4DO4A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 130
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do4A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do4A01
5AHEA 3SGUA 1BAGA 3QW3A 2B7NA 4MUZA 2CLHA 3STCA 3GK0A 3SW6A 2YKKA 4NT0A 2F61A 3SR7A 2EKCA 3UEQA 2AQWA 1LBFA 3N2XA 2ZZ1A 3EJTA 1WP6A 3WMSA 2X1TA 5C54A 4O4VA 3W70A 1WZMA 3LV6A 3BVXA 3FW6A 4UTWA 3BMVA 2OW6A 4Z1DA 2NUYA 2FH8A 1EEPA 1YPIA 3BG3A 1JUKA 4FX7A 5KZDA 1JULA 3WNOA 3B0PA 3IVUA 1H62A 4OV9A 3NQCA 4RLIA 2EJ1A 3VX1A 3CWOX 1LWJA 1U5JA 1TTJA 2WJZA 1H61A 1JIBA 1I75A 1D9EA 3EDFA 2QR6A 4U28A 4UFKA 3D4YA 3M5XA 2V3EA 2GQAA 5HUOA 3N9RA 3I65A 1W3NA 2EACA 1O7DC 1QPRA 3T40A 1FQ0A 3WENA 3P5YA 5FEPA 3LCIA 1KFEA 3TXZA 3L4XA 2Q3RA 1KLZA 3GYEA 4LV4A 4UCGA 3ZT5A 3VMNA 5KEZA 3GDRA 1UH2A 1QWGA 2ZZ3A 3OVPA 3DFTA 3P84A 3QC3A 1KM6A 5K4ZA 1EPXA 4UUIA 2WSKA 4ADTA 1AQMA 2E6DA 1KV8A 3S42A 1NF0A 1FCUA 3ATZA 4UTWC 1G9HA 4D2JA 1QNVA 1SO6A 2F2HA 2ZZ2A 3TSDA 4FXRA 8CGTA 1IZJA 3K8LA 2PWGA 1MEIA 1JCYA 4EF8A 3DHPA 3M43A 3MHGA 1QFEA 1JRBA 2NWRA 3DH7A 3VMPA 3QRHA 4FB7A 1BEUA 2ATMA 4IMDA 4WZHA 1S5TA 3TJLA 3W7OA 4J9JA 4UFIA 1K8ZA 3UXAA 2QMKA 2G96A 1HL2A 5CZTA 2EADA 3GNDA 2YR1A 3TH6A 3N3MA 1BSIA 3PVFA 3GBEA 2QCMA 3K1DA 2ATSA 3NZRA 3LXCA 2V2HA 4UFLA 5DLCA 2OW7A 2A2IA 3IIVA 3QMSA 3G1FA 4UTUA 3ZR6A 4UR7A 4JTGA 5CLTA 3BLKA 2FIQA 1LBMA 1ZJIA 4IUOA 1XBYA 4PA8A 1CGTA 2FQIA 1XDMA 3P67A 4Z0SA 3LHZA 4J3SA 1OFBA 3G18A 1PIGA 1QO5A 1B2YA 2ISSA 2CPUA 3NL2A 5AOUA 5LNWA 4GFSA 3N2MA 5HWJA 3LCGA 4N9EA 3PB0A 4N6EA 4U31A 2ALWA 1LDCA 2TPSA 4JTSA 2CZDA 3HGOA 3W1AA 1QX1A 1B57A 1JR1A 1KW1A 4OBTA 2C8NA 1QDSA 4DEFA 2QDHA 1J5TA 4CGTA 4G1KA 5EMYA 1OGSA 2V2CA 1RQBA 2G97A 3QJAA 1A5BA 4ATWA 1AK5A 1W9XA 1FDZA 3TKFA 5I3IA 3KX6A 2CLLA 2FDSA 3BH4A 3THQA 2Y88A 1W0MA 4DO4A 4S1FA 3E12A 3TW6A 3W7QA 4AWUA 1F05A 1W5OA 6CGTA 3MUXA 3NGJA 3TNOA 1RP8A 4BFAA 4RJEA 3BW2A 2FPTA 2BHUA 1IXPA 1TPEA 3L2IA 3P7YA 1KM0A 2NX1A 3HJZA 4NNAA 4CKQA 4J28A 4HOZA 3H53A 1GJPA 1DBTA 3R12A 3AO0A 3PBUA 3DHUA 1D3GA 1KFBA 1B9BA 4FEZA 3CZSA 2ZRWA 2ZRXA 3W1UA 4OKDA 3WJYA 4HSNA 1PZ2A 4J3XA 3EWBX 1WX0A 2O7SA 2OZ0A 1F6PA 4N9DA 1OX4A 2YDAA 2WOQA 3ZSSA 2A7RA 1CDGA 1JCNA 2C16A 1G4PA 5A2AA 1TJRA 1VJSA 4O18A 2Y7EA 3TDFA 3NQFA 4S2CA 1PIIA 5AYZA 4J3UA 3VFLA 5CZJA 4ZQNA 1F2JA 3CQ0A 4PFMA 1N55A 4R33A 4FNUA 1KTBA 3PAJA 3RIKA 2VEKA 1KFCA 1VIWA 3WN6A 1CW2A 2AAAA 3KLKA 4GI6A 2CXGA 1LP6A 2FYVA 1TPC1 3WNPA 1MXSA 3ABQA 3TIMA 1V3KA 2QUTA 4JX5A 1TRIA 2EO7A 2P0OA 2X16A 2YFNA 4PCTA 1YPFA 4DF0A 2OSWA 2UV8G 1KFJA 4IWWA 4MY9A 2DZWA 3INPA 1B4KA 3R8RA 5HUPA 1JCJA 2VFHA 2NXGA 1HVXA 3I7QA 1BKSA 3EDKA 1P1XA 3HB9A 4AW7A 2I9EA 3KL3A 3TFCA 3GDTA 3S1UA 1DEDA 1MEWA 3TONA 4O53A 3GX9A 1BTMA 3MJYA 1G69A 1QW8A 2VFDA 4BZYA 4MOZA 4S2BA 3B0VC 1W31A 4ZMGA 2ZXQA 1OT2A 1EX5A 3HGJA 1BWKA 4RCXA 3HJEA 3LTPA 3D51A 3TSBA 1LOLA 3ZWSA 3VX0A 2Y7DA 1M53A 2BY0A 5I3HA 3QFEA 2XFWA 3S0CA 1JGIA 4NJKA 3DFQA 4JTLA 2YYUA 1FXQA 1LTDA 3BUPA 1K7FA 4FIRA 1O60A 3QF0A 4U3CA 1OFRA 1VPXA 5BRQA 2ZXAA 3L4VA 4MVAA 3IJ9A 1WYIA 4M56A 3V75A 3A6OA 3W2LA 1CX9A 3LCFA 4NVTA 1EP3A 3A9IA 5KINA 3WY4A 3UCQA 1KXTA 6TAAA 4K39A 4BK9A 3M07A 5EY5A 3FJ6A 5LHFA 3IIZA 1KBBA 4YWIA 5J5DA 3BUIA 2A85A 5DFAA 3HG5A 3GNNA 2NZLA 2C15A 4CCDA 2VUYA 4CVWA 3MMTA 3S9YA 3PR2A 2OYKA 4U33A 4XB3A 3LCLA 3GXFA 3UY8A 2IQTA 2XWEA 4PL1A 3RLVA 1I2OA 3BK0A 2VRKA 3O16A 4BWLA 1ZALA 1W5PA 4H6KA 1JF6A 2E6FA 1K03A 3QEZA 1OYCA 2Z1KA 8TIMA 3RMJA 3TXVA 1DHPA 2BSLA 2RDTA 5FF0A 3DZ1A 3GXIA 3G1AA 3B05A 3EJQA 4K7VA 3BLEA 2X2JA 1ALDA 1T96A 4JX4A 3L65A 3WDHA 5E6YA 1QPQA 1ZY9A 3IGSA 1WOBA 1FX6A 2BXZA 2FLIA 1Q6OA 4AF0B 1HL9A 4RKAA 3USBA 1KBJA 1FWSA 1AW1A 1MW2A 3WNNA 3A5VA 2QLYA 1VLIA 4YXGA 3MHFA 2NV2A 2EPHA 2BHZA 4XBSA 5FEZA 1GPWA 1BVNP 2DJXA 4N2YA 4JFVA 3ZT7A 1SMAA 1I2QA 3VSTA 1WXJA 5G5IA 4WY0B 3KFTA 2NUWA 5LNRA 5FI8A 2AAMA 3G3MA 3KHJA 2DZTA 1MXGA 4H8UA 3G8EA 3KVLA 1WZKA 1B3OA 4QQ3A 3W7PA 4KWVA 1M7XA 1C8VA 2VEPA 3W7RA 2ZUSA 2WQPA 4O52A 2XN0A 4NJGA 5AHLA 2RHGA 5CGMA 2NX3A 4PL2A 4N02A 4UFJA 3BAWA 5HPOA 2HMCA 4MJMA 1ZHAA 2E8ZA 4OGZA 4IGHA 5G2HA 4ALDA 5L9FA 4Q4KA 4JL1A 1OYAA 5ABTA 2D2OA 1Z48A 3NQAA 4WQ6A 1VZWA 3ZOAA 5K9CA 2JKAA 3NG3A 1OSEA 1H50A 3KAOA 3WK3A 3IJ7A 2VEIA 4WXYA 3UD6A 3HOJA 3NQDA 1YXDA 2HS6A 5D37A 1KWKA 3NPVA 4KFPA 3RF9A 3L5MA 4AMXA 3R2GA 2ZUVA 3Q37A 1VS1A 1A47A 1YXCA 4LTSA 3H55A 4JXCA 3BV4A 2EF9A 2GQ8A 1E43A 1ZJAA 4AVFA 3N14A 2EEXA 3OBKA 3CPUA 1QW9A 3IJ8A 3LPPA 1QO2A 1R2SA 1XC4A 5G4WA 1KTCA 1NOFA 3C52A 4JY9A 2VENA 4RZ5A 5K7JA 1VC4A 3UERA 4B9YA 3E0IA 1F74A 3PULA 4QSHA 3LLDA 4HT3A 4FLRA 4UZSA 1Q4NX 5BW6A 2WNQA 4MZ8A 1SZFA 4DF1A 1RD5A 2PC4A 3NPWA 3WJZA 1CXFA 3O6CA 4UMBA 4O8RA 4ADSA 1W8SA 2V30A 3PSWA 3TCEA 3KEHA 4O19A 4UOQA 5BMWA 4BWLC 1U30A 2Y7GA 3VM7A 3PY2A 2YA0A 3W7EA 4MY1A 1YYAA 3LI1A 1TJPA 1MXDA 2QJIA 4LOCA 4WSKA 1OK6A 4UTHA 1PCWA 1JL8A 1VRDA 3IVSA 3OLEA 4IMCA 2NT0A 5I3KA 2JK2A 3FA5A 3OG3A 4LT9A 1HTYA 3N73A 3KRUA 1C29A 1CGXA 3BUBA 4FMVA 2QDGA 2WKJA 2ZQ0A 1A50A 5F2LA 5TIMA 4Y96A 3IIXA 3W7MA 1GJUA 1OFDA 2CW6A 1TV8A 3GAKA 3G1SA 