4DO4A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 130
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do4A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do4A01
1OFDA 2QLYA 1H7OA 1B4KA 2XWEA 1OX4A 3O63A 3SGZA 1QWUA 2XVKA 3OA3A 4O14A 3VNYA 3C52A 2V82A 2EO7A 3TNOA 4J7RA 1JCYA 1FXPA 4O11A 3GNDA 1TPC1 1R33A 4BZYA 2FTPA 2WO5A 1FBAA 4YMZA 3DX0A 3WDHA 1JUBA 3G0UA 4H8VA 5KITA 4AWTA 3L4WA 4YCPA 1OT2A 3IJ8A 3DBPA 3SIZA 7TIMA 4UNKA 1F76A 2X1RA 3IK2A 3P8JA 4S2CA 5BW6A 3V75A 2E6FA 4AF0B 3R89A 4O10A 4UMCA 1O95A 2YPIA 3OG3A 4IMCA 1P6WA 2A6NA 1KFLA 5I5RA 5HUOA 1CIUA 2X16A 4XB3A 1G4SA 2YKKA 2P1FA 2F61A 3ZFHA 1WV2A 1X8FA 4X9SA 3BVWA 3PBYA 4NVTA 2ZRWA 3C8FA 4Y6GA 1VC4A 3B06A 1DQXA 2FGZA 1KWKA 3KWXA 1XCXA 4UQAA 3UZJA 3EX4A 3VM5A 4GKLA 3K8LA 1N55A 1N7KA 5CG7A 3QMRA 4UOQA 3K30A 1QO5A 5BNKA 3MBFA 3LRMA 1DV7A 3RIKA 5KSWA 4H2CA 3EJTA 5AHMA 2TRSA 3ZR6A 3HB9A 2E6DA 4O53A 2ZWZA 1BTMA 3BLBA 4PSRA 2ZA1A 4FMVA 3IIVA 1G1YA 1RR2A 3PG9A 4GUJA 4JTHA 2E77A 2ZX7A 3GIYA 5DBTA 3VSVA 4DPQA 1V3JA 2E0PA 1YTKA 2XWDA 1OVDA 4Z0JA 3STCA 5L6UA 3BO9A 3HF3A 4DEFA 4M5PA 2CLLA 3LHYA 4U3CA 1CI1A 3TX9A 3BLPX 1U2YA 3S1WA 5DXYA 3BH4A 5F7UA 4LUIA 2CHNA 1S46A 1ZHAA 2QCGA 4O8RA 4NX5A 2J6XA 4BK9A 2FDSA 3DHUA 4WUIA 4EOUA 4MAZA 3ZO9A 3CZKA 4J27A 1TQSA 5K7JA 4NJIA 5DY2A 1JCLA 3EWWA 1XM3A 1ZALA 2C6QA 2WSKA 4JY9A 1YPFA 4JX4A 1Z42A 3LCXA 5G2WA 1UUMA 3NL6A 4RR4A 2GJPA 2XVLA 4W93A 8TIMA 3BVUA 2ZZ1A 1OJXA 2ZZ5A 2Q3OA 3HZ3A 2YA2A 4GFSA 2A7NA 1F73A 1W5MA 2GUUA 2V2HA 2AAAA 1TO3A 1I2QA 3F4WA 1KTNA 1XDMA 2VEIA 2VEKA 5HWJA 5A2BA 4EIVA 2KZHA 4FNRA 5LNRA 2Y4SA 3BVVA 3RF9A 2O7QA 3NQMA 2FFCA 3W38A 3ZOAA 1D3GA 2NZLA 5TBOA 5E0FA 1UOKA 1GVQA 2DZPA 3HO8A 3L66A 1LRQA 4N9DA 3FOKA 3TONA 1JD7A 1XL9A 3WY1A 3HPXA 1BSIA 5CGMA 3W7RA 3W7EA 5I3GA 3G0SA 3MUXA 3NQDA 3SGUA 1MEHA 2QCLA 1CGWA 3SZ8A 3UWZA 1UBSA 4J9JA 3LCHA 5DCBA 4MPQA 3H54A 3CZNA 3HGJA 1RQEA 1V3MA 2F1AA 1G4TA 1WZAA 1ME7A 3T40A 2ZX9A 4FNUA 4BI7A 3TFCA 1KW1A 3KVKA 1JXJA 1KCKA 3L4VA 1FY6A 2AGKA 1HG3A 2G95A 2R14A 4ML9A 5LGXA 4OGZA 5U4NA 4AEEA 2QDGA 1XD1A 5HWMA 2C8NA 4UTMA 5D33A 1L6SA 3TC6A 3U6WA 5CGQA 1FDJA 3BW2A 3N19B 3BUBA 3VGFA 4M6VA 3LV5A 5CSRA 1HL9A 1OFQA 3LXAA 4N6FA 1DQWA 2DZVA 3LI1A 1UD6A 1P1XA 1OK6A 1GVSA 2BWGA 3MP5A 1PS3A 1EX5A 1Z41A 4CQ8A 3KL0A 3G0XA 2QJGA 1CXEA 5J5DA 4PA8A 1BG9A 2LLEA 1PCWA 4JDYA 5EMUA 2V9DA 3G1YA 2VOMA 3W3OA 3CEPA 4X0NA 2WVTA 2HSAA 2PCQA 3NQCA 3C3NA 4HPXA 2W79A 4GUHA 3NQAA 4PFMA 3VO0A 4E2DA 4WF7A 3O07A 2GPTA 4IXHA 1U5JA 2A1YA 3IIZA 1HVXA 3QMSA 4RZ6A 3W7KA 5BRQA 1OSEA 3TJLA 4NX0A 2F7PA 1GZGA 3G22A 2WOQA 1YDOA 1OX6A 1YDVA 1A5CA 4LWWA 1B57A 2Y5EA 1XBXA 5FF7A 5FF2A 4RLIA 1OX4B 2X2GA 5FEXA 1TPEA 3D0CA 1GVFA 1R2RA 2TMDA 7CGTA 3DI1A 3WDJA 4NT0A 4JFUA 4RKAA 1SFLA 4UOZA 5GVJA 4JTSA 1MEIA 1H1YA 3TSDA 2BSLA 4PSPA 1NFBA 2OX1A 4Q32A 3KVJA 4Z1DA 1XH2A 2ZUSA 5CXPA 1I2RA 1QCWA 3MO7A 5AC8A 5FEPA 3TKFA 3A21A 1GYLA 2QJIA 1ICSA 3VMOA 1EO5A 3W87A 1IIHA 5D09A 2QCHA 4M19A 1PHWA 3S1UA 3UERA 5HQEA 4O15A 3IJ7A 4IMDA 2V5BA 4JY8A 1VCGA 1OF8A 5F4WA 5G1YA 2FJKA 1H62A 3S5OA 1IXNA 3L2LA 4MOZA 3VM7A 4CCDA 3W7NA 2XN1A 3WDIA 3GR8A 3LTYA 2ISVA 3GKAA 1BKSA 5G2HA 3D50A 1TTJA 3T78A 1TV5A 3CM4A 5HR7A 4PODA 4E0CA 4RV8A 1PEZA 4J3VA 1M7PA 5IBXC 2GJRA 2NT1A 3EB2A 3BLIA 4H3DA 1Z44A 3VI2A 1CXFA 2VEPA 4ICNA 1XI3A 4AEFA 2V3DA 3PC0A 3TAOA 5LGZA 3EJSA 3AXHA 4CN6A 1KFCA 4MLJA 5I3KA 4K8EA 1BF2A 3MJYA 4CKQA 2B4GA 5EA9A 2W0UA 6TAAA 3M5XA 4R34A 3M5YA 1ODUA 1OT1A 1AQMA 1MFVA 3M9YA 3UNDA 1LP6A 5DXXA 3W2JA 3WNMA 4AMXA 3NZRA 5SWUA 4O17A 1I2OA 1QMLA 3W7QA 4YXGA 3PF3A 1MW2A 3M7WA 4O50A 2VFGA 1LOLA 3BMVA 3WY3A 1F2JA 1RV8A 3KOFA 4JTEA 1QPKA 1F7BA 4NNAA 4P2VA 3EX6A 1H7XA 3G1FA 1NM9A 4C1KA 5IM51 1FXQA 1ONRA 2QV4A 3L4UA 4JYEA 4N4QA 1TJRA 5MHBA 3A6OA 3PULA 1TPUA 4AXKA 3UWYA 1JFHA 3R8RA 3B4UA 4Y9AA 4PCSA 1VJSA 2J24A 2CZFA 1K3UA 5CLTA 3CC1A 3TOPA 3O6CA 1DVJA 1HO4A 3B03A 3P84A 3HGOA 3L2IA 2ZBTA 1B4EA 1PHQA 4QJ1A 1WP6A 3MHFA 1OK4A 1AVAA 2E5CA 3QF0A 3W9ZA 3NQFA 5G2IA 1JQVA 4JTJA 3BARA 1W3TA 4YLWA 5ABTA 5A6MA 1K7FA 2VC6A 1ZAJA 4HP5A 1EHAA 1CDGA 2TYSA 1CXHA 1LZOA 2B7NA 1JRCA 4QNWA 2F7FA 3QQ1A 3S5YA 2DZUA 5DO8A 5KZMA 4FLOA 1W5PA 2E09A 4CCCA 4O28A 1Q45A 1WE5A 1X7FA 4R53A 1KBJA 4E2BA 1CGVA 2EJ1A 4UFJA 2YIHA 3W7MA 4GO8A 2DZXA 1EUNA 1Q6QA 1CYGA 4JYDA 1J4EA 2E6YA 1IIGA 2OYLA 4N9EA 2EAWA 5I3JA 2VT0A 4XBKA 4CVWA 1CX9A 3AJXA 3G1DA 5A5WA 4M8UA 4O16A 3WNOA 1DHPA 5DN1A 2FHFA 2R91A 4QAWA 2C18A 3W88A 4EF9A 3G1VA 2WSPA 1AL7A 3DDGA 4X3ZA 1ADOA 1P0NA 2WV8A 4WLCA 2CLFA 2WVSA 3VE7A 1U33A 2ZZ6A 2ZRXA 2E9BA 3SJ3A 3W1TA 4AHQA 1SR9A 1YXDA 3DXIA 2G5WA 2BY3A 2WKJA 4LRTA 3VX1A 3GXMA 4FX7A 4ONVA 3BK0A 4FIQA 3STFA 4EWND 2VNCA 2EHHA 3L4ZA 2VELA 4TR9A 2FLIA 3BC9A 1XD0A 1VHNA 2ISSA 4UZSA 1QR7A 3S5ZA 1U83A 2J9YA 5G4EA 1CPUA 3VMNA 3WJXA 4B5NA 3TQ0A 1DJQA 4J3SA 2NWSA 4LT9A 3DDFA 3EWUA 2FB3A 4GIAA 3GDRA 1BVNP 2PWHA 3OLEA 1BWLA 3MI3A 2FE0A 4FLRA 3KLLA 5LHFA 3A24A 2ZDRA 3MP4A 1G5AA 2VKZG 3R2GA 4UFIA 5DCEA 2BX7A 4UFKA 2ZTKA 1SO3A 1XUUA 2RDUA 3TE9A 4N9CA 2YR1A 3BAKA 2X2HA 