4DO4A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-N-acetylgalactosaminidase
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
total genus 130
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do4A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do4A01
3BGGA 1DKWA 3CTLA 4X2RA 5AN7A 3W7NA 4JTSA 2VKZG 2AMGA 4JFSA 1I8JA 2ISWA 1KM0A 3QQ0A 1WA3A 2FH6A 1WE5A 3W6YA 1SO3A 4DBEA 3G1VA 5FI8A 4JEQA 4YCOA 1DHPA 1HTYA 1XCFA 1GVOA 2NWSA 4TX9A 1G4PA 1CXIA 2EKCA 4BI6A 4O1BA 3G1YA 4GUFA 3BLFA 3W83A 4JX5A 1OFRA 1M7PA 4AF0B 4N4QA 2RH9A 3LXCA 2O7QA 5HULA 3PBYA 3PWAA 1QOPA 3MI3A 4Q33A 4ZQCA 5LNRA 3DX4A 2OZ0A 4FX7A 2BY3A 4LV9A 4Q32A 4KMQA 5DY2A 1AMKA 3WN6A 1XH1A 3CPRA 3VE7A 5AYYA 5KMYA 5D2WA 3EWXA 3NG3A 1D3CA 3TUUA 3BLEA 3GYEA 3TSDA 1V3KA 4UQDA 3C2FA 2E5DA 3NL2A 1O94A 2WJZA 1MEWA 3BAXA 1PZ3A 2G97A 4PEKA 5LNVA 1VH7A 3WY2A 2V82A 2WNWA 4DPQA 3TJLA 1KXVA 4WY0B 1CXFA 2JKPA 1O4UA 3D52A 1J4EA 3UERA 3C2OA 3QSTA 3EX6A 1Y7VA 1CXLA 3NM1A 4A3UA 1ME9A 1LRQA 3TDFA 3EDFA 2W6RA 1WX0A 1J0HA 4H6KA 1W3IA 1SMAA 2GQ8A 3GZ3A 4UFIA 5F1VA 3L2IA 2NUWA 2RHGA 4FIQA 1GQNA 1QPNA 2WNZA 3HGJA 4H3DA 3W84A 4TMBA 2ZX8A 1HO4A 3ATZA 4MY9A 5FEXA 1CI1A 3IV3A 2HTMA 3IIVA 2WSRA 4J27A 3NOEA 1GYLA 2A5HA 1TV8A 1U5JA 4BK9A 1DVJA 2C16A 4H4IA 4R33A 1MWOA 7CGTA 3GXMA 3S6DA 5D38A 3T7VA 1QPKA 3VFLA 3LCXA 2C1HA 1PAMA 3BO9A 3L67A 3M47A 2BXZA 3AO0A 3EWZA 2DZTA 1R33A 1FCUA 4Z08A 2A2IA 3ZR6A 3NQMA 2XIIA 5K9CA 5I5RA 6ALDA 2HSAA 3KOFA 2ZIDA 3U8GA 3W7GA 1UB3A 4HIBA 4FNPA 3G1FA 1YDOA 1QX1A 4Y6GA 4FIRA 3L65A 2HS6A 1UD8A 3BPWA 5LKYA 3GDLA 4UTJA 1QW8A 2QMJA 3VO0A 4WY0F 3A9IA 1JF6A 3TH6A 1YXYA 1XBVA 2KZHA 1EUNA 3GXDA 2WC7A 4JX6A 4EF9A 1UKQA 3TXVA 1RPXA 3NQCA 4MYXA 5HDRA 1KWGA 4RXGA 4YLWA 1YTDA 3HGRA 4MFDA 4TIMA 2DZVA 3JRKA 1X8FA 3IVTA 1B57A 3SZ8A 5CZTA 1H7PA 3TQKA 1TCMA 3UXAA 3DKLA 1O7DC 5D2XA 2FGZA 1NEYA 1YXCA 2QEZA 4GQQA 1OF6A 2QCMA 1B9BA 2ZUWA 3BG5A 2PWDA 2FLIA 3NZRA 3VCRA 2LLEA 5LZLA 3U6WA 3GKFA 3MI6A 4QNWA 4DEFA 1G9HA 1FWSA 5AHNA 1N8FA 4RKAA 1QWGA 1CLVA 4UOZA 1P6WA 1W56A 3DHDA 3G3MA 2E4TA 1WXJA 3ZS4A 4AB4A 4QNEA 4HNNA 4Z1AA 2C6QA 9CGTA 2ZE0A 2Z1KA 3QZEA 3W7DA 2G96A 4S2CA 2J24A 3MI2A 3NQVA 1KM6A 3W1QA 