4MWAA

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
260
Chain Sequence
MNEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTKTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDVRINPGNIGRRHKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 93
structure length 260
sequence length 261
chains with identical sequence G
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaA00
4DJDD 3H22A 1AJ2A 2Y5SA 3TYUA 4DJDA 2Y0FA 3TR9A 4DJFD 4PZVA 4MWAC 3H26A 4NILA 4DJFA 4DB7A 4S3FA 3TZNA 4S3AA 3H2MA 3MCMA 4S3DA 2VEFA 4D9PA 3TYCA 3H2OA 2VP8A 4MWAA 2DZBA 4NL1A 3H21A 3H23A 4C1NA 4S3EA 4DAIA 4DAFA 3H2NA 2DZAA 1TWWA 2E7FA 4HB7A 1F6YA 3H2FA 4DJEC 1TWZA 1AJZA 3H2AA 3TYAA 3TYDA 3MCNA 1Q8JA 4S38A 1TWSA 3NOYA 2YCIX 4O0QA 4S39A 3BOLA 4D8ZA 2YCKX 3H24A 4G9PA 1Q8AA 2YCLB 2VEGA 4CCZA 4MWAB 4NHVA 1Q7QA 4MWAE 4D8AA 1Q85A 3MCOA 2H9AA 1AD4A 2YCJA 1AJ0A 3TYBA 2BMBA 4S3BA 2DQWA 4O1FA 3TZFA 2OGYA 4DJEA 4MWAD 4S23A 1Q7MA 5JQ9A 3TYEA 4DJFC 2H9AB 4NIRA 4DJDC 2YCLA 1TX2A 3H2CA 2Y5JA 3K13A 1EYEA 3BOFA 3TYZA 3H2EA 1TX0A 1AD1A 4S3CA 4O1EA 1Q7ZA 4DJED 3V5OA 4C1NB
chains in the Genus database with same CATH superfamily
4J9JA 4E38A 1PWMA 4CCEA 3BCFA 3BDKA 4UZUA 1JUKA 1OYAA 3LNPA 2XFFA 4CD5A 2VC9A 3N25A 4G1NA 4YWIA 2YBVA 5IHSA 3TWAA 1J93A 2GWGA 3BMWA 2A21A 4WY0A 1PKYA 4DZAA 1Z6KA 5FACA 5G4WA 2ATMA 4O4VA 3VNMA 2OT1A 3LGGA 1V51A 5FI8A 3LCIA 3WBAA 1DE5A 2WAGA 4TMCA 3MMDA 4Q8WA 2XZ9A 4C90A 3ALFA 1B90A 3UZZA 4MDOA 4UQCA 5KZMA 1ZBWA 4NZ3A 1DTNA 4UUIA 4GY1A 2E68A 2QDEA 3RLGA 4D6DA 4X61A 4F0MA 4D6EA 4YWSA 5HJXA 2IMRA 4UNIA 1ZU8A 2OWXA 1W37A 3IS4A 1YQ2A 1MRQA 1BVNP 2I17A 4K8GA 1J9YA 2D2JA 4M7TA 4RJEA 1A5KC 3RLVA 2GOKA 1L2QA 4C1NB 4JIQA 1S1RA 4UTHA 1HT6A 1GZ1A 3FYOA 4BZYA 4IIEA 2E5CA 3OHMB 1JUBA 3ZVIA 4HU8A 5EFDA 2A85A 1UUQA 3DHFA 3QXBA 3INPA 5E1QA 5TNVA 1EO5A 3UP8A 4AQLA 1TSIA 4UOJA 4KPLA 1XYBA 4LVGA 1E56A 2XDFA 1A53A 2NUXA 1KBKA 1PB0A 5I3FA 3NZPA 1TPH1 1GYNA 1ENUA 4NZFA 5IXEA 1E3XA 4H00A 1P5BA 4D8LA 1KM3A 3IAQA 3W2NA 3SECA 3KRUA 3STPA 1FFQA 1GCYA 4XZHA 1O60A 1HJWA 1QHOA 1HFBA 4F79A 3B03A 1G7VA 4DY1A 1XBYA 5G1YA 3CUIA 4KEUA 3RITA 2A1YA 4H8NA 3RN6A 1Q7QA 4ZBCA 2ZZ2A 3WD4A 2VRQA 1CB7B 1QNQA 1QT1A 1O5QA 4JX6A 2A6NA 2VEKA 3SCQA 4KIRA 3IGHX 3WUFA 3MHGA 3TYBA 1EC7A 3QGVA 2NT0A 1US0A 4EPBC 3QOKA 4QJ5B 4JCMA 4M0XA 1GQNA 1XR2A 5K9XA 1SJBA 4H9ZA 4K8HA 4QG6A 4TX8A 3UY7A 1UWTA 4D1IA 3LTSA 2FKPA 5PTDA 2Y5JA 1E1CB 3BOXA 1HXJA 2OTDA 1PIFA 2ZX6A 1X39A 3P60A 4R7OA 1K9DA 4WJEA 3TUUA 4GYPC 4HCLA 3WQOA 1PKLA 4JTAA 2XIMA 3GU9A 3QOMA 5D8WA 1JZ6A 4LAZA 4GOAA 1UUMA 4G1KA 2J9YA 3GXTA 2WMKA 1TPC1 3CQIA 3RYSA 5MKGB 1Q4WA 1HKKA 3APYA 2ICSA 4K3ZA 3AYTA 4DBEA 3ABOA 4AF0A 1T96A 2X30A 2E40A 4GI8A 3EOEA 4QAWA 4P61A 3SQLA 1MW2A 2PWDA 3LCGA 3HO8A 4JTLA 3OO2A 1J2WA 5LIUX 1US3A 5I03A 3IIVA 1Z89A 3BJFA 1WXJA 5CBIA 1R9XA 3T0TA 1XYCA 3QZEA 2CEQA 1NH6A 3OTRA 4LALA 2JF7A 5JVLA 3UJFA 3ITVA 2WNWA 3S46A 4C7GA 3R0DA 3MV01 1QWKA 3PZOA 1KCXA 2JK2A 1KR1A 1E55A 2D24A 4F0LA 4JTQA 8A3HA 1KXQA 4W84A 1XGDA 3PULA 2HK0A 4I8DA 1ZP4A 4AMCA 1J4EA 1IF2A 5LNRA 2OXNA 1JCTA 1UPPA 2PDWA 5CPQA 1N7KA 3OLIA 2NQHA 1V93A 3VOGA 3PP7A 1OGBA 1ICQA 3C3NA 2CLPA 2VTFA 5LIXX 1R6WA 3KDOA 4TIMA 5L9FA 3WH7A 3A13A 2Z0IA 3GXDA 4B9ZA 2PDCA 4QP0A 4J7RA 3PAJA 3CZKA 1SFLA 2ZUVA 2XIBA 2FYMA 2IQDA 3CGTA 4M5PA 5FEPA 2PDUA 3TW9A 4F8XA 1XRFA 2ZC8A 4IGMA 1IR1A 2V9DA 1AZ2A 3TA9A 4IMEA 3T55A 3U4FA 1OK4A 3A4XA 3BSMA 3VNKA 1MDLA 3MT1A 5JUVA 3DDMA 2Z1BA 2BVTA 3EGJA 2VQTA 1VPXA 3MUY1 3QPYA 4Q8UA 4JCLA 1CDGA 1RPXA 2R1NA 2RH9A 1MUCA 5FJPA 1XXXA 3PG9A 3QGKC 4UOQA 3WMBA 5LSMA 5DMLA 4LAOA 4UNKA 4B4FA 2J7EA 4YVXA 1RH9A 3QRHA 2QJJA 5A6BD 4NRSA 3KRBA 1ZB5A 2GJNA 2PLCA 3H2CA 4PMYA 4XX6A 4B4HA 4GYKA 2I14A 3RXZA 3ZFHA 2E6YA 5FEWA 1QW9A 2I5GA 3GSMA 3FGCB 1XRSA 2PTXA 1HJUA 1YMYA 3NEHA 4I8YA 4H7CA 1JDCA 4MTVA 2XSAA 3PB0A 4YCPA 3G18A 4HOZA 3RX2A 3BSHA 4GBDA 3S4TA 5FJOA 1R9YA 4GA8A 4B3KA 4M24A 4JTHA 4H19A 1YPFA 3B8VA 2Y62A 4X3ZA 1TA3B 1ZJIA 5HJYA 3CAWA 4JTSA 4L6OA 3WK2A 1HZYA 4LUTB 1VBJA 2D22A 4X9YA 1L8NA 5REQB 4DVOA 3GQYA 2DVUA 1H4PA 3RNDA 2C13A 4PRRA 3GR8A 4H6RA 2C71A 3EXRA 2FGBA 4MGGA 1XINA 2ZX7A 5I3HA 3AS2A 2CKSA 2E9MA 2QAPA 3NVTA 1BSIA 4GUHA 3SJ3A 3LSCA 4IIFA 1Q2SA 1W1YA 1BVWA 2WM1A 3HQNA 3JUGA 3ANVA 3I4EA 3PZVA 1NARA 3W7MA 2Y8KA 4UTTA 2I5IA 2NQZA 3UG5A 5DCBA 1SQ7A 1LYXA 4Z1AA 1B9ZA 4RUBA 4MNLA 4JKKA 5C9XA 4DYEA 2AAMA 4MNKA 1UP3A 1B4KA 2VENA 1XUZA 1KNWA 3Q94A 2VQUA 4HNOA 4TXEA 5CZJA 4ERAA 4PUMA 1BEUA 3TH6A 3OZPA 2C6QA 3HOJA 1R7OA 1AW5A 1JYNA 3EBVA 2G37A 2EPLX 4LC8A 3VE9A 2VDGA 2G3NA 2GUBA 1W3NA 4PEKA 1GOOA 2ABAA 1FKWA 1YXYA 4FLOA 2CLFA 2J75A 2NSXA 4HYRA 3PUEA 1ONXA 5I24A 1PL9A 3W7CA 4LANA 1YDYA 4G7FA 1CNVA 4PCNA 4CNTA 4K8EA 2OLAA 3K5XA 2WOQA 4PEEA 4LFYA 1W1A1 3Q65A 3NTYA 3AMDA 4JX4A 4GABA 3TJ4A 1JRCA 1UD5A 3TXVA 4Q6JA 1IWBA 3C4UA 1MDRA 3PUGA 4NHVA 2J7GA 2PDYA 4WDUA 3MC5A 3GAKA 2BY1A 1FWAC 1CGUA 3WJWA 1RBAA 3KRZA 4UR8A 3TN6A 3MMTA 1MVYA 2ANUA 4AD1A 1Z3NA 3REQA 5CQ1A 3WELA 3AYRA 3VABA 4BKNA 2ZWYA 1Q63A 3QBUA 2BGSA 1RCQA 2PRHA 1F07A 3HG4A 4IJCA 3ELFA 4MZYA 