4MWAA

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
260
Chain Sequence
MNEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTKTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDVRINPGNIGRRHKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 93
structure length 260
sequence length 261
chains with identical sequence G
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaA00
3TYAA 4S3EA 4DAIA 1Q7QA 4NHVA 2YCIX 1TX2A 4C1NA 2DZBA 1EYEA 2YCLA 4D9PA 3H2NA 2BMBA 4DJED 2H9AB 2YCKX 4DJEA 3H21A 3TYZA 3H24A 3TZFA 2DZAA 1TWZA 2OGYA 3K13A 3H22A 4O1EA 2YCLB 1TWWA 3TYCA 3MCOA 4HB7A 4DJFD 3MCNA 3H2FA 1Q7ZA 3BOFA 3TYUA 4DJFA 4S3DA 1AD4A 3NOYA 4O0QA 4DB7A 1AD1A 2YCJA 3TYBA 3H2MA 3V5OA 3H26A 3H23A 4DJDD 2DQWA 5JQ9A 4DJDC 4PZVA 1Q8AA 4DJDA 4DJFC 4MWAE 1Q7MA 2H9AA 4S38A 4S3BA 2E7FA 4CCZA 4MWAC 1AJ2A 4MWAA 4S3CA 3H2EA 4NIRA 4NL1A 3BOLA 1TX0A 3H2CA 2Y5JA 4C1NB 4G9PA 4S3AA 1TWSA 3TZNA 2VEFA 2Y5SA 2VEGA 1F6YA 3TYDA 4DJEC 4MWAD 2VP8A 1Q8JA 4D8ZA 4NILA 3MCMA 3TYEA 4D8AA 4O1FA 4S3FA 1Q85A 3TR9A 1AJ0A 4MWAB 4S39A 3H2OA 4DAFA 1AJZA 2Y0FA 4S23A 3H2AA
chains in the Genus database with same CATH superfamily
3DXIA 2VD8A 4DI9A 3B8DA 3V18A 4IUOA 4HCHA 4LAKA 1XD1A 1VBJA 1ZTVA 1WAWA 5AZ0A 2ALDA 5CAHA 4UFIA 2HDJA 1W3NA 1VB9A 4EVZA 2OZTA 4AW7A 3WD1A 1UCWA 1OFPA 3GTXA 3N4EA 3NPVA 4G7FA 4RE3A 4F40A 4KRTA 3V5FA 2JKAA 1XH0A 3AYTA 4U10A 2J6XA 3KAOA 1B3XA 1WUFA 1TCMA 3R79A 4MF4A 2FVLA 4ZB0A 2V6AA 1PWLA 7XIMA 1K6WA 3UXDA 1V3JA 3F4WA 3ECQA 2PDJA 3W25A 4W86A 3MJMA 3I4KA 4A3YA 4WZHA 3VD5A 3E9AA 3WH8A 1JCMP 4PUMA 1TV3A 3IV3A 3TW9A 3WMCA 3WNOA 2O0TA 2PC8A 2OEJA 4RNFA 1KTBA 3PZMA 3VDBA 1NWRA 5I3FA 3M44A 3SCPA 2HE5A 2TODA 4WXYA 3NCOA 1GOXA 1UPMB 3LHYA 5BXSA 1REQB 4HPJA 2DIEA 3KHJA 3TIMA 2SFPA 5BROA 3B06A 2JEPA 1KFEA 3VD7A 5HXMA 5A6AA 1K03A 3A9IA 3BG9A 4GY0A 5D4YA 3N6QA 3SCSA 2PGWA 1I2NA 4RV8A 3C3NA 1YADA 5LGZA 2D0FA 2VD9A 2F8QA 2XSXA 4A29A 4QQUA 2B0MA 2XN2A 3WMBA 5A69A 3STCA 2W91A 1IEIA 1ZAJA 1X1NA 1V6VA 2AQWA 1NF0A 2EPKX 1OJXA 1EQCA 1FWBC 1O4UA 2DH2A 2BGQA 3WQ6A 1ZENA 3V16A 4YMZA 3KOYA 1ISYA 4FNTA 2E9MA 5HK4A 5AHMA 1OABA 1YKWA 5M1TA 1W1VA 3VC5A 1PUDA 2QIWA 3BURA 2VI0A 3OTRA 4WKHA 4W88A 1XFCA 4TVDA 2W3ZA 1BF2A 3GRIA 3RXZA 3UCDA 1KBIA 1S5VA 1W54A 3UZYA 1MXDA 1DIDA 1OINA 3IJ9A 1L6YA 3PC0A 1BG4A 2OVLA 3P14A 2D2HA 3RM9A 1TZ9A 3NURA 1XIFA 3GXIA 2PRLA 3SECA 1HX0A 2V9DA 2J7DA 4JDBA 1S1RA 3RGTA 4ZOEA 1ME8A 3HV9A 4LTSA 1NOWA 3JUGA 2WSPA 2G3NA 3QYSA 3SCUA 1QOXA 3WH5A 3BGGA 3EOSA 4KMQA 4QS6A 3W24A 2PODA 4ZGYA 3PJUA 4REQB 4UTJA 2V5LA 3ITCA 3IGXA 1EO7A 4Q8MA 4CD4A 2EPMX 1OYCA 4AWUA 2OWCA 4YTRA 4FHAA 2BLEA 3F2CA 1PIIA 1E1CA 3ARZA 3JVAA 4YS1A 4Q4PA 5DANA 2O9PA 4CD8A 4ZQCA 3K13A 2EAWA 1TVLA 5CPLA 4OJYA 2Z4GA 4A3UA 3UWWA 1H62A 3EEGA 3SFWA 3GVGA 4O8AA 4HZ8A 3S9IA 2FDSA 1WZMA 1RVGA 3C0SA 3VOIA 3I3BA 1F5ZA 1FDJA 3SCWA 2OFJA 1SZEA 4UQ9A 5F7UA 4YTTA 1FCBA 3FA3A 1EJXC 2VURA 2E6AA 1UD2A 1T7LA 1H7PA 1YW1A 4CNSA 1E1FA 2OZ8A 3L23A 1FRBA 3TZNA 3LTPA 1BQCA 1HJXA 4Z1AA 3I4EA 4LUJA 1MQRA 4Z0JA 5E5CA 2ZIDA 3N1AA 2BOGX 2OO0A 5A2AA 3ID7A 1V7AA 5C71A 3VZZA 4ZOBA 3LHTA 4LCQA 4F9JA 2OLAA 3WLQA 1SVDA 4C1NA 4GIRA 4HMCA 1EJRC 1GW1A 3QGVA 5JH2A 4LC6A 4CQ9A 1ECEA 2QCDA 2PGEA 1W1B1 4ZQRA 1WXZA 3TW7A 3T1GA 4PEEA 1FWHC 3AC0A 1G94A 4XD5A 1ITQA 2DW7A 1AW5A 1LF1A 3HU7A 4OV9A 3SIZA 1WKEA 3FYPA 4C6OA 1FX6A 2HXUA 3GDRA 5HQLA 1ME7A 1IIGA 5K9XA 4H8VA 1JRCA 1ML1A 1DL3A 2O55A 3NZPA 2WSKA 4C6MA 2UV8G 3BG5A 4BF7A 1XIMA 2H9AA 4RCXA 1XIBA 4M56A 5I5RA 3W1NA 2B7PA 4O17A 3RF9A 9XIAA 4JTFA 3TSMA 2Y85A 3D3AA 2QCEA 4ERIA 3G1RA 4QE1A 1Q45A 1UROA 1QI5A 3U3HA 2B31A 1XQLA 5HA7A 4OIFA 4OBSA 4WKAA 3W84A 3WLIA 3AU6A 1C91A 4XVEA 1NDWA 2Y89A 2BB0A 3FIGA 3ABOA 2PWEA 3QKZA 2GUYA 4UTHA 4IMCA 4UTLA 1QPKA 3Q37A 1EBGA 8RUCA 1OIFA 3AISA 4LBRA 1XM3A 1B30A 2J8FA 4KRZA 1EDGA 3ZJKA 1WO2A 3BCJA 4W8AA 5BOEA 4JN6A 5EKYA 2H8ZA 2CU0A 4U31A 4WGXA 3E0LA 1YQ2A 3TKFA 3LHVA 3T09A 4JTRA 3E6EA 4H01A 5AC7A 2GLKA 1A53A 3B0UX 2VGBA 2PP1A 5AZ1A 2QS8A 1E55A 3W00A 3Q2DA 2CZVA 1XLMA 3AIVA 3ABSA 2Y8UA 2I5GA 3W81A 4R85A 4NZFA 3OODA 1S5TA 3IEBA 4OBRA 5C70A 2ODOA 3WY1A 1O94A 2O9RA 4P7OA 2PDKA 3S2NA 4G9PA 2HS6A 2F61A 2BZNA 2YSWA 1FKWA 1CCWB 4S3KA 5BRPA 1RAKA 1SPQA 3UJEA 2AL2B 4Z2IA 2PS2A 4IHCA 3EOOA 2J27A 2GVEA 3CIVA 4F3HA 3TMQA 5H8MA 4G1KA 3NQ8A 4H9YA 3WH9A 3NXLA 2G97A 1G6CA 1C9DA 5HPCA 4A3RA 2DVTA 1VBHA 4GQ0A 3KS6A 4D9PA 4WDWA 2ZWZA 2FHBA 4C6BA 2QYGA 1KGUA 5GQBA 1VBRA 1W9DM 1PDYA 4YCPA 4DBUA 5HWJA 5IBXA 4PUNA 1PL9A 2YCLB 1PKNA 3EB4A 4PMZA 1POKA 3L0KA 5KZMA 1K8ZA 5D04C 4HD5A 2VGFA 3UP8A 1EDTA 1EA0A 3PPCA 1XYAA 1R9XA 3O2LA 3W1XA 2FVMA 4ZODA 1RY8A 2F2KA 4HHMA 2R1LA 1GORA 1MNZA 2WANA 1HL9A 1A0DA 4O50A 3U7VA 4JNZA 4OE7A 1B1YA 9CGTA 3G1AA 4PULA 1DKWA 4Z17A 4Q33A 3DG6A 1VH7A 1AK5A 4JFSA 1BKSA 3GYEA 2FDMA 3WQFA 4YVVA 3GH7A 4REQA 5E09A 2DSVA 2H90A 1H63A 2ANUA 4DO4A 4AYGA 2DW6A 3W6MA 1NIUA 4ONVA 1FP8A 3MP3A 3JZUA 3M64A 1NQ6A 2QPUA 1HP4A 3APGA 4ZFCA 1VYSX 2V5CA 4N6EA 4BJHA 4ZO6A 4JYEA 1Q6QA 1VF8A 3EOEA 3WEMA 1NF7A 4PCFA 4GY1A 1TZ7A 1Q7QA 3SQMA 1WDSA 4I7VA 2UWFA 