1OK4A

Archaeal fructose 1,6-bisphosphate aldolase covalently bound to the substrate dihydroxyacetone phosphate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
250
structure length
250
Chain Sequence
NLTEKFLRIFARRGKSIILAYDHGIEHGPADFMDNPDSADPEYILRLARDAGFDGVVFQRGIAEKYYDGSVPLILKLNGKTTLYNGEPVSVANCSVEEAVSLGASAVGYTIYPGSGFEWKMFEELARIKRDAVKFDLPLVVWSYPRGGKVVNETAPEIVAYAARIALELGADAMKIKYTGDPKTFSWAVKVAGKVPVLMSGGPKTKTEEDFLKQVEGVLEAGALGIAVGRNVWQRRDALKFARALAELVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE CLASS I
publication title Crystal structure of an archaeal class I aldolase and the evolution of (betaalpha)8 barrel proteins.
pubmed doi rcsb
source organism Thermoproteus tenax
total genus 90
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ok4A00
1QDSA 3PY2A 3P5ZA 4WOQA 3PM6A 4NT0A 2PE4A 3BLFA 5K9DA 1SSGA 1O5XA 2V5BA 4CCCA 1ZCOA 3SSJA 4LS0A 2DZWA 3EX4A 3C2EA 4NJIA 3L67A 3LM7A 1HO1A 3T4CA 2V0TA 4LC8A 1SW7A 2JKPA 4L4LA 1ICPA 4IMEA 4RX0A 4UMBA 1EP1A 1BTMA 3NG3A 5I3HA 4JNMA 4E38A 1L9WA 2ZZ7A 4IX0A 1W3TA 4QSHA 1GQNA 3PG8A 2DU2A 4UFKA 2AQWA 3W07A 1K7EA 3FLUA 3G1AA 4LT9A 3BV4A 4UTHA 3U8GA 3BGGA 4MZ8A 4YXGA 4AF0B 5AFDA 4MKNA 3LCLA 3LV5A 1KBJA 2X2GA 1U5JA 4QNWA 1XBXA 1BKSA 2BSLA 1RR2A 4Y6GA 4GNJA 5HULA 2YW3A 3NGJA 2PRMA 1RQEA 3LI0A 4NUWA 4GWEA 1VZWA 4UFHA 4C1LA 4MOZA 4IWWA 4GUGA 4UMCA 1TQJA 3LBCA 3FIGA 5D30A 4OT7A 2EHHA 3R5EA 2NUWA 1TO3A 3QQ0A 4BWLC 4JX5A 3B05A 1M6JA 1Q6OA 1OJXA 2H3BA 2DZVA 3BPWA 4QISA 5G2HA 1J5TA 1TPWA 4N9EA 3HGRA 1A5AA 5F4SA 2VEKA 1KA9F 2NX9A 4GUFA 3TXVA 4O4VA 4U28A 1PVNA 3W7JA 2R94A 3IVTA 4K7YA 4OBTA 1TIMA 1VS1A 3LCIA 4IGHA 3LDVA 2HSAA 3OHIA 2G95A 5LNWA 1GTEA 2QAFA 4MZ1A 3BARA 3MUXA 5I3FA 2DORA 2NX1A 3G1DA 2NZLA 3NA8A 4ZQPA 5FEXA 5D2YA 4JY9A 1IIHA 3TFXA 1MEIA 5DBTA 2E6DA 3PC0A 2PRHA 3PB0A 1F74A 1BEUA 3W1NA 3WFAA 2GOUA 2GVLA 3LCXA 1GEQA 3W1PA 5DCBA 1VGAA 3S5ZA 1A5BA 4WUIA 2V2DA 3TW7A 2ZA2A 1FDZA 2QDHA 2JGYA 4JYFA 3CPRA 4MIMA 3UZJA 3A24A 3GKAA 3B0VC 1TPEA 4AMAA 4DO4A 3S42A 1R30A 4HPXA 1GVRA 2ISWA 3C2RA 1W5MA 1Q6LA 2XN2A 5D2TA 3BG5A 1KM2A 5CG7A 3STFA 3EWBX 3DBPA 1VCFA 3INPA 3MMTA 1H7PA 4NNBA 3WK0A 5AYYA 2ZBTA 1XKYA 2ZYFA 3GDTA 5D04C 2GVGA 3W22A 1H50A 5K4ZA 4JS3A 2CLKA 3TW6A 5HWMA 3W1QA 4FIRA 1H60A 1OHLA 4LS1A 4PODA 1Z41A 3W72A 4ZQOA 5H91A 3UWZA 4AH7A 1GYLA 1YXYA 1V7YA 3NQ8A 2YYUA 1WOBA 3PBWA 1NEYA 3QSTA 4UR8A 4A22A 1OFDA 3C52A 5G4WA 2FIQA 4JTLA 2ABAA 1TV8A 2QCNA 3NL2A 4UNKA 1W5NA 3LRKA 3TCEA 1A5SA 3QC3A 3IGSA 3B0UX 1K7XA 3W70A 3W1TA 3L66A 5LNVA 2B7NA 3P60A 1XUUA 1QOPA 2GVJA 3S0CA 4JDBA 3W7CA 5AHNA 2ZTJA 2B4GA 4O50A 1JUBA 3NL6A 2NXGA 2WNNA 5AHFA 1HO4A 1QPRA 2GUUA 2Z0IA 1S5TA 2YSWA 3W2LA 3GAYA 4MY1A 4I9AA 5CZTA 3TK7A 4JX6A 4AHPA 4ALDA 4LRSA 2WQPA 5KITA 3HGSA 5KSWA 3CT7A 4FEZA 4XUGA 3RLUA 4O12A 3W76A 3STCA 3I7QA 3K30A 1EX5A 1AK5A 4RJEA 5C5YA 3DAQA 1JCLA 1I2RA 3P84A 2A1YA 4HT3A 1T96A 4OGZA 1IXNA 2H90A 3UWVA 4Q33A 4MVAA 1VJIA 1SO4A 4PFMA 3W7PA 3YPIA 3ZS4A 1M5WA 2A2IA 5J5RA 4NJJA 2QCHA 1GT8A 1MZHA 4QQ3A 2R8WA 3ZWTA 1H7OA 3TNOA 3BG3A 3MHFA 3BK0A 4UR7A 1YTDA 3JRKA 2HTMA 1GPWA 2NWRA 1OK4A 1Z44A 1P1XA 4GUJA 4WOZA 5FEZA 1Y0EA 1K7FA 2QCCA 3DGRA 3NQCA 3NZRA 4NXSA 1ML1A 2NV2A 3EKZA 3I7SA 1P5BA 1NF7A 5K7JA 4EF9A 2KZHA 3GDRA 3W1RA 1JCXA 3SIZA 1H1ZA 1QPNA 4UTIA 2X1RA 4WY0B 2YDAA 1LRNA 3TA6A 5D33A 3RFAA 2GPTA 2QCMA 1SU5A 2WPBA 3G1SA 3TROA 1QWGA 1KBIA 5K3VA 3W7EA 1H63A 5G4EA 1YXCA 4LRTA 3NEVA 3I68A 4WQ6A 1L6WA 2QUTA 4UIOA 3UXDA 3HF3A 3F4NA 3THQA 2RDUA 3V1PA 1LYXA 4NVTA 1DJQA 3B06A 2A0NA 4A29A 2DZUA 2W79A 4B5NA 4XKYA 4JXCA 1EWEA 1OVDA 3L0KA 1QO5A 4RZ5A 3NOEA 4BR1A 4FB7A 4HNUA 2P0OA 4OHQA 3TQVA 4QAIA 5HJLA 3T40A 3EKLA 3DFOA 1IGSA 1KFKA 5DN1A 4OV4A 1PE1A 5LGZA 5MHBA 4IMCA 5G1YA 1KM1A 4EVZA 1NAL1 1LOQA 5CPMA 5HWNA 1ZALA 1B3OA 4NXKA 1SUXA 3PS7A 4BF9A 3GDMA 2TMDA 3W3OA 5U4NA 2R91A 3M9YA 3N2XA 2ZZ6A 3NQEA 4JTFA 4IMGA 4BI7A 3GKFA 5LHFA 3NVTA 3EXRA 2W6RA 2ZZ3A 3GVGA 3MBFA 5DY3A 3HQ1A 1G7VA 4UTJA 3HPXA 2WKJA 1KV5A 1OYCA 3LTSA 2H3DA 3B8DA 4K6AA 4MYXA 3IIOA 3LXBA 1R46A 3W85A 1ME7A 2AAMA 4UUIA 1ZNNA 3W23A 4LVBA 3O1NA 5HUPA 1UJPA 3G24A 3E49A 3HG2A 1IIGA 1J4EA 3TE9A 4A2RA 3O15A 3QW4B 4RCXA 3AO0A 2FPYA 4FF7A 3S6DA 5AC7A 1LRQA 1NSJA 3NQ2A 2TYSA 3TJLA 1GYNA 1TCDA 5EBUA 4GRSA 4ORMA 4DELA 1L6SA 2EPHA 1THFD 3TSBA 2ZZ2A 1EPXA 5SWUA 1TV5A 3LCWA 5BRBA 3DI0A 4AVFA 1H7XA 1L2UA 1OX6A 3M47A 3WJYA 4H3DA 2WOQA 2FDSA 1TB3A 3CIXA 1JRBA 5EPDA 3GLCA 3N9RA 3ZWSA 4JTIA 3HG3A 3G8EA 3RF9A 5LNRA 1KW1A 3G0SA 4MFDA 1J2WA 2H8ZA 3I6RA 3DFNA 3QYQA 5F2LA 1GG1A 4JTSA 1GWJA 3KHJA 5IM51 4XKYB 3PR2A 3W7MA 2ALDA 3QRHA 3W1UA 3FKKA 3L2IA 4N4PA 3G0UA 3FA5A 3EXSA 1T0OA 3IIPA 2DZSA 3LCGA 2TPSA 3FFSA 3LI1A 3NQDA 1W0MA 5DLCA 3DI1A 4KFOA 4NZFA 1WYIA 4AAJA 5AC6A 1XC4A 5G1TA 4IMFA 4FX7A 4LUJA 1G67A 3W7GA 3M5XA 3V75A 1S5WA 5F4XA 5HUOA 4PL1A 5TIMA 1WXJA 2ABBA 1DKWA 3DKJA 3M5YA 4QNEA 5HNRA 2EKCA 4ADSA 4UCGA 4A2SA 1WX0A 1LDCA 2C14A 4O19A 2VFIA 1WA3A 4O1DA 1XCFA 3TIMA 3HIJA 3W1MA 2FFCA 2B0MA 4LUIA 2TRSA 4NJGA 5C6MA 1A5CA 2QUVA 4ML9A 4JTTA 4KWVA 5EKYA 1MO0A 3DHFA 3O07A 3QF0A 1TSIA 1OFEA 2QCDA 3G3MA 2PURA 1VRDA 1YTEA 4MYAA 