2D3LA 4GUJA 4Z1BA 4H4IA 3SGZA 2NXHA 4O12A 1M5WA 4M5PA 2FFCA 2C13A 3MHUA 3ZS4A 1PPIA 4U4MA 5E9AA 3NQVA 5F2MA 1XBZA 1OFPA 2ZBTA 1XGZA 2QCDA 1YLVA 3P60A 5HJLA 2WVTA 4JTJA 3IVTA 4JYDA 1OVDA 3EWZA 3GDMA 2CLOA 3W1QA 1THFD 1E3ZA 2Y24A 1KV5A 3S5NA 5AN7A 2WVSA 3S5OA 3KXQA 5D05A 3HG4A 4IXXA 1OFOA 3LHWA 3UG4A 3G3DA 3BW3A 1ZAHA 3SFKA 4M7TA 4IX2A 1K7EA 3FJLA 3DI1A 3HMJG 2A7PA 4O13A 1OFQA 1GJWA 2R14A 4ZL1A 5C2XA 3LPOA 1ME7A 4E38A 1NAL1 3BAIA 4N9CA 3LLFA 4UZUA 2QJHA 4FHAA 1H1ZA 4KWWA 3SY5A 3EXSA 2YW4A 5FESA 5DXXA 1VCVA 3MI6A 4O14A 3NL3A 5F2IA 1XI3A 1FXPA 2CLEA 2XVKA 3PG8A 3HPXA 2J88A 1ONRA 2FB3A 3TC6A 1UD6A 3B06A 3L0GA 1GOXA 1YDNA 3UWQA 2H8ZA 4UMAA 1TMHA 1Q6RA 3BLPX 2WV8A 1QHOA 3W7LA 5EKYA 5DBUA 1UD3A 5DCBA 3L4UA 4MYXA 1T99A 4LU0A 2ZICA 3HZ3A 2R8WA 3OA3A 1MVYA 3DX1A 1LLWA 3ECQA 2ZWYA 5D33A 1B4EA 3IK2A 3IRDA 3NQ2A 3W7HA 4OQVA 2NXIA 2TAAA 3AJ7A 1VFUA 5AYXA 1I45A 4HPXA 1NEYA 3O1NA 1CXLA 4LS0A 1ZJBA 3W1XA 1GTHA 1PV8A 3S1WA 4FX6M 2X1UA 1YXYA 3O8AA 2ZUUA 1C8QA 2WNNA 3P82A 5CKSA 2ZZ5A 2BY3A 5KZEA 3PWAA 3W2KA 3HG3A 4K8EA 1V3LA 3S5ZA 1GWJA 2ZDRA 2J9XA 1EWDA 1QOQA 2Y6ZA 1JJKA 3LBMA 1IIGA 4AHPA 1XXXA 1LYXA 3QM3A 4Z1AA 4M7SA 1A5SA 3RFAA 1LROA 5D04C 4NX0A 4JFSA 2PWEA 1NF7A 1L6SA 2C0AA 2NV1A 3ZQ9A 3BAKA 3O05A 4E2BA 4XKYA 3MBFA 1EP2A 3O6DA 1XUZA 2B7PA 1VFOA 4QISA 2OYLA 3TSMA 1ICQA 2E4TA 2DIJA 5CGTA 3CIXA 3DI0A 4Y9AA 1H7NA 1WO2A 2ZUTA 5D2XA 4LRTA 3ABOA 1LORA 5HULA 1CPUA 1VHNA 2Y63A 3W22A 1MEHA 3ZWTA 4MZ1A 3QYQA 1I2NA 1WBHA 2X2GA 5AC8A 3VO0A 3I7RA 3NYZA 2TRSA 4LC6A 2ZIDA 3QMTA 3EDJA 2F1BA 3GXPA 2V2DA 1M7PA 1A5CA 5D02A 2J9ZA 1TQSA 1ZAJA 2ZRUA 4JTUA 4CNPA 3W7NA 5K2ZA 5BMXA 1RR2A 1PHWA 1D7FA 3Q58A 1JFHA 4UNLA 3TOPA 1CIUA 3F03K 3L67A 4M8UA 5A8GA 4YMZA 5U7SA 4NNCA 4CQ9A 1H5YA 4TO8A 1KGXA 2FHCA 3S6DA 3W84A 2F7FA 4R53A 3KE0A 2EHHA 1LRNA 3W2MA 1K02A 3VNYA 4Q32A 4RX0A 5FF7A 3VGFA 2WVVB 3B04A 3ZSTA 3ATYA 4AHOA 2Z6IA 4H7VA 1X1ZA 5LHEA 3U2OA 1WQ5A 1XBXA 3PM6A 1GZGA 1N7KA 3PS7A 1QCWA 3C4UA 5FF4A 4GQQA 3I68A 4TMBA 3VGDA 3GKFA 1TTIA 3DENA 4JCLA 4A2SA 2CLKA 1NFBA 2ZCGA 3GZ3A 4JIQA 4K38A 1RZMA 1E3XA 3W23A 2G3MA 5H2ZA 2J6XA 3OLDA 1BG9A 1Z32X 2ZWZA 3DAQA 2B0MA 3R13A 1EB3A 1KM5A 3SI9A 3STEA 3ZR4A 1XV8A 1MO0A 3HIJA 4HNUA 3BUQA 2ZXBA 4JDBA 1WOAA 3WJSA 2WSQA 4GO9A 2Y2WA 4Y8FA 2QCLA 4AEOA 1OG0A 1P6WA 1LOSA 2H3DA 3Q2DA 2AMGA 4RV8A 4RZ4A 3EB2A 4AEFA 5D30A 4O1DA 3OIXA 1HUVA 3FYOA 3MP4A 1PVNA 2Z2UA 5HMSA 4P61A 4QJ1A 1DORA 4GI8A 3O6YX 3SSJA 1L6WA 3NPXA 1OJXA 3W7GA 2OYMA 2VEMA 3TAKA 4AB4A 3SECA 1J4EA 1WE5A 4H8HA 4LVDA 2Y4SA 3OVRA 5KTLA 3NVTA 2V0TA 4GIAA 4E2OA 5I24A 4CCCA 3FFSA 4JL2A 1VH7A 1FWNA 4MAZA 1KM4A 5D2WA 3WNLA 4YCPA 2VELA 1OYBA 5F4WA 1UUOA 3PUDA 4FIQA 4ZQRA 4JTHA 1C9DA 1UBSA 3UWZA 3W85A 3CLMA 3VMOA 1TREA 2A6LA 1CI1A 3MYPA 4O15A 2KZHA 4AXKA 1P0NA 1DJQA 2A1YA 3PSVA 1XCWA 3MI3A 4Z1CA 4GO8A 3EWUA 2V5LA 1TQWA 3MYOA 1WDWA 4AWTA 4ZQPA 2BWGA 1SUXA 4LS2A 3BLFA 1V3JA 3G1VA 3PG9A 4MLJA 3AMKA 2FB2A 1ZCOA 1KB3A 3NL5A 1JI2A 2G3NA 4O28A 1EO5A 3NXFA 4JD4A 2D73A 5MHBA 2WCSA 3KLLA 1TV7A 1CXKA 2V82A 1IIHA 2RFGA 1SPQA 2J24A 1L9WA 3BG5A 2OSYA 3OEXA 3CZEA 2GUUA 1V7YA 2DZVA 4XBKA 1OF6A 4XTDA 5HWMA 5LSMA 1QOPA 1G7UA 2J25A 5AYYA 5CLWA 1HFBA 1O95A 3TQKA 5E93A 3W37A 1TO3A 2WPBA 1M7OA 2X30A 1G7VA 1TMQA 5G1TA 3KOFA 1K3UA 1W3TA 3ELFA 1JXKA 3S1VA 4L4MA 4O50A 2BY2A 1XD1A 4JTEA 1SO4A 1G4EA 1UUMA 4JTIA 3C56A 2DORA 4CLMA 4ADUA 2NT1A 3LHUA 2VFFA 4LWWA 3P80A 4YCOA 1GVRA 4X0NA 4CN1A 4UQCA 2P10A 2DU2A 1UKTA 3WDIA 3MI2A 4LQ1A 2ZRYA 4MFEA 5CSRA 3W38A 2ZX8A 3A47A 1F7BA 2WNZA 3FIGA 4AYGA 4GUHA 2CZFA 4TU1A 4EVZA 2PCQA 2OX1A 3I6RA 1ML1A 1SU5A 1HL8A 2VXNA 2X2IA 1LBLA 4J3WA 2A7NA 4WF7A 2GVYA 1WZLA 4HHPA 4IJBA 1R2RA 2B7OA 5LNVA 3S8HA 3CB8A 3HPZA 2ZZ7A 3MBDA 3P8IA 3TMQA 2JKPA 2E68A 4J27A 4CN6A 1QI5A 3DGRA 5GVJA 4OWGA 3TAOA 2Y85A 5G2IA 5AC7A 1Y0EA 3G22A 2Z0IA 3WNKA 5TBOA 4MFDA 4B9ZA 5SWUA 4FNTA 1MW3A 1VHCA 4FLQA 5BOOA 3AMLA 1ME9A 2QAPA 3FS2A 3T7VA 5J5RA 4PCSA 1OHLA 5D03A 2YA1A 4WY0F 2BX7A 2QCFA 4A2RA 1QMLA 1UH4A 1T8XA 3W2UA 1OFAA 4DQWA 2VNCA 2CFFA 2ABBA 3GR7A 2E9BA 3BW4A 4J3TA 1GG0A 4J7RA 4OT7A 5HDRA 9CGTA 1CXEA 4DF2A 3BCFA 4AMWA 1JD7A 2ISWA 1UKQA 4DBDA 1JI1A 1DTUA 1LOQA 3W7JA 1JUBA 4LVGA 4XKYB 5DBTA 3EKZA 1X6UA 4NJHA 1W5QA 3UWWA 1R34A 3BVWA 1QR7A 2WVUA 3NM3A 2X1RA 2LLEA 1KA9F 3TMLA 2Y7FA 5DY2A 3G1HA 4PCFA 1N8FA 3W76A 5D09A 2YFOA 1XSKA 1J2WA 3GKAA 3L21A 4WY0A 4YL2A 3DFNA 4K7YA 3BLBA 1CGUA 1KCLA 3M6YA 4UIOA 4NI3A 1XD0A 2WVVA 3NZ1A 1H7PA 3B03A 5DXYA 3VGBA 3TW7A 4ZVJA 2XVGA 2QCEA 1ZS2A 4AYSA 1LCOA 4FO4A 4ZQCA 1PCKA 5G1YA 1ADOA 4GE8A 5D2YA 1K7XA 2ZUWA 1U83A 4HKPA 5LGXA 4HNVA 2CLMA 3QSRA 4DO5A 4PODA 3V1PA 3CU2A 1JCXA 2ZXDA 5E6ZA 5HWNA 5BRBA 2WKGA 3LI0A 4JTTA 1SSGA 2NSXA 1R2TA 2ZZ4A 1PIFA 1CYGA 1UJPA 1TCMA 3F4NA 2HSAA 4RR4A 2PRHA 4U2YA 3DHFA 1YTEA 1KTNA 4DXVA 4LXFA 2E8YA 3FEMA 5TD4A 3STFA 3L2LA 2E1DA 1LZOA 2C3ZA 3FAXA 1S3HA 1WZAA 4UTKA 5BNKA 2WANA 1EIXA 3C2FA 1D3HA 5D32A 3RU6A 4HNNA 2E6AA 1CGVA 1SSDA 1TPDA 2C7FA 2ZFAA 2WPGA 1Q6LA 1ZFJA 2V3DA 4CNNA 1FWRA 4X9YA 1JVNA 4WD0A 3TX9A 3W7DA 3CEUA 