 1U5VA 4G5DA 3KP0A 2V5JA 4DJDC 2W6RA 4EK7A 3OW1A 4NAFB 3R89A 4JEJA 3MMUA 3VZYA 4DNMA 3KZPA 6REQB 5B7ZA 3S8HA 1QPKA 3N9RA 5C54A 3QTGA 4GKLA 2FDMA 3KAOA 4MMWA 1LP6A 3CPRA 1GVRA 1OJXA 1BVNP 2Y70A 1M9HA 4JQAA 1O1ZA 3W26A 1FKXA 1QNSA 3F4NA 1C90A 2DH2A 1UWUA 3AHTA 4MNJA 1NAL1 3QJAA 3M43A 4QJ5B 3W07A 3LNPA 5DCDA 2X7WA 4LV9A 1A4LA 4WQ6A 1VYRA 1F6KA 2BP1A 1DOSA 4UOQA 3U2OA 4H2CA 4PMDA 4PTVA 1C8YA 3EBVA 2CETA 1B3OA 5ABTA 4O50A 5HJXA 3THDA 4HVXA 5AB3A 3RCMA 1CGUA 1US2A 3DHUA 3VUPA 1X7IA 1T0OA 2WMHA 4EAYA 2ZIDA 3ME3A 2Y8VA 3KBMA 3SECA 2REQB 1NQKA 1FHUA 2H9AA 3WF1A 2ANUA 1R2TA 3BAJA 4F2TA 3SI9A 4FF7A 3OU8A 1X97A 4QR6A 2WZMA 5EPDA 3R58A 2XTKA 3EDDA 2HDJA 2CLMA 1W17A 3W84A 1WDQA 4RPQA 4IMCA 3S6TA 3VCNA 3XISA 4B4FA 4MM1A 2XVGA 4V27A 1ZAHA 3Q37A 5E5CA 1VH7A 4GC3A 4XSLA 4DZIA 5HNUA 1N7KA 4NILA 3STEA 4O13A 2UV8G 4EVZA 1W5NA 4N42A 3I7SA 3QFEA 3SUTA 1QOQA 2QCDB 4Q33A 5FJIA 2J25A 1F4HA 4S3FA 3UR7A 3RX2A 2C7FA 1NJJA 2O0TA 1K1DA 1TPH1 4O0QA 4LS2A 2V9DA 1Q3NA 3HPSA 1V3IA 1NWSA 5DMLA 4WHBA 2D3NA 2FJKA 1CBGA 3AHVA 1VEPA 3VO0A 3FA4A 1VFTA 3FCPA 2IXUA 3S2MA 1FCQA 4Q4SA 3I68A 2CESA 4GX9A 5HXMA 1BSIA 5FEPA 4O0KA 3FKKA 3S2LA 1H4PA 3SCTA 3TAKA 3IIZA 6XIMA 5A69A 3HURA 3URNA 3GR7A 4XIAA 3LMYA 1R3RA 3CYJA 3BPWA 5F4WA 4UTKA 2I57A 5JXQA 4KIEA 2G3MA 3OLIA 1JJKA 1UD2A 3CU2A 1KXHA 1XYFA 3L5AA 3N11A 2TMDA 1M04A 2D22A 3ABQA 1QHPA 2DIJA 4DF0A 4I9MA 4YTRA 1W5MA 4QSHA 1BXBA 1POJA 1RP8A 2PMQA 4BHYA 2PGFA 2QXWA 1BFNA 3N3MA 4Y6GA 3VE9A 5LNRA 1R9XA 4KCWA 3VC6A 4UTJA 5AY7A 4E4FA 3ARPA 1M7XA 4RNFA 4E0CA 3O9NA 3C0JA 5E09A 4ZB5A 3B9NA 3C4UA 5A6TC 4LUYA 1F76A 4OZOA 4KKXA 4IMEA 4OVXA 1KCXA 2JGQA 2G4JA 1M1BA 1H5VA 2FKPA 4JR5A 3DFTA 4S3CA 2X0YA 1CI1A 3U2CA 3HV8A 4JQ4A 4MYAA 1FWDC 3THAA 5EMJA 2OO6A 1EO5A 3ALFA 3C0LA 3N9KA 3P93A 3GDKA 3V7PA 3CV7A 3SN4A 3O8AA 1R86A 4AG0A 3EGJA 4HN4A 2GQ9A 4KFOA 4IG2B 4ZQPA 3C0SA 3PZQA 3SZ8A 1PAMA 4O4VA 2ISWA 1V6UA 4RZ4A 3EX2A 2VR5A 4O0ZA 3SCQA 1M68A 4GY7A 3SRKA 5H2ZA 3GNXA 2I9UA 1FWSA 1US0A 4AIUA 3TROA 3V0UA 1XIDA 4YIWA 3S47A 2BDQA 4P8XA 1FBAA 2D2OA 4UOZA 2CHOA 1AD4A 3WJYA 4GNKB 4C6DA 1RH9A 4LVBA 4W93A 4FHAA 1RHCA 5GNXA 3VOHA 4DBWA 2J7EA 3RU6A 1TKKA 1Q63A 1CECA 4M19A 2O9PA 4H7CA 3WLIA 2QIWA 2CFFA 5HWJA 4ADSA 1VPXA 3UJRA 3F5LA 4PBGA 3O2LA 3LDVA 3IAPA 2DVUA 7TIMA 4ATWA 1E6ZA 4IQLA 4LUSA 2W62A 3KBVA 5AYYA 4N7QA 3SY8A 1I8JA 1EPXA 3LRMA 3IJ8A 2BNJA 4OE7A 4US5A 4P7OA 3KOXA 4O12A 5I03A 1W2PA 1O4UA 2RDXA 4FOUA 4BWLC 1DHKA 1EJXC 1G67A 3A4JA 4EPBC 3OODA 4AEOA 4NZ5A 1OK4A 1VFHA 1J0IA 1ZBCA 4MB1A 1ODUA 1EB3A 3ANYA 1G6CA 4O11A 3F4CA 3LB0A 4DN1A 5FAJA 4PMJA 1VIZA 4MKNA 2ZRWA 4E2VA 3LCWA 2RDUA 3TYBA 1QI0A 1WUFA 2YZ5A 3HQNA 4NZ1A 1TZZA 3WD1A 2D69A 1F74A 1HF6A 3W7KA 4PFHA 2WHKA 4MZYA 3BJSA 4JHZA 