1H09A 5REQB 1TV5A 3W7LA 3VIOA 1JUKA 2V5DA 3O63A 3SBFA 3AIEA 3WLMA 3EWBX 1R3WA 3S6TA 3ZT6A 4LYKA 4AZ7A 3KCJA 3OVRA 4O4WA 4F0RA 1H7NA 2VC7A 3TC3A 3M43A 1C3FA 4M51A 2E0PA 2XIQA 1VQTA 5D2TA 2V69A 3ZZ1A 4TTGA 1KGWA 4B2DD 3MCNA 3H12A 4IPLA 1F6KA 2ZUNA 3WN6A 3KBVA 2Q8ZA 4PTVA 2HBXA 4KESA 1U1UA 2FFIA 1RD6A 3CPUA 1MZRA 1V7YA 5HWNA 3WJWA 5ABFA 3AJ7A 3NQ2A 2NUYA 2Y61A 3QZ6A 3TJXA 3DBPA 3BAXA 5CG0A 3N12A 2HS8A 5EFFA 1NP0A 3UPBA 4GO9A 3CMGA 4IGMA 5KZ6A 1XI3A 4CNNA 1BVNP 1JEZA 5HOSA 3DFSA 4GZIA 2V2HA 3L21A 3UNDA 4LYRA 2XWDA 4LJ3A 5D9MA 3ZLFA 4A3HA 2J6VA 3L4VA 2V3EA 3LPFA 5I02A 4MKVA 1UUOA 3S1VA 4R88A 4LV4A 5G1TA 2F2HA 4CD6A 3PWAA 4NJIA 4AAJA 2GVGA 4IQDA 2YFOA 3MSDA 5SWUA 3EEZA 3QR3A 4H9XA 5AVHA 1M7XA 3SJ3A 1F07A 1JXKA 4LVGA 1XBXA 4FO4A 1KQZA 3ITYA 4HNUA 1XIHA 3E38A 3BW4A 3HN3A 1OFEA 5AC5A 1A5BA 3FNDA 3SUWA 2PA6A 4GABA 4ICNA 3THCA 2MNRA 4DWDA 3MV11 4OKDA 3NZ1A 2XH2A 4HP5A 2QR6A 3VE9A 4HA3A 3E2RA 3R5EA 3H70A 1V02A 2ZX6A 3ME3A 1JPIA 5REQA 4L6OA 3WBXA 3IK2A 1B3WA 2P76A 1BEUA 2XFFA 4JD4A 1E6QM 2A85A 1TWIA 2TYSA 1HQTA 1J96A 5D2WA 4IFOA 1R3YA 1TPB1 3T55A 5C7HA 1P48A 1WDPA 5CJMA 3N11A 4RDWA 4JY8A 2GZXA 4JFWA 4XAFA 3VKJA 4MB1A 3GKFA 2VELA 4FP1A 2PDIA 3FN9A 3VIHA 3TA9A 2RDUA 1J18A 3TE9A 1Q6EA 3SW6A 4IFKB 4U28A 2BTMA 1Z41A 3A5VA 3STGA 1KM4A 4BA0A 3N3TA 3KRBA 4RDVA 3AO0A 4LUSA 3S8HA 2YXXA 1QO2A 5H91A 3CHVA 1JGMA 1MQQA 4IICA 3BTNA 5G4WA 4C6EA 1IV8A 3G1FA 2OGYA 3TQ0A 1GOQA 3ZR5A 2GJNA 2F84A 5FEXA 2IQDA 3BW3A 2Z2AA 3U7BA 4BQ4A 3ZXWA 3CQKA 3L4XA 3FAWA 1JZ8A 2TRSA 4W5UA 1KFBA 1F3TA 2CLIA 4DJFC 3HTWA 3XISA 4AXNA 1QUMA 2P1FA 1P1XA 2I14A 2Y24A 1Q6LA 1ISWA 4AVFA 1B54A 3DN5A 3CK5A 2YXGA 3CLWA 2I5IA 5FACA 5DFAA 1EGMA 1SJAA 1PZ2A 1FWAC 2VEFA 3VIKA 1N8IA 5HQEA 3S83A 2F38A 1AH3A 2GVYA 5EMYA 1G5AA 1M7PA 3GG8A 4AD2A 1M6JA 2WNQA 4C7DA 4ML4A 1OCJA 2C1IA 4GCAA 3AHXA 3N4AA 2YFNA 3J7HA 3LQGA 3GIPA 5M03A 3IGUA 1VFLA 4O1DA 3ELFA 1E6XM 1F9CA 5E6YA 2DZBA 1LLZA 3NPUA 5JIPA 1U83A 4O0ZA 4RLIA 4R7OA 3N3MA 5D02A 2BMBA 4IXHA 3H54A 1PJ9A 5FF2A 1JJKA 2V8ZA 4PUWA 1CGVA 4I9MA 3MYOA 4H7CA 2ISWA 3FA4A 3LLXA 3I10A 2DV0A 3UY8A 4GWEA 2HXTA 1UJPA 2WJZA 1XGZA 3LGGA 2PI6A 2ZA2A 4U33A 3CNYA 4E8DA 1RK6A 4TU1A 2NWSA 2H3BA 3QPYA 2IXVA 3URBA 1HJSA 1A5LC 1E4LA 1CPUA 3CMJA 2GSEA 5HNRA 1N8FA 1CX9A 1X7IA 4J3WA 1F05A 3KL5A 1CEOA 3QRHA 1F76A 2IKJA 2INFA 1I2PA 1RLDA 3L5MA 1TV7A 2VR4A 1OFOA 2PDXA 4AIEA 4H04A 3CO4A 2NVAA 3HZ3A 4JTEA 3TSDA 4D6DA 2NXHA 1UP0A 3GNRA 1XXXA 3GTFA 3DU0A 1P6BA 2PDNA 1X8FA 4MVAA 5EPDA 4UFKA 4E6MA 4XZMX 4HGXA 1Y7VA 4JZ5A 4FIRA 2ABBA 2O9TA 4BI7A 1JNEA 1AODA 3WDQA 3TN5A 3IVUA 5C8BB 1OD8A 5DRIA 3C2OA 1GQKA 2PDBA 3DESA 3UXAA 2BXZA 5A8OA 1XD0A 1P0BA 3LCHA 5C9ZA 4X9SA 2P50A 4C6JA 3M7SA 4JTJA 1U2YA 4ECLA 3VE7A 2XGZA 4JIRA 4PTMA 3TMLA 3OZOA 2Z24A 3PZ9A 5A6BA 1WQ5A 1DYSA 4UR8A 1GHRA 3XINA 1JI1A 2YL9A 5ECUA 3QBUA 3O3RA 3N73A 2ZTKA 2ZRXA 3EKLA 3WK2A 5D9PA 2AAAA 4K36A 5EMLA 3BAWA 4JEJA 2X1TA 3PZOA 3UR2A 3M9YA 1MDRA 4NZCA 1B5TA 4IPNB 4IJRA 1OFRA 4S3CA 4H8NA 4LY4A 3HB9A 5GJPA 3AXXA 3QZAA 4WSKA 1O5KA 3O8AA 3PY2A 4Y8EA 4L6DA 1C8XA 3G8EA 1GOIA 3VGEA 3FJ6A 5TNVA 2CLFA 4QITA 1AMYA 3M0HA 3CZEA 3QY6A 2WJDA 1XIGA 1W3IA 2VZUA 1GKQA 4QM1A 3HPXA 4A21A 5I3DA 4FXJA 2ZXAA 3GR7A 2WW5A 1T6MA 3QVQA 4I9AA 5I3JA 3LCIA 3OLEA 2DZWA 4R3UA 3HQNA 3GH5A 1A5SA 2RUSA 2Z00A 2ZC1A 1L6FA 5CC5A 5A3HA 5H8PA 2C0HA 2YA2A 2XHYA 4UMCA 2Y7FA 3OVPA 2YCLA 1UR9A 2I1OA 2WCSA 3FAXA 4OUEA 4BZYA 1XCXA 3EZ4A 3GDLA 3WELA 2X30A 3W29A 4ZENA 3LSBA 1NSJA 3GU2A 3WK0A 1O7AA 4GOAA 3W7PA 2V68A 3DHPA 3WLTA 3N19B 4DJFA 4X2PA 5HMEA 3VYLA 1AW1A 4DWSD 1YE4A 1UC4A 3QMRA 2HEJA 4ZOAA 1B2YA 1NQKA 3SCQA 1GYMA 2GSJA 3IJ7A 1L6WA 3ORWA 3CZLA 4B9YA 2MANA 3P81A 4C1NB 1ZALA 3S47A 2A6NA 1PX3A 3E0IA 1K8XA 2VTFA 1XKJA 4DXVA 3E12A 3VD9A 2X1IA 1TE6A 3HQ1A 1BGGA 3I7QA 3KOZA 4RKAA 5GJMA 5DMLA 2OB3A 3UJFA 3TN4A 1W9UA 2P0IA 2CLMA 4F2BA 3NEHA 5ABTA 5AB3A 3B9EA 2XISA 3P82A 3H2AA 1S39A 4IX2A 1Q6FA 1KNWA 3K4WA 3LU2A 4Q3MA 4H7VA 4L7ZA 3CEPA 1AL8A 3R13A 1YDYA 1J5TA 1JDFA 2UZ9A 1RBAA 1MUCA 3P8IA 2OYMA 5CXPA 1EYEA 4HHLA 2OTDA 3QFWA 2G95A 5HNUA 3VI2A 3VGDA 3LPOA 2EGZA 3I7SA 1XLBA 2J78A 4OUIA 2IQ0A 3QKEA 5BYWA 4MJ2A 3UPMA 4MKSA 4NYUA 4HZMA 4UQEA 2BXYA 1I1WA 4U2YA 1JUBA 3GYCA 1HIZA 1MXSA 1KA9F 1NELA 3CT2A 4XSMA 4LNCA 2Z1KA 1V0LA 4A35A 4Z1CA 1GVIA 1GTEA 1A5UA 4G1NA 3NM1A 3IUHA 4DJDC 2ZX7A 2WNZA 5CSRA 2NQHA 4U5IA 3TCEA 4NX0A 4KFPA 2DY3A 4V1XA 4YJ5A 3RRAA 2FIQA 4MIMA 4GKLA 2OPJA 3IRSA 1PHQA 4KCUA 3W2MA 1PYFA 4O1BA 4C1KA 1R3QA 2VCCA 1XPYA 4NZ1A 2EQDA 4K39A 1IZKA 1F6YA 4LANA 5A8PA 4MJZA 2WQDA 1ISXA 4PODA 4A22A 1XFBA 5LA0A 4IIBA 3ZT5A 3KE0A 4BS0A 1DPMA 1EXBA 3AHTA 1XYZA 4GGBA 2JQXA 3BQ6A 3YPIA 3D46A 1EDQA 2CYGA 1XRVA 2PE4A 1AVAA 2WMIB 3WLLA 4JDYA 3OPSA 2DT1A 3OIXA 1FWIC 2QPXA 3WD4A 2IS7A 2D69A 1W0MA 4GBUA 2HNEA 4H3DA 3NQEA 3VNIA 1HNYA 3BH4A 1IXPA 1QHPA 1CZ1A 3CASA 4C6PA 2VFHA 1EH9A 3NSMA 4XD3A 3V7PA 5CBBA 2WJEA 3WD3A 4FNSA 2E6FA 1AQ0A 4FA3A 1BD0A 1GG1A 4JTGA 2J7BA 4WOQA 2AL2A 4Z2JA 4PCSA 3ABQA 1W37A 4HBKA 1MWOA 3FDGA 5BWFA 5C9XA 1DQXA 1W1IE 2CLOA 2F9RA 3W2KA 2VMFA 2TMDA 5HWMA 2W5FA 