3VTRA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 e328a complexed with tmg-chitotriomycin
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTNHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVAPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERFVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/antibiotic
molecule keywords N-acetylglucosaminidase
publication title Structural insights into cellulolytic and chitinolytic enzymes revealing crucial residues of insect beta-N-acetyl-D-hexosaminidase
pubmed doi rcsb
source organism Ostrinia furnacalis
total genus 194
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vtrA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3vtrA01
3AS0A 4MNJA 1EA9C 2PC8A 1KWKA 1XD1A 4JCMA 4MB5A 1W91A 4XV0A 4V2XA 5CPQA 1KFWA 1WZKA 2EPMX 3MU7A 5GNYA 4GZIA 1E6QM 2X1IA 1NOFA 4BS0A 4MPKA 1J12A 4NF7A 3N15A 1FP9A 1WO2A 4Z2GA 5A1AA 4MTVA 4W87A 3WEOA 3PHAA 1C90A 4H41A 3GNPA 1ZBVA 1C8QA 4J3UA 4WSKA 4JL1A 3OIHA 4W85A 1D2KA 3ARZA 3DC0A 2GJRA 1DWAM 3QHOA 1E0WA 3W82A 5ABFB 3POCA 2VVSA 4NRRA 5DFAA 4Q22A 3WD0A 4C7FA 4PSRA 2DDXA 2WW5A 3CZEA 2J47A 3VIMA 1WCGA 3ZQ9A 3GYCA 1CLVA 1M01A 3AIVA 2ZE0A 4PTXA 3G6MA 2VZUA 4HPGA 2TAAA 4H2CA 4D72A 1C91A 1EHAA 4BQ2A 1GOWA 1V6XA 6TAAA 4M29A 4AZIA 3WUBA 1I1XA 1BYCA 4B15A 3FHAA 1WP6A 4P8VA 4HPHA 5ABHA 1NWUA 1UD4A 1NP0A 3WH8A 1HVQA 2CITA 4CN1A 3L4XA 2CPUA 3TONA 2D22A 2GJPA 2X09A 3K4DA 4B16A 1SFSA 1JZ3A 3AJ7A 1E3ZA 2WWDA 2Z1SA 2FHCA 5JBEA 2V5CA 1H41A 3FNDA 3WL0A 4MDPA 6CGTA 3WKZA 3ZT7A 4AY1A 2EPOA 4AD2A 4JL2A 2W91A 1UD5A 3BLKA 4WJXA 4X0NA 1UKSA 3AIBA 3MMUA 4W93A 3OLIA 3AISA 3VNZA 5A8QA 1B1YA 1R87A 4ZE4A 2ZUWA 2NT0A 1OGBA 1EDGA 4UQCA 1QPKA 4BCEA 5IFTA 2CEQA 2ZUNA 4PSPA 1MYRA 1ISZA 4U3AA 2G3IA 1D7FA 3VGEA 4DUXA 3GXDA 4D6GA 3CGTA 3DYPA 2HISA 4U5IA 1EDTA 1LG2A 2GSJA 1RH9A 3PZMA 4ACZB 4OOUA 3GBEA 4PN2A 3AIRA 2VZOA 1JGIA 3OZOA 1OSEA 3N11A 3WDPP 1GORA 4LYPA 1U30A 4PMOA 3FY1A 3WQ6A 2BY3A 3ARXA 1ZBCA 5I24A 2DT2A 4CCDA 3PZNA 1KBKA 3LPPA 3AFBA 1VRXA 3CUHA 2Y2WA 1ZJAA 1H49A 1C8YA 2DPEA 4H8HA 1MQQA 1TG7A 3WUFA 4AEFA 3QHNA 5IXEA 3KL0A 1JD7A 5CPSA 5LA1A 1J0ZA 1D3CA 3O9NA 1GW1A 2WKLA 5A6KA 3VM5A 1ODUA 3VD3A 2GK1A 3NDYA 4NSBA 2WYSA 1FFRA 2WSPA 3K46A 3K4AA 1G01A 1KQZA 4MB3A 1CWYA 5D9MA 3RPMA 1BYBA 1KGXA 4OIFA 4KGLA 4W8BA 1M04A 1IT0A 2WCSA 1GOKA 4GZEA 4AD3A 1V6WA 5A3HA 4ML4A 1ZS2A 1EQPA 3QR3A 3LMYA 4UR9A 2G3JA 3II1A 4TVDA 9CGTA 3CZKA 3UCQA 2VQTA 2VJXA 4AD4A 5HPCA 4CU6A 2D23A 4JAWA 3AS1A 1E72M 3CTTA 1CGTA 4WSJA 3QHMA 4P7OA 1SMDA 1UG6A 1M7XA 1CDGA 2J77A 4CD6A 4W5UA 3F5LA 1XD0A 2DT3A 1VB9A 5HXMA 4AWEA 4ATDA 1JZ7A 1JYNA 4CVWA 4XZWA 2CBIA 3SUWA 1FP8A 2ZXQA 2CHNA 4Z2HA 1YQ2A 3SCRA 1KXHA 3K8KA 1HP4A 4LPCA 1XSIA 4UQDA 1BYAA 3WNOA 5E0FA 3EBVA 2VI0A 2XJ7A 3ZJ8A 1HJWA 1ISWA 1QVBA 2D0HA 4YHGA 2A3HA 5A94A 5KEZA 1WDRA 3FW6A 5GQBA 1CBGA 1PZ3A 1OGGA 2CHOA 3N12A 2F61A 4J3VA 4AZBA 3WEZA 4LXFA 3RO8A 3MKKA 1W9XA 3A4WA 2YA0A 1TZ7A 2DT1A 1V6YA 1GZJA 1K9DA 3BSGA 3VIOA 1VEOA 5CPTA 1CGUA 2BVYA 4W88A 4S3JA 3CBWA 4TVUA 3OG2A 2YDQA 2QHAA 2E3ZA 2JE8A 3VM7A 1UYQA 5FIPA 1LG1A 4BF7A 1QBAA 1IZKA 4XX6A 2D0GA 3SCSA 4UQEA 2BNJA 1XH2A 4HA4A 1J18A 2EPLX 2E0PA 3KE0A 4UCFA 2D20A 1NM9A 4IPLA 2YA1A 1ZBWA 2OYLA 1KGUA 4DUWA 3VGBA 1LF1A 4MB4A 3W81A 4MJ2A 1BG4A 4PMYA 5IHRA 2CBJA 2YBUA 5I5RA 4GKLA 3ZOAA 3TTOA 3GM8A 3NIYA 4LYRA 4JZ5A 4QLKA 3HN3A 1Q6GA 1XCWA 1HX0A 1UKOA 2QMJA 2W66A 5EFDA 5CSUA 1V3LA 1TR1A 3F5JA 5DMYA 1UR1A 4X9YA 5D8ZA 2QLYA 3ZMRA 5JBDA 2WM0A 4D6IA 1MWOA 2WMGA 2G41A 3TTYA 4AZCA 3CUIA 3MUZ1 2RGLA 1V3IA 3TTQA 1GNXA 1LL6A 2A3AA 1UH4A 5GPRA 2CNCA 2WBKA 3CPUA 5HBFA 1JXKA 3NSNA 1V3JA 4WIWA 1E1EA 4B9YA 2BXYA 4Z2IA 3WDIA 5HDRA 3PZIA 5BWFA 3BMWA 1BHGA 5FL0A 1E4IA 2F2HA 1PAMA 1V03A 1XV8A 4U33A 1XC6A 4FLQA 4D6FA 3CH9A 2W62A 3GNOA 4EK7A 1V02A 1J11A 3AMCA 1XYFA 2WPGA 2IXUA 3AMDA 3B9AA 2ZICA 3N13A 4TX8A 3UG5A 3VOCA 3EDFA 3WH9A 3WFLA 3UEQA 2JIWA 4GO8A 3EDJA 1C3FA 3AHZA 2G3NA 3U5YA 1W9PA 4AMCA 4DWSA 5A2CA 1QI0A 2QPUA 4PUEA 3WF4A 1JD9A 2XFFA 4AIUA 4LGXA 1CLXA 5CZKA 5A6MA 4MJ4A 2A3CA 3IAPA 3VMNA 3BC9A 4UZSA 1QW9A 4WLCA 4HZ8A 2FH8A 4GO9A 2O9TA 1NOWA 1KXQA 1WZMA 4JHZA 3L2LA 1JDDA 4U2YA 3NJ3A 4HOXA 8A3HA 2C7FA 4AZ6A 5E70A 3CMGA 2X0HA 3W37A 1QI5A 3A6OA 2J7CA 3GNRA 2J78A 3MANA 3MUY1 4PMQA 3D5HA 2Y5EA 3VU2A 3EMCA 1VEPA 1W1YA 1ITXA 4KWUA 3FN9A 4J28A 4GI6A 3DYOA 4R5EA 3GZAA 3WNLA 4EKJA 3SCNA 1E0VA 2VZSA 5FL1A 2FHFA 5DT7A 2UY2A 2E9MA 2V3EA 1EHNA 1Y7VA 2BHUA 3GXMA 1VFOA 2GJXA 1OT1A 5BXRA 4V28A 2WVVA 1TE1A 2VX4A 1E6PA 4DM2A 1CNVA 3VGHA 2VX6A 4AIEA 1DP0A 1H1NA 4QCEA 1EOMA 5M03A 5E09A 3K8MA 4AISA 1OD0A 5A6JA 1BYDA 1H0GA 3HJEA 3WDJA 5AYIA 1MQPA 3AI0A 3ZR6A 2DH3A 3L4VA 3CZJA 4U31A 1GQLA 3AROA 3MSGA 1UD6A 1UWUA 3DHUA 3B9EA 1GVYA 1ODZA 2YA2A 4KMQA 4C7GA 4IM4A 1CXEA 3VD9A 4UQ9A 2E8ZA 1UR9A 4J3XA 4EAMA 1JG9A 4RE4A 1OIMA 2D0FA 4XZBA 4UFJA 1OGSA 4FLSA 4GIAA 3G6LA 4WF7A 2VR4A 2OWXA 2CYGA 3MS8A 5ECUA 2WHKA 2WHLA 2ZUSA 4PYSA 4OUEA 3MSDA 2V3GA 5C70A 1FHLA 4GZJA 3CZLA 3SCWA 1P6WA 1S46A 3T0BA 3BAWA 3HMCA 2FH6A 1UKQA 4D6HA 1E15A 3BAXA 1GQKA 4PMNA 3VX0A 3K8LA 1QHOA 2RGMA 2X05A 2ZUTA 