1BQCA 2QPSA 5D04C 2WKGA 2WSYA 3UCDA 3P61A 3TYCA 1EHAA 2YR1A 4H9VA 1JYVA 3HPZA 4O53A 4B5SA 1G4TA 1CX9A 4RE0A 2O7SA 3C8FA 4GBUA 1LQ0A 1OX5A 1UH2A 4MUPA 1OYAA 2NUXA 4J40A 1GKPA 2V67A 3VM5A 2EQDA 2GSHA 2DQWA 1TE6A 2PLCA 2INZA 2WHJA 3C52A 4LBRA 4NT0A 4A05A 4M24A 5HWNA 1Z32X 1SZRA 3STPA 4C7DA 4RXFA 1OCBA 4XZNX 3L66A 3P8JA 4DBSA 2P50A 4OQVA 1TREA 2E68A 2DW6A 5EFDA 3NYDA 4FS9A 1P4CA 2G95A 3MJYA 2X0HA 1GJPA 1PHQA 1IZKA 4ZE4A 5I2UA 1LF1A 4G9PA 5ABFB 3MI3A 3UZWA 1Z3NA 2W0UA 3W86A 4F0HA 3EPNA 1TJ2A 2GJXA 3BUVA 3WNKA 1KGUA 4RE2A 4Q8OA 5AC5A 4I90A 1EGZA 3E2VA 2DT2A 3PJTA 3DDMA 4GVFA 3HGOA 4IP4A 4ACZB 3K30A 1VBUA 2BY1A 4KFNA 1XH1A 1IV8A 1KA9F 3A4XA 3SY1A 4B5WA 2EBNA 2LLEA 4NAEA 5LA0A 4DF2A 3V5OA 3CT2A 1K70A 3TXZA 1KKRA 2BXZA 4K2SA 1J93A 3NPVA 3S5NA 2J7HA 3ZT6A 1WUEA 1XYAA 1EC8A 2GDUA 4WJ8A 4R34A 4EWJA 3N25A 1WZAA 2DIKA 3B8SA 3WDIA 1VFOA 3ARZA 4HYWA 1IT7A 5C9ZA 4J2PA 3NTYA 4IJRA 1IXQA 4Q4RA 3BLIA 5DMYA 2AL2A 4YVPA 1EHNA 4O1EA 3L21A 1XGDA 4OBRA 5A2AA 5HR6A 3QR0A 1Q8AA 2PDCA 1XLLA 3VIKA 4QJ3B 2X1RA 3BGAA 2D24A 3FAWA 1C93A 4D6EA 3FEQA 2OWCA 3N2MA 3AXXA 2RDWA 4MB4A 1JI2A 4IX0A 4U10A 3BSHA 2NLYA 2IS7A 3W1PA 2R8WA 1HO4A 1HKWA 5I77A 3OBKA 1LL6A 3MCOA 4RJEA 4HZ7A 3FHAA 3PWAA 1KQYA 2V3GA 3DERA 2C71A 1AQ0A 4AFYA 1EWEA 3OYZA 1S38A 3UPMA 4NJHA 2YCKX 3NQ8A 3TVAA 2FTPA 4HB7A 3N4AA 7TAAA 2J6VA 4PMNA 3NO3A 2Y7DA 4FIRA 4H6KA 3RPDA 3QN3A 1NDWA 1X1ZA 4C1KA 4Z2JA 1YBQB 1QO2A 1TV8A 2W9MA 4JEQA 3RUBL 4MB3A 3W1XA 4IPNB 5LZLA 4BK9A 1CW2A 3FNDA 4FZIA 2XSAA 2AGTA 3BW2A 2PDKA 2NSOA 3RU8X 1B4EA 3G1AA 3WG6A 3UJ2A 2ZZ6A 1G1YA 1U83A 2X30A 4ZQCA 5BZAA 4PTMA 3B4UA 5KEZA 3CAKA 3ZJKA 1Q7ZA 1S1RA 2RJGA 5I3JA 1J4EA 5BXSA 3I7QA 4M81A 3E1F1 3QKEA 3R8HA 1VZWA 3U57A 1O94A 3ZXWA 5A2CA 2FHBA 4UFKA 5D09A 3WF2A 3RDKA 2J24A 3BC9A 4X60A 4UMCA 4UMAA 4A4AA 1J10A 3Q4DA 4QJ1A 1VR6A 4ADUA 2I14A 3K4DA 7REQB 4I8YA 2A7NA 3VZXA 2Z25A 1JF5A 1FY6A 1QAPA 3VMOA 3FDKA 4F4RA 1M01A 1LLOA 2PBOA 3CT7A 3ARVA 3O06A 5IHSA 1A50A 4YTQA 4TMCA 3O07A 3UA3A 3URQA 4JKMA 1E6NA 1SZGA 1EC9A 3QM3A 2E5DA 4AC7C 3GU2A 2PWDA 2E40A 4GIEA 1TZ9A 1J0YA 2AL1A 3GE7A 2HSAA 4NF7A 1SJBA 3WENA 2VRKA 3LGDA 4Q4MA 4JIRA 3E0FA 3L2IA 4J3WA 1UR8A 1A80A 1C8XA 2W3ZA 1UKQA 3GZ3A 5FA5A 3SCWA 1CEOA 5DY3A 4CQAA 2WC3A 3W53A 3ZLFA 3LTSA 3A3WA 5FF7A 1LDCA 2H90A 2Y6ZA 4ERGA 5AC6A 4E8DA 3W6MA 5H8MA 2PRMA 4ZL1A 2YXXA 2EPNA 3B8WA 1I2NA 2DEPA 1UROA 4PRTA 2C79A 1NOUA 4TX8A 1RBLA 2DUAA 2PLJA 4JKKA 1PS9A 4DO6A 4PMVA 1YTEA 2ABBA 4YYFA 3BURA 2YL8A 4PSRA 1IZCA 4WXZA 1J6OA 2NXGA 4LVGA 3RF9A 2VGIA 4ROQA 2ZRZA 3S1GA 3WK3A 4H41A 4JTJA 3GFXA 1O5XA 1K4GA 4LAKA 1F3EA 1RA5A 4ACYA 1HT6A 3N2BA 4FNSA 1G01A 3TA9A 1UD5A 1J18A 2F84A 2PDWA 1OQFA 3E3HA 4FSAA 1HX0A 3HQPA 4G8TA 2OKOA 1PZ1A 4LS1A 4JNZA 