4DO4A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 130
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do4A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do4A01
4JTGA 1Q6LA 2ZZ3A 3K8MA 1EWDA 3R13A 4NX5A 3WFAA 4DPPA 1WXJA 1W3IA 3FJ6A 3NAVA 5CG7A 1DVJA 4A3UA 1VHNA 2EF9A 1OJXA 2ZZ2A 1K3UA 2BZNA 5F4SA 1QR7A 1OF6A 3NQVA 5DY3A 4UQAA 4IJBA 3CZSA 2PWGA 1XXXA 1TMHA 1AW2A 3N9SA 1KBIA 2WO5A 2ZZ5A 3EJPA 1TPH1 2C1HA 1J4EA 1ZENA 3KXQA 4CNPA 4JY8A 3M5YA 3W2NA 1UA3A 3BV4A 4GI6A 2DP3A 1ZJBA 2VOMA 3C0JA 3W71A 1ZY9A 1VJIA 3LCFA 1K8ZA 3LRKA 1QWUA 2C6QA 4LC6A 5J5DA 1LM1A 2DZSA 1DL3A 3QMTA 1JAEA 4QQ3A 5BRBA 2QCCA 5I3GA 3BVTA 1XH1A 5KEZA 3M9YA 4MOZA 3IK2A 2XFWA 4K36A 2Z1KA 5F4WA 1EB3A 1S5VA 3QF0A 2D73A 2XVKA 4AEEA 1PE1A 5AC7A 4RLIA 3BGJA 2ZQ0A 1M53A 1XSJA 1CXIA 3FA5A 3CLWA 1JQXA 4Z08A 5K4XA 1CYGA 1QI4A 4LVDA 1A5AA 4AIEA 1L6WA 2RFGA 1XH2A 1CW2A 1LORA 2NZLA 4R53A 1EX5A 5E70A 1QOQA 4I9AA 1EA0A 4XBSA 4WSKA 1TPEA 5FF7A 3M5ZA 2EKCA 1QI3A 2BWGA 1MFVA 1SZFA 3F4NA 4FXSA 4MZYA 2YPIA 2VFDA 3W1MA 3QSTA 3IVSA 2R91A 4J3TA 2Y62A 5EA9A 1QMLA 4RV8A 4UTTA 2BTMA 3QPYA 4JNMA 1KTCA 1CGWA 3UWZA 1JCXA 3D52A 2ZE0A 3E9AA 1D9EA 1IIHA 3H55A 1H7WA 3DHUA 1XUUA 1Q6OA 1TPC1 2W79A 4K7VA 1I8JA 1D3HA 3W1PA 1OVDA 1JF6A 3C2OA 3TXZA 3W23A 3TH6A 4FNTA 1YTEA 3NOEA 1SPQA 1FWRA 5I5RA 4FNUA 3G24A 3W7MA 5CGMA 4MYAA 3ZWSA 4UIOA 2OMAA 3CWNA 1SW0A 1K7FA 5A6MA 4NJJA 3NR0A 3GXNA 3L4XA 3IIZA 2P1FA 1HNYA 3G1AA 4P2VA 1MZHA 3BW2A 2FHFA 3LRLA 2HS6A 3M16A 1GG1A 3VFLA 1G67A 1FUYA 1LLZA 4E2OA 4JICA 2F61A 1YDVA 2ZA1A 2NUWA 4NJGA 4ORIA 1ZALA 1YPIA 3GXFA 4HPHA 3WNNA 1AMKA 3O06A 3EKZA 3NQ8A 3VM7A 2JBMA 4Z0JA 3LPPA 1E3ZA 2XN0A 1KM3A 3HPZA 3OVRA 3TQ0A 5I3IA 1PCWA 3CB8A 3WEOA 1PCKA 3G3MA 3L5AA 4NU7A 4IQLA 2VFEA 1BTMA 3BAYA 1D3GA 3BMVA 1I2NA 4LU0A 4ZQPA 3PB2A 1QPNA 2EEXA 3P5ZA 2A0NA 1TMQA 4UCFA 4LNYA 2CZEA 4QISA 7TAAA 1Y0EA 2CLKA 4DXVA 4OU1A 5HWNA 1KCLA 3KRZA 1ZHAA 3W2JA 2V8ZA 1W5QA 4UTIA 3W74A 4O19A 3DI0A 3B03A 1TRIA 4CNNA 2FLIA 2ISVA 1W5OA 5CPMA 4QM1A 4B5NA 1VAHA 3NEVA 4RZ6A 2RDUA 4KKXA 3SW6A 3R12A 1NFBA 6TAAA 4ZVJA 2V9DA 1WA3A 3TUUA 1UBSA 3O07A 3L2LA 5AFDA 1YXCA 5LHEA 1JI1A 3DBPA 5CPLA 4GO8A 1BVNP 3YPIA 5AHIA 4Z1CA 4N4QA 3I7RA 3QM3A 2H3DA 1H62A 3WNPA 4AWSA 2PURA 2Y7FA 4IX0A 4DF1A 4QAIA 1QX1A 1K02A 2GJNA 3UG5A 1VZWA 2Y7DA 4OV4A 3DX3A 1EIXA 2PE4A 4Z1AA 1OFQA 1WQ5A 5D09A 3RMJA 3LB0A 3IGUA 3FAWA 1KCKA 5EL1A 4XBKA 2E5BA 4MFDA 1LDCA 2EADA 3VGEA 3FYOA 2Y2WA 1WBJA 3L4UA 4PEEA 3FYPA 2GVJA 4AWUA 1QW8A 5K3VA 2OCZA 3UG3A 4HPXA 4IXHA 4X9YA 3B0VC 1TQTA 1DV7A 4KFOA 1Q6QA 3RK8A 1OFDA 5AYYA 5A8GA 3OVPA 3CLMA 5ABTA 2X2GA 1KBJA 4EF8A 1AG1O 4KWUA 4OWGA 4FX6M 4POCA 5FI8A 4NZFA 2YSWA 5F2IA 1G7UA 2E6AA 1OT2A 1AL7A 3EJSA 4QAWA 1LYXA 2E0PA 2DZXA 4AH7A 4DELA 4DQWA 2C14A 1G9HA 5HDRA 1HL2A 5LSMA 1R30A 4M7SA 1JI2A 4JX4A 1I45A 2B7QA 2P0OA 1SO5A 2G97A 2R14A 3M6YA 4UQ9A 3TOPA 4O1DA 5AN7A 1FCQA 2QR6A 1OFRA 3JR2A 1KLZA 4UTTC 5G1YA 5KINA 3NQAA 1CXHA 2E4TA 4GC4A 4EOUA 2J25A 3LLFA 3WELA 4GO9A 1ZJAA 3MI6A 4U3CA 5D05A 1XD0A 1HXKA 1OGSA 1LWHA 1Y7VA 3BSHA 2NV1A 1IF2A 3GDLA 3BAJA 1RR2A 1W37A 4J3WA 1JULA 3O6CA 2WVSA 4WJEA 3KRSA 1M5WA 3W7NA 2EO7A 5AHNA 1H61A 3A4AA 3UG4A 2Z0IA 3NDOA 1TREA 3W83A 2Y61A 1TJRA 3QFEA 2B7PA 2CZDA 4AAJA 1CGUA 3WJSA 5HXMA 1OT1A 1IZKA 4L4LA 2YFOA 3EWUA 1W5MA 5E1QA 4PFMA 5HJLA 1K8YA 4DO5A 3W1AA 2GVLA 4GUIA 3TFXA 4M7TA 2I1OA 3BG5A 3B8DA 1H7XA 3LXCA 3HIJA 4JTIA 2GUUA 3BLKA 1N55A 3ANYA 4Y9AA 3P80A 3PY2A 2F2HA 3UY8A 2QLYA 3UPWA 3BUBA 2VEPA 1U30A 1C8VA 4IMCA 3M7WA 4U2YA 4OBTA 2YA1A 2ZIDA 1RZMA 4WSJA 4ZZ9A 2WNNA 2XIIA 1DHPA 2NLIA 5F7UA 3O6YX 3DFQA 2J88A 4TMCA 1GVRA 4RK8A 3STEA 3VNDA 4LVFA 3HG2A 1H51A 1J0HA 1BWLA 4RKAA 3UWUA 3VCRA 2BY2A 1VGAA 3WY1A 3S1XA 2NV2A 2QCEA 1D3CA 3MP4A 2P10A 3PUEA 2FTPA 4AIOA 4AF0B 3CZLA 3G1DA 1UUOA 2DH2A 3I7SA 1SU5A 1LRNA 4UNLA 3UWWA 4FB7A 3CZNA 1PVNA 1UH4A 3W70A 3W7DA 3W7QA 1EH9A 1KV5A 3FFSA 4BI5A 1UUMA 3OEXA 4NT0A 3UXDA 3TJXA 2ZA2A 3W1TA 4JFWA 4N02A 3OIXA 3PSVA 2E5CA 2JGYA 2Y7EA 2CLMA 3PSWA 1ME9A 2A1YA 1WDWA 3ABOA 3MW7A 2C15A 1GVIA 5D2VA 3VE7A 3P8IA 3K8KA 2EQDA 1Z48A 1QHOA 1UD3A 1EWEA 1ZAIA 1OF8A 1JR1A 3W7KA 4RXFA 1W31A 3VMOA 1THFD 4CCEA 5DBTA 2YX0A 3DAQA 2WVTA 1QDSA 2WJZA 3MI3A 3W75A 5CSSA 3C2FA 2BY0A 4WXYA 1LP6A 2CHNA 4D2JA 4FIQA 3I6RA 2WVUA 5BOOA 2CZ5A 3L4VA 3TC6A 2V82A 3FKRA 5CPNA 1JUEA 5HWJA 1MW2A 2ZRUA 3L5MA 1VPXA 4PCSA 3LDVA 2YA0A 1PIGA 4JFUA 3IGXA 2ZXBA 4WY0F 1UH3A 2E9BA 1DORA 3GKAA 1J2WA 1XDLA 2QAFA 4NNAA 2EPHA 3HG5A 4UQBA 4CQAA 3TDFA 4MKNA 2F7FA 1JCLA 1LCOA 1MSSA 1V3KA 1XCWA 2JK2A 4AHQA 1EO5A 1LWJA 1MEIA 3L2MA 3G3DA 1JCMP 2OYLA 1GTEA 1GQNA 3LHYA 4AF0A 3CTLA 2Y85A 4TVUA 1R2TA 4LVAA 4MVAA 2DZTA 3MMTA 3IIPA 2VKZG 3L0KA 1MW3A 3NQ2A 4WF7A 4MUZA 3T7VA 2R8WA 1YTKA 1I2OA 2V2HA 2EGZA 1O60A 3LTSA 2CFFA 4PL2A 1MFUA 3EX3A 3CTTA 1Q6RA 2VFIA 1UASA 4UQEA 5A6LA 1EA9C 1QWNA 3GB6A 3STFA 1G69A 3PUDA 3UWQA 2QKFA 3N34A 3W7GA 3EJTA 3F03K 3WNMA 3AXIA 1B0IA 3G1FA 2NT1A 5DY2A 4YWIA 3ATYA 3NL5A 4MFEA 1KXTA 4O0ZA 3W2KA 1CGVA 3JS3A 4BI7A 3MBFA 4ZQRA 4HIBA 