3VTRA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 e328a complexed with tmg-chitotriomycin
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTNHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVAPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERFVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-acetylglucosaminidase
publication title Structural insights into cellulolytic and chitinolytic enzymes revealing crucial residues of insect beta-N-acetyl-D-hexosaminidase
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase/antibiotic
total genus 194
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vtrA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3vtrA01
3G6LA 1HL8A 4QCFA 1C92A 4ACZB 1Q6GA 3VD9A 3WD3A 3WQ8A 2PB1A 3ARSA 2YOCA 2J7EA 5M03A 1WDSA 1JF5A 2VX5A 1KGWA 1V6UA 2JALA 2WSPA 5E0FA 2XVNA 4MJ2A 2CEQA 4C7GA 3GXMA 4BQ2A 4S3JA 4CU6A 1OIFA 3BCDA 1ODUA 1O7AA 2WNWA 1GHSA 1JZ6A 2MANA 3VGFA 2EPMX 4J7RA 3AXXA 4XZWA 4URIA 1DWAM 1QHPA 4W5ZA 3O6AA 3ZJ6A 2DSUA 3IJ7A 2GFTA 4GKLA 2X09A 3FNDA 3NDZA 1IT0A 3WD2A 5A6KA 2D1ZA 2V5DA 1SMDA 5JBDA 2QPUA 5DMYA 2BY3A 1JI2A 7TAAA 4BF7A 4AEFA 1DWIM 5FL0A 3SCVA 1ITXA 4MDPA 1XCWA 1NQ6A 4D1IA 2GJXB 1V0NA 4TUFA 4W8LA 1TZ7A 3CH9A 3MS8A 1VENA 1KWKA 1TG7A 2CBIA 2WMHA 1HXJA 2J7HA 4CU7A 3U57A 1E5NA 3CUFA 3VO0A 3SUTA 3PTQA 4JKKA 1KXVA 2E9BA 1JNEA 4AEEA 5BXRA 3BCFA 1W3JA 1QI4A 2UY2A 3GH7A 1R85A 2WBGA 2J47A 3W6LA 5BROA 1BPLB 1UH3A 4M81A 2VURA 2ZWZA 2VQUA 3EBVA 4D6DA 3SCUA 3OGVA 5E9AA 4F66A 5HPCA 1JZ4A 3SCPA 3W4RA 1XHGA 3GM8A 3SUWA 3CUHA 1ZU8A 1E73M 1US3A 5HDRA 3ZM8A 1HX0A 2OWWA 4AW7A 4U2ZA 4DUVA 4X0VA 3F4VA 1VEOA 3GDBA 1JZ5A 3WNKA 3I3DA 3QR3A 3WMCA 2QV4A 1B3YA 5E6ZA 1TA3B 3KL3A 5FL1A 2XJ7A 5GNXA 4D6HA 2DIEA 3GXIA 3N9KA 1EO5A 4X0NA 3VIPA 2BHYA 2XFFA 5DF0A 2D3LA 2WC7A 3SEPA 4EE9A 1M53A 1HIZA 2G3IA 4L4OA 2VC9A 1MXDA 4UOZA 1HN1A 1ECEA 3UERA 1CWYA 1NH6A 3RILA 3AIVA 3VNYA 4GO8A 4E8CA 1JYVA 4P8XA 1NM9A 2CESA 1GVIA 4AD3A 2G4FA 2HVMA 1EGZA 1UD3A 2W67A 3PZ9A 4GIAA 1EIBA 1CXKA 2BHUA 4BCEA 4B3KA 4W7UA 5A6BA 3LPGA 2QMJA 5LYRA 4PN2A 3AOFA 4Z2HA 1AQ0A 1Z32X 2YL8A 1PPIA 2ZOXA 4CKQA 3I3EA 4J3WA 2OWXA 1GNXA 3AHVA 4JCMA 3VIHA 5D9NA 1K9FA 3UG4A 2J7CA 3GXFA 4A4AA 2PWDA 1C8XA 3UG3A 1UWQA 3K8MA 1UR4A 5TD4A 2D24A 3M46A 3U7VA 3WH6A 1PIGA 3K8LA 5JBEA 2BY2A 4ZXLA 6TAAA 3VDAA 1W2VA 2WXDM 2XGIA 2QMKA 1OCQA 1ZBCA 1GOKA 4CD5A 4AD5A 4PMYA 4HA3A 5HOSA 1V3IA 5E70A 1QOXA 3UR8A 5JUVA 2UWFA 2JFEX 3VIOA 2YIHA 4H04A 6A3HA 5CPTA 4GI9A 2GUYA 2OYKA 1XSKA 4C7FA 6CGTA 2WCAA 3B9EA 3ZJKA 4CCEA 4PUDA 4OIFA 2J77A 2VZUA 3EYPA 5I24A 4GXPA 2XVLA 5ABFA 2XPKA 3WH8A 1C90A 2YDSA 4UCFA 4CD8A 4MPKA 3MMDA 2E3ZA 2CHOA 3WF2A 3FAXA 1UKPA 4W89A 1MQRA 1QI0A 5HBFA 4KRTA 3AMCA 3OZOA 1PBGA 5CLWA 1H09A 2BS9A 4CN6A 2ZXAA 4JZ5A 3AS2A 4OBRA 4HOXA 2V3FA 1NOFA 2EQDA 1MWOA 4Z2JA 1E4NA 2EEXA 2G3MA 4Z2GA 1J0JA 3E1F1 2O9PA 3VGEA 1XH0A 1HJWA 4UQAA 5C70A 1XH1A 2ZX5A 5I77A 2QF8A 4JFTA 4WSJA 3W24A 2WC3A 3AIUA 3WDIA 1JDDA 1JF6A 1GJWA 4WSKA 3K4AA 4MADA 4EANA 3FY1A 1VBRA 1UWUA 1XYFA 3ZT7A 2V38A 4PCSA 1QPKA 3K1DA 3W37A 3L4TA 4MNMA 1U30A 2DT2A 1NOWA 3CUGA 2BHZA 2XSAA 1NWUA 1VB9A 4ML4A 2VZVA 1WZKA 1J0HA 4HMEA 2BY0A 4HA4A 4FLQA 3GNOA 5CXPA 3MMUA 2WVVA 1CIUA 4UQCA 3D3AA 1E6NA 1TFVA 3WBAA 1I1XA 1FA2A 1QVBA 1R7OA 1WE5A 3SCWA 3O2LA 2ZX8A 5A6SA 2JF7A 4WK9A 1V0MA 4D6CA 1W9DM 1I75A 1M01A 1PX4A 2AMGA 3BAYA 3B8SA 4AXNA 2OSYA 4MB1A 2DSWA 1CXIA 3BAWA 1LWJA 4JIEA 4TVCA 1QNQA 4EAMA 4HA1A 1CEOA 1LWHA 1C3FA 1JDAA 3BXWA 3WY1A 3GBEA 3RPMA 3AHYA 1OGBA 1EQCA 4AYSA 1XD1A 1KGUA 5I79A 1JYWA 1JD7A 1PJ9A 3UCQA 1R87A 3WDPP 4PSRA 2VVNA 2X8RA 1CGYA 2DT0A 4FLOA 5CZKA 2QLYA 3ZIZA 3VDCA 2G3JA 4U2YA 1UKSA 2CIPA 4BS0A 3WQWA 1KR1A 3POHA 3QOKA 4GZIA 2ZXBA 2VT0A 1OGSA 1UD2A 3T08A 3WD0A 4Y7EA 2EXOA 2Q8XA 3WF1A 5ECUA 1LG2A 1GJUA 3QHMA 3S2CA 4M24A 3AZTA 2DT1A 2Y8KA 4CD6A 2WHLA 3PZQA 4AD0A 4WJXA 1E70M 3OLGA 4LYRA 1CLVA 4LGXA 1VFFA 1JL8A 5DT7A 1V3MA 2DPEA 3CIVA 3SCSA 1GOOA 3OLEA 3WFLA 1G1YA 3CZKA 1NOUA 1ZBVA 3LPOA 1W9BM 1ZJBA 1UKTA 4MB3A 1V6VA 4PMUA 2J7GA 3BMWA 2X2YA 1QNSA 1IV8A 4JFWA 2CYGA 5IHSA 4AZCA 2BY1A 3FHQA 1C91A 1BQCA 8A3HA 4R27A 1AQHA 1JYXA 5CJ5A 2WWDA 1E40A 3TTOA 2YL6A 1K9TA 3PTKA 3AISA 1GONA 5CSYA 5IFTA 3PZTA 2X05A 3PZNA 1R86A 2ZXDA 1ZL1A 3B9DA 1HKKA 2YJQA 3AI0A 1E6RA 1FH7A 2DEPA 4LXFA 3AJ7A 4JAWA 2CETA 3RM8A 2X0YA 4YHGA 1A3HA 3KWXA 1QHOA 1WNOA 3DC0A 1Q6EA 1XV8A 1E5JA 1WZMA 5D8ZA 3T2PA 3IK2A 1GQJA 3VGBA 2V3EA 3BAIA 2VX7A 4UNIA 4D6FA 3KZSA 4TVDA 4FMVA 2VX4A 2VUYA 1J18A 3PZVA 5CPQA 3VPLA 3S6TA 2O9RA 5BWFA 3AYRA 5EFDA 4PTMA 1E1EA 2DT3A 3NSXA 4XV0A 4CVWA 1KFWA 3OGRA 4IPNB 3CHDA 2JE8A 4E2OA 3AS1A 1E6XM 1HT6A 3WDQA 1W9UA 1BVNP 1JGIA 1XC6A 1F4HA 5F7UA 2FHCA 3PZMA 2UY3A 1UD8A 4M1RA 1UQYA 3WNMA 3VM7A 1JD9A 1A47A 1V02A 3APGA 4OOZA 4P7NA 4QAWA 5FOOA 4LX4A 1QBAA 2G41A 2WZIA 3ZR5A 3K4DA 2WMIB 3AMKA 3EMCA 4DWSD 1Q6DA 2YL9A 3KL5A 4ZEPA 2CNCA 3T0AA 3CTTA 4UQBA 5IHRA 1H5VA 2RGLA 2Z1SA 1O6IA 1WB0A 1FOBA 4PMNA 4E4PA 3CUJA 1OGGA 3AQUA 4U33A 3DYPA 1B0IA 1FHDA 4MTVA 3LMYA 4QLLA 2YBTA 1V3LA 2EJ1A 5LA0A 1J10A 1JXJA 3TTQA 5D8WA 1FHLA 1E15A 1C93A 