2ZXBA 3LERA 3L0GA 4K8HA 3TA6A 2WCGA 3FKRA 4PL2A 1F5ZA 3BSHA 3L0KA 2VENA 4C1LA 1E3XA 2ZUWA 3I68A 4GUIA 2C3ZA 1AMKA 1G4EA 2CWNA 3TH6A 3NQGA 4LNYA 4UZUA 3WK0A 4WOZA 2GQ8A 4FNTA 2V3FA 1DORA 1O60A 3VNDA 3HMJG 3WK2A 1XCFA 2NXHA 3HBLA 3PWAA 1QO2A 1S5WA 3ATYA 4Z1CA 3S0CA 2V8ZA 2QUUA 4UIOA 3GDLA 4GXMA 4JEQA 2QCDA 4WXYA 4HKPA 2D0HA 3ZSTA 3W73A 1PIIA 3NEVA 3W2UA 1WX0A 2PURA 3C56A 5HMSA 1KM6A 3A5FA 1H7PA 2V81A 3P81A 4LY8A 3KXQA 3P5YA 4O57A 2E8YA 1QDSA 4HNVA 1B0IA 1BWKA 5E93A 1PE1A 4L4LA 3LX9A 5D03A 1SU5A 1FDYA 4UQDA 4RZ4A 3EJQA 3W1XA 3C61A 1JCXA 2WVVA 4UTIA 4QISA 1O5XA 5KMYA 4XTDA 4O1BA 5C6MA 1VIWA 3BLKA 5F2MA 1XC4A 3NG3A 1SW0A 1MW0A 3RK8A 4O13A 1R75A 3LLDA 2DH3A 4ZQPA 4KFPA 1RD5A 4MLRA 1EA0A 1QHPA 1QW9A 4HOWA 3LPOA 1UKQA 4FF7A 2F1BA 3TSBA 4OU1A 3KX6A 1H63A 3PAJA 1CXLA 4JDBA 4Z1BA 3EEGA 4AHPA 1JUEA 4S2BA 3DFQA 3EJPA 5I0DA 3RU6A 3W2MA 3UG5A 1SO4A 3P74A 4WXZA 5BMWA 3L5AA 3A22A 8CGTA 1OX5A 4BFAA 4A2SA 5D02A 1MEWA 1TV8A 1YXCA 1LBMA 3BG9A 5AB3A 1D3CA 3AMKA 2E6AA 4TMCA 3THQA 1JQXA 1TPVA 2CFFA 5CZSA 5G1TA 1QFEA 3UWUA 2D2OA 2ZRZA 3USBA 3P60A 4JR5A 3IRDA 2X2JA 1J5TA 4LVDA 4A21A 4D2JA 4KFNA 3DENA 3MMTA 3PSVA 3NM3A 2EPHA 4HNUA 3M0ZA 2I1OA 1PCKA 3VNZA 1A5SA 1SMDA 1EIXA 2ZUTA 4WD0A 3W76A 3O1NA 3L68A 1CXIA 5K4ZA 4DO4A 2C14A 2OSWA 3O05A 1VHCA 4IOTA 2PRHA 4J3UA 4K7YA 4H8HA 3ELFA 4WJEA 1ME8A 1SPQA 1GWJA 2OZ0A 3EKZA 4YWIA 4CN1A 4WX2A 4UCFA 1C8VA 2YW4A 1MWOA 4IMGA 4UR8A 1L6WA 2Y2WA 2VRKA 3EDJA 2ZZ4A 3LGEA 4GJ1A 3LHUA 1K7EA 1VS1A 5FI8A 4LVAA 4TX9A 2NXGA 1Z48A 1R2TA 3NQ7A 5E6YA 4FB7A 3LTPA 1VYPX 4UTKA 1TJPA 3EWXA 3OLIA 1Q4NX 3A4AA 2PRMA 2CXGA 3W7DA 4DF0A 4O0KA 4GC4A 3SR7A 3TXVA 2ZUUA 5EMYA 3VFLA 3EDEA 4GBUA 2H8XA 5E0KA 1QOQA 3CPRA 3WENA 5D2VA 2P0OA 2JBMA 3G1HA 2QPSA 1JG9A 2OYMA 4M7TA 1UCWA 1FWRA 3SI9A 4DELA 3EJUA 4GINA 3DGRA 4P61A 3W1PA 2ZXDA 3BVXA 5AHNA 1T0OA 4BI6A 1PL9A 2I14A 4LS2A 2D73A 3LRKA 2FH8A 2AAMA 2ZA2A 2RKXA 3Q58A 1ZJAA 1FWNA 4NU7A 2PC4A 4MFEA 3HOJA 3UQNA 3LCIA 5D04C 3WELA 3MP3A 5I3FA 1LM1A 5EL1A 4A2RA 4ORMA 3NQ6A 1TQTA 3P5ZA 2V0TA 1TPB1 4OE7A 1HL8A 3FJ6A 1HUVA 3O8AA 1TQWA 1SZFA 5DLCA 3WJZA 3W86A 3Q94A 1FCQA 3O16A 3PB2A 1NF7A 2O7SA 3DHDA 2CLIA 1BVZA 3T4CA 3G1AA 2ZXQA 3GX9A 3HG4A 1QHOA 1OFRA 1XDLA 1ZJIA 3KVLA 3V1PA 1NAL1 2D0GA 2QMKA 1TMHA 1LCOA 3IIPA 4MKNA 4CLMA 1HXKA 5LNWA 1SUXA 1CGTA 2ZYFA 1VLIA 2YA1A 1I45A 3W2KA 1W5QA 1N8FA 2CU0A 1MXDA 3E12A 2V5LA 3U8GA 1GJWA 3GXPA 1KV5A 1GTEA 4M56A 4MY1A 2PWDA 3TROA 3EX1A 4O19A 5KZDA 2YDAA 4CNPA 3PBVA 1T96A 3ZT5A 5F2LA 3PY2A 4MZ8A 3K1DA 3N73A 1LLZA 2UV8G 3BUIA 3VCRA 3RLVA 5C2XA 4WY0F 4FLQA 4JIPA 3B0VC 3HG3A 1H61A 3BG3A 3FAWA 5HXMA 3B04A 2H6RA 3RILA 2Q3RA 4JX6A 4QQ3A 1G6CA 4CCEA 3P67A 1QI5A 3DX1A 4MJMA 1UUOA 4O12A 4YL2A 1I8JA 4CNNA 5CZJA 1FWWA 2CZEA 3C2FA 3KRUA 3BV4A 1NSJA 4JTTA 1KXQA 2ZICA 4UUIA 3U2OA 5CZ0A 1YTEA 3RLUA 1ZAHA 3KE0A 3DZ1A 6CGTA 1DL3A 3F4NA 1XV8A 1S5VA 2FB2A 3IGSA 2EQDA 1BAGA 3OVRA 3BPWA 3TJXA 2OJPA 1MXGA 4JIQA 3ABOA 4CNOA 4LVBA 2G3MA 4UC5A 2HS6A 4U31A 4ZMGA 2EADA 1YXYA 1MW1A 3QRHA 3GDMA 1GCYA 1E43A 3CGTA 2Y88A 3UY8A 2OCZA 1KM4A 2GOUA 4GI6A 4A29A 2CLHA 2YX0A 5T26A 1OGSA 1GPWA 3Q37A 1OF6A 4N4PA 5F4SA 1YLVA 1KBBA 1V5XA 1NEYA 3DFTA 3WY2A 3T44A 5DY3A 1NOFA 1L0PA 3L4XA 3S5NA 2WNQA 1W54A 2EF9A 1OFBA 4LVGA 5AFDA 5E70A 2FHBA 3UXAA 4A22A 5D2TA 4OBTA 5LSMA 4WOQA 3CTTA 4O4VA 1EWEA 3DHFA 2EABA 3KVMA 3CZSA 3FYPA 2YXGA 1H5YA 1GVOA 1NVMA 1FCUA 2C7FA 3MI2A 4Q33A 1SZEA 4UFMA 2YCEA 3FW6A 2ZQ0A 4K37A 5AYZA 1PJ9A 1W3NA 1EA9C 1QX1A 1PZ2A 3G1SA 4K6AA 1OG0A 3D4YA 2BXVA 3TR2A 2CW6A 4FXRA 4NI3A 1KV8A 1SFJA 1WXJA 3EDKA 4XKYB 4U2YA 2CLOA 2R94A 1YTDA 3WNLA 3W74A 4I7VA 3M16A 1MVYA 3K8KA 3ZWTA 2E1DA 3O06A 3W7OA 1A47A 2JGYA 2WVVB 2JKAA 1H50A 3W7PA 1WZMA 1X1OA 1TCMA 3WNNA 5TD4A 2QCCA 5HINA 4JTGA 4HIBA 3W7GA 3KL5A 4RXFA 3W37A 1F74A 3IV3A 4B9YA 4X9YA 3NPWA 3UCQA 3EDFA 2A2IA 2QR6A 1XSIA 3G3MA 2FHCA 2VRQA 3VGEA 3TW6A 2A0NA 2WANA 3KEHA 3HGSA 3B8DA 2PWFA 4AVFA 4IPIA 2WQPA 3TSMA 1KGWA 1ZNNA 3SECA 5CLWA 4U28A 1K8YA 5KTLA 2V30A 1VYRA 1L2UA 1E3ZA 2CPUA 1LORA 1W0MA 3LXCA 1VPXA 2J27A 4I7UA 3EKLA 4UXDA 3S42A 2ZX6A 1ML1A 1MO0A 1P0KA 4NZFA 2XVGA 3CWNA 3FAXA 1FQ0A 5AHLA 2DJXA 4JTUA 5K9DA 1K7XA 2A7PA 4LW7A 1KFEA 1VLWA 4UTLA 4H6KA 2OW6A 1H3GA 4MZYA 4DO5A 4HN4A 1PAMA 2DZTA 5C5YA 1UD2A 4MFDA 5HDRA 2BY2A 2CLKA 4AMAA 3W72A 5CKSA 4KMQA 1PS9A 1I2NA 1ZAIA 3PVFA 1JVNA 3M43A 3PUOA 4K7VA 1CLVA 2Z1KA 2DH2A 1KM0A 1LBLA 4M6PA 1KA9F 2H90A 1Q6RA 2NX1A 3RFAA 3BGJA 3QH2A 4IMEA 4DPPA 3DFOA 1X1ZA 4R7JA 4Z1AA 2NT0A 3LM7A 2EGZA 5D30A 5AHIA 4O1AA 2VFIA 3CQ0A 3LCLA 4UTTA 2D3NA 2ZWYA 3VGHA 4FIRA 1AW2A 1LBFA 2QCEA 3LHVA 5TIMA 1XBYA 3EJRA 1UASA 4ZQCA 3TW7A 1SW3A 4Y8FA 5D2XA 5FEWA 3WMSA 3G24A 1KFKA 4LOCA 3R12A 4N02A 2ZX8A 2F7QA 2E68A 3N34A 5CPOA 1Q6OA 2PWEA 4AIEA 1Q3NA 1D9EA 1JI2A 1XSKA 3N14A 3LCWA 2PWGA 1K03A 1TCDA 4QSHA 4H4IA 1QPRA 3GAKA 1MFUA 2JGQA 2RH9A 4IX0A 2Y24A 3QJAA 4CN4A 5I3HA 2QJHA 3BCDA 1GTHA 4NXKA 1W31A 3E96A 3LI0A 3T7VA 3W1LA 1EP3A 5CPNA 3WJYA 4J28A 2NXIA 1WZKA 3W1QA 3LXBA 1O4UA 1JDCA 1EWDA 1TB3A 2H3DA 2J9XA 2JKPA 