1TPVA 3GUGA 4IP5A 1MFVA 2NX9A 2O4QA 1QHOA 2ESCA 1SYTA 4LYPA 3W2LA 1W2PA 4FAMA 3POCA 4ZTXA 4IIDA 3GXTA 2E28A 1HP5A 1ITUA 1QT1A 1RCOB 3FHAA 4CU8A 3RU8X 3KRZA 4MDOA 3GIYA 1LRQA 3CT7A 4OV4A 4CQCA 3W82A 1VC4A 1CBGA 2E25A 1V6XA 4RDYA 3WF2A 5M5DA 1OVDA 2GGGA 1YNQA 1PKYA 4GGHA 2HE8A 3DI1A 2G4JA 2WVVA 1KTNA 4DO7A 3WZ0E 5CLTA 4POCA 4PUJA 3W1MA 4AFYA 3T0CA 4L61A 3R6IA 5FL0A 3B03A 1DE6A 2QDHA 5LNRA 3VMNA 4Y6GA 1QJWA 3GNPA 3M0KA 1V79A 1SGJA 3WF1A 4TUFA 5GPRA 2UY3A 4Y9MA 4GHRA 3VNZA 1EP2A 2GQ8A 2AGTA 5DY2A 1QW9A 1EXPA 2PDCA 4O8RA 4DB7A 5A6KA 2E5CA 1XBZA 4EWND 4UZUA 3G1VA 1BXCA 4UR9A 3H23A 4HQVA 3G22A 4XX6A 2OELA 3TDFA 4UC5A 1P7TA 4LU0A 1PYMA 2E7FA 3BJTA 1GOMA 3B3DA 3VMPA 1FWDC 4PC8A 4H9MA 1NDYA 2V82A 4LVAA 3O06A 4ROPA 3PK7A 3P61A 4O19A 3IK4A 4OU1A 3GC4A 3NQDA 4F0KA 2QIIA 2CWNA 4GH3A 4DJEC 2HBVA 1O95A 2A79A 5TD4A 2VVNA 4IPPA 3POHA 2ON3A 5D9OA 4L1WA 3U4AA 5CJNA 4DUWA 4FX6M 3W27A 5AKQA 4QXIA 2NQLA 1KBJA 4FLOA 4IMGA 1YRRA 2KAUC 4U3CA 4IMEA 2Y1HA 5LIYX 3N04A 4GPNA 1VPYA 2ZX5A 1US0A 4AMCA 3CO8A 1TPEA 3QOMA 1IQ8A 8XIAA 3V75A 3QPZA 1WDWA 2V3GA 1M3UA 3UJ2A 4NNBA 2OQYA 3ARSA 3KDOA 1R85A 1LUCB 5A8MA 3TJLA 1EQPA 1XW8A 2CCRA 1EO5A 3WL1A 4X2RA 1NWSA 3STEA 3AYSA 3BWWA 3MTWA 3LI1A 4ATDA 4ICCX 1TWWA 1EOMA 3G6MA 3DBNA 3ATZA 2WAGA 2YB1A 3WLSA 3VGHA 3HGRA 3EWUA 4UTTA 1W5NA 3ITLA 3T81A 1XQKA 4JICA 5DX7A 4CCEA 4AIBA 3H26A 5K4ZA 1CB2A 3WSUA 2V3DA 1XINA 1SMDA 1UR0A 4ALDA 3F4DA 3ZR4A 4PFMA 2OWXA 3NGJA 4I7UA 3CJPA 3ZVIA 3QC0A 4UOJA 3FFSA 1WAUA 2Z27A 2ZC8A 5LNWA 3A47A 2POTA 1QXLA 2Z26A 1VCGA 2Y5SA 4JQ4A 1E71M 4ES4A 3HQOA 2GVJA 4WK9A 1DQUA 4ICMA 3UWVA 3ZYZA 1E0UA 1KQYA 4V15A 2PMQA 3U6WA 3S1GA 3MBDA 1OYAA 4K1GA 3G0SA 2CZEA 3WJZA 3C2VA 3HM7A 2P8BA 2GJLA 1CT5A 5LHEA 3CQJA 4I9JA 2UBPC 2Q3OA 4FOUA 4L5ZA 3WH7A 1WUEA 1GQJA 3G1XA 2XIMA 1PTDA 4WRHA 5FKYA 1RBOB 2QAFA 2ZZ6A 2D3NA 2CXGA 2YCKX 4JOMA 3HMJG 2A3AA 4U4MA 3EMQA 2VUYA 1OSEA 2VX7A 3MDUA 3TVAA 5I09A 3USZA 4Q4KA 1LQ2A 3MCOA 3WQGA 4PFHA 1QWKA 4W84A 1YPXA 4S3GA 1OGSA 3GR4A 1OFBA 3DFOA 3PZIA 3TROA 4HN4A 2DZSA 4NJKA 3AHZA 4N02A 1YXDA 1KXHA 1O1ZA 3NO3A 4I5RA 1SUXA 3WLRA 3W76A 4ILSA 4M6PA 2AKZA 3BDKA 4AISA 5KINA 5T91A 1ZJHA 3WDJA 1ZFJA 2WHKA 4MWAA 3WK1A 3W7DA 4HIBA 1GT8A 3OZYA 5ABEA 1GUVA 4LQ1A 1PXGA 4MB3A 3V35A 2ZDSA 3VDAA 2DZVA 3MDWA 4NJHA 3N9RA 2CHOA 1PKLA 5FOOA 4I3GA 2PZNA 3TTYA 4NZ3A 2ZXBA 1V3IA 3UA3A 5KMYA 4XAYA 5AYYA 1RALA 3GU1A 2CZDA 1B9BA 1M03A 4GYKA 1WV2A 5TBOA 5C9RA 1TQXA 1J0ZA 4L9ZA 3TYAA 4NASA 1KBBA 3MC5A 4GX8A 7A3HA 3RU6A 4RZ6A 4WDTA 2QUTA 5I2UA 1JF5A 1KM0A 1E73M 4NXKA 5HJLA 5F4WA 5CZJA 4W9TA 1U1HA 1UIPA 2PURA 3NUKA 3WD0A 4Q7IA 4L4OA 4IX0A 1R86A 1UH3A 1YTKA 4FX8A 3WYZA 3FEQA 5GNYA 1DE5A 3SCOA 3WJYA 3M5XA 4E2VA 1OM0A 2QCFA 4LAZA 1WCGA 2CBVA 1IEQA 3DYMA 1DWHM 3EWYA 1CTNA 2VZSA 3VTRA 3LPGA 4BF5A 1V6YA 1ESWA 3WNPA 3H6OA 1VBGA 4YU1A 1SM9A 4OBTA 2OODA 2ZTJA 1CNVA 2WPBA 1E51A 1VPQA 6PTDA 1SFSA 3P84A 1P7TB 4L9YA 1V3MA 1G7VA 4H2CA 1XWYA 4AB4A 3H2CA 4O52A 4GX9A 1EC8A 1LQAA 5U7SA 1JQXA 2WKJA 2X40A 3F4NA 3VC6A 5BU9A 2W92A 2PDLA 4KWOA 4BI6A 3OLGA 3N6JA 5C2GA 1U5VA 2VEGA 3K8KA 2ZICA 2WBGA 3BAIA 3AZSA 1CXHA 3S5YA 2J4GA 4O4VA 3EWWA 4BI5A 1W5OA 1UP2A 3L4YA 3P2VA 4FZIA 1N82A 3W71A 1UYQA 3LCFA 4CU7A 3PTMA 3D6NA 1HKJA 5B7ZA 2O4MA 4F8XA 3KRSA 4FR6A 3W7RA 1FVPA 4IMDA 4KERA 4D1IA 3SEPA 3FCPA 1RPKA 4GXPA 1M41A 2VRJA 3P67A 4Z2HA 5DCBA 5K4XA 1BKHA 3CU2A 4FMVA 3WLPA 2QCNA 4V27A 4GY7A 1X8CA 3PWGA 5DMNA 3VO0A 1NFGA 1XKYA 4MLRA 3EX3A 4FNPA 2EPHA 3E1F1 1R30A 4IMFA 1JG9A 2R9RA 5CSYA 4DPPA 1XX1A 4J3VA 3IVSA 5GJNA 4AZBA 1E9IA 5FSEC 5BWAA 2QUMA 2DZUA 4G5DA 1UR3M 4H8HA 1XYFA 1GVYA 3TTSA 5CGTA 5DRCA 3L66A 4Y9NA 1LL4A 3UR8A 4KEUA 4UMBA 4GXWA 4RUBA 4DLFA 2ZRZA 1UKPA 2FYMA 2RDXA 1T96A 2XM1A 4UTIA 2QVNA 2YIHA 4E2DA 1TV4A 3PZGA 2E9BA 1QDSA 1EBHA 2VDGA 5IDIA 1HTIA 3LHUA 4LH8A 2EKGA 4LCRA 4YVPA 1HJWA 3I3EA 3TYEA 5DELA 1IWPA 3CS2A 1P0DA 1BRLA 4S39A 2E4TA 3OB8A 5FJRA 3A13A 1LORA 3HMCA 2QKFA 1HKWA 1PCWA 3GG0A 3OYXA 1R5YA 2YCIX 3BJSA 1OT1A 3EBVA 3PUDA 4X3ZA 4AD4A 2NSOA 1VRDA 3VFLA 2Y70A 3NM3A 3T2OA 4TR9A 1E9ZB 2HNHA 2Z1WA 3TUUA 3LLDA 3NDYA 4Z2GA 2BHYA 4JN7A 1SW0A 1ZGDA 2X8RA 4P7NA 1QI2A 4ZO9A 3MVIA 1XLKA 5EA9A 1RHCA 1KKOA 3FV9A 1YDOA 1IYXA 3NQBA 3WKZA 1V0KA 3C0LA 3PJTA 2DFAA 1VYPX 4KGLA 4F0HA 5AYXA 2F6UA 3UG8A 2J7GA 4J40A 1WZLA 4DZAA 1R38A 4AXKA 1XV8A 5BCAA 3I6TA 5E9XA 4JFVA 5CSSA 3SUVA 2QXWA 3BVJA 2BSLA 2C3ZA 1JZ2A 4N4QA 4NY2A 3RR4A 3CUJA 1FDYA 3FOKA 3VILA 1RA0A 2WSQA 2IKGA 5AECA 3CHFA 3LCWA 1KRCC 4P8XA 3BAKA 4UR7A 1ICSA 3WUGA 3EWDA 2VOTA 3MO4A 1Q85A 4GC4A 4FX7A 4YCOA 3WF0A 3N25A 1ZBCA 3HPFA 1AJZA 3A4XA 3MSRA 3UQNA 1OD0A 1EA9C 4KBXA 3ZFHA 4X9YA 5D37A 3NQCA 3NDZA 2VFDA 4YIWA 1R3TA 2NZLA 2VRQA 1B90A 5DCEA 3WQPA 2WHLA 1L9WA 2P10A 3AJXA 4H9VA 4L64A 1XRFA 3G6LA 4BEUA 5RUBA 3SY8A 1NP2A 2BY0A 1PAMA 2J47A 2EJAA 2HV5A 1DXEA 3DFNA 4UFLA 4PEKA 1Z3NA 1CLKA 1E6RA 3BC9A 4ZVJA 3JS3A 1KGXA 4H9ZA 3S5OA 3MY9A 3OHMB 3S4TA 4UWMA 2YB4A 1O12A 2QV5A 1BSLA 4WQ6A 3A24A 4JYFA 2DSWA 1PHWA 1E0TA 2CLLA 5A8NA 1MFUA 3DFYA 4CN6A 4CCDA 2OEKA 3FY1A 4S2CA 2E9LA 2G41A 3AHYA 2QAPA 