3VTRA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 e328a complexed with tmg-chitotriomycin
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
572
structure length
572
Chain Sequence
b'EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTNHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVAPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERFVRMGIQAESLQPEWCYQNEGYCYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-acetylglucosaminidase
molecule tags Hydrolase/antibiotic
source organism Ostrinia furnacalis
publication title Structural insights into cellulolytic and chitinolytic enzymes revealing crucial residues of insect beta-N-acetyl-D-hexosaminidase
pubmed doi rcsb
total genus 194
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vtrA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3vtrA01
3AS2A 2QMJA 2J7BA 4F66A 1E4LA 5A3HA 2DEPA 1K9FA 3WBAA 1K6AA 1UOKA 2UY5A 3GH7A 1H5VA 4B3KA 4HA4A 3F5JA 4U5IA 2WSPA 3B9DA 4MAZA 2XJ7A 4M8UA 4TUFA 4OOZA 3NSNA 2WK2A 2Y2WA 1UD6A 1QPKA 3S6TA 3IK2A 1MQQA 1V02A 1JDCA 2IUZA 2J79A 4B15A 5I6SA 1QBBA 1EDQA 1EHAA 1KBKA 3EDJA 3RILA 4PMZA 3O9NA 1V02E 2VVNA 3VM5A 3GBDA 2XTKA 1B0IA 4D6GA 4ACYA 1WDRA 1GOKA 4YPJA 1TVPA 4U33A 3W6MA 5I24A 2VZOA 2WVVB 5JBFA 2YA2A 4DUXA 2WMJA 4MJ4A 5D8WA 2Z1SA 3TOPA 2VOTA 3CZGA 3QOMA 4PCTA 3VIMA 4D1JA 3BXWA 3WDRA 5D9NA 4M29A 3MMWA 1W9DM 2VZSA 4HOWA 1H3GA 3K8KA 3WNPA 2CBJA 2ZWZA 4P7OA 1OIFA 1A3HA 1WZAA 4MB1A 1HX0A 1E6RA 2PI6A 2VMFA 3CUHA 2GJXB 1MVYA 3CO4A 5A8PA 2D2OA 4J28A 1EGZA 1E15A 6TAAA 2WAGA 4AWEA 4F9JA 3WDQA 1MXDA 1OM0A 2PWGA 2ZXQA 3WKZA 6CGTA 2G4FA 2Q8XA 5DEZA 4BQ5A 3WH5A 1UD8A 2OWXA 3ARRA 1XRVA 1E3ZA 3W0KA 4PMNA 1FHLA 5CPQA 1N82A 3OZPA 2RGLA 4M1RA 3RIKA 4EANA 3LPFA 4Z2KA 4NRSA 5CPSA 2OSWA 1FA2A 3AS1A 2UY2A 3WDJA 4Z2HA 1UG6A 4BQ3A 3PZUA 3POCA 3L4XA 5E0FA 1JIBA 2VO5A 2AOSA 1C8XA 4WKFA 5ABFA 2BV9A 5A2BA 3OLGA 2Y4SA 5AYIA 4B3LA 1UD3A 3WUGA 4BF7A 1BSIA 1XGZA 2ZWYA 1UH4A 3G6MA 1KXTA 3WMBA 4PTWA 3VDAA 2J77A 1MFUA 1JYVA 1OGBA 3BAKA 4FLSA 2QF8A 3SCRA 5A94A 2J7FA 3PTKA 1NH6A 1GORA 2ZX9A 3AHYA 1QHZA 1U33A 2CHNA 3RCNA 2CITA 2Y24A 1UD2A 1BLIA 3W29A 3AS0A 4HTYA 3WEOA 4MNLA 4CCDA 3DYPA 1OSEA 4UTFA 3VMPA 8CGTA 4PTVA 3WNMA 3AIBA 3SCQA 5CGMA 3W24A 1KCLA 2J8GA 4H8HA 1BVNP 3WQ8A 3AXHA 3CLWA 1PPIA 4B16A 3I3EA 3WFLA 3TTOA 1G01A 1GOQA 1UR1A 4P8UA 5E70A 2J7CA 1O6IA 5ABEA 1V0KA 1V6XA 1E5JA 3AMLA 4CD6A 1UHVA 1V3LA 3GNRA 1GCYA 3KL0A 3THDA 4FLQA 2ZX7A 5I3DA 1OCQA 4PMQA 3MANA 2ZXDA 2XM2A 3MS8A 1GHRA 4PMYA 1UH3A 1GPFA 1PAMA 3A3HA 3PZOA 2CXGA 2XVNA 4RL3A 3QGVA 2HISA 4LYRA 2GFTA 4OJYA 1B31A 4L4PA 4N42A 5JIWA 1J0YA 3QOKA 1M53A 1SR0A 4HU0A 1OBAA 1J01A 1VAHA 3K1DA 1CYGA 2CBUA 1MW3A 3VDBA 3BSGA 4ATDA 2AAAA 2VCAA 4UOJA 2QLYA 2ZUTA 5E9AA 3VIOA 3RM9A 2CYGA 3AMKA 5A95A 1SMDA 2YDQA 4C7DA 4EK7A 3VIHA 3VIPA 1TG7A 2BY3A 3EDEA 2VC9A 4E4PA 3WDIA 1JZ6A 4MJ2A 3A4XA 4F8XA 3LPOA 4U3AA 2O92A 2VCBA 2E9LA 2VI0A 4B9ZA 4UZSA 3ARTA 3PHAA 2XYLA 3DECA 5KZ6A 5AYBA 1QI5A 3VNZA 5ABGA 4D72A 4V27A 3EBVA 2DT1A 4AD2A 2DH2A 4CCEA 1W3JA 2J7HA 2YIHA 2CHOA 4RE2A 4U31A 2WMIB 3RM8A 4GZIA 5E6YA 5LA2A 2WKGA 1PJ9A 4URIA 1DHKA 2WHKA 1JFHA 1FP9A 1JL8A 2XM1A 1BG4A 5EFDA 1LWJA 3CZJA 1QI3A 1VBUA 3NDZA 3PTMA 3I3BA 1UWRA 3OGSA 5D4YA 3APGA 2BY2A 2G3NA 1VRXA 1D7FA 2ESCA 4AMCA 5FKYA 3N17A 1UKSA 4HPGA 1GONA 3SURA 3TTQA 2QHAA 2XHYA 5C71A 1FFQA 2XIBA 1NM9A 3AJ7A 3WIJA 3ZT5A 1JYWA 1WAWA 1OB0A 1XD1A 1AQHA 4TTUA 2WYSA 1GJUA 3W37A 3S2CA 3AICA 1KGUA 1KR0A 1HL9A 1EIBA 4F9DA 2PBOA 3VGDA 1V6YA 4PCSA 3ALGA 1E4IA 5BXPA 3MMDA 1TA3B 4R27A 1TFVA 4GQQA 2JIWA 4H2CA 4W86A 2PBGA 3W82A 3AISA 4AY1A 4PRWA 4J3VA 2BVYA 4OBRA 2OSYA 1HVQA 3LPGA 2V5CA 3SCNA 4TVUA 4KRUA 4LPCA 2EXOA 5CXPA 3VTRA 3VX1A 3UG5A 3N18A 1R8LA 1XH2A 3AFBA 4GI6A 3D3AA 4YHEA 3T0AA 4EAMA 4DM1A 1OD0A 1M03A 3GTNA 2JALA 3HMCA 2XUCA 1V0LA 4AISA 1UA3A 3MV01 2W5FA 2YLLA 1GQLA 3AXIA 1LF1A 4MDOA 5A6AA 2WMHA 1QBAA 3A47A 3GM8A 2IXUA 3KWXA 1X6LA 1W2VA 5CG0A 4WKHA 3FY1A 4JKKA 1H09A 3T2PA 3O2LA 3SEPA 2ZOXA 4IPNB 3AQUA 1C93A 3OA5A 1XYZA 1B3YA 5D8ZA 3UCQA 2FGZA 3G6LA 1UZ4A 2J7DA 1DEDA 3T0BA 3WF0A 3EMQA 4JFSA 4JFWA 4UQDA 2PF0A 2VTFA 4DWSA 1KGXA 1E4NA 3MV11 2WCGA 3WF3A 3WELA 2ZXAA 4IUGA 5A2AA 1B9ZA 1W1YA 1JYXA 1JAKA 2JEQA 3OGRA 4Y7EA 3WMSA 1W1PA 4ACZB 5A6LA 1W2PA 2E0PA 1NWTA 4J3UA 4B9YA 3VUPA 2EPOA 5JBEA 3OG2A 3W38A 3WQ4A 3BMWA 3ZJ7A 3TA9A 4CVWA 5I0DA 2X09A 3T2OA 1BQCA 3B8SA 1ISXA 1V3HA 1M7XA 3GNPA 5DMYA 2WPGA 1JF5A 5CSUA 4XB3A 1V6VA 5HXMA 4U2YA 1KXQA 5I78A 4CD8A 1ZBWA 1UQZA 4KMQA 2OWWA 3GYCA 1CIUA 1TMQA 1R86A 4HA3A 4BZYA 3WFZA 1E70M 5AY7A 2BY1A 4OZOA 3WSUA 7A3HA 4S3JA 1L0PA 1HL8A 1VEPA 1CENA 4R5EA 5DT7A 2JFEX 3K46A 2UWFA 3UG3A 1GJWA 1XV8A 7TAAA 1BFNA 1ODUA 4J3XA 4CU6A 3T0DA 3PZTA 3WUBA 2WZEA 2VX5A 2ZX5A 1PIFA 3MMUA 1FFRA 2ZICA 1HN1A 2XWEA 4J27A 5GNYA 5I5RA 3POHA 5A6KA 1CXEA 3OGVA 1S46A 3N1AA 3CZ8A 1JG9A 3AROA 3DHPA 3K8MA 2DQXA 3GXIA 3WMCA 2VNCA 4MPKA 1GQIA 2YA0A 2HVMA 4GO8A 3W28A 2DDXA 3VX0A 1JF6A 1SYTA 4PBGA 2XIIA 3ZJ6A 4CD7A 4ZE5A 3AIQA 1XD0A 3MUAA 3CUFA 2QMKA 1B2YA 1UR0A 1FH7A 2J47A 3VILA 5CZKA 2E8ZA 1ISZA 1GOWA 3U5YA 1GUVA 2GJRA 3FAXA 