1OK4A

Archaeal fructose 1,6-bisphosphate aldolase covalently bound to the substrate dihydroxyacetone phosphate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
250
structure length
250
Chain Sequence
NLTEKFLRIFARRGKSIILAYDHGIEHGPADFMDNPDSADPEYILRLARDAGFDGVVFQRGIAEKYYDGSVPLILKLNGKTTLYNGEPVSVANCSVEEAVSLGASAVGYTIYPGSGFEWKMFEELARIKRDAVKFDLPLVVWSYPRGGKVVNETAPEIVAYAARIALELGADAMKIKYTGDPKTFSWAVKVAGKVPVLMSGGPKTKTEEDFLKQVEGVLEAGALGIAVGRNVWQRRDALKFARALAELVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE CLASS I
publication title Crystal structure of an archaeal class I aldolase and the evolution of (betaalpha)8 barrel proteins.
pubmed doi rcsb
source organism Thermoproteus tenax
molecule tags Lyase
total genus 90
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ok4A00
5KSWA 1B9BA 3P61A 2YX0A 3MI2A 1YADA 3SECA 3HQ1A 4HHPA 1RR2A 3B03A 4UR7A 4WX2A 3W7QA 4RLIA 2NV2A 2VEPA 2C1HA 1G4EA 2TRSA 5C54A 4O14A 1LLWA 4O1CA 3DI0A 1OFAA 1KBIA 1W3TA 1HFBA 2JK2A 2HS8A 1VRDA 7TIMA 3M9YA 1OX5A 1SZEA 3PULA 1EEPA 1NFBA 1NEYA 1R2SA 2NX9A 1YPIA 3CWNA 1QPRA 3UZ5A 4PODA 2ALDA 3G1YA 3TFXA 4AHPA 2PRLA 1JCXA 4JD4A 1TRIA 1OFEA 2GJLA 1OX4B 2YXGA 3FJLA 1OG0A 5KINA 4MLJA 4GFSA 3NQ7A 3C6CA 4XTDA 1ZCOA 1M5WA 4JYDA 1JRCA 2Z0IA 1ZAJA 4DQWA 1IF2A 4UFHA 3KAOA 1EB3A 4HSOA 1W37A 1ZAIA 3N73A 1H50A 1KFBA 1OABA 3VE9A 1SZFA 3TJXA 3PB0A 1TJPA 3BGJA 4BI6A 3CLMA 3DFTA 1GYNA 1GWJA 4DPQA 3CQ0A 1PV8A 2CZEA 3NVTA 3V75A 3PUOA 3W70A 4ZL1A 1QO5A 5AN7A 4UTIA 3G8EA 5AYYA 1XBVA 1QFEA 1JRBA 2X1TA 4CQ8A 4AH7A 2TYSA 3LCLA 1OJXA 1SSGA 2J9ZA 3W75A 2ATSA 3W6YA 3L0KA 4Y6GA 3WK3A 1I45A 1TTIA 3PG9A 4QAIA 1DOSA 4WXYA 1H5YA 1K8ZA 1X1OA 4KFNA 1AW5A 1YPFA 1W5MA 2CFFA 4WJEA 4RX0A 1TPEA 2NWRA 3A21A 3PUEA 3THAA 1OFBA 2CLHA 3IIPA 4IJBA 1FX6A 3C56A 4R34A 3EXTA 3B0VC 2CZDA 1FWWA 1R2RA 4WY0F 1FDJA 3WJZA 4DXVA 3PWAA 1ONRA 3SSJA 5HR6A 3FJ6A 5J5RA 2ZYFA 4A3UA 3CEUA 4FB7A 3L0GA 3N3MA 3W88A 4TMCA 1F73A 2CWNA 3DAQA 4NJJA 3NQAA 3Q58A 4RR4A 4CCCA 2Q3RA 4OQVA 3L0NA 1SO4A 1A5BA 2VFIA 1FCQA 3UXDA 3QQ0A 5K4XA 4LOCA 5CPOA 3MI3A 4RZ6A 2E09A 2RFGA 3W86A 3LXBA 4BFAA 4N4PA 4YWIA 1LLZA 2FFCA 1UUOA 3M43A 4LS0A 2OX1A 2B7OA 1DL3A 2Y7EA 3USBA 2UV8G 4LWWA 1ICQA 4NZJA 2BXVA 5E0KA 4OU1A 3BVJA 4GWEA 5LGZA 4R33A 4BI5A 1GZGA 3BLIA 3F03K 4RXGA 5DBTA 1IIHA 2FDSA 3G0SA 2GQ9A 3EXRA 3SGZA 1GEQA 1I2QA 3NPUA 3DFOA 2DU2A 2CLEA 4MJZA 3Q94A 4Z1BA 1GVOA 4YCOA 3CTLA 2CLLA 1BWLA 2G97A 4ZQNA 4LW7A 2GVJA 3P5YA 3DI1A 4O18A 5K9DA 3KVLA 5TIMA 4MJMA 2QCEA 1JULA 4YL2A 3SI9A 3WJSA 5F1UA 5LSMA 3LLFA 2WV8A 5D02A 3GYEA 2C13A 3NQCA 2PE4A 1QCWA 1XCFA 2Z6IA 1ZJIA 3EX3A 3PM6A 4UXDA 4GJ1A 5G1YA 4LV9A 4WZHA 1DQXA 1F76A 4JTUA 5G5IA 5KZMA 1OYCA 3W7LA 4JR5A 1GT8A 1R46A 1FDZA 4NXKA 4ZQCA 1B3OA 2ZCGA 5IBXC 3GNNA 2P1FA 4Q33A 1IIGA 1L2UA 5K2ZA 4MUZA 1Q3NA 1TO3A 4UMAA 3C8FA 3HGOA 4XBKA 5D2XA 3UWZA 1CW2A 4NU7A 4M6PA 4RZ4A 1DJQA 3TQVA 3OEXA 3UWUA 3W84A 3EB2A 5LNUA 1KM2A 3LHUA 1K3UA 4Z1DA 4LNYA 3BLEA 3F1QA 1ME7A 4BI7A 3UXAA 3QYQA 1EX5A 3LRKA 4QNEA 3BK0A 2QCGA 2QJIA 2GJNA 3ZWTA 3UD6A 2E6AA 4MKNA 4PC8A 3GXPA 5U4NA 4TU1A 2C14A 2FPYA 4MVAA 4N9EA 2WNNA 5LNSA 5AC7A 3TK7A 3P5ZA 5HUPA 2QCMA 1QOPA 3W7HA 5HR7A 4ICNA 3I7QA 1JCJA 1R2TA 3UWYA 5K3VA 4M6QA 3UQNA 2O7QA 1KM1A 3PSVA 3GXTA 1W5OA 4UTTA 4Z1CA 3E49A 1I2OA 3W7OA 1K02A 5KZEA 4PL1A 1JUKA 5KMYA 4LV4A 1FWSA 4JTGA 2A7NA 5HUOA 1JCLA 4Z08A 1AW2A 1WOAA 3A23A 1U83A 2V2CA 3UWWA 3S1UA 2GVGA 4O19A 3EX6A 4XUGA 4CLMA 1KTNA 5AC6A 1TPH1 1OFRA 4JTKA 1KM4A 1VYRA 2WJZA 5HWMA 3IV3A 4TR9A 5AHEA 2GPTA 1JCNA 4AWUA 4AHOA 2BWGA 2A7PA 4UNKA 2V9DA 1AG1O 3QFEA 4PL2A 1SO3A 2ZRXA 1K7XA 1TJRA 3G1FA 3FFSA 2JKAA 1QDSA 5D32A 1VHNA 1H1ZA 3AJXA 1KM0A 3B05A 4N2YA 4N4QA 4YLWA 3A24A 2R14A 3L68A 2QDHA 2W0UA 1C9DA 4NUWA 4IMDA 1UCWA 4JICA 4TO8A 4L4MA 1LOQA 1GG1A 3GAYA 3NNTA 3Q2DA 1TQXA 3P80A 4N6FA 2CLOA 3LCFA 3I7RA 1EUNA 5SWUA 4IMEA 5MHBA 1K8XA 3VI2A 3OIXA 5BW6A 4DO4A 4C1KA 3PVFA 4WY0A 2CLIA 3TR2A 4TMBA 1I2PA 3WK0A 2Y61A 3TMLA 4MYXA 1KFKA 3G1AA 4CNOA 3GDRA 3EKLA 1F6PA 2A5HA 3KRZA 5DCBA 3CWOX 1O4UA 5AOUA 1T99A 1GOXA 5TBOA 4ZVJA 1O5KA 2ZA1A 3W3OA 5D33A 5KITA 1QPOA 3NA8A 5IM51 2NUYA 3GAKA 4FXRA 4JN6A 4GUHA 3HGSA 1KM6A 4O17A 3L5AA 2PCQA 3G18A 4XQ6A 4NZFA 4YCPA 3LI0A 3R5EA 1H7XA 1X1ZA 3NM3A 3KXQA 5FF0A 3T7VA 2ZZ2A 3FEMA 4O1AA 2Z2UA 3DKLA 1Z44A 2J9YA 4MYAA 1H51A 2A85A 4HPJA 2YYTA 1IXOA 3W1NA 4UTWA 1WV2A 4FF7A 3HG5A 5BMXA 4A21A 5ABTA 4QM1A 4YMZA 3W1UA 4RKAA 3BPWA 3M16A 3IIVA 2H6RA 4HN4A 4WUIA 5G2IA 5A8GA 3LB0A 2EHHA 3P74A 4IXHA 5CGQA 2QF7A 3HGRA 2A6NA 2EGZA 3DKJA 4OE7A 1FQ0A 2TSYA 1LRTA 4GUIA 5H2ZA 1THFD 2QCNA 1VH7A 4UIOA 3T40A 1Q6LA 2NLIA 1LM1A 2V30A 5GVJA 2VEKA 1QPQA 3PS7A 4MFDA 4DBDA 5HWNA 3P8JA 1VYSX 2YR1A 5FI8A 2D73A 3QM3A 2O7SA 2NUWA 3PUDA 4NJGA 4JY9A 3GVGA 4IPIA 4ONVA 4XTIA 4HNNA 3PBVA 1I2NA 2C3ZA 3L67A 1LP6A 3PSWA 3UPBA 1OFPA 1XDMA 3GIYA 4LVGA 1AMKA 4ORIA 4XZ9A 3HG2A 3S8HA 5F4XA 4KFOA 1KA9F 1O5XA 2WNQA 4FEZA 3IGSA 1J2WA 5AYXA 3O16A 3EWXA 3FYOA 5D38A 2YCEA 5HULA 3P7YA 1XBYA 1KBJA 5K9XA 2CLFA 2ZRUA 5AHNA 2WOQA 3NQDA 1XBZA 3OVPA 3C0JA 3NQMA 4BWLC 1PCWA 3W1TA 1KTCA 4QITA 1TMHA 4GE8A 4K37A 4MZ8A 