4MWAA

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
260
Chain Sequence
MNEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTKTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDVRINPGNIGRRHKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
total genus 93
structure length 260
sequence length 261
chains with identical sequence G
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaA00
3H24A 3H2NA 4MWAB 2OGYA 4DJEA 5JQ9A 2Y5JA 4S3CA 1Q7ZA 3TZNA 1TWZA 4O0QA 4DJDC 4MWAA 1Q7MA 4DJEC 4NIRA 3K13A 4DB7A 4S3BA 4MWAC 4DJDD 4G9PA 4S3AA 3TYBA 4C1NB 4DJED 1Q8AA 1Q7QA 4HB7A 3TYUA 3TZFA 4DAFA 3MCMA 3MCNA 3TYDA 3H26A 3H22A 4MWAD 4S38A 1Q8JA 4C1NA 3H2OA 3TYEA 1TWSA 4D9PA 1AD1A 1Q85A 4S3DA 4PZVA 1AJZA 2DZBA 3H2FA 1TX2A 3BOLA 3H2MA 2YCKX 3MCOA 3TR9A 3H2EA 4D8AA 4O1EA 4DJFA 1TWWA 1AD4A 1F6YA 2Y5SA 1EYEA 2DQWA 2VP8A 4MWAE 3V5OA 4O1FA 4S39A 2E7FA 3H23A 4DJFC 2H9AA 4DJDA 2VEGA 3TYCA 1AJ0A 4NL1A 2Y0FA 3H21A 3NOYA 4NHVA 3H2CA 2YCLA 1AJ2A 4D8ZA 1TX0A 4DJFD 2VEFA 2YCJA 2H9AB 4S23A 3BOFA 4DAIA 2DZAA 2YCIX 3TYAA 4CCZA 4NILA 4S3EA 3H2AA 2BMBA 3TYZA 2YCLB 4S3FA
chains in the Genus database with same CATH superfamily
4P2VA 3W4RA 1YNYA 4NASA 1Q4NX 1W17A 3IEBA 4IGSA 3NYDA 1A5AA 3DKJA 2QXWA 4W89A 2BY1A 5EMMA 4PTDA 1QVBA 4UQCA 2XVKA 1P1XA 4JTRA 3KE0A 1HFBA 3ID7A 4GISA 3H54A 3KS6A 2INZA 4JY9A 1KV8A 2ONEA 4BF5A 3R1ZA 8TIMA 4P8XA 4GY0A 1EJTC 2QJJA 4JFUA 4WD0A 1SMDA 5K9DA 1EFZA 1TWSA 1RQEA 4I9AA 4OOZA 3CH0A 3JW7A 2YBUA 4NRRA 2A79A 2DUZA 2QIIA 4A3QA 1V79A 1X96A 1B31A 4PMRA 1EGVA 1ZSXA 4HPJA 1NWUA 1C7SA 1OX6A 4J35A 2VMFA 1U33A 5G5IA 1YE4A 3CZEA 1G7VA 1EF3A 1H63A 2AL1A 2EPHA 4LY8A 3T0BA 1ZP3A 1FKXA 1Q66A 4A3RA 4XV0A 1FQ0A 4G5DA 2VCBA 1VGAA 7ENLA 3FJ6A 3HPSA 2FVMA 3T4CA 3OA3A 3NQ2A 3SECA 4DBUA 5CXPA 3S4TA 1HNYA 2C3ZA 2GJNA 4GYFA 3CPRA 3L0GA 1XIMA 1UPPA 4K8HA 3HQPA 1UWTA 3N25A 4MKVA 4Q8NA 1G67A 2QUUA 1ISXA 3O07A 4WKHA 4AZBA 2EQDA 3V36A 1MXSA 1W1IE 7ODCA 4LVDA 3KM8A 3G1VA 1BRLA 2C7FA 2RGLA 3SY1A 4CU6A 1EP1A 2CLIA 2OYMA 2DIJA 3I6RA 4GKTA 3VKBA 5E9XA 4OFCA 5HNRA 4PMNA 1FH9A 4J1OA 4YTUA 2GGIA 3TKFA 3B8TA 3MJYA 4FA3A 2PRMA 3TQ0A 4EE9A 3DN5A 3W07A 2HMCA 3P93A 1J0ZA 3LPFA 7A3HA 1VP5A 2V3GA 5FI8A 3VIPA 1WYIA 3ZJKA 2QCNA 2VI0A 4IPLA 5HNUA 2PSNA 1K70A 4H00A 5HAOA 1RA0A 2VWSA 3GNNA 4DJFC 4A8LA 4Q4OA 3UWQA 1OVDA 2GL5A 2V68A 2VVNA 1A0DA 1WBJA 5AECA 3GC2A 1XJBA 4H3DA 1OY0A 2VGBA 3VNIA 4ECLA 1XLBA 3D3AA 4RE2A 2WYSA 4QCFA 3NQEA 4UTWA 3WCZA 4P7RA 1NOUA 4F0RA 1V02E 4OHQA 1THFD 1C8XA 2QQ6A 1TTJA 2PLCA 1WKDA 4FLSA 1A5SA 3KRBA 1E1CB 5JBFA 1ODUA 4NAEA 4AXKA 3JRKA 3CHVA 1D3HA 3ZLHA 1DWAM 2R1MA 2XPKA 3TTEA 2OMAA 3MPGA 2C19A 4ZO9A 3VXGA 4NVTA 3TX9A 3CM4A 3KWXA 3GRIA 2WNQA 3U7VA 4I8YA 4F2UA 3DFYA 4MY8A 4G7EA 1GPWA 3THCA 3L65A 5T8GA 1W3LA 5I3GA 1ZCOA 2PDYA 4I7WA 1OEPA 4GYPA 3IARA 1ZJAA 2OKTA 3C52A 2QCHA 1RQBA 3VGDA 3GXPA 1GJUA 2CBUA 4EWJA 3ARYA 3NDOA 4HA0A 3BDKA 1CXHA 4C6LA 1G94A 3NEVA 4ZCWA 5HNNA 2JKAA 3LENA 2FGLA 1FTXA 4Q8VA 2YBTA 3KWSA 4LANA 4JQ1A 3CIWA 4JTEA 3RLVA 3LBCA 1WUFA 4JXCA 4XO7A 1F61A 1CLKA 1F2JA 3MMDA 1DHKA 3RITA 3UT0A 3PBWA 3WUFA 3S6OA 2EGZA 1BYAA 2P8CA 3A64A 2TSYA 3VZXA 1E73M 4HZ8A 2PTZA 3STCA 3WQWA 3CUGA 3S5YA 2JGYA 2E5BA 4ERAA 4RW5A 2ON3A 5MKGA 3UNTA 4CVWA 3DFTA 1C91A 3IV3A 1ONWA 4N9CA 4OVXA 5FEPA 2PLJA 2VC5A 1FCQA 4WDUA 4ORMA 5DF0A 2DW6A 4HNVA 1FUYA 1QATA 1RK5A 2YPIA 3BAJA 1M41A 4D6IA 1R47A 4C1NB 1PB0A 2QPUA 2G3FA 1LQAA 5F2GA 2HXTA 4MYXA 6A3HA 1M53A 3SQSA 2Z1XA 2Q6ZA 3B9AA 1Q8JA 1DWFM 1PE1A 4NJKA 5LGXA 1DKWA 2VCCA 3GM8A 3TP4A 1VJIA 1OSEA 2WKJA 4PBGA 3DAQA 3H70A 1JVNA 3G18A 1NWTA 3ZVHB 4AZ5A 1LLOA 4BI5A 3C3UA 7REQA 4GVHA 4DXXA 2H9AA 3VGBA 1MZHA 3C2RA 4WK9A 3RF9A 1JCXA 3OOQA 2QDDA 4GH3A 3CK5A 2YCLA 3G1RA 1A5NC 1JPKA 2NSXA 4FNSA 3GAYA 1O5RA 3GZAA 2PWDA 3IJIA 4US6A 1G5AA 1S2VA 4GMEA 1UR1A 3V16A 3W2LA 1G6CA 1SZEA 5EL1A 1T96A 3UYCA 1XBVA 5HWMA 2L5HA 4B90A 4Z1BA 1RALA 2DZPA 4S3CA 2WC7A 3B9NA 3N73A 3SADA 2XGIA 3PPGA 3W2NA 1K8YA 4CN1A 2A7RA 3IIVA 4MWAC 3YPIA 3N4AA 1XDJA 1F6PA 1QW9A 3B8UA 4LAZA 3EEZA 2BXYA 1SZRA 1XCWA 2FB2A 5GNXA 3UP8A 3TC3A 1NIUA 3LBMA 4J9JA 1A53A 2X30A 4TX9A 4UB9A 3T2PA 2GGGA 3VM7A 4HYRA 4FXSA 1R6WA 3LMYA 3P62A 3NEHA 5L9FA 1MI3A 1K8CA 2DQWA 3NXLA 5D33A 2J25A 3N9RA 3DHDA 3NPUA 2YZRA 3R8RA 3W88A 1O6IA 3PBGA 2VRQA 2C1GA 1I8JA 1CTNA 1FVPA 2WC3A 3BW3A 3JR2A 4R7OA 3C0SA 1UD8A 3ITVA 1ITUA 2YCJA 1C7TA 4FF5A 4O1CA 5CG0A 4I8DA 4DBSA 1G01A 3K8KA 4F9JA 3H2AA 3R13A 4BWLA 2IXVA 4HZ6A 2B7PA 4MAVA 3W29A 3QEZA 4P5UA 1B9BA 4PCFA 3BURA 4IQEA 3UCQA 4E3TA 5AC4A 5JBDA 5B80A 1LUCA 3KOWA 3DBNA 4LSBA 1TR9A 1WXJA 2Y7DA 1M03A 4NT0A 2J6XA 2CC0A 5ECUA 4GUGA 4DRSA 2AOSA 4OZOA 4QCEA 3WH9A 4CQ9A 5AC5A 4HB7A 4AMCA 5I5RA 4QJ3B 3GTFA 3Q58A 3T08A 2WB5A 4CN6A 4HKPA 2HVOA 3TVAA 4Q4PA 3MMWA 1DV7A 3UZYA 2ZUUA 2X1SA 3KHJA 3B3DA 3O2LA 4GXPA 1KW1A 4H9YA 3MCOA 2YFNA 2R82A 2PC4A 2Q3RA 3A24A 1R2RA 5I78A 4CCCA 5AHEA 3RM8A 5FJJA 2VEMA 3CMJA 2VFHA 3OIHA 2ZRUA 4XTDA 1QNSA 3NJ3A 1UKTA 3C86A 5LHEA 3R79A 2BS9A 1DWIM 4F0SA 1YKWA 2WMGA 1E5NA 4HPNA 4XWUA 3WUBA 4PH6A 1E40A 4L9XA 5LXEA 1PX3A 1EX5A 