2DJLA 1B3XA 3EXTA 4OJYA 3TTYA 4GQQA 2GVLA 3S6DA 4OOZA 1B9ZA 3B0YA 5CPOA 2YCLA 1PIGA 1RLDA 1VD6A 4R7OA 2XIIA 4L4LA 3KCJA 2W61A 5L9FA 2GVYA 2FYMA 3HGSA 1ISZA 1R2SA 4W7WA 1CXKA 4TVUA 2GOKA 4F8XA 3OQ8A 3ITCA 3SEPA 4QQ3A 5E1QA 3M16A 3QR1A 4LC8A 5F4SA 4MF4A 1W9BM 2ZX8A 1K02A 2UWFA 3ONBA 1ITXA 3QSTA 1KM0A 1C8VA 4JZ5A 1SYTA 4AHOA 4DYJA 1O68A 4KEVA 1XYBA 4KS0A 1TMHA 2OX4A 1XR2A 4CU6A 4OIFA 1ONXA 2VEIA 3W2UA 3WCZA 1AW2A 3KBWA 3UZZA 3RR1A 2WKLA 3PSVA 2YIHA 3M0KA 2XIJA 3KL3A 4HU3A 2HROA 3A4WA 3B8VA 2FLIA 4A8LA 4LNYA 3SDOA 3NFUA 3DESA 1P6WA 4K39A 3GVWA 2X09A 1US3A 1YXYA 4P8WA 5TIMA 1W1A1 3TWBA 2DGAA 1PBGA 2DDXA 2O7QA 1F6PA 5DANA 3CQJA 1JRBA 3LZ3A 3IVUA 1FKWA 3HMCA 1DIEA 1TPDA 2KX9A 5JVLA 4HJWA 1BSLA 4HYRA 1EZ2A 4D6IA 1FP8A 5AHFA 1BWLA 1YX1A 3ZZ1A 2Z7KA 4LF2A 4NZ4A 4IXHA 1XICA 4PMOA 3RLGA 4A3UA 1WCGA 2QJIA 4W88A 5ABHA 1EJRC 2AQVA 3E5BA 3JZEA 4A8IA 4KWWA 2P8CA 3PF3A 3PNZA 4FPSA 1ZPTA 4QDMA 4GINA 3N4EA 1Q2SA 2W27A 3BE7A 1D8CA 1BAGA 2VVNA 2WCGA 1A5BA 3PHAA 4JIQA 3RLVA 1P5BA 4MDPA 1XI3A 1VBHA 5C2CA 1GOOA 1V3HA 1W9VA 3QYQA 4GC4A 3P3BA 4LYPA 3PB0A 1EF3A 3GLCA 4EF9A 4ZVJA 2TODA 4TXEA 2ZX6A 4NI8A 2OX1A 4N4QA 3AHZA 3TA6A 3G1YA 1PE1A 3WUGA 5A6KA 5HULA 2QGYA 4GY1A 4RW5A 1YLVA 4AXNA 5C9RA 3M4HA 1K8CA 3AZSA 3OVRA 1JVNA 4AQLA 2ZUSA 2TPSA 5FKYA 1OB0A 4ZQRA 3P14A 2NV2A 2OQHA 1S5NA 3QPEA 2B0MA 3BOLA 3VOGA 2XVPA 1TVPA 4J35A 3R0KA 1R3TA 1XRSA 2PDIA 5I02A 3VDBA 4GOAA 3WMCA 5EYWA 1VFMA 1B54A 4O14A 4C1NB 2WVVB 2DUXA 4CQ9A 3TYUA 4RNJA 2A6LA 5CH9A 1SJAA 1W5QA 3ECQA 3T1GA 3LQLA 5KETA 3QRHA 4J4KA 1BF6A 4RX0A 2PCQA 3Q67A 2Z1BA 4MUZA 1LQAA 3KLKA 1QMLA 3N29A 4CLMA 1ADOA 1SU5A 1EPVA 3WMLA 1C8QA 4M7SA 4YMZA 4EF8A 4C6KA 1KFBA 4L6OA 3BV7A 3KWXA 2DZBA 1BXCA 1CPUA 3LI0A 2JQXA 2HVMA 4JY9A 2P76A 3RK8A 3EYPA 4W85A 4GKTA 1JPHA 1JZ5A 3V1HA 3USBA 1D7KA 2O9OA 4GIRA 3ENLA 2QUNA 1MRAA 4B4HA 1EO7A 4ACZA 2VX5A 1WOBA 3CM4A 2F6UA 4GUIA 3CL8A 4J27A 4KMQA 3WQEA 4XQ6A 3DI0A 1F61A 1H7OA 3CHCA 3GHUA 4AZCB 5I78A 4TV6A 3RN6A 3VKCA 2PTXA 3VDCA 2ZTKA 3R94A 2V2DA 2GWNA 5JMUA 4KGLA 1OX6A 2YXOA 3KBSA 4GMEA 1WXJA 4HHHA 2CKSA 5M17A 4XTIA 1AQHA 1W9UA 4A22A 1DWIM 2PDHA 1MQPA 4I9TA 1JQVA 1I9CB 3HU7A 1HJSA 4C7GA 1TMLA 1GVOA 2C1IA 4HNTA 3FX4A 4PUKA 3ELFA 1H60A 4UFIA 1B3WA 1F3XA 4H83A 2VD9A 3TWAA 4GXWA 3C2RA 1TV5A 4CNOA 3EAUA 2QDGA 1V79A 2FDSA 3PBVA 3BTNA 4I6KA 1UHVA 4XVEA 3OGSA 3KS5A 2ALRA 4AZ6A 1TZ7A 2IQ0A 5CZTA 1IGWA 1V0LA 5EKYA 3GO2A 4AXKA 1TWSA 4GGBA 3VDAA 1RPKA 4JTSA 4OV4A 4UUIA 3GIYA 2POTA 3NL6A 4TVDA 3KDOA 5I23A 3WIJA 3ZS4A 3OVPA 4LVAA 3V5CA 4XD3A 1FDZA 3KL5A 1EKOA 2ZADA 2E6AA 2ZE3A 2C8NA 2PODA 3UXIA 4NRRA 4WGHA 3NAVA 3LGGA 5HWMA 4IJCA 1SUXA 1NH6A 1QCWA 2R1LA 3A21A 4JCLA 3TKFA 3INPA 3KLLA 2CW6A 3ES7A 1H41A 1JD9A 3AS1A 