1W9PA 2WAGA 1PEZA 3I3BA 2CKRA 3CGTA 1DWJM 4P8UA 1W32A 1CXFA 2WZHA 5D9OA 1BVZA 4W84A 7CGTA 3TONA 4QDMA 2VZTA 2W4XA 4A3HA 1EHNA 1Q6CA 2V3GA 3UG5A 2FHBA 2VCCA 3SUVA 1UHVA 4CCCA 1GORA 1S46A 4PMQA 3WEOA 3M7SA 1HKIA 4UFIA 4AD2A 4DWSC 2DH2A 2XWDA 3WL1A 1KXTA 1H1NA 1BG4A 3CBWA 3FW6A 4Q22A 3WNPA 1MXGA 3WUGA 2CKSA 1JG9A 5I78A 2D20A 3VUPA 1R7AA 4F8XA 1AVAA 5M17A 4BQ5A 2EO7A 5KZ6A 1TVPA 3FAWA 4JFUA 2O92A 2W61A 2WBKA 5GNZA 4DM1A 1J0ZA 4WLCA 5FIPA 3MSDA 3CHCA 1GW1A 5DEZA 3CHFA 5ABEA 3JUGA 5D4YA 2WMKA 4JHOA 2ZIDA 1CGVA 1K9DA 3SURA 5FKYA 4NRRA 3AHXA 1VIWA 3EDDA 4KGJA 3AZRA 2OWCA 4BQ4A 4BQ3A 2XFRA 1WDQA 3M6DA 2ZUTA 4WKHA 1G94A 1KQYA 1HVXA 1W3KA 2C8NA 3AMDA 2E8YA 3A4AA 3EMZA 3W25A 2XHYA 3WN6A 2WLZA 2Z1KA 4Q7NA 2PBGA 3NJ3A 4AC1X 2XVPA 4PBGA 4GZJA 1E43A 3L4VA 1C8YA 1FH9A 1YHTA 3DYOA 2FHFA 5A6LA 1MW2A 3CZ8A 4YHEA 1E55A 3AIQA 4AZ7A 4MNKA 2ZUUA 4D6EA 4KMQA 4UQ9A 3OGSA 4NZCA 2RGMA 4B16A 4PMXA 2D22A 2D0FA 4LQ1A 3OG2A 2Y4SA 3GNRA 2VX6A 2VCAA 4H8HA 4D71A 3RM4A 3BGAA 3W27A 3L4WA 1GOQA 3F5KA 3CZEA 1RD6A 3VD7A 2VRJA 3T2QA 1N82A 4HU0A 1WDRA 2GVYA 4D1JA 4FLRA 4N0RA 4UFKA 1HP5A 5D9MA 1OBAA 4M56A 1CGWA 1GPFA 2EPKX 3WENA 1EOMA 2WHMA 3BSGA 3SCQA 3VMNA 2XIIA 1MW0A 1E6SM 1BFNA 3PN8A 1CYGA 5GPRA 4P7RA 1MFVA 1GHRA 2WW5A 4MNJA 4PEEA 1BTCA 1GVYA 1QBBA 4UOQA 5A94A 3OBAA 2J62A 5I6SA 3AIRA 2WLYA 4PMRA 3KEHA 5EMYA 4W7VA 2WZEA 2DSZA 2J74A 3WUFA 3WD4A 3UETA 3RO8A 1CXEA 2VRQA 4KWUA 1V03A 3BMVA 4R5EA 3RDKA 3HN3A 1M03A 2XUCA 1QI5A 3U7BA 4J3SA 4ZE5A 2A3CA 4UQEA 2WKLA 1UD4A 2BFGA 3IJ8A 4MB5A 3W38A 3GNPA 1GQLA 1NP2A 3SUUA 2VZOA 2VL4A 4TTUA 2OYLA 3OA5A 2Y8VA 1CGXA 2XGBA 2DH3A 4P8WA 4HZ8A 1KGXA 3W29A 1ISXA 3NIYA 1JDCA 2F61A 1W9XA 2YLLA 1WO2A 2X0HA 4RE3A 2PWHA 1BLIA 2WSKA 3CZLA 2EPNA 8CGTA 3BC9A 4TX8A 4MNLA 2DIJA 1DHKA 1LQ0A 3EDJA 3VNZA 4W8BA 2VO5A 1QNOA 3ARWA 1GOMA 3G6MA 3N1AA 3WNNA 1EXPA 3ZR6A 5BRQA 4CD4A 3IAQA 3WF0A 4V2XA 5A6MA 3THCA 1NWTA 1QNPA 3WEMA 4XB3A 1C7SA 3N11A 2CHNA 2GK1A 2WMGA 3WDRA 1HP4A 3AYSA 4IUGA 3MV01 2ZWYA 2NT0A 3ZMRA 3N12A 1VF8A 3AICA 1GOWA 3ZQ9A 1TUXA 1VAHA 2J4GA 1NWSA 2HISA 1JXKA 4HPHA 1XD0A 1UZ1A 3VDHA 1KQZA 2BVTA 3TP4A 3WF3A 3AS3A 4GQQA 1WKYA 2ZICA 4CN1A 1VRXA 1W1YA 3GYCA 1WDPA 5A8NA 2ZUNA 1X6LA 3L4XA 1FFQA 1UD6A 4UFLA 2G8ZA 1DP0A 2D0GA 1W1TA 5BXTA 5DFAA 5EB8A 5LA2A 2OSWA 1E4IA 1UWRA 3WNOA 2PWEA 4ZENA 4LYQA 4JL2A 4F9DA 1PIFA 4CUCA 4J3VA 3WDHA 4K68A 2BVDA 2W62A 2W5FA 3AXHA 3A3HA 3ARZA 1K6AA 2ZUWA 1OT1A 2YL5A 3AHTA 4J28A 3W81A 2Y5EA 4UZUA 3F5JA 4Z2LA 2J7DA 3OB8A 1OB0A 3WH7A 3AFBA 2F2HA 1D2KA 2JIEA 3LPPA 1UA3A 1HKJA 4CGTA 1HJXA 4CVUA 3N15A 3PZIA 1UH2A 1VEPA 3VIMA 1TR1A 1V3KA 2ZXQA 3KL0A 1Y7VA 3AXIA 4U3AA 1QNRA 2WYSA 3FN9A 2QPSA 3RM9A 3FXYA 1BG9A 4DWSB 3AZSA 1JZ7A 2NW0A 1UUQA 1MYRA 1CXLA 3VX0A 4PUEA 2WB5A 3LPFA 2JEQA 3SUSA 4W86A 1KXQA 3KE0A 5CSUA 1VJSA 3GTNA 3MKKA 4NSBA 1B3VA 1HJUA 3SCNA 1CECA 3VIGA 4AD4A 1D7FA 1JI1A 3K46A 5ABFB 1E0VA 2YA2A 1E3XA 1BYAA 3WSUA 1WPCA 2WMJA 3PZOA 4U5KA 2VJXA 1KBKA 2WPGA 3VMPA 1UD5A 1VFMA 5CQ1A 4ACZA 4XX6A 3VTRA 1KXHA 1DTUA 3W0KA 1HJQA 3W26A 5CGTA 1CLXA 1X6NA 3MUY1 4H41A 4KGLA 2ZX9A 4PRWA 1K9EA 3VM5A 3VX1A 3ZO9A 1UR8A 2WVTA 2JEPA 3NUKA 4HZ6A 4U5IA 4OOUA 2J8FA 4D6GA 3AMGA 3GH5A 1OT2A 3OIHA 3TOPA 4FLSA 4KRUA 2VQTA 3B9AA 3MSGA 3ARQA 1DWFM 1UWIA 2YA0A 1B9ZA 5ABGA 1F4AA 1UKOA 3VIKA 4ATLA 2XVKA 2XFYA 4NRSA 2O9TA 1EDQA 4B9YA 1GZJA 1B2YA 1WZLA 2YA1A 1KWGA 2ZUSA 1KR0A 3EDEA 1LF1A 5GNYA 4PMDA 2UY4A 2X1IA 4QCEA 2XWEA 1HKMA 4XZBA 1GQKA 4X9YA 1V3HA 2WVVB 3EMQA 1IZJA 3BAXA 3ZSSA 3WEZA 1E0WA 5A6BD 4HP5A 5I3DA 3BLPX 4GZEA 4V28A 2GJXA 2G3NA 1GCYA 4Z2KA 1V02E 1I1WA 1ISYA 5AY7A 2WKGA 5JBFA 4W93A 2IXUA 2D3NA 1CENA 5C71A 3ZT6A 5A8PA 2O9OA 1J0YA 2IUZA 3SCTA 2A3BA 3WD1A 1W3LA 3WFZA 1JAEA 1J0KA 3L2MA 4B9ZA 1UKQA 2PWGA 3AIWA 1ITCA 4S3KA 5IFPA 3ZOAA 1V6WA 1HL9A 1W3HA 4GQRA 3A4XA 5CLTA 3WH5A 1HNYA 3W53A 1VJZA 2E8ZA 1UH4A 2J7FA 5A95A 5ABHA 3WUEA 1M7XA 4JKMA 3VVGA 2J7BA 1L0PA 4PCTA 2VNCA 3WH9A 1MW1A 3O9NA 3ZJ8A 3NDYA 3UESA 3IANA 4CN4A 3TTYA 2VVSA 3CLWA 3BSHA 1SMAA 4GO9A 2DSKA 4WKFA 3VGDA 2XTKA 1B1YA 1MQPA 3ARVA 5CGMA 1E6PA 4CU8A 4AD1A 4P7OA 1E6QM 3F5LA 1UR2A 4UFMA 4HOWA 5E6YA 3ARPA 3EDFA 5I2UA 4AIEA 3U5YA 5A2CA 3AIBA 4PMZA 4DUWA 4C7DA 2D2OA 2E4TA 1TA3A 2ESCA 4P8VA 4W8AA 1ZJAA 2WVSA 4D6IA 3NSNA 4J3XA 5BCAA 3VD3A 3OLIA 4AZGA 5A2BA 3WQ4A 3L4UA 1QW8A 4Z2IA 1LLOA 1R8LA 2WCGA 1TE1A 2PI6A 5I23A 5M3WA 1CPUA 1E56A 2A3EA 3L4YA 2WWCA 3DHPA 5HNNA 4AZCB 3IAPA 2ZX6A 1E72M 2J79A 3UEQA 4UFHA 3RIKA 2GDVA 4MDOA 2WCSA 3OLDA 3PHAA 4M29A 1UR9A 5AYBA 1V08A 1JZ3A 3PZGA 3MV11 3RJXA 2XVGA 4AZIA 2W91A 1YQ2A 1EH9A 4QLJA 1SFSA 4JKLA 1U2YA 3GZAA 1MW3A 3CHEA 3U5UA 1BAGA 1E4LA 3TA9A 4PSPA 4PYSA 5JIPA 3VGHA 2EBNA 4JFVA 3RCNA 4TXEA 1JAKA 2WK2A 1B90A 3DECA 4LPCA 3WQ5A 4IPLA 7A3HA 1V6XA 4BZYA 2OSXA 1BYBA 1DWGM 1UYQA 1UQZA 2TAAA 4DM2A 1E3ZA 1TMQA 2F8QA 4JFSA 1XSJA 4F9JA 1HJSA 1CGUA 1JZ2A 2XM2A 3PZUA 1VFUA 3HJEA 2DGAA 2VCBA 4HMCA 5I5RA 1W9VA 2CBUA 3WQVA 1CDGA 1H2JA 2YBUA 2W66A 2PF0A 1HF6A 1WAWA 5DT5A 3AS0A 4GI8A 4C91A 2XSBA 2QHAA 3ARUA 5HPOA 4NF7A 4E8DA 2XIBA 1H3GA 3BAJA 5CG0A 2FGZA 4U3CA 2ZX7A 5EFFA 1Q4NX 3MUAA 1U33A 1OIMA 