5EB8A 4KWUA 1UR8A 2XGBA 1E56A 2J78A 2VJXA 1Q6GA 1QW9A 2X0YA 3MO4A 4TTGA 5A8NA 2G3MA 4CN6A 4W7UA 4UCFA 3WEZA 1GVYA 2A3HA 4A3YA 2YA1A 1HNYA 3VKKA 5DF0A 4C7FA 3SUSA 3WF1A 2WWCA 3VD5A 3MU7A 5A1AA 1F4HA 4JFTA 3SIMA 2X05A 2VR4A 1ITCA 1US2A 3M07A 1CGUA 1V0NA 3WD4A 8A3HA 3ECQA 3W53A 3ZT7A 2XVKA 1Z32X 1UKTA 1ZBKA 3EYPA 3F5KA 3VD7A 4Q7NA 3PZIA 4NSBA 1C91A 2WZIA 3IJ8A 4PMDA 3RDKA 5A6BA 4W5UA 3CH9A 2UY3A 2VVSA 1HJWA 2J75A 4Z2IA 5LA0A 1PX4A 4AC1X 4CUCA 3VIGA 3EDKA 1UWQA 4E2OA 3RMEA 2D3NA 1VIWA 4JCMA 4P7QA 1UWUA 1E43A 2B31A 3NYDA 1IZKA 3KL3A 3FN9A 3A4AA 1KXVA 2OWCA 5BWFA 1OINA 3CZEA 4IISA 2XFRA 1PZ2A 2CCRA 1I75A 4IPLA 3VIJA 1EO7A 1CXKA 3A6OA 4MTVA 5A2CA 4A3HA 1C90A 4JZ5A 4UZUA 1I1XA 4D6IA 3OBAA 4PN2A 3VD9A 4J3SA 1CGVA 4AIEA 1J9YA 1XSKA 1OT2A 1JZ5A 1ZBVA 2JE8A 4CN4A 3MUIA 1F4AA 3CHDA 1Q6FA 2O9RA 3WNNA 5HOSA 3VGEA 3ARSA 4FF5A 3GXMA 3VIIA 3PZ9A 2WBGA 1E4MM 3WEMA 3VDHA 5CPTA 2D23A 2WVTA 1FP8A 1XHGA 1H1NA 3L4TA 5LA1A 4UFKA 1J18A 1PEZA 4AYSA 4Z2JA 3CUIA 2CESA 3VIFA 1LG2A 2CKSA 3AIRA 3L4YA 2W61A 5IXEA 3F4VA 1SMAA 2WMFA 1DWIM 3WENA 3FNDA 5EFFA 3W25A 2WANA 4OUEA 4AIUA 1Y7VA 1UKOA 3BAJA 5CGTA 3EMCA 1JZ2A 1E9LA 1MQPA 1R7OA 6A3HA 3MUY1 3O6AA 1J0KA 5A8MA 2E40A 3BSHA 1UWSA 1LL6A 4IM4A 2D0GA 5A8QA 1HKIA 2EJ1A 4M81A 4RE4A 2CETA 1QOXA 4N0RA 1WKYA 2Z1KA 1NP2A 3AHZA 3AZRA 1D3CA 1OT1A 1OD8A 4OIFA 1CPUA 4W89A 2WWDA 1CWYA 3AMGA 1OWQA 4HZ6A 4U2ZA 1BYCA 2G41A 1HJQA 3WD2A 2E8YA 1B30A 1RD6A 2BHZA 1PX3A 2WHLA 3SCWA 3U5UA 1L8NA 1NQ6A 3AIUA 1KWKA 3OLDA 3IANA 3WL0A 2DT2A 1WZLA 2VURA 2F8QA 3I3DA 3PZGA 1WP6A 4LX4A 4JAWA 7CGTA 2OYMA 1Q6EA 2YLAA 4TVCA 4XZWA 2EPMX 3ZJ8A 4W5ZA 3ARYA 3L2MA 3PZMA 1UH2A 1K9EA 2YL9A 4EKJA 2X8RA 1WZKA 4H8UA 4AW7A 2XVPA 2ZUUA 2NT0A 1JDAA 3CHEA 4F79A 1E0XA 4KH2A 1C8YA 3UR7A 4HOZA 9CGTA 5IFPA 3KE0A 3PBGA 1PIGA 4WSKA 1W1VA 2OLHA 3AI0A 2YL5A 3F5LA 2WZHA 4W8LA 5CLWA 1KB3A 3CIVA 4LQ1A 2WHJA 2VUYA 1V03A 1M04A 2JF7A 5I79A 2J7EA 4GI9A 2X0HA 4MADA 3UERA 4BA0A 4H04A 4MB4A 1U30A 1E6NA 4X0NA 2OSXA 2GK1B 1CTNA 1WDQA 1DWAM 3ARXA 4M56A 2WVVA 3N13A 3WNLA 5BRPA 3FHAA 1HIZA 1QNSA 1H4PA 5BROA 2W66A 2OYKA 2CNCA 4ZEPA 3NIYA 1BHGA 1LLOA 1EHNA 1JFXA 1B90A 4AZ5A 4C91A 1NWSA 5HDRA 2CIPA 3BLKA 4FLOA 1HT6A 2VRQA 3GXDA 1GNXA 3QHNA 1DP0A 1GVIA 2J62A 4D6FA 4P7RA 1TCMA 1Q6DA 1TE1A 1TUXA 3CHCA 4P7NA 4W85A 1H11A 1C7TA 3AXXA 4GQRA 2YKKA 2WKLA 3AMCA 1RH9A 4ZFMA 3RO8A 4QP0A 1LL7A 1XH0A 2CBVA 3N9KA 4AZCA 2O9PA 1HJXA 2DGAA 3GNOA 1ISWA 2PWHA 4UR9A 3VGGA 4C7GA 3MKKA 3LMYA 1YQ2A 5I2UA 1BAGA 2XG9A 1VBRA 3WL1A 2PWFA 2EO7A 1J11A 2V3GA 3ZO9A 3BAWA 1OIMA 3NSMA 3CGTA 2C8NA 1VF8A 1PX8A 4GZJA 1YHTA 3PZQA 1CNVA 1UKQA 4H41A 3TONA 1E0WA 2NSXA 1H2JA 2WMGA 3ZSTA 2Y8VA 4E8DA 4XV0A 3BC9A 2WCAA 2XGIA 2XFYA 1UYQA 3ZQ9A 3K4AA 3FAWA 2XPKA 5A6SA 1NOFA 3L4WA 1JI2A 4WKAA 1UD5A 1XCWA 4TXEA 1G9HA 2WMKA 3WH9A 4JIEA 1CECA 5GQBA 3NJ3A 4ML4A 4PMOA 4UFMA 5D9MA 2GUYA 1V3MA 1B1YA 1FH8A 3AIEA 1GHSA 1I1WA 3BAIA 1W3HA 4TOQA 2D1ZA 3M6DA 4Z2LA 1GOOA 1W1TA 4P8VA 5IDIA 2V3DA 1IT0A 3BH4A 4E8CA 1E3XA 5A69A 1XCXA 3WQWA 3WF2A 3L2LA 1G1YA 5DFAA 3WUEA 1BF2A 2CKRA 4GZEA 2FGLA 3B9EA 2WW5A 1KCKA 2VRKA 1OGSA 2W92A 1G94A 1RP8A 1BGAA 2VZVA 2W62A 2PC8A 4V2XA 1C7SA 4H8VA 3VGBA 1LQ0A 1BGGA 4Q22A 4PUDA 4Z2GA 1W91A 5D9PA 1SFSA 2GSJA 2XVGA 3CMGA 2X2YA 2PWEA 4W84A 1VJSA 4AEEA 3W27A 2O9OA 5HPOA 1IZJA 1W32A 3CZKA 4PUEA 2DSKA 1WB0A 1E72M 1W9XA 4V28A 1ECEA 4LGXA 3ARQA 4XX6A 1U2YA 3CUGA 4ZXLA 3M46A 2J74A 1KWGA 1QI0A 4JL1A 4D6JA 1E40A 2VX4A 4TVDA 3N12A 3UETA 3J7HA 3VGFA 3ZSSA 1HVXA 4OBSA 2ZUMA 2MANA 2VR5A 3ARVA 3NSXA 5FCZA 2YL8A 5FOOA 3TTYA 1CGWA 2WVUA 3AYSA 3HU7A 2EBNA 3GBEA 4WIWA 1ODZA 1EO5A 2FHCA 1UWIA 3AZTA 3WD0A 4CD4A 1CZ1A 2YJQA 4PMXA 3K4DA 4OKDA 1XSJA 4W8AA 5M03A 4C90A 1ZJAA 4AD1A 2BVTA 2IXVA 1AQMA 1C8QA 1GOIA 3CMJA 3TTSA 4AD4A 2WMIA 1RPKA 2E3ZA 1QHPA 2YDRA 2DIJA 4M24A 2VL4A 3CPUA 5D9OA 3WBEA 2XSAA 3II1A 2GVYA 4GO9A 1WCGA 2XVLA 4H7VA 3UEQA 3BAYA 4MB5A 1K9TA 4LYPA 3NUKA 3T09A 4PSPA 2J7GA 3IAQA 1UZ1A 1MXGA 4XZBA 3GH5A 2ZUSA 1MW1A 5JIPA 1MW2A 2ZE0A 1TR1A 2VQUA 4AZ6A 2BY0A 4HPHA 1US3A 3WH6A 1JI1A 1E6ZA 1QNPA 1HKJA 1WDSA 1WO2A 1UA7A 1JZ7A 2DSVA 4GXPA 1JNDA 4BS0A 3ARWA 5CSYA 3BGAA 3SUTA 1V3JA 1CGXA 4UQBA 4WLCA 2XFFA 2YBUA 3ALFA 5CLTA 2DSZA 1HP5A 4RE3A 4GKLA 3WDPP 5JUVA 3ARZA 4W8BA 4JCLA 1A47A 3KZSA 3VGHA 1E55A 5TD4A 3FW6A 3GXFA 4MAVA 4NF7A 1UQYA 2DT3A 4DWSC 4PEEA 4K68A 1TZ7A 3WNKA 2G8ZA 2A3EA 5IHRA 4DM2A 1V6UA 4XUYA 1HXJA 4P8WA 1O7AA 1ZJBA 4WK9A 5ABFB 2VX7A 1JAEA 1BYAA 3FHQA 3U7VA 4HZ7A 5I77A 2WC3A 2CERA 1JNEA 2ZUWA 3PZVA 3WH8A 1AQ0A 1JD9A 4AZGA 4WJXA 2JIEA 1NWRA 1VFMA 4MNJA 2J25A 3AIVA 1TVNA 4P8XA 4QDMA 3AMDA 1J0JA 1H41A 4JFVA 3OIHA 1X6NA 2VZTA 1JZ8A 4YN5A 2J8FA 3L4UA 4EE9A 1KQZA 1G5AA 3W81A 3VO0A 1JD7A 2W4XA 5A6JA 2O9TA 4MDPA 4J7RA 2ZIDA 1H0GA 3WF4A 1QVBA 1H49A 3ZR6A 3RM4A 2AMGA 3D5HA 1CEOA 1IV8A 2FH8A 3SCTA 2J4GA 2V3FA 2BHYA 4KGJA 1BYBA 2CEQA 4ZE4A 2D24A 1CXLA 4ACZA 1UUQA 4LXFA 3NCOA 4P7LA 5EBAA 5DO8A 1E5NA 1ZS2A 4HMDA 1VJZA 4DWSB 1J0HA 4W7VA 1FOBA 1E1FA 5BXRA 4D6HA 3VU2A 5ABHA 4GPNA 4CU8A 2VT0A 4AZ7A 3T2QA 2E4TA 4D6CA 3QHOA 1R87A 1NP0A 3L4VA 4AZCB 3VOCA 3CBWA 1CLXA 1KXHA 2ZUVA 1MW0A 1WE5A 