3QW4B 1JDEA 4PMJA 3ABQA 2VC7A 4L61A 4XKYB 3ZFHA 2YYUA 2D0GA 2DT0A 1PCWA 2VGFA 3S6DA 2PODA 2WHMA 1GVQA 2XFFA 4W93A 2E5DA 2OELA 3AIWA 4QAWA 1BAGA 1I2PA 3FIGA 4L6HA 2E5CA 2F61A 2CLOA 5FJTA 1TIWA 3BSMA 4GFIA 3UY7A 3Q94A 1E3ZA 3TUUA 2PWFA 4JKKA 1PS9A 4J3VA 5EYWA 3H55A 2QCEA 3P67A 2ZYFA 2OGJA 3DERA 1W1B1 4ROPA 3W1TA 2J75A 4MZYA 3POCA 1WV2A 1WAUA 5G2HA 3TNOA 2JF6A 4RLIA 3LHWA 2ATMA 4XZNX 3TSBA 2QKFA 3M7SA 4Z2JA 1UJQA 2Z1BA 2CESA 3PUDA 3W73A 2PDHA 1VFUA 3RO6A 3DG7A 3HFYA 2X0SA 3WD1A 4ZQNA 4AWEA 1DIOA 2XGZA 1YIXA 3BAWA 3SCRA 3GH7A 3PG8A 4LVAA 1HKKA 4XZLX 4J3XA 3CWOX 3P80A 5IDIA 4OIFA 4WKFA 5IOBA 1JDCA 1Q65A 3UGVA 3RX4A 4F2TA 3T07A 3FSTA 4WOZA 4DBDA 2A5HA 4F0LA 1EDTA 5LIYX 1UD5A 4YPJA 3AYRA 3H12A 1WOAA 4HYWA 1RVGA 3PTQA 4R9XA 4YNGA 4KCTA 2W3ZA 3GO2A 1TFVA 2RDUA 3UXKA 1REQB 3UETA 5F1UA 2ODOA 1GVEA 1IWBA 4Z08A 2E6YA 1L6SA 1HF6A 3CUJA 3FCPA 3EWYA 4KWSA 1WOBA 4NX0A 4OWGA 2A85A 2WBGA 3WNMA 2FJKA 2ZC1A 1RSCA 4WGXA 1B30A 1T41A 3WD4A 2ZICA 4QIUA 1GOQA 1VIZA 1J2BA 1L9WA 1TZZA 4JEJA 3SFWA 5DBTA 4DYKA 4IUOA 3WLKX 3A5FA 1ZAHA 3LLFA 4JCMA 3PSVA 3LYEA 3L4WA 1GCYA 3MI2A 4IHCA 1AD1A 2QMJA 4V33A 1QO5A 2DVTA 1OADA 4GCAA 1FBAA 3ZVHA 5CC7A 1X8CA 5TNVA 3W25A 3WX7A 2YZ5A 2Y89A 1DWGM 1CW2A 4HJWA 3KOFA 4NUWA 1FFQA 2CLMA 4GD0A 1PDZA 3TAKA 3IJDA 1EOKA 3W7GA 2ALDA 1OABA 3T55A 4HPGA 4GFSA 1UR2A 1J11A 3CB3A 2VUYA 3GUWA 4HGXA 2G8ZA 4X61A 4ZMGA 2G41A 4HN4A 4E2OA 4IX2A 4JGDA 2DU2A 5AHNA 1BPLB 4EAMA 3PB2A 2PI6A 1VIWA 2OU4A 1IT7A 1HG3A 4XZHA 4GWEA 1A47A 3T42A 5XIMA 1GOIA 1S46A 1UR4A 1PXGA 3UBPC 3E38A 1JCTA 3GSMA 2EPKX 1GONA 2Y88A 2EG6A 1KBKA 4DJEC 4BK9A 1D7FA 5LIWX 3QMTA 4W8AA 2VZUA 3KFTA 1H11A 2O56A 1PL9A 2BZNA 4ZB2A 3N9KA 4DJDD 4I6VA 3S6TA 3EMZA 1LCOA 3L0KA 5C9RA 1H7WA 3GVGA 4ATDA 2VENA 2WLZA 1DQUA 2BFGA 1LOSA 4I90A 1TV2A 4O16A 2ZDSA 4YIWA 4PODA 3TYEA 5XINA 1B90A 3VNZA 1AJZA 3B0VC 3U2EA 5F2MA 1C29A 2BASA 2XH7A 2G97A 3GHUA 1SMAA 2WOQA 3KBNA 4ZTYA 5C9WA 2XUCA 4AX7A 2ZZ1A 2WBKA 1ADSA 1A5LC 1RJRA 1HKJA 2E9LA 4AX6A 1UASA 4B9ZA 2XH2A 2VGIA 4ZOEA 1UKSA 4L80A 1E6SM 3N12A 3U6WA 3PC0A 5DEZA 4M19A 4XD5A 4GK8A 4ZXOA 3P8JA 4Y8EA 3QGKC 4MG4A 3A4AA 2OTDA 3URQA 1LDCA 3E5PA 1XIFA 4FSAA 4IL0A 1X6LA 3NWRA 5A6JA 5D9OA 4A21A 2Z00A 2VFIA 4C6QA 3SRHA 5D37A 4PYSA 4FNPA 2FB3A 2G3IA 3G1SA 3TC7A 1NSJA 1UD3A 1MDRA 1EQCA 4AISA 1H60A 2DEPA 4KWWA 3E0VA 3VDHA 3BLLA 3QV6A 4NZ4A 4WDWA 3VO0A 3EEGA 3C0JA 1AA1B 3N4EA 3LERA 2QF8A 3KTXA 2FGBA 4WX2A 1KCKA 3VKCA 3Q37A 1K9EA 3SRKA 2ZXAA 2VGGA 4OE7A 4GQBA 1TTQA 2OT0A 2WVVA 4JIHA 1XINA 1XC6A 2TPSA 3GFXA 3W1AA 2FPYA 3TC6A 1UWSA 1BYBA 3W0KA 1XH1A 1WDDA 1GOWA 3IVSA 2OQLA 4L7ZA 1GQKA 3AXMA 3W1RA 2D3LA 4E2BA 2VD8A 1EEPA 3EKLA 2UY5A 3VIKA 3BJTA 3GDLA 4NHVA 3S2CA 4Y6GA 4LF1A 3T44A 2NLYA 1KM4A 2FMNA 1F3EA 1LT8A 3AMKA 5D2VA 3RXZA 3W7EA 1F07A 5LA0A 1X6UA 3MI6A 2H3BA 2NZLA 1YXDA 5KZ6A 1JRCA 2HCVA 2X0HA 2W91A 3NO1A 3O8AA 1ZRQA 1IR2A 2WSYA 2D2OA 5A2AA 3WMSA 1KLYA 3JZEA 4IGHA 3ARVA 3BLFA 2QDHA 1XLGA 3PBUA 3RLUA 2MNRA 4D6HA 1QK2A 1RBOB 1ZJHA 4O17A 3A4XA 3LTPA 1OBAA 3G5EA 3QW3A 2YFOA 5EBUA 5IHSA 2J74A 1AZ2A 1CGXA 3PUEA 4XAGA 5GNYA 4F0HA 5FACA 3UPWA 3GG7A 4PCSA 3MV11 3NZQA 1Y7VA 3RCYA 2P76A 1FDYA 3USZA 3RU8X 4K38A 3KRZA 4YCOA 3IANA 4LW7A 3MW7A 1H0IA 4ZODA 3MWAA 4JQ4A 4B15A 4DLMA 3FJLA 1OC5A 4M81A 2VNCA 5C0QA 1EA9C 1PZ1A 2WZEA 4GQGA 1O5XA 4NSBA 1O66A 4A05A 3NQCA 3EB2A 1U5VA 2FKPA 4C5ZA 4TUFA 4H7VA 1WQ5A 1VD6A 1Z7AA 5HPCA 3FS2A 3CC1A 4FXFA 3IACA 5G1YA 1I1WA 4AZHA 4DI8A 4GKLA 2WZIA 3E74A 3WDQA 1JI2A 3QFWA 2V3EA 2WW5A 3QF0A 5HMFA 4NZ5A 1EA0A 1QHZA 4O0QA 2GFTA 3L4XA 1JD9A 6XIAA 1OX4B 3SQLA 3VD9A 1VFTA 4IP4A 1KFBA 3VE9A 4WIWA 2PWHA 2A3HA 4DUOA 4TV6A 4BJHA 3FYYA 1RY8A 4G9PA 1E0TA 2DZTA 1VFFA 4WLCA 4JN7A 2QMKA 2WO5A 3EOLA 3UG5A 3QMSA 3H26A 2YR1A 3STPA 4XSLA 1OGBA 4YTSA 2HQAA 2P88A 1OYCA 2J9ZA 4HHPA 1RY0A 1PO9A 1HIZA 2DV0A 3NURA 4JHMA 3G3DA 1UG6A 4IG2B 3GB6A 4RCXA 2GGJA 4EPBC 3S46A 1BF6A 3CXOA 2ZUWA 1VCFA 3CUFA 5H1WA 4DJFA 2OOFA 1L6YA 5D2WA 1M04A 2B7NA 1E4NA 4J40A 4DZAA 5TQLA 4NNAA 1NFPA 4TOQA 5BXRA 2A21A 3NQMA 1CB7B 5KTLA 5CZTA 3OZYA 3IUDA 4HYVA 1IZKA 1VLWA 1ZENA 2J6VA 3MHFA 3Q2DA 4NZJA 4K7YA 2CHRA 4GJ1A 4UR9A 2E67A 4V27A 5C71A 5EMKA 4KGLA 2OLHA 2OZ3A 4B16A 3V0TA 1HP5A 2QUVA 4D1IA 4QDPA 4JEQA 2VZTA 3N4FA 1EWEA 3N6HA 3LTYA 4AD0A 4XSMA 4YVPA 4ADTA 2PRHA 2ZE3A 1SFJA 4O14A 1SGJA 4Q7NA 2QIWA 5K9CA 3CQJA 1MSSA 2PWGA 2RJHA 4A3UA 4GIRA 4CD6A 4P8VA 1V3HA 3SN4A 4OU1A 1XICA 5M03A 1YTKA 1ZL1A 4HOXA 1V6XA 2ZCGA 1ZU8A 2X09A 2DQXA 4IOTA 4KEVA 5EMYA 1KGXA 3E96A 1V51A 2X1IA 2V2HA 5ABEA 1KCLA 1W2VA 5KITA 1KR0A 4HZMA 2G3JA 3T0TA 2EKGA 2QPXA 3OU8A 4GBDA 3MZNA 1S5MA 3ZJ8A 5BOFA 3NDYA 5HQEA 4PTXA 4GC4A 5AFDA 1AH4A 5TAOA 3A12A 1WZLA 2WJEA 4WZHA 3CBWA 4H6RA 1EJSC 3EXRA 3UPMA 1MEIA 1E55A 1GZGA 1Q6CA 2CWNA 4IWWA 2GOKA 3P3BA 4RDZA 2YXOA 4UR8A 3H21A 3BTNA 1JZ2A 2X7VA 2NQHA 1IWAA 4UCGA 3GDRA 5DX7A 3W7MA 4QP0A 4LNYA 3MSRA 3W81A 2Y85A 3QPEA 4ZQOA 4ZA0A 4OECA 4GG9A 2ASHA 1JD7A 3V1HA 1UZ4A 1YE6A 4DEFA 2EPMX 2OX1A 4L9ZA 1Z42A 4N02A 3V0SA 5FESA 3LXBA 3B8DA 3HIJA 4REQB 4K7VA 1TWDA 4GO8A 3DIPA 3JS3A 4DB7A 