1WKYA 4GPNA 3V3WA 3K1DA 3VKDA 4NSBA 3VDHA 1WBHA 3KOWA 3P7YA 3PWAA 5CGQA 4O8RA 4KBXA 3GUGA 3UWZA 1WAUA 5G1TA 4AWUA 2EXOA 4XUYA 4WGXA 4LVAA 2R1KA 4PUDA 4FZIA 4K1GA 4K7VA 5H2ZA 3ARRA 3TN5A 1OHLA 4M1BA 4GI9A 1J2BA 1W56A 2QCGA 1OCJA 5I02A 3S47A 1CYGA 2C0AA 1R3QA 1AH4A 2J77A 3UQNA 2W4XA 3SDOA 5ABFB 5CZKA 2ZDRA 4CQDA 3UPWA 2QS8A 1NDVA 1CGTA 4MYAA 2HV5A 2B7QA 3REQB 3S6DA 1FH7A 1AMKA 1JPDX 3PC0A 2PDMA 2HE8A 3C2RA 3E1F1 1QOPA 2HNHA 3UXKA 1KM2A 3AHZA 1UOKA 3DCPA 5D9PA 1FDZA 3KWSA 2VC6A 4K2SA 4DJDC 4FXJA 1VENA 3C2FA 1H2JA 3ITLA 1Z9AA 1PKMA 2V3DA 1F76A 4DBUA 5CJ5A 3MYPA 3NQCA 2D2GA 2TPSA 3QW4B 1H41A 4JQ4A 1EJRC 1IWAA 1CGXA 1RJPA 2W67A 1XIFA 4DWDA 1JEZA 4GI4A 2F8QA 5JXQA 1H7NA 3CNYA 2AAAA 3W75A 3UWYA 4N6EA 3AI0A 4TVUA 4EF8A 3L21A 3N15A 1AQHA 4RNHA 1DQUA 1CGVA 3V7PA 2XGZA 2IPJA 4W93A 4IFOA 2WMIB 2XVNA 1J10A 1HKMA 1ME7A 1S2UA 3O6YX 2WC4A 4S3KA 3A5FA 2QCFA 1QK0A 2WKGA 3ALGA 4LCQA 1JYWA 2XISA 4WJXA 4AVFA 5EMMA 4MNJA 3LZ5A 4Q4KA 1F8IA 3H53A 2QR6A 2YYUA 1XYZA 1IZCA 1UKQA 1P0KA 3WEOA 1E4LA 2J7DA 4OUEA 3KLLA 3IUIA 2IXVA 3PWIA 2DQWA 3G1HA 2C16A 4ONVA 4FIRA 3LHTA 1W32A 3I68A 1JCJA 4L6HA 3GVVA 4NVTA 5AHIA 4FX7A 2EF9A 2FJUB 1H7RA 3TJXA 1RP9A 3LI0A 3PTDA 1KO0A 1BWLA 3VIIA 3PZIA 2VJXA 5B7YA 1XLBA 3GC5A 5CZSA 1N8IA 3STCA 4GYPA 4FLRA 2I56A 3TEVA 1W3KA 3CUXA 5FEXA 5EKYA 1YHTA 3W1TA 1C92A 1IZJA 4PTMA 2F84A 2FGZA 5D2YA 1XYAA 1MW1A 4PMZA 5REQA 1JR1A 4JTTA 2ZXDA 4GJ1A 3TC3A 1TB3A 5AC7A 1RVGA 3SURA 4WHBA 4QAIA 4L9YA 1D3GA 5D37A 4H04A 3W23A 3LCXA 3W7QA 2OODA 5AYIA 3TYCA 4RNIA 1VYSX 3BLFA 4RW5A 5CGTA 2DZBA 4H9YA 4YN5A 4AW7A 1F4HA 2VR4A 3WQPA 4MLRA 3RU8X 3T4WA 2OO6A 2IKGA 1H11A 2Y8UA 3G1RA 4IH3A 1F6YA 3A64A 2HEJA 4HGXA 3GLCA 5G5IA 5LIYX 2A3LA 3WNLA 1AFSA 1BPLB 5BMXA 1B3WA 2CLKA 3AYVA 5DRCA 1NDZA 1OC6A 1E6ZA 3LHWA 4KESA 4KKXA 2XH0A 3S2NA 1C93A 1VKFA 1YXDA 1KKRA 4I9MA 4QE4A 3VTRA 3VD4A 5LA2A 1T40A 3ERPA 5HBFA 1EDTA 3BICA 3NFUA 3BLLA 3YPIA 5CAHA 4ZENA 2AMGA 1ISWA 2A5HA 1XLEA 5KITA 2YCLA 3TC7A 1HJSA 3UU0A 1VEPA 1JRBA 1W3TA 4JIHA 5KTLA 3SCUA 4IFRA 4QGCA 1E1EA 5AC8A 1R8LA 4KCUA 1NP2A 1POJA 3FSTA 2DH2A 3HGJA 1LT7A 4Z1YA 5KZDA 3G24A 3RR4A 4LVDA 3B3DA 4DF1A 1P0DA 1PTDA 3NPVA 2GL5A 3FAWA 2XIIA 5CGMA 4QX4A 1OINA 1DVJA 1WE5A 1K4HA 3VFCA 2PDPA 2RDXA 5FJJA 4IX0A 1FCQA 4KWOA 2G3MA 4Z0JA 3V75A 5LNWA 5A2CA 3MUIA 5D2WA 4H9VA 2O7QA 3KTXA 1KBBA 4RDVA 4PCFA 4Z2JA 4UFJA 4Q6XA 3V1PA 3RCYA 1VBGA 1DWJM 2XPKA 1AG1O 3EKGA 2FVLA 5HAOA 3KVKA 1R2SA 2BXZA 1XL9A 2UY4A 4MFDA 3P93A 2ZBTA 1GHRA 5IRPA 5C9ZA 1DIDA 4A4AA 4EAMA 1RZMA 4P2VA 2WMIA 2FTYA 4V27A 3T42A 3W9ZA 2I9EA 1W3HA 3GIPA 4K6AA 1M03A 1TQJA 3KVLA 1MO0A 1VEOA 4AWSA 3WLKX 3D3FA 1JDDA 3W7PA 3KFTA 1JF6A 1VFHA 1XPYA 2E1DA 2Y70A 1WDWA 5LZLA 2EEXA 1QPRA 1SW7A 2WO5A 2Y61A 3VNJA 4JX5A 4H9MA 4EACA 2ZTKA 1EZ2A 1IXQA 4MB1A 5CLWA 1FCVA 4DJFA 4LY4A 2A3CA 3SCRA 1PPIA 1SJAA 4XZWA 3MW7A 1LUCA 1VFMA 4IT1A 4FIQA 1IEQA 1TPB1 4MKNA 3GIQA 4US5D 3DENA 5M1TA 2CBVA 1PBGA 1XCXA 1NAL1 2FZNA 2G5WA 1DWFM 4CD4A 2RGMA 2DW6A 1I8JA 3W22A 4DAFA 2NX1A 2VX5A 1MEWA 2NV2A 3B9DA 3ITCA 2HVNA 4Z2LA 1NP0A 3K30A 3DKJA 3DG3A 1OIFA 3DG6A 1QPNA 4W5UA 4G9PA 3KW3A 4ZL1A 3NL3A 4V28A 3M43A 5I06A 4L4MA 4UTJA 2VGBA 2WQDA 3H12A 2QCLA 5JIPA 2A7NA 3LPGA 3L7RA 3WQ5A 5IFTA 3W2LA 4LSBA 1CT5A 3FV9A 2QGYA 2DFAA 5XIAA 8CGTA 1E9ZB 5I00A 1T6MA 4H2CA 4MVAA 3N29A 3BLDA 3Q45A 2PLJA 4L9ZA 1ISXA 1XDLA 4UQBA 2MANA 3NM1A 2CERA 3BVJA 4DPQA 1FQ0A 3WX7A 2ACQA 3M1ZA 2PF8A 2X1TA 1XIMA 4PN2A 3AFBA 3U5UA 4US5A 4C5YA 4ICCX 3CUJA 3HFTA 4H9UA 3L68A 3A12A 3M0JA 3GO2A 4L1WA 3UETA 2WSKA 4XZ9A 1I0DA 3L5LA 3MUAA 2UWFA 4WKHA 4RPQA 4S3AA 1TV5A 1U2YA 3O15A 4AZGA 4KFNA 2MUCA 4RDZA 4LS0A 3O7UA 1QPOA 5EL1A 1G4TA 4BEQA 2J47A 4HTYA 1IGSA 2BXVA 3W1QA 5K7JA 4FNQA 3L23A 3CXOA 1JD9A 4M51A 2ISWA 4LS2A 3M46A 2VEPA 5I09A 3TNOA 4GVIA 1XISA 4LQ1A 3OGRA 2YCIX 4PSRA 1UD8A 5BMWA 5C71A 4HHPA 4WDWA 1JYVA 2R9RA 2HBXA 4MWAB 5AHEA 3VAVA 1Q85A 1R2RA 1CCWB 1KV5A 2Q6ZA 4C6EA 3VNZA 3WFLA 4PC8A 5TD4A 3TTEA 4JQ1A 1VEMA 4LV9A 3M5ZA 1OFEA 2OMAA 1CECA 1Q7MA 4FX6M 3GBDA 2VUNA 1PS9A 4S2BA 2IQTA 1ZAHA 4CCCA 1G67A 4HU4A 1KRBC 2V82A 2O7SA 2ZUSA 4MJZA 4L4PA 2PRLA 3QKEA 3VNIA 2Q09A 4ZVJA 5HOSA 1E43A 4DIAA 2XFYA 4Q8OA 2AKMA 2X41A 3SR7A 5BOOA 1WDPA 3NJ3A 1GZGA 4N9DA 1E4MM 3WJXA 4WY0B 2FPVA 1GNXA 5CEWA 3D0CA 1F5ZA 1EIXA 1XIEA 1JUEA 5G2WA 1P6BA 2J7HA 3M16A 1EKOA 4WSKA 1DXFA 3MJYA 2ZKMX 1T41A 2JE8A 3TJLA 3W38A 3C6CA 4JL1A 3JZEA 1ML1A 4OUIA 4OHQA 3WLLA 2ZE3A 2POTA 4DNMA 4P7QA 1E3ZA 4L56A 1C7SA 2JQXA 2PTZA 3HGOA 1IYXA 3AUJA 3W28A 1EQPA 4NX0A 4D6JA 1NJJA 4QLJA 1I9CB 1PX4A 1VFLA 1ZZMA 2PZ0A 3CUHA 3LDVA 2YCJA 2YA2A 4JIEA 5BWAA 2BMBA 2YB1A 4ML4A 3LHVA 5GQBA 4PBGA 3DFYA 1JZ4A 2XTKA 1DHPA 2CFFA 3AIQA 5AC4A 2P8BA 1I2PA 1J8VA 3GS6A 4TV6A 4GNKB 4QQUA 3NOEA 3ME3A 3AZSA 3UWVA 3AHVA 1RVKA 1XLGA 3N6JA 2G95A 3S0CA 3NYDA 1OX4B 3O63A 3AU6A 3GR4A 3NA8A 4DXXA 4B5NA 2FGLA 4OOZA 4FNPA 4GVFA 1UWIA 4XISA 1R9ZA 1FCBA 5M3WA 3IGXA 5K4ZA 3NZQA 1V7YA 2R24A 2NX9A 3G22A 3N2CA 1W9DM 3B4UA 3UF9A 4DBWA 1PX3A 1SMAA 3DEQA 3W7KA 1TPUA 1S2AA 4BQ4A 3MMUA 4K68A 1H61A 2YDAA 1RK6A 4AZIA 3I7RA 3I4KA 