4DO4A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 130
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do4A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do4A01
5DO8A 2QLYA 2NUYA 3KL3A 3DZ1A 3HOJA 3D4ZA 1O95A 3LXAA 4HIBA 3A21A 3NL2A 4UFJA 1SO3A 3MW7A 3EDKA 4Q4KA 1CYGA 1VB9A 2AMGA 4UTLA 3STFA 4JICA 3W7KA 2XWEA 3CHVA 1OT2A 3P5ZA 4O50A 4WXYA 5D09A 1FBAA 1PCKA 2A5HA 3S1UA 1BVZA 3IJ7A 2GOUA 3QW4B 3BW3A 1XUZA 1CI1A 4JGDA 4U31A 4GKLA 5EMYA 1LRNA 3PAJA 1LOQA 5EBUA 1SU5A 2FPVA 1JD7A 4JFSA 1J0KA 2WSRA 1LWJA 2NSXA 4JEQA 2GQ8A 3C2FA 3DHUA 1UA3A 5E6ZA 3GR8A 3W3OA 4O1CA 5LKYA 1MW2A 3HJEA 1SR9A 2DIEA 3TA6A 1PPIA 2EF9A 4AWTA 4POCA 5C6MA 4H7VA 1G94A 2VEMA 2VT0A 3STCA 1JCLA 3S2CA 3OG3A 3DC0A 1BEUA 2YX0A 3VGDA 4JTUA 1QI5A 4AMXA 3UY8A 1I75A 4UZSA 3ANYA 3PY2A 3LCWA 2QEZA 4GUJA 3KL5A 2ZE0A 1H7OA 3R12A 3OLIA 2A6NA 4UTWA 1Q6RA 5BNKA 3P8JA 3LCIA 1JI2A 1SW7A 3WY2A 2PCQA 3TUUA 2BZNA 3NZ1A 1ODUA 4DO4A 4MY1A 4DBEA 4C1KA 1XSJA 1Z32X 2CLLA 5I3JA 4K7YA 2Y4SA 2YOCA 2Y7EA 2ZX6A 3B8DA 1VHNA 1WDWA 1ZJBA 2QJIA 1KCKA 5BMXA 4UXDA 4AB4A 1D3HA 5AYZA 5I3HA 3RK8A 1IZJA 4UCGA 4H8HA 3G1HA 4XBKA 3NQVA 4O17A 1LROA 1TTJA 3D50A 6TAAA 2X2JA 5FEZA 1YADA 3BGJA 3UWUA 5G4EA 4JTIA 1W9XA 1UA7A 1JIBA 4FF7A 2VOMA 4UNLA 1XC4A 4UFMA 4UC5A 2A1YA 1DORA 1QR7A 3N2MA 1L6YA 2P0OA 3KRUA 1LLWA 5DELA 4CQAA 2G3MA 2B7NA 5H91A 5KZDA 3EJSA 5CPOA 2QUVA 2CZEA 3DX1A 3VI2A 1QMLA 3HIJA 3CZNA 3G1DA 1HL9A 1GTEA 3FJ6A 2WNQA 4KFNA 1I2PA 2OX1A 3LB0A 1A47A 3W9ZA 1LLZA 3W1RA 1TREA 1PHWA 3DFNA 1JD9A 4EOUA 1H3GA 1KM0A 1HG3A 1KTBA 3PULA 1HFBA 1LORA 4DO5A 2QDHA 2ZZ6A 3ZR4A 1J5TA 2PWGA 2Y89A 2ZXAA 3LPOA 3ELFA 4RKAA 1IXQA 1JCYA 3RNDA 2XVGA 4HT3A 3LV6A 1KFEA 3L5AA 4UTWC 2PRHA 4JTSA 4EF8A 4LS1A 4NU7A 4QNEA 3P5YA 3INPA 4U3CA 4RCXA 2QMKA 4Y8FA 2ZICA 3PSVA 1Q3NA 1LRTA 3UWVA 3IIOA 1VLIA 3HJZA 1B9BA 1ZAHA 1HT6A 4JCMA 1ZAIA 3HO8A 1PAMA 3KLLA 1PIIA 4WQ6A 1JULA 2J9XA 5A8GA 4CLMA 1HVXA 3CM4A 2RKXA 1LCOA 1O5XA 4DEFA 1W5NA 3WNKA 1BPLB 2F61A 3NPVA 3W75A 4H2CA 4ZVJA 1XCXA 2FFCA 3CWOX 3LI0A 3U2OA 1R2SA 1W3NA 1CPUA 4LOCA 2GJNA 3UCQA 1EP1A 1HWWA 5EL1A 4LVAA 1UKQA 4JYFA 3TOPA 3ZFHA 1BWKA 3NR0A 4IWWA 1UASA 1VYPX 2BSLA 3LRMA 3C2EA 5AOUA 1K03A 2QV4A 3S1WA 2F1AA 4O14A 4O12A 5U7SA 4GFSA 3WFZA 1BKSA 3KVKA 1KM2A 4NQ1A 4LVDA 5BOOA 1TV5A 4EVZA 1KM5A 1H7NA 2WCGA 4MZ1A 1BWLA 1F7BA 1OFRA 4BI6A 4CQ9A 5F4XA 1LBMA 3BAXA 3DU0A 5CZTA 5HUPA 3S6DA 4GINA 3AMKA 5DLCA 3EB2A 4QM1A 2X1TA 1LOSA 1LYXA 1GVFA 1X6UA 4Z1CA 1OSEA 3BW2A 1KXHA 3CC1A 3GIYA 4WLCA 4FX8A 1ZAJA 1H7RA 4JDBA 2HS6A 4AEEA 2XN2A 3C6CA 4PL1A 4R34A 1FCBA 2Q8ZA 2X2HA 3ZSSA 5HR6A 4MUZA 3Q58A 3LGEA 3WFAA 1QCWA 1HL2A 4J27A 4GO9A 3WJWA 3GAYA 1ME7A 4H8VA 2CLHA 3HG4A 1FCUA 4DF2A 4QNWA 3LRKA 4JYEA 2J6XA 5FF4A 2BX7A 4PFMA 1OFBA 1DHPA 2OMAA 3PBVA 2YA1A 3NM1A 1EHAA 1UD3A 2CLKA 3IIPA 2ABBA 1MFUA 1FDJA 2B7QA 1XM3A 2QAPA 4X9YA 3GVGA 5CZJA 2OYMA 3S5ZA 4P61A 4MZ8A 4LV9A 1KFBA 4RR4A 4CQ8A 1HXKA 1GQNA 2Z2UA 1G4TA 1AW2A 4HP5A 4CCDA 1RP8A 3TK7A 5HUOA 1SZFA 3C2RA 3L21A 1GT8A 1K8XA 4AF0B 3DDGA 2QJGA 2D73A 1VR6A 1MEWA 3G3DA 1K8YA 1MXSA 3QQ1A 1H7XA 2GVGA 2F2HA 1TQXA 2W79A 5D2TA 5KITA 1QOQA 1ICPA 3CZLA 4ZMGA 3W7CA 2GQAA 4Y90A 1KBKA 4AIEA 2I1OA 3WK2A 3IIZA 1WYIA 2ZTKA 3HMJG 4QQ3A 4O54A 3VX0A 1SFJA 4JFVA 1MWOA 1R34A 3CLWA 3NPXA 2OYLA 1TJRA 4QITA 4J3XA 3W7DA 5K3VA 4WSKA 4Y6GA 3B0UX 5FEPA 4AYGA 1JJKA 3MI6A 1TB3A 3UG5A 1QPNA 2CFFA 4ZQOA 2WNZA 1UKTA 2ISSA 4K7VA 3NL6A 1LDCA 2ZZ5A 3L4YA 1XGZA 1W5PA 1M7OA 4UR7A 2QCEA 4Z0SA 3BH4A 5CPNA 4JTHA 1DHKA 1J4EA 3WEOA 1FXPA 3OIXA 1Q6OA 2FHCA 1QI3A 3G8RA 1KFLA 1W8SA 2V9DA 4NJJA 4JN6A 1QWGA 4ALDA 3TW6A 4U2ZA 2F1BA 2GQ9A 3JR2A 1EWEA 5DN1A 2E1DA 3UPBA 2E77A 3WENA 3VO0A 5G2HA 4MLRA 1QHOA 3VCRA 3NPWA 1QPQA 3LCFA 3GKFA 1TPWA 3GBEA 1MFVA 2ALWA 3M07A 4FNQA 1MW1A 3CTTA 1Z41A 1D7FA 2XVKA 4GE8A 1TV8A 4ADTA 1PZ2A 1S5VA 3ZQ9A 3ZWSA 4XWUA 1MEIA 1JL8A 4K8HA 5D38A 3R8RA 1XH2A 3EWBX 3TSDA 1EH9A 3K8LA 1QWUA 4TU1A 1RR2A 3Q2DA 1S46A 3QPYA 1G4PA 3IK2A 3RFAA 3WEMA 3NQDA 4FNRA 3T78A 4DELA 5I3GA 2GJPA 4NX0A 2D0FA 2YW3A 4MKNA 4UNKA 3O8AA 4Y9AA 4IXXA 4CGTA 3LV5A 3W7MA 4GQRA 2WVVB 3EWXA 2A21A 3LHZA 4H4IA 2PWFA 4RK8A 3C8FA 5EPDA 1F76A 3QPZA 4AYSA 4O1AA 4TIMA 3PB2A 3TX9A 4MOZA 2ZA2A 4UR8A 4O11A 1VRDA 5CGTA 5DFAA 3N3MA 5BRBA 4UFKA 1ZFJA 3L2LA 4RX0A 3BK0A 4NJIA 2PWDA 1KWKA 1UUMA 1VYSX 2FJKA 2TAAA 4J7RA 1KLYA 3TAOA 4UQCA 1J0JA 2YXGA 2CXGA 5I23A 1GZGA 2ZUWA 3USBA 4J28A 2VFDA 2QKFA 2WKJA 4JFTA 5AHEA 2G95A 3W2NA 1UD2A 4UUIA 1CXHA 2H6RA 1XBVA 1U2YA 2QCGA 3CPUA 4RLIA 4XKYA 1JAEA 1WPCA 3P67A 1G6CA 1H5YA 4UTTA 4YCOA 1AQMA 1MZHA 1RV8A 4ZQPA 3HPZA 4QSHA 3T55A 5LNSA 1GEQA 1TRIA 4JXCA 1AG1O 4ZL1A 1P0NA 2BWGA 5A6MA 4JX5A 5DY3A 1TCMA 4NNCA 3TC7A 1N55A 4OQVA 3EX4A 5G1TA 1V3KA 3HZ3A 3CTLA 1PS3A 2J88A 4O4WA 3L4VA 1OF6A 3QMSA 2ZX5A 2BTMA 5DY2A 4CNPA 3CGTA 4JTFA 5AHIA 1EA0A 2QCDA 1JUBA 3FW6A 1FCVA 2DZVA 3TJXA 2EADA 2NX3A 4AHQA 1NVMA 4GUHA 4O28A 4HOWA 4RXFA 3A9IA 1GJWA 1KW1A 2ZTJA 1SMAA 1MO0A 1TMHA 4LU0A 4JTJA 1KM3A 4JL2A 2VFHA 5CXPA 3W73A 1EX5A 1SO5A 4TMBA 4NJGA 5CG7A 