4MB3A 3TP4A 3QHMA 4PTMA 1FHDA 2BVDA 4NI3A 1DTUA 4BQ4A 3QR3A 3ZJKA 1JGIA 3ZOAA 1MFVA 4S3KA 1BTCA 2VQTA 3CUJA 4CCCA 1J10A 1HJVA 3SCOA 3W26A 1QNRA 5A6BD 1KR1A 4WF7A 3VD3A 3ARUA 4UQCA 1E6QM 1HJUA 4CKQA 1LWHA 1GW1A 1AVAA 1EOKA 2D22A 1B3VA 2VX6A 2WB5A 5M5DA 4CN1A 1ESWA 4PYSA 3CZLA 3W6LA 2EPNA 5C8BB 1EQPA 4J3TA 3SCSA 4M80A 5FIPA 3AHXA 2C7FA 1WDPA 4UOQA 4J3WA 5FD0A 1W3KA 4JL2A 1G0CA 4JKLA 5E0CA 1ZB5A 3WD1A 1EXPA 1J0IA 4M82A 5BXSA 4PMRA 3WUFA 1DWJM 2F2HA 3SCUA 1OGGA 3RPMA 1JZ4A 4MNKA 3BCFA 2VZUA 3WN6A 1VEOA 1QHOA 1J0ZA 3OB8A 3ZMRA 3AS3A 1E73M 4PTXA 3BMVA 1J12A 1GQJA 1HKMA 4W7WA 1KQYA 4AD0A 2TAAA 1C3FA 4QLKA 4UOZA 2BNJA 3AHVA 1NOWA 2WXDM 5HBFA 2ZX6A 1HP4A 1GZJA 4JHZA 4QLLA 3VM7A 4PSRA 4NRRA 2DIEA 3WQVA 3IJ9A 3GZAA 4JKMA 5HNNA 2EPLX 5BYWA 3ZM8A 2CPUA 3MSGA 1B3ZA 4QAWA 4BCEA 4UQ9A 2BS9A 3FXYA 3VD4A 1LL4A 4FLRA 1QNOA 2ZX8A 3UESA 1V6WA 3BCDA 2V3EA 1ZL1A 3HJEA 1JDDA 3DYMA 2BXZA 2DH3A 4GINA 1TA3A 2GK1A 3PZNA 3AYRA 2EEXA 1V3IA 1E1EA 1ZBCA 3RJXA 1P6WA 1QI4A 3LPPA 1CGTA 3MSDA 1PZ3A 3IJ7A 3WD3A 1NARA 4HP5A 4D1IA 3W4RA 2E9MA 1BYDA 3GDBA 1M01A 4AIOA 1HJSA 2OYLA 5IFTA 4AZBA 2G3JA 1MYRA 4QFUA 1EDTA 1BG9A 1GOMA 1VB9A 1BPLB 4LYQA 4ATLA 3N11A 4D71A 4BQ2A 1XC6A 3OZOA 4GIAA 1VFOA 3U57A 3WH7A 3EDFA 3B9AA 4HMEA 5A6MA 1XSIA 2V5DA 4JHOA 3T08A 5EMYA 2WNWA 3VDCA 2BHUA 2D0HA 5LYRA 4AD3A 1GQKA 2ZUNA 4W88A 2DPEA 2VCCA 4NZCA 3WQ6A 3ZR5A 2V38A 5E6ZA 3UR8A 4CD5A 1W9BM 4UQAA 5DT5A 5CJ5A 4U3CA 2D3LA 3KEHA 1RP9A 2FDMA 4KRTA 2WM0A 2XSBA 3VINA 1CDGA 1BVZA 1CLVA 3SCPA 2QPSA 1KBBA 4ZENA 3MUZ1 2WSKA 5BCAA 3GH4A 1DWFM 2DSWA 3N04A 3VMOA 1KGWA 2Y5EA 4U5KA 4HZ8A 2YBTA 2W91A 1C92A 1X1NA 4UFJA 2RGMA 4X0VA 3VPLA 2YL6A 3M7SA 4L4OA 2WBKA 2BFGA 3VIKA 3HN3A 1NOUA 5AC4A 1CXFA 1JZ3A 1W9PA 2E9BA 4HOXA 1UWTA 1WZMA 4A4AA 4HU8A 2WVSA 3DC0A 1E6PA 3AZSA 2WCSA 1E6XM 2YDSA 1UD4A 5AC5A 2D20A 1Q6CA 4WSJA 3WDHA 5BRQA 2WLYA 1MWOA 3IAPA 5CQ1A 1EH9A 1W9UA 4QCEA 5GPRA 2QV4A 1VFFA 2W67A 2WHMA 5IHSA 2NT1A 1CBGA 4W93A 3ZIZA 5FL1A 1B3WA 2ZXBA 5F7UA 2WLZA 2NW0A 2W63A 3DHUA 3OLEA 4PMUA 1B3XA 4FMVA 1V08A 4AZIA 3UG4A 1EOMA 4CGTA 1QNQA 4W87A 4X9YA 4ZXOA 1NWUA 1DWGM 3K8LA 4PMVA 3VNYA 2PB1A 1E71M 3U7BA 5GNZA 2EPKX 4GI8A 2D0FA 5BXTA 1EQCA 1V3KA 5KEZA 4ATWA 3SCVA 3WNOA 4DUWA 3CTTA 3L4ZA 5ECUA 4UFLA 1MQRA 2FHFA 5GNXA 1FH9A 3KL5A 2C0HA 1JXJA 1V0MA 1R85A 4DWSD 2G3IA 3ZT6A 4AD5A 1JXKA 4QLJA 2FHBA 4KGLA 3WQ5A 3RJYA 1AMYA 3DYOA 1E6SM 4TX8A 2GDUA 3BLPX 1XYFA 1QI2A 3AOFA 1VEMA 1JYNA 1UR2A 4D6DA 1UR9A 4QCFA 1R7AA 3JUGA 1UR4A 5I23A 2GJXA 1CGYA 1EDGA 1QW8A 2WC7A 2A3CA 4HMCA 4OOUA 3N15A 4FK9A 1VENA 3AIWA 3VMNA 3PN8A 5FL0A 2CBIA 3PTQA 2WC4A 2PWDA 2FH6A 4UQEA 1K9DA 1ZU8A 4UFHA 3SUUA 2BXYA 2A3BA 2F61A 3CHFA 1DWHM 2JEPA 4HA1A 3BAXA 5E09A 1ITXA 3SUWA 1H0IA 2A3AA 1LJYA 5C70A 1D2KA 3SUVA 1Q4NX 2XWDA 2JF6A 3EMZA 1HF6A 2UY4A 5M3WA 4UNIA 1E0VA 5HPCA 4AZHA 3A4WA 4AXNA 5JBDA 4YHGA 2X1IA 3THCA 4MNMA 4D6EA 4UFIA 4JFUA 1LG1A 1PBGA 1XH1A 2YOCA 3WY1A 2GJPA 4DUVA 1UKPA 1ISYA 3NDYA 4AEFA 1ISVA 2Y8KA 1CXHA 1KFWA 2QPUA 5A8OA 3OLIA 4TX6A 4CVUA 1HKKA 1CXIA 3EDDA 2EQDA 4CU7A 1EA9C 2DT0A 1WPCA 3VVGA 2DSUA 3E1F1 3AHTA 3ARPA 1W9VA 2VRJA 2GDVA 1WNOA 1VFUA 1W3LA 5M17A
chains in the Genus database with same CATH superfamily
4JDYA 1S2TA 1UC4A 3APTA 3Q45A 2IS7A 2O4MA 4JEJA 4H6QA 2UY5A 1OFQA 3GH7A 2CLOA 4I6KA 1FWTA 3MSRA 4B3KA 3F5JA 3JS3A 1ADDA 2OKOA 3B9DA 4MAZA 3P0XA 3ABXA 4PL1A 1JPMA 4M8UA 3M5XA 3OVPA 4OOZA 2WK2A 3KVLA 2QNEA 2Y2WA 2FKPA 4K8GA 1VC4A 3S6TA 4C5ZA 2BVWA 1MQQA 4HPJA 5I6SA 2ZYFA 3I65A 4N6EA 4XAZA 2D73A 4WY0B 2INEA 2XSXA 4YWIA 5FJUA 3LSCA 5I06A 3O9NA 4I90A 1V02E 2VVNA 3VM5A 2PDXA 3TYDA 3URQA 3MTWA 2GGIA 1X7IA 3TLQA 3HOJA 4CLMA 3LBMA 2E6DA 3VNJA 1VFTA 4JQ3A 5I24A 3KRUA 2VZOA 2WVVB 5AYYA 4L5ZA 1YXCA 2F6UA 2V67A 3SRKA 3CZGA 3THQA 3K4WA 4PCTA 3W1XA 4IMFA 5D33A 3VABA 3BXWA 3KTCA 4MJMA 2PLJA 3DI1A 4GC4A 5M1TA 3GG7A 1KM1A 1H3GA 3CT7A 1FBAA 2ZWZA 3RX2A 4MSSA 1OZMA 3WK1A 1E0TA 3W2MA 3CUHA 2GJXB 5A8PA 1XKYA 4QNEA 2YYTA 2RJGA 5HINA 3GD6A 4HHPA 2WAGA 2P10A 3T7VA 3WDQA 3SADA 3JW7A 1MXDA 1R3SA 2ZXQA 3H2NA 3TFXA 2G4FA 5DEZA 3ARRA 4ADUA 3RN6A 3FDKA 4GE8A 4G8TA 5C2CA 3W86A 5CPQA 2RGLA 3RIKA 2FZ9A 2EJAA 5CPMA 1EP1A 5LNVA 1KBIA 4BI5A 1XIBA 3DXIA 2OSWA 1VYRA 4YJ5A 1FA2A 4FZIA 3AS1A 3D3FA 4Z2HA 2FZDA 4GWEA 3NNTA 1XLBA 3CQKA 2QJGA 1PYFA 4YCOA 3L4XA 5E0FA 2QJJA 4PEKA 2AOSA 9XIAA 2Y4SA 4B3LA 3WUGA 4WEVX 3HQNA 3TJXA 1KXTA 1N8IA 1XJBA 1P0EA 1OGBA 2V69A 2DP3A 1QHZA 2EG6A 2CITA 3F2CA 1UD2A 3AS0A 2V63A 1XX1A 3C52A 4GD0A 2QGHA 3PSWA 1M7OA 3VMPA 2PS2A 3EB4A 4CNTA 1KCLA 1U5VA 3PS7A 1BVNP 3HFTA 3AXHA 3ISIX 3CLWA 1PPIA 3SQLA 3I3EA 3WFLA 3B4UA 1Y5VA 1UR1A 3WBXA 1E9IA 3SSJA 2GUBA 3N73A 4UTHA 3UF9A 1M9HA 1V3LA 2E6FA 3KL0A 1N8FA 1TSIA 1P1MA 3DAQA 5HNRA 2ISSA 1OCQA 3MANA 4YWSA 1Q2SA 1SO5A 3ID7A 1PAMA 3BANA 1FDYA 2CXGA 3PAJA 5GJNA 4JEQA 3QMSA 3QY8A 2HISA 3AWNA 5E93A 4HN4A 2GFTA 4OJYA 4NZ3A 1B31A 4WZHA 3GAYA 3KW3A 3P7YA 1M53A 4BKNA 1XF0A 2XU2A 1B4KA 1ZP4A 4UOJA 1F8IA 1HKVA 2QLYA 2ZUTA 1ITUA 3AMKA 4QGCA 2BY3A 2KX9A 4E4PA 2OQLA 2W0UA 2REQB 4MJ2A 3A4XA 4R9XA 4F8XA 4P02B 4U3AA 1G4PA 2VCBA 4DAFA 2VI0A 5C9UA 4UZSA 2I56A 3PHAA 5KZ6A 