3UZWA 3EA3A 1E9YB 3WNMA 2WV8A 2P53A 2QDHA 3W1NA 2ZRWA 3R12A 4HVXA 3C5QA 5I0DA 1OSEA 1PDZA 3PZ9A 5HJLA 4NZ4A 2D2OA 1XDMA 4I7VA 2QYGA 1K8ZA 3WQWA 3W1UA 3L5AA 4NXSA 2X1UA 4ZB5A 4ACZB 3W6MA 4AFYA 4PL2A 4HPJA 3W81A 2YCEA 3L4TA 4E2DA 1D3HA 3NQFA 2TODA 3RJXA 5A6KA 4WLCA 4IG2A 3S5ZA 1Q5MA 3E49A 1XLJA 4WD0A 1KXVA 4L7ZA 3F1QA 1NOUA 2DZUA 3CHFA 3PK7A 4TX6A 1PX8A 1LROA 1BG4A 4U2ZA 1W5MA 1M04A 3TTSA 3MANA 1A50A 1JAEA 4KERA 4PSPA 1TQXA 5LHFA 3SIMA 1V5XA 4H4IA 1OFRA 1R5YA 1EEXA 4B5TA 5DCDA 2Y4SA 1LCOA 1PZ1A 1DWGM 3N73A 2PDHA 1GG0A 1JCXA 4H7ZA 3SGUA 4O54A 4QDMA 2J74A 1XH2A 4FNSA 1ZGDA 3WFZA 4AEFA 4AD5A 5HWJA 3PF3A 2BOGX 5T8GA 3RLHA 3DFOA 4GH1A 1W5QA 3UZXA 4XZLX 3PZUA 4KEVA 3W1PA 4PFHA 1GW1A 1G4SA 3HMCA 2A3EA 3TX9A 2QJHA 3AWNA 5F4XA 4QIUA 4HK5A 3MS8A 3LRMA 2ISDA 3KDNA 1RV8A 1SJCA 5J04A 3VYLA 3NAVA 1XIBA 2VT0A 1TVLA 1KFBA 2V6AA 3H24A 1MXDA 5A8PA 3C0JA 2QZRA 5AYYA 3OP2A 1RP8A 1UD3A 1E4IA 3TZFA 2VL4A 1LLWA 3GDRA 1X1NA 2YX0A 4HCHA 3IK2A 2XN0A 1UWUA 3PTKA 3POCA 4TV5A 3GW3A 2ZRUA 2VM8A 2GVJA 1UC5A 3K13A 2ZE0A 3W37A 2NSOA 1NWTA 4LX4A 5DEZA 4MJ2A 3KCOA 1CXEA 1D3CA 1E0WA 3V5OA 2E8ZA 1ZJAA 4X0NA 4XIAA 1VBHA 1ZP3A 1VYRA 2J25A 3QHOA 2ADAA 2VCAA 4AIBA 5LYRA 4GMEA 2ACRA 1KRCC 2A3HA 1GQKA 3NDOA 4JZ5A 3ZLFA 5CG0A 3AZTA 5CC5A 4KRTA 1XICA 4GRSA 1WXYA 4IUOA 4IMAA 3M5XA 3AWOA 2DSWA 4OV9A 3NSNA 3SUTA 1Q6GA 3W3OA 5F2GA 3FDGA 1VCGA 2E7FA 3TIMA 1SPQA 4GISA 4GJJA 1TMLA 4RXGA 1X97A 1UD2A 5C9UA 4GVGA 5BWFA 1IT0A 3OYXA 2WWDA 3ECQA 3BOLA 1S5VA 4IMFA 4TVCA 5IDZA 4PL1A 1TCMA 3UR5A 4LB4A 1CTNA 1PCWA 1JL8A 2XH7A 5IM51 3IWPA 1W3JA 1A80A 3VCCA 1ZCCA 2QPSA 4TQTA 1I0BA 1VHCA 4MJMA 3EDJA 2NT1A 3HGSA 1YXCA 3RMJA 1XHGA 2GSHA 1E5NA 1BXNA 4UTLA 4GY7A 2C19A 2DW7A 1J0JA 4FI4A 1THFD 2Z2AA 3ABSA 1WDSA 4AISA 2A3AA 5IDIA 3LLXA 4NY2A 4AZ6A 1OCBA 1OG0A 2R94A 2R14A 5I79A 4JYEA 4ZE4A 4S2CA 3G0XA 1OGGA 4M6UA 4HOXA 3F2DA 3N11A 4O0KA 4ILSA 1VIZA 5ABEA 4S3JA 3OHIA 3UNTA 4DB7A 3SN4A 4L1GA 1PSCA 3PM6A 3S9YA 3KOZA 3L65A 5J5DA 5D9NA 1Y65A 4S3DA 3UPBA 4MAVA 4LUTA 3WDIA 2V69A 3N13A 4PE8A 4IOTA 4UCFA 4BFAA 3TA6A 5AKQA 4O1AA 3KL5A 1FY6A 4H8HA 5EBUA 3C2VA 4HMCA 3HPXA 2WHKA 3URAA 3ARQA 4X60A 1QTWA 1WUEA 1E6PA 2VYOA 2A6LA 1TE6A 1HF6A 4GXWA 1R3SA 3IRSA 3S1WA 4LRTA 2PGFA 4KMQA 1C29A 5EGRA 1NY1A 3RIKA 4WSJA 3UZYA 4DNHA 1JG9A 2OKTA 3V16A 1MQQA 1XYLA 3E5PA 3WL0A 1OJXA 4GY0A 1X8FA 1Q2RA 2C91A 4HPGA 1XUUA 2QCHA 3G1FA 5D9MA 4O11A 3QY7A 1A5LC 4PFMA 3PS7A 1B3XA 4HA1A 5LXEA 3Q4DA 1VAHA 3M0VA 2GK1A 2BZNA 2Q3RA 1LF1A 3QR3A 3N6HA 4HMNA 2PDFA 3LQGA 4WDXA 4DJFD 1TJ0A 1EBHA 2ZZ7A 4DELA 2OOGA 4R27A 1IEVA 4C1KA 3WY1A 1G1YA 2CLLA 4D6IA 2OO0A 1K7FA 1P4CA 3HPZA 3EXSA 4W88A 2QUTA 4U3AA 1I2QA 5D2TA 2VZSA 4I9TA 4FA3A 3T2QA 1TO3A 3A5VA 3BZGA 1U22A 2BP1A 1KQYA 1UQZA 1FWHC 2VDIA 1U1UA 2VZVA 2Z6IA 4GZJA 3TYAA 4S38A 4W4QA 3PBYA 1Z44A 5EU9A 4J3XA 1BWKA 3AC0A 2YXXA 3BAJA 1M3UA 3E74A 3SZ8A 1KA9F 4DLFA 4V15A 1ME9A 1RBOB 2PGWA 2O9RA 5GNZA 3LMZA 3MZNA 1XH1A 1UH2A 1DYSA 3PY2A 1UUOA 2DZSA 2G97A 4O1BA 4NNBA 1I45A 4GQ0A 4REQB 2NQ9A 2QXWA 3P5YA 2YBUA 2EPKX 7ENLA 4XTIA 4HN8A 3STEA 3P0WA 5CC7A 3E2QA 4E8GA 5C5YA 2F6UA 4HNCA 4LEQA 4U5KA 5H8MA 4I90A 1KW1A 4UWMA 1EA9C 5C8BB 1DXEA 1EL3A 2DP3A 3DYPA 1VLWA 2X7VA 3UFYA 3VI2A 1K6WA 2XFRA 3U9IA 5HNTA 2NV1A 4AIOA 3KCLA 4H6QA 1LBFA 1H60A 2WHLA 3DX5A 4ATWA 4K7YA 4INFA 1XIHA 3EB2A 3DFHA 1K4GA 5RUBA 1GQLA 3N4FA 2Z1VA 3TTOA 4GZ7A 3PPHA 3CT2A 1ZCOA 3W53A 4ICMA 1WDQA 2PDGA 4I5RA 2Y7GA 4O16A 2DT1A 4IQDA 4MFEA 5HNUA 2G3JA 3LPFA 2O55A 4JN6A 3G8RA 4UTTC 1WUFA 1FWEC 5JIWA 3V0UA 2JFEX 1LWJA 1XS2A 1HKVA 1LL7A 3FIGA 4CNOA 1JCYA 1JCMP 1EJVC 3EA1A 2QCMA 1ZNNA 3MBDA 1FH9A 3HV9A 3W76A 2YLLA 1H50A 4ZQPA 4AD2A 1BYBA 1B4EA 4AHOA 3AXKA 1BGAA 2C0HA 3ITOA 4OGZA 4W86A 5A6JA 4W85A 3F4DA 3IIOA 1Y5XA 4C6CA 3FVMA 4LNCA 1O5KA 1O94A 3POHA 2D0HA 4NUWA 1F6PA 3L9CA 1EB3A 4DWSA 2X40A 2BHUA 4MSSA 3W7IA 1RHCA 1R3TA 2QIWA 5FF0A 2OYMA 3FA4A 1GTEA 4PYSA 2OQYA 2PAJA 1DV7A 5E93A 3VKKA 5HNNA 1BFNA 2PDKA 1RCOB 3OPSA 3EA2A 4IFKA 4Q7IA 1DEDA 2WZMA 4DUXA 4QE5A 5DT5A 4NP7A 3PZTA 5B7ZA 4DO5A 1BD0A 1XLCA 5D2VA 1GK8A 4OBSA 1YBQB 3SGZA 5AHFA 1PEZA 3OJGA 3ARWA 3LXAA 1TIWA 4JHZA 4N0RA 1FWTA 4JQAA 1TTQA 4KQNA 1U1HA 4GXPA 5C9RA 3G1VA 2WLZA 2ZC1A 1RCXB 1XYFA 4N2YA 4REQA 2P3EA 1HP4A 4EE9A 1LG2A 2Q8ZA 2IXUA 3VX0A 4Y9OA 4C6JA 4MPKA 3UJSA 4C1LA 3I65A 2VXNA 2E6DA 2WMJA 5AN7A 1XH0A 5I5RA 4Z42C 2QCEA 1AW1A 4LUSB 2W27A 1X8CA 1KFWA 3QLLA 1Q6QA 1OK6A 3I6EA 4LUJA 4M56A 1J0ZA 4GX9A 4JDYA 4YL2A 2WHMA 3GUWA 1W17A 4ENLA 1RUSA 3GG7A 4ZGYA 4P8WA 2YL8A 3FY1A 3R8RA 1FWWA 5D4YA 3FHAA 1V3KA 3GNDA 2Z7GA 3CMGA 3DERA 4URIA 3UXDA 4C1NA 3BAKA 4ZSUA 5D33A 2PLMA 3R0UA 3RG6A 2GQ3A 3DFQA 2J6XA 1S2VA 3G6LA 3RFAA 4O18A 5EMUA 3AXMA 1AQ0A 2SFPA 3NPXA 3WLNA 4WR3A 4B2DA 5H8PA 3OZOA 1BGGA 4IPLA 4K36A 2FPTA 2YB4A 4HU0A 1F4AA 2HMCA 3SUVA 1EWEA 3AXIA 1EXBA 3G3DA 4PTVA 4HTBA 1AQFA 3BLKA 3WIJA 4QDPA 4YJ5A 5CKSA 4O17A 3W7DA 3VMPA 1W9BM 3KZPA 3LERA 2XIOA 1B3ZA 2EJ1A 4AB4A 3NQDA 3P5ZA 5FJUA 4RXFA 1V7AA 4MUPA 3M0XA 1KWKA 3NPWA 3AUOA 3WUBA 2W5FA 1E0XA 2HXUA 1U5VA 1CIUA 1IEIA 4JAWA 3N18A 1QWGA 2WMGA 