1JR1A 1UJPA 5K9CA 2VNCA 3TIMA 4XQ6A 3UNDA 1YYAA 1XSIA 1DKWA 1K3UA 4N4QA 3FS2A 4KWWA 1JXKA 4WY0B 1TPUA 3D4YA 2RDUA 5HQEA 3RF9A 3CT7A 4JY8A 2BXVA 1V3JA 1JCNA 1QNVA 5AFDA 1QO2A 3WNPA 3S5YA 3I68A 3O6YX 3CWNA 1TQSA 2AAMA 3TFXA 3TQVA 1HUVA 5AHMA 2EAWA 2ZFAA 4X22A 3SW6A 1DL3A 5LGXA 3G1YA 1U83A 4AAJA 2ZRUA 3UWZA 4UTUA 3O63A 4WOQA 1R2RA 3MHGA 3QZEA 4OV9A 3BUIA 1C29A 3LERA 1SPQA 3NGJA 4AEFA 1TPDA 1VZWA 5L6UA 1XSKA 5CGQA 2A85A 3II1A 3AXIA 3BCDA 3GXNA 4UMAA 1T8XA 1CGWA 1KTNA 3E9AA 2V3FA 1EIXA 3LCGA 1FWSA 3FKRA 4HKPA 3W2MA 3WELA 1G9HA 5CPLA 1JG9A 4CNNA 3UQNA 4O52A 3WDJA 1EUAA 3TDFA 3BLPX 1XL9A 3VGHA 1KFJA 4PA8A 2VELA 2FH8A 5GVJA 1YDNA 1MSSA 1BF2A 1PCWA 3L2IA 3KVLA 3LHVA 3OLGA 2TYSA 3W1AA 1RP9A 3OVPA 2E09A 5D2YA 3TTSA 4E2BA 1UBSA 2ALDA 3JS3A 4LVFA 4O4VA 3O6DA 1C8QA 2Z1BA 3BSGA 3W7PA 2PRMA 4HPHA 1O7DC 4A21A 1I2OA 3O16A 2YFNA 3UY7A 2TPSA 3FEMA 3W2KA 1DJNA 1N8FA 2EHHA 2VXNA 4JD4A 1E43A 1SO4A 1SZEA 3LHWA 1H1YA 3MMTA 3FA5A 1JUKA 1LZOA 3I65A 4MFDA 4QJ1A 2VFEA 3M5ZA 2XFWA 1XCWA 1TQTA 3LHUA 1H50A 1YXDA 2DH3A 3N73A 4FMVA 4AEOA 1G69A 1GVRA 3TNOA 3LCXA 5A6LA 3IGUA 3NQAA 1NF0A 4B9YA 3W1NA 5D2XA 2QF7A 3A6OA 5K4XA 3A22A 5K2ZA 4AXKA 5G2WA 1VS1A 1YDOA 4H8UA 2J9ZA 3M6YA 5AHLA 4DPQA 3DX4A 4LPCA 1B3OA 3DFOA 3WDIA 2E6DA 3NM3A 2E8YA 3LHYA 1YXYA 4QAIA 3N9SA 1OB0A 3TXZA 1TPH1 1JXJA 2EKCA 1EO7A 2WC7A 1OFDA 4LS0A 3AO0A 3W07A 1VPXA 4K8EA 2X16A 3MP3A 5J5RA 3W83A 1ALDA 2VEPA 5E1QA 5BMWA 3LTYA 1UOKA 3RLUA 4JTKA 1K7FA 2DZTA 3A24A 3EXTA 4LVBA 5F2LA 4HOXA 4W9TA 3BVXA 2NWRA 3KOFA 4HN4A 6ALDA 3QSRA 1KA9F 2H90A 3SSJA 4LT9A 3W1LA 1FQ0A 1KBBA 4M6QA 2GUUA 5DCEA 4IMGA 2YZRA 4MY9A 3V75A 1KFKA 1F05A 1IZKA 4MZYA 3TE9A 4A29A 3T44A 1UD8A 3VNZA 3FJLA 1JUEA 3LX9A 4CN4A 3P80A 5D2VA 1H51A 3BARA 4HNNA 3W7EA 1OX4A 3QYQA 1A50A 4HSOA 1ONRA 3EDDA 3LTPA 4LVGA 1HTYA 3C4UA 8CGTA 2X1RA 4RV8A 3IVSA 2A2IA 3E02A 3HPXA 1FX6A 3KFTA 3D52A 1WV2A 2V82A 2E6FA 5TD4A 1TRDA 4LS2A 4H6KA 2QUTA 1KXQA 1OFOA 4FIRA 1QHPA 1GJPA 4O1BA 3E96A 2E5CA 3ABRA 3ZR5A 4TVUA 4QAWA 2A7NA 2EJ1A 5F1UA 5K4ZA 3KE0A 4BA0A 1TJPA 3NQEA 3BLEA 4GUGA 3H55A 4YXGA 4DO6A 1VCGA 4JFUA 1MXGA 3GXPA 2V5BA 2JK2A 1QPKA 4AWSA 1CXFA 2VRQA 1OF8A 2PURA 3WDHA 3OEXA 1VC4A 1E3ZA 1W5MA 3KRSA 1H61A 4JTTA 3IJ8A 3ZT5A 3BLBA 1FUYA 4N9DA 4FNUA 5G4WA 1SUXA 1I8JA 1YTEA 1QPOA 3WNNA 5G1YA 1J0HA 1QO5A 4Z1BA 4AHOA 2H3BA 4LUIA 4U28A 5E70A 3PG8A 2I14A 3WK0A 3CZEA 1XUUA 1YPIA 4FLOA 4E38A 2FHBA 2WKLA 5F1VA 2A7RA 3UXDA 3B0VC 3DKLA 3IGSA 3NQ8A 3I7RA 5BW6A 3G8EA 5LZLA 4S1FA 2WPGA 2BXZA 4FIQA 5HJLA 4MAZA 1VAHA 1IF2A 3LCLA 1WOAA 2WKGA 1GG0A 2RH9A 3DFQA 3G0UA 4E0CA 4MY8A 4IX0A 1B4KA 4K37A 3QM3A 1CXKA 3NQCA 1FDZA 2RFGA 4JYDA 3TQ0A 4N4PA 3DFTA 5KZMA 4GQQA 1JI1A 1DQWA 2YDAA 3VX1A 1UD6A 3LRLA 2Y7GA 3STGA 3PUOA 4UQDA 1I2RA 3EJUA 1GYLA 2X2GA 3NQ6A 1FWNA 1XD0A 1JRBA 4PSRA 4Z1AA 2J25A 4FLQA 3OBKA 3W7OA 5AHFA 3BG9A 4NNAA 3RMJA 1BAGA 1RPKA 3BGGA 1EPXA 3BUQA 3B06A 1GPWA 3P74A 1JVNA 1XDMA 3TCEA 1UCWA 4H3DA 3EDFA 4GI8A 1VHCA 4ML9A 3L4UA 1XXXA 1IIGA 3NVTA 1SSDA 3HF3A 4YLWA 1TTPA 3M41A 1CIUA 1S3HA 3IEBA 3BPWA 3FYOA 1K8ZA 3M7WA 5LSMA 5F2MA 5K7JA 1VQTA 5EA9A 3OHIA 3FAXA 4M7SA 2FPYA 1D9EA 4AVFA 4A2RA 5CZSA 1YXCA 1Z44A 2VFGA 1TQUA 2A0NA 3CQ0A 3MHFA 3RU6A 4IUOA 3P62A 2V0TA 2Y7FA 3W87A 4ZQRA 1OVDA 3M5YA 5FEWA 2B7OA 3N19B 2TSYA 1FWWA 1R30A 3TQKA 1L9WA 2E6YA 1JCMP 2NXIA 2X1SA 1PVNA 3BW4A 1B57A 3AJ7A 5E6YA 1E51A 4DXVA 1O94A 5AB3A 1IXOA 2VC6A 3DFPA 1PHQA 2Y61A 4PCFA 4WZHA 1TMQA 2F7FA 1RD5A 4BF9A 5AN7A 3WJZA 3THQA 2V30A 2DZUA 2EEXA 1LBLA 2G96A 4O13A 3WNLA 3P8IA 4WF7A 1UH2A 2KZHA 2Y88A 4IMFA 5F4WA 4BI5A 4IQLA 1CGVA 2NXHA 1TPB1 1AL7A 3DDFA 3NQFA 4A2SA 2PWHA 3ZT7A 3CZGA 3QW3A 4JIPA 4LC6A 3SGZA 1A5AA 2DU2A 3EJTA 2P10A 3S8HA 3KL0A 2VR5A 5HNRA 2Y85A 4O16A 4XZ9A 2GJRA 3F4NA 3IV3A 4O19A 1KV8A 3G3MA 2ZRZA 4U33A 2IQTA 3NQMA 5D02A 3R5EA 1XBZA 4K6AA 3M1ZA 4NUWA 5LNWA 3EWUA 1DOSA 1VYRA 2ZIDA 1AL8A 3VKJA 1SSGA 3BVWA 4OJYA 4CNOA 3BG3A 4UNIA 4UQBA 4FLRA 3W1TA 2ZXQA 3HGOA 2G5WA 4GUFA 3PS7A 1D3GA 4M5PA 3GAKA 2F18A 4TMCA 1CGYA 4GO8A 4L4LA 1O4UA 3VGGA 2FE0A 5I0DA 3R89A 3UG4A 2ZCGA 2XIIA 2WNNA 3W2UA 1OX5A 3GZ3A 1YLVA 3B4UA 3EXSA 3UXAA 1UB3A 3I7QA 1F6PA 5KSWA 5LNRA 2EGZA 2JKEA 3KRZA 1L6SA 2PC4A 2Q3OA 2FYVA 3GLCA 5A5WA 3U8GA 3NPUA 3LXBA 2FB3A 3M44A 3EJRA 2TRSA 3BV4A 1JCXA 3MJYA 3W1QA 2Y70A 1OABA 4NXKA 3G0XA 3BVUA 2DORA 4PH6A 1UH4A 5CGMA 5I5RA 3DKJA 3ABOA 1M6JA 3M5VA 3STEA 4UQAA 2HMCA 5SWUA 1DVJA 4JS3A 4FLSA 1BG9A 1JDCA 1NSJA 4GNJA 3QQ0A 3MBDA 4MJZA 3BUBA 3YPIA 3WY4A 4AMWA 1G4SA 1EP3A 1Y0EA 2ZRXA 3M43A 4J3WA 4CVWA 1CGTA 1WAUA 3ABQA 4XKYB 3KVJA 1AMYA 3E49A 3GNNA 3GKAA 3L0KA 4RXGA 3PBWA 2ZX7A 2CU0A 4IGHA 5LHFA 2FGZA 1QDSA 1YDVA 4HPJA 3UPWA 3TMLA 1TPEA 3TU9A 1DBTA 1OFPA 3CV5A 2ZZ7A 2ZX9A 1CDGA 3U6WA 3G0SA 1ZJIA 3EJPA 3BLFA 1JGIA 3G1SA 3W70A 5K9DA 2J27A 5K9XA 1L0PA 2V5LA 2V2HA 3QFEA 1M53A 2ISWA 5D37A 4OHQA 3O06A 5H2ZA 2ATSA 2ZXBA 1OYAA 3ABSA 4HNTA 2D3NA 3UG3A 1H60A 4OIFA 1OFAA 4JNMA 5FEXA 4XBSA 3IIVA 2VRKA 3ECQA 4LV4A 1XDLA 3NQ2A 3A47A 3HG5A 3IGXA 2V3EA 4I7UA 2UV8G 1CGXA 3WMSA 4BR1A 