4MWAA

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
260
Chain Sequence
MNEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTKTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDVRINPGNIGRRHKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 93
structure length 260
sequence length 261
chains with identical sequence G
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaA00
4MWAD 4S3DA 4O0QA 3H26A 4C1NB 4S23A 1Q8JA 2H9AB 3MCNA 3H2MA 4DB7A 3H2EA 3H2AA 4DJDA 1Q7MA 2OGYA 4S3EA 4DJDD 2YCLA 4MWAE 1Q7QA 3TZNA 4G9PA 2Y5JA 2DZAA 3TYUA 4C1NA 4MWAC 3TYAA 2H9AA 1AD4A 4O1FA 3BOLA 4S39A 1AJ0A 2VEGA 4HB7A 3TYEA 4D8AA 3NOYA 3H21A 1Q7ZA 2BMBA 3H2NA 1Q85A 4S3FA 4DJFA 3TZFA 4DJFD 4DJDC 3MCMA 2VP8A 3BOFA 1TX0A 4S38A 3H22A 1TWSA 3TR9A 3H2CA 4S3BA 3H2OA 4D9PA 2Y5SA 2YCKX 3TYZA 4NHVA 4O1EA 3K13A 1AJZA 4MWAB 2DZBA 3V5OA 1Q8AA 2VEFA 4DJEA 2YCIX 1AJ2A 4DJED 3TYBA 4NILA 2DQWA 4DAFA 4NIRA 1TX2A 3H2FA 1TWZA 4S3CA 1F6YA 1TWWA 4DJEC 4D8ZA 3TYDA 1EYEA 4DJFC 3H24A 2E7FA 4CCZA 5JQ9A 4PZVA 3H23A 1AD1A 3MCOA 4NL1A 3TYCA 2Y0FA 2YCLB 4S3AA 2YCJA 4DAIA 4MWAA
chains in the Genus database with same CATH superfamily
3LM7A 4PRRA 2E77A 1I2PA 2WMFA 4TX9A 3AZRA 1L6SA 2XVGA 3GU9A 1LT7A 4AZBA 1BWVA 1Q7MA 3VE7A 1XBYA 4CD4A 5DMLA 4HPXA 2FTPA 3AWOA 3QYSA 3W1XA 1GGOA 4BWLC 2E6FA 3E2QA 4GI4A 1J8VA 1SO6A 2QDGA 4MNKA 4J3ZA 2A2IA 3ZIZA 1RA5A 4KCWA 3DKJA 2QMJA 3RUBL 5BNKA 1W1ZA 1ZHAA 1SSDA 1JUEA 4GQRA 2NSXA 2J27A 1LLZA 2NWSA 1OYCA 1SQ7A 4P8UA 4C1LA 4A8LA 1NU5A 4Z0JA 1QR7A 5H8PA 4OWGA 3NQ8A 3SZ8A 5HJYA 4FLQA 3VIOA 3XIMA 1NELA 1DTNA 5HMDA 3K30A 4GY1A 4BQ4A 1XCFA 3N2BA 4DBUA 1TCDA 4ERIA 1F4HA 4L9XA 4QBXA 4YWSA 1F3EA 1ML1A 3CUIA 5AYZA 1S2UA 2WV8A 2GPTA 4HT3A 4JNYA 3IIZA 3N3TA 4K2SA 4A3QA 5BWAA 1JD9A 3KXQA 4FZIA 2DT0A 5HNNA 2PCEA 4A3YA 1UZDA 3Q67A 1XFCA 5KEZA 2VMFA 4XD5A 3CHCA 3SQSA 4KFPA 4RW3A 3UZXA 5G1TA 4A29A 2OOGA 3TKFA 3OA5A 2WC7A 1VC4A 3BTNA 4UOQA 1VFOA 2ODOA 4N4PA 1XGDA 4ZVJA 2NUWA 1OM0A 1MW1A 4UR8A 3LPGA 4E38A 1JCMP 3NL3A 4LNYA 3GU1A 2O7SA 1K7FA 2GUBA 1FRBA 1P0DA 1YXCA 2YKKA 3TN6A 5JBDA 4GH1A 2CERA 2UY5A 4LS2A 3SCOA 1OFRA 1UR3M 1EP2A 3CB8A 3ATYA 3HPFA 3IAPA 1DJQA 5D2TA 3DG3A 3LYEA 5LYRA 2J47A 3TA6A 1KBKA 2ZYFA 1P1MA 3KCOA 3AJXA 3PBGA 3VIPA 1OGSA 3PC0A 5I09A 3SCQA 3EB4A 3T0TA 1FBAA 1TA3B 3UYIA 4C7GA 3K13A 3FY1A 3P0XA 1E70M 3WNNA 3A9BA 4CQDA 4F48A 4HZMA 2OODA 2QDHA 3DFHA 1WDQA 2GOUA 2GVJA 3QVQA 4QITA 3RPTA 2C0AA 1A5LC 3PJXA 2VZTA 5AVNA 3WJXA 3ZZ1A 3EOSA 2WJZA 2A3EA 5JU6A 3CV1A 1OGBA 1OK6A 3ORWA 1H60A 1HGWA 3WLRA 4KCTA 1VIZA 3P5ZA 1J0ZA 1DBTA 2PPGA 3OJGA 5PTDA 3WLMA 1Q8JA 3A23A 4IP7A 2V5CA 1XLLA 3VPLA 5HMEA 1L0PA 3II1A 3H6OA 5GNXA 2V5JA 1QT1A 3BPWA 6ENLA 5CPTA 1WBJA 3R4IA 3WMSA 1XIGA 4JY9A 1KBJA 3W7MA 3TMQA 3WIJA 1QO2A 3URAA 1V0NA 5CPOA 2Z2BA 3M64A 1DWAM 3TLLA 5C70A 1CEOA 1QPOA 2CW6A 1H7RA 3RIKA 4LNCA 4RDZA 3DBPA 2TYSA 1KLZA 2GVGA 4XAYA 3ZVHA 3O16A 3OOQA 3SAZA 4YLWA 3TYEA 3LHVA 2CBVA 1J0JA 4OUEA 1AMYA 1BTMA 1IIGA 2J7CA 1CXFA 1NP2A 4RKAA 1YX1A 2WJEA 4JTJA 1SW0A 3TYZA 1J01A 3RM4A 2DSWA 1KFCA 2Y8UA 5LXXA 3K4AA 4TTUA 2D2OA 5ABFA 1J10A 4BJHA 3TDFA 5BROA 3R0DA 4J35A 1JUBA 3ME3A 3FK4A 4CCZA 4ACYA 1Z42A 5ABGA 1BGAA 1GKRA 1DIKA 3IJIA 5FEXA 2XU2A 5HK4A 2E67A 1P6CA 3WUBA 1Q6EA 5I3JA 1XLJA 1W1IE 2D22A 2OR2A 3VGDA 2JKAA 4MPKA 3U57A 2NX3A 1W5PA 1GQNA 3V7PA 3A47A 2QYGA 1QI2A 4RNIA 2CETA 1EGZA 3TIMA 4HNVA 4PMXA 2VQUA 1HGYA 2BFGA 7XIMA 3MWCA 4UFIA 2G37A 3RLVA 3BLEA 4OIFA 2BVDA 1LORA 4B9ZA 4CEXC 4MNMA 4D8AA 3GTNA 4L4PA 5CPQA 3RJXA 4W87A 3RN6A 1ISZA 2PC4A 1KFBA 3N2CA 1TX0A 2QKFA 3RMJA 4UOZA 4IIGA 3EXTA 3F5LA 3U4AA 1K8CA 2H90A 2F38A 5D05A 2OU4A 1QK0A 5C7HA 1KKRA 4CD6A 5FEPA 4K1WA 3QY8A 1HNYA 4NNCA 2DJLA 2ZXQA 3W6LA 2W91A 2WJFA 2OWCA 3W81A 3R94A 3F5KA 2OZ8A 1DIEA 3GNXA 3FEQA 2IKGA 5EFFA 4E6MA 1JJKA 3WNLA 1OF6A 3VIJA 1HF6A 2BDQA 3M5YA 3MCOA 4MNJA 4ENLA 1GOIA 1UIOA 4LV4A 3IUIA 2W3ZA 3PVFA 2XVKA 1HP5A 1DEDA 1D3CA 3S1WA 1US0A 1W5MA 3W23A 4K7VA 2NQLA 3ZVHB 2DY3A 4AHOA 1UKTA 4MOZA 4Q4RA 2YYUA 3EGJA 2XZ7A 3EYPA 4DJDD 2V3DA 4JKLA 2PUZA 2NSOA 5EMYA 2W79A 1JZ5A 1CGTA 3UZWA 1ZBWA 1E0VA 1T5AA 3MP5A 3G1YA 2IW0A 1OB0A 3TSBA 3T81A 5HNTA 3LB0A 2OFJA 1A3XA 3LI0A 3SY5A 4Y9MA 1QPNA 4DXVA 3WLHA 5ABFB 1EO7A 2FB3A 3TW9A 1AH0A 3MP3A 1E6NA 3GUGA 3TCSA 1XHGA 2AMXA 2WMIA 1JZ2A 3VIKA 3WYZA 4AX7A 4QE1A 4YIWA 3NYDA 4HPHA 1OF8A 4N9BA 3UETA 1V6VA 2PSNA 3S42A 2QCCA 2DDXA 3PZ9A 1QHPA 2YCIX 3G1VA 3P67A 5HNRA 1IXNA 4X9SA 3OLGA 4MY8A 1VAHA 4XD6A 3E0VA 3GVWA 2DIEA 4QJ5B 3SGGA 4DJFC 2DVTA 4GVGA 2VC7A 1EUAA 2E6AA 3BGGA 3UWEA 3VIFA 4HNTA 1XBZA 1UD3A 3VM5A 2BGQA 3K1DA 5I0DA 3MZ2A 5CGTA 3STGA 4M7SA 3LBMA 1EDQA 1X8CA 3QFEA 1HN1A 2QUNA 3WH7A 2Q02A 3TFXA 1B3VA 5A6BD 5HQLA 2OZTA 3WH5A 2DEPA 2HMCA 3ZM8A 3OZOA 2A3CA 2VI0A 5IHSA 1EH9A 3ZR4A 2E4TA 3RM8A 1I0BA 1I1XA 4C7FA 4JYFA 4JPGA 8A3HA 2J62A 1XL9A 1TR9A 2C3ZA 1NJJA 3E0WA 2A7PA 2E5BA 3H54A 2FQIA 3A5VA 3UEQA 3CQJA 1W9PA 3WH8A 1BYCA 4S1FA 3WBAA 1ZBCA 2DW6A 4GVFA 3IPWA 1W3LA 5TQLA 4LU0A 2YGYA 3W01A 3CL6A 3HG5A 3KL5A 4KEMA 1DHKA 2X41A 3T40A 3EMZA 5CZJA 3BSHA 1M68A 1G01A 