3K46A 1GVEA 1DJWA 3DBNA 3KTCA 4QDWA 1MW0A 2Q71A 1EJUC 1POKA 4XWUA 4ZB0A 4MG4A 3SBFA 2VDHA 3ZSTA 5LNUA 2CLOA 3MV11 1WO2A 2BVYA 1QRQA 2PWGA 3CB8A 4JNZA 2WNZA 4HA0A 3ZZ1A 2R1LA 4TUFA 4DX3A 4PMDA 3QGAC 5GVJA 3THCA 1G4PA 4YHGA 3WLIA 3LLFA 1XJBA 4UMCA 2OT0A 4KGJA 4NT0A 1I60A 3P3BA 2WCSA 2Y89A 1VB9A 5AHLA 1PXGA 1P48A 4HOWA 4ORMA 3F5JA 3TMQA 4WXZA 5HDRA 3P14A 1LBLA 4CNPA 1UROA 4GQGA 4QFUA 3NG3A 4C7FA 1KBJA 3KS5A 2G41A 1BYAA 2X2YA 3W73A 4F0SA 5C2XA 2ZICA 3VCRA 2BVDA 1KKOA 1PUDA 3ES8A 3SB0A 3BGAA 2UY3A 4WRHA 3AJ7A 1S5MA 1L6WA 4BJHA 1QHPA 4WDTA 4J3SA 1RA0A 1HJQA 2OR2A 2QNEA 4AY8A 1W1VA 7TAAA 3GR7A 6A3HA 3IV8A 4DBDA 4MHBA 1SW0A 1WOBA 1QOQA 3MP5A 2NV9A 1AK5A 1RJRA 2VURA 4A3HA 4JQ2A 4NI3A 1TRDA 3LOTA 4LYPA 1FA2A 2VVNA 5AVNA 1MYRA 4XVEA 2VCBA 4AG0A 2QJGA 1DWAM 4MNMA 1U5HA 3VGFA 1QO2A 2PWHA 1W3LA 2PCQA 2HXTA 5HNRA 4A21A 6PTDA 3OYZA 2WQPA 5A6SA 1S38A 3W7OA 3WJZA 2PWEA 1FCUA 1A3XA 2HRWA 4GBUA 2XWDA 2DZTA 4K1WA 1L9WA 1V0LA 1M7JA 5I3DA 2AL2A 3G3MA 3LHUA 3R13A 1XBVA 3G1DA 4JS3A 3SCWA 2WSRA 3U2CA 1PZ0A 3IJ6A 5XIMA 4B9YA 2GPTA 3JS3A 4AD3A 3E6EA 2PD9A 4F48A 3IIZA 1M68A 3N4AA 2ZZ4A 3GE7A 2POZA 6XIAA 3PAOA 3FSUA 4O12A 1M5WA 3ZJ7A 2OYKA 3MP3A 4H9XA 2VELA 3FCPA 4ZE5A 5BXTA 2W3ZA 3BMVA 4FXSA 4H8VA 5AZ1A 2XVPA 3RHGA 5C54A 3IUDA 1QI4A 4E4FA 2E77A 3L0KA 3H8AA 3I6TA 1LL6A 1PYMA 4QXIA 3BSGA 1W91A 3UCCA 4HK6A 4KF1A 1ADSA 3JZUA 5BCAA 2QPUA 4W7VA 4ZFCA 1QU4A 3W6LA 3N04A 4PUJA 1IR2A 1Y5VA 1TZ9A 3VD5A 2RJGA 5I3GA 1P1XA 2PLKA 3MDUA 3NGFA 3SUUA 4HA3A 4JFSA 1U1JA 3FYYA 4LAKA 2DZXA 3I7SA 3NL5A 1OEPA 1VQTA 1YPXA 4J5NA 4DYKA 1W5PA 3HQPA 2HK1A 1UPMB 3EMZA 3IRDA 3KBVA 2I9UA 1EGMA 3UW6A 4QITA 2BXYA 4HP5A 3PANA 4CNNA 2I5QA 3O06A 4UC5A 3CV1A 5D30A 3TKFA 3QF0A 3CZ8A 1LRTA 2IW0A 4DJEC 4I5UA 4BQ5A 3WDQA 1TTJA 1CLKA 1JULA 3THUA 1ONWA 2YDSA 1EP2A 1SZFA 2ZRYA 4BF9A 3T2PA 1O68A 4LCSA 3DU0A 3CC1A 1YW1A 4AZHA 3ZLHA 3PR2A 2WBKA 1R86A 1TCDA 3G77A 3IV3A 4XAPA 2ZVRA 2JIEA 4QJ1A 1YE6A 3ANYA 5JH1A 3BTNA 2Z29A 4GKTA 3GDLA 3ZVHA 1NEYA 3GYEA 5A5WA 4Y90A 5BOFA 2CIPA 2GQAA 2OFJA 4D6HA 3NEVA 4XAGA 5FF3A 3SO7A 4DHGA 2GDQA 1EJWC 3LQLA 5FAJA 4L61A 3EPOA 4IPPA 1CPUA 5CZ0A 2AQWA 5TIMA 5CPTA 1FDYA 2OZTA 2WNQA 2D20A 2Z25A 3MKVA 1ZENA 3ZOAA 5CPMA 3OVPA 2I7GA 9CGTA 1CZ1A 1XIDA 2TRSA 3TW7A 2BS9A 4N7QA 3LCFA 4Q32A 4XO7A 3VGGA 2D3LA 1TWDA 5GPRA 2R8WA 3W1RA 4DPPA 3N2MA 1TJPA 2D3NA 1SO6A 1H0GA 3M47A 1WX0A 1VFFA 4HB7A 3N2TA 5A8MA 4XB3A 1OT1A 4LVBA 3R7MA 2J8FA 3GVGA 2R82A 3GNPA 4JTIA 3W74A 1XI3A 1JXKA 3VC5A 4EKJA 2JF6A 4FB7A 4QTGA 5F2IA 1E1CA 5DY3A 1LDCA 4MWAE 1WP6A 4PMXA 1YRRA 3VU2A 1N8FA 1XLKA 5JMUA 4D6FA 5HR7A 2V30A 3ZT5A 1AD4A 4LEFA 1ZBKA 1B5TA 4FNTA 3KZSA 4BR1A 4Q4RA 2VFGA 3PJTA 1LTDA 2AL1A 2XIJA 3E0WA 1X1OA 2GGJA 3BQ6A 1VFTA 1D7FA 3GXMA 1MMFA 2O9OA 2WCAA 3W72A 3BV7A 3AHTA 3S9ZA 1KB3A 1ZHAA 2WZIA 1V08A 5CPOA 2H8XA 2J88A 3E12A 2GFTA 3W2MA 1NWSA 1W8GA 2BG5A 3CHVA 3EB4A 2WKJA 4GNJA 5C55A 1AW2A 3TWBA 4IXHA 3WQEA 3SRFA 4AHQA 2FVMA 4MM1A 3BCJA 3M0HA 5BXRA 3B9AA 4JTDA 4S3FA 1P1MA 3NO3A 1QBBA 3QR0A 1D8WA 4J3UA 4ZCWA 4JYDA 1I2OA 3H2MA 4XZIA 3W01A 5K3VA 4G7EA 2Y2WA 1C8YA 4AIUA 4W89A 1W6TA 2J4GA 4G56A 4LNYA 2D0FA 2Z27A 1HJXA 3GH7A 1XD0A 4L64A 1RQBA 2FLIA 4H01A 1UHVA 4IL2A 5EA9A 5HULA 1F74A 3GXFA 4JTGA 4MJ4A 2UV8G 4DF2A 3R79A 3EX6A 2ZUNA 1WKDA 2YXOA 1XM3A 1KCLA 3HPFA 4DEFA 3CL7A 1CBGA 2X0SA 3FXYA 5G4EA 4Z1BA 3PBVA 5BRPA 4RE2A 3L5MA 1ICPA 1B9BA 4ROQA 3GRIA 2DH3A 1B30A 1H09A 2CCRA 5L6UA 3SCVA 3W7NA 3OU8A 4POCA 1E9LA 1HJVA 1W1ZA 1DIOA 3N2BA 3LMYA 4TOQA 3TP4A 2QGHA 2GJLA 1XSIA 3RF9A 4FK9A 1E1FA 3O6CA 1IIGA 4E5TA 5E9AA 3RPDA 2W0UA 2NVAA 1H5YA 3PNZA 4GUJA 2QQ6A 1V0MA 3VOFA 4GUIA 3B0XA 1M7OA 4QLLA 5I3JA 4K38A 4LYRA 2E25A 4PZVA 2HS8A 1MUMA 3S5YA 2PDQA 4O4WA 1NF0A 2ZA1A 1C90A 3CZJA 2VRJA 3M0MA 3ONCA 4YPJA 4Q8NA 4LUSA 2OWWA 4Z2GA 2VC7A 3NDYA 4UTFA 4HMDA 4O57A 3IEBA 3OVGA 4OV4A 2XVLA 3MUXA 4CD6A 3TXZA 3WUGA 3CK5A 1QOXA 4KWSA 3C2EA 4J3ZA 4W5ZA 1BG9A 1VFUA 3QJAA 4OU1A 3WZ0E 3IANA 4R9OA 2R91A 2BVWA 2QEZA 1GPFA 2OGJA 4LV4A 2GUUA 4MF4A 2BLEA 3GYCA 3WJSA 5FIPA 2OZ3A 1GJUA 4I7WA 2O4MA 3NL2A 3VDAA 2GYIA 4TVDA 3QQ1A 3LM3A 1RY8A 3QLDA 4R53A 4C6DA 2CKRA 3CPUA 4F66A 1UJPA 2F6XA 2Z7KA 5A6AA 5HXMA 1V6YA 3AHXA 1XGZA 3V36A 4GWEA 4IMCA 5C2CA 2VWTA 4UR7A 2DZWA 3VINA 1I1WA 4HYWA 1IQ8A 3QYSA 3DGRA 4JTCA 1A5SA 4GG9A 5T26A 2GVGA 3IJ9A 1KFEA 4FS9A 4Q8QA 1KRAC 1XG3A 4E2OA 2EAWA 3TZNA 4HPNA 5GNYA 2UY2A 1OWQA 2I57A 4R7WA 2AQVA 1ZALA 3TVAA 4KFPA 2CC0A 3BUVA 2GJRA 3WL1A 3NURA 4IIGA 4Y9AA 3VD3A 3W4RA 1XD1A 1EJTC 1XGEA 2VP8A 3NZRA 1GVSA 4GUFA 3W88A 1IXOA 4W7UA 3F03K 3QVQA 2DPEA 3BWWA 2O56A 3O9NA 4AIEA 5BW6A 1UBSA 3VM7A 5DMYA 4O50A 2J8GA 4O13A 2QV4A 3ES7A 5TBOA 4AEEA 1PHWA 4F9DA 4AWTA 5LGXA 1G5AA 1A5CA 4MPQA 3U2EA 2DVTA 2GGEA 3VFLA 1S5NA 1KTNA 1JPMA 1SW3A 1KR0A 2ZUWA 4EXQA 2OWCA 3LPPA 4WX2A 4LW7A 3NPUA 3L12A 2EKGA 3BJSA 4NJJA 3VMNA 1GOQA 2AGKA 1GG1A 3G0SA 4A05A 2Q02A 2RUSA 3CMJA 3H54A 2NX3A 3VKAA 3OA5A 4PULA 3QV8A 3MYOA 3TOPA 4NZJA 3UR2A 1HVQA 3N2XA 2CHOA 3H7VA 1KC7A 5LIWX 1EF2A 1R3YA 1UR4A 2ASHA 3UGRA 1BTMA 3HTWA 3PFMA 3VIKA 1A5OC 2YDRA 3WLQA 5JH2A 