2BNJA 5CPSA 4PTVA 1E0XA 3N18A 3ARXA 2A3HA 1ISZA 5A1AA 4KH2A 2ZUMA 2PWFA 3OZPA 1EO7A 1BF2A 4EK7A 2WHKA 2CERA 3CUIA 4H2CA 2D0HA 1FFRA 4TX6A 4IISA 1BSIA 2DSVA 3IJ9A 4ACYA 3A4WA 2VR5A 3VKKA 2J8GA 4UTFA 2EPLX 1HJVA 2XG9A 1CTNA 1C8QA 1ZBKA 2CPUA 3CO4A 4PMVA 5DO8A 1CXHA 1GUVA 3ZT5A 5FCZA 4M8UA 3DHUA 4AISA 2CCRA 1UOKA 3WF4A 5AYIA 1TCMA 2E0PA 2A3AA 1H41A 1V0LA 2FH8A 2YDQA 4J27A 1JYNA 3N13A 3L2LA 1EQPA 2NT1A 1CBGA 1BYCA 4CD7A 5BYWA 3FHAA 3UR7A 3WIJA 1MFUA 1DEDA 1L8NA 2AOSA 4D6JA 3ZJ7A 4DUXA 1VEMA 1W1PA 2VRKA 1JFXA 1JNDA 3TTSA 5A6JA 3W82A 3W28A 4U31A 1RP9A 5A8MA 5M5DA 3DYMA 2DDXA 1H4PA 2E9MA 4JL1A 3RMEA 1QI3A 1J01A 5EBAA 4MAZA 1BHGA 4XUYA 1JFHA 1QHZA 5AC4A 1LG1A 1UA7A 2V3DA 3WBEA 2IXVA 5I0DA 2YDRA 1QW9A 4HTYA 1M04A 5A6AA 1XYZA 4AZHA 1H0IA 1X1NA 1UZ4A 4DWSA 1UG6A 4P7QA 4AZ6A 2UY5A 1XCXA 3D5HA 4WKAA 1ZB5A 2XM1A 4B15A 3CZJA 1QI2A 5IXEA 2VR4A 3QGVA 3WNLA 3VINA 2W92A 1H11A 5KEZA 3WQ6A 4TOQA 2YLAA 1XGZA 4A3YA 3II1A 2VZSA 4ZXOA 3VIFA 1G9HA 1KB3A 2B31A 5AC5A 3CMJA 4WIWA 1NP0A 1OD0A 4RL3A 3K8KA 1RP8A 3AHZA 1CGTA 4RE4A 2BXYA 4FF5A 2WANA 3EDKA 3VD4A 1ESWA 1H49A 3VIIA 1JZ8A 5C8BB 9CGTA 1UWSA 1BGGA 1B3XA 3HU7A 2OYMA 1GOIA 2FH6A 4M82A 3AIEA 3WDJA 1J12A 1HVQA 5LA1A 4OJYA 3CMGA 1W1VA 4RE2A 1OM0A 3VGGA 1PZ2A 1MQQA 3POCA 2DQXA 3ECQA 3WKZA 3QHOA 3NSMA 2BXZA 1B3WA 3ARRA 4PTXA 5A8OA 3MANA 5BRPA 2XYLA 1WP6A 1EDTA 1OINA 1KBBA 3BH4A 3BAKA 3T2OA 3MU7A 1FP9A 3ALFA 3WMBA 4HZ7A 3BLKA 1B30A 3QOMA 3T0BA 4D72A 2V5CA 1AQMA 2Y24A 2BV9A 5E0CA 3MO4A 2ZUVA 4OUEA 1C7TA 1LJYA 1P6WA 4AZBA 3M07A 1G01A 1LL7A 4ATDA 4H7VA 1WCGA 2GSJA 2VMFA 4JHZA 2W63A 2VI0A 1PX3A 3GXDA 1E6ZA 4AWEA 5E09A 1KCKA 1Q6FA 1FH8A 1RPKA 1J0IA 1VFOA 2WHJA 3WELA 4W7WA 2CITA 4P7LA 2D23A 4WF7A 2E40A 4J3UA 2CBJA 2C0HA 1AMYA 1EOKA 1D3CA 1UR0A 1W2PA 1NWRA 2WVUA 4NI3A 1GQIA 4GINA 3A47A 1EHAA 4FK9A 3W6MA 1LL6A 3AMLA 3VDBA 3SCOA 4PMOA 1US2A 4C90A 1KCLA 2J25A 1OWQA 3ZSTA 1OSEA 1EA9C 2VOTA 3A6OA 1V0KA 3VOCA 4B3LA 1DWHM 2CBVA 1E1FA 4J3TA 1B3ZA 3QHNA 4HOZA 1EDGA 2E9LA 1VBUA 5IDIA 3MUZ1 4V27A 1SYTA 3CPUA 4ZE4A 3L4ZA 4M80A 3VIJA 2EPOA 4YN5A 4OBSA 2PC8A 3RJYA 4TTGA 3WUBA 5BXPA 1ISWA 1PZ3A 2WMIA 4MB4A 2WM0A 3ALGA 2GK1B 3N17A 4W88A 3AROA 4GI6A 5JIWA 3NCOA 4F79A 2FDMA 2WC4A 1XH2A 1J11A 3PBGA 2BVYA 3MMWA 4AIUA 2Y2WA 3T0DA 1NARA 1WZAA 5HXMA 4AIOA 4UZSA 4HPGA 3SCRA 2CXGA 4N42A 3HMCA 1IZKA 1FP8A 2JF6A 4W87A 2JIWA 2GDUA 1RH9A 1CZ1A 3VU2A 4OZOA 3CZGA 5BXSA 4UOJA 4QFUA 2PBOA 4OKDA 2YKKA 4MAVA 4UQDA 1UWTA 4W5UA 1V3JA 4YPJA 2AAAA 4ATWA 1ODZA 4ZFMA 5A69A 4PTWA 3VD5A 4HMDA 3THDA 4QLKA 4MJ4A 1CNVA 4AZ5A 1B31A 1ZS2A 1UR1A 3WMSA 5A8QA 3PTMA 1ZBWA 3ARYA 4QP0A 3SIMA 1SR0A 2NSXA 5A3HA 2GJPA 1LL4A 4EKJA 2GJRA 1PAMA 2ZE0A 5FD0A 5D9PA 3J7HA 4AMCA 1H0GA 1PX8A 3GBDA 4GPNA 3ARTA 2VTFA 1E9LA 3GH4A 1BYDA 1E71M 1TVNA 4IM4A 3N04A 3T09A 2J78A 2WMFA 1MVYA 3MUIA 5A2AA 5GQBA 4BA0A 1J9YA 1JIBA 2OLHA 1V6YA 1OD8A 2FGLA 4H8VA 1XRVA 4TVUA 4AY1A 4CCDA 2C7FA 4L4PA 4W85A 3WL0A 4LYPA 3VMOA 1G5AA 4UFJA 1BGAA 3VILA 4JCLA 1XSIA 1G0CA 4UR9A 2J75A 3NYDA 1ISVA 4HU8A 1W91A 4H8UA 1E4MM
chains in the Genus database with same CATH superfamily
3P84A 3W74A 1C92A 4ACZB 3TVAA 1ZRQA 3VD9A 4H1ZA 3TN3A 3WD3A 1XRFA 5CSRA 4K38A 4ZB0A 3NNTA 1VC4A 1UPPA 1EBGA 2B81A 5B7YA 1RBLA 1WDSA 1JF5A 2VX5A 2JALA 2XVNA 1BWKA 1SR9A 6XIMA 2GGEA 4BQ2A 4S3JA 1A5NC 4ZL1A 3S1WA 4E3VA 3GS6A 2DZPA 4GUIA 2CZVA 4B92A 4J7RA 3AXXA 4JXCA 3R8HA 4DO7A 3P6LA 3MHUA 1AH3A 4W5ZA 2DSUA 2ISVA 4GKLA 1UIOA 2RH9A 4KWWA 3WMLA 1W1ZA 1N7KA 1LOQA 1SMDA 2AQVA 2FTPA 1JI2A 3STFA 4JNZA 1NF7A 4C6CA 4MDPA 3CEUA 4OGZA 3MI2A 2GGIA 3KOXA 3HOJA 1UWAA 2VR2A 4MYAA 3NPXA 3MS8A 1VENA 2R1PA 4O14A 3PTQA 1REQB 2E9BA 1JNEA 1W54A 2WBGA 2PU1A 1BPLB 3C5QA 1UH3A 3T8LA 2ZWZA 3HPSA 3PAOA 3BARA 3OGVA 3UWUA 5HPCA 2AL1A 3Q4DA 3WLKX 4WDWA 2H90A 1JZ4A 4DPQA 1RK5A 3HQ1A 1XIGA 3SGUA 1FWSA 3E2VA 3ZM8A 4N4QA 1HX0A 3W85A 1EC7A 4DUVA 3KRSA 4X0VA 4I8DA 4ERIA 3DFYA 1TPDA 2D69A 2HPIA 3BOXA 3LBOA 2QV4A 2PDPA 2Q02A 1TA3B 4R7OA 1AJ0A 5CH9A 2V5LA 4QG9A 1Z8AA 4HSNA 5HMDA 4MVAA 1EO5A 3K30A 3VIPA 3JW7A 1KFEA 1LUCB 3TYCA 2ZRZA 4ZGYA 5REQB 3R43A 1J5SA 1KO0A 5K7JA 4POCA 2E6FA 1AG1O 3V36A 1VFSA 2Y1HA 3AIVA 5H8MA 3VNYA 1JYVA 1TJPA 2HQAA 3G1AA 1EC8A 2G4FA 3BURA 2W6RA 1JCXA 3PZ9A 2H9AB 1EIBA 1CXKA 1WAUA 2QCHA 5A6BA 4I5RA 2QXWA 3AOFA 4KBXA 2C18A 1DJYA 2TMDA 3KDNA 3DENA 4CKQA 3I3EA 1GNXA 3E3HA 2VEMA 4JCMA 4FA3A 1YYAA 2R91A 3A22A 4WUIA 1M5WA 5D9NA 1K9FA 1OX5A 1S5TA 3DKJA 4REQB 2PWDA 2ZE3A 3NG3A 1YE6A 4NASA 1XWYA 3GU1A 2BY2A 3MT1A 2WXDM 2XGIA 3R79A 4GH3A 1DKWA 1OCQA 4CD5A 4K6AA 4AD5A 4PMYA 3IV3A 4O0ZA 4HA3A 1P1XA 1S1RA 1WUEA 2A85A 3UR8A 4H6KA 4A8IA 2V67A 3W6YA 1V5XA 3FXGA 2JFEX 3VIOA 1KRCC 4KERA 4FNRA 4PUUA 2Z25A 2GUYA 4PB4A 2EG7A 3WLMA 6CGTA 4UR8A 4GC3A 5C2GA 1XYAA 1EEPA 1V8EA 3T07A 4PUDA 3PFMA 3DFSA 3BLFA 3CUZA 1SO4A 4DRSA 2XVLA 1YLVA 1C90A 1JCMP 4Q4OA 3G1RA 1A80A 4MPKA 1Q7MA 3MMDA 3OYXA 3JVAA 3S1VA 3FAXA 1QI0A 1LRNA 5HBFA 3OZOA 4H9ZA 3O63A 4Z1YA 1EJSC 2ZXAA 4I7VA 2RFGA 1H7RA 1ZY9A 3QZEA 2P88A 4JTKA 1OFOA 2G3MA 4Z2GA 4C6BA 4XKYB 3VGEA 2WNQA 1HJWA 5SWUA 1G4SA 4DF1A 1F6KA 1XH1A 3B8UA 1KBLA 5I77A 3RLVA 