4O53A 3DU0A 4JIPA 3BUPA 2ZZ7A 5LNSA 1B57A 3NM3A 2ZRWA 1OFBA 2X1RA 1M7OA 4R34A 4C1KA 1F73A 1PJ9A 4W9TA 1DOSA 1GT8A 2F84A 1PV8A 3B06A 1B4KA 4MZ8A 4MY8A 1LOSA 2PWEA 5C6MA 1WO2A 1BLIA 1JF5A 1NEYA 1FWTA 4ATWA 3ZWTA 2RDWA 4M19A 2FDSA 3BAIA 3HJEA 3PC0A 3W87A 1YXYA 3GKFA 2C7FA 2J27A 3VU2A 1GCYA 3TMQA 4JDBA 2B7OA 4DO6A 3L65A 3W7CA 1FX6A 3GDTA 1KGWA 2OSYA 2BY1A 1RQEA 1L9WA 2ZA3A 3O05A 5D03A 3O8AA 4JFTA 4UFMA 3CU2A 2ISSA 3ZR5A 1PEZA 4A2RA 1VS1A 1NM9A 1XV8A 3O1NA 5KITA 1TRDA 4QJ1A 4S1FA 2B0MA 2QCFA 3D0CA 1PZ2A 4CN1A 4JYDA 4LPCA 4J27A 4UNKA 3ZFHA 2WNWA 5DCBA 3QW4B 3D50A 4WUIA 3SFKA 3OLIA 1KLYA 4JFSA 1X1OA 4UTJA 3LTYA 3EX6A 1KGXA 4LRTA 5HWMA 2D3NA 2ISWA 2VEMA 1S3HA 1FWNA 4PSPA 3DFNA 4BF9A 2Y4SA 2V0TA 2DU2A 3TAOA 1TB3A 4KFPA 4J3VA 3NZRA 3CEUA 2JKEA 4MB1A 5HR7A 3HGOA 1UJPA 3KVJA 5A2CA 2YDAA 1P6WA 4YLWA 3CT7A 3ELFA 5I23A 4CGTA 3GTNA 4Z1BA 3LCXA 3TMLA 4YMZA 3S1UA 4I7WA 5CLTA 1KXQA 4NZJA 3W7RA 2I14A 1KBKA 4JTFA 2TRSA 2WPGA 1KB3A 5CKSA 3IGSA 3TV8A 1HG3A 3D4ZA 4LY8A 3W6YA 4O16A 3NQMA 2LLEA 4H4IA 1B4EA 3WK3A 5U4NA 5D33A 2QCNA 3NO5A 4FMVA 4AMXA 3D51A 3GXIA 3S5YA 5FEZA 5DCDA 3MYPA 1J0IA 1GZGA 2D2OA 2CLEA 4TIMA 3HO8A 4UQDA 2DJXA 3UZ5A 1GG0A 1I2RA 3OLDA 1SW3A 4JTSA 5F1UA 3VKJA 3W7HA 2YKKA 4FLOA 2JKPA 2G5WA 1SR9A 1B9BA 4AEFA 3VNZA 1VLIA 1BKSA 3FW6A 1O4UA 2OSWA 3S5ZA 1SMDA 3VO0A 3M5XA 4GJ1A 4LT9A 2VNCA 1SZGA 1FY6A 3KHJA 4L4MA 1JCYA 2DZPA 3EB2A 3NPWA 4G1KA 2WSRA 2EAWA 4C1LA 3G0XA 3GNNA 2C3ZA 3W7EA 4GQQA 5LNRA 1QO5A 1GEQA 5D2WA 1JL8A 3RLVA 3R8RA 2EHHA 5KZEA 1TQXA 5MHBA 1L6YA 2WVVB 3QQ1A 1IXOA 2DZVA 1XL9A 3BVJA 1GVOA 3KL5A 4GE8A 4N6FA 4BI6A 5BMXA 5LZLA 2A7RA 2BY3A 3OA3A 3DZ1A 4XTDA 3BH4A 4EIVA 3FOKA 4UTWC 3QMRA 5EMUA 5I0DA 2NXIA 4A29A 3UPBA 2BXVA 3P84A 1RV8A 2ZDRA 4CN6A 4U28A 3B0PA 5I3JA 5D04C 1W8SA 2A4AA 2Q3RA 3USBA 3TCEA 5E9AA 3IIXA 2WCSA 3DX2A 7CGTA 2V3DA 3LPOA 4J3UA 1G1YA 4JXCA 3MHFA 4JY9A 3NPUA 3EWWA 2CWNA 4HSOA 1H7RA 2ZX8A 4MLRA 2EJ1A 3VGHA 2DZUA 3LM7A 2FH6A 4JTHA 2AQWA 2OT1A 3ECQA 1ICSA 3GK0A 3BVWA 1XBZA 5AHFA 3KL3A 3L4TA 2YIHA 1VFMA 3G0SA 4LVGA 5D32A 3W3OA 1JUKA 2H6RA 1TPUA 3W84A 2WSKA 1FDYA 3SECA 3PM6A 1KM5A 2VELA 2VFFA 4UQCA 3HB9A 3WJWA 4O1BA 5C2XA 1TCMA 1VYSX 5H91A 4M6PA 2WSQA 3K1DA 1ZNNA 4CCCA 3NL6A 5E0FA 1HFBA 3DC0A 2F7RA 3WY4A 1R47A 2AAAA 1YDNA 2OYMA 3PS7A 1GPWA 3PBYA 1H3GA 3TSBA 4AEOA 4ZMGA 1MXSA 2WVVA 4UTUA 3B04A 2ZX7A 1TPFA 1XCFA 1QHPA 3L9CA 1TSIA 1VFUA 1MXGA 2FE0A 3S8HA 2NXHA 3EKLA 4MJMA 3WJXA 3GXMA 2QPUA 4JYEA 3WENA 4GUGA 1W3TA 2KZHA 4CQ8A 3Q58A 1AVAA 1ADOA 2CLHA 2J6XA 3W2LA 2QPSA 3FEMA 1CGYA 3U2OA 4K8HA 5EPDA 5C54A 3LV5A 1ZFJA 3ZR6A 2G3NA 1ODUA 1XKYA 5CZ0A 3A5FA 2B7NA 4E2BA 3CIXA 1RQBA 3CZKA 1L6SA 2QF7A 4PH6A 2ZXDA 3W7JA 5G2HA 4GBUA 3GIYA 3MI2A 1SSDA 3NL3A 4QITA 1WZMA 1OFAA 2PCQA 1XSKA 3BGGA 3IRDA 3TROA 1TCDA 1KBBA 2ALDA 4JDYA 3W86A 3DFPA 3C52A 1T0OA 2FH8A 3E02A 3FJLA 4LTSA 2XVLA 4JCLA 2X2HA 3PBVA 3PF3A 1K8XA 4ICNA 3C6CA 2HTMA 4ALDA 4N9EA 1AW5A 2F7OA 3FAXA 1JQVA 3SZ8A 4LS0A 2YFNA 2FPVA 4TU1A 4JTLA 1FWWA 3LBCA 3TE9A 1AK5A 5CZSA 4HNNA 4YCPA 3E12A 3DGRA 4R33A 1UD4A 2FB3A 3T78A 3BLIA 1HVXA 4M5PA 2PWDA 1C29A 1ZS2A 1PZ3A 1IZJA 1EO7A 1Z42A 2DORA 2AAMA 1WX0A 1RVGA 2ZYFA 3QQ0A 3NQ7A 4GRSA 4AVFA 1TPWA 1UH2A 1FXQA 4QIUA 1HL8A 1QAPA 3W73A 1PPIA 3L66A 1EHAA 1SW7A 4N4PA 1HWWA 2ALWA 3BVVA 3PVFA 1W5PA 4CNOA 4CKQA 1VHCA 3RNDA 3LX9A 3DDFA 1PS9A 2CW6A 1UKQA 2ZUUA 1AMYA 2A21A 1JXKA 5GVJA 2E09A 1JXJA 3BLBA 4X3ZA 3HMJG 2Y63A 1KFEA 4Q4KA 2V3EA 3V75A 2NWSA 4DBEA 4MYXA 2VR5A 3U8GA 1YXDA 3CHVA 1OG0A 4JD4A 2XIBA 3BUQA 3FLUA 3THQA 4GNJA 2VENA 4IPIA 4NXKA 3LHVA 3NXFA 3BLEA 2QJIA 1BEUA 3WMSA 3BVUA 4GI8A 4UNIA 4HA1A 2QAPA 5L9FA 3NQCA 4DEFA 3TTSA 1WP6A 4ONVA 3DH7A 5FESA 3BCFA 5A5WA 1BVZA 1KM0A 2Y7GA 2FB2A 1U2YA 1KW1A 3HPXA 3OBKA 2V2CA 5FEXA 3T44A 8CGTA 2CLOA 3KL0A 1G7VA 3JRKA 4O13A 4O12A 1XSIA 4E0CA 1S46A 2X2IA 3TONA 3A5VA 3LHUA 4ADTA 2J9XA 3WDJA 1IIGA 3CWOX 1J0JA 1FBAA 2BHUA 4GI9A 1I4NA 3O63A 1MW0A 4BWLC 3DENA 2ZX9A 3W1LA 1MWOA 1OHLA 4DO4A 4QNWA 3AJ7A 1QFEA 1PS3A 4J7RA 1XI3A 3LHTA 4K7YA 4ML9A 4BFAA 3BLFA 1OFEA 3W38A 1KTNA 4PODA 2X1TA 2E6FA 2YGYA 3VM5A 1ME8A 1S5WA 4HOWA 4FNSA 2X1UA 4CLMA 1ZCOA 2ZRZA 4EF9A 3HBLA 2Y89A 3S2CA 4LS1A 4E38A 3TQKA 1N8FA 2Q8ZA 4H8HA 1CXFA 2RH9A 1H7NA 3PBUA 3VNYA 1WYIA 3UWYA 2YR1A 2CLIA 1H1YA 1WAUA 1IV8A 3QYQA 3AMLA 5KSWA 4RJEA 4WX2A 3W1UA 4UR8A 4O52A 1QPOA 3BW3A 4FF7A 4HOXA 4Z1DA 1EPXA 2Z6JA 3NVTA 3VGDA 3B0UX 4NJKA 1ICPA 3W72A 2V81A 3KX6A 1KFCA 5EY5A 1A5CA 1E51A 5G2WA 4YCOA 4ZQMA 1OX6A 2A2IA 3WK1A 4JYFA 1HTIA 2GUYA 1G6CA 1CXEA 3H54A 3KVLA 3W22A 4FLSA 2OJPA 3CQ0A 3QC3A 2NX1A 2DIEA 4FHAA 3TJLA 2ABAA 2VEKA 3SSJA 4RZ5A 3EWBX 1FCVA 1PIFA 2V30A 2J24A 4UOZA 4PCFA 4UTLA 4AB4A 3W1RA 4UZUA 3SJ3A 2QUTA 1G4SA 4U31A 3VSTA 5F2MA 4DF2A 1VYPX 1CXLA 2PWHA 2WC7A 1BPLB 2IGTA 1TJPA 4UFIA 3WFZA 1TTIA 3CC1A 4YXGA 4UFHA 1ONRA 1FXPA 2A7PA 3HPSA 5I3HA 1JDAA 3G22A 4PTNA 3A24A 1JRCA 1QNVA 3DX0A 3EXSA 1PL9A 2BHZA 3INPA 1U5JA 1VYRA 4GUJA 3OG3A 4IXXA 1W54A 4GQRA 5TIMA 2FGZA 3WDIA 3N9RA 4AMAA 1E43A 2CLLA 4RX0A 3TC7A 1H7PA 5D02A 