3EKLA 1ICSA 3NEVA 1FUYA 1X1OA 4XZ9A 5K9DA 2A4AA 1GEQA 1OB0A 1W1ZA 2BXVA 3BVUA 4IXHA 1IGSA 3A22A 1UD2A 4FNSA 4RXGA 2V9DA 4A21A 1YTDA 5KZMA 1GVOA 4UXDA 1RV8A 2QCGA 3IV3A 1SMDA 1R33A 3FAWA 3WY1A 1A53A 1H7XA 4HN4A 4DELA 1FCQA 2E5DA 4IX0A 4UNKA 2CLFA 1VFMA 1PS9A 4EWND 2ZA2A 7TIMA 4A29A 1O94A 3M44A 4TX9A 1WBJA 3A24A 2DH2A 2XIIA 4Q33A 3WK2A 1ZAIA 4Y6GA 1S5WA 2QCCA 3CHVA 2WO5A 2D0GA 3EDDA 3LGEA 3EJRA 4PEEA 2PWHA 3HGRA 1AQHA 1QWUA 4XTIA 2YYTA 4CNOA 1FCVA 1LWHA 1AL8A 5H91A 4O0ZA 1TSIA 3RILA 3L4TA 3M5VA 3N19B 4JEQA 2W6RA 4O17A 2J27A 4UOZA 3W3OA 4E2DA 2WSYA 5HR7A 3OLGA 4UQBA 4BI7A 2ALDA 1CLVA 1J0JA 3W9ZA 2WSPA 1XSJA 5DY3A 1IZKA 3NL6A 3CTLA 3G0UA 4NZFA 1Z44A 5AHMA 3VCRA 3IIPA 3DKLA 4NZJA 3L68A 4FLOA 1KBKA 2F7RA 4LY8A 3BVTA 2H8XA 1BPLB 2PWDA 4WX2A 1G6CA 3DHDA 1JAEA 3UPBA 1CGYA 1J0HA 1Q45A 4UTJA 2VR5A 2A6NA 3O06A 4IOTA 1VYSX 3L5AA 5CPOA 5AC6A 1X7FA 1PJ9A 1SQ7A 4O16A 1J0KA 4XUGA 1RVGA 4X2RA 1LRTA 2XWDA 3KRSA 3C2EA 4I7UA 3TU9A 3A4AA 1VGAA 1UASA 2WC7A 3LERA 5EL1A 3DX4A 3TV8A 3L9CA 5F4XA 1OX4B 3NO5A 3NPUA 5K4XA 2ZZ6A 5I0DA 3BO9A 4O1BA 5HR6A 4JR5A 1VAHA 2WKLA 1DVJA 1VLWA 4BI5A 5KSWA 3LRKA 2V5BA 2XN1A 4GRSA 1EWEA 4OE7A 2QUVA 3EEGA 3IGXA 3BCDA 2YX0A 3JRKA 3R5EA 2Z1BA 1J0IA 1B0IA 4KFOA 2VC6A 3G1DA 4ONVA 1RPKA 4UFMA 5DO8A 1SZNA 1GQNA 1VYRA 1SFJA 2FJKA 4UTTA 2FHFA 3ZR5A 3P81A 1BWLA 3W1TA 1TPUA 4N9BA 2BY1A 3OLIA 2P1FA 4K37A 4UQEA 4W93A 4IMGA 1BLIA 5I23A 1YDOA 4GNJA 3LCXA 3PBYA 5DCDA 2J9YA 4POCA 5C6MA 2WCGA 3C8FA 4GC4A 2VOMA 3CTTA 2JGYA 1GYLA 1FY6A 2RH9A 2OCZA 1XCFA 4CN4A 1P0KA 2CWNA 1S5VA 1W37A 1JD9A 4PTNA 1L2UA 3DBPA 1GYNA 4LVBA 1BF2A 4H2CA 4IPIA 4AHQA 3M9YA 2NUXA 4NUWA 3LRMA 4FNRA 3TR2A 4MKNA 4AH7A 4JYEA 1U2YA 7TAAA 4U2ZA 1Q3NA 3CZLA 4X22A 2ZRVA 1AMYA 3BLIA 3EX4A 3UQNA 1TTQA 4IMEA 1KXQA 1U33A 4N6FA 4EF9A 3GIYA 3TROA 1RQHA 4LVFA 1YDVA 3QH2A 4WSJA 2ABAA 1Y7VA 4UTTC 4CQ8A 2GVJA 4UMCA 3ABRA 3C2RA 5F4SA 2A21A 3EX1A 3W1RA 3ZT6A 4E0CA 1TQUA 2C18A 5BRPA 2YCEA 1S46A 3UG5A 1VR6A 2CZEA 3GDKA 4UTMA 1KXHA 3C2OA 4GBUA 3P74A 4R34A 1GVFA 2YPIA 1DV7A 4L4LA 3M5ZA 3BVVA 1TPH1 3CZKA 3G1YA 1XCXA 2DZPA 3W75A 3UY7A 4LW7A 3MWAA 2ZX9A 4WJEA 4HPJA 4HNTA 1W56A 5D2VA 5LNUA 4BI6A 1KXVA 4M6PA 1RQEA 3CC1A 1EO7A 3I7SA 1JF5A 1KGWA 4HOXA 3TUUA 3AXIA 2RKXA 1G94A 1V3MA 2XN2A 1UKSA 4LVAA 2W0UA 3VE7A 1MZHA 2QJGA 3R89A 3FLUA 5K9XA 3P61A 3KVMA 2FH6A 4YLWA 3LBCA 2F1AA 4RK8A 2A5HA 4GQRA 1XH2A 3LHTA 2F84A 5I5RA 3TJXA 2ZE0A 3JR2A 3GAYA 4GINA 3LTYA 3D52A 3PUOA 1HTIA 3L0NA 4KKXA 5FF2A 3PUEA 1HNYA 4LUJA 1PEZA 5CPMA 4BR1A 3L4WA 4NX5A 4FX8A 4O4WA 1GTEA 5CSSA 4JNMA 3QQ0A 3ANYA 3LB0A 3W87A 1X8FA 3VGEA 1SR9A 3C3NA 1TIMA 4MIMA 4O10A 3T44A 1XL9A 1F76A 2TYSA 1LM1A 1G5AA 1F5ZA 3D4ZA 1SO5A 5HNRA 2GQ9A 1P4CA 3BG9A 2DP3A 2VFEA 1FDYA 3WFAA 2HS8A 3M0ZA 3P8JA 3QPYA 3BSGA 1IXQA 1DHKA 3G0SA 4MB1A 4GUIA 4HA1A 4PH6A 3VKJA 4BF9A 1WAUA 4UNIA 5F2GA 1SW0A 5G4EA 1TRDA 1O4UA 4MPQA 1E51A 3L5LA 3WK0A 1M6JA 1XBVA 4ORIA 2D0FA 4H8VA 4JTFA 1DL3A 1LRQA 2QUUA 3LHYA 4HIBA 5AHNA 1JG9A 3II1A 1ZNNA 3S5YA 2I14A 3KVJA 4WLCA 2F18A 1KFLA 2TMDA 4M19A 3NQ6A 1DJNA 1YTKA 3E96A 4KFNA 2G5WA 4Y90A 3CIWA 2Y70A 3E49A 4JDYA 1GT8A 3W07A 4AWSA 3CV5A 1TTPA 3EDEA 1O5KA 4ML9A 3TE9A 1PAMA 1BVZA 1R30A 3GDLA 3Q94A 4W9TA 2ZX6A 1L0PA 1HWWA 1CXIA 3UYCA 3UWUA 1H7OA 1UCWA 4UQ9A 4QAWA 1ZENA 3IEBA 2E6YA 4ORMA 3GXDA 4Z08A 2PRMA 3MO7A 3NAVA 1AVAA 5A2BA 1JCLA 1JRCA 5DELA 5F7UA 3EXTA 1OX5A 3EX6A 3W2JA 1VYPX 4OIFA 1QI4A 1JUEA 5CXPA 3TC7A 2R94A 1JCMP 3BARA 4XWUA 3C2VA 2F7QA 2F7PA 1JXJA 2BLEA 2FPYA 2GVGA 4FF7A 4PSRA 1VCGA 4UTIA 1MW0A 2E77A 3DKJA 3G0XA 3UXDA 1WV2A 5LGZA 3BAYA 3RNDA 5D2TA 4IPJA 1FWTA 2ZX7A 3NQGA 3CM4A 4WOZA 3NQ7A 5AHIA 1FDJA 4TR9A 5FEWA 1UD4A 2EAEA 3M16A 1AMKA 3W1NA 4NXKA 3KL0A 4IQLA 4HP5A 3O63A 2JKEA 1KFKA 3RK8A 4O1CA 1IV8A 1P5BA 1HG3A 3HQ1A 3TK7A 2GVLA 1W5MA 3HO8A 3HGSA 1FCBA 1EA9C 5A2CA 4PEKA 3W88A 3DXIA 3MP5A 2GJPA 3BAXA 2BTMA 3DFOA 4H3DA 3GBDA 5L6UA 3W74A 4QNEA 3FKKA 2AGKA 1GG1A 2GJNA 2Z6JA 1WA3A 2HTMA 2Q8ZA 1QI3A 4OJYA 4JFWA 3DFSA 3QPZA 3UZJA 3EX2A 1TQTA 2NLIA 5CGQA 3EWXA 5E1QA 1ME8A 4UTLA 5F1VA 5HQEA 3VGHA 4GUGA 2G95A 4NJIA 3TFXA 3M1ZA 4WXZA 5T26A 3VGGA 4GJ1A 3WDJA 3S2CA 3AJXA 3EWWA 4OHQA 3BVJA 3G24A 1SZEA 4P2VA 3E02A 3OHIA 3HPSA 5AFDA 3CEPA 2QMJA 2V8ZA 4AIEA 4LUIA 4NQ1A 3VSUA 1H51A 1MSSA 5EBUA 5LNSA 2OSXA 3TA6A 4MYAA 3W86A 3D50A 4AMAA 4JGDA 3K8KA 3LCHA 3CZNA 3NM1A 4RXFA 5A5WA 2XVLA 3W72A 1XKYA 3E9AA 2Y62A 2ZA1A 1JDCA 3DX0A 4ICNA 1AW5A 2D0HA 2EAWA 1PZ3A 4TVUA 1TQXA 3PB2A 2VFIA 1UOKA 3W6YA 2YW3A 2E5CA 1IXOA 1PE1A 1IF2A 5A6MA 3O07A 3BSHA 2FTPA 1EH9A 1Q6QA 2IGTA 3SJ3A 2H3BA 3D0CA 4M6VA 1HO1A 3W1LA 1XH1A 3ZFHA 2H90A 4EIVA 1SW3A 3LOTA 1XDLA 1G4SA 1DOSA 3VI2A 3OVQA 3ZO9A 1XUUA 5I3JA 4O57A 2VFGA 4K8HA 2V3FA 2DZSA 4QNWA 2RDWA 2QCHA 3P62A 3PBWA 3PBVA 1RPXA 5CG7A 4MLRA 1SFLA 1DKWA 3KVKA 2C14A 4O1AA 3NDOA 5LKYA 4FXSA 3NQ8A 3N34A 1UB3A 3EX3A 4UCFA 4M6QA 1D3CA 2EABA 1JDDA 1ODUA 3HG2A 3THAA 3DFPA 1EP1A 4KWUA 1XH0A 4JN6A 1G1YA 2CU0A 2E0PA 2ZTJA 1VB9A 3U8GA 3KWXA 2FGZA 1F6KA 2NX9A 4NJJA 5LZLA 1DQXA 3WFZA 1AG1O 