4B4HA 4OBTA 4WSJA 3W24A 3NOYA 3BLDA 4JYDA 3SFKA 3VOFA 4CQ8A 1OFBA 2ZRXA 3GFYA 1XYFA 1UWUA 3ZT7A 2V38A 1JRBA 3K1DA 3W37A 1ZALA 3A13A 2DT2A 2GOKA 4WX2A 4XAGA 4M6UA 4Z42C 3NM1A 2PDIA 5D04C 2PEVA 4S2BA 2ZZ4A 4EPBC 1M6JA 1RSCA 4RXFA 5CXPA 2WVVA 3DIPA 2A7NA 3O8AA 1BEUA 4UQCA 1VBJA 2QUVA 4DEFA 3WBAA 3FK4A 5A6SA 2JF7A 3C61A 1V0MA 5I3GA 3B8TA 2A21A 3UPBA 4QEEA 3VI2A 3WLHA 4GI4A 1PV8A 2OSYA 2DSWA 3GD6A 1CEOA 1LWHA 4PFMA 1QOPA 1C3FA 1IWAA 3MVTA 1JVNA 4YIWA 4JQ2A 2QIIA 4C1LA 5GJMA 3P0WA 4KEVA 1IWPA 1GEHA 1JD7A 4L1WA 3WDPP 5D2WA 4MWAA 1XLMA 3W1MA 3VOJA 2DT0A 2OJPA 4YMZA 5FF2A 3ZIZA 2DVXA 3GR8A 4NNBA 4ZQCA 2G3JA 1SQ7A 3W73A 2DY3A 2JKPA 1T8QA 4LNCA 3WQWA 1KR1A 3QOKA 2WJZA 2VT0A 5BWAA 3LN3A 1TWZA 5ECUA 1TWWA 1HG3A 2CLMA 3BW4A 1GWJA 2Y6ZA 2GQAA 4CD6A 3PG9A 4NIRA 3PZQA 4Q8VA 3KBWA 4C6IA 1E70M 1X39A 4XZMX 4LYRA 5I3JA 1TV2A 4LGXA 1RBAA 3QH2A 1YRRA 3MP3A 1XLLA 1TWSA 1WKFA 1L9WA 1DJGA 4L1GA 4E8GA 4G56A 4PMUA 2P8CA 1IV8A 2PDMA 3E5PA 4Z1AA 4U10A 4NU7A 4F2TA 4AZCA 4PEKA 1GZ1A 3E49A 4IQJA 1K9TA 1V51A 3AISA 3NXFA 1BTMA 4DJED 3PWIA 1NEYA 2G97A 2Y7DA 2X05A 3PZNA 3GUGA 4LV9A 4JOMA 3B9DA 1HKKA 3GG0A 3AI0A 1Z3NA 3BQ6A 4LXFA 3AJ7A 3KS6A 4DF0A 3RM8A 1IIHA 1WNOA 3CC1A 3DC0A 4QRNA 3S2JA 4AG0A 3IK2A 4LEQA 5AHMA 3VUSA 3TQ0A 2V3EA 3A23A 4UNIA 3AUOA 2VX4A 1J18A 3PZVA 4L5ZA 1NFBA 2A4AA 1IEVA 3STPA 3AYRA 3PS7A 1VD6A 4DX3A 3IARA 2PD9A 1KFWA 2GQ3A 3OGRA 4S1FA 3CHDA 4WY0B 2KZHA 2JE8A 4IL2A 3AS1A 1E6XM 2XZ7A 4O0QA 1HT6A 4LUIA 2QYGA 4DVOA 2WZTA 2OGJA 2XISA 2UY3A 1UQYA 4O8RA 3VM7A 1TPB1 1JD9A 2YCLB 1FCUA 1EFZA 3LXCA 5FOOA 9RUBA 5AC8A 3H2CA 2CC0A 4X60A 2WZIA 4LVBA 1IXPA 1R2SA 5H8UA 3UBPC 5FF0A 6ENLA 4DWSD 1Q6DA 2YL9A 3LQLA 4ZEPA 3E0IA 4B5XA 1ICPA 1XDMA 3UZWA 2MNRA 1EJVC 4KWVA 3OU8A 2Q6ZA 3CUJA 3T9PA 2HK0A 3WLSA 1LUCA 1FHDA 1C29A 1PCWA 1Z6KA 5LNVA 2YBTA 1J10A 2VENA 4ZBCA 5D8WA 2P0IA 3ISIX 3TJXA 2CKRA 1O1HA 1QNVA 5D9OA 2GLKA 4LUTB 4N9BA 2E25A 4AU0A 1LORA 3P62A 4GNJA 5DQPA 2AL2B 2VZTA 2W4XA 3RMJA 3IACA 4A3HA 1Q6CA 2V3GA 2A6LA 3W7RA 4GD0A 2VCCA 3HTWA 1Z42A 3GO2A 3KHDA 1TYGA 4ZOAA 1VH7A 3WL1A 2XWDA 1BG4A 4Q22A 4V33A 1FDYA 2D20A 3PNZA 1XLFA 3GZ3A 4REQA 5C9WA 5KZ6A 1TVPA 3UVAA 4AXKA 2Y61A 5GNZA 1G7UA 1A3XA 3RAOA 4NZ5A 4WLCA 4BHYA 2VFGA 5FIPA 4JPGA 3U48A 4GFSA 5ABEA 3JUGA 1BRLA 5D4YA 3W1TA 3S46A 2ZIDA 1K9DA 1PHWA 5AHLA 4NRRA 3MI6A 3RLUA 2I7GA 1VIWA 4KGJA 3ZLGA 4BQ3A 2XFRA 1XYMA 3M6DA 4US6A 3A5VA 1G94A 1HVXA 1VZWA 3KTCA 2E8YA 1H5YA 4QSHA 3EMZA 2WLZA 2Z1KA 1Y8BA 3ZYZA 3TAOA 3I6RA 4RJEA 2G4JA 4LB3A 3KP0A 2DW6A 2NXGA 4MLRA 1YHTA 1F05A 5A6LA 1A0CA 2F6UA 1F73A 2Y85A 3BICA 1F3XA 4ZQPA 1M3UA 5KITA 4UQ9A 4NP7A 2RGMA 1ZP3A 3QPYA 2D0FA 2VX6A 4KF1A 3RM4A 5LNWA 1DYSA 1T7LA 3CPRA 3WQDA 4NL1A 1GVOA 3CZEA 3VD7A 3T2QA 4D1JA 4RXGA 3VNDA 1GPFA 3BSGA 3VMNA 4GJ1A 1BFNA 1CYGA 1GHRA 2WW5A 3ZXWA 1O5QA 1TWIA 1HKWA 1XUUA 3IGSA 5A94A 3OBAA 1R0MA 5AZ0A 5I6SA 3LNPA 4PMRA 3HF3A 4W7VA 3FDGA 3MBDA 3N2MA 1L6YA 2WZEA 5DMMA 3BCJA 5HNRA 1R2TA 2DSZA 3IVSA 2Z7GA 4S39A 3RO8A 1CXEA 2VRQA 1V03A 3V16A 1SVDA 5DX7A 3HN3A 1QI5A 1YKWA 3SBFA 3LX9A 2WKLA 5CPMA 1DQXA 1G4TA 2Z7KA 2DJXA 4XAYA 3LHWA 3HFTA 3TN4A 4MB5A 1W5OA 4QG8A 3GW3A 3N2TA 3CWOX 2YZ5A 3GNPA 2QGYA 1NP2A 4Q6XA 4ADTA 5PTDA 2VL4A 2PDKA 1R9XA 4K1GA 4PCNA 1CGXA 4YTQA 5AYXA 3TXZA 4HZ8A 2HV5A 1V79A 4XQ6A 1WO2A 2X0HA 2EJAA 4JX4A 1BLIA 4PBEA 1XICA 4TX8A 1UBPC 2NVAA 4AQLA 7TIMA 2DIJA 2NXHA 4IG2B 5CC6A 1GOMA 3G6MA 3N1AA 4J9JA 1AW5A 3BVJA 3VOIA 5BRQA 3F4NA 4V2XA 1NWTA 4JTJA 1BXCA 3W2JA 2GK1A 3WDRA 4FOUA 2X16A 4MGGA 4GYPC 4IUGA 3WLNA 1OZQA 4EX4A 3ZMRA 4XZNX 3G1DA 1FCVA 2V30A 2QF7A 5T8GA 3AICA 3ZQ9A 3GHSA 2ALDA 1JXKA 4JDYA 3S9ZA 2BVTA 2EKGA 3UJRA 4O13A 2ZICA 4CN1A 1W1YA 1VPXA 1LRQA 1XKYA 2ZUNA 3VA8A 1FX6A 1NDVA 4UFLA 2D0GA 2CXEA 1W1TA 3H2FA 3NO5A 3GAKA 1E4IA 1UWRA 1Z9AA 2I5GA 2PWEA 2C1HA 3NPVA 4BWLA 3SB0A 4Q7BA 2BVDA 2C16A 1E0UA 3ARZA 2ZUWA 3MUCA 1H7NA 2WJDA 3AHTA 1S2VA 4Z2LA 4O53A 3W1PA 1DHPA 1XL9A 4QHRA 5CZTA 3T0CA 1D2KA 3LPPA 2YCJA 1TTPA 1TJ2A 5LNSA 4JR5A 3N15A 4WCJA 3VIMA 1SW0A 2ZXQA 3KL0A 1Y7VA 3UJ2A 3R0UA 2QPSA 4FXRA 3ITVA 3G77A 4DLMA 4DWSB 1HUVA 4QBXA 1JZ7A 1CXLA 1FXPA 3TLQA 3SUSA 4PUJA 2NUXA 1KXQA 3N4FA 4ML9A 5CSUA 1VJSA 1E1CB 3FSUA 1UIPA 4NSBA 4AD4A 5JVLA 1D7FA 1JI1A 2TYSA 1E3XA 3BJFA 5XIAA 3PZOA 5CCZA 1KBKA 4CNUA 5CQ1A 3UD6A 3WQGA 4XX6A 1A50A 4G2DA 3WX7A 4IMDA 4XO7A 3VTRA 1EJUC 3E0VA 2GUBA 3MWCA 3FYPA 1EJRC 4E38A 1XPYA 5CGTA 3KVJA 2DW7A 3L5LA 3ZWTA 4R85A 2OU4A 1S38A 4B3ZA 4EOUA 4C1KA 4KIRA 1UR8A 2JEPA 5XINA 1ICQA 4OOUA 4F2UA 3AMGA 1KM6A 3GH5A 3OIHA 3E0FA 4KRUA 1R3VA 3MSGA 2WO5A 3ARQA 1A4MA 2YA0A 4HHLA 1F4AA 1R9ZA 1UKOA 4BI5A 1Q8AA 3DOPA 4ATLA 3L21A 2XFYA 1I0DA 1EDQA 3LY0A 4B9YA 2I16A 4GNKB 1JDFA 1KWGA 1QTWA 2E6DA 2ZVRA 1KR0A 2ZUSA 3FIGA 4PMDA 1CB2A 3ERPA 4H83A 2UY4A 2XWEA 3C0JA 3LI0A 3QY6A 1GQKA 2QUMA 3QBUA 4AWTA 3BAXA 3ZSSA 1E0WA 3ANUA 2Y7GA 2Y5SA 4GMEA 4GUGA 4HP5A 3GLCA 4V28A 1J96A 2G3NA 3H2MA 4GG9A 5K4ZA 3QGKC 2IXUA 1CENA 4PH6A 5HWNA 2WSRA 2O9OA 3SCTA 1W3LA 3MWAA 3DGBA 1VR6A 2J9YA 4HJWA 4KWSA 4MKVA 1L6WA 3AIWA 3Q37A 2GOUA 3A9IA 3A4XA 5CLTA 4Z0SA 3W72A 1AK5A 4PRRA 1UH4A 3WUEA 2F7FA 4JS3A 4O17A 