5EY5A 5HNRA 4MLRA 3FA5A 3G3DA 1TPFA 1QMLA 2FTPA 1H7PA 3OA3A 2QCDA 3S1XA 1ICSA 5BNKA 1X6UA 3GX9A 5HJLA 4L4LA 1EWEA 2QR6A 3BG3A 4OHQA 4FNUA 3L65A 3M5XA 4Y96A 2GQ8A 2X1RA 3C2RA 2HS6A 1VCGA 1GTEA 2EKCA 4LTSA 1FBAA 3SZ8A 4UFIA 3NZRA 1P4CA 4FXSA 3W71A 3DFNA 5HINA 4KKXA 3NXFA 3W2JA 4WOQA 4E38A 3O63A 1LBFA 1YDVA 1NF0A 4JTHA 1J5TA 2VFGA 1KTBA 1OF8A 2B7QA 4IUOA 3HG3A 2QJHA 4K39A 4CCDA 4UTKA 1TV5A 4IMFA 2I14A 3W07A 5L9FA 5I3JA 4WY0B 3OG3A 3TU9A 1VHCA 3HPSA 1TPC1 3C3NA 3RLVA 4JGDA 2W79A 1U5JA 4NJKA 2F7FA 2Y62A 3S5NA 3KFTA 1F5ZA 3OVQA 3STFA 4E0CA 1EP3A 1RQBA 2VOMA 4U28A 3TSMA 4PEKA 1Q45A 3ZFHA 2OMAA 3W72A 4MZ1A 2QDGA 2Y88A 5DBUA 2NV1A 3N2MA 5D2TA 2C16A 3RFAA 1L6YA 2CLKA 3GKFA 2GOUA 4U4MA 4JY8A 2Y6ZA 3QW4B 2FJKA 2AAMA 1VR6A 4E2BA 3W2MA 3FIGA 3P84A 3NYZA 1JVNA 5LKYA 3GNDA 4K38A 1W5PA 5H91A 3TFCA 3KVKA 4FIRA 4O28A 2DZUA 3M6YA 3NQ2A 3DH7A 4GNJA 2ZA3A 4JTSA 1A5SA 3UNDA 3FS2A 3W1AA 3HMJG 3E0IA 4CQ9A 2QCCA 1LRNA 2VELA 3B0UX 4O0ZA 1T96A 8TIMA 1FCUA 2CZFA 2V2DA 3BGGA 4M5PA 2V5LA 1H63A 4DF1A 5BRBA 1ADOA 3EWWA 4N9CA 1VCFA 3NEVA 3RNDA 5CZ0A 1PCKA 3PBYA 4WD0A 3P60A 5CSRA 2RH9A 3LXCA 3W73A 1YYAA 4JX4A 1EA0A 4MIMA 4AF0A 2ZRZA 1P0KA 5DN1A 4XBSA 4O57A 3W7EA 5C2XA 2YYUA 1VCVA 3TMQA 2A21A 1AW1A 1GVSA 3W83A 1Z42A 3BO9A 3OVRA 1S5WA 2WSRA 4M7TA 1TPDA 2V82A 3LCHA 2RDTA 5I3FA 4OBTA 1F74A 3LTPA 3NM1A 3S5YA 2Y89A 2QUUA 5F2IA 2Z1BA 3RF9A 4EVZA 4CNPA 3GDKA 4RZ5A 3NL6A 2V5BA 3WJWA 2J9XA 1PHWA 3MBDA 1QAPA 1T8XA 3I7SA 4LVBA 5LZLA 3RMJA 2G96A 2ZTJA 4JTEA 4K7YA 1OFDA 3LOTA 4JIPA 2A6LA 1VJIA 4ML9A 6ALDA 3A5FA 1W0MA 1K7EA 2P0OA 3JRKA 1JCYA 3W85A 1CI1A 2OZ0A 3TW7A 3CIWA 4UMBA 2B7PA 1HTIA 1PHQA 2C0AA 5HQEA 5F2MA 3H55A 4P61A 2YW3A 4RV8A 1FWRA 2WNZA 3LTYA 3VFLA 2YZRA 3A5VA 4OWGA 4JDYA 3MP4A 3P81A 3R12A 2NWSA 4JDBA 4DPPA 4JX5A 3UWVA 5EPDA 3U8GA 4HKPA 2QCDB 3M7WA 1A53A 3W1LA 4ADTA 3KVJA 1X8FA 2A7RA 4O11A 5EMUA 4QJ1A 4K7VA 3MP3A 1W5QA 1F6KA 4TX9A 3S0CA 2VFFA 4K6AA 1H1YA 3ANYA 1PIIA 1AK5A 1XI3A 2KZHA 3QSTA 1EUAA 2BLEA 3G24A 3MHUA 3NAVA 1HG3A 3S5ZA 1QO2A 1VYPX 5F4WA 1TRDA 2Y7DA 3W7CA 3PG8A 3G0UA 4N6EA 1SFJA 2Y85A 1B4KA 2A4AA 3WFAA 2QUTA 1EP1A 3SIZA 3LV6A 3B8DA 5C5YA 3W23A 5LNWA 4LRTA 5AHLA 3IIZA 3M0ZA 3W7PA 1YTEA 2RKXA 2DZTA 2ZTKA 4UR8A 2DP3A 2Z6JA 4JIQA 1SUXA 1JR1A 2DZWA 4HNTA 2RDUA 1Q6RA 1XM3A 2QCLA 3LRMA 2ZRWA 2AGKA 3MYPA 4AB4A 2A0NA 2YSWA 1DORA 1VQTA 3HGJA 4O4WA 3QMRA 2WSYA 3G22A 1G7VA 4H3DA 5F2LA 3NGJA 1SW7A 5DELA 1DVJA 2E6FA 3G0XA 3NPVA 1D9EA 2NX3A 4IPJA 5I3GA 5AHIA 1KFJA 3TW6A 1W1ZA 3NQGA 4LC8A 4ORMA 2E1DA 5F2GA 1FUYA 3DHDA 1RQEA 3A22A 2VKZG 4NJIA 3IVUA 3L2IA 3MHFA 1JQVA 4N9DA 3QW3A 3NG3A 4FX8A 4R53A 4X3ZA 2ZZ4A 1O94A 1SQ7A 2X1UA 3I65A 3T44A 4WOZA 4ZQMA 5U7SA 1SR9A 3ABRA 1KLYA 3M41A 4H4IA 1ME8A 4MY1A 3V1PA 3LXAA 4GUFA 1W3IA 4FNPA 1RQHA 3UZJA 1TV8A 1LORA 1KLZA 3LLDA 3GKAA 3KVMA 4JTFA 1UASA 1B57A 3EX2A 3R89A 4O52A 4MFEA 3QMSA 4ALDA 3EKZA 4I7UA 3UYCA 1HUVA 1MZHA 2LLEA 4AF0B 4UC5A 2R8WA 5LHEA 1G4SA 4NQ1A 5EBUA 1DBTA 3RU6A 2FQIA 1Z41A 2RDWA 3G8RA 3IEBA 1OK6A 1LOSA 1XUUA 4N02A 4JTJA 4PCFA 4O8RA 1OHLA 3K30A 3TC6A 3TJLA 1D3GA 1C29A 3OHIA 4C1LA 3H53A 1G67A 4O15A 4LVFA 1MO0A 1TPB1 3W1PA 3ATZA 5FEZA 5AFDA 3BARA 1S5VA 2J6XA 3PC0A 3VCRA 3L21A 1OVDA 4MY9A 2BX7A 3MMTA 1SZNA 1GJPA 3P8IA 1KM3A 3R8RA 1RZMA 4LRSA 3ABOA 3PBUA 3LTSA 3CIXA 2QAPA 1MEWA 1TPWA 1VZWA 3EX1A 5FF3A 3T4CA 2YGYA 1W56A 2VEIA 1EWDA 3W1QA 4JTTA 3FKRA 4UTLA 2A1YA 5CZTA 1MSSA 2ZBTA 3W22A 2GQAA 3W7JA 3LRLA 4IOTA 3LHWA 3IIXA 4XWUA 3MBFA 4UUIA 3N9SA 4JXCA 4O16A 3PBWA 1KFCA 3QPYA 3G1XA 2PC4A 1MEHA 1M6JA 1ZHAA 2DJLA 3KOFA 2V8ZA 4MZYA 3G1HA 4W9TA 1WAUA 4K36A 3DHFA 2JKPA 3GK0A 3VKJA 1GVQA 3LCXA 1BTMA 4NNAA 3P67A 1XL9A 4FNQA 1SO5A 2DJXA 3W9ZA 1ZFJA 3QRHA 1H61A 2ISWA 3HOJA 3TQKA 1JUBA 2Q3OA 5E93A 2ATMA 1PVNA 2E6YA 1G4PA 3IIOA 1WDWA 2H90A 1ZY9A 3MO7A 4PTNA 2VC6A 2QEZA 3GB6A 1DHPA 1L9WA 3R2GA 2GUUA 3FYPA 4UTHA 3Q37A 2BSLA 3PB2A 3NL2A 4Q32A 2Y7GA 1SW3A 4MOZA 1UB3A 1ZENA 4QSHA 1WBHA 3CB8A 3MI6A 1WQ5A 3NQ6A 5KTLA 5LHFA 2TPSA 1SZGA 3NO5A 3E96A 1W5NA 4KWVA 2E5BA 1L6SA 1V5XA 1WX0A 2X30A 5G1TA 2NX1A 2FPVA 2OT1A 3NOEA 4FNRA 3A9IA 1L6WA 4GUGA 4UTUA 1VC4A 1N7KA 1TYGA 3LCIA 3KX6A 5FESA 3C4UA 2H3DA 2FPTA 4O10A 3W7MA 4AWSA 3C2VA 5FEWA 1V7YA 1FXPA 5EKYA 3SR7A 2X16A 3TIMA 3MW7A 4RJEA 4A2SA 3LCWA 2ZQ0A 2I9EA 2EPHA 3M5ZA 2HMCA 3TCEA 1H7RA 3GDTA 4UTTC 3YPIA 4FHAA 3BW3A 1T0OA 3UY8A 3O6DA 4IX2A 3U2OA 3W2KA 3W7IA 2H8XA 3ZS4A 3LCGA 4UTMA 4D2JA 4AEOA 3F4NA 1SO6A 2B0MA 5CKSA 4QISA 4UFKA 1QWGA 1X7FA 4HIBA 1LCOA 4Y8FA 5G2HA 2YFNA 4QQ3A 4NX0A 3G3MA 4A22A 4EWND 3S5OA 3C52A 1NVMA 3PR2A 4OT7A 2DZXA 4NJHA 1HO1A 1WOBA 5CG7A 3W76A 1LROA 3I6RA 3NZ1A 1VLWA 5IBXA 3EWUA 1M7OA 2QJGA 3C2EA 4O0KA 2X1SA 1XUZA 3C2OA 3W1MA 3TC7A 4DF2A 4IMCA 1D3HA 2VFHA 1TIMA 2EF9A 4OV4A 2NUXA 1GPWA 1VGAA 1H60A 2G95A 5BMWA 1JCMP 1XBXA 1ZNNA 3GXNA 1TTJA 3W1XA 3BG9A 1G6CA 4MPQA 1FWNA 3W7NA 1TV7A 4WXZA 3FOKA 3QZEA 3DFPA 5CZSA 4B5NA 5K4ZA 3DZ1A 1TCDA 3GZ3A 2QAFA 3HO8A 1ICPA 3QQ1A 2G5WA 1J4EA 1EIXA 1H7NA 1YDNA 3I68A 5D2YA 1LYXA 2C6QA 2WKJA 2V81A 3O6CA 1IGSA 4UNLA 5TQLA 2VXNA 3SW6A 4IXXA 4K8EA 3CPRA 1QPNA 3NL3A 1G4TA 3AO0A 4LVDA 4IMGA 