3L4ZA 1QI5A 3GHRA 3LCLA 1TTIA 3KVMA 4QITA 3CV7A 5I23A 3T6CA 4QSFA 4Q8TA 4FB7A 1OCJA 4BHYA 2Y61A 4XUGA 4FX8A 3UD6A 4DHGA 4N42A 3KBVA 3DHUA 4AC7C 1TJPA 1DIKA 2ESCA 3WLRA 1PWMA 3MHUA 3TONA 3VA8A 1PTAA 1AMYA 2YXXA 2Y5EA 1YDYA 5I24A 2FLIA 2PB1A 3G1AA 1GNXA 1AD4A 1TWWA 2ZZ2A 4DZHA 1XLFA 2BY0A 1E51A 1MEWA 4DJDA 2WNZA 1H0GA 5CH9A 5LNSA 1OG0A 2P53A 1K7EA 2YCEA 4NQ1A 2ZRZA 5IBXC 2EO7A 3L2MA 2JEQA 2CLKA 3BICA 1OFBA 3W83A 4RNHA 1C8QA 4IFRA 4JIQA 1S1PA 4ACZA 3JUGA 4FX7A 4LXFA 1E15A 3LCWA 2PDWA 4UZUA 2BHYA 4ERGA 3WENA 3ZSSA 4I9TA 4RUBA 1Z44A 4MWAA 5DY2A 3W53A 5EFFA 1L0PA 1ZBKA 3BMVA 2DSVA 1SW0A 3B9DA 3HG3A 4MLRA 2FPVA 1XIHA 3TMQA 1BTCA 4OBTA 2PDMA 3LGEA 1KTCA 1TPVA 2XIMA 4J28A 4B5NA 2XHYA 3GXIA 2G5WA 3DFPA 1EDGA 3N2BA 3DXIA 4Y2WA 2FDMA 2P3EA 1BXCA 1XD0A 1V77A 1WAWA 2WCSA 3DUGA 2DUXA 2VR5A 4H9XA 1UC4A 4HK6A 4Q32A 3RX2A 2AMXA 3A4JA 4DPQA 3WNPA 1DJIA 5A2BA 2QNEA 3LV5A 3TN3A 4AH7A 3IGHX 1QHPA 4RDYA 1KM1A 2VTFA 1XI3A 3HPAA 4E8GA 4G6CA 3EMQA 1VC4A 3WFAA 1FCVA 4IFOA 2D22A 2KAUC 2V9DA 5TD4A 2VX5A 3T9PA 3OO2A 2J7EA 3SRDA 1CPUA 3CQKA 3S2JA 1X8FA 1J8VA 3IJ8A 3NR0A 1TZ7A 1KFKA 2YDAA 3ANYA 3R25A 2DT3A 1FCBA 4QR6A 3RCMA 4EK7A 3BAKA 3VD5A 3WLIA 1Y0EA 1GKPA 1W9UA 3NL2A 5IFTA 3OG2A 2V30A 1IXQA 3WZ0E 3HJEA 4M0XA 1QBAA 2DUAA 1QO2A 1FX6A 3EWBX 2F2HA 3BGGA 3EWZA 4A2SA 1C93A 4JIRA 3QZAA 2A3AA 3B9OA 3RMEA 3H2OA 1LL4A 2UV8G 4O4WA 3V7PA 3OHIA 3LM7A 3BLDA 4UCFA 4GUJA 3BK0A 2XSXA 4H4IA 4QEHA 4S2CA 3W37A 4LYQA 1UMLA 4C65A 4ZZ9A 1W8SA 1UB3A 1S3HA 3QR1A 1EO7A 2G4JA 4RKAA 3VIFA 1TPB1 3IGXA 4IL2A 1XSIA 6REQA 2F84A 1V3IA 4CLMA 3H23A 3C8FA 4AHPA 3N29A 3G22A 3ENLA 1YW1A 3WBAA 3CZJA 1V6YA 4ZE4A 3DYMA 2Y2WA 2I57A 4QE4A 1TJ1A 4ROQA 2NVCA 3PZTA 5EU9A 3KCOA 3HV8A 3NZPA 4M56A 1WDWA 4AEFA 3AWNA 1GHSA 4Q8MA 4LB3A 1SSDA 5EBAA 3LZ5A 4P8UA 1CNVA 4IT1A 2EJ1A 3QY6A 2Z6JA 1RLCL 2QGYA 3AS3A 5AYZA 1TA3B 2NT0A 3S0CA 1G4EA 2W79A 4PMUA 4M80A 1XHGA 3AICA 4LCQA 4WSKA 2VQTA 1EQPA 2A6LA 4LBRA 4YXGA 4W5ZA 3H7UA 2IQDA 2OQYA 2DDXA 1UR3M 4ZQRA 3SCTA 3HG2A 1V0NA 4KETA 4BCEA 4ONVA 3UA4A 5A6SA 1K1DA 2NLIA 1JCYA 1BSLA 3M46A 3BC9A 3TE9A 4NJGA 1DIEA 1GW9A 2CXGA 4MPQA 4C6PA 3U2CA 2XN0A 1Q4WA 3WBWA 5GNZA 4QX4A 4O18A 3WDPP 3TW7A 3W71A 2EEXA 1IE7C 2UY3A 3IUHA 5H8MA 3DHPA 2C71A 1UUQA 2XISA 4MLJA 4EANA 5I77A 1W9VA 3ES7A 3K4AA 1K7XA 1IYXA 1AJ2A 4ORIA 1W1A1 1AFSA 3ZT5A 1JYNA 3K8LA 3D6NA 3L4UA 4REQA 5HJXA 3VD4A 3TYAA 1FWNA 3TSDA 2VJXA 3PPFA 4B2DA 1XUUA 4BF7A 1UWAA 1XC4A 5D2XA 4H9VA 4RW3A 5FJRA 2PCEA 1M7OA 2BGNE 2R91A 5D4YA 4V28A 2Q09A 3U4AA 3A3HA 4JBRA 2EHHA 3OQ8A 2ZXBA 2X05A 4YYCA 1WE5A 4CUCA 3SEPA 3MUIA 3IVTA 3L7RA 5A8PA 5LIXX 2ZC8A 1OFDA 2PDUA 2WJZA 4C6KA 1XDMA 2DJXA 2DPEA 2J7BA 2PDNA 1PSCA 3CB8A 3EX1A 3SY8A 3W75A 3HQ1A 1WKFA 3NL6A 1XISA 3II1A 4MB4A 3WLMA 3W2MA 1SW7A 2Z28A 1LP6A 3PTDA 1NDWA 3ABOA 3NO3A 3AZTA 4OGZA 1VPXA 3MP4A 4OBRA 5PTDA 1YBQB 3C5QA 4N6EA 3GYEA 2BBFA 2UZ9A 3H8AA 4HU8A 1EJVC 1XD1A 1PEZA 3AALA 1P0EA 5IHRA 2XTKA 8XIMA 1P7TB 3MKCA 4K36A 3G0SA 4ENLA 3CYVA 3O6DA 3NCOA 3PBVA 5LYRA 4U33A 3E3HA 5TIMA 4IP7A 3SSJA 2CKRA 3CU2A 4XD3A 4C6DA 1C9WA 2P1FA 1GHRA 1CBGA 3ZWTA 3R10A 1VR6A 4C7FA 1BHGA 3QHOA 2A6NA 3ONBA 3UJRA 3VCCA 1DXFA 1W5QA 1OD0A 7PTDA 3B05A 4DJEA 5C9XA 3NQ7A 5CPTA 1R86A 1JPMA 3HQNA 4C6IA 1PIFA 1QW7A 1SM9A 1D3GA 4AWSA 1LG1A 5HNTA 3SN1A 1NELA 3K13A 3VNYA 1XW8A 4TO8A 1OWQA 2ZADA 3GDMA 5HR6A 1DQXA 3QSRA 3Q4DA 4AXNA 4OKDA 1VBUA 4HNLA 1CXKA 2HTMA 4H01A 2FZMA 2PBGA 3WUGA 3UWYA 3EYPA 1J6OA 2VRKA 4KERA 5F4SA 2POTA 1E4LA 3E02A 3O6CA 1CXLA 4PTWA 3MBFA 2QJIA 1VHCA 1Z48A 3CLMA 5D2YA 3TTYA 3WNLA 1US2A 4Z2KA 1NJJA 4YLWA 1FWGC 4YN5A 3DGBA 1JF5A 1GORA 1O7AA 2FZDA 3GVQA 5CPMA 4I5RA 3T2QA 3VKDA 3F2CA 4HA4A 4PN2A 3BWWA 4JQAA 3UZZA 4Z2HA 3MUCA 4DUXA 2Q8XA 1J0JA 2Z1KA 2R1NA 3KP0A 3ABXA 4KPLA 2GZXA 4AU0A 4IIFA 1LF1A 4EXAA 2ACQA 3PJUA 3VGFA 3PR2A 3SGUA 1HKWA 2FZ8A 3A6OA 3FV9A 5IM51 1AW5A 4LYPA 1FXQA 2ISWA 1DIDA 4GPNA 2Q3OA 1W91A 2WK2A 1JJKA 3FVDA 4AYGA 2YL8A 3EOSA 2OCZA 4KF1A 2GDVA 2NXIA 3AIEA 5E9AA 2OODA 2C16A 1GT8A 5CGMA 2OGYA 5AHIA 3VCRA 3R58A 2OEMA 5JQ9A 3P7YA 4W85A 3ZVIA 6ALDA 3TZNA 2FZNA 1W9BM 1K3UA 1EZWA 1QU4A 1XYFA 1R46A 1GK8A 2HE8A 2ZE0A 3DX5A 3U5YA 3S1GA 4QRNA 3T0CA 1HJVA 4M24A 1XIIA 3EKGA 3DH7A 1VLIA 2BP1A 2HBVA 2OLSA 1K9TA 3APYA 4HMCA 3M41A 4G8TA 4YL2A 5EB8A 4MDPA 4PEEA 5K3VA 1TB3A 4LUSA 4JYEA 4Q4RA 4Y9PA 1H1YA 4NNCA 1W5OA 2JQXA 3U48A 3MDWA 1EYWA 4JFVA 1OZQA 3P60A 2VX7A 2FYMA 1UA3A 2WM1A 3MUY1 3NIYA 2Z2BA 4HA3A 2XJ7A 3NYZA 3UJEA 3GIYA 4YHEA 1GQLA 1DJNA 3GX9A 5HJLA 3PPCA 1RPKA 5JVLA 1VS1A 1P1MA 1I6NA 4O1DA 3VDAA 3WLQA 4FLQA 1EPXA 3MUXA 4P8WA 4R27A 2G3MA 1PIGA 3ES8A 5G4WA 1I4NA 1MFVA 2VKZG 3T40A 4Y96A 3C8NA 1FFRA 2ZXQA 1Y65A 5BOEA 5LZLA 1WDRA 2HJPA 1JEZA 1QPNA 2OEKA 4KFPA 2GVGA 1QMLA 5FJIA 3ICJA 2PURA 4KIEA 3TTSA 3E0LA 1TWZA 1SJBA 5A6LA 1IEXA 5CLWA 4GX8A 1SU5A 3V18A 2I7GA 3KL5A 3NQFA 5C2GA 5H2ZA 2HS8A 2GQ3A 3OGSA 5CPOA 3WBEA 1TV5A 4MM1A 2NVDA 4M1RA 1CGYA 1P0DA 1RBAA 2PFHA 2Z1SA 3ARXA 5C9ZA 3WJYA 3NZGA 4GNVA 4B91A 4OV4A 3WNNA 2R1PA 1PTDA 3PHAA 1R3YA 1GVIA 5HMEA 2PDLA 4RNJA 2YB1A 4C6EA 1VFMA 3BQ5A 3S83A 