1L0PA 3FOKA 4QM1A 1MW1A 5CBIA 4S3EA 2VVSA 5KZDA 4WKFA 2YCIX 1LROA 5HATA 3VGDA 4IT1A 2XTKA 1B1YA 1MQPA 5AVNA 2R1LA 1P7TB 4L65A 1XDJA 4WHBA 1E6QM 3F5LA 4UFMA 3LXAA 1WDDA 5I2UA 2V2HA 1LZOA 2C0AA 2HMCA 2VEKA 4X63A 3E5BA 3UWQA 1WA3A 2FTWA 2E4TA 1IEIA 4NT0A 2BODX 3H2EA 3PUOA 3DFQA 2I17A 2QCLA 1U5HA 3U6WA 3NSNA 4J3XA 4EVZA 3UCDA 5BCAA 5EIYB 4HZMA 3OLIA 1VYRA 3PULA 2CW6A 3L4UA 3CIXA 1TSIA 4Z2IA 1LLOA 3W1AA 5B7ZA 2CFFA 1XBZA 2WWCA 4UTTC 1E72M 1Q7ZA 2J79A 1H7XA 2BOGX 3RIKA 1DJHA 3E2QA 2WCSA 4AX7A 5AYBA 3DESA 1JZ3A 3STEA 1R5YA 2XVGA 2Z28A 5MF5A 1YQ2A 3UZJA 1U2YA 2H3DA 1PIIA 3CHEA 1FWHC 3ICJA 5LIKX 3IGUA 3VGHA 2EBNA 4UWMA 1XLCA 3MJMA 2PDFA 1LT7A 3T78A 3REQA 4AC7C 3TMLA 2CZDA 1UYQA 1E3ZA 1TV3A 2PTWA 4JFSA 3R8GA 5DY3A 2DZXA 4MM1A 1PB0A 2DGAA 5D03A 3TW6A 3ITTA 3WQVA 1SJCA 1HF6A 3HZ3A 3PVFA 2PCEA 5DN1A 4GI8A 2DUXA 2XSBA 3NEVA 2ADAA 2QCMA 4NF7A 4ZMGA 4Q4RA 1BD0A 2GL5A 1LTDA 3NDOA 5CG0A 1M41A 2PDCA 2YB1A 1Q4NX 2HSAA 4GVGA 2BNJA 1OIMA 3TMQA 4YVXA 5CPSA 3HPAA 1THFD 1E0XA 3N18A 2PDXA 3NO3A 3ARXA 4XSMA 4KH2A 8RUCA 3WCZA 1BF2A 1GVRA 3HPZA 4PCFA 4M7TA 4IG2A 3T4WA 5EJZB 1IQ8A 3S0CA 2D0HA 2I5IA 2E09A 4TX6A 3GKFA 4ROPA 2ZDRA 2OQYA 3BWWA 1MZRA 1K4HA 3O6DA 4ACYA 5IOBA 2ZTKA 4UTFA 2DVTA 1IEQA 4DJEA 1CTNA 4S3CA 3W9ZA 1AQFA 5AYZA 4RK8A 1ZBKA 3QYQA 4G6CA 3ES8A 3CO4A 2H8ZA 4JNYA 5FI8A 4E5TA 1A5MC 1TREA 4OWGA 5LZLA 4NXKA 1K8YA 4YU1A 4AISA 2X1SA 4GQ0A 2DZSA 2CCRA 2OCZA 3GG8A 2A3AA 1X96A 4IMFA 1TRDA 1JYNA 3N13A 2GJLA 1XG4A 3WLTA 4DAFA 1D9EA 1ZENA 3DXIA 3IJDA 1TIWA 4I9MA 1QMLA 3FHAA 2WPBA 5L6UA 3WIJA 1OCBA 2AOSA 2ZCGA 1VEMA 1W1PA 2VRKA 3TIMA 4JEQA 3UJFA 4D2JA 1WOBA 4JN6A 4U31A 1RP9A 5I00A 4JX6A 1QFEA 3NPWA 4XK2A 2J9ZA 3P80A 1UUOA 3Q45A 4HSOA 5EBAA 2XH7A 3B4UA 4MAZA 4B90A 3U2ZA 1OJXA 4JD4A 1QHZA 3GQYA 4FZIA 1E0TA 3WBEA 1AFSA 2IXVA 3I6TA 3W7LA 1ZAIA 3FVMA 3IWPA 1I9CB 1H0IA 4DWSA 2ISDA 4WEVX 3C8FA 2GJNA 5AECA 1ZB5A 4OV4A 4R9OA 1XUZA 3MZNA 3CZJA 2VR4A 3OIXA 4TMBA 3QGVA 5FAGA 4PMJA 1PTDA 1XXXA 3WQ6A 1YPIA 1XQKA 2TSYA 1MUWA 3CMJA 2TPSA 1RP8A 4QISA 3AHZA 4TQTA 3EDKA 1H49A 3VIIA 5C8BB 9CGTA 4LS2A 1BGGA 2B4GA 1J12A 3NR0A 5AYYA 4OJYA 2QAFA 5E0KA 4HHPA 3POCA 3ECQA 2Z0IA 5IBXC 3GR7A 3DGRA 1FWCC 1KBBA 2OPJA 3BH4A 2JK2A 2NX3A 3VKBA 4DNMA 3OG3A 1B30A 3QOMA 2NLYA 2Y24A 2BV9A 1C7TA 4AZBA 3KTXA 1DXFA 3RCYA 2ZQ0A 1G01A 1WCGA 4KS0A 4NG3A 3S2LA 2GSJA 2VMFA 4ORIA 4JHZA 1PX3A 1RCQA 4AWEA 1TPUA 3R0KA 4IWWA 1Q6FA 4LV4A 1P0BA 1J0IA 1VFOA 4TR9A 3WELA 2CITA 3NQFA 4A3UA 2A0NA 4TX9A 2CBJA 4XUGA 2X40A 1PHQA 1FWWA 1FHVA 2PSNA 4NI3A 2W79A 3OBEA 5I03A 3O6CA 1NQKA 3N6QA 4FK9A 3CHVA 1LL6A 4JTDA 2VUNA 4XG1A 3R89A 3W00A 3TQVA 4KFPA 4LUYA 1QPNA 4RDVA 1OWQA 1OSEA 1ML1A 3QKEA 1EA9C 4AHOA 3A6OA 1V0KA 2C91A 4B3LA 2ACQA 3HURA 2CBVA 3QHNA 1NJJA 3ONBA 3W22A 1XFBA 4YTUA 2MUCA 3EB4A 3EGJA 2SFPA 1P7TA 1SYTA 3CPUA 4ZE4A 3HFYA 2GVLA 4M80A 3BSMA 1OF8A 3EX3A 1UOZA 4YN5A 3PBUA 4TTGA 3WUBA 2WMIA 2FB2A 3AROA 1C8VA 4GI6A 2FPTA 2PE4A 1K03A 1XH2A 3NZ1A 3PBGA 1RQEA 4NUWA 4BY3A 1NARA 2CZ5A 1D7KA 1I6NA 2OODA 3KRUA 4HPGA 3SCRA 3VDGA 3SIZA 4N42A 3HMCA 1IZKA 3NQMA 4HIBA 3VU2A 4XIMA 4OZOA 4WD0A 1W17A 3P0XA 3CZGA 3V0TA 3LEPA 4L9ZA 4Q8WA 3L65A 5I3IA 2XH4A 4ATWA 4LVAA 1UC4A 1YTDA 4F0LA 1DXEA 3H24A 5AHFA 2WJFA 2FZ8A 3AO0A 1S2AA 3EA3A 1ZQ5A 3W1QA 3CXOA 5D32A 3L0GA 4DI9A 2C3ZA 3WYZA 4O1BA 3LMZA 1SR0A 4XZIA 3TWBA 3R2GA 2NSXA 4FNPA 3ONCA 1QU4A 2ZBTA 2GJPA 1W1A1 4J35A 3VNJA 3J7HA 3GBDA 1AJZA 4GPNA 4NZ1A 3EWCA 1J2WA 3A5FA 1DOSA 1E9LA 2VTFA 4G8TA 1E71M 5HNUA 1XIJA 3FKRA 3W7JA 2J78A 1VIZA 1MVYA 4ZOEA 5GQBA 1TX2A 3C8NA 1J9YA 4LJ3A 2OLHA 1OD8A 3VAVA 4H8VA 1XRVA 1OFDA 2V81A 2RKXA 1TKKA 3EKZA 4CCDA 2Z1BA 3M5VA 2PMQA 3EPOA 4GY1A 3BLEA 1G5AA 3VILA 3G1SA 4JCLA 4H9VA 1PCKA 1XRSA 1FCBA 3C56A 4UR9A 4HK6A 1E9YB 1XIIA 5LIUX 1VFTA 5KTLA 3GWQA 3NYDA 2RUSA 3WBXA 1LLZA 2RDTA 3DFPA 3FYOA 3U0HA 3SI9A 4AIBA 4ENLA 2YOCA 4O1EA 2J7EA 2DZUA 3URBA 3DI0A 4HYRA 5M03A 1KGWA 5E0FA 2WSPA 4IIHA 2W9MA 5BOOA 3UY8A 5CG7A 3BCDA 3GHUA 1QO2A 4MFDA 3QC3A 1D3HA 2VGIA 1ITQA 2EPMX 3VGFA 3QV7A 4URIA 4WDXA 2PA6A 3GC4A 2H3BA 1XLEA 1QHPA 1IT7A 4B5VA 3O6AA 4PE8A 2X09A 4L9XA 4R9XA 3W02A 4KEUA 3NDZA 1IT0A 5A6KA 3IV8A 2D1ZA 1WX0A 4MZ8A 4JX5A 1HZYA 3DAQA 4DYEA 5JBDA 2V63A 4GY0A 1DWIM 3SCVA 1R9YA 1BWVA 2QCCA 2EG6A 1NQ6A 4PZVA 1TZ7A 3CH9A 1RJQA 1R3TA 1CT5A 3NVTA 2NUYA 5L9FA 3CQKA 4AEOA 3PWGA 2WMHA 4J4KA 1E5NA 4E4FA 3W7OA 4JKKA 3GU9A 4AEEA 5BXRA 3GAYA 5G1YA 1TPFA 5TQLA 5I07A 5U4NA 1XBVA 2VQUA 4D6DA 3SSZA 4H6QA 3HG2A 5F4SA 5E9AA 4MG4A 3UNTA 3E96A 3HV8A 1TWDA 4UMBA 3GKAA 5EL1A 3GC5A 3CWNA 2PGFA 5D02A 3LS9A 2X1UA 1US3A 1VGAA 2OWWA 2IKJA 5LNRA 4O12A 3EXSA 1VEOA 3GDBA 4X2RA 1VFHA 2E1DA 2Z6JA 5CSSA 1Y5XA 5E6ZA 5EGRA 1OG0A 3OZMA 1XCFA 4M5PA 1FWTA 1M65A 2DIEA 3GXIA 4UTKA 2ODOA 3Q67A 5DF0A 4L6OA 5CC5A 2J88A 1HIZA 4L4OA 3PPHA 4UOZA 1HN1A 3UYIA 2XDFA 3TN6A 5CAKA 1KTCA 3RILA 3CAKA 1KBJA 1JCJA 3RN6A 1NM9A 3TTEA 3G5EA 2HVMA 3M0LA 4GIAA 4AMAA 4IIGA 4K8HA 5LYRA 3W7HA 4PN2A 3LYEA 1R3SA 1A0EA 1RK6A 4Z2HA 1Z32X 3GK0A 3FGCA 1RZMA 5EMKA 1W8GA 3N2OA 4UUIA 1XLIA 3VIHA 2P10A 3SQLA 2J7CA 5D2XA 3UG4A 3GXFA 1C8XA 3JU2A 2Z2AA 1W5MA 3K8MA 1UR4A 