4DO4A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 130
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do4A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do4A01
1XM3A 3EJTA 3CU2A 1H63A 4N02A 4NQ1A 2XN2A 3QF0A 2C14A 3CHVA 1EO7A 2F7FA 3M0ZA 2FHBA 3W88A 4Z08A 3ZFHA 1UJPA 3AMLA 2B7NA 4IGHA 3C3NA 1I75A 1KXTA 1AL8A 3MP4A 3L4UA 3W2NA 1GVRA 2YYTA 3O16A 2F84A 2QR6A 2J6XA 4JTIA 1GQNA 3P7YA 4IUOA 5CZ0A 4K8EA 3AXIA 1B9BA 3E12A 3BH4A 4O15A 1OFEA 4GI9A 2YA1A 1R2RA 4JFVA 2XN0A 1W3TA 3TMLA 3L9CA 3PM6A 4PTNA 2VT0A 2Y7GA 4XZ9A 2WOQA 1W3NA 5D09A 3HMJG 3W7EA 4A2SA 3VGHA 4HIBA 3VO0A 3TNOA 3NZ1A 3IIVA 1QPKA 2JGQA 2YYUA 3HGOA 4WOQA 3RFAA 4O4WA 1MFVA 3RMJA 2OT0A 5EL1A 2NXIA 5D32A 4RXGA 4IXXA 4AAJA 3W07A 5IBXC 1JCMP 2EACA 4J3XA 3W2JA 2Y61A 3L66A 1U2YA 5F7UA 1TCDA 2QCLA 2R91A 4O4VA 3LHVA 1VYRA 4BI7A 4E2DA 3HQ1A 3BAXA 3E49A 4P61A 5HINA 3LXAA 1H7PA 3DHFA 3EDEA 1TMQA 1S5VA 4S1FA 1JCXA 3CWOX 3W7RA 4JR5A 2DZTA 3W7OA 3NPXA 3BG5A 1BVZA 3HGJA 3NOEA 2WVVB 1NF0A 1DKWA 3MI6A 4PSRA 5I3JA 3FYOA 1OYAA 4WQ6A 3LBMA 4BWLC 1CPUA 4OBTA 5EMUA 2OSXA 3BLKA 3OLIA 3M5VA 3LHYA 2DIJA 1LBMA 2ZUTA 4J3UA 3EKZA 3FFSA 2WVVA 3PG8A 1XD0A 3I7SA 3RNDA 5TIMA 3C52A 3M5XA 1KFCA 1OFAA 3BLIA 5I3IA 5KZEA 2VENA 1LCOA 2GQAA 4LS2A 3IEBA 3VGEA 3NQVA 2Y89A 2YFNA 2FB2A 4HSOA 1UUMA 2ATMA 2C13A 3NZRA 3EX2A 3K8KA 1W3IA 2NZLA 1WXJA 2FPYA 3EXSA 3GDRA 1LOQA 3PSWA 4GUIA 1L6SA 4FLQA 2ZUVA 4H7VA 2Q3OA 1VR6A 4AYSA 3QRHA 5CKSA 3OHIA 5A8GA 1G7UA 2QMJA 2W6RA 3G8RA 3R89A 1LBLA 1F05A 1X1ZA 2B7OA 1FWTA 1WOBA 3IIPA 2Z0IA 2P10A 3OVQA 4E0CA 1YADA 4Z1BA 3MUXA 3ECQA 4K8HA 3NQEA 4OJYA 5CXPA 4WD0A 2WNWA 1BKSA 2QPUA 4FNSA 2Z6JA 4QNEA 3VNYA 3OA3A 4HKPA 1LP6A 1KB3A 3K1DA 1ZAHA 2DZVA 3B04A 4Q4KA 1ADOA 1Z48A 3EWUA 3SGZA 2ZZ5A 2WKJA 3CIWA 3TXZA 1KGUA 3EB2A 4M6QA 5D2XA 3W72A 2G5WA 3UNDA 2EADA 4UUIA 4M19A 1CLVA 4RR4A 4GBUA 2D2OA 1EP3A 2F7RA 1MXDA 3EKLA 3V1PA 4AB4A 5DCBA 5G4WA 1ODUA 3C8FA 4PC8A 5EKYA 1JGIA 4O1CA 2EAEA 3WY1A 4CQ9A 2VFEA 4GO8A 1KM1A 5E9AA 5F2GA 2X16A 1E3ZA 1VRDA 1KV8A 3N9SA 1KGWA 1EIXA 1L2UA 3BVUA 2NUXA 4FLRA 3TQ0A 4LVFA 1UD6A 1R34A 1YTKA 3S0CA 5H2ZA 1VB9A 2HS8A 1QOQA 5A5WA 2Y7DA 1P0KA 1SUXA 3GDLA 2X30A 3GZ3A 3DX4A 2D0FA 4NUWA 1HTIA 3BSHA 1PZ3A 1A5SA 2PCQA 3EXRA 3I65A 3GKAA 5ABTA 5LHEA 2E1DA 1I2PA 2X1UA 1WAUA 1UA7A 4UTLA 4IPIA 2CZFA 4MIMA 3L2MA 1P4CA 1R46A 1VHCA 1OHLA 4M6PA 3GNNA 1K8XA 1PVNA 4J28A 4FXSA 4LQ1A 2EKCA 1LTDA 3LCGA 3TV8A 5CGMA 2NV2A 2VOMA 4UTTA 4UTJA 3HG2A 1GTEA 3GR7A 3LI1A 2EHHA 2A2IA 1JD7A 1Q6OA 5BW6A 1G94A 1A5BA 3FJ6A 2YXGA 1FY6A 4K36A 1NFBA 3KVLA 5F4XA 3WN6A 1MEHA 3W71A 3DAQA 4RV8A 2XFWA 3GAYA 4N9CA 5DO8A 2E8ZA 1DHKA 3CB8A 2W79A 4GXMA 3LTYA 3VMPA 5BRPA 1VCFA 3P60A 2JBMA 5AYZA 1OF6A 2V3FA 3II1A 1SW7A 4N9EA 5KZMA 3HOJA 1M7PA 1MEIA 4UIOA 5F2LA 4NX5A 2ZA1A 3IJ8A 4TU1A 4O12A 2DH3A 3OBKA 4R34A 1X8FA 4W9TA 3R12A 4QM1A 4MZ8A 3EWXA 4I7UA 2A7NA 3BUBA 1ZJIA 4JL2A 3T44A 1XV8A 2RH9A 3GLCA 1EUAA 2VFHA 3UZJA 1F76A 4LVBA 1WP6A 1S3HA 3THQA 4OGZA 2WNNA 3FAWA 5TD4A 4LW7A 1OX6A 1Q6RA 2ISVA 3W7KA 2CW6A 2XWDA 3UG3A 2G95A 3B05A 2Y7EA 4AF0A 4NNCA 3TOPA 4ZL1A 3FA5A 3DFQA 3DDGA 1UKSA 1FX6A 3LV6A 1TQSA 3I7RA 1XXXA 4OU1A 1HO4A 2BXYA 4IQLA 3VU2A 1ZALA 3HGSA 1KBIA 4MJMA 4LVDA 3W2KA 3TONA 4Z0SA 3TFCA 1EP2A 1PJ9A 1JJKA 1H51A 1WOAA 4GE8A 3VGDA 2QCDB 1AMKA 4KWWA 1H7WA 4ZQPA 1OGSA 4MZ1A 4L4MA 1JI2A 4ADTA 1SMAA 1W1ZA 1QFEA 2V2HA 2WVUA 1W56A 3S8HA 3EX6A 3K30A 3CLMA 4MYAA 3RLVA 3GXPA 2GPTA 4JN6A 5K9DA 3CZEA 2OYLA 5KEZA 4HA1A 1C9DA 2ZX8A 4YWIA 4MUZA 4MY1A 3KX6A 4LRTA 1KLYA 1AMYA 4UTWA 2BY3A 1DOSA 4LC8A 3BGGA 1VAHA 3OLDA 4HNNA 2NWRA 5HNRA 4WOZA 3TK7A 4JIPA 4J3SA 3NQFA 2EGZA 4AIOA 4C1KA 3CZGA 3KRUA 2NXGA 1JL8A 2JKEA 5DCDA 2V2DA 4WXYA 3BW2A 1QO2A 4R33A 1W37A 3GXMA 1OFOA 3R2GA 1VZWA 1YDNA 1KM0A 3W83A 4PCFA 4MAZA 3W1NA 3TW7A 1EUNA 4N9DA 2OJPA 3U2OA 2CLEA 2H8ZA 1V7YA 1YXYA 2XVKA 3EJRA 1XCFA 3G1HA 5KSWA 1JRBA 3IRDA 1WO2A 4NJKA 1PAMA 5FI8A 3W7DA 3DFPA 3GR8A 1P0NA 2ZZ3A 3D52A 3DBPA 1H62A 3IJ9A 1XBXA 1T8XA 1KA9F 3KLKA 4HPXA 4HOWA 1FCUA 1NM9A 5E93A 2C1HA 3GDTA 1G5AA 3DFSA 3A24A 2EABA 2YX0A 3IIXA 3ZWSA 5KTLA 3W7IA 4YLWA 7TAAA 1JR1A 1G6CA 1VQTA 1G4SA 3ABOA 3BG9A 3GDMA 3D4ZA 3G0XA 3W1TA 2WPGA 3BLPX 1KM4A 5I23A 1SO5A 2YFOA 4D2JA 1K7XA 4WY0F 3CT7A 2C6QA 4OQVA 2NSXA 5HWJA 1C8QA 2J9XA 3HZ3A 2V0TA 3GTNA 3B0PA 3WDJA 1CIUA 1IXPA 3I68A 1VCVA 1CXHA 2DZPA 1VLIA 3QQ1A 4J27A 4LY8A 3WNNA 3AJXA 4JFTA 1K8ZA 2CZDA 5AB3A 2X2HA 3WY3A 3CGTA 4CN6A 3L5AA 3HB9A 3L5LA 4Z0JA 2ZDRA 4LTSA 4UNIA 4O13A 3D0CA 2YZRA 4BZYA 2OMAA 5LNUA 5G1TA 4S2CA 3DHPA 1DEDA 3L4VA 3MI2A 1XH0A 4Y8FA 2G97A 5DBUA 3STEA 2E77A 3TROA 3LV5A 5HXMA 5G5IA 3HPXA 4NXSA 1HG3A 3O05A 3LPPA 5I3FA 1MWOA 2C8NA 1JCJA 5D2WA 1OT2A 1XL9A 3SGUA 4CCCA 3VX0A 1FDJA 1X1OA 1D3HA 4CCEA 2OW7A 1F6KA 3KL0A 2ZUUA 4M8UA 2QKFA 3MO7A 1F73A 5FF2A 1TRIA 1FDZA 1A5AA 3PBYA 5TBOA 1P5BA 1TJRA 1SW3A 4U3CA 1QW8A 1IGSA 2PWDA 3A23A 3VCRA 3G1XA 1GVSA 4JNMA 2RDUA 3O07A 3ELFA 1BPLB 2ZUSA 2ZYFA 1W5NA 3VI2A 1CXEA 4EWND 2BHYA 2IGTA 2ZZ7A 2J9YA 2V8ZA 3W87A 2YOCA 3SJ3A 3LHZA 3UG4A 