4Q8WA 2O7QA 4CD7A 1Q6OA 5D2VA 3T08A 3HF3A 1SJCA 2GJRA 3GAKA 1DJZA 5KSWA 4Q8OA 5CG7A 1M7OA 3KVKA 2XZ7A 1JPDX 3SRDA 4CLMA 3ONBA 1H1ZA 1S38A 1OC5A 4DVOA 4HU3A 3R12A 4S3AA 1TMHA 4CN4A 2VX4A 3TN3A 2RAGA 1HO1A 5I0DA 1XJBA 5CPSA 1SO5A 1T41A 2PCEA 4IJBA 1E4NA 3IAQA 3KW3A 4Y8FA 1YMYA 1FP9A 3A3WA 3C5QA 5G2IA 1ME9A 2O9OA 3IIVA 4QE5A 3AIUA 2QJMA 2ABAA 2Y88A 1JRBA 2NX3A 3B0XA 5DMYA 2BXVA 4XKYA 2RJGA 1PS9A 3QN3A 3BQ5A 3R2GA 4GNKB 3LD5A 2QJGA 3G1DA 1QCWA 4JTSA 3N18A 4QS5A 3A22A 1V6WA 5DBUA 3EAUA 1YBQB 1UWAA 3F5JA 1UQYA 4UTUA 3VNYA 1EF2A 4WCJA 3BXWA 3MYPA 1BTCA 2NXIA 4PCTA 3FYOA 4M81A 3I6EA 7REQA 2HQAA 1Z69A 3BMVA 3ABRA 3NL6A 3PPGA 3N6HA 3LHWA 3SDOA 3HG4A 1EJSC 4JHZA 1VFMA 4MUZA 1LBFA 1GOOA 3WQ4A 1G9HA 2YX0A 1W9VA 2G8ZA 4I7WA 4F2TA 2HK0A 3P3BA 1JZ4A 1TSIA 2VYOA 5MF5A 4HHHA 5I00A 1FWGC 1H0IA 4LB4A 2GL5A 2BY3A 1VFSA 3APYA 2QUUA 2P0OA 1ECQA 3LGDA 4L9XA 4LS2A 1REQA 4QG6A 2W63A 1Q2SA 1DXIA 1UWTA 4DYJA 1TPUA 1A3WA 2PEVA 2DH3A 3LNMA 3BMWA 4H9TA 1KXQA 1TQJA 1E70M 1L6GA 5F1VA 1IGSA 3BW2A 2W66A 3UZZA 3MMWA 4W7VA 3ABZA 1SJBA 3KZSA 1DJQA 3LG3A 3BANA 2RDTA 2OU4A 3T0AA 3T0TA 2Q01A 4AZHA 1PB0A 3STFA 4JKLA 4MHBA 3ZS4A 3TA6A 3TFCA 4ORIA 1WDRA 4OQVA 1W1ZA 3IUDA 3L2IA 3WDIA 1E0XA 4HNLA 4PB5A 4KETA 3CAVA 2GSHA 2OQLA 4Z1YA 2P88A 4UNIA 4LVBA 2QDGA 1OHLA 1RH9A 2HRWA 1OADA 4EIVA 4G7EB 5EBUA 3CB8A 4HB7A 2RHGA 3BLFA 2OGJA 4HMNA 3W75A 3BLOA 4LNYA 1JDEA 1DWIM 2CNCA 3G3DA 3LCXA 4FK9A 3CUIA 3UZXA 4IMAA 1U5HA 4A2SA 4AWTA 3PZQA 1EIXA 5LA2A 2PTWA 4IL0A 2YCEA 2I7GA 3GG7A 2J7EA 1K7XA 5BRBA 3SURA 1RJRA 3RO8A 3W1RA 2VFFA 1LG2A 3F2DA 3WNLA 4I90A 3E3HA 5KITA 1OF8A 3QF0A 2VC5A 2POZA 3DFQA 3PFRA 2WNNA 1THFD 4NRSA 5AHIA 2GVLA 2VEKA 3WQCA 3G3MA 5D8WA 1WYIA 2GUUA 3LM3A 1S46A 4QEHA 5I79A 3B97A 2D73A 2GDUA 1FWJC 5J5RA 1I2OA 3H53A 3GAYA 1MUWA 3LLFA 4GE8A 2A7PA 1MVYA 3D47A 1IEXA 3PB0A 4Y9PA 2JGQA 1FY6A 2YDRA 4LUYA 2YGYA 1PVNA 2WPGA 2WJFA 1PBGA 3ARPA 2XH0A 2JE8A 4OZOA 3UJSA 3W85A 3PWIA 1GPWA 1DHKA 3BARA 2QLYA 1JFXA 2P5NA 1DWAM 3AOFA 1AD1A 1SO4A 3UEQA 4IWWA 1SZGA 3SCRA 2ZUMA 3RJXA 1KW1A 2V81A 3RO6A 3RCYA 1A4MA 3NGFA 3M4HA 1GTHA 1TPDA 4ZO8A 2W61A 4GACA 2W79A 4DZIA 4D8LA 1XYMA 3R8HA 1TTJA 1VJZA 1HKVA 2DSUA 3THQA 4W4QA 3HPSA 1VCVA 2YDQA 3K30A 1EKOA 3RX3A 1MW2A 2ATMA 2C7FA 3Q67A 1TZZA 3L4UA 4HPGA 1B9ZA 5HJXA 4E2BA 3A4AA 5D9NA 2QJJA 4PCPA 3PBGA 3CHDA 3LQLA 4W87A 4A2RA 1QNQA 4LYQA 2OT1A 3TTQA 2WO5A 1F3XA 1NOUA 2VZTA 3ICJA 4UBPC 2WVTA 3RX4A 2ZE3A 2Q8LA 3VX0A 3RLGA 1J93A 3FA5A 5ABFB 1A0CA 2VJXA 4A3QA 2ZYFA 2WC7A 5B80A 4AQLA 3THDA 4IGSA 3WBAA 3VDGA 4NNAA 1KM6A 3WIJA 2Z29A 3VKBA 3UT0A 2JBMA 2AQOA 1ADDA 3DECA 1PIGA 5K3VA 2WWDA 3G1SA 5FJIA 4PMXA 4H9UA 4YYCA 3OBAA 4KWVA 2OX1A 5CC3A 4AZGA 3KL3A 2VENA 3VMOA 1J9YA 3IJDA 2ZXQA 1O1HA 3ARRA 4EXQA 4HPNA 3M0ZA 4INFA 4GUFA 6XIMA 2P3ZA 3RN6A 1K9EA 3VOHA 3HV8A 2X2GA 4JTIA 1RPXA 3W1LA 2NVCA 4M6QA 3DUGA 2NUWA 3ALGA 1UD4A 2XPKA 1MSSA 3N2MA 1UKTA 3SUUA 4GA8A 1GEQA 4O10A 3M0IA 3MO7A 3W53A 3KHDA 3NQAA 2XU2A 3IRDA 3VU2A 3PS7A 4OVXA 1BXBA 3GKAA 4TMCA 4R5EA 3UZ5A 2PDYA 3U2CA 2PCQA 2OWWA 4MYXA 1X38A 1Q3NA 1UUMA 4HNCA 4QLKA 4JX6A 4DUXA 5I7GA 5CSUA 3LERA 3FSTA 4O1CA 3JU2A 2ZUSA 1E5JA 2G3FA 1HFBA 1TVNA 2PC4A 1ZJBA 3BOXA 1WP6A 3QMTA 5A6LA 3LXBA 1CXEA 2X09A 1FHLA 2J7HA 3EPOA 5AOUA 4IPIA 3AZTA 5XIAA 3A12A 3U8GA 3T42A 1NFPA 4MJMA 3W7EA 4DXXA 1YXYA 1B4EA 2EO7A 2WKLA 3UR5A 2PP3A 2R1KA 3NQFA 4NL1A 2FZ9A 3M41A 4FOKA 3IARA 1ICQA 4DZ5A 5JMUA 4N0RA 1VLIA 1TA3B 2VR2A 3O6YX 5CC6A 1AZ2A 2C0AA 3S1UA 2IUZA 2C8NA 5A2BA 3M0MA 2Y63A 1LOSA 4LX4A 4HJWA 4Z2LA 4QX4A 4XO6A 1OG6A 2B7NA 2XN1A 4DAFA 4E3TA 3M0LA 3TR2A 1NWUA 2CETA 2FPTA 5JIWA 2WZTA 5A94A 4DF0A 3BGJA 3G1YA 3QSTA 3T07A 4MOZA 1QNVA 1AH4A 1FOBA 4PMVA 4ZA0A 3LCGA 1JCNA 1J79A 4BQ2A 2Y7DA 3NNTA 4EE9A 1LOLA 5BXTA 1GPFA 3MUCA 4BQ3A 3B8WA 4LRSA 2DGAA 3OVGA 2BODX 2Z6JA 1S3TC 4FEZA 3NPWA 3H7UA 4Q8TA 2XINA 3SCNA 4W8LA 1RCQA 1GOWA 3H2FA 3RLHA 3CHEA 1OCBA 1P0KA 3TYUA 3KEHA 1WDQA 5IFTA 2C1HA 3GXPA 2PRMA 3UY7A 1W5QA 3L9CA 4N4PA 5L6UA 3BLPX 1BSIA 1A50A 4N2YA 4BR1A 5BXRA 3KVJA 3EDEA 1ADOA 4CQBA 3QV9A 1H61A 3PVFA 2DUAA 1CYGA 2PD9A 1OX4A 3CMFA 1VGAA 3H2EA 2FZBA 3NO1A 1H5VA 1C92A 3SRKA 2A4AA 1EJUC 2DDXA 1AH0A 3GW3A 1V3KA 2A21A 1UMYA 3BGAA 4B5VA 4IGHA 2NWRA 4XIMA 3I3DA 4PMQA 2Y6ZA 2PAJA 4RW3A 5GNZA 1SU5A 1ZJIA 2NLYA 4IISA 1OIMA 4WSHA 2VO5A 1TJ0A 4AH7A 5BOFA 1OX5A 3MUAA 2OKTA 5XINA 3MMTA 3B8UA 4Q8NA 1DWJM 1IHIA 2REQB 3QTPA 1LDCA 1UHVA 4M6UA 3AHVA 1W2VA 4V33A 1J4EA 4AD1A 5M17A 3QGAC 1RJQA 4BCEA 1WZKA 3RIKA 4ZXLA 3C4UA 1UKQA 1XCFA 3DFHA 2ZZ3A 3AS3A 1EP1A 2W9MA 4WJEA 2H9AB 1P6CA 2QPSA 3R0DA 4M6VA 2YOCA 3URAA 3WLKX 4EPKA 1C7TA 3L4WA 2XIIA 1QU4A 3V36A 1KFJA 2J66A 3TXZA 1WKFA 6ALDA 2XUCA 5I03A 1UBSA 5E1QA 3SO7A 2RFGA 2VHLA 3KCLA 4IL2A 4Z42C 4FLQA 2OX4A 2XVLA 4D6EA 5DQPA 2Z0IA 3OG2A 3CZ8A 1OY0A 3ZR6A 5HMFA 4QRNA 4AZIA 2QUNA 2VWSA 4ADUA 2I56A 3W4RA 3TEVA 4NZ4A 4FB7A 2VM8A 3CEUA 2XWEA 1TV8A 1TKKA 2FTYA 3DZ1A 1QO5A 2DJLA 3CWOX 3IACA 2E40A 3GM8A 3G0UA 1XLAA 3SADA 2CC0A 1N8WA 3TH6A 3D0CA 2GGEA 3QR0A 2FH6A 3P62A 2Z25A 1KR1A 3RPDA 1XLLA 1CGTA 3Q65A 2WHJA 4YTUA 2XFRA 