4R88A 4B4FA 5AN7A 4DBEA 1W2VA 4LVGA 2J8TA 4CQAA 2E1WA 1OHLA 1ADOA 4O52A 2VC5A 1WQ5A 5E70A 1QOXA 5HR6A 3W2MA 2WQPA 3MCNA 5DBUA 6A3HA 3PF3A 1XSKA 1FDJA 1OY0A 3ZLHA 1Z48A 2Q3RA 4H9MA 5AC7A 2D2GA 3LBCA 5AHIA 4XZHA 1SZEA 4C6QA 1BF6A 2NX1A 5CBJA 4IJBA 3EB2A 1F8IA 1QK0A 4I9JA 1O66A 1OABA 1TELA 4W89A 4KQNA 2NWSA 3H8AA 1L6FA 4NX5A 1GKQA 1S2TA 1A5UA 1PBGA 4S3BA 1H09A 2I1OA 3AS2A 3HMJG 3WLIA 1I4NA 2O55A 3IIOA 1W31A 1NOFA 3CQJA 5CPLA 1MWOA 3DBPA 1E4NA 1J0JA 3E1F1 2O9PA 1PZ1A 1TJRA 3ANVA 4JTIA 5EMJA 1NELA 5D2TA 2ZX5A 3QRHA 4FEZA 3PFRA 2A7RA 3K2GA 3IVTA 3WDIA 1JDDA 5MKGA 3EB3A 3SN1A 1LT8A 1GJWA 1OZMA 4WSKA 1RQBA 3K4AA 3EOOA 4EANA 1MDRA 4FOJA 3T6CA 4OUIA 4PULA 1TB3A 1JRCA 3L4TA 1GOXA 1U30A 1NOWA 4ZOBA 1VB9A 4X3ZA 1WZKA 4HMEA 3UP8A 4FLQA 3GNOA 3MMUA 1CIUA 3KM8A 1T40A 1JPMA 1R7OA 4D6CA 3AXKA 4BKNA 1RLCL 3CB3A 1M01A 1PX4A 3B8SA 4AXNA 2UZ9A 4YWSA 3H21A 3BAWA 1LWJA 2ZZ1A 3BXWA 4NAFA 3CM4A 1U83A 3AHYA 1OGBA 1EQCA 1TCDA 2BLEA 2ALRA 1KGUA 4LCSA 1D8WA 3ITCA 1JYWA 4PSRA 4S2CA 5CZKA 3LUTA 1OCNA 2GYIA 2QLYA 2NXIA 3VDCA 3N2XA 4YWIA 4BS0A 3POHA 3BOFA 4GZIA 2FZBA 2ZXBA 1IF2A 5HINA 3T08A 2EXOA 2Q8XA 3QV9A 2G95A 1GJUA 1HGWA 4ZB5A 3S2CA 3PBWA 1EYEA 4IMAA 3ITXA 2WHLA 4DIAA 3OLGA 1NF0A 3MPGA 3VKAA 2E5DA 3HM7A 4L9YA 5M2FX 3VOHA 3R8RA 1JL8A 5DT7A 1NDZA 2DPEA 3SCSA 3FCPA 1GOOA 3OLEA 4W4QA 3ID7A 4G7EB 3M43A 1NOUA 4FALA 5C2XA 3BLIA 1W9BM 5C9ZA 2X7WA 2J7GA 1QNSA 3BG9A 1QPQA 3XINA 3RLGA 3V35A 1WBHA 1XYBA 4O15A 4WRHA 3ZR4A 2ZC8A 1AW1A 1C91A 3FHQA 3QVQA 4R27A 1AQHA 2OOFA 3GIYA 5CJ5A 4K3ZA 4TO8A 4DY1A 1NDYA 2OLAA 2WWDA 3BGGA 2HE8A 1E40A 1P6CA 4B5TA 1P0EA 2YFNA 1WOAA 4AY8A 3PTKA 1XJBA 4M19A 4Y96A 1P0NA 3PR2A 5IFTA 3UJSA 1SO5A 2PC4A 1NVMA 2J6XA 3W1NA 6REQA 4IMGA 3NL3A 4DBDA 3TCEA 2YJQA 1HTIA 3PPFA 1RA5A 4R53A 1FH7A 2DEPA 4M3PA 3SFWA 3SM0A 1V4YA 4YHGA 2INZA 3KWXA 1QHOA 5XIMA 3TCSA 1Q6EA 3L2IA 2NLIA 5D8ZA 1XPGA 3ORWA 1GG0A 1TV4A 1EKOA 4ICMA 2NSOA 4GJIA 3BAIA 2VX7A 4D6FA 1E9ZB 2VOMA 3CV7A 2O9RA 5EFDA 3DDMA 3WLOA 3NSXA 3E2SA 4MJMA 4CVWA 1P48A 1U1UA 3DEQA 4IPNB 4S3FA 1EUAA 4E2OA 1DJZA 1GYMA 1W5QA 1SZNA 1U22A 2BWGA 3CV2A 3H4WA 4EAYA 1KM4A 1F4HA 5F7UA 3PZMA 1MUCA 3GDLA 2OB3A 1V02A 1A47A 3L66A 4P7NA 1W5PA 4H6EA 3KAOA 3IGHX 4K8EA 2PTZA 1V7YA 5KETA 3K4DA 4FNUA 3ZWSA 3AMKA 3EMCA 2ASHA 2QJNA 3KL5A 4UQBA 5IHRA 4EF8A 4ES4A 4PTNA 1O6IA 3G1YA 1WB0A 1FOBA 2PWVA 3BW3A 3DYPA 5C0QA 1B0IA 1IXQA 1SW7A 3LMYA 3WLRA 1V3LA 2EJ1A 5LA0A 1L6SA 1IR2A 3OTRA 4DBWA 2RAGA 4P8UA 1W32A 1CXFA 3MHFA 5DBTA 4XAFA 4W84A 3RRAA 4HA0A 1SZRA 7CGTA 4I8YA 2BXVA 2QCFA 1RAKA 3TONA 3LCFA 4QDMA 3BUVA 1IEWA 1VHNA 3QV6A 1HQTA 3S2MA 3MJYA 5H8PA 4GKTA 3C0LA 4KWOA 3UG5A 3W7EA 1EF3A 1YXYA 3RHGA 5EY5A 3WEOA 1M1BA 1IGSA 2DUZA 1JG9A 3ELFA 5T91A 5M17A 2E28A 1H61A 1IIGA 3I7QA 3LHTA 2W61A 2WBKA 1GQNA 3G18A 4ZO9A 2OELA 4H8NA 4JNMA 4W9TA 1FBAA 2WSQA 3MSDA 3CHCA 1GW1A 2Z1WA 5DEZA 3CHFA 2WMKA 1TV7A 2OEMA 2JKAA 2QZRA 2XINA 2OWCA 2OT0A 1WDQA 4ZQRA 2ZUTA 1FKXA 1EX1A 2DZTA 3MA8A 4YS1A 1W3KA 3AMDA 3H7VA 2EAWA 4IJRA 4WXZA 3WN6A 3KLKA 3IK4A 3QQWA 3N6HA 2QIWA 4UMCA 4PBGA 4GZJA 4NILA 4GGBA 3NEHA 4CEXC 4QSFA 2CWNA 2HBVA 4LBSA 3IEBA 1OFPA 2NVDA 1MW2A 2PPGA 1E55A 4GVHA 3R10A 5D05A 4ZCWA 1Y5WA 4KMQA 3P3BA 2PWUA 3TJLA 2D22A 4LQ1A 4H8HA 2VCAA 3B8WA 3F03K 2C15A 3L4WA 3F5KA 4FX8A 2B7PA 1I0BA 4IHCA 1RD6A 4AX6A 1EGMA 2BDQA 4ROQA 2GVYA 4GHRA 1HW6A 4N0RA 1DIOA 3G0SA 4UFKA 3BLLA 5D9MA 5CEWA 2W3ZA 2EPKX 4Q4MA 3F4CA 5I3HA 1EOMA 3TXVA 1MW0A 4OFCA 2B7QA 1E6SM 1PS9A 4MKNA 4YVPA 5G5IA 1ADSA 1QBBA 5DMLA 4AF0A 4GFIA 2DU2A 4UOQA 2J62A 3LLFA 5EMYA 3LG3A 4S3AA 4WQ6A 1ADDA 4C6LA 3UXIA 3UETA 4A3RA 3I68A 4XKMA 3FJLA 2HXUA 4UTTA 4FXFA 1ZHAA 3A21A 2HBXA 2YCKX 3S9YA 4IFOA 3MBFA 3NQCA 2FPYA 2BFGA 3IJ8A 3W38A 4HNTA 4S38A 1PVNA 1GQLA 2P1FA 3SUUA 2VZOA 3RYSA 4TTUA 5HWMA 3GX9A 2DZVA 3MYOA 3TU9A 4MOZA 3OA5A 3EXRA 2Y8VA 1YNYA 2DH3A 4P8WA 1KGXA 3W29A 3S5OA 3NIYA 4EACA 4US5D 2F61A 1QW7A 3HO8A 5HA7A 1LP6A 3EWZA 4H9YA 4YTRA 4RE3A 1XRTA 8CGTA 3HGSA 1XBXA 5FJOA 3MZ2A 4IGSA 3AAMA 3M0IA 4MNLA 3W70A 1DHKA 4W8BA 2VO5A 5HUOA 3UQNA 4HNOA 1TPVA 1EXPA 4NZJA 3IAQA 3WF0A 3PK7A 3JZUA 2GZXA 3CU2A 4RDYA 4EPDC 1HP4A 2FFIA 1K02A 4A29A 2OZ8A 2NT0A 4C6OA 3WQPA 1T5AA 4C6NA 4QIUA 3HA1A 1TUXA 1AZ2A 2HISA 3IJ6A 4CQDA 3VNMA 5CGQA 4JN8A 3TP4A 1AA1B 3WF3A 4G7EA 4GQQA 1WKYA 3LK6A 3M7WA 4IP5A 5C9RA 3TNOA 2PDNA 4JY8A 3CAQA 2G8ZA 1DP0A 2PURA 5EB8A 1Q65A 6ALDA 3U2EA 3WNOA 4LYQA 2RDUA 3D6NA 1ONEA 4MWAE 1PIFA 5IRPA 5KSWA 3G8EA 1KFCA 4YXGA 2YSWA 3QYSA 2OEKA 1XIDA 2Y5EA 4OV9A 4EP8C 2J7DA 3OB8A 1OB0A 1GT8A 2C19A 4MY8A 2V8ZA 2JIEA 1UA3A 1YXCA 3P2VA 1LOSA 3PZIA 1TR1A 2Q09A 1KV5A 1V3KA 4JTHA 3AXIA 3GE7A 4U3AA 4N9EA 1R3RA 4GYKA 1QNRA 2P3ZA 3FN9A 3FXYA 3DKLA 2NW0A 4ZR8A 2KAUC 4HK5A 3S5SA 3GXNA 3SN4A 2WB5A 3LPFA 2JEQA 2ON3A 3OBKA 3KE0A 3EOSA 4X9SA 5J8LA 1O5RA 2PDJA 3SCNA 3VIGA 3CLMA 4N6FA 4AVNA 5C7VA 2RJGA 4QQUA 2YDAA 3O05A 1BYAA 4XD5A 1RD5A 3WSUA 1WPCA 2WMJA 3S4TA 4HHHA 2PAJA 4DO6A 3KBVA 3MHGA 4RX0A 2VD9A 4I3GA 1JUEA 4IP4A 1DTUA 3C4UA 3UWYA 1L6GA 1DIKA 1GK8A 4ORMA 2I9UA 2HTMA 4H41A 3USBA 4BI7A 3VX1A 4BFAA 2WVTA 3S5NA 3BGJA 5C55A 4U5IA 2QJJA 2I5QA 1F8MA 