4WKFA 7CGTA 3VD4A 2XUCA 4QAWA 1DTUA 1QBBA 2XWDA 4CCCA 3HU7A 2JEPA 3MUAA 1Q6DA 2ZX6A 3N1AA 4UFIA 1YHTA 1HL8A 3VINA 2NSXA 2VQUA 5HNNA 3A47A 2YL8A 3W53A 5C8BB 1VFMA 2Y24A 1J0KA 1CXFA 3VD7A 4F66A 2WMJA 2E4TA 3RILA 5EMYA 2J7EA 3WF2A 1EOKA 1KGWA 4BQ5A 3ZJ7A 1FH9A 1VIWA 2YJQA 1WB0A 1V0KA 3WL1A 2BY1A 1LQ0A 1DHKA 1B30A 1OB0A 1EQCA 1Q4NX 5DO8A 1V0MA 2PBGA 3WELA 4GI8A 2VZTA 3WUEA 3AHYA 3FHQA 4ACYA 1U2YA 1CEOA 1K9TA 4B9ZA 3L4YA 2E8YA 2O92A 5ABFA 5A6BA 4P7QA 1JYXA 1A47A 3IJ7A 4TTGA 1GVIA 1JI2A 2WLYA 4AW7A 3BAYA 3AZRA 4ATLA 1PIGA 1E0XA 5A8NA 2VCBA 2EPNA 3NUKA 4U2ZA 4HMEA 3ARPA 3MO4A 1SMAA 4JKMA 2XM2A 1MW3A 2A3EA 1TA3B 3NSXA 3WD3A 1E73M 2FHBA 1F4HA 2J25A 1E43A 4W7VA 5FD0A 1WZLA 2DSKA 3EYPA 1Q6CA 3T2OA 2V3FA 1MW1A 3PN8A 3WNNA 3PZQA 2PF0A 2ZX8A 3WF1A 2YLLA 3TOPA 3AZSA 3AIWA 5CGTA 4OKDA 4M24A 3N9KA 2O9PA 1HJVA 4IUGA 2C0HA 3S2CA 2J7BA 1BQCA 2EBNA 3ZT6A 2BHYA 3VX1A 5D9PA 1VFFA 2JF6A 1GOOA 5I6SA 1UD8A 3FAWA 2FGZA 3I3EA 3I3DA 4M81A 1BLIA 3L4WA 1HJQA 2J7GA 3T2PA 1BVZA 1CIUA 2ZXBA 2WMIA 3BGAA 1VFUA 3WUGA 5E6ZA 1W3HA 5ABEA 1JAEA 3VIIA 1IV8A 2DIEA 1BF2A 1KCKA 2DSVA 4F8XA 5F7UA 3WH7A 3WQ8A 1A3HA 4J3WA 1UKPA 3WDQA 3UG4A 3NDZA 5HPOA 2DEPA 3IJ9A 1B3XA 3ARWA 4CD8A 1M03A 1VJZA 3M6DA 4URIA 3AIUA 4AIOA 1HN1A 2GK1B 3BSHA 4AD1A 4AYSA 3O6AA 2WCAA 2VX5A 3S6TA 3NCOA 2WXDM 1JFXA 2BHZA 2XVNA 3VIGA 1DWHM 3AYRA 4L4OA 2VURA 2IXVA 1GOIA 4KRUA 4ZFMA 2BV9A 4W84A 1UWQA 5I78A 1FH8A 1I1WA 1NQ6A 3A4AA 3CHCA 4PCTA 5BRPA 1MW2A 2NW0A 3WH6A 3BXWA 1OIFA 3U5UA 3SIMA 3AXHA 3CUGA 2J7HA 4MDOA 2WNWA 2XGBA 1GHRA 3W26A 3IK2A 1DWIM 4E8CA 1E55A 1L0PA 1WKYA 2EJ1A 2CKRA 1E6ZA 4M1RA 1MW0A 1OCQA 2XIBA 4D6EA 3CLWA 2UY4A 1WAWA 1E1FA 2DT0A 3UESA 4CD4A 2G3MA 3ZR5A 3BAJA 3OLDA 2E9BA 4GQRA 3SUVA 4W5ZA 1G0CA 2XIIA 4HU8A 4DWSD 3EMQA 1ZU8A 1SR0A 1C8XA 1JNDA 2VRQA 1HKIA 3BCFA 1JXJA 4UZUA 1W2VA 1TFVA 2WC4A 5BXPA 4PTMA 2D3LA 1QNQA 3WIJA 3O2LA 2WBGA 3B8SA 3N18A 1B3WA 4JFSA 3QOKA 1I75A 1CXHA 1DWJM 4X0VA 1IZJA 4OBRA 5A6LA 1UQZA 1JIBA 2W63A 4HOWA 2AAAA 2VNCA 3SEPA 1V6VA 1B31A 2VOTA 4Z2LA 4W89A 2JF7A 3WSUA 5DT5A 2OWWA 2WLZA 4KRTA 3I3BA 4BQ4A 3WQVA 1KQYA 2BVTA 5C71A 2J4GA 4B3LA 1LWHA 2W92A 1LLOA 4PTVA 5AC4A 2V5DA 2Y8KA 4R27A 4NI3A 5CLTA 2DH2A 5HOSA 2WAGA 2ZWZA 4MNMA 4PMDA 2UWFA 3CZ8A 3KWXA 2VX7A 3OBAA 3ZJKA 1KR0A 5IHSA 2YDRA 4ATWA 2BVDA 4CCEA 4OBSA 4AEEA 2E9LA 1JZ2A 2EO7A 1U33A 4E8DA 2JFEX 1W9BM 1PX3A 1LL4A 4U3CA 3WMCA 5FKYA 2VRJA 4FK9A 3KEHA 2EXOA 1FOBA 5LA0A 1CTNA 1ZB5A 3WD4A 1UA7A 3DYMA 4RE2A 1KXVA 5GNXA 1E4LA 1CGVA 4QP0A 3PZOA 1AQHA 1TVNA 3AYSA 3VIPA 4Q7NA 2X2YA 1M53A 4ZXOA 1JYVA 1WDPA 2ESCA 1J10A 3CUJA 5E0CA 1PX4A 1W3JA 5A2BA 4M8UA 3PTQA 2DSWA 1TCMA 3ZM8A 4MNKA 2QF8A 4IPNB 4LX4A 4P7RA 1HJUA 4J27A 1GPFA 3SCUA 4AZCB 1K6AA 5CJ5A 4AD0A 3VNYA 4UQBA 3TA9A 5D9NA 3AQUA 3CO4A 5CG0A 1CECA 4B3KA 3ARYA 2CKSA 2MANA 1Q6EA 3BAKA 1OINA 1FA2A 3CHEA 1QOXA 4QLLA 4P8UA 4UQAA 2WB5A 4DUVA 3E1F1 5M17A 1W9UA 1UQYA 3NSMA 2D1ZA 3CHFA 3QGVA 1WZAA 1J01A 1JZ5A 2CBUA 1XH0A 4OZOA 2QPSA 2WC7A 3UG3A 1PBGA 1QHZA 4LQ1A 1NP2A 1H09A 2YLAA 2WHMA 3WH5A 3W29A 1MXGA 2ZUVA 3VD5A 3WMBA 4EE9A 2XPKA 4CN6A 2QMKA 1VEMA 2VL4A 2WVUA 5A95A 1V3MA 2VCAA 5GNZA 1LWJA 1TUXA 4PUDA 4ZENA 3RMEA 3F4VA 4Z2JA 1LJYA 3W28A 2YKKA 4JKKA 2CBVA 4CD5A 4KGJA 1CGWA 1NWRA 3W6LA 3D3AA 2ZOXA 1MQRA 1R85A 3OLEA 3M46A 4WKAA 1JDCA 2PWGA 4RL3A 5IDIA 3AS3A 3OB8A 4TXEA 1XYZA 1ISXA 1W3KA 3ARUA 2WWCA 3TP4A 4U5KA 2UY3A 5A6BD 1R7AA 2XVLA 1UH2A 1TVPA 3WNKA 1HKJA 2FGLA 1BG9A 2VMFA 1V0LA 2IUZA 2WHJA 4JHOA 2XHYA 1WNOA 4UNIA 2WVTA 3GXIA 3N04A 1NWTA 5I0DA 1ECEA 3CIVA 1BGAA 3BMVA 4YPJA 1HVXA 4M56A 1Z32X 3OA5A 4TX6A 1Q6FA 1PX8A 5ABGA 5I77A 3NYDA 4LYQA 1QI3A 4YHEA 2WVVB 3WQ5A 4AZ5A 1NARA 2GUYA 1NWSA 4RE3A 3CUFA 1QI2A 4JFTA 1WPCA 4PEEA 1JAKA 2VR5A 1W3LA 7TAAA 2WCGA 3KL5A 3UR7A 2J74A 4UFHA 1AMYA 3FXYA 3THDA 3VUPA 3T2QA 1ZBKA 2CCRA 1PEZA 3WF0A 4J3TA 3EDDA 3GH4A 3VMPA 1W2PA 4ZEPA 4NZCA 5FOOA 1RP9A 3EMZA 3ZJ6A 5I23A 1MVYA 3WDHA 2YL5A 3OGSA 1PIFA 2QV4A 3BLPX 4F9DA 2ZUMA 4J7RA 3RIKA 2JEQA 1B90A 4P7NA 1UH3A 2XFRA 3SURA 1H4PA 2J79A 4H8VA 1HL9A 2WZEA 3VDBA 3LPFA 3W25A 5A6AA 1UD2A 2ZIDA 5CLWA 1AQ0A 1MXDA 3EDKA 4TOQA 1V3KA 1RD6A 4MADA 2ZWYA 3JUGA 3VIKA 5D4YA 2AOSA 1RP8A 1NOUA 1OWQA 2OYKA 1UWRA 3PZGA 2DIJA 1H11A 3ECQA 2WANA 2ZX9A 4XUYA 3ARTA 1E5NA 1KB3A 4BZYA 3CHDA 5CGMA 3QOMA 2VCCA 2O9OA 3VTRA 1E9LA 2J8FA 3AMGA 3WY1A 1UR4A 4Z2KA 3SCTA 3WN6A 3F5KA 3N17A 3RJYA 4BA0A 3VPLA 1GCYA 3FAXA 1HNYA 4HTYA 1CGXA 1B3VA 4UOQA 4YN5A 1BFNA 2D3NA 3ARRA 3VGDA 1UWTA 5KZ6A 2ZXDA 4D71A 1J0HA 2J75A 3AHXA 4QFUA 2JIEA 3OZPA 1H2JA 3GDBA 1PPIA 3MV11 3A4XA 3VDCA 1KWGA 4H8UA 1GQIA 3AIQA 2GFTA 3SUSA 3WQWA 1E70M 1OM0A 1QNOA 3SCOA 3T0AA 2W61A 2PWHA 4JFUA 4CU7A 4TTUA 2Z1KA 4FMVA 2ZX7A 1XH1A 2WK2A 2BS9A 1GOMA 1CYGA 1EDQA 5IFPA 1UKTA 4HOZA 1VF8A 5JIPA 1UR0A 2EPKX 1XGZA 2PWEA 1V08A 3AOFA 4UTFA 1CXKA 1WE5A 1E4NA 3ZIZA 1R86A 4W7WA 1VJSA 2E40A 4CD7A 4AZHA 2BY0A 3VGGA 1E40A 4PBGA 3LPGA 4J3SA 1QW8A 4OJYA 1E6NA 4XB3A 5A69A 3W38A 1AQMA 1JDAA 1QNSA 3APGA 3ZSTA 1VBRA 5I79A 3GBDA 2ZX5A 3PTKA 4HMCA 4GPNA 4QDMA 4HU0A 4FLRA 1ITCA 5BXSA 8CGTA 5TD4A 3M7SA 2GDVA 1TA3A 3BAIA 2GDUA 2WMIB 