1F2JA 2PRMA 4O53A 3L5MA 4FNSA 4G1KA 4N9BA 2J24A 3NQEA 2BZNA 4LC6A 1SSDA 4HNVA 1GG0A 1IXNA 4H6KA 4MY8A 4LUIA 3ZR4A 5D2WA 1FCBA 4NT0A 3IGUA 2ZZ5A 3WK1A 5AB3A 2F84A 5DXXA 3G1SA 1B4EA 3DU0A 3THQA 3PF3A 2ISVA 3BLFA 4S2BA 3TX9A 4HPXA 3QPZA 4JX6A 1NF7A 3LHTA 3IRDA 5FEPA 1E51A 2FLIA 1VLIA 2FB3A 4R7JA 4CQAA 3W7KA 3N9RA 5D05A 1IXPA 5D37A 4ZQOA 2OCZA 2A2IA 2ZZ3A 1AL7A 3OBKA 3HJZA 1SW0A 5AHFA 3DENA 5DCDA 3NQ8A 1WA3A 1P5BA 2FB2A 4X2RA 3TXVA 4UTWC 3UPWA 4PA8A 5HMSA 2QKFA 1LBLA 2V2HA 4FNTA 3D0CA 4FX6M 4HSNA 4I7WA 1QOQA 2PRHA 3GDMA 4UFLA 1ZAHA 2Y63A 3HB9A 1I8JA 2ABBA 4BF9A 3N19B 3PY2A 3MJYA 1HO4A 4O12A 1OYBA 4RK8A 2B7NA 4UMCA 5AHMA 2HTMA 2ZDRA 4LT9A 2PURA 4JYFA 1XDLA 2HSAA 2QCHA 2J88A 1VPXA 4Z0JA 1JQXA 3LV5A 5D2VA 4FX7A 4AMAA 1W8SA 1H7OA 1N55A 1TTPA 1YXCA 4RXFA 5FEXA 5CPNA 3BW4A 3O07A 4DO6A 1G69A 3IVTA 3LHYA 2J27A 2NZLA 4GXMA 1WYIA 2Q8LA 2BTMA 3KHJA 3TSBA 4FO4A 3BW2A 1N8FA 3NR0A 1W54A 3T55A 1P0NA 5HWJA 4AHQA 3LX9A 4AXKA 4M19A 1A5AA 1W3NA 4JNMA 4XKYA 2CLMA 5G4EA 1LDCA 4S1FA 2FIQA 3IVSA 1PS9A 2QUVA 1GVFA 1OYAA 3DFSA 2ZA2A 1C8VA 4IX0A 3TSDA 3BG5A 4NVTA 2JKEA 3MYOA 1VS1A 1EPXA 3S42A 1RPXA 3VNDA 1BKSA 3NPXA 1OFOA 5A5WA 4JTLA 1SPQA 2DZSA 2W6RA 1YLVA 2OT0A 2V0TA 3HBLA 2ZZ7A 2YW4A 3O1NA 3ELFA 4JEQA 3W2LA 3ABSA 2DZPA 2OJPA 3EX4A 2JGYA 1NSJA 3GDLA 1Q6QA 1F05A 4AAJA 5LNRA 2WPBA 4PH6A 3MP5A 4LS2A 4M7SA 4BR1A 5CPMA 3LBCA 1XKYA 5DCEA 3O05A 1TQJA 3W74A 5F4SA 1YTDA 3N34A 3TNOA 1YDOA 3H54A 1GVRA 3UWQA 1TPVA 3DBPA 1FCVA 1BWKA 3CU2A 3QSRA 2VENA 1KW1A 4LY8A 1QNVA 3W1RA 4KWWA 1DKWA 1OX6A 2WSQA 4IGHA 3LHVA 5K9CA 4RCXA 5I3IA 1BEUA 1FWTA 3NQVA 3G1DA 4X9SA 2CW6A 4NXSA 1Z48A 3HG4A 5CSSA 4CNNA 2JBMA 3O06A 1A5CA 4IQLA 4YXGA 1LRQA 4HNUA 3O6YX 3CHVA 1DV7A 4EIVA 2C18A 2E5DA 3STCA 1QR7A 2C19A 1AL8A 3E12A 4LS1A 1KM5A 3TA6A 3E02A 4BWLA 3B0PA 1EP2A 1H7WA 1ML1A 4J9JA 3JS3A 1P1XA 3RK8A 3U6WA 5CPLA 1TB3A 4GRSA 3TKFA 4ZZ9A 1O60A 1KFEA 1HL2A 4GUJA 3MUXA 3C2FA 1LBMA 2XN1A 3STGA 4Y90A 4UCGA 5FF2A 2Q8ZA 3WJXA 4LU0A 5LNVA 3HPXA 2TMDA 5DXYA 2Y70A 3L9CA 3TV8A 3TXZA 3B4UA 2VEMA 1K8YA 1RVGA 3MWAA 5K7JA 2NXIA 4O1BA 4DO5A 1TREA 4QNWA 3CM4A 1LTDA 3KRUA 3P62A 3NQFA 1JUEA 1A50A 4LUJA 3LGEA 5T26A 4DELA 4GBUA 2GVLA 4DBEA 4HT3A 3EWZA 3UY7A 2ABAA 2ZRYA 3R13A 2EAWA 1DQWA 2YDAA 3KRSA 4EF9A 5G2WA 3QF0A 1RV8A 4NX5A 3W87A 4ADSA 1PE1A 1DJNA 3M5VA 1NAL1 5KZDA 4CCEA 3SY5A 4I9AA 3N14A 3MHGA 6TIMA 5F1VA 4ZMGA 3M47A 1S5TA 5AYZA 3F4WA 3LERA 3QMTA 1PL9A 2H8ZA 1ME9A 1TPUA 4I7VA 3WK2A 3S1WA 1MXSA 5EYWA 3SJ3A 4DF0A 3TROA 3NDOA 3G1VA 5C6MA 1YTKA 4DEFA 1OX4A 5FF4A 1XFBA 5D09A 3EEGA 3FKKA 1Q6OA 4EOUA 3QEZA 4O1DA 5AC8A 1GTHA 1UBSA 3IGXA 3N2XA 4XKYB 3HIJA 4WQ6A 1OK4A 2CU0A 2I1OA 2ZFAA 1YXYA 1FY6A 1RD5A 2XN0A 1H62A 2ZZ6A 5FF7A 3DXIA 3QC3A 3S6DA 1XC4A 5C55A 3HF3A 3INPA 1R47A 2E68A 3B06A 4O4VA 5EA9A 4NNBA 5G4WA 3O8AA 5CZJA 3STEA 4UFMA 1ALDA 3TAOA 1WXJA 1YXDA 5EL1A 1IXQA 2E5CA 1JJKA 2ISSA 1SU5A 1K7FA 2X2GA 3W7GA 4QIUA 3VE7A 3DFQA 2NXHA 1KV8A 4OGZA 4UTJA 3WJYA 4KFPA 1K03A 3C61A 3SFKA 3ZWSA 3QJAA 2VFDA 2YFOA 5DY2A 4P2VA 3EWBX 2XFWA 4PFMA 3RLUA 1KFLA 4AVFA 3GR8A 3LHZA 2H3BA 3QH2A 2WQPA 2CZ5A 3W7DA 2C15A 2E77A 1OF6A 4K8HA 2P10A 4O50A 3PAJA 1TSIA 1G7UA 2DZVA 3TH6A 3LM7A 5LGXA 3GLCA 4A2RA 4X22A 3L66A 4POCA 4IWWA 3B04A 1SFLA 1I2RA 2R94A 3TAKA 4GC4A 1XXXA 1O95A 3CEPA 1MEIA 1LOLA 1FXQA 1F7BA 2YPIA 3S1VA 4ZQRA 2XN2A 4LVAA 1WBJA 4UFJA 3LBMA 3M5YA 1GQNA 5BOOA 4ADUA 2VFEA 4JYEA 4NNCA 3M1ZA 4JS3A 4AWTA 4JTIA 4A29A 5I3KA 2B4GA 1CX9A 5J5DA 3FLUA 2NXGA 2JGQA 1UUMA 3NPWA 3ATYA 4OV9A 5DY3A 3E9AA 5D30A 1ZALA 3GR7A 4M6VA 3TUUA 5E1QA 3ABQA 4TIMA 2E6DA 4BK9A 3P82A 3SGUA 4Y9AA 4E2DA 2WO5A 4O13A 3DGRA 3W2NA 3W2UA 3LI1A 1S3HA 3LDVA 2Y7FA 3O15A 1LZOA 3M44A 3HPZA 1KV5A 4Z1AA 2R91A 2ZRVA 3BV4A 3CT7A 5L6UA 1I4NA 1Y0EA 4S2CA 1UJPA 3W7RA 1OFQA 4O54A 5I3HA 4Z0SA 4ZQPA 2QCFA 3TQ0A 1TTQA 2AQWA 3EXSA 1R30A 4Q4KA 3CC1A 5D03A 3JR2A 3S9YA 2ZZ1A 1W31A 3TE9A 1M7PA 5D04C 3EWYA 4FIQA 3TDFA 2IQTA 3NL5A 2RHGA 4EF8A 1FDYA 2DORA 3T78A 5DLCA 1GYLA 3L5LA
chains in the Genus database with same CATH superfamily
3MI2A 4HJFA 3SECA 1V02A 4HHPA 3UCCA 1U1UA 2OR2A 2W67A 4WX2A 2ZE0A 3W7QA 4GG9A 4QQUA 5C54A 2GSEA 3UG5A 3CGTA 2WMFA 4RNFA 3CV2A 2HS8A 1VRDA 1TELA 1SZEA 3PULA 3T8LA 1VFOA 4NI8A 1CIUA 1YPIA 3WCZA 3TFXA 2P8BA 1TRIA 2DVUA 2GJLA 1OX4B 1OG0A 3WD4A 4FOKA 3PZOA 4MLJA 1G9HA 2NV9A 4XTDA 1MRQA 2OEMA 1M5WA 1JRCA 5A2AA 1ZAJA 5A6LA 3KAOA 3VNLA 3K2GA 3S46A 5B7YA 5J04A 3PN8A 4DHGA 4B15A 3N73A 4IIBA 2ZUTA 3SCSA 5ABGA 2BP1A 1KFBA 4EXAA 5JBDA 3OGRA 6REQB 1SZFA 5BXTA 3PB0A 3BGJA 1BQCA 3CWHA 3CQ0A 1M7XA 1RVKA 5C8BB 1UQZA 5BOEA 2GUYA 4ZL1A 3UG8A 4S3CA 1AFSA 4UTIA 1XBVA 1QFEA 9RUBA 2X1TA 3QTGA 4WDXA 2J9ZA 2ATSA 3EKGA 4Q8OA 2OYLA 5AZ0A 3N12A 4QAIA 1TV2A 2OODA 1VBGA 3L4WA 2WKGA 1ISWA 4EK7A 1AW5A 1YQ2A 2FKPA 2CFFA 1M41A 4WJEA 4RX0A 3A21A 4AX7A 1OFBA 3IIPA 4IJBA 5JH2A 2J7DA 1FX6A 2J7GA 5CC3A 2CZDA 1R2RA 1KCXA 4DXVA 1QK2A 3PWAA 4GXPA 4AX6A 3SSJA 4IFKA 2WB5A 2ZYFA 3CEUA 3W88A 3DHUA 3TNBA 2CWNA 1XKJA 1NQ6A 3NQAA 2HK0A 2F38A 2G37A 1A5BA 1GHSA 2VFIA 5H8UA 4PBGA 1FCQA 5ABEA 1NOFA 3H2CA 3UXDA 4LOCA 2D24A 5CPOA 1B1YA 3M0KA 2E09A 