1W5NA 1KBIA 3B0UX 5DN1A 2CZ5A 1EUNA 2YIHA 1CXHA 4OU1A 2F7OA 1T0OA 6ALDA 3VM5A 4Z0JA 3AXHA 4AF0A 4UFHA 4C1KA 1EHAA 4I9AA 1O5XA 3L2MA 3T55A 4HPHA 1RP9A 3T4CA 1UA3A 3PC0A 5EYWA 3NQEA 4O54A 5HXMA 1L6YA 4AIOA 1TB3A 1VQTA 1A5AA 2YGYA 3CLWA 2ZTKA 5KITA 3WJWA 1SO3A 4MY8A 1QPOA 3W7KA 3DDGA 1TV5A 3QMRA 4ZQOA 1XSIA 3NNTA 3CT7A 4MZYA 2X2HA 4R7JA 4NXSA 2Q3OA 2PRLA 5CPNA 1MWOA 3EJSA 1EA0A 1UA7A 4UR8A 3VE9A 4QM1A 4TMCA 3BUDA 2CLIA 1QAPA 1XM3A 2E5BA 4EOUA 2YZRA 2TSYA 3A23A 3GXMA 3KL5A 5KMYA 2Y89A 2DZXA 3BAJA 4NU7A 3FOKA 3VU2A 5AB3A 3WEMA 1JDAA 3L66A 5U4NA 2E09A 2X1SA 3BPWA 1HXKA 2ZX5A 3DC0A 3W1PA 2FE0A 3LCWA 3C61A 2DZUA 2QPSA 2C19A 1UD8A 1QHPA 1Z41A 5EA9A 4DBEA 2GPTA 2QPUA 3WNMA 2ZA3A 3GLCA 1UH3A 2QEZA 3F4WA 1KM1A 3W73A 3T78A 3LM7A 4QIUA 3GTNA 2JBMA 4JS3A 4JY8A 4BA0A 2GJLA 2VT0A 2C6QA 1E40A 1H63A 1JQXA 4K6AA 3JS3A 2EQDA 5E0KA 5IBXC 5EPDA 1KLYA 3B8DA 1MFUA 1KCKA 2WSRA 4ZQMA 5G2WA 4I7WA 2PE4A 1TQVA 3GXTA 5TQLA 2GJRA 2A0NA 4JFUA 3VNZA 3SIZA 4B5NA 4CCEA 1KWGA 4QITA 2OJPA 3PF3A 2DJLA 3WELA 1JQVA 3WK1A 5K3VA 1NSJA 4NNBA 2YA2A 4JICA 4ZZ9A 1QWNA 3G1XA 3LRLA 4FLSA 3WEOA 4MJZA 3TTYA 3WY2A 1WPCA 3LDVA 1VCFA 2OMAA 2OT1A 1F73A 3M41A 4DPPA 2ZYFA 2OT0A 3BGJA 2PWFA 3EXRA 3NR0A 4X9SA 3STGA 4GKLA 1MFVA 3C0JA 4K36A 4HSOA 4UQAA 4FNQA 2BHYA 2I1OA 3BC9A 4GUFA 3YPIA 1OFEA 3LX9A 4DPQA 3O15A 3H54A 3SZ8A 3W2NA 3L4YA 3QGVA 1KGUA 3VSVA 3NOEA 1TQJA 3C6CA 1NVMA 3CGTA 2EGZA 5IM51 3NQMA 4WOQA 2GOUA 3VNDA 4LNYA 2Y5EA 5CZSA 3UWYA 2V81A 4LV9A 4X3ZA 5I3GA 3W83A 2RDUA 4JTKA 1TPWA 5C5YA 3TQ0A 2PURA 2YSWA 3QZEA 1K8XA 3W7CA 3W71A 1IXNA 3DX3A 1SW7A 4LS1A 5CZ0A 2D3NA 1QPKA 1UD5A 4JFTA 4A3UA 5EMUA 4OV4A 4XQ6A 1G67A 4O0KA 1H1YA 1XFBA 5HINA 3QQ1A 3M5YA 1W54A 4FNPA 2QV4A 1MW1A 3U6WA 1R75A 5E0FA 2NWSA 1TPB1 3L0KA 1OABA 4DO6A 3UWVA 3IIOA 2XIBA 3W7IA 2W79A 4TIMA 2B4GA 4HOWA 4KMQA 1TCDA 4LRSA 2CHNA 4O11A 1PL9A 4J3VA 1H7RA 2B7QA 3BMWA 3QSTA 3P5ZA 2R91A 1FBAA 1FWWA 2QCNA 1HO4A 3TQVA 3NA8A 3UPWA 4PSPA 3TTSA 6TIMA 5CPLA 5FF3A 1I4NA 4JYFA 5F1UA 3HF3A 3CPRA 3GR8A 2DH3A 1AW2A 2VKZG 4JIPA 4N4PA 2GUYA 2YJQA 1I2PA 1H3GA 5FEXA 2QCDB 4LPCA 3UG3A 4GI9A 1K8YA 3WJXA 1H7WA 4RZ6A 4AAJA 3GVGA 3N9SA 5A6LA 3GB6A 3LXBA 3UNDA 1ICPA 1GVSA 3LHVA 4LC8A 2H6RA 1EUAA 2JGQA 3LTSA 3MW7A 2VRQA 1V5XA 2FPVA 2Y61A 1GVQA 3MP3A 1OT1A 1I2RA 1PHQA 1YADA 4CQAA 1GCYA 4WUIA 3A21A 2FHBA 4JCMA 3S1XA 3UZ5A 2C1HA 1OX6A 1G4TA 2QKFA 2Q8LA 2BZNA 5IBXA 2O7QA 2DIEA 3ABSA 4IMFA 3DX2A 3M7WA 3K30A 2WNWA 5AHFA 2QF7A 1HX0A 2QAFA 5DCEA 5D38A 3L4ZA 2YXGA 3GXNA 3EJUA 1TPVA 4QAIA 3IGUA 3QW4B 4I7VA 1R46A 5E70A 4UC5A 4GWEA 1TYGA 1W3IA 1GVIA 1NM9A 1KM3A 2BXYA 3LV5A 3LXAA 1VJIA 4GXMA 4JX6A 1DQWA 3RLUA 3A5FA 3FYPA 4C1LA 1TPFA 3M47A 3HBLA 1Z42A 4A22A 1OF8A 1LLZA 3EJPA 1H60A 3KRZA 4N4QA 3DDFA 4PC8A 3K8MA 4AEEA 1R47A 3EWYA 2YOCA 1I8JA 1QPNA 3DU0A 2ZRZA 3CZGA 1SZGA 1PS3A 5I3FA 3FKRA 3CWNA 1AL7A 3W1MA 3BGGA 1HT6A 1CGWA 5C55A 7CGTA 1OK4A 3B4UA 3WY3A 3F1QA 4UQDA 2ISVA 3G8RA 1KM2A
chains in the Genus database with same CATH superfamily
4W7VA 5AHEA 2DOCA 1SJAA 3SGUA 3QW3A 3BMXA 2BIOA 3VKJA 4V1DE 5FKPA 2IPFA 1XL6A 4K7PX 2C1IA 4QX4A 1Z9SA 3AW5A 4RGNC 3GK0A 3AS0A 3ZU8A 4OJFL 2AQWA 2B14A 4ZUVB 3N2XA 3GGWB 1Q1JH 2VDOH 4PHXA 4XMPL 4XBPA 2Y7MA 2R1MA 4LESA 4KWOA 2CHXA 3THDA 2X1TA 1AGFB 2MOVA 4JGUA 1TQBC 5C0CE 1SOXA 3BVXA 2XYBA 4IK6A 4NM8H 3V9CA 1AUSL 1F3JB 2OQJB 4XPAL 5KSUB 4I2XA 4AZCA 1EEPA 1ED3B 1MHHA 1JUKA 4FX7A 5ESVA 2R56H 1RJYB 3WNOA 1HJCA 2GITA 4OV9A 3VIJA 5CAHA 4RLIA 3RZCD 4LF3A 4XBJA 4JFEB 4MQXC 3WH7A 4DYJA 1C9WA 2WJZA 3SQSA 5B39G 4LVEA 1P53A 1KTLA 3KBHE 4JDVB 5BVPH 1SFTA 3T0WA 4BFGA 2QR6A 4F1ZA 1FV1B 5K9QI 3S35X 4UFKA 1ISYA 1T6MA 3A4EA 2J6VA 1GSMA 5HUOA 2IANB 1ZTXL 3N43F 3TJPA 5I17B 1U91A 5JXEC 3R0DA 5M03A 3ARUA 3T40A 4H19A 3WQ8A 3PAZA 2Z1WA 4YBLC 5FEPA 2QL1A 2HTLC 3IFOA 1KFEA 3HG1E 1YMYA 5DJCA 1V55B 3ESPA 4QRTA 5BOEA 4R7NB 1S9VA 4CILA 2Y8KA 4GBXD 3GYEA 3ZT5A 2E7BA 5JW4R 3CPGA 5M94B 1KDIA 3L3DA 3HB3C 1BQLH 4MJ5A 4ZMNA 3OVPA 4Q6IA 3LJ3A 1QSED 5TGBB 5K4ZA 1PZ5B 5IW3A 2VDQH 1FP5A 2WSKA 3O2WH 1AQMA 4QTHB 2E6DA 3NAAH 2XV3A 4XVOA 3FUDA 4E6MA 3JV6B 2HVBA 2X4TA 5A2FA 4I18A 2BW4A 4S11A 1QNVA 3IWVA 2OMUA 1INEL 2DQDH 5ABDE 8CGTA 1MEIA 1T2JA 4U05A 3PRZA 4AZ5A 4XZIA 4EF8A 4MF4A 1ECYA 1AKJB 4TVPH 5F89A 1UMLA 2XU2A 5DRNB 3MHGA 4JQ1A 4TQTA 2DRUA 4R7LA 3B7RL 4W4OA 2PUZA 3QRHA 1DXFA 3CVHL 2ATMA 3TJLA 2GHZA 2QVKA 4ZYKB 1THCA 3VW3L 4NNXA 3HG1B 1K8ZA 3CUZA 5CEYB 5C0AD 5JMUA 2EH8L 3UXAA 1GKOA 2JF6A 4HC1H 3F58H 1CLOH 4K3GA 3SUUA 4KX8A 4WJKB 1Q5MA 3EF7A 4P46A 5D72L 1CENA 3ZDYF 4GYKA 1EJTC 1GW0A 3DPBA 4PY8J 3EOAB 3GBEA 3L81A 4XR8C 2A3BA 1WG3A 2L0DA 3BD3A 2ATSA 4E4UA 3QCVH 4G5ZH 5ALBL 4E4FA 1TWIA 1AS8A 2C1OB 5F7HA 1GRWA 5HGBB 3QP3A 1FVEB 3GU9A 2A2IA 3ZLHA 4BQ6A 1C9SA 3G1FA 1YEWA 3ZR6A 2ORBH 3OG2A 4JTGA 4QRRA 5IMLB 2DLFL 2M2DA 1SFSA 1KIRB 1LBMA 3VD3A 4OR1A 3US0A 5DSCB 2GZXA 4Z95H 1PZUB 2X44D 4L18A 1MQPA 4KKLC 1CLZL 2IAND 4QHNA 5KVDH 5CEZH 2NSMA 1G1OA 3H2QA 4J3SA 4X8GA 5KVFE 3A3HA 3G18A 1HHJA 2CPUA 2XCMC 3WTXA 5AOUA 4OUEA 1HWGB 3IYLW 2IQ9H 