3P82A 3ZSTA 2FPYA 1CLVA 4A22A 2QMJA 1W56A 4HHPA 2YW4A 3QMSA 5CZTA 4M6QA 4QNEA 4PCTA 2HMCA 3M0ZA 1H1ZA 3S1WA 1M6JA 1O95A 5BNKA 1VIWA 1A5SA 2PC4A 2YA2A 2Q3OA 1GWJA 1FWSA 1CXKA 1VRDA 1JFHA 2WKGA 4PEKA 1VCVA 4UC5A 1YTDA 1G4EA 4Y6GA 1F6KA 2YW3A 3GDKA 3G8RA 1OYBA 4O4WA 4Y8FA 1OB0A 1V3MA 3VMPA 4NQ1A 4UTHA 2YZRA 3THAA 4X22A 3RIKA 4ZQOA 1J0KA 4HP5A 1NOFA 1DQWA 3KVMA 4PC8A 5C55A 3GYEA 4FNPA 3NQEA 4UTWA 3GR8A 5IBXC 2NUXA 3G8EA 1WBHA 4HKPA 4N9DA 1KFBA 4JL2A 2A6NA 2ZZ1A 3EDJA 2E5DA 4O11A 3G1HA 3NG3A 3IJ7A 4H2CA 3MHGA 3SI9A 5AYZA 2D0FA 3GNDA 1JD7A 5HULA 4NVTA 1OFPA 2NX3A 3UNDA 1P5BA 1MEWA 4KFNA 5AOUA 2V5LA 3D4YA 2NWRA 2WKJA 3M44A 3L0NA 1KGUA 2PRLA 2G95A 1VC4A 2VC6A 5FEWA 1V3JA 3F1QA 2Y70A 3LCHA 3MBDA 1KM2A 5D30A 1TO3A 1IXQA 3KVKA 3UXAA 3L4WA 2F18A 1LZOA 3DX4A 2W0UA 5LNUA 1U83A 3KE0A 3SGZA 3LERA 4UMCA 1KWGA 4JEQA 4IMEA 4TO8A 3EJRA 5LNVA 3SY5A 1NSJA 4JN6A 2VXNA 2D3LA 1UA7A 3EJUA 1OK4A 1MVYA 4MJZA 5D2XA 1XCXA 3RF9A 2ZUVA 1HT6A 5FF2A 4WQ6A 2ATMA 4JCMA 1C9DA 3QEZA 1JCNA 3HGRA 2GQ9A 5HQEA 6CGTA 2A5HA 1A53A 3GVGA 3IJ8A 3BVXA 5K4ZA 2VRQA 1LBFA 5LHFA 1L2UA 3MO7A 2H8ZA 4KWVA 2GJLA 1F6PA 1AQMA 1QPRA 2WSYA 1T99A 5AB3A 4UUIA 1TQWA 5LGXA 3BARA 1KFJA 3VGBA 1HO4A 1JJKA 1S5TA 1VCFA 2F7PA 4O57A 3MP5A 4O18A 3S6DA 1YLVA 1QI5A 1ICQA 1Z44A 3WK0A 1T8XA 3W2UA 3N2XA 4HNVA 3QW3A 4MAZA 3VX0A 3EJQA 3W2MA 1XBVA 4XB3A 1RP8A 2DIJA 1CDGA 3WNOA 3ZO9A 1DKWA 3RLUA 4UTMA 4HNUA 5K9CA 2H90A 3LXAA 1TTJA 3DHFA 3OLGA 3WY3A 2WNZA 3CEPA 3KAOA 3NPVA 4OQVA 2AGKA 4JTEA 4J9JA 2EACA 1T96A 3HOJA 2QDHA 3L2IA 5CSRA 4XKYB 4CVWA 2PRHA 2W6RA 5DELA 2CLFA 1RP9A 2QCHA 1TPDA 2XWDA 2F1AA 3W07A 2QJGA 5HR6A 3NQFA 2QCLA 2NX9A 3TNOA 3CZEA 2X16A 1SZNA 2ZXQA 3PAJA 1GJWA 1W9XA 3W7LA 5K9XA 3VGFA 4AWTA 1PHWA 1G5AA 3NYZA 3CGTA 2QCDB 1ME7A 4DPQA 4UFKA 1O5KA 1AQHA 3NA8A 5CZJA 2ZBTA 2ZFAA 3M43A 3E96A 1WZKA 1WOBA 4H3DA 4UOQA 1W3NA 1Q3NA 3WEMA 3DHPA 3IVUA 4GWEA 3M47A 3TW7A 4FNRA 1KM1A 3I68A 5HMSA 3N3MA 1KXVA 2A85A 1DHKA 4ZL1A 3GXPA 4HT3A 3O16A 2CXGA 2G3MA 1KXHA 1TYGA 3M5VA 3VI2A 1H7OA 2JKAA 4OE7A 2JGQA 3KRUA 3STCA 1JCJA 5AC8A 3DKLA 1X8FA 5TBOA 4IOTA 1M7XA 4ADSA 1SFLA 1X1ZA 2QDGA 2Z2UA 3AO0A 1B2YA 1LRTA 3TIMA 3W76A 2ZX6A 3LRMA 3WDHA 1JDCA 2VT0A 2NSXA 1GYNA 3M41A 3BAWA 2GVGA 1TQVA 3EX1A 2E8ZA 4W93A 3WY2A 1EP2A 2V2DA 4LOCA 3EWYA 1SSGA 3UZJA 2Y88A 3DFOA 5TD4A 1XBYA 1O5XA 3LXBA 4GKLA 3A21A 1J5TA 2RKXA 3QZEA 4Q32A 1BAGA 1QPKA 3P62A 4O8RA 1UD8A 4HPJA 4XKYA 5BRPA 4OJYA 5G2IA 3W1XA 1ML1A 2I9EA 3MYOA 4TMBA 1SMAA 2TYSA 4LS2A 3CPUA 1ZAHA 1PHQA 3NQ6A 4FEZA 5I24A 1IXNA 4U4MA 3CZGA 3UWVA 5K7JA 4JTTA 5F4XA 4H8UA 2BX7A 4YL2A 3SGUA 3KWXA 3OHIA 1BF2A 3II1A 1MW1A 3B05A 5FF0A 1FDZA 4JX5A 2QJHA 1FCUA 1GVQA 2ZWZA 1KM4A 4ORMA 3FKKA 4OGZA 4J3XA 2OSXA 2QCDA 4KWWA 1GYLA 3WNLA 4CN4A 1LOQA 1XUZA 4DF0A 2ZUTA 1CGTA 4K8EA 2ZZ6A 2VEIA 4BWLA 3TSDA 4GFSA 3ABRA 3KLLA 4JTJA 4K38A 1GJUA 1C8QA 4O28A 3S5NA 4NNBA 5E93A 3HJZA 3WK2A 3LCGA 1OYCA 1UCWA 3R5EA 3T4CA 3NL2A 4K39A 2HS8A 2C13A 2X1SA 3I7QA 1TIMA 4LV4A 3TKFA 7TIMA 4H8VA 4TX9A 3ABQA 3DFSA 5G5IA 1SO4A 3P7YA 2GJPA 1P4CA 2WNQA 2FHCA 2C18A 1N7KA 2ATSA 3GAKA 1JGIA 3P8JA 2X30A 4N9BA 1R34A 1KFLA 3K30A 3C2RA 3C56A 3CIWA 3UYCA 2Y6ZA 3W9ZA 1TV8A 3W7IA 1KWKA 3DKJA 3BUIA 4GXMA 5LGZA 1A47A 4WY0B 5LNWA 4UTKA 2WV8A 5D2YA 1KM6A 2GVYA 4CQ9A 2VRKA 2OT0A 3UEQA 3ZR4A 4UXDA 3ZS4A 3P67A 4MY9A 2VUYA 3QSRA 1JDDA 3BUDA 5G4WA 1JIBA 4LC8A 1SFJA 4PSRA 4M8UA 3LHWA 1CGXA 1GJPA 2QCMA 3G18A 4LUJA 3GR7A 3W1QA 2D0HA 1RQHA 5DLCA 4UMBA 1V7YA 4WOQA 1CIUA 3BSGA 1H5YA 1GTHA 1WZLA 4JTKA 1R75A 2YCEA 5K9DA 3TK7A 3TA6A 4RXGA 1TTQA 1HX0A 4FX7A 4HSNA 3RU6A 2Z6IA 1UOKA 5D2TA 3EDDA 3BO9A 2CZFA 3MUXA 3PULA 3L21A 3O15A 5EBUA 5BW6A 4HN4A 2E6DA 1MXDA 4MZ1A 4AXKA 4A21A 1QO2A 4NJIA 5SWUA 3QJAA 2VFHA 1L0PA 3ZQ9A 5KZDA 3HQ1A 3TTYA 2DJLA 4AMWA 3RFAA 4AHOA 3C61A 3U6WA 4S2CA 2EABA 5H2ZA 4AYGA 1NVMA 5A2AA 4OHQA 2FJKA 3NZ1A 3S42A 2G96A 3PUOA 1I2PA 1XD1A 3MJYA 4KMQA 3BMWA 5DBUA 3DDGA 2J9ZA 4K37A 4UMAA 4MPQA 3WN6A 3TQVA 4MLJA 3MHUA 2A7NA 2FIQA 1YPFA 5U7SA 1RD5A 5HPOA 3EX2A 1UD5A 3A22A 3L4YA 1XFBA 2OZ0A 1HUVA 3MP3A 3NM1A 2OW7A 5D38A 4EWND 3LTPA 3TSMA 2F7QA 3EEGA 4RR4A 5L6UA 4JFVA 4OIFA 4JIQA 4WY0A 1UD6A 3WJYA 3B4UA 3LCWA 5CGTA 3VGGA 5AHMA 3UD6A 5HUOA 1OSEA 3BCDA 4NXSA 3BK0A 4UFJA 3GBEA 3F4WA 5AHLA 4LQ1A 5I3KA 4XUGA 3A6OA 3G1SA 3IJ9A 3LI0A 5HINA 4DBDA 3NPXA 1ZAJA 1RPXA 1R46A 4XWUA 4GUHA 1OABA 2WPBA 4FNQA 2RHGA 2IQTA 5CPOA 1A50A 1VCGA 4I7UA 4LVBA 3LOTA 4BR1A 1Z41A 4EVZA 3STGA 1B3OA 1LROA 2BLEA 9CGTA 3GDMA 1JD9A 4HOZA 1GVSA 1P1XA 1I75A 3CPRA 1MO0A 3L68A 3BAKA 2PWFA 3ZT6A 5EYWA 1DJNA 5IBXA 3EDKA 1H63A 2GPTA 1FCBA 1OYAA 3DX1A 1TQSA 2GOUA 2B4GA 2A6LA 2ZRYA 4JTUA 3MWAA 1SO6A 2WKLA 4IMDA 4LV9A 4X2RA 5DXYA 3BLPX 3QPZA 5AHEA 2GJRA 5G1TA 4O14A 3G1YA 6ALDA 3EX4A 1QCWA 4ZQNA 1X7FA 3LGEA 2TSYA 4NX0A 2XN1A 2E1DA 3IIOA 3QGVA 3C2EA 1VLWA 5BRQA 1UD2A 2C19A 4IGHA 2BHYA 3VE9A 2E68A 3GBDA 1G4TA 1CI1A 1JUBA 5AYXA 2NXGA 5KTLA 1H50A 3HGJA 3A47A 3TR2A 3UCQA 1IGSA 5T26A 3GDRA 4JR5A 5DFAA 4IWWA 3IVTA 1U33A 4CCDA 2E77A 4P61A 1SQ7A 2ZCGA 