3COTA 2PLCA 4N4PA 4L7ZA 3TTYA 3CBWA 4OJYA 3UR2A 4A35A 1V0NA 1EL3A 2QJMA 4DJDC 4GI4A 2WVVA 1QHPA 2UV8G 4LWWA 2ONEA 2J7FA 5IXEA 3WNLA 3BVJA 5LGZA 4R33A 2D69A 3SUWA 3QV8A 3WL0A 3G0SA 3EXRA 3AS1A 1W8GA 1GEQA 1M68A 3NPUA 2DU2A 1W9BM 1GVOA 4RE2A 4YCOA 3Q45A 3CTLA 3G1RA 1XF0A 1X98A 2CLLA 1BWLA 4L56A 3N11A 3VMNA 2VM8A 3MKCA 4LAMA 5CLTA 3DI1A 4O18A 5K9DA 2G3IA 2XIBA 2QCEA 1JULA 1G01A 2WV8A 5D02A 1KQZA 2WMIB 3GYEA 2XH0A 1Z8AA 2C13A 2J25A 3NQCA 4GH3A 5M2FX 1G0CA 3ARUA 4KW2A 2NQ5A 4NHVA 2TAAA 1E73M 2VCBA 3NO3A 3W7LA 4JR5A 1R46A 1B3OA 2ZCGA 1UWTA 2PAJA 2ZICA 3PJTA 1CGUA 5IBXC 1K8CA 3FAWA 4Q4PA 3DOPA 1TVPA 4XBKA 3W27A 4RZ4A 1FWAC 1AQMA 2GQ3A 3EB2A 4DJED 5BRQA 3GBDA 2QYGA 3LRKA 2CWXA 2QJIA 3KTCA 1QI4A 4PSPA 1QNQA 1S39A 3OQ8A 5HNTA 1JIBA 1DWGM 2XUCA 4EAMA 3P5ZA 4KERA 2JEPA 2DVTA 4ZENA 1QOPA 1PEZA 1EC8A 3DEQA 2AL1A 3GXTA 1W5OA 3VABA 8XIAA 4NASA 4Z1CA 2O56A 4PL1A 5KMYA 4JTGA 2A7NA 1BVNP 3UWWA 3B8TA 4Q4QA 4XUGA 1DWHM 3RX4A 3B9AA 1OFRA 4JTKA 2OEJA 3H6OA 4GHRA 3WBWA 1KM4A 2JFEX 2WXDM 2GPTA 3WMBA 4BS0A 4DUOA 4CQBA 2A7PA 1WXZA 8XIMA 1AG1O 3QFEA 1TJRA 3ITVA 5BWFA 4LUSA 4ACZA 5D32A 3VOFA 1VHNA 2PTDA 1H1ZA 3AJXA 4N2YA 3FV9A 3A24A 2R14A 4I8DA 5BRPA 1DP0A 2RDXA 4GBDA 3C0SA 1PZ3A 2ACUA 1E0WA 3R0KA 4JCLA 3N18A 3D46A 1KQYA 4NAFA 5CGMA 1CECA 1LQ2A 1GOWA 3U7BA 4C1KA 3KOYA 4TMBA 2V3EA 1DE5A 2Y61A 5C7VA 4C6PA 1XS2A 5DMYA 1BAGA 1UH2A 4IH3A 1O4UA 1CYGA 3ITGA 5AOUA 1TWSA 1UUQA 5C9WA 3W3OA 2VDIA 4XAYA 5D33A 1QPOA 1NU5A 3PZQA 3GAKA 4JN6A 5DF0A 3SIMA 1V8EA 4Q7NA 4NYYA 4EXQA 3NSNA 3WLPA 3R5EA 4ZB5A 2EJAA 1X1ZA 3VGFA 3AU2A 3NM3A 2PWUA 3II1A 1XLJA 3T07A 2QIIA 2Z2UA 3DKLA 4AW7A 4KIRA 1FOBA 3GYCA 2VL4A 2WBKA 1ZQ5A 3HQOA 1UD5A 4HU3A 3RPMA 4E6MA 3U4AA 3EDDA 3DG6A 3L4YA 1E5NA 3O9NA 2F2KA 4F9JA 4TTUA 4AEFA 2HVMA 1IXOA 1I1XA 3W1NA 1MQQA 3R58A 3ARYA 1WV2A 1X97A 4K1WA 5ABTA 4YMZA 4RKAA 4GX9A 3IIVA 3UG3A 4YVVA 1GCYA 3HGRA 1K6AA 3T0BA 1DTNA 2EGZA 4L6DA 4OE7A 1JZ8A 3D6NA 1DJYA 4MWAA 2DUXA 3CASA 2TSYA 2JF7A 2Q01A 4EWJA 7REQA 3FW6A 1VH7A 4UIOA 1B54A 5CSUA 3BAWA 1Q6LA 3PNZA 4WSKA 3UPMA 2V30A 5HWNA 5IRPA 1QASA 3PUDA 2XVNA 4B3KA 3GVGA 4F0KA 4XVEA 4IPIA 4XTIA 4HNNA 2C3ZA 4DWSD 1LP6A 1RJPA 2VTFA 2QS8A 1XDMA 3OA5A 4OUIA 4H00A 5HK4A 3CUHA 1W1A1 4XZ9A 3HG2A 2W66A 1O5XA 1CXLA 2WNQA 3VUSA 3IGSA 1JXJA 2FZ9A 3KS6A 3EWXA 4ZO7A 5HULA 3P7YA 2Z4GA 4AZ5A 3MKKA 1UZ4A 2ESCA 1P0EA 2CLFA 3N2CA 3TYBA 4DUVA 3NQDA 2VRQA 3OVPA 4K68A 3C0JA 3GWQA 1PCWA 1QW7A 3ITCA 1TMHA 4MZ8A 5HNRA 5EY5A 2Z1WA 1TX2A 3A4WA 2OGYA 4MNMA 1YIXA 4YHGA 1UWQA 4J1OA 2QCDA 4OBRA 2GVEA 1XH2A 1JZ7A 1S2WA 4ES4A 2E28A 1EWEA 3VIIA 4HPGA 1UJQA 3QV6A 3BQ5A 2XH2A 4A8IA 1EH9A 1FBAA 4AC1X 3SZ8A 4FXSA 1S1RA 5HINA 3NXFA 1NIUA 5FJTA 3WDQA 4E38A 2BY3A 3GXMA 1YDVA 3IJIA 4K39A 4CCDA 1TV5A 3PP7A 2I14A 3W07A 2FGLA 1V6WA 3ARSA 1VHCA 1TPC1 1HQTA 1XINA 3NOYA 4QRNA 5EMJA 1HF6A 3KFTA 2YJQA 1IEIA 3OVQA 5HMEA 2WMGA 3VDGA 5J8LA 4GH1A 1AJZA 4E0CA 4P7OA 3VM5A 1MW0A 1Q45A 3IPWA 2P53A 4W8LA 2OMAA 3W72A 1SR0A 2POZA 3OW1A 4O0QA 5BOFA 4B9ZA 3N2MA 1L6YA 2CLKA 1BF6A 4U4MA 1VB9A 4Q8MA 5MKGA 1S2AA 5LKYA 4K38A 4B16A 4YVPA 3SSZA 4HHMA 1S2VA 4HTYA 3KVKA 2QUNA 3M6YA 3NQ2A 3GU9A 3WLMA 6TAAA 2XM1A 3JU2A 2F6KA 1A5SA 1QW8A 2QVNA 3VK5A 3E0IA 2YXOA 3W24A 1XDJA 3B0UX 2Z1SA 1PKMA 4J7RA 8RUCA 1FCUA 4AFYA 3BGGA 3GO2A 4M5PA 3KWXA 2BMBA 5BRBA 1ADOA 2IW0A 3IACA 3K1DA 5CZ0A 2GWNA 1XW8A 5LIXX 3P60A 5CSRA 2RH9A 5HQLA 4Y8EA 1YYAA 4H6RA 3CPUA 3QBUA 4XIMA 2ZX8A 3MS8A 3TMQA 1MFVA 2NSXA 2EPMX 2WSRA 1Z89A 4GO8A 2AGTA 1XPYA 2P88A 1CGVA 3BL3A 2RDTA 3HQNA 1F74A 3LTPA 4CKQA 1GQLA 3ALGA 1BYBA 3CYVA 4CNPA 3T05A 1EOKA 1PHWA 3MBDA 1T8XA 4Z2IA 5LZLA 3RMJA 3EDEA 1BXBA 4JTEA 1QNRA 1V6TA 3S2LA 3BAXA 2A6LA 3GS6A 3S6OA 4RNIA 5KETA 1VJIA 2FTYA 6ALDA 3TA9A 1E4IA 2P0OA 2O4MA 3W85A 2EKGA 2CPUA 4S3EA 5CC7A 1HTIA 1B5TA 3H55A 4MB5A 2EJ1A 3R12A 2NWSA 4ZO9A 2HXUA 4JX5A 3UWVA 2PTYA 1XCXA 2O9TA 3M7WA 1A53A 3BJSA 3PTMA 2QQ6A 1X8FA 1LWIA 3CHEA 1ZLPA 1E70M 3V1HA 3AICA 3ANYA 3GTHA 1AK5A 2J7CA 2BLEA 4NRSA 3MHUA 4JN8A 1B3VA 3RPDA 3N6HA 4TUFA 3PG8A 3WFAA 4DM2A 4FR1A 3K4AA 1LT8A 3XINA 5C5YA 3GUWA 3W23A 1Z32X 3M0ZA 1UKTA 1T6MA 3KBNA 3UWEA 2DZTA 4C6NA 2DP3A 1R3TA 2C91A 2Z6JA 3DECA 1TZ7A 1D3CA 4INFA 3CZGA 4HA4A 2HBVA 4HNTA 4AYGA 1EJUC 3AOFA 3LRMA 1KRBC 2BGNE 1DORA 2FVMA 2V63A 4H3DA 2WSYA 3G22A 2Z29A 3VIHA 5F2LA 1ZBCA 3H4GA 3WBAA 1C90A 1TE6A 3HZ3A 3ZSSA 3CAWA 4FOJA 1F3WA 4QAWA 1KFJA 3TW6A 1O7AA 1OY0A 3NQGA 3WEOA 4YTRA 3PANA 4WLCA 2R9RA 3WEZA 3KCOA 4LB4A 3MHFA 3KL3A 1AD1A 2IPFA 5IDZA 4X3ZA 3ZR6A 5GNYA 3T44A 3W38A 4WOZA 1VIZA 1SR9A 1KLYA 2B81A 3ZJ7A 3OP2A 4G1NA 1ME8A 1OC5A 1W3IA 2VOTA 1TV8A 4C6FA 1Q4NX 3WF2A 4FI4A 4I3GA 1UKPA 3KVMA 4JTFA 1B57A 3GG7A 3QMSA 1PKYA 4DX3A 2R8WA 5LHEA 3VIMA 5EBUA 1Z41A 5A6MA 1J10A 4RE4A 4N02A 4PCFA 4O8RA 4ZFMA 1ADSA 1OHLA 3K30A 5I78A 2FMNA 3TJLA 1D3GA 3A6OA 3OHIA 1GOIA 4LVFA 1TPB1 1NDVA 3W1PA 1KGUA 1W2VA 3ATZA 3KP0A 2TODA 4H7CA 1E1CA 1SFTA 3AIWA 3L21A 2BX7A 4J2PA 3OBEA 1KM3A 3R8RA 3WFZA 2QAPA 4IGMA 3T4CA 2HV5A 2YGYA 4HHLA 3CS2A 3W1QA 4B2DA 1PIGA 3MSGA 4YN5A 3UETA 3DC8A 3W26A 3VX0A 1OCNA 1W3KA 4NL1A 2GQAA 1US2A 4IOTA 4GZEA 3VYLA 1P43A 