3WEZA 1KGUA 4NAEA 3NM3A 1DIEA 4Y2WA 4NL1A 4WSHA 1M6JA 5ABHA 4S3EA 2L5HA 1JJKA 2ZUMA 1Q6OA 3SAZA 2C1GA 1FHDA 3EWDA 1Y8BA 2V2HA 3S6TA 3QC0A 1SZEA 2F61A 1V77A 5GJMA 5BXSA 4JTJA 4XUGA 3GDTA 1O5XA 1V3HA 5BRQA 1ISYA 1JFXA 1MSSA 1EQCA 1U30A 2BTMA 2YCLB 3AO0A 2Y88A 3OIXA 1PTAA 4GI6A 3T78A 2QUVA 3OGVA 4LS1A 3QQ0A 3WENA 2PPGA 3SCNA 4F0RA 1PJ9A 3KCJA 1CB2A 5F7UA 3E96A 5U7SA 1KLZA 1GW9A 4QROA 3IJQA 3GHUA 4N9CA 1P6WA 1V6WA 2YBTA 1QMLA 3B04A 2F9RA 3CQJA 3EX2A 2XN2A 4PTXA 3QH2A 1KM0A 2GDVA 4PB4A 2DIKA 2PCEA 1VGAA 4AZCA 5TQLA 3RUBL 4E4UA 2W92A 4IPIA 3W07A 4OBTA 1G6CA 5E70A 2VNCA 2NWRA 3IARA 5D38A 4HHLA 8TIMA 2GOUA 2G8ZA 1WDRA 2VFFA 3SJNA 3UBPC 3EOLA 3ZR6A 1SJDA 3BARA 1TG7A 5FESA 3W7LA 4ACYA 3HM7A 3WFAA 4AEOA 5LA1A 3TQVA 4C6QA 4UTWA 4A6GA 5LNSA 1E6QM 4JIIX 1JDAA 1A5NC 2PRMA 2D2HA 1Q8JA 1ZJBA 5C7VA 3NQ6A 1BSLA 3AYSA 3STFA 3WQVA 1YPIA 1X6NA 1AODA 1QW8A 3CL6A 3B9EA 4E2VA 3DXIA 1UMLA 4CQ8A 3VZYA 3CH9A 4IISA 1W5NA 4EXBA 2REQA 4LBUA 4KFOA 3S2LA 2PSNA 3SGGA 1KTBA 1DE6A 4GH3A 1GVIA 2PC4A 2J7BA 3XIMA 1BQCA 2YW4A 4PRTA 4ZXLA 1SFJA 5I77A 3TNBA 4AY7A 2ZXAA 1TR1A 4H7VA 3W1AA 4AX7A 3BG5A 3W7JA 1E70M 3WLHA 3VZZA 3VD9A 3C52A 1W1B1 3SSJA 2NZLA 1CENA 2VZOA 2QV5A 2HPMA 3NWRA 4NG3A 2XFWA 2G50A 2Z2BA 4W7WA 2RDTA 3B9OA 4R9XA 1B3OA 4A8NA 2HVOA 1LOSA 1FVPA 4GCAA 3G2GA 3WH8A 2Y63A 5E9XA 1VR6A 1QR7A 1T8QA 2EKCA 1PDYA 1Z69A 4A2RA 3B97A 3MA8A 1JPIA 3GTXA 4UXDA 4UFKA 5A6TC 5IBXA 3C8FA 3ARUA 1J6OA 4YTTA 1C3FA 3IK4A 2E6FA 3URBA 6REQA 2IUZA 3QSTA 3SSZA 3IIXA 4ROPA 2GDUA 3BLOA 1DQXA 2VFEA 1QCWA 3B8DA 2XWEA 1X7IA 5M17A 4Q8VA 2Z1XA 3S1XA 3VGBA 1LJYA 1F7BA 4AYGA 3V0SA 4AWEA 1XBXA 2PU1A 1B31A 1EYWA 4HNTA 1KXHA 2P8CA 3ZR4A 1I6NA 3CJPA 3PBWA 1ZRQA 3FEQA 2OYLA 3PBGA 1GJWA 1TKKA 1UWSA 1ZY9A 2YR1A 4Q3MA 4G2DA 4LYKA 1WOAA 2OEKA 3TYZA 4UOZA 3QQWA 2IKHA 2VX7A 2P0IA 1XLAA 3I10A 3U0HA 2ISFA 4PUUA 2YOCA 4FXFA 3UYCA 2Y24A 1J5SA 1E5JA 3B05A 4IL0A 4QISA 3FJLA 3DC0A 5E0KA 2VC5A 1ITCA 1KM6A 3ONBA 3LLDA 3OGSA 5I23A 4J35A 1RK5A 1C9DA 3FXGA 1QHZA 4CN4A 4R5EA 4GZIA 1OD8A 3TFCA 3MQTA 3MO7A 1VBUA 4AZ7A 1HX0A 2DV0A 3FA5A 3U8GA 3ZYZA 3LBOA 4KT2A 1GUVA 2OVLA 4AZBA 2ZFAA 1IWPA 1E0UA 5JBDA 2QJIA 3P80A 4NNCA 3THQA 1JXJA 3B0UX 5CC3A 4F0HA 2HQAA 2QT3A 3U4AA 4MYXA 5U4NA 4XV0A 3SFWA 1GKRA 2PEVA 1UZ4A 4Q7BA 3BW3A 4F2TA 1K77A 4OJYA 1TPVA 4UMBA 2OGYA 4LUYA 3GD6A 1SO3A 2EBNA 4CN1A 1NFPA 4O0ZA 3XISA 4HJWA 4E3VA 2GVYA 1JPKA 3GAYA 1JGMA 1DHKA 4NJGA 2ATSA 1UZ1A 2EPHA 5J5RA 4U4MA 4IP4A 4GKLA 3CM4A 1KBIA 4ZOAA 1R87A 4OKDA 1ALDA 2NUWA 1K70A 4QRNA 2OZ0A 1HP5A 4KEMA 4P8UA 1GHSA 2C1HA 1PZ3A 2FDSA 3UGVA 3HV8A 2WC3A 4JEQA 4A8LA 2YL9A 3LV5A 3PBMA 1KFJA 4Y9NA 3KBWA 1JPHA 5HMFA 4J2MA 4JOMA 2C1IA 2NQJA 2IPFA 1Q6FA 4YIWA 5AYZA 3A22A 2CETA 1N8WA 1A5MC 3T40A 3BJTA 4MB4A 3ORWA 1ICSA 1NF7A 3SQSA 3T0DA 1EP1A 3QN3A 3TYDA 3MCNA 4MUZA 3O16A 3WMSA 4WKFA 1VIWA 2CLMA 4RE3A 4IIHA 4EWND 2WJEA 3AROA 2HISA 2INZA 1TV7A 3WDHA 2CU0A 3FKRA 4J3VA 1S2WA 4UCGA 1BXCA 1T0OA 3G8EA 3W1MA 1TREA 2BBFA 5BRBA 1XIIA 2BNJA 4H9TA 4LRSA 2P0OA 1Z48A 1FP8A 1W3IA 2ZRVA 1OB0A 1FBAA 2X0YA 4O19A 3VKBA 3P8JA 3V18A 4D6CA 4OECA 7A3HA 5DY2A 2H6RA 4LJ3A 5CCZA 5ECVA 2W63A 4QNEA 3R2GA 3ABRA 1UR0A 1LM1A 5D9OA 4RCXA 2HSAA 2CYGA 1CLVA 3B8WA 2V3EA 3EDEA 3W7GA 3BL3A 5SWUA 4HJFA 4MWAC 2WZTA 1MEIA 1UMYA 1KLYA 4ZQMA 2J13A 3AALA 1Q65A 4QBXA 3LXBA 2VZUA 2PGRA 1OYBA 3RX3A 3MSRA 3CEPA 5HATA 4WCJA 3P84A 2PI6A 3AAMA 1OADA 2GSEA 3DYOA 2HNEA 3OZMA 1M7PA 4TU1A 3WNNA 3OLGA 3P74A 3UXIA 4UTMA 3W70A 3ARZA 5M03A 2C3ZA 3PPCA 1B54A 4CU6A 5F2LA 5EMJA 4KCTA 1BTCA 4Y8EA 3DH7A 1GVFA 3DFSA 3B0PA 4WVXA 4F2BA 1CXLA 1TFVA 4JHMA 1Q6EA 1HGWA 4UFMA 3W7RA 4UTUA 4OOUA 1CXHA 5FAGA 4KWWA 3VC6A 1X6UA 3PVFA 5IBXC 3CHCA 4GQRA 1EBGA 2ZZ5A 3L4YA 5EPDA 1W31A 5MF5A 3OW1A 3R11A 3W00A 1PV8A 1XYMA 4R85A 2EO7A 4C6FA 3CASA 1T7LA 2PTYA 1HL8A 1TX0A 3N6QA 2WZEA 4N42A 3DGBA 3D3AA 2Z28A 4UQDA 3TE9A 1AJ2A 3GVQA 1FHUA 4WJ8A 2OSYA 3QTGA 4GUGA 4IZGA 2FPYA 3WLMA 3N1AA 2JBMA 1FH8A 2RDUA 4MADA 3TSDA 3ABQA 5C9WA 2FHFA 3TV8A 2W9MA 1JAKA 3HG3A 3RRAA 3IVUA 4WIWA 3V5FA 2BDQA 4XTDA 3K8LA 3LM7A 3E0LA 1A3HA 1EGZA 2ZRXA 1SU5A 1V6XA 5ABFA 1DPMA 1ODUA 1WAWA 1BXBA 2KAUC 2YZRA 4QE1A 1ZBCA 4FHAA 4Y6GA 1SYTA 1B3YA 3WLOA 5H8UA 2QUUA 1JZ5A 1XWYA 4ZTYA 1UW9A 3RR1A 1W8SA 3SRDA 2R1PA 3C3UA 2ZVIA 1F2JA 2FHBA 2F38A 3OOQA 2G96A 3I3BA 3M41A 2QKFA 1GGOA 5DMMA 1WDDA 3EWCA 2A7PA 1QNOA 3PZQA 3O6AA 4JIRA 4L6DA 4PCPA 4S23A 4FALA 3D5HA 4DI8A 2XHYA 2IKJA 4IF2A 3VX1A 2OX4A 3K4DA 2JGYA 3OBKA 3EWXA 1W0MA 1XP3A 1CX9A 4U3CA 5D32A 2TYSA 2VO5A 2VRKA 1TELA 1UKOA 5FF7A 4AHPA 3R1ZA 5F4SA 1Z7AA 1HL9A 5LIKX 4M6VA 4GQQA 1H7OA 1A5AA 2XSXA 3IGSA 2DSZA 5FJTA 3R10A 1NU5A 2WJZA 2BY0A 4ASTA 4R33A 2DVXA 4N9BA 3W1LA 4GNVA 3TN4A 4A22A 4ZR8A 1LBMA 3CAQA 2BB0A 1MQRA 4HBKA 3T6CA 1X1ZA 3BGJA 1HO1A 1O12A 2E28A 3WF4A 1EX5A 2NXHA 4JFWA 4EK7A 3P62A 2QMJA 4BI7A 3GDBA 1YX1A 2XVGA 3B9NA 3IJIA 3WF0A 3HN3A 4QG9A 1LOLA 1LQ0A 1NWRA 4AAJA 3OG3A 1GPWA 1J11A 3LUTA 3GZAA 3OBEA 1BRLA 1VP5A 4PMUA 3PJWA 4KW2A 3RPTA 1VHNA 1HGYA 3R43A 3JW7A 3W29A 3UY8A 5AC5A 1TV8A 2YIHA 1F3XA 1LWIA 1YTDA 3AISA 1ZQ5A 