4DO4A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
387
structure length
387
Chain Sequence
b'LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 130
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do4A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do4A01
1LORA 1PIFA 1O4UA 1EWDA 5DO8A 1OX6A 1ZALA 3WK3A 2RKXA 4KWWA 1CW2A 1TQTA 5AN7A 2PWGA 1Z44A 1GYLA 4WX2A 2FHCA 4JTFA 4LW7A 3PBWA 5K3VA 2VKZG 5A2BA 3FJLA 3NPUA 4U33A 3QQ1A 3TAKA 2XFWA 3T7VA 3TOPA 3SY5A 1GQNA 3W23A 2GJRA 4WF7A 4EF8A 3TMLA 2GPTA 2OT1A 3K30A 3G3DA 2Y89A 4O0KA 3KVLA 1MXDA 1F73A 3OIXA 2ZXAA 1F7BA 3UG4A 1XDMA 1C8QA 2VXNA 1PAMA 4CKQA 2WSRA 2E6DA 3S5OA 5LNRA 3UXDA 2I1OA 3KVJA 2ZICA 3O16A 2QJGA 3L65A 3EDDA 3PBVA 1MSSA 4IJBA 4JTIA 3W38A 3H54A 2EJ1A 4DBDA 3W7JA 2CWNA 3VU2A 3HZ3A 5I0DA 1UD2A 5D2WA 4ZQMA 1ZHAA 3AO0A 1ICSA 1JRCA 3CEPA 5D2YA 3B04A 3G0SA 1W37A 1FCQA 3ECQA 2XVKA 3GB6A 1KBBA 2FH6A 4GBUA 2ABAA 5CPOA 2X1TA 4LXFA 2H3BA 2NXHA 1LLWA 3GXPA 3BLPX 1GWJA 4C1KA 3L0NA 1H7NA 1LRTA 3DHPA 1ZY9A 5C2XA 1M53A 2H90A 1KFJA 4LS1A 1MEHA 2FHFA 1ME7A 2QF7A 4EVZA 1KM4A 1V3KA 4FXSA 4GE8A 5A2CA 2OYMA 4QNWA 3W84A 5TQLA 3BLIA 3S9YA 4Y90A 5D05A 4N6FA 2XVGA 4NU7A 3F4NA 1BWLA 1CXEA 1PPIA 2Q3RA 2TRSA 3LHYA 4UTWA 1I4NA 1XBVA 1Q6QA 1F2JA 3LXCA 3W7LA 3CZNA 5EL1A 3L4WA 1SO4A 3FW6A 2BXZA 1JVNA 1KFLA 2PRHA 4WUIA 3II1A 4N9CA 4N9BA 1OK6A 4YWIA 4UFMA 4BA0A 3OVRA 4O57A 3P67A 3DXIA 1BAGA 3NPVA 3VNZA 3WNNA 4XTDA 4O54A 3GKAA 2F61A 1IIHA 1S46A 2UV8G 4RXGA 3DFTA 1AW5A 3LLFA 2QPSA 3C2OA 5AC7A 4I7VA 1JULA 1VLIA 5D32A 4DBEA 2E8ZA 3LXAA 3SGUA 2D2OA 3R8RA 3LCXA 2HTMA 2FPVA 1X6UA 5DCBA 3HB9A 2J9XA 4JTLA 4N4PA 2NXGA 4O53A 1ZJAA 4UFKA 4AF0B 2ZUUA 2R94A 2CW6A 1SPQA 1RQHA 3WK0A 2GVGA 1KCLA 2ZQ0A 1AL8A 1A50A 5AHLA 2BHUA 3WNMA 4J28A 3RU6A 1H51A 1YADA 1YLVA 3P8JA 1OSEA 3BGGA 3EDEA 4FNTA 3LCHA 5T26A 2X2JA 3QW4B 5L6UA 5FF0A 3QMTA 1NFBA 5H2ZA 3EX6A 1XSKA 3DHDA 1FWSA 1X7FA 4K8EA 4IGHA 4XBSA 1MXGA 2CLEA 3NEVA 1I2QA 1O60A 5E6YA 1BKSA 2X1SA 1J0JA 4UMBA 4K39A 3UYCA 5I3GA 1IZKA 4PL2A 2F7OA 1QO2A 1KM2A 2HS6A 4IMCA 3BV4A 3NYZA 1HVXA 1SFLA 4ZZ9A 2FYVA 1E3ZA 3N9RA 2VFDA 2WANA 4M5PA 3FJ6A 4U3CA 2XN0A 2DZVA 4Z1AA 1S5WA 5I3KA 1VYRA 5D38A 3M7WA 4NZFA 3OVPA 2EAEA 2ISWA 3O07A 2WKJA 3MHUA 4Z0JA 1A5CA 3GBEA 3IK2A 4LS0A 1S5TA 1VIWA 4UR8A 2ZRVA 4UQBA 3NR0A 4H3DA 4H8UA 1I2NA 4JCMA 4HA1A 1SUXA 3A5FA 2FE0A 3DFPA 2A7NA 5I3FA 4TO8A 3TXVA 5DFAA 4FX6M 1QOPA 3BMWA 1M7PA 1VJIA 5HWMA 4Q33A 1JI2A 3M0ZA 3WEOA 1EX5A 3O15A 4RCXA 1CYGA 1ZNNA 1R30A 3STCA 4CNNA 4MJMA 2QMJA 5LSMA 1WDWA 2AAMA 1X8FA 4UXDA 4X2RA 5DELA 3M16A 1F5ZA 1RP9A 4O1CA 4XTIA 1GTEA 1Q3NA 1C8VA 4WSKA 4H6KA 1IXPA 4BWLA 2ZRXA 4RR4A 3WMSA 3TONA 2DZWA 4R34A 2D3LA 4Y96A 2ZWZA 2WC7A 1WZKA 3BAKA 4X9YA 4MZ1A 5LZLA 3KL0A 3VSVA 4P2VA 3TMQA 4IOTA 5U7SA 1OYBA 5LGZA 4JR5A 3HG5A 4IMEA 4MUZA 1HL9A 3NAVA 4ZVJA 1GVFA 3HGJA 2QUUA 1O5XA 2V8ZA 3L4UA 3W3OA 3PUOA 3NQEA 2DZTA 1NEYA 3BMVA 2VEIA 1OF8A 2HS8A 1TPEA 4HNVA 4ZQNA 2YOCA 8TIMA 2YR1A 3LHUA 1AK5A 4ORMA 3M5YA 4DF1A 4GKLA 4O1BA 1W3TA 4TMBA 2OSYA 3NQVA 2QCGA 3LPPA 4MY8A 7TIMA 1ZAJA 1I2RA 1M7OA 1EP1A 3VMOA 1G6CA 3PS7A 1W54A 3LGEA 2J27A 1LWHA 4CQ9A 2C15A 2Y7FA 5BNKA 4MVAA 2X2GA 3DI1A 3PC0A 4PEKA 1G4PA 4DF2A 3BC9A 4FLSA 1FDJA 4KKXA 1OYAA 3CTLA 2JKAA 1Z48A 3LRMA 4OU1A 1XM3A 4BI6A 4M8UA 4M56A 2A85A 2JKEA 3EKLA 3MHFA 3L9CA 3HOJA 1U2YA 1H60A 4B5NA 3WENA 3MBFA 3CHVA 3NA8A 5F7UA 1OFEA 3KRZA 4UZUA 1R2SA 2VR5A 3IVUA 3W2LA 5HUOA 1K7EA 1SSGA 3W7KA 1W5QA 1GJWA 2DH2A 2W0UA 3BVTA 3RMJA 2CXGA 3TC7A 4LPCA 1P1XA 4GINA 3DDFA 1L6WA 1KGWA 3DDGA 3VGHA 2BZNA 2GJLA 1NM9A 1G5AA 3IIVA 5H91A 4AHPA 3LPOA 3HPZA 4AH7A 3BLKA 1MWOA 3MMTA 3GYEA 5AHNA 3LCWA 3TQ0A 3O1NA 4JL1A 1WV2A 2E68A 2Q3OA 3UPBA 1FWTA 5HR7A 1Q6RA 1W5PA 4AWUA 2VOMA 4NJIA 4MYXA 3D4ZA 2PRMA 3W1QA 3GXDA 5DY3A 1JG9A 1DEDA 5HUPA 2C18A 3N3MA 3VI2A 3W87A 3NL6A 2C7FA 3HJEA 1KTCA 4OWGA 3TKFA 3GDRA 1VFOA 4JYDA 1YTEA 3PG9A 1RPXA 3BLBA 3A23A 2V2HA 3GDLA 2VC6A 3EJQA 2FIQA 4Z08A 3EJUA 2WSKA 4FNRA 1FWNA 1YXDA 3HGRA 3M5VA 3TFXA 4BI7A 2WKLA 2YW4A 3N34A 2CLMA 1GYNA 4MZYA 1PL9A 4MAZA 1D3GA 3A47A 5AYXA 3PB2A 2JGQA 4XWUA 2OJPA 3GZ3A 3U8GA 3HBLA 4K8HA 4LUIA 3UNDA 3GX9A 3TQVA 4K38A 1H61A 3PB0A 4ZQCA 4W93A 2ZRYA 5LNWA 4LWWA 1SSDA 4NJJA 1R34A 3IJ9A 3SFKA 4EF9A 1Q4NX 3JR2A 7TAAA 1KLYA 3MWAA 3EXTA 1KBKA 3CLWA 4HNNA 3I7RA 4H8VA 3QEZA 1CLVA 3MP3A 3EX3A 3B03A 3B8DA 3IV3A 3ZR6A 2A7PA 3P80A 1OFBA 3GNNA 3TSBA 3HPXA 1UA3A 3C2RA 2HMCA 4LOCA 3I7QA 3FEMA 1KFCA 2F7QA 2D0HA 1OFQA 1XCFA 5ABTA 1B0IA 4AF0A 2EADA 3HO8A 3Q58A 1B57A 3VE7A 4PCTA 5I3HA 5EYWA 2Y4SA 1JXJA 2WNWA 2PC4A 1B3OA 3FIGA 3VMNA 2X2HA 5CXPA 5HNRA 1HFBA 5K9CA 1WO2A 5HPOA 3UWZA 3RF9A 2DIJA 1RPKA 5AFDA 2WV8A 3OLEA 3W2JA 1NF7A 2OCZA 4M6PA 2ZA3A 3R13A 1ME9A 5D03A 1VR6A 4U2YA 2QCFA 1BG9A 4PH6A 4UIOA 1ZAIA 4NVTA 2ISVA 2YYUA 3VM7A 1F76A 3PSWA 2V3DA 5D30A 1UD8A 3IIZA 3NL3A 4Y8FA 1EUNA 1U5JA 1W8SA 2ZA2A 4MKNA 3STEA 3D50A 2C8NA 3GDMA 3TSDA 2X16A 1ZJIA 1GVSA 1LYXA 5LGXA 2WKGA 1BWKA 3JRKA 4O17A 1AL7A 1OFOA 4FXRA 2WVSA 1HX0A 3VX0A 3KRSA 1OG0A 3ZOAA 2WCGA 1LRNA 