2L7EA 4QYOA 4M7ZB 3S3PA 1N5YH 3IV8A 4P5KA 4L7ZA 4MSSA 3RRAA 2C34A 3DLQR 5HHOA 4JO4H 2H32B 4CMHC 4MXQC 4FZEL 1LDCA 2TPSA 2NXZD 5D72H 5LDUA 3ULUE 4GFTB 4RESB 3C60A 1T7VA 2I07B 5DURB 2FX7H 1J8HB 1XGRB 3OQ3B 4MMYA 1QDSA 2DWTA 3C2AH 1KENL 3EJJX 1SJEA 5GRYA 1LEKA 4Z3EA 1YECL 2QGHA 2V2CA 1OGSA 3ZVHB 1MY5A 3CVHH 2H1PH 5AB1A 4E9LA 1AK5A 4G8FB 3WNJA 4BEUA 4F8QA 1A7OH 3GMMB 1OTSC 1RK0B 3MREA 4NP4H 4XCEA 4H0GA 4NN7B 2CLLA 3CASA 4O5LL 4GH3A 4MADA 4X5PA 4BDVB 2Y88A 1KBWA 2Z92A 3RZCA 3PWGA 1UVQA 5DUML 4E8CA 4IICA 1F05A 3UAJC 3X3GH 3QRFM 6CGTA 1W5OA 4J39A 4KK6C 1A9EB 3REWA 2OQHA 4ROPA 2VMFA 1OEZW 2IH1A 1MQQA 3BW2A 1EUUA 2BHUA 1QRNE 1IXPA 3KBVA 3ENEA 4JVPA 2EZ0D 4X6DB 2ESVE 2NY6D 2NX1A 4NNAA 4LHQB 4OIBA 5D8JH 5C0JA 3MKGA 3B1TA 1B6DA 3ETBJ 3N43B 3RWHB 4LSTL 2NCMA 1D3GA 3R12A 2ZRXA 2ZRWA 5JYLA 4EUPA 5MI0B 2L04A 5I73B 2R4RL 3OR6A 4Y9CA 5LG6A 3EWBX 4WY7L 3QDJA 1CZ8L 5SWSE 4D9RE 3U6RB 4GAFB 5LBSL 3QOMA 3LA4A 1R4XA 3SOBH 3LDBB 1QWKA 3ZSSA 2YDAA 4D8AA 1CDGA 2WLKA 3F7YB 5A6SA 1JWSA 4ZD3L 3QFJD 1T1YB 1IM3A 4KGLA 1VJSA 2EYTB 3VFTA 1EHXA 2Y7EA 5TJWK 4GZJA 4NUJA 1Z9NA 4DJDC 1LO5A 1PZ5A 3MR9A 3QXDB 4U0RC 4RW3A 2Z8WC 4J3UA 5E03A 3VFLA 3DRQB 2I9LB 4Y4HA 2AITA 3VRIA 4OT1L 2VURA 4HPOL 4MNHA 2WAHA 4ZQNA 4I5RA 4E0RB 2IG2H 2RACA 4FNUA 1RK1B 1AXTH 1WXYA 3BW9A 3QDJD 1CICD 4I9WE 3PAJA 1MAML 3Q5YA 4N1HB 1VIWA 2EILB 1IKNC 2ADFH 4KMTL 1KFCA 2AAAA 2IIJA 2DYPB 4L1SA 2JIEA 1QNZH 4JPIA 4WENB 4Q6IC 1MFCL 3KLKA 5EO0A 1T0MB 1DANT 2CXGA 4GI6A 1LP9B 2OZNA 1WFTA 4LNVA 3CQJA 4Z3JA 2KHAA 5FSEC 1JZDC 4EVNA 4FALA 3FB7A 5TNVA 4XIMA 3FTZA 3N9GL 1LXMA 1ZOXA 2DMCA 4FYQA 1M68A 3C8FA 2WQRA 4JX5A 3B7YA 4OJFH 3VXTB 2X16A 1YPFA 4AL8H 3I2CL 4DF0A 1FAIL 4JO2H 1BAFH 1H3WM 1LF1A 3MRDB 4FFZH 3MRFB 4AGMA 4BFNA 4IWWA 2YQ2A 3PE9A 3SRKA 4C5ZA 4TU1A 3EAKA 1BRLA 1KELL 2HFEA 3GRWA 4GRLC 3U2JA 3QG6A 5A8GA 5AC4A 2JB5L 2Y36L 2EPLX 2MSPA 2TRYA 3CFJA 3SGKC 5CILH 2YGVA 2I17A 2QJJA 4JG0L 1S3KH 4MS8D 3ZDYB 3AHYA 4AW7A 1QASA 1PKYA 3TFCA 2H3XC 4HEPG 3QZOA 3GDTA 4KK8D 2PW1B 1TTUA 5IOBA 2AXWA 4F58L 2YPVL 4R90L 4G7QB 4PJBE 4TNVF 1QLRB 2W67A 4O53A 3CVHA 3LNDA 4KROD 1V77A 4BH8A 3MJYA 3BWAA 3FMGL 1QW8A 2BLFA 3QIWB 2IAAC 4QNPE 5CINL 2VM4A 3MCG1 4LYKA 3MRNB 4RDBA 3W53A 1S7RB 4WEEA 4ZRGA 4OLUH 5BPPA 3GS0A 1ZHNA 1PDKA 1XO8A 5HI5C 3U6RA 4MOZA 4ENZA 2ZXQA 1OT2A 1EX5A 1X5KA 4PGDA 1BWKA 3HGJA 1UJ3B 2QEJA 3NA9L 1AZ1A 2NY6B 2WC3A 3VFCA 4H0LC 4RFEB 4RZCB 3QARA 3VX0A 1DCEA 1RFDH 3QNYB 3QXDA 3D3VB 4X42A 5I3HA 4L23A 3NQBA 2F9BT 5TF1H 2XFWA 3I84A 3L3DB 4GS7B 3DFQA 2YYUA 1FYTD 1IEAB 4KO7A 4YDIL 1K7FA 3LIZA 3OHXA 1VPXA 3C5ZC 2ZXAA 5J7CC 3L4VA 3H2FA 4G7VL 3FTSA 3V75A 1AH1A 1C90A 4E42B 3A6OA 5GS1C 1CX9A 1JHLL 4R3SB 2YB1A 1Q38A 5T1LA 3R1GH 3E2RA 3LSBA 3CK0L 4XBGA 2INZA 5IHSA 4O2FA 3UCQA 5DRWB 3CH1A 2ZOXA 3VXSA 4PRAB 3WMPA 5C6WH 4N2CA 4NENB 1FV1A 3FJ6A 4C6BA 4RUBA 5LHFA 4JVUA 4IHCA 2VWEC 5F7YC 5AYTA 2EDFA 2ICEA 4IS6A 3TGXA 3LNMA 5G4MA 1U8OB 2QKIA 1BXXA 4JBSA 3U4EA 5J5DA 2WZHA 1ETZB 2RQEA 3QPQD 1RUQH 5DFAA 5AEAA 2YL8A 3ZMRA 4NQTA 1AGEB 1BBDH 4ERAA 2FB4H 5HY9B 4CCDA 3OXRB 2GJJA 4YO0B 2VUYA 2E56A 1IUZA 1IQDB 3H0TA 3QJHB 4L5FH 4DGIH 2ZUYA 1UZ8A 4A6YA 4PRHA 3BSZH 3O8XB 4XB3A 3VXRB 5BCAA 3LCLA 1F8TL 3W39A 1NL0L 3O8XD 3OF6D 5A5WA 1QZNA 1V8HA 4LPWA 4JM2C 3BXWA 3MFFA 4EDXA 1JF6A 4K5OA 3Q06A 2ED7A 3E6HA 3T04D 3LZQA 5D2LA 3FCSB 1AO7D 3EH3B 3VFVB 1OT4A 2Z1KA 5C0EA 1BQSA 1OSPH 1DBBL 1IX2A 1HQRB 4GIOA 4NZUH 4XMLH 3O6AA 5EZOL 2C4FT 2I9TA 2BSLA 2XV6B 3FT4A 1K6QL 4PJAF 1RHCA 3G1AA 4KT2A 5IRPA 3IEAA 3B4NA 3EJQA 1KGCE 4B9GA 4K7VA 3FSTA 1JNNL 3BLEA 2X2JA 1ALDA 3T8XA 4HX1B 3RRQA 4PRWA 1IGML 3QQ4B 1XPGA 4QRNA 4ZR8A 4OCRH 1AR1C 3HZKA 2OZ4A 5KJRL 1K85A 2BXZA 3W2DL 2Z91B 4CDHA 1IGTA 1QLRA 2VUKA 2FLIA 1HQ4B 5ISZA 4AF0B 4RKAA 4H8WC 4W9JC 4AGOA 2DWDA 4KI5E 5HDBB 1KBJA 1FWSA 1WTGT 2PDIA 2W61A 3WYZA 3A5VA 2QLYA 5IG7B 5GRZA 2IANE 2EDTA 1VLIA 4NI8A 5FB8B 1P7QB 2EIMB 3K46A 4YXGA 4WFHD 5JW4Q 3F2DA 3OD3A 2BHZA 4P46B 4AG4H 4RGNE 1JPFB 3NIGB 4QRRE 5FEZA 1GH7A 4DWSB 1A1OA 1ZXQA 2HJFA 1HH6A 1T5KA 1DWFM 3DI2B 3FQXB 4N2YA 1ZDSA 3MLSH 4JFFB 3ZT7A 2DW6A 4IKJA 4FE9A 4PJIB 2AQQA 1SMAA 5DD3L 1I2QA 5HGBA 1YDPB 1AD1A 4XVUC 1JPSH 3RDTA 3FFCA 4Y1AB 1OAXH 4ZO8A 1WXJA 4EI5A 4G8FA 1XLJA 2NUWA 1GORA 2HT4D 2LR4A 4EPKA 4F0SA 5LNRA 1P5VB 3HQOA 1F41A 2DZTA 1Q2RA 4GSDH 4H8UA 3GO1L 3T9WA 2RQ8A 3GZKA 3TX4A 3G8EA 3N1AA 3NSMA 4IP7A 1DJIA 1I7ZA 3I50H 3ILQD 4GO6B 3L3GB 2Z4GA 4L9ZA 1PSKL 3L9EA 2UWEE 2OQYA 2WQPA 2WLHA 4DERA 5IOPA 3U2ZA 2BH0A 3VGAB 3VILA 2GTWB 4PL2A 1OY3B 4EKJA 2L5HA 1FVDB 2V5MA 4IKKA 2OXGA 3BAWA 3QDMA 4Y2DD 4U3XA 2GSGA 3ELAT 4XMXA 4MJMA 1ZHAA 4F8PA 4EAEA 3GWQA 2DI7A 4KPHL 1IEXA 4X7SL 5KSBA 5G2HA 4MCYB 3S5LG 2NNRA 3FB8B 3HM7A 3U5UA 3MROB 4JL1A 5HDBE 3UIYA 1OYAA 3NQAA 4G6CA 3I6KB 5DGQA 4PJXE 3B9KD 3VCLB 1TEGA 5K9CA 3V7AG 3NG3A 1H50A 3NCXA 3KAOA 2ZAGA 3ZHFA 2HTLD 4WXYA 3H7BA 5AW2B 3BQ6A 4AW4A 1V6VA 4QLLA 3NQDA 3QRGL 3OYZA 4WKHA 5D37A 1I9EA 2VR9A 4KKBD 4WQOA 1J1XL 5E51A 3EXJA 1E4HA 1TIWA 4W9EC 4DZIA 9XIMA 3ATFA 2VDRH 4D9RD 1YEHL 1X4XA 4JCWA 