3NL3A 5CZJA 5AFDA 2BXZA 4GO9A 3WEOA 3TCEA 1PZ2A 1JDAA 2ZX5A 2B7PA 4GC4A 1JF5A 4EVZA 3VMOA 2FQIA 1KWKA 1JRCA 1TTQA 4U2YA 2D3LA 2QCHA 3W7MA 2CPUA 4DF1A 2QJIA 3NL5A 1L9WA 3QW3A 3CZSA 2WSPA 4JICA 4EF8A 1MXGA 1H7OA 1YTDA 3WJZA 1TYGA 4JL1A 4AHOA 3UD6A 5HJLA 3D51A 1K7FA 4GRSA 2DORA 1UD8A 3BPWA 4CGTA 1J0KA 3KL5A 2WSQA 3A9IA 3EWWA 1A5CA 3LCHA 2QDHA 3O63A 1MW3A 3NPWA 1DL3A 4LXFA 1E43A 1O95A 3H54A 2G3MA 5KMYA 3FAXA 4WY0B 3SI9A 4KWUA 2KZHA 3UY8A 1TPUA 3EX3A 1UH4A 1GTHA 1QR7A 4WXZA 3LHTA 3PSVA 3MP3A 1UD2A 3EEGA 2RHGA 2DJLA 3PB2A 2D73A 3KLLA 4EIVA 4LRSA 4FHAA 3UWQA 2C19A 4PH6A 4JGDA 1FCQA 1K03A 5GVJA 1CX9A 4S2BA 3WNPA 4LT9A 4FEZA 3EWYA 4N4PA 1PIFA 4NJJA 1PS9A 3CIXA 3N2XA 3M5YA 4K6AA 1DQWA 3EJUA 1QCWA 2QDGA 2Y2WA 3NEVA 4JTTA 4UTMA 2V82A 1JAEA 3P74A 1U33A 4IXHA 1R75A 3PBUA 4MFEA 4QNWA 4UR7A 2QUUA 1MVYA 4TMCA 2EO7A 4NI3A 3FEMA 3P8IA 1UBSA 3LDVA 4AIEA 3PVFA 2OW6A 2DZXA 1VH7A 2FLIA 1CXIA 1GEQA 4O14A 1Q3NA 4O1DA 3VMNA 3L4TA 2A7RA 1EPXA 3VGFA 1TPEA 4HNTA 1DV7A 3PWAA 2QCNA 2NT0A 5LGXA 1GVQA 4OKDA 3EXTA 1MW2A 3EWBX 4PSPA 4UQCA 4KFPA 4ZZ9A 2A1YA 4HNVA 2VEKA 1OX4B 1EHAA 3EX4A 1GJWA 4J3WA 1KFEA 1YDOA 5H91A 2OSYA 1KFBA 3M5ZA 1XFBA 4RZ6A 4QJ1A 3NA8A 3LXBA 3G3MA 2CLIA 2GJPA 1S5WA 1Q6LA 4H3DA 1DTUA 4DEFA 5DFAA 3BAKA 1F74A 4NZJA 4A2RA 3MW7A 3NQ6A 2V5LA 1W5OA 5AHFA 5A2AA 1SZEA 1TV7A 4AXKA 4WLCA 3P5YA 4CCDA 5FESA 5K4ZA 1TQTA 4PEEA 1KFJA 1T96A 3CM4A 3LRKA 3WELA 3GK0A 4UZSA 4ONVA 5D33A 5L9FA 4YCOA 5D38A 1EB3A 4JX5A 3GB6A 3LLDA 3B03A 4IMEA 2NT1A 4O52A 1KTNA 2CFFA 3C2RA 3CZLA 2O7QA 3L2IA 4LWWA 3ATYA 2FB3A 1CGVA 2WANA 2ZRYA 4PCTA 4X0NA 3S5OA 1RPKA 3WNKA 3UXAA 2FHCA 4HNUA 3MYPA 3NYZA 1CGYA 1EX5A 1H5YA 3SSJA 3NVTA 3ABQA 2VELA 2YDAA 3QSTA 5G4EA 4QQ3A 3MHUA 1BVNP 3TU9A 3IIOA 3O6CA 5F4WA 5I24A 4QAWA 2OT1A 5F4SA 1TV8A 2DU2A 4UFHA 4AVFA 1O5XA 2A5HA 3BMVA 4JFSA 4UTUA 3IJ7A 3E9AA 3I6RA 2QAFA 1M6JA 1LZOA 3WJSA 3OLGA 1VFOA 1BWLA 2NV1A 3W75A 1D9EA 2ZE0A 1KCLA 4AF0B 2BY1A 4CN4A 3LCLA 3VNDA 2FH6A 2D0HA 3HG4A 1B3OA 2RKXA 1WX0A 2D3NA 1R47A 1QHPA 2ZA3A 1LBFA 2BX7A 3Q2DA 4GQQA 3CTTA 3PC0A 3G22A 1TTIA 2LLEA 1J5TA 8CGTA 3P82A 5J5RA 3BCDA 3EJPA 4TX9A 1GVFA 4MPQA 5C54A 1RVGA 2UV8G 2BTMA 1KFKA 1OVDA 1MO0A 4M5PA 1BF2A 4BI6A 3IIZA 5FF4A 1J0IA 4UTWC 3ZR5A 1B2YA 1UB3A 1UUOA 4X9YA 4LV9A 3S1UA 1H7NA 2DZSA 3AMKA 1U83A 5HUPA 3L5MA 3W7JA 3ZS4A 2J25A 1G4PA 2GVYA 4IMFA 5IM51 1VHNA 3UEQA 1VLWA 2GOUA 3M6YA 4MZYA 1GJUA 1AK5A 4LS0A 4ZQOA 1HNYA 3SR7A 3DX2A 4UFMA 3WJYA 1XCWA 2ZA2A 5CPLA 2Y6ZA 3HG3A 3P61A 4A21A 3GXDA 3KVJA 3W84A 3HPZA 4NT0A 4U2ZA 1RV8A 1SZNA 2Q8ZA 3TC6A 3BARA 3DKJA 2BY2A 4H8VA 3C2EA 2XVGA 4HN4A 4ATWA 3UERA 3MBDA 1JXKA 1MW0A 4NZFA 3INPA 4UCGA 5SWUA 3B0UX 2ZXBA 5DBTA 1S46A 3C4UA 5AC8A 3ABSA 1AG1O 2Y70A 2WC7A 1ZAJA 1RP8A 3NG3A 2NX3A 1XBVA 2BXVA 5FEZA 3W2LA 4IMDA 4HT3A 3KEHA 1LWHA 2GVGA 2G3NA 3QMSA 3TJLA 3W86A 3P62A 1C29A 3LTPA 1KM2A 1G7VA 1WYIA 3RK8A 3M16A 2Q3RA 3VSUA 1RD5A 1FUYA 1GVIA 1YLVA 6CGTA 1NVMA 1N55A 2Y88A 4PODA 5BMWA 3BVWA 1ZJAA 4Y6GA 3W23A 5LZLA 1JVNA 2VEMA 1XDMA 4GWEA 6TAAA 2ALWA 2NLIA 3C2VA 4E2BA 3IV3A 4AH7A 3M07A 4KMQA 1F5ZA 3VFLA 1TQJA 4FIQA 3LERA 1RPXA 4JTSA 1FXPA 4U4MA 3NQDA 3B0VC 4WUIA 5LKYA 2GUUA 1Q4NX 4PL1A 4FNRA 4QITA 1HXKA 3BLFA 2HSAA 1WBJA 4AMWA 3QH2A 3TSMA 3TTYA 4DO4A 2C3ZA 2NX9A 5J5DA 3NQMA 4MFDA 1XUUA 1OK4A 4MVAA 5T26A 3W7QA 2WVTA 3UPBA 1KXHA 3S2CA 4UOZA 4IOTA 3Q37A 1FBAA 1JQVA 3EX1A 1FDYA 1KXVA 1E3XA 3USBA 3L0GA 2AAMA 1K3UA 3CZKA 3B06A 2XN1A 3NQ7A 1AW2A 2DZUA 4JDBA 1PS3A 2TYSA 5CPNA 4BR1A 1EO5A 2A21A 1JXJA 1OF8A 2H8XA 4WX2A 3W85A 1XSIA 3N19B 5AYYA 4UTHA 3BCFA 2Y24A 1SO3A 3FKKA 4O0KA 3PUOA 5AN7A 2E0PA 3F1QA 2I9EA 3QSRA 2FIQA 3W1RA 4UQBA 2BY0A 3DU0A 4DBDA 1H61A 1UKQA 1FQ0A 3SY5A 1R30A 1ZNNA 4FIRA 5G2WA 4BI5A 3A5VA 1R33A 3PB0A 3HIJA 4BWLA 3BGJA 3O6YX 5HULA 1W5QA 5A2BA 5D02A 1XKYA 4JY8A 5FF7A 5D05A 1SFJA 5CSRA 5AC7A 3GYEA 4O16A 3GXNA 4J9JA 2ZX7A 4NU7A 2J24A 1G67A 2D0GA 2QJHA 3A21A 1HL9A 4Y9AA 5D30A 2Z1BA 3TQKA 1TO3A 4LC6A 3VGGA 4O8RA 2TAAA 1KGXA 2VRKA 1OSEA 4X22A 1HL2A 4Q32A 3DENA 2X1SA 3NL2A 3WDIA 5AHLA 1DJNA 2E5DA 1UCWA 2GVLA 1Q6QA 3WJXA 2FDSA 1KTBA 4M56A 3GNDA 1I45A 2ZUWA 3BVJA 2O7SA 3NQAA 3L4YA 1WA3A 6TIMA 2QMKA 2WCSA 4ORMA 1JG9A 5DELA 1TIMA 3MWAA 5LNWA 1JUEA 1IZKA 3CLWA 3LCXA 4CKQA 3P8JA 4UFKA 4AWSA 2QCEA 3L65A 1UASA 1U30A 1QOPA 5HWNA 2BHZA 1ONRA 3LTSA 1BTMA 1KTCA 6ALDA 3STCA 4JTGA 3F03K 4H8HA 3GBDA 1C8VA 3W6YA 3KFTA 5HUOA 4E2OA 1XSKA 4CVWA 4J7RA 1X7FA 1DHPA 2F1BA 3EWZA 2B4GA 4UNKA 2ZZ1A 3KRSA 3S9YA 1WV2A 4UOQA 3G18A 4BFAA 4ZQNA 3JR2A 1CXFA 1PL9A 5HQEA 3WY2A 3EDFA 1ZAIA 1W5PA 1MEWA 1DJQA 3KE0A 3P5ZA 3W7PA 3NPVA 3GX9A 5E0FA 2V3EA 1SZGA 1WBHA 1EEPA 2WNQA 1HWWA 4IJBA 3KWXA 3GVGA 4CLMA 2ZFAA 3FOKA 1Y7VA 1LRTA 4O57A 3W1QA 1UH3A 3IK2A 2JK2A 4OHQA 1TPVA 1TQXA 2ZTKA 4JX4A 1MSSA 1D3GA 3C2FA 3IGXA 4PL2A 4AMAA 1V3LA 3H53A 4GQRA 3YPIA 3C0JA 3BAWA 3LRMA 2PRHA 3HBLA 3SIZA 2JKPA 2QV4A 2VR5A 2WNZA 4R7JA 4WZHA 5FF0A 1GT8A 1CW2A 1OJXA 1JCLA 3DX0A 3FIGA 4O18A 3KOFA 4MLJA 3W3OA 1WQ5A 1TPFA 1GG0A 3NPUA 1I4NA 3CEPA 3LHWA 3BAIA 5K3VA 4FF7A 