3PG8A 5K2ZA 1HL9A 3EXTA 4JS3A 1OX5A 3S0CA 3FS2A 1BSIA 4BK9A 4AHPA 1R33A 3N14A 1TPVA 3IV3A 3RILA 2H8XA 3E0IA 1O7DC 1EP1A 1G4PA 5BMWA 1EUAA 4OT7A 1UB3A 1VH7A 4IPJA 3BAXA 5KZMA 2QUVA 2WCGA 1HO1A 4J28A 4UR7A 1KTBA 1VB9A 1XDMA 5A2BA 3GAYA 1DBTA 3W1NA 5LKYA 1KA9F 2ZICA 1W5NA 3LCLA 2ZUWA 2TMDA 3P60A 4M56A 2NUYA 1WPCA 3TX9A 1H60A 4MY1A 4R7JA 2ZUSA 6TIMA 1R2SA 1DTUA 3G1XA 3QH2A 2FHBA 2NT0A 4UZSA 1LBMA 3SIZA 1QWGA 2WSPA 1K7XA 3S5OA 1OK6A 4IMFA 4BA0A 2WQPA 3VSUA 4NJHA 5D37A 1F5ZA 2BSLA 3A23A 4QSHA 3N19B 2PRMA 3BPWA 1JVNA 1VR6A 4LRSA 2Q8LA 2DH3A 1K03A 2OW6A 3ZOAA 1AW1A 1A5BA 4IX2A 4WXZA 5FF3A 1EEPA 1TV7A 3UY7A 3BG3A 1JRBA 4BZYA 1G94A 1FQ0A 3W88A 1YYAA 3BW4A 1CPUA 4GINA 1PIIA 3LLDA 1YDOA 1SZEA 2BXYA 4IUOA 3EXRA 3UQNA 2ZRXA 2D0GA 2E8YA 2R94A 1XH0A 4O54A 1QW9A 1K7EA 2GQ8A 2FYVA 4XQ6A 4FLRA 4I7VA 4WOZA 3WJZA 3K8LA 2XVGA 4LW7A 4MIMA 4LXFA 3PWAA 1XBXA 1TQUA 1SO3A 3ATZA 3IIVA 4ZQCA 2WANA 3C4UA 5E0KA 3E49A 2EAEA 1BWKA 2ZWYA 3OLEA 2FFCA 1ALDA 1XGZA 1VQTA 2YYUA 3DXIA 3AXHA 5C5YA 1DJQA 3VMNA 5DCEA 3EDFA 1TV5A 5E6YA 1GVFA 2X2JA 3N73A 3W7PA 3L67A 3LI1A 1GOXA 3C8FA 1E40A 3GXDA 2O7QA 4JL1A 1QOPA 2CU0A 4Y96A 3R2GA 5FF4A 1EUNA 1WZAA 3HGSA 5J5RA 5F2GA 3W7OA 1LBLA 2O7SA 4PA8A 1O94A 5G4EA 1TPB1 4U33A 5FEPA 1I2QA 4UFLA 1XM3A 3W37A 1VJSA 5DO8A 1VFOA 4Z0SA 3CV5A 2OX1A 3I65A 3LBMA 3DFTA 3FIGA 2QMKA 1LTDA 2ZZ4A 3AJXA 1YADA 1WOAA 3IEBA 4O10A 3TXVA 3LCIA 2DZWA 3BG9A 4O1AA 4IMGA 3KOFA 1UKSA 1TQJA 2TPSA 3KEHA 3ZT5A 3M07A 3N2MA 3UERA 3P5YA 1WV2A 2UV8G 3NQGA 3NGJA 4JX6A 2C16A 1LLWA 4FX8A 3OVQA 2C0AA 5EKYA 3WNKA 1F7BA 2ZTKA 2ZTJA 4O0KA 5EMYA 2GQAA 1AL8A 3G0UA 3DHDA 1F76A 1W1ZA 4FLQA 4O50A 1Z32X 3SR7A 3VX1A 5CGQA 3EDEA 2Z1BA 1HTYA 2QEZA 4NI3A 3C3NA 3TFCA 4LWWA 4H7VA 2YJQA 3GXTA 1Q45A 3ZT7A 4S2BA 3W85A 4JGDA 4WLCA 3A9IA 3LHZA 4PL1A 2AMGA 1IXPA 3EWZA 1W0MA 4NNCA 3AMKA 3H53A 4N6EA 4Q33A 1OX4B 1NF0A 4ADUA 2E6YA 2CPUA 4OKDA 4J3SA 1X6UA 3DI1A 4LUIA 5HUPA 3GLCA 3BC9A 4TR9A 1NF7A 2Y24A 1SUXA 1V5XA 4OV9A 3ZSSA 1P0NA 1TTPA 2OYKA 1BG9A 2H3BA 4N2YA 3HG4A 4FO4A 4O4VA 4NUWA 2QV4A 5AC6A 4WZHA 3NNTA 1EP3A 3PR2A 3R89A 1E3XA 2YXGA 1DQXA 4X9SA 3GX9A 2XN2A 1PAMA 1Q4NX 4FIRA 2RDTA 1LRQA 1R2RA 5CLWA 3P61A 3PBWA 5HNRA 1F74A 1P0KA 5I3FA 3Q94A 3L5LA 5KMYA 4AW7A 3P74A 5F2LA 4U2ZA 1D7FA 3VSVA 3Q2DA 4UCGA 2HSAA 2ZRVA 5TQLA 2XWEA 1UKTA 2FQIA 3L0GA 4K6AA 2Y5EA 1MEHA 3PG9A 1NAL1 4GIAA 3EWXA 3GZ3A 4RCXA 4Y90A 4A2SA 5DXXA 4FXRA 1ZJIA 2YOCA 2FPTA 1KV8A 1FDJA 3CM4A 3M1ZA 1DEDA 2V5BA 1WE5A 1F2JA 2QUUA 2ZXAA 5E6ZA 2BXZA 3ABSA 1QPQA 3P81A 5DN1A 3L4ZA 4B9ZA 5CXPA 4O1CA 4GUFA 3HZ3A 2V3FA 3TW6A 2WOQA 3TU9A 1OX4A 1RPKA 4AYSA 1V3LA 2C8NA 4O15A 3T40A 4RZ4A 1KFKA 1LOLA 3T55A 1F05A 2ABBA 3LV6A 3PB0A 4X0NA 1XC4A 3G1VA 2ZX5A 3KLKA 3KFTA 3NQDA 3O6DA 2F1BA 3Q37A 4H6KA 5F1VA 3S1VA 1CX9A 2YYTA 4XZ9A 4E2DA 3S9YA 2J9YA 3QRHA 1OFOA 4N9CA 4O17A 1M7PA 1JG9A 3C2VA 4XTIA 2TAAA 2VFGA 8TIMA 3V1PA 4M6VA 4B9YA 3TAKA 3HF3A 3HG3A 5IM51 2QCGA 4HNTA 4WD0A
chains in the Genus database with same CATH superfamily
2BMKA 3ZE1B 5IHSA 4NGHL 4X6DF 4Z3EA 1NBYB 3AWEA 1KCZA 2BZNA 4KRUA 4UQAA 4W6WB 5FAJA 1KBIA 5CG0A 1EXPA 2C1HA 4AQ1C 3H7UA 1E9ZB 1K9DA 3BV4A 4GI6A 5FYJH 2YXVA 4P8WA 1IL1B 4TNVK 2BS9A 4OKVB 4JKLA 3BVTA 3VNJA 3PGCB 5DJZA 1S5VA 2VXQA 4JHUA 5GNXA 5KJRH 2XM2A 4OLVH 3OWRA 5D8JH 4K1WA 4WO4C 4GLRI 1V7NH 1QOQA 4HD5A 4W9KC 3OTRA 2VGIA 1TPEA 2WZPA 3EYOB 5L88H 3M5ZA 4JHMA 4ANXA 3F4NA 3T6WA 3B2UC 1X5XA 3QSTA 5FJJA 5TAOA 4BRJA 1KTCA 4C55A 4TNWK 5EULV 1I8JA 3TH6A 3AS0A 2VDGA 2ZXWB 1REQB 4A66A 1B0WA 1MZHA 1R3VA 4QRBA 2WO3B 4ORIA 1FE8L 3MJ8B 4IF2A 4PR5B 1HXMB 2BVPB 3NJFA 1KBGL 3STBA 3OVRA 2A6DA 3ARDB 1QD0A 2XYBA 1KCRL 5EEZA 3J07A 1WFJA 4PJBF 2QADB 4M1CD 4UCFA 4J3OH 1TV3A 2V6HA 5EN3A 3ARRA 2FX7H 2UZPA 1IE7C 4BK8A 4CNNA 2FLIA 3PHOB 5C9RA 4S3CA 3ORWA 2XZ7A 3NEVA 4A8RA 3CG8A 6TAAA 4KI5C 4PJ8B 3LQAL 4AXNA 3LGDA 1U3YA 4U3AA 4NM8H 3RURA 3JVFC 4ZUVB 3BGFC 3RVWD 3FSAA 4HNOA 1NWUA 4CMMA 3I6EA 3MRBA 4BELD 5ERWB 4CSTA 1YX1A 4NN5C 2W07B 4ZB0A 4QLJA 4F0MA 3RMJA 4UAOC 4ZXBD 3D87B 2X28A 3K2MC 5IW6A 3O3DB 3BKYL 3VGEA 5T5NG 4MCYB 2E7MA 4XXWA 1YYMH 3LKSB 5BZWA 4HPXA 4LLVB 4F91B 5AYYA 3CLMA 5JW3H 2FYMA 1AG1O 4GKNB 4OWGA 4YS4A 4FX6M 5FI8A 3B43A 4QAWA 2PXYB 2J72A 1KT2B 3WXVL 1R30A 2BINA 3QYMA 4ODXA 5I06A 5BV7B 1AZUA 1F2QA 1XIDA 1WT5C 4HKJA 3FFCA 4S1QL 1QVBA 1SOXA 5CP7B 4XP5L 3SPHA 4OUUA 4H20H 2XUWA 1W2KT 2JIWA 3KM2A 5JHLL 1IF2A 2HPTA 4PGDA 3WTXA 5JMRA 1U8KA 2PLTA 3MYJB 5JVLA 3GIVA 4P2YA 4HX1B 4HWUA 3H9HA 1MHCA 1OAJA 3D25B 3MRPB 4F20A 4DO5A 1I9CB 4W70A 2F2HA 1O7AA 4LVOC 4PJ5D 3Q43A 5GRXG 2XIIA 1FFQA 2J88A 1DXFA 4GQGA 4U4IA 1H51A 1YNLH 3VXGA 1J96A 1VGAA 3O3EB 2LGNA 2VDPH 4UNLA 4FB7A 1ZA3A 3QUXA 3G08B 4IGMA 4NT0A 1KFWA 2OWCA 4N02A 2AVGA 2X8RA 3J8F7 4XAGA 4NASA 4YK4B 3JTSB 4R90L 2GZXA 1NJ9A 2IQ0A 4YDIH 2K7PA 1I9JH 1W31A 1QTPA 5DBTA 1YO4A 3BZ5A 4YNGA 4P46B 3I6RA 3BD3A 1LEKB 3FKRA 1CECA 4KJPC 4P2QD 2YA0A 4IKKA 4QF1A 5TDPB 3PWPD 3WLSA 4C60A 5I1GH 3TNMB 2XVBA 4YE4H 2XQYA 2Y85A 1MW3A 4E5XA 2OMNA 4XBGB 4Y2OA 1T22A 3EX3A 1Q6RA 1S9WB 