5JBFA 4GA8A 3VD9A 1HJWA 1LTDA 3T0AA 3N9SA 2VWSA 3EOUA 2I14A 2C91A 1PKNA 4HYVA 2QCNA 4U3AA 2A7RA 5JQ9A 2FMNA 4O28A 5RUBA 3QV8A 2RKXA 3W1AA 1R8LA 4XAPA 4GWEA 2Z28A 3ES7A 2QCHA 5EBUA 3SADA 3NPUA 4LQ1A 3GNNA 1SZRA 3LV5A 4WKFA 3NPWA 4F0RA 3ABRA 3ITVA 3VA8A 3JVAA 3OEXA 1KBIA 4B9YA 3C0JA 5LA0A 3E0IA 1RCOB 2BY1A 1XJBA 1PCKA 1JF6A 3EX1A 4O1CA 5KMYA 2V6AA 1ZENA 1ZAIA 2WMIB 4PFMA 4JFVA 3KWXA 2BX7A 1QHOA 2G0WA 3S9IA 4F2BA 3B8IA 3KBSA 5DXXA 1EKOA 4WJ8A 2Z1XA 5MF5A 3ZWTA 4AY8A 4XSMA 4IISA 1EEPA 2ISFA 1G4EA 1EUNA 3HV9A 5I23A 3VU2A 3BICA 3MCMA 5F2MA 4P7NA 4IIFA 2PRLA 3AICA 4WXYA 3N6JA 1JXJA 3LHUA 2PI6A 5CPMA 2EPNA 3RR1A 4DYKA 2V9DA 3BLKA 3B0XA 3LK6A 4ATWA 3QOKA 1BXNA 3CO4A 1LUCA 3UGRA 1S5WA 4Q7BA 1NY1A 4L4LA 3W1LA 3HOJA 2CBJA 1RD5A 3E2RA 4LAOA 3M1ZA 3FW6A 4HA0A 4LXFA 4MZ8A 3CHEA 2EO7A 5TD4A 3W7NA 2IXUA 2XVLA 2OYKA 3PANA 3W0KA 5A1AA 1OJXA 2X1RA 4N9EA 5C9XA 5KINA 1QJWA 2D23A 4IX2A 1GVYA 1XQKA 2CESA 4XKYA 3TK7A 2AAMA 4B5TA 4CEUC 3H2MA 4DB7A 4N6EA 4LAMA 1SZGA 5CPLA 2ZRWA 2QQ6A 1X39A 5C5YA 2B7NA 1ECEA 1E0WA 1EBGA 4IT1A 1FWEC 1JDEA 4E5TA 4I5UA 1ZTVA 5HA7A 4DF1A 1NF0A 4F2TA 2QAFA 2W0UA 4GJIA 3U2CA 4R27A 4XTDA 2KX9A 3AYTA 7TAAA 1VPXA 1NDYA 1NOFA 3TJ4A 2P88A 1GKQA 5CCZA 2WMGA 2HEJA 1J12A 1DWGM 3NZGA 5KTLA 3SJNA 4H8HA 3FFSA 1UHVA 4L4MA 3AS3A 1W9XA 3L21A 2POTA 1UR4A 2YL5A 4B91A 3XINA 3DYPA 2WJDA 1IEQA 4J3WA 1XG3A 1JUKA 1ZP3A 4A2RA 2XIJA 4L6HA 3VKKA 1A0EA 4R9XA 4Q4KA 4AMCA 3RLUA 1QK2A 1NM9A 3TCEA 1AJZA 3THCA 3R0UA 1S5MA 3DDMA 1AFSA 5GNYA 3C8FA 4HCHA 2ZCGA 4Z1BA 1KWKA 3HJZA 4XKMA 2BSLA 1QNSA 4IL0A 1XLIA 2GJNA 1SZNA 2CXGA 2V30A 3WJWA 6XIAA 1M3UA 3B8TA 1PL9A 2XH4A 3GNDA 2Z7KA 4G8TA 1KTCA 9XIMA 3G77A 4B5NA 1ONEA 3EWUA 1E9LA 1S5VA 1TJ1A 4MVAA 1YDYA 4BK9A 1UWUA 4LUIA 3P0WA 5CJNA 3GYEA 2XIOA 5BXRA 1JD7A 1EF3A 1POJA 1E6RA 3QTPA 1JAEA 3GXDA 2GJXA 4EKJA 3GVRA 4ZGYA 4O50A 4FAMA 2IQDA 4NVTA 3GRIA 1KR0A 4BEQA 1ZJIA 1B4EA 1TPUA 1VR6A 3BAKA 3LBCA 2Q3RA 1PIFA 2RJHA 3B8DA 2XGIA 4XV0A 4PMYA 5E70A 3V1PA 3E02A 4CQ8A 3PBMA 4EF8A 2DT3A 3T78A 3UWZA 1LUCB 3W76A 4S3FA 5FEWA 4DJFA 3LZ3A 3W7OA 3P3BA 3KOZA 3ZQ9A 1ZFJA 1FCQA 2OTDA 4IJCA 4FXFA 1EBHA 4H1ZA 1JCTA 3V75A 2OZ0A 2J7DA 4HK5A 4L6DA 3S2LA 4XKYB 5JXQA 3WK3A 4DJED 5LKYA 4KPLA 1EP1A 3LLXA 3PUGA 3VZXA 2HWGA 3RK8A 4OV4A 3OTRA 1F07A 1GVSA 4WDWA 3AIEA 4X9YA 3SN4A 1I2QA 3USZA 3QHOA 1GNXA 5JMUA 1E9IA 1W3NA 1P0KA 2F61A 1PIGA 1P4CA 4O13A 3GAKA 4JTQA 3O2LA 1UOZA 4H19A 1H09A 2PD9A 4WJEA 2DUXA 4MM1A 3EOEA 4K8EA 4RL3A 1CGVA 4JIIX 3V0UA 3EWZA 4RE4A 3NL6A 4UFKA 3ID7A 3EX2A 4WEVX 2J8FA 3BJTA 2XFRA 3TYUA 1Z69A 3CZKA 1BWLA 3LA4A 5F1VA 3WMLA 1QWGA 4GI9A 4M7TA 4CQAA 2R6OA 4CGTA 2VFEA 3F2DA 1EGVA 3PZNA 4LC8A 3PS7A 3MSDA 2VUNA 3PK7A 2Z1VA 2I56A 3E49A 1T8XA 1PTDA 5F4XA 2IKIA 4Q8OA 1DOSA 3M47A 4X61A 5A2BA 2GQ9A 3CV2A 2OG9A 3NM1A 3LQGA 3AMCA 1UWSA 1J0YA 1XYBA 1SMDA 1E72M 1NP0A 1BHGA 1IZJA 5C2CA 4A4AA 3V5OA 5LHEA 3W87A 5K7JA 1SZFA 3ZS4A 4DIAA 4BI5A 3PTMA 3N4AA 2PDIA 1KM1A 4YN5A 2GUYA 3ES8A 2GJXB 5AYXA 5I78A 4IMCA 1JL8A 3KBWA 1MDLA 3W7KA 1UPMB 5CZKA 3WF3A 3NJ3A 1UWIA 2XYLA 1XR2A 3MKKA 2WZEA 1JI2A 1QNQA 3MYPA 1GEQA 1GJWA 1AA1B 3GXMA 3C86A 3JZUA 1V6XA 1NARA 1Q66A 3PPGA 2D0HA 3T0DA 5CC5A 4EAMA 1T96A 2ZTJA 4HOWA 3IK4A 1ISWA 5C9WA 1R7AA 5IRPA 1DWIM 4DX3A 4PB5A 3CAKA 4B3ZA 1G4SA 3O06A 1HO4A 2BHZA 1TPVA 1XPYA 3CV7A 3LPFA 3PWIA 5JH1A 1W56A 2DPEA 2L5HA 3U2EA 1DIDA 4ICMA 3FXYA 4TUFA 3SO7A 3SI9A 3LCXA 2V69A 3W07A 4AD3A 4YTTA 4WGHA 2QV4A 3QY6A 3KDNA 3E12A 3N13A 3QMTA 3BDKA 4MDOA 1LDCA 4GD0A 2YW4A 3N1AA 2Q8LA 1ALDA 4LUJA 2ZUUA 1AL8A 3VOGA 3FCPA 2YL8A 3EOLA 1WPCA 2WSKA 4CQCA 1TX2A 4NZJA 5T9BG 3KW3A 3BOXA 4M6VA 4NJHA 4NJIA 3WG6A 3P81A 3IJDA 2Y85A 1RK5A 5F1UA 3OGVA 4KGLA 4GCAA 3AFBA 1M9HA 5A69A 4G6CA 3LQLA 5I06A 4YPJA 3QOMA 4GHRA 1GJPA 1A53A 2VEMA 1X8FA 3W73A 3CH9A 4OBRA 3UG8A 3CQKA 2OKOA 4Z1DA 2FZNA 4ZQOA 1C8VA 4PMNA 1XUUA 4OQVA 3LXBA 3W4RA 1QI5A 2P3ZA 1RD6A 4MWAC 4LANA 5CSUA 5LGXA 3PHAA 4AWUA 3C2EA 2VEGA 3CAVA 2VOTA 5CJMA 2PFHA 4F0LA 3FJLA 1TPB1 1ZP4A 3EXRA 4NAEA 1K9TA 5HNUA 1W1YA 1TB3A 1GTEA 2P8CA 3HZ3A 3C56A 1FOBA 3ONCA 4J2MA 1UJPA 5I02A 4RNHA 4WKAA 2OYMA 1TE1A 2EAWA 3S5YA 4MKNA 4EVZA 4LAZA 3ZT6A 3ARZA 1M5WA 2QJJA 2WHMA 5G4EA 3WLQA 3E1F1 2X0HA 1KM5A 2GSJA 4BA0A 1R3TA 5AC4A 4US6A 3RX4A 3N25A 3GH4A 4WHBA 2QXWA 3D3AA 4IMDA 5DXYA 1FUYA 3STPA 5I00A 2VFGA 3LMZA 3TONA 2G3MA 1ZZMA 2E6DA 3K4DA 4ICCX 3GXPA 4U31A 2BXYA 2IS7A 5CSSA 4LUYA 3W3OA 1E1FA 1M7JA 3P7YA 1YPFA 3DHFA 5D03A 3ARXA 5M1TA 4PB4A 3OBAA 3OA3A 5K4XA 5HATA 4UQBA 1HJUA 2ZVRA 3E0FA 4PMVA 4TV5A 5HR6A 1A4MA 4NZ1A 2C1HA 3ARVA 4O54A 2INFA 2CLOA 1EPVA 1W1PA 2QAPA 5E6ZA 1L8PA 4QCEA 1IEVA 1G7VA 3OHMB 2PEVA 2V2CA 2JQXA 2V3EA 1MSSA 5DCEA 1DXIA 1ITQA 3CTLA 2J75A 4OKDA 1FWTA 3WK1A 1JCLA 3E3HA 1BAGA 1JDCA 1I4NA 4B16A 4PUMA 4I5RA 4O4WA 4QJ4B 5AC6A 1RY0A 3ITXA 2VD9A 3G5EA 3VOIA 1B9BA 1VZWA 3PN8A 3TLQA 3MSYA 3TC7A 5JUVA 1UR2A 1F61A 3MYOA 5CZ0A 2VD8A 1W3HA 3A64A 3KZPA 4GC4A 2JE8A 4NT0A 3IWPA 3S83A 3WQGA 4POCA 3G8EA 3OQ8A 3RYSA 3T09A 2J25A 4HJFA 2PWFA 4HTBA 2E5CA 3W2LA 2GGGA 3TQKA 4XUYA 1SR0A 4DXXA 4FR6A 1O5XA 4PA8A 4LAUA 