4D6DA 1XSKA 2C8NA 4GXPA 4C91A 1JF6A 3VIJA 1E3XA 4GINA 1XCXA 1HKMA 2OWCA 4DWSC 1EO7A 1X6NA 1J0IA 1E56A 2V3DA 5A2AA 2D2OA 1E71M 2J7DA 3T08A 1WDSA 3L4TA 3L2MA 2WZHA 4CN4A 1V02E 1DEDA 1GJUA 2ZUUA 4HA1A 3MV01 3THCA 3WMSA 1CXLA 4P7LA 4AC1X 4CU8A 3UETA 1VENA 5M5DA 1V0NA 1E6SM 1W1TA 3VDHA 1US2A 3VVGA 2PB1A 2EQDA 2WMKA 2G4FA 1BSIA 3ARQA 1EO5A 4QCFA 4WKHA 2VC9A 3UERA 4M82A 4W86A 2OSWA 1ISYA 1CZ1A 3BCDA 1JFHA 1C92A 5A8MA 5DF0A 4ACZA 3VILA 1SYTA 2WC3A 2OYMA 2NT1A 4QLJA 4GI9A 1KR1A 1HJSA 2J8GA 5BROA 4MAZA 4H7VA 4D1IA 1FH7A 1HXJA 2OSYA 4E2OA 3RM4A 1N82A 4JKLA 1V3HA 1C7TA 1UD3A 2ZXAA 1XRVA 3EDEA 4CVUA 3PTMA 1C7SA 3GH5A 3K1DA 4PTWA 3AHVA 1W9DM 2XG9A 3ZO9A 3PZVA 2DQXA 1PZ2A 2VZVA 3SCQA 3ZT5A 3OGVA 3IAQA 4PRWA 3LPOA 5CQ1A 2WMHA 3AZTA 4D1JA 2W4XA 3SUTA 2CETA 4NRSA 3AMKA 7A3HA 2X8RA 4N42A 1W1VA 3AIEA 1GOQA 4KH2A 3AXXA 4ZXLA 1KBBA 4AZGA 2CXGA 5E9AA 3RJXA 2YL9A 2UY5A 4PMXA 2XFYA 1K9FA 2HVMA 1J0YA 1MFUA 1H0IA 3AS2A 1GQJA 5AYBA 4MNLA 2JALA 3SCPA 1B9ZA 4UFKA 4DM1A 2OSXA 2CERA 1CGYA 4PMRA 1E6RA 1ESWA 3WBEA 4W8AA 1H5VA 1PJ9A 1FFQA 1HKKA 3AHTA 3B9DA 5BCAA 1OT2A 4HZ6A 3VGFA 1X1NA 1K9EA 1FHDA 1JL8A 2O9RA 3RM9A 2WSKA 2XYLA 5AY7A 1C93A 3W4RA 2Y4SA 1KCLA 3U57A 1ZL1A 1EH9A 3AMLA 4GQQA 3WNMA 2XVGA 2XM1A 3KL3A 1JF5A 3WFZA 3WBAA 4IISA 5JUVA 2D24A 3WNPA 1TMQA 2WMFA 1W32A 2BFGA 5A8PA 5FCZA 3L4UA 4CKQA 5BYWA 1H3GA 3CZGA 5EBAA 1B3YA 3WD1A 4A3YA 4K68A 1XHGA 2GVYA 2VVNA 1QNRA 4HZ7A 2XSAA 4C90A 3WF3A 2VRKA 4JIEA 4MAVA 4PMZA 2YIHA 2YDSA 1DWGM 4PMUA 3RM8A 3WEMA 1US3A 1BTCA 1G9HA 1R7OA 1UZ4A 2WVSA 1JYWA 1EXPA 1EGZA 1MFVA 2AMGA 1RPKA 3M07A 5D9OA 1QNPA 4WK9A 2X0YA 1CENA 1ISVA 3WENA 4V27A 3U7VA 3WDRA 2BXZA 3SCVA 1VBUA 2XGIA 5BXTA 4HMDA 4UFMA 3ZSSA 3BH4A 2YOCA 3U7BA 1R8LA 3T09A 1OBAA 4P8XA 1HJXA 4UFLA 4AXNA 3OLGA 1OD8A 2YBTA 4A3HA 6A3HA 4HP5A 3GXFA 1WDQA 1J9YA 3ALGA 1ZJBA 3RDKA 1GJWA 5D8WA 3WQ4A 5I2UA 4E4PA 4FF5A 1CPUA 2XWEA 2F8QA 4C7DA 2J7FA 4H04A 1UZ1A 5BRQA 2Y8VA 1HP5A 4JFVA 3ALFA 3VDAA 4P8WA 1O7AA 4DWSB 5EFFA 3A3HA 2VT0A 4OOZA 1G5AA 2BY2A 1E5JA 3PZ9A 1JZ8A 1UR8A 1GUVA 1XSJA 3W0KA 1BAGA 3MMDA 1JNEA 2CESA 4CUCA 2XTKA 3PZUA 2PI6A 4L4PA 3PZTA 4PCSA 3RCNA 2EEXA 1E4MM 4JCLA 4F9JA 5JBFA 2CIPA 5CSYA 3VO0A 4FLOA 3T0DA 4UOJA 3VKKA 1L8NA 1HF6A 4PMVA 5I3DA 2PWDA 2G8ZA 1O6IA 3TTSA 3OGRA 3MUIA 5M3WA 2WKGA 1UWIA 4ZE5A 5CXPA 4W7UA 1NH6A 1GHSA 4HA3A 1LL7A 4MB1A 5EB8A 1GONA 2DSZA 3MMWA 2GJXB 4A4AA 1AVAA 4S3KA 3CMJA 2DGAA 1B2YA 3UR8A 4CGTA 5LYRA 1F4AA 2DSUA 1W1PA 1JZ6A 3GTNA 3W6MA 3VIHA 1QI4A 2A3BA 1G1YA 3KZSA 1B0IA 2W5FA 4Y7EA 3PBGA 4UOZA 1VAHA 3SUUA 1JI1A 5A8OA 2V38A 3AICA 4M80A 1UHVA 1CXIA 1UA3A 1JZ4A 5E6YA 3GH7A 2PBOA 3IANA 1UR2A 4N0RA 3AXIA 3W27A 3ARSA 3J7HA 5AC5A 2XSBA 3ARVA 1E6XM 4W8LA 2FDMA 3W24A 5LA2A 1KXTA 1UUQA 1BGGA 4D6JA 2OLHA 2WZIA 1G94A 1HT6A 5JIWA 2J62A 3L4ZA 1V6UA 3WD2A 1J0JA 1HIZA 2VO5A 3VMOA 2VTFA 2PWFA 1BPLB 1B3ZA 5DEZA 4AD5A 4BQ3A 4TVCA 2W67A 2B31A 1W9VA 4JFWA 3POHA 3VIFA 1EIBA 4F79A 4AZ7A 1X6LA 5A6SA 4D6CA 3DECA 2XVKA 1BVNP 4TUFA 1QHPA 2YL6A 1DWFM 2XVPA 3IJ8A 1UWSA 1UOKA 4EANA 2VUYA 2Q8XA 3DHPA
chains in the Genus database with same CATH superfamily
3Q67A 4MNJA 1KWKA 4N4QA 2FZBA 1SW7A 4JCMA 1IR1A 4PMJA 4J2PA 1WZKA 2EPMX 2CZDA 2Y62A 5GNYA 3TMQA 1E6QM 2X1IA 1XLJA 4OVXA 1J4EA 3L65A 2Z29A 4DWDA 3N15A 1WO2A 2RH9A 4WXZA 4W87A 3ZVHB 1S2AA 3W1AA 4JTQA 2R1NA 3V3WA 3W75A 3SM0A 3RLHA 1KTBA 4B3ZA 4JL1A 3SR7A 3AXKA 1EBGA 3FJNA 2XH2A 1T40A 1X8CA 3DCPA 3P5ZA 3TXZA 2PFHA 4JYDA 4LY4A 4Q22A 3WD0A 4C7FA 4PSRA 2WW5A 2OO0A 3CLMA 4X9SA 2DW7A 2J47A 1LBMA 1QO2A 2TPSA 1EEXA 2IPGA 2F6KA 3R5EA 1M01A 2G95A 4HHLA 1SJAA 2ZE0A 2E7FA 4HPGA 2TAAA 1RCXB 4GMEA 4BQ2A 1V6XA 2QCDB 7PTDA 4AZIA 1BYCA 4ERIA 2C1HA 3FHAA 4X22A 3E02A 1LQ2A 1TPC1 3FSTA 1UD4A 1NP0A 4S38A 4GQGA 1HVQA 1TJ0A 4G1NA 1DE6A 3DHFA 1O5XA 4B16A 5C2GA 1KNWA 1E3ZA 1QPRA 3T07A 2Z1SA 4QG9A 3CB8A 1GVFA 1WDDA 3ELFA 4O19A 5JBEA 2RJGA 1YDOA 3WL0A 4CNNA 3UR5A 4MDPA 2XN1A 2GGHA 4AD2A 4C6MA 2W91A 3BLKA 4WJXA 2ZZ3A 1UKSA 4W93A 3MTWA 3OLIA 4I5XA 3EOUA 1BSLA 1PL9A 1FDYA 3VNZA 2PTXA 5LGXA 2ZUWA 2EHHA 2ZA3A 4BCEA 5HK4A 2HNHA 3PVFA 2CEQA 4R9OA 1ISZA 1UZHA 4DVOA 3V18A 3GHUA 2WV8A 4B5VA 4NZ1A 2HISA 3NEVA 2GSJA 3WLHA 4QS5A 3PZMA 3QV6A 4GA8A 2H3DA 4RDVA 3WDPP 3GR4A 1MO0A 3QY7A 4ZOCA 2BY3A 2GGIA 3TQPA 1ZBCA 1A49A 1AJ2A 4AYGA 3LPPA 4EX4A 1D3HA 3CUHA 2DPEA 1TG7A 3WUFA 4PRTA 3CU2A 2GUUA 4N6FA 5IXEA 3GAKA 3KCJA 1JD7A 2P1FA 3FLUA 4A6GA 1KM6A 1R30A 1GW1A 5AZ0A 3WX7A 1JDFA 1ODUA 3HZ3A 3H4GA 2VOMA 4FSAA 1NQKA 4BF9A 3CAVA 5BW6A 3UPWA 3TJXA 4CNTA 2GPTA 3K4AA 4XK2A 1G01A 4MB3A 1TZZA 5MHBA 4O10A 1XR2A 3LQGA 5D9MA 3RPMA 3LV6A 4GZEA 4Q8UA 1ME7A 3ES8A 5AYYA 5DBUA 2ZFAA 3TE9A 4DO4A 4A21A 4TVDA 1VYPX 4PUWA 1BRLA 1A53A 4XBSA 4LJ3A 1E72M 1CGTA 4WSJA 1UG6A 4NVTA 5FEXA 1M7XA 3GR8A 4AIBA 3C0LA 5D37A 1YNPA 1E0UA 4WJEA 5HXMA 2QVNA 4ATDA 2C91A 1JZ7A 1JYNA 4XZWA 2CBIA 2R94A 3M0XA 4Z2HA 1GYLA 2A7NA 4QSFA 2Y8UA 4HYVA 1HP4A 4HU3A 5DLCA 3GTIA 4Y96A 4LPCA 5FEZA 1LOSA 3ITYA 3MI3A 3R6IA 4K2SA 2Q3RA 5E1QA 2V5LA 4QG8A 1W17A 2BLEA 4BFAA 3G77A 2D0HA 3PNUA 3QV7A 4GLEA 2PLCA 4HU4A 1O95A 4ADSA 5KEZA 1MUMA 5GQBA 1FWDC 4WY0B 3N12A 