2YFNA 5I3KA 4CQAA 3C6CA 4M5PA 3OA3A 1SZFA 3S1VA 2OZ0A 1A53A 4MPQA 3EWWA 3UQNA 1PHQA 5F4WA 5HR7A 2YX0A 1YYAA 2QCLA 2W0UA 5FF2A 1G4PA 2YFOA 6ALDA 5AN7A 3SFKA 3PUOA 4M6PA 3HBLA 3M7WA 5BW6A 1SZEA 1NF0A 1FCUA 1GVQA 4LVGA 2V2CA 3LGEA 5HMSA 3W73A 4QITA 1FXQA 4LVFA 2Y7DA 4KWWA 3LX9A 2H6RA 4DF1A 1FWSA 1CW2A 2J88A 4MY9A 3G1HA 2WO5A 3NM1A 1MXSA 1EIXA 3F4WA 1W5QA 3UD6A 1QOQA 4ORIA 3ABOA 2A7RA 3TAKA 3L65A 1L6YA 2Y61A 1G69A 4LVDA 3MI3A 1JRCA 2VFFA 4KKXA 3G1XA 3W7QA 1LLZA 1VQTA 5K9XA 1TTQA 1AW5A 4GUHA 3O6DA 3LHYA 1RV8A 5KZDA 1AW2A 5GVJA 5D02A 1XDMA 2BXVA 2RHGA 1GTHA 4N9DA 5G2IA 1RQBA 3MBDA 4PL2A 4BI6A 4HNTA 3PSVA 3GNNA 1NVMA 2DZPA 3LHUA 1MEWA 1KLYA 2E09A 2Q3OA 5AOUA 1HUVA 4FXSA 4MJZA 4FNSA 4UTWC 4A21A 4H4IA 3UY8A 3DZ1A 3CHVA 4Z1CA 5LZLA 1OYBA 5AHIA 2OJPA 1YDVA 1PHWA 1RZMA 5AHMA 2CFFA 1PIIA 1LM1A 1YDOA 3ZFHA 4N6EA 3FKRA 1U83A 3A22A 3BW4A 1KLZA 4RZ4A 1UASA 3PUEA 1GJPA 4Y96A 2LLEA 1FDYA 4QM1A 4Z1BA 4UTUA 2Z1BA 2Y7GA 3QQ1A 4YLWA 1K8YA 3L0NA 2DJLA 1FCQA 2DJXA 3IIVA 4HSNA 1OK6A 4O14A 3Q37A 5J5DA 3G8RA 1WAUA 1TPC1 3KVKA 1LZOA 4U4MA 1VR6A 5HR6A 1F76A 4RZ6A 1UBSA 2VFEA 3GIYA 3WK2A 5TBOA 4TU1A 1K8ZA 3GXNA 1RVGA 3O16A 3S9YA 2BLEA 3C3NA 1TPVA 4WZHA 4XWUA 3ANYA 2WNZA 1LLWA 2E6AA 5D2XA 2VEIA 4O4WA 3C2OA 1VHCA 1D9EA 1EUAA 4TO8A 1YTKA 4Q32A 3P8JA 3W71A 3M43A 5FF3A 3PBUA 4XTIA 3STEA 2ISSA 5EMUA 3NQAA 5LSMA 3C8FA 3N9SA 5T26A 3ABQA 2EF9A 1VYRA 4I7WA 1VLWA 1H62A 1KTBA 2J24A 4LC6A 1W3NA 3G1FA 3BO9A 3N73A 1RQHA 2A21A 1OFAA 3C2VA 4M6QA 2J6XA 3A5FA 4UMAA 5D03A 4JTHA 3OVRA 4N9BA 3LXAA 4DXVA 5LKYA 3G22A 3M6YA 4JY8A 4WY0F 3DKLA 3UY7A 2XN1A 4FNQA 1UUMA 3OIXA 1I8JA 1W31A 2CZFA 4CQ8A 3GB6A 1K3UA 5D32A 1DORA 4Z0SA 1TPDA 4M7SA 3A9IA 3ABSA 3LHVA 4UXDA 3GX9A 4TX9A 2CW6A 4O16A 5AC8A 2O7SA 3Q2DA 3OVPA 1YADA 5CZJA 4BFAA 3BVJA 1W5OA 4I7UA 1N8FA 4N9CA 2A4AA 3QMSA 2CWNA 3VNDA 2JKEA 3BW3A 4ZQCA 2QUUA 4N4QA 4C1KA 4QJ1A 3O63A 1W5PA 3CEPA 3KFTA 5D2WA 4DBEA 1DQXA 4LW7A 4K37A 4AWUA 4RKAA 2O7QA 3RU6A 3W6YA 1GG0A 3NQFA 3SI9A 4BK9A 1JVNA 1G4EA 4JDYA 2DP3A 1F5ZA 4IXXA 3W75A 3LTPA 3O8AA 1P0NA 4GE8A 3L5AA 3C56A 3P82A 4RLIA 4JTJA 4GBUA 1QNVA 1B4EA 2X1TA 3TAOA 3M5ZA 5LNUA 1XBYA 4RXGA 3LB0A 1UUOA 1XXXA 4J9JA 2RH9A 3ATYA 4OU1A 4ICNA 3QEZA 1Q6QA 3P5YA 1Z48A 2ZA3A 4ZZ9A 3WJZA 1SO5A 1LOLA 4FO4A 2E68A 4Z1DA 5IBXA 3JR2A 4TR9A 3FOKA 3U2OA 4DF2A 3GZ3A 4I7VA 2R14A 1ALDA 1QPQA 3MW7A 1KV8A 1GVSA 4QIUA 3SR7A 3T55A 3E12A 3R89A 1TRIA 3TQKA 3L5MA 3MI2A 3EWZA 3LBMA 2C18A 2ZFAA 4FNRA 3B03A 1O95A 2ZRVA 3EXTA 5K4XA 4GFSA 3G1VA 3E0IA 1OYAA 1ZFJA 3M1ZA 3M41A 3MHUA 3TSMA 2A7NA 4LVAA 4R53A 2Q8ZA 2Y70A 4UNLA 3L0GA 1QFEA 2NWSA 2V82A 2RKXA 5E1QA 4FIQA 1ADOA 1WBJA 3CM4A 1JQXA 4JIQA 3TFCA 5KTLA 2YGYA 1GVFA 3NPXA 2YYTA 3W88A 1QPOA 2Z6JA 2YCEA 2V81A 2YW4A 1G4TA 1XUZA 4XBKA 1FWRA 5F2MA 1XDLA 5U7SA 3DFSA 1XM3A 4O52A 2ZZ5A 1AL8A 5AHEA 1BWKA 5D38A 1ZY9A 4DBDA 3NPWA 1FCBA 4KFPA 1H61A 3IIZA 1N55A 1TPH1 4ZVJA 4A3UA 4YCOA 2JGQA 2GQAA 4YCPA 1S3HA 1LBFA 3R2GA 5EL1A 2E1DA 1EP3A 1F6KA 3HO8A 4MZYA 1PL9A 3AJXA 4MLRA 5CPOA 4TMCA 2EGZA 1FWTA 2Y88A 4KFNA 1TMHA 3R12A 3RNDA 1D3HA 1EEPA 4Z1AA 1FWNA 3IVSA 5G2WA 4Y8FA 1FBAA 3EWUA 1BWLA 2B7QA 3OG3A 3VFLA 2ZQ0A 1DJNA 3W7LA 2JK2A 3KRZA 3CB8A 2Z6IA 2DZTA 2PRLA 5BMXA 1G7UA 4MFEA 1OF6A 4NU7A 3QFEA 3EX1A 3TX9A 1N7KA 1WDWA 2OMAA 2VELA 1UCWA 3A23A 5D37A 3TC7A 5A8GA 2BTMA 3KVJA 3DFTA 3RLVA 4IPJA 3O6YX 5I3JA 2I14A 4K7VA 4JICA 4K36A 4E2BA 3P7YA 3PULA 2E5BA 3NQVA 5C55A 4BWLA 3MP5A 4TIMA 2TSYA 1I2PA 4LWWA 3W1LA 4CNNA 2VENA 3OEXA 3NQGA 2ZA1A 1RPXA 4AB4A 1OFRA 4O11A 4PEKA 1AL7A 2RFGA 4X3ZA 2ZRUA 4R34A 4FNUA 3E02A 1SFLA 2QF7A 2VC6A 1M7PA 1FQ0A 3NPUA 4H6KA 4O8RA 5CSSA 1VLIA 3D0CA 2QCFA 4JX4A 3DH7A 5H2ZA 1C9DA 1VHNA 3GK0A 4CQ9A 1KFJA 4UTMA 1KM5A 4OQVA 2RDTA 1IXQA 1YDNA 3VE9A 3IGXA 3NAVA 1FY6A 2OCZA 1KM0A 1FX6A 1EP2A 4LU0A 1KM4A 1T8XA 1TPFA 2A7PA 4RK8A 3W7KA 2CLMA 3PSWA 5CGQA 8TIMA 3DFQA 3MP4A 3W1XA 1JCNA 2Q3RA 2A6NA 1ZAIA 3MO7A 5L6UA 4JEQA 4UTKA 3EX3A 2WJZA 4EWND 1DVJA 1H7WA 2C19A 3HPZA 2IQTA 3SW6A 4LS2A 3RK8A 4JGDA 4UFMA 1SO6A 4O13A 2J9YA 3IGUA 4DF0A 3MWAA 3CTLA 4CCDA 3TUUA 2QAPA 3Q94A 4EOUA 1FCVA 2QCEA 3O05A 4UFLA 1W8SA 4P2VA 1R2SA 1WV2A 3NNTA 4CNPA 4O1BA 3P74A 5KZMA 3THAA 1C29A 2ZZ1A 3WJWA 2NUXA 4CNOA 2VEMA 3LV6A 4RV8A 3MJYA 4MUZA 3TMLA 4JYEA 5KINA 2E5DA 3CWNA 1LOSA 5AB3A 2CLHA 4WXZA 1Z42A 2DZXA 1GOXA 2WV8A 1OX5A 1R47A 3L21A 3NZ1A 1TRDA 1OX4A 2AGKA 3DHDA 3EEGA 5HQEA 2FTPA 1I2NA 1GZGA 2GQ9A 4DPQA 4LTSA 1TTJA 4IJBA 4HSOA 5I3IA 2ZRYA 4ZQMA 3W7IA 4FNPA 6TIMA 2FB3A 4UTTA 2E5CA 4PTNA 4ZMGA 2B7PA 2C13A 3PAJA 1VYSX 4LOCA 1F7BA 2GJLA 3PBVA 2GQ8A 5DCDA 1H1YA 3I7RA 3W9ZA 5AYXA 1OFPA 3IEBA 1LBMA 2YR1A 3NYZA 1KFLA 4OWGA 1XBZA 3P67A 7TIMA 2CLIA 4CLMA 3UPWA 3W84A 3M44A 4HPJA 1AW1A 2A5HA 2ZCGA 1LCOA 4POCA 3UWUA 3G0XA 3HGOA 1OFQA 3Q58A 2Y63A 4MY8A 4WX2A 1F2JA 1DBTA 3NQ7A 1PS9A 3P80A 1F6PA 3NR0A 5FESA 2QEZA 3USBA 3FYPA 5CPLA 5F2GA 4N02A 1C8VA 3M16A 1YXDA 3LRMA 5EA9A 2QCDB 4M6VA 3NQMA 2NLIA 3TU9A 4UFJA 3BG9A 2P1FA 2C15A 1TJPA 1B4KA 5CSRA 3GR7A 4IUOA 1SO3A 1I2OA 5FF4A 2X1UA 2A85A 3KVLA 1TREA 3S5OA 1X7FA 4JTEA 3HB9A 1CX9A 4AWSA 3DXIA 1ZAJA 5F1UA 3A21A 4HNNA 