1VFSA 1ME7A 3H2MA 3L4TA 4LEQA 1B3VA 1JIBA 1S39A 1TE6A 1U2YA 3CLWA 3A9IA 1RPXA 3K30A 4HK5A 3QYQA 4EACA 1L8PA 1V6VA 4B5WA 3C61A 3QPYA 2QS8A 5A69A 1R3SA 1W8GA 8RUCA 1RAKA 4LAOA 4TTGA 3GXTA 5CGTA 3AIVA 3SQMA 4KEUA 3KTSA 1SW3A 1B3XA 2J24A 3NO5A 5LNWA 5DQPA 1SPQA 3NFUA 3NSNA 3M5XA 3OLDA 4RDWA 1IF2A 2NQJA 3I3EA 1E6QM 3OLEA 5DMMA 3VIGA 1EOMA 3VMPA 3KVKA 4M7SA 4EWND 4AD5A 3PS7A 5GJMA 1J0YA 1AK5A 1MNSA 4W84A 1VH7A 3IIOA 1WZKA 3TCSA 4GBUA 1TV3A 1VBJA 3R11A 4AZCB 3NQAA 3EX4A 5HA7A 2F38A 4HN8A 4Y9OA 1TMQA 4AW7A 3WH8A 3CAKA 1UCWA 2XGBA 3BZGA 3W87A 3ME3A 1P0KA 4AUBA 2X2YA 2A0NA 1DYSA 1IT0A 4QQ3A 1OFEA 3F4WA 5FL1A 1JZ6A 1KWKA 3KL0A 5T9CE 5AYIA 3F5KA 5A8MA 2DW7A 1L6GA 2Y5SA 3HM7A 2C91A 5C54A 1QAPA 3R94A 1WDPA 3GD6A 4ATLA 2IKJA 2C0HA 3BMXA 3GTIA 1WX0A 3MT1A 2D3NA 4UZSA 5C7HA 3SIZA 1SYTA 4XUYA 4AD1A 3KLKA 2VDGA 4CNPA 2J13A 1AL8A 1O5QA 4S23A 3R0DA 2F2KA 1K9FA 4JTJA 3O6AA 4Q4MA 1JL8A 3OVPA 1MXDA 4S3FA 1A5MC 2VXNA 1KCZA 4AVOA 3EOEA 5A94A 3W7HA 4FMVA 1HJWA 5HR7A 3BLIA 3E2QA 1A5KC 2RUSA 2ZUNA 4DPPA 2BXZA 3A13A 3ITXA 5F4XA 4EIVA 3QR3A 3UWEA 2V8ZA 1U83A 1OD8A 1TWIA 4PFHA 3RNDA 4BS0A 5I6SA 3ATZA 1IIGA 4ZO6A 1KA9F 4B3ZA 3NQBA 4Z1AA 2VFGA 2OXNA 1UP2A 3MDUA 3URBA 1OFRA 4MADA 2AQOA 3VKKA 3POHA 3AWOA 2JK2A 3PZOA 1W1PA 4K2SA 4RXGA 1H41A 3GIQA 3R8GA 4IICA 2GGHA 4HSNA 5CSYA 2D1ZA 3MQTA 2E28A 4NZ3A 1H4PA 4HNCA 5KZDA 1GVSA 1UHVA 1YHTA 1FWSA 1JYWA 1V93A 1P0BA 3DFSA 3LQLA 3M16A 4LVFA 4NAFA 1ZPTA 4DUWA 4Z2LA 3EDKA 2B0MA 2CBJA 5I7GA 3IJLA 1OGGA 2NQZA 2ZUTA 2WSRA 1V0LA 4O52A 2ATSA 4U5IA 1LBLA 2OYKA 2YIHA 3MI3A 4U4MA 5BZAA 5CPLA 3O05A 3AS2A 1XIGA 2YDRA 1E5JA 2Q71A 2QV5A 2YX0A 1FRBA 3GC4A 1KKOA 2WZTA 1MQQA 3AIUA 2R8WA 2Y7FA 1KGUA 5EMUA 1Z3NA 3NVTA 1EXBA 1T99A 4QFUA 4JOMA 3VC5A 1VHNA 1OYBA 4DI9A 3OLGA 4CKQA 3N14A 3RX3A 4GGHA 1VFOA 2DSKA 1JFXA 3G6LA 2DP3A 2AGKA 1W2PA 3IRSA 3G0UA 4I5XA 3EXTA 4MUZA 5IBXA 3U7BA 3M47A 1FWHC 4LUTA 5AHMA 1JAEA 1QNVA 4NYUA 2J9YA 1BGGA 3C3NA 3NTYA 3LLXA 1HJXA 3I7SA 4RPQA 3KRUA 4L4PA 5CC5A 2R24A 3TSMA 3ITTA 2ZA3A 2VEFA 1E9ZB 2ZA2A 4ZEPA 1LWJA 4Y9NA 1G1YA 1I75A 2GJXA 4GUFA 2DT1A 3N2MA 3ZO9A 3DHFA 1I60A 2IPGA 4MPKA 3DG3A 1A3HA 1PAMA 1BRLB 1MEHA 3P81A 3W1XA 4TMCA 2XZ9A 4JFSA 3EOUA 1H7XA 2QUTA 5HPOA 3GNPA 3UGRA 4UTMA 2FIQA 4MB3A 4CD7A 5FA5A 3GY1A 4KKXA 5JIWA 4R7WA 1K03A 2EF9A 4IGNA 1ISYA 1QBBA 3AJ7A 5BXTA 3PULA 1E4IA 1FWRA 1N55A 3D5HA 4A6GA 2GUUA 1KNWA 4Z1DA 3V3WA 3W2JA 2V2CA 4JKLA 5MF5A 3AO0A 3QFEA 1O4UA 4JHOA 3WD3A 3TEVA 3VUPA 4IJRA 1TMLA 3MZ2A 4O19A 1OYAA 1W1ZA 2ZUVA 4AHQA 1Q45A 3UXAA 4CQCA 4UTJA 4QHRA 3T78A 3M5YA 1W31A 2AMGA 1LRQA 5L6UA 4AB4A 4B5TA 3WLPA 3HG4A 4ILSA 4O1FA 3FXYA 3URNA 2CZEA 2PEVA 2INFA 2J7HA 1U30A 3W1UA 5E70A 1K4GA 1MW3A 3AUJA 4QNWA 3QHNA 3K1DA 3KEHA 3GE7A 1B0IA 3WK0A 1CDGA 2OB3A 4XBJA 5D09A 3LI1A 1P6CA 2HS6A 2TRSA 2WPBA 1R5YA 2J27A 4JQ2A 3QPZA 2VURA 1NU5A 1QPOA 1V03A 5CJNA 1TREA 3LCXA 5KETA 4LOCA 4WGHA 2WLYA 1JCMP 4N9BA 4O10A 5HWJA 4NAEB 3WEZA 1W5NA 4IQDA 1Q13A 3FEQA 4Y7EA 4PUUA 3M6DA 2QHAA 4QE1A 3QY8A 4UTHA 3WD2A 3BAYA 3A21A 4Z2IA 4G7EB 4DWSD 4ASTA 2PDKA 5DXYA 3R43A 3WLHA 3WF1A 2XIIA 1E9YB 3AIQA 4IPNB 2A7NA 1P5BA 4AZ7A 3E6EA 2QJHA 1A3XA 1VEMA 1ELSA 2AGTA 1Q2SA 4RPPA 4AIEA 3I65A 1LT7A 2GQAA 4GINA 2J62A 3E1F1 2QAFA 6CGTA 1UW9A 3EDJA 3MP3A 4MKNA 2FTPA 4FNUA 3GG0A 3OYZA 2OG9A 3W7LA 3W7OA 2W27A 2VR2A 1ITXA 2DVUA 4BEUA 3B0PA 1KM6A 1XIDA 3RUBL 3H2CA 4R33A 3AYTA 4D8ZA 4JPGA 4UOZA 2EXOA 4HU0A 1B3ZA 4MVAA 5MKGB 2V82A 3FOKA 4PCTA 2ZWZA 3FYPA 3ZR5A 2FMOA 2GGEA 1XGZA 5C6MA 3THDA 2I16A 3I3DA 4DNHA 1N8FA 3EKZA 1XKJA 3KDNA 4JIIX 4LWWA 2J7FA 3TN5A 3GC5A 3H4XA 1UQZA 3DI0A 4C5YA 4F4RA 3PANA 2X16A 4O4VA 4GI9A 2GVLA 1S38A 3EA1A 2P0IA 4YVVA 3AHZA 3IS4A 4DVOA 4M82A 4D6CA 3N2CA 4JIPA 5FF4A 3BW2A 4EOUA 3SI9A 3ZS4A 3I3BA 2NQ5A 2PAJA 2WZHA 1P43A 2QCFA 4PSPA 2F6KA 4IFKA 1G7UA 1GG1A 1XM3A 1XIJA 4PZVA 3WF0A 3ARZA 2D69A 1YXYA 3GG1A 2QJNA 1UD2A 1KFWA 4D8LA 4PUWA 1XRSA 5LGZA 4AC1X 2VEIA 3MC5A 3PBYA 1XUZA 4I7VA 7REQB 1P6BA 2F8QA 4PSRA 3AMDA 4Q8QA 2XVLA 3MSDA 3CQHA 3WNOA 3M7WA 4JIEA 3LTSA 5JH2A 2Z25A 2OPJA 3NOYA 3NSMA 2C0AA 1V6WA 4Z42C 1LLZA 1KKRA 4CQ8A 3EB3A 3UNDA 4PC8A 1KRAC 1QWKA 4AF0A 1EP3A 3VTRA 3WF3A 4PTMA 2XM2A 3G1XA 4JQ3A 5HATA 3IGUA 2BHUA 1OCQA 2HBXA 1E6PA 4BY3A 3W23A 1DTNA 1ICPA 1Z89A 2Q8ZA 2TMDA 4O15A 2QCCA 4HBKA 4MMWA 2A3CA 1VQTA 4ZTXA 3T0AA 3BLOA 1DJGA 1GQJA 4XK2A 3LSCA 1TSIA 4UXDA 3S3GA 1AZ1A 2PDFA 4F48A 1KTNA 5I79A 4ZQMA 5DBUA 2VZSA 3NQDA 5BNKA 2O0TA 1VRDA 4LBSA 2QCMA 1H5VA 1BYCA 1S5WA 1CEOA 3EA2A 3HTWA 4H9ZA 5KMYA 1E3XA 1ZAJA 1OFOA 2FZBA 1YDOA 3FK4A 1V6UA 2FJUB 1O5KA 2H8XA 1FOBA 2YXGA 3BE7A 5C55A 4JFWA 4WHBA 3EGJA 2OLAA 4O53A 1CCWB 4IX0A 2J7DA 2DZXA 1W37A 2Y62A 3CIXA 1AG1O 3U57A 4GQ0A 2NV1A 3N15A 3OJGA 4PB3A 3SCQA 2NQ9A 3W72A 1RHCA 5F2IA 3WQ8A 5BOOA 4MZ1A 1W56A 2VC9A 2C15A 1DOSA 1UOKA 1TTPA 1BKSA 4IZGA 1T0OA 2V67A 4LGXA 3EZ4A 3NM3A 4S3EA 4DX3A 2GQ8A 4ZE5A 2EG7A 3TYZA 4FR6A 4ZBCA 3EB4A 3GDBA 1XLEA 1LUCB 3F4VA 4LV4A 1NWSA 3F5LA 1VF8A 2OWWA 5HK4A 1NF0A 4V2XA 3TA6A 4FOKA 1CB2A 1GYNA 3KBWA 3B8IA 4TVCA 2ZBTA 4XD6A 3S8HA 1JR1A 4M6QA 3ZZ1A 1SFSA 