5IDIA 3CZGA 3VK5A 3FVDA 4NAEB 2X2YA 4MWAE 1QBBA 2VX7A 3M16A 2VM8A 2YL6A 4JX5A 2VX5A 3ARTA 2H8ZA 2V5LA 3R12A 5A3HA 1RA0A 5T91A 2CHRA 1V4YA 3NZRA 1EA9C 4CU8A 3UU0A 4W7WA 2UY2A 1PBGA 3S9ZA 1P6WA 4LWWA 4YVPA 1GONA 1KXQA 2FGLA 1UCWA 4LRSA 3PPFA 4R7JA 3BCFA 2FVMA 3OVQA 2DV0A 4IQEA 3IIOA 4W89A 4J4KA 1E4MM 3QN3A 1PPIA 3L5MA 1GHRA 4LX4A 3QR0A 2YDRA 4FNQA 3PUEA 1E6PA 2I5GA 4HK6A 4H83A 3B40A 3BURA 1YDNA 1K8ZA 4QQUA 3SCWA 3R5EA 4AG0A 2ZA3A 3H2FA 1CGWA 4HOXA 8RUCA 2ISWA 1ISXA 1XYFA 4AWEA 4LYRA 1G0CA 4OBTA 1NIUA 4DXKA 1JRBA 4I5XA 5I6SA 3VXGA 3VDAA 1VB9A 2A3AA 4GVHA 1LLOA 4TV6A 3CQ0A 1RQEA 5J04A 4L1GA 4RV8A 3KHDA 1WYIA 4GBUA 1D7FA 2W67A 3DFPA 3CV6A 3TWBA 3C2FA 3I4KA 1W5NA 3SIMA 4NYUA 3GHTA 4Q7NA 1XGZA 2WVSA 4K6AA 1V08A 2XG9A 1V03A 1B4KA 2E40A 3OQEA 1Y7VA 1KC7A 4A8NA 4AYSA 3N14A 3APYA 3V3WA 1SO3A 2VGGA 2J8GA 3RILA 3ITCA 3I65A 3O63A 3NPXA 3B05A 3QMRA 1K7EA 4FXSA 1UZ4A 5FJOA 1SYTA 4X60A 2DGAA 2E3ZA 5D9MA 4YYFA 5I5RA 1NDVA 4JN7A 2XIIA 1DL3A 2ZUMA 2NVDA 5B7YA 4ZQRA 3TN3A 3HIJA 1CXLA 4WDUA 3TAKA 4PC8A 4EIVA 4W4QA 3LDVA 1WP6A 4OHQA 3IARA 3AI0A 3UR8A 3CHVA 3O0KA 3EB2A 4DLFA 1DXEA 2WBGA 2YBTA 3I6EA 4ZOEA 2C19A 2V81A 3K2GA 3WH6A 4MWAA 4DUOA 3URQA 1U5HA 3NURA 1W9VA 4IQDA 3G1RA 1O6IA 1TPFA 1GQIA 3PTQA 4M6QA 2ZDRA 3G1HA 2XGBA 1CZ1A 3CL7A 3N17A 4LVBA 2V3GA 2WVTA 1OFQA 1EP3A 1TZ7A 4JDBA 2EPMX 2Q8XA 4O1DA 2OGYA 5C9UA 1J5SA 2CKSA 2Z4GA 3ARSA 3VX1A 6XIMA 3DENA 1E1CA 4JTFA 1X96A 5G5IA 1W3IA 3WQDA 4RK8A 1YADA 1HX0A 4IL2A 5EMJA 3A4XA 3MANA 3S6OA 2C13A 3WF2A 4NXSA 2RGMA 1WUFA 3QM3A 1TJ2A 2E9BA 4WOQA 1AH4A 3C52A 1OX5A 3SN0A 3STCA 3WDJA 1Q6LA 3PTKA 1OFEA 3BG3A 4IXXA 3SUVA 4MKSA 3RHGA 2YFOA 3HFYA 4NNBA 4P7RA 3AIUA 1E6QM 4FLRA 1LP6A 3NSMA 5BOEA 3KRUA 4KWSA 1NWSA 1UH4A 4YTUA 2HK1A 5C71A 1B1YA 1IF2A 1M53A 3MVTA 1CXHA 4CN6A 3WKZA 4AZ6A 3UESA 3ZT5A 2YW3A 1FHVA 4QDWA 1UASA 3FJ6A 3H24A 4HVXA 3UQNA 4KF1A 2QJNA 3HG3A 4R7OA 3E5PA 3LPPA 1J18A 5A6MA 1KWGA 4IGHA 2BV9A 5CC7A 2PDBA 1UA7A 1DXFA 2C16A 2WK2A 4L9ZA 3VFLA 2IQ0A 5I3IA 3CMGA 3FA5A 4HN8A 2GDUA 3O6CA 5A8MA 2PF8A 4HNOA 1XLHA 3KRZA 4I3GA 2QT3A 1BPLB 3PNZA 4EF9A 3EX4A 4LUTA 3FA4A 2DP3A 3KBJA 3W1RA 4GJJA 2H6RA 1HP4A 3MUAA 4GXMA 5DRCA 4PUDA 1WAWA 3R10A 1LOLA 1OHLA 2X42A 3NZ1A 3CT2A 3W2JA 3LUTA 4KS0A 1W8GA 1ICPA 2FH8A 1KTNA 4H01A 4H00A 1JGMA 2AL1A 4ZE5A 3TZFA 3BG5A 2DSKA 2ZRUA 5KSWA 3I7RA 3JR2A 3DI0A 3DH7A 1UPPA 2WW5A 4MWAB 1HJQA 3HV8A 3DYMA 1V6WA 4UTHA 2BY3A 4DQWA 1TVNA 4RZ4A 2FDMA 4ZB2A 1PYMA 2ZZ6A 4JNZA 3MBFA 5BOFA 1RXOB 3GK0A 3NQAA 4HHHA 2INEA 2PWEA 1ZJBA 1KA9F 3DGBA 3MP4A 5BRBA 1TPDA 5G1YA 1IIHA 4OGZA 4EWJA 3SGZA 2CHOA 2FJUB 3EXSA 3AOFA 1E1CB 4FS9A 4OJYA 3T8QA 4IPPA 4QEHA 3FYYA 5JH2A 5BXTA 3MA8A 1VIWA 2DSZA 3K8KA 2VWTA 3AAMA 1O1HA 3GH7A 1FKWA 1X98A 2BZNA 4AU0A 4U2ZA 3HBLA 3LNMA 1PX4A 1SW3A 3L4WA 4GPNA 3BW4A 5LIWX 2ZWZA 1XLFA 2B7OA 3PG8A 3THUA 3RLGA 3P2VA 1XSIA 5AHEA 4O1FA 5DELA 3VMNA 4RDWA 1ITXA 2Y2WA 4JQ4A 2O0TA 1FA2A 1FHLA 2Z24A 5K9DA 4UMBA 4H8UA 3VABA 3V18A 4J7RA 5BW6A 1OCBA 4GZEA 5DRIA 3UXIA 4DJDC 2Y61A 5LIXX 2ICSA 2VL4A 3M5XA 1S2AA 1PIIA 1OG0A 2PCQA 3KX6A 1OZMA 3OLEA 3L7RA 2FKPA 1DYSA 3UWVA 3BGJA 2YA2A 1SFJA 1XIHA 4I9MA 4WSHA 3VI2A 2QGHA 4V15A 2W63A 4NIRA 3KCJA 4AUBA 2PTYA 2PE4A 1FQ0A 4ATDA 2G97A 4RJEA 4QM1A 3H23A 3M0VA 1TV5A 3WEOA 3ISIX 1GKPA 2O7QA 1M01A 2PWHA 2D2JA 2C6QA 4ZL1A 2R91A 4LUTB 1AG1O 3Q45A 5A6KA 2WNNA 2JGYA 3N18A 3UZ5A 1D8CA 3CZ8A 3U6WA 3TC3A 2P0IA 3P6LA 5EMMA 3IIPA 1EX1A 4FK9A 4S3GA 4HK7A 4UNLA 3QGVA 3B3DA 3UW6A 5IFTA 2BXZA 1Y5XA 3W7DA 4XAFA 4QG8A 4WQ6A 2PDUA 1B3WA 1DVJA 4G9PA 4MB5A 4HZ6A 1ITCA 5FJIA 1DQUA 3VGEA 4O14A 2VFDA 2D73A 1Z7AA 1O60A 2GZXA 4C90A 4TVDA 3AHYA 3CWNA 4KCVA 4Q6JA 4NI8A 2NVAA 1TYGA 1BG4A 4MFEA 4WD0A 3VZZA 1CB2A 3KP1A 4V33A 3E0LA 3RCNA 3T4WA 1J93A 4S38A 4XZNX 1OFDA 3W7RA 4ECLA 1KFJA 4OUIA 3ELFA 2XN0A 2KZHA 3UGVA 2ZX9A 2EG8A 1RJPA 4GBDA 1ZL1A 3PUOA 3IV3A 5LXEA 4R7WA 2ABBA 2IKHA 1F76A 4ADTA 3MTWA 1XLCA 4OFCA 3LHTA 3S6TA 2WVUA 3PWAA 3W1QA 3T0CA 4QJ1A 4GGHA 1L9WA 4Z17A 1FWNA 4PUWA 4KW2A 5FF2A 2YR1A 1TV2A 1ZPTA 4P61A 2CLPA 3GTXA 1W91A 4ZQPA 1PKYA 1U1HA 4LF1A 1BQCA 4MB4A 5HDRA 2PRMA 4GLEA 2QIIA 5D02A 1Z48A 3BAJA 3U2ZA 1UQYA 3R79A 2XIMA 3AISA 3UJFA 3WD2A 4EPDC 3BAIA 1W8SA 4LB3A 3RG6A 4CLMA 1EIXA 4CNPA 4EANA 2PDFA 5DT7A 1AZ2A 2IUZA 4JCLA 3TSDA 3BMWA 1GYLA 1B3ZA 1X97A 5LIKX 4J3TA 1GWJA 2NUYA 3QZ6A 2W4XA 3T2PA 3RAOA 4H2CA 2Z27A 1GOWA 5AC7A 3WN6A 3SW6A 1MI3A 3MUZ1 3GHRA 1J6OA 4ACZA 1PAMA 1HT6A 5KETA 1UWAA 4KWWA 3PR2A 1UD5A 3IJ8A 3HJEA 4PTVA 1BXBA 2HK0A 1J0IA 2EBNA 2ZZ4A 2VFFA 5D2YA 1PYFA 5ABEA 4RE2A 4NQ1A 1WKFA 1WNOA 1H0GA 3PF3A 5D9OA 2ZRXA 3PSWA 4UTMA 3HA1A 1UKQA 2LLEA 2VYOA 1X1NA 3NQMA 3N4EA 2PODA 2WZHA 4XBJA 3RITA 2ZA2A 3VKAA 4BQ5A 4I6KA 2YDQA 4HN4A 1MXDA 1LZOA 3PTDA 4WVXA 3W7LA 3NQFA 3THAA 4AD4A 4MHBA 4UMCA 5REQA 4IPNB 5LNUA 2GK1A 4M3PA 4IFOA 4Y9OA 5JBEA 3KS6A 4PUJA 4L64A 2XVNA 4IUGA 2GQAA 2D0FA 1PWLA 2OSWA 2YA0A 3AALA 3UG4A 1XP3A 4JTUA 1C7SA 1K02A 1R0MA 3G0UA 2O9TA 2P3EA 1QNVA 1QW7A 2RJGA 1T6MA 1V6UA 3DX5A 4LUSA 3BCDA 1WQ5A 4R9OA 2OPJA 1XLKA 2YBVA 5C54A 1R3RA 4AVNA 4N02A 3OPSA 