3GDRA 2ASHA 1NQKA 2QZRA 1KD0A 1Z6KA 2C18A 4AUBA 3PJXA 1O5XA 4GCAA 3S5YA 1UR3M 4CNPA 3RM8A 4N9CA 4GZIA 4DZIA 1DHKA 3U2EA 1FP9A 1JL8A 3VA8A 4GJ1A 1PDYA 1S2CA 4DQWA 1VYPX 1H63A 2VGIA 4ZCWA 4MUZA 3HPZA 5KZMA 1ZCCA 1D7FA 1C29A 5FKYA 3N17A 1UKSA 4HPGA 2VFHA 2QHAA 3HM7A 4LSBA 1NM9A 1TPEA 3SN4A 3E0VA 3W7NA 3C2OA 2QS8A 2HXTA 5I3HA 1EIBA 2IKGA 4A8NA 4RDZA 2PBOA 3VNDA 1V6YA 3WMLA 3ALGA 4WRHA 5BXPA 3MMDA 4IXXA 1TA3B 2P8BA 3W1MA 1TFVA 2A6LA 2XIQA 3SZ8A 2PBGA 3W7LA 4DX3A 3W82A 3STPA 4PRWA 4J3VA 4HCDA 3LPGA 2OT0A 4JTJA 5KINA 1KM6A 1PVNA 4MKSA 3KOXA 3VX1A 3N18A 3N4FA 4ORIA 3BLEA 1A3WA 5AHMA 1S39A 2PDQA 1O94A 4L1XA 4TMBA 3HMCA 2XUCA 1OCNA 1V0LA 1FCBA 1MZHA 4AISA 2YLLA 3AXIA 3G1DA 2HNHA 3PFMA 4DJDC 2NV9A 4UUIA 4UR8A 4DZHA 4X2PA 3P6LA 3B4YA 5LIUX 1A4MA 3RX4A 3T4CA 5CG0A 1KTCA 4DYJA 3O2LA 2ZOXA 2XN1A 4JQAA 5C2XA 3AQUA 1C93A 4JN6A 1XYZA 1UZ4A 5HNUA 2QEZA 2C19A 4DY1A 3T0BA 1D3HA 5E9XA 2PPGA 4J2PA 1QWKA 3B97A 1E4NA 4Q8VA 3MV11 4WY0A 1AG1O 1I0DA 3JZEA 5LIKX 4ACZB 1LCOA 2I5QA 3OGRA 1NWTA 4NY2A 3GHUA 3LNPA 3V3WA 3IGHX 3TMQA 1I2RA 1BXNA 3OG2A 3W38A 3WQ4A 3BMWA 1O5KA 3TA9A 1OG6A 4NAFB 4GYJA 2X09A 1SFJA 4QJ1A 3PP7A 3SRHA 2J27A 1W31A 3G0SA 1UIOA 1LP6A 5CSUA 1J6PA 3VOHA 4XZHA 3MQTA 1UQZA 3ANVA 3G5EA 3TC6A 3H8AA 4GK8A 4LOCA 2WSYA 3IIZA 4OV9A 4ADSA 3WFZA 3TV8A 4C6MA 1HL8A 2E6AA 3O6CA 3QY6A 1SJAA 1FWNA 3UZ5A 4Q4OA 1FDZA 1XV8A 1ODUA 4J3XA 4KCUA 3PZTA 1GEHA 1IT7A 3HQ1A 2PP0A 3KZPA 4AU0A 1WXYA 4XAGA 3M43A 5GNYA 1OYCA 1S46A 3A22A 3AROA 1JR1A 4NZFA 2VNCA 4GHRA 4GO8A 4C5YA 5KITA 4KPLA 1QJWA 5MKGA 1JF6A 4IIBA 1W17A 4IP4A 5DX7A 3NZPA 4E5TA 3IRSA 2ZZ6A 1XD0A 4KCTA 4C65A 2AKMA 4Y9PA 4WDUA 3IJQA 4R9OA 3NR0A 1UR0A 3M64A 1FXPA 1FH7A 5CZKA 3NQAA 1GOWA 3U5YA 3NL2A 2PDNA 1EGMA 4BEQA 1G4EA 5EB8A 1UR8A 3GO2A 2CZDA 1Q6GA 5DY2A 2X0YA 3JZUA 2YZ5A 3S1UA 3W7EA 1F61A 1IWPA 1PCKA 4JY9A 4JXCA 3UP8A 3W73A 1F76A 4K7VA 4UWMA 2A3HA 4A3YA 3IJDA 4C7FA 3MU7A 3K30A 4JIRA 1YPIA 3QM3A 3UXLA 4S3FA 3SIMA 2X05A 1ITCA 5TAOA 1V0NA 4LRTA 4FSAA 1Z32X 3B0VC 3H4GA 1EL3A 1ZBKA 3IPWA 3CNYA 2QGYA 3JVAA 3F5KA 4Q7NA 2PEVA 4XVDA 4KIRA 4CNUA 3CH9A 2IQTA 2CLPA 3UNDA 1MNSA 2UY3A 3RITA 3G3MA 2PRLA 5GJMA 5LA0A 3WQOA 3VIGA 1J6OA 4E2OA 5LHEA 4LNCA 4AB4A 3TJLA 4P7QA 3H2EA 5CBBA 2VGGA 1Z42A 4BHYA 3WLOA 2PD5A 1PS9A 4GNKB 3T4WA 3MVTA 3FN9A 3A4AA 1OINA 4IISA 2E25A 3MCMA 1VP5A 4TMCA 1I75A 4IPLA 3VIJA 4Q7BA 4DN1A 5A2CA 2Y7EA 4MWAD 1EA0A 4H1ZA 2QF7A 3OA3A 4A3HA 2PDLA 4D6IA 2IPGA 4LVAA 1WXZA 4IHCA 3E5PA 5FEWA 3UGRA 2FQIA 4CN4A 3KCLA 1XLEA 1Q6FA 2OZTA 3CWHA 4IIDA 3ARSA 3GXMA 3WEMA 1E4MM 2I5IA 5CPTA 4DRSA 2D23A 1FP8A 1FWHC 1XHGA 2QVNA 4G2DA 3W7HA 3VIFA 3H70A 3LHTA 2CKSA 4IUOA 4UTTC 2W61A 1BXCA 3F4VA 3RHGA 3CTLA 1DWIM 3G1RA 3WK2A 3LXCA 4LTSA 2WANA 7REQA 2QCCA 3RLUA 3EMCA 4JTQA 3HA1A 1MRQA 5MF5A 1EJUC 3TW9A 1TV2A 4FF7A 1TV4A 1MUMA 2J13A 1AA1B 4IPJA 3W07A 2R1KA 2X0SA 2KAUC 2FJUB 3OYZA 3PJUA 2BTMA 1HKIA 1QWGA 3QLDA 3BTNA 3FKKA 4PUWA 4G1NA 4N0RA 2NUXA 1X8FA 3H7VA 1XLLA 2Z1KA 1NP2A 3AHZA 1D3CA 1OT1A 1YKWA 1HGWA 2PMQA 1DE5A 4GISA 8TIMA 4HZ6A 4HNLA 3WLNA 4GABA 2IKHA 4AVFA 1LBMA 1RD6A 3V5OA 3U5UA 3N4AA 3IANA 5D2XA 4ZL1A 3IGXA 1EEXA 2VURA 2FZ8A 2F8QA 3I3DA 1RVGA 3PZGA 1DJIA 7CGTA 4Q4KA 3V7PA 3TYAA 2EPMX 4KBXA 3S3GA 3UCDA 3FJ6A 4ZO7A 3APYA 4XAYA 1G67A 1W1IE 2BODX 4GACA 4DJFD 4AW7A 3EXSA 1JDAA 4C6IA 4KH2A 5IFPA 3OO2A 1SUXA 3DX5A 3F4WA 2OLHA 4LAZA 1W3IA 3ORWA 4W8LA 4HNVA 5CLWA 1U5HA 2YPIA 1A5NC 4ZQOA 2YX0A 2WM1A 5IM51 3C4UA 1M6JA 3CIVA 4WDWA 2CLIA 2PSNA 2VUYA 5I79A 2J7EA 5IDZA 4HPXA 3UQNA 2Z2UA 4MADA 4WR3A 1OK4A 3PG9A 4IMCA 4C60A 2QJMA 4H04A 4MB4A 4YTUA 2GK1B 3WLTA 1TX0A 4ICCX 1AW1A 2WVVA 2R1NA 3N13A 3WNLA 2GLKA 4H9YA 4A21A 1H7PA 1OF8A 3T81A 1ZCOA 2CNCA 3NPVA 4ZEPA 4BI6A 2DORA 3ZWSA 3IACA 5HDRA 3LCXA 4FLOA 3EA1A 4ML9A 9XIMA 1HT6A 4H8NA 3GXDA 4HGXA 1GNXA 4K7YA 2C16A 1LRTA 1IEVA 3GE7A 4P7RA 1Q6DA 3MB9A 1SVDA 2PP1A 4HNUA 3V0UA 4P7NA 1H11A 2P3ZA 1RH9A 3UT0A 4ZFMA 3RO8A 3WQPA 3N9KA 4NAEB 2O9PA 3P3BA 1WOAA 5C9XA 4GKTA 1ISWA 3M41A 4UR9A 2NQJA 1V4YA 2PCQA 1YQ2A 1BAGA 3E2VA 4IFOA 1VBRA 4GH1A 1LTDA 1TR9A 3ZO9A 3UWYA 1KNWA 2ZZ2A 1TV3A 1VF8A 1FWBC 1NFPA 1YHTA 3G77A 1CNVA 2Y8VA 3TR2A 1AFSA 2WCAA 3FLUA 3STFA 3BW4A 4B5NA 4W4QA 4FI4A 4LY8A 3FAWA 4PODA 4AHOA 5A6SA 1QO5A 3V4BA 2ZC8A 1G9HA 3WH9A 3SJNA 4LAMA 4UFMA 1FCUA 3EOUA 1B1YA 1EFZA 1O1HA 4PC8A 4KERA 5AZ0A 3BAIA 4ONVA 2Z7KA 3M6DA 3P5ZA 5HATA 3QGAC 1GOOA 1RK5A 3RYSA 2G4JA 5IOBA 1PXGA 1W8GA 4IQLA 1UASA 1Y5XA 3M0XA 5IDIA 3TEVA 2V3DA 1Z41A 3QR0A 2MUCA 3I6TA 2Z1VA 2CZVA 3LS9A 1E3XA 3CIXA 3OU8A 1NFGA 1X1OA 5DFAA 1Q6LA 2XFWA 4C1LA 4GZEA 2FGLA 3TYCA 3MHUA 2C13A 4XO7A 1OGSA 4DELA 1V5XA 1BGAA 1YTKA 2W62A 4LJ3A 1AQFA 2HE5A 2PC8A 1POJA 1V7AA 4CQAA 4N6FA 3GNNA 3M0VA 1FCVA 4H8VA 3O1NA 1LQ0A 3LCLA 4PUDA 4Z2GA 4XZLX 2FIQA 4W84A 4DJDA 3W2UA 4AEEA 3XISA 5MHBA 2O9OA 3CZKA 4PUEA 2E7FA 2PZNA 4ERGA 2PA6A 5XINA 1W9XA 3W83A 4S3GA 4RDVA 1P48A 2QCDA 4HMNA 2YCIX 1U2YA 2J74A 4ZO8A 4JL1A 3NQ7A 5AYXA 4IP7A 3ZSSA 3LLXA 2MANA 2VR5A 1RD5A 5FJOA 5CC5A 4M0XA 1R3VA 1TWIA 3AYSA 2EBNA 1EO5A 1RQHA 3EX1A 1U1UA 1QU4A 4X9SA 1Q6OA 2PDFA 3K4DA 2O4QA 1Q45A 3HGOA 3MO7A 3LI0A 4W8AA 4C90A 5CEWA 