5KSWA 2XVGA 4RCXA 3S1WA 4A2SA 5CZ0A 1VQTA 1GWJA 1DQWA 1KFKA 1TTPA 3UY8A 4NJJA 4UR8A 1XSIA 4QSHA 2AGKA 2DJXA 3STGA 2ZA1A 4OE7A 3O16A 4UCFA 1GVQA 3N9RA 2C14A 2ZTJA 4E2BA 4K8HA 1DORA 2QCNA 3F4NA 3V1PA 3W2UA 4HHPA 2VNCA 3TKFA 4MLRA 2HS8A 4K37A 5TD4A 1XM3A 2QUUA 4JTTA 2QCDB 3RFAA 1PPIA 1Q6OA 2PWEA 4GXMA 4S1FA 4GQRA 1MXSA 3KVLA 1CW2A 2NV1A 3GXTA 4JL1A 4JGDA 3W7MA 3L4WA 2A6NA 2QPUA 1K7XA 3IEBA 2DU2A 1W8SA 4P2VA 4JS3A 1Z41A 2ISVA 1EO5A 3D4YA 1WYIA 2GJNA 1GEQA 1X6UA 1J0JA 1EEPA 3N3MA 2ZRVA 3OEXA 2I14A 3KVKA 3JR2A 4BA0A 4B5NA 3A5VA 4P61A 3CZKA 4UQ9A 1H63A 1QPQA 3HOJA 3TQ0A 2V2CA 3B05A 2C18A 2QCEA 2D73A 2E09A 2YA1A 4OJYA 3L4XA 2Q8ZA 2GUYA 1VC4A 4N6FA 3BARA 3KFTA 3B06A 1JD7A 3BSHA 1RR2A 4GC4A 4N6EA 4CVWA 1IXOA 1LOSA 3LV6A 4JN6A 2HMCA 4LVGA 1K03A 1GPWA 4BWLA 3GDTA 4XQ6A 4H7VA 1UH2A 1LOLA 3SW6A 3G8RA 2OX1A 3LDVA 5HR6A 1ZNNA 4M6VA 2QDGA 3KVMA 3RNDA 2TPSA 4ADUA 1LRNA 1L6YA 2J6XA 1U83A 2BXVA 3FS2A 4RZ5A 2WSKA 4HOWA 4HOZA 1LOQA 3EJRA 2ALWA 3NL6A 4UZUA 1OSEA 1M7XA 1IZJA 5KTLA 3LCWA 2C3ZA 1AQHA 2NXIA 1CPUA 2X1UA 2R14A 4HNTA 4IGHA 4M56A 1YLVA 1WO2A 3QJAA 5SWUA 3MHFA 2EQDA 3DX1A 3C56A 3QW3A 3W85A 1HNYA 1LWHA 5DCDA 4AH7A 4MZ8A 1SO4A 3HPSA 3WENA 3HQ1A 1MZHA 5G1TA 1TSIA 3RLUA 1W5MA 2WV8A 2QCFA 3NQ2A 4UNIA 4RZ6A 3CT7A 4M7SA 3F4WA 2WANA 6TAAA 2X2IA 2BHYA 4K7VA 4UTTC 1TV7A 3N19B 1XC4A 3ZOAA 3TR2A 2J27A 4LC8A 3UZJA 1U30A 2XFWA 1HX0A 2PWHA 2F84A 2YXGA 1FDZA 1ZS2A 1LROA 4E0CA 2WPGA 1Q45A 2TRSA 3KRSA 3NPWA 4JTHA 5BOOA 3C61A 5K4XA 3W1RA 1MEIA 2GVGA 1UH4A 5HUPA 3KEHA 1NOFA 1EWDA 3GXNA 4AYGA 1QDSA 4JIPA 3WJSA 1PCKA 2DZSA 1D3GA 1TQTA 4XKYB 4GUHA 1NF7A 1H7XA 1CXEA 4AEFA 4GINA 2RFGA 1CX9A 1TB3A 7TAAA 3MBDA 4GUJA 1KB3A 3VE9A 4GUGA 2F1AA 4QAIA 5AFDA 2YA0A 1WAUA 3OG3A 1IF2A 3GNNA 2VC6A 1QHOA 1SR9A 3LGEA 4U3CA 5G5IA 3FEMA 2A4AA 1VYRA 1Q4NX 3VU2A 2BHZA 4AYSA 3UWZA 4GFSA 5LHEA 1BAGA 2Y2WA 3HG2A 1TMQA 4O13A 1PCWA 1OFEA 3ZT7A 4J3TA 2I1OA 2Q3OA 3IIPA 3YPIA 4UFJA 1SSDA 3BH4A 1LRTA 1SZFA 4MLJA 3WNPA 3BUIA 4RX0A 1GVSA 4QQ3A 3C3NA 4U28A 2WVTA 3WK2A 3GK0A 1JDAA 5KZEA 4FF7A 3WMSA 3ABSA 3VNYA 4LVBA 2CLMA 4M6PA 3STCA 5D2TA 4LS0A 3VX1A 2WKGA 3E0IA 2YZRA 3CTTA 4EVZA 5I3FA 1WDWA 1XDLA 1OYCA 1W31A 3SSJA 