3QH2A 3C2RA 1GW1A 1NQKA 2DUAA 2RH9A 4XO6A 4LBSA 2XWDA 3UZZA 4HSNA 1BGGA 2VR4A 3PBWA 1F9CA 2QCFA 4HZ8A 1JPHA 2NXGA 1XD0A 4NZ5A 4N42A 4JIEA 3ANVA 3BANA 3O6YX 4E0CA 4YCPA 9RUBA 2W66A 2NWRA 1V8EA 3KP0A 3TOYA 1YNPA 4K39A 2QNEA 3VKCA 1XRVA 3WF0A 4GIRA 4JHZA 4LB4A 1Z6KA 2E09A 1W2PA 4LW7A 2VFHA 3WDQA 3RO8A 3LG3A 3LOTA 3WQFA 4B3KA 3ARPA 1FDZA 1QPKA 2I5IA 4TX6A 2GVYA 3PZQA 4DPPA 5F2IA 4J3XA 4LS1A 3S2CA 4D6DA 1ICSA 2PDHA 1S2VA 4G1KA 4ADSA 1JDDA 4ZCWA 1VPYA 4I8YA 3NA8A 3IJ6A 5BRQA 1L6WA 4DJDA 4Q8UA 3U0HA 4ACZB 4JIRA 3SECA 1KCZA 1F05A 3R25A 4TQTA 5AHIA 4GGBA 2ZE3A 1O5KA 4U2YA 5E93A 3JW7A 1OK4A 4A8IA 5A2CA 1E43A 4MJZA 1VBJA 3FSUA 1MUWA 1YE4A 1OWQA 1KM0A 4Z2JA 3FLUA 2ZRYA 4AYGA 3NR0A 1RHCA 1CXIA 1IXOA 1TWSA 3ABZA 3DZ1A 5REQB 2ISVA 2UWFA 3BCJA 4ZMGA 1X38A 2NT1A 1FFRA 4XZLX 2GK1B 1LOQA 1XRSA 3MI6A 1PTGA 3CUHA 4DN1A 1EX5A 4GIYA 2D2HA 4GX9A 1G4PA 3GKFA 2WKJA 4HPJA 3SQLA 4CD7A 3I3BA 2HNHA 1U22A 3SRDA 4KWVA 1KD0A 4PL2A 2E9LA 3QPZA 3APGA 1MUCA 1THFD 1NDWA 1DWHM 3B03A 3B0UX 2Z6IA 4G1NA 3NOEA 1QBAA 1DJIA 4LUSB 2NV2A 5A94A 1ODUA 2IXVA 2JKEA 3P8JA 1FWCC 3IRDA 2CZVA 5A6BA 2ESCA 1ZJHA 2J7FA 3QW4B 1XH2A 4US5D 4JAWA 3NXFA 5M2FX 2NUXA 5JVLA 1CW2A 4M19A 2O9RA 3TX9A 3DGRA 3KOWA 1LRTA 3ENLA 4HA1A 4E2DA 4Q8NA 1NAL1 1SJDA 5E5CA 1GW9A 5MHBA 3WQVA 4GI8A 5GJPA 1U2YA 3VGGA 4AZ5A 2WSRA 2IPFA 2G95A 1VF8A 2DIJA 5CKSA 4G2DA 3GG8A 3ZJ7A 3H2CA 1UROA 4QX4A 3ZJKA 3A21A 3I3EA 2XVPA 3IVSA 1GVFA 2J88A 3QZEA 3RF9A 1XS2A 1PHQA 3K8LA 3VOJA 3VNZA 4CNSA 3R11A 2BODX 1J2WA 5A95A 2O56A 4Z2KA 4EXQA 3BLIA 1TPEA 4K37A 3UA3A 4QE5A 4NL1A 5I24A 1OX4A 1R3WA 3S2JA 3QBUA 2D0GA 4X2RA 3VNMA 3JZEA 4IG2A 4V27A 2I17A 2VDGA 2O92A 2GWNA 2QCDA 1S3TC 4AHPA 4MJMA 3TWAA 4QEEA 5GJMA 4PRWA 1FP9A 1E6ZA 4IZGA 2V67A 4NXKA 3A4AA 2DW7A 4CCDA 5C9RA 4OECA 4IIDA 1T40A 5A8OA 4NZCA 3VIMA 1E56A 2BHYA 2IPWA 2DJXA 3MJMA 4Y8FA 1CB7B 2FYMA 3CK5A 4PL1A 2CPUA 1FDYA 3RPDA 5CG0A 4AB4A 4H9VA 2J6VA 2WSQA 4IX0A 3DHUA 2ZZ3A 3H8AA 1XRFA 4O53A 3FOKA 3U5YA 1BEUA 3KAOA 1YYAA 1P0NA 5GPRA 4D6FA 2ATMA 4GYPC 1KO0A 1FCUA 1YEYA 2BGNE 2PAJA 4ZQCA 1WBHA 4KIEA 4I7WA 3OBKA 2VX4A 4U3CA 4D9PA 1P0EA 3PZMA 1S5TA 3PG9A 4HZ7A 4NSBA 4H6RA 1FWGC 1SU5A 1MNSA 2PBOA 3BMVA 3QTGA 4NZ4A 1FWJC 3GIPA 4DAFA 1VLWA 3OHIA 2A5HA 2EPHA 2PP1A 4BHYA 3F4VA 3GDBA 1LT8A 3MW7A 4O57A 3WJZA 2CWXA 3UY8A 4QRNA 1PCWA 3W1TA 3HQ1A 4N9DA 4UQAA 5EBAA 2CLMA 3WDRA 1C29A 1XIBA 1YTKA 1U1UA 3HMCA 4B90A 4BI6A 4AVFA 4Q8PA 1US3A 3EA3A 1F4AA 1QFEA 4GZ7A 5AHMA 4MUPA 4PCNA 5EPDA 3WD0A 2OXNA 3QYQA 3W53A 4J9JA 4KH2A 4TOQA 1AODA 2QDEA 3PP7A 5U4NA 1J0HA 3EPMA 1X6NA 2QZRA 2XIBA 4C6DA 1M7OA 4TX8A 3CQHA 4O0ZA 3NTYA 4JN6A 3UR7A 2GGIA 1C9WA 1XFBA 2GGEA 2CKRA 1O5RA 5I3HA 1BVZA 3RU8X 4JYEA 1MRQA 3UCDA 4GXPA 1ZB5A 2J66A 3COTA 5CEWA 2V63A 1TTPA 4O8RA 3KFTA 5G2IA 1EC7A 1KBBA 5DLCA 1PZ2A 3QXBA 2CLHA 3POHA 2AL2A 3KOXA 5FAJA 1OX4B 3GG0A 4Y8EA 4XZIA 3HG4A 4IG2B 1TIWA 4WCJA 1PVNA 1KW1A 2BVYA 2CC0A 3GR4A 2QCDB 2FPYA 5H2ZA 2WOQA 4TXEA 1F6YA 1KV5A 3KS5A 2G3FA 2V5DA 1TPH1 5EB8A 4UCFA 1WDDA 3AYRA 5M3WA 1Y5VA 4CQ9A 3EPOA 1JDAA 5XIMA 4KBXA 4A3HA 3BMXA 3I68A 1GG0A 4N2YA 4ZEPA 4M6UA 3F1QA 3E6EA 2OWWA 4GC3A 4Q4PA 5LNSA 4UXDA 3A13A 2B81A 4ORMA 4B3LA 3LI1A 3LGDA 2NW0A 5GNZA 5AECA 4IOTA 1DV7A 3V5FA 3GNOA 5I3KA 2R94A 2ZX5A 3Q94A 2VVSA 1UBPC 3OZYA 1QWKA 4E2BA 4PUEA 3SRHA 1AD4A 1WE5A 1KRAC 1VJIA 1VFSA 3V5CA 2QJGA 2HQAA 5HWJA 4HHLA 1SJBA 3RCYA 3EKZA 3K5XA 1WOAA 5LIYX 2YB1A 3MU7A 1KFEA 1VCGA 4MLJA 3TQVA 4AF0A 5FSEC 3FYPA 2Y7EA 4C91A 4EOUA 2ZXAA 3CUJA 4LCSA 2G4FA 4HYWA 4LVDA 5EKYA 5C55A 1UQZA 3KVMA 3L2LA 4DJEA 5D4YA 2A7NA 2Q01A 3NWRA 3L4XA 3M5ZA 4C6QA 1JEZA 4EX4A 2DT1A 4V2XA 4MDPA 1CGYA 1KKOA 3AMKA 3SUWA 2UZ9A 3L66A 4NUWA 4JQ3A 3D5HA 3RJYA 4ML9A 5M5DA 4C7DA 1Y5WA 1EHNA 3H26A 1QU4A 2MUCA 4ZSUA 3W00A 3CT7A 2A79A 4EPBC 2BGSA 1W9UA 3TTSA 4QQ3A 3T44A 3OGRA 2CZEA 3KDOA 1CGXA 3M5VA 5E1QA 4UR7A 3L68A 2Z26A 1GYNA 3W29A 4W8LA 3W1PA 2Z7GA 5DX7A 4PSRA 5AVHA 2D3NA 3QFWA 1HVQA 3WFAA 2FGBA 1O12A 2AL2B 4PUUA 2VJXA 3VTRA 4PR4A 3A9IA 2O9OA 2Y7DA 4RE3A 2YJQA 4NU7A 3AROA 4IQJA 4QE4A 4DHGA 3LXCA 5AZ0A 3GHSA 4FIQA 3GXIA 4M1RA 2FZDA 3BQ5A 3H4WA 3RRXA 3LNPA 1IWAA 4G7FA 1REQA 3BLLA 3VMPA 3R2GA 1YKWA 3NSNA 3LX9A 1WDRA 1TQXA 3ZSSA 3QV9A 4J3SA 2AOSA 1H63A 2ZDSA 2DU2A 3HPAA 1HW6A 3NIYA 1CNVA 1RQHA 4XIAA 9XIAA 5J5DA 3P80A 1EEXA 2EG6A 3AIWA 5LIUX 1C8YA 1S2TA 3CBWA 1TWZA 1CXKA 3DFTA 4BF5A 3KEHA 4J27A 1OZQA 1V93A 1RPXA 4H7VA 3FKRA 2Z1SA 1BFNA 3GS6A 2GJPA 2C71A 3EDJA 1EO5A 1G69A 4URIA 4F0SA 1HL9A 1N55A 1GYMA 3GNPA 1UP2A 4LALA 1JCXA 2PDWA 1ZALA 1I1WA 2QEZA 3KL3A 1RUSA 3WLLA 3WQ4A 2XN2A 3FN9A 1IYXA 3VZYA 4GYPA 3EX6A 2WM0A 5AHNA 3S0CA 4LY8A 3EEZA 1XCWA 1G5AA 1HKWA 4LRTA 1AZ1A 3D0CA 5BU9A 3L4YA 4AF0B 3NQ6A 1OD0A 1IT8A 4C60A 4LVGA 1SM9A 1ME9A 1TVLA 3G1AA 2VOMA 1VYSX 1XXXA 1TZZA 4PEKA 1JPDX 4IHCA 2RHGA 2XFFA 3I7SA 4MSSA 1PDZA 5JIPA 3BAYA 3MO7A 3V0SA 5FJTA 1GJUA 3ARWA 3K1GA 3N19B 5FIPA 4JD4A 3R6IA 3QHNA 4QSHA 2QCEA 1DTUA 3M0KA 2FPTA 1UH3A 3H2OA 1SO4A 2F8QA 2JIWA 3FS2A 3QQ0A 4L65A 1XDMA 4IMAA 3C3UA 3W72A 4EAYA 4DWSD 3BXWA 3AXKA 1OFOA 1QI0A 4QHRA 1TJRA 1XWYA 