4Z1AA 1TPEA 2YXOA 4LXFA 1C29A 1O1HA 2GLKA 1IGWA 4DPPA 2DT1A 1K9DA 3C3NA 4IP7A 3WFAA 1X1OA 1SSGA 1CGUA 5AZ1A 4S3JA 3TW6A 4H00A 2YDQA 3KS6A 3ZZ1A 4AXKA 3ZXWA 4ZMGA 3S2NA 4BF7A 4RZ6A 1XF0A 3M0JA 3VFLA 4E3TA 3G1RA 4M0XA 2ZDRA 3FJ4A 2NX1A 3GVVA 3K5XA 1FKXA 2E0PA 4L5ZA 3R89A 5DRIA 2DUXA 6XIAA 5EKYA 3HPXA 3VGBA 2Z7GA 1OC5A 3MZ2A 1PYFA 1BG4A 1QCWA 4FS9A 3S3GA 3PB0A 4R88A 2VHLA 2YBUA 1D8WA 4IMGA 1SW3A 1XP3A 5HJYA 5JMUA 1GZGA 3NIYA 1US0A 1FWHC 4IPPA 2O7QA 3M1ZA 1HX0A 1UKOA 2F84A 4IIGA 5DMLA 2WZMA 1V3LA 5D8ZA 2QLYA 2DZXA 3SFWA 4CQBA 5JBDA 3OYXA 4D6IA 2G41A 3A3XA 1DJQA 1LOQA 2Q6ZA 3NPWA 3CUIA 1G4EA 2F2KA 2OLAA 2A3AA 4NILA 3CPUA 2W9MA 2IS7A 5HBFA 1JXKA 3NSNA 4DZ5A 1JDEA 3H2NA 1S2UA 4UTMA 4Z2IA 4TV5A 4I7UA 5BWFA 3BMWA 1W5NA 4ZQCA 5FL0A 4B5UA 4IZGA 1HO1A 2F2HA 1PKYA 4QEEA 4U33A 1ZZMA 4D6FA 5D2YA 1J11A 2ICSA 1PE1A 1ML1A 3PP7A 1GK8A 1XYFA 1LLZA 4FX7A 4AVFA 4O4VA 3B9AA 1DL3A 1A3WA 2EAWA 3E3HA 3G0UA 1YTEA 3DOPA 1CCWB 3F2CA 3C2YA 1KKRA 4GO8A 4H6KA 1ICSA 3EDJA 3GRIA 4DF1A 3U5YA 1Q8AA 2EG7A 4DWSA 4PUEA 2QPUA 2Y89A 2V5KA 3ITOA 2XFFA 4AIUA 1CLXA 3GTFA 5G4EA 3AUOA 1QW9A 2Z6JA 2O9TA 1NOWA 4JTIA 2FJUB 2OKOA 2RDTA 4DJDC 1WZMA 4JHZA 3L2LA 5I00A 5H8PA 4U2YA 4UTIA 1S1PA 3NJ3A 4UMBA 4PEKA 4GGHA 1O68A 1GVRA 1DJIA 4AZ6A 2X0HA 4L1GA 1GEHA 2OLSA 3D5HA 3LZ3A 1HGWA 3H2EA 3L7RA 3DXIA 3CC1A 3EMCA 1KTNA 3FN9A 2PDBA 1IGSA 4KEVA 1UIOA 4HG6B 1PTDA 1E0VA 3B06A 3VCNA 5BRBA 3EXRA 5LXXA 3L5AA 2FHFA 3KBMA 2UY2A 4LVBA 1UOZA 3FJLA 2V3EA 1EHNA 4G1KA 2W3ZA 2ZA1A 2GJXA 2CZVA 4A05A 2DZSA 3QR1A 1O66A 2VX4A 3BW3A 5EMUA 3CQ0A 2VX6A 3PNZA 4AIEA 3UJFA 4NUWA 2VWSA 5E09A 3BK0A 3K8MA 5K3VA 1BYDA 5AYIA 3L9CA 2H9AA 1JRCA 1LWIA 3BOXA 4U31A 3MSGA 4P02B 3GIQA 1O1ZA 3BG9A 5F2GA 4QXIA 4IM4A 1CXEA 2C1GA 3U4AA 1HTIA 2E8ZA 3F4DA 3QVQA 1YE6A 4EAMA 4IGMA 4KWVA 4RE4A 1RLCL 3P7YA 4XZBA 4Q3MA 3D46A 2VR4A 3C2VA 1TWSA 2OWXA 3RX3A 4PYSA 4F48A 2V3GA 3M0VA 1AW1A 1RVKA 4GZJA 4LW7A 4K3ZA 4DNMA 3SCWA 1S46A 3BAWA 5LNUA 1AL8A 3B0VC 5AHNA 2QIIA 3BAXA 1QHOA 4NHVA 4W4QA 2JQXA 2RGMA 2X05A 3GU2A 1OCBA 1XL9A 1XYBA 4DUOA 3B4YA 1IYXA 4F0MA 3O1NA 3HU7A 4J2MA 3MUAA 2NLYA 2ZX6A 4UFIA 3E0VA 2FGBA 3DFOA 3WCZA 5HNNA 1NVMA 5LXEA 1CXFA 1Z89A 4QISA 2WMJA 3P82A 2VGGA 4DJED 3LSCA 2HXUA 2ACUA 5EMYA 3WF2A 4UB9A 3ZJ7A 2YJQA 2DZVA 3N6HA 2C3ZA 3H2AA 3M0ZA 3KRUA 1S5WA 3FEMA 2J66A 1AJZA 1B30A 4ZVJA 4NZFA 4DF2A 4EXQA 3CASA 1V0MA 2PBGA 1Q7MA 3OG3A 4MFDA 4I6KA 3NL6A 3WELA 4ORIA 3WUEA 2VZTA 4I3GA 4L1XA 3N4AA 1GWJA 5BU9A 4O1EA 3UD6A 2O92A 1XLCA 1A3XA 4C6LA 4P7QA 1A47A 1XIFA 4HQVA 1SGJA 4GY7A 4L65A 3AZRA 1PIGA 1E0XA 3N29A 5AVNA 3CYVA 4M51A 3MO4A 1MW3A 1TA3B 2HZGA 2V0TA 1ZUAX 4WVXA 1F4HA 4IP5A 1UMLA 5DMNA 3TR2A 1GOXA 1E43A 3IGUA 2AMXA 4IFKA 1VZWA 1FQ0A 2EJAA 4JIQA 2YCLB 4AY7A 3T55A 3QKEA 1YBQB 3T2OA 3PN8A 4HHHA 1P1XA 3PZQA 1EIXA 1EF2A 3E6EA 4QE4A 1KFJA 2QUMA 3TOPA 1CB7B 1EJ7L 3AIWA 5REQB 2QJHA 2GQ9A 1VFFA 1GOOA 3VNLA 3FAWA 1S3TC 2QDEA 4M81A 4AEOA 3L4WA 1HJQA 4B4FA 3ZWSA 4KRZA 2WMIA 3R1ZA 2DIKA 2YR1A 1VFUA 1KM0A 3WUGA 4LAMA 5CEWA 4ZSUA 5AHEA 1EF3A 3E2SA 2DIEA 3M5ZA 5F7UA 3VCCA 3W76A 4UTWA 5AHMA 5HPOA 2DEPA 1E1CA 2NQLA 4CD8A 3M6DA 4URIA 3AIUA 1RD5A 3DKJA 1R9YA 4MLJA 1J2WA 4YLWA 2GGEA 1A4LA 2A7PA 1V7YA 4PTNA 4HBKA 1KRMA 4L4OA 3PTDA 4WOQA 5MKGB 1I1WA 4DXVA 3LTYA 3HGRA 1J96A 1NQ6A 4PCTA 3KVMA 3U5UA 2NXHA 3VDGA 2B7OA 2YGYA 3VI2A 2OB3A 4E8CA 1L0PA 1A5BA 4E6MA 3KS5A 2EJ1A 4G7FA 2CKRA 4LAUA 1E9YB 1OCQA 2XIBA 4D6EA 3CLWA 3W02A 5JQ9A 4QNEA 1E1FA 1AK5A 5CZSA 3ZR5A 3CQJA 4TMBA 2E9BA 3SUVA 4W5ZA 1G0CA 4HU8A 4XD5A 1SR0A 3CV2A 3T0TA 1Q7ZA 2BG5A 1TFVA 2WC4A 1ZY9A 4XZLX 5BXPA 2D3LA 1QNQA 1VFLA 1FRBA 4KBXA 3HG3A 3N18A 3UG8A 3QOKA 1CXHA 1EUNA 3FYOA 4A8NA 5A6LA 1EJUC 3WJSA 3IK4A 2WZTA 3MI2A 4YCPA 2AAAA 2PRLA 3KTCA 8RUCA 4HK6A 1F9CA 3WQGA 3C0SA 5AYXA 3WSUA 2FIQA 1JPDX 1Q45A 1F5ZA 2ZYFA 2WLZA 1Q2RA 1KD0A 2E1WA 4PTVA 3BV4A 3W1UA 2ASHA 1Z3NA 1WX0A 2OJPA 4HHMA 1EBHA 2DH2A 5HOSA 4S3EA 5IHSA 1L6SA 1KKOA 1F8MA 4AEEA 3RXZA 1EEPA 4TX9A 1U33A 4E8DA 2JFEX 4HT3A 1W9BM 1LL4A 5T9BG 2OGJA 3WMCA 4FK9A 3KEHA 4N9DA 5LA0A 3NGFA 2WOQA 3WD4A 3DENA 3W7GA 1UA7A 1WBJA 5DX7A 1QMLA 5GNXA 1E4LA 2KAUC 1K8XA 4JIPA 1AQHA 4ZO6A 1TVNA 5I3FA 2GVEA 3VIPA 1RA0A 3OIXA 1J10A 3CUJA 4NQ1A 3S4TA 2R1MA 3LGEA 2SFPA 1TCMA 2ACSA 1SZFA 3RG6A 3TN4A 1R6WA 4EPKA 5HNUA 3SCUA 4AZCB 3VNYA 3TA9A 5D9NA 1Q13A 1CECA 3KTXA 2B4GA 4XD4A 3KVKA 3AU6A 3T7VA 1W9UA 2XZ7A 4LBUA 4DEFA 3O07A 3HQOA 1T99A 1T8QA 1NY1A 4OBTA 4OZOA 2PDXA 1IE7C 3EWDA 2WC7A 1W0MA 1O4UA 4E8GA 4HYRA 2YLAA 2WHMA 3W29A 4S3BA 3AXMA 1MXGA 3C4UA 1G6CA 2QZRA 1A80A 4JTEA 4IX0A 3KHJA 1XJBA 3RMEA 3H6OA 1TSIA 3HG4A 1KCXA 3I4EA 2Y61A 3SRDA 3VKAA 3RU6A 4AFYA 4KGJA 4YTRA 4Q4SA 4ICNA 5HQMA 3D3AA 1WV2A 2GQ3A 5HQLA 5HQEA 3UPMA 4WCJA 3OLEA 4IQLA 3E2QA 4D9PA 4X61A 4RL3A 4DYEA 5IDIA 2Y7EA 3LHZA 3C0QA 1IR2A 4DBEA 3ITTA 3UT0A 1JPKA 4C6FA 3IGSA 1JCNA 1W3KA 3UR2A 1TJ2A 3ARUA 4WR3A 3M44A 5K4XA 3W00A 3RFAA 3V35A 3WLSA 1PVNA 1W1A1 1HKJA 2BB0A 1BG9A 2VMFA 3WQPA 4GYKA 2NQ5A 2HNEA 1U22A 1BGAA 3STCA 4YPJA 4M56A 3OA5A 1HKVA 4LH8A 4LYQA 5HATA 1HUVA 4DYJA 4RE3A 1AG1O 4JFTA 1IXQA 4FXSA 1EZ2A 2VC7A 3FYPA 2QNEA 3LUTA 