3LV5A 2X42A 3CWNA 1TMQA 4M56A 3C5QA 3C61A 2CNCA 4M8UA 5FIPA 3VGGA 2Y7GA 2JE8A 2XH0A 1XF0A 4JTAA 3MV11 1FUYA 4KERA 1E6QM 4H3DA 5DY2A 4QFUA 2GDQA 5CGTA 1YMYA 2ZZ2A 1V0KA 2Y5JA 4L9XA 1RR2A 3BJTA 3ZJ6A 3DFYA 2WNZA 5HUOA 3T08A 1DJQA 1PTGA 1WXZA 3H2EA 3UVIA 1RBAA 1GTEA 1XM3A 4M0XA 4IGSA 4LY8A 2DVXA 1CWYA 4JS3A 2WAGA 4QAIA 3PULA 5EFFA 1FDJA 1WBHA 3NXLA 3LHWA 3ITVA 1OGBA 1P1XA 4ERAA 4JIEA 1XV8A 1LL7A 2YL9A 1VPYA 2Z1SA 1NFGA 1UR3M 1OCQA 4XBSA 1F4AA 5LXXA 1TPB1 3PZIA 4GG9A 3CPGA 1V77A 4JTGA 1E1EA 5KTLA 1XBXA 3OLDA 1E0UA 4O52A 3UJEA 1H0IA 5CSSA 1WDPA 3NQVA 1SSDA 1UPPA 1C9DA 2XYLA 3TC7A 4D8ZA 1F2JA 2P53A 4Y9PA 2E3ZA 4ICMA 1OWQA 4HNVA 3SAZA 3M1ZA 3FK4A 4KQNA 2J9YA 5LIUX 3MO4A 2ZZ4A 3OG3A 5AYZA 1KR0A 1YDOA 1EYWA 2BY2A 1JZ7A 2NQLA 1Z8AA 1V7AA 4WDXA 4C5YA 3WUFA 3B05A 1QHZA 3UWEA 2AMXA 3SFKA 1W3IA 4WLCA 3H2AA 4J3TA 1DQWA 4P8UA 1GG1A 3S2JA 4GUHA 1I4NA 4OECA 4EP8C 4O54A 1HKMA 3E12A 2Q02A 3ABRA 3R12A 4DNHA 2RGMA 4MFDA 4U3AA 1IGSA 5HJYA 2WPBA 1QWKA 1I75A 2Y7FA 1PCWA 5AZ0A 2NVAA 1TV4A 2VXNA 4S23A 1P48A 2H8XA 4QX4A 2BOEX 4DUXA 1KCLA 4E38A 1FWAC 1E55A 3W22A 3PFMA 1BYDA 3MHGA 4ZQOA 3AIQA 2WBGA 3PB2A 5HINA 1LZOA 5C71A 1ZJHA 3K8LA 4N02A 1TX2A 3PP7A 3DKJA 3QVQA 4R85A 2PEVA 1MW1A 4EAMA 2EPMX 4C6NA 1WA3A 3LBMA 3ITXA 4K8EA 4B92A 2PBGA 3F7JA 2C91A 2CLPA 3EWZA 4QP0A 2ZRXA 4AW7A 2A3HA 1OC7A 1K9TA 3CZGA 3DCPA 4XAZA 3HV9A 1BYCA 3VGFA 4W84A 4AZGA 8XIAA 3E0LA 2R14A 4A8NA 1VFSA 3AMDA 2O9RA 3UT0A 2HISA 4MGGA 3S9YA 3UG3A 5D2YA 1FA2A 4XD6A 3DIPA 1WDDA 3T8LA 2OU4A 5D4YA 2A5HA 4LSBA 5FD0A 4CD8A 3ZWTA 4B15A 3E6EA 3HGJA 1XLIA 1XJBA 4HOZA 1A5KC 3FN9A 2I5IA 1SZNA 1XW8A 4YJ5A 3VFLA 1A3XA 5D32A 3WD0A 4HMDA 5HUPA 4JKLA 5FAGA 3PBWA 3L2LA 4UFHA 4CNSA 3WBAA 2YDSA 4ZR8A 1YW1A 4YWSA 4EPKA 3QMTA 3MHUA 4H8NA 1DJIA 3AHXA 1S46A 2CBJA 3L9CA 3WL0A 1KXQA 5A6JA 4DM2A 4GZEA 3TSMA 3EXSA 1TPC1 3LBCA 4OBTA 3MP5A 1LM1A 3AYSA 3EOEA 1NWTA 4I3GA 2ZC1A 1WDSA 5CZJA 3BLPX 5FJUA 5A8QA 5EMYA 4MWAD 2BGSA 2WJEA 3VNLA 1YPFA 4WKFA 5T9CE 4YL2A 4NKCA 3VGHA 4M1BA 1LRTA 5IRPA 4ZOBA 5L6UA 5EBAA 4OTKA 3OVQA 3TDFA 3TYDA 2XH4A 3GM8A 3WFAA 1VBJA 1EOKA 3FJNA 1NDZA 3J7HA 4L5ZA 3TTQA 1EYEA 3VNMA 2H8ZA 2BX7A 3O6YX 1DJXA 3TW7A 3TC6A 3P60A 1KC7A 3GIPA 1IEIA 4HZ6A 4L61A 1ZU8A 4R9OA 3EMCA 1WBJA 6TAAA 2AQWA 3ORWA 4DAIA 3D3FA 3LNMA 4Q8QA 3B9OA 3G3DA 4GBDA 3ZR4A 3GXFA 2QAPA 4A3YA 1DWAM 4LTSA 4AY1A 3RIKA 3W82A 5AVHA 4TTUA 2ZXBA 1MYRA 3KOFA 2CKRA 4O4WA 2OT0A 2X2YA 1BYBA 2XN2A 1ME7A 4IFKB 3CHDA 2HCVA 4H8UA 1Q2RA 3W7QA 1V6VA 5I7GA 4GQBA 4AB4A 1N8FA 5K9CA 3QQWA 4IHCA 3CTLA 1YKWA 3DHFA 2GK1A 1L8NA 4ZSUA 2E6DA 4J9JA 4I6VA 1J6PA 1R47A 5D03A 1UZ1A 4UTFA 3A24A 3OQEA 3PC0A 5CJNA 4PUMA 3IJLA 2A2IA 1VJSA 5U4NA 1ZNNA 1ZP3A 2EPLX 4M6UA 7XIMA 4GABA 4RDYA 4HNUA 2CZDA 