4YL2A 5FEWA 2CU0A 4IMDA 1HFBA 1TPB1 2J27A 4TMBA 5CPNA 3R13A 4GUIA 5BNKA 1XI3A 1P4CA 3SZ8A 1OX4B 2NXHA 1FUYA 4XQ6A 2CZEA 4JTUA 2Y89A 1D3GA 2CLFA 2CLLA 3KRUA 1PCWA 3S5NA 1H7NA 1IXPA 1TV7A 3LHTA 2CZDA 3NQ6A 3P62A 1EUNA 4LNYA 1KTCA 3NL5A 4UC5A 5DBUA 5LHEA 3QJAA 4BI5A 3SECA 1QMLA 3W74A 3MYOA 5EY5A 1ME8A 4IOTA 1VH7A 1GVOA 3B04A 3DFPA 1XFBA 1QAPA 5K2ZA 2ZTKA 3FJLA 3UXAA 3L9CA 4GXMA 4N2YA 4HIBA 3H54A 4DPPA 2JKAA 2F7FA 4XTDA 3LRLA 5A5WA 2V8ZA 3FEMA 4K8HA 3W7HA 5DCEA 2Z2UA 1DV7A 4NX0A 1JJKA 2Y85A 4O1AA 1KFEA 2I9EA 4AEOA 3SGUA 4MLJA 1VC4A 3VCRA 2NV1A 1I4NA 4NQ1A 3QM3A 1DQWA 1VPXA 4LY8A 3L68A 3VI2A 4W9TA 3BGJA 1KFBA 1KTNA 4RR4A 1M7OA 3C4UA 1JULA 1SFJA 3CQ0A 4O57A 3HGJA 1W1ZA 4JR5A 4AWTA 1LP6A 2QJHA 2J9ZA 3CU2A 5LNSA 5CZ0A 1HTIA 1SW0A 2A6LA 3KAOA 3MI6A 4X22A 3W2JA 3UNDA 1SSDA 3UWWA 1X1ZA 3KXQA 1JQVA 1WOAA 1ZENA 5KMYA 4D2JA 1ICQA 3A5VA 3GDLA 2V30A 3QSRA 3EWYA 1IXOA 3JS3A 1EB3A 5G5IA 4O54A 4X2RA 2D73A 1MEHA 2BWGA 3GNDA 3WJXA 3ZR4A 3QMRA 4E2DA 2NUYA 2C3ZA 3QMTA 1G4SA 2FPTA 4ZL1A 3EX6A 3S1WA 3N19B 2ZRZA 3OVQA 2BX7A 3MYPA 1K03A 4WY0A 3TMQA 4O10A 1OFOA 3EB2A 3PUDA 2CZ5A 3P81A 3HOJA 4O0KA 2ZRWA 4MJMA 3FS2A 4YWIA 3LHWA 1FWWA 1SPQA 2VXNA 4R33A 3TKFA 3NO5A 1W54A 3GXPA 4S2CA 1AG1O 1WBHA 4K39A 5C2XA 4WD0A 4HHPA 2VFGA 4N6FA 3W2UA 2ISVA 4O1CA 3UZ5A 1KM6A 4UTTC 1I45A 3H53A 3NL3A 1VCVA 4K38A 4NX5A 3OBKA 1QCWA 5E0KA 4FHAA 3HG4A 1TYGA 5CZSA 1P0KA 3N3MA 3M5VA 3QH2A 4GC4A 4HKPA 2PCQA 3SY5A 5HWJA 1SZGA 4RXFA 3GAKA 1R2RA 4JTGA 5AHLA 2X16A 3R8RA 3MHGA 1UB3A 4O18A 1YPFA 1LORA 1G6CA 3TH6A 3ABRA 2C0AA 4FX6M 2VEPA 3WK3A 5K9CA 1FXPA 2V5LA 1R2TA 3S5YA 3HJZA 3CEUA 4FX8A 3HPSA 4LV9A 5ABTA 3NXFA 4PC8A 1YLVA 2PC4A 1ME9A 3G3DA 3W83A 4ZQNA 2X30A 3W7DA 3IV3A 3TDFA 2OT0A 3W2MA 3HG5A 4WJEA 3UWQA 1B9BA 3IIXA 2NXIA 3LTYA 4Z0JA 5F1VA 2WSRA 3WK1A 5LGXA 4ADUA 5DY2A 3T44A 3LHZA 1JCYA 4S2BA 2B7OA 3PG9A 3W86A 4ADTA 2X1SA 1E51A 4NNAA 3NDOA 3B4UA 4L4MA 5DXYA 5E93A 1EA0A 1XL9A 1O5KA 2QKFA 3TSDA 1LBLA 3W7RA 3WJSA 4WXYA 4DEFA 2J9XA 4EIVA 3P8IA 3B0PA 4CCEA 2UV8G 2E77A 2FLIA 3SJ3A 3GDKA 3DU0A 2F84A 3RMJA 2FJKA 2Y7FA 1F05A 4PCFA 2WNQA 4JD4A 1DL3A 1Q3NA 4O15A 4NJKA 3S1UA 3QPZA 2Y6ZA 2VFDA 2ATSA 4IPIA 1AMKA 1HL2A 4OV9A 3KVMA 4JN6A 2OX1A 3TC6A 1Q45A 5BMWA 3LLDA 1W3IA 4NJHA 1LROA 1OFBA 2NX3A 4Q4KA 2QJIA 4PH6A 4XZ9A 3EX2A 3QZEA 3E9AA 2QDGA 1DHPA 4YMZA 2GJNA 4E0CA 1H7RA 2Q8LA 2ZRXA 1X1OA 2V9DA 5TQLA 2EAWA 1PV8A 3CLMA 1ZHAA 3FJ6A 3LLFA 3C2FA 4JYDA 1KFCA 4DO6A 3W2KA 4AXKA 2HMCA 3G18A 3DENA 1ZAHA 4M7TA 4IQLA 4UTWA 3HMJG 1X8FA 3N14A 4M19A 3GYEA 3MP3A 1OABA 3GXTA 2YPIA 3L5LA 2CLOA 1VYPX 1KM3A 2WSQA 1SW3A 1X6UA 3U6WA 1RD5A 1YPIA 3C61A 3TR2A 3PF3A 3IRDA 1LRTA 1DOSA 3W87A 1O60A 4Y9AA 3UYCA 5C54A 5L9FA 2E6YA 3N34A 2YXGA 3F03K 1ICSA 1F73A 5FF7A 3ATZA 3VKJA 1QO2A 3CWOX 3QPYA 4AHOA 4O17A 5EYWA 1CI1A 5CKSA 3BLEA 4HNVA 3KRSA 1W37A 2RDWA 5HINA 3G1YA 2FB2A 4ZQRA 4DQWA 5DXXA 1EWDA 2QCGA 3KX6A 2G5WA 2ZZ4A 3GR8A 1I2QA 1NFBA 2ATMA 5D2VA 2G97A 5F2IA 3W2NA 3PVFA 3W1AA 1V5XA 3CC1A 3TXZA 2HS6A 2QR6A 1ONRA 1TJRA 5FF0A 3IVUA 4Y90A 2P10A 1S5VA 3S1XA 4PA8A 3E96A 4S1FA 1O4UA 3O06A 1JR1A 1FDJA 2HS8A 5D05A 4IXHA 1TPUA 2H8XA 3BW2A 1VCGA 1JCJA 2VKZG 3LCFA 3N2MA 4IX2A 2BZNA 2QJGA 5D09A 1QR7A 1SZNA 1T99A 3NPVA 3H55A 5AYZA 3LOTA 3C0JA 4LV4A 2FQIA 2JBMA 4Z08A 1OG0A 1Q6RA 5KZEA 2Y62A 4NZJA 4XBSA 3UPBA 3PBYA 4O28A 3KOFA 4JIPA 1B57A 1K8XA 4HN4A 3PB2A 2XN0A 3ELFA 5FEPA 4O0ZA 1K02A 1IF2A 2CLEA 3TJXA 3I65A 3UWYA 3SGZA 3FYOA 3M0ZA 3VE7A 3QW3A 4OE7A 3STGA 1JUKA 1TQXA 2I1OA 3T7VA 5IBXC 1TTIA 4AF0A 4NNCA 1XBVA 2OT1A 3W7OA 4R7JA 1JUEA 1H5YA 3EWXA 5BOOA 2V2HA 4G1KA 3O6CA 1WQ5A 5I3GA 2C16A 4K8EA 1A50A 3LCHA 1LTDA 1W56A 2FPVA 1OF8A 2C1HA 1SR9A 4JTKA 1SQ7A 4FNTA 4UTLA 5FI8A 1O94A 2G96A 3T78A 2Y7EA 3BLIA 3TQ0A 4FXRA 3F1QA 1MSSA 3W7NA 4DO5A 3S8HA 2ZDRA 2WSYA 1TTPA 3CIWA 3PWAA 1HG3A 2XFWA 2VFHA 2C6QA 5DELA 1ZJIA 1H51A 1PCKA 3P61A 2VOMA 4X9SA 4EF8A 4UFIA 3NM3A 3TV8A 3LERA 4ONVA 2E6FA 4GJ1A 4P61A 4O53A 4AHQA 1JCMP 2YZRA 3LXCA
chains in the Genus database with same CATH superfamily
3PY2A 1Q7QA 1EC9A 3PM6A 4ICMA 1EX1A 4PCNA 4CCCA 3BZJA 1FKWA 2D22A 5EMKA 2VEFA 4NJIA 3L67A 3LM7A 3AWNA 1FA2A 2CBJA 4IIDA 1TWSA 1LG2A 1SW7A 4IMEA 4QHRA 4DO7A 4XO6A 1FWHC 5GNXA 3W07A 1K7EA 2XVLA 3E1F1 3OIHA 4JIIX 5BU9A 3GXDA 3SCWA 1KBJA 4QNWA 5BROA 1H41A 1JPMA 1RR2A 1XGDA 2YW3A 3U48A 1RQEA 1WO2A 4JFUA 4ZOAA 1XIJA 3ALFA 4C1LA 1IHIA 4MMWA 3UF9A 2Z2AA 1TQJA 3LBCA 2PDBA 3BLDA 2EHHA 3R5EA 2PLKA 3ITXA 3SBFA 4LUTB 4JX5A 3B05A 1DWGM 1NTHA 1W1A1 1OJXA 1RJQA 3AXXA 3T0AA 2EPMX 3T2QA 1ZZMA 4FOKA 5IOBA 3MUAA 3ZJ7A 1W9UA 4UZSA 3NOYA 3AQUA 4PUMA 5F4SA 2QNEA 1NOWA 3VGHA 3W7JA 4U28A 3BE7A 1MWOA 4K7YA 4OBTA 1TIMA 2GJPA 3L4YA 3OZOA 3PJWA 1P0DA 1V93A 2QAFA 1BF2A 2NX1A 2NZLA 4B90A 4ZQPA 4E6MA 2Z25A 1GOOA 1MEIA 4IHCA 6REQB 1PKNA 2PRHA 2QIIA 1DXFA 3UXIA 5DCBA 3KS5A 4ZFCA 2ZA2A 4H9VA 2QDHA 2JGYA 1CCWB 2XH2A 2R1NA 5JXQA 1EPVA 1J5SA 3WX7A 4G7EB 1ZSXA 2ISFA 1XYAA 1MNSA 2W63A 2XZ7A 1ITQA 3GXMA 1J0ZA 3BG5A 1KM2A 3RCYA 4GINA 2HXUA 2XWEA 3BAJA 2Q02A 3SQSA 1C90A 5AYYA 3EBVA 5D04C 1YW1A 3BH4A 1RK5A 4AYGA 5KZ6A 3WMSA 1Z41A 1FWFC 4ZQOA 2QW5A 