1E6XM 5D05A 5A3HA 1V6TA 1K77A 1M1BA 3PJWA 2DVXA 4FPSA 1WNOA 2HVNA 1TVNA 2PP0A 3P74A 5FF7A 3U2OA 3LXCA 4ZFMA 1YDVA 5DMNA 1R87A 1SSGA 3B8VA 3B0UX 4GYJA 1GUVA 4GGBA 3FYOA 1LBFA 2D73A 2HNEA 3SZ8A 5CZSA 1MWOA 1KBBA 3ARPA 1E0VA 1L6WA 4D71A 2Z24A 2E77A 2E3ZA 1U5HA 1TQXA 2PDIA 3C2EA 3DESA 5D2TA 1HVQA 2PF0A 4NZ1A 1D8WA 1PX8A 1YYAA 3E5BA 3QYSA 4UMAA 4C91A 2Y24A 2E6DA 3RAOA 1GVYA 3W1LA 2VCAA 3AHTA 2PPGA 2A7PA 5CC6A 4DQWA 4N4QA 2ZVIA 5K9XA 2ZDRA 1ZFJA 3IV8A 4H7ZA 1LBMA 4R7JA 4H9UA 2QJGA 4JYFA 4KESA 2YGYA 4KRTA 3MSYA 1R9XA 2WMIA 1TG7A 3GR4A 3MUZ1 2OYLA 3VE7A 4A35A 3GNXA 3QQWA 3UR8A 3CHCA 4LBUA 4HSOA 1JI1A 3QTGA 2EJAA 1RD5A 4URIA 1B54A 5FEXA 4FP1A 5I2UA 3L66A 1RVKA 4OV9A 2GPTA 2OQHA 4NRSA 3LHVA 2W6RA 3VMNA 5M3WA 4F40A 3MKKA 3OBAA 4N0RA 1UIPA 3THUA 4QXIA 1VCGA 2J78A 1NP0A 1A3WA 4H1ZA 4B3LA 2OT1A 1V0MA 5D30A 3SRFA 2WVTA 4LT9A 1PX4A 2ISSA 1FY6A 1UKOA 4LCSA 4GZ7A 3P61A 3MYPA 3FSUA 1J0HA 2QEZA 1C8VA 4PCNA 4YWSA 4BI6A 3RDKA 4PCPA 3UA3A 4ZO8A 3IIZA 3B9EA 4X63A 4HT3A 3PY2A 5E1QA 3UVIA 4DM2A 1QOQA 1W3NA 1R7AA 3L68A 2D20A 4HSHA 1XR2A 3GFZA 2FH8A 2G37A 3O15A 1XIBA 4FK9A 4L9YA 1YX1A 5T26A 1A5CA 2PTYA 2WM0A 2NV9A 3S5OA 2REQA 4RZ6A 3UZJA 4KW2A 1TUFA 1GOOA 2HISA 3UXIA 5K4ZA 2XN1A 4GABA 1PDYA 2QDGA 3BARA 1CZ1A 2OO0A 1XCXA 1HZYA 1EJWC 1L8NA 5HWNA 3HGOA 2CZVA 2VRJA 2J7GA 3TYBA 2OZ8A 2C14A 4CEXC 1PYFA 5EFDA 1W32A 5G1TA 2PTXA 2PZ0A 2HV5A 3KBSA 3TA9A 2VELA 4L4LA 4AD3A 3KRSA 4OUIA 3WLJA 3T0DA 2E8YA 4B5VA 3T4WA 3KAOA 4JTDA 4E4PA 4ZQPA 3TOYA 2IXUA 2ICSA 3GH4A 4LNCA 3WQCA 3VINA 5TBOA 1EZ2A 1XLLA 5BMXA 4FOJA 1EWDA 3HGRA 4UQBA 4Z0SA 1UD6A 3DCPA 5C8BB 1QWGA 3A3XA 2IKGA 4JTTA 3Q67A 4UFMA 1LLWA 1WPCA 2ZZ5A 1RCOB 1XGDA 4B9YA 2VFFA 5U4NA 1ADDA 4DWSA 1C90A 4P7OA 3CUZA 4JKMA 3BCDA 1ISVA 2YCIX 3GVRA 2G50A 3MU7A 1OJXA 4HMDA 3SN0A 2Z0IA 2YL5A 1XH0A 2V3DA 3PZIA 3DI1A 4WY0A 1KB3A 1MUCA 4GO9A 3OG3A 2PDCA 1TRIA 3QV9A 3VGGA 1OCNA 4KIRA 4AIUA 1TCMA 3N6JA 5FF3A 2WNNA 2I5IA 4N6FA 1A5OC 2YBVA 4JTAA 2AL2A 2JKPA 1HKVA 2ABAA 3HO8A 5C7VA 3UR7A 2Z7GA 1NY1A 2XVPA 3W7RA 3CWHA 2CLFA 1VPYA 3LRKA 4H19A 2VDIA 3GBEA 4GX9A 3UG3A 3VC6A 3IWPA 3NXFA 4JZ5A 1VBRA 3K2GA 4HZ7A 1JGMA 3UZWA 1OINA 3ECQA 2OWXA 3MV01 1H2JA 1AH0A 3TLQA 4K37A 1IGSA 4EKJA 5BYWA 2VEGA 3CO8A 2WVSA 4MFEA 1YXCA 1MRAA 4O54A 2ZTKA 3M0IA 1DWHM 1S2UA 1AQMA 1IR1A 4ZFCA 3QKZA 1ONEA 1B3YA 5BRBA 2ZUSA 1ONXA 2V5DA 2GSHA 3CV2A 4PR4A 4V1XA 1HKIA 3RPMA 4A4AA 3WQPA 5DT7A 3LBOA 4JTSA 3LM3A 5J8LA 1GOMA 1C92A 4RR4A 5FJUA 2DY3A 3UR5A 1T8QA 4AY7A 4HNOA 5LA1A 5CKSA 2BG5A 3BL3A 3VIOA 3BO9A 4LRTA 1H09A 1ZJIA 4Y9AA 1I0BA 2CHOA 4J3TA 3WDRA 4XZIA 3VABA 2Y63A 4BWLC 1I45A 5LXXA 2FGZA 4K1WA 1ZY9A 4JCLA 1TE1A 3U8GA 3LD5A 2EPNA 3E0WA 3QC0A 4FNRA 1LL6A 2HRWA 1KR1A 4ICNA 3WF2A 3DFHA 4WRHA 2WVVB 3MYOA 3BJFA 3SCVA 3B8SA 5H91A 1KWGA 3PWGA 3TR9A 4JTCA 3OBEA 3KLLA 3S1WA 1BKHA 5FOOA 1XS2A 2VOTA 4AZIA 4GI4A 1CLVA 1OFQA 2JIWA 2Z2UA 3WJZA 4M6VA 3DGRA 1OX5A 3WMLA 3I10A 2VR4A 2E4TA 1G4TA 3L12A 3VGHA 3JU2A 4JX6A 1QJWA 1FHVA 5CPSA 1XBYA 3CEUA 1L6FA 3G1HA 4JN6A 4RE4A 4DJFD 1YTDA 2IPFA 2QF7A 3ORWA 1S2AA 3T81A 4O13A 3S5SA 4JDBA 1DQWA 4O1AA 2QDEA 3IJ7A 3GVVA 1Q6FA 4KQNA 4PUKA 2X1TA 4GCXA 4WXZA 4UFLA 4DO7A 3LCIA 4H8NA 1PZ0A 3ZT7A 2Y5JA 3M1ZA 3RJXA 3WLLA 1JZ3A 1Q7MA 1ZBCA 2XVNA 1Y5VA 2FFCA 5KZEA 2JE8A 4AZ6A 5HUPA 4K8EA 2XSBA 1LG2A 2ZOXA 1LWIA 1GZJA 2WSPA 1WZAA 3HG5A 3GVWA 3MCNA 4JNYA 1XPGA 2CITA 3HQOA 4Z1CA 3XINA 2ZA1A 1XYLA 3MWCA 2ZXDA 4O8AA 4I9JA 4ZVJA 4BQ5A 1LWHA 1SR0A 1YPXA 4QGCA 4WEVX 5HQMA 3AFBA 4US5D 2R1LA 3W74A 3D3FA 3HJZA 2OFJA 3SB0A 4XIMA 4AEEA 4PRTA 2C18A 1UMYA 1WDSA 3BG5A 4NF7A 3OVGA 4IIDA 1HXJA 1HGYA 2FVLA 4PUJA 3T8QA 1NQKA 3W7PA 2V81A 4GYKA 2PDXA 5HXMA 1I1XA 4C6CA 2NQLA 2HK1A 3WMBA 1XSKA 3U0HA 3E49A 3CS2A 3O7UA 3OQEA 5AN7A 3NDZA 1CXIA 1HO4A 1TV8A 1JF6A 1Y5XA 4UTIA 3MJMA 4AD2A 2YL9A 4GNKB 4LS0A 3L23A 1V7AA 3BOXA 3SBFA 1E72M 4ZOCA 4C1KA 1ESWA 2FHBA 1EEXA 1RCQA 3GS6A 4IIEA 2WMJA 3S42A 3CAQA 5I3FA 4H6KA 2ZZ3A 3VFCA 1IZCA 5CZJA 2UWFA 3L5LA 2PUZA 3AHXA 3N13A 2BOEX 2PD9A 1XWYA 4D1JA 3VDBA 5HMSA 3S9YA 1EPVA 3TYDA 3UXLA 4ZB5A 4XZMX 1RP9A 3P6LA 1W54A 1QNQA 4LQ1A 3KOZA 1QOPA 4CGTA 4UFIA 3AS0A 4XAYA 4U2ZA 5B7YA 2DGAA 3S2LA 4EPKA 4PL1A 5AZ1A 4ADSA 3CQIA 4MJ4A 1UH2A 3ZR4A 2E68A 4HJFA 4O0KA 3LZ3A 5AYBA 2H8ZA 3ITLA 1MQPA 4DBWA 1XYCA 1BYDA 3B04A 4NJIA 3UWWA 4Q7BA 5BWAA 3LN3A 3QGVA 4J2PA 1HGWA 3VOJA 4U28A 2QV4A 3M0LA 4GVGA 2ZX5A 3L9CA 1QW8A 3R0UA 4IPJA 4AAJA 3CT7A 5F2LA 5CG7A 1XG3A 5DT5A 1XYBA 2J8TA 4CNNA 3ZJ7A 3REQA 1NFBA 1SZNA 3GW3A 1N2VA 2R6OA 5DCBA 3ZM8A 2RKXA 3B8WA 2VZVA 1E0WA 3CUHA 3DDMA 4QJ5B 3VKJA 1MW2A 3VMOA 3PF3A 2WSQA 3EPOA 3KZPA 1K7FA 3QGAC 5CC3A 3LHYA 2BWGA 3MP5A 3FGCA 2CERA 4WCJA 3RCNA 1W3HA 1ECEA 4MWAD 1O95A 2E25A 1F76A 3LHTA 2JFEX 3B97A 2PF8A 3QC3A 3W86A 1UKQA 5DFAA 4ACYA 4GVFA 4MFDA 1O68A 2A3EA 4O12A 1XLMA 2OEJA 1E43A 5K4XA 4QDMA 4UQEA 4GI8A 3S9ZA 1Q5MA 1FWEC 1HQTA 4S39A 1Z6KA 2PLMA 2ZKMX 4HCHA 4RL3A 4EF9A 2CZDA 2HVMA 3MSGA 3QR0A 3GYCA 1AJ0A 5KSWA 1ODZA 2Y70A 1V0KA 2OOGA 6PTDA 2DFAA 1HO1A 3G1FA 5DO8A 4QS6A 1VCVA 4TXEA 1CGUA 1VKFA 2HPMA 4IMAA 3AXIA 3FA3A 4IIGA 