1UA3A 5DY2A 4UXDA 4JTJA 3L0NA 3WENA 2H6RA 1AQHA 4RZ4A 3AJ7A 5CZTA 1XD1A 1VIWA 1W0MA 1XBYA 1Z42A 2YPIA 2ZRVA 1FWRA 3WK0A 2ZRWA 3NO5A 4J3TA 2ZX6A 3QM3A 1HFBA 2C15A 5LNSA 4RXFA 1SPQA 3EDDA 4UQDA 1MXSA 3DGRA 3WFAA 1JULA 3G0SA 3A4AA 4DO5A 3TC7A 4J3VA 3DX1A 2XWEA 3K8MA 1W5MA 3MBFA 1H7RA 2ZBTA 2A6LA 4RLIA 3R8RA 3RLUA 3OG3A 1B4KA 1I2OA 1PV8A 3CC1A 5C2XA 3EJSA 5L6UA 3G1SA 1KBKA 2HTMA 4M7SA 4N2YA 1KV5A 1PCKA 3BW3A 3FS2A 5DCEA 2NWSA 2ZXQA 1OFBA 1XCXA 2TRSA 1GCYA 3QMRA 1YYAA 3O15A 1YPFA 1ZENA 4YMZA 2CXGA 4IX2A 1QO5A 1QI4A 5C5YA 3PAJA 2XIBA 1CGWA 2ZZ2A 3SFKA 4WSJA 1HVXA 1XBZA 5HWMA 3TE9A 4B9ZA 3P67A 4ORIA 1W8SA 2FPTA 2X2GA 3IGUA 4K37A 1J2WA 3QPYA 2VFIA 3DKLA 3ZO9A 1XH2A 2OCZA 4N6FA 3LI0A 3VX1A 2QCCA 4DBEA 1JFHA 2W0UA 4GKLA 1ICPA 4O1AA 4KKXA 3IVTA 1OG0A 1SQ7A 4GUHA 4U31A 4QISA 3S1XA 4XBSA 1TMHA 3E02A 2ABAA 2QPSA 1LWJA 2P0OA 1VYSX 2ZXDA 2ZRUA 3VKJA 3C2OA 5EPDA 3L68A 4DPQA 3ZOAA 3PR2A 4JTLA 4PFMA 2IQTA 2VC6A 1PEZA 4OIFA 2YIHA 2HS6A 2CLKA 2BHUA 3QQ0A 4AW7A 4LUJA 5I3KA 1NAL1 1OX5A 1SW0A 3UWYA 1JCYA 2A6NA 1GYNA 3WJWA 1DQXA 3BVVA 4ADUA 1IV8A 1U5JA 2YSWA 3VE7A 3TDFA 3LPOA 3NNTA 4B9YA 3S5YA 5LHFA 4FLSA 2Y7FA 4OT7A 1G4EA 2E8YA 1I2NA 1E40A 3OIXA 1VGAA 1N7KA 4MOZA 1A50A 3TTSA 4H6KA 4CNOA 1AL7A 4QSHA 2V5BA 3NM3A 1YDVA 1GOXA 3NL6A 4Q33A 3LCIA 1L6YA 3N3MA 4FX6M 1JI1A 7CGTA 1DORA 4ZQRA 3KRZA 5CSSA 4UQEA 1K8YA 2WKLA 2ZWYA 2A7PA 1IXOA 1ZJBA 1KLZA 3FYPA 3GXTA 4I9AA 2V81A 4QAIA 2BWGA 5U4NA 2EEXA 3VNZA 2ZQ0A 4O53A 3NQCA 1QI3A 1WZKA 1OFRA 3UXDA 4E38A 4ICNA 1YPIA 3BUIA 1GWJA 1HTYA 1TQVA 2BSLA 2YCEA 3UWUA 4GI8A 3WDHA 1JUBA 4CNNA 3W7CA 1O5KA 1LROA 2GVJA 1IIGA 2PC4A 2PE4A 4GUJA 3UWVA 4DXVA 1LRNA 4UTKA 5BNKA 1M7XA 3BW4A 1LORA 2DH2A 4H8UA 1KM6A 1AQMA 1JUKA 3DDFA 3NGJA 1SZFA 3DHUA 3WK2A 4XKYA 4LU0A 4AHPA 3LB0A 4XB3A 3CWNA 4AEOA 2GQ8A 3KVMA 5AYXA 1ME7A 3ATZA 2J9ZA 3WY4A 1CYGA 4CQAA 4POCA 2YA2A 1UD5A 4FXRA 1SU5A 1EH9A 1QAPA 2H3DA 5AC6A 3L0KA 2E6YA 2JKAA 3S1VA 4ADSA 1P1XA 2WO5A 1UD3A 2FYVA 3CV5A 4U28A 4DQWA 4JFUA 1QWGA 1R2SA 5MHBA 4LPCA 5E0KA 5G2IA 1M5WA 4QIUA 5D2TA 4UQAA 2YW4A 3TJXA 4FNQA 2PURA 4YCPA 3WEMA 2VEPA 5D2VA 2ZRZA 1JIBA 4AHQA 2OYKA 1OYBA 1JQXA 3PG9A 3P80A 3TH6A 5BOOA 5DLCA 4UQ9A 3A5FA 4XKYB 2CZ5A 1HT6A 4NJGA 4PA8A 5EBUA 2EPHA 2CLLA 5LNVA 1IF2A 4CN1A 1BEUA 4O1BA 1G9HA 2FTPA 1UD4A 2Y63A 1I2QA 2RFGA 4MLRA 3TA6A 1O60A 2XIIA 3W1XA 1G69A 3W1LA 3CEUA 4JYFA 3TR2A 1Z41A 3TW6A 5IBXA 1JD9A 1IIHA 1FWNA 4X9SA 2PRLA 3W1MA 1AVAA 5DY3A 3NR0A 2GQ9A 5LGZA 2I1OA 1OFQA 4K39A 2GJNA 1OFPA 3NM1A 2QJGA 2WSKA 2I14A 1LDCA 3MHFA 5G2HA 3UPWA 3QC3A 3TFXA 2HMCA 1RP9A 3WNLA 4YXGA 5AHNA 3JRKA 2X2IA 2OX1A 1SR9A 2F7PA 3M47A 3QEZA 1XDLA 3T4CA 2FGZA 3DI1A 5EA9A 2JGYA 3U8GA 4MY8A 1ALDA 1ZHAA 3W2UA 2E6FA 2ABBA 2QAPA 5AHIA 4TIMA 1E51A 1LRQA 3BLBA 2NUWA 3UCQA 2F7QA 5HR6A 3TUUA 1WE5A 3CQ0A 3DHDA 3S42A 4TR9A 1YXDA 4PEKA 2F18A 4N4QA 4UFLA 2VNCA 2F7OA 3Q94A 2Y4SA 3OEXA 3PBVA 1V5XA 3BUDA 2DJXA 2QCGA 2R8WA 3UWWA 3UQNA 3A22A 2VFDA 2Y85A 4NNAA 1CI1A 9CGTA 2EF9A 4Z1CA 2A0NA 4I7VA 5HR7A 3NAVA 4UFJA 5I5RA 2G96A 1JF6A 1TCMA 3PY2A 5BRQA 2ZRXA 8TIMA 3NDOA 2V30A 3KL3A 1PE1A 3G0UA 4JTEA 4MJZA 2CZEA 2Z2UA 4JTFA 1TPWA 1Y0EA 1H1ZA 2GJLA 3BO9A 3O6DA 4FLOA 2CHNA 4AWUA 4JTKA 2CLMA 5C6MA 3TQVA 4UTTC 4WJEA 4ZMGA 1J0HA 1H60A 3LCFA 2OSWA 1JCNA 3L4ZA 4JYDA 3T7VA 3ABRA 4K7YA 3L21A 4CNPA 3L4XA 3K8LA 1F7BA 5D03A 3T55A 2R14A 4O0ZA 5AOUA 5HMSA 1V3MA 1K7EA 1PIGA 1D7FA 3QGVA 5K2ZA 4JFWA 1XC4A 3S6DA 1OX4A 3GDKA 2E4TA 1I2RA 1KXQA 1CXLA 2E5CA 3TMQA 1B0IA 2H3BA 3TIMA 2YJQA 3NQ2A 4C1LA 1OYCA 4UMBA 4NJHA 4LVAA 3QPZA 4BF9A 1O94A 1UKTA 5EYWA 3DZ1A 3DXIA 3G1DA 2CLHA 3MHGA 3G1YA 3G1FA 1RZMA 1UH2A 4UCFA 2QEZA 1HL8A 4IMCA 3O8AA 3QW4B 4UMAA 2QF7A 1GG1A 2WKGA 4XTIA 2E68A 4UC5A 3BUQA 3OVRA 2F61A 1TQUA 3FLUA 4XWUA 3AO0A 1LOLA 2VXNA 5I3GA 3NQ8A 4FNTA 3W1PA 4WSKA 1EWEA 3PF3A 4RK8A 5FEPA 3W1AA 5KITA 3DC0A 5A6LA 1KM3A 3G1AA 2PWHA 4ZVJA 1QX1A 2F2HA 3W22A 1FXQA 1QPNA 1F6PA 5LNRA 1VFUA 4LUIA 1UOKA 1P6WA 2E09A 5KZDA 2VEIA 1B57A 4YL2A 1PPIA 1OB0A 4KWVA 3HO8A 4ALDA 1L0PA 1QMLA 2QLYA 5CPOA 1ME8A 3ZR6A 1QI5A 3ZWTA 1JDCA 4NX0A 2ZTJA 3S5NA 1BSIA 4FNPA 3UZ5A 4DF2A 3G3DA 3R5EA 1LLWA 4GINA 1RQEA 1IZJA 2WV8A 4NVTA 5TQLA 5E1QA 3AXHA 1HUVA 2X1TA 3PBWA 1QWUA 3ZT6A 4RZ5A 1A53A 1FCBA 3U6WA 4ML9A 1CGXA 4HPHA 3TAKA 1VJSA 2WJZA 2VUYA 3IVSA 1RQHA 3LM7A 2CLFA 3T78A 3DFNA 2VFFA 3E0IA 1H7XA 3WNOA 2V2CA 1EA0A 3LX9A 4BA0A 1XI3A 2FJKA 5U7SA 4NJIA 3DH7A 3W7NA 1VYPX 2PWEA 1I8JA 1SFLA 3W7LA 1TPH1 3WK3A 5DN1A 1CGTA 1JDDA 4MKNA 2ZCGA 3LRLA 4Y90A 2VKZG 4LVGA 1TPDA 3I7QA 4DF0A 2FFCA 3PUEA 2NX1A 3M7WA 1VJIA 3BAJA 5D04C 3PUDA 2EAWA 1XUZA 3ANYA 2FH8A 4O11A 3VSTA 3O1NA 4LS1A 3FJLA 4Y96A 1QDSA 4M6VA 1M53A 3M41A 3S5ZA 1BWKA 4A3UA 3W76A 4WF7A 2ZX9A 4A29A 4LNYA 5G1YA 3GIYA 4O54A 1VS1A 1HX0A 1Z32X 4XQ6A 2NUYA 4DPPA 1EP1A 4JTUA 2ZIDA 4TMBA 1RR2A 2WQPA 1V3JA 3HF3A 4JTHA 5I0DA 4OE7A 1TPB1 3ZSSA 2GJRA 3B8DA 1QHOA 4FX8A 5EY5A 3SECA 1KW1A 1VPXA 3CPRA 5E6ZA 3DX3A 1G4TA 4JYEA 4L4LA 4M7TA 2WCGA 4HOZA 3KAOA 3C6CA 4KFOA 2TSYA 2CU0A 1TREA 3LGEA 5F2MA 1AW5A 