2OSYA 3WQCA 3DBNA 4UQCA 3G6LA 2DZTA 3KRUA 2BVYA 2UZ9A 2UY3A 2XUCA 5CZ0A 1TUXA 3M0XA 5EMMA 4TO8A 4HOXA 4RL3A 4LUTB 2GQAA 1S1PA 4MG4A 3CHEA 1PJ9A 5BRPA 4IFRA 4HNLA 3B8UA 1LWIA 1QTWA 2WXDM 3DYPA 4UR9A 2R1PA 4Q8MA 3QQ1A 1FWIC 3L4ZA 4O1CA 1BRLA 3W2NA 2BHYA 3GZAA 3KFTA 3KVMA 4IF2A 5I00A 4M82A 1NARA 4H9YA 5CXPA 4FX7A 4C1LA 3BG5A 1PYMA 3MO7A 7PTDA 2QGHA 4IMGA 5A2BA 4DI8A 3WD2A 1JGMA 4Z17A 4JX6A 1QASA 1ISYA 3W2MA 4QDWA 1I2QA 3CS2A 2QMKA 4MZ8A 4HIBA 1QK2A 3B0PA 4E2OA 4O1AA 4CNPA 6XIAA 4D2JA 1XRVA 4EPDC 1X98A 3U8GA 2ZXQA 1QWGA 1NQ6A 2XH7A 3EWCA 4JTRA 3L4WA 2YDAA 2QCEA 1U5JA 4H04A 1AQFA 3H4GA 3GSMA 1YE6A 5D8ZA 2R9RA 1XLAA 3W7GA 1SO6A 5CJ5A 3TTSA 3W24A 2WM1A 4KEUA 2F6KA 5LGZA 1UKSA 4AYGA 2BHZA 3H12A 1UIOA 3UR5A 3M5XA 1W3JA 3B0UX 4B5UA 3TYZA 3T0AA 1LL4A 2EKGA 1UG6A 3W74A 4G7FA 1GEQA 1V5XA 5BXPA 1KFEA 3NA8A 3HTWA 1EXBA 2HWGA 4H19A 4ZE5A 3IJ9A 3WQOA 1VLWA 3GVGA 3WBWA 3LA4A 3FYPA 1J96A 3I6TA 4M7TA 3VIMA 2WMFA 3G1FA 2AGKA 1K6WA 3NDYA 4ZO9A 3LLFA 1NSJA 3SUVA 5K9DA 3UZ5A 4WSKA 1KKOA 3JVAA 3N17A 1OABA 3LS9A 1XUUA 3NPUA 4M29A 3TZNA 3VIJA 3FS2A 1RQHA 3VPLA 3SUSA 3L5LA 2RHGA 3BICA 2GSEA 2E25A 4R53A 4UFMA 4FR1A 4LOCA 3UU0A 4AX7A 3OPSA 4NJGA 3H70A 2CXGA 4LB4A 4PH6A 1HVQA 1XX1A 3A6OA 3LMZA 2E09A 3R43A 3R7MA 1CENA 2EAWA 1VAHA 1KM2A 2YA0A 3QLDA 1V3LA 3TN3A 3IJIA 1FCVA 3C3NA 1IF2A 1IQ8A 4P7NA 3KVJA 1W1VA 1ICQA 2QUMA 1KWKA 3ATZA 2VFIA 3EEZA 3CL6A 1UH3A 4L7ZA 2OCZA 4NZ3A 1WX0A 2QUVA 2BFGA 2ON3A 3TX9A 3UWUA 4JAWA 1KW1A 3MDWA 5ABGA 1Z69A 4GQRA 1GG0A 2E1WA 1UUQA 4PTWA 5BOFA 3WELA 4GUFA 5C7VA 3QXBA 4JYEA 4FF5A 3ZVHA 4AZ5A 4OV9A 1RUSA 1TPWA 1FFRA 1F05A 2VURA 2AMGA 4KEMA 2FIQA 3HFYA 4Y96A 4I9AA 1KCKA 3WQ4A 4FOKA 4X0NA 3TR2A 3GG1A 3GX9A 4DJEC 1C9WA 1TX0A 1F07A 1NP2A 3AJ7A 1BHGA 3GDMA 3H2OA 2OEJA 2VRQA 4PODA 5SWUA 3ISIX 3T7VA 1B1YA 1UYQA 3C86A 3OYXA 5C0QA 3SY5A 2V5DA 5T26A 4QBXA 4F9JA 1HFBA 1OGGA 5G1YA 5M03A 5AYIA 2NV1A 4ZO7A 2XHYA 2VFDA 3MSYA 5I3HA 4RDWA 4IJBA 5G4HC 6PTDA 2WLZA 1JDAA 3S6OA 4AX6A 2ZUMA 1WQ5A 1TCMA 1IIHA 1XIJA 1MWOA 9RUBA 5KZDA 2F6XA 3NL2A 4QRNA 1JUBA 1AVAA 1UD8A 2FGBA 4FXRA 5J5RA 5HQMA 4HZMA 5C2GA 1LCOA 3CZJA 1X1OA 1NOWA 5GVJA 1JCJA 1JFHA 3GDBA 3PAJA 4AY8A 4GLEA 4XIMA 3GNRA 3PPGA 4U28A 4LQ1A 3NZGA 2EG6A 4J5NA 1UWSA 1M5WA 1PDYA 1AJZA 5E9XA 3WFZA 3QHNA 3AS3A 3I4EA 4S3DA 2YCJA 4XZHA 2OR2A 2Z2AA 1GONA 3MVTA 2Z4GA 2Z7GA 1KXTA 3FJ6A 3NOEA 5K7JA 3AWOA 2CZ5A 2WC4A 1CXLA 3M6YA 2E0PA 4MY9A 2A7PA 3RPMA 4HCDA 2WZEA 3AXKA 1JPDX 3O7UA 2OQLA 1EFZA 2Y89A 3VOJA 2YGYA 4CEUC 4H6QA 3KVKA 1OCJA 1MQQA 2HNHA 1V4YA 3TNOA 4FLOA 4GUGA 2R82A 2R91A 5C55A 4MVAA 1AODA 3T8QA 3ZM8A 1OC5A 2UY2A 4H1ZA 5GQBA 2GJLA 1S3HA 1HP5A 2BS9A 4UOJA 4MZ1A 3T55A 3CO4A 3PUEA 3AROA 1EBHA 3RITA 4IT1A 2NQJA 4HGXA 1J0ZA 1YYAA 