1WA3A 3VNDA 1KQYA 3BGJA 3NQGA 3ZLGA 2SFPA 3A47A 1MUWA 3QZ6A 5CBBA 3LRMA 4R9OA 2RAGA 4HTYA 3SJNA 3RYSA 4C90A 3V1PA 1QUMA 1EDQA 3S2MA 2WNWA 1CI1A 1HX0A 3ELFA 3R4IA 3ZSTA 1IQ8A 1PCKA 3F4NA 3WF4A 2HSAA 1FWTA 1UWIA 4E4FA 4BQ2A 2OZ0A 4Y8FA 4IQLA 4H04A 4S38A 3VOCA 2I5GA 3BJSA 3C4UA 1IXPA 2V2DA 3GXMA 1HP4A 4PA8A 1K8ZA 1V02A 2E9BA 3QN3A 2VX6A 4ICMA 1HJUA 1X38A 1YMYA 3ZMRA 1PBGA 2V69A 1E56A 3NZRA 1MFUA 1HVXA 3QV8A 4Q4KA 1TUXA 2VQUA 4LC6A 3NA8A 1BFNA 2GQ9A 4QEEA 4UMCA 2E9MA 3W70A 1KXTA 3O9NA 3ZIZA 1UA7A 1QNRA 3WN6A 3PAOA 3V5CA 4PGLA 5LSMA 2HPIA 1D7KA 3GTHA 4J5NA 4KBXA 2EBNA 3SCNA 4ALDA 1A49A 9XIAA 2V5LA 1S3TC 4DLFA 2BVYA 1OK6A 2ZRWA 2J7CA 4K39A 2ABBA 5CJ5A 4ACZB 3TJ4A 1UWRA 4HP5A 5MHBA 4JICA 2QVHA 3FA5A 1Q6GA 1WDQA 3WL1A 3CJPA 4CNOA 4MWAB 3HPFA 1TPFA 1DJQA 1R2TA 4EPDC 1JDDA 4HTBA 2PCQA 2OVLA 2A4AA 4V1YA 2FTYA 4RV3A 4YYFA 3H4WA 3LSBA 3CV6A 3U9IA 3H53A 3TTOA 4F2BA 1KFJA 2XFRA 2Z27A 3TK7A 3HMCA 2Q8LA 4HPHA 3S1VA 3QY7A 1ZP4A 1KCXA 3BLPX 3WD0A 1NM9A 3WL0A 3AU6A 5C2CA 1QI0A 4XAFA 4F9DA 3I6TA 4KMQA 3OVQA 5K2ZA 1G4PA 5CPNA 1F05A 4PTVA 3TMLA 3N17A 4ZB0A 1OIMA 4L1GA 5LNVA 3VX0A 4O8RA 2KZHA 3B40A 2X7WA 2XIBA 1F8IA 3WK1A 1UKPA 5FEZA 2QAPA 1H51A 3KBJA 3ISIX 2F6UA 2OWCA 4W8BA 1TJRA 4B92A 1OF6A 1P6WA 5H8UA 3NPWA 3LPPA 3CAWA 1JPHA 4GRSA 3UEQA 2FTWA 1X1NA 1CT5A 1TPH1 7XIMA 1WXYA 4FLOA 1TCDA 1H7NA 4K68A 3WELA 3W7QA 1M7JA 3IAPA 4LCRA 1BWVA 1RBLA 2EKCA 3UW6A 1EJUC 5ECVA 3LMZA 3PPHA 2ALRA 3VZYA 1MW1A 4NIRA 1HL8A 1LRTA 1KM0A 3M0HA 1XGEA 3KVJA 2NUXA 4B2DD 1JYVA 4FHAA 1NQ6A 1TR1A 1E4MM 4KRZA 2PU1A 3WIJA 3AHYA 3BVJA 5DMLA 1E1EA 4B5UA 3OA5A 5K7JA 2Q01A 3BUVA 1TMHA 4EXBA 3OIXA 1OB0A 1H7OA 2RFGA 3B0YA 1M68A 1VYPX 2X40A 2GK1A 3L2LA 1F4HA 3P0WA 3LY0A 2QCDA 4Q6XA 1CECA 2W62A 3O06A 2VEKA 3S9IA 4ZGYA 6REQB 5LIKX 1BF2A 3C0QA 3ZLFA 4ML9A 3UJSA 1R3TA 4B5XA 4XQ6A 3W6MA 3ARUA 3OVRA 2H3DA 4AY8A 4KH2A 4MNKA 3M07A 4MHBA 3W82A 2WJDA 2W67A 2XM1A 2FH6A 1EB3A 1B1YA 3M43A 3S47A 2V3FA 1XRFA 1FA2A 1VFHA 4XAZA 1FWBC 3SY5A 2YW4A 3CO4A 1QTWA 2OX4A 1VEPA 2OZTA 3AC0A 5IFPA 5AY7A 2BVTA 3TNBA 1R0MA 2P0OA 3HOJA 1SJCA 1US0A 4DYEA 4D6GA 2HK0A 3SUVA 3FW6A 2BMBA 2DSWA 1UZDA 3QSTA 1PJ9A 2XZ7A 4PEKA 4RV8A 5AC7A 1B4EA 1BG4A 4ZR8A 4US5A 3ALFA 5FEWA 3UYIA 1V7YA 4KFOA 5AVNA 3WYZA 1E6NA 3C0LA 3BV4A 5JUVA 3NG3A 4E8CA 2VZOA 3EXSA 3ERPA 4TVUA 1VJSA 3VI2A 4C6FA 2Y7EA 4DJED 5J04A 1TZ9A 3FAXA 3HPXA 2DJLA 5T9BG 3VD3A 3AQUA 1PYMA 2NV2A 4K1GA 2DZBA 4GIYA 2GUBA 1JZ7A 1UP3A 2PWUA 2YA2A 3K5XA 1UC5A 5J5DA 1MMFA 2P8BA 3P14A 4N9DA 5D02A 4FIRA 3F4CA 3TV8A 3T7VA 2F9RA 2XH0A 1IWPA 2ACUA 2D2JA 4ERIA 4O50A 1HL2A 1W5PA 1GGOA 3W7CA 4S2BA 3WBYA 4WXYA 1SO6A 3LPGA 4OT7A 1R3WA 1SJAA 2HWGA 3BOFA 1WXZA 5I3HA 4M6UA 4U3AA 5M1TA 2WHKA 1HN1A 2E8ZA 1F73A 4GQQA 4KWOA 3VVGA 2Y8UA 2BLEA 5GJNA 4C6MA 4UMBA 1ALDA 3ABRA 3H6OA 1TVLA 2PRLA 2D2GA 3UY8A 5C5YA 4I5UA 4PBFA 4L6DA 1DE6A 1EUNA 2JIEA 3GTNA 3CTLA 4E6MA 3WDJA 4PE8A 2QCGA 4K3ZA 3EBVA 3PM6A 5I3JA 1UUMA 3KVLA 1JNEA 1EUAA 1E6ZA 3EX6A 5HQLA 3WJXA 5A95A 3MVIA 3EMCA 4WY0F 3R6IA 1QI4A 3F03K 1JAKA 3CPUA 1YADA 5A5WA 3A23A 2YCKX 2O92A 3WQFA 4D6EA 3CZKA 1EO5A 2DZSA 3K4DA 3L5MA 4LUIA 1YLVA 3O16A 2Y7GA 3R0KA 3KHDA 4HHHA 3WNKA 1W9DM 1XV8A 4W86A 4IUGA 3UERA 3GIPA 1ZQ5A 4EPEC 3OBKA 1NEYA 3CUXA 3VKAA 4NX5A 3VX1A 3XIMA 1SR9A 2QYGA 5KEZA 2JBMA 3W2UA 1JDFA 4Q33A 4AWUA 1R2SA 1BLIA 3SCPA 1GYMA 4Z2GA 1LZOA 3PFRA 4OOUA 1KLZA 1OM0A 3EWUA 3QV7A 3NOEA 3GXDA 1FWDC 4LV9A 3CMGA 3KOYA 3ZYZA 2QVNA 1KFCA 3H7RA 3M0VA 4DJDC 2VFDA 4AWTA 2XIJA 1FDJA 4TMBA 4LAMA 4MDOA 1PZ3A 3N04A 1SO3A 2EPLX 3VOHA 4LRSA 3TQVA 3FN9A 3T05A 4H8HA 3K4WA 4S3GA 4TV5A 1UZ1A 1OC6A 1IXOA 4G56A 2E40A 1HJSA 3SCSA 4AD4A 1D9EA 3UCDA 4AFYA 3MUAA 2A1YA 3VIIA 1DXIA 1W0MA 4L4OA 1Z69A 1XP3A 2RHGA 4LUYA 4Q8UA 1R3RA 3LNPA 1F3WA 1Y5WA 3QJAA 2ZTJA 5CLTA 2W0UA 3GZ3A 2A3BA 3WLNA 1NOWA 2WQPA 4DYJA 5F1VA 3ARQA 3W01A 1DEDA 1YQ2A 3S5NA 1W6TA 4W4QA 3W24A 4A3YA 2NT1A 2IQ0A 2YA1A 3WLTA 1QI3A 4HMNA 3SAZA 4H8UA 3PZMA 3WQ6A 1QXLA 2VOMA 1GOKA 4KEMA 3N18A 1VEOA 3N6QA 2XYLA 1Q63A 2P10A 1A5UA 4UFKA 2PWEA 5BU9A 2PA6A 4NG3A 3L0NA 3PTKA 4PMOA 3R89A 4XBSA 2GLKA 4DAIA 4HMEA 3LGDA 1E6RA 3UFYA 2PTDA 2PLKA 2V5KA 2CXEA 4W88A 4RZBA 1I2OA 4PUDA 2CW6A 5A6TC 3M0MA 4CNSA 2G3NA 2DZVA 5AC8A 1LQ2A 3TOPA 5D9MA 5LIUX 4FEZA 4IPPA 3PUOA 4PMQA 1VBHA 4PRWA 4Q4SA 2CIPA 3G2GA 4L56A 3VIMA 4QBXA 4GI6A 4WJ8A 4LUSB 1DJXA 1JCNA 3DBPA 2V5JA 4NYYA 7TIMA 1OK4A 5D32A 1NTHA 1XLHA 1TJ2A 1PWLA 5E5CA 3FLUA 3JZUA 3UVAA 3FVMA 4LF2A 4DM1A 3B03A 5FSEC 3J7HA 2WANA 2GJPA 3ARRA 5ABFB 1KM2A 1S2TA 5H6HA 2ACSA 3PNUA 3AXHA 5BMWA 4ZOBA 4PUMA 2P5NA 4A8NA 1BEUA 4WDXA 3HPZA 4C6BA 5D9NA 2GJRA 4P7NA 3GXNA 2RDTA 4QE5A 1ZBWA 1OFPA 5E0FA 2O7SA 2BGQA 1JQXA 2CLPA 3GK0A 3HA1A 3P2VA 4KWVA 3KX6A 3UU0A 1GVFA 5BRQA 1FP8A 3W02A 1JG9A 1BWLA 2XN2A 1R3VA 3OP2A 3B4UA 5D04C 1J5TA 1EIBA 1W1TA 3MA8A 1YTEA 4L1WA 4BFAA 1SFLA 1XLDA 1NWRA 4XZWA 3BLEA 1JUKA 2F6XA 5E6YA 3ZR6A 1A5BA 5D8WA 3E2VA 3WK3A 2INEA 5DN1A 2VC6A 3AUOA 4MYAA 3IAQA 4XG1A 2FZ9A 1N82A 4B4FA 3N2TA 3O0KA 1E1CA 1KGWA 3RK8A 3U5UA 1Q7QA 1CYGA 3FDGA 3RR1A 4E2VA 5CAHA 5GVJA 2OSXA 