3N9SA 3T1GA 2I7GA 3PBWA 5CLWA 2ZXQA 3G1XA 2GSJA 2G3JA 1MEHA 3TN5A 4W8AA 2V8ZA 4KETA 1KWGA 1WAUA 1Y8BA 3MUIA 2JKPA 5I79A 1GVQA 3NIYA 3LCXA 2GK1A 4NNAA 4FNQA 1WUEA 2DJXA 4B5UA 1ZFJA 1E0UA 2Q3OA 1EO5A 3UCQA 4FLQA 2E6YA 2BODX 4DNMA 1WDWA 4GQQA 3GB6A 2PDWA 3AWOA 1JPIA 3U4FA 3PTKA 2BSLA 4JTQA 4Q32A 3WH8A 2XJ7A 1SJAA 1GVIA 7XIMA 3MI6A 1WQ5A 5KTLA 1XIFA 5LA0A 3OLGA 3IAPA 5T9CE 1XYLA 1WX0A 4NAEB 2OT1A 4QDPA 4LYKA 5MF5A 2I9UA 4KCVA 4GUGA 2HDJA 4KRUA 5FESA 1QK0A 3C4UA 5HPCA 4IISA 3N4EA 2FPTA 3GVQA 4O10A 2QT3A 3RX2A 3CAVA 4AWSA 3QLLA 4US6A 3GTXA 3TCSA 2VCAA 1V7YA 3VGHA 3TIMA 1IQ8A 4UZUA 3MW7A 2VDGA 3URNA 1B30A 1QATA 1I9CB 1DXIA 2I9EA 2EPHA 5HDRA 3GDTA 1YKWA 3WNPA 3BW3A 3O6DA 2XFRA 3SEPA 3U2OA 3BGAA 3TEVA 2H8XA 2QW5A 4AEOA 2WLYA 3F4NA 3KOXA 2Q8XA 1QWGA 3GC2A 3M0MA 2OO0A 1NVMA 3V18A 2DZXA 1RY8A 4JTRA 1WOBA 5CG7A 3W76A 3I6RA 3PPFA 1PB0A 1VLWA 1AQ0A 1MXDA 2QJGA 3TP4A 1N82A 3MMDA 3TC7A 1JYVA 3OZYA 2DT3A 3B3DA 2EF9A 4HK7A 1R3QA 3I6TA 1IT0A 2G95A 2ZVIA 3WBXA 1ZNNA 3IJ6A 1TTJA 3W1XA 4MM1A 3ZSTA 2XM2A 4PSRA 2HJPA 4WXZA 4HZMA 3FOKA 2ZC1A 3AMCA 2CBJA 5ENLA 4W93A 1FHUA 2GGEA 4ZE4A 3QQ1A 3PZNA 2D1ZA 3NFUA 1W9UA 3IK4A 1TMLA 3N4AA 2C6QA 2V81A 1RK5A 1QNOA 1EC9A 1IGSA 4UNLA 4IPPA 5TQLA 2D0HA 1C91A 3L12A 2GDVA 4IXXA 5C2GA 3KL0A 1QPNA 3VKCA 1PWMA 1EIBA 5DMLA 4O53A 2OYMA 3L5MA 3NQEA 3EZ4A 3C0LA 1YE4A 4LC6A 5LXEA 4EANA 3OBAA 4HNVA 1EBGA 2ZZ5A 1QW9A 5DXXA 3SCWA 1B4EA 2ISVA 4PUNA 4YNGA 2W5FA 5FEPA 3HMCA 2FB3A 3WF1A 2OTDA 5D05A 1H3GA 5D37A 4S3DA 5AHFA 4RPPA 3NQ8A 3H7UA 4HZ6A 4DWSB 1BXNA 3NZGA 4PA8A 3SCNA 3EDKA 3D3AA 4NZ4A 5IDIA 4XSLA 5HMSA 4CD7A 1LBLA 1UOKA 4PYSA 5D4YA 2CHRA 3AZRA 3GDMA 1MYRA 1ISVA 3PY2A 4WEVX 4QE4A 2POTA 2GJRA 3DHPA 4HOZA 4MWAC 4LT9A 2QMKA 2Y8KA 5HJXA 1HJVA 4AIEA 4Z0JA 1R86A 5D2VA 2PWVA 5AC4A 4AMAA 1H7OA 1N55A 1TTPA 3BURA 4MGGA 3UVAA 4PCTA 4Q4SA 4JFUA 4GCXA 3WD3A 1M3UA 3KLLA 3IVTA 2J27A 1NP2A 1C8XA 4QSFA 4FO4A 3TZNA 1EQPA 1UWUA 2OOFA 5TAOA 1A5AA 3OLEA 4E5TA 3KWSA 4NYUA 1P7TB 4S1FA 1AH0A 2DPEA 1C8QA 4CU7A 2ZC8A 2QUVA 3DFSA 2GDUA 5GJPA 2WHMA 4IX0A 3FVMA 3MYOA 2YZ5A 3THCA 3ONBA 3UZYA 5ABFA 1BKSA 3VIPA 4Z1YA 3EMCA 3HBLA 5GQBA 3GFXA 3NDZA 3F4VA 4JEQA 3W2LA 4KWOA 4ZSUA 3WIJA 4HCHA 2DZPA 2OJPA 2JGYA 4GKLA 5I23A 1JF6A 1Q6QA 5LNRA 1FKWA 1BQGA 2WPBA 4Z2GA 3N15A 1XISA 3H2OA 2R1KA 1R38A 3W74A 2VURA 3N34A 5DT7A 1YDOA 3H54A 3N2OA 3UWQA 3EAUA 1NWUA 4V1XA 1UR0A 3E0VA 2GYIA 4K2SA 2VENA 1KW1A 3SUUA 2Y0FA 3RJYA 2GOKA 3VCNA 4KWWA 1OX6A 2WSQA 4IGHA 3FK4A 3LHVA 5K9CA 5I3IA 4GC3A 5HJYA 4DRSA 2E3ZA 2CW6A 4NXSA 4CNNA 2OWCA 3OLIA 4YXGA 3J7HA 2BVYA 4JQAA 4F9DA 4QX4A 4OIFA 3O6YX 2IUZA 3WX7A 1MNSA 1DV7A 1TJ0A 2C18A 4JIRA 3Q4DA 2XSXA 3OYZA 1DWIM 3ZVHB 1EP2A 1H7WA 4ZR8A 3APTA 1W32A 1B3WA 1Q63A 1TB3A 2FGBA 2BB0A 4AG0A 1KFEA 3ARZA 4L80A 3WDIA 4M80A 3C2FA 4J3XA 2HRWA 3BCJA 1LBMA 1UG6A 1FTXA 1IWBA 4W85A 5JQ9A 4LU0A 3HPXA 2TMDA 1F8MA 2EXOA 3TXZA 3B4UA 3R1ZA 3UZWA 1YX1A 3BSMA 5K7JA 1LT7A 3HPAA 5HA7A 4QNWA 3K8KA 4C6IA 1J79A 1SJDA 1Z3NA 1LTDA 3KRUA 4GFIA 3NQFA 4XB3A 4LUJA 5BCAA 4QDMA 2GVLA 3GG1A 1GK8A 1BF2A 4HT3A 3RAOA 2DSZA 3EWZA 4H9YA 1BRLB 1RLCL 1XV8A 3SUVA 3TJ4A 3WBEA 2Q6ZA 2ZRYA 4WJXA 2D2GA 4N42A 5G2WA 5AYIA 3W87A 3M0XA 2GZXA 1DJNA 3M5VA 1NAL1 1W1VA 1BPLB 3C3UA 3MHGA 1K9TA 5F1VA 3LERA 1P1MA 1A3XA 1QVBA 2H8ZA 3AXXA 3VXGA 2DV0A 4ZXOA 3GSMA 1UD2A 1HJXA 3S1WA 3SJ3A 4TX6A 5A69A 3NDOA 3G1VA 1KKOA 3MA8A 3WNNA 5FF4A 2UY3A 2YDRA 3FKKA 4DZIA 4G8TA 3QEZA 4E2OA 4O1DA 5AC8A 3WNOA 1UBSA 2XIOA 4XKYB 3HQPA 1OK4A 2W3ZA 3G77A 3WO8A 3N25A 1EZWA 4TVUA 3AMDA 5FF7A 3W25A 2E68A 3B06A 5EA9A 1EJXC 1IEWA 1YXDA 2PP3A 3PBMA 5EL1A 1IXQA 2E5CA 2ISSA 1K7FA 3BTNA 4UOQA 4B4HA 3VE7A 2NXHA 4G6CA 4FR6A 1Q2RA 2CXGA 1UC4A 3UXIA 3C61A 3AYRA 4LX4A 3GXFA 3QJAA 1R3YA 1CGTA 1CBGA 2QNEA 4H9MA 4B5XA 1XIMA 3VC5A 3R8GA 4CD8A 2PS2A 2VEGA 3BZJA 3QY7A 3WQ6A 4BKNA 3W7DA 2C15A 4J3VA 4K8HA 3CUFA 3MY9A 1ENUA 3ZM8A 3TH6A 2PDMA 1Q13A 3LM7A 4A2RA 1XGDA 3L66A 1S1PA 3LZ5A 2WQDA 4PUWA 4GC4A 3RM4A 5CBBA 4LPCA 4G5DA 1CGXA 2EG7A 2XG9A 3LBMA 2QDEA 3M5YA 1VPQA 4FF5A 4GI9A 4PE8A 2VR5A 4NNCA 2AL2B 3GNXA 5I3KA 4WRHA 5J5DA 3N6QA 4JIIX 3FLUA 2NXGA 1UUMA 4ICMA 3UYIA 4OV9A 1HKVA 3GR7A 4DVOA 2BHUA 3ABQA 1XD1A 1HVQA 3SGUA 2Z2BA 2WC3A 3DGRA 5DANA 3WUGA 3TTSA 1S3HA 3M44A 4IL2A 1UPMB 2ZRVA 5L6UA 3G6LA 1IWAA 1Y0EA 4UQCA 2EPNA 1J0YA 4ZQPA 1R30A 5FJIA 4Q4KA 4X0NA 2ZZ1A 4FIQA 4UR9A 3NL5A 4WKAA 2RHGA 4EF8A 1FDYA 4MB4A 3S9ZA 1B9BA 2FZNA 2YX0A 3BLOA 5T91A 4P7QA 4IF2A 1RR2A 3B03A 4TOQA 1L6GA 1GKRA 2JE8A 2NV2A 3TR9A 1YHTA 4P8WA 1MWOA 1LLWA 4O1CA 3IANA 2IS7A 2FFIA 1OFAA 1Q6GA 1UR8A 4HHHA 1W3TA 1CENA 2PGRA 3RN6A 1TA3A 4QR6A 1OZQA 4UQDA 1H0GA 7TIMA 1PZ0A 1OX5A 4XZBA 1XRSA 1R2SA 1ZBKA 3DN5A 3CWNA 1QPRA 1NTHA 1RK6A 3V4BA 2GJXA 1J8VA 1KGXA 3ECQA 4CNTA 4L5ZA 1ZCCA 3LMZA 2FTWA 4H9TA 2ZVRA 1XLHA 5XIAA 4BQ3A 4QGCA 1IF2A 3R0DA 1W37A 2BOEX 3MUAA 1HIZA 7A3HA 4ZSTA 1H50A 2W62A 1Q4WA 2DW6A 3R94A 3M07A 3IWPA 4DPQA 3H70A 4U2YA 3V75A 2VWSA 3PUOA 3URAA 1REQB 2JIWA 3MV01 2PDIA 5AYYA 5AVNA 4BY3A 1JRBA 3GFYA 3NTYA 4AH7A 3AYSA 4GIRA 3LCLA 3P2VA 2VQTA 2PU0A 1W9VA 4DBUA 2A3CA 4I9JA 1DOSA 2CZVA 4LCRA 5E0FA 1K8ZA 3UA4A 