5HINA 3W7IA 3I7SA 1TPB1 4YCPA 4PC8A 3N9SA 2OZ0A 3BVWA 2AAAA 2GOUA 1BVZA 2GQAA 5K2ZA 1DJQA 3YPIA 2ZZ5A 3EDKA 4L4LA 1JR1A 3TAOA 2FFCA 3A21A 2ZZ3A 3G3MA 3FLUA 3B05A 1UUOA 4RZ4A 3LOTA 4UTTC 4MB1A 4UTMA 4HOWA 2BTMA 3G1VA 3MI6A 3OLDA 1LOSA 4WY0F 4FEZA 2A6LA 2NWRA 4HOZA 3E49A 3KE0A 1MEWA 5J5DA 4CNOA 2FGZA 5KSWA 1VHNA 3SECA 4Z1DA 1QHOA 3TTSA 1H7OA 1TTJA 1RD5A 2Y70A 1BEUA 4K6AA 3GIYA 4DO5A 1H5YA 1OT1A 2QCLA 4YLWA 3ZR4A 5KMYA 1K3UA 3W71A 1VYSX 1FCUA 3SI9A 2QLYA 1K8XA 4UQEA 5D33A 1LBLA 3T78A 4OQVA 4NNAA 3P60A 2YGYA 5G2IA 3H55A 1Z42A 2EEXA 2PWFA 4J3VA 1PV8A 2ABBA 3LX9A 3RNDA 2V9DA 2ZTJA 4OHQA 5C55A 1A5SA 4FLRA 2B7NA 4MPQA 1CGTA 2Z6JA 1A53A 2D73A 3N14A 4KFPA 1RQEA 1I45A 3DENA 2DZPA 2FDSA 3CLMA 1KXHA 1QWNA 1TB3A 3ATZA 4LTSA 3UD6A 4IMDA 2Q8LA 2YA2A 3W2MA 1M6JA 3L4XA 1IGSA 4XZ9A 1CXIA 3UEQA 2BX7A 4OV9A 2Z1KA 1ML1A 4UQCA 1H7WA 1N8FA 1XC4A 3W37A 3DFOA 1L0PA 4O16A 3EWYA 4CN6A 2XWDA 5LKYA 1SU5A 3O05A 4CVWA 1LDCA 4MFEA 1W56A 4JTTA 1W31A 2CFFA 3NOEA 4QIUA 3G1FA 3W1UA 3L4TA 2BWGA 1CGUA 1G67A 3P7YA 4YMZA 4AEEA 1EH9A 4DPPA 1QNVA 2E09A 1VCGA 3M44A 2ZTKA 2NUXA 4O50A 3HIJA 1GCYA 4UC5A 2XIIA 1CGYA 2F1AA 4G1KA 4UFIA 2XN2A 1VAHA 3DH7A 4AWSA 3EJSA 2O7QA 2ZZ2A 3AMKA 5A8GA 2W79A 3CZKA 3VMPA 5D2XA 4OT7A 2CZDA 4S1FA 3LHWA 1F6PA 3W1PA 3KFTA 2QPUA 4JIQA 2Y24A 4GQQA 2EQDA 5CGQA 1MFUA 3WN6A 1TMQA 3W1RA 1TV8A 3L68A 2CLHA 2G3MA 1YPIA 3FKRA 3UZ5A 3W07A 3NL5A 1QHPA 3G18A 4E2DA 1TPWA 3NVTA 2Y5EA 1VB9A 2WVTA 5CLWA 1YTKA 4O8RA 3WY4A 2C1HA 1X1OA 2NX1A 1KGUA 3W1XA 2VFEA 1CXHA 3ZSTA 1FQ0A 2QCEA 3TK7A 3IJ8A 3B0PA 3KVKA 3HGOA 3I65A 2BHZA 3W9ZA 3CEUA 5K4ZA 2ZZ4A 1P0NA 3L0GA 3S1WA 1PVNA 2J9YA 5AHMA 2E8YA 1VC4A 2AGKA 2ZXQA 5CG7A 1K7XA 5I23A 3GNDA 4U2ZA 4GUGA 3MUXA 2OW7A 4O18A 3R89A 3W7PA 1UASA 2ISSA 1OFPA 4AHOA 1JF6A 5KITA 3PULA 4K7VA 1KTBA 4AEOA 1WZMA 1JUBA 2ZZ1A 1KB3A 4QM1A 3FAXA 5EMYA 1G4EA 3EWWA 1CGVA 3NQAA 3NQ6A 3PWAA 2QMKA 5EKYA 3QH2A 1QX1A 1TQXA 4RKAA 3ABOA 4UTIA 1CIUA 4GO9A 5DXYA 2NZLA 2TMDA 4FX7A 1KM3A 1ICPA 4JY8A 3GXNA 3CZLA 4UMAA 3PBYA 3BW4A 2BSLA 3B4UA 2NSXA 3DX3A 3W22A 3MO7A 3RLVA 3WNKA 4UTJA 1WBHA 2E6AA 1QI5A 1CX9A 4BI5A 3WJWA 4DPQA 4NX5A 3GR8A 3LCGA 4AMAA 1DVJA 4KMQA 1KM1A 1SW3A 3AMLA 1JJKA 1GT8A 5A2AA 2VUYA 1OVDA 1W1ZA 5FI8A 1AMKA 3LI0A 1EP2A 1MEIA 4N6EA 5K4XA 4RZ5A 3TJLA 3VSTA 2P0OA 1D9EA 5TD4A 3PSVA 2WOQA 1TQJA 1WX0A 3MBDA 2WVVB 1FCVA 3ANYA 3IVSA 4UFHA 5HWNA 4LRTA 5G1YA 1QW9A 1JDCA 4DO6A 1FCBA 4AWTA 5KZDA 4OIFA 5E0KA 2CZ5A 3UWQA 3QSTA 3I68A 1OB0A 1JCLA 3DHUA 4RJEA 3CQ0A 3EX4A 5CPMA 3FS2A 1IXQA 5IBXA 1A5AA 1B9BA 4MZ8A 3T44A 2Y61A 3FYOA 3N2MA 4UCFA 4ONVA 1MZHA 1KXTA 3KXQA 3BVJA 1BSIA 4WOQA 1FDYA 2R14A 3UY7A 2TPSA 3UWUA 5LNUA 1OX5A 3B0VC 4J3XA 3M9YA 4UTUA 3EJTA 3P61A 4CN4A 4LC6A 1WZLA 4UFLA 1JD7A 2V3FA 4AYSA 2DZUA 2ZYFA 4JTJA 4RXFA 1MW2A 1E43A 1M5WA 1VCFA 4FIRA 4M7TA 3NPXA 1B4KA 1KGXA 3GAKA 1PHQA 5EA9A 1E3XA 2Y62A 2DORA 4S2CA 3SSJA 3EEGA 2NLIA 3NG3A 4U4MA 1GVRA 1W3NA 2ZA1A 3W2NA 5G1TA 3EKZA 4AHQA 1DQXA 3W7CA 1TREA 1P4CA 3G8RA 3R12A 2G95A 4NT0A 1OJXA 1GJPA 3CPRA 2FH8A 3DX0A 2C13A 1M7XA 3M07A 5G4EA 1XUUA 3MP4A 3DFSA 4NXKA 2VFGA 4RZ6A 1HO4A 3CZEA 3A6OA 1QO5A 2PWEA 1UJPA 4CCEA 3LB0A 5E9AA 3LDVA 2H8ZA 1RP8A 1QW8A 3NQ8A 1K02A 5D2TA 3NL2A 1OFDA 4HHPA 4HSNA 3SGZA 1QI3A 1DORA 4HT3A 1H50A 1KM6A 4LVGA 3UWYA 3S6DA 1K03A 4FIQA 5F4XA 3S1UA 2JBMA 3FA5A 3W1TA 1Q6OA 1VYPX 1LZOA 2F18A 1KV8A 1TQSA 4XBKA 2QDHA 4N4QA 1W9XA 3GAYA 3BK0A 1XD0A 4MJZA 2RH9A 4UOQA 3WFZA 1HG3A 5KZMA 3BUDA 5AYZA 4GIAA 3VGEA 1SZGA 1JQXA 2G3NA 2WNZA 1GVIA 4Z1CA 2D0FA 2EKCA 5KEZA 3P74A 1EIXA 3U6WA 2EAWA 1PHWA 4JYFA 3ZT6A 2RDWA 1TTIA 1JI1A 4UNIA 4HPHA 4UQAA 3BAYA 3AJXA 5CSSA 4HNTA 4JX4A 2DIEA 1TRDA 4O1AA 1N55A 3C0JA 3QQ0A 3VFLA 4AMXA 3DKLA 1UCWA 2E5DA 4YL2A 3S0CA 1L9WA 6TAAA 3WY3A 4AB4A 1U33A 2A7RA 5C5YA 4WJEA 2OYLA 1RVGA 5BMXA 3M1ZA 3DFNA 1EO7A 4CN1A 3UZJA 4FLOA 1PJ9A 1HL2A 3AXIA 4GI8A 5J5RA 4ADUA 4AIEA 4NI3A 2E0PA 3VX1A 1R2TA 4K7YA 1GOXA 1S5VA 2BXVA 4H7VA 5FF4A 4K37A 2WNQA 3TUUA 3A22A 5BW6A 3MYOA 2E1DA 1VHCA 4AVFA 1ICQA 4HIBA 4UTWC 1OGSA 4UUIA 4O12A 1PEZA 1RQBA 3EWUA 3EWBX 2QCCA 2DZXA 4FO4A 3W7OA 4GI6A 3TJXA 4EOUA 4LC8A 4ZQOA 2J9ZA 4NX0A 1Z41A 3Q2DA 1JGIA 4HOXA 2QCDB 5KTLA 2RDTA 1LLZA 3VGDA 3K8LA 2GJNA 3SZ8A 1EO5A 1QPKA 3VGFA 1EA9C 5HXMA 1O95A 1SW7A 1T99A 4JFUA 2GUYA 2P10A 4RK8A 3KLKA 1SW0A 4O14A 3K8MA 4J9JA 3LRLA 3KLLA 3OHIA 5LNVA 3TA6A 4B9YA 4CLMA 3ZWTA 3RK8A 3GXMA 4GRSA 3F4WA 1KA9F 2ZFAA 4OE7A 3BUPA 3TIMA 3NQMA 2EO7A 2QCMA 5BRQA 3TH6A 4I9AA 4NJKA 3BLEA 3SW6A 3C61A 1UA7A 1I2OA 3UQNA 4JTUA 1G9HA 3QSRA 1R46A 4ZQRA 3P5YA 3BH4A 1XH1A 3W1AA 3M6YA 3ZO9A 4PCFA 5FESA 3P84A 2WVUA 2OYKA 1A47A 3A24A 1TPC1 5E93A 4BR1A 5L9FA 4JD4A 5U4NA 3MYPA 4NJGA 2ZZ6A 3M5XA 1TRIA 2A4AA 2X2IA 4JGDA 2GUUA 2NWSA 1R75A 4JN6A 3VKJA 4L4MA 3THQA 4I7UA 3O06A 2EHHA 1CXFA 3KVMA 4U28A 3EB2A 1I8JA 4JEQA 1LBMA 5F1UA 4GUFA 3W2UA 5CPLA 1ZAHA 1V3LA 3W1NA 1JD9A 2WVVA 3BVVA 4OGZA 1KM0A 1UD5A 3LERA 1VS1A 4J7RA 4UQDA 3VSUA 1LTDA 1TQUA 5DY2A 4EIVA 3CM4A 4HPXA 1W5OA 2V30A 5F4SA 1XGZA 2OSXA 1J0HA 1QOQA 3N2XA 3EWXA 4J3WA 