4WGHA 3UWZA 4AH7A 1YXYA 1V7YA 4RE3A 2VGGA 2YCLA 4A22A 3URAA 2ABAA 3R4IA 1A5LC 1J96A 2ZX9A 2HK0A 1S38A 4MWAD 3W70A 1VP5A 1C92A 4ZODA 1XUUA 4P8XA 1R3VA 3MSRA 4JDBA 3W7CA 2ZTJA 2BY2A 1XIMA 2Z0IA 1T7LA 4BJHA 1NARA 5ABGA 2XH7A 3W2LA 4MF4A 4IPNB 3CASA 3PTDA 4AHPA 5A2AA 4H7ZA 3PANA 2YBVA 1P6BA 2D0GA 4O12A 3W76A 4H1ZA 3QHMA 5BZAA 3R8HA 2HRWA 3P84A 4XO7A 2IPFA 5BYWA 3U7VA 2H90A 2PDHA 1E6QM 4PFMA 3W7PA 3G5EA 3KHDA 1M5WA 1J0JA 4PBEA 5J5RA 4NJJA 1W9VA 4QQ3A 3BK0A 4UR7A 5A2BA 3EB3A 1GPWA 1OK4A 1XLLA 4WOZA 3DCPA 1Y0EA 4H9XA 1K7FA 3W6LA 2QCCA 3NQCA 4NXSA 3WLRA 2NV2A 3EKZA 1QNRA 3UR2A 3RR4A 1EZ2A 1Q2RA 3FY1A 3GH5A 3M0JA 2KZHA 1JCXA 3I6EA 4ASTA 3OHMB 4J3UA 1XKJA 5D33A 3RFAA 3PTKA 2QCMA 2WPBA 3WH9A 1SMDA 1J2BA 3SUVA 2DSWA 4GA8A 1R9YA 5HOSA 2WWDA 3SFWA 4FA3A 3MA8A 3AS3A 3I68A 3NEVA 1VBGA 4WQ6A 1L6WA 1UKOA 3V1HA 3B3DA 1XIHA 4OBRA 3F4NA 1ISXA 1E0TA 4AVOA 5A8OA 4NI8A 2RDUA 3UVIA 1LYXA 2OQYA 1W1TA 1XP3A 3BXWA 1EF2A 4RZ5A 3NOEA 4CD6A 2BV9A 3TQVA 3T40A 1OCQA 4GY0A 3TA9A 1XRTA 4JTQA 1PE1A 4E5TA 1PBGA 4IMCA 1KM1A 4EVZA 3RM8A 1LOQA 1GOQA 3CHFA 1PTGA 1XH1A 5U4NA 3PZQA 3AZTA 2XG9A 3M9YA 2ZZ6A 3NQEA 4XUYA 1CTNA 3IJLA 1UWRA 1ONWA 1CLKA 2G4JA 3NVTA 2ZZ3A 3GVGA 4B5VA 1JZ5A 2G3NA 3W29A 4UTJA 2WKJA 1KV5A 3ARYA 3LTSA 3PK7A 3B8DA 4K6AA 3ZVHA 5JU6A 4JTRA 2HBXA 4UUIA 1QUMA 4LVBA 3O1NA 5JVLA 4M24A 2CBIA 3HG2A 1IIGA 3E6EA 1J4EA 4V15A 3TJIA 2BNJA 4QAWA 3S6DA 1LRQA 1NSJA 1UOKA 2TYSA 3TJLA 1GYNA 5EBUA 4GRSA 3BTNA 5XINA 3GW0A 1QT1A 4S3DA 3GY1A 3HTWA 2QVNA 4XD5A 3M47A 3WDRA 2OQLA 4H3DA 1V6TA 2FDSA 2BMBA 1PDZA 1JRBA 5EPDA 3CAWA 3N9RA 3HG3A 3WLQA 3PNZA 1J2WA 2H8ZA 3QYQA 5IM51 3CQHA 2ALDA 5FACA 3L2IA 4H2CA 4CD8A 2BG5A 3FA5A 3MMUA 1T0OA 3K13A 1V3KA 3IIPA 3LCGA 3FFSA 2VR4A 3NQDA 1JZ7A 5DLCA 3ZSTA 3VOFA 3QZAA 2PDMA 5M3WA 4U5IA 4LUJA 2ESCA 4PUWA 1G67A 1GOWA 4W5UA 3V75A 1S5WA 5HUOA 1RY8A 1ZP3A 4XVDA 3EWCA 3K4WA 3W24A 3DKJA 4EAYA 3RITA 2EKCA 3SRDA 4UCGA 4WGXA 3VOJA 1WX0A 1LDCA 5EMLA 4O1DA 4INFA 4GO9A 3W1MA 3RG6A 2B0MA 2TRSA 3ZVHB 5C6MA 4H2HA 1NP2A 2GVYA 5EKYA 4KWVA 1MXDA 3QF0A 2HCVA 2QCDA 1YTEA 4MYAA 2YFNA 4CQAA 3POHA 2FVLA 4DJFC 4M5PA 1MYRA 2OEJA 3VGGA 1A53A 3CAKA 4MPQA 3EWWA 2B81A 1BG9A 3BCJA 5MKGB 4US6A 2VRKA 3PUOA 3E5PA 5BW6A 2HV5A 5CJMA 5HMSA 3AMGA 3W0KA 4LVFA 4IG2A 1RY0A 1TVLA 5CCZA 2F2HA 2Q71A 2RGLA 3G1HA 3NM1A 4AFYA 3ZYZA 2AOSA 3EWDA 3DG6A 1QOQA 3ARVA 3ABOA 4ORIA 1AMYA 2Y61A 3WLKX 1JRCA 1PIGA 3G1XA 3H2NA 2ACSA 4QP0A 1AW5A 1XH2A 3WLLA 2HVOA 3O6DA 5A8QA 2QMKA 1RV8A 3SRFA 3OZMA 1ZP4A 4RPQA 4A3HA 1XDMA 2VCAA 2VX5A 4LF2A 4HHLA 5G2IA 3MBDA 4PL2A 2BVTA 4BI6A 3S3GA 5CAHA 1NVMA 5AVHA 3LHUA 2PP0A 4M29A 1EJVC 1LJYA 4F0RA 5H8MA 3WUGA 3UY8A 1E70M 1RJRA 1FH9A 4DZIA 5AHMA 2W3ZA 1QRQA 2CFFA 1PIIA 4TQTA 1LM1A 5LIYX 3FKRA 3RN6A 1VKFA 1XD1A 1I6NA 3HQNA 4XX6A 3QOMA 1KLZA 1UASA 2GDVA 4C1NA 2DVXA 1LQAA 1E1EA 3ZO9A 2X0SA 2Y7GA 3QQ1A 1MDLA 2DJLA 4AC1X 1HX0A 1FCQA 1PJ9A 3NSNA 4H9UA 3IIVA 3RPMA 2O9RA 4JQ3A 4HSNA 1OWQA 4IJCA 3ANUA 1L8NA 2GGIA 3KBWA 4DLMA 2Z1VA 5FA5A 2C71A 2GGEA 4D71A 5CBBA 5JBDA 3S9YA 1V3HA 2BLEA 3C3NA 1TPVA 1GZ1A 4WZHA 4H01A 3TTYA 5FL1A 3WD4A 4RNJA 3ZT7A 2IPGA 1RK6A 2HVNA 4O4WA 3E0FA 4W89A 2A3HA 4ZFMA 4TO8A 1TWDA 2XFFA 1Y5VA 2CHRA 4Q32A 4Q7NA 3P8JA 5HATA 1CXIA 5DO8A 1WZMA 5EMUA 3NQAA 2ADAA 4DY1A 3B8VA 5T26A 1S2VA 1GYMA 1VYRA 3O0KA 4I7WA 1LUCA 2AL2B 2BVWA 1W3NA 2P3EA 1UZHA 5DT7A 3JW7A 4DN1A 1OG6A 1RQHA 1QNQA 1KR0A 3UXKA 3A5FA 5D03A 3OVRA 1PTAA 5LKYA 4JY8A 4WY0F 1PWMA 1P43A 3OVGA 4G56A 3GTHA 1CGYA 5BXTA 4XV0A 1Q7ZA 4EANA 1W2VA 2YLLA 1O5RA 4OTKA 4E2VA 3T0DA 1TPDA 1JZ4A 3XIMA 3ABSA 5CSUA 3GX9A 8RUCA 4QLKA 5AC8A 1EJUC 2O7SA 4XB3A 5CZJA 4XSMA 3L7RA 1W5OA 2IQDA 3M0VA 5I03A 1AH3A 2HNHA 3BW3A 4L4OA 2QUUA 1O1HA 4J3WA 3CUZA 1AH0A 4A05A 1R6WA 1PZ0A 1KCLA 4K37A 4WKAA 1VFLA 3W6YA 1U1UA 1JVNA 2GJXA 1G4EA 4NAEB 3WF0A 1F5ZA 1FWJC 3QV7A 3N4FA 4LB3A 3TYDA 3TYUA 2DDXA 1ZGDA 1DHKA 3LY0A 4JTJA 2J78A 3C86A 3H6OA 3M5ZA 1XBYA 3LB0A 4J9JA 4CEUC 1M68A 4ICNA 1I0BA 1L6GA 4L6HA 1LUCB 3ITLA 3N11A 2VX4A 3V7PA 3QY7A 3JR2A 2OZ3A 4GYKA 3VOGA 3WLSA 2WVTA 4BY3A 3PTMA 4DF2A 1E0WA 3KDOA 2R14A 1ALDA 2WQDA 2DUXA 4ZTYA 3T9PA 3MCMA 3MW7A 1KBKA 1KV8A 2DW6A 4QIUA 3T55A 3E12A 4JQ2A 1JF6A 3MUCA 4EPEC 1S2TA 1JGIA 3E5BA 4H04A 4KQNA 3BQ5A 1M04A 4GFSA 3NZQA 1JFXA 3M1ZA 1UQZA 3WEMA 4UNLA 2PWGA 2WM0A 2Y70A 4QXIA 1QFEA 2NWSA 4F2BA 2Z2BA 1RBOB 4C6MA 3SCRA 1TKKA 4F9JA 1UA3A 4QSFA 5HNTA 3KBMA 1GVYA 1FWRA 1K4HA 5F2MA 3DC0A 1XDLA 5U7SA 3DFSA 3BJSA 3CS2A 4O52A 1AA1B 1EA9C 1XYZA 1ZY9A 3H21A 4IQDA 2YLAA 4QQUA 4CU7A 7REQB 4BEQA 4ZVJA 4A3UA 1EXBA 1JDDA 3PWGA 4KEVA 1YRRA 4EPKA 4YCPA 3UVAA 3S83A 3R2GA 5FSDC 6XIMA 5EL1A 3DERA 2NQJA 1EP3A 3HO8A 4MZYA 1PL9A 4QRNA 2XVNA 3AMCA 3KWXA 3RNDA 3RR1A 3H4WA 4Z1AA 3CAVA 4MWAE 3D46A 3OG3A 3SB0A 4RPPA 3S2CA 5CJNA 1DPMA 2BGSA 1NWTA 2JK2A 2Z6IA 2J7FA 1FP9A 2F9RA 1V6VA 4MFEA 3PZNA 3EOSA 4NU7A 1N7KA 2VELA 5D37A 5C70A 1UD6A 3TC7A 6ENLA 1Z7AA 4K7VA 3N12A 5C55A 2PMQA 4BWLA 1NQKA 1GKRA 4R5EA 4LWWA 4H9YA 3W1LA 4F0HA 2E9MA 4M3PA 2EPLX 4HZ7A 4O11A 1DIKA 4PEKA 4IFKB 4R34A 4NRRA 3UPMA 4FNUA 4IH3A 3DN5A 1UR3M 1M7PA 4HU8A 4O8RA 4AWEA 3H2FA 3DH7A 2J4GA 