1N2VA 4WI4A 3QZNA 3MLSL 2VR8A 1BM3H 1IC5L 1RKRA 2O5XL 3K5RA 4KUCD 1A47A 1OCBA 1RA0A 1JGDA 4NC1C 4D71A 3QQDA 1JMXA 5DD6A 3BV4A 3DVGB 4KK9C 4JXCA 4Y9MA 3TA9A 4CNTA 4X8JA 5KSUA 3B83A 2EXYD 1EFXB 3G6JA 4YXLH 1WQVT 3LPPA 1E4WH 3P0GB 2ODHA 2HWGA 4LPTA 1KTCA 1E5JA 4FQHA 4H9YA 1OIOA 5I6PA 2XN9D 4IKIA 4N0YL 3W2DH 1V0LA 5J13C 1N2RB 5EDSA 3UTPD 4IRSA 4AQ1B 5K7JA 1XXFC 2NY1B 5FL0A 2ZNWA 4TN9A 4L48A 3LKNA 1VF8A 2BASA 3Q1SL 2B31A 2QS8A 1F74A 2CBMA 3NK3A 2P5ED 1D9KD 4ZX4A 4L37B 3PULA 3A3XA 4IIQA 2D7TH 3PYCA 4OZFB 3KGTA 4HT3A 1WDRA 1RUAL 3FT2B 3FQXA 2XYLA 3EMQA 5I1KH 1U8CA 3VXME 1DANU 2VM9A 4M62H 5T5FL 5KUKA 1RD5A 3AIRA 4KEMA 3I02B 1ZRUA 2VLKE 4O8RA 1UXSA 1XT5A 1TJMA 2O30A 1KLUB 2GSHA 3WEAA 1HDMA 2L4OA 4O19A 1MCOL 2CO4A 1XLIA 4MHHG 1CDHA 4GYFA 3D0LB 3ES6A 4UDUB 3WKQA 1OF2B 1K8IA 2XRAH 2V9RA 4MAYD 1EPFA 4MY1A 3LI1A 2PYEE 5E8OA 4W8AA 5I15H 4ZMLA 4HWZB 2Z93A 3ABGA 5AZEL 1MXDA 2BZCA 2NY5C 3BUTA 4WWKC 5DMJB 4AMKL 3DJZA 4J8QA 4LOCA 8A3HA 4FTVA 5C09B 5T3ZD 1PY4A 5HDBF 5I02A 4JN2B 1VRDA 3M0VA 5B22A 4IMCA 2JK2A 2C7UA 1QVOB 4MA8L 3FA5A 4LT9A 4XPGH 4GG9A 2ATAA 3TT3H 3FFOA 5F3HA 4Z2KA 2XWBB 3K81A 3NEXA 2P26A 1W0WA 2BOFX 2O6EA 2XJ7A 4FMVA 4YUEL 2QDGA 1FYTE 2G4JA 2WKJA 1E2VA 5FCUH 2BVEA 2EC8A 3W11D 2XHYA 3MMUA 5AY7A 3ZJ6A 4ZE4A 3MRCB 3QCUL 4RIRB 3S37H 1X8CA 1UEMA 3CZFA 5B39B 5DVMA 3ETSA 3GAKA 2R29L 1CNVA 4GUJA 4Z1BA 3QBUA 4I8YA 1KJ3L 3TM6A 2P48B 2DZAA 2C9PA 3ALGA 3QV9A 1BV8A 3VTMA 2VZ3A 4FGMA 1PKQA 2IQAB 3PFUA 5DHYA 2FTAA 4K9JA 4NN6C 3ULSA 3V6FA 1BXBA 2C13A 2FFCA 5HYJA 3PWNA 5IB4A 3KJ6L 3G2GA 4EI5C 3DUGA 3TYZA 5HYSB 3LZNA 2IBBA 4J3OD 3B56A 4CNIA 5IHZA 1B54A 5C8JB 1X5JA 4LSBA 1OQXA 2FD6H 1OFPA 4D6EA 1LDPH 3RWFB 2QCDA 4H8PA 5I1GL 1QAWA 1ISXA 1U58B 4RNHA 1RPUA 1A6WH 4YDNA 5EBGA 5HI4C 2A2QT 1Q9KB 2HFGL 2OI9C 2BNRB 4WWNA 4AIXA 1CVRA 4GEIA 1MJJA 1THFD 2CLOA 1D9KB 3H6JA 3HZMB 1QSFE 2EEBA 1A65A 1XCQA 4UYPA 2Y24A 4NFDA 4ZMWA 1KV5A 2HVMA 2O26U 2WVSA 1KIPB 4P9HC 5F96L 5BOZG 5D05A 4PJEA 1OFOA 1S7WB 1TX2A 2I9UA 3FUNA 5F0JB 1TV2A 1ZAHA 3H7BB 4K7PY 3SRDA 5MEND 5EOCJ 2NNAB 4BH7A 2FMOA 3N1MC 3T8XB 1AY1H 1BAFL 5JW3H 3DI1A 1H19A 4LU5H 2VKWA 2L8AA 4F7TB 2YXVA 4LDCA 4KNQA 1P9MC 4Y4FB 3I3BA 1IAOA 5C0DA 3VFNB 1TZZA 4XD4A 4JREB 3Q8BA 3PS6A 4PRNB 5IDIA 4XNXH 4AY8A 1JGDB 3SE8L 4N8PA 3G1RA 5CKSA 2OPCA 5T1DH 5EOTB 2NNFA 4B60A 1ESWA 4Z23A 2QJHA 4FHAA 3FSUA 4MJ6A 2V0AA 3ARWA 3BO8B 4NO2A 3GI8H 4LCYA 5ITBH 3DMMA 1FH7A 3EXSA 4L1WA 5D7JA 4TS6A 1HGWA 3EYVA 4NAFB 1UZ8B 2G0LA 1QRNB 3AAZB 3U9PL 2OCJA 4A6YB 2TODA 4Z7OB 4AYFA 4K9EC 5FJJA 3BZDA 5E8OB 4NJAL 5FJRA 1JWUB 3HPXA 1DSYA 4NZDA 1ONRA 4E41A 4F5CA 2ZONA 3WUWG 1WT5C 1XC6A 2Q02A 5CD5C 2Y1ZA 2QHRL 1P1MA 1K5NB 4NIKB 1JE6A 2XZCL 1GOXA 1YDNA 3OQEA 3UWQA 1Q6RA 1TXKA 2PKDA 1JK9A 1JPTH 1ZT1B 3GQYA 2CXKA 2EDEA 4AEIL 2WV8A 4PREB 2YPVA 5IF0B 4IG2B 2PPDA 3NUKA 2Z4QA 3N0PB 5EKYA 3LSOA 3TBCA 4LS1A 5J0BA 1AZVA 1UD3A 1GPOL 1HW6A 1U8CB 1NCNA 1NC4D 3L4UA 3N25A 4HIXH 2WXNA 4F91B 2IVFC 1T99A 1NMCC 3WF1A 3LKSB 2QV2A 4XZLX 2PCEA 4AT6B 3WBWA 1RQ5A 2X4PA 4P5RA 3X1FA 1NDYA 1P6BA 2RTTA 2ZG3A 1HNFA 5CEXB 3KPQA 3PWPE 4KKCD 5F6IB 1LLWA 2VQ1B 1J9SA 1A4CA 2LOEA 2P5WD 3CX2A 2ZUXA 5E8PB 4XXWC 5EF0A 5JVLA 2VW6A 2DI9A 1G9NH 2J7HA 3IRDA 3INUH 3TBYB 2R2HB 1A3RH 1YDPA 2EDLA 3QJOA 3SJVD 1GUVA 4MNKA 2W07A 1Q6GA 1E2ZA 1GOKA 3AJ7A 2AL2A 5T3XE 1Q8JA 1QG3A 3NDYE 3D39D 4FMKA 4K2UL 3WLBA 4MA3B 1FGVL 5HANA 3O1NA 1WUEA 4TNGA 4GMSL 2PCXA 4XXCC 3W1XA 4LAQH 4TQEH 3S1WA 4I2XB 2NQLA 4U4BA 4PI0A 3QV8A 4IIFA 1RULL 5TPWL 4M1DH 5JHAA 1EZLA 3AG3B 4JAMB 1AGBA 2BY3A 5IM7B 3ZUNC 1SNRA 4L2YA 4OD3L 3C6EA 3IE4A 1JBJA 3UGRA 1A6TB 3QK0A 4P8XA 4FKKA 3FCUB 4NPJA 3MV7B 3FT3A 1GQLA 3WLPA 3HS0B 5C86A 4JFXB 5L9DL 1QYGL 3CFQA 2E5EA 4H6QA 4UUJB 4AOFA 1DO5A 3IAQA 5CJBA 1QRND 4R4BA 4TRPL 5I5IA 4JUSA 1MY7A 1PCSA 5CMAB 5L88L 3LBMA 1S7RA 4P7RA 4U3SA 4QGCA 3V6OC 4DUOA 4Y0GA 3CQPA 1XXXA 3GS6A 1OSZA 3SPGA 1UWFA 1WAPA 5I30H 2H2PD 2C5DC 1XR8B 3UPAA 4ACPA 3RY4A 3IMUA 1A5SA 3RFAA 3DSNB 4PWKA 1VACB 4BCXA 5BMFL 4JFSA 1NF7A 4HUNB 1TZ7A 3VTAA 3N11A 1L6SA 5SWSD 5HVGB 3ZQ9A 1UP0A 3E6EA 4Z1YA 4CRPA 1Q9OA 3L95A 4U6VL 4XKYA 3TYGH 2EUWA 1SZRA 4N0CC 3AMGA 5DA4A 4QISA 4LHUA 3TSMA 3W0KA 2E4TA 5CZRA 1KTJA 1JHTB 3CQIA 2PXYA 4BGLA 1WO2A 4P4RA 5EEUA 1H7NA 5HULA 4RZCA 1CPUA 1VHNA 5BUPA 2J78A 1RJLB 4PJ8C 2EH8H 1DWIM 1MEHA 5AVSB 3W22A 4F40A 3WXVH 4L8SB 4NQQA 4L6HA 4MZ1A 3N42B 4PGEA 4HU3A 4K3EL 4XNAA 2DVXA 1WBHA 5DRWA 2X2GA 2H0FA 4AKOA 2YD0A 5AC8A 2TRSA 3W9EB 5E2TH 3MDUA 2ESCA 4AQZA 1GQKA 1M7PA 4GW4B 3E8UH 4DZ8B 4KNUA 2ZRUA 4M1CD 1AA1B 2CIPA 1U36A 3LPGA 3WSQH 2J8GA 4TNFA 1ZP4A 3VA8A 2ROYA 1PNCA 2MNUA 4JAMA 4W4OC 5F7EH 1D7FA 4UTBL 1PHWA 3GG8A 3Q58A 4MB3A 4NO0D 1TNNA 3F03K 4ANUA 1BFVL 3NSXA 3WKYA 3L67A 3OA5A 1C5BL 1OB1A 4XP9L 3GH7A 4AZHA 3EB3A 1XWVA 2CO2A 1H5YA 4FA8A 3ZLFA 4XAWH 5I73C 4HHAB 2PF0A 3CWHA 3KE0A 3BWSA 3W2MA 4YZFE 4KETA 3WLRA 3SHSA 4ASTA 1H5BC 5E8NA 5IBLC 5KN5B 1K02A 2Z25A 5CJMA 1TTFA 3NG5A 3ATYA 1XL4A 5D4JA 3V6OE 4OCXH 4GVHA 2XFXA 4H7VA 4KUZL 1EHLH 1XBXA 4XAGA 1GZGA 4EXPX 1N7KA 3V0UA 4D9LH 