3ZR6A 4LY8A 2WANA 3BVTA 4WSJA 2ZYFA 4CCCA 1EO5A 4CKQA 1DV7A 2QPUA 2GVLA 3VSUA 3LDVA 1LP6A 3E12A 4BWLA 1H62A 4AH7A 1K02A 3MWAA 3K30A 4FHAA 3MYOA 3EX1A 1KM1A 1SW0A 4JX6A 4S2CA 1V3LA 5HDRA 1G1YA 2E8ZA 1WP6A 4GXMA 2BXYA 1Y7VA 2WJZA 5A2AA 1EWDA 3QSTA 1ADOA 3TTYA 3ZOAA 1XH1A 2Y24A 4W93A 5AC6A 4UTMA 4MVAA 2NT1A 1WZKA 1SO6A 4IMEA 5A2CA 4IXHA 5C5YA 2CLMA 2BY0A 3PG9A 4PL2A 2YA0A 1F5ZA 3TV8A 3W38A 2YIHA 3VGBA 4GUIA 2PWEA 1VJIA 1JCJA 3WJSA 1I45A 1LRQA 3W1XA 1DQXA 5KEZA 7CGTA 3T7VA 3W1MA 3CZSA 3VMPA 2FB2A 4KKXA 4N2YA 3CLMA 5F2GA 2ZWZA 3BAIA 5HXMA 1C9DA 1ZCOA 3GR7A 3N14A 3B04A 3DFSA 1LTDA 3NNTA 3W86A 2A7PA 1EA9C 5MHBA 4FEZA 3ZT6A 1GJUA 4YCPA 2WVSA 1FDYA 3FFSA 4M6VA 2RHGA 2FLIA 2WV8A 3W7GA 1WBJA 2WO5A 5LNVA 1IV8A 5DXYA 1GOXA 3EJQA 1O60A 4X9SA 2Q3RA 3DXIA 2H8XA 5G2IA 1R75A 3PSWA 2OSYA 1H7WA 4NI3A 7TIMA 3EX2A 3M9YA 4GBUA 1AMKA 3DI1A 1BSIA 2D3LA 3CU2A 4LRTA 4LXFA 2BLEA 4J9JA 4TO8A 5EKYA 2ZZ1A 2E9BA 3TFCA 4DQWA 1KM4A 4JX4A 2C13A 1G4EA 1CXEA 1X1OA 5AC7A 1NOFA 3UYCA 2NT0A 3HPSA 5HULA 3AXHA 1K7XA 1M7XA 1UD4A 1UUOA 2YR1A 3W7IA 4OBTA 1XI3A 1ZHAA 3LM7A 1GWJA 2J9YA 4GJ1A 1P4CA 3RIKA 1MEHA 4BWLC 4UIOA 2RDWA 1HTIA 2CLOA 4JY9A 4WJEA 5I3IA 2WSPA 4UTTC 5TQLA 3MI2A 2C0AA 4O0ZA 5L9FA 5I24A 2Y6ZA 3S0CA 3SY5A 1QWNA 1Q45A 1I2QA 4BZYA 5HMSA 4NNBA 1W37A 1YPFA 1E40A 1LWHA 4B9ZA 1NFBA 2OT0A 3GDRA 5T26A 4HNVA 2DZSA 1OYCA 1SFLA 2DZXA 4NXSA 2NUWA 4FB7A 1J0IA 5F4SA 5HINA 3LTSA 2YGYA 5EYWA 1LBFA 3D51A 1WA3A 1BVNP 2F7OA 3OVRA 2QR6A 2WOQA 4D2JA 1XV8A 3NQ7A 3FLUA 5DCBA 4N02A 4UTKA 4ADUA 3MBFA 5F7UA 2LLEA 4BK9A 4GWEA 3W7LA 4WY0A 2XN1A 3OVQA 3MUXA 4MIMA 3L2MA 1CLVA 4LQ1A 1RQBA 2VEIA 4XB3A 3DBPA 5CPMA 5KMYA 2DJLA 1JF5A 1KGXA 4IMCA 4HHPA 4K38A 3TSBA 1DJQA 4FNTA 1TYGA 3V1PA 2VFIA 1U5JA 5C2XA 3HG2A 2CLIA 1F74A 1KTCA 1V7YA 3DHFA 4N6EA 4JTEA 2X30A 5TIMA 1H7PA 3EKZA 4PODA 4TX9A 4YWIA 3AMLA 3WY3A 3MP5A 4Z1DA 4PC8A 3SJ3A 2E5BA 1RZMA 2OW6A 4OKDA 4LC8A 2E4TA 3K8MA 3HB9A 2JBMA 1T96A 3L67A 3VGEA 2ISVA 3MI3A 3B03A 4KFPA 2DZPA 1P5BA 3O6CA 1F2JA 1JDDA 4UZUA 2GVJA 2QCNA 1FY6A 2WPBA 2ZWYA 1OX4B 3SR7A 1VJSA 3B0PA 1JQVA 4E2DA 1FWRA 3LLDA 1PEZA 1AW5A 1OHLA 3W85A 4YMZA 3IIXA 3S5NA 3M47A 3LBMA 4UCFA 2O7SA 4HSNA 4J3VA 4UTJA 2OSWA 1Z42A 1W5OA 1B2YA 2WSKA 2ZA3A 3BVVA 3OLEA 1BTMA 1KBIA 4IPIA 5CKSA 1AVAA 2CZ5A 3W22A 4Q32A 3CEUA 4UFLA 3GK0A 3TJLA 2F7QA 4UFHA 4M8UA 3VGFA 1PL9A 3PWAA 4WUIA 3GBDA 4DF1A 4NJHA 3DHPA 1WZLA 2X2IA 3KEHA 3FYPA 1B4EA 1IXPA 4L4MA 4OE7A 2DZWA 4Y96A 3NYZA 3F03K 2V8ZA 1SMDA 2EQDA 2ZZ2A 3N34A 1HNYA 2EABA 1XFBA 2QAFA 1KCLA 1O5KA 1WQ5A 2A6LA 4KFOA 3O05A 2NUXA 3W6YA 1Q4NX 3BG5A 1R2TA 3NO5A 1S5WA 2C16A 2ZDRA 3QF0A 1VFOA 3TH6A 3G1AA 1W31A 4WXZA 3VSTA 1J2WA 4JTLA 1G7UA 3L4TA 2F7RA 1QFEA 3IVUA 3HBLA 2DP3A 3M16A 1QAPA 2NLIA 1T0OA 2HS8A 2H3DA 5AC8A 2D0GA 2F7PA 3F4WA 2CZDA 1CXIA 1OFEA 2XN0A 3P7YA 3GDTA 3EX3A 1GVQA 3UZ5A 2V3DA 1WZMA 3C61A 4PTNA 3TKFA 1QW8A 2HSAA 4IMDA 2Z0IA 4WY0F 4EWND 4MLJA 4UQ9A 3KWXA 2VKZG 5I3KA 4ZQNA 2CHNA 1F6KA 1M5WA 5F2IA 3ZO9A 4HPXA 1TTIA 3VNDA 4PCSA 5D32A 4ADSA 1UH3A 4PSPA 5KINA 1R33A 4AW7A 3VSVA 3BUDA 4O8RA 3GDLA 2FIQA 9CGTA 2QCCA 3EWZA 3ZWTA 2Z1KA 1ICQA 1VCVA 4JFWA 1GTHA 1T99A 4QIUA 3BLIA 5AYYA 4FXSA 5HWMA 2WCSA 1A5BA 2ZQ0A 2BHZA 3G24A 3DX0A 3Q94A 4O57A 2C3ZA 3RLVA 3W7JA 3VU2A 3BVJA 5U4NA 3LOTA 5HWNA 2XWDA 4R33A 1D3CA 1RVGA 2QMJA 3E0IA 3A4AA 5LNUA 3A23A 2E68A 1SZGA 4R53A 3BO9A 2EACA 5EY5A 4OGZA 4R7JA 3LXCA 5C55A 4M56A 1P6WA 2C8NA 3W1PA 3L65A 4M19A 4GIAA 2OT1A 3QMRA 4B5NA 1ZY9A 3L4ZA 6TIMA 1W5QA 1NF7A 4RZ4A 4N9BA 2FTPA 4PEKA 1JQXA 3GDKA 2D2OA 3PM6A 2CW6A 3G22A 2XIBA 2YCEA 1SW3A 1G5AA 3NAVA 8TIMA 2FH6A 2D0HA 1W56A 4NT0A 3KX6A 3L66A 5E9AA 1VLWA 7TAAA 2AQWA 2QCMA 3W76A 1W3TA 1GYNA 3I6RA 5C54A 3DHDA 4RZ5A 1GVIA 1X7FA 2Y63A 2NX1A 5FF2A 1Q6QA 1OGSA 3O15A 4FXRA 3DI0A 5KZEA 1WX0A 1PV8A 3HGJA 3N9RA 2ZUSA 4A3UA 2YA2A 3W7NA 1GG1A 1I4NA 3SI9A 2R94A 3C2VA 3HGSA 3WJXA 3WN6A 1PZ3A 4I9AA 2QUUA 4X0NA 2OCZA 2OYKA 1PS9A 1WO2A 1YTKA 2DH2A 1VGAA 2GUYA 3PBUA 3EX6A 1Z48A 4LRSA 1X8FA 2C7FA 3BC9A 1RQEA 3NG3A 3GDMA 2ATMA 1MW0A 3CPRA 1BLIA 1KXVA 3BAKA 3CIWA 2YFOA 1IIHA 4UOZA 1CX9A 2PE4A 1A53A 5CSRA 2PRLA 5E0KA 4N9EA 3JRKA 1V3MA 3PC0A 5E0FA 1R46A 2IGTA 5ABTA 4UOQA 2VFFA 2ZX8A 3EKLA 3UEQA 3MHUA 1FCQA 1G7VA 5J5DA 1ZS2A 3UZJA 3TW7A 3BMVA 1OK4A 3QGVA 3H53A 3O1NA 3EDJA 3QRHA 1UD5A 3VM5A 3H54A 1W54A 3VE9A 4DF0A 4NJKA 3PVFA 4AWUA 3BUPA 3UWWA 5BRPA 5FF7A 3L0NA 1TTQA 2E6AA 3VM7A 4FX7A 1DEDA 3MP4A 3G1FA 1L2UA 2C18A 4BFAA 3FIGA 2ZUTA 3RILA 2W6RA 4AHPA 1FXQA 3NL5A 4ICNA 6CGTA 1HO1A 3W7RA 5CZ0A 4CN1A 2QCFA 3GXTA 1XD1A 3IVTA 3BCFA 1X1ZA 2JKAA 2X1UA 1CXLA 4N6FA 1KGUA 3QMTA 1XCFA 1GVSA 2CLFA 2DIJA 2Y7DA 3PR2A 1EUNA 2EPHA 3NXFA 2OSXA 3L4WA 1K7EA 2FDSA 2WVTA 2OZ0A 2Y5EA 4ATWA 1TIMA 1XBXA 2Y2WA 4Z08A 3C0JA 3WNOA 3NA8A 1OJXA 1VH7A 3NQGA 1B0IA 4GC4A 4WX2A 3SGUA 3W2LA 1NAL1 3R2GA 4OWGA 3N2XA 5DBTA 3W37A 1W0MA 1QW9A 2C19A 3W7HA 3FAWA 1A5SA 1JRCA 3UERA 4HOZA 3P61A 4XTDA 2A4AA 3CEPA 4ORIA 1R47A 2C14A 3GXMA 3A5VA 3W72A 2YSWA 4JCLA 3L0GA 3ATYA 3S42A 4JTGA 3T40A 1MVYA 1WZAA 