1J0JA 3I7SA 3LBMA 2NLIA 1SZGA 2WSRA 3BW3A 1GG1A 4OT7A 1JDAA 3W7LA 2VUYA 1JIBA 1S3HA 3CIWA 2YFOA 5F4XA 5C54A 3N9SA 1UKSA 3EWBX 3VSUA 1UD3A 1UH2A 2CZ5A 3ABRA 3D4ZA 3E02A 3TQVA 3LOTA 3H53A 4FO4A 3WJWA 4GE8A 4H7VA 3ZR4A 4JTKA 4NNCA 9CGTA 2VFEA 4OQVA 4WQ6A 1IXPA 3FKKA 3HG2A 2QPUA 2X30A 3OVPA 3TMLA 4UMAA 3UD6A 4Z08A 3NR0A 3KHJA 4AWSA 3ZR5A 1DBTA 4J3XA 1RZMA 1TPH1 5I3IA 3I65A 3DU0A 3GLCA 2WPGA 1OYCA 2XN2A 4MVAA 4K39A 3SY5A 1HT6A 2TSYA 1OB0A 4NNBA 1JGIA 3ZS4A 4FNQA 4PTNA 3HJEA 3CWOX 3UXDA 3N2XA 3C2VA 2DU2A 4RXGA 5A8GA 5L9FA 2YJQA 3QEZA 1F05A 4GRSA 3G8EA 3NPXA 4MB1A 3L67A 5BOOA 3CLMA 3LHWA 3EDDA 4B9ZA 3ECQA 5F1VA 1LDCA 4N6EA 3VU2A 4ZQNA 1KB3A 3BUDA 3FA5A 3NQVA 3WN6A 4DBDA 1R30A 1IZJA 4UFLA 1QPNA 3TQKA 1VR6A 3CZEA 4DQWA 1E51A 5IBXA 1TRDA 2CZDA 4PH6A 2YA0A 4JS3A 1SSGA 2QKFA 4O4WA 2QCDB 5F1UA 3RNDA 3GBEA 2WSYA 1I75A 3CLWA 4HOXA 2X1TA 3I6RA 3PUDA 3KAOA 2C1HA 1P5BA 1QNVA 3UPWA 3UYCA 3VGBA 3ZQ9A 4UNLA 5AN7A 4ADTA 3IEBA 3GAYA 2C15A 3M44A 1HX0A 4DF1A 4MUZA 1BLIA 2W6RA 2YFNA 2A6LA 4FXSA 4QM1A 3C0JA 4ZVJA 4AEOA 1RP9A 3GXNA 2BLEA 3W84A 4ADUA 4IQLA 1SQ7A 3LCFA 4IX2A 2DORA 1W1ZA 1Z32X 5D2YA 1W9XA 5AOUA 3HPSA 5EKYA 3RMJA 2GVLA 5K4XA 2ZZ2A 4GUGA 4IWWA 1MXSA 3QW4B 1IF2A 1A50A 2FPVA 4PL1A 1LRTA 3UY7A 3GVGA 2C19A 3WNPA 5D05A 1L6YA 5H2ZA 1H7WA 4XQ6A 1UH4A 4OV9A 1QWGA 1SZNA 5FEZA 1NF0A 1SMAA 1UD5A 3ABQA 3CB8A 1QPOA 3A9IA 2F7RA 4I7WA 1WPCA 3W22A 5A6LA 4YCOA 3FFSA 5DELA 3LRLA 3D51A 4EVZA 1GJUA 1H51A 2YZRA 5HWNA 1J2WA 3B0PA 3IVTA 1PVNA 1K8XA 5FF4A 3W2LA 5LZLA 5FF0A 3L2MA 3S2CA 3QQ0A 1UA3A 4HSOA 1KLZA 2BXZA 3NZ1A 4GO9A 1UJPA 4JFTA 1VYSX 4UR7A 3S1VA 3NNTA 4KWWA 4AH7A 4WSJA 3NPUA 5K2ZA 1OFAA 3TK7A 3EX3A 1F6KA 1HTIA 1H7RA 2QUVA 2PE4A 5LNSA 1JF5A 3M41A 2EAEA 4JNMA 4JXCA 1OFOA 1K02A 1JI1A 5CPMA 1VRDA 4RCXA 2GJLA 3BVTA 5HULA 1E40A 1HFBA 1PV8A 4LS0A 4AWUA 1PPIA 2E8ZA 4UQBA 3E49A 3TV8A 4HOZA 1F6PA 1XFBA 1A53A 4K36A 2OT0A 1JUKA 3TMQA 1V7YA 3GB6A 2DZSA 1B2YA 1VZWA 4JN6A 3YPIA 1VFOA 3Q2DA 4K38A 3UG4A 2WNNA 5KEZA 1EEPA 1HL2A 1SO5A 5F2IA 5AHEA 4FNPA 4KWVA 4LU0A 2ZXAA 3WEOA 2Y6ZA 3C2RA 3L65A 3DX2A 2Z2UA 1UB3A 3M5VA 3BAIA 1WAUA 2ZRVA 3JS3A 3GR7A 2E5DA 4DBEA 3BVJA 3OLDA 4LC8A 4MJZA 3IVUA 2GUYA 3G3DA 2C13A 2IQTA 4IUOA 1TPWA 4WZHA 5A2AA 1T8XA 1RPXA 3BGGA 3C4UA 3S6DA 1CGYA 1KWGA 1QAPA 1QI3A 2BHUA 2NV1A 4WSKA 3SSJA 3VGDA 3LHTA 3L5LA 4GI8A 4J3WA 3VX0A 2WNWA 3GXTA 3EXSA 1KXVA 4LS1A 1QI4A 1YPIA 1DKWA 3KRSA 1WDWA 2D3LA 3CZGA 1O7DC 5I24A 1LRNA 1FUYA 1IXOA 3DKJA 3TDFA 1C29A 2GVYA 3OHIA 3A23A 4CQ9A 1C8QA 4FLSA 1LOSA 4JL2A 3WK1A 1XGZA 2A85A 2G96A 2Y7FA 3W1NA 3CTLA 3W83A 2QCMA 5HNRA 2ISWA 3MHUA 2DJLA 3EX2A 4JCLA 5LKYA 1JL8A 3DX4A 1EPXA 2WSQA 2Y70A 1J0IA 2NUYA 4ATWA 5G4WA 1A5BA 1GT8A 3W7CA 4UTJA 1W37A 3VSTA 3KL3A 4MZ1A 4RK8A 3BCFA 3NO5A 4PCFA 1W56A 1HNYA 3QM3A 4MY9A 3W70A 3MYOA 2WKGA 3CZLA 3NQEA 1M5WA 1KFJA 3OIXA 4OV4A 4O1DA 3TAKA 3R13A 4UFHA 2ALDA 1KCLA 3DX3A 3NXFA 4TO8A 4UTWA 4WY0B 1VQTA 4JL1A 3NYZA 1W3IA 2J9ZA 2J88A 3NVTA 2EACA 4XKYA 2C16A 1L9WA 4JTIA 2BY1A 4H8UA 5D37A 1KFBA 1BPLB 3QGVA 2FPTA 3MHGA 2BTMA 2H3BA 3G8RA 3DH7A 3E0IA 1TTQA 2BY0A 1ZY9A 2F7OA 1WZLA 2NSXA 3IJ9A 3W7HA 3MBDA 3W71A 3KLKA 1Y7VA 3ZSSA 3NA8A 4LUJA 4A3UA 5TQLA 3HIJA 1LTDA 2QF7A 3TTSA 2Z1BA 4NJKA 3GXDA 3UPBA 3TUUA 2OW7A 4LQ1A 4E38A 4HPHA 2RDWA 3QPZA 3TU9A 1HO1A 1KLYA 5EBUA 3OVQA 3TC7A 5F2GA 4BR1A 1KBKA 2YOCA 3HGRA 3QW3A 3P7YA 1XSJA 3GXIA 4EF8A 4G1KA 4TVUA 1TSIA 4JGDA 4QIUA 4O54A 2Z0IA 2JK2A 1C9DA 2OSYA 2QUTA 1G7VA 1QW8A 1FWTA 3GDKA 4MIMA 1TTIA 5FESA 1JRBA 5AYXA 3K8MA 1DOSA 4MY8A 3ZT7A 4O52A 4POCA 3ZWSA 1ME9A 1TRIA 3ABSA 1WOAA 1Y0EA 3PR2A 3NGJA 3DKLA 5AC6A 3A5VA 3S9YA 1AK5A 3NQ8A 2GQ9A 2BHYA 4KKXA 2RDTA 4UQ9A 1G69A 1XBZA 3BW4A 4PEEA 4HPJA 1CGXA 3BG5A 2BXYA 3DI0A 5U7SA 1RPKA 1KM2A 2R8WA 1TQUA 3CIXA 3JR2A 3M07A 3WJSA 1JCMP 4AB4A 4UTUA 4ZQOA 3B05A 3VMPA 4JTFA 4PC8A 2QMJA 3C6CA 3G18A 1KTBA 4UTWC 4Y90A 2WCSA 1O5KA 1GG0A 2A5HA 1OYAA 4ZQMA 2ABAA 4Y96A 1EUAA 5KINA 3IIOA 2AMGA 2ZRUA 4NJGA 2F18A 4IPJA 4RJEA 3ANYA 4GQRA 1AMYA 3I7RA 1AG1O 2BZNA 2BHZA 3B0UX 3LV6A 2TAAA 2F2HA 4HA1A 1TPFA 2ATMA 3THAA 5DBUA 3QMTA 1XBVA 3GXFA 1IXQA 2B7OA 3VKJA 4J3TA 4JCMA 4UQCA 5BMXA 2VFHA 1QPQA 4LPCA 5HUPA 2I9EA 2DIEA 4IGHA 1H7NA 3TIMA 3PM6A 2QEZA 4IXXA 3T55A 5H91A 3WEMA 2ABBA 2X1SA 4LTSA 1WBHA 2OSXA 5E6ZA 1ZS2A 3NDOA 1HWWA 1KM5A 1MZHA 2Y7DA 4UQEA 2A21A 1GVIA 3W07A 3NL3A 3FIGA 4HNNA 4O1CA 2ZIDA 1IGSA 2V2DA 4JX5A 2Y63A 3P8IA 1BEUA 4UTTC 1ZFJA 3UWVA 1G9HA 2OT1A 1GOXA 3LDVA 2Y85A 1GVRA 3PSWA 4HSNA 2B0MA 4LV4A 4OHQA 3W23A 3QYQA 1KGUA 2GJNA 3R5EA 3NAVA 2OYKA 3SFKA 1LWJA 2Y7GA 4AW7A 2RHGA 3PUEA 3P82A 3H55A 2NUXA 2P10A 1AW1A 3EWZA 1PIFA 4ZL1A 3P80A 2YW3A 2E5BA 1GEQA 6ALDA 3VE9A 1JF6A 3A47A 3ZT6A 5AHFA 2OMAA 2QCNA 2FH6A 4OJYA 1TMQA 4X22A 4JYFA 1J0KA 2NX9A 2ZTJA 2C0AA 1TYGA 1XCWA 2WVUA 1KTCA 1JDDA 1I4NA 3W1RA 1UD4A 1KM3A 3W7JA 3TTYA 4NXSA 1CW2A 4U2ZA 1B3OA 2Y7EA 4XWUA 1FX6A 3MI6A 4L4MA 3NOEA 3LHZA 1JXKA 2ZCGA 3LTSA 1U30A 3L5MA 3PB0A 2X2IA 1YDNA 3LPPA 1M6JA 2NUWA 1PIGA 2DZWA 3L4TA 2FYVA 4XZ9A 4XBSA 3BUQA 1VGAA 