3LXCA 4XBKA 4AEEA 4JX6A 3ZT7A 2FPVA 1LM1A 1PIIA 2FHFA 4H2CA 5HDRA 1MZHA 1X6UA 4K7VA 5HPOA 3PS7A 3BLEA 3ZR4A 2QCDA 2VRQA 1KBBA 1NSJA 1CDGA 2ISSA 2DZWA 2DIEA 4MB1A 4FO4A 4FNUA 3A47A 2R94A 4G1KA 1A47A 3TX9A 1TPC1 3RF9A 2E6DA 3M1ZA 2BZNA 1TQWA 1MFUA 1KCKA 4O19A 1XH1A 2TMDA 3KVKA 3RU6A 3W1UA 4GFSA 5F2IA 3JS3A 4Z1AA 5CGTA 1ICSA 3N34A 5AHEA 1WPCA 1W31A 3MJYA 2J88A 5F1UA 3LBCA 1YTEA 3H55A 1TSIA 1SMDA 3BG3A 3L2LA 3RIKA 3WFZA 2QCMA 3BV4A 3OVPA 4X2RA 3TXVA 2X2JA 4HP5A 1THFD 4O10A 3RILA 5E6YA 3BAYA 4HSNA 1ME9A 3S1WA 1J0JA 1QPQA 4GJ1A 4UR8A 3LHUA 4EOUA 1TRDA 3NXFA 2J27A 1PHWA 1FWWA 3QMTA 3PULA 3EJQA 4N6EA 1GJPA 3SW6A 1SO6A 1H1YA 1PHQA 1NEYA 3GXIA 2Y5EA 3G8EA 3L4WA 4MY9A 1OABA 3LOTA 4RX0A 1J4EA 3QYQA 2F1AA 4O17A 1VCGA 1TTJA 4H4IA 3ZQ9A 4RJEA 5KINA 1G1YA 3BUPA 5AHMA 1SSDA 3BMWA 4JXCA 1K02A 3HPSA 1VFMA 2C18A 3A6OA 1SO4A 4Z1DA 1AW1A 1O4UA 1ICQA 4UTIA 1NOFA 4UZUA 3FKRA 4JY9A 1WZMA 2WPBA 3VM5A 2ZZ6A 2PRMA 3MI3A 3VGBA 2C0AA 1T0OA 4O28A 3P84A 3C61A 3TSBA 3M44A 3V75A 3KHJA 4JDYA 3L67A 4WY0A 3STGA 5I3HA 2Z1KA 3FW6A 1VC4A 1CGUA 3ZSTA 5DXYA 3MYOA 3TSDA 3W37A 4CQ8A 1NF7A 4R53A 1XGZA 4ZQMA 4GIAA 3EDKA 3P81A 1O7DC 2C16A 4OWGA 2ZWZA 3IVUA 1T99A 3QZEA 3BC9A 1QPOA 5F1VA 2OZ0A 1IXQA 2V3DA 2B7QA 2AGKA 3CPUA 2V9DA 3GKFA 4AWTA 1L6WA 5K7JA 1WZAA 4P2VA 4NXKA 3ZT5A 2DP3A 3F4NA 3BSGA 1OT1A 4FMVA 3VSVA 4HPJA 4B5NA 1OFDA 1KBJA 2B0MA 1ZY9A 5A6MA 3HG5A 3HJEA 1N8FA 4OV4A 5DXXA 2Q8LA 3VM7A 1M7OA 1Q45A 2PWGA 3BVXA 3O06A 1GVOA 4IPJA 4MYXA 5C55A 3C56A 1TV5A 3N73A 3VE9A 3WK1A 1D3CA 5CGQA 4XUGA 5BMXA 3TAOA 3EDJA 2QUVA 2VFGA 3F4WA 2GUYA 5LSMA 3W73A 1H50A 2TPSA 2YW3A 4JIQA 3UG5A 1ML1A 3W74A 7TIMA 2YR1A 3MMTA 3LCWA 1DVJA 3N14A 1XSJA 3QJAA 2E6AA 2A4AA 2H90A 3Q58A 4X3ZA 3R13A 4NNBA 2WVSA 3STFA 4HHPA 4I7WA 5K9CA 5EMYA 3HGRA 4RKAA 1ZS2A 3CTLA 2OYMA 1ZFJA 2Z6IA 4UNLA 5CZSA 5D37A 3D50A 4U33A 5FEWA 3QFEA 3W9ZA 2P1FA 4JS3A 2CLOA 2QCFA 4JD4A 3CZNA 2ZXAA 1V3KA 1ZCOA 2YA0A 2QUTA 3W2MA 3T40A 2AQWA 3DFOA 2FE0A 3W38A 1QW9A 2ZICA 3OLEA 3DFTA 2PWFA 2BLEA 1QWNA 4PCSA 3WNMA 1WZLA 3LLFA 3G1VA 1TJPA 5CLWA 4GI6A 2EJ1A 2ATSA 1DBTA 4XTDA 3W7HA 4AMXA 4LOCA 3DI0A 3G24A 3TKFA 5CPMA 1LOSA 1S5TA 5K9XA 3WMSA 4HOXA 1YXCA 4FX7A 4KFNA 4DELA 3GBEA 5E70A 2EQDA 2E9BA 4TO8A 1BAGA 4W93A 2RDWA 3N9RA 1LLZA 1IXNA 3E96A 4BK9A 4RCXA 2Y62A 4O50A 3SZ8A 3M43A 4FB7A 4A22A 2AAAA 2X1RA 1Z44A 4GNJA 1B4EA 4K38A 3MP5A 1GPWA 2RDTA 2YGYA 4ZQCA 1W54A 4IWWA 1BLIA 1TTPA 3B4UA 3D4YA 4EF9A 4N9BA 5CG7A 2NXHA 5FF3A 1GZGA 5K4XA 2XVLA 1BG9A 1PCWA 2ZZ4A 3IGSA 2ALDA 1QNVA 5A2CA 2C7FA 3UY7A 3UYCA 4IMGA 4DO6A 5D2YA 2WSYA 3GXFA 4AYGA 1KFLA 1QPRA 4LV4A 1FCVA 5CLTA 2A85A 1EA9C 3HJZA 4IX0A 1KWGA 1WDWA 4OV9A 5BRBA 4JEQA 4GUGA 1FWSA 1W9XA 1F2JA 1RQBA 2WSRA 3THAA 2E5BA 1GYLA 4JCLA 1H3GA 4AEFA 3BVTA 1TB3A 3M9YA 4GUFA 3W7GA 1KM5A 2AMGA 4UMCA 5FEXA 1EWDA 1SSGA 4UFIA 2CWNA 3NQGA 2ISWA 1OK6A 3N2MA 3W70A 1HO1A 3GAKA 1CXKA 1LYXA 2YKKA 4TVUA 1MW1A 1R2TA 3UWZA 3BK0A 4JCMA 3KXQA
chains in the Genus database with same CATH superfamily
2AVFA 3EJTA 1G0XA 1H63A 1MDRA 4MJ2A 2NQJA 1M05A 3CHVA 3P0GB 2F7FA 3U82B 1JWSA 2P52A 4HPOL 3TNMA 5D6DC 2PDWA 3W88A 3ZFHA 5FJOA 5CBBA 2IH3A 3E7JA 3VG9C 4N8VB 5I0WA 1GHRA 2B7NA 3UBHA 4QDGA 1GJIA 1AL8A 1G01A 2PDFA 5E2WL 2WIIB 2MTAA 1EJOH 5ISZA 4X8XA 1IGJB 1XT5A 1GS8A 2YAOA 3FFOA 4N1EA 4OB5H 4XP4L 1EANA 3KPLA 4KI5D 4N2NA 1NUGA 1JBJA 2J6XA 4MMWA 15C8H 3GMPA 1GQNA 3VRJB 3P7YA 4IUOA 5BUPA 3P11H 4O8AA 4Q4RA 3TCXA 2VX5A 5DO2C 5B38B 1HYSD 4WW1A 4GI9A 2EJAA 1J9YA 2VDNH 4JFHE 3UPRB 4QHLB 4XWOC 3TMLA 4PTNA 3PWPB 2BP0A 4OD3L 4XHQA 4BQ8A 5D72L 2EXTA 5I73B 5K9KA 4JN7A 1T1WB 5ICUA 4KQNA 3HMJG 4L4TD 2FWOB 2J7HA 3W7EA 4JTQA 1QRND 2DT3A 3TVMA 4Y9MA 4A2SA 4BFKA 1I8KA 3HLAB 3VW3L 1QSED 5C0AE 3VXUB 2DLFL 2RGMA 3U0PA 4QHLA 4L18A 2HVKA 1ZLSL 5D55A 2H3NA 3UZVB 4QYAA 4KMLB 3IACA 2XV6B 4J35A 4HUMB 4A6YB 4O4WA 2Y1VA 3MSYA 4Z17A 2ZWLT 3QZOA 4JM2C 1T03L 1CCZA 5E2TL 4UILL 4KRUA 4WFFD 4J1UA 2FZ8A 5B39B 4RXGA 1WD8A 5IR1A 3SGDI 3TVMD 1O7VA 1JCMP 4KDTC 1U5VA 2ZG1A 1VBJA 3ILQD 3DXAD 1XR2A 4ZNEA 1MAML 4D6IA 3DK0A 3VXTB 1QHZA 1HKLL 1NMCB 3L66A 5F7UA 2JXMA 1H49A 3NZHH 2PDUA 4JDEA 2QCLA 4PAZA 3RPBA 4I0PB 1ZGDA 4AH2A 1XLBA 4AGLA 4E2DA 5C08B 3R7MA 5HINA 2A9DA 5B7FA 4FR1A 4NDMB 1KRMA 2YAHA 4RZBA 3K81A 4RESB 4W9EC 2O5XH 3NPXA 3U2SA 3DIDA 3HGJA 2PZ0A 1EEUA 3BP6A 2WVVB 3TLLA 4JNXA 4NHCL 4QKTA 1NF0A 1AJ0A 2REQB 4IYKA 4OTXL 4PSRA 4CU7A 2O5NA 5ESQA 2DW6A 3ENEA 2QTVA 1WA2X 4P5KA 5JHDD 1NFDB 2AJ3A 1UP2A 3PGDB 4LMQI 5EMUA 1DEEA 4A2GA 3DI3B 4IGBA 3EKZA 3TVAA 1RH9A 2DJ4A 3FFSA 3K6NA 2YMXH 3DVIA 2EDWA 3GYCA 3NA9L 3FN3A 3RNDA 5TIMA 4H2HA 5EGRA 3PBGA 4TQHA 2EEBA 2VITB 3ES6B 1ZGLM 4DZ8B 1MQKL 3IS1X 1YDYA 2GK0A 5DFVD 2C4XA 1U8NB 2QQNH 4RDWA 3OXSA 1DUYB 1YUHB 3FU5A 3GRWA 4KTEH 4XPBL 5KSVB 3MZTA 2R8SH 1EFZA 1PBGA 4OKVB 1W2PA 3F7VA 4P4KD 3GIVA 3BIKB 3NFUA 4E41A 3VD9A 1N18A 4Q56A 5DURD 4KTGA 3V5FA 5AC4A 3VIHA 1X9QA 1BXAA 2W94A 3RU8L 2NY6D 4APQD 4DZBA 3MODL 4J3OF 3K8KA 1W3IA 3LAFA 3H2OA 3EXSA 2HJLA 3QXWA 4GUIA 4Z2HA 3EXLA 1S7WB 3O3DB 1FA4A 4AYSA 