1W91A 1R9XA 5EMMA 1W5MA 4R27A 1EHAA 3VUPA 3GIPA 2CIPA 3IAQA 3CL8A 2PDJA 2F9RA 3C56A 3CUIA 4R34A 3B0VC 3H24A 3QR1A 1PUDA 4DJFD 3EYPA 3M0VA 1FDJA 3UJ2A 3WJZA 1FWCC 3JZEA 1MUWA 3EGJA 4XUYA 4FB7A 4TMCA 5AC5A 1H2JA 2PZ0A 4NJJA 3Q58A 2VNCA 4OQVA 3L0NA 4QDWA 4XZLX 1Q7MA 1EGZA 1XP3A 2HK1A 1JGMA 2X0HA 1LLZA 2KAUC 3A4AA 2FFCA 4GGHA 1JAEA 2RJGA 1UUOA 4IG2A 4LS0A 4QLJA 2B7OA 1WZLA 4GY0A 3M0LA 4L6HA 3CHCA 1ICQA 3RMEA 1RA0A 3QOKA 3M46A 3H12A 3WH7A 4GWEA 4LALA 4AY1A 5FJPA 2Z27A 1IIHA 3G2GA 3DUGA 2GQ9A 3SGZA 4H8VA 2VRJA 3KLKA 3MZNA 3DFOA 4L9XA 1J96A 1O5QA 4Z1BA 1H49A 4QXIA 5I07A 2G97A 1GOQA 2X1IA 3BV7A 3KVLA 3CMGA 4TTGA 3SI9A 1JEZA 3WF0A 3LLFA 2PWGA 4V28A 1ZJHA 2X41A 2Z6IA 5G1YA 1US3A 4GJ1A 4HBKA 2P8CA 4MTVA 4WZHA 1CXKA 1F76A 4DJEA 3GVRA 1HJSA 5KZMA 1YBQB 4PFHA 3SCRA 2X09A 3QXBA 3V0SA 1PJ9A 1EDGA 1PZ2A 4CN4A 5K2ZA 2VRKA 1Q3NA 1TO3A 1BSLA 3HGOA 1OT2A 5JVLA 1O66A 4W84A 1CW2A 4NU7A 5EFDA 4DN1A 4EPEC 3TQVA 3CYJA 5LNUA 1RJQA 1KM2A 1DPMA 1NFPA 4KF1A 4LNYA 4Z1DA 1IGWA 3UXAA 1US0A 3BK0A 4QG8A 3SN0A 3ZWTA 2XIIA 1XWYA 3UD6A 2E6AA 4MKNA 4PC8A 4LY4A 2FHCA 5U4NA 1XX1A 4N9EA 2WNNA 3CUXA 2IKGA 3WH9A 3OZOA 4IMAA 1GW9A 4PMUA 4ICNA 1JCJA 4H01A 2O7QA 5I77A 1KM1A 3EOOA 3ARTA 4UTTA 1GUVA 3D3FA 3S47A 1J2BA 4Y7EA 2VC7A 2W4XA 3OQEA 3BDKA 3WF3A 5M5DA 3A23A 3S1UA 2F6UA 4CLMA 3EEZA 4IT1A 5AC6A 4TVDA 1O1ZA 2HNHA 3AU6A 1MRAA 4PUUA 5JU6A 2WJZA 5HWMA 2YKKA 4LUTA 1JCTA 5DEZA 4AHOA 2BWGA 3KE0A 5A6JA 5AY7A 1SO3A 1ONXA 4Q8WA 1K7XA 1QWKA 2G3MA 1KM0A 4UNIA 3B05A 3IARA 4E8CA 3WQ5A 4IFKB 1C9DA 4QFUA 5A6BD 1JPMA 4LEFA 4L4MA 5M03A 4WHBA 1GG1A 2BOFX 3GAYA 1U5HA 1TQXA 3P80A 4N6FA 1FP8A 4WGXA 5I3DA 4J5NA 3SN4A 3R8HA 1EJSC 5GNXA 5MHBA 1RUSA 4KQNA 1T5AA 2OGJA 5BW6A 4DO4A 3WK0A 3TMLA 2ZIDA 3ARXA 5EGRA 1XIEA 3G1AA 3WD0A 4CNOA 3GDRA 4GNKB 3OB8A 2A5HA 3SFWA 2WVVB 3KRZA 3AXIA 1FRBA 2HEJA 4AWEA 1T99A 4XISA 4ZVJA 2ZA1A 2E40A 3VKBA 5KITA 2WWCA 3KRBA 4W89A 4GJJA 3GR4A 4GUHA 3HGSA 2PCQA 3PZUA 3G18A 3CAKA 4XQ6A 2BDQA 1GJWA 3WELA 1RCXB 2PGFA 4TX8A 3KXQA 4IP5A 4IFOA 1ZL1A 1B3ZA 2ZZ2A 1H51A 3VOGA 1YW1A 4AXNA 2A85A 4AIUA 3RIKA 3WQWA 4H9UA 1GVEA 4BZYA 3A13A 3ZT6A 2V5KA 4KH2A 4CNSA 4QM1A 3W1UA 3JW7A 2H6RA 5A8GA 4WUIA 2EHHA 3LS9A 5CPQA 4IXHA 4KRZA 2QF7A 5A1AA 1XIIA 4Q8NA 3SAZA 2A6NA 3DKJA 4FAMA 2XZ7A 5D9MA 1BWVA 4WSJA 4DWSA 3BAYA 3WFLA 1EPVA 1I1WA 2Q02A 3ARRA 2P5NA 4PUDA 3WQCA 5GVJA 1C8YA 1QPQA 4PBFA 2QPUA 4DBDA 2D0FA 3S1GA 1VYSX 3CUJA 3QM3A 3K8MA 3PBVA 1I2NA 2RAGA 3BOFA 4LAUA 3QGKC 4LVGA 4FALA 4R85A 5F4XA 4D1JA 3WNKA 4KFOA 2WJEA 3DBNA 4Z2JA 3BLKA 4FEZA 5AYXA 3O16A 1TV3A 3FYOA 2YCEA 1PX3A 2DIEA 2PLMA 1KBJA 1KBKA 2WOQA 4Q8VA 1GZ1A 1V08A 3NQMA 4QE5A 3WD2A 5AZ1A 2OU4A 4FLOA 4UOJA 3G3DA 4KT2A 4U31A 1UZHA 1I6NA 3OA3A 3S1XA 5HMFA 3BC9A 1ICSA 5BNKA 3GX9A 3RRAA 1OADA 4DM1A 3PFMA 2OZ8A 4FNUA 4TVCA 4ACZB 4P5UA 3V5FA 2X1RA 3C2RA 1VCGA 1GTEA 1I75A 4LTSA 4US5D 4GI6A 4AVNA 4IGSA 3GH4A 1P4CA 3W71A 3DFNA 4W7UA 4C7GA 4WOQA 1IEVA 1EXBA 5AYBA 3O63A 3LPFA 2YBUA 1NF0A 4NAFB 2PP0A 3OYXA 3HN3A 3CK5A 2R1MA 3VD4A 2Y2WA 3TU9A 4X60A 3VU2A 4H8UA 1U5JA 2JF6A 1FHVA 2F7FA 3GVVA 4N7QA 1F5ZA 4G7FA 3STFA 1EP3A 3TSMA 4PEKA 3ZFHA 5DRCA 4JKLA 2Y88A 5DBUA 1H41A 3F5LA 3RFAA 3W6LA 3GKFA 1NOWA 1RALA 2Y6ZA 1TX0A 3W01A 2FJKA 1VR6A 1ZSXA 2QPXA 3ZYZA 3GNDA 1EYWA 1TUXA 3ZO9A 2Q71A 2YXXA 4FIRA 4O28A 1RH9A 2CITA 3DH7A 2YBVA 4PTVA 4MB3A 5HATA 2ZA3A 1MXGA 2FZBA 4HVXA 5LXXA 2INEA 3FS2A 1OC7A 2R1LA 3SM0A 3W1AA 4CQ9A 1PKLA 2QCCA 1LRNA 5JUVA 2PBGA 1JFXA 3TWBA 2CZFA 1H63A 4M81A 1TG7A 1E4MM 4FA3A 3PBYA 5FL0A 6PTDA 5HQMA 3LXCA 4FZIA 3W73A 4AF0A 2ZRZA 1HKWA 2OSXA 4XBSA 3W7EA 5C2XA 2YYUA 1VCVA 1VFFA 4PMNA 1NDZA 1AW1A 4MWAB 2C71A 3W83A 3BO9A 3OVRA 1MW3A 1S5WA 5A6AA 4E8GA 7REQB 4AMCA 3AXHA 4JL1A 3ORWA 1LUCA 3S5YA 1BRLA 4XBJA 1V0KA 3RF9A 4EVZA 4J3ZA 5A2BA 2J9XA 1QAPA 2BS9A 4XIAA 3VZYA 3I7SA 3FAXA 3K4DA 4LVBA 3UR8A 1XGEA 2ZTJA 4F2TA 2DZAA 2J8TA 3LOTA 3H4WA 3WH6A 4JIPA 3LU2A 1NDWA 1J0IA 2YLAA 5JIPA 4GK8A 3MC5A 4QP0A 1K7EA 2XDFA 1WKYA 1CI1A 2OZ0A 1UQYA 2PDGA 2NQHA 4UMBA 2B7PA 2CCRA 3PWIA 1HP4A 4CN1A 3ME3A 4P61A 1E5JA 3VFLA 4JDYA 3P81A 4B3LA 3VA8A 1OB0A 3KUMA 2REQB 4MPKA 5EPDA 1JFHA 2Y4SA 2YL9A 2C1GA 2E9LA 4HKPA 2QCDB 3W1LA 3WQ8A 5A6KA 3MP3A 3EOLA 1KNWA 1NARA 2HWGA 2PSNA 2OQLA 5D8WA 1DEDA 3R4IA 3S5ZA 1ZU8A 4GZIA 1EKOA 3W7CA 3WUBA 3H2FA 3U7VA 1HL8A 2Y5EA 1J6PA 2Y85A 3F2DA 1B4KA 2A4AA 1DJGA 1TWWA 2WHLA 1V0MA 3B8DA 4JFSA 5LNWA 4I9MA 3W7PA 3NEHA 3VGDA 3UEQA 4KWUA 1S2CA 3QKZA 4EX4A 1SUXA 3VNMA 2VJXA 4WJ8A 2PDBA 2HXTA 2PD9A 1XM3A 2AGKA 2XIMA 1BVWA 3MYPA 2WMKA 2YSWA 4U33A 4D9PA 2FH6A 1G7VA 2JALA 4AC7C 1OBAA 1SW7A 3GHUA 3UJRA 3NPVA 4HB7A 1D9EA 5MKGB 3WDPP 1UD6A 5F2GA 1UMYA 1RQEA 3DDMA 3LLXA 1L6FA 3A22A 3MU7A 2VKZG 1E1FA 3IVUA 4NJIA 1JQVA 3QW3A 3AMKA 2QJNA 2E9MA 3DIPA 1WDQA 4DYEA 1V0LA 3VDAA 1ZS2A 2VP8A 5U7SA 4ERGA 3B9NA 1F4HA 4MY1A 3V1PA 1AJ2A 3LUTA 4C6EA 4GUFA 2VHLA 2CBVA 2WC4A 4KESA 2A3EA 3LLDA 3VIGA 2Z25A 3I6EA 1OGSA 2YA0A 4ALDA 4MFEA 3VPLA 4ZB2A 1FWIC 5TD4A 4UC5A 1E9IA 2V3DA 3U0HA 1XYMA 1DBTA 1H09A 3H2NA 4LYPA 4ZO8A 4YVXA 3G8RA 3IEBA 1E55A 1OK6A 2WVUA 1LOSA 1PPIA 1XUUA 4H7ZA 2JEQA 2QF8A 1XR2A 1UIOA 4C6LA 