2QJHA 4GI9A 4Z0JA 2HTMA 3VNYA 5E93A 3K8KA 4QISA 2Z6JA 3GXIA 4NX5A 3WK3A 4I7WA 2QPSA 4JIQA 1KBJA 3ZS4A 3EWYA 3DX3A 4PEEA 1TQJA 3QC3A 3IRDA 1CGUA 1P0KA 2OW7A 3S1XA 3EEGA 1TV7A 5CLTA 4ZQCA 4E2OA 2GPTA 3S9YA 4OU1A 3KXQA 2NWSA 1OYBA 2O7QA 1I2NA 1PJ9A 2EO7A 1TSIA 4HA1A 2W0UA 1KV5A 4O53A 5D03A 4ZZ9A 2H8ZA 2YYTA 1GCYA 1QPRA 1C8VA 2OJPA 4P2VA 4WOZA 3C2OA 1VFUA 5AYXA 3C3NA 5IBXA 2C6QA 5LHEA 1LOLA 3ZSTA 5D04C 3DX2A 3DENA 3PUEA 2I9EA 2XVLA 2WQPA 4NZJA 1VIWA 1F73A 3IJ9A 4UMBA 2RDTA 4X3ZA 3S5OA 1KFCA 4OV4A 1EB3A 1OT1A 1L6WA 2FPTA 1HX0A 5EMUA 1ICSA 2V2DA 3SZ8A 3W88A 2ZZ3A 3AJXA 5G5IA 4M7TA 1E3XA 4UQEA 2ZZ4A 3VFLA 4AF0A 2YYUA 2B4GA 1HL8A 3WY1A 3I7SA 5FF0A 2QCHA 3TC6A 1Q6LA 1H63A 3GX9A 5DCDA 3LCHA 4BI7A 2V2CA 2QDGA 4IPJA 1TPFA 3SECA 2ZA1A 3SFKA 3D0CA 3NZRA 3P60A 4LUJA 1SZNA 2QCDB 3NDOA 4O18A 4UFIA 2R8WA 4KWUA 3GYEA 5HWJA 1G67A 3TXVA 1N7KA 3L4XA 2AGKA 3LHTA 3W1UA 2NXGA 1WXJA 2FQIA 4CCEA 5I3FA 3VMOA 4DBDA 5IM51 4ORMA 3QH2A 3B05A 3HQ1A 3HG3A 3EXRA 2CLEA 2ZUVA 2C1HA 2NV2A 1EEPA 2G97A 4NVTA 5HPOA 1TO3A 2ZRYA 3A5FA 2C15A 3K1DA 3TR2A 3F1QA 4LTSA 2WNWA 2FHFA 2B7PA 3CB8A 3QJAA 4GRSA 4K36A 4J3TA 5AHNA 1TCDA 3BSHA 2NX9A 2GJLA 3QEZA 1CW2A 4MYAA 1U33A 4TR9A 4X2RA 3DAQA 4O10A 1KXTA 4O1DA 4U2YA 2VUYA 1XBYA 5TBOA 4IJBA 3M0ZA 2CWNA 1P1XA 1PIGA 2WSQA 2E5DA 2BY2A 2P1FA 2G3NA 3DGRA 3BAWA 2WSYA 1QI4A 1SQ7A 1IGSA 1ZALA 5LGZA 5IBXC 3GTNA 2Y62A 3L68A 1QOPA 4MB1A 3TAKA 1OK6A 3VMNA 2JGQA 3CZKA 4O0KA 3TSMA 1U30A 3LI1A 3KHJA 4MFEA 3GB6A 1RPXA 1ZNNA 3ATZA 2J24A 3W84A 4LW7A 4J3UA 4ONVA 4EF9A 3P82A 3BAJA 2TMDA 1S5TA 3KLKA 1THFD 1KWGA 1WOBA 1ZENA 1NM9A 3Q37A 1JF6A 3LBCA 4U4MA 3NL3A 1PIFA 3FOKA 1MXDA 2WVVA 1FWTA 2YKKA 1PE1A 2CZFA 3G1XA 3PF3A 4UTIA 4OT7A 3W7QA 1DTUA 1TPC1 1WE5A 4IX2A 2V81A 4DPPA 3LLFA 3GXFA 2VENA 3TONA 3CIXA 2Q8LA 3BLKA 2BY3A 3PUDA 2VEKA 3FKKA 5HR7A 2BHYA 3M5XA 4MPQA 4FNPA 3MYPA 1LM1A 4WD0A 5FF3A 2R14A 4YL2A 5DBUA 1VFMA 2BY1A 1ME9A 3PBYA 3GNDA 1MW3A 2F84A 4IOTA 3C56A 2E0PA 3EWWA 4FO4A 1TQVA 4FNSA 1GVOA 3THAA 4J3SA 1W1ZA 3W2JA 3W71A 4CN6A 1KM6A 3TROA 1OFQA 4NZFA 2JGYA 1UKSA 4RZ6A 2NV1A 2EAEA 1M7PA 1ZJAA 2ZXDA 5D2WA 1H1ZA 1TPVA 2DJXA 2ZRWA 1VCFA 3OA3A 5CLWA 3KVMA 3L9CA 4HNUA 3TMQA 3BAYA 3LPPA 3KAOA 2BHUA 3C52A 2JKPA 1V5XA 3UWYA 3T4CA 1OG0A 2NZLA 1XH0A 4EIVA 3NEVA 2AAAA 5FESA 2Z6IA 2YPIA 4G1KA 2WVUA 4O15A 4RJEA 4N9CA 4JL1A 3W74A 4LNYA 5DXXA 5D30A 2ABAA 3G1VA 4C1LA 1KGWA 3DH7A 4A22A 2YW4A 2CPUA 2ZUUA 4AIOA 1AQHA 3R13A 1EP2A 3HGRA 1TQWA 4JDYA 1AK5A 1WBHA 3PB0A 1AW1A 1XKYA 4XTIA 4K39A 1KB3A 3VE7A 3L5MA 4FX6M 3WNMA 5FI8A 1ML1A 1KLZA 3UD6A 3W23A 5A2BA 3P84A 4MJMA 2ZRVA 4I7VA 4M6PA 2ZBTA 3MO7A 1RQHA 1HO4A 2B0MA 4UTHA 2GVYA 1A5CA 2QCLA 4LWWA 3GXDA 5D33A 1QX1A 4XUGA 1W3IA 1JDAA 1IXNA 4MYXA 4Q33A 4PCTA 2YJQA 4JR5A 4S2BA 4GI6A 5KTLA 4ZQMA 1NEYA 4UMCA 3L5LA 3SIZA 1JFHA 3NOEA 4KMQA 1ME8A 5BRQA 3EDEA 1YTDA 3P81A 3S1VA 3BMWA 3UWQA 1OX6A 3G18A 5D05A 5CSSA 2R91A 3WK1A 3O07A 3WJYA 4KWVA 3OLDA 4AMAA
chains in the Genus database with same CATH superfamily
2AP2A 4G9FE 3A21A 2BNQD 1MIML 5KS9A 2W3ZA 1FVEA 2A74C 1YEFH 3C5ZC 4KKPA 4GKLA 3ULVF 1JF1A 4ZMQA 2XG9A 4IFKA 2GQ8A 5IM7A 4ZMWA 5A43C 4POCA 1DE4A 3D25A 1TIUA 3S2CA 1BEUA 2Z28A 5FYJE 4NUJB 2WQVA 4AMXA 5D1ZA 3O6LL 2DM3A 1IAMA 4M00A 5CSZB 1L9MA 4JRYA 2XN9E 4DBEA 5DEGB 5IVXE 5GS2H 1CFNB 5E4IA 1MLBB 4WKHA 1RIVH 1GZQB 2A79A 1ONEA 1ES0A 1Q6DA 3ZE2B 4YN3A 4MB5A 5DHVH 4CC4C 3B3IB 1V55B 3AQYA 4M7LT 4AKPA 5CEZL 2EDBA 4V2CB 2ZP8A 4HBCH 2ITDA 4Z2KA 1GMEA 1ZVHA 4J35A 2EIJB 2IAAC 2G3MA 5JXAL 4N9GB 3ZL2A 1DQDH 3HI5H 1UG9A 4YIQA 3AREB 4JOMA 1HINH 2BP1A 1UUNA 4X5QA 3WUWA 2K4AA 1A47A 3PAOA 1YNKL 2ONEA 4ROPA 3ZR4A 2INEA 3PWGA 4PQXA 1G0DA 5C0EB 3MRLB 2XVGA 1RUAL 1FWFC 1KFEA 2HN7A 3WLRA 1MAML 1DLHA 1FCGA 2YL5A 1IGCL 1VLIA 3DURA 5JIPA 2EH7H 4PIBA 4XZMX 4RAUA 2FFCA 2W63A 2QVHA 3MMWA 4LOCA 3FT0A 2FQFA 3UCQA 1KT2B 1HWWA 2F6XA 5JHDA 3B4YA 3TOPA 1BWKA 4WTZG 4CJ1A 4PM1A 1K03A 1VCAA 2X40A 2Y22A 4PBFA 4X5RA 3W00A 1U8MB 2RFXB 2WCGA 5DJZA 1OFRA 5IQOA 2CIPA 1PNCA 2IQAB 4L4VD 4YHZL 3GI9L 4AEEA 3WTXA 3WLWC 1ZSDB 3VXQB 4A3QA 4LYQA 3WHE0 1ACYH 2CWRA 1S2TA 2HPOA 5LLIC 2OPJA 5I6SA 1BYPA 5C08B 4G3YL 4QYOA 2YA1A 4BZ1A 4ZMVA 5LBGA 3HMWL 3W26A 2K9FB 4RGNB 4LU5H 3QFDA 2Z2UA 2A0LD 2EH8H 4HP5A 4R96A 3M7SA 3C2RA 3L21A 3NZUA 1K8YA 3TWCH 2W79A 5KITA 4JDVB 4EO5A 4XP9H 3LNPA 4L1SA 5CIPH 1QBMH 3MPCA 3UR7A 1HEHC 4ORGA 4K2UH 1S2EA 4JQXA 3LZOA 1GOWA 2IQ0A 4KNTA 1WKYA 1MH5B 1O1HA 4QROA 4I3GA 1YYMH 3BH4A 1E5NA 1DHKA 4U2ZA 4FJYA 5D6CB 1NFAA 5G2HA 1K4HA 4MSWA 2XRAL 5FW6A 4WW1A 1G4RA 1ETJA 2OELA 3ZQ9A 1E6QM 5EBWB 3GFUA 2AGJH 1RR2A 3PJUA 4U1SB 4XXWA 3FRPB 1QR1A 1V3IA 5A94A 4WFGD 5EZJA 4GRWB 1QSFB 4ZFGH 2OMXB 3RWIA 1H0DA 4F24A 3GT6A 4GJJA 1XWVA 3I6LE 4LZKA 2YEZA 4XPGL 1ZFJA 1QFWH 1BEYH 4OFDA 1TJHH 3GTFA 3U0HA 4JFTA 5SWSA 1H49A 2VR7A 1G6CA 2QJNA 5LNSA 3MPGA 1E8ZA 3ARXA 3TC7A 3NCFB 4MB4A 2B15A 3HZ3A 1PS3A 2J88A 3QMSA 2W65A 4HIPA 3EYFB 2OTWB 1T1WB 1T80A 2NUPB 5DQJA 3CUFA 3B83A 3MLRL 4JTJA 4WFHD 2VFHA 5L88H 3QJVB 2NNRA 2I57A 4U1NB 2JMRA 1HYSD 4PUMA 