2W95A 3X14B 5DS8B 2QMJA 3N40F 1D5IL 3R89A 1D7BA 2O61A 1F05A 2OZ8A 5DSCA 2WUBH 4FG0A 1P6AB 2QQKL 3IIPA 2IO5A 3OAZK 4PCPA 3R0KA 4F15C 3FT2B 4E0CA 1YADA 3P73B 4ONHB 2CO6B 3F6IA 4M6ML 5T3ZE 3F7KA 3MTRA 1LTXA 1YMME 4OJYA 1E6RA 3ITTA 3DX7A 5F3BB 2O26U 5CLZA 4US5A 4FNLL 1I4FB 1FHNA 4ZFOA 5DEZA 2ENQA 4UTBA 2XIQA 4EIGB 5EHFA 2Z6JA 4QNEA 2LOEA 4OCLC 3ZE2E 1FJ1B 1ZVYA 3ZVHB 1FP8A 1PAZA 2YAMA 5DJ0B 5B22A 4NWUL 1ZAHA 2DZVA 1RHCA 2PD5A 5ID1A 2VR8A 2Q6WB 4I5XA 4YFLI 1Z48A 1ES0B 3VXSA 3VINA 4EI6B 2BVDA 2PA6A 3SCRA 4XCFH 2Z31D 3DVGB 3HN8A 1IEWA 2FLRT 3GJFH 4DZBB 2WKJA 3QZ6A 2FVLA 3Q1SH 1EGMA 2V5MA 1GSMA 4WVXA 5KANG 3G08A 2G5WA 1E6ZA 5D2XA 3NSDA 3ZQXA 4GCXA 1BJ8A 1IEQA 1RUAH 1C1EH 4QRRE 5IT2L 1N3NB 1T6MA 2HJFB 6ENLA 3W1ZA 1LO3H 4KJPC 4GBUA 4DX3A 3VJ6A 2QV2A 1EP3A 1O7SA 3SJVD 2H9AA 1MXDA 1RVFH 5H4ZA 3EKLA 3ITLA 1ZT7B 5DCBA 1QJWA 5G4WA 1T2JA 5FYLL 3ABZA 3VXRD 1C12B 4JFEB 5E7BA 3GZKA 1F3JB 1A3RL 4PRHB 4K55A 5EUKA 1O68A 3MV7A 5B38A 3HE7A 1LYQA 1MRQA 1NEPA 4DN1A 1RJCA 3UAJD 5FCUH 1LE9A 1A3QA 1KV8A 4P5KB 1CIDA 5BVPL 4HYRA 1N9PA 2P8LA 3L3DB 4IP4A 4H41A 3CQPA 1EBHA 5I1DB 2PTDA 1Q0EA 1R34A 1OANA 3BN9D 4X9FA 1YTKA 2GWNA 1KNOA 3AI0A 3SGKA 4X6CE 3CMGA 3NYKA 3CAQA 1LILA 1VB9A 4PJFE 4AVIA 4FPSA 4QLKA 5A5WA 1D2OA 4GQ9L 1UQSB 4JG9A 4NDMA 3FONA 4Q14A 3S37H 1XIDA 2X30A 3GDLA 3W6MA 3II2A 4IW4C 4PGZA 2CALA 2X0VA 3AADB 3FVDA 4JB9H 1HSBA 1S3KL 3EXRA 3QHZH 1AI1H 1MFNA 2XZQL 5ABTA 1DO5A 2QHRL 3QUZD 1UROA 2L7UA 2CIKA 4KKLC 3PHQA 2I60H 2EINB 3E3QC 4W7UA 4HVBA 3GSMA 4MIMA 4AWEA 2Y5JA 3X11A 3IFLL 3SKNB 3GNNA 4M6PA 3B2PA 5AVZB 3KS0H 3SCWA 4M6AA 4ETQB 2QZQA 4LRNH 4J28A 3L45A 4HWBA 5IJCC 4MQ7B 4FXSA 4M51A 1TR1A 4JO3L 1LK3H 1PG7L 1SEBA 2Y6SD 3MOAH 3TV8A 2EKCA 4ERAA 3ABKB 4NHCH 4XP4H 3UJSA 2C1PB 4R5EA 3UT0A 3H7RA 5I9QB 2A2IA 5EFIA 3FQWB 1XIJA 4NN6C 2EHHA 2CKNA 1PJWA 2XZZA 4P23A 5C0AA 1HNFA 4LBUA 3URAA 1TYJA 4DWSA 3KTXA 2V6HA 3F4NA 3W71A 3DAQA 2XFWA 5HHOD 1F11B 1SVZA 3P0YL 2Q71A 1HOEA 3WTXA 1US3A 3AREA 2WV3A 2AKRA 5EIVA 1DHKA 2EIBA 2WWMD 4PWGA 5IW1A 1NDTA 2WMHA 4IPPA 4GXMA 2GSGB 3H26A 3VMPA 3L95A 1T3FA 2YUZA 1PBYA 4WTWA 5BRPA 2JBMA 1AKJA 1EAJA 1RZPA 2NY3D 3JT2A 4EI5A 5JO5B 3FFDB 3II1A 3TXAA 1VP5A 3DIFB 5EU5B 3IDMB 3C8NA 5EH1A 3WYZA 3FXIC 4JY5L 4JX0A 1TMLA 1YNYA 4JUSA 2HTKD 1XIWC 4N9EA 3HOJA 1M7PA 3WLNA 1BJ1J 4NX5A 1A4KA 5D96C 5IKCA 3UAFA 4B9IA 4F0MA 4UDUB 3CN0A 1L6ZA 3VYLA 5HNUA 2XVNA 4L2YA 3RWGB 3EWXA 1VBGA 1FNHA 1QSFD 1GYCA 2A7NA 3P4NA 2FWUA 4HPYL 1ZJIA 1ZXQA 4J3OD 1MAJA 2CQVA 3LKNA 5B1BB 5I1IL 1JYWA 3KBNA 2D31A 3DXAA 1U93B 4HQQL 1EUAA 2VGBA 4GPVA 5BNXD 5FYKU 2PYEA 5B7EA 4ZZKA 3Q44A 1CFTB 2PW1A 2GUBA 3FAWA 2CBOA 3CUFA 4G3YH 2ISVA 5CBEB 4GYPC 4FHKA 4HV8B 2JWYA 5A8OA 2IBZX 3GUTA 2WMIA 2ZF8A 3KLSA 5LCVL 1GNXA 4W9HC 1GZPB 4GAYA 2Y7EA 4Z8FL 1HINH 3PZGA 4PY8I 4V2CB 1I9IH 2AP2A 3S3GA 4TPRL 3PJTA 1QRQA 1SYVA 5PAZA 1R3HB 1UKSA 3TESA 1FX6A 2A4CA 3NJXA 5D5MB 1AOZA 1ZGLA 3I7RA 4ZMOA 3O4LB 1XXXA 1EJ7L 2VLRD 3IXAB 4KFZC 3VKDA 1JE6A 1HO4A 5DRWB 4RFEB 4QEGA 4MXQD 3VU2A 4XNQB 4MJMA 1X5FA 4Q9BA 1D9KB 1T7XA 5DI8B 1XBRA 4RZCA 2PDIA 3TFCA 1EP2A 2GHZA 3CC5B 3Q2NA 4GW4B 3RM4A 4EWJA 3NP4A 1JJKA 2WQWA 4UUJA 1ECQA 3KYAA 3SN6N 1AMKA 2XH0A 3AREC 1OM3H 2OYPA 1R3KA 3RG1C 2OV0A 3V4PA 2KKQA 5T3XE 1Q90A 4Y8EA 2BSTB 2QQLH 4HSQA 4TN9A 1CN4A 4AOFA 3T0VA 3UZXA 4F2MB 5D4IA 1QFEA 2Z7KA 2V2HA 5M95B 2WVUA 1UM4L 1VACB 4JFPA 3DNKA 4JRYD 5ICXA 4EPSA 4OR1A 3BV7A 4S3JA 2HISA 3S8HA 4GBXC 2CAKA 4ZOBA 4H8WL 3S35H 1IR2A 3GXPA 3VXSD 1JZ7A 1Y18A 1NWSA 4ZB5A 4GXVH 4LEOA 1EJRC 4NO0D 3DTDA 1CTNA 5JOPE 2ERJC 2C9VA 2Y36H 2CIIB 4R4BA 2GOKA 1GSKA 4L8SC 3ARUA 4JFXB 3KX6A 4R27A 4LRTA 4L9LA 1VA9A 3RWGA 4RMBA 1QZNA 1HNGA 1PF3A 3E6HA 4IMLA 5EOCH 1Q65A 1U5HA 1OOWA 2EG8A 3LGDA 2JKRM 1D5MA 2NWRA 3TK7A 2DRUA 1NWTA 2ICCA 1DFBH 2P5WD 2GIMA 2APTA 1BYPA 3FO9B 4C4KO 2YCLB 2OL3A 1QKZL 1T04A 1EJ6A 2XZAL 3AS0A 3OC8A 4FRWA 2DLGA 4FKKA 4HD9A 3KRUA 3CDYA 4JREB 2YPLD 1VJZA 5BZDB 3OKNA 5DCDA 3B9KC 2Z92B 4R33A 5EC2A 3EZ4A 3NOIA 3R2GA 2CBMA 4KQ4H 1R3SA 1YDNA 1TTBA 1NINA 1NMAL 4PJIF 4X99A 1T22B 3F7YA 4FQCH 4IH3A 4B2DD 2J1YA 2HXAA 1VPOH 4NN5B 4H0LC 3UZEC 1EUNA 4N2FA 5F9JB 4QOKB 3TBVB 5ABHA 4EDXB 1FVCA 1JVLA 2IPUG 4HWUA 2XVKA 3EJRA 3U1SH 4ZS6D 5EUOA 4EN3B 3IM1A 2X7LB 4Z7NB 3G1HA 3MV8A 4NF7A 4IT1A 3RJXA 2C4FU 4M48L 1JRBA 2Y0SA 3MU7A 2R15A 4WK9A 1EAQA 1PAMA 3W7DA 5IMMA 2VJXA 3OBAA 5KG9A 4BXSV 1P0NA 1TYRA 4DN4L 1PY9A 5GRJH 3OKYA 2DN7A 4X60A 1Q2SA 4WK0B 1A6TB 3IJ9A 2AEPL 1TT6A 4ESKA 4DSYA 1FCUA 1NM9A 1CNVA 2C9PA 4YUEL 5JZ7C 2C1HA 1XLMA 4QGCA 1GIGL 2X1OA 4NQCD 4P4RA 4IGBD 3QUMA 4EDWH 3IIXA 3IJHA 4AD0A 5KTLA 4PGDA 2WLMA 3OKEB 4PJFA 5CINL 4JGUA 5GRJL 1A3ZA 4B60A 3F05A 4JKKA 1E4MM 1EYEA 3HV8A 4YLWA 1QNZH 2YPLB 3LRSA 1G4SA 3EWCA 4X6DE 3P0WA 3MLYL 5H2BA 3GDMA 5A40E 4E3TA 4PRAA 4PYHA 3RVTC 2DT2A 5ILTL 3PL6A 2RUSA 2ED6A 1I7ZA 3ARFC 4JVWA 3ZDZE 2W92A 4PWJA 3CT7A 2OGJA 4M6OL 3QAZB 4NKIH 4U3XA 5DCCA 3TFKC 3AG4B 3E80A 4DEWA 3CD4A 4JPIA 4KOBA 3LG3A 3SCOA 1GKOA 1E4JA 2V0TA 3AFBA 4QDWA 3WDJA 2ICSA 4BHUI 2RACA 3C6LB 2NZIA 1F6FB 