1ZBVA 1FWNA 1VCFA 3TROA 3RDKA 3TOYA 2CZDA 2PWUA 1WA3A 3WMLA 3VNLA 3GH5A 5I78A 3VIMA 2X1RA 1PYFA 3EWWA 1Q4NX 4CQ9A 2GGIA 2WBGA 2D0GA 2P88A 1UJQA 1VYPX 2GGGA 2ZQ0A 3KX6A 4CEXC 4ZOEA 1SM9A 1UA3A 2O0TA 4E2BA 3UG8A 4Q7NA 2H3DA 4ES4A 4RX0A 1I2NA 4R34A 4YXGA 1F3WA 6REQB 1OQFA 4GIEA 1OFBA 2JKEA 5CXPA 3MVIA 4I5XA 4AC1X 2YA1A 1X6LA 3M7SA 2NQ5A 3HGRA 1TR9A 4JBRA 7PTDA 2XSBA 3T8LA 4KGLA 1PIGA 3GXPA 2DT0A 4HU3A 1Z42A 4FF5A 5HINA 4Z1DA 2VFDA 1I1XA 3UG3A 5G4HC 1P6CA 4ATLA 3T1GA 1QNRA 3KL0A 1UWRA 1JF5A 4CUCA 4IIBA 4D8AA 1BKSA 3GC4A 5DX7A 4U31A 1S3HA 4TTGA 3E2VA 1TVNA 4C6PA 5A2BA 1R3RA 2PP0A 3SCTA 3A3HA 3BLEA 4Y9MA 1J0KA 4N4PA 3VDBA 1VRXA 3WK3A 1E72M 2VR5A 1TZZA 1NOFA 4X9SA 3MPGA 1Q6CA 4NX5A 3SW6A 4KWVA 1UD6A 2QF8A 2OQHA 4GFSA 1HIZA 1J79A 7CGTA 3T0BA 1AUSL 3DFNA 1EPXA 1TTIA 1WPCA 3Q58A 1KGXA 2OQLA 3H22A 3CAVA 2DJLA 2YYTA 2GGHA 3R25A 1S2CA 4PR4A 1R38A 1ZLPA 1JCNA 3MP4A 2YW3A 4JQ3A 4UZSA 1OF8A 3V35A 2RKXA 3L4VA 4KRZA 1TV3A 3IPWA 4Z2KA 1F61A 2W91A 4LT9A 1C8XA 3WK0A 1KFKA 1XCWA 3A3WA 1XLFA 1EDGA 3H2AA 4XD3A 1RY0A 1K8YA 3I6RA 4DYJA 1ECQA 4U10A 1LWHA 3MKCA 1BHGA 1R3VA 4XVDA 1VC4A 3GWQA 3AXHA 5HMDA 5DANA 4HCDA 4J3TA 2CWNA 4YU1A 3M0LA 1TVPA 1JNDA 3NIYA 4B2DD 2PGEA 1GVYA 5HR6A 4U5IA 1DKWA 3V5CA 4B5UA 3M44A 3UA3A 4Q4OA 2NVDA 1P7TA 3S2CA 3VM5A 4BK9A 3ARTA 2PTWA 4QCFA 3E3HA 2O4QA 2WZHA 2X0HA 2A0NA 2B0MA 2FHCA 3GC2A 3CQHA 4XZNX 1HN1A 1TWIA 1ZFJA 3CZGA 1FWSA 3BAYA 3DAQA 3V1HA 3UERA 4AD4A 3IJ8A 4GQBA 3DHUA 1IE7C 1PE1A 2QVHA 4K39A 7REQA 2C8NA 1H1YA 5D04C 1GORA 2PC8A 4B16A 5DXYA 2BX7A 1XFCA 1AH3A 2QHAA 2E1WA 3O3RA 1YNPA 5DF0A 5F1UA 1X96A 4F0KA 3OQ8A 3UD6A 4Q8TA 4FMVA 1SSDA 3H70A 3HPSA 3LTPA 1DJYA 4KIEA 4FNRA 3B0VC 3CAKA 4ZO9A 3VNDA 1T8XA 2XH4A 4UQAA 3K8KA 2PBOA 4RZ4A 5KMYA 3WF3A 1TZ7A 3EDDA 3EAUA 5BU9A 3QMRA 2YSWA 2QUNA 4WZHA 1A5BA 2HS6A 1IXNA 4JFTA 4IWWA 4W87A 3LCWA 4IICA 3OLEA 1AJ0A 3WQCA 3TK7A 1RPKA 2Y85A 2ZADA 3MO4A 4QHRA 3URNA 3F4CA 1BYDA 1O5RA 2E5BA 2VOMA 4IX2A 3IACA 3V4BA 4FOUA 2HBVA 4DWSD 4RNFA 4WF7A 7TIMA 3H55A 3CU2A 1GYLA 2G3IA 3ITGA 3ZJKA 1H0IA 3ZS4A 2OLSA 1DJHA 2AMXA 4IUGA 4YTQA 3MI2A 3S5OA 4QS6A 1J01A 1YE4A 5T9CE 1V3JA 3E0VA 1N82A 3SUSA 5FJRA 3COTA 1V02A 5FSDC 3N2OA 3W82A 2CBIA 2GK1B 2CZ5A 3R5EA 1J0YA 1K7EA 1A0DA 4MB5A 2H3BA 3BW4A 4Z2HA 1DJGA 3CMFA 4OBRA 2RDWA 5CSYA 4MAZA 1CXIA 4S3GA 3HG5A 2E6AA 2P1FA 4UMAA 3AMGA 1EC9A 8RUCA 3HG2A 3ZJ6A 3S8HA 3PZNA 2VEFA 1W9PA 3BXWA 3P0XA 5F2MA 4DUWA 3WF1A 1E6XM 1A3WA 1WNOA 1RALA 1UB3A 4NJKA 3OG2A 1EP3A 3N14A 3ZLGA 2DZAA 3QEZA 1N2VA 1EWDA 2PDBA 3QHMA 3GNNA 3GNXA 3FJ6A 1IXPA 2W6RA 3G1YA 1ODZA 1LQ2A 4QSFA 3WBEA 4DBSA 2FZ8A 2V2CA 3G1XA 4DLMA 2C7FA 4RW3A 2FZ9A 3II1A 1UA7A 1KWGA 1S3TC 1VF8A 2EHHA 3UVIA 3IJ7A 5T9BG 2CZEA 2Y5EA 4RK8A 3M7WA 3HBLA 3STGA 4MLJA 3VGHA 4RE0A 4A8IA 4YNGA 2E4TA 2PP1A 1WV2A 2OU4A 5I6SA 4AZ5A 3VOIA 2EPNA 2GLKA 4WQ6A 3SI9A 1CGWA 1TPEA 4ZQOA 3WSUA 3QFEA 1JDEA 4IPNB 5A69A 3W7HA 4B5SA 4OT7A 4CQCA 3NQVA 5H91A 3THAA 1CW2A 1XC4A 2A3BA 3BK0A 2R1MA 4FNUA 5C0QA 2J9ZA 2WSPA 1GYMA 3WEMA 2JEQA 4N9EA 5C6MA 2XINA 4P8XA 3BLIA 1GOIA 4Q4PA 4DO4A 2AQOA 3O2LA 3FHQA 2Z6JA 4D72A 1UKPA 3C0LA 4Q8PA 3PSVA 2G0WA 4IPJA 1WZMA 1M41A 4JPGA 2J7FA 4LYQA 3W02A 2VCCA 3KWXA 1PVNA 3MSGA 1KQZA 5BU6A 4LAUA 1OFOA 5A8NA 2J7CA 3WUEA 4TO8A 4L4LA 4R7JA 1LUCB 2BFGA 2GVLA 3APTA 4DXKA 1RD5A 1E71M 3CL8A 4M80A 1CXFA 3EX3A 4EANA 5GJNA 1EHAA 2D1ZA 3CBWA 4Y8FA 3ZR5A 4BWLC 3Q67A 4I6KA 4JXCA 2DEPA 3N3MA 3TYEA 2HROA 3HIJA 4Z08A 2CWXA 3QV6A 1UWQA 2XZ7A 4NIRA 1ISVA 4CNSA 5CZTA 2QLYA 4HYVA 1E15A 3ITYA 4D6GA 3F2BA 3BMXA 4Z17A 5CPNA 2HCVA 1D8CA 3BGGA 4Y7EA 4C7DA 3BV4A 3L4UA 3KOXA 1GONA 4UTWC 1BQGA 2E5DA 4HZ7A 5AVHA 4GIYA 4Q8MA 2PWFA 2FB3A 3LRKA 2Y0FA 3H4GA 3EPMA 2NVCA 5TF0A 4LPCA 1KTCA 2BV9A 5FEZA 2FMOA 1QPQA 5KSWA 2ZDSA 1ITUA 2DT3A 2OOFA 4P7LA 1UBPC 2TMDA 5DELA 3OA3A 1PZ2A 1XSJA 1EIBA 1L0PA 5A8QA 3UCQA 3U3HA 4YCOA 3TN3A 3UXAA 1JI2A 3RJYA 5C7HA 4C6KA 1BYCA 3F5KA 1W54A 1UYQA 5EY5A 2ZXQA 3GVWA 1B1YA 1YNYA 2YJQA 3B40A 3PFRA 1C7TA 3MHFA 5FSEC 1O7AA 4CU8A 4F2UA 2DY3A 3WD2A 3NDZA 4HNVA 1B2YA 2WVUA 1DORA 1R47A 3GTNA 1SFSA 4S3BA 2PE4A 2ZA2A 3CHEA 3UA4A 4A35A 3E02A 6TIMA 1WQ5A 2X16A 3PZGA 4ADTA 1B57A 4M6QA 2Z24A 1XBZA 4AZCB 1VJZA 1XRTA 4GD0A 2Q01A 1UCWA 3ARPA 5HUOA 3GBEA 2V67A 1D7KA 4C6NA 3LCLA 1GVQA 2X05A 3W7EA 4AMAA 4M19A 3OB8A 5K2ZA 3BZJA 4JEJA 5JBEA 3IVSA 3M4HA 4DO6A 2PDXA 2ZRZA 1DQWA 3WLPA 4JIPA 4J3WA 3CZEA 1M7XA 4V33A 3R94A 3L2IA 3P6LA 5AHMA 2J78A 4Y96A 3G1AA 1TYGA 5EMYA 4CD7A 1B3VA 4BQ3A 4JN8A 3H4WA 2FVKA 1OYCA 1UH4A 1BWVA 2I16A 1V8EA 2Z4GA 3ZT6A 1R3WA 1V0NA 1AL8A 3PNUA 3R8HA 2KZHA 4P7RA 1Q6RA 4HK7A 3A9BA 1VPQA 2FZMA 3RO8A 1MZRA 4DQWA 9XIMA 4ZEPA 2WVSA 4RV3A 3WCZA 1K8CA 1HNYA 3MCOA 4GJIA 4DO7A 5M2FX 1WZAA 2LLEA 5A94A 4W8LA 3QW3A 3UVAA 2J8TA 3LGDA 2NWSA 4HZ6A 3GU2A 3DG7A 3TSBA 3O05A 4W8AA 5E0CA 4EP8C 1QO5A 4G5DA 5F4WA 3M07A 3MI6A 1L6FA 1TJRA 2WSYA 4KCVA 2A4AA 1A0EA 4FX8A 6ENLA 4Z1CA 3KBNA 4B15A 1K9EA 1RBLA 2Y5SA 5FF2A 3Q37A 4ZMGA 3GTIA 2ZTJA 3UCDA 5AOUA 1T5AA 3LNMA 3WQ4A 5I3IA 4HNLA 4FPSA 2Q8XA 4N6FA 3RK8A 4E8DA 1W2VA 4UQEA 4W9TA 3BC9A 4M82A 4ADSA 