1Q6CA 5FF4A 3N6QA 1Z5LB 4HWUA 2JKIS 3IETB 5T1LB 1KY7A 3QIWC 3VGDA 4Z7QB 1TTIA 4TMBA 4TUUA 1MVUA 3MVIA 4A2SA 4L29A 5I5JA 3NIFF 1NOWA 1QLEB 2WMJA 4K38A 1RZMA 4DGWC 2GYSA 2NQ5A 1CLCA 5H2ZA 4ZUWB 5FYJD 5KW9H 3Q8FA 1I1RA 1HQ4A 1UPPA 3EHBD 3BE1H 2J6XA 1BG9A 2YD2A 2ZWZA 1YEDA 2KZWA 3F4CA 1SM3H 2FGBA 1JP5A 1S7SA 1KTRL 2WUCL 5GJTL 1EB3A 2V69A 3STEA 3ZR4A 3CCHB 3BKCL 4YWGL 3ZHLA 3MRHA 1A25A 3GSVA 4ZODA 4GS7C 4MSWB 1U4FA 2L7QA 5IT2H 4AUBA 3GUFA 3T08A 2BVTA 3DXAD 5DUJA 2QCLA 3FHEA 1KPVA 2NYZA 3GSRA 1QWHA 3NIFB 1V6UA 4KEZA 4OUIA 4JTCA 3O11B 1LOSA 1V3IA 2H1XA 1Z9LA 3DIPA 3AIVA 1W3LA 3EB2A 1TTRA 4JAWA 3CFBA 1PCXA 5FB8A 2K3HA 4EI5D 3TYAA 3S46A 1KEML 1TO5A 4XN8A 4TXEA 1RBAA 2Z2UA 1YEKH 5DMKA 4UTAH 1NGWB 2E7HA 1DORA 1LHZA 2FJFB 3AC0A 3O4LD 3RTQA 3SQBA 4QLWA 4ODXB 1B3IA 5FUCE 1IEWA 1L6WA 3BLLA 4Z7IA 2IH1B 4LCYB 4WKXA 1F3DH 1RZIB 3RVTD 4UIKH 3SGJA 1GY2A 1BREA 2ARJB 2OYMA 4WU5B 1FWHC 4TULL 2MANA 3TAKA 2EJAA 3TL5A 4C6KA 3SECA 1NIUA 1GYMA 1R3LA 1WE5A 4PLJD 3EBGA 4OF6A 2Y4SA 1E27B 3FU3A 3R0MA 1HYRC 3NVTA 1TZIB 2E74C 3ETTA 5IP4A 3MO1A 4BFKA 3MNVB 3PWJA 3DUHA 3QJFA 1MJ7L 3NCJH 3HBQA 4HC1A 4JL2A 4Q58C 4D9QD 3C5JB 5A8MA 1RK0A 1RMFH 1I4FA 2E76C 3HKFA 4KK9D 4TLUA 3ZL1A 1HF6A 4XPHH 3VRLF 1EAPB 3CB3A 1B9KA 4GQZA 3WNLA 1RZGA 4PS3A 1DVUA 4ROQA 4A1RA 5AKTA 2VELA 3JWNG 2FQGA 4RFNC 2HX7A 5IHUL 3U0TB 1UUOA 4TL4A 1A7PH 3VRJA 4I48A 2PW1A 3W27A 2A6LA 2JB6A 2D2HA 1LEGB 2VGIA 5LAPA 1XGQB 1QSFA 3C5SB 4AXKA 3V8OA 1AO7A 2QPEB 2D23A 2E7CA 4MCNA 3UTQA 2A1YA 1N4XL 3QDGA 1LTXA 2RB8A 3JWOL 4G71B 4GVGA 2QZ5A 3DGDA 3P9MB 2V5LA 2RFXB 3QNZA 5DJ0B 4YIWA 1N7ML 1YNLH 4L1BA 1CF8L 4KI5D 3D09A 3V55A 2OAAA 3LRSA 4LS2A 4GYPA 5IHRA 2K78A 3L3IA 5E08H 4D9PA 3T6ZA 3BLFA 5DWUH 3G1VA 3G5EA 3CL8A 3K2UH 2KERA 3WQ4A 1T0PB 5DZAA 5I16A 1QRQA 4MLJA 1M71B 4B53A 4DKFL 1C91A 1BYCA 5HYSG 1JI2A 4EACA 1FH2A 2O93L 3ARBB 3D7PA 5F9WB 4GIRA 2FWOB 4HUUB 5F7MC 2A6JA 3HUJF 3PHQA 5I28A 1TV7A 1CXKA 5C6TH 3UU0A 1C1EL 1I8LA 2ESVD 2D8KA 4TUKL 4AJWA 8PAZA 1IIHA 1UMYA 1NDGB 3L8QA 4P5MA 1GW1A 1L9WA 3SYPA 2WGNB 2MHAA 1SY6L 4LSSL 4M5YH 2O5ZH 2BSDA 1A4KB 4XTDA 5JH1A 5FL1A 2W9EH 4O00A 1VFSA 2P8CA 1QOPA 2ZOKB 3GEFA 1G7UA 1O6SA 2J25A 1UXWB 1TKWB 3E9UA 4HWBH 1HFBA 1O95A 1X7IA 2YWYA 2ADJB 4BQ4A 1DBAL 1L9PA 4FFWC 4Y5YB 5DEGB 5AALA 4NWUL 3TYFB 2Y07L 4OLEA 1L0QA 1MREL 3VFRB 2X30A 3VOFA 1M1XB 1TMQA 2ALAA 4OZHF 3HNTL 3F6JA 1FH5H 4YXKL 4TSAL 4PG9A 4WDXA 1JXKA 3VD9A 5AB0A 3CMOL 3ZGIA 2NQZA 4L4MA 1O7SA 4WNSA 1XD1A 1IZCA 4M1GH 3QQXA 4EJ1C 1X98A 4Y4HD 4ZCWA 2AGJH 2DORA 2HH0H 1BD2D 1CFNB 1V79A 4JO3H 1M2VB 1KB9K 3Q48A 1B9ZA 1AD0A 4NN5C 1KZQA 1R5YA 4YTRA 4Z0BH 4BQ9A 2Q7YB 1MCKA 1POJA 3WDIA 4NFBA 3EFOB 1AZ2A 3CDYA 4LQ1A 3RKDD 2VTFA 3BAEH 2EE6A 3W38A 3SI9A 2WNZA 4GUHA 3GI9L 5IFJB 1E9ZB 4B9PA 1S7UB 1ML1A 3GGWA 1KIQB 2X2IA 5I16B 2E7FA 4W9FC 3IDJB 4HJ0D 4PYGA 3UTSA 2DW5A 1H1NA 2A7NA 3BE7A 4WEVX 3PP3H 1CF8H 3OKMB 3S3CB 5HGHB 1FVPA 1L6GA 4IJBA 1MEXH 2PDKA 3NQKA 2G9HB 2ZCKH 4E9SA 3CB8A 3S8HA 2QTEA 3S9DB 5MKGB 1AFSA 1DQJB 5A2JH 4QXVA 1WT5A 4XVEA 1QI5A 4OZHA 5GVJA 4OWGA 2WTRB 5GGTL 2Y85A 3L5WA 2N1KA 3MVSA 4C47A 1Y0EA 1AIZA 2PDWA 4NQCA 3GVVA 4JFEA 4PRRA 4AVJA 3GHUA 4W6XB 1CU4H 4NO3B 1YMME 4YHYB 3R25A 4YGVA 2J4GA 3TA3C 3KDMB 1R3KB 4IIZA 5HYQA 1ME9A 1DQLH 4U6YA 1EEZA 4GIEA 4PCSA 3DK0A 3S1GA 1UB6A 3JZUA 2A4ZA 2W59A 3V3WA 4IU2B 5D03A 4J35A 3GBML 3PWUA 4GNVA 1W1YA 2BX7A 1HKVA 2QCFA 1QMLA 4L6DA 3WO8A 3M7SA 2WHLA 3LS5L 1T8XA 4HZ6A 4GMEA 3PFRA 1OC7A 1OFAA 5GS2H 2QJNA 4DQWA 4HS8H 1S2CA 4WEUD 1IM3D 1OCRB 3D25B 5TQ2H 4ELKB 1YQVH 3PTQA 5ESQA 2E9BA 5CBEB 4HX1A 1H8LA 4PJEB 4JQ2A 3VIGA 5HI4D 2PD9A 4NQUA 4ZTEA 3I9GH 3DBXA 3ASOB 2VXSL 1JD7A 3ARFB 2G4EA 3S6CA 3PDOA 2BNRA 4AJVA 2CHWA 1UKQA 1GYCA 4Q4SA 1RZ8A 4DBDA 2VC2L 2J74A 4ZT1A 4N2OA 4BKTC 4DNLA 4ZXLA 5BS0A 3RNQA 2PYED 4QRPE 3PZMA 3EKZA 3GH5A 1PJWA 4OUUA 4TNEA 5AW1B 2BOCB 5BUAA 4Y16B 3NM3A 3RPBA 2OWCA 5IB4B 3TMLA 5CFHA 4MM1A 2Y7FA 4NO2B 3G1HA 3SBWC 1CECA 2VERN 5F89B 3RM8A 1KTDA 2UWEA 5F7BA 3KWUA 2OK0H 4NOBA 3WXWH 1T7WA 5CU9A 1NOLA 3IPFA 3TH3T 5D96C 1EZ2A 2IH3A 4X5RA 2YCLB 4WHTA 2D7OA 4K7YA 1YJDH 2LW3A 3T4AC 3VABA 1GGYA 1LE9B 1XD0A 1BZQK 3NZ1A 4HK6A 2ZOOA 5K9JL 2ZC8A 4IGNA 3WD3A 4AZBA 3WJLA 2E3ZA 5AECA 1LCOA 3DFYA 3DXAE 1G9EA 1AI1L 3DMMB 5D2LE 1K7XA 1FYTA 1RIVH 2YB4A 2ZUWA 1U83A 1B0GB 4FQQA 3HTLX 4JPKH 2CG9X 3MRMB 4L3AA 2BSRB 1JPFA 1BYDA 2V17L 4XMWA 2MUCA 1Z69A 3QSRA 2YBUA 3PBGA 2ISDA 4DO5A 1T5AA 3TT1H 4POYA 4PODA 2X9XA 2XJKA 1JCXA 1S7TA 2XQYA 2HBXA 4D9LL 1R7OA 2DLGA 4R5EA 4ZX5A 1XYAA 5HWNA 3QUHA 3IDGB 1LT8A 1GK8A 2CGRL 5EF2A 1JNHB 1R2TA 2ZZ4A 4WW2B 1GSKA 5L8JB 1CYGA 2ZJSH 2A6DB 3F4NA 1N6QL 2PRHA 4CJ0A 2J6EA 2Z4QB 1YTEA 1ZUAX 4HZLA 2E9GA 5TD4A 1BAWA 4XAWL 3AQXA 2C3ZA 3EO0B 2P44B 3GJFB 1IILE 1KN4H 2XZZA 4QWWC 5DHDA 5C0AE 4EI6A 4ZS6C 5ACLA 1TMLA 1UZ4A 1ORQB 2P53A 4RFOH 4N68A 2E6AA 4HNNA 3TVMA 4LASL 1MI5B 1UJ3C 5IMOA 1FSKC 2C7FA 4HJJL 2WPGA 3HC0A 3Q2VA 1Q6LA 1SYTA 4Z42C 4QCEA 2P42B 4K7PH 5KYUB 2XG9A 4I13B 1GKPA 3FCPA 4X9YA 1F58L 4WD0A 3W7DA 6A3HA 1JZFA 2EXWC 3EOBA 3RO8A 