4ZUTB 5IJKA 1NELA 4NQED 1IXPA 2WZTA 4O5LH 3AXMA 3BT2L 3HS9A 2DVUA 2DZPA 4I3RH 3GIZL 1E8XA 4J27A 5XINA 3RZCA 3FMGH 3EB4A 2H0PA 4GIYA 1ILSA 1F3JA 4PN6A 4E5TA 3QZMA 2CZDA 3FN0H 1FZOB 1XHHA 5AB3A 2X2HA 3WY3A 1RAMA 3WFLA 1NOWA 3T6QC 3MPCA 1F11A 4QCIB 3D08A 3WLBB 2ZDRA 1QLRA 2XH7A 3D0CA 4TTUA 5ECUA 1S7XB 3S2JA 3TCTA 1R5IB 3TZFA 1F5WA 3QIWA 2R69L 3L1OL 4BQCA 1O6TA 2PTTB 4PJCF 4XCYA 4AVKA 1F3TA 2GGHA 1MI5D 3QA3B 2OSLB 1YA5A 4XN2A 5JQHC 5DBUA 3HS0C 1BZ7B 3DOHA 4PGLA 1EGJL 5EZJA 2E77A 4NZDA 2XG9A 5IM7B 4AIZB 3CN3A 2VC2B 1YEKL 3U9UB 2Z1WA 1T0NB 2DKUA 2FAUA 1OSZA 3VWKC 5HXMA 3WUEA 2Z92A 3IJSA 3DFYA 4HZLB 3HPXA 4I9TA 4AD4A 4HK3N 3BX7C 3LPPA 4NQUA 3Q0HA 2CIKB 3E8UH 4Y4HA 3BFOA 3HNTL 1LMIA 4FA6A 3MOBH 3HUJE 1MWOA 2EDMA 1JWMA 4AQZA 5HYEA 1QTWA 3NOYA 2QQLL 4XISA 4DN4H 3RGTA 3MFGB 5DK0A 1NCBL 3GS4A 4UM9D 1XG3A 4R6UA 3VX0A 3B3DA 3DXAE 3GE7A 4EXPX 2B81A 2ETWA 4MPKA 4Y7EA 2BGSA 4LYKA 4Z0BH 1S7TA 2A3LA 4M8UA 1SLXA 2M1KA 2J44A 3MO7A 4EO5A 4ORGB 4BQBA 3QFJD 4YHYB 2P3ZA 4G43A 5HGHB 4GIOA 3O6LL 1A5AA 1FVEB 3QIUD 3CFEB 1HK6A 3DG7A 5TBOA 3SBFA 3R1ZA 5F97E 4YHLL 2EG7A 2KMWA 4U3CA 4KKBD 4YDIH 3VPLA 2IQAB 2N7BA 5LA0A 2FBRA 4PW4A 4Z95L 3VCRA 4MD5A 2OZTA 2L5HA 4YYCA 5F6IC 4YSUA 3WL9A 1D5BB 5IVZB 2PUZA 4E3VA 3MLYH 1N5YH 3MRIB 3RUGF 1BPLB 2NXZD 4XHJC 3H4WA 1F13A 1CB7B 3M0YA 2Z2AA 4RNJA 4WKFA 4JFFA 3VWJD 5FECA 2PDJA 3ITVA 1J5OL 3EOSA 1QKZH 3V6OE 2RAGA 1DVSA 1ADDA 3OD3A 3UG4A 2H2PC 1E8ZA 1ETZB 1AC0A 2OKTA 2BXZA 5CS7A 3WL1A 1PZ2A 1S9WB 1XGRA 2R2HA 2CBTA 1JF5A 5EFIB 3U83A 3VMOA 2FQIA 3QUYC 3D0LB 4O02A 3QDGD 3VOFA 1NFAA 2AK4B 2FTWA 3QUGA 1TTQA 5EIIA 5I15L 2DB8A 2QNEA 1TJIL 3ZDYB 1C9SA 3UWEA 3X1BA 4I77L 5CIPB 3STLB 3NL5A 3VI3A 1L9WA 1XGYL 2DT1A 1ES0A 4H1LG 4KDVA 5HJ3A 3TZVA 3ZMNA 5IHHA 4NNXB 4YOKA 4BQ5A 4NPYA 2H47C 3UDWA 4PS7A 4PJ8B 5FM8A 1YE6A 4NQSA 4LBRA 3VFOB 4DKFH 2LU3A 3MRFB 1X39A 4KROD 4C91A 5IBLD 2EBNA 2HX9A 4JHZA 4S3DA 5E8PB 1KPUA 1FWEC 2JI3A 4OFYA 2AV1B 5ENWA 4AHOA 4JL1A 4Y2DC 2QGHA 5IHRA 3CPLA 1PYWB 4Z7NF 1GZHC 1J0KA 2NXZB 1RUKH 1EX0A 4KXZH 4PJ7B 3A9IA 3VZYA 4JN2A 1XGEA 3UJEA 4JO1L 5GJTL 4O2EA 3TYFB 1AD0B 1FO0B 3NPWA 3HC4L 4JDEB 2IS7A 3T1GA 3EOTL 3DOSA 5AVVB 1VFTA 3H54A 1WITA 3ARSA 1MHPH 3MVIA 4AZCB 5GGSY 4A7QA 2KZHA 4ZXBB 1PNCA 3S83A 1RUSA 4PR5A 3ZKQD 5LVEA 3K72B 4KJQC 5CSZA 3X1FA 1LWIA 4L8BA 3PZUA 2JEQA 4L5FE 4YVUA 2YUWA 1QRNE 3LB6C 5KYXB 1UWRA 2KH2B 3LMYA 2D2JA 2FO1A 4BYHA 2LABA 3QUXD 3ARBA 1G9EA 2PTYA 3AIUA 3G04A 3WLWD 4HWBH 4NUGH 1KB5B 1UT9A 3GHEH 4I5RA 4FYSA 5ICZB 2BVWA 4YHOH 1NCIA 2R23A 3GSVB 2GSEA 1TZHB 1AGBA 4FQ1L 5D6CA 3ZRFC 2FWOA 3GWJA 4NWUH 5F0LB 4TLTA 3WNPA 3ZRCC 4A2HA 4AMKH 5LGKA 4LT9A 1BFVH 1HHKA 1Y07A 3EWYA 4FEZA 5D9NA 2WZAA 3EA1A 3EO1B 3N9GL 2G5RA 4U49A 1PS9A 5L9DH 2IKIA 3CIXA 2VR3A 1DVXA 2P47B 3FUNA 3ZYZA 1ACYL 4H88L 4UTMA 1WVZA 2V82A 5A8MA 3DYMA 2KPNA 4R26L 4AM0A 5KYNA 4MFEA 4Y5YB 3RE0A 1RUMH 1F45A 2QUUA 2EO7A 3P8IA 4MJHA 3D3AA 3LZLA 3LDVA 1MFAL 3RI5F 2WXFA 4X50A 4R90H 4P2RA 2DZXA 4O51B 4QR6A 2CMRH 1TIUA 2QXWA 5GSVA 1HEHC 3LH2L 2MCPL 4I5BA 5DRCA 1Q3NA 5E94B 3VMNA 1FIGH 3VNMA 1HSBB 1X8CA 3QYMA 3OB8A 4TMPA 3SADA 1A7RL 3ICJA 4ZW6A 3QJZA 1TPEA 1E1FA 2EEDA 3BQUB 4S1DC 2OCJA 3QE5A 32C2B 3UZYA 1MW2A 2RFXA 5GXBB 4LO9A 5KW9H 1UB3A 3BPOC 4CADB 3RCMA 1TETL 3DIPA 2D7QA 5CZXD 2A1YA 4PWEA 4JZ5A 4OLUL 1GL4B 3OO2A 1LWRA 1RUPL 3BL3A 4HNVA 4L4TB 2R0WH 2HMIC 3AZRA 2I07A 5M5DA 1YDOA 2VKXA 3C09C 4GW1B 1DWIM 2OSYA 3G7TA 3KW8A 5H91A 1F9CA 2Z27A 5H94A 4ZAKB 4BF7A 2Y7QB 3AQXA 1OAUH 2J4WH 3LXBA 1KB9K 3HBPA 4NNXA 4K5NA 4X9BA 3SKUD 3VXUD 4DTGL 5MP6L 3N1FC 4OT1H 2OPCA 3U7WL 3BPLB 1YQ2A 5AB0A 3QFWA 3SSZA 1DTUA 3P3SA 2VDPB 1ZT1A 3VQ1C 2BGNE 1KEML 4PUWA 1XPGA 3NIFB 1CLYH 4NZJA 5IF0B 1C8PA 4BUHA 3MW7A 4A2RA 4Y4FD 3PTDA 5E9DD 1YVLA 2CLZB 2MQCA 5I5JA 2IAMD 4Y2OA 1G7PB 4F8NA 3WUZA 2X4OB 1NL0L 4X4YA 5CPQA 4GOSA 4HAFA 5AHFA 1SXZA 4WLCA 1AXTH 5IF0A 1XF5B 3P5YA 4CCDA 2RJHA 2IC2A 4KI5E 1BVWA 4YVNA 2KI6A 1TQTA 3DRQB 4PEEA 5KANI 3CM4A 3UP1A 4LOFA 4UZSA 1KELH 1JF1A 5I0YA 3H2QA 5BOFA 5CU9A 3O6FA 1YC7A 4L8BB 4XBPA 3MXVH 2BP5M 4FZ8L 4NQXB 3TF4A 5D38A 4TNWF 4RISH 4HJUA 2H0FA 4GCAA 4JPIB 3HE6C 1HC1A 3OKKB 3GB6A 1PKMA 2JK5B 2NT1A 2CFFA 2GITB 5AW4B 4MAUH 5AW3B 3C2RA 3FV9A 4GHRA 2O7QA 3L2IA 4PG2C 2P42B 2FB3A 4EP8C 3MXVL 2WANA 2OBGA 3ESVF 2JQZA 4M3PA 1J12A 3P73A 2FHCA 3KYMB 1XW8A 2JB5L 2YPLA 1E4KA 3LRSB 4R97C 1XYMA 4HNUA 3S6CA 2GC7C 3L9YA 4JFDE 1KIRA 3U46A 4UT9L 2B8OT 4MM1A 2VELA 4U1JA 1H41A 2VMJA 2E1WA 3KPOB 4G6FD 4IHOB 1UKOA 3C0SA 3GG1A 4QQ3A 1K2DA 4PMXA 1KBLA 2QR0A 4GMSL 1M56B 5JW4M 1NBZA 3NJFA 1Y6MR 4PP2B 4TXVB 2FR4B 3DG6A 3TU9A 3CV7A 5F4WA 2YGPA 2YPVA 4QAWA 2OT1A 3PS6A 4V27A 5F4SA 2JELL 1TV8A 1HH9A 4Q2ZA 1QEWA 1FV1A 2GJ6D 3P9LA 1TQBC 4MD4B 4TQIA 3V6OA 1O5XA 3AXKA 3SYCA 1R9FA 4IKIA 4PRTA 3X3GL 2QKIB 3SDYH 2AJVH 1MFMA 4F7TA 2PNDA 1AR1C 4PJ7F 1L9MA 3LZ5A 3R6IA 2CA4A 2J4WL 1UOVA 3EYUH 3SIKA 3TYEA 2OK0H 1NDYA 2ICEA 4RIRB 4AF0B 2BY1A 4MHHG 4GJTB 5GS0C 5A6JA 3RVUC 4S0HA 1P5UC 1MCSA 2WLHA 3JV6A 3QWQB 4A37A 1C91A 4Z23A 1WKYA 4EMZA 4OLUH 5K9KB 4XXCC 