4HSOA 2YFNA 4HKPA 3CZGA 3ZQ9A 3GTNA 1JRBA 4PEEA 4X9SA 1IZJA 2EABA 3M5ZA 4JS3A 1H1YA 4R53A 3GK0A 3DAQA 3IIXA 1J0KA 4XUGA 4CGTA 3EDJA 4TX9A 2WCSA 1TMHA 3G22A 3L4VA 1THFD 1QCWA 4DO4A 1TPDA 4MYAA 1J0IA 2CZFA 4MFDA 1SQ7A 4O19A 2EACA 5G2WA 4GUJA 4FNPA 3OA3A 5FEWA 4HP5A 1JQVA 2H8XA 2ZDRA 3BUBA 3KHJA 1UKQA 1K7FA 4N2YA 2C19A 3EJRA 5DCEA 1XSIA 1OT2A 3LXBA 3NGJA 2P1FA 4UNLA 1QAPA 3T55A 1U30A 2DU2A 3MHGA 1XFBA 4QAIA 5HULA 2E9BA 3W2KA 3LTPA 1TYGA 1AMYA 4J27A 1G69A 3PF3A 3A5VA 4O11A 2ZRWA 3W7EA 1FWRA 2ZX9A 1XDLA 4JYEA 1MFVA 2J88A 3L4ZA 2PURA 5BMWA 1G94A 1GVQA 3O6DA 3UWWA 1ME8A 3QZEA 3CWNA 2CLOA 2CLFA 5K9DA 1Z32X 1OX4B 3GXFA 3QC3A 1MW1A 2OT0A 1P6WA 1DV7A 4JTKA 1OFAA 1GZGA 4OBTA 2IGTA 4ATWA 2YDAA 2Y88A 2A1YA 2H6RA 1WZAA 3WNOA 1BF2A 4GI9A 4UFJA 3LTSA 4N9DA 3VNDA 4TVUA 1PCKA 3IEBA 2ZWYA 3OBKA 3B06A 1KXQA 2XWEA 1MO0A 2YPIA 5CZJA 3WEMA 1LP6A 3LHTA 4OKDA 2FTPA 1SZFA 4GC4A 3W76A 3KAOA 3KL5A 3IVTA 4FB7A 2ATMA 4JX5A 5A6MA 2Y7EA 4BF9A 3W75A 3HQ1A 2ZX8A 2V5BA 3C2FA 3PUDA 1W3IA 4WOZA 2A21A 5AHIA 5F4WA 1PS3A 3W1LA 1AQMA 2G5WA 1TJRA 1V7YA 1JF5A 2GVLA 2VFFA 1K8ZA 2QCNA 2EPHA 3L5MA 1FWWA 1TTPA 2GQ9A 1HUVA 2QUVA 1G7VA 3HG3A 3CWOX 3E12A 4B9ZA 4ZL1A 3W7HA 2TYSA 2GJPA 2RHGA 3TSMA 3BG5A 1VCVA 4QITA 5TIMA 1HNYA 2A2IA 3VM5A 3L5LA 1JIBA 1TV7A 3LCFA 3HMJG 5FEZA 1DHKA 2WSPA 4JICA 4FX8A 5CPNA 2R8WA 1D3HA 1SMDA 3BAIA 1G7UA 3RIKA 2NX9A 3NQ2A 1VGAA 3P8IA 3K8KA 1NF0A 4MIMA 5BRBA 2FPTA 2A6NA 3MP5A 5EBUA 2PWHA 3L2MA 3B0UX 5AHFA 2BLEA 1TV5A 2C16A 3OVQA 4DQWA 1X1ZA 5CZSA 1QWGA 3CIWA 3TQKA 3HG4A 5TBOA 2WNNA 2ZRUA 4GO8A 3TROA 4A29A 3L0KA 4ML9A 3BPWA 4WY0B 4Q32A 3BO9A 4GQRA 5AOUA 1JFHA 3WDIA 1CGWA 4IX2A 2ZXDA 3HG2A 1LBFA 4A2RA 3WY2A 2ZCGA 1H7RA 3FFSA 2G97A 3QPYA 4MLRA 4QNEA 1UKTA 2VELA 3C6CA 5E6ZA 2C3ZA 3BG9A 4K36A 2QCDA 3G1HA 3BSGA 4JTEA 5EY5A 4WSJA 1PCWA 4IUOA 2VRQA 1D7FA 4ALDA 4GFSA 1SO5A 5EPDA 1KXVA 2Y7DA 3TW7A 3DU0A 4LUJA 1KBIA 1J2WA 1YYAA 1V3JA 2DJLA 3HPSA 5CGMA 2QJIA 4M19A 1YDOA 3DX2A 2ZUSA 1HTIA 3UY8A 1YPFA 3T4CA 1BTMA 1QMLA 4KFNA 4JIPA 4PSPA 3W7RA 5AYYA 2C6QA 4BK9A 4C1LA 3NQ7A 4FNSA 5FF3A 5D02A 4ADTA 4QJ1A 5CLTA 4LT9A 4UNKA 3KX6A 1YDNA 1V3MA 4PCSA 3W7GA 3WDHA 3D52A 3C2VA 3M47A 2ZXBA 1AVAA 1IIGA 3T40A 2YX0A 1SO3A 3NM1A 4FMVA 1Y0EA 2YA0A 2BY3A 2XN1A 3WDJA 4E2OA 3ABRA 3SJ3A 4J3SA 3P5ZA 2GVJA 3CC1A 4IXHA 1XXXA 4CQ8A 3W73A 3L66A 3D0CA 3ZR5A 3ELFA 3W1MA 2W6RA 1SZNA 3BVXA 3KEHA 1UH2A 1TPH1 4XB3A 4UZSA 1QFEA 3TDFA 1WXJA 1AW2A 2Y7GA 3BUIA 4POCA 2V81A 3NZ1A 1N7KA 1Q6LA 3NQDA 4A2SA 5BOOA 1U83A 3IJ7A 3CIXA 3PAJA 2RFGA 1DKWA 2J24A 4MY1A 4IMGA 4IPIA 1WPCA 4XQ6A 1ZS2A 2ZRZA 2BXYA 1XH2A 4LU0A 5D09A 2OSWA 3G24A 2IQTA 5CKSA 3G1YA 2VEPA 3UCQA 1L2UA 1QPRA 3QF0A 3HF3A 3L21A 3EXRA 4N9EA 3VO0A 5AC6A 2CLLA 2CLKA 4ZMGA 4GUIA 2NV1A 5D37A 1ZCOA 2BY0A 1D3CA 3G0XA 1W0MA 1S3HA 2X30A 3GDTA 3L4YA 2QV4A 1T8XA 3I6RA 3UG3A 3VE9A 4BZYA 3MJYA 4LRSA 1IF2A 1OHLA 3KWXA 4MOZA 2LLEA 4JFWA 5EMUA 1R47A 3NO5A 3L2IA 2QJHA 1F05A 3BCDA 1V5XA 2QKFA 3BG3A 4P61A 1XCXA 1H63A 1XL9A 3ZFHA 1BLIA 2YYTA 1YDVA 3C4UA 4NXSA 3BW2A 4JNMA 3FKKA 2F1BA 5HMSA 2TAAA 2QUTA 3W88A 1FUYA 4E0CA 3BAWA 3G0UA 3QMRA 2YFOA 3W7DA 4Z1BA 3WELA 2FJKA 4CCDA 1UH3A 2EGZA 3INPA 3S1VA 1YTDA 4OJYA 1UKSA 1XV8A 3IRDA 4KFOA 4E38A 3NQGA 3C3NA 3GVGA 2QAFA 3CPUA 4M6QA 5HQEA 2VT0A 2V2DA 1F6KA 3QJAA 1SR9A 1FXPA 1OX4A 1QR7A 4IQLA 3IGUA 1GG0A 5D2VA 4DXVA 4AIOA 3BW3A 3WK1A 2E4TA 2YA1A 1NAL1 1NSJA 1TO3A 4QQ3A 4RX0A 2B4GA 2TSYA 3QW3A 4ZQPA 4GWEA 3ZWSA 2F2HA 2Y63A 4WXYA 5F1VA 1XI3A 4LV4A 1L6SA 4WXZA 2H3DA 3C56A 1VJSA 3UG5A 4M7SA 4QSHA 3FOKA 5BRPA 2F7PA 1HXKA 2CU0A 1DQWA 3W7QA 2X1RA 4O52A 2NUWA 4GXMA 2BHYA 2DH3A 1B2YA 4FNUA 2NUYA 4AMWA 2FQIA 5I24A 5HWJA 3TNOA 3A4AA 5K7JA 3BGJA 1RR2A 3ZT7A 3LM7A 1VFUA 4I7WA 1JL8A 2ZUTA 3WJZA 3LHVA 2YSWA 3P81A 1LCOA 3GXTA 4XKYB 5DCDA 4JTSA 4LVFA 1HWWA 3QMSA 1LOLA 2WQPA 1VPXA 3EDFA 3PUEA 3R2GA 1EEPA 3CV5A 4CCCA 1HT6A 3FAWA 4JX6A 5F2LA 2XVLA 1VLWA 2ZX7A 1ZFJA 1EB3A 1CXLA 1DHPA 2NT1A 3HJZA 4ICNA 2F84A 1EA0A 1WBJA 2YIHA 1TJPA 1OF6A 4JTHA 3DZ1A 2NT0A 3TC6A 1FX6A 2OMAA 2NV2A 4TR9A 3STFA 3E02A 3WY1A 4ORIA 5F2MA 4BFAA 3TU9A 1IXOA 1RZMA 4O4WA 3PG8A 1PZ3A 1DJNA 3E0IA 1KFKA 1FBAA 1K8YA 3H53A 3O63A 3LBCA 4H2CA 5E0FA 3TXZA 5AC8A 3UWVA 5AHEA 3TTYA 3PVFA 5DBTA 3E9AA 3IIOA 2ZX5A 2FPYA 3RILA 4O4VA 4TMCA 4WY0A 3IGSA 4WD0A 1VZWA 4JL2A 1JUEA 3KRUA 7CGTA 3ABSA 2V0TA 3LTYA 3P82A 4NQ1A 1RV8A 2A5HA 4KWVA 1MVYA 1VRDA 5A5WA 3IGXA 1WOAA 3CB8A 4JDYA 3BAJA 4OV4A 4YCOA 5HR6A 2Z0IA 1CPUA 3NPWA 3RLUA 1C9DA 1ODUA 3BARA 3AJ7A 3S5ZA 1I75A 3VNYA 4LV9A 2I14A 1PIGA 2E5BA 1EPXA 2VENA 5IM51 1HL8A 1H7PA 1MXSA 4A3UA 3CGTA 3M43A 4PA8A 5CZ0A 1H62A 1UB3A 3GKFA 1ADOA 4H4IA 1T0OA 1QPOA 1UUMA 2PRLA 4JFSA 1TPUA 2V2CA 2B7QA 4Y6GA 2J6XA 1OYCA 4NNBA 1TPFA 3ZS4A 1QI4A 2E5CA 3DHFA 1SO6A 4NZJA 4JTGA 1OFRA 5SWUA 3CZSA 4UTHA 3TV8A 3S42A 1B4EA 4JY9A 4PODA 2CLIA 3W70A 3OG3A 1YXCA 1QDSA 3JS3A 2YW3A 3VCRA 2ALWA 3O8AA 8CGTA 4R33A 3MW7A 1FDZA 5I3JA 2KZHA 4A21A 2FHBA 2YXGA 4S2BA 3VGBA 1JCXA 3QFEA 2X1UA 1AG1O 1OK4A 3LV5A 3W7NA 2I9EA 1PIIA 3DI0A 3ZT5A 5I5RA 3A9IA 2DJXA 