1W3LA 1RPXA 1TR9A 4KS0A 2WCGA 2J9XA 2A6LA 3KRBA 1WUEA 2J74A 3EA2A 1EWDA 3T2QA 1UJPA 2CCRA 1ZP3A 1F2JA 2ANUA 3PANA 3GH4A 2IW0A 3VMPA 5FOOA 3EMZA 1QOQA 1MVYA 4JBRA 2Y7GA 4IGSA 2V6AA 1XYCA 3BLPX 4G5DA 3RIKA 2JEQA 1B90A 1UP3A 1QK0A 3SURA 3JU2A 2J79A 3WJWA 2IQ0A 3FKRA 2WZEA 1PZ1A 3LPFA 3W25A 2AL2A 1UD2A 5A6AA 3QM3A 1MXDA 4JN6A 3APYA 4HPJA 1S1RA 4F0RA 2NUWA 3VIKA 1Z42A 1XWYA 3SO7A 3LHVA 2P10A 3VYLA 1SO5A 1OWQA 1G4TA 1UWRA 4ADTA 4CNPA 2WANA 4LV9A 1IEQA 1NSJA 3W7QA 4JN7A 2O0TA 3QQ1A 1FWRA 2O9OA 4M1BA 1P6CA 3VTRA 2YW4A 3WY1A 4Z2KA 3MWCA 3SCTA 2Z1VA 3VPLA 4GE8A 4FA3A 1B3VA 3KOXA 3DC8A 1TE6A 5D2VA 4AWTA 3W7CA 2D3NA 1TWDA 4UTHA 1BKSA 3KDNA 3LBOA 1GYMA 1THFD 4H9MA 4KKXA 4IIBA 1XQLA 4O53A 2PA6A 4FNUA 4XO6A 3M9YA 1KWGA 3BLLA 2FVLA 3OJGA 2GFTA 4FR6A 5G1TA 1EP3A 1NIUA 4GI4A 5C0QA 2PDCA 5EMLA 1XG3A 4L4MA 3HMJG 3WBXA 1Q65A 1YXYA 3LHYA 1XIDA 4F0LA 2QIWA 4LSBA 3CYJA 4R7OA 4Y90A 4FNPA 1R86A 3QXBA 2ACQA 2BDQA 1ZCCA 4PZVA 3N9SA 4J3SA 3ORWA 4PODA 4MY9A 4XB3A 3W38A 3T40A 3RPTA 1AQMA 2X41A 3APGA 3ZSTA 5XIAA 2OFJA 5I79A 3N2XA 3W7OA 1AD1A 4JTHA 4GPNA 2BGQA 5FACA 5GJPA 4GUGA 8CGTA 4NZ5A 4NX0A 3R4IA 3BAIA 3MT1A 4GXPA 1KO0A 2TMDA 2H8ZA 5FF0A 6PTDA 3CQIA 2OWCA 1EO7A 2R6OA 2J7DA 3URQA 3SAZA 1JUEA 2MUCA 3MC5A 1V02E 4B2DA 3WMSA 1Q6LA 1CXLA 2WQDA 1Z6KA 3UETA 5M5DA 1V0NA 1E6SM 3VDHA 1IXPA 1XIMA 1Q4WA 1Q6RA 3PUOA 3R11A 5FF3A 2WMKA 2G4FA 3ARQA 1W5QA 1GPWA 2QJMA 3TAOA 3BJTA 4JQ1A 4HHPA 4XISA 2TODA 4H4IA 3GVGA 2OSWA 1J2BA 3KFTA 1JFHA 3UWVA 3MVIA 1JULA 1R38A 1C92A 1VD6A 1E9ZB 3EX2A 3N4EA 4DN1A 6TIMA 4DJDA 4HPXA 5U4NA 2WC3A 2OYMA 4H83A 2GQAA 4L64A 3DG7A 3TTEA 5AVHA 1IT8A 2J8GA 4GISA 3C56A 4H7VA 5J8LA 1TRIA 3C6CA 1BRLB 4E2OA 3RM4A 4QSHA 1C7TA 3CUXA 1GKRA 3EDEA 4LVAA 3QY6A 1XYMA 3PTMA 1C7SA 2P0IA 4K6AA 4PTWA 5EYWA 4ZB0A 1YXCA 3GTXA 4LBRA 4JICA 2GGJA 1PZ2A 5FSDC 3ZT5A 3OGVA 4YL2A 3R0KA 1M41A 4MKNA 3SUTA 4GFIA 7A3HA 3R94A 2X8RA 1TTIA 1GOQA 4KH2A 1OFPA 3PG8A 3G2GA 4XZMX 3AXXA 4ZXLA 1KBBA 1ME9A 2CXGA 4S3FA 2ZZ6A 5E9AA 2UY5A 5CBJA 1SJDA 1K9FA 1RR2A 2HVMA 1MFUA 1H0IA 3W1QA 2WNZA 1KFCA 3SCPA 2P3EA 4UFKA 3FDGA 3QV8A 4G6CA 1CGYA 4GBUA 1JR1A 1WKDA 1Z69A 2OX4A 1MDRA 3WBEA 1H5VA 1PJ9A 1HKKA 1OT2A 5HJXA 4A22A 1XG4A 1XYAA 1IEIA 1MEIA 3W7DA 3G1SA 4C1NA 4YTSA 3NPUA 2XYLA 5AY7A 5FESA 3T1GA 2DVXA 1GYNA 1EH9A 3AMLA 3FVDA 2JGYA 1POJA 2L5HA 1A5NC 2I5QA 3KL3A 1JF5A 4XQ6A 4Z08A 3WBAA 1Q2SA 4GNJA 4NY2A 5A8PA 3VOGA 3N2BA 4KPLA 4HNCA 3GXTA 3WD1A 3CJPA 3LTSA 3U9IA 3DH7A 5FI8A 1R3VA 4HZ7A 3A9IA 3ABOA 3GQYA 5BZAA 4JIEA 1UZDA 2TRSA 2YIHA 4AHPA 1O5KA 1B4EA 3K2GA 3B04A 2Z27A 1US3A 5G1MA 1BTCA 1ITQA 2QVHA 1MFVA 5H91A 5PTDA 4K8HA 1S2TA 3AALA 1QNPA 1P5BA 4JX4A 3LHTA 5LSMA 2DU2A 2XIMA 1LOLA 3CPRA 1ISVA 3WENA 3NQAA 3U7VA 1B5TA 1EJSC 5ENLA 1EGMA 2PGRA 2XGIA 5BXTA 2Y7FA 3CAQA 4JYEA 3ZSSA 2YOCA 4LVGA 4QEHA 1R8LA 3T09A 5CBBA 3WLTA 5FJTA 4AXNA 2B7QA 1DIKA 1OD8A 2J27A 4GXMA 4A3HA 4WX2A 4HP5A 1J9YA 1QRQA 5EJ1B 1J5TA 3GFYA 4US5D 3WQ4A 3F4NA 4LUJA 4E4PA 5C9WA 4QAIA 1PS9A 3L67A 1HP5A 3V36A 4XWUA 4MWAC 3ALFA 3VDAA 4P8WA 4IMCA 4DWSB 3A3HA 1K7FA 1R47A 1F3XA 1G5AA 4ZSTA 3NQ8A 1NDYA 2HE8A 1E5JA 4EAYA 3HQ1A 3PZ9A 2E6AA 1UR8A 3BARA 1GUVA 2X1TA 1ZRQA 3H2MA 4DNHA 1JNEA 4CUCA 2NQZA 3SI9A 1W56A 4N02A 3M0YA 2ATMA 4Z1DA 4CQAA 5DMMA 3W7PA 4MWAE 3H53A 3H23A 4DLMA 3FK4A 3R0UA 3GTHA 4DB7A 2BODX 3NM3A 5CZ0A 4ALDA 2A3LA 3STEA 5FEWA 5CXPA 4W7UA 3N19B 4PE8A 2EPHA 1LRNA 1GHSA 4L61A 4HA3A 8XIAA 2DSZA 5CAHA 2GJXB 2YPIA 3NXLA 1AVAA 3B05A 3OOQA 4ZR8A 1Z8AA 1GVSA 3G8RA 3TUUA 1B2YA 3UR8A 4JTTA 1VPYA 2PDJA 1F4AA 1JZ6A 4HMNA 3W6MA 3DUGA 2ZE3A 4C6CA 3EX4A 3KZSA 1DXIA 4Y7EA 1XDJA 1WYIA 1ONRA 3TWBA 2PDQA 4QR6A 3THUA 4RE0A 3LX9A 3B8VA 2JK2A 5A8OA 2PRMA 1A50A 1UHVA 1UA3A 1JZ4A 1TPB1 3M0MA 4TMCA 2P76A 1AMKA 1W8SA 2PBOA 4EF8A 3AXIA 3MHGA 3ARVA 2VC6A 4W8LA 5LGZA 2HE5A 5EGRA 3KCOA 3M0HA 4B4HA 9XIMA 4BF5A 2OLHA 2WZIA 3L4ZA 1FVPA 2CZFA 3M5XA 1CB2A 4GG9A 3M43A 1K03A 3OYZA 5E9XA 4BI6A 2Z2BA 1TIWA 2B31A 5E93A 4JFWA 1RJRA 4AZ7A 1IIGA 1AFSA 5EIYB 1X6LA 4M6VA 1BVNP 3H12A 1QHPA 3HPAA 1DWFM 1UWSA 3N3TA 3FA4A 1DE5A 2VUYA 2Q8XA 3KLLA 4NXSA 4XSMA 1EA9C 3KVLA 4MM1A 4MB5A 3CV1A 1MEWA 1EA0A 3T9PA 4GZIA 4ENLA 4ZTXA 5CPOA 4ZQMA 3A5VA 4W9TA 3F4WA 1H7PA 3CQHA 3S1WA 3VXGA 5A1AA 3WEOA 2QDHA 5C9RA 1EUAA 3OODA 4F0KA 4H41A 1E0TA 1ZBVA 1D8CA 4PB3A 1C8QA 4J3UA 1TV2A 4WSKA 4JN8A 1AUSL 3OIHA 1YDNA 2ZZ4A 3PAOA 5CG7A 1D2KA 3OTRA 3E0WA 4O0QA 3DC0A 1B57A 1DWAM 4NNCA 2PPGA 2VVSA 1REQB 2DDXA 4MHBA 3CZEA 2ODOA 3VIMA 4NZ4A 1M1BA 3GYCA 1CLVA 3C8NA 1GTHA 4I5RA 4PTXA 3BANA 3DI1A 4DELA 4RKAA 3UJ2A 2HDJA 3GNNA 1S5VA 1C91A 1EHAA 3EGJA 2WM1A 4M29A 4FP1A 1R46A 3H4WA 4IFKB 5KZEA 1QR7A 2F7FA 1NWUA 2X42A 5D33A 3BOLA 1KM4A 3LNMA 3UZWA 5LIYX 1FWFC 3VE7A 1KV5A 1XISA 3L4XA 4GQ0A 3TONA 1I2RA 2GJPA 2X09A 1YE4A 1IXOA 1EFZA 1FCUA 4DHGA 2UBPC 3RHGA 2J6VA 2V5CA 3GIYA 1H41A 3CWHA 1PZ0A 3UJEA 4L4LA 4S3DA 1L6WA 3GVWA 3THAA 1VYRA 3PWGA 1UBSA 2ZBTA 4Y9PA 2EPOA 1OJXA 4JL2A 3QZ6A 4ZO9A 2GVLA 1SZRA 3MMUA 3RLGA 3AISA 4E5TA 5AC7A 3GC2A 1B1YA 1XBYA 1OGBA 4UTKA 4XD3A 1QPKA 4JDBA 4NNAA 3VZXA 5IFTA 2ZUNA 4U3AA 2OQHA 3CHVA 4QG6A 3CPGA 3PPFA 1D7FA 3CGTA 