4B5WA 1X38A 4YTRA 3NVDA 4UFIA 1XG4A 3H23A 2QUMA 4HSOA 4DAIA 2VEMA 4NAFB 4WK9A 3WH9A 3FYPA 1EUNA 1OFQA 5FCZA 1EOMA 3SM0A 3VE7A 4JTFA 5DRIA 1A5UA 1FWFC 3TMLA 2BGNE 3QV9A 3VDGA 4GYJA 2NXGA 1ZAIA 2DT2A 1PIIA 4UBPC 3CS2A 3MY9A 3M6DA 4Q4QA 3ZWTA 3I3EA 3LPOA 5CAKA 2MNRA 3AS1A 1K3UA 1MQPA 1CWYA 3AQUA 1NDWA 2PDJA 5KETA 5AYBA 3EOSA 3QKZA 3AS3A 3C2YA 2ZX9A 4EPEC 2P5NA 3UZJA 2EG8A 4C6IA 2AL2B 2FQIA 4FLQA 2XYLA 3IJDA 3VA8A 3RO6A 4Z0SA 3GDMA 1SZGA 3N9KA 3NCOA 4DJDD 1XX1A 1L6GA 3NQ8A 1HQTA 2FIQA 4PRWA 1GQIA 3ICJA 4ZSTA 1DOSA 3MKKA 3AJXA 2CW6A 4JY8A 3VCNA 3EMQA 4J2PA 4AH7A 4WKAA 4O28A 1ZL1A 4NXKA 4B5VA 5HPCA 1OZMA 1G69A 5HQEA 4XKMA 4L65A 5AC6A 3VGEA 5BNKA 5CBJA 3VZXA 4TX9A 3H6OA 3DHDA 3K1GA 2E9BA 3HF3A 3OIHA 3HPAA 1L6SA 2PU0A 1MNSA 1ESWA 3PPGA 4V1YA 1ADOA 2WNNA 4F4RA 1SVDA 1S46A 4BI6A 5EMKA 3FAXA 1DWHM 4CGTA 3CLMA 4HSHA 1LOQA 4Y9PA 2YZ5A 1L8PA 5IFPA 1JZ2A 3NXFA 2WMFA 3DBPA 4XSLA 1OCQA 5FOOA 2UZ9A 4C6MA 3UESA 3FA3A 5JQ9A 3R89A 3GZ3A 3D47A 3P8IA 1O95A 3A4WA 3CO4A 3KEHA 4PA8A 1PTGA 4DJED 1SGJA 1MWOA 3O07A 2WSQA 1MZHA 4JKLA 3E0FA 3RU6A 3VK5A 3WBYA 3GG1A 4NQ1A 1HTIA 2OJPA 5AHNA 1GEHA 4PCSA 1VH7A 3VOHA 2IPWA 4IGNA 4RKAA 4MKVA 3DUGA 2G3FA 1FX6A 3KM8A 3ZM8A 2PDLA 1A4LA 2GJXB 3CQKA 1NOWA 2FFCA 3T0CA 1SR0A 3NZ1A 4EOUA 1TWWA 1XPGA 3CLWA 1QI0A 4QLKA 2WPGA 1YIXA 1DTUA 2C15A 3K4WA 3IGUA 4WEVX 1TWSA 3KXQA 3EB3A 4E3TA 4A2SA 3WDPP 4GIAA 3RCMA 2NW0A 1ME8A 3CEUA 2V0TA 3C8NA 1YKWA 2VGIA 4M8UA 6TAAA 3UR7A 1V3MA 2WHJA 1ITQA 1DJQA 2E3ZA 3AIUA 2FTWA 1VJIA 4MWAD 4PH6A 3DESA 1ZAJA 5CJNA 3NSMA 3TQKA 4QG8A 5IHRA 4BA0A 4EAYA 3S6OA 4QNWA 1QK2A 3MUCA 1GOXA 3WQ8A 2YL6A 4BY3A 2CITA 3M5VA 3FOKA 1F9CA 6ALDA 3TYUA 2BHZA 3T07A 3TR2A 5LNVA 1S2TA 4FF7A 4KS0A 3GXIA 2ACUA 2CLHA 4GVHA 3GG8A 2V5LA 3GDKA 5K4XA 2OCZA 4FOKA 3UR8A 4EX4A 2BSLA 3ABZA 1YDNA 1F73A 2XIQA 2HPIA 3MWCA 3L67A 3KBMA 2DGAA 3G6MA 4A3YA 3KHDA 4LAMA 3VIPA 3EXTA 4MKSA 1K8XA 2UY5A 5DBTA 3HJZA 3TTQA 2H8ZA 4B91A 4LVFA 3CWHA 3TW6A 3PJXA 3DI1A 1FWRA 5MHBA 2IKIA 1DXIA 2BWGA 4ADUA 3MU7A 1TV2A 1DP0A 3JVAA 4IMDA 4H83A 3RCNA 3WMCA 1OC5A 4ZZ9A 3F5LA 3NL6A 4YTUA 2VVSA 4PB3A 3FJ4A 1S39A 4G7EB 1SFTA 1KD0A 1MFUA 2A79A 1ZSXA 4BWLA 4I6VA 1UR1A 3LBMA 1EZWA 4A3QA 5H1WA 3LK6A 3W26A 7REQB 4HT3A 2WPBA 5D05A 4HHMA 2WJFA 4ERGA 2PBGA 3FJNA 1HG3A 3TONA 3UWUA 2QJNA 4NJIA 4BF5A 2Z00A 1TRIA 3ITTA 4IP7A 3W87A 1ZJHA 1K9FA 1LZOA 4RDYA 2B7OA 4ZXOA 4LF1A 5LGZA 1UP2A 4Q22A 1ISZA 1LL4A 1EJXC 1FUYA 2Y1HA 3CUZA 1GKQA 3PN8A 1L2UA 3HB9A 3LEPA 3SIZA 3T7VA 3W84A 2YKKA 3ARVA 5A3HA 4CQAA 1P7TB 4ZFMA 4KEZA 3L66A 3NQBA 5CH9A 4LU0A 4Z2IA 3WLTA 3LSBA 3VIOA 5DBUA 3SADA 3L2LA 2R6OA 2V81A 1KXTA 4NZCA 2H9AA 4AUBA 2RHGA 4GIRA 3FLUA 2ISSA 2WW5A 3E5BA 4WUIA 1Q45A 3S9IA 1P0NA 3T4CA 5C2GA 4AD0A 4A3RA 4IG2B 5A6LA 2XU2A 3C2OA 4WGHA 2ZOXA 3AIBA 4ACZA 1HKWA 1I2RA 3UJ2A 4DF0A 4BI5A 3LZ3A 1EYEA 2QCCA 1UIPA 1AD1A 1XCFA 1OFDA 3QY6A 1QJWA 1O4UA 2V5KA 4H3DA 4LUIA 8XIAA 4LCRA 5CLTA 4DZIA 1MEHA 1LP6A 3VO0A 3FNDA 2VFHA 4C91A 5BZAA 1TA3A 2YFNA 3VNYA 3FDKA 5I3KA 3TCEA 3KHJA 3MVTA 4GXMA 5ABTA 4J40A 3R4IA 3E9AA 4MDPA 3S5SA 1G01A 1ONEA 3MBFA 2HWGA 3BAIA 3LHYA 4PBFA 1QNVA 2IQ0A 1OT2A 4J28A 3TDFA 1AMYA 1DJXA 3DHPA 4NF7A 1XSKA 2QPXA 3EWYA 3JR2A 4ZQRA 5FKYA 4QJ3B 1KRMA 1SMDA 4O52A 4JR5A 2CPUA 3UG4A 2ZZ3A 1IEXA 1ONRA 3T2OA 4PBEA 2HE5A 3ARSA 4HMEA 4A29A 1V02E 5CJMA 2BODX 2CESA 5A2AA 3TLLA 5HMEA 1EJ7L 1TV4A 3HA1A 2PA6A 1KBLA 2XH2A 3O1NA 1QNPA 2PP3A 3EOUA 1FWGC 3GB6A 3TTYA 3AICA 1KM4A 4F9JA 1TPDA 2CLEA 1VLIA 4GO8A 3KP0A 2X1IA 3N4EA 4ORIA 2VI0A 1CGYA 3GVRA 3KLKA 3B8SA 5D2XA 5ECUA 3IIPA 3AHYA 4DRSA 4MY8A 4LH8A 3L0NA 3NUKA 1JGIA 4ZO6A 4CLMA 1VZWA 3QMTA 3VKJA 4UTIA 1I75A 3KUMA 1XLIA 2V5JA 4ZB2A 4HPHA 1YDOA 3ATZA 3EWZA 1E40A 1UKSA 3UEQA 1QBAA 4BS0A 1L6YA 3F2CA 2ALDA 1JVNA 2DSVA 1DJZA 4Q33A 2DZVA 2WJDA 4I7UA 2PMQA 3CWOX 3U7BA 3RGTA 4PMVA 4U28A 3C56A 1EUAA 3EZ4A 3HQ1A 1U83A 5HK4A 2BY2A 2D73A 1OG6A 4MOZA 4QSHA 3ZQ9A 3PTQA 2ZZ6A 3CH0A 2J27A 3CWNA 4ALDA 4CCZA 2HDJA 2BHYA 1V03A 3NXLA 3KS6A 4AYSA 3EMCA 4OE7A 3WLSA 4K37A 2ALRA 1IHIA 3DECA 4MMWA 3QTPA 2WXDM 3HFYA 2ZYFA 2VMFA 4I9JA 5DFAA 4V1XA 1QATA 3WLRA 1D2KA 3KRSA 3VIHA 4RV8A 2WWCA 3EYPA 1LLZA 3KL3A 4PODA 1ADDA 2B4GA 2E09A 1R0MA 4PUEA 3CPRA 3PSWA 3PWGA 1V79A 1NFGA 3E0IA 5CG7A 1M53A 1R30A 3SQMA 2C14A 2QW5A 2E67A 4D2JA 1YNQA 3MDWA 3SEPA 3VMOA 3UWQA 1V4YA 3QPEA 2P10A 3PPFA 5CPLA 3MMWA 4CNUA 1ZPTA 3S2JA 2OG9A 5ABGA 3T08A 5DXXA 4PGLA 1GTHA 1KV8A 3H2OA 3VIFA 1S5WA 1CEOA 1G9HA 3VDCA 5HUPA 3FEMA 3QPZA 2YA0A 2INEA 2XM1A 3CUFA 3OVRA 1WYIA 4RLIA 4S1FA 1LRNA 4JTKA 1VPYA 3USBA 2FH8A 3KOYA 4Q4SA 1V3LA 3WO8A 3B8TA 1MW3A 5A8GA 4CQBA 4S39A 4R3UA 1YTEA 4JNMA 3NGJA 4IXXA 4WOZA 2QULA 5E5CA 3FN9A 2Z1KA 3GFXA 3F4WA 3LN3A 1E6NA 1WKFA 3UPMA 2V3GA 3BPWA 2PB1A 3F7JA 2ESCA 2DJXA 3KP1A 1UP0A 2OEJA 2VOTA 3SY8A 1RQEA 3IJLA 3W0KA 1AZ1A 3LTYA 4KCWA 2DSKA 3T81A 2GZXA 2XVKA 3R58A 3DKLA 1W1TA 1Z32X 1AQMA 3SY5A 4IGSA 1IT7A 3PG8A 3NSXA 1JIBA 3C61A 4QQ3A 3NQGA 3GU1A 4EIVA 1Q7ZA 2E8YA 3TSMA 3UYIA 1PO9A 4HKPA 4XAYA 4EPKA 2QDGA 5A8OA 2GSJA 2FH6A 2ISVA 2WLYA 1V6VA 3S1GA 1UQYA 1JFHA 2Y7FA 