4IWWA 4UOZA 3SIZA 3G1DA 3CTTA 3HGSA 1FXQA 3KOFA 1GVOA 1GEQA 2GQ8A 1KLZA 2QDGA 2V5LA 3UERA 2WJZA 4LVAA 2Y2WA 4DEFA 3KL3A 1XSJA 1SFJA 4FNQA 3WJYA 1GPWA 1Y7VA 5F2IA 3WJXA 3LCLA 4RLIA 2OX1A 5IBXC 3PY2A 1DL3A 2CZEA 5KZEA 1WA3A 3U2OA 5HJLA 1EHAA 3TR2A 4A22A 5E1QA 4UTTA 1KFEA 1JUKA 2B7OA 4D2JA 3DC0A 3NXFA 1R33A 2D0GA 1WAUA 1UD6A 3PM6A 2FLIA 1DBTA 1XBZA 4NNCA 1J5TA 3W85A 5MHBA 1T96A 2RDUA 1KV5A 6CGTA 2Y6ZA 5A6LA 4PL1A 4HNUA 1KBJA 1LRQA 2G96A 3SR7A 1TQWA 3F03K 3EX1A 2E6YA 1H3GA 1JAEA 3BUQA 1XBYA 3BCFA 1WOBA 3Q37A 1MW0A 3QPZA 1E51A 5CZTA 2JK2A 2WPBA 5HDRA 3TE9A 1DTUA 3S5NA 2AMGA 2B7PA 1KTNA 1XUZA 3OEXA 1XCWA 1CGXA 4LS2A 5G2HA 1O5KA 4ADSA 1KFBA 1G1YA 3LBMA 4Z0SA 2YKKA 1WYIA 2PWDA 4AXKA 3G1AA 1HTYA 2ZUVA 4JFVA 4O28A 5DN1A 3LV6A 4PTNA 1KWGA 2O7SA 5LNSA 1PS9A 3LRKA 5FF2A 1WE5A 2OW6A 2VRKA 4DELA 2BY1A 2ZX6A 1BVNP 3EXSA 3OLGA 5FEPA 1TIMA 3NZRA 3L2LA 2PE4A 3CU2A 3V75A 6TIMA 4IMFA 1G4SA 4GNJA 4GUHA 3GR7A 2ZE0A 4O1DA 1O94A 4TIMA 3EJPA 2QAPA 4RV8A 3TFCA 3PR2A 1UH4A 3E96A 5FEXA 3USBA 1EUAA 1JCYA 3OLIA 4UTLA 4BWLC 4EWND 4W9TA 4UCGA 1LM1A 5E70A 3G1SA 3GDKA 1IXNA 4M6VA 1JCNA 1Q45A 1CI1A 3DBPA 1W5MA 3N19B 3WJSA 1A5BA 1F74A 2V3EA 2JKPA 1JCJA 3N73A 3THAA 1JXKA 6ALDA 1FY6A 3FYPA 4AYGA 1J4EA 3VGGA 4FF7A 2WO5A 3NDOA 3DGRA 1QPQA 1WQ5A 4IXXA 3G1XA 4X3ZA 1UD3A 2VEMA 2F7FA 3S2CA 4XKYA 3D4YA 3WFAA 3V1PA 4J3UA 5AB3A 4H8HA 3L67A 4AW7A 2QEZA 4NUWA 2CPUA 1EP3A 1G4TA 3O6YX 1PZ2A 3GLCA 3L5AA 4TU1A 2F7RA 1UBSA 4Q4KA 4LNYA 3WNPA 2XIBA 1ALDA 1XD1A 4UQ9A 3S5YA 4R7JA 2B0MA 5F2GA 1EWEA 1QPNA 5DXXA 3DX4A 2Z6IA 4PFMA 1TPVA 2EF9A 2FB3A 3TW6A 3LI1A 3LCIA 1P0KA 3S8HA 3GBDA 3F1QA 1H1ZA 3S1XA 3C8FA 2QCHA 4O15A 3W83A 5CSRA 2E6FA 1WP6A 1XBXA 1KW1A 3LLDA 4WQ6A 1TSIA 1GJUA 3K1DA 3W7MA 4JDBA 3QYQA 5D04C 2ATSA 4X22A 3W86A 4WLCA 4O13A 2YCEA 1SMAA 3ABQA 3GXIA 2GVYA 2Z1BA 1GTHA 4Y9AA 2BY2A 2DP3A 1CDGA 3D51A 1KCKA 4O0ZA 2VEKA 1LOQA 4QAWA 4LQ1A 2ZBTA 2R91A 3BLFA 3DFQA 3M41A 3BAXA 1JDAA 3W6YA 3C2EA 1AW1A 4UTKA 2Q8ZA 3IIPA 1R2RA 3QGVA 3NQCA 5I3IA 1KM5A 2C14A 5C54A 2Y85A 2D3NA 3G8EA 4AAJA 2FB2A 2NXIA 5G4WA 3WK2A 1HO1A 1P5BA 2Z2UA 1YXYA 2YZRA 3PBUA 2WSQA 1IV8A 4N02A 2JGYA 1ZENA 1ZJBA 3EX2A 4YXGA 2DZSA 4HPJA 4X0NA 1LWJA 3O6CA 3BSHA 1JCMP 2VFHA 5FF7A 4KWUA 1SZEA 3QM3A 1XH0A 2QR6A 2VFIA 5DBUA 3TCEA 3ATYA 3NM3A 3C52A 3AXHA 1KWKA 1UOKA 4QISA 2NX3A 3RFAA 1DOSA 1I2PA 1MW3A 1LROA 1VFMA 1OABA 4JXCA 3NQFA 3BVUA 1VH7A 4O10A 1NVMA 4LY8A 4LVBA 4IPJA 4FHAA 3ZSSA 3UPWA 4AEFA 1TCMA 1H7XA 3P62A 5C6MA 3CT7A 1VQTA 4NJHA 2ZUWA 4MLJA 1XKYA 5G5IA 3WNLA 4CQAA 3MI2A 3QRHA 5KINA 3Q94A 3W74A 3W72A 2V82A 3DKJA 1C29A 4FLQA 1L6YA 4IX0A 1PE1A 1UD4A 2J25A 4WZHA 2PCQA 2AQWA 1W5NA 1ONRA 1TTQA 1QWUA 5K9XA 2A0NA 3TX9A 2ZIDA 1GG1A 2C0AA 2HSAA 5LHFA 3MI3A 4JFTA 3R5EA 1TQVA 4HN4A 4J3TA 3STGA 4DF0A 2CHNA 1TCDA 3LHZA 1O7DC 5GVJA 4PSRA 2ALDA 1E40A 4E2BA 5LHEA 3EWZA 4JCLA 4GJ1A 3NNTA 1AQHA 1JDDA 2WPGA 2E77A 4LVDA 2VNCA 4U31A 1NOFA 2ZZ7A 5CGTA 2YJQA 4UMCA 4CNPA 4MY9A 4UR7A 9CGTA 5DLCA 2WSYA 3UXAA 1BPLB 3DX1A 1CXKA
chains in the Genus database with same CATH superfamily
3UJEA 5AN7A 1L3NA 4KJQC 1CQYA 4B16A 2YQ2A 3VABA 2QIWA 3X13B 1ESOA 2K8MA 1AC0A 4QRNA 4XPBL 1K4CA 3E80A 3UG4A 4R5TA 1G7JA 2ICCA 4DBDA 2ICWI 4K8RH 3B2VH 3SDOA 3L1OL 2CKNA 3ECQA 5GGUB 5BRZD 4XD5A 2VR6A 3NEXA 4HIXH 3BLPX 2CM6A 4FXSA 1KEML 4KO9A 3WN5B 3DVNA 2FSEA 1UC4A 3HB3D 3TPUB 2PCFA 1OALA 1PWMA 1G7IB 3QP3A 5E99H 5BROA 4M8QA 3TEWA 3NQKA 4NM4H 4L4VB 4RRPM 5ICUA 5BXRA 1E4IA 4F9JA 1JPFA 4LOEA 3HNTH 4X2UA 3R19A 3GJFA 1EYWA 4HK3J 3V3WA 1NARA 3ILPA 5A8OA 2X9YA 1A5LC 4FNTA 4PB4A 1U8OB 4L5FL 3P14A 5E6YA 3GT6A 4K39A 2KYIA 2YBVA 5JHMA 3QEUB 2EKGA 1YEWA 3SIKA 1PX4A 5ADOL 5I3KA 5AC4A 2EAEA 3O07A 4Y19D 4FOUA 5GGSB 3EUDA 2R0ZL 1JV2B 3LH2H 4W9LC 4X7DC 2JJVA 2XGBA 3CO8A 4LLDB 2ZP0T 1U21A 3STCA 5LSMA 5H94B 3U7WH 4JREB 1C8VA 4WHYH 4GUCA 1KBLA 4FFVC 3KXFD 2WO3B 3G6JF 4DLMA 3VGAC 1V55B 1IGML 4ANVA 1B30A 4XPTL 4PRID 3ARGD 2E9LA 1UM5L 3L9RB 5CJQL 4MD4A 3BVDB 4I6VA 1RQ5A 4HUWB 3NBNA 2DYPA 4OD1L 3FSVA 3W11D 3VFPB 3C60D 3VXUD 1FHVA 2BGSA 3E74A 4FLSA 3CNYA 1P4LA 4KZDL 1CFBA 5AW2B 1CK0H 2DQDL 2Q76A 3IJYB 2E9JA 1AD9B 4G8FA 4AUUA 4ZOCA 1WKFA 2GI0A 2YB4A 1OE1A 4FULA 4AHPA 3VW3H 5FYJU 4XVJL 4ZO9A 1Q85A 2Y8VA 1W5PA 4GKSB 2F15A 2X4QB 4XC3H 4XH2B 2ATKB 1AZ1A 1XRSA 1UUQA 4EACA 4AD3A 1DBMH 4DO7A 2OEKA 4OWGA 4UIMA 2XQBL 5LWYH 4W9KC 3SGEH 3RL1B 4Z08A 3JWNE 1FWNA 3M7FB 3HGRA 3G5XB 1OARH 3VD2A 2HX7A 2OJPA 4ZUTA 2E1WA 3TJ4A 2C79A 3GX9A 3K0YA 4K38A 3TQVA 4QCFA 2OZ4L 4LZKA 5LNWA 3LRGA 1X5GA 3SFKA 5CBEA 3GBLA 1NC4A 1CICC 5JOPE 2GUOA 2EVJA 3MVIA 1KFCA 2ICWJ 2GK1A 3BZFA 3HO8A 4G7EB 3OX8B 3IETB 3U1SL 3ILQD 3WIHH 1HFBA 3QCUL 4U6YA 3WQFA 5LBSL 4ZXBD 2WXIA 3GRWL 3W2JA 3V52L 4M6PA 3APDA 3IVKA 2UV3A 1IC4H 3Q8AA 2EPLX 5DQ9A 1I1XA 3NRPA 4TNVF 4S1QH 3RAJH 4ABUA 1U5JA 1ZSDB 3AB0B 2XM1A 3ETBJ 4QHKI 3UTSA 4DZ5A 3V0VA 1D9KD 3D4CA 3OKDB 4DVBB 2J1WA 3J8F7 3VX0A 3KRSA 3U0PB 4PLKC 1FIEA 2W38A 4PB9L 3GKZA 3QWOA 5HINA 3K5RA 4RNRA 1JK8B 3T77A 1YY9C 2ZZ5A 4AZIA 5HYJB 3BWAB 1RKRA 2EDDA 3IACA 4HOZA 5IJKC 