1CX9A 2PDMA 2DUZA 3WEZA 3GKAA 1ESWA 4F79A 3QR3A 3V4BA 3PBVA 2A3BA 3N4FA 4K8HA 5LGZA 4NRRA 3NGFA 2IKJA 3P60A 4S3AA 1Q2RA 3IRSA 1XC4A 3KOFA 1E6SM 1NFPA 1PTAA 2OT1A 4A2SA 1SMAA 3V36A 1H4PA 1W1B1 3WCZA 1K1DA 2GVEA 3EMQA 4F0HA 2OO0A 3AWNA 2DH3A 3TJXA 2WNWA 3G18A 3OGSA 2Z6JA 3WUEA 4H7ZA 4AZ7A 1XISA 1KB3A 2JBMA 3PPHA 1RSCA 3LLDA 3VKDA 3MHUA 4HMNA 3PUDA 1KBLA 4GIEA 3W85A 3DFSA 4CUCA 3L4ZA 4JKKA 1REQB 1WCGA 5E0KA 2DSUA 4FNUA 2PU0A 5DT5A 4JTLA 2BB0A 3HM7A 5AYYA 4C5YA 4UR9A 5FF7A 1QASA 4YHGA 1VHCA 3E9AA 1EC8A 1OGGA 2I9EA 3NXLA 3VIIA 2GQ8A 3W83A 1HTIA 2H3DA 3MO4A 1HQTA 3NNTA 4ML4A 2EJ1A 1EJSC 3ZJ8A 1RVKA 4UUIA 1UZHA 1SJCA 4B2DD 4O16A 3HPSA 2O9PA 4YJ5A 1XDLA 4QNWA 5FF4A 3AXMA 5A6SA 3TEVA 3WBXA 5AHLA 5A2AA 4GK8A 4O0KA 3SUUA 1VBGA 3V16A 5EMLA 2VEPA 3PZVA 4J5NA 1TPWA 4O12A 4GKTA 4QNEA 1HUVA 3TN5A 4XTIA 2J9YA 3S2MA 3O0FA 5CJ5A 1H7WA 3WQCA 1CDGA 1TVPA 1KM2A 5DMYA 3AHVA 1JYNA 3TTOA 3UT0A 3H7VA 1UYQA 5A8GA 5AC5A 3ARQA 3TP4A 1VBRA 4LYKA 3LERA 1SR9A 3RNDA 1Q6RA 3N04A 4GG9A 1EDTA 4H04A 4P7OA 1U83A 1C8QA 1OSEA 4MAVA 5ECUA 3RGTA 2AKMA 3EAUA 2GOKA 1WAUA 2HZGA 1V7AA 3BV4A 4R34A 3T4CA 5CH9A 3R13A 3MC5A 2PWVA 1EOMA 3WLPA 2ZE0A 3WFLA 1XW8A 3RX2A 3VOFA 1ZBVA 4JQ1A 2CZFA 1KFKA 4NILA 1D2KA 1SPQA 1TTJA 2XZ9A 5EMKA 3OU8A 5EYWA 3SB0A 3C61A 5K9XA 4ZOBA 4LFYA 1TV3A 4PRTA 1BKSA 2CHNA 3M0JA 1TR1A 3VOCA 3W1NA 4ZB0A 3ANUA 4FPSA 3H2EA 1BD0A 1OBAA 5D2WA 1HVXA 1VFUA 2A0NA 1ME8A 1FWDC 5KZ6A 2HDJA 4RW5A 2YDAA 3WBYA 4JY8A 1Q7QA 4W7UA 3RX3A 2DZAA 4DI9A 2GL5A 3C2VA 4OT7A 2Y62A 2G50A 3GM8A 2GJLA 4BF7A 1X1ZA 4JTAA 4D6IA 3N2TA 4KWUA 3J7HA 4AC7C 1TQJA 3GX9A 4UQCA 3CZLA 3GR7A 2Q71A 1R46A 2WHLA 4UNIA 2ZUVA 3R8GA 1B5TA 2X0YA 2JF7A 3WDHA 5I07A 4C5ZA 5HPCA 2Y7GA 1JF5A 2VO5A 1G4TA 3EZ4A 3B9OA 1K9FA 1OY0A 2HPIA 4HIBA 4EXBA 3TXVA 2WQDA 4IFRA 4M56A 3AZTA 4B4FA 5D33A 2HE8A 3OLIA 4F8XA 1BKHA 4X0NA 7CGTA 3QJAA 4O0QA 3L9CA 3W7EA 2EGZA 4MPQA 4F0KA 1AW2A 2XJ7A 1RAKA 4KEUA 1R3VA 1JFHA 1OT1A 2FLIA 1ITUA 3QC3A 1T8QA 4AMAA 1AQ0A 2D1ZA 1IR2A 4WKHA 3C0QA 1HKIA 3TNOA 3WENA 3GZ3A 3ZLGA 1RVGA 4HHPA 2QS8A 3UZJA 3PBUA 1B31A 4HSOA 3W25A 4AD0A 2OGJA 3F2BA 3IJQA 4GNVA 2AGTA 4JGDA 1ISYA 1AJ0A 5TIMA 3CASA 1IZKA 4JTKA 1G7UA 2W9MA 2R82A 4LV9A 1RR2A 4HTYA 1B3XA 2FB2A 1MRAA 2HISA 1TCMA 3NQEA 1BXCA 3QMSA 1KQYA 1QRQA 1KFWA 3N73A 1DPMA 4LCRA 4AX6A 3PAJA 1B30A 2DZTA 1T7LA 3REQA 2Q09A 3VGFA 2WVVA 2EF9A 1C3FA 1NOUA 3EB3A 1LQ2A 3GVGA 3B9EA 1TWWA 4CN4A 2O55A 3H55A 2SFPA 5A6JA 2OWXA 3VDCA 4IMGA 1HIZA 3HO8A 2XIQA 3CWOX 3OIXA 1UG6A 1F6PA 3G3MA 2YFNA 2RDUA 3AHTA 3B8SA 4C6CA 3BLOA 3NL5A 3CAWA 2ZUTA 4DBWA 3LV6A 4WOZA 3O05A 1PDYA 1P1XA 1GOOA 1H7XA 4S3EA 4JEQA 2YXGA 1I2NA 2HVOA 3GC5A 3F5JA 3BH4A 3IJ9A 1D8WA 3W84A 4XSLA 2WC4A 4YTSA 2VENA 4JIHA 1HFBA 4H9UA 3OODA 3P93A 3NQDA 4JHMA 4H2HA 3G0XA 1A5BA 3OYZA 3FA3A 4P8WA 1UMYA 3IUDA 2PLKA 2V2DA 3EDEA 2OX4A 4AHQA 2WLYA 5DO8A 2YX0A 2UBPC 3LBOA 1JCYA 3R7MA 1RK6A 2ISSA 3AMGA 1P48A 2J7BA 3UR2A 5LA1A 4GZJA 1UD2A 1Z44A 2WCGA 5BOOA 2RDXA 5J8LA 3GXNA 3BVJA 3VVGA 2E68A 4Z0SA 3N9KA 2OB3A 1EYWA 4IGNA 1YXDA 1LWIA 1J79A 3VDHA 1TELA 3L0NA 1GHSA 1AMKA 1IXQA 4UQEA 3KLKA 3OVGA 4XD3A 1BQGA 1V7YA 3H7RA 2DVUA 3GFYA 5K4ZA 2J9XA 3WEMA 2OKTA 1MQQA 3LCGA 3N2XA 2GFTA 3SY8A 3M7WA 4AFYA 3ZMRA 3GFXA 3GG1A 3NDOA 4DZ5A 2CWNA 2VGIA 3WQWA 4RDVA 5CGMA 4H4IA 1PUDA 2PDYA 2WMHA 3ICJA 1E0XA 1SUXA 4MF4A 3KM8A 1HJXA 4XZ9A 1G1YA 3G24A 3W2NA 1A5KC 1EA0A 4YL2A 2E25A 4Q22A 3CNYA 3N2OA 1PX3A 1DJNA 2D69A 3REQB 2VURA 2WVVB 8XIMA 1XIFA 1PXGA 1DQXA 3UJRA 5AC8A 2D20A 3SUSA 4C6BA 4UTWC 1JG9A 3FIGA 2ADAA 2VNCA 3B9NA 3AYSA 2YCKX 3TTEA 3DG7A 3WUFA 1IHIA 1ADDA 1LWHA 2QCLA 3QLLA 3SCPA 2ZVIA 2ZZ1A 1WDPA 3EKLA 1I2RA 2DZPA 1EC9A 3W6YA 1UP0A 3IACA 1QI3A 5FD0A 5HANA 1IEXA 5IOBA 3KL0A 3VNYA 1GOMA 3IANA 2W6RA 5HWNA 2WWDA 1V0MA 3FNDA 4LVFA 2C18A 5IBXA 5DMNA 5CPSA 1YTEA 2EJAA 3WDPP 2ZICA 4IJRA 4ZO6A 2Q3OA 4Q6XA 1IT7A 1MUMA 3OVPA 2V3FA 2GSEA 3WQ6A 4L56A 1K4HA 1EJXC 5D32A 3N2MA 1MEWA 1Q6OA 3BW3A 5HQEA 4GACA 1VP5A 4D1IA 1VKFA 2DORA 4EP8C 4KERA 4TVCA 2R1NA 3WLSA 3L0KA 3Q4DA 4UTTC 3UXKA 1V3MA 3TMLA 2DT2A 1JVNA 4AWSA 1V6YA 1NF7A 4JTSA 1LQ0A 4MNLA 4ZTYA 2Q6ZA 4Q8WA 1S2WA 4ERGA 3TTQA 1MQRA 2B4GA 2CBIA 3GAYA 3E38A 2VUYA 1TPC1 2Q8ZA 3KTSA 4GKLA 5HAOA 3HPXA 1FCBA 1EYEA 1W54A 1A5NC 2DSVA 4MYAA 2AGKA 3UF9A 1M1BA 3CYVA 3LZ5A 1F73A 4C6KA 3LCWA 3QEZA 5LHFA 1WXZA 1GZJA 5AOUA 4Y6GA 2MNRA 4AEFA 4YXGA 4CU6A 5FESA 2ZWYA 5XIAA 4PMDA 2ASHA 2DH2A 2XH7A 2CITA 5G4WA 5I77A 4XZWA 1A0DA 2OLSA 2ZADA 1YMYA 4YTQA 4IJBA 4IPJA 4F9JA 3A3WA 3N34A 3TJLA 4BCEA 3ABSA 1A3WA 2V8ZA 1IV8A 2J74A 4RXFA 2QUUA 4QJ3B 4XBSA 4H6KA 1QOXA 3IK2A 2GGJA 4AZGA 2QCGA 2ZUSA 4JR5A 3KBMA 1X7FA 1B57A 1DHPA 2O4MA 2WB5A 3W70A 2OMAA 3E2SA 4UFJA 3ZR5A 3GUWA 3UA4A 4AIOA 2DZXA 4UOJA 2E28A 1P43A 3GG7A 2GDVA 4A6GA 3JRKA 4JL1A 2PWGA 3APTA 4IP4A 3CPUA 3MUY1 3CO8A 2EG7A 1JNEA 3F4WA 4LEQA 1PSCA 1E40A 4MJ2A 3ITLA 1I60A 2XISA 3M0LA 4K1GA 1UJQA 1E1EA 3TYCA 1YHTA 4HA3A 3A4JA 2BP1A 4M8UA 3VD5A 2DZSA 1JR1A 3CGTA 2FTWA 4H41A 4C6JA 5I7GA 1VFLA 2C7FA 3AXHA 4Y90A 3DESA 4JL2A 1TTQA 3BAWA 3CPGA 1P7TA 3SCSA 3P74A 3IUHA 