1ODUA 3RCNA 3LPPA 2QQ6A 5C9WA 2AGKA 4FXFA 1EOKA 1CI1A 3THAA 1VIZA 4B5NA 1BVZA 2OMAA 2WXDM 2D20A 4JYDA 1F4AA 1DJYA 3OZPA 1SMAA 3U48A 3G5EA 3WFLA 1EL3A 1UZHA 3LN3A 1GJWA 3IV8A 3T7VA 2INZA 2ZZ5A 3MVTA 1ZAIA 3GD6A 3R10A 1EWEA 3CTTA 5G5IA 3BL3A 1PZ0A 2OZ0A 3EXTA 6TIMA 4PBGA 4RZ5A 4P61A 8TIMA 2A3CA 1QFEA 4PRTA 1AL7A 1WX0A 4HOXA 5DXYA 3VDCA 3QLLA 1MQPA 4TX9A 4DWSA 4AD5A 2C15A 1WKDA 1V02E 3W1AA 4JTKA 1TCDA 3TW6A 3W07A 4NRRA 1T99A 2REQA 4GI4A 1QNSA 2CESA 1R3VA 1JF6A 1E9YB 5LXEA 3MUXA 2V63A 1TRDA 3WD2A 3O16A 5LIUX 4GLEA 3P5ZA 1KRAC 2GWGA 4ASTA 1I2RA 1MRQA 4C6DA 2PD5A 3MWAA 4WDXA 1EF3A 3KLKA 1H2JA 4NQ1A 1E5NA 3PJWA 3B8VA 4OHQA 3LBCA 1UUQA 3WLOA 5FF4A 3V3WA 5F4SA 3VA8A 2FZNA 3NIYA 1J8VA 1OB0A 5KZDA 1JZ5A 3MT1A 2Z2UA 4EOUA 2VFGA 3MHUA 1I0BA 1S5NA 3AWNA 1OX4B 4MFEA 1GNXA 2FMOA 3MPGA 1XDJA 3EDKA 4XAZA 1KWKA 3W6LA 3R43A 1F74A 4PTNA 3MSYA 2BNJA 2E68A 2V67A 4C7GA 1DOSA 1Y5XA 1IXQA 3RCMA 1UWIA 3N34A 3P6LA 3FKKA 3N15A 3WNNA 3VIPA 4HYRA 4N42A 3S2JA 1J0YA 1UOZA 3NTYA 3OYZA 3EX1A 4FSAA 1H11A 2EPNA 4OOZA 4CQ8A 3VM5A 5JQ9A 4DEFA 3V0TA 1O68A 1O6IA 1JCTA 1CIUA 2I57A 4O13A 4XSLA 3VIFA 3CUGA 5AVNA 1ZLPA 4N6FA 1C8YA 1PWMA 3XIMA 2YYTA 4ML9A 3ISIX 3EPMA 2VR5A 3L65A 4GK8A 2YL6A 1F8IA 1G67A 3OGVA 1E3XA 4M19A 3WK3A 5HDRA 4LGXA 4O1FA 2HTMA 4LAMA 4S3FA 4B5UA 3SN1A 2YXOA 1H41A 4F2UA 3SB0A 4YXGA 4S23A 2W67A 3ATYA 1VJIA 5FF0A 4UTTC 3PPHA 3AALA 2Q3RA 4DBWA 4JXCA 3KTCA 1XG3A 2NT0A 1YPFA 1QPNA 3KVLA 3W7CA 3T8QA 2ASHA 3OA5A 2TPSA 5HBFA 1EZ2A 4EAMA 3PB2A 4MKNA 5FJOA 3AUJA 2XH4A 4CVWA 4JFTA 3NQVA 1UIOA 4OGZA 3K5XA 4J3UA 3NOYA 2A7NA 1FH9A 4QAWA 4UTMA 3GXFA 1T5AA 3DFTA 2PUZA 3LV6A 4AC1X 4HCLA 4AZCB 1MEWA 1VENA 1BWLA 4L4MA 3ALFA 3L7RA 3QHMA 1D9EA 5LIXX 3W22A 4JIEA 3OBKA 3CUZA 4KH2A 2IKIA 3LOTA 2FJKA 3RFAA 3GLCA 3VKAA 2FPVA 2OLHA 3S5SA 4JPGA 3UZWA 1K7EA 2EEXA 1VKFA 3W1TA 1SZFA 3O9NA 4TO8A 2G4FA 1K70A 1XL9A 1US2A 4ZFMA 4H19A 1FDZA 4FXSA 2BVTA 4TVCA 2VCBA 1HGYA 3HG5A 1GZGA 2ZUVA 1ZAHA 3PBYA 3G24A 3TQVA 1TX2A 4LSBA 4DELA 4JTCA 2ZZ7A 3VD3A 5LNVA 4RE0A 5FCZA 2FQIA 4C6IA 4F4RA 3FS2A 5CPTA 4DJED 4LALA 2QJNA 1FWFC 3QOKA 3T44A 1EX1A 2EF9A 1NY1A 3DC8A 2BOEX 4CKQA 3B4YA 1E56A 3CWNA 4IQLA 4GVGA 5LNUA 5CZSA 3W7QA 2JEQA 1QPOA 5I3GA 1F3WA 3WUFA 2UY4A 3HJEA 3LB0A 4MNJA 4WUIA 5HNTA 2QT3A 4HNOA 3W3OA 4K8GA 3FYYA 4MWAE 4C6LA 1FUYA 4IXXA 4GINA 1YTEA 4GBDA 2C18A 1OC6A 2KZHA 1TX0A 3W88A 4LAUA 4PSPA 3PF3A 3WLHA 1ZBVA 3GS6A 3VOJA 3W87A 3UNTA 4EAYA 2HISA 4Q8VA 3KBWA 4I6KA 1TFVA 4Q32A 1CXIA 5T9BG 1ZHAA 4Z1DA 2RDWA 4NJGA 4AD0A 5DY3A 1NDVA 4PRRA 1GJUA 4HSNA 5EB8A 3PR2A 3MHFA 1C90A 2G3IA 3M0XA 3N29A 3VCCA 2DPEA 3MZNA 1XLGA 3DH7A 4J1OA 3LBOA 1FWSA 3WQ8A 4QLLA 4U3AA 3S1WA 4IM4A 4MAZA 3RAOA 5K7JA 4W7WA 3QV8A 4BEQA 1YYAA 4DJEA 5EYWA 3RNDA 4UTKA 4Y9AA 3W28A 1W32A 3QY8A 3ZWTA 4Q7BA 4P7QA 4LB3A 3KRUA 7TIMA 1W1A1 1LJYA 4WLCA 1JCJA 5G1YA 3HG3A 1P5BA 3ARTA 1F7BA 4GIAA 2VNCA 5CLWA 3DHUA 1EWDA 5A5WA 2D23A 4K8EA 3UD6A 5MHBA 2XG9A 1DORA 3A4WA 3CXOA 3AUOA 3SCVA 1RQHA 4AF0A 1TJ2A 3DKLA 1LWJA 1HJUA 5FIPA 4O1AA 3WQVA 4IZGA 3MSGA 3EX4A 4HA0A 3GX9A 5BW6A 4WY0A 5A2CA 3FSUA 4PR4A 1LRNA 4CU6A 1S5WA 2VXNA 3GVVA 5I06A 1EP3A 3UVIA 1Y5WA 3GH4A 3S42A 3O07A 2PWVA 3ANUA 1JL8A 3AYRA 2CWXA 4KFOA 1OFAA 4PN2A 1PSCA 3CBWA 2FLIA 2C1GA 1N55A 5FF3A 3L5LA 3KBSA 3EXRA 2C71A 4HHPA 4R27A 4UQDA 2BDQA 4AIOA 1IF2A 2QULA 4S1FA 1Q65A 4H83A 3UERA 3K4DA 1QW7A 1F4HA 2W27A 1SSGA 1E1EA 3F4VA 2NQZA 4B15A 2VEIA 1Q2RA 5LIWX 4MPKA 3RX2A 3CWHA 1W56A 3SY5A 4LV9A 2D2JA 4DXKA 2BHZA 4LRTA 1G4PA 3L4ZA 4LUTB 1OFQA 1W1TA 4PE8A 4NAFB 4C65A 4DN1A 3N4FA 3CL7A 3H2MA 5ENLA 3VNKA 2YA0A 1Z42A 5FI8A 4DJDD 3SAZA 1PZ3A 1IWBA 3SN0A 4JCLA 2RGMA 2R8WA 4Y9OA 3QC3A 1LCOA 2PFHA 1ZBKA 4JBRA 1K6AA 1B31A 4TOQA 1RR2A 2OOFA 2XM2A 4Q7NA 2PTDA 4OFCA 3WFAA 2BGNE 3T9PA 4ZSTA 1ZSXA 3GNNA 3DGBA 1GKPA 3OLIA 2FFCA 3MZ2A 1MYRA 1W9XA 3NL3A 1A5AA 4PBFA 5FAGA 3DOPA 1FHDA 1WDDA 4HVXA 4GQBA 5HULA 1E3ZA 5CPMA 4P8WA 1TIWA 1JFHA 8CGTA 1AFSA 4H6KA 1HL8A 5BMXA 2QZRA 4K7YA 3DKJA 1IE7C 3COTA 4J3SA 5I78A 5LXXA 4UFJA 1A5KC 2DU2A 2YJQA 3F03K 1J01A 1TR9A 5I07A 1Q6RA 2PF8A 5FEPA 3PFMA 3CZJA 2EXOA 2WZHA 4LC8A 3BLKA 3CPGA 2G5WA 4AD3A 3W9ZA 3PTQA 4PZVA 4DJDA 3LHZA 2QF8A 3VINA 2HVOA 5D2YA 3UGRA 2WZEA 4QE4A 2ZRUA 3EOLA 4G7EA 4J3XA 1ZJAA 4XKYB 1OZMA 1XSKA 2FZDA 4JTLA 1LZOA 2V38A 1B3YA 3Q94A 3LY0A 3PPFA 2YYUA 5CZKA 1E6SM 2XVNA 1MMFA 2DIKA 4DO6A 1I60A 1ZB5A 3WUEA 1RP9A 3MCMA 4IP7A 1E1CB 3E5BA 4CNTA 5HINA 4O14A 2PZ0A 4F0MA 1TE1A 1TMQA 1OF6A 3HURA 4QROA 4B91A 1KTCA 2C16A 2IXUA 4EF9A 1X1ZA 4WSJA 1EEXA 3ITXA 4GJJA 1XHGA 3R0UA 1W9PA 1QTWA 3BK0A 4JN8A 5LHFA 3M5ZA 4HN8A 4UNKA 1UKOA 1GYNA 4DO5A 1HT6A 1KXTA 3NQGA 5AYIA 2R24A 3CC1A 3LTYA 5FEWA 4BK9A 1YDVA 4GISA 1PCKA 4QP0A 2G96A 3W7JA 4GVIA 3USBA 3CQ0A 1CECA 4QFUA 2A2IA 1QK0A 1A0EA 1A5MC 1K3UA 1L8PA 4KCWA 1O5RA 2YLLA 1SO3A 3VPLA 1F6PA 1M7JA 4NT0A 2YKKA 3TYBA 4D6IA 1GVRA 4AWSA 1V5XA 2BVWA 3GFYA 5CBJA 4O53A 3VNMA 4ACZB 3N17A 2R82A 2HJPA 2WOQA 5H6HA 3PBWA 4KFNA 1WE5A 2WV8A 4LUIA 3ERPA 2R91A 2BGSA 1YBQA 2YBVA 5I23A 2OG9A 5TIMA 2YZRA 1LUCA 3A23A 2J75A 3MUY1 4GYPC 3MMUA 