2VFDA 1WQ5A 3I7QA 3STEA 1HTYA 4MYAA 1M7XA 3DAQA 1OHLA 1IV8A 4O0ZA 3OEXA 3UWWA 3WFAA 2ZE0A 2NV2A 3MYPA 4CQAA 4FEZA 1H60A 4XUGA 3WY4A 1CXKA 3FYOA 1FCBA 1TTPA 2J25A 1ICQA 1JJKA 4IJBA 3W2NA 1H1ZA 3QPYA 2XIIA 2ZX5A 4DF2A 4LXFA 3L4YA 1V3LA 3O6YX 1RQHA 4FX8A 1T99A 5E9AA 1FDZA 3BLEA 4IMFA 4BF9A 3N2MA 1D3HA 6TIMA 1G94A 1W8SA 1WA3A 5HR6A 3AO0A 3QZEA 3C2EA 4AF0A 3QC3A 2D0FA 4O18A 5BRPA 2VEMA 3GZ3A 5LNVA 2ZA3A 1XH0A 1TIMA 3KRZA 3AJ7A 1XKYA 4M7SA 5D38A 1QOPA 1ZCOA 3BAJA 5DFAA 3G1XA 1B9BA 2VFFA 2Y89A 1M7OA 1IZKA 4BWLA 1K8ZA 3IVSA 4JICA 4UMBA 2YYTA 4QNEA 3BUPA 1JCJA 3WK3A 3GKFA 2Y61A 2NWRA 4GQQA 3GTNA 1JD9A 2WPBA 4ORIA 3GNNA 2F84A 4TIMA 4ZQRA 4UCGA 1DEDA 4AAJA 3S1XA 2Q8LA 4LC6A 3S8HA 3C2OA 5EY5A 5DCDA 5K3VA 3IGUA 1SW7A 2AQWA 4I9AA 4KWUA 3GDTA 4GUFA 4N9BA 3CEUA 3UZ5A 2XIBA 4KFOA 1LLWA 4AHOA 4JFSA 1LYXA 2CLMA 1JR1A 3IGXA 3NPVA 2FQIA 5HPOA 3FLUA 4TU1A 1W5NA 2Z6JA 1QWNA 5AC7A 1UA7A 1VB9A 2ZUVA 2WKLA 1GQNA 1VCVA 2V2CA 2ATSA 2GQAA 3M6YA 4ALDA 4JFVA 4CGTA 3D52A 3VGGA 3DFSA 3FS2A 2G3NA 2RFGA 2A4AA 2VXNA 3W1UA 1KBIA 2YSWA 1UKTA 4LRSA 1M53A 3TXZA 1WO2A 1D7FA 1GYNA 2HTMA 3GK0A 3TFXA 1UD8A 3AMLA 1XH1A 3BSGA 3PBUA 1EB3A 1WBJA 2PRLA 3ATZA 4FHAA 4NJHA 1KGXA 1ALDA 4JTLA 4UNIA 4Z0SA 2WC7A 1SSDA 5EPDA 2IGTA 1G4PA 1JAEA 1TQJA 5CSSA 2HS8A 3GBDA 4LVFA 3W75A 3L9CA 3HPZA 3CV5A 3IIXA 2B7PA 2E4TA 4X2RA 3BAXA 2ZZ7A 3CHVA 2H8ZA 2XFWA 5EYWA 1ZJBA 4LV9A 4RX0A 3SW6A 4M6QA 3QSTA 2CLEA 3EXRA 5D2WA 3W1AA 4GI9A 2JKEA 3DFNA 1TQVA 1JCNA 4NJJA 1GJPA 2QAFA 1DJNA 1DTUA 5CPLA 2HMCA 3PS7A 2EKCA 1DHKA 1TQXA 2TPSA 4RZ5A 2G97A 1FCVA 1X6UA 4Q4KA 1YYAA 3FEMA 4AYGA 1XXXA 2FPYA 4PCTA 3OBKA 5J5RA 5LNUA 2B7QA 3LLFA 5E1QA 3CT7A 5HJLA 5BRBA 3CU2A 2FIQA 3KFTA 2ZZ3A 2Z6IA 1JULA 4MYXA 5I23A 1ZENA 1I2PA 4AMWA 1VFUA 1LROA 2ZRYA 2YYUA 3LB0A 3N3MA 2VR5A 1WOBA 5D32A 1VH7A 4BWLC 1VAHA 3M47A 4R33A 4JFWA 3DFPA 4OWGA 2DIJA 5AYYA 3O6DA 1TREA 3UWQA 3DHPA 1PZ3A 1FWSA 4AIOA 3WFZA 4U33A 5LHEA 3PBWA 2X1UA 2EEXA 3W1MA 3W85A 4BI5A 2NX3A 2QCFA 4GWEA 4TMBA 3OLGA 3BMWA 4OIFA 3W6YA 3UEQA 1EH9A 1MSSA 1A5AA 4FNSA 1AL8A 4NQ1A 1O94A 3NL5A 1LWHA 4ADSA 4BA0A 1RVGA 1CGUA 1Q6LA 2ZFAA 3QSRA 4HNTA 1SO6A 4NUWA 3WNKA 3HQ1A 1LOQA 3LCGA 1S5TA 1ICPA 3JRKA 1OYBA 3N9RA 3QFEA 3BAWA 3BAYA 2DP3A 1TPDA 3M5ZA 4S1FA 4WY0A 5G5IA 2GVJA 5K9CA 4W9TA 2ALWA 1OFEA 3F03K 1G7UA 3HG5A 1XUZA 4OKDA 1TV7A 3UG3A 3FJLA 3TCEA 4NZJA 2Y62A 3LBCA 3BLFA 1R47A 3O15A 1EO7A 4JD4A 4GNJA 3MWAA 1EP1A 4N2YA 4DXVA 4E2OA 2QDHA 3HJZA 4AYSA 2Q8ZA 3NQ2A 5CGTA 1R34A 5FF3A 1EP2A 5C55A 4FX6M 1G67A 1OABA 3MW7A 4QITA 1RP8A 1V3KA 1RQBA 3NL2A 1R2SA 7TAAA 1KM1A 4U4MA 1VFMA 1OFPA 2XN0A 1W5OA 3EWYA 3P62A 1THFD 1VJIA 3PG8A 3F1QA 3E9AA 2QAPA 3AXIA 1MW3A 4XTIA 3W7IA 1R46A 3INPA 4QAIA 3L0NA 4PEKA 1KXHA 2WJZA 1AW5A 1J0HA 5K9XA 1KXTA 3GYEA 1WYIA 3II1A 4UTHA 2GVGA 3NM1A 3M1ZA 3P61A 4ZZ9A 3STGA 3CPUA 1P4CA 1VCFA 5CZTA 1UH3A 2A7RA 3L21A 5KZEA 5A2CA 3EXTA 4HHPA 2WNZA 1AQHA 2V3EA 1YADA 2YGYA 4DO6A 3DC0A 4HT3A
chains in the Genus database with same CATH superfamily
3NA9L 4ML4A 1A7PH 1OFDA 2QLYA 4PJBB 1H7OA 4H9TA 1B4KA 2HXUA 3TN0C 4NLHA 4NT6B 5DLLA 3WLPA 3D0AA 4L65A 4HVBA 3TIEA 3VNYA 3N43B 3C52A 2V82A 2EO7A 4JPQA 4N1EA 5JR1L 4L4VE 4OZIF 1RY0A 4J7RA 1GKOA 1JCYA 1DQQB 5EOCL 2PDXA 2OB3A 4IL2A 1RIVH 4O11A 2WYHA 3CVBA 3FU0A 3GNDA 3BE1L 4W68A 4ZX3A 3H9YA 1TPC1 2FTPA 2WO5A 5EULV 3R4IA 5CZRA 4YMZA 5XIMA 2P42B 3W75A 1VKXB 1Z5LA 4H8VA 1GY1A 1S7SA 5HPMB 3CQHA 4RDZA 4AWTA 4PTVA 3SIZA 3WF2A 4BKNA 4LGXA 2UWEA 4FCHA 3VCLB 1F76A 3PTKA 3IK2A 3SPVA 1ZGLB 4S2CA 3WHE0 3KD4A 1CD1A 2A3LA 1H5BC 3DROB 4JHBA 3KVPA 4PR5A 1F3RB 1E9ZB 3ZVHA 3R89A 2F54D 4QG6A 1OPGL 3EUDA 3O2DL 3EYVA 3PFQA 3KUMA 4O10A 1I6NA 2YPIA 2FYYB 4WNQA 3WH5A 2IG2L 5CP7A 2CKBL 4E2DA 2D7TH 2GYIA 1OQXA 1MJJB 3IU3A 4FLHA 5LCVL 2AJXL 5I5RA 3I4KA 1H8NA 1CIUA 4K94C 4PJIF 2VISA 3KCWA 1I8MA 5I1KL 3UYPB 5FKPA 1TPXB 1IE4A 4MQTB 2P1FA 5C6WH 3V0AC 3QY7A 1U58A 2W8CA 2W60B 3ZFHA 1WV2A 3NURA 4HIQA 3WQ6A 1P9MA 1GRWA 1SFDA 3FO2A 2GITA 5DJZA 3T4AC 3RZWA 4AD3A 3C8FA 2VVSA 3U4BH 1TXKA 5ILTH 2FGZA 5ICZB 4Z3IA 1XCXA 1F97A 3GMLA 1E8YA 4JJ5B 4K7PL 5LXVA 1P7HL 3UZJA 3SADA 3BH8A 5B38A 2GKIA 1H6FA 4GKLA 3PWIA 1NDMB 3K8LA 4HHGA 2VCAA 3HAEB 4K9JA 4TX6A 5SX5H 3TVMD 5MEQA 4YHML 1MQKL 4MRCA 2IDFA 4XNYH 5JLZA 3O9NA 5HI5C 3WMQA 3EBAA 4Z7QF 3K30A 4FTVD 1RMFL 5HDWA 1XDTT 1MNSA 3DVGB 5CQ1A 1AKJB 3OG2A 1E9QA 4F92B 3MBFA 1U95A 5D9SA 4UNTA 5HYJD 2PCEA 4H41A 2WHLA 1N0LB 1DV7A 3WQVA 3GVVA 3SUWA 3T8QA 5F9OL 5AHMA 2C3VB 2TRSA 3STLA 4Q8PA 1Y0LA 4O53A 2ZWZA 3OZYA 1FRGL 2BCMA 1YN6A 2MQCA 4R96A 4ZDHB 5C07B 1R8LA 3UTPE 2V2XA 3EH1A 2B1AL 1G9NC 4M5TA 4GUJA 1YSOA 5D7IB 1SLWA 3PG9A 3V9EA 3X13A 5L6YH 1J1PH 2V9RA 5DXWA 5T1DH 1U22A 2PDLA 5GS1B 2E77A 2ZX7A 4NYYA 3TN6A 1Q9OB 2CR3A 2E0PA 3O9WB 3CC5B 4ADJA 5KJ7E 2P46B 3G3LA 5FLVA 1YTKA 5C9WA 1ODZA 4XX6A 1PY9A 3BQVA 5L6UA 3QPKA 4NERA 3HRZA 1TV2A 1WDDA 2CLLA 1CI1A 2WHMA 3BLPX 3LHYA 3B2UD 3ZIYA 1I1RA 1UZ4A 1D5IH 4GH1A 3SDCA 3TPUA 1ZHAA 1NGPL 1WICA 3FUNA 4DP6X 4FE9A 2A3AA 1M03A 3MJMA 5IVNA 2L5HA 2VM4A 4EVNA 2FDSA 