3CM4A 2Z1WA 3EWBX 3B0YA 3QLDA 3M9YA 1W37A 2FHBA 3QGAC 2ZUNA 1SVDA 5FCZA 1MZHA 3CUFA 3GBDA 2I9UA 4H9ZA 1L8NA 2VCBA 4MG4A 3KTXA 2BTMA 2VZOA 3JU2A 3G8RA 1XYCA 2OZ3A 1T41A 3K8MA 3NDYA 1EQPA 1I0DA 2CZ5A 3B0PA 3QQ1A 3G22A 1W5QA 3HGSA 1OC5A 4JEJA 2WZIA 3B8WA 4AIBA 1TFVA 4UTKA 1K8XA 2OSYA 5A6LA 5CAKA 2JALA 4ALDA 1UB3A 5I2UA 3N12A 4MGGA 1GPFA 2VEFA 1AJ2A 2JEQA 1KXTA 3UWWA 3GIYA 1V0KA 2VCAA 4IWWA 3LEPA 3S8HA 3T9PA 4N6FA 1Q6QA 2FVLA 4PZVA 2WLZA 2F2KA 1HKJA 4UFMA 3TU9A 2V0TA 4PMQA 1R86A 4I6VA 2A6LA 4AW7A 5AYBA 4Z42C 2J24A 3PJTA 1SFTA 1NFGA 4HU3A 4G5DA 3BJSA 3FKKA 1XPGA 2PDNA 4RX0A 2E9MA 4UTWA 4Z1CA 1JZ4A 2QIWA 2TODA 3LTSA 1KTBA 1GOKA 1R2TA 1WKYA 3W71A 1ZNNA 3W7QA 3FHQA 3AIQA 3LHYA 4W5UA 2YB4A 5AHFA 4WUIA 4HB7A 3GO2A 1PX8A 3OBEA 4LS0A 3ZVIA 1UD4A 1O94A 2Y24A 3M43A 5M17A 3WL0A 3L5LA 1QAPA 4L61A 1J9YA 3QV7A 3MV11 3TR9A 4K8GA 3MKCA 1FWBC 3L4VA 4UTLA 1US2A 4FMVA 5HOSA 3SBFA 1D9EA 2YSWA 4UTJA 4R3UA 3DYOA 2F6XA 2UY3A 2PDLA 4L1XA 2OEKA 2JK2A 3P62A 2BLEA 4DY1A 6ALDA 1LF1A 1UC5A 4JFUA 4P8VA 3L2IA 1W9DM 4PYSA 3UYCA 1DKWA 3WBEA 3R89A 2F6UA 1P7TB 4X0VA 2Z2AA 1GOQA 4CU7A 1MEIA 4O10A 3ZR6A 1FWSA 4LAKA 3QGKC 4UZSA 2XN1A 1EB3A 3WQ8A 4UBPC 1TWDA 3CWHA 4PCFA 3NQGA 4GMEA 5LNVA 2G3IA 2QCMA 1AH3A 4C1KA 4CVUA 3AS1A 1K7XA 1OIFA 3LCFA 2V82A 4UTTA 4XBKA 4INFA 3GQYA 3DECA 2FZMA 5E6YA 1DJHA 4ERAA 4XZMX 1DWFM 1R3SA 3TFCA 4M81A 3W7JA 4U10A 1MWOA 4O11A 2TRSA 1XKYA 3G6LA 1YBQA 2ZX7A 3UNDA 3AXIA 5IM51 3DERA 2WQPA 3ARYA 4JQAA 5BRPA 3ZLHA 1UWRA 5JIWA 4DBDA 4H8NA 3WLOA 5CC3A 4YMZA 1W31A 2BY2A 1QVBA 5FI8A 2BWGA 4GYKA 4Q32A 1BLIA 5FJUA 4L7ZA 1I45A 3VNLA 2VGBA 5L9FA 4M6PA 3TW7A 4ONVA 4NZ3A 5FKYA 3MMWA 4IUOA 1L6FA 1XC6A 4J2PA 1XBVA 4Q4MA 4CCEA 5D2XA 1HL2A 4HHMA 1VJZA 3OVRA 2PU1A 3CTTA 3QZAA 1QOQA 3THDA 4Q4SA 4QLLA 3ITGA 3PFMA 5C7VA 3BUVA 3CHDA 3IIVA 4O19A 3S46A 1UA3A 2VGFA 4WIWA 3VUPA 3YPIA 3CMJA 3LSBA 5C9ZA 1GEHA 4US5A 4F2UA 4UNKA 4ZQNA 1XH0A 1CT5A 3W28A 1PJ9A 1DE5A 4D1JA 1EJ7L 1HL8A 5DCDA 3IEBA 2FFIA 4CQBA 1RLCL 1G9HA 2CXEA 1UZ1A 3MMDA 4HSHA 4S39A 4Y9AA 3B0VC 2OOFA 3GXFA 1H1NA 3FHAA 3EWCA 1LLWA 3NZPA 3W7CA 2HSAA 4MTVA 4A3UA 2ZC1A 3DHPA 4HCLA 1I9CB 3VIGA 5GVJA 1EWEA 5DBTA 1ZJAA 2WKGA 1B3OA 1KXVA 1CI1A 4QG6A 2PBGA 1Z8AA 4B5UA 5HINA 3SCUA 3WZ0E 1P5BA 3T07A 1MW2A 1UR1A 4H3DA 2X05A 5HR7A 5A6AA 4BKNA 3S1UA 4U5KA 4YS1A 4RZBA 4A35A 1S3HA 3R0KA 4O1BA 3ARRA 2WZTA 1LRNA 1R9ZA 4Y2WA 1OX6A 1YQ2A 8CGTA 3LTPA 3RPMA 3FYOA 1N7KA 1E0UA 1XLDA 4REQA 3S3GA 1K3UA 1I2OA 1TUXA 4ZO8A 3BSGA 3EWXA 1S46A 3B06A 4HOZA 3W2UA 5DEZA 1A5UA 1Q6CA 4TTGA 5DFAA 1EJWC 2R14A 4JFTA 1X6UA 3U8GA 2CBUA 3N6HA 1YBQB 1WUEA 1K6WA 5DANA 2X16A 4WSKA 3QPEA 4RXGA 4DZAA 3PJWA 3MMTA 1Q13A 2VR5A 2VFIA 4PSPA 4B5XA 1O68A 4Z1AA 1K9EA 3N29A 2INZA 3GTFA 3H2NA 3RRAA 4LJ3A 5J5RA 4JHOA 3CMFA 1IEIA 1VENA 3W82A 5CPNA 4DWDA 3B4YA 2MANA 1EQCA 3EDDA 3WLJA 3BARA 4B92A 2Y5SA 3UD6A 3TTYA 4ILSA 5F4SA 1LRQA 2QMKA 3WNMA 6PTDA 5E09A 1H1YA 2AMGA 2V2HA 3AHZA 1DJZA 6CGTA 3G0SA 4O18A 3W7HA 5LZLA 3N11A 5H8UA 3H7UA 3GSMA 2JF6A 1Z3NA 2ZZ7A 3M0YA 3VGHA 4GNJA 4NP7A 1KNWA 2V5BA 4EXAA 4D6HA 4GE8A 4TMBA 4WZHA 2NT0A 4YVXA 4DAIA 1V77A 4PBEA 4FEZA 3OLDA 4TMCA 4FIRA 4DWSC 3GB6A 1Q6FA 4JTTA 1FFQA 1R2SA 4BZYA 2ZXDA 1JULA 4BWLA 4C6FA 1LBLA 3PFRA 1H5VA 4J28A 1OT2A 2EQDA 3O7UA 2NQ5A 2J77A 3KLLA 1E9YB 2VTFA 5CG7A 3AO0A 3SIZA 4XWUA 1O7AA 4Y7EA 2X1TA 1ELSA 3F7JA 3HGOA 1R87A 5G2HA 4ZSTA 1NQ6A 1GQJA 1Q85A 1TG7A 4PMUA 2P50A 3CLMA 3VCRA 2BOFX 3VD7A 4PMRA 3WJYA 3AMLA 1D3GA 4KFNA 4LYQA 2X40A 1YTDA 2EPLX 1XYLA 4QS6A 3OB8A 4REQB 3N15A 3ZYZA 4OBSA 3A24A 3UVIA 1H7OA 2XGZA 4PBGA 1C7TA 3W24A 2HROA 2ZUWA 3KVJA 3WSUA 1EJRC 3HTWA 4OV9A 2REQA 3WMBA 1B90A 1A5AA 1TREA 3OP2A 4FLSA 2BG5A 3QHMA 3A3HA 3WDIA 2B0MA 4GISA 2PDKA 2KAUC 4JX4A 4RUBA 4E2OA 1ONXA 1Q6DA 1NWUA 3NQ2A 4S23A 3BL3A 4PE8A 1V0LA 1UOKA 1V02E 2XTKA 1QNRA 2RGLA 3EBVA 1KM6A 2P5NA 3HU7A 4FNSA 2XPKA 3N6QA 3QSRA 5L6UA 3ANYA 4V1XA 3NQCA 3JS3A 4P5UA 4YWIA 5LSMA 2JGQA 1RLDA 4WY0A 4HP5A 3NGJA 1PZ3A 2Y8KA 1H3GA 1KGUA 2NLYA 3DAQA 3NEHA 2QJMA 2WHJA 3IS4A 3NL2A 4JTGA 3ZJ6A 4PCPA 1H2JA 3Q58A 4BS0A 4F40A 4KFOA 3UG5A 1RPKA 4CNOA 3FVMA 2FVKA 4H7CA 4J1OA 4Z2GA 2ZBTA 4R85A 4Z08A 3DI1A 2DZUA 5ECVA 1B54A 4TVUA 2PZNA 4WGXA 3KE0A 2HE5A 4GH3A 4K36A 5DF0A 5FAGA 1DWJM 4NAFA 1L2UA 2F2HA 3RFAA 3LCHA 4RLIA 1A49A 2BNJA 3WF1A 2J7HA 3ECQA 4JN8A 1CECA 2EKGA 3VKJA 1O5QA 3ITTA 3WUGA 1FTXA 2C14A 1NVMA 4DVOA 1PEZA 9CGTA 1K6AA 4I9AA 4PUKA 3VMOA 2WO5A 1UD6A 1GK8A 3GYCA 4JNMA 3W38A 5BZAA 3ZXWA 4IM4A 5LNRA 4Z2IA 3RO6A 3KVLA 4W9TA 5CBIA 1EJTC 4ZXOA 3ONBA 2GLKA 4W86A 1BG9A 4PMZA 1ZGDA 1OQFA 1UKOA 1F7BA 1M04A 3VOHA 4E8CA 2ACUA 3GC4A 1FWAC 2PTDA 5CZSA 4BI7A 4K7YA 3UJEA 3L12A 1R47A 1HZYA 1R38A 1BVNP 1ZSXA 1E15A 1K03A 1A0CA 2IQTA 4LH8A 1GZ1A 1TRIA 1YPXA 2Z29A 1LM1A 3GW3A 2FDSA 6TAAA 2WSYA 1W0MA 2REQB 3AUJA 4AVOA 4XO7A 4DO4A 2X1UA 3S5OA 4LT9A 3T08A 5KZEA 3NO5A 1TMHA 5M03A 2C79A 1FY6A 1PKMA 4QXIA 3L5AA 1JDFA 4YYCA 4EPKA 1V3HA 4Q3MA 1GVQA 1V3KA 1SW7A 3NPVA 4PULA 4AY7A 3O6AA 1X6LA 3W37A 3W88A 3NDZA 4W85A 4QAWA 2OSXA 5FACA 2Y1HA 4LF2A 1V02A 3LRKA 5C0QA 3MSRA 3LD5A 2HXUA 