4GP5B 5DZOA 3EUDA 3G08A 1SYSA 2WJEA 3R06A 3TO4A 1TZOA 2VMCA 3U36A 1XP3A 4GACA 3WF0A 1OK8A 1SJMA 3V4VH 2J7CA 5F44A 3G1YA 5CJ8A 4C6OA 4AAJA 4DJMA 3O3DA 1HQTA 1DBAL 5EF1A 3SIKA 4QS6A 1JPFA 5K59F 2DMGA 4D7PA 4FQQA 1UP3A 2J8OA 5FFOA 2J8HA 3LCGA 1OW0C 2W9EL 1AQFA 2BOBA 1QR4A 4F8TA 5I0WA 1K4DA 3X1NA 2IG2L 4DP8X 1YDNA 4FC3E 2CBVA 4L4TD 2ZKMX 3PS6A 3LKRA 4GLRH 4LF3B 3FZUD 5TDOB 4YO0A 3VW3H 2PRMA 4NJAH 1FFNA 1GXEA 3G1RA 3UY7A 2Y36H 1PKLA 4WWKC 5JQ6L 3M5ZA 4JRXA 2OMNA 1T0NA 3BJ91 4URIA 3VFTB 3W1NA 3TZVB 2FLMA 2WYTA 4DQAA 3PTMA 1WTGT 4M6OH 1EZWA 4OCLC 3IGAA 5KUMA 1JYXA 1TPH1 5K9JH 2FBOJ 2XV0A 4QBXA 2FL5B 3S8GB 1OCWH 1UZGA 4HJ0C 1SJCA 4LVBA 4RWHA 3GHEL 5C0QA 4N8VG 4AD1A 1BA9A 4AQ1B 2OSLB 4OD3H 4HQQL 4U4IA 4N0UA 3APDA 3TBVA 1SHMA 1H51A 2PGFA 3QYQA 4XVUC 5KWYC 1E1EA 5GGRA 3X14B 4XCCL 1PX3A 4LCQA 2QR0B 3H6OA 3RRQA 5DMYA 4LSRH 4W6WB 4PGCA 3ZR5A 1VENA 3SCSA 3UBGA 3VACA 3CO4A 5H1WA 1ZOXA 4ZYKA 3JWOL 1U21A 4AWSA 1AZUA 1P1ZB 3EGDA 1YEFL 3OEXA 4DZIA 4DK6A 3EFFA 3QQ4A 4GQ9H 1HGYA 3F12B 1ZTVA 3P2BA 4AXWB 3FB6B 4PW4A 2XU2A 2K6ZA 3HG0A 2A7RA 3B0VC 2CHRA 3U1QA 1UVQB 5REQB 4I48B 1NQKA 2R2BB 2ZP9A 1CXKA 1DIKA 4XX1E 3STBA 1FUNA 3AHXA 1U0QA 1YCSA 3WQPA 4UQDA 2HKAA 1S9VB 3I75A 1AGBA 4KJYB 4IBSA 1XD0A 5J56B 1JRBA 3ARQA 4HUMB 5A6BD 3MMEA 4U05A 4F3FB 4HUNB 3BUQA 4FAMA 2Y1AA 1MLCA 2WKOF 1DSWA 3S47A 3CVCA 3ZE1F 4HBCL 5D1XD 5CPSA 4B5ZA 4RH4A 4AVFA 5GS1A 1QTSA 2YPVH 1PXGA 3M5YA 1DQDL 5HK4A 4MMZB 2J74A 2VUOA 2BSEA 1XQ4A 1RK1B 3TH2T 3TPUB 1S5MA 5HDOA 3PU7A 2PDPA 2Y6SC 1CZ8L 2IFFL 4PJ8D 2PWHA 5DLMH 4LUSA 3QW3A 4AVKA 3FPXA 4EQ3A 5IGXH 2VCCA 2KZWA 3FSTA 3WF2A 1MCLA 3HCVB 5DUPH 4YFDB 3VPLA 1VYRA 5L0QC 2EH7L 4TNEA 3ONCA 4D6DA 1A1OA 3KYOB 2WK2A 1G5GA 3EJZD 2OLAA 1TA3B 5KBMA 3HZYA 5CWSB 3ETBF 4NQUA 3NQIA 3V9EA 5K59E 3VRIA 1NDYA 5E56A 1FP8A 3U8GA 1TR7A 4BIKA 3N6YA 1FC2D 2DDQH 4GKNA 3KOWA 4PH6A 5I5RA 1IBHA 4GX8A 2CA4A 4Z5RA 2CLZA 3YPIA 3WH5A 5EPMA 3RDJA 2P5PA 3RZWA 1O7DE 2DKUA 1XYFA 1LK3H 3S7GA 2W66A 5C09B 2O5ZH 2ZX9A 4ZEPA 3EYVA 2K8QA 5IFHH 4L4OA 2O4QA 3SPGA 2ZKHH 4OHQA 4LU5L 2FT6A 3ABSA 4JNMA 2EH8L 5IB1A 3VIPA 5EEVA 1V6YA 3VOJA 2NX5E 4L3FA 5FHAH 3TWCL 3MRGA 4XP9L 3WIAA 3V9CA 1LP6A 3PIQB 4H9VA 3TCXA 2D7TH 1SW0A 4G8EB 4I2XE 2H1PL 2QLVB 2FGWH 1WDDA 1TYEB 3EOEA 2Y24A 4Y5XC 1YYML 3BDBA 1OGAB 4MCYA 3SCMD 2BSRA 3LDBB 4IU3B 4NNXA 1TE1A 3NNTA 3MVSA 1EA9C 3T0TA 3RWFA 3ZT6A 3BPNC 5C7HA 2WO5A 4ABQA 2AGJL 4YSQA 2AQNA 4UBDC 4KQ3H 2W67A 3BESR 4AQOA 2D7OA 3JT2A 4DQWA 3FH5A 3B0YA 2FT8A 4ZFGL 5HYEA 12E8H 1Z9NA 2X88A 4Y5VB 5GRVK 2MQ3A 2DKSA 1UUSA 1Q0YH 5F0PB 4Q74A 1TR9A 5TQLA 1MDTA 1QFWL 4UTTC 1BEYL 1I1WA 1TJHL 4LOUD 4JNXA 1LWHA 4S11A 4JDEB 2OXHB 4ABWA 4WJ8A 2ZPKH 2DZSA 4NXSA 1J0IA 1UACL 4FG6C 5GPRA 3D51A 3I9GH 4N3TA 4S3FA 3UAEA 4EKJA 3DMMC 4WUUD 4V28A 4MYWB 1P9MC 2PTTB 3WQWA 5MEPB 4LAJH 5HJYA 3RPIB 4A8IA 2A7BA 8XIAA 3L12A 5PCYA 2CLIA 5L88L 4YWIA 3SJ3A 3GSVB 3QFWA 3W5NA 3ZE1E 1JNJA 3PRZA 1SMOA 1RBAA 3U7YH 4HEPG 4JUSA 2Z0BA 1JCVA 3IS0X 1F3DH 4D6FA 1Z66A 4OZFH 3V4VL 1DVXA 1W2VA 3LS5H 2PPGA 2J8UB 2LFEA 1F11B 5HI5D 3VGFA 3PWAA 4YAQB 1A4KA 3DUUA 2CK2A 3EJYC 3HC3H 5C3LD 3HVNA 3SDXB 5JPNA 4KRNA 2P3EA 5JXEA 1KJ3H 5FX3A 4K9EH 4M5SA 1O5KA 5FR3A 1OCJA 3C5SB 3NO5A 2ZDRA 4MJIB 1G7IA 1U8LA 2F7RA 3GUGA 1CXIA 4L1DA 1OE1A 3C61A 2DZAA 4WY0F 2B39A 3VW3L 4MLJA 4UQ9A 3TF7C 4NJAL 1JZJA 2J62A 3CUIA 5SWZE 1VBHA 2GFBA 9CGTA 2DJUA 5JHDE 1W0WA 1DWIM 3CQJA 4WDIA 3GWQA 2DRUA 2OMVA 2ZQ0A 1RK7A 4M6NL 1LP9A 3ZZSA 3A4JA 2NNXA 3VFRB 1JBJA 2JCCF 1NIFA 1YKWA 2UZPA 3HE6D 4M6OL 4M1CC 3TYAA 1SZGA 1NBYB 4D6HA 1FZJA 2YCKX 2XBTA 3L4ZA 5B4MC 4F0KA 3SE3A 3QC0A 1NF7A 4FXLA 5DEFB 4DAFA 1JQXA 1OCWL 4JZJB 1X6LA 2RAMA 5CBEB 1W1PA 3MZNA 2YL9A 3VVGA 4KHTH 4W9IC 1CDHA 4G42A 3HMCA 2EXWC 4FFZH 2XIOA 4OD3L 1ORSB 2HX8A 1Q6QA 3ZKNC 5M17A 2OLDA 4QNPF 2R2EB 3SDDB 3GDMA 4I6KA 2UY7B 1T1XB 4JFDE 3OMIB 2IGTA 2ZX8A 4AZBA 3MHUA 2BPBA 5TE6L 2FZBA 3BP5A 4PUEA 1W54A 4LSQH 1HXYB 2FGBA 4YDJA 5E6ID 3WQVA 3UZQA 5A3ID 3DERA 1L2UA 4YHYC 1V6UA 4BFAA 4FP8H 1ED3A 2ZUNA 2DQCH 5C0FA 3RFZB 4WIQA 2EYRB 3O6FB 4XN9A 1WFNA 3QMTA 4ORZC 3KEDA 3DRQA 1EUNA 1PDKA 5DT5A 4LLMB 4GFXA 2YGNA 1FYTA 4XXCC 1A14H 3MRDA 5DZPA 5KANG 1XEDA 1K3IA 4BCXA 5J3HD 4RDZA 1A5SA 5GSVA 1JVKA 4Z17A 1C9WA 3KRBA 1J5SA 4ZS7H 2O4EA 2YSWA 4WWPA 1N6VA 1PX8A 4YS1A 1Z9OA 3AFLA 1KC7A 1E6RA 1URLA 4Q4QA 1NGPH 3KXFA 2ODIA 4OZGF 5CILH 1IARB 4E2OA 3NJVA 3QYNA 2IAND 2IF7A 4PWIA 1OYBA 2FJGB 3ULUF 1TV4A 3KP1A 3BZEA 3IMWA 1YBQA 3B8IA 3JV4B 1OT1A 2O61B 5D70L 3EWDA 4MCNA 3EO1B 5B1BB 1TU2A 4GX9A 3PWNB 5ABAA 4AE0A 1PZSA 3M17A 2F74B 3B6SB 4O18A 3GVQA 3NDOA 4UFIA 3GYEA 1G67A 3ZIMA 4JM2A 3IFPA 5FV1L 1LYQA 5GS0H 4JJ5B 3HG3A 1EC9A 4OJFH 3ATDA 3VZYA 3F1QA 3DSNB 3UP8A 4DJFD 5AHNA 4H13C 2VITB 1N4XH 2CDFA 4XBEH 4IJBA 4X4ZA 2VWEC 1N70A 3IJLA 1FNHA 4G7RB 1U3HB 4OV5B 1FFOA 5FKPB 3HW7A 3OOQA 2F53A 3FTZA 3IFNH 1WWBX 1SQ7A 1IGSA 1R6VA 5LGZA 5IBXC 4YEEA 4ILSA 4YHLH 5K39B 1CCZA 4X5WA 3KHJA 3NZPA 2DDQL 5DJXA 2QQKL 3RB7A 3HC4L 3PFRA 1UADC 3WSQL 2PDLA 1ZBWA 4IIDA 4MPKA 2WVVA 4HMNA 4M24A 4PR4A 