5CZJA 1OT2A 4FLSA 2VQTA 3B9AA 3S1GA 1X1ZA 3GUWA 1QK2A 1B9ZA 3TH6A 2CLHA 4O1FA 1S2UA 5HQLA 1LQ2A 1GVSA 4MZYA 3WLLA 1GZJA 3E0WA 3P74A 3EDEA 5GNYA 1HKVA 2PTYA 1UBSA 4QCEA 2OT1A 4IPIA 1HKMA 3QKZA 4I5XA 4XZBA 4L7ZA 4X9YA 4RNHA 2WVVB 3TX9A 4UTWC 1XLKA 3CASA 3SSJA 1XIBA 3DX5A 3MMTA 5I3DA 3BLPX 4R33A 4GZEA 2GJXA 3B0XA 4GCXA 3ABOA 1ZUAX 5IBXA 1TTQA 5HR7A 1MXSA 3H4GA 1F3WA 1J0YA 2IUZA 1J0KA 5HNTA 2BVWA 3A64A 1XYCA 3A24A 2B7NA 3M1ZA 1UKQA 4S3KA 1MZHA 3TV8A 1XLBA 2HDJA 4GQRA 3NL2A 1M7JA 2X42A 3CAVA 3CTLA 1VJZA 3N9SA 1KC7A 4QITA 3C0QA 4GE8A 5AVHA 3VVGA 2J7BA 4GX9A 2H8XA 3ZJ8A 3NDYA 3UESA 3C6CA 1MEIA 4LT9A 4G5DA 1SMAA 1U5JA 1OYAA 2Z6IA 3GTXA 3KDOA 2Z24A 3ARVA 3DUGA 4OU1A 2BB0A 5LXXA 4LAUA 5E6YA 1SJBA 2ZDSA 4LUJA 4AIEA 3CV1A 4AHPA 2PDBA 2PGRA 4NZFA 2HROA 3AIBA 5LKYA 4AVFA 2ZZ6A 3CL6A 3ITOA 1KFBA 1W3NA 2P5NA 1G69A 4D6IA 3MSRA 4IFRA 3VYLA 5ENLA 1LQAA 3VD3A 1Q2SA 4IL0A 1S2CA 4DYKA 4JTEA 4RCXA 1IEXA 1FTXA 1R8LA 2WCGA 1OEPA 1TE1A 3TFCA 1I2OA 2PI6A 5CZ0A 1CPUA 1E56A 2FZNA 4YL2A 3MI3A 3L4YA 2G0WA 3DHPA 3M0HA 2D2HA 4MHBA 2FZ9A 4AZCB 3IAPA 2ZX6A 4XWUA 1KNWA 1V08A 3ITYA 1EH9A 3LSCA 3HGRA 1J8VA 1MW3A 3U5UA 3M5ZA 4PSPA 2OX4A 4I5UA 1JAKA 2C14A 3NTYA 4CQBA 3DECA 4LPCA 4DXKA 1V6XA 3FLUA 4YTTA 4L6DA 3DG6A 1FVPA 1DWGM 4DM2A 2BP1A 4MY9A 5CKSA 1XSJA 2QDEA 1HJSA 3KUMA 1FWJC 2QJMA 3B40A 2VCBA 2GWGA 1CDGA 2Y7FA 1WXJA 4I7UA 2W66A 2O4MA 1ZPTA 5G1TA 2NQLA 3TUUA 2XIOA 5FEXA 2AGTA 4M1BA 4C1NB 5HPOA 3M0XA 4WVXA 2NQ5A 3K13A 2ZX7A 5EFFA 3WLJA 3DZ1A 4PTVA 5A1AA 1H7WA 2Z29A 2ZUMA 1R46A 3H7RA 2JGYA 5BZAA 2WHKA 3KCOA 3KOWA 3GB6A 1EXBA 2CERA 4H2CA 4GIEA 1FFRA 3VNKA 2YB4A 1NDWA 4E4UA 1Y0EA 2DORA 3C52A 4IISA 4PGLA 4DO4A 4IFKB 3IJ9A 1HFBA 3A4WA 3VKKA 3TYEA 3QR0A 1TV8A 2EPLX 3MCMA 2PS2A 3CK5A 1PL9A 4PMVA 5DO8A 3ZT5A 4ZOCA 2VXNA 4RPPA 4A3QA 1KFLA 3BL3A 1V0LA 2YDQA 1DJIA 5B80A 4MWAC 5EMUA 3EPNA 4AWSA 1EQPA 1CBGA 1BYCA 2XFWA 3OQ8A 4H2HA 4U4MA 4CD7A 3R58A 3M4HA 1DEDA 1L8NA 4C6PA 4D6JA 4K39A 4NKCA 1JFXA 4GUFA 1JNDA 4GIRA 4JTGA 5FF4A 1EWDA 1TJ1A 5A8MA 2DDXA 1H4PA 3GVGA 3AJXA 3NXLA 3WG6A 3G0UA 5G4HC 1BRLB 2A5HA 2OQLA 4HHMA 1SU5A 4XUYA 1JFHA 4GLEA 5F4WA 3FA4A 4RV8A 4LC8A 3W7KA 2BTMA 4FX7A 2QEZA 1RUSA 5A6AA 1X1NA 1TJ0A 1EF2A 1UG6A 3A3WA 2IQTA 3W1UA 4P7QA 3D5HA 4WKAA 4DXVA 2XM1A 5FSEC 3GNDA 4B15A 3VNIA 3WNLA 3VINA 5EYWA 1H11A 5KEZA 1LBMA 2YCEA 1XGZA 3BG5A 3RITA 2A2IA 4ZXOA 1UR3M 4KT2A 4Q8MA 1KB3A 3PP7A 4RE4A 3LHZA 5I3FA 1RLDA 1B3XA 3AUJA 4Q4KA 2OYMA 1FKWA 3TR9A 1VCVA 4LYKA 1OM0A 4FXJA 3C2OA 5C2CA 4DZHA 3WKZA 4QS6A 3QHOA 3NSMA 2BXZA 5I06A 4XD6A 5A8OA 3LV6A 5BRPA 2XYLA 4OT7A 1XS2A 3BDKA 3MU7A 1XW8A 3ALFA 4LH8A 2XIMA 3ABRA 5DRCA 2V5CA 1TQJA 1AQMA 3HG4A 5E0CA 4PR4A 3I10A 1P6WA 3M64A 4GIYA 3M07A 1J5TA 4QAIA 4CQCA 4ZVJA 5LXEA 2VI0A 2HCVA 1IGWA 3GXDA 1TUFA 3IPWA 3W7QA 5G2WA 3V0SA 3T05A 1ONRA 1O12A 3QEZA 1RPKA 3G1HA 1YNQA 2ZC1A 2WV8A 3RGTA 3MCOA 4JYFA 3UNDA 2PRMA 3EEGA 3O6YX 1R47A 3K5XA 3VKJA 1UR0A 1NWRA 3G3MA 3IRDA 1GQIA 4UR7A 4GINA 4UTUA 1EHAA 2DQWA 3SRFA 3CT7A 3VDBA 3SCOA 1US2A 2IPJA 4YLWA 3GFXA 3LV5A 2RDWA 4XBSA 2E67A 3GTIA 3GIQA 3LHYA 1E51A 3VOCA 3A9BA 4XAZA 1B3ZA 4KFOA 1SPQA 1Q85A 1XLHA 1EDGA 3QF0A 1VBUA 1OQFA 4HYWA 2YPIA 5EBUA 4RPQA 2GGJA 1UMLA 3GW0A 1ZAHA 3LGEA 1T6MA 4XISA 1CLKA 3HPXA 2EPOA 3KBMA 1UASA 3V75A 2QJGA 2PC8A 1ISWA 3QY8A 2QQ6A 2GK1B 4LU0A 1QCWA 4F79A 5DLCA 5C6MA 3TC6A 2H6RA 2CLFA 1J11A 3VABA 4ZQOA 4ZTXA 3SAZA 3PB2A 2Y2WA 1AL7A 1EJXC 2ICSA 4ALDA 5HXMA 3STCA 4AIOA 1DIEA 2RJHA 2NQJA 2VFDA 2CXGA 4D8LA 2JF6A 3R5EA 2GDUA 1RH9A 3MYPA 3S1XA 4GJJA 3UT0A 2ZA3A 5BXSA 1I2QA 1XQLA 4HNLA 3QR1A 3GXPA 3RNDA 2YKKA 4UQDA 4W5UA 4XO6A 4YPJA 2OVLA 2AAAA 3KX6A 4K37A 3VKDA 4JIQA 3UU0A 3CYVA 1R6WA 3DFOA 4PTWA 3VD5A 4O11A 3HQOA 2HS8A 1DE5A 4QLKA 3TC3A 1TR9A 3QW3A 3SRDA 3GVQA 4HGXA 1B31A 1R38A 1U1HA 1ZS2A 5U7SA 2F9RA 3WMSA 2FJUB 5EMMA 4XZ9A 3ARYA 4GXMA 4QP0A 3ZLFA 3T7VA 4Y9OA 5A3HA 1FUYA 3WBYA 2NQ9A 1LL4A 3H55A 1DE6A 4EKJA 1IT8A 5D9PA 1H0GA 1EUNA 4US5A 3LRLA 3UYCA 5FF3A 5T26A 1XYLA 4Y6GA 1DJNA 3KBJA 4YCPA 3MUIA 4HB7A 1JIBA 4HYVA 4AY1A 3ZS4A 3WL0A 2Y7EA 3VMOA 2QCGA 4UFJA 1BGAA 4J2MA 1KLZA 1FWBC 1XF0A 4HNNA 5H1WA 4Z08A 3MDWA 4ZB2A 1LRTA 3S9IA 2PGEA 2QT3A 4DELA 1SUXA 3HGOA 4C1NA 1WBJA 1ISVA 1EC9A 1BVWA 1W91A 1E4MM 1HL8A 3EPMA 4HG6B 1H7PA 5E9XA 3H23A 3WQ8A 3R13A 1MUMA 2R8WA 3SY1A 1DL3A 2PB1A 4ZSUA 4B5UA 4Q8UA 1VCGA 1V6UA 5E93A 3GR4A 2CEQA 4LY8A 4F0SA 1EA0A 3V3WA 2ZRWA 3WLPA 2C79A 3TC7A 4NVTA 3I7SA 3GDKA 3LTPA 1J6PA 1JZ6A 2OOGA 1P1MA 2MANA 5JXQA 4XZWA 3VNLA 1DWAM 4TV6A 5CPOA 3Q2DA 4B5NA 1YPXA 2ANUA 2IS7A 4IFKA 9XIMA 3IJ7A 2GFTA 3FNDA 1IZCA 4XBJA 3LERA 4H7ZA 3WD2A 1XDLA 4L56A 2V5DA 3WQEA 1I60A 2QPUA 5DMYA 1KM0A 4IGMA 1VPQA 7TAAA 2BASA 4HCDA 2QCDA 4BF7A 4AEFA 1V6TA 5FL0A 1ITXA 4NHVA 1XCWA 3H7UA 3Q94A 1ZCOA 5DXXA 4DJDC 1V0NA 1F74A 3P61A 1KWKA 3QZAA 2BGQA 3SECA 1LM1A 3VO0A 3PJTA 1O68A 1KXVA 2INFA 3BCFA 2UY2A 3TDFA 1R85A 5BROA 4M81A 2VURA 1S5VA 1DQUA 3N3TA 3EBVA 3TK7A 1VFLA 1WXZA 3RG6A 4F66A 2QW5A 5KZMA 1JCYA 1ICSA 3N73A 3KFTA 2OZ0A 4FIRA 1XHGA 3GM8A 3UGVA 3SUWA 1BQGA 4H9UA 1E73M 5HDRA 2J13A 4AW7A 5JH1A 4U2ZA 2FKPA 3C3NA 2PDHA 4NJHA 3F4VA 