5I77A 3EMQA 4D72A 5D8WA 3LGDA 1C9DA 1VHNA 3WH5A 1KBBA 4UTMA 1KM5A 2RDTA 1WNOA 2G3FA 3KLLA 1KC7A 4JQAA 5H6HA 2W5FA 3IGXA 4F9DA 1BFNA 2OCZA 3TR9A 1KM4A 3D5HA 1IGWA 3MPGA 1F3WA 4RK8A 3PSWA 4ZB2A 5I24A 3VIFA 4KGJA 3MP4A 4XBJA 2FGLA 1UR2A 3WQ4A 1V51A 5L6UA 4IJRA 2ODOA 1F8MA 1CLVA 4MDPA 2WJZA 4ZO7A 1DVJA 2FHFA 3B8SA 5BOFA 1J9YA 3THUA 1C9WA 3RK8A 1X7IA 2P5NA 4UFMA 4PMOA 3MWAA 4PUKA 2HROA 4LEFA 3CTLA 3TUUA 1Z8AA 4EOUA 4X61A 3HN3A 1W8SA 3BOLA 4DI9A 1WV2A 4DUWA 4WSHA 5CGMA 1X97A 1TZ7A 2VEMA 5CEWA 4MUZA 3TMLA 2EG8A 3CWNA 4ML4A 1JGMA 4M81A 4WXZA 1QBBA 1FTXA 3L21A 3NZ1A 1IZCA 1TRDA 1OX4A 2AGKA 3RUBL 4JHOA 2FTPA 3FV9A 1TVNA 5BCAA 2GQ9A 1E40A 1TTJA 3CUXA 2VWSA 2ZRYA 3LSBA 3TWAA 2FB3A 6TIMA 1IV8A 2E5CA 5CPSA 4ZMGA 3PAJA 1VYSX 1BXBA 3AHZA 3M7SA 2W4XA 2QGHA 2WSKA 3I7RA 2XIJA 3C0QA 3WMCA 2YR1A 1KFLA 3P67A 2CLIA 3GVQA 2VD9A 1BTCA 3KZPA 1N2VA 2G3MA 4POCA 4S3JA 3UWUA 3G0XA 4GBDA 2Y63A 4MY8A 4WX2A 1F2JA 4CD5A 3ZLHA 1CT5A 1Y7VA 1XSIA 3PFMA 1HKIA 1V6UA 3RPTA 1UROA 2X0YA 5FESA 5EA9A 4M6VA 3REQA 3NQMA 3BG9A 1OCNA 5IFTA 5CSRA 4OBSA 4QROA 3GIPA 7CGTA 2I5IA 3QHNA 1TR9A 4LCQA 4QBXA 5I09A 3AXKA 3ZR5A 2OFJA 3HB9A 1JAKA 2E67A 4J2MA 2J27A 1CEOA 1TPB1 1V6XA 4GUIA 1P4CA 5AZ0A 4GPNA 1OX4B 3BOFA 3DGBA 4JTUA 1S2WA 2Y89A 4QTGA 3S5NA 3TW9A 1TV7A 4W88A 3VM7A 1KTCA 4AY1A 3VIPA 5LHEA 4BI5A 3TN3A 3MYOA 2PDXA 4IOTA 1VH7A 3IJ8A 2Y24A 5I02A 1IR1A 3L9CA 3CWHA 4Y7EA 4DPPA 2F7FA 4XTDA 5A5WA 9CGTA 4K8HA 3W7HA 2Z2UA 3K8LA 3E38A 1DV7A 3DBNA 2ACQA 5M2FX 1R7OA 1R3RA 1VC4A 1VF8A 3RHGA 3VCRA 2CKSA 3WLIA 4HNLA 3L68A 3SCNA 4QE1A 4PTMA 2YL6A 1TA3B 2PLJA 3EB4A 3GH7A 3BGJA 2WC3A 1KTNA 1WB0A 1XIIA 1B54A 1TG7A 3UZZA 3KCOA 1W1ZA 4JR5A 3KOZA 3REQB 2WKLA 1UWSA 2V68A 3LPGA 3MI6A 3SN1A 1U5HA 3VNZA 3EPOA 4ROQA 4J5NA 3GTIA 5H8PA 4U10A 3H4GA 1OEPA 2FGBA 1EOMA 1YBQA 4D2JA 1EBGA 3IK4A 3W28A 2NLYA 1IZJA 1CB7B 5G5IA 4O54A 4X2RA 4PUUA 4AZIA 1MEHA 3ZR4A 5M03A 4E2DA 2NUYA 2FPTA 3CK5A 4KCWA 1POKA 1B2YA 1UHVA 3CZJA 1HJXA 3N19B 2J7EA 3VDBA 4GQBA 3OVQA 1QBAA 1OGSA 3MYPA 3P81A 3HOJA 2CCRA 4O0KA 3QTGA 2OGJA 3P3BA 2OYKA 3R7MA 2VXNA 3NO5A 3HMCA 3NO3A 4DJFD 4HU4A 3CHDA 1DWFM 1XLGA 4HHPA 1O1ZA 1OCBA 4JBRA 4F0LA 3WH7A 3IJQA 3NL3A 4IT1A 3OBKA 4FHAA 3HG4A 4J2PA 1IQ8A 1GW1A 1P0KA 3QH2A 5HNNA 4DJEA 4HKPA 2GSHA 1NQ6A 3EDJA 1R2RA 1XLFA 2VVNA 4QCEA 2INZA 5AHLA 2X16A 2DQWA 4KWSA 1UB3A 4AD1A 1G6CA 3BAWA 1BKHA 4GQRA 4A3YA 2C0AA 3N2OA 1R2TA 4KCUA 3CEUA 4Q7IA 1AUSL 3HPSA 5A8NA 2BOGX 4MUPA 5EGRA 3WF1A 4PC8A 4PN2A 3QXBA 1ME9A 3SM0A 3W83A 3OU8A 4ZQNA 2X30A 4WJEA 4P7NA 3AMKA 4Z0JA 3WBWA 3QC0A 5F1VA 2WSRA 3WK1A 4Y8EA 4UCFA 2XU2A 3T44A 3U5UA 4AD3A 2B7OA 1E1CB 1WDPA 4ADTA 4NNAA 2GGHA 3CV7A 3NDOA 5BRPA 4H6QA 2QV5A 2ZC1A 5DXYA 5E93A 1XL9A 1LBLA 5E9AA 1H49A 4WXYA 2DSKA 3UCDA 4PSRA 2UV8G 3T42A 5CLWA 3IUHA 2FLIA 3SJ3A 1LT7A 4FR1A 3WQGA 5HQMA 4JD4A 4NJKA 1CXFA 4MB4A 3RLHA 2Y6ZA 1PTDA 2J7GA 2VFDA 4Z17A 4LAZA 3ARXA 1AMKA 1HL2A 4OV9A 1MQQA 4Z2JA 1SJDA 3KVMA 2OG9A 3GQYA 1QNOA 5ABEA 3LLDA 3WQ5A 1GHSA 1SGJA 1UC5A 1ZUAX 1LROA 1OFBA 1UPMB 4K8GA 1AJ0A 5JH2A 5CC6A 3SCQA 2QDGA 3TYAA 3UFYA 4E0CA 5A6LA 3IJ7A 1OY0A 1HF6A 1B3VA 3CLMA 3FJ6A 3NCOA 4AEFA 1NDVA 2PDFA 2UY5A 3C2FA 1NOUA 1ZAHA 4NF7A 1LF1A 1XC6A 4US5D 2R1LA 4M19A 2HISA 2DY3A 3MMDA 2CLOA 2P50A 3TYBA 4D6IA 1X6UA 1YPIA 3UNTA 1EO7A 4LGXA 1R0MA 4Y9AA 4B9ZA 3VILA 2P88A 4HZ8A 3QPEA 2Y8KA 4UTFA 3F03K 1EL3A 3L23A 5M5DA 3VXGA 4PMNA 4GD0A 4AHOA 4O17A 2XIOA 1VJSA 3BSMA 2XJ7A 5CKSA 3KRSA 2RDWA 1JYVA 1JD7A 1W9PA 1M1BA 1EWDA 5AYBA 3GR8A 2DIKA 5LXEA 1NFBA 2WMFA 1FH7A 2G97A 5HK4A 1J79A 5F2IA 3PVFA 3UERA 4I8DA 2JFEX 1ONRA 2WWCA 4AD4A 2HPMA 3S1XA 3URNA 4I8YA 3O06A 4XZMX 1FDJA 1F4AA 2PD9A 1PSCA 5D05A 3BW2A 1VCGA 1V02E 2VKZG 4QDWA 2W66A 1XQLA 4LYPA 1YE4A 2J8TA 2FZDA 3A13A 1I1XA 2XGZA 3WLNA 1T99A 3PZTA 1VPQA 2FQIA 5C9ZA 2DQXA 3CL8A 1Q6RA 2XSBA 3TTEA 4PBFA 4E3TA 3PBYA 1R5YA 3MS8A 4R7WA 3S6TA 1KWGA 1XS2A 3MY9A 3LZ5A 4XZBA 1E71M 1IF2A 3I65A 4XD4A 4YVPA 4GIYA 1Q6DA 3M0ZA 2R82A 4KCTA 2PWFA 4YS1A 5LXXA 3QW3A 2WZEA 4REQA 4OE7A 4A3RA 4DJEC 3GSMA 3CBWA 4CKQA 2I1OA 5IBXC 2TAAA 1VFTA 4QFUA 4IPPA 4V1XA 4J7RA 4HYWA 1H5YA 1JI2A 1TX0A 1T5AA 2J47A 1W56A 2FPVA 4PEEA 1X6NA 4H41A 2VR2A 2FZMA 1KCXA 1ITXA 5FI8A 1JEZA 3FSTA 1CB2A 3T78A 3BLIA 4F0KA 1WUEA 4AIEA 1JZ2A 1XW8A 4DO5A 3VIHA 1TTPA 2VZOA 3M0IA 3CIWA 4ZB0A 1R3SA 4YTQA 1BGGA 1HG3A 5M17A 2O4MA 4EXBA 1Q66A 4HSHA 1PCKA 2Y8UA 3IJIA 3TV8A 4ONVA 2VGIA 3GNOA 1HVXA 2OO0A 1JCMP 3LXCA 3FN9A 5DRIA 3C5QA 4DBSA 4NT0A 3H2CA 4G7FA 4QX4A 1BRLA 5K9DA 2V6AA 1SSGA 2F6UA 5HNUA 4LS0A 4ZXLA 4TVDA 2YCKX 3OODA 3C2EA 1HO1A 2D2OA 5DFAA 2JKPA 4WK9A 4L4LA 1JIBA 4RX0A 4UMBA 3WENA 1EP1A 1BTMA 3HM7A 5I3HA 1L9WA 4QSHA 1GQNA 3PG8A 2DU2A 4GZIA 1JAEA 2AQWA 4X60A 4REQB 2VYOA 3CQIA 3BV4A 3OGSA 3U8GA 4MZ8A 4M82A 5BWAA 3QR1A 1QNSA 3OGVA 2OSWA 3DHUA 4ZO9A 4MKNA 2X2GA 3WD3A 3VOIA 4DXKA 1VIZA 5EU9A 2WLYA 3QY6A 5HULA 3FA3A 4JFSA 3LI0A 1QK0A 4NUWA 1P0BA 4U3AA 1VZWA 4UFHA 3SY1A 3MWCA 5FKYA 4IISA 4XSLA 3FIGA 3MKVA 5D30A 5C9RA 5A6KA 4OT7A 1EZWA 3VX0A 1GOMA 2IMRA 1UWIA 4Q4RA 1M6JA 1XWYA 4P7RA 2H3BA 2VTFA 1J0IA 3PZ9A 3II1A 2DZVA 3BPWA 1VBRA 4OZOA 3W53A 3BGAA 