2INFA 5I0DA 4H6EA 3EOEA 1IR2A 2EQDA 3H53A 3VAVA 4O15A 4CUCA 1UPPA 3WLQA 2J66A 3O0KA 5AECA 3TQPA 1NOUA 5JH1A 3R6IA 1DJIA 3O0FA 1OVDA 4MY9A 3MMTA 3VD5A 1SZNA 3ABOA 3PBUA 4MAVA 4EAYA 1KR0A 2WHKA 4CQDA 4CVWA 2W27A 1BYCA 4PUKA 1TPWA 3EX1A 1AQHA 2VDHA 4WKHA 1B3XA 3V36A 1EWDA 2Y8UA 4E3VA 1KKRA 4UTLA 2A1YA 3BAIA 3AMGA 4ZBCA 4XK2A 2IKHA 2CBUA 1Y5VA 2P3ZA 1E6PA 1UR9A 3W7JA 3L4XA 4DUWA 3IIXA 4XWUA 3MBFA 3HA1A 1PX8A 2PDHA 1KFCA 4Z2HA 1WCGA 1M6JA 3KOFA 4UOZA 2GJPA 4W9TA 3DHFA 4ZTYA 3GK0A 3VKJA 1BVZA 3E1F1 3H22A 3BH4A 1P48A 3GW3A 3W9ZA 1REQA 2ISWA 3QLDA 4DZ5A 3TQKA 5IHSA 1P6CA 4HGXA 2ATMA 4PMJA 3NYDA 1G4PA 2ASHA 1O1HA 3VIJA 1T40A 4PTNA 3GVWA 2VR4A 2GUUA 3T0DA 4UTHA 3Q37A 5E9XA 2V3FA 4OECA 3PB2A 4DJEC 2Y7GA 2XINA 1V3HA 1ZENA 4L9ZA 1J5SA 1WBHA 1UP3A 2D3NA 4HCDA 5LHFA 1TR1A 1XSKA 1JZ5A 1R3VA 1OIMA 5IHRA 1C7TA 4KWVA 1HJQA 5EMLA 1F3TA 3K1GA 3AHYA 4PB5A 1EX1A 1X6LA 3GIQA 3T2PA 3N04A 3NOEA 5KZ6A 3VIKA 3S83A 2Y5JA 4LF2A 2H3DA 1A0DA 4B4FA 2I5GA 6A3HA 1UP2A 5HAOA 1E0XA 1V3KA 4P8VA 4QE1A 4C6KA 3MDWA 5EKYA 1BGAA 2X16A 2FVKA 2PA6A 4A2SA 4PMYA 3QR3A 2ZQ0A 4ATWA 3SCQA 5XIMA 2XH4A 3B8VA 4UTTC 3YPIA 4FHAA 2PDQA 1T0OA 3UY8A 3W7IA 4IZGA 3MT1A 4O1FA 3ZS4A 4GOAA 2HNEA 1M53A 2QJJA 4IIEA 3QVQA 1OGGA 1K77A 4KEMA 1XLAA 4NX0A 1X38A 4Z2LA 3UJFA 4EWND 3LBOA 2J77A 1TZ9A 4NRRA 3PR2A 3A12A 4AD5A 4IIFA 4NJHA 5A8NA 1TCMA 1HO1A 1DHKA 1V51A 2XSBA 4MDPA 4AZBA 3E6EA 2WSPA 3EWUA 1SFSA 4O0KA 4GVFA 1D3HA 2FMOA 1TIMA 4W87A 4RNJA 1VGAA 1E1CB 1H60A 2YDQA 1NM9A 1XLLA 2I17A 4XSMA 1G6CA 1YBQA 4MPQA 5C0QA 1IT8A 2VYOA 5CZSA 1ESWA 2WBGA 3DZ1A 4FSAA 1CTNA 1TCDA 3HO8A 2QAFA 3NWRA 2PF0A 3BJFA 2G5WA 1OCBA 4FLRA 1J4EA 2OQYA 1YDNA 3AIUA 2WKJA 3O6CA 1MFUA 4L64A 5CJNA 1WDPA 3SW6A 4K8EA 3CPRA 1W9DM 3ZLGA 1J12A 4IMGA 2PRMA 4XG1A 2BHZA 4G1KA 2J24A 2BZNA 5DQPA 2ICSA 4TV5A 3VD7A 1QI5A 4D6FA 4HU4A 4MY8A 1FFRA 3ZR4A 5D2WA 1FCBA 4NT0A 5LIUX 3IGUA 3WK1A 3LPOA 2F6XA 2UZ9A 2ZADA 5AB3A 2NQ9A 2F84A 3WQPA 2GK1B 3OU8A 3BLFA 4S2BA 2ZWZA 3WH5A 3L4ZA 4C7DA 4HPXA 2YDSA 2DVXA 3IRDA 3GU2A 2FLIA 3EOSA 1EXPA 2NT1A 3GC4A 4ZQOA 3RG6A 3UT0A 2RUSA 2ZZ3A 4JKKA 3OBKA 3HJZA 5DCDA 4C6CA 4PN2A 3KOWA 2I57A 1WA3A 1P5BA 4X2RA 3DG7A 1GNXA 1R0MA 3IUIA 1E3XA 2QKFA 2O55A 1TV4A 4I7WA 7CGTA 1QOQA 3WY1A 2OXNA 3H26A 1KFWA 1ZAHA 2Y63A 4RDWA 1I8JA 2ZOXA 4E4FA 3MJYA 4LB3A 3WQVA 4AZ7A 2NVAA 3PPGA 4UMCA 4DWSC 5AHMA 2HTMA 2ZDRA 3SDOA 1RBAA 1C9WA 1VPXA 3LSBA 1W8SA 3W00A 1DIKA 3CB3A 4RXFA 2GDQA 3BW4A 4QJ5B 4DO6A 4S23A 3LENA 3QGAC 4GQRA 2NZLA 4GXMA 2BTMA 1W17A 3N1AA 3KHJA 4E8DA 1WB0A 5ECUA 4G2DA 1TUFA 1VIWA 3NR0A 4JN7A 5HWJA 3VX1A 1J11A 4M82A 3LX9A 4M19A 5C9ZA 1W3NA 2G0WA 4PUJA 2WLZA 1LDCA 2C79A 1WDRA 2FIQA 3WLSA 3IVSA 3N9KA 1PS9A 2ZA2A 2PF8A 2JKEA 3KCLA 1VS1A 1SMAA 4F2UA 2DGAA 2PUZA 3VNDA 1OFOA 5A5WA 2OWXA 4JTLA 2W6RA 2OT0A 4DI8A 1TKKA 2YW4A 4BF7A 1XLBA 1J0ZA 3ABSA 4PTMA 4BA0A 4FXFA 3RJXA 4DYJA 1PTGA 1F05A 4TV6A 3MP5A 4LS2A 1MW1A 4GY7A 3LBCA 1XKYA 2WCAA 1JPHA 3BQ6A 2Z24A 3NSXA 1HGYA 1D7FA 2X40A 2YL6A 2DH2A 2WCSA 3H21A 2XWEA 5JBFA 3ZXWA 1UROA 4JCMA 1UD8A 2VD8A 1QNVA 1DWAM 2VD9A 2BY1A 4ZA0A 1W2PA 3NQVA 4L6OA 4PCNA 4X9SA 1Z48A 3HG4A 3MCMA 3ZMRA 5CSSA 2JBMA 2HPIA 3BXWA 3O06A 5IFPA 5FACA 3CHVA 3POHA 5E9AA 5DMNA 1W1IE 1QR7A 2C19A 1AL8A 4LS1A 1UWSA 1KM5A 4R3UA 1CCWB 4JHOA 4BWLA 3GNRA 3B0PA 3JS3A 1P1XA 3RK8A 3U6WA 1X1NA 2YLLA 1IE7C 4NZCA 3MB9A 3TKFA 4ZZ9A 2CNCA 1LQ0A 2DY3A 3AXKA 3MUZ1 4CEUC 3CLWA 1HL2A 4GUJA 3I3BA 3MUXA 3KTXA 2V67A 3QPEA 3NJ3A 2XN1A 4PMVA 3P14A 4UCGA 3K5XA 2Y70A 1HKJA 1WAWA 3KZSA 4F2BA 4NG3A 4UQEA 3MWAA 1SMDA 4Q4OA 2PTZA 2J79A 4M1BA 1QI0A 1TREA 3CM4A 1XQKA 4B90A 3VOCA 3WYZA 4LFYA 1Y5XA 1CGYA 1A50A 3R25A 4GBUA 4L1GA 4JFVA 2UY5A 1EF2A 2VX4A 3WLOA 5CAKA 4XZWA 5JXQA 1W3LA 1UP0A 1BXCA 2VT0A 3UY7A 4GI8A 2EEXA 1PAMA 4JNYA 3GHRA 1RV8A 2FJUB 1GORA 5E70A 1PE1A 2QGHA 1DJXA 1RCQA 4QS6A 5A2CA 5KZDA 4C6DA 1Q6FA 1W6TA 1E6XM 2WVTA 4I9AA 3N14A 1KB3A 1WO2A 4ZMGA 4IICA 2ADAA 1UZDA 1PL9A 3H8AA 3QFWA 4V15A 2OLHA 5A8QA 1OG6A 1DQUA 3TROA 3TN4A 4PCSA 4DEFA 3RLHA 3V7PA 2VMFA 1XFBA 2AQVA 1RBOB 4CEXC 4LJ3A 3SCOA 1Z6KA 2DSWA 4EOUA 5CZKA 1W3JA 3ITYA 4AZHA 4D6JA 3TJIA 1A0EA 3N2XA 3HIJA 1ZBWA 2I1OA 1YXYA 2XN0A 1H62A 1QU4A 2PWDA 5H8MA 3DXIA 4PMOA 3BLPX 1SJCA 5G4WA 1CDGA 1ZUAX 5B80A 3TZFA 5ABFB 1JJKA 2DIJA 4QIUA 1ELSA 1F3XA 3PJXA 4M24A 3MSRA 1A5OC 4UTJA 1E6SM 2QVHA 1CXHA 1ZRQA 4KFPA 1H1NA 4S3FA 1XSIA 1XQLA 1B0IA 3OO2A 3R79A 2YFOA 1P0DA 4H2HA 3EWBX 2XFWA 1KFLA 3RUBL 4FLSA 2BVWA 2E77A 2P10A 4GQBA 3PAJA 1O5RA 3C5QA 4PTWA 2DZVA 2DUAA 5C9XA 3ID7A 2A3LA 2QLYA 3TTQA 4POCA 3B04A 1SFLA 3MV11 3TAKA 1XGZA 3VILA 1LOLA 1FXQA 2YPIA 3PK7A 2Z1KA 4UFJA 4MMWA 1A5NC 4JEJA 2WNWA 1RPKA 1NP0A 2FDMA 3M1ZA 2PDCA 1XLCA 3EB3A 4JS3A 4JTIA 4CU8A 5JMUA 1CX9A 1VENA 2BY0A 1BKHA 2JGQA 3TTOA 1XJBA 4AD2A 1ZALA 3TUUA 2Z00A 5E1QA 1TVNA 1UIPA 4O13A 3W2NA 3W2UA 1M04A 5CPSA 4F40A 3WUFA 3CV1A 3HPZA 3PZVA 2XHYA 4FOUA 3CT7A 5C2CA 4Q4MA 3ZIZA 4S2CA 1UJPA 4O54A 3U3HA 4Q6XA 4Z0SA 5BYWA 5I09A 1OCJA 2AQWA 3QZ6A 3MVIA 4GINA 1Q8JA 1TWDA 1M7PA 5D04C 3TDFA 2IQTA 4BEUA 4Q8TA 2I16A 2REQA 4ECLA 2YCLA 4ML9A 1GYLA 3BICA 4BQ5A 1HKIA 3P61A 3TVAA 1CEOA 