3IIXA 1OYAA 3KBNA 5HMSA 4DBSA 3P8IA 3AMDA 2D24A 2ZRZA 5IDZA 1S1PA 3AU2A 4Q8QA 3AS2A 1LROA 3ALFA 3OZMA 3AS0A 1XLGA 4GRSA 4MAZA 4WY0B 3FDKA 3WLIA 4B4HA 1RP8A 1J11A 1XIDA 2W61A 2TPSA 5EA9A 3GDTA 3C0SA 4GQQA 4K68A 2CIPA 4CKQA 2ATSA 1Z32X 4H8VA 3GXTA 1H7NA 4ZB5A 1FP8A 4YVVA 1IQ8A 3SUTA 1XICA 1NOWA 2QDDA 2VEIA 1M65A 1R9YA 3GNRA 4ADUA 3NO3A 3G3DA 4LY4A 4UQ9A 1JQXA 3NOYA 2OCZA 3H21A 3MJYA 4HJWA 4DZHA 1RZMA 2QJHA 2C1GA 2JEPA 4NAFB 1ZAJA 3NAVA 3SR7A 2PDXA 4QR6A 1MZRA 4FF7A 1FHDA 4ZFCA 1W9BM 3MPGA 3W7GA 4JZ5A 4RPQA 5C6MA 5AKQA 4JX6A 1HKVA 4X2PA 3W27A 3GWQA 2PA6A 1UUQA 2QF8A 4UIOA 4DWSA 2POZA 4D72A 1FDJA 6TIMA 3OZPA 1C9DA 3WD1A 2AQWA 4H9TA 2PGEA 5U7SA 2VC9A 1P6BA 4D71A 2R1PA 1BSIA 2ZOXA 4P7LA 3VAVA 5FJPA 5K2ZA 3BJFA 3FGCA 3G1DA 2W92A 1KM3A 3WL1A 4H9MA 2HBVA 5TAOA 4DELA 1F3XA 4Q8TA 1UC4A 1E3XA 3H53A 4IMEA 2W5FA 4GYFA 3ZWSA 4LC6A 1I8JA 1CIUA 1A5CA 5BMWA 1TIMA 2AQOA 1JRCA 3TW6A 3AYVA 2PZ0A 4FO4A 2YIHA 3BG9A 3UJSA 1DJWA 3WX7A 4I90A 3DHDA 3VC6A 2NQZA 5HWMA 3MBDA 1ONRA 1QMLA 3IAQA 3AZSA 3UJ2A 2F84A 1GVEA 4N0RA 3T0BA 3U48A 1GOXA 6A3HA 3MDWA 1RBLA 4U4MA 4G56A 3BZJA 4XAZA 1ECQA 2VX6A 1KGWA 3CC1A 4QDMA 3T6CA 5E0FA 3GHUA 4XB3A 2X1IA 4A22A 1E3ZA 1ZBKA 1UUOA 1KQZA 1Q7ZA 5IHRA 4C65A 3OG2A 3M0XA 4HPGA 4GQ0A 4D6JA 3TE9A 4BQ2A 4FB7A 2Z0IA 5HXMA 2DZVA 3IVTA 1YNQA 4F3HA 2E1DA 2IPGA 4WR3A 4GY7A 3LLFA 4DUWA 2HNEA 3IVUA 4AISA 4ZOAA 1BSLA 3H70A 4B2DA 3SFKA 1WDWA 1V3IA 4IPLA 3VM7A 5I79A 2PDCA 2ABAA 3SN1A 3LCIA 3T7VA 1E51A 3EDFA 2OLHA 1GUVA 4LBRA 1RCXB 3GE7A 4ZENA 1TO3A 3DBNA 1K77A 4ZZ9A 5BCAA 2CZDA 2NXIA 2YCEA 4JCMA 2NXHA 3MS8A 1JIBA 3W02A 3B04A 1UH2A 1LOSA 1FHUA 4R33A 2UY4A 1W32A 1M7XA 3ATZA 1A4LA 1SGJA 3RR4A 3NM3A 3UWUA 3TQPA 5AZ1A 1QATA 3IGHX 3PZUA 3SY1A 2VCCA 4DWSB 4MY1A 4AXNA 1VS1A 5EL1A 3BK0A 1JFXA 1KCLA 2P1FA 3B97A 3WELA 3THQA 2X1SA 4C6MA 4F9DA 3FGCB 3FEMA 3TSMA 2OQHA 4XVEA 2RDTA 2H8XA 1QO5A 2ZZ2A 4GINA 3OO2A 3F03K 4ICNA 7A3HA 5DY2A 3GTHA 4PN2A 3WNOA 2X0SA 1KV8A 4IP5A 5D2VA 2DQWA 3GVVA 4E4UA 1N82A 2E8ZA 2Y5EA 4ROQA 3M6YA 4D8ZA 1VPQA 4WXZA 3TYDA 3ABQA 1NEYA 3S2NA 1RJQA 4NJJA 3GBEA 4H9XA 2EEXA 4DNMA 2EXOA 2YCJA 4MFDA 5A8NA 1WA3A 1JZ7A 3TJIA 3LHZA 4G7EA 3VYLA 2X7WA 4FOKA 1RP9A 2QPXA 4UC5A 3U9IA 4QGCA 3NO1A 2YZRA 3O1NA 2GQ3A 4FI4A 3GLCA 4WF7A 1J96A 3CIVA 2QF7A 4D6EA 1H51A 1O4UA 4MIMA 3VO0A 1XYAA 1PS9A 4KQNA 3M46A 4IGMA 3KRBA 3PWGA 4C1NA 1JZ8A 4M51A 4DRSA 3EMCA 2G5WA 1EZ2A 1ZY9A 1OC6A 4S2CA 5A8PA 1CCWB 1UD8A 4PMJA 4CD5A 4LBUA 4DUVA 3LGEA 4KEVA 5ABHA 1OIMA 2HV5A 3C5QA 1A5MC 7PTDA 3QPYA 3A5FA 1XM3A 1JYVA 4AIUA 2JKPA 3P84A 1Q3NA 1RH9A 5AY7A 1EXBA 1ICQA 2G3JA 3TN4A 2BY0A 4UTFA 4PBFA 1OVDA 1GORA 1TWIA 1LQAA 1PE1A 1VRDA 2WYSA 4GXWA 1CWYA 1NWRA 4ORIA 1JQVA 1WZKA 2QVNA 1KM4A 1MVYA 3PZIA 4GUJA 2ZZ5A 3LTYA 1ZLPA 4PTWA 2GYIA 1EJUC 3ZO9A 1UR8A 4HNNA 1FKXA 4O8AA 1OCNA 3UPBA 2E7FA 3TH6A 3DIPA 4HNLA 3QSTA 4S3KA 3DC8A 2JFEX 2R1LA 1CGUA 2DVXA 1HJVA 5G2WA 4RR4A 1Q45A 1HG3A 1VCVA 4W84A 1ADOA 1IXPA 3TA9A 4O1AA 2FPVA 1NFBA 3SQMA 3W26A 3M4HA 4A8RA 1TMLA 3WNKA 1AQFA 4XVDA 1RALA 3WQEA 2PTZA 1VBHA 1H61A 2DZWA 3GDMA 4YNGA 2VDHA 1WDSA 4WLCA 5K3VA 3BQ6A 5H8MA 4U5IA 4GZIA 1B3YA 2ZIDA 3S1VA 3F4NA 4Y96A 4AY1A 3HF3A 1M03A 1PHWA 2Y88A 1YDVA 1ME7A 4M80A 1HXJA 5F2LA 2QGYA 3MY9A 4EPEC 3LN3A 3FV9A 1U33A 1UR9A 1MFVA 4UTIA 4CD8A 4W93A 3VNIA 5D09A 4IMFA 4GUIA 3D46A 4KRUA 1H0IA 2ON3A 1JXKA 1DP0A 3W22A 4CNUA 2YPIA 5FJJA 1AUSL 3B8VA 4P2VA 2P76A 4OU1A 3LXAA 4P8XA 4AD5A 4B5SA 1LBMA 3M07A 4D6GA 4HCDA 3P5YA 1ISVA 4G7EB 1S5NA 4JYDA 3S6DA 5FL0A 2PWDA 2YXOA 4CN1A 4DJEC 5D37A 5G1MA 5HJXA 5EGRA 3ZLFA 3UVAA 3W7PA 1AD1A 2HRWA 1KCKA 2A21A 2PGFA 3M0ZA 1OFPA 4HU4A 1U30A 1VYRA 4LGXA 4NYYA 5E9AA 1VFMA 2P53A 2X8RA 4KMQA 4HMEA 2ZQ0A 4C1NB 1VCFA 2AQVA 3UWQA 4GIAA 1W3KA 4QLKA 1MYRA 4F0MA 3PZTA 3PBYA 5TBOA 2XSBA 4B15A 4M82A 3QRHA 1R3YA 3NQ7A 1KRCC 2HJPA 4GYJA 3UXAA 3TZNA 1VBUA 2Y70A 1LBFA 4PTNA 4XIMA 1QUMA 7ENLA 3BLPX 1UR0A 3CZJA 2P8BA 3F4DA 4JXCA 4W8BA 5TF0A 3A4WA 3DC0A 1Z41A 4ZXLA 4FLOA 1LJYA 1C91A 3CUGA 3LENA 4KGJA 1WZMA 3LY0A 3VNKA 3GVQA 1TJ0A 1XIJA 1H7PA 1RQBA 2HBXA 4QIUA 1VJSA 2Y4SA 5CC6A 1MW0A 1KR1A 3OIHA 1SZEA 2VKZG 2FGZA 4K3ZA 3UCCA 1MW3A 4A05A 1DIOA 1XSKA 2PF0A 4XAGA 2VRJA 3NQBA 2PD5A 3TNBA 4IXHA 1WO2A 4HU0A 3MQTA 1QCWA 4M29A 2VQTA 2GSHA 4W7VA 2PB1A 4OTKA 2I57A 1GVOA 2PTXA 4KT2A 2FHCA 4N4QA 5K9CA 4Z2HA 2B31A 3W74A 1FWRA 2OEMA 3CU2A 3UP8A 4DPQA 2G3NA 4BFAA 4WJXA 2YA1A 2QUVA 1UP3A 4E3VA 2J8TA 1Y0EA 3MMUA 4H9YA 3E74A 1F8MA 1POKA 4Y9PA 2PDJA 1E6XM 1WZLA 4RNJA 2TSYA 4MY9A 4GO9A 2NV1A 3TUUA 2A4AA 2OQYA 3WJSA 1KCXA 2QUMA 3A12A 5EU9A 1WXJA 1F3TA 1VQTA 1IEWA 1A50A 4MZ1A 4KCUA 1YRRA 1MMFA 2QUTA 3QKEA 1H49A 1VYPX 2R1KA 3RM9A 2EKCA 5HPOA 4A3RA 2J78A 5CSRA 3MDUA 1Q2SA 4WK9A 3SCRA 4I7UA 1JI1A 3O9NA 3T1GA 1XLMA 1TJPA 1VEMA 1R3QA 3WY1A 4TIMA 4AZCA 3U3HA 1N8FA 5KZMA 2C15A 6REQA 1F8IA 2OEJA 4KEZA 3AC0A 5D8WA 2QW5A 3CXOA 2OJPA 1QNPA 1LL4A 2OO6A 5DBUA 5SWUA 3LPOA 4WSJA 3WK0A 1Z89A 2XHYA 1AVAA 4NASA 3SCVA 3BO9A 2I5QA 2I1OA 4RZ6A 4JTRA 1CLKA 1J5TA 1UKPA 5FL1A 2J4GA 4DEFA 4JICA 4ATLA 4HYRA 1JCNA 4PTMA 2HTMA 5E9XA 2CLKA 