4JGDA 1DPMA 3IIVA 3QMRA 1EDTA 1XIEA 3LG3A 4PN2A 1OSEA 3OZOA 1GORA 1VYSX 5TBOA 1U30A 2FFCA 3SFKA 3FY1A 3XINA 4DX3A 4LRTA 2V2HA 5FJJA 2DT2A 1IIHA 3AFBA 1VRXA 1I45A 2BOFX 5CH9A 2YYUA 1XBZA 5GJMA 4OUIA 5LHFA 5C7VA 3U48A 2J88A 1H7OA 1JCYA 1TO3A 3T78A 3IVSA 2I1OA 3AWOA 4NSBA 1DJGA 2AKMA 2DZWA 4H9XA 4RNHA 2RUSA 4LALA 3H2OA 4QQUA 1KGXA 3EXSA 1YADA 1M04A 4GXWA 4AD3A 1GOKA 3IV8A 1BWKA 2B81A 3HV8A 1BXCA 1ZS2A 3QR3A 3LMYA 2G3JA 9CGTA 3CZKA 3UCQA 2VQTA 2VR2A 3EOOA 3WLMA 2W6RA 3CTTA 4E4UA 4IIHA 3UJSA 3BW4A 3B8UA 4EPEC 1HQTA 3QQ0A 1FP8A 2CHNA 1EPXA 2DQWA 1KXHA 1N8WA 3E0FA 1XUZA 3UPBA 1SR9A 2A2IA 1YPXA 5E0FA 3EBVA 3IIOA 3GY1A 4JTFA 2NV9A 4NJIA 2A79A 3ZJ8A 3H7RA 5BOFA 1ISWA 2PP0A 1UW9A 2OQYA 1QVBA 1YPFA 2QR6A 1WDRA 3FW6A 3W87A 2ZZ1A 5B7YA 2A6NA 4IWWA 1R5YA 3FX4A 2Y63A 5CPTA 1TPFA 4W88A 4Q4QA 3E9AA 4TVUA 4DBUA 3W73A 4KWSA 2JE8A 3VM7A 2RFGA 1LG1A 5D09A 1HZYA 1XLMA 1IZKA 3Q2DA 3IGXA 3UU0A 1I2PA 4R3UA 1EJTC 1VFTA 4XX6A 1K77A 2PGEA 4FO4A 4IMFA 4G9PA 2BNJA 2EPLX 5K4ZA 1SQ7A 3KE0A 1VP5A 2D20A 3M7WA 1KGUA 1LF1A 3C2EA 3WZ0E 4MJ2A 4LCRA 2H6RA 1WKEA 5DY2A 2CU0A 1FWSA 2QJJA 1M7PA 3SBFA 3ZOAA 3GM8A 4UTJA 3EX3A 1XCWA 1KM1A 4ZFCA 3P2VA 3WQCA 1UP2A 1UC4A 5EFDA 3EA1A 2Q3OA 4O4WA 3KAOA 3F5JA 5DMYA 1UR1A 1XIHA 4IIEA 4RJEA 4X9YA 2HROA 3MUZ1 2AQVA 2RGLA 4AH7A 3TTQA 1LL6A 5HWJA 5GPRA 2CNCA 2WBKA 2ISVA 3RYSA 5HDRA 3PZIA 1DJZA 4IJRA 1PAMA 2VD9A 4MOZA 3TJIA 1V03A 1XV8A 2AGTA 2YXXA 3SDOA 2W62A 3LNPA 3GB6A 3IUHA 3TKFA 2DUZA 1M6JA 3DFQA 3CL6A 1V02A 1KBLA 3AMCA 2F6XA 2GQ8A 1S5MA 1FCQA 2YCJA 2WPGA 2IXUA 1N2VA 3UG5A 3STPA 3WFLA 1P0BA 1M65A 2JIWA 1C3FA 4NU7A 3FEQA 3KW3A 3K1GA 3T0CA 2NSOA 1QI0A 1GTEA 1XUUA 3SY5A 4PCPA 4JDYA 3SECA 3IAPA 1OF8A 4WLCA 4GO9A 5D30A 4ZCWA 1W5MA 4B91A 2OX1A 1JDDA 1MEHA 4KEUA 8A3HA 5E70A 4FX8A 2W27A 3CMGA 3IV3A 1X39A 3QTPA 2J7CA 1DQXA 3GNRA 1W6TA 2Y5EA 4FOJA 3NEHA 3VU2A 4NAFA 3WK0A 4ZODA 2INFA 4LVDA 1W1YA 2OXNA 4J28A 3DYOA 4R5EA 3GZAA 3WNLA 3SCNA 3DFPA 1BWLA 2Y7DA 4XBJA 4JIIX 4UR7A 3Q65A 1OT1A 2QCNA 4XZ9A 5LZLA 2WVVA 1SO4A 2J13A 1E6PA 3W7HA 3VGHA 2Q8LA 2C18A 2FB2A 2Z4GA 1KCZA 1F3TA 1EOMA 3EX6A 3L66A 4BEUA 4PL1A 3IJQA 1AH3A 4KEZA 1MQPA 3H22A 3GDMA 3OU8A 3HBLA 1GQLA 3AROA 2NXGA 4Q8MA 1ZPTA 2NUYA 2OMAA 2OTDA 3B9EA 3EWXA 1RBOB 2ZRWA 3MZNA 4IH3A 1UR9A 2F6UA 4PCNA 1JG9A 5HNRA 4D8LA 3S0CA 2D0FA 1OGSA 3NZRA 3DDMA 2CYGA 1RA5A 2WHLA 2ZUSA 4OUEA 1U1HA 1EXBA 4O17A 6ENLA 3PJTA 4GY0A 4R34A 4REQA 3T0BA 3W7LA 3TYCA 1VFSA 2FPVA 1W8GA 3ONCA 3K8LA 2WO5A 1U1JA 1H7WA 1I4NA 3ZYZA 3SW6A 1H7RA 3DU0A 2XUCA 3DG6A 2JEPA 3N1AA 1HL8A 3S83A 1TPDA 3P62A 1B54A 4IQDA 4GCAA 2X7VA 5C8BB 2Y24A 1J0KA 3VD7A 1YKWA 4F66A 3T42A 1TJPA 1EOKA 1GG0A 3RLUA 3S5ZA 3LXBA 4JNZA 2HWGA 2I7GA 2GZXA 4DRSA 1V0KA 3C2OA 3TYDA 4GVFA 5IBXA 3IACA 3FFSA 1XLLA 1AZ1A 5DO8A 2XINA 1IQ8A 4GI8A 3TC3A 4BJHA 4B9ZA 5CPLA 4I9MA 2VFGA 4PCFA 1JYXA 4C65A 3D0CA 1JI2A 2WLYA 3BAYA 3BLEA 5G4HC 4K39A 5A8NA 2VCBA 3DG3A 4QHRA 4L6DA 4HMEA 4OE7A 4Y9AA 3NSXA 3WD3A 1E73M 2FHBA 4HN8A 1BQGA 2J25A 1ZQ5A 2H90A 1UWAA 4W7VA 1WZLA 3GYEA 1K8CA 1D9EA 1MW1A 2PF0A 3W7JA 2ZX8A 5CGQA 4RDYA 4UIOA 3QZEA 2DUAA 3IGHX 4KWWA 4GOAA 1WAUA 4OKDA 1HJVA 3S2CA 4NAEB 2J7BA 5LNVA 2EBNA 3QGAC 4MWAA 2VEKA 2TYSA 2D2HA 3I3DA 5A5WA 3EEGA 4H6RA 4IL2A 2UV8G 2J7GA 3W3OA 3MYPA 1ZNNA 4O0ZA 1VCFA 4WJ8A 1X98A 2ISDA 2IMRA 1JAEA 4FX6M 5C6MA 1VPXA 1OFRA 3LCHA 2QAFA 4C6JA 4F8XA 1F76A 1NFGA 4GIRA 3RAOA 4HD5A 1OC6A 1A3HA 3T6CA 5RUBA 3WDQA 3UZ5A 4WOZA 4E4FA 3IJ9A 3DGBA 3OQEA 3ARWA 4BI7A 1VJZA 2QJIA 4AIOA 1HN1A 5KTLA 1LUCB 2GK1B 4X60A 3GFZA 2W79A 1O60A 3W9ZA 1A0DA 2R1PA 1XQKA 4FOKA 3UQNA 3NCOA 3ABSA 2XVNA 3VIGA 1OVDA 3ANUA 3W1RA 4ERAA 3AYRA 3LDVA 1WXYA 2VURA 1J6OA 1GOIA 4RV8A 3RNDA 3F2BA 8TIMA 3A4AA 1FDZA 2HTMA 4BY3A 1MW2A 1P7TA 2G4JA 2CLMA 4RPQA 3DERA 3B40A 3EOEA 4L6HA 4AF0A 2BSLA 3SIMA 1F3EA 4K7YA 2WNWA 4R9XA 4X3ZA 3W26A 1DIDA 3GW3A 3BG5A 1DWIM 3UWWA 4OHQA 1WKYA 5EJZB 1TPWA 2G37A 4MMWA 1MW0A 3SIZA 3LY0A 1NU5A 3MJYA 2QS8A 1KLZA 1WAWA 2GSHA 3NO5A 3UESA 4B90A 1TJ1A 2IKJA 1N8IA 3BAJA 3C2RA 3OLDA 4IG2B 5AC8A 3EMQA 4HKPA 3O6YX 1C8XA 2ISWA 1A5MC 3SGGA 4AY8A 3THQA 3GE7A 2V2DA 1VBHA 2ZKMX 4IX2A 4PTMA 3M64A 1I2NA 2DJXA 4XAGA 2P3ZA 3RR1A 2OOFA 4JNMA 4JFSA 3MKVA 1FTXA 1I75A 1DWJM 4ZO7A 1IZJA 4OBRA 1UQZA 3COTA 3UXKA 1JIBA 2W63A 3U2OA 1V6VA 3V0UA 3KM8A 4FXJA 1ELSA 4DXXA 2HPMA 1P1MA 3QJAA 4ZQOA 3HOJA 4W89A 2QQ6A 1W3NA 3I3BA 3ICJA 4HYWA 2PDHA 1KQYA 2BVTA 2J4GA 2W92A 2Y5SA 2I9EA 2V5DA 2Y8KA 3F7JA 4R27A 4NI3A 4PUUA 1IWPA 4K1GA 2PP1A 2REQB 3QSRA 5CLTA 3CS2A 2OZ8A 1HW6A 2HVOA 1H60A 2UWFA 3NVDA 1KR0A 2G5WA 4CCEA 1V93A 4OBSA 4X2PA 3TCEA 1PX3A 2Y6ZA 3GK0A 3LERA 2C1IA 1CTNA 4RE2A 4EF9A 3BSMA 4D8ZA 4QP0A 4IXHA 1IEWA 1LZOA 4ZXOA 1JYVA 4Q33A 1PX4A 1XFCA 2PGFA 3PTQA 3O06A 4LX4A 4F2UA 1GPFA 5CJ5A 1K6AA 4KWOA 3W2UA 4UQBA 1QATA 1P0NA 3CO4A 3VKJA 4Z0SA 4M6UA 2CKSA 4GIYA 1NJJA 1XINA 3BAKA 3QYSA 2WB5A 4DUVA 3E1F1 2P53A 3MB9A 3TLLA 4MIMA 3ES7A 2W0UA 4D8AA 3STGA 3QGVA 2QPSA 3D3FA 3WQDA 4LQ1A 1NP2A 1LT8A 3VABA 3EPNA 4OGZA 4NYUA 3WMBA 3I6TA 4CEXC 4EE9A 4CN6A 4IMDA 3PUDA 2VL4A 1EPVA 3B0UX 1GW9A 2VCAA 4P00B 3SN1A 4ZENA 1KFEA 1Q85A 1OYAA 3URAA 