1EA9C 1G69A 1GZQB 3NFPB 2DKMA 1ECQA 3JS3A 5FYJU 1Y07A 3BH9B 4UB9A 3FFOA 1CB2A 3VE0A 1MAMH 5J0BA 2XA8L 1FVCA 3VWKC 5J3HC 2NR6C 3CHRA 5CM1A 1GT8A 5IOBA 3LNEA 1BZDA 4XPGH 1N8WA 4P9ML 3SJVD 1TG8A 4M19A 2WLLA 3HJEA 1A80A 4PE8A 1WD9A 2EEDA 4DO6A 4LIQE 1OAQH 2YXXA 3D05A 3U1PA 1PEZA 3CFDA 4QY8A 2ESVE 3K6SA 3WS3A 4KK9C 3KXFD 2YD1A 3DFNA 4KAQL 4WUKH 1JJUA 2O1AA 3IE9A 3A6BL 1FC2D 1DE5A 3PJNA 4GKOA 1X4YA 4I7WA 2X4NB 5I09A 1WICA 1MFMA 4NF7A 3Q48A 4TQ8A 4XHJC 4KKBC 3TV8A 3UXKA 3DUSA 3O2WH 3K2KA 4BH8A 1RIUH 4X7EC 3KHDA 4KVCH 1J1PH 3FQWB 3MYPA 5MERB 2DWSA 2AK4D 4U1SB 2WXOA 4LVNB 1AUSL 2DZAA 4BS0A 4XP6H 3NJIA 4FLOA 3JTTB 4M93C 4PUDA 1H0DA 1RZGB 3W82A 4G1KA 3O6ML 4XAFA 2UX6A 5I2IB 3G0XA 3EOUA 4KROB 4AL8L 3HHMA 1CD8A 1GVOA 4GE8A 4P2OD 4QXVA 4N20A 5DJXA 2WZTA 1E1EA 2VMEA 3BESR 1DJIA 3UPBA 1D5BB 3OYXA 3U0TA 2Y7QA 4CN6A 3BKCH 5D04C 3MJ9L 1LO5A 2KPWA 4JFED 4HF5H 4XHQA 3EWWA 3VH8G 5DYOB 3ZY7A 2FX9L 4BY3A 2R7EB 1WLHA 3SQLA 1PX4A 4D0DB 2X3BA 1ZLWH 3DNKA 1M56B 3UABA 2FX8L 4YLCA 4NT6B 1SFSA 2IF7A 4CCCA 4AXWA 1OTUD 2ENPA 3BW9B 3SCMD 4FI7A 4TUUA 4XCFH 2Z4GA 3Q06A 3GJFB 3P0GB 2QPUA 2OZ4A 3WENA 4MZIA 4XNYL 2CLHA 2X0WA 1X7QA 3LV5A 3KCLA 1MH5A 3EO9L 5F7WC 4TVCA 3RY6C 4FR6A 4D1JA 3EO0B 1XSKA 1KBBA 4TPRH 4KBPA 4BKTC 4LRIC 4KX8A 1XGDA 4JCLA 3ATAA 3C6SA 4CU8A 2R2EB 5LN8A 4XNAA 5BZDA 4TU1A 2G60L 1KPRB 2ZOXA 3ARWA 3QUZC 4PJ7E 1GGYA 4WI8A 3ULVD 1M9HA 1ZS2A 2VDOB 5H37G 4GRSA 3VWJC 3SGDH 4KDWA 1HN1A 1PPIA 2JKNA 2WYIA 3IJYA 3I3EA 3WHXA 1YCSA 4CSPA 1XLGA 4MJ6B 4NOBA 2IOMA 4UIKH 4M80A 1UR3M 1AP2B 2R1WA 3ZHFA 3VQ2C 3B0YA 5LKNA 2X3CA 3VD2A 1YXDA 1BXBA 4X5RA 3MGTB 2IS7A 2O61B 3BAEH 4JFXB 5EUOF 3VZYA 43CAA 1J9RA 2B0SH 3DH7A 1D6VH 1KW1A 5BCAA 1L8NA 4KRLB 3N1AA 1NGWA 2NY4B 2ESVB 5LA0A 2QJDA 3CVDA 5KBLA 3DENA 2E9MA 4QNWA 2XWRA 3CSFA 4J7RA 4Y4HA 4HZ6A 5LJYH 2VMJA 3ZE1F 4FK9A 3L3JA 4LRNH 1TIUA 6FABH 2KAUC 4FNSA 1VSCA 1WBZB 1A7OH 3KJ6H 3S2CA 3UR2A 1LD9B 5GZNA 1ZSXA 1VRXA 2AXFA 2SFPA 3NCBB 3D3VE 3CAFA 5KYXB 4L9LA 5DRWB 2X1WL 3FN0L 4RISL 2H4EA 2DUZA 1NBCA 3N1FC 2VDLB 1A5CA 1XG4A 4F0RA 4RQQB 4X4KA 4XVSH 2XU2A 1GA2A 4RZ5A 4K3JL 3KH3A 3HG1A 3P69A 4PB9L 5AC4A 5LXGH 3GR4A 4AYEC 1K4DB 3VXOB 3LB6D 4NY2A 3ZQXA 2IGTA 1AGBA 4FLHA 4G5AA 2X9XA 5FW6A 1P7TB 2V63A 5I3HA 2P8PA 2GI7A 3SYAA 2DUAA 3HLAA 2HVKA 3H26A 4QO1A 3DG7A 4H5SB 4KNTA 5DZAA 1GOKA 1L2QA 4FNLL 2PGFA 2EUWA 1LF1A 3ARGB 1D7DA 4FQXC 1VFHA 4X5XB 1OYBA 1FZKB 3VMPA 3GSXB 1BRLB 3RIKA 2VD9A 3AM8A 5C07D 4FQHA 4L4PA 2R0KL 4AV5A 3GTHA 3VXNB 2OKOA 4J6IA 3EWCA 2RBLA 4X4ZA 4LP4A 1XRVA 3OBAA 1T80A 4Z3HA 4TUOB 1CB4A 1R3IL 2VABB 3DUHA 3QQ9C 4JGNA 4TLTA 3L4WA 2F8IA 1J93A 1HESA 1RZIA 3EJRA 4HOMA 1FN4A 3ULSA 2HZGA 2AFNA 5GGUA 3BP5A 5L2KE 3OKNB 4X6BA 5HYQB 2JXMB 1XIGA 3N5AA 3G5ZB 4PJ7B 3IJ8A 3LN4B 4WUUE 3PJWA 1LBFA 4Z1PA 2Q8AL 4PB4A 2K70A 3PFQA 5F9DC 4JIHA 5L2JB 1KCWA 1S5TA 1BTCA 2W5PA 3RLUA 2YLHA 5FCZA 3MLUL 3NCWA 2H8PB 1E9QB 3COTA 1EZ2A 1CJYA 1GJWA 4L3FA 3FVDA 3C60C 4ZFMA 4R85A 4GA8A 4DGIL 2WBKA 3M43A 1FE8H 3P1VA 2R56L 4CJ0A 1QRKA 1U8NB 1KBGH 4FNRA 3RQ3A 4UIMA 2AQOA 2D7QA 3M5VA 2VZUA 3NMEA 2QVIA 4N8PA 4EWJA 4FR1A 5C3IA 3LN3A 3CWHA 3B6SB 4GGBA 1OAKL 3MRLB 3LRMA 3W01A 3FCGA 1UYWL 3WY2A 4G6AD 5TD4A 1O5XA 5T1MA 3B8UA 1TENA 4HPJA 4XAKE 3AXKA 5LUMA 3D3VB 1ZGLA 5DZNA 1YPZA 3UWVA 2NX5A 3LQAH 5GJMA 3SGUA 2PDKA 1F3WA 1JGLH 2ZSVB 2OSXA 3JWNC 4G8GE 3D39E 1Y8BA 1BQHG 1BXCA 2IH3B 3BKYH 3BT2L 1VFFA 1S5HA 4ZTEA 2H6OA 5DC4B 1IGCL 4K0OA 3SCSA 5IQMA 5KZCD 5D7JA 4MD5B 3OKEB 4C7FA 4H9MA 5FOJA 1TF4A 1JGIA 2X41A 4N9BA 1FNGB 3RPIB 3GB7A 1JUFB 3WXVH 3BPOC 4LNCA 3DPBA 4HUVB 4IUGA 4FABL 3NJXA 1PD6A 4X6EB 4L1DA 4LVEA 4UXDA 2EEFA 2NQCA 2XWXA 3RWGB 4R5EA 5JHLH 3EZ8A 5C0ND 4LUJA 3HHSB 3GVVA 1RQHA 1IWPA 2ZF9A 4IBWA 5I76A 2A1WL 3L21A 2AJ3B 1OLLA 4X5WB 3ILEA 4MZ1A 3EUUA 2I07B 1YN7B 5H37A 1JGVL 4GRWH 4AVJA 5JW4N 3HEIB 5H2ZA 2E7LA 1TIWA 4F4RA 4Q4RA 5JUEL 4NP4L 5CC5A 2RR3A 4MRBA 2WHVA 4I9XA 2G3XA 1NICA 3B3IA 3EX2A 3QAQA 1HUVA 4LLWA 2RFXA 2F7QA 4OOZA 1UD6A 1DL7L 2A9DA 3TO4A 4JPIA 4KKLC 3GJEA 2W91A 5L2KB 1B3OA 2BLEA 2GPZA 1PMYA 4WUUB 1KLFB 3EBGA 2VX4A 4Z78A 2GPTA 2P49B 2IANA 1KFGA 5EEYA 1Z7JA 4R90H 4FEMA 1ZSDB 3O6FD 3JUGA 3GMLA 4HWZA 1RPUA 2C4FU 3CYVA 3MCMA 3UJIL 2G5BA 4R6UA 3CHSA 5ACLA 1VLWA 2FKPA 4QHNA 4IGHA 3RPMA 5J06A 4B5SA 2DJ4A 2GG1A 5AYXA 1SPDA 3UFIA 2W88A 4EUPG 3A47A 4A37A 2QGHA 3RCMA 2LLLA 5DFAA 5TGBB 4O1FA 2P44B 5IB1A 2XPGB 2PYEE 1N67A 2RDXA 1NAMH 4RFEB 5GGSB 2GUBA 5IHBA 2Z7YA 1GKRA 1KMGA 2NW0A 1PGRB 3V4PA 3LIZH 3K3QA 1CWYA 1FORL 2QUVA 2M8XA 4UR7A 4I1NB 3RN6A 2BIMA 4K7FB 2PTVA 1W5NA 4M56A 3U9UB 5I71C 4H25B 4UZSA 4QAMB 4IRSB 1JMZA 4G3YH 2XA8H 3QUML 5BRZD 3Q2NA 4IMFA 4FRWA 4NC1E 2PS2A 4YSQA 5F7MC 1OY0A 1EXUB 1JRBA 3LNFA 3W88A 1AZZC 1FHGA 1B54A 5FO7A 5B1AB 1MVUB 5EGRA 1J9QA 3EGDB 3NEEA 4GRMA 4WOZA 4UINH 8A3HA 4MIMA 3GS0A 4G8GB 2YBRB 2C79A 5KSAB 2FFCA 4KCWA 3D39B 4GJTB 1DJQA 4ZTPL 1AE6H 4FG6D 4H83A 4KAQH 1RUAL 4RBPH 4YGVB 4NUMA 3A6BH 3CN4A 5BXFB 2XLLA 4F9PC 4HWBL 5FEPA 4UFLA 2PO6D 3CVHL 2CO4A 4O5LL 1I31A 3QEQA 3B9KD 4C6OA 3WO4C 4PR4A 