2AXFA 2VH5L 4WUIA 3PS6A 3VTAA 1XLEA 3EMZA 4HPOL 3N85L 4HIEA 2VO8A 2XXGA 2VDQH 4OZHF 4IBWA 5F70A 1GORA 5K59E 1QR4A 2OCCB 4JY5H 5LDUA 4NSKA 3FNKA 2E27H 2FIKB 4TTDD 5CJOL 4NJIA 4LCVA 3ITTA 5BU6A 1CEOA 1U92A 3HN3A 5DY2A 3EPNA 1MJUL 5D7KE 3EWWA 4I90A 3GUWA 1HNFA 3QI9D 1YNPA 2PDFA 1A6VH 2YAMA 3QPQC 1EAPB 2DY2A 4WO4C 2ZXWB 4IIDA 1OTUC 2F54B 4OT1L 4HTYA 4P8VA 1F00I 4V27A 4EPBC 3ZE1F 1JVOA 3TYZA 1E72M 3S1GA 1EFXB 3OB0H 5KWYC 3DYMA 3ULVD 3BVUA 1ADQL 3K6SB 2NY2D 3QFWA 3Q8FA 4M7KH 1FGNL 2CBUA 4Z2KA 1QMUA 3HZ3A 4RMTA 3AUJA 3W11C 2XXFA 1VF5C 2IKIA 4AU0A 1F73A 2YB1A 3T8XB 4NQDE 4PREB 4QTIH 3U6XA 1Z3NA 2A9BA 3REVA 5HJ3B 4XAFA 1KJ2L 1QQDA 1CB4A 4OAWA 4X9FA 2A3CA 2CKRA 4IG2A 1T0NB 4FZ8L 5F72S 5E03A 5I1GL 2PTXA 2BDQA 2AF2A 4FNRA 4GYKA 4N20A 3N41B 4OCSH 4UV4H 1C90A 3C60B 5LNRA 4TVSa 2Y4SA 3IDIB 1UJQA 1EPFA 1YEHH 4O5LH 1IAOB 2NTFB 3GSOB 4FXTA 4KROB 4XP9L 4F7MA 1T40A 5CILH 3I84A 3NQMA 2Z1SA 5C3TA 3ZOAA 5KOVC 5K9JH 2QSCH 4OQTH 1UOKA 1XO8A 5C2UB 1GVQA 1U8KA 5C09A 1NICA 5C0AB 4F7MB 1GVEA 2DZPA 3F7PC 5D9NA 5IVXA 4E9XA 3ITGA 1WDPA 5EWIH 4C6BA 4LCCC 1JD7A 5F1KC 2WZPD 2ZC8A 3W7RA 2X4TA 4XG1A 2P7TA 4Y19D 1OK8A 3FQUB 4KKNA 2O4MA 4XPGL 4K8GA 3UYOD 1M1SA 4TN9A 1MEHA 2QCLA 3SZ8A 1NQBA 2FEDD 2X4PB 3D85B 1FZKB 5D9OA 2Y1ZA 4A2DA 4Z0BH 4AIBA 2VLLA 2W07B 4O00A 3HRZC 4ZFFA 4XPBH 1ME7A 3JTTA 1NCBL 3UP8A 5IQLA 4BI7A 3UTOA 1YPZF 2PP8A 1JXJA 3LD8C 3L95B 2V2TB 2IKJA 3CH0A 5TH2A 3NGFA 1EMTH 2XTSA 1AGEA 2AK4A 3LZQA 4OGZA 4H7ZA 3S1XA 4MGXA 2V7HB 4JQ2A 3RAOA 4A2HA 4AL8C 2SFPA 5FKPB 3EZ4A 3EZ8A 4PTWA 1L6SA 5IMMA 4CNTA 1WXYA 3UC0H 1PKOA 1FDJA 4NYLB 3ARFC 1MVFA 3N19B 4F2BA 5JYMA 5EB9A 5HJBA 3VGFA 4KJYA 3U2JA 4DGYL 3V6OC 3AXLA 4HX1B 3ESOA 1EERB 1IWPA 3T3PB 5HMFA 1GVSA 3JT2A 4E42B 1MJ7L 3WNJA 2AL2A 1BOGA 4H2HA 4S3KA 3MP5A 1OAZH 25C8H 4CQ8A 3SCNA 1G01A 1CZ8L 1GPOL 4GG8B 3N2BA 3CFKB 3KL0A 5LAPA 3WF4A 2LLNA 3QP3A 1E2VA 1K8DB 4UUJB 4XBEL 3F00A 4FDWA 4YDLC 5D8JL 3V5KB 3RCMA 4MDPA 2YCJA 3ASOB 1PCWA 1UXLA 5FYKE 1XYCA 2X5PA 3O41A 1LO3L 4L1SA 2VWSA 1XMEB 1XF4A 4ENLA 1AIFB 1FYTE 3CEPA 2R9HC 4X0NA 2HSAA 3HAEG 5EN2B 2HKAA 4QTFA 5HGBB 1IEWA 1BBJB 3QJXA 5GGVY 4YSAA 2AKZA 1E8WA 5FYLH 2J7HA 5E6UB 3NQCA 4NWTL 2OEKA 1TCRA 3WFDH 3ZLHA 1RPQA 5DT5A 1CE6A 2YWZA 1I1FB 4HPYL 1X5LA 1UR0A 3IF1B 4Z77A 2Z2AA 2DTMH 4C58B 2JJSC 2GJ6A 2RCSL 2Z24A 1U5JA 5CPQA 4W6XB 4F58H 3Q2NA 3CYJA 2H6PA 5SWZD 4AENA 5JPNC 1OGAE 3W7KA 4C91A 2VVNA 4NX0A 1ZBWA 4OIIL 4EACA 4LCCA 4NYUA 3DK2A 3G22A 2A4EA 2WOQA 6REQA 5FLUA 2I24N 2VDHA 4JQ1A 1OP3H 4JM4H 3R6IA 4G42A 1GHRA 3PQYA 4HCFA 1KPVB 3N44F 5EUKA 3MU3A 3ZE1E 4LWWA 1AHWC 1B57A 3MV11 4ZUWB 4XXDA 1XBXA 1G7HA 3HBGA 3ISYA 5FF7A 1AR2A 3P3SA 5FF2A 1A5OC 2X2GA 3ZJ8A 3UGEA 1BJ1J 2W9EH 1QLFA 4KY2A 5T3XL 4ZCWA 5D1QA 5FKAB 5H8MA 1ITUA 5A7BA 5C6PB 1X9LA 4NT0A 1AQDB 4YIQA 3VIOA 3OMAB 1AZBA 4JFUA 4RKAA 1BQCA 3AMGA 1SQ2N 2VL5B 5DVKA 5GVJA 2HJLB 4KEVA 3O7UA 3VG0H 3N0AA 2BSLA 3FHEA 1YJDH 4AY0A 1NFBA 2OX1A 3IJEB 3TP4A 4KS0A 2VR9A 4Y9PA 1NBZB 1GGUA 4PRPA 3LYEA 1EDHA 3A6CH 4AG4H 4E9RA 4DO7A 2NY4D 4UM9A 4ICMA 5AC8A 3MROA 5JBDA 4AZ6A 2UYLB 1ZVNA 3AB0C 1S9KC 1DDHB 1MLCA 4F2MB 2OBGA 43CAB 4QRBA 3S34L 3AYVA 1A6UH 2R29H 1K2DB 2QIWA 2B14A 4NGHH 3TA4D 2HT3C 4HS8H 3W87A 2GG1A 5EOCH 3NCYS 4NP7A 2AMXA 3IGHX 4WGHA 2IMMA 4GSQA 1IIHA 5D09A 4KDVA 1EJFA 2QCHA 1OGTA 4TVPD 1CLOL 3N1FC 4RNRB 1YIXA 1ET7A 2O30A 1PHWA 4M19A 1Z9PA 1NEZA 4O15A 4XIMA 4IMDA 4EKJA 3HQNA 4RV3A 4P5KB 5EO0A 2Z2BA 3ITXA 5F4WA 1BF5A 2BSTA 3P0YL 1IXNA 3S5OA 4CCDA 1WJ3A 1XL6A 1F58L 3V5HA 3ANVA 4AM0A 2JB5L 4XWOD 5T33L 1Z5LB 3LTYA 1IGML 3D2UA 2ISVA 2P76A 4WIWA 4YPGA 4W6WB 2G5RA 2ATKA 3IMSA 3ARSA 5D2LE 1XLMA 4L5ZA 3B8SA 3DXAD 4RV8A 1PEZA 4J3VA 2EG7A 3EB2A 3VJ6B 2FWUA 1Z44A 4I8YA 5GXBB 2VEPA 3DGCR 4I9JA 4WAFA 1YHTA 3C5SA 4AEFA 2HDJA 5E09A 4F1SA 4ZSUA 5LGZA 5F0LB 2Y23A 1KFCA 4ICXA 1VGEH 1HIML 3GHTA 3S98A 3BMXA 2B4GA 3S3DB 5CBAA 4L1XA 1FZKA 2OGJA 4NRYB 5EA9A 3U3HA 2V38A 3U7YH 5B1BB 5FUCE 4F37F 4PJXA 3F4VA 3RI5F 5I6XB 4R34A 5I1DA 5MI0C 1IVTA 1OT1A 2IWKA 1VESA 3JTSA 2PPCA 5EOQL 3KGRA 5D1ZI 3RURA 2XETA 4AMXA 5DXXA 3NIGE 4ZMYA 3ME3A 4UTCA 3Q43A 5DJAA 1UZ6E 4PS7A 4MLIA 3KM1A 4WO4A 4Y4KC 5GS3A 3SKOA 3UOAB 3PLYA 2ROXA 1F45A 2BOBA 4EIUA 4L3ED 4FAAB 2VFGA 4MXQD 1F8IA 1CTOA 3LH2H 3W0WD 3WY3A 5IMMB 2OMXB 3QEGH 5IFJB 3KOFA 1QPKA 3IAQA 5I0YA 4JTEA 4NNAA 4DXKA 4EQ3A 1BWVA 3N2TA 3I9PA 3EF4A 3ZQXA 2G9HA 4OU3A 3TURA 4XNYL 3QDMD 3G1FA 4C1KA 5BVJA 2RHEA 2UY6B 2FLMA 1JHTA 1FPTH 3G6JF 2GT9A 2BIPA 4QNPF 1SJXA 5D7JC 3ROOA 3DX9B 1OZQA 1TJRA 3LGGA 5MHBA 5C9XA 2PTTB 5LAXA 4Q89A 1EZ2A 3D3VB 4FXLA 3EYVB 3T5WA 3B4UA 3N4FA 2E9JA 4GW1A 1ZLUH 3CFQA 4ZD3H 2CZFA 5A8QA 1CGSH 1CLKA 1HH6B 2OKOA 3R8GA 1NGWB 2UXGA 3BT2L 1BQRA 1KN2H 3ZKXC 1DVJA 2HVOA 3OR7B 2UZXA 3L3DB 3F4CA 1BWMA 1IM9D 4WRLA 2AQ3A 3E6HB 5JQHC 3G9AB 3Q2VA 3BXNB 3H3PL 4JKLA 4AW4A 3M7SA 4HUWB 1Q9LA 4YSEA 3V7PA 1WP6A 1SFSA 1OK4A 1O9VA 3GHPA 3CFIC 3OMNB 4AVIA 4Z7VB 1AVAA 3ZE0F 3FO2B 2AQSA 2P8PA 5IROD 2XU2A 1A21A 2ZOOA 3MRLA 5EC2B 1KB9J 4JTJA 1LYQA 4OFDA 3EGXB 1YX1A 1N4XL 1Q94A 4MNGE 