3C0QA 3S83A 3MCMA 3K2GA 1VJSA 1OM0A 4UB9A 4IQEA 4H2HA 2Y7EA 3EDFA 1SO5A 3WLJA 5AFDA 3CO8A 1DJIA 1QI5A 4ZQNA 4J1OA 1QAPA 3WNPA 2ZX8A 3A47A 1V0KA 4NAFA 3FFSA 1UKTA 2CBJA 3RILA 2VEGA 3A24A 3LBCA 4XKYA 3AMCA 3WK1A 4G8TA 3AXXA 2GWNA 2YXGA 3JRKA 1GOMA 1LLOA 1TE1A 2DORA 3S2MA 4JGDA 1I4NA 2AGTA 4NASA 1Q3NA 3ZMRA 1S5TA 2NQLA 2WC7A 4IQJA 2OELA 1YBQA 3QR1A 4EVZA 2FB2A 4E8CA 4QJ4B 2F6KA 2H9AB 1BVZA 2CXGA 2ZIDA 4RZ5A 1R46A 4X2RA 2CBUA 3H2EA 3HURA 3ABXA 3OVQA 3QMSA 3USZA 1Q6DA 5I7GA 5AECA 1XW8A 1JDFA 4D71A 4MZ8A 3WKZA 3T09A 5H6HA 4EF9A 4O10A 1FWBC 1EX1A 2ON3A 3HJEA 2DIEA 1EEPA 2JKPA 3LXCA 3TAOA 4DZ5A 1Q13A 3GTHA 1WZLA 4CEUC 4MZ1A 3MJMA 4XZMX 3CTTA 1K7XA 4OZOA 3L4ZA 3WNKA 4JTUA 1YDVA 1K02A 3E38A 1UOZA 2DUAA 3AIEA 1RLDA 2WCGA 4OIFA 5DN1A 4UIOA 3E2SA 1BLIA 4G6CA 4WY0F 3GG0A 4AU0A 1G7UA 4XD5A 1EF3A 2CHRA 4C6LA 1R7AA 2IPGA 4XSMA 5AYXA 2RFGA 3A4AA 3W24A 1H5VA 1FWIC 5CPSA 1NM9A 2B7PA 5TAOA 4FOJA 3GM8A 4JDBA 4UFLA 3ZVHB 3BO9A 5FL0A 5E6ZA 4DI9A 3UXLA 2ZZ1A 3EKLA 3UZ5A 4FR1A 2C18A 4XBKA 5CSRA 5D09A 4JKMA 3BOFA 3ZWSA 3O6DA 3WYZA 4ECLA 4XK2A 3C86A 1PCKA 1V6UA 3TJIA 1UC4A 1C9WA 1ZUAX 1HL2A 1DWIM 1P0BA 3T44A 3S1UA 1OCNA 1XLDA 1R2TA 4ZO7A 4JFVA 3W83A 3BQ5A 1WZKA 3EWUA 4L5ZA 3BH4A 4H6KA 1EFZA 3A3XA 5G2HA 5E0FA 2E0PA 3ZXWA 2V3FA 1HKJA 2VGFA 3R0KA 4L80A 3CIXA 4MB3A 3VIGA 4UQ9A 1AL7A 3CZLA 4BHYA 4O1DA 3L0GA 2QVNA 3OBAA 2EG6A 2H90A 3WBXA 3ZT7A 4GO9A 2CZFA 4GFIA 3E2RA 2OEMA 3QV7A 4R88A 1H1ZA 3WDJA 4BEUA 1UWAA 3BANA 2WB5A 4E0CA 1VRDA 4XAZA 4DN1A 4HA4A 3NYZA 2X2GA 3ZIZA 2V2DA 4IMGA 2ABBA 3RM9A 2EPOA 2BASA 2XG9A 3W1XA 5BXPA 1H3GA 9XIAA 2EGZA 2ONEA 3CT7A 1EH9A 3L4XA 4UNLA 2G4JA 1KFLA 1FFRA 1PAMA 4C6OA 1Y7VA 3SUWA 1F8MA 2EQDA 3EKZA 9RUBA 4AY1A 4ZOBA 2JIWA 2F2KA 3F4VA 1KFCA 2CNCA 2CLIA 4ZTXA 3HMJG 3GIYA 5LHEA 3BAWA 1BRLB 5A1AA 3WQDA 4L4OA 2NUYA 3KVMA 2X8RA 3JU2A 4AVNA 1TTPA 3CV2A 3SY1A 3HQOA 1UR3M 7ODCA 3GNRA 1VFOA 3G1SA 1JCLA 3U6WA 4TMBA 3NQ2A 4CCDA 4PTNA 2FZDA 4I3GA 3VIJA 1W9XA 1YEYA 1S1PA 3W6YA 3WBWA 1W2PA 3H2FA 2YDQA 3FK4A 4O53A 1XQKA 3APGA 3U48A 4ML9A 5EFFA 2P76A 3CIVA 3GKFA 1JI1A 3H7RA 4D8ZA 4BQ2A 2QMKA 3M64A 2BY3A 3VGDA 3WF2A 3WQGA 2DDXA 1AH0A 1FDJA 1GVOA 4XD4A 1HKIA 2WVVB 3M0YA 3QC3A 1NSJA 4GK8A 1J6PA 3URQA 3AS0A 2DIJA 3QZ6A 1WB0A 4O1FA 4KH2A 1XKYA 1TMHA 1VBRA 2Z1WA 4QS5A 4RR4A 3UJEA 2REQB 4DZHA 1J0IA 4TR9A 3ZO9A 1UR9A 3T9PA 3S42A 1TX2A 5D8ZA 1AVAA 2IS7A 4C6BA 4UFHA 4LXFA 4FO4A 4CU7A 3VKCA 4QCEA 3VUSA 3GHRA 3IVTA 1E0TA 1J12A 1MXGA 3CTLA 4GLEA 2FDMA 3WN6A 3N3TA 4NZ1A 4DJDA 3THDA 3TR9A 4DUVA 1Q6LA 3SN1A 1QI3A 4P5UA 3DZ1A 5T91A 1ZTVA 3OEXA 1OX6A 4XZBA 1RXOB 2PODA 5E6YA 4XBJA 1BF2A 4M29A 1X98A 1VS1A 3AIWA 4XQ6A 3XINA 1QW7A 2GJXA 3VVGA 4GZEA 4IFKB 1IIHA 2J9XA 3BE7A 2YPIA 4QR6A 2ZX5A 3TCSA 3B8IA 1UD4A 5EYWA 1QFEA 1GEQA 2BOFX 3TFXA 1JD7A 3GKAA 2ZUUA 3DFTA 4P7OA 1W9UA 5HWMA 5FF4A 4JTEA 2X09A 4DWSB 3R6IA 3SCPA 1RJQA 3QYQA 4JN7A 4DJEA 2VR2A 5DCEA 3M5YA 1JZ7A 1JQVA 1RLCL 1H1NA 5GNXA 3B8UA 3CYVA 3RMEA 2F7FA 3PBUA 4O15A 2WVVA 1MI3A 2WKLA 5A95A 4FR6A 2XJ7A 1LQAA 4H8UA 4LWWA 1NIUA 3DIPA 1IGWA 3SRKA 4AX6A 2AOSA 4YVPA 5K9CA 2UBPC 4EXAA 7XIMA 3ID7A 4YMZA 5B80A 4UR9A 4GYFA 2O9PA 1RAKA 1GZJA 4XIMA 4OFCA 4A8RA 1M9HA 2D23A 2GQ8A 1RD6A 1E6RA 2NLIA 4LF2A 1WXZA 4XAFA 2PURA 4JHOA 5F1VA 4ICNA 3N19B 4MIMA 4KWUA 1QUMA 2XUCA 2INFA 5CC6A 1F3EA 4YTSA 2QIIA 5HMSA 3UT0A 3DYMA 2Z2UA 4O14A 1A4MA 1EPVA 5KZ6A 3VUPA 1O6IA 5FL1A 1DIKA 2FJKA 1D9EA 1RSCA 2DUZA 3N34A 3TQPA 4JY9A 1V6TA 1XKJA 1OD0A 2W61A 4B92A 1H7WA 3NOYA 3AIVA 1E73M 5G1MA 1XRVA 5KZEA 3LU2A 3TLQA 4M81A 2EPMX 3EDKA 2VEIA 1TPWA 3FGCA 3L4WA 3UWEA 1H51A 3UWWA 4GINA 4NYYA 2X1SA 1WKEA 3GNOA 3LCHA 3WD0A 1H49A 3CV6A 3VXGA 3ZSSA 3D46A 3J7HA 3W86A 2VHLA 3EX4A 2ZWZA 3AIRA 3T05A 3P61A 3QM3A 4U33A 4GHRA 2PTDA 3F4NA 3LI1A 4AXNA 1U33A 4J4KA 2VFIA 2OX1A 4E6MA 1Y5WA 1JQXA 2HZGA 3PTMA 4ZQCA 4YVVA 4IIDA 8XIMA 5DT7A 5IOBA 2QDDA 4I9AA 3DN5A 1C8QA 1A49A 3B06A 2HJPA 3ZJ8A 2QCNA 3BG9A 5LKYA 2CXEA 5BROA 1TJ2A 4NNAA 1GT8A 3MWAA 4JTRA 2JALA 4NILA 4XG1A 2ZUTA 4XD6A 3NNTA 4FLSA 3EEGA 2J79A 3N12A 1NWUA 4A3UA 1Y0EA 3LX9A 5CSUA 2WANA 4AC7C 4B90A 1A0CA 2Y8VA 1HUVA 2V8ZA 1K1DA 4CVWA 1MFVA 3PJUA 4M6PA 1EDQA 1OZQA 1LT8A 2Z26A 1EOKA 4GACA 3CV7A 4O0QA 3W27A 2OKOA 4V2XA 2J24A 3KAOA 1SZNA 2WMHA 3WH6A 1EHNA 3ARXA 4HQVA 1DJNA 3NQAA 2DQXA 1YYAA 2PZNA 3M6YA 2HVMA 5BYWA 4JNYA 1W1IE 3W2UA 4EWJA 3VOJA 3GW0A 4IP5A 2ODOA 4JYFA 1OX5A 2PF0A 2XGIA 2ZA3A 3ITXA 5CBBA 1MUWA 4DJFC 4NJHA 4ERIA 1R85A 2DSUA 4HNUA 1HW6A 2P3ZA 4HHHA 1NQ6A 4F40A 2A2IA 2V5DA 4PCTA 4H6EA 5EBAA 1J5TA 1ITXA 4O1CA 1LRQA 4S3CA 3AMLA 1QPKA 1FWDC 1PKNA 3U5YA 1NFBA 4NAEB 1Z8AA 1SZRA 3S1VA 4HZMA 2CHNA 4PMOA 3ISIX 1TJ1A 4J27A 1X7FA 2VUYA 4IM4A 1JYXA 1GOWA 1OBAA 3CB3A 1BF6A 2FZBA 4H1ZA 1FXPA 3NQMA 4YHEA 3W85A 3RPMA 2OPJA 3NQEA 3Q2DA 2W79A 4EPDC 5HA7A 3FX4A 5A6MA 3QSRA 4US6A 5LXXA 3I3DA 3OODA 3GXNA 4NYUA 1SSGA 2PUZA 5DQPA 1ELSA 3CHDA 3WD1A 3SN0A 3LS9A 2X7WA 3FW6A 1O1ZA 4NRRA 5EB8A 2YFOA 3MUZ1 1IT8A 3U7VA 5D02A 3R8GA 4U2YA 5HPOA 4RZ6A 3GHTA 1K9TA 1RA5A 4PUNA 1V3IA 2F2HA 2DU2A 1MNZA 4RNJA 1VCVA 5I07A 2VD9A 1SUXA 4PMJA