1TREA 4C6LA 2XISA 3GC5A 4Z1AA 3GDKA 4C6CA 3LGDA 1GKRA 1RPKA 3CAQA 3CPUA 3E49A 4LC6A 2XH2A 4CQCA 3VOFA 3LHUA 3WBEA 2GVYA 1Q8JA 1OFOA 2Y0FA 5I09A 4H7VA 4E2BA 4MB5A 3T09A 2J7GA 3D0CA 1O68A 4AXKA 3GG0A 3GH5A 1MW1A 5JIPA 4OV4A 1Z8AA 1TR1A 5FJRA 5SWUA 4GX9A 1HKJA 4HSOA 4GLEA 4GRSA 1XP3A 4ROPA 3LLDA 1JZ7A 1EPXA 4GXPA 2ZRVA 3ARWA 2ISWA 1EJRC 5DMLA 3SUTA 3PUDA 3USBA 5CZ0A 3NFUA 2YBUA 2PLCA 3TAKA 4O4VA 1K1DA 3EXTA 4NF7A 3W7RA 4D9PA 1P6CA 5LIYX 3IGUA 1YBQB 4MWAE 4DM2A 3GIQA 4WK9A 4IPIA 2VX7A 4L6DA 1BYAA 2DZUA 3FHQA 1VBJA 1A5MC 1EPVA 3C86A 4X3ZA 4ZB0A 3ABZA 2YSWA 2E77A 4WJXA 3AIVA 4FR6A 3Q2DA 4QDMA 2PD9A 1J0JA 3M0JA 3P8JA 2QCHA 2VZTA 2BGSA 4FPSA 1X96A 1HFBA 1KQZA 2Y89A 4REQB 3VO0A 1JD7A 2W4XA 3HPSA 5EKYA 3L7RA 2ZIDA 4EACA 4O12A 3RM4A 1IV8A 3VXGA 2C71A 4O11A 2CEQA 4ZMGA 4J4KA 4FIRA 1UUQA 1NVMA 1QW7A 4P7LA 3H2MA 4S3EA 4V1XA 1VJIA 4XSLA 5LGZA 5G2HA 3GKAA 3FS2A 2PTXA 1Q85A 3ITVA 1FOBA 2ACRA 3ZFHA 1BEUA 1JPKA 2EAWA 3PUOA 5ABHA 3S42A 4CU8A 5F4WA 2VT0A 3PNUA 4NX0A 1Q6RA 2E4TA 4UIOA 2NXHA 3W7OA 4I8YA 1R87A 3L4VA 4QSHA 4AZCB 2VHLA 3VOCA 3TWBA 3F2DA 2Q01A 3PY2A 1MW0A 4R7OA 4HKPA 3GIYA 4R3UA 1FHDA 4A3UA 4NI3A 1PUDA 3UWZA 3ZJKA 4H6EA 2NXGA 1XFCA 1J10A 1HJVA 3SCOA 1HZYA 3QC0A 2E09A 3W26A 3MY9A 1KR1A 1D7KA 1U83A 5DLCA 3L65A 4DF0A 4O53A 3ARUA 3HZ3A 1HTIA 1UUMA 1GW1A 3G3DA 5EJ1B 1EOKA 4QX4A 4LH8A 2WB5A 1A5UA 4CN1A 4AWUA 1FWDC 1BWVA 4PYSA 4RCXA 4J3TA 1NF7A 4F0SA 1KLZA 3URNA 1DXEA 4MFEA 3DDMA 1KCZA 4OVXA 1VFSA 2VD9A 3M0HA 1ZB5A 2PDWA 4M82A 4PFMA 2OLSA 3F4CA 3W7JA 2BB0A 1OGGA 3BCFA 3G1VA 5DXXA 2V2DA 1EIXA 4B5WA 5I3IA 3P93A 1RBAA 3R89A 4EPBC 4Y96A 4IT1A 1C3FA 4ZA0A 3STCA 1NOWA 2WXDM 2ZX6A 2RH9A 4QLLA 3DGRA 3TA6A 4ZFCA 3IJ9A 3S47A 2YFNA 3S46A 5FJPA 5HNNA 5BYWA 5C55A 1AL8A 4QAWA 4BCEA 2NUWA 2BS9A 4RNFA 2UZ9A 3MYOA 1DL3A 4PBFA 1DYSA 1QNOA 2ZX8A 2V0TA 3I4EA 3DYMA 4FEZA 5BMXA 4GINA 3PZNA 2H3BA 1E1EA 3MWAA 3R25A 1P6WA 4JX5A 4IGNA 2V5LA 2YCLA 1ZQ5A 3GDBA 1LROA 1M01A 4AIOA 5HUOA 2OYLA 5FA5A 2GWGA 4QRNA 2RKXA 2CU0A 1BG9A 1SJDA 1AMKA 1PZ1A 1J5TA 4O15A 2ZFAA 2H90A 1LUCA 3KTXA 1TWSA 4AX6A 2GQ3A 1XSIA 1F2JA 3H6OA 3DFTA 3RG6A 3VDCA 1P43A 1B54A 2D0HA 4AD3A 1YDOA 1DJNA 2VCCA 3WQ6A 1R5YA 2HEJA 1UBPC 3I68A 4CD5A 3TU9A 3LTSA 1W9BM 5DT5A 3SGZA 2FDMA 3VINA 4D8AA 1S5TA 2IPJA 3DFOA 2WJFA 5BCAA 4LUSA 2A5HA 5LGXA 4GVHA 3FJLA 3EX6A 3VMOA 1YXYA 3LG3A 2Z24A 3BGJA 2W91A 1TJ0A 4UFJA 1O12A 3W1NA 2F6XA 3Q65A 5L6UA 1D8WA 4Q4RA 2VC7A 1QDSA 4UB9A 3N3TA 4X0VA 4UMAA 5IBXC 2CFFA 3VIKA 1NOUA 1XBZA 1LM1A 3CPGA 1VPQA 3MDUA 5AC4A 3KBWA 1WZMA 4HU8A 1ZJIA 2ZQ0A 3AZSA 1A4LA 4S3AA 1E6XM 2PF8A 1UC5A 2HWGA 1OFBA 3OJGA 1GVFA 4O14A 5CQ1A 1EH9A 3P2VA 2E28A 1S1RA 3N34A 3HPAA 2HXUA 4ZQPA 3C0QA 2NT1A 1LQ2A 1LBFA 2ZXBA 2OO0A 3OLEA 1B3XA 1UZHA 4FMVA 4AZIA 4YYFA 1GW9A 4BF9A 2YW3A 3GK0A 4CGTA 1QNQA 4I5UA 4Q8WA 2E5DA 5CZTA 1NWUA 3TSBA 3VNYA 1E71M 3U7BA 1AL7A 3REQA 4FNUA 4GI8A 2D0FA 3RX3A 2O0TA 3C0LA 1EQCA 3QQ0A 3MWCA 3W1QA 1F3WA 4CEXC 1KFEA 2C0HA 4G56A 4L56A 4YS1A 1IEQA 3ITTA 4QLJA 3ENLA 4WDXA 2CW6A 4K8HA 2WJEA 3RJYA 4QG6A 1KTBA 4L64A 2DUZA 1XYFA 2V30A 3L5MA 3TVAA 1OF6A 1O4UA 3HMJG 2WQPA 1Z48A 4QCFA 3KOYA 4O4WA 3GRIA 1H1ZA 4FK9A 3FJNA 2GGHA 3AIWA 3VMNA 3ZVIA 3S0CA 4F0RA 2I7GA 2CBIA 2WKJA 2NSOA 1NY1A 3MP3A 4LVDA 3PTQA 2YYUA 4HTBA 4OECA 1DJZA 2FH6A 1K9DA 4UFHA 1WBHA 2JEPA 4HA1A 3BAXA 4NI8A 4Y9AA 3B8TA 3SUWA 3NQCA 1BTMA 4DNMA 3ZVHA 5GVJA 3NQVA 1BF6A 2JBMA 4UTMA 5M3WA 3PM6A 5HPCA 1E0VA 4AZHA 3L12A 2X1IA 1TIWA 1ZGDA 4DUVA 1UKPA 3NDYA 2HV5A 3W2KA 2Y8KA 2QPUA 5A8OA 4A3RA 4RDWA 5D02A 1KA9F 3P60A 5CKSA 4RDYA 3N2TA 1XL9A 5D2VA 4XWUA 4OT7A 1WPCA 5G4WA 1ZRQA 1UJPA 2GVGA 1W9VA 2GDVA 4LV9A 1PKLA 3GDLA 4NXKA 2YDAA 3SB0A 4F66A 4NVTA 3TJ4A 5A3HA 3CJPA 3TXVA 1K6AA 3FVDA 2OJPA 3QKEA 1H7XA 2PTDA 4S2BA 4X2RA 2QPXA 3CWNA 3L23A 1TELA 2WSPA 2XJ7A 2PRMA 1QPKA 3P62A 3IK2A 2OR2A 2IUZA 2J79A 4B15A 4EOUA 3BICA 1QBBA 3C6CA 4YMZA 1KBKA 2A7NA 1V7YA 2Z2AA 4A6GA 2J6XA 5B80A 1B0IA 4PCNA 4O0ZA 3F4DA 4ACYA 1GOKA 1TVPA 1Q4WA 3ME3A 4LWWA 4IG2B 3PC0A 4DUXA 4MZYA 3TOPA 2VOTA 4UR7A 2QCEA 3VIMA 1YPFA 4JQ4A 3W7PA 4GIYA 1W9DM 4L6HA 4HD5A 3MCNA 2CBJA 3WLKX 1RA0A 1OIFA 3VOGA 1A3HA 1PWLA 1WZAA 3OVGA 4MB1A 1HX0A 3UWWA 5H8PA 1MVYA 1M65A 4HG6B 5XIMA 1PHQA 3ES7A 2TSYA 1T5AA 5BWAA 6TAAA 4AWEA 4L1GA 2QW5A 4R34A 2GUUA 3WKZA 3TAOA 3VOJA 1SSDA 5AYZA 3NQ6A 1UD8A 1L6SA 3KLKA 2ZA2A 4PL2A 3VKAA 1E3ZA 3W0KA 3DESA 3M47A 4DXKA 3H24A 4JTRA 3OZPA 3WJSA 4M1RA 4XD4A 3ZS4A 3U8GA 3RUBL 3L67A 5CPSA 3MI6A 3WDJA 1FWIC 4DJED 4YL2A 4IJCA 4BQ3A 4E0CA 3NG3A 3TZNA 4DJFC 4F0KA 2VO5A 1C8XA 5ABFA 2BV9A 5A2BA 4HYWA 2OGJA 3A9BA 2PTZA 1LOSA 1IXPA 1YBQA 1BSIA 3WBWA 3W72A 4IOTA 1UH4A 3G6MA 4XAPA 3WMBA 4AFYA 3WLSA 4PTWA 3L0KA 4JNYA 1JYVA 4UTWC 4M6QA 3R5EA 3UWVA 4E2DA 4QEEA 4NJKA 1NH6A 3A21A 3G1AA 1NIUA 1U33A 3RCNA 4TV6A 4YTSA 3RNDA 5D2YA 1A0CA 2XH7A 4RZ6A 3PUEA 3QSRA 3SR7A 4E38A 3N6JA 1Q2RA 3LZ3A 4NQ1A 5RUBA 4C6PA 2WO5A 4F2BA 4UTFA 4PTVA 3WNMA 3LLFA 2OQHA 3AIBA 4IICA 3W24A 1GPWA 3WQ8A 4DO4A 4B16A 4Y9MA 4QQUA 4TU1A 3TTOA 3T42A 2C3ZA 3GZ3A 4JQ2A 4P8UA 2J7CA 1O6IA 5U7SA 3UD6A 4LVBA 3KVJA 5ABEA 8RUCA 4CD6A 1UHVA 3GNRA 1GCYA 4H9ZA 3THDA 4FLQA 5I3DA 