3UXIA 1GZ1A 5LIWX 4O15A 1OX4A 4GVHA 1XPGA 2CLFA 1NWRA 3TN5A 3QSTA 1MQRA 4KESA 5F2MA 1JDCA 2PWGA 2E67A 1L9WA 2V82A 3DAQA 3AS3A 3OB8A 2ZVIA 3INPA 3U6WA 3DHDA 2PCQA 1YTDA 3DESA 3NOEA 3EWUA 2AL1A 3OA3A 1R7AA 3IIZA 1J79A 5A6BD 2XVLA 1UH2A 3WNKA 3LCWA 1GEQA 3LLDA 4UNIA 2WVTA 3N04A 1NWTA 1TPUA 1U5VA 3MBFA 3R8GA 1CW2A 4IGHA 1QFEA 1PX8A 5ABGA 5I77A 1M7OA 1LBFA 1QI3A 4UNKA 3T4CA 2CLIA 4AZ5A 1LRQA 3KLKA 1NWSA 4HIBA 3CUFA 2IQTA 1MUCA 1WPCA 4NL1A 5C9XA 4PEEA 4EPBC 3EB4A 4O13A 2DVUA 1OFDA 3USBA 1TELA 3G8EA 2Z7KA 3ISIX 3UR7A 3NO1A 2VEIA 1AMYA 2XN2A 2GOUA 3THDA 1K4HA 4JTAA 4BR1A 3EWYA 3WJYA 1UJQA 2GSEA 1W2PA 4ZEPA 2ATSA 1TV5A 4NNBA 2GDQA 3OGSA 1PIFA 2BX7A 4CNSA 3H2CA 3V0TA 4LY8A 1Z41A 4ILSA 3HJZA 1H4PA 1VBGA 4IP4A 3TN6A 1U5JA 4F4RA 4J3ZA 3LCFA 3TR9A 4EPDC 3EDKA 1V3KA 2ZWYA 2BVWA 1PKLA 2OZTA 1A5SA 2HS8A 3L68A 2ZZ7A 4IICA 3P14A 2DIJA 2QUUA 3MA8A 3ECQA 4XSLA 3ARTA 1KB3A 4BZYA 3NQVA 5EPDA 1YRRA 3SSJA 1ADDA 1PKMA 3VOFA 2VCCA 4O1CA 1SFTA 4L7ZA 4FIQA 2J8FA 3AMGA 3ANYA 3P0XA 1UR4A 4YWIA 1KRCC 5CAKA 1GG1A 1LBLA 3CIXA 2OEMA 3BZJA 4BA0A 4MSSA 4YNGA 3FAXA 1HNYA 3TWAA 4HTYA 3HF3A 1CGXA 1DJHA 3EWWA 2HBXA 2PDLA 5FJPA 1UWTA 3VC6A 3G1XA 3WJXA 3USZA 1DKWA 2WPBA 3S1UA 4ZQPA 3E0LA 1PPIA 3A4XA 3ZVHA 2J9ZA 4H8UA 1GQIA 5JH1A 3SUSA 2BMBA 2HBVA 1OM0A 4A29A 5LHEA 4Z0JA 2JBMA 1AD4A 3SCOA 3T0AA 1UASA 3G1VA 3KBJA 3NZ1A 2W61A 3BV7A 2PWHA 3IRSA 5B80A 1JCLA 2G3FA 2WJZA 4JFUA 3ZLHA 3MWAA 2DZBA 3TQKA 4FMVA 3RRAA 3OBEA 4BKNA 1R3QA 5F4XA 5EMKA 2IPWA 1P43A 3GD6A 1K7XA 1EDQA 1LRTA 3MQTA 2X1RA 3W83A 5JIPA 1XC4A 1XGZA 4GUFA 3PJWA 4HSHA 3AOFA 4O28A 2ABAA 3VNMA 2WSYA 4W7WA 3W2LA 3W86A 4YYFA 2QCDA 1E40A 4PBGA 3UXDA 2QV5A 1MNSA 1BWVA 5KZDA 3HFYA 1RALA 4BEQA 4DIAA 1RBLA 3S6DA 2PWVA 3U4FA 1QNSA 2IKHA 4N9BA 4UBPC 2BBFA 3VZZA 2ZX5A 3PTKA 4HU0A 5BXSA 3L5MA 4CNUA 3BJFA 3M7SA 2O7SA 2GDUA 3TQ0A 2V5BA 4C91A 1XGDA 1JF6A 2WJEA 2WSQA 2OCZA 4KFNA 3LRLA 1PWLA 1E56A 4MF4A 2CFFA 1LORA 2EGZA 2D2OA 2HK0A 1LP6A 3OVQA 3L4TA 3L2MA 1EB3A 4PB4A 5DXYA 4HA1A 4AC1X 1Y8BA 2V63A 1LTDA 4TR9A 1US2A 3S6OA 1BSIA 4A3QA 4YS1A 3FKKA 4R7JA 4DBWA 4WKHA 2VC9A 4AG0A 3UERA 4M82A 1RY0A 1ISYA 4RK8A 3E74A 1EP2A 5AKQA 2FMNA 5BU6A 2ZQ0A 5EMJA 3I68A 3P0WA 1ITUA 3CL8A 3HV9A 2XGZA 3Q94A 5BMWA 3ITGA 2NWSA 4XKYB 3WLOA 3IPWA 3M0KA 1VBJA 3MDUA 5BROA 1H1YA 4PUJA 4D1IA 9XIAA 1FH7A 3UBPC 1HXJA 2AKZA 2OSYA 4NJJA 5B7ZA 1N82A 1QWKA 3NG3A 4JTKA 3OHIA 1UD3A 1XRVA 3GHTA 2O4MA 1NF7A 3K1DA 4XBKA 3AHVA 4JQ3A 2QDDA 1W9DM 3SCQA 4RNFA 5I02A 4XZNX 4I8YA 3AZTA 2W4XA 3AMKA 3DFNA 4N42A 1W1VA 3AIEA 3AWNA 1SJBA 1W3IA 5C9ZA 1XIGA 4AZGA 1KV8A 5EMMA 3URBA 1NAL1 3RJXA 2YL9A 1GQJA 2X40A 4UMCA 3W22A 2V9DA 4XAYA 1DHPA 4TIMA 3OVGA 3GC5A 4MNLA 3OO2A 4DM1A 2CERA 4U28A 2A0NA 2C0AA 3MI6A 4MGGA 2V8ZA 4I9AA 5FSEC 1NTHA 3AHTA 3GX9A 3VGFA 3ANVA 1JPIA 1TWZA 1FHDA 2FPTA 1JL8A 2OODA 3MMTA 2WSKA 1DXEA 1KBJA 1X1ZA 1C93A 2C71A 2HSAA 5G5IA 4MYAA 5L6UA 4GQQA 1XRTA 3TFXA 4M19A 3ABXA 2XVGA 3A13A 3PUEA 2D24A 3WNPA 2WMFA 3T8QA 5BYWA 3IUDA 1B3YA 4K38A 5CPNA 1PO9A 1SW0A 4EIVA 1JGMA 5I7GA 4LV4A 1K1DA 3LB0A 2XSAA 4C90A 5AFDA 3I4KA 5D04C 4C6KA 2YDSA 2VFDA 3RCMA 4PMUA 3NXFA 3WEMA 1OYCA 1E51A 1K3UA 2WVSA 1EXPA 1ME8A 1EGZA 4FAMA 4QDPA 3M07A 4GX9A 1PDYA 4WK9A 2X0YA 3WDRA 2BXZA 4POCA 1V79A 1VBUA 1RVGA 3P74A 2BXVA 3CM4A 4XO7A 1ZJHA 2UZ9A 3KUMA 5IRPA 4P8XA 3TNBA 2FVMA 2QXWA 4ZL1A 2PMQA 2YBTA 5DN1A 1WDQA 3GXFA 3ALGA 3QKZA 4GD0A 4N6EA 4EVZA 4IHCA 1GJWA 4H8NA 3N73A 4S2CA 5GJNA 1WOBA 1XICA 1RZMA 1CPUA 2HEJA 2F8QA 4C7DA 3S9YA 3NPVA 1ZGDA 4N7QA 4GKTA 3KVJA 2Y8VA 3CIWA 3QPYA 1O7AA 1X7FA 1JCMP 3QBUA 4OOZA 2BY2A 3WLNA 4ADUA 1KRBC 4JX6A 4MZYA 3R7MA 4OECA 1PHWA 1L8PA 4QJ5B 5HR7A 3CEUA 2YFNA 2CESA 1JCJA 5F2LA 3WO8A 3PZUA 4L4PA 3RCNA 3OEXA 4MZ1A 1KM5A 1E4MM 4F9JA 3U8GA 3KOZA 3CO8A 3CL7A 3P3BA 4I7VA 3WLPA 3VKKA 1A5LC 2EG8A 2PTWA 3G5EA 4V33A 4V15A 2RDXA 2F38A 2X0SA 1A5KC 2JKPA 3TTSA 1EC8A 2XH0A 1ZCOA 3MUIA 2X7WA 5M3WA 1IT7A 3FSUA 2WKJA 4I9JA 4ZE5A 4LUTB 2P8BA 2X16A 1QU4A 2XDFA 3TVAA 1GONA 1VQTA 1HGYA 3MMWA 4S3KA 3CXOA 4GUJA 4CGTA 2VDHA 1W1PA 3PJUA 1ZENA 2INEA 2DV0A 1FY6A 2OR2A 1RY8A 1G1YA 1B0IA 2W5FA 4UOZA 1XLBA 4DAFA 3VK5A 1YW1A 3M16A 3SUUA 1TKKA 3EKGA 4B5NA 2PF8A 3HO8A 4EACA 3NURA 5H8UA 3ARSA 1F05A 3J7HA 4PULA 4E2DA 1K7EA 2OG9A 2XFWA 5LA2A 1KXTA 1UUQA 4PA8A 3ZLGA 3RCYA 1EX1A 2J62A 1GVQA 3RRXA 4GVIA 4GJ1A 3WD2A 3T4WA 1PUDA 1BPLB 4AD5A 2W67A 4C5ZA 3W7RA 2BGSA 3TFCA 4I8DA 1EIBA 3E5PA 4H7ZA 4DAIA 4Q32A 1A5UA 1X97A 2XVKA 3HIJA 4MLRA 3UP8A 4LUSB 3BG3A 5BOOA 4EANA 2FFIA 3QRHA 3NQ7A 3AS0A 3QFWA 4QIUA 2PC8A 4Q8OA 1Q6OA 3TJ4A 3IEBA 4GY1A 1QDSA 4AVOA 1KFWA 2XSXA 2PEVA 2ONEA 1MI3A 3NYZA 1FP9A 3MO7A 4Z2GA 1K6WA 3PHAA 1C90A 3KTSA 3TMLA 5J5DA 1UUMA 1VRDA 3RLVA 3ARZA 2XU2A 4H9ZA 4H7CA 2GJRA 2XIOA 4JTJA 1H5YA 3POCA 5TQLA 3UZXA 2RDUA 3GNXA 5DFAA 4JY9A 7ODCA 1EYWA 3E49A 1DJXA 3SN0A 3FVMA 1WCGA 3ZQ9A 3BGGA 2PWUA 3WLLA 4WSHA 3NO3A 3SGUA 3F2DA 2VGFA 2VZUA 2VEGA 4D72A 5I09A 1P4CA 3CV6A 3IIXA 4GBDA 3WUBA 1I1XA 1XLKA 2OEKA 1TWIA 1WP6A 4P8VA 5ABHA 1OFQA 3VNDA 1ZAJA 2J24A 2CITA 3EAUA 4XIAA 5DELA 2D22A 4UTTC 5DXXA 1SFSA 1JZ3A 4JQAA 3AJ7A 2WWDA 2Z1BA 4WEVX 4MWAB 4CQ8A 