3DRTB 4WSHA 4ZNEE 5H8MA 1R9XA 5ITBH 4K6AA 2MSPA 3W71A 1VYSX 5TPWH 2Z31A 5DGRA 3ME3A 1AD0B 2AI0L 3QR0A 3NDYA 1KR0A 3H55A 3MC0A 3E2QA 4DCQB 1TNNA 4Z7UA 5I6PA 1RQEA 2PDNA 1H5BB 3CLMA 5J11B 3VNIA 2XGIA 4Q9BA 3F85A 4IMDA 1XDJA 2EEAA 2Q8LA 3SY6A 1AH1A 3S2NA 2MRYA 1HF6A 1ZHNA 3QWRA 5DT7A 4UQCA 4QJ5B 5DZVA 5F0PB 4ZMVA 1JHKL 1E6SM 2DZBA 4G43B 1T04B 5TAOA 4JFOB 1YEKL 3KBVA 3FQXA 1OQFA 4GQQA 1GOMA 2ITCA 2J66A 1MJUH 4XK2A 5DS8A 1TV8A 4B9JA 1DP0A 2ZCZA 2W5FA 2C1HA 3OG6B 1I1WA 3RG6A 1FL3A 5IFAH 1QBLH 5JOEA 2V67A 1F4XL 1VC4A 1FNAA 2EXYC 5GJNA 1JZ6A 2HV5A 4NOBA 4RSVA 4AC4A 5J13B 3OAUH 3U30B 2ISSA 3N91A 4NP4L 4BZ1H 2MANA 3GIZL 2DIAA 3ORJA 1W9VA 3BJTA 5DC4B 1T89A 2E75C 4LLWB 1CIUA 4HK5A 4E9TA 5CWSB 1DR9A 3FUHA 2QT3A 5DI8A 4P5UA 3PWJB 1F6LL 1U3YA 1MLCB 3LCGA 3GNOA 3CNKA 1FLRL 3OQ8A 1Q72H 4EXPX 2WOQA 5TDOB 1MI5A 4L8DA 1PGRB 4EQ2A 1D5ZA 1OB0A 2DIKA 5IVXB 1IXQA 1BCIA 4ONVA 2CO2A 2H0EA 5J5EA 1PZCA 4CBZA 4CC0A 5LXXA 5EO9B 5FHAH 3GAKA 5TK4A 4E42A 1QJWA 1QABA 1NBYA 3MV7A 1OANA 3GPSA 3TYBA 3IARA 1HAWA 3M07A 1XUUA 5JPMA 1DVYA 3C8KB 3W39B 3VFMB 4HNOA 4L80A 5D9SA 3KDMB 4ODSH 2BODX 3JWOL 5GRYA 4XC1H 2MCPH 2BOCB 4ONOA 2F68X 1KY6A 3IAQA 4QHKJ 4XVOA 5IW3A 3WFZA 5KVEL 2A77L 2FIKB 3L23A 4GIAA 5CINL 4XZWA 1AE6H 3OPZL 1Q0XH 4AE1A 4HNTA 1UWEH 2JK5B 4JX4A 1K9FA 1ASPA 4JTQA 3FUIA 1QFWL 1Q9OA 3PUUA 5L4FA 5DRZA 1RD6A 5LKNA 5CD5C 5C3TA 5GGRY 2A6KA 2CO1A 1TQBC 1TCRB 3QR2A 1P6FA 2P44B 2P5WD 3BYTA 5GIRA 1YUHB 5GS0D 1FO0H 3TN0D 1EX0A 1WXZA 3I6GB 1EEZA 3RM8A 4ZQOA 1YEEL 1BZOA 3RCMA 3OAWA 1JK9B 4GVGA 2HAZA 2FNBA 4WUKH 4O14A 1G7QA 2PXYD 1N5AA 2EVIA 3FKUS 3N29A 3V9EA 2ZFAA 2IBZX 2AXJA 5FCUH 2M2DA 3WV0A 1R46A 3TJHD 1EQWA 1JNNH 1D2KA 2GKIA 4X99A 2GB2A 1AGBB 4GG6A 4MKVA 3L3JB 4Q3MA 2W60A 4IKJA 1N4XH 3PPGA 3M0YA 4JN6A 3X1EA 1G6RL 1GPOH 3VKJA 4PTTB 3OVUB 4HBCH 5F7BA 1XLCA 2IAMD 3HG0A 1QOQA 1E4KC 4ZSOA 3U2IA 3RGBA 2HK0A 3BIAX 1Z8AA 3GK0A 4NAFA 3IIXA 2QW5A 1F97A 2VW7A 1F3XA 2MNWA 2WUBH 2CUHA 4YO0A 5HAOA 4XXCA 4BEQA 4NKMA 3U7BA 1GYVA 4L4VE 4LHUD 4GUJA 3G08B 1JGDB 1L6ZA 1NKGA 5FA4A 4FI7A 2VC2L 1NGZB 2POTA 3SN1A 4MWAE 4QXGL 3QCVH 5BVJB 1XFBA 1PFCA 5IMOA 5C6WH 5HULA 1HEHC 1IAIM 1XGYH 4JFFB 2H7WA 4KX8A 1EJTC 1FWRA 3W7EA 1IC7H 1GW9A 4C6JA 2CLFA 3QC3A 1DV7A 1S3RA 2X3AA 3LZOA 1AI1L 3BDKA 4ATWA 2A1YA 5EFFA 4DVOA 1BF2A 4F33A 4D9PA 4HQQH 4NPYA 1MO0A 1JPKA 3SOBL 3IVTA 4FB7A 1E2WA 2Y7EA 1Q6EA 4IQEA 3GUTA 4FTVA 4L6OA 2GVLA 4UWMA 3UETA 3AZUA 1TUFA 4BBWA 2NX5A 2L5HA 1KLGB 2QUVA 5EPMB 3S36L 5JMRA 1BYPA 3V9CA 1YEJL 5TIMA 5KYUB 3S6OA 4AV4A 2AFNA 5KYWA 5E8EA 2ZSVB 4BH8A 1W6TA 2VDRB 3FUFA 2P8MB 3VCNA 4QTHA 4URTB 2PB1A 4MJJA 3RR1A 3FTVA 5GGRB 3C6EA 2UYLB 5I26A 2OTUA 4TQIA 2ZCGA 3MNWB 3QPYA 5D7LE 4U1SB 1N18A 4W88A 5T3ZD 1DSFL 2VCOA 4J4KA 3CIAA 4BUGA 1OCQA 3B83A 2C7UB 3QDGD 3KUMA 4MSWB 2V33A 3UY8A 4PRWA 2DQEH 4PSPA 5AYYA 2P5EB 2C9PA 1NWPA 4Q8PA 1KSRA 4RDVA 3H9HB 3T40A 3CFBA 2IKGA 1UACL 3NM1A 4ONHB 2YS4A 1R3IL 2V3GA 5F8QC 2Y69B 4JDTL 3JWDL 1BQHG 1FC1A 3CVIL 3KEHA 4GMTL 1QFEA 5DJ0A 3FY1A 5HJYA 2HJPA 1UENA 4NZ4A 3FU9A 2XG4A 3SDYH 3X3FH 3TJEH 1AG0A 1ZS2A 3QPXH 3PQYB 1C91A 8RUCA 4IDLA 2BJML 2X1QA 1A7OH 4HS3B 5D37A 1W0MA 3QA3A 1WBYA 4A2DA 4X7EC 1O12A 3I6RA 5HHOB 2BGQA 3UJFA 1Y65A 4HZ6A 1KD0A 4I3SH 6FABH 1ADWA 2QKFA 2B2XL 2Q6WA 3NFNB 5FM4A 2IV8A 3FTGA 5CBAA 4KKAC 4F2MB 1OTTD 4DN4L 1OEPA 1CC3A 4TPRL 2VZ1A 1XLBA 1WXYA 1BQGA 4CCDA 4MDRA 3S5LG 4OJYA 1F9CA 5IMLA 3GVGA 2YZ1A 3NAAH 5CBIA 4Z7VB 1Z89A 3CUHA 4M02A 2YA1A 4AKOA 2ARJQ 5KJ4A 3APCA 5D7IE 3V6OE 3EGJA 3AABA 1ONQA 1L6SA 1MQ8A 2E7HA 3VB9A 1Y8BA 1P5UC 3N6HA 2HVNA 2DH3A 3OMNB 4FNUA 1HEJC 3NEEA 4F8TA 3RL2B 3UBXG 2CG9X 3N85L 1EQPA 4HWZA 3U2JA 4F3FA 2VCCA 1ZLUK 2NQLA 4WHYG 1MFEL 1JWMB 3GNPA 3PAYA 4LSQH 3MHZA 3C2AL 2YD0A 5DJCA 1SN2A 1ADQA 1S4IA 5HYJE 4D9QE 2WMJA 4DWHA 1FX6A 1EQCA 4O2FA 3WY1A 5EO0B 5JIHA 8FABA 1DFBL 1RZMA 1E4XL 25C8H 2IALA 4GIOA 3E0IA 4F20A 2CHRA 2INEA 4FXJA 3V7AE 3CUPB 1RU9L 5AC8A 2F5AL 4NKIL 1SZRA 3PVFA 2Z7KA 3QWNA 3B7UX 1TJHH 1MAMH 2CQVA 1TR7A 3U0WL 2VM8A 1X5AA 1KNWA 1GONA 3IGXA 3BAJA 3UTZB 3PU7A 4YEFA 2BZDA 3CLEL 5KYYA 1MCPH 1DQKA 1HL8A 3M43A 3HC3L 1EPFA 1T0OA 3HE6D 2CNYA 2P42B 2EDLA 2C1OA 4HGWB 2WTPA 2DEPA 1VFAA 1B4EA 1YXCA 3S36X 2WLIB 4MGXA 5GRUL 3CB3A 1FDZA 2YXGA 4S2BA 1SHSA 5HD8C 2N3JA 4CQBA 1SJMA 3FMGH 1UR4A 4HX1B 2PF0A 4I0CC 4HK0A 1FXQA 2QDGA 5DC0A 4LVAA 3T0TA 2ATAA 3CVHH 4LLUA 2NY4C 1GOHA 1GL4B 4P3DA 4L4TA 1OP4A 3RZCA 4DJEA 2B7OA 5C0CB 4Z7NE 3NSNA 2XZ9A 3IJSA 1J5TA 3NIFF 4DI8A 1REIA 5F7DA 4GIYA 1KBJA 4PTWA 3MUJA 5F96H 3ZVHA 1TQWA 1XHGA 2PDGA 1WOBA 4NFCA 1YNKH 2F9BT 1KTNA 1UJQA 5C71A 4NKOA 1WYIA 3H4GA 1HQRA 1Q0EA 3ES8A 3LRKA 1WC7B 1RL1A 1T8QA 1US3A 3DARA 2V5RA 3GU2A 1YQVH 3OLGA 3VXMA 4PTXA 5DRNA 1BAFL 2ODHA 1BWWA 1QRNB 4E3TA 3VXRB 1EUAA 2V8LA 3LZFH 2BIMA 5I77A 4OOZA 2BS8A 4PJFE 2VRAA 3EOBA 4F58H 5T9BG 1I9EA 3FU7B 4ZK8A 5LGYA 2WV3A 3BT2H 3N73A 3THAA 3GG0A 1J4EA 5IVXE 4PG2C 3TTQA 3VOHA 1RK6A 1WRFA 1BYAA 3VCLB 3QEQB 5E6SB 4O9HL 1F1DA 4FEIA 5JXEA 1A4LA 3B8IA 4KEVA 5JR1L 4HK7A 2CRIA 2B0SH 2FB3A 3PCYA 4XISA 3FK3A 