3QY8A 1RJLB 1J5IA 3OVGA 4DPCX 4Y7EA 4QR6A 5ABTA 5I09A 3S97C 4YO0B 4CDGC 3EO9L 3KPSB 3Q4DA 4XD5A 2VEFA 1CDGA 4R7DB 2JJWA 3VXME 1FSKC 4P8WA 3HC4H 3LQZB 1P84J 4NWUH 5FFGA 2XICA 1S7RB 1JRCA 3KVDD 4ABUA 2HTLD 3FN9A 1KJMA 4JMNA 5G2NA 2DZUA 2EXWD 3PWPA 1M2OA 4FLOA 5LNEA 2B7OA 3U2EA 5EF1A 5GNZA 4NLAA 4CCCA 1MREL 4R4BB 4UBPC 1YJDC 4PJEB 1Q45A 1WE5A 1X7FA 2IAMC 3HI1A 1FC2D 2OMNA 5TK4A 3WJJC 4Y2DA 4ZFQA 2H0FA 4GO8A 5I66B 2HVBA 3QAZC 1RBAA 4M5ZL 5AW3B 3PDGA 4YDLB 3IETA 1F4HA 2VT0A 4XBKA 4CVWA 1CX9A 5C0GA 3VOCA 4Z3GA 3IJEA 3P1VA 2GWNA 3WNOA 4LFYA 3CDFA 3V0UA 4PWGA 4KBXA 3M1BB 2FHFA 4N2HA 3A4FA 4DW2L 4TV5A 5FSEC 4EZMA 3C9NA 3MX0B 4NAEA 4DJEC 3G1VA 3EOUA 3EAKA 1JF1B 1AL7A 1OCJA 2E9GA 4CADA 4WLCA 1F13A 1FO0H 2WVSA 5CC6A 2XQYK 3C2YA 3MJ9H 3T0EE 2AJZB 4XP9H 4GLEA 3BWUF 2ZRXA 3CK5A 3S83A 3SJ3A 1GGOA 2DZAA 1SR9A 2GI7A 5F1IB 2Y6TE 4RDQF 4PB0H 4I0PA 4E5XB 4N68A 2BY3A 5F1SA 2WKJA 2JCWA 4LRTA 1TFPA 1EGZA 4RBPH 5BOPA 5FV1L 4FIQA 1GH7A 4BIKA 3PZQA 1AHWB 2EHHA 4H1LG 1J18A 3QR1A 4U0RB 5D4HA 2DM7A 2ZYIA 3LERA 4MHBA 2BWDA 3V4UL 4XPGH 1T04B 3QULA 1VHNA 4Z7WF 2ENSA 3HUJB 4BSWA 3M86A 1QFUL 1VPOL 1U83A 3BICA 2D69A 2PTDA 3V0TA 1CPUA 4PMFA 3G6AB 1E6OL 3GJFH 1L8PA 4C57C 6PTDA 2L8AA 3REWB 1DJQA 3HS0A 1BZ8A 5A43C 1U6AL 1HIZA 2NWSA 2WNGA 3MR9B 4YDMA 1NIDA 4C6FA 4WU5A 4HWEH 2P5WE 4M81A 2XA8H 5GHWL 1BVNP 2PWHA 3MXWH 1BWLA 4FQCL 5GGSA 3MLPA 2A83B 2OFJA 3DG7A 3KM8A 5LHFA 2FD6L 1G5AA 3EF7A 2VKZG 5FA3A 4MD5B 3N2OA 1D7DA 2BOFX 3WH6A 2Y5SA 1AGDA 2NCEA 3TIDB 4KCWA 2B5IC 4EDXA 3N42B 4W4OA 4N9CA 2V8LA 3WQ8A 2XC8A 3BAKA 2AJ3B 1VZIA 2ZXBA 4PJAE 5DJXB 3S5LB 4CBPA 2W62A 3C0QA 3NCBB 1J1OL 1F5ZA 2NQHA 1BBJA 1NC2D 2VENA 3CHFA 4C1LA 4LL9A 4C4KO 3TLQA 4XODA 2HVNA 4PRWA 4R26L 2ICWA 4P5RA 1U4EA 4U1KB 3MGTB 4JFDD 1KN4H 5D7LD 3W9DA 1Y5WA 3VIPA 2V5KA 5IVXB 3EAUA 1KLFA 1JUFA 4WNJA 3DOIA 3QGAC 4F9JA 4E68A 2O5YL 3WK0A 4A7GF 2DEXX 3GMRA 5IVOA 5I75C 1T6BX 4Z5RB 1BVLB 2GQ8A 4DJFD 4WV1C 1F42A 1DORA 5HVHC 3K4AA 5DYOA 1WS8A 2FK9A 1YEKH 3H3KA 1MH5A 4UDTA 1S5WA 2CYGA 2H9AA 3VDAA 2MKWA 4P8XA 4F1ZA 1XS2A 2QUUA 3EOYG 2ODIA 6PAZA 2A74B 3NZUA 4I9MA 4YVXA 1OO2A 3GDLA 4N9OB 3M7FB 4YXKH 4IFOA 4CQBA 2H0EA 4GSDH 5HGBA 1MUCA 2D0HA 4PJHF 3W73A 4HC1A 3WUBA 4A6GA 3W2UA 3FY1A 3SKMA 1ZOXA 2PURA 5E4OA 7PAZA 5HHPA 5HVFB 4YL9A 1AQDA 4Y7OC 4YIQB 3T4AB 1M7IB 4ONFH 3P81A 3SE4C 4GRWH 3VTRA 3P5YA 1GC1C 2OR7A 1B0IA 3B9AA 4D71A 5FDWB 4JM4L 1R5VB 2CM6A 4H9ZA 4D6CA 4JRYE 4K0OA 2LE9A 4Z1PA 2EDXA 2F5BH 4OB5L 5DWUH 1SU5A 3PE9A 5F7FA 1DE5A 2FWSA 1LO2H 4UQDA 2V0AA 1TZOA 3C6EA 3LS5H 1DQMH 1VD6A 2Z8RA 1DVFA 5DJCA 1HOEA 4LGPB 1XR8B 3U5UA 3HHMA 4K5PA 5CIPA 1TTGA 3VRJA 4GKNB 3HI5H 3NIGF 4OLWH 2VC9A 1CCZA 4XOCA 1KT2A 3IPFA 1K8DA 1PX4A 3P9LB 1OP5H 1LQBC 3AABA 3RY4A 3VE0B 2DLIA 2J5WA 4UU9A 1A02N 3EOBA 2F38A 4O1BA 2VGIA 1RQ5A 1S7QB 1YJDL 3WF0A 1IQWL 1WCGA 1MW0A 2A4ZA 3RK8A 4O13A 1O6TA 1MG2C 4IICA 5EN2A 4PVBA 4QHNA 4ZQPA 2AJYL 4Y8EA 3MNZA 3MRCA 4JKMA 2V5JA 4MLRA 1R38A 1KGIA 1RLBA 2B0SH 2CKBH 3HVDA 4NKIH 4ZRGA 2D31A 3TNNB 3ZZLA 3RA7H 2VLJE 3D48R 3KPNA 5EF3A 5L2KA 4N2NA 3D09A 1ASPA 4QGTA 3O9WC 3LPOA 5F88A 3NOYA 3CZFB 3RX4A 4S1DD 2MFNA 2F1BA 3B7RL 5I1AB 4O2CB 5I5MA 2EBNA 4EE9A 3GDBA 3MOBL 3NACL 4IRJD 1F18A 43CAA 1BFNA 4ACYA 1TUXA 4OU1A 3BFQG 3CNYA 3KX6A 4Z7WE 1CFNB 3DOHA 3VRLE 2H3XC 2NY1C 4OUEA 4QWWD 1X44A 1CXLA 4UT7H 4PGDA 2BGSA 1TG8A 5TQ0H 4Z1BA 4RAUA 2FZBA 4WUUE 1M57B 3MMEB 5CINL 2QR0A 4NQCB 4ZZFA 4MNHA 1JUEA 4NHVA 4JFPA 4K7PH 4QLWA 4AV4A 4MQSB 4NAFA 2WINA 1NEZB 2VJ8A 3EJPA 1IGMH 4NZDA 4NNXA 3VNLA 4IMKA 2CLRB 2B1HL 5AW0B 2GUOA 3RDKA 5BMWA 2R1KA 3L5AA 5F3HA 3A22A 1O9WA 1B3XA 2EE2A 2MIZA 4IBVA 2ATKB 3LHAA 4HNLA 4FQ2H 4ZTPH 1A4CA 4WO4B 3N12A 1YN7A 2IGFH 3BG9A 1XX9C 2DIKA 2A7BA 3M6DA 3O3DA 3WUFA 2DLGA 5C8BB 3CJJA 4L9DA 1J1XH 1BOGB 3T3PF 2C9SA 4U7KA 5AW8B 5F9OH 3I9GH 1ZHNA 4H4NA 1L3NA 2CFFA 3FX4A 3JWDH 2R2EA 1QFEA 5CZSA 1CFSA 3QWOA 4KXCA 3SBPA 4ODXA 3USBA 5EF0A 3MRMB 1LILA 4D8OA 2X2JA 1C5DB 2R82A 2H7WA 4LVDA 3T65A 5I6KA 2XUWA 2G2PA 4FYRA 3GTIA 1JPKA 5HMDA 3OWEA 4A21A 3DENA 2O0TA 5SX4H 3AOFA 1UT9A 3LEYH 1ZT7A 1K70A 4JG9A 2PZNA 5BXFA 3M0ZA 3UROR 3VNZA 1PCKA 1XHGA 4JPWL 3BQ5A 1UOWA 1UM5H 1EEYB 1SMDA 4WHYG 1TJGL 1UROA 4LRNH 3G5ZB 3L68A 3QHFL 3PXHA 2C14A 4G8EA 4LBEB 3DJ9A 3LKQA 2V17H 1H9DA 1P84K 2J71A 3WUWG 3BANA 4K7YA 3N40P 1Q6DA 4WJEA 2R15A 1RIUH 5BXRA 1JFQL 3S5LA 4H1LH 15C8L 3OKEB 4LCCB 1HKWA 5D5MB 2YW4A 1J9YA 4IMGA 3GFYA 1N6VA 4PG9B 4W81A 2BP0A 5GJTH 3VFPB 1TELA 3GNMH 3EDJA 3KPRA 1DWHM 4PR4A 2K8MA 5DJ6B 1FDLH 3QJOA 4JFEB 5F9AC 3VFOB 1VS1A 3RL2A 4NQEB 3EGJA 3G5VA 4LVAA 5CZVL 3F2BA 1R2TA 2X87A 2XHNA 4XXDB 4LB4A 3N9GL 1P4LA 5E6YA 4FB7A 5JUEH 1A6WL 1NSNH 3LTPA 4UTKA 3EWXA 3WH9A 1P4IL 3NJFA 4L8DB 1DQDL 3ECWA 4KXAA 4R5XA 4LVHC 4GY1A 4M8QA 3W7DA 4O0KA 4HIIB 2IALB 4GC4A 4OZHA 1G0YR 4K9EL 3IDMB 4P9MH 3I9IA 2ALRA 1WKEA 2AK4E 1TOXA 5CM1A 4S0TD 3UPAA 4ZBCA 3V4VH 2FJGB 3X1GA 4HIHB 5MERA 2QGDA 3PG2A 3WENA 5D2VA 1VLXA 2JELH 2WWNA 3I74A 3EGXA 3P77A 5I1GH 3ZJ6A 1FWRA 5C8JB 3D3AA 5IK3B 4W86A 2WJ5A 4ZTYA 1QP1A 2B5IB 5L2JB 