4GUIA 3CL6A 4MIMA 1R8LA 3BG9A 2Z7KA 2B31A 3M64A 4PTNA 1JPDX 3FHAA 1TELA 1QHOA 5AHLA 3DOPA 4TX6A 2ZZ6A 4TX8A 2WMKA 4L4MA 3TROA 2POZA 1N8IA 2WHLA 1CIUA 2ISFA 2PP3A 3CTTA 4M6PA 3WO8A 1QFEA 3VYLA 3GWQA 4TU1A 4H9MA 5A2CA 3BH4A 4MWAE 4JTUA 4PRRA 3FAWA 2BV9A 4C7GA 3FY1A 2YJQA 4GH1A 5C70A 3IIXA 4XKMA 2O9RA 3TW6A 1M7PA 3C56A 3WH5A 2ZX9A 4NP7A 1W5MA 2P3ZA 3CT2A 1GEHA 1FH8A 4F66A 2WWDA 3NL3A 4NILA 1E0UA 4H2HA 3RRAA 3CWNA 5G4HC 2Z2AA 1I2NA 4G2DA 4DIAA 1X1ZA 5M5DA 1XLIA 4HQVA 2W61A 5DY3A 1HW6A 3WQDA 5CGQA 3VFLA 4NNBA 1I9CB 3F5JA 3TDFA 1GTEA 5GJPA 3VOFA 4BZYA 1ML1A 3ITGA 1C3FA 1Q2RA 1ZJBA 4L65A 2BNJA 1TRDA 4C6NA 1GG0A 5G2IA 3BANA 1K6AA 4JY8A 3PBMA 3W3OA 3L21A 2VVSA 4C1NA 1UOZA 4H2CA 4KRUA 4X2RA 1GOXA 5EGRA 3OZPA 1QNPA 2JGQA 1XFBA 4TQTA 2BOFX 3GBDA 4A3HA 4OJYA 1NDVA 1RP8A 4MOZA 2NXHA 4CU8A 4HOZA 4CQBA 1FHDA 3M4HA 3FNDA 4U5KA 1D3CA 2BHZA 2GDUA 3R5EA 1RH9A 3SW6A 1W1VA 2E6AA 2V0TA 3LB0A 3FXGA 5TF0A 3EDEA 4FXJA 5AVHA 4QG9A 2BVWA 4YJ5A 1UBSA 3TN6A 1ZB5A 1I2QA 1ONRA 4PL2A 1IEVA 4X2PA 4O57A 3R8HA 3G1DA 1F7BA 4MNMA 4CD4A 5HOSA 1XLKA 3UZ5A 4W7WA 5I09A 3PWIA 2BDQA 1K8XA 1FXPA 2ZIDA 2I5QA 1HJQA 1V3LA 5LKYA 2G0WA 2PGRA 4GJIA 3WFLA 3AYVA 1KRMA 1TPWA 1EP2A 1LRNA 2BX7A 4GJJA 3TH6A 3LXAA 3SUUA 3P5ZA 4D6DA 3F7JA 1SUXA 1IEQA 3RM4A 2QUNA 2CEQA 3VDCA 3EWCA 1T8XA 1ZHAA 1KFLA 1UR0A 4DO4A 4AIOA 3H22A 1JGIA 1J12A 3G8RA 1P0NA 2DIEA 3ARSA 3RMJA 3E0FA 5I03A 2RDXA 1NDYA 3M0XA 2PDPA 1XIEA 3LQGA 4XB3A 3LCGA 4QJ1A 1FDZA 1OQFA 5AHFA 3LRLA 2O9PA 2RJGA 4MAZA 4W7UA 3GR8A 4AEOA 4OUEA 2B81A 4UR7A 8XIAA 4LVGA 4GNJA 4UFHA 3WEOA 4R34A 5A8NA 1KV5A 4RJEA 2Y8KA 3STFA 2DH3A 3ZQ9A 3VGEA 3MANA 1M01A 3ALGA 3APGA 3R12A 3IJQA 2WKGA 1GKRA 5LNRA 4NAFB 3LI0A 2I56A 3IRDA 4PMXA 3UWVA 2ZX6A 4LPCA 2CLHA 3NQ8A 4Y9MA 4EX4A 4F8XA 2CNCA 2J8GA 4YWIA 3I6EA 1TYGA 1TVPA 4CD8A 1B5TA 1UPMB 4NI3A 2W9MA 3S1XA 4N4PA 4U2YA 4B3KA 4FALA 5JMUA 3KL3A 1GTHA 2R94A 4PMYA 3TR2A 1T7LA 1B4KA 3VPLA 1LOQA 4M29A 3QXBA 2ZZ4A 4QDWA 3GHSA 2NX9A 1MZRA 2WKLA 3FJNA 3TWAA 1YPFA 5IDZA 3RLHA 3TJLA 4M51A 4KEZA 4E3VA 1CXFA 4Z17A 1ZTVA 2ISVA 2B4GA 2JEPA 3PK7A 1MXGA 3OODA 3GFYA 5ABFA 4G1NA 2WCAA 1OC7A 3S2NA 1EBHA 2E09A 1XL9A 4WJXA 3G8EA 4HIBA 3H2FA 1XPYA 4DO6A 3I4EA 3OYXA 1G0CA 3G0XA 4DZIA 2GWNA 3PFMA 3ZJ6A 4AVFA 1O94A 1Q6LA 1B3OA 1FKWA 4YHGA 4KT2A 4LUTB 4QQUA 2BVDA 3V5OA 4H8VA 4M5PA 2CPUA 4WF7A 1OG6A 2QR6A 1IHIA 3TYCA 5I3IA 1B57A 1PKMA 3M5VA 2VYOA 4I3GA 2FHFA 3B0XA 2GJXB 3M0ZA 4RE3A 4FNQA 1TIMA 5BRPA 2VT0A 2ZRVA 1QPRA 1CXEA 2O4MA 3O0FA 2Y8VA 5I07A 3SUWA 4UC5A 3SJ3A 1HUVA 1UP0A 2C6QA 4N9EA 1J5SA 3ITYA 3UWZA 4C6OA 3EDFA 4C6JA 4BQ4A 1DJYA 3DENA 1GVRA 3KTCA 3OHMB 1H61A 4XKYA 2D0HA 1KBLA 2XIQA 1IZJA 2HROA 2W4XA 2OSYA 4UQDA 5CCZA 5C2XA 2PDQA 4XO6A 3TAOA 3O6YX 3AIBA 4XD4A 1EKOA 7CGTA 3IIPA 5U7SA 2QPSA 1OFAA 3MCMA 2VM8A 4LH8A 4FNTA 1ZUAX 3VNMA 1ECQA 3KW3A 1E1FA 4BF9A 1ZLPA 3LX9A 4TVDA 4IPIA 4UNKA 4KCUA 3RN6A 2VDHA 2OO6A 4E38A 3KOXA 3UJ2A 2XDFA 2X42A 3SURA 1LROA 2GWGA 5CSRA 4QG8A 1GEQA 3LUTA 4CU7A 3WUEA 2PGWA 2J88A 3RR4A 2CFFA 1KO0A 3GH5A 4A2RA 1I0DA 2YA0A 2CWXA 3MTWA 3ATYA 3VNKA 3ABSA 3WSUA 4GOAA 2R14A 2J77A 3LK6A 3MS8A 2AQWA 1JZ4A 1ME9A 1Q6RA 1IIHA 2TYSA 4RNIA 1XQKA 4HK7A 4MNLA 3W84A 5LA2A 1XYMA 3SR7A 5ENLA 2DZAA 3AAMA 3SIMA 4JX5A 4GY1A 4DZ5A 4RE0A 5FL0A 1D2KA 4CCEA 3ZXWA 4H6EA 3W1QA 5FJOA 3EPMA 1Q6OA 3QQ0A 1ADOA 3AIRA 3NGJA 1VPQA 1C9DA 1XLJA 4GUHA 1MYRA 3B06A 1REQA 3WH7A 1JYXA 1MQRA 4UTTC 3VNLA 1J0IA 3QM3A 5DANA 2NVAA 1UWUA 5ABHA 4RX0A 1XBZA 3CHFA 4ZOAA 1DJHA 1MVYA 4P61A 2GVEA 3W7NA 4D9PA 1FWCC 1X6NA 3Q45A 2CZFA 1S2CA 4QJ4B 2J47A 1TX2A 4GIEA 3PWAA 3T09A 3VAVA 2DT2A 1A80A 3EAUA 4OTKA 4E8DA 4WOQA 3THAA 3HV9A 2YSWA 3W7IA 1VENA 3HB9A 2I9EA 3W9ZA 5LNUA 5AKQA 2FHCA 1RXOB 3BPWA 4FO4A 2D23A 4LY4A 3SUTA 2NXGA 1F8MA 1QCWA 3WFZA 3S1UA 4F0KA 9RUBA 2NWSA 2YYTA 4FZIA 3PVFA 1BG9A 1JXJA 2NWRA 4IMFA 1KXQA 4GE8A 3IPWA 1PKYA 5I0DA 2C8NA 3D47A 2W66A 3S5ZA 5A8GA 4MJZA 5BCAA 2NX3A 4H7CA 5AZ0A 1V5XA 2W5FA 1EC7A 1PHQA 1S2WA 1QR7A 4U10A 3MO7A 1FCUA 4MZ8A 1AW2A 3AMGA 3GHTA 1WCGA 1M65A 5ABTA 2X1RA 1OT1A 3E12A 3DYOA 1B2YA 4W5UA 4Y90A 4IFKB 5G4EA 2BY3A 1VZWA 2IUZA 1V08A 2ZRXA 4DNMA 3BAIA 1K6WA 1UH3A 1F6KA 1BXNA 5FAGA 3W28A 3N34A 1LYXA 1MO0A 3VK5A 5DRCA 3LHUA 1V8EA 5BXPA 1Q6EA 2Z26A 4TIMA 4PBEA 3DEQA 5FJPA 3TCEA 4YU1A 3ANUA 4J2MA 3WK2A 2C1IA 1F9CA 3ANVA 1GQIA 4XX6A 3CZLA 3UQNA 3CUIA 1SO5A 4DF1A 4AF0B 2FPTA 3V5FA 4HD5A 3CMFA 3T1GA 3RFAA 1BQCA 3VM5A 3WJSA 3WEMA 1WO2A 3SO7A 3I68A 2BB0A 5HMDA 2BODX 4R3UA 4LX4A 3RU6A 3NPXA 4PMVA 1V4YA 4DXKA 5M2FX 4KFNA 3L2IA 1JQVA 3WLSA 3GAKA 4UTFA 4A29A 1BVWA 1H62A 3NNTA 1ISZA 1EHAA 4F0MA 3WMCA 2D24A 4GXMA 2AKZA 1TV4A 3L4YA 4CNTA 1LOLA 1WKEA 3HF3A 1ZS2A 1QI2A 2XVGA 4E2DA 4HU4A 2PU0A 4B4HA 3CASA 2C13A 1M9HA 1HT6A 2B7QA 2GJLA 4X9YA 4GY7A 1EH9A 4PMDA 1UBPC 3KZSA 2PGEA 3I7QA 1RQHA 4KCWA 3LS9A 3LCHA 5T91A 2R9RA 3M44A 4CNUA 3AOFA 3KCLA 3U2ZA 3GDKA 3LU2A 1J18A 1U22A 1GPFA 4BA0A 4XTIA 1RD6A 3TIMA 2WMHA 4IP5A 2X1UA 4EXQA 5F4WA 3PZQA 4WUIA 2I9UA 2YLLA 2WSKA 1XRVA 4MKSA 1NDZA 4A22A 1X7FA 3EOOA 3CL8A 3W27A 4YCPA 4LVBA 3E9AA 4WSJA 4L5ZA 4XAPA 