3RTQA 3I9IA 1V77A 1EJUC 3W28A 4R9OA 1EIBA 1W0WA 3P30L 3ZKXC 4WWOA 3SCMD 3HFMH 1LO3L 5EC2B 3ZHNA 3PC0A 2DQTH 3G22A 4PLKD 2H5UA 1J5TA 3HC3L 1VF8A 3GHSA 1E2ZA 1S9VA 3ARWA 4MJ6B 1HKMA 3LZQA 2PGFA 3AZTA 1OTTD 4ABWA 3WAJA 2WJFA 3DX8B 4TX9A 4DVRH 4HA0A 1ZLVH 4FJYA 5A2IH 1UR3M 3FT4A 4Y16D 3TV3L 3QI9C 1NFIB 1KYAA 2BMBA 3NQEA 1GK8A 3WLRA 3E6HB 4IMLB 3RO8A 1IAII 4R90L 4XMZA 1UA6H 5C08E 2NVAA 1MO0A 1UURA 4X5RA 1U6AL 1XGQA 4M5PA 1ID2A 1A14L 1BF2A 4RMSA 3TH4T 5A2JH 3CHEA 4BI6A 3ZR5A 3B9DA 4GY1A 5I18H 3TWAA 4APQA 3I4EA 1AGCB 2FT6A 2DZSA 1MEXL 2PDPA 4K8GA 1DR9A 3L3HB 3MV9E 3NIDE 3OQ3B 4KK5D 5F9AC 3IN2A 3H2NA 3LN3A 1XL4A 3ZS4A 2GVYA 1YPZA 2JH2A 4QFUA 4KAQH 4PTMA 4IMFA 3G6AA 5SWZD 4BUQA 4CNIB 4NS0A 6REQB 2NUPA 2WUCH 5C0RH 2H6OA 1J9CT 1ET8A 2VN7A 2QJMA 4MWAD 1T83A 2GOUA 1QSFA 5HDBB 1SLVA 3M6YA 1KD0A 1DVUA 3AG3B 1R3KB 4NJ9L 3QORC 4ZQOA 4GRLA 3SR7A 3I9PA 3SCMB 2DEWX 1BVLA 4N87A 3AGVA 2XN9D 4AISA 3O6ML 1WFUA 4DJDD 2P8MB 5CPLA 5IHZB 5CC3A 1W72H 1LP9A 3HG3A 1ZLVK 4HJTA 1SEQH 2CRYA 3D2UA 5TDNB 1WFTA 1CLCA 5KVFH 4F7CA 4RAVA 5DRZB 5KBNC 3HPZA 3R43A 4OIIL 3IXAA 2X70B 4NT0A 3WTVA 4PN2A 1RV8A 3TWBA 1J10A 2Q8ZA 4GYBA 4N0CC 3TC6A 5F7LB 3BARA 2J8UF 3TA3D 3N6JA 4HN4A 1SFDA 2IDTA 4K15A 2HWZL 1U3ZA 4IKLA 4KY2A 3LHPL 3INPA 2G8ZA 3VD4A 5SWUA 3UR8A 2ZXBA 3C08H 4L3FA 2EE0A 3WL9B 5HGAB 3RM8A 3B9OA 1NQBA 2OJEB 1S46A 4ZMTA 3S1GA 3ULVF 4MD0A 3VG9B 4YWGH 1UP3A 3ABSA 1AG1O 3PWNA 4K23L 3WYRA 1KJ3H 4L64A 4OF0A 4Y1TA 1A4LA 3F12A 3CUGA 3OL2A 3LNFA 4UV4H 4MWAB 5C0BA 3PHSA 3HTLX 2QSCL 4BE6A 2R7EA 2IXVA 4RDQG 1LWHA 3JWNG 3TJLA 4Z3FA 2WP3O 1ZQ5A 5JW4Q 4PPTA 4P9HC 1TTGA 4AD5A 1G4RA 1FDLH 1RULH 3O45B 1UM6H 2DDQH 2EH8L 4OW6A 3GSQB 2DQ6A 3RK8A 2Q3RA 5H37H 1FUYA 2VDNL 2Y88A 3CDZA 4NKMB 3E6FB 5EBLB 2A6KB 4M8RA 4ZK8A 4C57C 2WTRA 1JCTA 3TN4A 1MRCH 3F5WA 4XNDA 1JVNA 3BKJH 1XDMA 4L9YA 4KERA 2FZDA 1OGBA 1YY8B 4CDHA 2LE9A 1GS6X 3EFOB 5IIEB 3I10A 4JY4A 4GVFA 4GOAA 3QO1A 4OUIA 3C2YA 4OGYH 4ZTOL 3IV3A 3MVTA 1XIWA 2WBWB 3E1ZA 5IEHB 3BLDA 3M07A 1AQKL 1TQJA 4FIQA 1TF4A 4WEEA 4MSWB 4YEEA 1NCWL 1FXPA 1OSPH 3MQTA 4JTSA 4UILH 5BS0A 3UTQB 1XGRB 3FCBA 4P0DA 1H6UA 4KVCL 4YC2B 4QX4A 3WD3A 4KQ3H 5LKYA 1E90A 1Q4NX 2WXNA 3DARA 1HXKA 3US0A 1XTMA 3GTVA 2HT3C 5DC4B 2IH9A 4GRWB 4XB8A 3TN6A 1FZOA 4O58L 4PTDA 3QH2A 1NIAA 3TSMA 1B6DA 3PXHA 4ES8A 3CFBB 4DWSC 2YRLA 4MFDA 3VA8A 4I0PC 1OK4A 5T26A 2EIJB 2XFGB 3J27A 2WVTA 3K6FA 3SKMA 2HK0A 3UPBA 3FO2B 2J8UA 3GZQA 4PRIB 4QRUA 4UOZA 3GMNA 2PPAA 1T20A 3FZUD 3C8KA 3FO1B 1UT1A 3KYKL 1GKQA 1BD2B 3L0GA 3FOMB 2FYMA 3CVHH 3NQ7A 3W5MA 4FOJA 4AZUA 4P7NA 2KUTA 2DZUA 2YMTA 3F62A 4XD6A 1FYTD 1YEKH 5E6IC 3SBWC 2E9GA 4FE9A 4X7CC 4BR1A 1EO5A 2A21A 3ETBJ 2ZSVB 1TO4A 3NFSL 3LKQB 4RMVA 5HI5D 4L1WA 1INDH 1HWHB 1L3WA 3WLTA 5FGSA 3MO1B 3P1VA 1XKJA 4XBEH 2D7TL 3GR4A 2O4EA 4NP9A 3N19B 1WCQA 2O4QA 5IQ9B 3ET9F 4JHMA 1G7IB 2W65B 5ICXB 4U7KA 4I6VA 2N3JA 4O0KA 4X98B 4G6AC 3ZMRA 1ZK5A 2XWTB 4XZUA 2WAGA 3F1QA 3W1RA 1BLNB 4RCAA 4DBDA 1OE3A 1IQWL 3PV7A 3SGGA 5EN2A 2DQJL 2O6DA 4ZMPA 3TEXA 2J1KA 2X40A 3LS4H 3SGEH 1MH5B 2W60A 5G2WA 1J05A 1TPXC 2MIZA 3UOAB 1I1AC 4OY9A 1POJA 1VKXB 4LCWD 3PWJB 3BGJA 4IPNB 5FM5O 1CICB 4X0KA 1RK5A 5A2BA 2C1IA 2PP1A 3FYIB 2EE9A 3MCNA 5FF7A 4GLRI 3A67L 2Z1PA 4M5YL 3HMXL 4FYRA 3ULVD 5H35B 5CSRA 1FL3B 3GYEA 4O16A 3GXNA 3HZMA 3M45A 3EXJA 4ES4A 2ZX7A 4MB5A 4G56A 2JCCB 2CCRA 2PP0A 2HG5B 2N1KA 3MV11 5KS9A 4HMCA 4AT6A 3T09A 1IEHA 1KENH 4MNMA 4PMQA 3SQLA 1CDCA 1XGPA 2DIAA 1CD1B 4HH8A 5HVFB 4Y9AA 1HE7A 2WNKA 1LVEA 1MF2H 2O5ZL 3C8HA 4GSDL 5ABDE 4B3ZA 1HXMB 4P8UA 4MLSA 2L4OA 3C2AH 3X1EA 1HJWA 3AWGA 4YPJA 3V6OC 2WBKA 1TVDA 3WFHB 4YN3A 3HCVA 3FH7A 1PLBA 5EC1A 4N2HA 1J93A 1IWAA 1F1AA 1V3IA 2JJSC 2O72A 2YUVA 3NT0A 4XVTL 1DJNA 4U1MB 2NTSP 2O5YH 4GO6B 4NQEE 3AUJA 1U8OA 3C86A 3ZTEA 1IBBA 5LWYH 5HNTA 3FQNA 4P04A 3LLXA 4DAFA 3WJXA 5FDYA 2FGWL 2ZXGA 2RDXA 1WBZA 1RJLB 5A2LH 3LH8A 4S1RH 2L7JA 5AW7B 4IMAA 2WXRA 4YN5A 4LSUL 4M4RA 1IFGA 2O7SA 2ZUNA 2XPGB 4X6CB 2OJEA 2D22A 5ACZB 3L4YA 5J8LA 2I7OA 5MI0B 1MZRA 1WA3A 1FHDA 3AHXA 6TIMA 3EOYG 3B2DC 2NY7L 4MX7A 5KVFE 4U6VL 3OGOE 1JG9A 4PJBB 5CNHA 4ORMA 1T3FB 5LCVA 2DQCL 3KHQA 4NENA 5GZNC 1W0WB 1JUEA 1F4WL 4FOMA 4ZJ9A 4CKQA 5FO7B 2IDFA 3P8JA 5CEXB 1NAMH 1IE4A 2KDGA 3MGTB 3L65A 2PODA 3D30A 3TC9A 5DJAA 4C83A 1QOPA 4P9HH 4X2UA 1HINL 2B08A 4Y2OB 1NQ6A 4YZWA 2ED8A 4CL7A 2FVKA 4R83A 1BTMA 1P0SE 1T1XA 3PGCA 5K9OA 4P23B 1IWBA 3CHCA 3STCA 3F03K 4H8HA 5JMUA 4KEMA 4OJCA 5DJ2B 2VABB 4GMEA 5HUOA 1U95A 1XSKA 1N12A 1PFOA 3AY2A 5AOIA 5F7FA 4HEMA 4ELKA 3S8FB 1X7FA 2DL2A 5BO1H 2AXJA 2F1BA 3U25A 3VRLE 4I1PA 3SBPA 1YY8A 3G18A 3S9YA 1ZE3H 4ZQNA 1F07A 2SEBB 4GFXA 4CEXC 3ULUH 3VFUB 5EEYA 1WDQA 2AEPH 2C3WA 2J21A 4QHKJ 2NCEA 2HPIA 1W5PA 4TQ8A 1MEWA 2GK1B 5FKYA 1SHXA 4IM8A 3W7PA 1AR2A 4WFHE 3QUKA 3TJPA 4EOWH 1F3XA 4JW3A 4GC3A 32C2A 1XWVA 4RSYA 1NEZB 4XXDB 2V3EA 3GU1A 3SRDA 1SZGA 2XI9A 2BHFA 4QHUB 5D7LA 5DEFB 1E4XH 1G9NL 2BJMH 4XPGH 3GRIA 3GVGA 3M1BA 1D5ZA 1NEUA 1YMMB 2F19H 3FCTB 2EPLX 4DBSA 2CLRA 4Y8AA 4HGWA 3HMWL 3W1QA 2GTQA 2GZXA 5EBMA 