2VDHA 4HB7A 2NX9A 3DC8A 4O4VA 2OYLA 1T6MA 3IVTA 3R43A 3O7UA 4XZWA 1NM9A 1EOKA 3L2LA 3U2CA 1VS1A 3LCIA 4IGHA 2X0HA 3LDVA 1SJAA 2HSAA 3MUZ1 1E3XA 5LNWA 1GTEA 3F4CA 4MZ1A 3MUXA 5I3FA 3MO4A 2DORA 3U2ZA 1G5AA 4JY9A 4CU8A 1CDGA 4B3ZA 3V0UA 2E6DA 3SRHA 1F74A 3NZPA 2GOUA 4FP1A 1R9XA 1DEDA 4LANA 4WUIA 3TW7A 2OX4A 2XWDA 1UD5A 3CPRA 4GGHA 1ZQ5A 3VGFA 4AMAA 4ZO6A 1UW9A 1XCWA 3VIOA 1GVRA 2ISWA 3C2RA 1Q6LA 3M0HA 5CG7A 5RUBA 3EWBX 3DBPA 3UETA 4RV3A 1E72M 1H7PA 4AIBA 4MNLA 4CU6A 2CXGA 2DIJA 2XINA 2ZBTA 1XKYA 2ZYFA 3GTFA 3KL3A 1M41A 5K4ZA 5LA2A 4PRRA 1WDDA 2CLKA 4CCZA 3TTQA 1WXZA 3W1QA 3GZAA 2JEPA 4C6FA 4LS1A 1B5TA 5H91A 2DPEA 1GYLA 2J6VA 3NQ8A 2VO5A 3W4RA 3B8UA 4XAGA 3AXHA 2GL5A 3GNXA 4DZHA 1NEYA 3C52A 4JTLA 3QVQA 1EDQA 4NAFA 3TCEA 3QC3A 3B0UX 3W1TA 3L66A 4CD4A 2B7NA 1ELSA 1QOPA 1OD8A 2GVJA 4EE9A 1CGVA 3V0SA 5AHNA 3ZZ1A 4M1BA 2B4GA 4O50A 5I23A 1K4GA 2WNNA 2J8FA 5AHFA 1IEQA 1HO4A 1QPRA 2GUUA 2YSWA 5T9BG 3GAYA 4MY1A 4I9AA 5CZTA 1BQGA 4JX6A 1HZYA 4M1RA 3N15A 1OZQA 5KITA 2WB5A 3CT7A 3ITYA 3KCLA 2NT0A 4HPGA 1ZL1A 1C8YA 3ES7A 3K30A 1EX5A 4RJEA 2PD5A 1W2PA 1XISA 1JCLA 1I2RA 4B9YA 2VC7A 2A1YA 3KW3A 1T96A 4OGZA 7ODCA 3UWVA 4MWAA 2OEKA 3GFXA 4MVAA 3W02A 3ALGA 2WVUA 3TZNA 2A2IA 1DE6A 1MNZA 4YU1A 4C6EA 3TNOA 3MHFA 4C6JA 3JRKA 5BXSA 1P1XA 5PTDA 4DBUA 3DGRA 4MKVA 1ML1A 4GI6A 4GX9A 3I7SA 1P5BA 5CXPA 3H12A 3W1RA 5CZKA 3ORWA 3W27A 3SIZA 1H1ZA 1QPNA 4UTIA 2X1RA 4KERA 3AU2A 3EMZA 4AZ7A 1XRVA 3GW3A 2GPTA 3K8KA 2PWUA 3CXOA 4XAPA 2PDWA 3BLOA 3OJGA 2O0TA 2PBGA 3QGAC 3ME3A 1YXCA 5G4EA 2ISDA 3WCZA 1VFHA 3MKKA 2WNWA 4UIOA 3UXDA 3HF3A 4HYVA 3ERPA 1EIBA 3W82A 3THQA 2W61A 3V1PA 4MNMA 4NVTA 1DJQA 2A0NA 2PDQA 4A29A 1DWHM 1EYWA 1EWEA 1AODA 1FWGC 3Q65A 1QO5A 1XCXA 5I0DA 1IT7A 4QAIA 4GVGA 5HJLA 3LYEA 5D9OA 1XLJA 4FALA 3EPMA 5DN1A 3EEZA 3ZMRA 3N2BA 4LNCA 4IP4A 4TXEA 2X41A 1XPGA 5HWNA 1ZALA 2R1MA 4NXKA 3PS7A 4WR3A 3GC4A 4BI7A 3GKFA 4JFVA 3BWWA 3IUIA 3ARRA 2XIBA 3MBFA 2AKZA 3HPXA 1A0DA 4TVCA 3G77A 4MNJA 3PP7A 1R46A 5E9XA 3W85A 4IIEA 2YXOA 3G24A 2YBUA 1E1FA 1ISZA 1KXTA 1UOZA 1XIFA 3QW4B 3N6JA 3EPNA 2FPYA 2IUZA 4GABA 5AC7A 5CG0A 1UUQA 3NQ2A 1MUMA 3IJ9A 3FA4A 4FSAA 4ORMA 4DELA 3W00A 3KE0A 2ZZ2A 5SWUA 2QJJA 2ZUWA 1PUDA 3LCWA 3IS4A 4AVFA 1H7XA 1L2UA 2EPKX 4FLQA 1PZ1A 4YYCA 2IPJA 3AALA 4Z2HA 3AHXA 5HA7A 1RLCL 4W8BA 3RF9A 4GYJA 5LNRA 3VNIA 2WPGA 2OLSA 4EKJA 1FWIC 3KHJA 1PO9A 4ZCWA 3W7MA 2PDLA 4LH8A 3FKKA 1HJVA 4V27A 5EMYA 4DZAA 5ECVA 3EXSA 3RIKA 1WYIA 1XC4A 2YJQA 1JFHA 3W7GA 3M5XA 1VFSA 1MW3A 1WXJA 4B5XA 3COTA 4LALA 2D3NA 3LG3A 2NV9A 2YXXA 3KBJA 3M5YA 4QNEA 3O6AA 3QR3A 5D9MA 1XG3A 4LBSA 2C14A 1WA3A 3TIMA 1XCFA 2FFCA 3QHOA 4GZJA 1RA0A 2VMFA 1A5CA 1ZJBA 2QUVA 1GONA 4CVUA 4ML9A 1MO0A 1O66A 3DHFA 2VRJA 3G3MA 1VRDA 5I3KA 2ZC8A 3C6CA 3EGJA 5FL0A 3CV1A 3MU7A 3S1VA 2OZ0A 3NTYA 4LAOA 1PHQA 5HR7A 1YYAA 1G4PA 3SFKA 3WZ0E 4JTCA 1DYSA 2P8CA 4AZBA 1FCUA 1GVQA 4LVGA 3BDKA 3VD9A 5LIUX 3P6LA 1X96A 5REQB 3AZRA 4WCJA 2Y7DA 5B80A 4NI3A 3OZYA 4U33A 4DF1A 2P3ZA 1FWSA 3GC2A 1Y5XA 2WXDM 5GJPA 5C7VA 3SDOA 1W9BM 3KZSA 3DESA 1AH4A 2A7RA 3BCFA 3L65A 4ZGYA 3ID7A 3MI3A 3B97A 4JN7A 1HP4A 4XIMA 5K9XA 2CBVA 4GUHA 4KS0A 2YBTA 3M46A 3Q45A 5KZDA 1CGWA 1VJZA 3CUFA 4N9DA 3FCPA 2EBNA 4WJXA 4MAZA 4UB9A 1GQLA 2E9BA 4P8UA 1MEWA 1KLYA 1HVQA 2Q3OA 1XF0A 1BG4A 4Z1CA 3CHVA 1OYBA 4PRTA 5AHIA 2XVGA 2OJPA 3SRKA 3BZGA 1U83A 1WPCA 4AYSA 4HZ6A 4E8GA 3CZEA 4RZ4A 3HFTA 1EYEA 4ZOCA 3PUEA 2XGIA 5AY7A 1H2JA 3VCNA 1XQKA 1MW0A 2OKOA 4QM1A 3RX3A 2Z1BA 1UR4A 2D2HA 3RJYA 3DYOA 2FH6A 3B9EA 2DJXA 1QU4A 1OK6A 3Q37A 4NHVA 3NJ3A 3KVKA 4P5UA 4HMDA 5HR6A 3O9NA 1UBSA 3VGDA 3K8MA 2BS9A 2PODA 2XH4A 1K1DA 1AQMA 2FVKA 1LLWA 5IRPA 3VDHA 1R86A 2E6AA 5D2XA 2ON3A 2I57A 4KEZA 2VEIA 2X2YA 3UZXA 3LGGA 2QPXA 5C2CA 3W71A 4JIEA 4F2UA 1TIWA 5IDIA 4DAFA 4DUXA 3IUDA 5LSMA 2WC4A 4D1JA 2EF9A 4GYPA 3EZ4A 2E1WA 3AROA 2VGFA 4B5SA 4LC6A 1RA5A 3BO9A 3N73A 4AMCA 3ARSA 2A21A 1OFAA 1KXHA 3C2VA 2Y1HA 2J6XA 2WW5A 1R3TA 3LXAA 4I9JA 4DXVA 3UY7A 2C7FA 3KEHA 2XN1A 4FAMA 3WQVA 1I8JA 3GR4A 3ES8A 3POCA 2CZFA 4CQ8A 3GU2A 3HU7A 4Z0SA 4R9OA 4M7SA 4W8LA 3GHTA 1ITUA 1UP2A 4UXDA 3HQPA 3VK5A 1YADA 4D6JA 4BFAA 4I7UA 4N9CA 2MANA 2A4AA 3QMSA 5FAGA 3S2JA 3CLWA 3P93A 3WO8A 2FMNA 4ZQCA 4LUSA 4C1KA 3GVWA 1ZTVA 4IGNA 5ABFA 4QJ1A 3WQEA 1W5PA 3KFTA 1PIFA 4DBEA 3GS6A 4A8IA 2XVKA 4J1OA 2O7QA 2RJHA 1JNDA 3SI9A 1V3MA 4BK9A 3S46A 4IL2A 3B0YA 1R3QA 4Q8WA 3SO7A 3VZYA 4MTVA 4D6CA 3R0KA 3LTPA 3O8AA 3L5AA 4RLIA 2BY1A 1M03A 3IWPA 4B92A 3WNOA 1B4EA 2X1TA 4G5DA 3WNPA 3KP0A 1FWCC 1XXXA 2RH9A 4OU1A 2D69A 4Q4PA 4AEEA 3QEZA 3P5YA 4HNOA 1S2CA 4QJ5B 4C6IA 1MVYA 2G41A 3P2VA 1VAHA 1JD9A 3GZ3A 1QPQA 2XZ9A 3C0SA 4C90A 4LB4A 1V79A 1GVSA 2YCIX 4U31A 3L5MA 4DAIA 2C18A 3BSHA 2ZFAA 4FNRA 3BOXA 2P0IA 4W85A 4IUGA 2DT3A 2UWFA 5CAKA 2E25A 2QPUA 3E0IA 4S23A 1GNXA 4CQBA 2PDUA 3TSMA 3N29A 2A7NA 4OIFA 4R53A 1JDCA 4JOMA 2V82A 2RKXA 5E1QA 1WP6A 4LUSB 1UD2A 4Q8OA 5ABFB 3CM4A 1JQXA 4JIQA 1LG1A 3EDDA 4LCRA 3A4JA 3RO8A 1GVFA 3AJ7A 2YCEA 2V81A 3PZOA 2OQHA 4XBKA 2QQ6A 3PJXA 1K9EA 3KBNA 1XM3A 4H19A 4GC3A 4JCMA 1BWKA 2BHZA 5BXRA 1EC8A 1V02A 3ZT5A 3NPWA 3IIZA 4M8UA 4PMDA 1E56A 