2X4PB 3KCOA 1SY6H 3W83A 4G9DA 1VBUA 1YNLH 35C8L 1EXHA 1PUDA 5MERA 4WQ6A 4MNGE 3ABQA 4ICXA 5D7KE 2TSBA 5LIUX 1GC1L 3NCEB 1UJ3C 4IK7A 5EZLB 5IR1A 1SM3H 2ZBTA 4HISA 2FVMA 4O8AA 1UW9A 3BEVB 1QLEB 3RWFB 5KSBB 4FFVD 4AAJA 4TUKH 1Q9WB 5CP7B 1ONXA 4MA8L 1ZENA 1I1AB 4HPJA 3WXVL 5ABFB 1O6SA 1KDJA 2VFHA 4PR5A 3RTLA 2QR6A 1RLDA 2Y06L 3G5VB 3AXHA 4X6DE 4YHML 3MRBA 1HL5A 3QI9B 1OABA 1OAUH 3FN0L 3PZIA 5A2FA 1JVLA 5HI5C 2HG5A 3N6QA 3UZEC 4MM1A 4N2LA 1QATA 4IQHA 1KGYE 5EN3A 2B9BA 1PE1A 3SGKC 4K23H 5FF6A 1BIIA 4OSUH 4GRMA 1UMLA 2DQCL 3H0TB 4FL4C 3OGSA 4DF0A 3F2LA 4PJAB 5F7WC 2Q87A 1AJZA 1GGUA 1C8YA 1U1UA 1AHMA 9CGTA 1ZBCA 1BFNA 3E3HA 4HJJL 1OX6A 3BMXA 1R86A 4H9UA 4WHTB 5K3VA 4U33A 3QQ1A 1TJXA 1GQNA 2X7VA 5DC2A 4UTBH 1J9YA 2N7AA 3FU8A 1UEMA 4JY4A 4O0KA 1AZUA 3GLEA 1MXDA 1F73A 2ZXAA 4F48A 2BDNL 4XNZB 3UFIA 3DGGA 1DVFB 1JCVA 1U5HA 2CWNA 1IRAY 3T6QC 2A3AA 2Y07H 4FXLA 5IB1B 3BXWA 1W8GA 3GMMA 1CICD 3KYNA 3GK8L 2P88A 4XIAA 2X4UB 4DEPC 4Z3IA 2XG9A 4HA0A 1GWJA 3UIZA 3CHQA 1I7TB 2HB0A 1DVQA 2QF7A 3KPSD 3W5NA 2E7MA 3VFSA 4PJ9C 3QQ9C 1SYTA 2BP5M 4RIRB 3E6EA 4M1GL 4U6TA 4AZCA 1KIUA 1DIDA 2BW5A 4ATTA 1BAGA 1SYVB 2B08A 1KENH 1Q1JH 1I7UB 1RZKH 5DWUH 2GTWA 1EAJA 3NSYA 4KDTA 3SQLA 3AWNA 1S7VA 4PLKD 1X6UA 3QJQB 2IH8A 2R94A 1RQHA 4RQQB 2ZQ0A 1K2DA 1YY9D 3SGDI 1QMUA 3LZLA 1JZGA 3B6SB 5DMJB 4EAMA 3J2PA 4NUQA 2AABH 4RA3A 4YXHL 1CLOL 3N9RA 5E9DB 3FJ6A 3WLSA 1EMTH 4AL8H 1I53A 1RAKA 5I1JH 4JRYE 5LG1A 3NRFA 1S5TA 3I6LD 4H8UA 2IV9A 1FL6A 5I3FA 4TO8A 4S39A 1NCAL 3IU3A 4G8IB 3WUFA 1T41A 4MJMA 5KVGL 3MNZA 4X2RA 4M7ZC 1L0YA 5E1HB 5C07E 2X42A 4HETA 5I7GA 2ACQA 4PYSA 1HL9A 1LP9E 1CNVA 2QUUA 1HKLH 1VRSA 5A8NA 3NABH 3L5XL 8TIMA 1BP3B 1W3TA 2NZIA 2QCGA 2A1WL 4TOQA 4G8EA 5TTRA 2UZIL 3NJVA 5TFSL 3MYJB 1OCWH 1LWHA 4IIHA 1N9PA 1Y18A 2P5EE 5DHVH 1BZQK 5EBMA 2A6IB 2PGEA 3RX9A 5DMIH 2BVQB 3PIQB 4HTBA 3RX4A 2F5BH 1XP3A 4WTWA 1Z48A 4WWOA 4G11A 3CHVA 1YEGH 3ULAB 1HJCA 4MAYC 1DQLL 4H20L 3KM2A 3AMGA 4B92A 2XZAL 4GOAA 5DJYA 2XNAB 4AXNA 3UPBA 4A2MA 1UZHA 3D4ZA 3NFPA 5IXEA 1RZPA 4Y88A 4I9WE 2WKLA 3VDHA 5DYFA 1D3GA 3LZPA 1JZ2A 1FZOA 4F2ME 3JZUA 1SFHA 1PF3A 1R34A 3JR2A 7TAAA 2AF2A 1U42A 4RZCA 1GMEA 3LCYA 1I1CA 4F8XA 3NZHH 2D4DA 2A7PA 5E2VH 3LY0A 2PTDA 2XWCA 3ML9A 5EUKB 4LOCA 3DX6A 2CHZA 5DXWA 5ESVB 3IKCB 4WGXA 5J6GA 3CFNA 4XB8A 3MS8A 2DQGL 4HULB 1J8HE 2D24A 3SRHA 4AENA 1J10A 2PLTA 5C0FA 2ADJA 1W72B 2YUVA 3VM7A 3IIZA 4MKNA 4JFDA 2VL5B 2W9DL 1REQA 4LDEB 2E9MA 2BNRA 4Z7QB 3WEAA 3ARDD 4AD0A 3EA2A 4FEMA 2WCGA 4OQ1A 1NC2D 3PJNA 4ZNEA 1FYTE 4YCPA 2CR3A 4AZGA 3G5YA 3IYLW 3UDWC 5IT2L 4QG9A 2ZCKL 2MWCA 3RDTD 2PDMA 2YD6A 1RK1A 2Q10A 5IHSA 1WBZA 3MI6A 4V15A 4DP7X 4FEZA 2NWRA 1JYVA 4QHRA 4MB5A 3ABZA 2DZEA 2FBJH 1E6PA 1C7TA 4S3KA 1JPSL 1C9SA 1I6NA 4A63A 5FKYA 5CD5D 5CEZD 4U0RB 5AW4B 2PDYA 3GUFA 1OAKL 1QYGL 4XPFH 1UPPA 4N86A 4OZFB 1AZVA 5CHNA 3AU1A 3H42L 1PMYA 5KSAC 1EOMA 1N0LB 1I45A 2DZPA 1TITA 5HQMA 3WQDA 2QKIC 2M26A 4HBQA 4DZHA 1Y5WA 1LDCA 4GCXA 2WLNA 1E8XA 5E2WL 1JTTA 3H7RA 1LDPH 3MV8D 2DZAA 4RDYA 4AWSA 3J27A 2O7QA 4OFCA 4JHMA 2P53A 1OO2A 5A6BA 1F6PA 5IG7B 4HHWA 3ARWA 5SV4A 4G8AC 4Y5YC 2R56H 5CSUA 4WFHD 5T1LD 1OW0C 2YC1A 4OV5A 2SEBB 3FKRA 3UZ5A 4PGDB 1KGUA 2EEDA 4KROD 2XTJC 3EOAA 2VDLH 3PZOA 5CJBA 1A4MA 3L0GA 3WF1A 3S35L 4AJWA 4JQIH 2ADFL 2OW7A 2BZCA 3LN9A 1VHPA 1X5ZA 4JK0D 4OGXL 5KYNA 1II4E 1OM3L 4PWIA 3QQ4A 1CGVA 3UABA 1E56A 2QMKA 5EKYA 3E6HA 3L7EB 3IMSA 4N8CL 2XA3A 3FRPA 3BLLA 1P4UA 1IAMA 5HHQA 3NSXA 4MZIA 3THMH 3REQB 1UXSB 4UTJA 1WBHA 2MQ3A 1T6BX 3QUMB 4PV8B 4MX7B 3A3XA 3VXRE 3AMLA 1GT8A 2ZUYA 3LI0A 3WI9A 4N6EA 1YEDB 3QSKB 2GSGA 2XPKA 3QFDB 1AR2A 1M9WA 3EAUA 5JOFB 4CDGC 4RBPK 3UWQA 2OM5A 4I18B 5F9JB 3OXSB 2QF8A 4GAGH 1B9BA 5E8DL 3FXYA 1T0MB 3FUNA 3GSNH 4LCWE 3D3VB 4Y4FC 4MXQC 3P61A 3D39E 3PHOA 3EF4A 4JTJA 1VCFA 3PABB 4NOFA 4EI5A 3VI4F 2Q8AH 3CFDB 4S2CA 3LEXB 1I8KA 3V6FB 1WGOA 1JNHB 3PZMA 5C0QA 1TREA 1MNUH 3HUJE 5IQOA 3BJSA 2EDXA 3QEGH 2PWEA 3IBEA 3KOZA 2UWEA 4R26L 1OFDA 5CAKA 4N0FB 3ERPA 4NZTL 5IQ7H 1P5VB 5MENB 1KV8A 2J7GA 3F01A 3TZNA 3CO4A 4KPLA 3WLOA 4BKLA 2D2CC 5F3BB 4PJ8B 5A3IC 2W91A 3BAYA 3N3EA 3DX7B 3I9PA 3IS1X 3BH8A 2IMRA 1UIPA 1M1XA 2X4TA 3MREB 2HBVA 4GP5B 4PG9B 4XO8A 4IF2A 3GMLA 1S5IL 4YAQA 3ULUH 4F79A 1G4RA 2VUKA 1ZTXE 4FO4A 3W7OA 4GI6A 1MUJA 2NTSP 4HIEA 4NX0A 1Z41A 1DBAH 5HHME 2UZXB 2O1AA 1KB5H 5DQJA 1T03L 2EC9U 4Y5VB 2EICA 2YAHA 2DRUA 2PTWA 3MRIA 4TVPD 3KLLA 2MTAA 2X4NA 3HE7B 1PY4A 4QRRE 3O2WH 5CCZA 2ZYSA 1SEBB 3BUPA 2H1XA 2N1KA 5CZXC 3TH6A 4Y7EA 3VFVB 3FO0H 5F88A 1I1YB 2MQGA 1HCVA 5LIXX 3CXFA 5H6HA 1MJ7L 5U4NA 3O6KL 2DSKA 4LMQI 2NNFA 4JGDA 4WDXA 2OSLA 1CFQB 1DWIM 1LWRA 4P8VA 5FO8B 2C9RA 1LBMA 4TL5A 3R4RA 5C08E 5F4SA 1XGZA 5IKCB 2YFNA 3C8NA 2KERA 1J8SA 1QR1B 4MWAA 4YSPA 4ELKB 3MRGB 3E8VA 3S35X 1TZGL 3EOUA 4LSVH 3V4UH 2FAUA 2YD2A 2WZMA 2EC8A 3IMWA 4XPAL 5L8LB 1XSIA 3WDQA 1S9KC 4BE6A 1PZ5B 2JJWA 5I1EH 1UR1A 1Q66A 1PKQB 3G6DL 3RJOA 4TULL 1IBZA 4QRPD 5KBPA 1CN4A 2VHLA 2OT0A 4KRTA 5CC7A 3LH9A 3VFRB 4WJ8A 2ICWB 2DEYX 4UAOB 5IHWA 3KL5A 3CHFA 2GABA 2E5EA 5F7EL 