1TPC1 4QRRB 3UESA 4NASA 3IRSA 2Q8LA 5HYJA 1L6ZA 3AG1B 5AWNH 3ANUA 1LK3L 2P24B 2VDNB 5EEYA 2R4SH 1I82A 3CSFA 3MYPA 3MQTA 2O5ZL 3PZVA 1OGAD 4XO7A 3W02A 4AM0A 5FF3A 4YL2A 1ECQA 5IFHL 5L9DH 2ZKHL 2JCCE 1UURA 4BFBD 2ZF8A 5I78A 4L37A 3GC3A 5C86A 1NCIA 3GTHA 1AG0A 1UOVA 2R39A 3FTSA 1SXSA 1ZT1A 5CLWA 2AXJA 1VBJA 5FHAL 3TBBA 3GSWB 1PG7X 1PB0A 4G6KL 1DWJM 4HUXB 5HNTA 3JTTA 2Z6IA 5EB9A 5C0DA 2J5LC 2FGWL 3AYRA 2PABA 3UZEA 4WJKB 2YCJA 3O9WB 2V2TA 1KLZA 3JBG7 4N68A 4D72A 3EFOB 4KNUA 1E6XM 4AQEA 3MUCA 4I7VA 2QCLA 5TQ2L 4QNPE 1R3VA 1T6BX 2ZVRA 1JMXA 4R3UA 1AGEA 2YD9A 4WHYG 3HZMB 2EPOA 2H4EA 2HWGA 1VPOH 1IEXA 1LK2A 2VDKB 1SO3A 3VXPB 3FSVA 2F54B 1G6RL 1P5UC 3TZNA 3QW4B 3ARGB 2IKHA 1J7VR 5EMYA 2H6OA 1A3LH 5PAZA 2RCSH 3H0TB 2FVKA 4JFSA 2XSKA 3DHUA 4X7DC 1CDCA 1OD0A 3OG2A 2DIEA 1Q0YL 1HCZA 3IVKA 4LL1A 1AAJA 2YMTA 1A4BA 3VJ6A 1VKFA 2DW7A 5DMMA 1R5YA 4M81A 1N0LB 2ZPKL 1Q6RA 5BNKA 3WY2A 4I0PC 2PMZA 3WS6C 3RNKB 3QN3A 5CBAB 4MY1A 4P5TB 3I9GL 2GCYB 2ICCA 1O66A 4ZW5A 3KYMA 1DN2A 4UAOB 3BOLA 4N5UA 3UA3A 3ZMRA 3KPLB 4NQDA 2WP3O 2APBA 5C0AA 3QS3A 2VERA 4DKEH 3ZMNA 5FUZH 2FZNA 3RJQB 3V0GA 2VO5A 1L6YA 2E9WA 4HKBB 3WJLA 5E2VH 2FTAA 4HJ1A 3R0UA 4O58H 1ZVNA 1HL9A 4DGUA 3F65A 1TCRA 3LS5L 5AG9A 1DWGM 1JD9A 1H3GA 1HFBA 1A0CA 4YNGA 1IBGH 4XP6H 3GH5A 1T5XB 1ZPLA 4HEME 1P43A 5TF1H 3HC3L 2GDUA 1O1ZA 4NZRH 3T8QA 2YMXH 1OO2A 4XAWH 4Y8FA 3N4FA 1WCQA 4ZOBA 3MGAA 3VQLA 4ONHA 3HO8A 3K72A 4WQ6A 1AHWB 4NN7C 2J9XA 1HVXA 1RHCA 1BZ7B 2E7FA 4RNJA 1W5NA 3NPVA 4X6DB 3LI0A 3LKQB 4EOWL 5PTDA 4N2KA 4S0SD 1PNDA 2FSEA 4AZ8A 1U8IB 2VDLB 4J4PA 2O9TA 1T7WA 4AC4A 2CNZA 1ZUAX 2QT3A 4EVZA 4BSWB 3DU0A 2WB7A 4MAYA 1BEXA 4NJ9H 3UTTA 3BW2A 4FX8A 5JDSA 2XN2A 3N0PB 4IMLA 1KCWA 1H9DA 4M5ZL 1RBLA 4WGHA 4TS6A 1P7KA 5TJWK 4GO9A 5JLZB 1FCUA 3BE7A 5F7NC 1BQCA 4AEHH 1KTDA 1O6TA 3KPNB 5F9JB 3U1PA 4NHUA 5KSBF 3TYGH 4KHTL 4OVUA 2V7NB 4TTDC 4U6HA 5KSUA 2DQHH 1NCCH 3U2CA 1ECZA 3MHZA 2FMOA 4F93B 4ZE4A 1XIMA 4Y16D 3OZ9H 3W24A 3DBSA 5I0ZA 2Z4QA 5EU6D 1T1YB 4K71C 3P77B 3H4FA 4AIEA 2AHIA 3WK2A 3WFBH 4XO4A 1KIRB 2PCYA 4R8WH 4IHOA 4ETYA 3TWAA 25C8H 1XSOA 4AYGA 3UJTL 4R7LA 4DKFL 5IBLC 1ZHNA 3E74A 4WHBA 3MBEC 3WEOA 4R85A 4LBRA 2GQ9A 4FP8L 2VGFA 1SJHA 3VYNA 2DQCL 3T77A 1X9QA 3P0VL 3LCFA 3O41A 1PYFA 3GHBL 4G6AC 2X6BA 3W3BA 1MFDH 3TNNB 4PAZA 1NL0L 3QG6B 2H26A 4IXXA 4X6FB 4CGTA 1B4LA 4FXKA 2A21A 1K8IB 4NAEB 3U5YA 5DLLA 5MP6H 4R9XA 5AKSA 1JPEA 3CMFA 1J0JA 3EHBB 1NCUA 5I23A 2ZUWA 2DV0A 3TN0A 3G6JF 3CPUA 2DQGH 1T7XA 5DO2C 2ISDA 2NQLA 3RR1A 3CPLA 2MWCA 2J7EA 3EOYG 4NENB 2VMFA 4NNCA 4IRJD 3FTXA 4NDMA 3ITYA 3FQXB 4WUKH 3NVDA 4E9WA 1R3KB 2HRPH 5AHIA 1Q65A 2EADA 5BXTA 2BOLA 1U3HD 1UZHA 5IVZA 3GS4A 1UJPA 3DGGB 5K9CA 2BFVH 4XQ6A 3V6FA 1P0SE 2Z93B 3K6FA 3ZJ6A 5T3ZD 4PJ9A 3EGSB 3D4YA 1MIMH 1NANH 2APXA 1UZ1A 1R3SA 3O6YX 4O02H 4D9QE 4DBWA 3WQEA 1SDAB 3TQVA 3TYCA 4PR5A 5GS0L 3PJNA 4DNHA 3QPKA 4OJFL 3O2VH 4YPGB 2XH0A 1DVFC 3BUIA 3VYLA 3CYJA 3GDBA 1TPDA 1XSKA 2ZG2A 3IXTB 5DHVA 4NQEB 1PTGA 1BJ1J 5LG6A 1R3QA 1ZAGA 3WELA 4ZNCD 4CNNA 2XGIA 3Q0HA 5CPTA 3IFNL 5GVJA 5EOQL 1SLXA 4YHLL 1ZT7B 3WE6A 3UBXI 3CT2A 3LD5A 1F18A 2BNQB 4AWJC 3O6DA 4O4VA 5FOBA 3O4OC 2H9AB 2CIIB 5CZXD 3MV8A 2TPSA 3S4SA 2W4XA 1BQHB 1ZVYA 1YHTA 4RE4A 3AABA 4S38A 3U6RB 1AC0A 4FMVA 5IB4B 2UUDK 3D4GA 1GVRA 5AWNL 1WUEA 4ELMB 3A22A 2R4SL 4F7EA 4DH2A 4LCWA 3M6YA 5IMKA 5L9DL 4Y1AA 3UT0A 1V3HA 4PLJC 3WAKA 3I3EA 3S2NA 5E1QA 1GKQA 2XIJA 3QXTA 3HS9A 3DIDA 4RZCA 1OZUA 1RLCL 3K80A 1MAMH 3WH9A 1PCSA 2WLIA 5KSBE 2I25N 1WICA 4S2SB 3BXWA 1H8OA 3L95B 1T6WA 8CGTA 1JPTL 1U36A 1EZSA 4FA3A 3VNKA 1RAMA 4MWAE 3GSUA 3SCPA 3U0TA 3ABRA 1E4WH 1AXSA 1KIPA 1DVUA 3OYZA 4FYTA 2DT0A 1HXMB 5D1QD 3PP3H 1CD9B 1E3ZA 1FDLH 3FFCA 3NGFA 3GIZL 2DQDL 3KVQA 2RCSL 4ICCX 3QHOA 4QHMB 1YTEA 2X9XA 1I8UA 1NEZB 3NCMA 1H3VA 4AHOA 3F7VB 5CIPA 3RGBA 3G8EA 4KC3B 4DHGA 1ZJHA 1MHCA 3AIVA 4MY8A 4AZ5A 4PJ7A 1JZ2A 3QM3A 1O9ZA 3HMWH 3ZZQA 3TQ0A 5AW4B 2RFGA 2G75B 3MTWA 4BGDA 1DQWA 1UD6A 1Q9OA 5L2JA 3N9GL 2Z64C 3HTLX 4YHGA 3VAEA 4NRRA 1FWNA 5AOIA 4HDIA 2W0FA 4HH8A 2OMZA 2ID5A 4C4KT 1RPKA 4L4VB 4HD5A 5KYYB 1DQQA 5DMGD 3GNMH 1VEMA 4DKEL 5FUZL 5IW1A 1CIUA 3G6JE 3FB8B 3FYOA 3M7WA 4PW3A 3ULSA 4JTDA 4HB7A 1NCHA 4M7SA 2VFGA 3P62A 4YC2C 2DWXA 3LRHA 4XVEA 3MUZ1 2QKSA 3NJ3A 1RSFA 1FWWA 2OP4L 4O58L 1EGZA 3PWUA 4WTQA 3T0EA 4DB7A 3C6LC 1E51A 1O94A 1EEYA 1TMQA 3L3JA 2PP9A 4FA7B 1EBGA 4PRNA 4XP6L 4P7NA 1SEBA 4FE9A 2YUVA 1CGVA 4PP2A 4NZRL 4GKZA 2YMXL 3ZUCA 4XAWL 3SN4A 1C90A 2Y23A 3RXZA 2FWLB 2IQTA 2DQEL 5LBSH 4GH7B 1E8WA 4Q9CA 1I1YB 2Y7OA 1YLBB 3FXIC 4X9GA 1DXIA 4KVNH 4H6QA 1X9RA 3HBQA 1OX5A 3EXSA 4L9LC 2J2ZA 4F8PA 4PBEA 3MJYA 5FYLD 3F7PC 5CD3B 2ADJB 3RX4A 4GS7C 2BCKB 3WFEL 4NJ9L 3FUDA 2XINA 4GNJA 1YG9A 2OK0L 1LTXA 1QNZH 2BGNE 1VPYA 4DJDC 5H6HA 5CC5A 4JB9H 2XOTA 4C59B 5LHFA 4DOHE 2FGZA 5IXEA 4AEHL 1WNOA 3U6WA 1QSED 5B39B 3TYGL 3V4BA 4J3OD 2IUZA 5K9DA 3DOSA 2X05A 1M53A 2BRRH 2DQHL 3KZPA 4QT5A 1NCCL 2JKLA 2BS71 3OZ9L 2VE6B 1UZ4A 1A4CA 1DBAH 3EZJB 1W72H 5DRNB 1NGWA 1L6XA 3AZUA 3WFBL 1SLUA 2ARJA 2RQEA 4CD6A 