4X61A 1K7XA 4N2YA 4ICNA 2HTMA 3KP1A 3A3HA 2ADAA 1QOQA 1S2UA 3FDGA 4RL3A 8XIAA 1CLKA 5B7YA 5CPOA 4V1YA 3RGTA 4L4PA 4N42A 3LHVA 3QOKA 4HU0A 3CEUA 2Z27A 1CYGA 4AY7A 3U3HA 1RY8A 3FX4A 3BSGA 1U1HA 1UPPA 3NL5A 1R3QA 3HURA 2AAAA 3R2GA 2XZ9A 3W76A 5E9AA 4B5TA 1TJPA 5A8GA 4D2JA 4DBSA 3UJRA 4C7DA 3CT2A 4ZZ9A 3EDEA 3PSVA 4UTWA 2GQ8A 4DYKA 4I6VA 4M7SA 4DLMA 1JZ6A 5HMSA 1I60A 4YTRA 1QK2A 2WV8A 4RUBA 1HUVA 4NJIA 4B9ZA 1R3RA 3ARTA 3VFLA 4QTGA 5IRPA 1W6TA 5AYBA 1OYAA 1QI5A 1XIGA 1IIGA 5ABGA 2DT1A 3BLOA 4CCEA 3QYQA 1W3JA 1TX2A 2CHOA 3AYTA 1EC7A 5LA2A 1B57A 2WKGA 5ENLA 5CAHA 2WHKA 1JFHA 2XM1A 3GC4A 1OY0A 4HU4A 5CBJA 3NDZA 1NAL1 2FPTA 1XIMA 1ECQA 4DYEA 1UWRA 3QZAA 2EPHA 1SFLA 3APGA 2VR2A 3W2NA 2VGBA 3MA8A 3H55A 3THUA 5C71A 5CC3A 1FFQA 1VCFA 1FWRA 3KOFA 5DY3A 2AQOA 3H4XA 3DI0A 3ZT5A 1JYWA 3HV9A 1AQHA 4QXIA 3BGGA 4TTUA 2WYSA 2R1PA 3S1WA 1E1CB 1KGUA 2GQ9A 4ZSUA 1HL9A 1DKWA 1W3NA 3MP5A 3VE7A 2INFA 3EWWA 2OKTA 1YNYA 1VGAA 3GDMA 2QCDB 3IV3A 4W86A 2YXOA 1H5YA 3GKFA 1VLWA 4AY1A 1XGEA 4NAFA 4OBRA 5FI8A 1I0BA 1HVQA 1XIEA 3QV8A 4KRUA 1W5MA 2BGQA 4ORMA 1I2PA 3RK8A 2R94A 1XH2A 3NQ2A 2XDFA 3AFBA 5L9FA 4GI6A 2FTWA 3B0UX 4EAMA 1OD0A 3BJFA 1KTNA 3IS4A 5CJNA 3GTNA 1GTEA 3LXBA 4MZ8A 3LCWA 2W5FA 3B06A 1GQLA 3EWBX 5A5WA 4Z0SA 4PULA 2WMHA 3H7UA 2X7WA 4L1WA 3TN6A 4O19A 3CPRA 2A85A 3LEPA 2IXUA 3KWXA 1X6LA 2EHHA 4HBKA 4NX5A 4PZVA 3SEPA 1EZWA 3OA5A 1AJ2A 3UCQA 2PWUA 2J7DA 1KRAC 3D47A 3EMQA 4JFSA 2PF0A 4HK7A 4DWSA 1KGXA 3KP0A 1EJWC 1S3HA 3WELA 4J9JA 3QVQA 1JYXA 1Q7QA 2JEQA 5A6LA 1XYMA 1W2PA 4A35A 5F1VA 3FV9A 2HK0A 4J3UA 2EPOA 1NDYA 3ZJ7A 2ZZ1A 1VBHA 4CVWA 2QAFA 2PUZA 3B8SA 4FXSA 3RR1A 3GNPA 4MPQA 2WPGA 3GU2A 4XB3A 1F74A 1V6VA 6ALDA 3WQDA 2I17A 1PTAA 4GY0A 2V5JA 4PB5A 2FYMA 2QUNA 3TQVA 2V2CA 4FX8A 1L0PA 4B5UA 4HN8A 2DQWA 1YDVA 4FAMA 4R5EA 4CNOA 1WQ5A 2JFEX 3K46A 4NAEA 1VD6A 2PDCA 1YYAA 1BFNA 3T0DA 3NEHA 3WUBA 2WZEA 2VX5A 2ZX5A 2ODOA 1FFRA 4J27A 4RPPA 4EWJA 3POHA 3M0IA 4PMJA 2B7QA 3OGVA 4QISA 1ADOA 3N1AA 1JG9A 3DHPA 3K8MA 3GXIA 3LCGA 4MHBA 3QR1A 3CM4A 4GI4A 2E6YA 3T40A 2DDXA 3VX0A 1KM3A 6PTDA 4PBGA 4H2HA 3ZJ6A 1J79A 1EX5A 1Q7MA 4ZE5A 1KBJA 3MUAA 1JEZA 4GX8A 1FTXA 4LU0A 3L68A 4RNJA 4EIVA 1DQXA 2J47A 1TTQA 1FY6A 3HB9A 1ISZA 2X41A 3LBCA 5DXYA 2FZNA 4HHLA 1XQLA 3L0GA 2PODA 1L6FA 1GZ1A 2VFGA 2XGBA 1E56A 2VJXA 4MLRA 3MO4A 3R94A 3UXKA 5A8NA 3IEBA 4Q33A 4JY8A 3DEQA 4JDBA 5D05A 1P0NA 5FF4A 1JVNA 3URAA 1TPWA 1HNYA 3BQ5A 5TIMA 5DF0A 1ZALA 1XCFA 2WWCA 3VD5A 3M5VA 1ZUAX 5LSMA 5A1AA 4F2UA 4YXGA 1QASA 3R58A 4JFTA 2QUVA 1C8VA 1US2A 3W53A 2XVKA 4FOKA 1UKTA 1O66A 4A05A 1HKWA 2A79A 1PL9A 4A2SA 4IJBA 3PZIA 1C91A 2WZIA 4ALDA 3OBEA 1IEIA 3UNTA 4W5UA 3LRKA 5A6BA 4Q8NA 4F2TA 3OYXA 3CK5A 3LHYA 3KHDA 2VVSA 2PCEA 2J75A 2TPSA 1YTEA 3B0YA 2NQLA 5HJLA 3OQEA 4IX2A 3KBMA 4N7QA 2HROA 1UWUA 4EXAA 1E43A 5D38A 4IGMA 5HJXA 3GB6A 3PG8A 1KXVA 5BU9A 1XG3A 3NQMA 1SO6A 2XFRA 5HR6A 4L6OA 1PZ2A 2CCRA 2AGKA 3TE9A 3A12A 1EO7A 1CXKA 1QATA 4MWAC 1EF3A 4C6EA 1BD0A 1EC8A 1C90A 4HJWA 4UZUA 3F03K 2R8WA 3OBAA 4J3SA 4LUTA 4AIEA 1XSKA 1JZ5A 3KBSA 4PR4A 3CHDA 4NJGA 2O9RA 1DJQA 2PDGA 5HOSA 1PTDA 3UJEA 3VGEA 4R53A 2WBGA 4F0MA 1OC6A 3TR9A 2GGGA 2WVTA 3L4TA 2BG5A 3RXZA 3T6CA 3UXDA 4AYSA 4Z2JA 4XQ6A 3T9PA 1XR2A 2R6OA 3GXPA 5IXEA 3H22A 3UZYA 1XG4A 5EFFA 4US5A 4B4HA 4LALA 5CGTA 3D6NA 3MUY1 1YX1A 3GXNA 1A0DA 4KWWA 3T8LA 1LL6A 1L8PA 4IM4A 1GZGA 3VCNA 3WK3A 4UXDA 2FTYA 1VZWA 1K8YA 1PTGA 1F3XA 1YE6A 4NHVA 4M81A 2CETA 1ADSA 1UP0A 1I4NA 4S38A 3Q58A 1OFEA 4LEFA 4KFNA 1OD8A 3W7IA 4FOJA 3AAMA 1IQ8A 4OIFA 2GWNA 1CPUA 4W89A 4A8LA 1DXIA 3ZLFA 1CWYA 5K4XA 2G41A 1HJQA 2J6VA 1L9WA 2E8YA 3KHJA 4OE7A 2J8TA 1ML1A 1NQ6A 4GGBA 3OLDA 1SZEA 4DXVA 3WL0A 1WZLA 2PDBA 4LUJA 3ABRA 4M5PA 3WQEA 5JH2A 1WP6A 4LX4A 2R14A 1QO2A 5LNUA 2YLAA 4TVCA 4IMDA 2OODA 4GMEA 2NZLA 3DUGA 2J24A 3UCCA 2HPMA 1REQB 3PZMA 4EKJA 2X8RA 1QOPA 2ZUUA 3CHEA 4F79A 9CGTA 2VGFA 3PBGA 4HSHA 3AI0A 4ZO9A 1G4SA 3LTPA 2YL5A 3IIOA 4Q4PA 3R79A 3NO1A 4LAKA 1P5BA 4IL2A 2NV1A 1AJ0A 2YXXA 4LQ1A 5DELA 4B4FA 3SGGA 5DQPA 1M04A 5C5YA 1YLVA 2JF7A 2NQZA 4XBSA 3S6OA 4NKCA 2ZA1A 4GI9A 2X0HA 3UERA 3UWUA 3V36A 4X0NA 4H01A 1S3TC 3QF0A 2A7RA 5BRPA 1A53A 2YXGA 3GW3A 4LEQA 3KBJA 4NXSA 1T0OA 3Q94A 1PWMA 4C1KA 2OYKA 1JCYA 1BHGA 3WYZA 1LLOA 1EHNA 4RK8A 4OWGA 1MI3A 4C91A 2CIPA 3BLKA 2VRQA 1A5SA 3QHNA 3MBDA 4F48A 1DP0A 5AOUA 2NVDA 4LF2A 1AH0A 3PULA 1GYLA 1RUSA 3LX9A 1M5WA 3CHCA 2PTYA 1C7TA 4GQRA 1FWSA 3BPWA 2CLKA 1HJXA 4GGHA 4IX0A 2YCKX 3MKKA 5EMUA 3A3XA 1WDWA 5I2UA 3WL1A 2PWFA 3HG5A 2DU2A 2IKIA 1Q66A 2PDPA 3Q67A 5K7JA 5DCBA 1EF2A 3NSMA 5EA9A 3CGTA 2L5HA 3GC2A 3S83A 2C8NA 2YGYA 3PZQA 1UKQA 2ZZ4A 4H41A 4MF4A 2BLEA 2WMGA 5TQLA 3KRZA 3EEGA 2XGIA 1MO0A 1W3TA 4GYPC 1SZFA 1QFEA 3K13A 1H7OA 4GFSA 1NOFA 1UD5A 1XCWA 2WMKA 3ABQA 1CECA 5D9MA 1JRBA 3UVAA 1V3MA 4KWSA 1FH8A 4TOQA 2QAPA 1BXBA 3IVSA 4I5RA 2X42A 3GG1A 4GXMA 1W1TA 3PVFA 1UPMB 4JGDA 3WLJA 4B5SA 4F40A 4N9EA 4DJDD 1O95A 3E5BA 1IT0A 2PAJA 4E8CA 5FACA 3ES8A 5A69A 5HMDA 2QDHA 1DTNA 3EWDA 1G1YA 3PUGA 3NPXA 2F7FA 2CKRA 3N2XA 4NASA 3B9EA 4PUJA 2W92A 2BASA 4WDTA 5EU9A 1RP8A 2VZVA 5ABTA 1J2WA 3SECA 2POTA 2PTWA 4A2RA 4PCPA 