2A73A 2IVFC 3HLKA 4BRJA 1MIMH 3BVXA 3BWSA 4DJDA 2FNWA 3K46A 3RGVD 2DWDA 1HE8A 4M93B 3GI8H 1HSBB 1M3IA 1SLUA 5F6IC 1SOXA 4V1XA 4GRWE 4MVBD 4TSBH 2OR8A 2J2ZB 3GIZL 1MRDL 5DJCB 4QXUH 3LA4A 4RISL 3R79A 2YD6A 3HMCA 4AE0A 1ZJAA 4OJFH 1FWNA 3DN5A 5DQJA 4U1LB 4NU7A 1RD6A 1UB5A 2BJMH 2DI7A 1DO5A 1PAZA 4NQED 4W9HC 1ECYA 4WV1B 3W81A 1Q0YH 4EF3A 4KKPA 2X89A 2NYYC 3DOSA 4Z0BL 3LXUX 1X38A 1YYCA 4XPBL 2Z31A 1LM1A 2CG9X 4DNLA 5EL1A 5G4OA 1TZGH 3G5YB 2B9AA 1ZTVA 3C5JA 4MZRA 5JPNB 4HEPA 1HL8A 3FJ6A 4GEJA 4UTBH 1KYOK 1G7MA 3QJHA 4M7JH 1HCFX 1RJYB 1HUVA 3MQTA 1OCRB 2VR7A 1V6WA 1ZGLP 5AVQB 3JBG7 1ZMYA 3WJZA 3W86A 5DGQA 1QOKA 2O6DA 4FA7B 1B0GB 3O16A 3GTHA 1W32A 3AREA 4XCNA 4FQXA 2OMZB 1PB0A 2VGLM 3PB2A 3CAKA 3S2JA 3SSZA 1IAKA 5AVNA 3ZLQC 2VABA 3G1AA 3O11B 3HG4A 3IGAB 1MRQA 3UJFA 1QHOA 2CXEA 5DZVA 1V79A 1ZJIA 1BZQK 2QMKA 3QQ9C 3RZCC 4AKQA 1W0VB 4BKLA 1GOWA 4W7UA 3WEXA 3R0NA 4AQ8A 1FWHC 1EZSA 4K9EC 5JQIB 2NQDA 3POHA 4LZKA 1JPIA 2PXYA 3HQPA 3F64A 3C5ZD 4BCXA 1I45A 3GC5A 4DBEA 4N2LA 5IWLC 3W2KA 3U79A 4N6RB 1N8FA 3PWUA 3MJ9A 1X5MA 2CU0A 2PU1A 3WQPA 3WQDA 2C1OA 3U8GA 1GJWA 3GXPA 1KV5A 4ZX6A 1YNKL 4M56A 5K9OA 1WZ1L 1DLHA 1W9VA 4WDXA 3TROA 1LO3H 4XO5A 3MXWL 3AGVA 1IR1A 4H44C 1E6JH 3T8LA 1DL7H 1QO3B 4A3YA 4D6EA 5C9UA 2YDAA 4Y9CA 4BXSV 3PBVA 4LSQH 2N7BA 2XFFA 1BV8A 4WEBL 5C0BA 3QA3B 4RUBA 1A3ZA 3O3UN 4HUVB 4XB7A 3N73A 5JNYA 4KXBA 3CLFL 2UV8G 1WQVT 5JIHA 4HPYH 3LS4L 3MA9L 3RLVA 3K6NA 1AACA 1XEUA 2CO6B 4U1HA 1T89C 4AZIA 2HX8A 3L7FB 5B3JE 4FLQA 3K3QA 4RZCA 1P43A 1PLBA 3OPSA 1GS8A 3NJVA 5EFDA 4IU3B 3O8XB 5EBMB 4MHHG 5BQ7A 5FJJA 3DSFL 3NK3A 4QQ3A 1GGCL 3DERA 2XPZA 2VKWA 3I02A 1G7PA 3P67A 4CCEA 1CUOA 1DQQA 3DX1A 3QUZC 3HR5B 3UAJC 4MJMA 4YL2A 4KQ3L 1FWWA 1US2A 3MRIB 3KRUA 2OP4L 1NSJA 3ARVA 1A22B 1RCOB 3JUGA 4ZS7H 3ZL4L 1JUFB 4LUTA 4BH8A 1KGCE 4WFFE 2W60A 4HISA 5FV2A 4HUNB 2EDDA 3VXRA 3RLUA 5DWPA 5GGUB 5BUPA 2PDYA 32C2B 4DN3L 1ZAHA 2EDEA 3KE0A 5B80A 1A25A 3TJIA 5L2KD 2XI9A 5I19L 1XV8A 3FH7A 1S5VA 3G5WA 2JE8A 3BPWA 3UJRA 1MXGA 4ZS6D 5INDA 2Y5JA 5CEWA 7XIMA 4CNOA 4G8FA 4UC5A 5CKGA 3S0PA 3VYPA 3VQLA 2QQLL 3OR6B 3MCKB 2QT3A 3QVQA 3X12A 5EC1B 4U49A 1YXYA 4L8DA 2XFYA 2OELA 3QCUH 1G6RA 3SKMB 1MFAH 2XRAL 3N43F 2H47C 1A6UL 1OP4A 4FI4A 1B1YA 1E43A 3CLEL 3CGTA 2Y88A 4N2BA 3TN0A 2XACC 4REQA 1IGCH 3CIVA 3Q6GH 4A29A 3UH8A 3D8MA 3TT3L 5J89A 5GRXG 3FOMB 1GGTA 1OF6A 1RLCL 4N4PA 1KYFA 1ZIAA 5EIIB 1AD9B 2CHXA 2J1KA 1KBBA 1V5XA 4XP6L 3DUSA 1NWUA 5DY3A 4C1NA 1KCZA 3D6NA 1L0PA 2ESVE 3L4XA 3MDJA 1B3VA 3S5NA 3T4YB 3IMWA 2X9XA 4GFIA 2JB5H 1QD0A 2OTWB 3LEXB 4KI5D 5T33H 3BXWA 5EA0L 5AFDA 1IBBA 4LAJH 4TNEA 4URIA 4OI7A 2X09A 3IDNB 2ZKMX 1QUPA 3PNWA 1S5NA 3ZKXB 1DXIA 4YK4B 3S4TA 1TMLA 2Q76B 3QXWA 4BQ6A 3DHFA 4X60A 1DEEB 4PWIA 3KVMA 1OPGH 3QUKA 1U3ZA 3ISIX 1CD8A 5D7KD 1ZHKB 3BEVB 2JF7A 1NVMA 2C7FA 3MI2A 4Q33A 5EZOL 2CRIA 3HPJB 4I85A 5LCVH 2WSDA 1T1ZA 2YO3A 2ZSVB 5I1KH 5HYQA 1W1B1 5IFPA 2LAGB 5HDBF 5BO1L 4WJ5A 1QX1A 4LVHB 4P46D 5JHBA 5C07A 3R0DA 1PZ2A 5GJPA 1H4PA 4OCLC 2HPTA 1CFTA 3W9EB 4PUJA 2VQ1A 3K74B 3FQ2A 3D4YA 3VI4F 4QRNA 1A6ZA 2CW6A 2EIZA 3PYCA 5I5JA 4FD0A 1V8HA 1KV8A 2REQB 4HYWA 4RW5A 4KPHH 4U2YA 3WO3B 3B6SA 2R94A 5E6ID 3L3KA 3UL4A 2XWZA 2VR4A 5D7LA 3W74A 3OJDA 4WKFA 3QH3B 1MVYA 2Z35A 1OAKL 3ES6A 3SDXA 4E36A 5I03A 1BDYA 1XR8A 2QR0B 3N2JA 4MYPA 1A1NB 1NC2A 1NOLA 4NQCA 2DDXA 4J35A 1A47A 2J12B 4YSRA 2WVVB 2A3BA 4U6XB 4XCFH 2JGYA 3IWUA 2ATPB 5DQDH 1TCMA 3L16A 3MKCA 4JQ4A 5CPTA 5TD4A 2OCJA 2ENYA 5FD0A 5HINA 4JTGA 4PP1D 3W7GA 4Q0XL 3W37A 1S7QA 1EANA 3FO9A 4D6DA 3UCQA 1E1FA 5F8RC 4ZX5A 4Z0XB 5F6IB 2GTWA 4WO0A 4EI6A 2Z8SA 3CV1A 4FR1A 2FO4B 3ARBC 3NIFF 4MMYB 1KLFB 1AZ1A 4BK8A 3BT2H 5TDPB 2WANA 1OIOA 2A0NA 4QRRA 3HGSA 3O3RA 4AVFA 1B9KA 2DMCA 3IMTA 4NENB 3QORC 4AT6B 5KVFH 4IPIA 3FN3A 3NTCL 4HU0A 1KGWA 2X6MA 1ZNNA 3RUGF 1FNEA 1IGIL 3C6SA 4U28A 4X6BB 1K8YA 4I5RA 4JB9L 2OTUA 4JDZA 4PJAA 5KTLA 3KTXA 2XQ0A 3D18B 2DLFL 1BRLB 2CPUA 1L2UA 1RVKA 1WFMA 2PDQA 4I7UA 2EXOA 2JCCA 2R7EB 2B15A 3FSWA 3WNIA 4XP1L 5IB3B 3FQYA 4Y1AE 5H6HA 4PBGA 3PP4L 4RZBA 4M61B 3QRLA 1MO0A 1P0KA 3S4SB 1G4MA 2NUPB 4GVGA 1FKWA 1Q5MA 5A8NA 4C54A 1PSKL 5DUPH 3S8HA 1INQB 4ZXLA 1RIUL 3F7LA 3Q2WA 3QHOA 2Q2LA 3HJ0A 1JFQH 4K3EL 4E41E 4K94L 2IAND 1XFCA 1HJCA 4HN4A 4LKXA 1X5JA 1UD2A 1E1CA 3GS0A 4P7NA 4LVNB 4R0LC 3PGCB 4LY4A 3IXAB 4F8OA 1N9PA 1G7JB 1KY7A 5HDRA 3V52H 2BP0B 3PWVA 4BELD 5IHBA 4E0RB 1DTNA 4IBQA 5CJOH 2K6YA 1WFOA 3W72A 4GC3A 1Q66A 1GSMA 3NZ8A 5E8OB 2VDOH 4NO0B 2HLEB 2JKSA 4ZW3A 3VRJB 2FKPA 1IHIA 1CLVA 3WUZA 1GXEA 1KLUB 5C7XL 1LBLA 1KA9F 1Z69A 2XYLA 2H90A 3I50L 3RFAA 4DIXA 3ZW3A 4AY8A 3BGJA 3QH2A 5FGRA 3DEQA 4PBFA 1ZSHA 3WIHA 4ICWA 4X6DA 1X1ZA 1F6YA 5EU3B 2A9DA 3QUHA 1BD2B 4TX8A 3BLLA 4Z1AA 1QASA 1HAUA 2FB4H 2NT0A 4HXBH 4AKPA 4APQD 3K0WA 3HCVA 2WNXA 5KSBF 1YNTB 5AHIA 4HK5A 3UR2A 4N86A 1QFHA 3LCLA 4JRXB 5EZLA 2P52A 3DV4B 3SE9L 2APFA 2DMGA 3PWPD 3VGHA 1AW2A 1LBFA 3UBPC 3NCJL 1E71M 2I60L 3MODL 3HG1A 1XBYA 4QCEA 4Q8OA 1XIWD 1UUNA 2Z7KA 3BDKA 4LL1A 1UASA 4LSRH 2CZVA 3TW7A 1EJRC 1SW3A 1PKYA 