2GDVA 5ABGA 2CXEA 2ZADA 3A5FA 3IJQA 3AWOA 3CUFA 1XIIA 1V3HA 1TA3A 2J9ZA 1KXVA 2OEMA 3IS4A 4NVTA 1WXJA 3TR9A 1V3LA 4GO8A 5TQLA 3TLQA 2X16A 3W74A 3GB6A 2OLSA 5JBDA 3C2FA 3KOWA 2PDGA 4KF1A 1AMKA 2MUCA 4LT9A 2VDHA 1WA3A 4XBKA 2YLAA 3K2GA 3UWEA 1RXOB 2XVPA 1D7FA 2FHFA 5A6TC 4AC7C 3OEXA 2IPFA 1S2AA 2EG6A 4ACZA 3FXYA 4XIAA 1I9CB 1S5MA 5L9FA 1FWNA 1W1YA 3SQSA 2XVKA 4JTDA 2DZAA 2E6DA 2PBOA 5BMWA 4P8VA 5DT7A 3P8JA 2GGJA 1JVNA 1W5MA 4UTFA 2D1ZA 4C6KA 4EX4A 3WEOA 2WLYA 4QG8A 4L80A 4HT3A 3UYIA 2YBTA 3RM4A 3VZYA 3ONCA 1Y5VA 1UB3A 2QEZA 3V4BA 3PANA 3SRFA 1KB3A 1VRXA 2WMKA 3HFTA 4M1RA 3PZUA 4E5TA 2VFEA 4ZQMA 4F0LA 4DUVA 3ANVA 2VGGA 2G37A 3EWZA 3N2OA 4X63A 3EB3A 4M80A 5A6MA 4J27A 3SM0A 5D03A 5A6SA 3E2VA 4AIUA 1VEMA 4LS1A 3EDJA 1GK8A 4IJCA 4LY8A 4BF9A 4QCEA 4XVDA 4ERGA 2ADAA 1CB7B 1S2VA 4LVDA 2DVXA 3EX6A 4UUIA 4GYPA 3EA1A 1HUVA 4WD0A 4DUOA 3B8SA 4NAEB 4W89A 2FPYA 4MSSA 4NP7A 1V0MA 3BLEA 4B9ZA 4IOTA 1G69A 1K02A 1L8NA 1QI0A 3UWZA 5U4NA 2VZOA 4UFHA 1ENUA 3W72A 3IAPA 3NSNA 5AC8A 2ZUUA 3TQKA 3KX6A 2BVYA 5MKGB 3TX9A 3UVAA 2DQXA 1HF6A 3LRMA 3PUGA 3REQA 1EX5A 4S2BA 2IMRA 3N13A 4XZ9A 5BU6A 1WBJA 3HQPA 1DTNA 1ZPTA 3W7IA 3NQMA 1J5SA 1F2JA 3BZGA 1J6PA 3A6OA 4L1GA 4H2HA 3R8GA 4Y96A 1EIBA 1F61A 1EC7A 2DORA 1A4LA 1JI2A 3GC5A 2PDWA 4O54A 3VK5A 1YLVA 1XR2A 2QNEA 3PNUA 4WXZA 1TIMA 3CHCA 1ZL1A 4LS0A 4B2DA 1V6TA 4AY8A 4ZCWA 3KCOA 1VYRA 4EK7A 3VNJA 2FGZA 3IUIA 4S3JA 3SCTA 4P7RA 3UG3A 5AN7A 1RQBA 4MZ1A 4IIEA 3ZM8A 4R33A 3VCRA 4C1LA 1DIEA 1FA2A 5HNNA 3F1QA 1OCQA 4MG4A 4GMEA 4PUKA 2WQPA 1YPIA 4PMUA 2OO6A 3MBFA 1OZQA 1YNPA 1V93A 4PL2A 3AXIA 2WBKA 3CUXA 2TSYA 4IQEA 3TNBA 2WYSA 4J4KA 4XZNX 3VOFA 2DZTA 4JKKA 3MI3A 4JX4A 1W9BM 4UFMA 3C0JA 3CM4A 3TONA 1VS1A 4JTQA 2V30A 2WB5A 3WX7A 4O18A 1KFWA 3UF9A 3PTKA 1H7WA 6REQA 1BGAA 4A8NA 3WUBA 2I17A 4XZBA 1ZBWA 3EA3A 3LA4A 3BZJA 3MKVA 2JALA 3GZAA 2QUVA 1J12A 3W2NA 1QW8A 1UR4A 2QMKA 3FXGA 3S9YA 5I3HA 3NZRA 5I3KA 2XIJA 3DG7A 1JNDA 5K9DA 3LTSA 3M7WA 3CV6A 1TWDA 1A5NC 4XTDA 1UZDA 1JYNA 4GIEA 4B16A 3H4XA 1D7KA 3NJ3A 4FALA 1HVXA 1SZRA 2WMHA 1A5CA 3DHDA 2HSAA 3B0YA 2A3EA 5C55A 1I2QA 1X97A 3OHIA 1RZMA 3W83A 4NSBA 1Q8AA 4KGJA 1PEZA 2OOGA 3M47A 2OKOA 1UR1A 3QV6A 5EY5A 4GZ7A 4CCCA 5LA1A 2E1DA 3VX1A 3PHAA 2CHRA 2ICSA 3U5UA 3ITOA 4LWWA 5JU6A 1RJPA 3AZRA 3B0PA 3R0KA 1RA5A 2CW6A 2Z1VA 3EDDA 4GI8A 3ZT7A 1DEDA 1VCFA 4XUGA 3PZNA 1CGUA 2HPMA 4TIMA 2V3FA 4L4PA 1UWQA 4ZL1A 3W01A 1ZRQA 3GR8A 3VABA 1BG9A 4MWAD 4K37A 4W85A 2YA1A 5ECVA 4FI4A 1E6ZA 4IIFA 3VM7A 1VHNA 1JD9A 2X1UA 4IGNA 1GJPA 5H8UA 4QJ3B 3K46A 3BSHA 4Z0SA 3O05A 4HSHA 1XSIA 2E8YA 2JGYA 5T9CE 4JNMA 1TV2A 2GK1A 4ZMGA 4JIQA 1FFRA 4ZQOA 1H7OA 4TV5A 1W3TA 2GWNA 1BPLB 1BYAA 1CXKA 4MDPA 1BLIA 3URNA 1TPWA 3CB3A 2VUNA 5AHLA 1P0EA 4AX7A 5A6BD 1PDZA 3FX4A 4MMWA 3FKRA 1Z9AA 2ISFA 3M46A 4C6QA 2VEPA 3NZGA 4C5YA 2NQ9A 2JKPA 1XP3A 2J77A 3LRLA 4V1YA 2FKPA 4FF7A 2V5BA 4NKCA 4QHRA 1M04A 3LV5A 4HJFA 4HU0A 1UBPC 3AU2A 1V77A 4HMDA 1E72M 1FH7A 1YEYA 1Y0EA 3ENLA 3NL2A 3GG1A 3MQTA 4AZ5A 3H7RA 4PMOA 4NIRA 3CH0A 2CKRA 3MKKA 1I75A 2GK1B 3TAOA 3A21A 3SI9A 5AC6A 2BHUA 4CD5A 5J8LA 1E43A 4JS3A 3WQDA 2ZKMX 1KV5A 2YL8A 3R89A 1SZNA 1VHCA 3BLLA 4CNOA 5CJ5A 1X96A 4PB4A 5AY7A 2O56A 4Q6JA 3W02A 3OQEA 4ENLA 2WC3A 3FK4A 1HN1A 1HXJA 1S2WA 1I4NA 1IEVA 1XLFA 5BRQA 4JKMA 1AQMA 1GZJA 3B8TA 1ZQ5A 2WC4A 4NYYA 2G50A 3WF4A 7REQB 1Z44A 4JQ3A 3PN8A 1YE6A 1YHTA 3W37A 4LBSA 4AMAA 4DY1A 1TWZA 2OCZA 4G56A 4ZBCA 3DG3A 3UW6A 4H6QA 1K4GA 4HTYA 4Q8UA 1E0WA 2PBGA 4ZE5A 3M5YA 3AROA 3V0UA 3GUWA 1W6TA 3O0KA 1QATA 3TP4A 3C8NA 4QEEA 2EKCA 2NV9A 1H1NA 1X6UA 4S38A 5CQ1A 3BPWA 2G0WA 1J11A 1JDAA 2J9XA 1Q66A 4Q4MA 1R87A 5LZLA 4QNEA 1L0PA 1E4IA 3E0VA 3KOFA 2WVSA 1JDCA 1VIWA 1U5JA 1K8CA 2AQVA 2R94A 1LQ0A 1W3KA 3NWRA 2PU1A 2C79A 3HIJA 1BQGA 4KS0A 2E3ZA 5FF7A 1EJTC 3GDTA 9XIMA 3SGZA 3BAJA 4HYWA 4O15A 1CLVA 3I6RA 1KBKA 4GFSA 1DIOA 2XFWA 2W6RA 2PDFA 3E0FA 1DQWA 3CV7A 1T40A 3S5ZA 4PUUA 4RXFA 3T78A 1JCYA 5C2XA 3AS2A 2BX7A 2B7OA 3MP4A 4X22A 4Q4RA 2GJXB 2HK1A 4RL3A 5EMKA 5CH9A 3EKZA 1VD6A 2VFIA 4PL1A 1GHSA 1UWRA 1WOBA 3NQ7A 5E0KA 3L0GA 1JPKA 3IIZA 2W0UA 2C19A 3BAYA 5FJJA 3W23A 1GEHA 4ATLA 5H1WA 1DJIA 3AS1A 3RHGA 4Z08A 2ZVIA 4TTUA 4PTXA 4FS9A 4KIEA 4IPJA 3TJIA 1XIDA 5C54A 3TC6A 1EJWC 5AFDA 3VAVA 2B7QA 3AMDA 1T8QA 2D3LA 4AY1A 1JXJA 4X0NA 3GHSA 2VL4A 3ZMRA 2RJHA 4YPJA 3DENA 3DC0A 2FH8A 3QHNA 4QSHA 2NQJA 3W0KA 4X0VA 1KRMA 3HOJA 3CAQA 1ELSA 4H6EA 3UWQA 3GBDA 4KCTA 2NT1A 4DIAA 4XZIA 1KM1A 5T26A 4QIUA 1Y8BA 2VZVA 3PZVA 2VX6A 3RLVA 5F2LA 2AMGA 5D30A 3TYDA 1ZCOA 4NILA 3H4GA 4D8AA 1AUSL 2JF6A 4UOZA 3P0XA 4CNPA 4W8BA 3G18A 4GJIA 3CUHA 4UCFA 1IR1A 2E09A 1TPH1 3QH2A 3WDRA 3ZSSA 2ZX8A 2X0SA 1M65A 3MANA 3FHQA 2WWCA 2J7CA 3MP5A 3R1ZA 3S2CA 1DJGA 3VXGA 4R9XA 4CQDA 4B4HA 1VFFA 2YR1A 2ISVA 3IPWA 4WEVX 3UU0A 1HZYA 1DV7A 4GVHA 1BYBA 3EWCA 3M0YA 3K4AA 1JPHA 2DJXA 4WDUA 4XV0A 3UJRA 3BLDA 4WIWA 2VQUA 4J35A 4NI3A 1KR0A 1RUSA 2XGBA 4MWAC 4AX6A 1BRLB 5F2IA 1OX6A 4NZ5A 3BV4A 1XF0A 2BG5A 3AIBA 3VNDA 2Y5JA 4ZZ9A 3FVMA 5F4XA 5FD0A 1M01A 4L4LA 3QPEA 1B57A 3GNOA 2ACSA 2LLEA 2Z2BA 1TWSA 1R2RA 3NQ6A 