5JIPA 4IMGA 2ICSA 2C16A 4PIBA 2Y22A 3QIWD 4PGBA 2QJNA 2FIRT 1YRRA 2E86A 3UBFA 4ENED 4HLJA 1EX1A 4XZUA 3FB7A 2B9AA 5CGQA 1WCGA 3V0SA 5AY7A 1FCCA 4IFRA 3PQYD 3QJFB 3O6MH 4IKJA 4LASL 3I02A 1PO9A 1AD9B 1DJYA 1SFHA 1TFVA 3TBTA 3BP7A 5E2TH 4P7OA 1OF2A 1DIDA 1WWWX 4JY4A 5E00B 2V5MA 2NY5L 2DSUA 1L9PA 2IKIA 3IRPX 2BCMA 3MJ9H 3R8HA 1E4KA 2CO1A 1NOWA 4G8AC 4JDTL 4U05A 3PBWA 3V6OC 3QHMA 1U8MB 1AD1A 3MMEA 43C9A 2FX9H 4UCGA 5C0IB 3GY1A 5DJDA 1SHWA 2QQ6A 2BVOA 1FL5A 4A7GA 4GISA 2XICA 3DBSA 2HFFA 3GLAA 2DI7A 4IP5A 1QPQA 1WA0X 1LQ0A 5GSRB 3TW6A 3TU9A 3HMCA 2BJMH 5F44A 2FJUB 4HK3N 4HCHA 1NKRA 5LB1A 1VEOA 1UPPA 3XIMA 3NQDA 2MCPL 2NXYD 3CDYA 3OODA 5GS1A 3EO9H 4TTUA 4U1JA 1WXJA 3NAVA 2ITEA 2ZUQB 3JXAA 1FZJA 3QXAB 1TMHA 1XF3B 2DT1A 2ACUA 3P4MB 3KXQA 4JY8A 4QHUA 2PYEB 1F07A 1ZY9A 2G60H 4UT7L 3D2UD 2JKWA 1OCWH 4V11A 2ARWA 3EYUL 3NACL 2H3NB 1UCBL 5CJNA 2WZ6A 2CPCA 5AC7A 1A4JA 1A9BA 2Z6FA 3SQSA 3BFQG 1QI4A 1BQHA 4OAWA 3O4LE 5I8OH 4UBDC 5I8CB 4PP1C 3MKGA 3FQYA 3RBSA 3AIEA 2VMDA 3WIHL 3DN5A 1I1WA 4RDZA 4PRAA 1AIZA 4QE5A 2KQNA 2W79A 2X05A 3RMEA 1CI5A 3OHXC 5JXED 1WFTA 2OX5B 4OZFH 2VN5A 2X70B 3L4XA 1OE3A 4NN7C 1EDHA 1TVLA 1GHFH 1RUSA 3OQ3B 1UQSB 4BUQA 1CL7L 2WBJC 3QO0A 3NQ8A 1KELL 3TYFB 2OXHA 2OELA 3QFJD 4WKFA 4BZ2A 3T4YB 1HP4A 3BAYA 3S37L 3BMVA 3BZEB 2EH7L 5GZOC 1O66A 5IW1A 4KK6C 3P77B 4OU1A 5E5LA 2Z91B 3WKZA 1ZHAA 4MDPA 1A4KB 5ESVA 1TRIA 5FYJL 5CPMA 5FK9B 2FZMA 4RISH 3EYSL 3RG1C 4XMLL 5DD3H 3FQNB 5BS0D 2A83A 3REVA 1AHKA 2R82A 3P2VA 3RR4A 3TZVB 5DUMH 1BVNP 4PJ7F 3MHZA 5BOEA 5MEND 5AAWC 2MQCA 1EGVA 4AWSA 3ZZLA 3V3WA 4K3JH 1ZT7A 2J7GA 1VJZA 1SEBA 1GC1L 5LGHL 4PB9H 2OYPA 3QQ9D 4RAHA 3VTRA 5K3VA 3HJ0A 3EPMA 4EXQA 2AOSA 3SCUA 2VR2A 1DV7A 4ERSL 3TIEA 4KFOA 3BJLA 2A3CA 4BQBA 5I0XA 4FQQA 1W6WA 1LQSR 2E0PA 1G9HA 4LJ3A 1PTAA 1KNOA 4IPNB 5H1WA 4FNLH 2WZIA 2XKUA 4IBVA 4UQ9A 1Z9SA 1K85A 4BSVA 4KDVA 2XJ7A 1BA9A 3LLFA 4W84A 2YN3A 2CR3A 3HNSL 3BGMA 4GG6E 2C3VA 1WTLA 4Y7OC 2WCAA 4JQ4A 2BP0A 4ZX4A 1JGMA 1BOGB 2Z0IA 1MZRA 1T20B 3RAOA 3FU6A 3R0MA 1OT1A 5IKCB 1I3GL 1D9KA 2XDFA 4GNKB 4HQVA 2FX7L 1K8YA 4FFVD 1LDSA 2GVLA 3B3BA 1QSFD 3EGSB 1REIA 1A6UL 3GPSA 3QORB 4ZZ9A 1IBGL 4GS7B 3RVXD 3FTVA 1NOLA 3EZJB 3O6YX 3D69B 3DX7B 3OYZA 3ZDYE 3T3ME 4LBRA 4AF0B 4UQ2A 3VIJA 2IEPA 3W70A 4WFGD 3FA4A 1RZ8B 3HG0A 2F9BT 1RK0B 2NXZB 3ZTJG 2WXDM 3GRWL 5IDIA 4HIIB 2H6PA 1IM3B 4B9IA 5JW3L 5EU3A 2NW3A 3MRCA 3DURA 1L0YA 2Z2AA 3O4LB 5IFTA 4HBQA 3DAQA 4ZYKB 4M1CC 3P93A 4FIQA 5I66A 3D18A 4GRLD 4RFNB 2ZRUA 3AB0B 4UWMA 1CN4A 1UG6A 5FM5M 5EG6C 2PMQA 5DTFB 3RWHB 2KERA 3WF4A 1LWJA 3G3DA 2DQMA 1R2TA 4MVAA 4DGIH 3GTVA 2R56H 4WK9A 3RVWC 1BV8A 4JVWA 1PZ0A 4F37K 3H2AA 4X4MA 5I17B 1R3RA 2NUPB 3W7GA 4NQCD 2W65B 4WO4A 1HW6A 4ZXBC 2ZZUT 2DDXA 1OAKH 1Q72L 4ZW7A 4Z76B 3AS2A 5LNSA 1KPUB 3BMXA 3V10A 3OGVA 4ZENA 4MX7A 1B4KA 3MR9A 4MY8A 1YNLL 3UNTA 1JF5A 1R6VA 5CF3A 4DBUA 1TR1A 4YBQD 1F8IA 2VC9A 1NBVH 5H2BB 2X38A 3L65A 3LRGA 1HF6A 1L9OA 4M4PA 4U1IB 2APBA 1QTSA 1L0QA 2BZ7A 1V03A 1E15A 1IEAA 5DHDA 2VZTA 5HGBB 1U93B 4F5CA 4PS3A 5FHAH 5ELIA 3CEUA 4YR6A 3KYNB 5A2CA 3AIWA 1P6WA 1IGCH 3VI4A 4HK7A 2R39A 5IB5A 2QSQA 3SY1A 2BOFX 4YQXL 3PDGA 5FM5O 4A8LA 4MJ4A 4YSRA 4OI7A 5I1GL 1FGNL 4KKLD 1F4AA 4XSLA 2WHLA 4FABH 1TZ8A 4YE4L 1C5CH 3TH3T 3FTGA 1FHVA 4KX7A 2G5WA 4WW2B 1B9BA 3VO0A 4L4MA 4GG6B 1UP3A 1NDYA 1FNEA 3HRZA 2D7MA 5JYMA 3RLVA 4I13B 2BERA 4JVPA 4XX1E 2A1WH 4N6FA 2O9PA 1MAML 4X6CE 2VYRE 2BNQD 4QRQA 2J7BA 4DXXA 3NSFA 4NZ3A 4XPGL 5JUEH 4WNSA 3CASA 4U7SA 4ZDHA 4J3UA 4AZ5A 3V0DA 1S2VA 4BXVA 3MUJA 1FH2A 3IFOB 3SKMA 4HNCA 5D5MF 3L4TA 4YE0A 3T3MB 3VG9B 2BOCA 4BV1A 1HIZA 4NZUL 4M6PA 1R5WB 3NJJA 5M94B 5E0FA 1T7XA 5ESQB 4PFEA 3H2NA 1GPWA 2JI2A 3PBYA 2K3TA 5LBSA 3S8HA 1FZOB 4GUGA 2OBGA 4LHUD 4BKLB 4HCRA 1BZQK 3DKHA 4FA7B 5AW9B 3O2WL 3HBPA 3UJIH 5C54A 1E5YA 4V2BA 1RIUL 1MCIA 4GEIA 1A4BA 3FQTB 4TQEH 3CZ8A 2ALDA 3TURA 4XP6L 2ZAGA 1S9KC 5HJ3A 1T0OA 3FJLA 2X2HA 1RPQA 2V67A 3DHJA 4WO0A 1C9WA 4ALDA 3T8QA 3RUGA 4W87A 3U2EA 3F58L 5L4IA 4LBEA 4D8OA 3NZ8B 1J88A 5AYUH 1MFAL 3T78A 1FORH 1C91A 1XBRA 4ZSOA 2AAMA 3EB4A 2R15A 5ECGA 1A21A 2WWOA 3F4CA 2O5ZL 1UUQA 3WE6A 1XF4A 4Q7NA 3LX9A 3SDDD 1UKQA 3UTTE 3IWPA 1O5QA 3KPRE 4YNYA 8FABA 3SDCB 5CEZE 3NVDA 4IS6A 2OXNA 5E03A 3TEWA 4NXKA 3QC5X 4Z42C 2YL6A 4LYPA 3TEUA 4GI8A 1J6OA 5L9FA 4DEFA 3MREA 5HHNA 1KM0A 8CGTA 4Q3MA 4RBPK 4UANA 5I8EB 2UZIL 3IAQA 1PX8A 4WWID 3WIFB 5D9SA 4ZTPH 4HWNA 1MW0A 5KS9E 5JW4Q 5HQLA 1VF5C 2AV7A 4K3EL 3CFJB 5IHLB 4HWBH 5BVJA 3CVHH 1TV2A 4GH1A 3MRHA 3VWKA 4GW5A 3NCYP 2NR6A 3AVEA 5K1VA 3PBUA 3VNYA 2OP4L 3W0KA 3GS7A 3G5EA 2QDVA 5EY5A 3KPMA 4YCOA 5E8EA 1EOKA 3WFBH 1M7IB 5IOPA 3ELAT 1RUKL 4LASH 4OJCA 5AVVB 4BFEA 3X3GL 4FLSA 2YWYA 3QC3A 2R0WL 3BPNB 5D4IA 3OXRB 1DO6A 2P5WE 2V30A 1OTUC 4AZCB 2EDNA 4AB4A 3DSFL 3SCMC 1F18A 4YO0A 4HPYH 1G4SA 2NY5H 4X6CB 3MNMA 5GGTL 4HBCL 4OCSL 1RLDA 3G6JE 5C09D 1OP9A 1PZ5B 4GXWA 4ONFL 3C12A 3BAEL 4JDTH 3QULA 2VX6A 4PTNA 5KBKA 3PPEA 1CD0A 1D6VL 5DURD 5TIMA 5I07A 5B1JC 2K6ZA 3V0EA 4A22A 3UPMA 4XNQA 3LM3A 5CZTA 4QNEA 1BFTA 