3MO1B 2ZAGA 5LBSL 5CILL 5FEWA 5I75B 3ARGB 1WISA 4DESA 3V4VA 5K9JL 3MWCA 4PB9L 4BWWA 3CWGA 5MHSD 5HVHB 1NGXB 3QUZB 1NGZB 1U8PB 5AY7A 2HT2D 5BXTA 3ZTJH 4HIPA 3IVKB 5AC5A 4A2FA 5IROA 3VG9B 4AIEA 3JVFC 3SOTA 1A5FH 1JI2A 1Q3NA 3SE4A 2J7LA 2WWKT 2WWKO 2PWGA 3VFNA 3LCWA 5MENA 3N14A 3TYDA 3IGFA 4R2GC 3GAKA 5IHZA 1JTTA 1MFUA 3R7MA 3W2JA 2P1YA 3IDJB 4FN0A 1HE7A 1E4KC 1PXGA 4TVCA 4ZUTB 4CN4A 4H01A 1GTHA 2PZ0A 4GVFA 2YHGA 2DIAA 4NCDA 1ZHLA 5MEPA 1EP3A 2VERA 5HYFA 3WJYA 3BKMH 1N8OE 3PHQA 4D7PA 4H04A 3W1QA 4R2GD 3LXBA 1O4UA 4OF7A 1JDCA 5FKAA 3RKDD 2FTAA 3ZMRA 3LBMA 4LEFA 4F0RA 1T5KA 2B77A 4MAYB 4OT7A 2VQUA 3V0SA 1CE6B 2Z31C 1XF3B 2YEZA 1BVNT 1JIBA 5LHDA 1JFXA 4U1GB 1IVLA 4QE4A 5C54A 4AM0Q 3HW7A 4Y9GA 3EWBX 1L9NA 4YWGH 1V02E 3VI3B 1UWIA 1AHMA 4C4KT 3MDUA 3H6JA 4W87A 5HJXA 1WWCA 3LOTA 2W0KA 1HF6A 4AQLA 1GZHC 2WKOA 3WJWA 2M26A 3V6ZB 1HSBA 2LVCA 1JZ2A 1Q8AA 4PUUA 1KCUL 4JQXC 2ZYRA 3AUVA 4YS4A 2YAOA 3ZKSD 1FL3A 3P40A 4OAWB 5ABAA 4IG2B 2J77A 5TAOA 1FAKT 1G7HB 4NZUL 4JR9L 2X30A 4GRMB 5AKTA 3N29A 4PRTA 2COQA 2HT4C 4U1NB 3QJQB 3QAQA 2N4IA 3NR0A 2BMBA 2GFBA 2XWTB 4EN2A 3SO5A 4AWSA 4RNRA 4P2AA 3X3GH 5I3IA 2OMUB 4GKSA 1VBRA 4L1DA 5T1JA 3DU0A 3GLCA 3I65A 3PRZA 3KCOA 1ZLPA 3RJQB 4C6LA 4JFEA 4PJBE 5TTRA 4EI6B 2TSYA 5E4EB 4NNBA 4IKLA 3C5JB 3CLFH 4FNQA 4R7VA 1XYFA 4UWMA 4PJDB 3V8OA 2WO4A 3HJEA 3A4JA 4IHBA 3RI5K 5IF0A 3GFZA 4PTNA 3IT8D 5JORA 4RXGA 4P9HL 5L9FA 3LN5B 1R3JB 5LXGL 2NY1B 3TAKA 4G6AC 1OL0A 32C2A 4GRSA 1UT2A 3MROB 4XZ4A 4LF2A 4MQXD 1WSST 3RFRA 5B4MD 1R3LB 1R5IA 4J5NA 1T1YB 1XW8A 4APQB 3OHXA 1QNRA 3EDDA 3D2UD 2O5ZL 4KBPA 4B9ZA 1C08B 1OAQL 1DIDA 5F1VA 5FO8A 7ENLA 2VC2B 4M7LT 5INDB 4KKQA 3A64A 3BUDA 3ARRA 4P2OA 3NQVA 3MRRB 4PCKA 3WN6A 1R30A 3L7EA 1V51A 1MCPH 2OP4H 2XG4B 4LYKA 2Y5QA 2A0LC 4MYWB 5GNXA 3UVIA 1IZJA 1CK0H 2NY7L 3FSVA 1QW7A 1A6TA 3HC0B 4KZDH 3N1QC 2YPLA 3HTWA 3TQKA 3V6BR 3M0HA 4I6VA 4RIRA 4KH2A 2X53A 4KNQA 2W0FB 1M01A 1VR6A 2YL6A 4BH8B 5L2JA 5IBXA 3RCNA 4NZ1A 4B91A 1NLDL 4KK6C 1CBGA 4JS3A 1EAOA 2QCDB 3RNDA 3KH4A 2J88H 3MBXH 5EIIA 1I7UA 3WQCA 3S9YA 4DZ5A 5KVGE 5E08L 3QT2A 3CLWA 4HOXA 3I6RA 3DUSB 4CVUA 4AYID 3QOMA 4XNQB 1KD0A 4YNYB 4HBCL 1JYVA 3UYCA 4ADTA 2B0SL 4NKIL 1B3IA 1ZIBA 1NCWL 4XMPL 1J11A 3W11D 4A3RA 2NVCA 3QCUL 3AY4C 3C0SA 4MUZA 1E0WA 3C75A 1MQ8A 3L7FA 4G7SB 3SE6A 5I18L 4TSAH 3D4CA 3DG3A 5IVZB 4GW5A 4QM1A 2R29L 4TOYL 1AXTH 4E5XG 4OV5A 3C0JA 1X5AA 4PJFB 1ZKAA 1DBBL 1L9OA 5D2NC 4IQLA 3ARXA 1ORSB 2COVD 4G80B 1TETL 1SQ7A 2X89D 2JJTA 5A6BD 3U9WA 4EUPG 4F8LA 1TEGA 2GBVA 2YGOA 4YLQT 2NQZA 5EKYA 5A95A 4L29B 3FOMA 4JFDB 3ABKB 2ZZ2A 1N0XL 2O5XL 4YFLI 5FJTA 2XTKA 3EPOA 1ND0A 3QIUB 1Z9OA 5D6DC 3ZGHA 4PL1A 3WQ4A 1LRTA 4LSTH 2WUCL 2OMZA 1XIFA 3BZ4B 3VGAC 3ZE0E 1TR1A 4YMPA 1H8SA 3GHUA 2OTWA 3LOWA 4LHQB 4C59B 4S3FA 5H2ZA 4K7PY 3K0YA 4Y1AD 3N5AA 3E2SA 4JTDA 4XQ6A 5IW6B 2J1WA 1SZNA 4LVNC 4R0LB 3NPSB 4BEQA 3P3BA 5FEZA 1YMHB 1BM7A 4HH9A 3MRDB 3P2DA 4N24A 1I0BA 1SMAA 2DQUH 2Z35B 3AQYA 3SDXB 3E6FA 1SR0A 3ABQA 3AZRA 2HYMA 4J40A 4EAYA 5HBFA 2PS2A 5I1JH 4I7WA 2P45B 2QXWA 5A6LA 4HK3N 4FFVD 3AADB 3LRLA 2CZNA 2EE6A 2PLJA 6XIAA 1TJPA 1KACB 2LLLA 3X11B 1A7OH 3ZZSA 1FFRA 3T0WA 1W8OA 2YZRA 1XGYH 4EOWL 2EINB 2F8OA 3B2DC 1I1CA 2BIQA 3OC5A 4RVBA 4WWOA 3BP5A 5T1KA 5IP4A 2QGBA 3ZL2A 4I6KA 2GTWB 5FF0A 2DYPB 3UP6A 1RA5A 2QNEA 2MHAB 4QEEA 1UM5L 4HS3A 1X4ZA 4AV0A 3QQ0A 4HSOA 3HM7A 3C6LB 2VUOA 4PB5A 1BBDH 4G7VL 4OCRL 4H19A 4G43A 3OAYK 4GO9A 4OKVA 4JFTA 4H5SB 5C0JB 3NNTA 4GXWA 1JPSH 2AEWA 4M93C 2FTWA 4ZQTA 2J7DA 4WSJA 1IT9H 2PDWA 2AFNA 3TK7A 1A1NA 2ZONA 4Q0XH 3IDNA 1M7UA 4WKZB 4N2IA 2EYTA 4WDTA 1A3XA 3D85D 5H37H 3L48A 3ZE0B 5HSFA 1JF5A 2DFAA 3M41A 5ERWB 4JNMA 4Y5YB 1JI1A 5ALBL 1JZ7A 1G7PB 2J79A 1MCEA 4RFEB 4NFBA 3THMH 2GJLA 4RCXA 2Y5TA 4I77H 5HULA 1E40A 4JTAA 1HFBA 1PV8A 4HZLA 4DJFC 5T3ZL 5TK2A 1AH0A 3R8BB 3TA3D 4KIEA 3H1ZA 4AM0B 4ZQKB 1I82A 4HOZA 4LKXB 4Y0GA 2ZSVA 1U3HC 3AQXA 4CW1A 1E6QM 1JUKA 2QF8A 2F9BT 3MV8A 5KTEL 2V68A 1OEZW 3QJSB 1VZWA 3YPIA 1VFOA 3Q2DA 2WLMA 4P9ML 4TULL 1LL4A 1EEPA 2ZD0A 4TS6A 4H83A 5DD0H 5AHEA 2HSIA 2WNKA 4FNPA 1FTXA 4KWVA 2PR9A 2ZXAA 4OBSA 2QVKA 4NKOB 3RUGB 4L6HA 1BPVA 1S1PA 1V6VA 3BAIA 1WAUA 3N11A 1R3KA 2K3HA 1KBLA 3IV8A 1U3JA 1Y1DA 3P30H 3O2VL 4NM4L 4YR6B 1I7ZA 3C6LD 4JQ3A 1YMMD 1F5WA 3VFMB 1MLBB 1YECH 3G04A 1XRSA 3OLDA 1P1ZA 2WMPB 2ZG1A 4DKAA 3W9ZA 1X7QB 4LL4A 4HT1L 3MZ2A 4LC8A 2DJMA 3EYSL 5EBWB 3IVUA 3CVHH 3UYIA 4YSQA 3QZBA 4FFYA 4OF5A 5E8NB 1L6ZA 2C13A 4M0XA 1TPWA 5E2JA 1LO0L 43C9A 5A2AA 1RPXA 3BGGA 2RACA 1P2CB 1FNFA 4M62L 2VDOL 4TSBL 1CGYA 1KWGA 2VISB 2DM3A 3MFFB 2BHUA 3QIWB 4O02B 2NV1A 4ZOEA 3L5LA 5EPMB 4CEUC 4J3WA 5HDQH 3LEXA 3ETTA 3I50H 1IBYA 4ZMWA 3EXSA 4JE4B 1KXVA 1UC5A 1OBAA 2RFXB 4M6MH 3KRSA 1BQHG 2D3LA 2K70A 4HIXL 1F6AA 3Q5TA 3EA1A 4WHDA 2FB4L 1FUYA 2WZTA 3QI9A 3AU1B 5IMOA 3WHE1 5C0DB 3OW1A 5BOEA 3HVNA 1RJPA 3BKJH 1C8QA 4NQXA 3TA9A 5HDBB 3KDMB 5HTSA 1PO9A 2Y7FA 3V36A 4U6YB 5L4MA 4PN6A 5EUOB 3S9DB 4NL1A 2ON3A 1MHPL 5FM5O 3TWYA 2ISWA 4ZPTA 4XPHH 5D2NE 5IB2A 4LSRL 3EX2A 5C7ZA 1CWYA 3C2AH </