1R2SA 4HU4A 4IIHA 2JF7A 1WPCA 3B04A 2XSAA 3OBEA 3VD4A 1FCUA 2ZA3A 3OO2A 3TNOA 4DLMA 2QDDA 1NU5A 4LUTA 3BJFA 4EPDC 5LGXA 4UQBA 3REQB 4RK8A 3IIPA 1PTGA 1UD3A 2QW5A 2IW0A 1YNYA 1P0NA 1EPVA 3WCZA 2ZOXA 3VOGA 3AXMA 1ISZA 3V1PA 1YTDA 1RD5A 1QNRA 3E2QA 4Q6XA 3AAMA 3FVDA 4MY8A 3I65A 5J04A 1YIXA 1L6SA 3S6OA 2X41A 1NM9A 4FF5A 2X0YA 3E74A 4AVOA 4QG9A 5F2MA 3W2JA 1UR2A 2XIBA 3NDOA 3G1HA 5G4EA 3NXFA 3RPTA 2GOUA 4MUPA 2NSXA 4XBSA 4QQ3A 5FSDC 3SJNA 1JZ3A 3OJGA 2ZUWA 3VIJA 4EANA 1UKSA 1PE1A 1XISA 3W7NA 2F6XA 4E4PA 3OLDA 4A05A 5AHEA 4M1BA 5I6SA 3QSRA 3PM6A 3T6CA 2W62A 5HR7A 3SGGA 5EFDA 3NG3A 5DBTA 2PWFA 3DYOA 2CZFA 1F73A 3U4FA 2VT0A 3T4WA 4I6VA 4JX5A 2QF7A 1ITXA 3E5PA 4C91A 4B3ZA 3LENA 1TPC1 3GW0A 2X0HA 3GO2A 4JY9A 4RDZA 1XGDA 3KP0A 1SQ7A 1V4YA 2D2GA 2ZX9A 4NHVA 3UXIA 2AMXA 3QXBA 3ES7A 1TJ1A 1GWJA 4MB4A 3TN6A 2EG7A 5D32A 1FWWA 2PDPA 3CL8A 4P5UA 3KM8A 4W7UA 4WX2A 2PPGA 3KXQA 5EMJA 5IHRA 1HKIA 3B05A 1VJSA 4QGCA 1ONWA 3ZLGA 1QVBA 4YTSA 2YPIA 3DGRA 2HMCA 5FJTA 1GW9A 3AQUA 3UETA 3BOFA 4MB5A 4MY1A 1H4PA 1Q5MA 1VZWA 2XGIA 3ZJ8A 3QJAA 2FGBA 4B5SA 4XZHA 2PTYA 5DLCA 2NVDA 4DF2A 4XBJA 3C2EA 3C0QA 1GKRA 1S2UA 3T4CA 1LT7A 4M24A 1TB3A 4YHEA 1XSJA 1MDLA 2ZQ0A 2J74A 2R1PA 5TF0A 1I1XA 3RMJA 3R8RA 1NH6A 3GK0A 3A9BA 3WBYA 4O0KA 1S2TA 5FESA 5T8GA 2X1SA 1UW9A 4KWWA 2WLZA 3II1A 1A47A 4JAWA 1MXGA 2NUXA 4MWAB 3TTEA 4N9CA 3W2UA 4GI6A 2OYKA 1IEWA 5HATA 3WL0A 4KEVA 4IF2A 3CQHA 5FL1A 4GVFA 1QNOA 3TU9A 3D3FA 4O57A 5A8GA 1UD6A 5I24A 3NYZA 3G2GA 1TMLA 5IRPA 1W17A 4RW5A 3O6AA 3WEZA 3OGRA 3HFYA 1M53A 5D38A 3M1ZA 4YYFA 4US6A 4BQ5A 3N2BA 5G2HA 1KFCA 1CWYA 4RXGA 4IFRA 1V03A 3OP2A 3F5KA 3VUSA 2A1YA 1Q6GA 3KFTA 2Z1BA 4HSOA 1VFOA 2CFFA 2X2YA 2ACUA 4NAEA 2CKSA 3H4WA 4PA8A 3N2CA 4EACA 1CXLA 1WNOA 3KZPA 4RPQA 1H51A 1J0HA 1WZAA 4KEMA 1LT8A 7CGTA 3GVRA 3PG9A 3BOLA 1LL6A 1MO0A 3LRKA 1LLWA 3W7OA 4B92A 1EGVA 1TELA 3OQ8A 2Y8VA 1Z6KA 3N9SA 5FEZA 5TAOA 3URQA 2PTZA 5EU9A 5HJYA 3HO8A 1Q6CA 1JYVA 2B81A 3WLJA 3GIQA 3ES8A 3OZMA 4FIQA 3VIMA 1V0NA 3RM8A 2CBJA 2CIPA 4X61A 3L4TA 2Y0FA 1J2WA 3JZEA 1GQLA 4M8UA 4PH6A 4PUEA 1FQ0A 3QEZA 3CAKA 2YW3A 4IG2B 3JW7A 5E0CA 3EYPA 3GTNA 1ADSA 4QDPA 4D72A 4CUCA 5HAOA 4UXDA 5CKSA 3QM3A 2XFYA 3LMZA 4ERAA 3THUA 1VBUA 4K7VA 2WVUA 4C6CA 3IANA 1BVWA 3W7GA 3UGVA 1G01A 2X7WA 2ZXDA 3ITVA 3W1UA 1AQHA 1FWTA 4ZSUA 3G0XA 4WJXA 3A4JA 4N7QA 1R9ZA 4BHYA 2GFTA 2XDFA 3HPAA 4M7TA 1QHZA 1CXFA 3MU7A 1I45A 3LM7A 1JAEA 3UG5A 3NEVA 1J2BA 2D2OA 1V51A 1P6WA 3AXKA 3S2LA 1LL7A 4GZJA 2NLIA 3F4CA 6REQB 4IUGA 3OG3A 4HCDA 4FLRA 1GONA 1U1JA 2VOMA 4YWIA 1UH4A 3OOQA 4URIA 3V1HA 3T0BA 1KLZA 2Q02A 2UY2A 4MZ8A 4MY9A 1YXCA 4PMDA 4D8ZA 1ZNNA 4LXFA 5DMMA 1IT8A 2YDAA 1CDGA 2GYIA 1W3JA 3EMZA 2QCLA 2Y8KA 4WGHA 4DAIA 3GNDA 4UTWA 4NJJA 4F0SA 4IH3A 5EMMA 3DEQA 1A3XA 1ZZMA 4AVNA 4QCFA 1ZP3A 2D0HA 4TV6A 2ZCGA 4FR1A 4F9DA 2PWHA 1YX1A 3WQ5A 4AEOA 2OZ3A 1DHPA 2WMGA 3UXKA 2ZWYA 4F66A 4JIIX 1TJRA 3DDMA 4PMNA 1GVFA 2R1NA 3MJYA 4O0QA 2YCJA 3AICA 4B3LA 3FEMA 4NNCA 4ZTYA 1XIJA 6XIAA 3DAQA 1R6WA 3BMXA 5IDZA 7ENLA 5M3WA 4DNMA 1B3VA 1QWGA 1ONRA 4WY0B 5MKGA 5JBFA 3PAJA 1JD7A 3LGEA 1G1YA 5C0QA 1Y65A 4C6NA 4QBXA 3SIMA 1U33A 1ZP4A 4H6RA 5JXQA 3GHTA 3BE7A 4KIRA 3SSZA 1LYXA 1TYGA 4XTIA 1O60A 1IT7A 2A5HA 3TOPA 4ROQA 4PMRA 1EUNA 1UC5A 4RV3A 4N9BA 4WJ8A 3FJLA 3W7HA 4B5XA 1MNSA 1W91A 1E40A 2OJPA 1M1BA 3ZIZA 3OA3A 1OK4A 1RSCA 2QGYA 1DVJA 3PP7A 4US5D 1Q63A 4PUDA 3SSJA 3RK8A 2V5KA 4JHOA 4K2SA 4H1ZA 4Z1BA 3EDFA 4J28A 4RNJA 3MI2A 3DFPA 1G4EA 2ZZ2A 3PBVA 3TZFA 2OYLA 2WK2A 1KM2A 3H22A 4B3KA 1BWKA 1JULA 1NTHA 3MKCA 4HNTA 1H60A 4R53A 4RJEA 3WNKA 4C90A 4O16A 1M9HA 2WMFA 3V5OA 1S2CA 1CLXA 1IT0A 3GZ3A 4E4FA 3SUSA 4NG3A 4HTBA 3CTLA 5HUPA 5XIMA 3W1QA 3MI6A 3LMYA 1VEPA 1ITCA 3EPNA 4RNHA 3S1XA 3EB2A 3C56A 2KX9A 4LEFA 1ALDA 4KW2A 1GGOA 5LYRA 4TX6A 7ODCA 1P1MA 3FDKA 1UG6A 1QOPA 4YWSA 1LWIA 3LZ5A 1G4SA 2IKHA 3MA8A 1EYWA 5JH1A 4DNHA 3V5CA 4PB3A 4D6JA 4MZYA 2O7SA 1X1OA 4GYJA 1VFUA 1IZJA 5G1MA 4G2DA 1C8QA 5E93A 2VDIA 4TMBA 4G8TA 4DI8A 1HKMA 4QTGA 3RG6A 3W38A 1JZ7A 1ZCCA 3NAVA 4J3ZA 3UA4A 4DWSB 3PJXA 4DYKA 3E96A 3LYEA 1R8LA 3TOYA 1O5XA 5PTDA 3MWCA 4GIYA 1E9LA 2A3LA 3WDHA 1KCZA 1ONEA 3L5AA 2HWGA 3L12A 1XC4A 2NW0A 3KL0A 3BUVA 3KDNA 4UIOA 1E6PA 3M16A 1BTMA 1QOQA 3T8LA 3QW3A 3GVWA 4MYAA 3VDHA 2CLEA 3KTXA 4AEEA 4AZCA 3WF3A 1MEHA 3B9AA 3FJ4A 1NEYA 2FB2A 4QISA 2GJPA 4MGGA 4H8UA 1SW3A 3IIXA 2EPOA 3RJYA 1M68A 3P74A 1VFHA 5C6MA 3B9OA 1A49A 2WSRA 5DO8A 1FKXA 2QCGA 3WJXA 2WM0A 3UCQA 4B5TA 1AJ0A 7PTDA 1TTPA 5KEZA 3ANYA 1LBMA 4K1WA 1RBLA 4LEQA 2FHCA 4US5A 4YN5A 2G3MA 5B7YA 4HZ6A 1JAKA 3KTSA 4J2MA 4JCMA 1JQVA 1JR1A 1FCVA 1XIEA 4PTDA 1PKMA 4EKJA 3VFCA 4GJ1A 2CZ5A 4ZE4A 4FNQA 1R0MA 2BWGA 5FAJA 1XYLA 3OW1A 1LG1A 2A3HA 4ATWA 2DIJA 1DBTA 4IG2A 2GDQA 3JRKA 3Q4DA 3GFZA 3GU9A 4QR6A 2ZA1A 3T40A 1PIFA 1XPGA 3TTOA 3EX2A 2F6KA 1MZHA 5HMDA 4Q4QA 2XH7A 2P3EA 2UY5A 4B5WA 3IJ8A 4V28A 3MUZ1 1QBBA 1IZCA 2ISSA 3LK6A 4ADTA 2BV9A 3S2MA 1LROA 1POJA 3GXNA 4ZB5A 3VVGA 1Q13A 5D33A 1UD5A 4JTUA 1DXFA 3EWXA 1OGBA 3U2EA 3QQ1A 1BFNA 1R9YA 1G7UA 3QQWA 4P7LA 3QZEA 4ZR8A 1YDNA 1FXPA 1JZ6A 