3IK2A 1VD6A 1Z9PA 4AEHH 1YMHA 1QVBA 4FZEH 4OUOA 1FLRL 3VACA 4CA4A 1MSSA 3ARYA 4L4OA 4GQRA 1BM7A 1JWUA 1KJVB 4AVJA 4ZMYA 3Q65A 4IFOA 2F54D 2HN7B 1I8MA 1EHXA 3C0JA 2HJPA 5L8LB 3UZWA 3BEVA 1HSAA 1BYBA 4GSQA 5DYOB 2PCPA 5GRYA 2NXYB 5B8CA 5C2GA 4AZ8B 2WNZA 3H7VA 3MLSL 2FJFB 4R7JA 5SV3A 4ZI8A 4QRTA 5H6HA 4ATDA 4JPQA 1CYXA 2B0SL 2I17A 1OB1B 3DX0A 1ZTXE 4P46D 5I6OA 1PO9A 5LA1A 5ETUA 5SWSB 1ZDQA 1WG3A 3WXWL 1E0VA 2WK2A 1TPFA 1GG0A 4RZCB 3B9KA 1G7HB 1KB5A 3M46A 4YBLB 3CEPA 3MZNA 1K4CB 5T3XH 1R6VA 2ZCZA 3WFEH 4M7ZB 1XIWB 1BIIA 3EJCA 4OCSL 4RMRA 3ZTJH 5IW6B 3SY1A 5T9BG 1ZIBA 1F8IA 3QZPA 4MQ7A 3L0NA 3WENA 2J8UE 2H6RA 3WH8A 1AQHA 3NCYS 3AJ7A 4DFHA 2BZ7A 2EPNA 4TTDC 4GG8B 5HHMD 1YECL 1A14H 1EZUA 4FG4A 1NPNA 1XD1A 4KI1A 5CO1A 3TO4B 2YPIA 4KNQA 4K3GA 1I85A 2WW5A 3CB3A 4WTZA 3THQA 3MLRL 1IARB 3U2IA 1BKHA 2DV6A 3RYSA 2GABA 4KQ4L 3MRGA 3QS3A 4O58H 4OCRL 1II4E 3BE1H 4LCCA 3EDDA 4UQDA 1MXSA 2PO6B 1MRAA 1CURA 1PYWA 3MCLL 3WSQH 1UWXH 3PV6B 2A5UA 5KS9F 4L1GA 2OM5A 1X5XA 2AEQH 2NQHA 1FG2B 3QDJD 5T1LD 1TE1A 4J3VA 2E6QA 3LV3A 4M9PA 1SGKA 1QUNB 3UTTB 2CK0H 1VF5C 2JK5A 3CNKA 4FCHA 3V5KA 3N3TA 3I6EA 1W5MA 5DDHB 4Z3GA 1UWUA 3MBFA 2ZBTA 4P5UA 3VIOA 1FPTH 1TZZA 4PJ8A 1J0ZA 2FUTA 2NNAB 2XC8A 2UY6B 3U30C 4BDVA 4ATTA 2NYYD 4WO4A 2P5WB 5MEPA 3CC1A 1PV8A 1PWLA 5KBPA 4AM0B 1FFPB 4Z7VB 4AI7A 5IW6A 4DYJA 3GLZA 1JPFA 3CN1A 5CJ8A 4LBEB 5CBAB 3S1XA 3L3IA 4HAGA 1FN4A 4HIEA 2C3XA 2V5TA 3AREB 4KITB 3UL4A 1GCYA 1OCRB 3GSUA 4K9JA 2I26N 1V02E 4IX2A 3OXSB 4L8CB 3MA7B 1G87A 4QUOA 3RHWK 2ODHA 4F7CB 3PAJA 1OB1A 4B9GA 5E5MB 3O6AA 2JCWA 4WSJA 1HVXA 5DMIL 2PEVA 3HQNA 1XMEB 4LDCA 3WQWA 3PFRA 4OLWH 1OTUC 2DQGL 4R4ND 1W8SA 4FNLH 3ZE0B 3QTPA 4AYID 4Z7UF 5BMFL 2IWEA 4BQ6A 2GCYB 4FXKB 5DJCA 2MANA 4K37A 3DKLA 2J6EH 2EE3A 1J18A 2ERJB 1KDIA 1Z89A 4GKOA 3ZL4H 1O5QA 4RE0A 4GW1A 1NGQL 3RHGA 4W9DC 2J8GA 1YRKA 5E1IA 1UC6A 3PHQB 5SWQA 3CFEA 4GKLA 4U1JB 1ETA1 1ICPA 4D3CH 4O1AA 5I6MA 4IG2A 3XINA 1WZ1L 3QG7H 4NQEA 2P7TA 2CG9X 1I9IL 2ADGA 3VQMA 3E2SA 1Q6CA 4QISA 4TVSa 2HXTA 1P0BA 3QXTA 4N0YL 2VZ3A 3T3PE 3ITOA 4XBSA 1XLIA 5BVJA 1UQYA 1JUFA 2ABAA 2QPSA 1LWJA 5B3JF 2UZIH 2BRQA 4QTGA 5KBKA 3C2OA 5EPDA 9RUBA 3L68A 4RFOL 1IHIA 4H8QA 4LBAA 5JBFA 4IG2B 4KCVA 4JTLA 3K2IA 4QO1A 1A9BA 4PFMA 3V10A 1RSYA 3GPSA 3ES8A 4OIFA 5JUEH 1UVQA 3KLHD 1H0IA 3HAEA 4P3DB 2CLKA 2HS6A 3S9ZA 2INEA 4NN5C 4S0SD 1BXNA 3C8DA 4NUJA 3UWYA 2A6NA 1GYNA 3CHXA 1DQTA 1DYSA 4Z7QB 3HZYA 3SCTA 4M9OA 2G4GA 1U5JA 1XF4A 3HC0B 3MJ9H 5FB8B 1ELSA 3MJ7B 4JHAL 4JDVA 4JN8A 2JIXA 4LAQL 1FWHC 1ZOXA 1OIMA 1TV4A 4B9YA 4KZDH 2WZMA 1B4JL 3GIVB 1XXFC 5DQJA 4DTGH 1NC2A 2E8YA 4C5ZA 5LBSA 1G7PA 4Y2LA 1EZVY 1A50A 4IIBA 2PR4H 2WXJA 4LVOB 4A67A 5K1JA 4CNOA 3UGEA 3U0HA 1S7RA 2A7BA 2QJJA 4ODHH 1FYTE 3NM3A 4E8DA 1PZSA 2WCPA 1RFDL 4HXAL 3S2LA 4PVNA 4M1RA 2EDTA 5IDZA 4FX6M 3I75B 4Y0GA 2BBFA 1MCWM 2ZYIA 4JZJC 3AIWA 4WO4B 3I6TA 5HHNA 3KRZA 5CSSA 2IQAA 4KKRA 3HAEB 4F40A 1X7QB 2MCPH 4R7LA 4CSSA 2ZWYA 2A38A 3X1GA 2PTXA 2FX8L 5D1QB 1IXOA 1ZJBA 3T0EC 5ABGA 2ESVA 2CLRB 1PQZA 2NZ9C 3RZCC 4DWHA 4FQIH 3L3KB 4G8EA 5D1XA 3WN5C 1JN6B 4Y5VB 4QAIA 1OP9A 3PV6A 2BWGA 3ES7A 3REQB 4JM0A 5AUMA 3VI3F 2EEAA 4IGNA 3EZ8A 5IJKC 3GVRA 1F6AB 1R1CA 5C0IA 4QCEA 2BSEA 1L6GA 1S2AA 4JFYA 3NPSB 4NIYE 3EX4A 2B15A 1J5SA 1SDAB 1QI3A 3AY4A 4AK1A 4LHUG 1OFRA 2OQHA 2ID5A 3DVNA 4C6OA 4ALAL 1RZIA 4GUCA 4UT7L 3R4RA 4QGTA 5JQ6L 3WF3A 5T3ZH 2X6BA 3WH7A 3OX8A 1XP3A 1T0NA 4CNNA 3MY9A 2NNXA 2GVJA 1LROA 2VZVA 1IIGA 4Q6JA 4GUJA 3HI5H 3L16A 4X9GA 3DVFA 1Q8JA 2OWWA 3LTVA 5D7KE 2IV8A 3EH3B 1GYAA 2XDFA 3AYSA 3G6DH 2VDHA 1TLKA 1LORA 1E6JL 4N8CH 1RH8A 1AQMA 2CDGA 1JZ4A 5A16A 3RX3A 5IVXB 2YBRA 2DLTA 5EF0A 2YPVH 1SHSA 4H20L 4HMDA 4P3CL 1MJ8H 3DHUA 1J8HB 2K4WA 3P2DA 1V6TA 3JVAA 3IWPA 5FK9A 2EXWC 4Y9BA 1EHLH 1DQIA 3BWUC 3MSDA 4Y89A 3WEZA 4MNLA 4AYDC 4LU0A 2WUBL 1PB0A 3CWNA 1IIKA 2R2EA 1A8ZA 2VDMB 4FTVB 5AYXA 4AEOA 3N4AA 4GI4A 2RD0A 5AYIA 1ZHNB 3JUZA 4J12A 1W8EA 4XODA 3I2CL 3WY4A 3WD1A 4FERA 4PUUA 3SO7A 5IROC 2EDQA 1GOMA 1O1HA 1O6VA 4I1NB 2P5PA 2XYLA 1RUQH 4NI6A 3O2LA 3QK0A 4ZW3A 4FQXB 1R0MA 4WTXA 4FXRA 4Z3EA 5KSBB 4DAGH 5I1GH 1QT1A 4HC1L 4OV5B 3L0KA 1IC1A 4F8XA 4YSDA 3FFCD 2XXMB 4IIQC 2B2XL 1E6QM 3CV5A 4IP7A 3CXFA 4ZX6A 2ZUXA 4LLVA 4BIKA 1E9OB 2D7PA 4WHYH 4IIDA 5C9ZA 3MHZA 5MHBA 3ZDXF 4LPCA 5E0KA 1F90H 3UW6A 2VB5A 2GGEA 1XRSA 1OGAE 4QIUA 4QJ4B 5DT1L 4RH4A 4EX4A 5D2VA 2GWGA 2VYOA 4LH8A 3KNBB 3ZGHA 1W6TA 5BOEA 3N2BA 4FP1A 4Z7UB 3ZMEA 5BOOA 4UQ9A 3BI9X 4XKYB 2CZ5A 5E2VL 4TXEA 3KGSA 3SKOB 2YO3A 4NG3A 1PDKB 4WJKB 4F2MA 3VXRA 4XGZA 3VVWA 3I4KA 3JBG7 5I71C 1FH9A 2C34A 3JWDL 1IF2A 2QV5A 3IJYB 1SDDA 1TZIA 3DBSA 2OXNA 4JTDA 4Q7BA 2VW6A 4F9JA 5DZ9A 2IPKB 4B9KC 2FTPA 2GFBA 2Y63A 4NQVB 3QA3A 4D8LA 4JE0A 3UETA 1IBZA 5E99H 1RCOB 2JCCE 1I8LA 1O60A 2G3FA 2V5JA 2CXEA 1T66C 5ECJE 3W1LA 3U6RB 4C6EA 4L1TA 1N4XL 2CLVB 1IM9A 3MJ9A 4N86A 4Q6IA 4E41E 5ABEA 2J4GA 1JD9A 4ONGL 4EDXA 1AGBB 4XOEA 4DI9A 2PRLA 4PJ8C 5IUCA 1JNJA 3AS3A 1CB2A 4GRMB 2WMPB 2DUZA 3TA3A 3F58H 3ULVL 5DY3A 4V15A 1QSEB 3UPRA 5F89B 2J1ZA </