3B8IA 2GQAA 3RXZA 1S3HA 1LBFA 4PCPA 5JUVA 4J40A 1F6KA 1H0IA 5CPOA 3SUTA 2EGZA 1L8PA 2POTA 1FKXA 2OEMA 2ASHA 1TMHA 2WBKA 2YB4A 1EEPA 3IACA 3VIGA 3EWUA 4V28A 1OINA 4HOZA 2YL8A 2ZQ0A 4QDMA 5GJNA 3W7LA 4HOXA 1R3WA 3AUOA 4KWUA 4NP7A 1US0A 5HPCA 4Y2WA 3AYRA 5I3DA 1KKOA 2AL1A 3NWRA 4HMNA 5BMXA 4NZ5A 1OF6A 4IGSA 3FAXA 3QKEA 1UCWA 1KCZA 3OYZA 5A8GA 3UJEA 2REQB 4AVNA 4Q6JA 4IPJA 5I3JA 4JICA 4K36A 1KRCC 3T6CA 3SADA 3MP5A 2TSYA 4YHGA 4HBKA 1UG6A 1V0LA 3TZFA 1AJ2A 4CNNA 3NQGA 2W91A 3AIQA 4MJ4A 4ZSTA 4CD7A 3KCJA 3VKKA 4AC7C 3ZOAA 4IIBA 2OWWA 1MQPA 3LENA 2Q8XA 1CGTA 2ZWZA 4LXFA 5C9XA 4PMYA 1I1WA 1SFLA 2QF7A 2VC6A 2FZ8A 3R11A 1OGGA 3GHUA 4KBXA 3S2LA 4BA0A 4WLCA 4RE4A 1L2QA 5H2ZA 3VDGA 4CQ9A 1K8CA 4KCVA 4OQVA 1G9HA 3BUVA 3VE9A 2O56A 3M64A 3WUEA 4YWSA 2OOFA 4WKHA 4LU0A 1P6CA 2IXUA 2ALRA 2G50A 2AKMA 3TJ4A 1HJQA 3UA3A 8TIMA 1JCNA 1VENA 1ZAIA 3MO7A 3MCOA 4LCSA 3HZ3A 5TF0A 1A47A 1H7WA 2ZVIA 4HTYA 1S2UA 4C6QA 1UJQA 3WY1A 2X05A 2CXEA 2QAPA 1SR0A 3Q94A 3AS1A 4UFLA 5FAJA 1BXNA 4O1BA 3P74A 3THAA 2ZZ1A 4RV8A 1FWDC 4JYEA 2V3DA 2CLHA 2DZXA 2WV8A 1HGYA 4UQ9A 4A6GA 1R47A 3EAUA 5C7HA 1BGAA 1P48A 1M01A 3DHDA 3H7RA 5I07A 3OLIA 3AHVA 1XLKA 1I2NA 2CNCA 3V4BA 4RDWA 4DPQA 5CPQA 1DJGA 3PBMA 2PS2A 1HQTA 4ZQMA 3TYCA 3W7IA 1WZKA 4QEHA 4UTTA 1IEWA 2RJGA 2JF6A 2B7PA 2YB1A 2E28A 4LOCA 1NY1A 2GQ8A 2QZRA 1UH3A 1H1YA 3VUPA 4OKDA 2W67A 1LBMA 5HPOA 2VP8A 4GXWA 7TIMA 4HPJA 1U22A 2A5HA 2ZCGA 2RUSA 1YNPA 1MDRA 1GZJA 1C93A 6REQA 3HGOA 1OFQA 4ERIA 1CXEA 2DUZA 5E6ZA 3R0UA 3NQ7A 4CEXC 3PWIA 2CHOA 1A0EA 1F6PA 3NR0A 3UJFA 2QEZA 3FYPA 1M53A 5F2GA 5TNVA 2QF8A 4N02A 5HXMA 2NQ9A 4G7EA 1ISVA 3GU1A 5AC5A 1J0HA 3TU9A 2P1FA 2I9UA 3SN4A 1ECEA 1IWPA 3K4AA 4IUOA 5F7UA 2PDNA 2O55A 2XIIA 1TREA 3JVAA 5FOOA 1UR8A 1X7FA 4JTEA 3DXIA 4YL2A 5FEWA 2CU0A 4IMDA 3JZUA 2BY3A 3FW6A 4ZSUA 3G2GA 5E6YA 2KX9A 2NXHA 4MG4A 4XQ6A 2XVPA 3Q4DA 2CLLA 2INEA 3OZPA 1Z69A 1IXPA 4NILA 4HA3A 2CZDA 1ZCCA 2BBFA 3P62A 3NL5A 4UC5A 4HTBA 3CO4A 2F6XA 3UEQA 3GNRA 1JF5A 1PKLA 3DIPA 3B04A 5C2GA 1R85A 4C6OA 2ZTKA 1V3LA 3BLKA 1KNWA 3UXAA 2GWNA 1F3EA 3URQA 1H3GA 1EJSC 3LPOA 1DWAM 2V8ZA 2DV0A 5DCEA 4CN6A 1JJKA 3T0TA 2Y85A 4Z42C 4O1AA 3UU0A 4AEOA 4MLJA 2NVCA 2NV1A 1DJYA 3V36A 3QGKC 1Q63A 5A6SA 5A6JA 4M6UA 4WEVX 3VI2A 1UIOA 3CQKA 3WQWA 1NDWA 1PAMA 3KRBA 5T8GA 2WMGA 4RR4A 1M7OA 3C4UA 2D2GA 2E40A 2WMJA 1YPXA 3HGJA 4Q8PA 2QJHA 2J9ZA 3CU2A 1HTIA 2A6LA 4X22A 3W2JA 4B3LA 3UNDA 4AZHA 1BYCA 1OD0A 3S47A 1ZENA 4D1IA 5KMYA 1ICQA 4GI9A 2PDCA 4E4FA 2QHAA 3GDLA 2EPOA 4WRHA 4UQBA 1BWVA 2ZXBA 3DYMA 3WJXA 2O4QA 4GLEA 2VCCA 1WXYA 1QHOA 1G4SA 1TJ1A 3I4KA 3EX6A 4MJ2A 4N0RA 3SN0A 1F3XA 1K03A 1NWRA 2PGRA 3EB2A 2IKJA 3PUDA 2CZ5A 2PF8A 2GOKA 3PZUA 3LHWA 4BQ4A 1FWWA 2WANA 3ITGA 4D8AA 3TKFA 3GXPA 2DT2A 1V3IA 4K39A 5ENLA 1JG9A 3HFYA 5LIKX 4BQ3A 5CBIA 2ISVA 3CUHA 3F4DA 3UZ5A 1KM6A 2Y5SA 4UTTC 2QVHA 3L4UA 1VEOA 1KGXA 2E0PA 5JMUA 1VCVA 1R7AA 4K38A 4NX5A 4LBUA 5E0KA 3MB9A 1TYGA 3TLLA 2O9OA 1D2KA 3M5VA 4GC4A 2PCQA 4RXFA 4I9MA 2OLHA 2BOFX 1BVWA 4DM1A 1A4LA 1EC7A 3WEZA 4O18A 2OOGA 3TH6A 2EXOA 3ABRA 4QS6A 1YMYA 1FVPA 3WK3A 2PLMA 5JBEA 2J74A 2XM1A 4QG9A 3HJZA 3V35A 4FOJA 3FYYA 4FX8A 4F79A 4WVXA 4DJFA 3N2TA 4WKFA 1YLVA 1J0KA 3U57A 4RDZA 3BMVA 3UWQA 3IIXA 2PP3A 5E70A 3QFWA 4DJDC 2ANUA 1QJWA 3F4VA 3VGBA 4S2BA 2GZXA 2HVMA 3PG9A 4GFIA 1W3LA 2YOCA 1U30A 1GORA 2X1SA 3CHCA 4X9YA 3W86A 3IANA 2VX7A 1UKTA 1Q85A 4L4MA 4HJFA 2QKFA 3WJSA 1UKQA 1WZAA 2VM8A 1L6FA 4CCEA 5A3HA 3GO2A 3GDKA 2D0HA 1FP8A 3RMJA 1AJZA 1H5VA 2GSEA 2GGGA 3N4AA 1DL3A 1Q3NA 4O15A 1SYTA 3QPZA 4QR6A 3STPA 3VINA 2QXWA 1HL9A 1YKWA 2WMIA 3OBEA 4JN6A 1QI0A 1O5QA 4NJHA 4NL1A 4TTUA 4Z1YA 4Q4KA 4I6KA 3EX2A 3E9AA 3H70A 3WF3A 2GJNA 3VNJA 3RRXA 1GQKA 3PPGA 5IXEA 3SAZA 4XIAA 2WCAA 1X1OA 2V9DA 2EAWA 2W27A 1ZHAA 3LLFA 3MV11 3WMBA 4DO6A 3UESA 3QQWA 3W2KA 1C8XA 1MQRA 2HMCA 3U0HA 4M7TA 3AMLA 3N14A 3GYEA 3QV9A 4GVHA 1OABA 1TE6A 3N6QA 3L5LA 1NH6A 1SW3A 3TR2A 3C61A 4URIA 2RGMA 1IT8A 3IRDA 1F4HA 4R9XA 3W87A 4W5ZA 3E2VA 4PMUA 3IPWA 5XIAA 4GI4A 2Q01A 1KWKA 3VIJA 3VKJA 1QO2A 4KMQA 2BXZA 3CWOX 3NEHA 4GISA 3LBOA 4HNVA 3G1YA 3A9BA 3TTSA 4QLJA 4ZQRA 4G1NA 4DQWA 4GIEA 3AHTA 3KX6A 1R87A 2J75A 1OC5A 2G5WA 2ZZ4A 3VPLA 5MKGA 4W7UA 2QYGA 4US5A 4UOQA 5D2VA 1VBJA 3W2NA 2Z7GA 3LPPA 3IGHX 3CC1A 3TXZA 2FKPA 3CV6A 1S5VA 2PP1A 1O4UA 2WMIB 1PDYA 5EFDA 3MTWA 1LT8A 4IXHA 4PB3A 2Z4GA 1JCJA 4L4PA 4IX2A 4O0QA 3S1GA 3GG1A 4Z08A 5EB8A 1OG0A 1KBLA 3UPBA 3E2SA 1VRXA 3U3HA 1Z3NA 4JIPA 4S38A 2WLZA 3TJXA 3UWYA 4C6BA 2VNCA 3SGZA 2OR2A 4AQLA 3VE7A 4HCDA 1HW6A 3N3TA 3STGA 1UC4A 4UR9A 1B3XA 9RUBA 2V38A 1NDYA 2WJDA 3T7VA 1QI5A 2P76A 1Z6KA 1R9ZA 1MRAA 3SQMA 3LN3A 3PZVA 3RLGA 2VC5A 1J6OA 4PCTA 1YDYA 1A50A 4QE5A 1QVBA 2YCJA 4GKTA 3IAQA 1CECA 4GY1A 3VMPA 2VL4A 2C1HA 1SR9A 4JTKA 1W6TA 4FLOA 4H83A 3F2BA 4FNTA 3QR0A 5J8LA 1O94A 3GXIA 2G96A 3FHAA 2Y7EA 3O2LA 3TQ0A 1MSSA 3W7NA 2WSYA 3PZMA 3CNYA 2FJUB 4CVWA 3OA5A 2NSOA 3AC0A 1QOXA 4LPCA 3SEPA 2OWXA 2OXNA 4DYKA 2JQXA 3DFHA 4NASA 2VOMA 2YZ5A 3H2OA 2UY4A 4EF8A 3HURA 3T0BA 3BJTA 3LERA 3TOPA 4OJYA 4GJ1A 4O53A 2YZRA 2YL9A 1QDSA 4J3XA 1AQFA 3P5ZA 1J93A 2PE4A 3DOPA 3R0DA 3OPSA 