1OEPA 4KS0A 1T40A 3CMGA 3QLLA 3S1VA 2PWEA 4IL0A 4Y2WA 3W27A 1QPOA 1W32A 4MUPA 4KFPA 3FA3A 3UJSA 4NIRA 3KX6A 1TIMA 4LGXA 4LCSA 3NXFA 2YFOA 1S5MA 1TYGA 3CUGA 4ZXLA 2PGFA 3M46A 1QI0A 4RNIA 5H8UA 1E40A 4QM1A 2VX4A 3H26A 3B0XA 4TVDA 3UETA 4JX6A 1YNPA 1CCWB 1K8CA 1HVXA 3FIGA 2ZUMA 3UR2A 1O60A 3ARVA 2YB1A 3DFYA 5FCZA 2YL8A 5FOOA 1CGWA 4AX7A 2HRWA 3PTDA 1XS2A 5K9CA 3GBEA 1TO3A 4ZVJA 2CXEA 5HMFA 1TRIA 2VYOA 3P82A 2OZ0A 5AFDA 4CD4A 2ZBTA 3DGBA 4NUWA 2QYGA 2VWTA 4OKDA 1XSJA 3M7WA 4K39A 4AD1A 1VS1A 3CAWA 3MZ2A 2FVKA 4AIBA 4LBUA 3W7KA 1XIJA 1DJXA 1T99A 4A29A 2I9UA 1WXJA 2E3ZA 1QHPA 3W1AA 4AYGA 2DIJA 2QIWA 2XSAA 2CLFA 1THFD 4AAJA 2XVLA 3BG5A 3BAYA 4WOQA 1K9TA 3H12A 3NUKA 1UMLA 2QV5A 4PSPA 1P7TB 4O10A 2VEFA 3MPGA 4F4RA 1MW2A 3IK4A 2YCLB 4AZ6A 3N19B 1US3A 3WH6A 2R1MA 4NT0A 4DO5A 1DXFA 2HPIA 1WDSA 2OZ3A 1UA7A 5JU6A 1FKXA 4YTQA 3W6YA 3KUMA 2FFIA 5CSYA 4H9UA 1UIPA 4IIHA 1V3JA 1CGXA 1ME9A 4UQBA 2XFFA 4K2SA 5CLTA 1GKPA 1VKFA 2CWXA 2OB3A 4MOZA 3WDPP 3ARZA 5CSSA 1XLAA 3UR5A 2PLMA 1TPB1 5TD4A 4GH3A 1OCJA 1Q5MA 4DWSC 1W0MA 4K68A 1E9ZB 4XKMA 5D37A 4P8WA 4MYXA 5ABFB 1JAEA 1M7PA 3U7VA 1RQBA 4LS0A 5I77A 2WC3A 4HU3A 4ZQRA 3A23A 1CT5A 5JMUA 3NZGA 4F0LA 4OFCA 2BWGA 1H41A 4DO7A 2RAGA 1VPXA 3U6WA 3CQJA 5CPLA 4WXZA 3L4UA 4EE9A 3S9ZA 1G5AA 4YU1A 1I45A 4LS1A 3N2CA 4GQBA 2TODA 2XIMA 3DBNA 5HNTA 1H0GA 1QVBA 1H49A 3QEZA 3D5HA 2FFCA 2XIJA 3SCTA 4KGJA 1LLZA 1BYBA 2Z1XA 3RPTA 5JQ9A 4KEMA 4LXFA 2QQ6A 3NCOA 5G5IA 1D3GA 2QCLA 1ZS2A 4DWSB 1PSCA 4EPDC 4YYCA 8XIMA 1I2OA 2PGEA 3QH2A 4O0KA 3DFQA 3T2QA 1PO9A 1NP0A 4QG9A 2OZ8A 3CBWA 2ZUVA 1OK6A 5EGRA 4GVFA 1WE5A 4MB3A 2AQWA 3QHMA 3WJZA 3GY1A 2RJHA 3TQ0A 3LCIA 4BQ4A 3QR3A 1MFVA 1O5QA 3SM0A 4MVAA 3T07A 1DJWA 5A6BD 3BOXA 3D46A 3B9OA 2BP1A 4QROA 5LZLA 1E51A 5K9XA 2GJLA 1RY0A 4UQCA 3RO6A 4ADTA 1E6QM 1XYAA 4CKQA 3VYLA 4QDWA 2CC0A 2D22A 1DBTA 3CZLA 2PDKA 5C8BB 2AL2B 1EQPA 3ZLHA 1J8VA 3SY5A 3BMXA 3AHXA 1GVOA 4YVVA 2DW7A 4J3WA 3GHSA 3LHWA 1Z89A 4BWLA 1W3KA 4JL2A 1EXPA 5T8GA 5BXSA 2QKFA 4PMRA 3WUFA 4GOAA 1JZ4A 3GAKA 2VZUA 4QJ4B 1QHOA 3NQEA 4YVXA 1ZAHA 1ONWA 3BMVA 4LV4A 3TYUA 1J12A 4S1FA 1KQYA 4UOZA 2BNJA 2F6KA 5AC8A 1HP4A 4O8AA 4PSRA 3TWAA 3AU6A 2EGZA 3BCJA 3G18A 1JRCA 4EVZA 3MSGA 4NZ1A 5BU6A 3FGCA 3NM3A 3E2QA 4D8ZA 4US6A 4FLRA 1US0A 1K70A 3W1TA 2V3EA 1RV8A 3W88A 2BXZA 1XLMA 3CV2A 3BLDA 2EEXA 3RJXA 3F2BA 4XD5A 3IJ7A 1X98A 3BK0A 2VWSA 3N9RA 1XPYA 3DFNA 4AZBA 2JKEA 3B9NA 4M3PA 2G3JA 5HQMA 2VDHA 3DBPA 3PANA 3OBKA 4ATLA 5K9DA 1TE6A 2C1IA 5AKQA 4GIAA 4JIPA 2WSQA 5A6MA 2VXNA 5I7GA 1W54A 1IXNA 3FSUA 3S2LA 1XQKA 2GGJA 3P14A 1AW5A 1OZQA 3VZZA 5I3FA 2TYSA 4C6OA 2DPEA 4NZCA 2V38A 5E6ZA 4UQAA 4U3CA 3NGFA 3QKZA 2D3LA 3KEHA 3IUDA 2R1LA 1RALA 3GVGA 2HQAA 3C2RA 4RXGA 3OQ8A 4S3DA 3KRSA 1BVZA 3SCPA 4ZENA 1KBBA 3MUZ1 2WSKA 4PFHA 3BOFA 3N04A 3TK7A 4QG8A 5FF3A 3H2AA 1C92A 4MM1A 1CB7B 4MMWA 1PB0A 3TNOA 7ENLA 5CJMA 1W5NA 3NL6A 2GZXA 2I57A 3HN3A 4GCXA 3RCMA 4GZ7A 1JZ3A 1UWTA 5CC6A 1AODA 2WCSA 2AKZA 2VOMA 3PBWA 1UD4A 2D20A 4WHBA 5H6HA 5I03A 1IZCA 3C8NA 4DPPA 5BRQA 4H9XA 3IAPA 3H2OA 3KS5A 4DNHA 2R24A 2J9ZA 1W9UA 5C7VA 5G4HC 1CBGA 4W93A 4EPEC 3ZIZA 1MZRA 3R0KA 1EWEA 3U48A 3COTA 4M6VA 3UG8A 5K4ZA 3C0JA 1DQUA 4ZXOA 3JRKA 5DRIA 1Q8AA 4PMVA 4B92A 7XIMA 3NVTA 4AY8A 1ICSA 5HMEA 2G5WA 4LUTB 5KEZA 4ATWA 3SCVA 4L4MA 3CTTA 1MQRA 5GNXA 1J4EA 2QJNA 1FH9A 3FYPA 3KL5A 3MKCA 1H7NA 4GYKA 1R85A 4DWSD 2G3IA 1LUCB 3L2IA 2FHBA 2P53A 3WQ5A 2KZHA 1EZ2A 2WSRA 1E6SM 3PWGA 4TX8A 3BLPX 1QI2A 3PR2A 3NZRA 1VEMA 4U4MA 1FWJC 4OQVA 1UR2A 4FNRA 4D6DA 3DHFA 5DN1A 1R7AA 4XBJA 5I3JA 3M0ZA 3SFKA 2WC7A 4HMCA 4OOUA 4O16A 4F3HA 1VENA 1J5SA 2QDEA 1EYWA 4Z08A 4FR1A 1F9CA 3CS2A 2OEJA 2PWDA 3ERPA 3DC8A 1N55A 4BK9A 4DUOA 1ZU8A 2BXYA 2A3BA 2F61A 3LA4A 1ZNNA 2Q71A 3N4EA 2CZ5A 4OHQA 3NZQA 1YXDA 2A3AA 1Q4NX 1DJGA 3EMZA 3LNMA 4ICMA 4UNIA 5EMKA 2C6QA 1K7EA 4AXNA 3QY7A 2OGYA 5JBDA 4MNMA 1R3TA 4D6EA 4HQVA 4UFIA 3O0KA 1YDYA 4LFYA 3LD5A 3W74A 4QAIA 1Y5WA 4MZ1A 3R13A 1ISVA 3NM1A 2QUTA 3ABSA 1R9XA 2CZFA 4TX6A 1HKKA 3W87A 1CXIA 2P88A 1LBLA 4WGXA 2H3DA 4B91A 1S38A 4HNCA 2XH0A 4I9TA 1GQNA 2VRJA 1XDMA 1VFUA 3QZEA 4Z1BA 1RLCL 4PGLA 4K1GA 5M2FX 2J7BA 5T9BG 2E68A 3CV6A 2DEPA 1K9FA 3E6EA 1UOKA 5KTLA 4ILSA 3O6DA 2OPJA 3GLCA 1H5VA 3FSTA 4HA4A 2X30A 2DIKA 4HPNA 2BOGX 4TUFA 2Q09A 3DERA 1SSGA 1QT1A 3IARA 3GTFA 5LIXX 3SY1A 1UD6A 3B0PA 1IF2A 3S1GA 3QYSA 1M1BA 4ZTYA 1OX6A 1JDCA 3V0SA 2NX9A 2VEPA 2X7VA 3EDJA 4NU7A 4PMZA 2ZCGA 5REQB 3EOSA 2P0OA 2DVTA 4JTGA 2XTKA 4D6GA 1WDRA 4U33A 3H53A 3GR7A 3W6MA 1QNVA 1KKOA 2WMJA 1R46A 5D8WA 4JR5A 3G24A 1FXQA 3W1RA 3QOMA 4D1JA 1NDVA 3TIMA 3KRBA 3U2OA 4M29A 2PC4A 2VZSA 4HOWA 2GGEA 1E6RA 2PFHA 2FB3A 2BDQA 6XIMA 3CO4A 1YIXA 4H9VA 5CAKA 4NZ4A 1EGZA 1S1PA 4Q8TA 1VCGA 2ATMA 1DQWA 4F9JA 2NLIA 2PWGA 3KOZA 3M44A 3NQFA 3WH5A 1XBVA 1EWDA 4AHQA 1XRVA 1SZRA 4PMNA 5AVHA 1N82A 1NDWA 2FZMA 3CU2A 4Z2KA 4NRSA 1ZJHA 4U28A 1A5AA 1U1JA 3ZVHB 4M7TA 2UY2A 3GHRA 2B7PA 1UG6A 2UBPC 4A22A 3POCA 4YNGA 3RLHA 4WKFA 1ME7A 4EP8C 3EKLA 3CQIA 4I9AA 1ALDA 1K77A 3PF3A 5AYIA 4RPQA 1UD3A 4H7ZA 3F4NA 3I6RA 4IJRA 3MI3A 4BF7A 2ZWYA 1R2SA 4JTCA 5DCDA 1ELSA 3BAKA 1P0BA 4FLSA 3KFTA 3SCRA 