2J1WA 3CSYA 4HIIB 4GZIA 3T4AB 4AH2A 4LCUA 1HOCB 4UU9A 2ENQA 2ZKHL 4F27A 4XZ9A 5K9DA 3HI1B 4RMQA 3DBSA 4U1KA 3IVKB 1BWMA 3NSDA 1CLYH 3GHBL 4H6RA 1W1ZA 4EBQL 4YX2L 2P88A 2H6PA 1JZ4A 1IAIH 1S5MA 2A74B 2O4EA 3THMH 4G11A 2O61B 4J12A 1IGSA 2OR8A 4M7LL 1OW0A 1BOYA 3O3DB 1UD2A 1RV6X 2QPDB 3OYXA 2G2PA 4R26H 4RXGA 3PHAA 2V38A 5LIWX 2V9DA 4L4VA 5D7IA 2TSBA 3ML8A 3ZL4H 4G1MA 4S2BA 4UXDA 4P2OC 1RV8A 1A3LL 4OIIH 4XBGB 1SMDA 4A2DA 4LLQA 5ADPH 3D46A 3W4RA 3AREB 1W80A 1BEXA 3FAWA 3PWPA 4PVMA 1WISA 4HZ1A 1H7XA 4HN4A 4DELA 1AP2B 2WBKA 3QUYB 1WZ1H 3K6FA 4UNKA 1PS9A 1T2XA 4ZAKD 3ZZSA 1QHQA 2OWWA 2H9GA 1WBJA 1YE6A 2J8FA 4RNRA 2R82A 3C5QA 4Q33A 2VH5L 3MBEA 1BECA 3EYUH 4L8BB 3NJJA 1NCWL 3R18A 4PUBH 3CHVA 4CC4C 2D0GA 3T1WA 4ZFZB 2J20A 5DK0A 2DQIH 5EHFA 3N2TA 4CD6A 5DS1A 1IBZA 4IIGA 3SSJA 3DBXB 2MCAA 1W1B1 3FCTA 3KH3A 5EOCL 1AQHA 3FUEA 3HGRA 1BXAA 4PG9B 1PZ1A 2AZAA 4XTIA 4CNOA 4MFHA 1CTOA 3RFRA 4LLMB 3V2AR 3BCJA 5CC6A 4O0ZA 1DR9A 3M5VA 3BYYA 3L4TA 2OR2A 1CDIA 5JORB 3VWKD 2W6RA 3N19B 4JEQA 4UOZA 4MNJA 1H9DA 2AK1H 4JY4B 5CSRA 4H2AA 4HIIA 4LAQL 4TQEL 5F7NC 1RZJL 2DM7A 1YA5A 4IBLT 4PRPB 5DK2B 3FYYA 3M0ZA 4LVNC 2QHLA 1HP4A 4H83A 5A7EA 1LL7A 2NRDA 1SLVA 2JTDA 4XPFH 3P9MA 1CLVA 1J0JA 1W72L 1YPZF 2WQAA 4U1NA 1AOZA 1X39A 2GBAA 3G5YB 4FKEA 3UTPE 1XIMA 2JK5B 3MC5A 4GQ0A 3D2UD 3I9IA 4JQ3A 3NL6A 4IPNB 1X5FA 3PN8A 1GW6A 1NBZA 3MRDA 4YIQB 3ZE1E 1ZGLP 3IIPA 5HVWA 2CLZA 5F9AC 2YAEA 4IHOB 4Z18A 3WLNA 3T4YA 2R6OA 4D7BA 1BPLB 4A35A 2PWDA 2ADGA 3EMZA 3KW3A 1G6CA 1JYWA 1ZT7B 2C3HA 1XIWC 3L7FA 3KXFD 3ZYZA 2VSMB 3DHDA 3EBVA 4JRYD 2IAMB 3UGEA 1XVSA 4MYWB 1R3YA 3O06A 1XQ4A 5FHBL 4IOTA 2RR3A 3HI1A 3L5AA 5AC6A 1GIGH 4HWEL 4YSOA 3U36A 1Q9LA 2RUSA 3EAUA 1PJ9A 3QFJB 5HPCA 1GIGL 3BWWA 2R27A 2XGIA 2XACC 4FXFA 3IFLL 3AWNA 4X2RA 1LRTA 1EC8A 1QBLL 4PJ9B 1Q72H 4GABA 1U3ZA 4UBDC 1DCLA 5AAMC 5A3HA 1T6VN 3FQRB 2BPBA 3QJRB 3CNYA 3GHSA 4RW5A 1NFDA 3CDGB 1AQFA 3LERA 1UASA 1TETH 3SKMB 1GZHC 4G6KL 1ZT1A 4QXUL 3JV4B 1MQKL 1E5CA 1R1CA 4PRPE 1XYMA 4XISA 3NPUA 4JIIX 1MWAL 4PH8A 3CLFL 3ULVE 5K4XA 3BO9A 3VIKA 1G4MA 4ONOA 4ABWA 4DAGH 3ILPA 3QO1B 2YCJA 3ZYOA 1IHIA 4HWBA 5B8CB 1IAKB 4Q9RL 5E6IA 5EEYA 2VL4A 2B4CH 5MERB 1YMMA 1BTCA 4WI2A 1DVJA 1VLWA 1MZZA 2DLTA 2XWJA 2CBVA 2W27A 4BI5A 2CUAA 1MJUH 2HK0A 1BYBA 2V5BA 3EOBB 1ZGLM 1EWEA 5D4QA 1ZBKA 1T80A 5IESH 5T3XL 1E15A 1MNUL 4BEQA 2DQUL 4HS3B 3BCDA 4NNYB 2R69H 2HRLA 2PTTB 3BZ5A 3QHFH 4PB3A 2LU7A 5DD6B 1R5WA 3LY6A 3N41B 4YGVB 1FRBA 2Z1BA 4C6PA 3MX0A 2VC6A 5ERWB 1DE5A 1ZRQA 1E4XL 5E56A 1S9XB 2WMPB 3FHQA 5IMKA 4DZAA 5CC7A 2HPMA 5AW8B 2IAMC 3ARPA 2DQEH 3GMQA 3HC3H 1FBIH 2CGYA 2LVEA 3L2NA 4QHPA 4XCNA 4ALAH 1P6FA 5FPIA 3L3OB 1NQBA 3BN9D 1XIBA 1VD6A 2FAUA 1R24A 1I8MB 2ITFA 3MZGB 2P1FA 4PUBL 5CZXC 4K37A 3QVQA 5A8OA 4OM1L 2NY0B 2WM0A 3WS3A 3BOVA 4ZXBD 4BSWB 3VNLA 1TVBB 2VDNB 3L6FA 1GZPA 4K5MA 4G1EB 4NZTL 2Z27A 4AXWB 4JFDD 2F19L 3QDME 3S5LA 4GVFA 1OE1A 5HHXH 3WMBA 3O4LB 1XCFA 3VZZA 3GW0A 1BZOA 1UR2A 1OOWA 1S5VA 1W37A 1R3KA 4DLMA 1JD9A 3E3QC 4PI2A 3P02A 3Q13A 5D1QC 4Q8MA 1SPDA 5IFTA 4YHNB 1BF2A 1L7IH 2X0WA 3A3YB 2HT4C 4TXVB 4OF7A 2YPLB 1A8JH 3IDIB 5C0IA 1SUJA 1OARL 3J7HA 4JMXA 4FP1A 3TR2A 4AVOA 3BPNB 4L37A 2CR3A 4XZMX 1KJ2L 4IBZA 4IP5A 1SDDA 4XN4A 2NXZB 5E95B 3TIEB 1M9HA 5E00A 3T2QA 1AMYA 3VIFA 3CQHA 3D5OF 4MB5A 3B8YA 1U33A 4Z1PA 1US2A 2KPNA 1YHTA 3QY8A 4G8TA 3TROA 5FCUL 4D6GA 4QOKB 4XMKL 1K4CB 3BHBA 4HUCA 3QH2A 3FU7A 1N8WA 3RI5F 2GT9A 4DP7X 1SR0A 3LNHA 2DFAA 4L05A 4CQ8A 3AIEA 1F3XA 1EL3A 3ABRA 4L61A 5I2IA 2P5EB 1DBML 2C18A 2V7NB 1OOAA 2WO2B 5T5NG 1WKDA 3GDKA 2VLLA 5IDZA 3KYAA 4ZO7A 4K7PL 4UM8A 1VBJA 2AI0H 5CZXD 3UJJL 2X4OA 6FABH 2A9AA 4PJHF 3UBXA 4AMKH 2D24A 3QXAB 1UZDA 3W75A 5C7VA 1YJDC 2B8OT 5DD5L 4WJEA 4HNTA 2WN2A 2WLIA 3ULAB 4FTVB 5D2VA 4XNZB 3W25A 2I27N 1TX0A 1YUHB 1NY1A 1KSRA 4POZD 4M6PA 4TUFA 4QXTB 2OOGA 5L0QB 9XIAA 1XB3A 3F5KA 3GNPA 2JH2A 2G5BB 3EWZA 3IJHA 5KVEH 3R0UA 3P1VA 3WO4B 2O92A 3CNKA 1P69B 3MLRH 4Y5YA 1SJEB 1G94A 5DEGA 4NP7A 2W0UA 1FO0B 2ITEA 4Y9BA 3ZJKA 2YCIX 1X9QA 1E1CA 1P5UC 1GHFH 1QBMH 3IBEA 5BUGA 3O0RL 3TU6A 4WR3A 5K9XA 1ZK5A 2APFA 2WUBH 4Z7QE 3WE6B 4RGND 4UAOC 5DTFB 5DI8B 1A7QL 2YBRA 5D71H 4EDWH 4Z7NB 5HPMB 3WLLA 2VDLH 4EEEA 5HMEA 4P3DB 5IEKB 3OGCA 4C7FA 4GKSB 4C56B 2WOYA 2V6HA 3O3BB 5I5RA 1PB0A 3CV1A 4QHRA 1MELA 4QDGA 4PJHA 5DD1H 2P0IA 1JWMA 5HJGA 4X2PA 5HJBA 1V03A 2VDLL 4G1EA 5ABAA 3HPFA 4JZNA 2K7PA 1F4WL 1DFBL 2NTFA 3GSUA 1KZYA 1Y1DA 3IETA 3QJXA 5LAXA 1UYQA 1XR8A 5JQHC 5DJDA 1YEGL 1J6PA 1T40A 4LUJA 3JWDH 5BJTB 4HCLA 4KPLA 1K9TA 3UYPB 4F7CB 1KRBC 3NRFA 1O6SB 1PEZA 1XF3B 1E3FA 3DJSA 4Z6AT 3M0XA 2WBJC 4B96A 5FD0A 35C8L 1WKEA 4IGBA 4NX5A 1EC9A 3MV9B 3HMWH 2V37A 3ZUCA 3JTSB 1XIWD 1KPUB 3QQ0A 3C0LA 1LE5A 3ANYA 5LGHL 3LB0A 4QEGA 4JN7A 3W87A 2IJ0C 3BD5A 1X97A 4U1NB 3ARDA 2XNAB 5I1IH 3VG0H 4OAWB 4MIMA 43C9B 4R7WA 1S39A 2CLVA 3CUXA 4MNHB 1MFAL 2F53A 2PYEA 3V4PA 4QNPF 2WMIB 1C5CL 4PR5A 3RPTA 3D5HA 3BG9A 5EZLA 4KROB 4GW4A 5K9QG 1YYLL 5FA4B 1FDYA 3SZKC 4KVNL 3AXLA 3ARQA 3KLAB 1OXYA 4Y2NA 1WFMA 5ESAB 1OTTC </