2E5DA 1J0IA 2J13A 1SO6A 4C5ZA 3UCCA 1U30A 4JFUA 4V2XA 4BWLA 4LF2A 1FHVA 2ZZ4A 2CHNA 5LKYA 4RNIA 1ZUAX 2OSYA 4NU7A 2I5QA 2ISDA 4ZOCA 3APTA 2RKXA 2XJ7A 4KT2A 3U57A 1TPFA 5EL1A 2CLKA 2O92A 3W6YA 4X60A 3NO5A 2WCAA 2H6RA 4CN1A 3VCNA 4JL2A 4IP4A 4I8YA 2R1MA 3IVTA 1ZY9A 3HA1A 4XK2A 2PWGA 3PNZA 1QRQA 1UMLA 3ZSTA 1OEPA 3GDMA 2XSBA 4KWSA 4DBSA 4OOUA 4Q8PA 4LCSA 4EPBC 4TVUA 4LBUA 3K8MA 3WBEA 3GNXA 2V5JA 1Q7MA 4I8DA 3EKGA 4LPCA 3C61A 3IIOA 3PULA 3W7MA 1OCNA 1PX8A 2QCHA 4H4IA 4E3VA 2GQAA 1WOAA 4J3TA 3HG2A 3EGJA 4BKNA 3AIRA 3UBPC 5JUVA 2A3BA 4HNVA 4ZB2A 2AKMA 1A5OC 3KLLA 1HVQA 4R9OA 2DUXA 3WBWA 2DP3A 3LI0A 1L2UA 3CAWA 3ZOAA 3ZO9A 1UP3A 1K4HA 2J8TA 4G6CA 2PLJA 2X05A 2FGLA 4RE4A 1K9DA 4QNWA 4XUYA 4E0CA 1XBYA 3UFYA 5D8ZA 2PDHA 4AUBA 3TC7A 2EHHA 3C6CA 2VCAA 4E4UA 4D6HA 2ZBTA 1GVEA 2NXGA 2C14A 5G4HC 1JPMA 5IBXC 5AHNA 3TXVA 4NZJA 4AY7A 3K1GA 1SR0A 2WVVB 5HQMA 5AYZA 4GZEA 1EHNA 5DF0A 1ICPA 5CAKA 5J5DA 1XLIA 1OWQA 2FZMA 1QAPA 1B4KA 2J9YA 2QCDB 4JTAA 2GOKA 1AA1B 3PSWA 4S3DA 1ODZA 2C13A 3P0WA 4YL2A 1EFZA 1PO9A 1JCLA 5D05A 3AMCA 4LF1A 2QJIA 2L5HA 6A3HA 2BY2A 3QY7A 4WHBA 1KD0A 6ENLA 1GG0A 4JQAA 1KM3A 1N2VA 1QI3A 3UESA 3ARUA 5I3IA 5LIKX 2J24A 1FWRA 4ZQPA 2J8GA 1D8WA 4DRSA 3GFXA 2VGIA 1QNPA 2RH9A 1SW7A 1XLJA 3QQ0A 3L0NA 4CVUA 1J0JA 1W8SA 3OVQA 5CEWA 1A3HA 5IFPA 3R7MA 1XLCA 1I0DA 1GQIA 2HPIA 1KLYA 2ZUTA 3M5VA 2VWTA 3GQYA 3VKDA 3W1PA 5EMUA 4A8RA 3GTHA 4CGTA 3I68A 2I9UA 1NAL1 2PGFA 1EPXA 3HJZA 3HGJA 1OYBA 3RRXA 3K8LA 4AWEA 3TAKA 2A6LA 1ZS2A 1R47A 2Z7GA 4XAPA 2DSZA 1MI3A 2ZE0A 3EA2A 1XUZA 4EXBA 3IWPA 3AMGA 1TUXA 2WHMA 3INPA 4GD0A 1XRSA 3AMLA 1BYCA 5A6JA 2INEA 3S3GA 1QMLA 4A8LA 4R7WA 1SSDA 3WMLA 5H2ZA 4JGDA 4O12A 1X6NA 1B3ZA 3M07A 1WBHA 2HVNA 3O15A 1LM1A 1AW2A 3JR2A 3N9KA 1UJQA 4GI9A 3VZXA 1XUUA 2D24A 3LNPA 3ZQ9A 4AHOA 1JDDA 4O11A 1D3GA 2EG8A 3RYSA 3PAOA 2IPGA 1HJQA 3K1DA 3MUIA 1FWEC 1UR8A 1W5PA 4AF0B 2VP8A 1Q8JA 1MRAA 4GKTA 4UNLA 3AMKA 3L2LA 4JQ2A 3CZKA 4QJ5B 4JQ1A 3H2OA 3BG3A 4KEZA 1XDMA 1BYDA 3LBMA 1RCXB 4YTQA 1XLDA 3KS5A 4UZSA 5KETA 4WR3A 4DBDA 1DJWA 1NOFA 5CBIA 1KFLA 1WXYA 3WNMA 1H1YA 4HNNA 1US3A 1LOQA 5C2CA 1NVMA 3G8RA 3CL6A 1LRTA 1CW2A 4AHQA 3RDKA 1XH1A 4PTWA 1H0GA 3NR0A 3EOUA 3GHRA 4DHGA 4GYFA 3LXAA 3UWYA 3W26A 5DT5A 2H8XA 2QGHA 5M2FX 2VC9A 2X7VA 5G2WA 2OR2A 1Q7ZA 2BP1A 3MW7A 3R94A 4J7RA 1PX4A 3NVTA 1XRTA 3BCDA 4D6CA 3NA8A 1Z32X 4YLWA 4GNVA 4QJ4B 3TLLA 5FA5A 3IGHX 2PWUA 2ZFAA 3O6CA 2P8CA 3T2QA 1ONXA 3EXSA 4E2OA 1ZU8A 4I9TA 4Q4OA 1CGXA 4L1XA 1KC7A 8A3HA 1K1DA 3BSGA 4E8GA 1KO0A 2A0NA 2QDEA 2Z28A 1GZ1A 3LSCA 3AXHA 1HW6A 2QMJA 3CIXA 3KVMA 4OTKA 3RPMA 4K38A 1BXNA 1OK6A 1KM5A 5C5YA 4CEUC 3WFZA 2ZDRA 5HPOA 5AYBA 4JEQA 4XO7A 4LFYA 3O0FA 2ZRYA 1QPRA 5JBEA 3WG6A 1C93A 1I6NA 4OECA 4J9JA 4HMEA 4AHPA 1QASA 2OSWA 3U2ZA 2Z6IA 2HVMA 4DYEA 3UYCA 2JIEA 3H55A 5E70A 2ZZ1A 3LX9A 4MTVA 2VKZG 4QSFA 4MNLA 3E02A 1FCQA 3HGOA 1BHGA 4N9DA 4JTTA 1W3HA 3W70A 3M0JA 3ARVA 3D5HA 4QAIA 1UWUA 5CPQA 2J25A 3ITTA 2Q8XA 1OT2A 4PBEA 1WB0A 2QVHA 4ZO7A 1FH8A 2WMJA 2E5BA 4HPXA 4I5UA 1NARA 4D71A 4H00A 4ORMA 5K9CA 3LCLA 1LWHA 2Y2WA 1Q4WA 5K2ZA 3TV8A 1OQFA 1C29A 3C86A 4DX3A 2CLPA 1FFQA 2AAMA 3A64A 1M5WA 2J88A 1EEPA 2EPLX 3VOCA 4FXRA 1H7RA 3QYQA 2PF0A 4L65A 2PSNA 1EUAA 4WOZA 3C3UA 4RE2A 1D2KA 1S1PA 3TCSA 3MMDA 2VC6A 1R46A 3R58A 3WQOA 4HOWA 1R3RA 1D3HA 5CGQA 4OT7A 3P5YA 4YHGA 4MADA 3AI0A 3GDKA 5A8QA 2Y7EA 1Q4NX 2DZXA 3B8IA 1A80A 1QI4A 3WO8A 5IHSA 3VIIA 4BY3A 4GUGA 5JVLA 2XYLA 1AZ1A 5DXXA 2DT3A 2GQ9A 4HK5A 1NJJA 4DQWA 1JCXA 2PB1A 1JGIA 1QPQA 1QK2A 4XISA 1TUFA 4QJ1A 3S5NA 3U5YA 1SFJA 3QGKC 2G3JA 2QJHA 3SFKA 3F2BA 3ARXA 3FW6A 3U2OA 2FMNA 2ACRA 3LDVA 4Q22A 4GUIA 4HOZA 1Z8AA 3TSBA 1K8YA 1EJVC 2NV1A 1UH2A 3KUMA 3DYPA 3M6YA 5BXPA 4A6GA 3VGBA 2J79A 4NAFA 1RP8A 5CGMA 3M6DA 3CZGA 4FOJA 3ARWA 2CPUA 4KRUA 1B3OA 4RZ4A 3UXLA 3S0CA 3I7RA 4JNYA 2BVDA 1W3LA 1GQNA 4IT1A 4E8CA 2V0TA 1HKKA 1OFDA 2NV2A 4D6FA 3B40A 5EBAA 2BBFA 1N7KA 3GWQA 4S3EA 3NYDA 4GG9A 3QFEA 3PG8A 2IPWA 4H41A 3SRHA 2PU0A 1V6UA 2CLHA 2NQ5A 1J6OA 5GVJA 1KKRA 1H7XA 3WQWA 1KCXA 3KWSA 2YBUA 2FJUB 3KBMA 4Y7EA 2B4GA 1G4TA 3MS8A 1UPPA 1AQFA 2FVKA 1EJ7L 4JHMA 3M0VA 2CITA 3T05A 2C6QA 4F48A 1KRBC 1DWGM 2R6OA 4UCGA 1BAGA 1LLOA 2V2CA 1GVOA 1K7FA 3R11A 4NXSA 3U0HA 3KBNA 4XD4A 1K9FA 5GNXA 3QV7A 2CBIA 2Q6ZA 1XDLA 3L68A 2F7FA 1B0IA 3RR1A 1WKYA 3F5LA 4RR4A 2WM1A 1XYCA 3NOEA 4P2VA 5LNSA 4XD6A 2J62A 9RUBA 1JYXA 4EWJA 2GGIA 1VPXA 4GCXA 2CEQA 3T0DA 3VUPA 4K8HA 1C7SA 1QR7A 1V08A 1TJPA 3C2RA 3FGCA 3ARYA 4IQJA 1T8XA 4XZLX 3UZJA 1SFTA 3RITA 5E6ZA 1E15A 4PMJA 4YVXA 5KTLA 5LSMA 3GVQA 3V0SA 4TX8A 4DWSC 3S9ZA 3HPZA 1PPIA 4JIHA 4UTWC 2PDUA 3OU8A 3SY1A 3WDPP 2ZRWA 3RMEA 5HUOA 1TR1A 1HG3A 4Y2WA 1R2TA 2OSXA 2WKGA 1VLWA 3BV7A 4N9EA 1GYLA 2XN0A 3VIGA 4MPQA 4LUSB 1MW1A 4QLJA 4CQAA 1ISVA 2EJ1A 5F1UA 4IFKA 3C52A 3BO9A 4JTHA 3STPA 4ADSA 5D09A 4DJFD 4Q8QA 4HPHA 5F2GA 3NVDA 2FTWA 1UQZA 3Q58A 2HCVA 2FTPA 2VQTA 2V2DA 3SZ8A 3W7KA 4F79A 2VEMA 2YDSA 3R4IA 4BWLC 3UG4A 5A1AA 1P43A 2JK2A 4J2PA 1U22A 1AG1O 1XCWA 2PTXA 5CC7A 3R25A 4HZ7A 4HYVA 1XG4A 2E6YA 1RVKA 1Q6DA 3ITGA 4WKFA 2GUBA 1EZWA