3PTKA 3MSYA 3GFZA 1TCDA 2B7NA 4MLJA 5G1TA 1GTHA 1XLCA 3W29A 3NPWA 2OEMA 3NO5A 4DAIA 4CCDA 3DYPA 4DJFA 3LSBA 1Q65A 1A50A 1OSEA 5EMLA 3SQSA 4FXRA 1GEQA 3G1SA 8CGTA 4P00B 4XKYA 4UC5A 3BW2A 4G7FA 3B8WA 1GOQA 3USZA 1WDDA 5E70A 1MEHA 3ZLGA 3LN3A 1V6XA 1K6WA 1A3XA 3NTYA 4IFRA 2CLLA 1F05A 5E0KA 3MS8A 2XM2A 4H00A 1GHRA 3FYYA 4PMYA 1EEPA 1GPFA 3PZOA 4IGSA 3MVIA 4QE4A 3HPXA 1NELA 3QGVA 2JGQA 3C3UA 4U10A 1J0YA 1SR0A 1OBAA 1J01A 4W9TA 3VDBA 1XYBA 3S6DA 3GVVA 2VCAA 2NWRA 3UXIA 3AO0A 3EOOA 1A5KC 2CYGA 4EK7A 1L6WA 1S5VA 3VIPA 1TG7A 3DFPA 3HIJA 2WZTA 2ALDA 3WDIA 2H8XA 1JJKA 4GIEA 3LPOA 4J35A 4ZOCA 5HANA 2E9LA 4XKYB 3KBVA 5EJZB 3L9CA 3OIXA 4CNSA 2XYLA 3QQWA 2Z00A 3UY7A 3W23A 3VNZA 4D72A 5A6TC 4V27A 3EBVA 3PPHA 2GVEA 3SFWA 3W7GA 4BJHA 5G4EA 3MHGA 2YIHA 4JTIA 1RJRA 2CWNA 2WMIB 2GDQA 3C2YA 4JYFA 1TJRA 3BSMA 1LWJA 3CZJA 4EF9A 1VBUA 3PTMA 3WQCA 3I3BA 2F2KA 2ZVIA 1JUBA 5D4YA 1DJHA 4Z42C 4KIEA 3ICJA 2ESCA 2HBXA 3DIPA 4NNCA 4INFA 1GONA 3SURA 4NZ5A 1DPMA 2XIBA 4H19A 3RF9A 3RFAA 2LLEA 3WIJA 1TWDA 4G9PA 1WAWA 1OB0A 1XD1A 5FJTA 3H54A 1GJUA 3W37A 3S2CA 4RR4A 4UMBA 5H2ZA 1KR0A 3MBFA 3LY0A 2ACSA 3GW0A 1E4IA 4R27A 1QPRA 2JIWA 1FHVA 4C6JA 4H2CA 5FSDC 4IMAA 3VFCA 3G0XA 3IRDA 1XRTA 2BVYA 1V93A 3SCNA 1TZ9A 4GA8A 4LPCA 1A5OC 3WJWA 2Z26A 3E0LA 5CXPA 1B3OA 3VTRA 3UG5A 4KCVA 1XFBA 4NNAA 3B8DA 1M03A 3O06A 5KZDA 2JALA 4O18A 1XIIA 1UA3A 3MV01 2A1YA 2QCNA 4AWTA 4N02A 1QBAA 3A47A 1XDJA 2VFDA 2VD8A 3FY1A 4XIAA 3T2PA 2BOFX 3N2MA 4FNTA 2IPFA 3WFAA 3WF0A 2VTFA 4BI7A 4JS3A 1F6YA 1Z7AA 3TLLA 4DJEC 4JTHA 2WCGA 3QN3A 3WF3A 3RLGA 2WNZA 4HJFA 1JAKA 2X1TA 3WMSA 1W1PA 2E0PA 3QFEA 1R30A 1JCLA 4B9YA 2D2JA 3VUPA 3V16A 3ZR4A 4RZ5A 3V0TA 2DW6A 4HZMA 3T2OA 4C6BA 5HULA 2YCJA 1V3HA 3HQPA 4YCPA 4O1BA 5DMYA 4ZSTA 1GYNA 1JF5A 4U2YA 3EKZA 2ZC1A 1KXQA 3EWCA 4CD8A 2P3EA 1RVKA 4KMQA 2E1WA 1GK8A 3IIXA 1FWEC 5G1YA 3KLLA 1TMQA 1R86A 4HA3A 1ZFJA 1XLIA 3CAKA 3MW7A 4H83A 5AY7A 2BY1A 2J88A 2VC5A 4OZOA 3WSUA 7A3HA 4S3JA 1Q3NA 1CENA 5DBUA 4WUIA 2UWFA 3S9YA 4MJZA 1DV7A 3W7MA 1FRBA 5DMNA 2WZMA 3E74A 5CH9A 2ONEA 3W75A 2ZICA 4Z0JA 1VYSX 1SJCA 2A3LA 1JQVA 1CXEA 1MNZA 4C6FA 3CZ8A 1LWIA 1OC5A 3WCZA 1JULA 2DQXA 3WMCA 1GQIA 4DZ5A 4Q3MA 2HVMA 3TOYA 4LCQA 3F7JA 3V1PA 4CEUC 3EWUA 3SBFA 2XIIA 1IR1A 3N14A 3TDFA 3LBOA 1MSSA 3W70A 4Q4SA 4KCWA 3TXZA 1RA5A 4PRRA 4ZGYA 1CI1A 1B2YA 1Z3NA 3VILA 5F2IA 3INPA 3E2RA 1TB3A 3PJTA 2GJRA 1GG0A 4ROQA 3B8VA 3FAXA 2A6NA 3QV6A 1W1ZA 4AQLA 1H62A 3PB0A 4CQDA 5BNKA 1X7FA 4IIEA 4WQ6A 4TTGA 3VKDA 4UNLA 3S5NA 4CN6A 4W7UA 1ZSXA 3H7RA 4UCFA 3WEZA 1BKHA 2W3ZA 3KS6A 2PDHA 4ZQCA 3T55A 4M51A 4AC7C 2YA1A 3PWAA 3BJSA 1TPH1 3VKKA 3CL7A 1PZ0A 1LOLA 4WXYA 3T05A 3KTSA 4BY3A 1F4HA 2QDDA 3GSMA 2Q8LA 2VR4A 2XIOA 3MYPA 3M07A 6REQB 2X1UA 8A3HA 1SU5A 5D03A 3VD7A 5AHEA 3JR2A 4TIMA 1TPVA 4YLWA 2VP8A 4N9DA 2G96A 1NDZA 3EWZA 3RLVA 2Y85A 1FQ0A 4KKXA 4Q6XA 4K3ZA 2W9MA 4RV8A 2PDUA 1PX4A 5F4XA 1P7TA 2PLKA 4AC1X 2IW0A 4OUIA 3EDKA 3SN0A 3VKBA 1IWAA 4HYVA 1UWQA 2VEMA 3RMEA 4ECLA 2D3NA 3C2VA 5I3GA 1X39A 1TPUA 3R0DA 1X97A 2B31A 1LYXA 2XGZA 3UPMA 2OWCA 5BWFA 3BZGA 2EF9A 3CZEA 3W00A 3IIVA 4NILA 3CL6A 3A6OA 2JKPA 2HNEA 4P2VA 2ZE3A 5ECVA 5LXEA 9RUBA 1T8QA 4JZ5A 1I1XA 3N3MA 5FSEC 2Y6ZA 1UZDA 3VD9A 1UMYA 3EWXA 1Q13A 1OT2A 2D69A 2JE8A 3FEQA 5F2MA 1D9EA 4LBRA 3WNNA 1VCVA 4NYUA 4FF5A 1IEWA 2QUUA 5LA1A 4UFKA 1PEZA 3LCHA 4DPQA 3E38A 3UYCA 4DBUA 1ZTVA 1LG2A 1K8ZA 3AIRA 2FDSA 2GSHA 3L4YA 5JH1A 2Z28A 3F1QA 5TNVA 4POCA 2WMFA 1R2RA 2BOEX 1LORA 1JCMP 1E9YB 3K5XA 3W25A 1ZP3A 3P80A 4OUEA 2IPWA 1Y7VA 3WLMA 3BAJA 3W2JA 4JYEA 1JZ2A 3KVKA 1MQPA 4Q8MA 1W56A 1J0KA 1FWGC 5EPDA 1ICQA 3BSHA 1R9YA 4Q7IA 2FLIA 4J5NA 4PB3A 2EKGA 3TSDA 2EJ1A 3UVIA 4J2MA 3QMTA 4JN7A 2E67A 4RE4A 1FDJA 1XYLA 1CW2A 1WKYA 5FESA 4EXQA 3EEZA 4IMEA 4G5DA 3WQGA 3BG3A 3UYIA 1DE6A 3QV9A 1OWQA 4BR1A 1JCXA 1BYCA 1T8XA 1VHCA 4KFOA 4LUSB 1B30A 2BHZA 2WHLA 1TJ1A 2OMAA 1KWKA 3HPFA 4C6QA 2ZA3A 2CLHA 4Y8FA 3FA4A 1RPXA 4JAWA 2OYMA 1Q6EA 2XN0A 1X6UA 3WLIA 2C79A 4XZWA 1MUWA 4W5ZA 4S2CA 4HSNA 2E5BA 1QCWA 5GJPA 2FJKA 3L2MA 1TQJA 3MZNA 2YL9A 1WZKA 2PE4A 3TNBA 2NT0A 3XIMA 3T78A 3UR7A 1C8YA 3LUTA 4UCGA 4HOZA 3KE0A 1T7LA 1KFJA 1PIGA 1P0DA 1W1VA 1CX9A 3LGEA 3SY8A 3GVQA 1FHUA 1OFRA 4GG9A 3RU6A 3CO8A 2AL1A 3R11A 1V03A 3KCJA 2QULA 3IJIA 2R91A 2DZWA 4JTAA 3I7RA 1TVLA 4QJ5B 3L5LA 2AL2A 2OSXA 3WBYA 3VNLA 1WDQA 3ARXA 4M56A 3EWYA 2ANUA 1M3UA 1HIZA 1QNSA 4TQTA 1GVQA 4K6AA 5BOOA 3NIYA 3DENA 1JFXA 4AZ5A 1OYBA 5C2GA 4LUYA 1PCWA 1I8JA 3U2ZA 5AHLA 4FS9A 1JPHA 2IMRA 1GVIA 2J62A 1VFLA 4D6FA 1TCMA 1KV8A 4L4LA 1R2TA 5HWJA 4MY8A 4JIHA 5HJYA 1H61A 3AXXA 2B4GA 2YKKA 3AMCA 3DU0A 1LL7A 2XH4A 3GNOA 4PH6A 3VGGA 4C7GA 2HS8A 4LB3A 2Z7GA 1S2VA 2OLAA 2DVXA 3TJIA 1GVSA 1J11A 3BAWA 3PK7A 1TWZA 1PX8A 2ZVRA 1OFDA 1RJPA 3QPYA 4H9TA 5C6MA 3ZSTA 3AXKA 4XV0A 2MNRA 2XFYA 3G1YA 3AC0A 3K4AA 5CC7A 4DO6A 2XPKA 4PUMA 2A7PA 2P0IA 1Y0EA 1B5TA 3L4WA 1SR9A 3HGJA 4L61A 4WKAA 1YRRA 5TBOA 4TXEA 1IIHA 4DF2A 5GQBA 4B5XA 3NJ3A 5C0QA 4PMOA 1WYIA 2GUYA 4GJIA 1IWBA 5EMJA 3CL8A 3AIEA 1GHSA 1LT7A 1I1WA 1EBHA 4Q8OA 2Y7GA 2D1ZA 1LQAA 1PDZA 4LF1A 1Y8BA 4HCHA 4D8LA 4I3GA 1XIFA 1PKMA 2H8ZA 3BH4A 4TO8A 3M0MA