4FEZA 4K8GA 4PRRA 1TMHA 3NGJA 2NZLA 3V5CA 4RDZA 2B7PA 3LTPA 2FPYA 1KFBA 1XLIA 1N8FA 4LYKA 3C2FA 2YCLA 5A8QA 4HNVA 5AOUA 1UMYA 1R87A 2Z00A 2NT0A 2GUBA 1EDGA 2ZADA 1OCNA 3QF0A 2VEPA 4PSPA 1MYRA 3EKZA 1P0EA 3B8IA 4Q8PA 4O0KA 1OK6A 4RNIA 5G1YA 2R14A 2G3IA 5REQA 3VGEA 4D6GA 3CH0A 4U5IA 4FZIA 1LG2A 3RPDA 1QO5A 4QQ3A 1DV7A 1WXZA 4ACZB 2PDWA 3GBEA 1DJYA 2VZOA 5HMDA 1JGIA 3N11A 5K7JA 1UUOA 2V68A 2E25A 3FGCA 3EXTA 4UMAA 1G69A 4EXBA 2IKIA 4CCDA 3PZNA 1SJCA 6REQA 1F6KA 4LF2A 5FJRA 3GR7A 2VKZG 1H49A 1C8YA 1T6MA 3QHNA 1WQ5A 5CPSA 4G56A 4KF1A 1J0ZA 4MG4A 1YEYA 1R0MA 3L12A 3S42A 2PDUA 3VM5A 1ONEA 5A6KA 3VD3A 5JXQA 3F1QA 3H4XA 1RSCA 3LCXA 3NDYA 1VR6A 1HKWA 2RKXA 3PWAA 1K4GA 3RMJA 1FFRA 2WSPA 4QROA 1R2RA 3K46A 1R2TA 4O1AA 3GAYA 3B97A 1BYBA 3A12A 1D7KA 4KGLA 4W8BA 3BVJA 1IT0A 1TV7A 1V6WA 3OBKA 5MKGA 1EYEA 2H3BA 5A3HA 4ML4A 3TQVA 4UR9A 2P8CA 4EWND 5HPCA 3TYZA 4CU6A 3AS1A 4BI5A 3QHMA 2DZTA 4DJEA 3QGKC 3LI0A 1CDGA 2J77A 3QYQA 2BWGA 3UVAA 5E0KA 3NQBA 5LNSA 4G7EA 4W5UA 3P81A 2RDWA 5K9XA 1VB9A 4AWEA 1F8IA 2OZ0A 3SUWA 3LM7A 3R43A 3ITXA 3GDKA 1WUFA 4O16A 5HAOA 6XIMA 1BYAA 3WNOA 3T81A 5AC6A 2VI0A 2XJ7A 1Y5WA 2PAJA 3SN4A 1HJWA 3TH6A 3PB2A 4PL2A 1C8VA 4IIDA 3UNTA 5A94A 4DPQA 4KT2A 1HG3A 5EBUA 2WJDA 2F61A 1TVLA 1TQXA 4PR4A 2HVNA 2YB4A 3WEZA 4AZBA 1XCFA 4GFSA 3RO8A 2CC0A 3BO9A 5KZMA 4KERA 2YA0A 4LU0A 1TZ7A 4NZJA 2NVCA 1A0EA 2DZPA 1V6YA 1GZJA 3BSGA 1VEOA 3H7VA 3N6QA 3CNYA 2PDMA 1FWIC 4LAKA 5HUOA 1QUMA 2CW6A 3OG2A 4H19A 5CCZA 4JTSA 2E3ZA 4LB4A 4HA0A 1UYQA 3QC0A 1KFKA 3EB3A 3UJRA 4C6QA 4JTCA 2DZUA 1P48A 4UQEA 3A3WA 4XIMA 3TEVA 4HA4A 1J18A 5A8GA 1AW5A 1DORA 4UCFA 1NM9A 4IPLA 2A85A 2YA1A 2QEZA 2OYLA 1L6FA 2OZ3A 4H2HA 4JQ4A 3W7KA 3CB3A 1L6GA 4PMYA 1MZHA 4KCWA 2CBJA 3UZZA 3GHSA 3SB0A 4GX8A 1JCTA 5HMSA 2QYGA 1F3WA 5CC5A 1AH4A 3TTOA 3PPGA 4LYRA 4JZ5A 3K13A 4QLKA 3HN3A 3W7IA 1U83A 3TAKA 5CSUA 1YNQA 1TR1A 3ZMRA 7ENLA 1O5QA 1MWOA 4CLMA 3TTYA 3CK5A 4AZCA 2CLEA 1HFBA 1GGOA 1V3IA 1UH4A 4PUNA 1V3JA 2F9RA 3DBPA 4B9YA 2YDAA 3GVRA 3WDIA 1AQFA 4ZZ9A 4HK7A 4LF1A 3TU9A 4FLQA 2FZ8A 3HFTA 4JIRA 4AHQA 1KM2A 3GNOA 2ACRA 3EWZA 4EK7A 3TJLA 4H3DA 2ZRUA 3N4FA 3ZVIA 4XVDA 4R33A 3UWUA 1QOPA 3I6RA 2FZ9A 1SZGA 3VOCA 2QCGA 3M0IA 1TV8A 4AMCA 4JTRA 4H9VA 4ES4A 5A2CA 5C2CA 3A9BA 3WF4A 3RK8A 3ATZA 2QPXA 4LGXA 4YVPA 3TV8A 5A6MA 4MJ4A 2A3CA 2XIQA 3BC9A 3KBNA 1RJQA 4HZ8A 4WGHA 3WQEA 2CWNA 3P67A 1Z44A 3U2CA 1ONXA 1JUBA 1FWCC 3TOYA 5DANA 2C7FA 3V5FA 4WGXA 1YDVA 1FWJC 3BICA 1A0CA 3O3RA 1B9BA 1QI5A 3A6OA 5C5YA 3LRKA 3MUY1 4DJFC 2P5NA 3C5QA 3BJSA 2OKTA 4LCQA 1VEPA 4XD6A 5FAGA 3LBMA 1FWWA 4EKJA 1RK6A 1UPMB 5DT7A 2E9MA 1P0KA 3W2NA 3DX5A 4S39A 2QUTA 1VFOA 1TYGA 3MHUA 2OGYA 1P0DA 3G0XA 5BXRA 4QTGA 3DFTA 4Y6GA 1XBXA 1CNVA 1K8ZA 3GG7A 3SY1A 4HCLA 1H1NA 1BTMA 1RV8A 5I03A 4QCEA 1QASA 1TREA 4Q8TA 3IRDA 2EF9A 4AISA 5A6JA 1H0GA 3WDJA 1A4MA 3GU9A 4MVAA 4NT0A 3AI0A 1H62A 3L4VA 2WQPA 1UD6A 1UWUA 2CLHA 3OQ8A 3WYZA 3MBDA 2OU4A 4S3GA 2VWTA 1XLDA 3VD9A 2KX9A 1XKJA 4K36A 1FX6A 5G2HA 1OIMA 3R2GA 5I3GA 3LA4A 3GLCA 3L5LA 4O1DA 2OELA 4GIAA 3G6LA 1YMYA 4WF7A 3HGOA 3KXQA 3T05A 3W70A 5ECUA 2WHKA 3ME3A 1AJ0A 3MSDA 1OEPA 2CWXA 2HK1A 5C70A 4R7WA 2B0MA 1P6WA 5K9DA 4O50A 4D6HA 3V4BA 1YPIA 1GQKA 1SZNA 3NL3A 2ZUTA 4WKFA 4DI8A 4CCZA 1FCBA 2XZ9A 4FB7A 3VD4A 4QAWA 3C8FA 3REQA 1QBBA 1SUXA 5DY3A 3WK1A 2VDGA 1MZRA 1LCOA 2VQUA 4HCDA 4DO5A 4ROQA 4WDTA 1VFMA 1XGEA 1T0OA 1GKPA 1VC4A 2ZC1A 3RILA 3TROA 5HUPA 1KGWA 3RUBL 2ZDSA 1FH9A 1VIWA 3M6YA 1AA1B 5DBTA 3JRKA 3MP3A 3O0FA 1DHKA 3LGDA 2QAPA 1G7UA 2Z2AA 3M5VA 3NQFA 3BLOA 3FHQA 2XISA 4R85A 4YU1A 3AUJA 1CEOA 5CSRA 1K9TA 1VCVA 2E8YA 3E96A 4LNYA 5ABFA 1C9DA 4O52A 3IJ7A 1NDWA 1GVIA 4AW7A 3NNTA 4ATLA 2GYIA 2NQ9A 2GWNA 3AYVA 2C15A 4Q4PA 2EPNA 1KA9F 3NUKA 3ARPA 4DI9A 1H1ZA 3ZLFA 5CJMA 3G18A 4JOMA 1VHCA 2EKGA 3L23A 3LMZA 5HWNA 1Q6CA 2V3FA 1LYXA 3TA6A 4JTUA 4RZ4A 3LGGA 3WF1A 2YLLA 2ISSA 5T91A 3UNDA 3M0LA 4JR5A 2PCEA 1NEYA 2OEJA 4OV9A 3N9KA 2O9PA 3PBUA 4JEJA 2ZTKA 2EKCA 1BQCA 2PS2A 2BHYA 3ZT6A 5I6SA 1UD8A 3AJXA 2FGZA 3I3EA 1EGVA 4GIEA 3HPZA 4TO8A 1CIUA 2GOKA 3BGAA 5E6ZA 1W3HA 1BF6A 2PODA 2WJFA 3VIIA 4YTQA 1IV8A 4HNNA 1BF2A 1KCKA 3MJMA 3D47A 3NAVA 2PLKA 1PB0A 3WQ8A 1SU5A 3SSZA 3UG4A 5AB3A 2E5DA 3UWQA 1RLDA 2HCVA 1L6YA 1M03A 1GQNA 3BSHA 1FWBC 3W84A 5SWUA 4AYSA 1R3TA 2WCAA 3S6TA 4S1FA 2YX0A 2WXDM 1JFXA 1S5NA 1F74A 4H9TA 4HSOA 2VGBA 1BVWA 2IXVA 2TSYA 4ZFMA 2BV9A 5I78A 1FH8A 3PAJA 1DJWA 3R25A 4HSNA 3LD5A 3CHCA 3GWQA 4C6BA 3BXWA 3LHUA 4JIHA 1OIFA 3CUGA 4MDOA 4RX0A 2XGBA 3C3UA 4P2VA 1E55A 2Q09A 3BQ6A 1IEVA 1E6ZA 4M1RA 4B5TA 3W1LA 2PURA 5I3HA 2DT0A 4CD4A 2DFAA 3QLDA 3N3MA 3H7UA 5I3JA 4PC8A 4DWSD 4HNUA 1ZU8A 3PULA 2VRQA 1HKIA 5LIUX 1XIIA 1W2VA 3A22A 3QPEA 1N7KA 2E5CA 3O63A 3EWCA 4OU1A 3O2LA 3PM6A 4B92A 5KITA 3B8SA 3BLIA 4WDWA 3H70A 4MKSA 4A3UA 1RXOB 4QS6A 4X0VA 3N34A 2B7NA 3GUGA 1ZTVA 1VGAA 1QK2A 1W3TA 3L0NA 2IKGA 3MW7A 1TV4A 5F2IA 5DT5A 2OWWA 1DBTA 3WQVA 5C71A 3QC3A 4B3LA 7XIMA 1LLOA 4D2JA 4GYPC 1G4SA 3Q58A 4H6QA 1J6PA 3ZWTA 1BXNA 2OT1A 1PCWA 3V7PA 1R2SA 2ZWZA 3ZJKA 3CZ8A 2YDRA 4LWWA 1JZ2A 1J8VA 4J40A 5FKYA 1R3SA 2VRJA 4MZ8A 2CLPA 2EXOA 1FOBA