4XKMA 5CSUA 3QV9A 4DZ5A 4EIVA 4Y8EA 4GFIA 3RRAA 3QSRA 1KBKA 4UTWC 1FWBC 5C9XA 1MXGA 1JCMP 1EX1A 5D8WA 3V0SA 2DIEA 2VCAA 2ZBTA 2Y24A 2Z28A 3G2GA 5CLTA 1D2KA 1GOIA 4JN7A 4JIIX 2FZ9A 3NEVA 3ZOAA 4OBSA 3QZEA 1FWEC 1ALDA 3TMQA 3LSCA 4X9YA 3V1PA 1A49A 3IUIA 1X8FA 3P7YA 1NEYA 4JHMA 2DT3A 4NQ1A 4ZQNA 4W87A 5G4EA 1GOWA 1HUVA 2XJ7A 1OFPA 4CVWA 4IH3A 4MWAA 1T6MA 4NNBA 1M41A 3JW7A 2Z6JA 1TCDA 3VDHA 4OUEA 4P7LA 4GD0A 3VIPA 5HMSA 2YA1A 5AHIA 4DRSA 3AICA 3CB8A 4F0MA 4FXFA 4PUDA 3TV8A 2QPUA 2E4TA 3BCDA 1R3WA 3DX5A 3NQFA 3NO5A 1O66A 4E6MA 4XKYA 4WF7A 1R6WA 3W27A 3QC0A 3IUHA 4PR4A 3ZIZA 4H2HA 2FB2A 2QCGA 3A5VA 2PDBA 1KTCA 1YDNA 1RY8A 1OF8A 1KFWA 2PDYA 1S5WA 3ZT5A 3EEGA 4ROPA 1YRRA 4MFEA 4BF7A 1F9CA 4XO7A 3PNUA 3F5KA 1HQTA 2G4FA 4LFYA 1LG2A 3MHFA 2DSVA 4MIMA 1QNPA 2E77A 3LN3A 1XLKA 1GZGA 2PC8A 3OLGA 5D9NA 1FWGC 2XWDA 5D2WA 5CG7A 5BYWA 2QF7A 4O10A 2VO5A 4IP5A 1UP0A 3UNDA 3R8RA 2YL6A 4IFKA 1KM1A 1GKQA 4GYPC 5TNVA 4L4OA 2ZE0A 2YBVA 3AIUA 2OZ0A 1DWGM 5A8PA 1E6PA 2DORA 3KXQA 3QY6A 4GX8A 2CLFA 3TAOA 4XAYA 1EIXA 4JNYA 3MJMA 3E0IA 4H9ZA 3LRLA 3B40A 4V33A 4OOUA 1WDWA 3NR0A 2P0OA 1RJPA 3T40A 4CD5A 1SMAA 3P62A 4W89A 1ZL1A 3W7DA 3BXWA 4RZ6A 1CLXA 3GUWA 1M53A 4Z2HA 3HG4A 3G24A 2J6XA 3WDRA 3L2MA 3LERA 5K2ZA 2OSWA 4IPPA 1OFBA 2GZXA 2Z1WA 4UQBA 2QS8A 2F8QA 3R25A 1TWWA 1I6NA 2IQDA 3A9BA 2VC7A 2A85A 2WNWA 2WBKA 3UY8A 2XGIA 5FSDC 2VENA 2YJQA 1GPFA 3BW4A 1CXFA 3AUOA 4KT2A 1G4PA 1UWAA 1GYLA 4ZEPA 1L8PA 1B0IA 2QJGA 1Q45A 3SGZA 3UYIA 1UH4A 3B8DA 2DZWA 3DG6A 3AQUA 3HN3A 4GI9A 1ECQA 4EPEC 2C1GA 4QLLA 2QVNA 3W1LA 1A3WA 3E0VA 3APGA 4G7EB 2PTZA 3E0WA 3KZSA 4M6PA 2HNEA 1D7FA 4CN4A 3GC4A 3WO8A 1JZ6A 5K9XA 5AC8A 3O1NA 4YYCA 2J8TA 4ES4A 3NURA 4POCA 1KQZA 1P7TA 1CLVA 3DFSA 4JTHA 4TIMA 4ENLA 2V5LA 3H54A 4AU0A 4JXCA 1TTJA 3UY7A 1IXOA 3I6EA 4Q8PA 3RAOA 1XYLA 4QG6A 3S1VA 4LCSA 3HG5A 1FWNA 1WAUA 3TTEA 3AIWA 2VCCA 3U0HA 3KX6A 2YFNA 2V38A 3E02A 3GVQA 4QSFA 3DFHA 1V08A 2I56A 2VTFA 4R9XA 3DFPA 4M80A 4BQ4A 5AZ1A 3M0LA 1RCOB 3WF3A 3SCSA 3CTTA 4H8HA 5LYRA 3RPTA 4UWMA 3GDTA 4E3TA 4K1GA 4P2VA 2PE4A 5IFPA 3NIYA 1UASA 3MWCA 5H6HA 1JYWA 3N2XA 4EACA 5DRCA 1A0EA 4F48A 3OZMA 1E0VA 3H24A 4IIGA 1LT8A 2VFEA 2XFYA 4B90A 1RJRA 3UXLA 4HSOA 3ITLA 1HKJA 2WPGA 2X8RA 2F9RA 3PTMA 3F4VA 1CGWA 4UXDA 1JNEA 4O1FA 1NVMA 1XC4A 2HV5A 3AMGA 3BSMA 4B9ZA 2AKZA 2ICSA 3NQEA 3JZUA 1IWPA 3G3MA 1PZ0A 3T9PA 3OZOA 5CJMA 1HJXA 4JNMA 4RNIA 4MNKA 2Z1KA 3OBAA 4LX4A 3H7UA 3WUEA 4ZFCA 1PXGA 3N19B 2A0NA 3PZMA 3WBEA 2INEA 5D33A 2HMCA 4GFSA 2NLIA 3BVJA 3KDNA 1ZY9A 4MADA 3DHDA 4IIEA 3G8RA 1SFSA 5A6BD 1N8IA 4XO6A 2QW5A 3UPWA 3K13A 4LNCA 5FI8A 3V4BA 3TH6A 3TUUA 1QUMA 3W88A 3I10A 3G1SA 1CGTA 1XBYA 3UESA 1B31A 1NF7A 3ABZA 1W56A 1XH0A 3LXCA 4NL1A 1JZ8A 4AIOA 5C9UA 