4S2CA 3NN8B 4R8WL 5M1TA 25C8L 2OTUB 2NR6D 3J07A 3UAJD 4KHXL 2HJLA 4MVAA 1NEPA 3CHQA 2X4OB 5EOCH 2BSSB 3H9YA 5KEZA 4S1DD 4KKXA 3X1EA 1ZK5A 3PPEA 3EGXB 2IDQA 5JQ6H 2WV8A 4ISVA 4TQIA 3EUUA 2WQUA 1KUMA 4X9SA 4C6NA 3TIDA 3DV6B 4A2HA 2Z6FA 1U3JA 1MFDL 3VXMD 1TEGA 1IL1B 5EKYA 1QLEB 5HJBA 3XIMA 4UQ3B 3HPSA 5HULA 1UQZA 1DQLH 4NS0A 5MP6L 3DO7A 4L4TB 1A7QH 3KUMA 2WSPA 2E7LA 2G2NA 4PN6A 2CO6A 2HX9A 4B9CA 1Z0NA 3GU1A 4HQQH 3LZ5A 3MSYA 4YGVB 3LKOA 3FLUA 4XD5A 1O6SB 1GS6X 5FO7B 4GWEA 3QYSA 4YSSA 1ROWA 3FQUA 3ZBMA 1DJQA 3TWYA 4Y4FC 4NQDE 4WK0B 2OMYB 1F74A 4J2MA 1AS8A 2R4RH 2EBNA 1TMLA 5I1HH 4PC8A 2BFVL 4LCUB 5HHOD 3MA7A 4ZUSA 2PCFA 3KWUA 4N9OB 1F2JA 1XX1A 3SR7A 1OINA 3GMRB 2PWUA 4PB0H 3JWOH 1ADQH 3RR4A 1E9OB 5ESVB 4UTJA 4Y7EA 2VLJA 4O02L 3QZ6A 2Q2EB 1KBIA 2CZ5A 1YPXA 3CMOH 2B1HH 3PQYA 3O2VL 2E7HA 4ZAKA 3HR6A 4I9MA 4PTTA 1H6FA 5IP4A 5ABFB 3GKWL 4WHCA 5HVGB 3KWSA 1RSYA 3BG5A 2JKJA 3ZKMC 2C16A 3QF0A 1Y1UA 1G7UA 1MHHB 2YPVA 3PGDB 43CAA 4FTDA 2A6JA 4IMDA 1EZVY 3M1BA 4ADSA 4BQCA 2RD0A 3BUDA 4KOCA 3LKNA 1VCVA 4B5TA 4PJAB 1H0IA 3UACA 4QO1B 4R7NB 3GG0A 5C0JB 1RHHA 1R9YA 3BQUD 5ICZA 3SFWA 5LNUA 2J20A 2MPAL 2Z91B 2X28A 4UDTA 4R7JA 4DCQA 5BRZE 3K13A 3SBPA 2CGRH 1SBSL 5GRZA 1XGPB 2FTPA 4KZEL 3GDKA 4P3DA 5E8NB 3IBOA 5ABDE 4K2SA 5LA0A 1T83C 2VN4A 3SCTA 4NT0A 1SXAA 3CSGA 5AW8B 2VN6A 1CZ8H 3DHDA 1NGZB 4RZ5A 2IFFH 3GJFB 2J1ZA 1B2WL 2UWFA 3W7NA 2BCMA 3DETD 1PZ3A 5AL0A 3AZSA 1WO2A 1ZS8A 5D1XB 2PO6C 2EDDA 1FG2A 3BC9A 2XJKA 4F8QA 3NG3A 2ZT9C 1NIBA 3I6GB 4YL9A 3GSXA 1R46A 3TNMA 2ZONA 1T4KB 3SPVA 5J5DA 3R4RA 2K6WA 1IGTB 3N2JA 4DF0A 3WD3A 1E4WL 3VE9A 1D2PA 4GG8B 5XIAA 3ML8A 4HAKA 3S6CA 3VM7A 4WDTA 3GC4A 4QHNB 3FCTB 2E86A 4ESKA 4PJ8B 1OG6A 1FDLL 2DIKA 3IVTA 5CC6A 3BX7C 1DJZA 3D0VB 3B9AA 3L4WA 4R2GD 1VPQA 4K9JA 5FECB 1TZ8A 3D3VE 5HYQA 1ASPA 2Q8AH 1B0IA 2YD8A 2DLEA 4XODA 1BIIB 3CDCA 3CBKB 4E68A 2ZXCA 1TJIH 3H56A 1Q7QA 3WEZA 4EI6A 4JCLA 4JTGA 3PGFL 3UYPA 3WMCA 1UR9A 3VNYA 5E93A 2Z6JA 4Y9CA 3LJ3A 4I7WA 2ATKA 3DECA 2O4MA 2WMPB 5MERB 1P0KA 1I8KB 4C56E 4M7KL 3ASWA 3GNML 4EN3C 3D3AA 5IHSA 2H1PH 3SN1A 3NUKA 2MMXA 3WQDA 1THAA 5AEAA 1W2PA 1U92A 2WO3B 1CICA 1ZP3A 1I9JH 4NQSB 3MKKA 1F73A 1UXSA 1D7DA 4X3ZA 1YMME 4G8AC 4OV4A 3UX9B 1WS8A 3ZDZF 1WKDA 4JIHA 4AX3A 3DESA 4UQIM 2ZZ3A 1P6AB 2H6PA 5ADPL 4UQEA 4RMTA 3ZDXB 2B4GA 1H09A 3I7SA 3FV9A 3B4NA 1WCGA 1M57B 3SECA 4IPPA 3U0PB 5ETUB 3EYPA 1SZNA 2QCDB 3B2VH 5D2NC 1U41A 2JJTC 1N7KA 4NZ1A 2QIIA 2NXGA 1WXJA 4W6YB 3FFDA 3RFRA 4XRCA 5LBSL 2JCWA 4XCFH 2BK8A 3ZYZA 4RGMC 4R7OA 1ZWIB 1BOGB 3ET9F 5ERWA 4NYLA 2RAGA 4DYEA 2FHFA 4W9GC 4J3TA 2NY2C 3SDCC 1F4XH 2XV6B 1GKRA 5TBOA 1UFGA 3EJCA 4FF9A 1NDVA 4KVNL 3CVHB 3SCMB 3C2YA 3OAUL 5IROA 3LHPH 1RI8A 3WIIL 1G7HB 1XIWA 1YE4A 1F58L 1UACH 1SOXA 4L0ZA 2QV2A 4A05A 1RPXA 5MHSD 2DI7A 1M7UA 4GUPA 3JWDC 3KLKA 4EIGB 3B2PA 1FBIH 3QUXC 4OZFA 1IM3A 4IDJH 4GXPA 1FWTA 1PE1A 2QVKA 3LA4A 5C7ZA 3QNYA 1QNZL 5FWRA 3TIEA 3A4WA 2Q3XA 3LLFA 4JB9L 4C1NA 3TA3C 5FA4B 1DJSA 43C9B 1AZVA 1FWGC 1RLWA 3RBSA 4IOTA 2BRRL 4C60A 3OAYK 4N5EC 4MDJA 1D5RA 5EBLB 3SSGA 1GR7A 1DQJA 4W9DC 3F05A 4JVUA 4QRTA 5IHUH 3ECUA 1W72L 4WUUB 2VVSA 3CC5B 4ERAA 5EC1B 4MXVF 2E4FA 5HGAB 3OB0H 2UBPC 2R2CA 4FA8A 4M03A 1IGJA 3UR8A 1R5WA 4PJDF 4PTUA 5A2BA 4MJMA 2FK9A 5EOCL 3IAGC 2ZBTA 4L1LA 1QX1A 5DHEA 1WYJA 1NC2A 3QORC 4IKJA 1BX2B 1NEYA 4Q8TA 3SD5A 3ALPA 3VWKC 3E5PA 5F89B 4I9WD 1P84J 1DBMH 1WA0X 4M8QB 3BEVA 3LN4A 1ZHLB 4I5BB 4Q7BA 3QXAB 1E4LA 1WJ3A 1QLRA 4FFZA 2OU4A 1EPVA 4M6NH 5ID1B 2GOUA 3W0KA 3GGWA 1XUZA 3O6AA 3GMOB 3PP7A 2AXHA 5FEBA 1B0GA 1CT5A 4RQQA 1S7SB 1F3RB 1LWJA 4R0LA 1DQLL 1UQSB 4O1CA 2DMHA 5C6MA 5T3XE 1A7QL 5E8EA 4AY7A 3VGDA 4RV3A 2AQOA 2DQXA 5DZLA 3NSDA 3IDMB 1EGMA 1F97A 3VUAA 3UBXA 1IEIA 4P57A 1ESOA 4U1MA 3P0XA 3VI4F 3FQTA 3B8DA 1E5BA 1QWKA 1ZJBA 1KCKA 3WLHA 3C09C 2UXFA 1E4XL 4F0MA 1Q9WA 4UCGA 1WHPA 3HE6B 2IBZY 4NG3A 2Q3ZA 3PJSA 2NQ5A 3VTTA 1HNGA 2R4RL 5I1HL 5TE6H 1DJXA 3MYZA 3S35H 4CCZA 2P5EE 5KS9F 4N2HA 1IGMH 5D4YA 5CPOA 4PB0L 1FWJC 3VI2A 1QMLA 1ADQL 3FN9A 2RALA 4HA3A 3S37X 5BO1H 2VQ1A 4M0XA 1PHWA 3CMOL 2B1HL 3ZDZE 4JFPA 4RGOH 3UFYA 3I6KB 3O81A 3CFBA 2OR2A 3ATEA 1P1MA 3E2SA 5FUCC 1CUOA 4NU7A 3INPA 2NNCA 4OLXL 1HT6A 5T8IA 1TVBB 1PAMA 2NY5C 4MKTA 2ZXWB 3RL2A 5CD5C 3PG2A 5E6IB 2X1IA 3SRKA 1V0LA 4L6DA 1WIPA 3VFCA 2YAMA 2GJNA 3RWHA 3FCSB 4LSBA 2XG5B 2G41A 5EF2A 2WWOA 2BSLA 4W5ZA 5GZNC 4GFSA 4D1JA 3PDOB 1FRBA 4F8LA 3QJFB 4Q2ZB 2HCVA 1KM5A 5IVOA 1F7BA 3FNDA 5ISZA 2HSIA 3GIYA 1XYCA 3IMUA 4LYKA 5HNUA 3ZSSA 4L1WA 2CGRL 4LSTH 4KDWA 3Q58A 5D70H 4F8XA 3RP1A 5DDHB 4G71B 5D7EA 4AENA 1PWMA 5TGBB 3FC8A 4P4KD 5I7GA 4GG6B 2QULA 4ENLA 3JWNE 3PBVA 1XZ0B 1KRAC 4BKLA 1FA2A 4CQ8A 1HXKA 4WSHA 4JGMA 1AW2A 1XLDA 2YWZA 2IANB 1LF1A 1UC4A 2OJEA 3WLBB 4DWSD 2GT9A 2JQAA 1Q1PA 1DJYA 4RLDA 3H7LA 3THCA 5K3VA 1TENA 2G0LA 2F58H 1RZGA 4MXVE 3N13A 2EE3A 3L4YA 2BZ7A 1M7OA 4GIOA 1MI5E 1J4EA 5E5LA 3REWA 3OGRA 3JVFC 4PJDE 3LY0A 1FE8L 1QWGA 4YDIL 4TPRL 4WSGA 1EWEA 5DN1A 1L0XA 4WGWB 2QQKH 3NQKA 1ACZA 4QDWA 5FLUA 3HC4H 3Q65A 4Q56A 1N3NB 1I8IA 3WSQH 