4N90E 4FCAA 3ZYIA 2MIZA 2J73A 4A63A 3VQ1C 4Y6GA 1CYWA 4O4WA 4UNTA 5E1AB 1EVUA 4ZXOA 1JWUA 5E6SB 3ULVC 4MS8D 3CFBA 3KVMA 2GJ6D 6FABL 2MCPH 4FG2A 1A7OL 3QA3A 1MCLA 4AD2A 1U3HB 3LYRA 3WN5B 3VJ6A 1NP0A 5D4JA 2R1NA 1HJQA 1MEWA 5A69A 4CVZA 1IQDB 4X4XA 1K1DA 5I9QC 2TSAA 1YNKL 3LCHA 4X63A 2F18A 3JWNG 2GGGA 4MYPA 1RD6A 3UZQA 4CSSA 3LJ3A 1NDVA 1MCJA 3M1OA 4GHRA 3VIGA 4UT7H 4P49A 1EGJA 1ZV2A 3MU7A 3EYUH 1CYXA 4JCMA 5LXGL 5HQEA 1UCBH 2VC7A 5ECUA 4HNLA 4JG0L 4KWVA 1F6PA 1V6YA 1N68A 1TQWA 3U6RB 4MNHB 4WI0B 2ARJQ 4MKSA 1JJKA 4O57A 3HE7A 3IDYC 4UV4L 3UTTB 1QOKA 2DIJA 3KPRB 2ESCA 5LQBL 1GZPA 1R3JB 3RTQB 3HU7A 4X7SL 2HJLA 2GAZB 3QQ3A 2X16A 3NPSC 2YDRA 4K7PH 3KLDA 1Q5MA 1E9PA 3V35A 1O0VA 3ZJ8A 1OG6A 3V5FA 1JZ8A 3UWEA 3ITTA 3QUZA 1E6SM 3FHAA 1O5KA 1AQHA 1KB5B 1R8LA 2Z28A 3IBEA 1N2RB 2APSA 2EDTA 1KELH 3DHPA 4I5UA 3VWJA 5KS9B 3ROLA 1KXHA 3S5SA 4LX4A 3S37H 3STCA 5AC8A 4EN3B 5TBOA 3I85A 4RNIA 1AS6A 2EH7H 3LB6C 5EC1B 5AB2A 2G2RB 4BF5A 5IV2A 4OF3A 4HEPA 5A7EA 5JTWA 1J5TA 4YLBA 2KQMA 1QPKA 4OJYA 1T7VA 3EYSH 4CC0A 2UUDH 4JKMA 1INDH 4XMLH 5A2IH 3ARFB 2CCLA 2NNXA 4JM2F 5HHOD 3KWTA 3L1FA 3B2PA 3VOFA 1CZ8L 2QCDA 1B0RA 1EDQA 1GC1H 4K38A 5LGHH 3D85D 4O28A 2P5WB 1MI5D 3GNPA 2HS8A 2E5EA 2QPDB 3HZKA 3IK4A 1DBKH 3U2CA 3HZYB 3EBVA 3G6JB 3PAVA 3QZPA 4ERSH 3L7EB 2Z26A 2FEEL 2EDFA 2ZYSA 1GTFA 4GPNA 4X7FC 2VZVA 3AC0A 4UYPA 2Y6ZA 3OGRA 1BZ7B 3WHE0 3W00A 4O2CB 4WY0B 4JRWA 5B8CB 2XJLA 2KZWA 2VRKA 3UEQA 1NQ6A 4P8VA 3ZS4A 3HNSH 4OF8A 1JIBA 2J2ZA 5FSDC 3GRIA 3EYFA 1AQ0A 3BSGA 2K78A 4GABA 3UDWC 1QA9B 3MUXA 3O3UN 3O15A 1I3GH 3ESNA 1P6FA 4HN4A 2FUTA 1FH7A 3N91A 2BP5M 5KZDA 3CZFB 5DU7A 4YOKA 2JWYA 3MX0A 3IJEA 5FHBL 1G9MC 5IFJB 5A2AA 4KGLA 4PD4K 2XUCA 2A5UA 4GX9A 1U2HA 3PUOA 5EF3A 7ODCA 4NQEA 1A6UH 2OTPA 5U7SA 1IBGH 5HPOA 3IFPA 1JGLL 5FW8A 3GTXA 2OW7A 3W26A 4EWND 3SHSA 2J8TA 4K15A 1YEEL 5CGTA 3UBPC 4UFJA 3A6OA 1TUFA 1XRSA 4FQXA 3T9PA 4NAJA 4EVZA 3KCPB 2A3HA 9CGTA 1CDHA 3GRWH 4WJG3 5JIDA 1SYTA 5H6HA 1JNDA 4DM1A 1S39A 2XJKA 4W5UA 3FQUB 5CBBA 5K9OB 2Z0UA 5I75C 1QUPA 3Q8BA 1JPST 2OMWB 1LLOA 4AYFB 3VUPA 2PP0A 1EXHA 12E8L 2WXGA 4EEEA 4G6AC 5CD5D 3PTDA 5I1KH 3TR2A 1IGSA 4MXQD 3GDRA 3KBVA 3R8BB 1US0A 4Q7BA 5K2ZA 3QV7A 4GG6F 3US9A 2W92A 1CCZA 2WTRA 4K73A 3N0PB 4NKDB 1R3KA 4LYKA 5F97E 3KW8A 1O7SA 1OZMA 3ET9F 1A3WA 3GSOA 3KG5A 1DBTA 2DQIL 2H9AB 5LKYA 1KA9F 1SN0A 3C09B 3EG9A 3IFNL 1KTJA 1Q72H 2PCXA 3GC3A 3BVNB 1QEWB 2F8XC 4BA0A 3UZZA 1DWGM 3BPWA 5BO1L 3FPYA 2G8ZA 4LRSA 2Q8LA 2X9WA 1PDKB 4N2IA 5DC2A 3ZYJA 2GSMB 3WQ8A 4QXWA 3H85A 3DV4A 2P43B 5LDUA 3MNZB 3ZDYF 5B39A 3AXXA 1NCCL 5C0CE 3T3MF 4QXIA 3BQUA 4UT6A 3C60A 4R5XA 3Q6GL 2XV6B 4IBQA 3IKKA 3S37X 2J6EL 1PFCA 3E9UA 4R27A 4ZPTA 2OFQA 3GLDA 1HEZA 1BWKA 4N28A 4TTGA 5JQHC 3AXHA 4Z7WA 5C0NC 5KYUA 1EJFA 4AY1A 1WZAA 5J5RA 4HTBA 2PSNA 4PA8A 4YQXH 3WD4A 4YZFE 4V1DE 3SPVA 5DO8A 3CQJA 4CD6A 3AJXA 2C7UB 1FGNH 4PV8A 2FK9A 3HUJF 3EJJX 1OV8A 4XBEH 3N2MA 2UV8G 4GKTA 1NAML 2WKOA 1LLWA 1S7WA 3WNKA 2HA1A 4J3OD 1XIBA 1P1ZA 3LEXB 4O50A 3QBUA 1F3JB 3LAFA 4NI3A 3LIZL 1KIUA 3FUJA 1NDTA 3GMQB 4L1BA 4RDQF 1IXPA 5JDSA 4LUSB 1WAAE 3HPJA 3T8VA 4G3YL 2B4CC 1AY1H 3MO1B 1R3LB 1SUJA 3O6FC 3KBMA 1ZV5A 3M1BB 5CLWA 5I3FA 2AQPA 3P74A 2YPKB 1SFDA 5TQ0L 3L3GB 4UINL 5DT1L 4DP1X 1A4LA 4IIBA 3TYCA 3GSNA 1W0VA 4Q8BA 3NJLA 4LKXB 1AE6L 1LO4L 1RK7A 1Z66A 3QQXA 4NZUH 4MMYB 3GDBA 1XGQB 1AH3A 4BE5A 3BX7C 3MV9E 3ERPA 3T55A 3GMOA 4YSTA 3KPNB 2WZAA 3WOVA 1RJYB 3IUDA 4NRRA 1WUFA 4PJGE 3EOAA 3Q37A 1ZE3C 4XZ9A 5ICZB 3RE0A 4M6VA 3P9WB 5CZRA 1MJJA 2O9OA 1YNTF 3WAKA 1S7QB 4AEIH 1DFBL 2OI9B 4FOJA 4YTUA 1IT8A 2PBOA 3BWUC 3BDBA 3TFBA 1AW2A 4YHYC 1TPH1 2R1XA 4NKOB 2IWEA 1XINA 2CLZA 3F58H 3QIUB 4GIOA 2C6QA 1F61A 2AKMA 3WXWH 1OWWA 1N7MH 4FHKA 2DZSA 1MFAH 1IWBA 2D22A 2DM2A 5CSGA 5KEZA 3OAUL 5E2TL 2XFWA 4K36A 3W39B 4F92B 4R0LC 1FVEA 1FFTB 4X6CF 1M53A 4R97B 4FG6C 4K3GA 3GFZA 3SURA 1M2OA 1BEYL 2O5ZH 3HTWA 2TRYA 1LORA 2FO8A 4KV5E 4FXGC 2CH8A 1E4XI 2R29H 2HXAA 2KLRA 2PO6C 1V93A 2C9VA 2UY6A 5T8IA 2F6KA 3B9KC 4FS0A 1TX2A 3V7MA 1KBLA 2H47C 1NCBH 1JF6A 5JA8B 3TP4A 5C0CB 3LKPA 3QIWC 1U3JA 4H9UA 1SW0A 2BJML 4ENEC 1JK8B 3GXNA 2UZIH 2DWXA 4GZEA 3H3PH 3LRLA 2ZA1A 1YPIA 4ZUTA 3EKZA 4C4KT 2D2GA 4Z0JA 4B9KC 2H0FA 4XB7A 5AYBA 4K3EH 1IWAA 4UQ3A 1DTNA 1WTGT 3W9EB 3FRUA 1QNQA 5KVFE 4V1DB 4EXPX 2A6IB 1Y0EA 3SKOA 2V5RA 2OP4H 3KDMA 5JQIB 5IESL 3VKCA 3DROB 3B9OA 4JN8A 2XIJA 4Y4FD 1KTRL 1XMEB 1FP8A 2Q7AA 4P5TD 5FO8A 3RM9A 1OCWL 2XZQL 3DOHA 4HU8A 3L2LA 3ZL2A 2ZP0T 4KWSA 1RUKH 2DW5A 5EPMB 1ICTA 3X3GH 3RKPA 2R0WH 4M8RA 3DSFH 4NAEA 5I8OL 1IB5A 4XBKA 3WEXA 5GGTH 5IBUB 4HBCH 4OCSH 2IWKA 2CJTA 4F9PA 3TBBA 4ONFH 4C6KA 3MV8D 2NXYC 2YQGA 3B0VC 3RIAF 2OQYA 5ABTA 1KBJA 4FA6A 4LLUB 5MEPB 2YSWA 1SRDA 2J79A 1T03L 3B2MA 1X38A 3VFSB 1HGWA 4GMSL 3VRIA 3EO1A 1GHFL 4BYHA 4URKA 1FCQA 1CLYH 5G1YA 4ZNEA 5DK0B 1OIMA 4C56B 1ZJAA 3KS5A 1LWHA 4OY9A 3MV9B 5CHNB 2HN7A 5D1QE 5M95B 4PJGB 4L4LA 3STLA 3F2CA 5JHMA 2G9HA 2O6CA 2XY1A 3BG5A 4DYKA 3D4GA 4ZE4A 3QXDA 3ANYA 4LCCB 4OFVA 1HWGB 2A9AA 1YNKH 3PV6B 1C8VA 3GW0A 2FGLA 