3DFYA 2BOGX 3WLTA 1EFZA 3OYXA 4QP0A 2ANUA 4GUHA 3LM3A 4XUGA 4NF7A 4ZE4A 3VE9A 5FF3A 5CBJA 4DZIA 1KXHA 3F2CA 4AQLA 2I7GA 2WKLA 2BMBA 2EHHA 1CXEA 4JKMA 3ERPA 3W9ZA 5EFDA 2B7QA 3CYJA 3JUGA 1N2VA 2PDGA 2X2GA 3WMCA 2F6KA 4LVAA 3STFA 4S3BA 5ENLA 2GDQA 3E5BA 3K4WA 4QISA 3V1HA 3UERA 5A8QA 1PZ0A 4NJKA 2NX9A 2JIEA 5CBBA 2RDWA 2XFYA 2XSAA 5AYIA 3UY7A 4PH6A 4PGLA 4EWND 3VD3A 3I6TA 2VEKA 1U1JA 1PKLA 2CU0A 1OC7A 4DUXA 4E8GA 2ACQA 1NSJA 1Q6GA 4HKPA 4LYPA 4JTCA 5T8GA 1ODZA 3BLDA 1DORA 1KLYA 3L23A 2FH6A 3GR8A 3TXZA 2Y0FA 3TAOA 3WNPA 4C6IA 2F7FA 3BE7A 3T2OA 3ABOA 1MDRA 1QPQA 4MADA 3WD3A 2PLJA 4HQVA 3CL8A 1NWTA 1FWWA 2PLCA 1FWFC 4JBRA 4L6OA 3GDKA 3MI2A 3C2OA 3D6NA 3GH5A 3KHJA 1ADSA 4GJ1A 3H4XA 1FX6A 4XZHA 2PP0A 1JPIA 2FFCA 3Q37A 3U7BA 1XLEA 1WX0A 1ZUAX 4HMDA 5A6TC 3VKBA 3AJ7A 1EGMA 3CEUA 4N7QA 5T9CE 2PRHA 4AZCB 3TQ0A 1F2JA 4W88A 4BF9A 1XIMA 6REQB 5HUPA 1FXQA 2BBFA 4GO8A 3BV7A 3S5NA 4OZOA 4XZBA 5KITA 5GQBA 3C8NA 2J79A 1JCJA 3SRFA 1OEPA 5H1WA 2XDFA 3FJ4A 8TIMA 3T42A 2DZBA 4PCSA 5D04C 2CNCA 4L9YA 3MV01 4K38A 1JAKA 4RV3A 1Q4WA 1AQMA 1PO9A 2WSPA 4LPCA 1E4NA 3LGGA 2QPSA 4JFWA 3NSXA 1W1A1 5H91A 3BSMA 3AQUA 2I16A 5KZDA 3M0MA 1C92A 3WBWA 3RU6A 4M1BA 2ONEA 4HNUA 4DM1A 3Q65A 4QAIA 1RY8A 1WB0A 2B7PA 1PZ1A 2R1MA 1LG2A 1RBAA 5EMUA 4YU1A 3KBVA 5HUOA 4ASTA 1YXYA 2DIKA 4I7VA 5HJLA 5C8BB 3L4UA 2WXDM 3C0LA 1BYAA 3L4TA 5DY3A 3EWWA 1XYMA 2Z2UA 1NDZA 1XH1A 3E2VA 3H2AA 3ZSTA 4FHAA 2WCAA 2GVLA 3POCA 1ZAHA 4HNCA 5FF0A 4IF2A 4FX7A 1JPKA 3FDGA 3NQVA 1L6YA 2BXVA 3T05A 1XCXA 3I3DA 3INPA 5F2GA 1BRLA 3KVKA 1LYXA 3UWYA 1AQHA 1AK5A 2ZXBA 2V68A 2Y7FA 4M5PA 3M0IA 3G1SA 3WO8A 3PJUA 4E4FA 1QOPA 1WKDA 4ZFMA 5I3GA 4RZ5A 1IWPA 1N8IA 2NQHA 2E1WA 1E4IA 3MSGA 3BOFA 2VXNA 1V5XA 4S2BA 4XG1A 1IZCA 1MXSA 1R30A 3MUXA 3VGBA 4D8LA 1XG4A 2NZLA 4H6EA 1CENA 1EXPA 2WAGA 4X3ZA 3U5UA 2C0HA 3FJNA 2WBKA 3NVDA 1XRTA 4UQDA 3UPMA 1S38A 4FP1A 5BWFA 3W2KA 1PWMA 5CLWA 4KKXA 1WKEA 4QCFA 1KRBC 2HS6A 4GUFA 1B2YA 5GJNA 4WDTA 4GQBA 3PSVA 3URBA 1H11A 1BTCA 3CAQA 4XX6A 2QV5A 2BHUA 2HCVA 1NH6A 2Y89A 5BU6A 5D9NA 1UW9A 1XIEA 1DQWA 1XSJA 3IJ7A 3VDBA 1EL3A 2R8WA 2C8NA 1N8WA 5FJRA 2DFAA 3P61A 1OCJA 1JYWA 1Y8BA 3GU2A 1CPUA 4NJGA 3AUOA 1I6NA 4DI8A 4FSAA 1XLAA 4GOAA 5CGQA 5AN7A 3CS2A 4TO8A 1GVRA 1VGAA 4NRSA 3TV8A 2ZRVA 3CLWA 3QV6A 1XKJA 3DUGA 1A80A 3H4GA 1C90A 3CUZA 5I3DA 3PZOA 1EOKA 5FEZA 4MJ4A 1H50A 3MUCA 1ZCOA 1XYZA 4LTSA 3SCTA 3WD4A 2XFWA 4GY0A 1O1ZA 4AIEA 1MEHA 4GI6A 1G67A 1XIIA 2R9RA 1SFSA 3C6CA 2BVTA 2VZUA 4LOCA 3W7IA 4IFKA 3SGUA 1ONWA 4HU8A 4IIEA 3RLHA 3HGJA 1VFFA 2OQLA 2QR6A 3C2YA 4KESA 3B9DA 4AAJA 4E8DA 3PB2A 3U7VA 4CVWA 3DCPA 1FCVA 4LEFA 1VD6A 1TSIA 1ZU8A 3OG3A 3CUXA 3O6DA 2ALRA 1UIPA 1TUFA 3HGRA 4AWTA 1PV8A 3EPNA 2PDPA 4J3UA 1J6PA 4S3DA 4UFLA 3MI3A 1UWTA 2YYTA 1BRLB 3VNDA 4WX2A 2ZTKA 2ZC8A 5C2XA 1RJRA 1KRMA 3GC2A 3PM6A 4BY3A 1YIXA 4J3VA 2PC8A 4FXJA 4Q8MA 4MKVA 2W27A 2YCLA 2X09A 1SJAA 1QNOA 3W1UA 2ZX8A 1M6JA 4WDXA 2FZBA 3I6RA 4JDYA 4YHEA 1FWHC 1GTHA 1YNYA 2PP3A 3LHWA 3BOLA 1UKSA 4OOUA 1XF0A 5T26A 5A5WA 4Y9NA 5FOOA 4DO6A 3H12A 4MZYA 2HVMA 3QW3A 1X1OA 1U5VA 1CTNA 5LNWA 4DJFD 3MHFA 3NZQA 4PUNA 3VIHA 2CLEA 3Q2DA 4M0XA 1A47A 4W5ZA 1IR1A 1GCYA 1LL6A 3I10A 1OD8A 3SURA 1EJVC 2XH2A 3VX0A 3EOOA 3M41A 2RAGA 4IGSA 1QI4A 4FXRA 3VCCA 1FWIC 2G41A 2J7GA 2C1IA 4I9JA 2VRQA 3NFUA 4ZA0A 3N9RA 4IIBA 3ZT7A 4F66A 5DCBA 2GGHA 1JPMA 4PB3A 1DE6A 2WHKA 4AH7A 1IGSA 1K70A 3HMJG 4U33A 2VHLA 1YPIA 2YZ5A 5D9PA 1XUZA 1UWQA 1TE6A 4GQGA 1Z9AA 3HPZA 4XQ6A 7REQA 4QG9A 2A3HA 4EACA 3EWYA 5MKGA 3USBA 3AIVA 2A3LA 1OABA 1OINA 3A6OA 3ABXA 5H6HA 1GQLA 2OLAA 3UFYA 2BVWA 1TMQA 4N9CA 1W3JA 4JTEA 4JIPA 1MXGA 2CYGA 4GVIA 1UMLA 1HO1A 2VELA 4IFKB 4I8DA 4JS3A 2FTYA 3A3XA 4DF2A 3NG3A 3BZGA 3R58A 1TV4A 2W62A 3GTIA 4D2JA 4DNHA 4UWMA 5F7UA 4QROA 4QTGA 8XIAA 3DKLA 2WANA 4PCTA 3T55A 3TR2A 3N3MA 2CLFA 4JFSA 1J4EA 2PTWA 3PPCA 4MMWA 3L2MA 1QDSA 1KFLA 4V1YA 3NYZA 1O66A 1R9XA 1VLIA 3FSTA 4UB9A 3GDLA 2GUUA 1XI3A 4GX8A 1V3JA 3QF0A 1BVWA 2X30A 2DQXA 3S5ZA 1VH7A 1D7KA 1B9ZA 4NKCA 1XGEA 4GUGA 3UXLA 4Z2LA 1Q5MA 3SSJA 3QKZA 2TMDA 3LCLA 4E4PA 2D2GA 4E3TA 3TROA 2YCLB 3SCNA 4FNRA 1E73M 3TOPA 4C6EA 1K9DA 2HPMA 3DFNA 1R85A 1I75A 3S4TA 1G6CA 4R53A 2NQJA 4PODA 5AB3A 5IBXC 1VEOA 2WCSA 4AC1X 3MVIA 1JYXA 4LCQA 5DQPA 3S47A 2ZFAA 2QPUA 3BW2A 2CLLA 3WQ5A 4PTXA 5HBFA 2WPGA 1ZS2A 3BLFA 2H9AA 2NX1A 3KUMA 3VC5A 3CPRA 1BYBA 3BGAA 3DU0A 2CEQA 5CLTA 1F3WA 3HG2A 1F74A 4GNKB 3V0TA 4AXKA 3WK2A 4ES4A 2J13A 2E5DA 3QR1A 2VZSA 3CEPA 2IPJA 1TTIA 3STEA 4MB1A 1R5YA 3L67A 1F6KA 2XWEA 1T99A 4DLMA 5BMXA 2IMRA 4UTUA 1V79A 4L4OA 4JTHA 2XH0A 3T2QA 4DO7A 4GFSA 7REQB 1W6TA 4HPNA 4MLRA 5IXEA 3LRLA 4Z1YA 1M7PA 5MKGB 3L0GA 3RXZA 4O17A 1SO5A 4BQ3A 5XINA 3UBPC 3GIQA 2FIQA 4ZR8A 4P7QA 3W2MA 1GQKA 2WM1A 2RUSA 3TC6A 2TAAA 1V51A 4LSBA 1BYDA 1IT0A 5DMMA 3CQIA 4JOMA 4GABA 3B9AA 4V28A 1E4LA 2RFGA 2WNZA 3BC9A 1E0TA 3RDKA 4R88A 3O07A 1GZGA 1QPRA 1W5OA 4L1WA 4QSFA 3HQNA 3AIBA 3QQWA 3IGXA 3A22A 1Q65A 2QVHA 3VINA 2QULA 2EPOA 3MT1A 1XBXA 3UXDA 1C8XA 3HQPA 2Z1BA 4FOJA 2BASA 5CAHA 3VCNA 4KRTA 5IFPA 1B0IA 4Q33A 5HULA 3IJLA 2OVLA