2V5BA 5HQLA 2DLTA 2XWJA 3Q6FA 4QF1B 1XIEA 1TJRA 1V10A 3SZKC 3I4KA 4TX6A 1S7WB 1TTPA 1HGWA 2KZWA 4O5LH 1TELA 4M43L 4M7LT 3K4ZA 1D6VH 4HUCA 4PUMA 4ZZKA 3O9WB 5GGSY 4B5TA 3PYCA 5D7LA 3BPOC 4JIEA 3QUZA 2QQLL 4B6ZA 1JGUL 4NSKA 3KYKL 4P5TA 4LSDA 4M7JL 1YDPA 6PAZA 2CNCA 2HT2D 5HD8D 5GS2H 5CILH 1CLZH 3FFSA 2AEPH 2G97A 3T3PE 3ATEA 5E6ZA 4WSJA 4IRZL 4OJAA 2Z65C 1J2WA 4QLLA 2NY4D 5CGMA 5JHLA 2FGWH 4HIHA 3EUUA 2EIZA 4RFOH 2PP8A 3ZE0B 4PBVC 2OLSA 3QJXA 4R2GB 3O0FA 5E5CA 1Z2KA 4P8XA 5I18H 4KH2A 5C0BD 2XWTA 3WH7A 3L08A 4JE0A 1UBPC 4PJHE 1MCSA 1GGOA 5C9XA 5AUMB 3V4PH 3S9ZA 4P2AA 1DE5A 2OMXB 3U6XS 2DSUA 4E9LA 4Z9KB 3NQDA 4HIPA 4XMUA 1AODA 3C6SA 5CKSA 1AXTL 1P0SE 1ASQA 3BSZA 3DPDA 5D1XC 4A2EA 1NDGB 1Q8AA 4GIEA 3BRDA 1J5OL 4GS7C 3CQHA 3BTNA 3UBXI 3A3WA 4JO4H 4FXGB 5EMUA 3DVFA 3KPPB 5EORL 4H6EA 4M48L 1E6QM 4QRQB 4NO0B 1INQA 4HKXA 1RY7B 3ZM8A 1P9MA 5D7IA 3W88A 1OTSC 1U8JB 3MRCA 3V6OA 2PDUA 5TDNB 2XN9B 3EOTL 1E9OA 2H2SC 1AAJA 1HJUA 1J05A 3MFGB 2DSWA 3L48A 3V5HA 4CQCA 5HHXH 4NCC2 3CSFA 1JPEA 1X7TA 2RGSA 4GWEA 4WXYA 3QRGH 1T5WB 3TTEA 4QOKB 3FCSB 1M6OB 2X1RA 4Y16B 1EC7A 2P0IA 5JDSB 5I2IA 1B88A 4IUGA 4CMHC 1UZ4A 3Q01A 1SLVA 4LVFA 5EZIH 2WQPA 3PUEA 4REQA 3KMDA 3VE0B 1KPUB 1F3DH 4M6OL 4YC2B 2QXWA 3MRDB 2HVJA 4LSPL 2BZ7A 3DZ1A 5JBFA 3NACL 5F2MA 4ORIA 1IAOB 1FNLA 3PWVB 4Y1TA 5I8KH 3N25A 1EBGA 5CSGA 3SGEI 2AXGB 3NCYS 5AHEA 3BIKA 3VI3F 1HIML 1LYQA 4CUCA 3REWB 4FZEH 3QG7H 4DP0X 3DESA 3IMUA 2YAEA 4EK7A 5A5WA 1CF8L 5HI5D 2QIIA 3W9EA 4YBQC 5C0DB 4XCCH 3UH8A 1A4KA 3BYYA 5DJ8B 3F7YB 1F6YA 1W1B1 1HCFX 3F5JA 4X5WA 4X5LA 3THUA 1EBHA 4PJDE 3JV4B 5JNYB 4FG0A 1MQKH 2IDCA 4HWNA 2YXXA 3V5DB 4FKKA 1UB5A 1N70A 2HYMA 1QDSA 4PGLA 3KOWA 4R83A 4A21A 3VGBA 1AG1O 1U93A 5IW6A 2O5XH 4OF7A 5FAJA 3FNKA 4GG8B 2GQ8A 4GRWF 4P04A 1QBBA 1A6AA 3QBUA 3LCLA 4RFNB 2CRZA 4Q6IC 1U8LB 3HIZA 4B5EA 3SE3C 3BVNA 3CFUA 1RZ7L 3TOYA 1FG9C 5ALCH 1JPIA 2HKAA 2BW4A 6CGTA 4LBEB 4XWGL 1H41A 3WCYA 1T7XA 5G4OA 4PVMA 3HTLX 4G5AA 5I8OL 2EXSA 1Z9NA 4XN7A 3OEXA 3GPEA 4R5XA 3LBMA 4PJBF 3O3UN 5H35B 3L1GA 1ISWA 3G1AA 1NOWA 4PJ9D 3NMEA 2DQJL 4B9KC 3QQ9D 4PJFA 1EGJA 1FFPB 1BTCA 1K5NA 2YK1L 5FO9A 3WCZA 1EO8L 2J77A 5EUOF 3SRDA 3U0HA 1R5IB 4OLUL 3IS0X 4YK4C 4DP6X 1HL4A 1CGSH 5J12C 5L7XL 4EWND 1S8DB 4N0YL 5I1IL 3BDXA 3ZUNC 3CHOA 5IJVB 3DBPA 1LWIA 1JXKA 1HJVA 4DH2A 3DGRA 3AG3B 2H6PB 2F7FA 4XKYA 3L67A 4J23A 3L5AA 4MNGA 1ZLSH 4P4KB 4URKA 5LAXA 3EYUL 3WEXA 5JHLL 4G71B 1AZZC 4KI5D 4KY1H 1Q94B 3GBDA 4E9RA 5I1GH 3WLRA 4GKNB 3GSWB 4ODHL 1L7IL 1KW1A 3BWZA 4WEMB 3PFUA 4PJIE 4X22A 4F0KA 1JN6A 1NBVH 1SMAA 1FH8A 5DSCB 1LEKA 4ZQTA 3MMUA 3HG1E 3D51A 2OPJA 2WMKA 4GJJA 2VITB 2R91A 3M41A 4AQAA 1Z5LB 3W6YA 4CNIB 1MF2L 5H8PA 1ZXKA 2R1WB 4X6DA 4WO4C 2Z1VA 4NYLA 4DQAA 2R83A 2D3NA 1G6RA 1LK3L 2CM5A 1NH6A 4N02A 3BSZL 4KCVA 1SXCA 3PHAA 2DLFL 1SOQA 2XFGB 1YAZA 1WKEA 5DVMA 1BLNA 1SUHA 2OK0L 1MY7A 1VH7A 4LY8A 1F4YL 1QFHA 3ARFB 1KZYA 4MLJA 1QQDA 3B5HA 1DBKH 2V5YA 2BCKB 1NAMA 4L1SA 3PZGA 3BWUF 2NLJA 4IX0A 2IMMA 4NS0A 1HFUA 1GG1A 3BIBX 1FVCA 4MAYD 3STGA 1TCDA 4ODWA 2ALDA 1E40A 1JVKA 4E2BA 4PLOB 4X6FA 4GJ1A 5F7FA 1MWAB 3GMOB 3URQA 1ZALA 2R69A 4HH8A 4TTUA 3AREB 3W23A 2CJ3A 1QNRA 4Q7DA 4LSUL 1DDHA 1PAMA 4PRHE 2CKBH 1XIFA 2PCPA 4LCYA 1EX1A 3LD8B 3SSGA 3U4FA 1BW8A 1SDDA 5ALBL 3HI1B 4IRJA 3TH4T 2VDQB 4HZLA 4XXDB 2CBOA 3RA7L 1V6XA 3OR6A 1CFSA 2X1TA 4Z42C 2F54B 1MUWA 1E73M 1UEYA 3GKWL 1H7NA 1B9ZA 5C2XA 4MJIA 4NO2B 1DJGA 2HVMA 1S9XB 5ECJE 2OYMA 3W84A 2Z4QA 3DIFB 4GZEA 1XTMA 2A0LC 1Q6QA 3ECBA 2OMTA 1JVNA 3LKRA 5L6YH 1CMOA 3TA3A 4KETA 3AQZA 3EMQA 2BNUA 1E71M 4YXLH 4DP4X 2FATH 5AVZB 3TZVA 2CK0L 1R5VB 3LLFA 1XGPA 3FFCB 4JN2A 4ETQB 3BPNC 3W0WD 1VLIA 2WMFA 4R3UA 4BHUA 2J9XA 1KJMB 3B2UC 4JMNA 2EBNA 3OGRA 2BSBA 2BHUA 3GFXA 2HH0H 4JRYA 3VRLF 4IPLA 1WCGA 3UYPA 1OQOA 1HU8A 1NFBA 4OKVA 4N2CA 1V7NL 2WBWB 1O60A 3CX5J 7ODCA 3NCYP 3VH8G 1BD2E 4IMCA 3D07A 1K3IA 3PWIA 3C86A 3O2DH 1N0XH 1HJWA 2BDQA 2A9CA 4LS0A 3ARDC 1VIWA 5L2JB 3H4FA 3NR0A 3C5SA 1FGNH 3MB9A 2VW6A 3MOQA 2NTFA 1LP9A 2XV3A 1JNEA 5KSAD 2HJLB 1X8FA 3UTPD 3KYMB 1RP9A 3RDTC 3WKPA 3QIWB 4KPHH 3F58H 3U1PA 1EGJL 4LKXB 5DMGC 1FF5A 4D71A 2WHMA 3VSVA 3D2UD 1U6AH 4ENLA 5C92A 1O5XA 2XINA 4QRUA 5E5MB 1KN2H 4GSQA 4ALAH 4HNVA 2Y8KA 5DD0L 2WYSA 4DF1A 2VERN 1AY1H 2XLLA 2EO1A 3V5FA 3M6DA 4CQ9A 2X2GA 4NQDD 4U1NA 3T8MA 3BC9A 3LZ3A 3DXAE 1MCNA 3SDDA 2HVKB 5JUEH 4MNJA 2JKEA 2XTJD 5D7EA 3CUXA 2IQ0A 3QNYB 3WENA 2CA3A 3L95B 4ORGB 5HUOA 1IGCL 4BE5A 4GYPC 1RZQA 2YCJA 8PAZA 4H88L 4Z77B 5F1NA 3H3PL 3ORWA 4YVUA 3H4WA 2GJLA 2K7QA 3QKEA 1BGGA 4PRPB 3MLPA 1SOXA 4PFEA 2VOMA 1P53A 3CN2A 4Q89A 1VGEH 3AUWB 4UDTB 3P40A 4JVUA 4JDVA 1KIPB 5BPPA 3VC6A 3HCVB 3WEBA 1A8ZA 3MANA 4KROC 2WSKA 4BI7A 3BQUA 3E2HC 4NHCH 2CLMA 4GUOA 3K74B 3IDNA 3PBMA 3UNDA 4H26B 3K6OA 3UROR 3QPKA 1J8HA 4EDXA 5CBBA 1QWHA 3VQ1C 3QLDA 3S5SA 3UXLA 2RCSL 3EX3A 2GSEA 1EFZA 3GNNA 2MKLC 5DYOA 1UQSB 5IHZB 4Y4FD 4MXQD 2CJSA 2OWXA 5AZ2H 4J8RA 5KS9F 2VGIA 4TNGA 2GJZB 3M0KA 5K9CA 3E8UL 3EEZA 3EB4A 1A4AA 3NVDA 1E4LA 1KO0A 2HKHH 1NAML 4D6FA 3R13A 1CVRA 1FYTA 1ZAIA 