1KEMH 5DD3L 1GY1A 5DUML 1OE1A 2VIRA 1J0HA 3DWTA 3H0TA 4H4NA 5EV7A 3UWUA 2D1ZA 3MP4A 1A3HA 5JXEC 4AIOA 4HS3A 3OKYA 1PVNA 2CD0A 1KV5A 2OXGA 3NSXA 4PGEB 3UXDA 5KSUA 2CAKA 4HETA 4JG0H 4G1EB 4C4BA 1B2WL 4L05A 1M7UA 2OTUA 1ME9A 5JYLA 3VE7A 3G6JF 3U0PA 3JW7A 3DBXB 2BODX 3KHOA 4UV4H 1E8YA 2OLSA 4GYFA 2DW6A 4WKZB 3C2FA 2BY0A 1LP6A 2Y0SA 5LQBH 4PMJA 2A6KB 3MANA 4X7SH 1AQFA 1GYAA 4U5IA 5EF1A 4JFDD 2YPVH 4WY0F 1DORA 1S7UB 1S9VA 4ZAKD 1JPGA 3GHSA 4KJQD 2JLPA 4AISA 3EHBB 1UKPA 4GW4A 1X5KA 3CTLA 1IEVA 3QV9A 1TDQA 3EKCA 1IGJB 4MUZA 3ZIZA 3T7VA 1YTKA 5D6DC 3LTSA 4PL2A 3WGVB 2VITA 4PTTA 5D7IA 4PV9A 4OD2A 2G0WA 1A7NL 3ECVA 3UWQA 2QKFA 2O5YL 3HAEH 3R7RA 4AY0A 2NT1A 1U8CA 1CFSA 4JO5A 4Y5VB 1IFHL 2YMTA 2JTYA 4HSHA 5KG9B 2UUDK 1KO0A 5A7BA 2F84A 1MCSA 1PV8A 1LOSA 1P6BA 4X7DC 1QBAA 3FO2A 4Q4SA 4FI6A 3N2JA 3NA4A 1G7JA 3O8AA 3CNKA 1CZ8H 3HR5B 4RRPM 1HKWA 1VS1A 3GQFA 5DSCA 4Q4EA 2WBJA 3X14B 4WUIA 1AR1B 5HTSA 1FFNB 3WFHB 2DU2A 1AGDB 3TAOA 2IALB 3NJMA 4HC1A 2ATKA 5HDBE 1MCWM 4ZOBA 2NZIA 1KIRB 2GSIA 5PAZA 5I6NA 4Z1BA 5GZOA 4HUCA 3QOKA 1KB3A 4FFVC 1JPEA 1BVLB 3D4ZA 4EKXA 3GQYA 4GIRA 1X5FA 4H4IA 2VWEE 1J8RA 3QJXA 1WBXA 3RVXC 1GG0A 1HILA 3O9WC 1TWIA 4PJIA 3VNZA 3EOBB 5AAWA 2VNCA 3KHJA 3U46B 2XINA 2EAWA 3ABKB 3ILQD 4GQQA 2WP3O 2O5XL 3R8RA 5C0BD 3VFWA 1TYEB 3QT2A 3KL5A 5D2NE 3OA3A 3DZ1A 5D1QB 4XTDA 3IVKB 1HHKA 5DI8A 1FYTE 3QMRA 4DVOA 3IRZA 3GU2A 3UPRA 5FHBH 4U28A 2QKIB 4ETQB 5D70H 1TG7A 2V3DA 1IVLA 3MRRA 5C7VA 1T1YB 3VH8A 1NBVL 3UG8A 2X9ZA 2CWNA 2XG9A 4UU9B 1KPVA 2VL5B 4ZMVA 1X5IA 1QSEA 5C3LD 4GRLC 1XYMA 1YEEH 4CQCA 3VXRE 4NDMA 4AYBA 2QF8A 4ANWA 3JYCA 4WI5A 5DRCA 4NQVB 1I1XA 4WDUA 2OEMA 5F89B 3K1DA 3ML9A 5FHAL 4J1UA 1HFBA 2PNDA 3WUFA 5IJDC 3BIKA 1WFIA 2FUQA 4HK3J 2AF2A 1W3TA 1AVAA 3L8QA 3GYCA 1Q6GA 1ZFJA 2B81A 2CIIA 1M1BA 12E8H 1NCJA 4WSGA 1L6SA 2HX7A 1C5CL 5TDNB 5HVFB 5SX4I 2RJMA 3CXHK 4YBQC 4FXKB 2EDOA 5E2VL 3PZ9A 4ZOCA 3BZGA 5HHPB 4LUYA 1JRHL 3QP3A 4M5PA 3JV0A 2N0MA 2J47A 3VXTB 3QUKA 4P5KB 1OBAA 4PY7A 3P9MA 3QQ0A 2DQIH 5H8UA 1FXQA 2P8LB 2N0KA 3SRFA 4Z77B 3IFNH 1J9CT 1E6ZA 4OF5A 4WI4A 2AK1H 3AIVA 4YSEA 1H09A 4QX4A 5GVJA 5BO1H 3UA4A 1EJ6A 1Q8JA 2PUZA 1RALA 5ISZD 5GGRY 6REQB 4CVXA 5F7LB 4IPIA 4FKEA 1NCCH 2I5IA 3NZHH 2RUSA 1W0WB 3NQCA 3Q6GH 4ZPVB 2J6EH 2REQA 1S3KH 1OIOA 2E56A 5L8KB 1I7UA 1O5PA 1GW6A 3LTVA 3PP7A 2NLJA 4O13A 2FL5A 2EG8A 2OODA 3NCCB 4PULA 5A2KH 1XISA 2G4FA 4JMXA 1I9IH 2GDVA 2NVCA 3FUDA 1MWOA 3AJ7A 1FHLA 4ZXBA 1DCEA 2BC4A 3QCTL 3VD4A 5HDBB 5ABZA 3RWIA 2P28B 3BZ4B 2WGXA 4TNGA 1IAIM 3O0LA 3PG2A 4TQEL 4MA1C 9XIAA 1M1SA 3BYYA 1BMZA 3OKLB 1QLEL 2UYLA 3SCPA 3BW3A 4YVPA 2BS71 4MA3B 3FH8A 4Q97A 2F0CA 4S1DD 4PMFA 1KFCA 5AYUL 1DLFL 4DP6X 1OX6A 1U21A 3HC0A 4PBWD 5FAAA 4N1HB 2ZWNA 2VEKA 3SSJA 2VDNL 2RJHA 4ODTL 1TSRA 1Q9KA 4TQPA 1KJ2L 1BGAA 5D2NB 1S1RA 3H2PA 1HJCA 3PZUA 4KNUA 1FYTB 2DKSA 1VYPX 3RGHA 2BLFA 3WD5L 3L3OB 3JZUA 4B2DD 1JPDX 3VXQB 1THAA 2PLKA 3EXSA 3ES7A 5TQ0H 3INPA 2DDQL 4PJXE 5DT1H 3N9RA 1PW3A 4AMAA 4PJ5A 5D02A 1U95A 2FPYA 4XCCL 3F7RA 4WWOA 3CUHA 2EYRB 5CZKA 3VXRB 2CCRA 4DKFH 1M6JA 4I5RA 1LO4H 1HXYA 3R19A 2KX9A 4IIDA 4HN8A 1VIWA 1H6EA 4LLQA 1M05A 3GIPA 1BYBA 1J0KA 3QG6A 4B95C 3VDGA 4LE8A 3FL7A 3ESOA 3WKYA 1XB6A 4YZFF 5G4MA 5HDOA 1DFBH 4L4OA 2ZWSA 4OSUH 4ZA0A 4QRPE 1KLUB 3SDDC 3EOEA 2HMID 3G5XB 2WKJA 5HOSA 1URLA 1S2EA 4PBXA 3WFBL 4P2QA 4XNUL 3PWPA 4K7PY 5IG7A 1RJQA 2DYPD 2WINA 1XIEA 1HKIA 3LMYA 3EJUA 1PUDA 1J8HD 5RUBA 1SF5A 4C5YA 3OAUH 1V10A 2QZQA 4HPYL 2V7HB 2A77H 3ZTNL 4I90A 5ITFB 1A25A 3QI9D 2BVQA 2H8ZA 1TA3A 3DIDA 1BEYH 5KVDE 5B80A 3VGBA 5AKVA 2CLPA 3SD2A 3H4HA 4AC2A 5ETUB 1T8XA 2XG5B 2XXGA 3F64A 2XH4A 1AODA 5E0CA 5CJ8A 1FL3B 3FOLB 1OGGA 5IMLA 2ED8A 5ABGA 3AQYA 2EPLX 4BZ1L 4E8GA 1RCOB 2QCHA 3SJVA 5C0JB 3UAJA 1LEIB 1S5MA 2DEYX 2WNKA 5GPRA 3V2AR 3PAYA 1PHWA 5HDLA 2EDDA 1RJRA 3AMCA 1OM3L 3QZWB 5CZJA 1SJCA 1U91A 2XG4B 3SKNB 1AXSB 2QHRL 4PJGF 4ZL1A 3KXFA 1DP0A 3P73B 8XIMA 3MXWH 3MQTA 1BQRA 3VIKA 5AB1A 2ZX6A 4JY6A 4OM1L 3U7AA 4QTHA 2QDDA 4QRFA 4C6PA 5DGQA 2V2DA 3LN9A 4GZJA 4JQXC 5IESH 3OJMB 2X0HA 1W6LA 1QKZL 5G2IA 4D9RD 2NVAA 2XX1A 1SMAA 1BXUA 1IXNA 1VBGA 2XZQH 5K7JA 1WDRA 3KWXA 4HUWB 4RAUA 4NZCA 5FF0A 2INZA 1GVQA 4ZW8A 4PJCE 5E99L 3DGGA 2OMYB 3E6HA 1CGTA 2JSFA 2JLLA 3C8KA 3U4AA 3SADA 4MZ2A 4JTJA 3L3KA 5HI5D 2XVPA 3R5EA 1TX0A 4BH7A 4P2OA 4KV5F 4MS8C 3S1GA 3CAVA 4UDUB 1B0GA 4IGBB 1VKXB 1R9YA 4YC2B 1FG2A 3P8JA 2BSTA 3IMUA 4JFEA 3D0VB 1T03H 1T83C 1DN0B 4K7PL 4JNZA 4PJXB 4GMSH 3DKJA 3LLXA 3B5HA 1D2OA 1W9DM 2XT1B 1QPPA 4QKTA 1YUHA 4AVNA 1FF5A 4ISVB 4JAMA 1OCOB 3LHWA 3KUMA 4UMBA 1V7YA 3P0VH 3O2VL 4LKCB 3EADA 4GT7A 3SCMA 4APXB 5JDJA 5F72S 3MVTA 4P23D 1CICC 4IU3B 2WLKA 2BP8A 4AHOA 1R3WA 3U6WA 3D5OF 1NVMA 5JU6A 4QRPB 1INDL 2YARA 4KMQA 4P57A 3GZOA 2XZCL 3PUGA 3ICJA 2JELL 5KBDA 1UD5A 2MCG1 1WC7B 3A22A 3VXUD 4KY1L 2FMNA 5AHMA 3BCDA 5T91A 1JPIA 2V9UA 3QDHA 2JE8A 3HC3L 5EU4A 2P5ED 2B77A 2UZXB 1DBKL 1B2WH 1NCIA 3L68A 3BAKA 5FYLL 4DXKA 4AH2B 2HNEA 1S5NA 5HJXA 4KK8D 2A6LA 1G9NL 3VFPB 1SO6A 4LV9A 1WA1X 1MY5A 3IU3A 4HG4K