4S3BA 5A95A 4Q8WA 2WCAA 3P5ZA 2DU2A 1A47A 1BG9A 2F2HA 4DBEA 3UR2A 1J79A 4E3VA 3KTXA 2WZIA 1ESWA 1I60A 1TTIA 5D37A 1E0XA 1AMYA 3W71A 2FFIA 5JBDA 1DXEA 3AYRA 1YXDA 4PTNA 1KM3A 3H4WA 1GCYA 1XCWA 3M64A 3I65A 1KLZA 2INFA 5C6MA 1CNVA 2HK1A 3CMFA 2J7FA 4EXBA 1H7WA 1DTUA 1G7VA 3W85A 2PAJA 4Y9OA 3LEPA 3BMWA 4A2RA 3M0VA 4AVOA 2IKIA 4OKDA 1LOSA 4S3GA 5EY5A 3PPFA 9CGTA 3WJZA 1KGXA 4Q7IA 2OZ8A 1CGYA 3A23A 3W73A 1E1CB 2FTWA 1TIMA 1XLEA 4OFCA 3GR8A 1R30A 2X1UA 2CC0A 2QYGA 3CQ0A 1UR9A 4UTUA 1QPOA 1HP4A 3ZQ9A 3OOQA 3WD3A 1BYAA 1OCNA 1Q8JA 3OLEA 1E43A 4X2PA 3EMQA 1K8ZA 3KBJA 4GCAA 4QJ4B 2OYMA 1JDEA 5B7YA 1HIZA 4N9CA 3WK0A 2V6AA 3TFCA 3WH8A 1JI1A 1TR1A 4QQUA 2J8GA 4ATDA 4JTQA 5D38A 3H7RA 1W1B1 1KFKA 5MHBA 2MUCA 4JTKA 4GZJA 1DJNA 1P0DA 3IACA 1XQKA 3MKCA 5AHLA 4PC8A 1CZ1A 4JICA 3N73A 4KWUA 1KM4A 3AIVA 3WH9A 4AISA 1X1NA 3CIXA 1E72M 2PDMA 3QKZA 1DIOA 1DQUA 3LENA 2EJAA 3M7WA 3CLWA 1N55A 2Q09A 3TCEA 1OG0A 2V5CA 4CN6A 3FJLA 3OB8A 4UBPC 1LORA 5BXTA 1XYZA 4DJDD 1U22A 4K37A 4BI6A 2WSRA 4WD0A 3U5UA 1R2RA 1QI5A 2VKZG 2VR2A 1CDGA 1UBSA 4PBFA 3F1QA 3LG3A 2P3EA 1VCVA 3REQA 1DJWA 3MUY1 1TV3A 5JIWA 3F2DA 2OELA 3VM7A 3PANA 1ZHAA 3B06A 4NYYA 1GPWA 3LY0A 4IFOA 1D3GA 4LAMA 2CLKA 1V6TA 1OHLA 1TJ0A 1C29A 4GQ0A 1E9ZB 4M51A 1UQYA 1OX4A 2ZFAA 3MT1A 3UGVA 4BJHA 5BMXA 1LWHA 3E5PA 3W72A 1TJ1A 4QLJA 3UVAA 2XGBA 2ZQ0A 3QV8A 1QW9A 1XLDA 3CWOX 2A4AA 3S9ZA 1TV2A 4Y90A 2FZMA 4MWAE 2RKXA 4CEXC 2O92A 3SQSA 2EHHA 1WKYA 3H22A 3H6OA 2CERA 3LCLA 3QTPA 4GI6A 1QW8A 3TEVA 2D2JA 3HG3A 1GYMA 1TTQA 2VI0A 4PTDA 4F0RA 3ZR5A 1TWZA 1TQJA 3MYPA 1X6UA 3MVIA 4TVCA 3DZ1A 4BY3A 4Z1AA 3DU0A 3GXTA 3EWUA 3T0CA 1ME9A 2DSUA 5FF4A 1GYNA 3LOTA 5CPNA 3JS3A 3WH5A 3BAYA 2C0AA 1GT8A 4IMAA 1KBJA 2YW4A 4LU0A 5DELA 2HBVA 2BLEA 1M7PA 3CUGA 3U4FA 2FVKA 5REQA 3EOLA 3TQ0A 1XWYA 3EB2A 3GIQA 5T9BG 2Q01A 3E2SA 2DVTA 1V3MA 4UR8A 3M0YA 2NXHA 2G3FA 1SZEA 1W5OA 1KBIA 1BKHA 1GNXA 3G1HA 3NO1A 4UIOA 4ZQMA 4UNLA 3V5FA 1DVJA 3LHUA 4S2BA 1GVQA 5FSEC 2OKTA 7A3HA 1ZZMA 4L9YA 3HM7A 2G41A 1K3UA 4IPIA 1LUCB 3ARTA 3PUGA 3CZKA 2BWGA 3BCFA 1GQLA 1HJVA 3HO8A 4WXYA 4KW2A 2QZRA 2G50A 4UTTA 5IFTA 4AAJA 1XXXA 3SRDA 1DJGA 1TO3A 1B90A 4Q8NA 1MDRA 2PDGA 4NYUA 3MI6A 3CYVA 1W3HA 1VKFA 3NQAA 3LM3A 2VQUA 4HMEA 4PMUA 1O7AA 3LCHA 2RFGA 3BWWA 3S5YA 2WC7A 3S5OA 3NSNA 2YB1A 4DZAA 5E70A 2XIMA 4L9ZA 3DKLA 5BU6A 1HL9A 1PV8A 2QULA 1MFVA 2CIPA 5CPLA 4B91A 3OJGA 2Z0IA 3HJEA 3EDEA 4TOQA 2Y63A 4L56A 1SO4A 4O17A 3GS6A 5A94A 5FJOA 2V5BA 1Y7VA 4GVHA 2VWSA 4QE1A 1LG1A 2NWSA 1JRCA 4KFPA 2J9ZA 4DO7A 3RFAA 1O60A 4URIA 1J2WA 2WMKA 2WVSA 1WZLA 5G4WA 4XX6A 3WZ0E 4HU8A 1U33A 3PN8A 1V8EA 1QPQA 3PPHA 2X05A 3BZGA 2VGBA 1XIHA 4LRTA 3VX1A 1JZ3A 3HPXA 3VABA 2JBMA 3WQVA 3A5FA 1H62A 3GKFA 5BU9A 2V63A 4LEQA 