4HJWA 1YADA 3P0XA 5F7UA 4UR7A 2QDDA 1HXJA 4RLIA 4DLMA 2VEPA 3HV9A 2TRSA 3I3EA 4PTXA 1W1YA 3M64A 4O14A 3MJMA 3W28A 3DI0A 1KBIA 4C7FA 3CZEA 1HW6A 4R9XA 4A8LA 1HFBA 2A3HA 3D47A 3NVDA 4F0LA 3CT2A 4JL2A 4HA1A 4ZTXA 3WLHA 1BFNA 2UWFA 4PODA 3UZ5A 2ALDA 3G1YA 3PZTA 4AHPA 2PRLA 1JCXA 4HU8A 1V03A 5HPOA 5FJUA 3BWWA 1HKKA 2YXGA 5KINA 4PB4A 3NQ7A 1EJ7L 2YA2A 3C6CA 3LEPA 1K9DA 4I8YA 3FGCA 4RDZA 2Z0IA 2OKTA 4DQWA 3NO1A 3E2RA 5FA5A 4HSOA 1ZAIA 4LBRA 2QV5A 1WKEA 3VE9A 4ZODA 4GO9A 3TJXA 4BI6A 4LEQA 5BXPA 3CLMA 1GYNA 1GWJA 3NVTA 3W70A 2X0YA 4JTDA 1QO5A 4Q8QA 3G8EA 1MQRA 3NGFA 2QZRA 3ZLFA 4DJFA 3C0QA 1HKMA 3AMLA 1HT6A 4XD4A 1OJXA 3TWAA 3W6YA 1V6YA 1I45A 3PG9A 3FYYA 1V6UA 4JFTA 4WXYA 3CPGA 1X1OA 4KFNA 3UNTA 4RW5A 1TPEA 3CQKA 3PUEA 1E9ZB 1DIEA 5REQA 1G1YA 4IQJA 2PZNA 3FCPA 2WM0A 3TW9A 5LIWX 3CQIA 5HR6A 3F7JA 5J5RA 4A3UA 3GZAA 3RCMA 3L0GA 1F73A 2QGYA 3LPPA 1SO4A 1UH4A 5K4XA 3A4XA 4GXWA 1ISZA 4RZ6A 3W86A 4BFAA 4ML4A 4S3GA 2ISDA 4YTTA 3MMUA 2OELA 2PWHA 1RJRA 4HOXA 2O9OA 2WHJA 3M43A 3WQEA 2YL8A 2P3EA 2Y7EA 2DT0A 4QJ3B 1VJSA 4NZJA 1GOMA 2BXVA 2VX7A 3WL1A 4OU1A 1B90A 3VNKA 3BLIA 3F03K 4RXGA 5DBTA 1JAKA 2FDSA 1B9ZA 2V5CA 3RGTA 1I2QA 4MJZA 3Q94A 3MQTA 1JNEA 1JNDA 2VZUA 4ZQNA 3BUVA 5AVHA 4LW7A 3VKDA 2C8NA 5TIMA 4MJMA 3LNPA 1K1DA 2ZKMX 3T0AA 3WJSA 4Z17A 5F1UA 2OO6A 5LSMA 5H8PA 3G6MA 4H8NA 4OTKA 3UR5A 3DYMA 2AQOA 4XO6A 2PE4A 1XCFA 1ZJIA 3PM6A 3C8NA 4LV9A 2OZ3A 1GKPA 3IJ9A 1TA3B 2XU2A 1DQXA 2BNJA 5G5IA 1XPGA 4ERAA 1GT8A 4XVDA 4ZQCA 4NKCA 3A64A 1EJTC 2G3NA 4R7WA 4CD4A 2P1FA 1L2UA 4H04A 4MUZA 4UMAA 2GJXB 3C8FA 3VDBA 4CGTA 1AJ0A 3FY1A 4HK6A 2FGZA 1DJQA 3BOXA 3GY1A 3EA2A 3OEXA 3W84A 3EB4A 1AZ1A 3BLEA 1ME7A 3F1QA 1A47A 5GJNA 1XFCA 3QYQA 4QNEA 4JIEA 4A3QA 4GISA 2GGHA 4V33A 3RM9A 1QUMA 2C14A 2FPYA 4JBRA 4WKFA 3TK7A 4IJCA 3WMSA 5HUPA 3OZPA 4GABA 1POKA 2QCMA 4XKMA 1JDFA 3W7HA 1EJRC 3I7QA 1R2TA 4HMEA 3UWYA 3UQNA 4F0MA 1KO0A 1I2OA 1K02A 5M3WA 1U2YA 1JUKA 4LV4A 1FWSA 1X7IA 1JCLA 4Z08A 1LJYA 4IP7A 5FAJA 1AW2A 1WOAA 1POJA 1U83A 2V2CA 2GVGA 3GXIA 1PO9A 5A6BA 4ILSA 3VCCA 2VX6A 3IV3A 1PWLA 5AHEA 2EPKX 4J3UA 4AWUA 3BAKA 4S3JA 2WW5A 1S3TC 1XYCA 2EPLX 3ANUA 3BJTA 2ZUVA 2ZRXA 3FFSA 1W9XA 4C6OA 1T41A 3WKZA 4N4QA 3L68A 4M6UA 3ERPA 4W5UA 1UD3A 4KPLA 1UCWA 4JICA 2DW7A 3AYVA 1FWDC 1QHZA 3ES7A 5TF0A 4HA0A 3NNTA 3Q2DA 1AMYA 1E3ZA 4ZOBA 1FHLA 1CGWA 3V3WA 3I7RA 1EUNA 1R3SA 4HD5A 5GNZA 1K8XA 1K70A 1OWQA 3PVFA 4WY0A 3TR2A 2XWDA 4U10A 5CCZA 1N2VA 1V77A 4IG2B 2ANUA 4MNKA 1MDLA 2PDUA 3E2VA 1F6PA 1QI3A 1HX0A 3VO0A 3VOHA 4ICCX 1GOXA 3SB0A 4Q7IA 1LQAA 1OSEA 1PZ1A 5IM51 3NA8A 1DJWA 1VEMA 4R88A 4FXRA 1KM6A 4HA3A 3LQLA 2R82A 3T4WA 3OGSA 1LG1A 4NZFA 5HNNA 4YCPA 2WC7A 1S2TA 2FH8A 1LWJA 3KBWA 3T7VA 3FEMA 3VTRA 3PZIA 3BMVA 1MZRA 2PTWA 4MYAA 1UKOA 4HPJA 1TVLA 4XZNX 3USZA 3K4WA 3AZTA 4PRRA 1Q65A 1ITXA 2YYTA 2AKMA 4IM4A 4UTWA 4C90A 1R7OA 4GVHA 2XVKA 3HG5A 4U3CA 3EWDA 1J6OA 5BMXA 1ZP3A 3BPWA 2GVYA 2ZX6A 3M16A 4HN4A 5G2IA 3SADA 1ONWA 3LB0A 1FWJC 2EPOA 1H0IA 3VGEA 1J01A 2HVNA 2DZBA 2V5DA 3ENLA 3ZOAA 3FN9A 1FQ0A 4I5XA 5T9BG 1OIFA 4C1NA 1LRTA 4FXJA 5H2ZA 3ITOA 4A6GA 1THFD 1CLXA 4W5ZA 2NLIA 4D71A 2R1PA 2VEKA 4X61A 3CAQA 3T0TA 1NH6A 4MFDA 3EOUA 3UW6A 3P8JA 3WLRA 3RCYA 2FHFA 2Y8VA 2YR1A 5FI8A 1U33A 1K9FA 4NJGA 4JY9A 1JZ4A 3AHVA 3BAJA 2ZUNA 4ONVA 2VUYA 5T8GA 3L67A 2NQLA 1JI1A 3PSWA 4YTQA 3UBPC 3GIYA 1AMKA 4IPLA 2C7FA 3S8HA 1NJJA 3FXGA 3FXYA 4ROQA 1J2WA 1R8LA 5D38A 2OZTA 3LM3A 1XBYA 1OD0A 1GHRA 5K9XA 3S2JA 3PUGA 4US5A 1DJZA 2ZRUA 1XBZA 1DWFM 4GIEA 4BWLC 2A3BA 3HURA 1MQPA 4QITA 3W1TA 3FSUA 4K37A 5CSYA 2XVPA 4HYVA 4MLRA 3FHAA 4LUTB 3ARWA 1QMLA 2OX4A 4WF7A 2H9AA 2IPWA 3RLGA 3S5SA 3RXZA 4LAKA 4S3BA 4AY7A 2WZMA 2GSHA 2QR6A 4L4LA 4PZVA 5E09A 3BG3A 3L65A 3M5XA 3PPHA 2HS6A 2EKCA 1B2YA 1DTUA 1QOXA 1V3MA 2G4FA 3H2MA 4H7VA 4KKXA 1LF1A 1FKXA 3GRIA 1LBFA 1ZB5A 3IJQA 3IJ7A 4JTHA 2VFGA 1KTBA 1OF8A 3HG3A 2QJHA 4UTKA 1CXFA 5C9UA 5L9FA 3OG3A 3SCTA 3C3NA 3RLVA 2WCGA 2Y62A 2ALRA 2ISFA 1QRQA 4D8LA 3WSUA 2VOMA 3SBFA 5FJJA 2Q09A 4Q8PA 5IOBA 1F9CA 4A8NA 4O1EA 1L8PA 1VD6A 1T7LA 2OLAA 3T0CA 1KRAC 4RV3A 3QHNA 5FJRA 4WDTA 2NV1A 3GNOA 5D2TA 1QI2A 4PGLA 1UWRA 4BQ2A 4B9YA 1C3FA 3WMLA 1E9LA 4JY8A 4DBSA 3PZ9A 3QW4B 4E2BA 3W2MA 1JVNA 1PYFA 5H91A 4XD3A 3AJ7A 1PIFA 2DZUA 2W63A 3ANVA 3ITXA 4JTSA 3M0JA 3L7RA 3KZPA 3UNDA 3E2QA 4XO7A 1PDYA 3FVDA 2VELA 2WSKA 4O0ZA 3VNIA 3L2MA 2V2DA 2V5LA 4XZMX 4C5YA 2OQHA 3EWWA 2ON3A 1VCFA 3NEVA 3RNDA 1XLGA 1PCKA 2IKJA 1UWIA 3WD1A 4WD0A 1UC5A 1E6ZA 3VVGA 3WQGA 4MIMA 1E6NA 2X7WA 4O57A 3CZ8A 3AAMA 4CQCA 2BY2A 1NFGA 2A21A 3HPFA 1GVSA 3GE7A 1ZPTA 1Z42A 1S5MA 2VZOA 4M7TA 2V82A 3LCHA 3NM1A 1WKDA 2QUUA 3QN3A 5F2IA 3GDKA 4RZ5A 4QCEA 3NL6A 2V5BA 3WJWA 4IQEA 3GM8A 1FA2A 4KRTA 3CUZA 3VKKA 2G96A 1OFDA 4CCZA 3E5BA 5H1WA 3OLDA 3T42A 4JTAA 4N0RA 3K8LA 3EMQA 3JRKA 1JCYA 2DSVA 5LA2A 3G5EA 3TW7A 1PHQA 2YW3A 1FWRA 2WNZA 3LTYA 1F4AA 4AEEA 2YZRA 3A5VA 4AZ6A 4JQ4A 5HOSA 4DPPA 4QTGA 3TYUA 3P6LA 4M3PA 2E7FA 1SYTA 1YNPA 3WZ0E 2OVLA 2A7RA 5EMUA 4K7VA 1F6KA 3S0CA 1EZ2A 4JQ1A 1PIIA 1XI3A 2KZHA 2J7BA 3APYA 3QSTA 3EPOA 1GQIA 1LG2A 1QO2A 1VP5A 1VYPX 2Y7DA 3G0UA 4N6EA 1SFJA 1LL7A 3V0TA