1ZCOA 4NYUA 1XDJA 3UP8A 2DZWA 3AIVA 4W86A 1UWTA 3EX4A 4Z2IA 4F0MA 3T4CA 2V5CA 1XINA 2V0TA 1QW9A 4LC8A 5D8ZA 2EEXA 1ICPA 2XPKA 4ATDA 5BXPA 4Q7BA 4JNMA 4E38A 4IX0A 2ZZ7A 1HXJA 2VI0A 1V77A 2YA1A 3W01A 2OB3A 5E0CA 3G1AA 3BGGA 4YXGA 3CYVA 2VOTA 4D6GA 2AL2A 4GY7A 4YTSA 3LCLA 1U5JA 1XBXA 1MFUA 2UY3A 2BSLA 4GNJA 2YDQA 2ZX7A 2ZUSA 2R24A 3NGJA 2PRMA 3WUBA 4GWEA 1W32A 2D23A 5EMMA 1KKRA 4IWWA 4GUGA 1X98A 4F8XA 4DUOA 2NUWA 5AZ1A 1TO3A 4MHBA 1WCGA 4IIFA 1DQUA 3CPUA 4QISA 3HJEA 1J5TA 3HGRA 1E43A 4E8CA 2PWEA 2FHCA 3TXVA 1PVNA 2PFHA 1VIWA 3VGEA 4RE0A 4PBGA 4X2PA 1R3YA 2G95A 1WDQA 4D6DA 4RNFA 3BARA 5GJMA 1WKFA 3G1DA 3VIIA 3NA8A 4Z2GA 5FEXA 5D2YA 1IIHA 3VABA 3UBPC 2OZ8A 5DBTA 3UZYA 1BEUA 1DJHA 3W1NA 2GVLA 1GEQA 4NAEA 1VGAA 2ZICA 1IE7C 1FDZA 4JYFA 3PZGA 4MIMA 2EJAA 3A24A 3GKAA 3B0VC 4ATWA 4ZOEA 1IZKA 1TPEA 2VQUA 1DJIA 3S42A 1R30A 5HMFA 4HPXA 1QW7A 1W5MA 2XN2A 4UOZA 5D2TA 2VD8A 3STFA 4C5ZA 4C6PA 1VCFA 4XZIA 3MMTA 1UKPA 3WK0A 3ZLGA 4P7LA 1EFZA 2DT0A 4QJ3B 3W22A 1H50A 4AG0A 3CZKA 4GVIA 3TW6A 5HWMA 3B9DA 1H60A 3W72A 2YYUA 3MSGA 4WHBA 3QSTA 1OFDA 1ESWA 5G4WA 5I79A 4L6OA 3GHRA 4UNKA 1JCTA 2Y5JA 1K7XA 4H7VA 5LNVA 4C5YA 4DWSB 6CGTA 1XRSA 3MVTA 4PZVA 3QYSA 1E6ZA 4Q4QA 1JUBA 4BS0A 2NXGA 1NIUA 1OB0A 4P7OA 5MF5A 1GEHA 4YTTA 3TK7A 4ROPA 4PR4A 3B9NA 2I7GA 4ALDA 3UR5A 4LRSA 2OZTA 3EMCA 3HGSA 5KSWA 4FEZA 4XUGA 3RLUA 7REQA 1B3WA 3STCA 3I7QA 5FJIA 4B16A 1AK5A 2IW0A 3S9ZA 3BLPX 1A5MC 3VZXA 1UP0A 4HT3A 2DSVA 1IXNA 2WK2A 4Q33A 1W1YA 1XGEA 1VJIA 1SO4A 3YPIA 1UZ1A 2VWTA 2CPUA 1T41A 1MZHA 2R8WA 3ZWTA 3BL3A 1YTDA 5A6MA 2HTMA 2CLPA 4DNMA 5FEZA 1V0MA 3WL0A 4WDUA 4LAUA 1NF7A 5K7JA 3U4FA 3U4AA 1EBHA 1A5UA 1LL7A 4L6DA 3GDRA 3TQPA 1S5NA 3BAKA 4Q8UA 3AYVA 4WY0B 2WJEA 1E9LA 5M1TA 4IIHA 3GIQA 4GCXA 3VCCA 3WEOA 4PMZA 1SU5A 3TROA 1KBIA 3LM3A 1RXOB 3LQGA 4IFKA 4HU0A 4W7WA 4ZEPA 2PBOA 5G1MA 4B2DD 2FH8A 5EBAA 2QUTA 2FDMA 1E0VA 1EXPA 2CC0A 4S3EA 8A3HA 5DEZA 4QE4A 3P14A 1ISYA 3TCSA 4B5NA 4JXCA 5CGTA 4DWSC 3NZGA 4FI4A 3L0KA 4BR1A 4FB7A 4HK6A 2P0OA 1XR2A 4OHQA 3VC5A 3DFOA 3RCNA 3PBGA 1KFKA 5MHBA 3VNLA 4Q8QA 3DYPA 5CPMA 1SUXA 1ZLPA 2WVSA 3CV2A 1GQIA 2TMDA 5LIWX 2R91A 1OSEA 2OLAA 4IMGA 4HK7A 3EXRA 2CIPA 2W6RA 4RW3A 5DY3A 2C0HA 4AUBA 3HQ1A 1A5NC 2H3DA 1HP5A 2E3ZA 4E3VA 1ODUA 2AAMA 3W23A 1ZNNA 2XHYA 5HUPA 1UJPA 3VAVA 4OFCA 3E49A 4U5KA 2V5KA 3B0XA 4RCXA 2YDRA 2ZUNA 4FF7A 1RHCA 1IEVA 2QJNA 4GQQA 2FGZA 2EPHA 2XM2A 2J8GA 1TZ9A 1THFD 3TSBA 1TV5A 2VURA 5BRBA 1DXEA 4K3ZA 4Z2KA 1OX6A 4J4KA 4ZE5A 4QGCA 3WJYA 3WNNA 1HJWA 3VO0A 1TB3A 4GCAA 1AQ0A 3CIXA 1NU5A 3GLCA 3ZWSA 4AY7A 4JTIA 3F2CA 2ZX6A 1UMLA 1KW1A 3MDUA 1UD8A 4MFDA 1GQJA 5F2LA 3A4AA 4ZXOA 4JTSA 1GWJA 2J62A 1IWBA 2Y4SA 3G0UA 4V1YA 5IHRA 2VQTA 2DZSA 3C2YA 4L1WA 2QMJA 3SCSA 4P8VA 2V69A 2IKHA 4ICCX 5G1TA 4IMFA 4LYRA 4FX7A 4D9PA 1QK2A 2FZBA 5F4XA 2VDGA 4CNUA 5DX7A 1FHDA 3M6DA 5HNRA 4ADSA 4G9PA 2IPWA 4O19A 3BCDA 4PB4A 3V16A 2VFIA 3AI0A 4WSJA 3HIJA 4LUIA 1GCYA 5C8BB 2RAGA 2ZIDA 1R8LA 4C6LA 5FSEC 1MUWA 2HK1A 1XSJA 1D8WA 4A3QA 3H7UA 2UBPC 3O07A 1TSIA 3ARUA 1NFGA 2A3EA 2WCSA 2VCBA 3VVGA 5LA1A 4ZA0A 4EX4A 1U33A 3UQNA 5F4WA 1E4NA 1Y8BA 1ONEA 2QCLA 5FF2A 1XPYA 3LS9A 2Z27A 6ALDA 4M6PA 4CN4A 3M7WA 1SZEA 4ERGA 2EG7A 2V2CA 2FVMA 1EQPA 3GTNA 1FWBC 2QGYA 1AD1A 3I3BA 1FFQA 2ZX5A 3TN6A 2XSAA 4KWWA 4B5UA 4HHHA 1RAKA 1E9ZB 1MMFA 4LAMA 3A4WA 1CW2A 1X38A 4MY9A 3R6IA 2WKGA 2WO5A 1MXSA 1EIXA 4OUEA 3UG8A 4DJDD 1PPIA 5D9NA 1W5QA 3UD6A 1O6IA 3TAKA 4GK8A 4EACA 4XD6A 1BF6A 3WBAA 1G69A 2VFFA 4KKXA 4JCLA 3AXMA 1A3XA 2NVDA 3QY8A 4YN5A 1TTQA 5A8MA 1RSCA 3LU2A 4GI8A 3ZJ8A 4L9YA 3OOQA 1LWJA 3B4YA 3BICA 3OQ8A 4E4UA 4UOJA 1AW2A 3G1RA 3WF2A 5GVJA 5D02A 1NWUA 2RHGA 3WD2A 1GTHA 4NG3A 3C8NA 2DT1A 4HD5A 4FOUA 1PKYA 2DZPA 4DWDA 1TA3A 4B3KA 3NVDA 2E09A 3VUSA 4LJ3A 1GOKA 4GIAA 5AOUA 1HUVA 4FXSA 4MJZA 4FNSA 4UTWC 4A21A 3DZ1A 5I06A 1Q6CA 1XIDA 2CYGA 1KQZA 4Y9MA 3A3WA 1XH0A 1QXLA 5I78A 2EG6A 1PZ2A 3VD3A 3VD5A 3ZFHA 1BYBA 3A22A 3W37A 4ATLA 3G6LA 4MGGA 1D7FA 5A2CA 4AX7A 5CSYA 4Y96A 2LLEA 1FDYA 3H2MA 2G8ZA 4UTUA 3BQ6A 2PZ0A 4JL1A 2RDXA 1BVZA 1K8YA 3HV9A 1FRBA 2E8ZA 4O14A 1KO0A 2CEQA 3AS0A 1XIBA 1B31A 3G8RA 5J5DA 5ABHA 4LQ1A 1WAUA 1TPC1 4I5XA 4U4MA 4BQ5A 3URBA 2QT3A 2VFEA 1MRQA 4DYJA 3BMXA 3ZVIA 1W91A 3WK2A 1ZRQA 4TU1A 1K8ZA 2CERA 1RVGA 1XLMA 3O16A 4G6CA 1GK8A 4MB5A 5CC5A 1J10A 4LYQA 3WBYA 3F5KA 4XWUA 3ANYA 2G4FA 5BU6A 3E74A 1E4IA 1XYLA 1D9EA 1EUAA 1YTKA 1TV3A 1DIDA 4BCEA 1W1PA 4GNVA 3M43A 5FF3A 3PBUA 4XTIA 4HQVA 5IDZA 3C8FA 3ABQA 1H62A 2ZADA 4C7FA 2J24A 3SUWA 3G1FA 2WHJA 1VD6A 1WZLA 3C3UA 2ZX8A 1UKSA 4M6QA 2R6OA 4JKLA 4UMAA 4JTHA 3KWSA 1W3HA 4FPSA 3CYJA 4FNQA 3K4DA 1UUMA 4Y9NA 2WCGA 5CC3A 3U2EA 5AKQA 2AMGA 2QLYA 3KUMA 1K3UA 5D32A 3UJRA 1HN1A 1DORA 4H8NA 1DP0A 1JXKA 3NO1A 3VU2A 3LHVA 2CW6A 4O16A 3OVPA 3VMNA 3CB3A 1E1CA 2Z1WA 1N8FA 1HJUA 4ZBCA 2R1KA 3VNDA 3MT1A 4NZCA 1BVNP 3N1AA 1E4MM 4N4QA 3O63A 3DHPA 3CEPA 2UY2A 7A3HA 1DQXA 1GVEA 2X1IA 3PFRA 1J8VA 3OYXA 3RU6A 1UR9A 3NQFA 4JDYA 1JZ3A 1PX3A 2DP3A 4YPJA 4IXXA 1YX1A 3A3HA 3W75A 2WM1A 2OKTA 5CC7A 3VTRA 3C56A 3P82A 1Q65A 3ZSSA 3QGVA 4LFYA 3TN4A 4GBUA 4OUIA 1QNVA 3TAOA 5LNUA 4RXGA