4O18A 3W0KA 3B0VC 4HKPA 4YN5A 3HJZA 1XKJA 2X1IA 4LAUA 2OFJA 3BCJA 3FKRA 2ADAA 3OIHA 1FHVA 4WKHA 3SGGA 3A13A 3W83A 1DIKA 2B81A 2XVNA 4TX6A 1X8CA 2WHMA 2GUYA 3CEUA 2BODX 2ZYFA 3ZT7A 1ML1A 3CGTA 3BLDA 3KHJA 3T07A 1RAKA 3THQA 3MQTA 1H5YA 3PAOA 1XLHA 1CXEA 1VEOA 1HJUA 1L9WA 3RM4A 4CNNA 1MNSA 1E4MM 2OTDA 2ZZ1A 4DY1A 3C2OA 2E9MA 4C6MA 5LHFA 1GEHA 1HKKA 1IR2A 2Y5EA 4YVXA 2CXEA 2GJRA 4MLRA 1S2UA 3RM8A 3GBEA 3T0TA 2AQOA 3N15A 1E4IA 3BLKA 7CGTA 4Y9AA 3UD6A 3WLTA 2PPGA 2PDXA 1ELSA 1XP3A 1AFSA 3PG9A 3ALGA 3FY1A 2AOSA 3A4AA 4Q8TA 2VFGA 2IPWA 3W1NA 4XBJA 4PCTA 4XTDA 1XC6A 2JIWA 4IWWA 3TQPA 2GGEA 4ZOEA 3PBMA 5D2TA 1NM9A 2Z00A 1SR9A 4M3PA 1E4NA 4FNRA 1EDQA 1Q6LA 4YPJA 2P1FA 3EA1A 3C6CA 3FFSA 3NZ1A 4Y9MA 3WN6A 1UJQA 4QEEA 3PSWA 5A1AA 4PB5A 1PEZA 4WDWA 4PULA 2VJXA 3CUFA 1R7OA 2GGJA 2O55A 5A6BA 3VCCA 3MB9A 1W3KA 2HTMA 2VEGA 1FXPA 4NJIA 4CD7A 1UUOA 1DE5A 4LS0A 5HANA 4LW7A 4A21A 2SFPA 3WEMA 3W7NA 4GIAA 3W9ZA 4E8GA 3VIGA 3GDLA 3V35A 4AWEA 2GGGA 4RR4A 4BI7A 3TJIA 2PLKA 4IXXA 3IGXA 4M5PA 1VIWA 1RD6A 4Q3MA 3OIXA 3KRBA 2Z27A 1OEPA 2XINA 3LXAA 3VIFA 1H7PA 1FWWA 2FMOA 3QPZA 1OFQA 2NQ5A 4YNGA 3VD4A 1SR0A 2DSZA 4MJ4A 5A6AA 2Z26A 3A3HA 1TA3B 1HGYA 2P88A 1UP3A 4P61A 3UXAA 3EX1A 1FTXA 1VFLA 2BGNE 4A3RA 2Y7EA 4FALA 4GE8A 1O5QA 1XPYA 2PWFA 4UZUA 4DUOA 2VDIA 4Q7BA 1GUVA 2CHRA 3B9AA 5IBXA 2RAGA 5GJMA 3K8MA 2XG9A 2QQ6A 4D6JA 2E7FA 4AC1X 1QR7A 2VZVA 3P2VA 4IICA 5KMYA 3W1RA 5CG0A 3EKGA 1S2WA 4NVTA 5AHNA 3A3XA 4HTYA 3UYCA 3CIVA 1U2YA 1SGJA 6ENLA 1HKIA 3RILA 3V0TA 3WQFA 3ZR6A 1OK6A 1S5MA 4L80A 4JCMA 3VI2A 1WXYA 2BY3A 4O28A 1GW1A 4MAZA 1JUKA 3OO2A 2C19A 4HSHA 4MHBA 2V0TA 2UBPC 5EL1A 3WF0A 2R94A 3SJ3A 4Q6XA 2QCLA 1E70M 1M6JA 2JKAA 5D9OA 1RY0A 4IIBA 2Y61A 1R5YA 3CO8A 3VGEA 3UWZA 4HA4A 5AECA 4C7FA 1A5UA 1AMKA 3MMTA 3VOIA 1XBVA 3PWGA 4HBKA 1V0NA 2VEPA 1PTAA 2RUSA 3DC0A 2XVLA 5BXRA 9XIMA 3L65A 3PZNA 1JF6A 3QYSA 3NQDA 3OA5A 4DJDA 4LB3A 3RRXA 1UMLA 4J1OA 3WK2A 1HN1A 2DT1A 4NY2A 1QK0A 3GNOA 3WDJA 5A6LA 3IK4A 3R5EA 4RZBA 2ZUNA 1WAWA 5DRIA 4RXGA 2WK2A 2E67A 3ARWA 3THUA 4B9YA 4CQ8A 2Y0FA 2BY0A 1WB0A 4R7JA 1TR9A 1TG7A 1F6YA 3PZOA 2HBXA 5A8OA 2HK0A 4CNUA 5FEZA 5E6YA 5LIWX 1UZDA 1C3FA 2JGYA 2Z24A 4GYKA 2J7DA 4LRSA 2WMIA 3KVLA 4GVGA 2VX4A 3G0SA 3ZSSA 4TTGA 5BRBA 3WQGA 4QXIA 2V82A 1TPUA 2VWTA 1NY1A 1ZB5A 3ARRA 3HG2A 1O6IA 3GHTA 3KWSA 2XIQA 1JZ4A 1PPIA 3Q2DA 4YU1A 3NUKA 3V36A 2A6NA 3QBUA 2JF6A 4ONVA 3A12A 3W6YA 3MY9A 2H9AB 5GNZA 3M46A 1EJSC 4LAOA 3Q65A 4Q8UA 2CLEA 3K8KA 1EQCA 4E2BA 1AQMA 2PGWA 1TPEA 4DVOA 1ICSA 3ZFHA 3KBNA 1RVGA 2VYOA 5I6SA 3GH4A 5PTDA 4QITA 1CLKA 2Q6ZA 1G4EA 3H2CA 4NAFA 5HATA 2XSXA 3AXIA 3FEMA 2VUYA 4EX4A 6REQA 1Q65A 5CQ1A 2YCIX 4ZOAA 2NVDA 2B7NA 3ZVIA 1XIMA 3IV3A 3NYZA 3UWVA 1OIFA 1MQRA 1ZS2A