3G2GA 1JZ5A 3WNKA 3QR3A 3WMCA 1B3YA 3TE9A 2QKFA 1JULA 2XJ7A 4S3GA 2OO6A 1OG6A 3N9KA 4X0NA 4O8AA 4L80A 2BHYA 2XFFA 3V1HA 3O3RA 5F1UA 2P53A 4LRSA 1M53A 2G3IA 4BWLC 4NJJA 4DO5A 4H6RA 1G4PA 2VC9A 1JUKA 1ECEA 3VXGA 4ZO6A 1NH6A 3NQEA 3BW2A 3RRXA 1FWIC 2VD8A 2CESA 4NZ4A 5G1MA 4AD3A 4NAEB 1QASA 4BCEA 4B3KA 4W7UA 2ATMA 3LPGA 1AQ0A 2R1MA 4RZ4A 3I6EA 4ZODA 5T9BG 1RJPA 1PPIA 2ZOXA 2ZRUA 1P43A 4PUNA 5BU6A 3L7RA 4LB4A 2ZYFA 3MUXA 3LLXA 1US0A 1SO3A 4CNPA 5C7HA 2YYTA 3REQB 1A5LC 3URNA 3QPZA 1UWQA 3CL7A 3M46A 3UG8A 3WH6A 4EPKA 1PIGA 3CPGA 4LF2A 3W71A 1A0DA 3K8LA 5BNKA 2R1NA 1ZBCA 3GG7A 1SO6A 4HCLA 5HOSA 2FTYA 3C2EA 4FS9A 1V3IA 3OVGA 2R94A 3GFZA 4H04A 4Y9MA 5FJRA 5CPTA 2XSXA 1OVDA 1Y65A 1EJTC 4R7JA 1P4CA 3TZNA 4LAZA 3CIWA 3S5YA 4BR1A 2WCAA 3B9EA 3M47A 4CCEA 4E2DA 4OIFA 2J77A 3OVPA 2VZUA 3EYPA 1H50A 1YADA 3TW7A 5ABFA 3PJXA 3GU2A 3WH8A 3ME3A 1GVFA 3SQSA 3N9RA 2FIQA 4CD8A 2E7FA 1KW1A 2E3ZA 4CNTA 3HQNA 7XIMA 2Y88A 3HG3A 4LC6A 4WDUA 1MQRA 2Z2BA 1PZ0A 1X8CA 3QQ0A 4KRTA 4R7WA 1FWFC 3WK3A 3AMCA 3B04A 5I7GA 4NJKA 5CBBA 5CLWA 2YFOA 4OBRA 1GG1A 3BZGA 4LTSA 4HOXA 2V3FA 2EQDA 4Z2JA 4MYXA 1VYPX 2TODA 2BGNE 2PDLA 4UQAA 5C70A 3TWAA 2VFIA 2QF8A 4JFTA 3CJPA 1TVLA 2WC3A 5JMUA 3MSYA 1ZTVA 2ZRVA 1SJDA 3K4WA 3WJSA 4MADA 2X7VA 4GACA 3IVUA 4HMNA 1VBRA 4IICA 4V1XA 3KHJA 1QPKA 4IXHA 4O50A 4MNMA 1VPYA 3FSTA 2BHZA 4HPXA 2XSAA 2GSHA 1CX9A 1J0HA 3D47A 4R3UA 5BOFA 4HA4A 3LA4A 3EAUA 1KM5A 2Z1VA 3PNUA 3D3AA 1E6NA 1TFVA 1I1XA 1QVBA 5FEWA 3SCWA 1ELSA 2ZX8A 4NX0A 4L61A 4NNCA 1W9DM 1I75A 4HNVA 3SJ3A 3SADA 1AMKA 2R9RA 2AMGA 3BAYA 3GNXA 1G6CA 1CXIA 4FOKA 4WOZA 1TMHA 4JIEA 4TVCA 1QNQA 2BG5A 1JDAA 2X30A 4DHGA 4RUBA 1FWRA 2QCNA 3RPMA 3URQA 1XD1A 5I79A 3TSMA 4N9CA 5IDZA 3UCQA 1R87A 3P8IA 1R3WA 4O1AA 2VVNA 1QO5A 1CGYA 2I57A 3AYTA 5D30A 4FLOA 4WGXA 4NJIA 4EWJA 3GYEA 2V6AA 4GC4A 1UKSA 1VP5A 2WQDA 2P3EA 2ZVIA 3SY8A 5F2LA 3H6OA 1WYIA 1UD2A 1U1JA 3WD0A 5FESA 1SFTA 1P6BA 5T9CE 2PF8A 1EBHA 2FDSA 4M24A 3AZTA 2DT1A 3OZYA 3UZ5A 4ZTYA 3RPDA 4QJ4B 4AD0A 1ITUA 4WJXA 4IMCA 2DZBA 3WQCA 3MKCA 1LOLA 3GDMA 4GCAA 4NI8A 1CLVA 1VFFA 4PFHA 1V3MA 3U4FA 3WFLA 2FQIA 1G1YA 2YW4A 3PBMA 5JU6A 3LPOA 3ZZ1A 2F38A 1UKTA 1M7PA 4IX2A 1V6VA 5EPDA 1RALA 3BMWA 2NUWA 4IPJA 2CYGA 5IHSA 1UP0A 2BY1A 4L64A 8A3HA 1JYXA 1PXGA 2YW3A 4F48A 3NYZA 3TTOA 2YL6A 4G1KA 1J93A 4FNTA 4WGHA 5CSYA 5HJXA 3R11A 4TU1A 3EX6A 2ZXDA 4M6PA 1ZL1A 1LYXA 2QR6A 1GTHA 4JQ1A 5HUPA 4Q7IA 4JAWA 1H7OA 2RDXA 4GYFA 1A3HA 3R1ZA 1QR7A 1E5JA 2Y8UA 3E12A 5KZEA 3T2PA 4C6EA 5KINA 3EZ4A 4FMVA 2R24A 2HXTA 3STGA 2O4QA 1OFAA 4M6VA 4B5SA 2VUYA 1UC5A 3E6EA 3Q58A 4PUKA 3S6TA 3VPLA 5BWFA 4O57A 2GQ8A 2YBVA 2DT3A 4FR1A 3L5MA 1DJXA 1N8IA 1T8XA 1IYXA 1EZ2A 3LCLA 1JGIA 1XC6A 2V5JA 1L2QA 4LEFA 1UD8A 1MEHA 4M1RA 4LW7A 4DJEC 1B5TA 3EX1A 3T44A 4OOZA 4BI6A 4J1OA 4QAWA 4CLMA 4DJDD 4CCZA 3EX2A 3QTPA 4LX4A 3G8RA 1QBAA 3O0FA 2O56A 2OFJA 2WMIB 1EEXA 3EEZA 1OADA 1XM3A 3W3OA 4IIDA 2CNCA 3T0AA 3CTTA 1H5VA 1B4EA 2E68A 3NWRA 4F3HA 4RE0A 2OMAA 4E4PA 3LM3A 1N2VA 3PUGA 4JTAA 4PBFA 1UROA 1RCOB 1UZDA 3B4YA 1JXJA 4HU3A 3TTQA 4HPNA 4GK8A 1C93A 1W9PA 3MVIA 1TPH1 1DWJM 3QW4B 4RR4A 3LB0A 1BVZA 1VBHA 4DF2A 3P60A 4NAEA 1OK6A 1F3EA 2VGGA 3AC0A 4DJFC 2FHBA 4K1WA 3EWDA 1OK4A 3CQ0A 2VEFA 3SUVA 1UHVA 2O7QA 3DC8A 1W6TA 4CCCA 1GORA 1S46A 3M7SA 4Z1DA 4DWSC 4AD2A 1XP3A 2DH2A 2A79A 1KXTA 2VC7A 3CBWA 1YDOA 1MXGA 2WNZA 2XIJA 3WNPA 3MW7A 2CKSA 2BSLA 2ZZ3A 4WOQA 2I14A 4BQ5A 1MEWA 2ISWA 3QSRA 4JFUA 1RVGA 2O92A 1OFRA 3VFCA 4GQBA 1J0ZA 3C2VA 3QSTA 3H2AA 3FYYA 4UNLA 2GVGA 1Q66A 4FAMA 1CGVA 3WK2A 4CNNA 4UTWA 3SJNA 4DXXA 4HT3A 3O06A 1EWEA 3AHXA 3AZRA 3CV6A 3KOFA 4RDZA 4LF1A 4GUHA 2VM8A 4UTHA 2C8NA 2V2DA 4TIMA 4GQGA 4QG6A 4AB4A 3LI1A 3NJ3A 2XVPA 4HNUA 4Q3MA 3DYOA 3GNNA 1YXDA 3LZ3A 1UW9A 4YHEA 3AIQA 4AZ7A 1S3TC 4XD3A 4MNKA 3L23A 4D6EA 4P2VA 1W1IE 1GJPA 4I7WA 1RA0A 4KKXA 2Q8LA 3OG2A 2Y4SA 1UJPA 1FWAC 3W27A 1C9WA 2EKCA 4U28A 1TRIA 2ATSA 3EOUA 2EHHA 2VRJA 5TNVA 4HU0A 3TSBA 3ENLA 1CGWA 1ZP4A 3TYUA 1AH4A 3WENA 3SCQA 2B0MA 3M0JA 3PN8A 4GBDA 1RY8A 4P7RA 1Q45A 1A5OC 2AQOA 1BTCA 1GVYA 2WNNA 2PLMA 1GEQA 1NU5A 3S83A 4RW3A 3S2NA 1H1ZA 3B03A 4DNHA 4FNSA 2V0TA 2J74A 3VFLA 1OYBA 3WD4A 2HS6A 5KMYA 3BMVA 3RDKA 3EKLA 3FS2A 3KCJA 1M03A 1RHCA 3NL5A 4UQEA 1UD4A 4PRTA 2PLJA 2X41A 1UMYA 3THUA 1NAL1 4AY7A 1KFKA 3RPTA 3KS5A 1O94A 4UTMA 3UA4A 1JDCA 1XLDA 4JTSA 2YLLA 3RX4A 2PWHA 2IKIA 2EPNA 1X38A 3BC9A 1DV7A 1OF6A 4Q8OA 4LY4A 1KRBC 3EDJA 2G5WA 3VNZA 2QUNA 1QNOA 3ZVHA 5A6MA 4Z1BA 3D0CA 5AOUA 2UV8G 4XB3A 3N25A 5GJNA 2CHNA 5DXYA 4NZ3A 1MNZA 4F2BA 3AYSA 1RBOB 2ZWYA 3W7NA 1KV8A 1VF8A 3ABXA 1XLAA 1GOWA 2J4GA 1NWSA 2UBPC 3QY7A 3TOYA 2Q3OA 5F2GA 3MP5A 1QXLA 1KQZA 2YXGA 3O7UA 1M9HA 1JPIA 2JGQA 1VRXA 2ISSA 2YXOA 3FGCB 1I8JA 1X6LA 1PWMA 1XIFA 3L4XA 4PA8A 1EJ7L 1PDYA 1UD6A 5MHBA 3VE9A 2G96A 1Q13A 3COTA 5LA2A 3BMXA 4IIEA 4LALA 3RF9A 3UF9A 5LIYX 4ZENA 3A3XA 4F9DA 1TIMA 4Q6JA 8TIMA 3GHRA 4Y9NA 4JIIX 3WDHA 2W62A 5A8GA 4ILSA 4UCGA 3I4KA 4J28A 1V7AA 2DFAA 4UZUA 3CT2A 3I7RA 4DZAA 4KPLA 2F2HA 4N9DA 3EOEA 4S23A 1JPKA 1HKJA 2X1RA 3QMRA 4CGTA 3VKCA 3NZGA 1HJXA 4CVUA 1K77A 3FX4A 1VEPA 4UBPC 3H12A 2AQWA