4MGGA 1H7PA 2GOUA 4ZQCA 3L67A 5CQ1A 3H2NA 1JPIA 1GJWA 3UG8A 1U5JA 2QCLA 3RHGA 3AISA 4IMDA 2XIOA 2VWTA 4ZSUA 1S1RA 4K6AA 2C79A 4BEQA 4EF8A 4WDTA 4JDYA 4WSHA 2VEPA 1WB0A 4LAKA 2CZ5A 4NJJA 3F1QA 1A4LA 2P50A 3NQVA 2WV8A 3LA4A 2DORA 4D2JA 4MTVA 3PN8A 4QG6A 3TWBA 2CLEA 4Q8PA 3CL7A 4LUJA 4NZFA 2ACRA 3E2SA 3SUSA 3TXZA 1JZ8A 1NVMA 4AHOA 3G77A 3PZ9A 1Q85A 1FH7A 5HBFA 5A6KA 4UUIA 4IQJA 1VYSX 2TAAA 3W85A 3ONCA 4AIBA 1M3UA 4Z0JA 2CLLA 1E70M 1JCJA 2UY4A 1SFTA 4IM4A 1A0CA 1AQ0A 3MHGA 2PS2A 2E7FA 2CKSA 3T8LA 2RGMA 3OW1A 2UY2A 1FHUA 4M8UA 4UNIA 4IJCA 1CGVA 3V4BA 5HULA 2DSZA 4RZ5A 3FEMA 4JFTA 4ICCX 3QKEA 1VFLA 1AH3A 2O9OA 4ZXLA 2ZX7A 3KXQA 1FHLA 4CD5A 1O12A 2HZGA 1TPC1 3WKZA 1QOXA 1GQNA 4NY2A 3NQ6A 2WMIB 1UD4A 3SGZA 3SFKA 5I06A 1KBIA 3PZNA 4OBSA 2ANUA 1DXEA 3B4YA 3LGGA 2Z1VA 4DXVA 5H8PA 3FHQA 1NFGA 3OPSA 4J3WA 1OX4A 3BG3A 5FKYA 1BSIA 6ENLA 4QROA 1XX1A 5E93A 4X0VA 4JTIA 2YB4A 2QULA 2VFEA 3LPOA 3PB0A 3TW9A 4PUEA 4P7LA 5EPDA 5JU6A 2MUCA 4PB4A 3UZXA 1UZHA 3OLIA 1IV8A 3QH2A 4HHLA 1FWJC 4IG2A 3LV6A 4CCDA 2XWEA 3EPNA 3EX2A 2W92A 1FWIC 3PAJA 1EBGA 4QNEA 2ZRYA 4GA8A 3Q65A 5C9UA 1ZGDA 1TQJA 4R5EA 1MRQA 5JBEA 5M17A 1KFEA 2BSLA 1PPIA 4RK8A 5DLCA 2Y1HA 1N8WA 1F4AA 4UOQA 4XBKA 4ADUA 4BR1A 3KBMA 3BSHA 3BXWA 4DF0A 1KM5A 1X97A 1ME8A 3ARTA 4KWUA 3KCJA 3RPTA 3CHEA 4CQDA 2REQB 3DFQA 3GLCA 4DBEA 4PULA 1DE5A 2XFYA 3PZGA 4UTLA 3WQGA 2GVJA 1X39A 5D38A 3QVQA 1Q7ZA 4LJ3A 3LCFA 4UBPC 1FWAC 2D2HA 1KC7A 1RV8A 3AJXA 2PP1A 4O28A 2WMFA 3MVTA 2YDQA 1DORA 3HZ3A 1EIXA 4NXSA 5G2WA 3RG6A 4HU3A 1DP0A 4GIAA 2ZZ7A 2JKEA 4GLEA 1G4SA 3N2OA 3P84A 1LJYA 4KGJA 3CGTA 5J5RA 5JIPA 3VZZA 1UIOA 1W3KA 3AXXA 3OTRA 5A6AA 3R7MA 3LDVA 3A9BA 3SSZA 3VIHA 3W1MA 1F74A 1IGWA 5FAJA 1CLXA 2Z4GA 4FS9A 1YNQA 3QOKA 1EJRC 1ITCA 9XIMA 4LAUA 3CZGA 1PZ2A 3OZMA 1YDNA 4DY1A 4D8AA 1T40A 4JX4A 3R2GA 3VOGA 3V75A 3LLDA 1F6YA 5A6BD 1TPEA 2VP8A 2V5CA 3WBXA 2HDJA 3UR2A 4DWSB 3EWXA 1IXNA 2VUNA 4EAYA 5FCZA 2XINA 1OIFA 4BI7A 3BSGA 3OZOA 4Z1YA 4X0NA 2WHJA 3W7DA 4QAIA 4G7FA 3ZWSA 4DF2A 1XLAA 4HCLA 1LTDA 1GVOA 1ZBVA 1DPMA 2ZVRA 3CH9A 4V15A 3GTXA 1ZCCA 4WY0B 3A4WA 1S5NA 4W87A 5DRIA 3PG9A 3M9YA 3H7VA 4QLKA 1LORA 1XYAA 2DSUA 1Z32X 3OB8A 4HCDA 2GSJA 2WAGA 4JTFA 1H7RA 2AL2B 3SCUA 5CJMA 2J79A 5CSSA 1NF7A 1GYLA 2H6RA 5FF2A 4TTUA 3VD7A 3C2FA 3BGAA 2X41A 3K46A 1Q6QA 4IIBA 1XRTA 3TLLA 5AYYA 4NZCA 4UIOA 1NOFA 3ARWA 1M7XA 1CWYA 4O11A 2YDSA 2R1KA 3M0JA 3URAA 5D9PA 1BWKA 2RH9A 4QTGA 2YOCA 2NSOA 3N2XA 5EMJA 2B7OA 4JNMA 1UR8A 3UG4A 1PUDA 3W7KA 2E0PA 2EPOA 3QRHA 1AODA 5D03A 3GUGA 4GXWA 3O3RA 2LLEA 4HNTA 1QASA 1K9DA 4EP8C 3HU7A 4JTLA 1R85A 4MY1A 2HXUA 1BVNP 1SQ7A 4RXFA 1RJPA 1RLDA 3ITOA 1HKMA 2V63A 1AW1A 3PNZA 3H24A 3AMCA 1G9HA 1W3TA 3IVUA 3VDGA 4QLLA 1KD0A 4QS5A 2GUYA 2GYIA 1JNDA 3GNRA 4J27A 1Y8BA 3WQ5A 1JXKA 4O0ZA 1P48A 1O1HA 1PVNA 2GSEA 1CENA 3IK4A 4ZL1A 1W9PA 1B3WA 3DYPA 1OCBA 2YL6A 3FKKA 4X60A 3I7RA 5F7UA 2E6FA 3HGJA 4X9SA 3F2DA 2QJMA 4NXKA 3AMLA 5DXXA 2X2GA 2GDQA 4JN8A 4AVNA 3LEPA 3RPDA 4H41A 1XQLA 1H49A 3AZRA 5EA9A 3TXVA 4UNLA 3WY1A 1EGZA 1EL3A 1J96A 1B9ZA 1H5YA 4BQ3A 2BOGX 4H9TA 5BW6A 3EWDA 1O60A 2PDGA 4R88A 4D6FA 3FFSA 1EJXC 2JF7A 1DL3A 1VBGA 5JXQA 2Z6IA 1RJQA 1OZMA 5RUBA 4K8GA 3VOIA 2X8RA 5FF0A 4W8LA 2G95A 4UOJA 2AAAA 5XIAA 1UWQA 3RILA 4ZENA 5G1MA 2CBVA 4DUVA 4H6QA 4J3ZA 1KM3A 3DC8A 4I9MA 4FX6M 5SWUA 4UTWC 3W6YA 3NM1A 3UPBA 4UTUA 1JCLA 5A6MA 3M6YA 3GR7A 1K4HA 3THQA 4N2YA 1JZ5A 3N3TA 4LC8A 1QPKA 1NARA 5HANA 4KS0A 2V5BA 1J9YA 2DH2A 2PZNA 2PDBA 2RDWA 2Z29A 3HMJG 1US3A 2VHLA 4F3HA 3AS1A 1JFHA 3E2RA 3GXFA 4FR1A 2YW3A 3BQ6A 3P8IA 4HOWA 5IRPA 3HN3A 4MSSA 3E0IA 2QGHA 3N3MA 4RNFA 1W9XA 3AYSA 1UYQA 3TJIA 2BXVA 1N7KA 4IXHA 4FAMA 1P4CA 3H2EA 1VRXA 2XH4A 3WQOA 5A8OA 1DBTA 4GYPC 6TAAA 5DMYA 5HUOA 1XDLA 1MW0A 4LYKA 2VL4A 4XIAA 5IXEA 2CBIA 4NI8A 4J3SA 3CZ8A 4UQ9A 1K02A 4HNUA 2WPGA 3OGVA 1AQFA 2WXDM 2OR2A 4MF4A 2Y0FA 2FFIA 3DKLA 3N19B 2XWDA 3C2YA 3RJYA 3AXKA 3MY9A 1Q3NA 3JVAA 3TFXA 1R30A 4XZBA 3AHVA 4HHMA 3L4VA 4YTQA 1POJA 4JNZA 3BV7A 3UF9A 3RGTA 3EX3A 3DG6A 2J4GA 2WCGA 2ZFAA 1XF0A 1XLCA 1E9LA 4Q6JA 2O9TA 2FQIA 3SCWA 1J93A 3EWWA 3AU2A 4TR9A 4PUNA 1U1JA 1W3IA 1VYRA 1POKA 4ML4A 1TA3A 4R53A 5CZ0A 1DWJM 2ISDA 2GVYA 3FJ4A 3ITCA 4GQRA 4JYDA 2YLAA 3V35A 3ZT6A 1JDAA 3WDIA 3VIJA 3SDOA 4LYRA 1GJPA 2ZX8A 3UXDA 1J6PA 4BKNA 1XBXA 2PMQA 5CSUA 4WVXA 3BLKA 4FF7A 4NKCA 1TKKA 2BY2A 1ZAIA 5D8ZA 4AZGA 4LS1A 1RUSA 2CETA 4UFJA 4QM1A 3IUIA 5HJYA 2HE5A 3PSWA 2O55A 1A4MA 3GDTA 4ES4A 4I6KA 2QLYA 4CN4A 1EGMA 3GW0A 4MJMA 3N1AA 4JS3A 1F3XA 1OGSA 1E9IA 4AY1A 2NX1A 1PIIA 4S3KA 4JTQA 1VB9A 3G24A 5I3DA 3F4DA 2HNHA 1VAHA 2HEJA 4LTSA 2QUMA 4NL1A 4IXXA 1TPDA 4MJ2A 5CEWA 2WWCA 3NGFA 5BU6A 4IMEA 1WUEA 2BGSA 4YMZA 3GNDA 3C6CA 2CU0A 2CCRA 2I1OA 4CCZA 3REQB 1VJZA 4HNNA 4G1KA 1L2QA 5E0CA 5KINA 4IIHA 2Q02A 2O7QA 3GNOA 2OSWA 3CIVA 3WQEA 3QTPA 4U3CA 1R3QA 4IF2A 3WG6A 3K1GA 1QDSA 3QHMA 2V6AA 2IW0A 4CEUC 2ZQ0A 3WH6A 2WJFA 1J01A 4FLRA 4UTTA 4MNJA 2VO5A 3D46A 3LHZA 1J0KA 3DECA 4DWSC 2AKMA 3FGCB 5AOUA 2IMRA 4AG0A 7TAAA 1XKYA 4MB1A 4IJBA 1F5ZA 1TPUA 4PMZA 1J10A 4U31A 4AMAA 4DWDA 2A3LA 5FIPA