1IJ9A 1PBYA 1FZMB 3W0KA 2XIMA 1EUNA 4Q4SA 4FN0A 3RWIA 3VDAA 2X16A 4JHAL 5A7BA 3EGDA 3QTPA 1RUMH 1FFNA 1DSYA 5AL8A 1Z9SA 1C7SA 1NEZB 1YPZB 5F1KC 1ZBWA 4Z7WF 4C56D 1AFVH 4PJEB 3USZA 3EDKA 4XP5L 2WLLA 5E9NA 4N8VB 4L1BA 2R69L 1UUOA 2JEPA 1J2BA 3G1VA 1W8EA 3KBSA 1YPXA 3SB3A 5JIKA 5A3ID 4IBZA 1MHPH 4Q0XH 4N22A 4BZ2A 1RVKA 1DVTA 1MUMA 1EC8A 4DUVA 3IDJB 1OT1A 3LEYH 5GRXG 4CBPA 2OXHA 2J88H 1NQKA 2YGYA 2BIIA 2PWFA 3PDOA 4J3VA 2W61A 4OM0L 5I6SA 4F40A 3KPMA 4MPQA 3Q8CA 4XCNA 2Z6JA 1A53A 1RSCA 1TIWA 1JPHA 4XBPA 4AC2A 1S2UA 2EC9T 3OO2A 2VSDA 1EXBA 3ZQWA 1LO0L 2Z3FA 3O8XA 4GH7B 1W31A 2O4MA 1G67A 3C08H 5C6PB 3TCLA 4PMUA 2DQFB 4B9CA 5BWAA 3HIJA 1DWGM 2XN2A 3EJSA 1NDZA 3HC4H 5JO5B 3W1PA 3RQ3A 1AKJA 3QHOA 5CZXD 2NY6B 4N0UB 5M1TA 3Q8BA 4AWEA 3T2OA 1Y1UA 1AIFA 5GRJH 4IU3A 4MYPA 1OE3A 3WY4A 1X1OA 1UATA 5IOPA 1A9EB 3KVKA 4QLKA 2GSIB 1KELH 1M05B 2E8YA 1JFXA 2VISA 5I23A 4DZ8B 2H9GB 5BMFL 4ZS7L 2QHRL 4AEOA 3ZKQD 2DMHA 3DECA 3QDMD 3NQ6A 5C0EA 1KOAA 2NZLA 4LIQH 1ICPA 2JV6A 2Y6TE 2NY3C 4M5ZH 4X5RA 1JZ4A 3WJWA 3RU8H 2BP8A 4XCYA 3BGMA 3H22A 3S88L 1JJKA 1A1NB 5FOBA 2DQTL 1M7DA 1SXBA 4LCWA 2D2JA 4S0HA 5MKGA 3OZ9L 4P2RB 3D39A 2VDKB 2F9RA 4W6YB 2ZQKA 5T3XD 2P76A 1MCKA 2PF8A 2JKJA 4OIFA 5A69A 2FWOA 4FG4A 3HBGA 4IDJL 1XPYA 3EWDA 3HUJA 3TWYA 3KXQA 3G5EA 4NM8H 5FJUA 5LNUA 3W2DH 4J3XA 4F4RA 1I8LC 4LC6A 2C91A 4RXFA 1BPVA 2OL3B 1J9QA 5EA9A 4LT7A 2HFEA 2IFGA 4YBLC 3WQ6A 4DK5A 3U82B 1GZHA 1A0EA 5I1DA 1PLAA 3WD1A 3MP4A 2G2RA 3CMOH 3HRZA 2XPGB 2WW5A 1E5UI 3NQ8A 4DBSA 1K02A 4NQCA 2D7MA 1U4EA 5CLYA 3SGZA 4OCWL 3DSNA 1MY5A 3G1RA 2OMUB 3E0FA 3L3KA 3BK0A 1R3VA 1YECH 1IX2A 2WNZA 3K1KC 1P1MA 3VIJA 4EUPA 4U1IB 1JI1A 4X80H 4JG1H 2OTWB 3QQ0A 4DAFA 1UR2A 1MJ8H 2ZT9C 4ONGL 3A6CH 4DJDA 4JQ1A 2VH5L 4PS4L 3L1EA 3VFCA 3VTRA 1IKOP 1EAQA 4PJ7B 4MYWB 1HL2A 4EDWL 5J5RA 1J5CA 4XBEL 2OLDA 1NLBH 5CR1A 1MKFA 1T7VA 4MB3A 2W65B 4QRRA 2GUBA 5LNDA 5TK2A 1C16B 3WGUB 1XB3A 2CLRA 4ZPTA 4IP5A 2HT2C 4UM9D 4LC8A 4FQHA 2J9ZA 4A35A 1UWGH 2HUEA 3QHFH 4D8ZA 3LZNA 4NRSA 1SW7A 1FUNA 3KLKA 4TUJB 3TT3L 5BZXA 2DFAA 3MRNB 3OKEA 1N64H 4QKXB 1E9ZB 2XFYA 5HHVL 4BKNA 2EDYA 5D1XD 2O92A 3BHBB 3SE8H 5HDLA 1AS8A 3VFWB 3ZE2F 1UA7A 2PPGA 5I76B 4A66A 3P5YA 1QEXA 4WGVB 3W1AA 2VJXA 3QIBA 5SWZD 4PRRA 5C08A 3IGAA 1X5YA 3WO4B 1T7LA 1PYWA 1JXFA 2W9EH 3M5XA 1TRIA 4NILA 5CJNA 5I17B 1OTSD 4X7TB 5D1ZI 2OGJA 3CZ8A 1AQKH 1BX2A 4K3JH 1CT8A 4BZ2L 3RVTC 1UD5A 4PJXB 2H2SD 1A1OA 1TEFA 1KCUL 4PW9A 4F0LA 1FWAC 4QRTA 2NY5H 2CPCA 5I73B 2OI9C 1IGTB 2KLSA 4LGPB 3O11B 4DO4A 1BXNA 2VXTH 4O2EB 3F4CA 5DMKB 1HH9B 4NWUH 4C6IA 1R0AH 2KX9A 3FO9A 3WIAA 2FYYA 1EJSC 4HIIB 2ZCLH 2ZYRA 2V5TA 2E9BA 1DEEB 3CIQA 4XE5B 4JG0H 3PF3A 4P46B 4AKQA 1ADSA 1N59B 5AW6B 4LCVA 1Z9MA 4WI6A 2IGTA 4XN8A 4EPKA 4GI9A 1FAIL 2W0PA 1EOKA 2QVHA 2R7EA 2YKLL 2V5SA 3NJKA 5AVRB 1LP6A 4NUGH 3C5ZB 4HFUH 4D8LA 5A6MA 3T65B 1XEDA 4J1UA 3F7JA 3T0EB 1IC5H 5GGVH 4FFYL 3ZJ8A 4YBQD 4W7UA 3BXNA 1XHHA 3D7PA 1E5BA 2R0LH 3BV7A 1KACB 4RMVA 3PHSA 1TV7A 1SHMA 2DGAA 4BK5A 1QOXA 4YNGA 1P0EA 2A6NA 5EBUA 5AHFA 2JB6A 2ZWLT 1X1ZA 3FTZA 3CQKA 4O1EA 4GO8A 4JDZB 3B1TA 4RMBA 3BO9A 1B6UA 1GTFA 2ZXDA 3D12B 3QUYA 5CJOH 1BZ9A 4XSMA 3L81A 2C3ZA 3GG1A 3LMJH 1TZ9A 5EY5A 2YZ5A 3O3DB 4R9HA 4LUJA 1TLKA 4PJHA 3MN8A 3JUGA 1Q0YL 1EJRC 5D02A 2JH2A 5CLTA 4L0PB 4WGWB 5DURD 4UINH 2QR0A 1SO3A 4Q4IA 1M57B 2LR4A 3EGXB 4OI9A 3WDJA 2RACA 4D72A 1SGKA 1XXXA 2OU4A 4OQTH 1XAKA 4PV9B 3V7PA 1P84J 4PRPE 4I5BB 4E9YA 4XNAA 3PXLA 3W81A 2XBZA 2PO6C 3HHMA 4OLZH 1BMZA 1A4JB 3OGCB 1L2UA 1QPRA 5FDWA 3JT2A 4L6DA 5C09B 2ED9A 5E5LA 1D3CA 3K2KA 5KSUB 2FRGP 1OGTA 3N42B 2J1YA 5AZ0A 3MJYA 1WT5A 1WAAF 5EIIB 5J1AB 4U1MB 2JB5H 2D7NA 1CE6B 1GKPA 1JGLH 1DJIA 2C1PB 1XCXA 2VL4A 3AYRA 5M95B 3G9VA 3MJ6A 2IPTH 1UZ8A 1BV8A 4K7PH 3AMCA 4LESA 2ALAA 3WELA 2EGZA 1YTDA 4Y9OA 3OKOB 1UZGA 4DN3H 2WLKA 1Q38A 4P99A 3AU0A 5SWQA 3DETC 5F6HI 4K7FB 3IJIA 1ZTXL 2OA9A 4ACPA 5FL0A 1JYWA 2QFPA 2C3WA 3HS8A 4LV4A 2H3DA 1VJSA 3TNNB 1UWIA 4S23A 2ITEA 5BRPA 4JFFE 1TZZA 2CESA 3QC5X 1TUXA 3T4YA 4DWDA 1VJZA 3TYFA 3ARQA 3F2DA 1VFUA 5K9JL 1ESWA 2R23A 1JOIA 1Z6KA 3MZNA 3DK0A 1SR0A 1MCCA 1TTGA 3WF0A 2BVPA 3U2CA 1OTUD 4G3YH 4WO4D 1ZHBA 1VLWA 2DIBA 4L56A 2NT1A 5H4YA 1I3UA 1PTGA 2H41A 2P8PB 4ICNA 4KI5C 4JTHA 2EXWC 3I3DA 2VABB 3EOOA 3E02A 3WTYA 3QO1A 1K8YA 3LYRA 4H2CA 3TXZA 2FPYA 1XL4A 3TVAA 4XX5A 4PJDA 2BVOA 4OI8A 2A5HA 4YCOA 3US9A 1CFNB 2RTTA 4GQBA 4LVOB 3ZIMA 5CO1A 3UZZA 2I14A 4NC2B 4PGEB 3VKCA 3SGJC 5BV7L 3BD3A 4MA1B 3QAQA 2PRLA 4PS7A 1HHHA 1OAXH 3NJXA 3ARBA 4JTGA 1OFRA 1TJIH 4G6MH 5LUMA 1WB0A 1IFHL 2BASA 3AQDA 3MW7A 3SDAB 1K6QL 3QQ3B 4AIBA 3LV5A 3W7NA 1FNHA 1EJ7L 5I5RA 3EAKA 4Y2OB 4FQIH 4JO5A 1GQJA 4KDVA 4X63A 1OLZA 4N5UA 4RLIA 2FO1A 4S11A 4W1TA 5EU4A 5E08L 3HLAA 2WBJA 3ABKB 4PCYA 3V4VA 4M62H 4UTTA 5J8OA 3NXFA 5CEXB 3KM1A 1JVOA 1AXSA 3BKCL 2MPVA 5MHBA 4PL1A 3H85A 4B5ZA 3TWCH 2I16A 1Y6KR 3QUKB 4JDEB 3PQYE 1OIFA 2JK2A 3QQWA 4NUMA 4NZDA 3GNXA 1XCWA 1N6VA 3HAEA 4Y5XA 4XHQA 3W6MA 4IEFB 1HTYA 1PLBA 4X7FC 1XGTA 1PS9A 2WXJA 5HHOE 3V4BA 2VR4A 2A0LD 3T6ZA 2D3JA 4ACYA