2IBGA 1TPWA 1ZHKA 3TC9A 4JG5A 1K4CB 3GMQA 4J8RA 2MANA 2OVLA 2AK1H 2Q8AL 4DELA 3KBVA 2AXWA 1ULVA 1WISA 2L4OA 4FHJA 2CIKA 1WLHA 1TQBC 1ONQB 1DP0A 1TJIL 4PWGA 3C8FA 3P73B 3S96B 3ISWA 4O11A 4S10A 3BK0A 3B7RL 4IGBD 4RDQF 1BVLB 4JFOA 4G6KH 1NWSA 2WXRA 1MOEA 2V7HA 1XLEA 1IGIH 3QIUA 2NNFA 4F9JA 3P4NB 3B8YA 4D9RE 1AQMA 4CNIB 1GAFH 4JXCA 4UAHA 4V2XA 4ZSOB 1E9QA 4GPVA 1EZLA 4XCEA 2V6AA 3MV9D 1I9JL 1D5ZA 3VI4E 3JZ7A 2FVMA 5TQ2H 1F8TL 2CA3A 4HOWA 3P0GB 4RXFA 1GJWA 4BSVB 1PVHA 5EU9A 3WLKX 4NJGA 1KC5H 4CNUA 1YDPB 1NPUA 3CQPA 4X8XA 3JYBA 4S3CA 4ZPVB 3OJGA 4AUUA 1CU4H 3MREB 3RF9A 3B2VL 3WV0A 1O9WA 4HKXA 1G6RH 3WNPA 1IJ9A 4K5LA 5KS9E 3TFXA 1GONA 1LD9B 4KKAC 2Q86B 4XCFL 4AGPA 3GHTA 2GVEA 1RY7B 2DLTA 1SPQA 3LERA 3IFLH 5L6UA 1JGVL 3Q5YA 4JG1H 1F4XL 3T3PF 4DX3A 5T91A 1VBRA 1FZMA 4X63A 1G9HA 3GM0A 1EQWA 3BLPX 3LHPL 3QDMD 4PA8A 5EMMA 1WIUA 3OLGA 4AVIA 2VUNA 3NP3A 3QAQA 4JRYE 3TTSA 2EZ0C 1HF6A 1PZ5A 4I18C 4RMVA 3BSGA 3W7PA 4L3EA 1NC4D 1FBIL 3S9ZA 3FSUA 1UEYA 4IDJL 4GQGA 3LHWA 4QJ1A 5DURD 5DWPA 1XCWA 5KJ4A 2Z1SA 2W9DH 1ETA1 4PWKA 2CCLA 4YVNA 3VWJA 2GTWB 2VX7A 4GYPA 2GYIA 1I53A 3ORWA 2CALA 2YBGA 1VS1A 4RESB 3TYBA 2W62A 3M7OA 4JPIA 4DPQA 3OXSA 4AQ8C 1JNHB 2FQEA 3N9SA 4BDVA 4GXUN 5CS7A 1DVYA 4K8EA 2I9TB 3WQ8A 5H4ZA 1DUYA 3SGJC 5BMWA 2XTJC 3M45A 2GGIA 3KWWA 3FU7B 5IHUL 1W9UA 3NK4A 3QHFL 3TT1H 3VFVA 3F01A 2CC0A 2EIEA 4ODWA 4HA0A 2R56H 5I76B 3QDGD 3THMH 5DCEA 1S78D 4MY9A 2CO3A 1IZKA 2FJFA 2N7AA 1SVDA 4DXKA 4YTUA 1V0KA 1ITQA 3BL3A 1T21A 3WLSA 1TZIB 4D6JA 5I6XB 3FL7A 3FU3A 4HNNA 5MEQA 4FQHB 3RQ3A 1QLFA 4PREB 2BGQA 4K7FB 3HNVH 3CSYA 2E6FA 4EOWH 5K9OA 1SPDA 1I8MA 1RVFL 1NWPA 2YK1H 5IUCA 2E5CA 3MNZB 1AJ2A 5K4ZA 1DBML 4B7LA 3IJ6A 1XAKA 4GUGA 5ICXB 1IU1A 5FGSA 5I1IL 1MXGA 1LWIA 2FFIA 1HHKA 2OI9B 1E4HA 4PJCA 1I8JA 1VEOA 5EU4A 4PY7A 1WFIA 4M5ZH 2H3BA 4LLYB 1XUUA 1XXDC 4LALA 1NPNA 2IWKA 2UZIH 5FOJA 3MSGA 3NQ8A 3GTIA 2WPGA 3APCA 4FIQA 4OY9A 1U8HB 1QFWI 3P2TA 4A6YB 5DSCB 4BFGA 4APQA 4H41A 4XBGB 4LVNB 1PKMA 2HFFA 1GYLA 4UUJA 3QWQB 5F93C 4H0GA 3PV7A 1F90H 2Y0FA 5AHFA 5J1AB 3P74A 4MVBC 1VHCA 4Q89A 5GISH 3LZ3A 1UR2A 5FF6A 4OIAA 1OE3A 4PTDA 3UJTH 3MUY1 4L5FH 3S35L 3SE9L 3PL6C 2MRYA 1YXCA 4DKFH 2EINB 2VL4A 3ILEA 3CQ0A 3RU6A 3NEXA 1IGML 2FJHB 4QLRA 3VKKA 1OVDA 4D0BB 5C70A 2EDEA 5BO1L 2NXIA 3CU1A 3TBSB 3P0VH 2RJGA 3MCMA 4OGAD 4RGOL 3OPUA 5KYWA 3GHBH 4MWFB 1LBLA 4Y16B 1IVTA 3IWPA 4D8AA 2I9UA 5EU6B 5H8DA 4JIPA 4JN8A 1SJVA 5I9QB 1NL0H 5EUKA 4U6VH 1UWXK 3LZRA 1XCQA 2WZPD 3R5EA 1FG9C 2NY6D 3BJTA 5FCUL 3K0WA 2GQHA 4HWZA 1O4UA 3R89A 2D24A 4GLRI 1N8OE 3W2UA 3T3PE 4PHZA 4NC1C 1L6SA 3EA2A 5SWSE 4K4KA 1F6AB 4X6EA 1OXYA 2OM5A 4XB8A 3MFFA 4ES9A 1AQKH 2YPLD 1Y5VA 1EGJH 1C93A 4Q58C 2YRPA 3POHA 2HMCA 4O02A 2FNBA 2O56A 4YHIA 2OOFA 3DTUB 1BAWA 1T6VN 4LSTL 4XKYB 3OJDB 1AMYA 3AY4C 3ZHLA 1NARA 2WQSA 4LSPH 1OFPA 3WTTA 4NP9A 1JGIA 4FFYH 4W9ZA 1SFHA 2EO9A 2YPKA 1E2VA 4GW5A 4BUGA 3A47A 4LSSH 2UV8G 3BP6B 3PZ9A 3CN2A 1GGUA 3OBAA 4IRJB 5TAOA 3BO8A 3K30A 4DETA 3G9VA 1VCBC 3SY0A 1Y6KR 4AC7C 1ZIBA 1FH5H 2F58L 5HI3C 3IETB 1ADOA 4YHEA 1F6LL 1YMHA 1FZKB 2LW3A 3CBJB 3G2GA 2BVPA 4M9OA 1CC3A 5I75C 5EOQH 3W38A 3OMZA 3LQLA 5E2WH 3QG7L 1CFSB 1WFTA 3WKNA 3CLMA 3BAEH 2EPMX 4HCRH 1B3WA 1W16A 1USQA 3PZQA 3ROLA 2QQLH 5BZXA 5AOMA 5DEJA 2VR6A 5B80A 2IPKB 4QJ4B 3P9WB 3OKKA 1R75A 4JRXE 2PDFA 3M1CA 2AK1L 3U2SB 3WJMA 2FT7A 4JVWA 5CZKA 2BLEA 2EUXA 2OWWA 5KSAD 5FO9B 3I50H 1EQPA 5AOJA 1D8WA 1TJ2A 1M7XA 3W7IA 1UT2A 4OBTA 3LM7A 3QBUA 4HYTB 3HHRB 5CG0A 4W9LC 3NRFA 3MI2A 4PLNC 5L9FA 5KTEH 2A6DA 3VXSA 4JZOA 3GMPA 2OT0A 5GIRA 4APXB 3UJRA 3BUTA 1IGIL 5HGHB 3AIWA 1T1ZB 2DGAA 4AD3A 1T22A 1JTOA 2YGYA 2J13A 1LO5B 1GAFL 4N0UE 5HSFA 4B9PA 4QHRA 1YUHA 4E41D 3FF8A 3W7LA 1EQCA 2X0UA 1CLVA 1KG0B 3B5HA 1JPTH 1OIOA 1DVTA 3BVDB 1V7YA 1QD0A 2MUCA 3MP5A 5GZOD 2EXTA 1KC5L 1RZMA 1Z9AA 2CUHA 2DZPA 4P7OA 4B16A 1OX4B 1VJSA 1CU4L 3CAKA 3L3OB 1QAWA 3IB4A 1JWMA 3LBOA 3MXVH 4PMJA 4ACTA 1K4GA 3SJVA 3GIZH 2DQDH 2CCWA 2ZOLB 3TJLA 3NFPB 2ZSWA 2CGYA 1LEKB 3NA9L 5CCZA 4MQXD 3IFLL 4JG1L 2XA8H 3F03K 2BZCA 3FPYA 4QPEA 3SADA 1KLGB 3MY9A 1KCLA 1KCZA 2YLHA 3VG9C 1IWBA 4WXZA 1P7QA 3GZOA 2YLKA 3PHAA 1S7WB 3LRSB 5HYSG 1MRCL 3N9GH 3CCHA 2I17A 4BFOA 4NQQA 5D1QB 5KINA 2XFXA 4QOKA 3DVNB 1BECA 2W9DL 3OZOA 1PD1A 3T6ZA 1CG9A 4HQVA 4PI2A 3FYIB 2JEPA 4ES4A 1GORA 2D22A 3DK2A 4XNQB 4YWSA 3MNMA 1D3CA 3RVWC 4KEZA 1PZUB 5LBSA 5IOBA 3KPOA 3KJ4C 1FO0B 3DX5A 2OP4H 1FL6A 5IQNA 2WLJA 2CCVA 5FGRA 4WI0A 3QUZA 4Y4HA 4YSUA 3IDGA 2IMRA 2PPDA 3UTZB 2DI9A 2FEDD 3G22A 1XHGA 2C9RA 3OPSA 3TT1L 1CYXA 4XN1A 2JI3A 3GWJA 4XPAL 5E4EB 2R56L 1VBGA 1E6ZA 1HDMB 3IAPA 3THML 3RPTA 2Z1WA 4BE5A 3GFZA 4FHBD 3C2VA 2DQEH 2FRGP 1E0TA 1JWUA 2AQQA 3WIFB 4U49A 4L65A 5IK3B 5J6HB 1ZLDA 2I27N 4ZFOB 4F80A 1X8FA 2A3CA 3BHBA 3HNVL 3REQA 1Q7ZA 3O3BA 5E0FA 5HPCA 2GABA 2PW2A 2CRZA 5BOPA 2YK1L 3EDJA 1VADB 4ZOCA 3LIUA 4P2QA 4NJKA 1BQLH 1XGUB 4GCAA 4HT1H 1LP9F 2IH3A 3VFNA 3TF4A 1QJWA 4PW9A 2WTRA 1XLKA 2BS8A 1EJFA 4TUOB 3WFEH 4DP5X 3K71B 1AR1C 5HHVH 3MUGB 2OK0H 2J71A 4NN6B 3NXFA 3EW3B