3NDOA 4NXKA 1G7UA 2WKJA 5K7JA 1OYBA 5HXMA 4XBKA 1VLWA 1CXKA 1OF8A 4HPJA 2CHNA 2R8WA 1JIBA 3I7QA 3L0GA 5AYXA 1H3GA 2YKKA 3BUPA 4GO8A 1GTEA 3QMTA 2J88A 3D4ZA 3DDGA 3N9SA 3L9CA 1R46A 3BVUA 1QO2A 2E6AA 4IMCA 3DBPA 3CEPA 5IM51 2E77A 3KL5A 2JGQA 3G24A 2J25A 1O60A 2ZBTA 3M16A 2ZZ7A 2B0MA 5F2LA 3L21A 3HO8A 4KFOA 2WVVB 1JR1A 3C2EA 4UTWA 3R8RA 2ABAA 3CM4A 3I7SA 1XBXA 3A21A 1VJIA 3WK1A 3NQDA 3B04A 3VGBA 1I45A 3W1LA 1PIGA 1TYGA 5ABTA 3D51A 2BWGA 3LHVA 3K30A 1WZAA 3W1NA 4XZ9A 2ZDRA 4BFAA 6CGTA 5HMSA 3L5AA 2FIQA 2VEPA 2X1SA 3LI0A 4DO6A 5HWJA 2CLHA 3H55A 2ZX5A 1OFQA 1A5BA 4W9TA 1S5WA 3WJXA 3HBLA 1SW7A 4WOZA 1KM4A 1VCVA 3P62A 1X1ZA 4IX0A 4AHOA 3C6CA 3GTNA 4O0ZA 4IPJA 1F73A 2GQAA 5EMYA 1OYAA 1YPIA 3S42A 3EDJA 2ISSA 3W3OA 3K8KA 1H7NA 1EA9C 5D2YA 3G22A 1DJNA 3LCGA 2NT0A 5EL1A 5C5YA 3HZ3A 2VR5A 3F03K 1AMYA 2BTMA 2V30A 1FCQA 3BSGA 3EB2A 3PUDA 5E70A 1KM3A 4JDYA 3W1MA 2V2DA 1VR6A 1RP9A 1Z32X 1UA7A 2ZX7A 5E0FA 4JFVA 3F1QA 1LORA 3LV5A 3MJYA 2FHBA 3NQEA 3NQ6A 3PVFA 3E9AA 1BEUA 2ZXQA 1J2WA 1TPVA 4C1LA 3CZGA 4UFLA 2YGYA 1E3XA 1TPFA 1JG9A 1W37A 2G3NA 5CZJA 2FJKA 3UWVA 2YW3A 1VFMA 2E8YA 1S5TA 3NL3A 3W7OA 1NVMA 2OT0A 3P82A 1OX6A 3S5NA 5F4XA 4OQVA 2Z0IA 1PHWA 2OYMA 4FXRA 2F7FA 4MVAA 3BVVA 4CN6A 3EDDA 1UD3A 2CPUA 2DIJA 2OMAA 4O17A 3S1XA 3LCIA 3NNTA 4ICNA 1DBTA 4MY8A 4ZMGA 3LBCA 3WY3A 3LRMA 4Z1BA 3LPOA 4FNRA 4X22A 4Y96A 2JK2A 4CCCA 1JXKA 2OT1A 5AYZA 4DO5A 3P74A 4QM1A 1BLIA 1CGUA 5HNRA 5BRPA 1G1YA 3PF3A 3WNMA 5DXYA 3MHUA 1T96A 3P80A 1SZEA 3BMVA 1R2TA 1Q6LA 3CLWA 1MW2A 2Z6JA 4AAJA 3UWQA 1OJXA 2ZICA 1F05A 1AW5A 3O63A 3PG8A 3UD6A 2Q3RA 5EPDA 5G4WA 3VKJA 3GX9A 3FLUA 1JCXA 5TBOA 1IXPA 3PB0A 4JTJA 4HKPA 1PIIA 4M6QA 3TONA 4KWUA 2F1BA 3GNDA 1H50A 3P8JA 2Y88A 2E0PA 1B4EA 1FWTA 1ZALA 4TVUA 4DF2A 3CV5A 3KLLA 3FJLA 1H61A 2Y6ZA 5FF2A 3S5OA 3W2JA 1RPKA 2VT0A 1QW9A 3EJSA 4PTNA 2QCGA 2EABA 3L68A 3W23A 2QJHA 3NVTA 4DBDA 3TU9A 1K8ZA 3VGFA 2QJIA 4UMBA 3UZ5A 4FX6M 1GG0A 1KFCA 3MWAA 3PS7A 3E12A 1YTKA 4I7WA 3N34A 4PSRA 5E6ZA 4O1CA 3Q58A 5DBUA 3CU2A 4FX8A 2CLLA 4JDBA 5FF0A 1E51A 3THQA 2QV4A 1RV8A 3QMSA 4EWND 1OHLA 4XUGA 5E93A 3LCFA 2V2HA 2NZLA 2FB2A 2DH3A 3M5YA 4NJKA 3WFZA 3TC7A 1FQ0A 3DFOA 1J0KA 3EDKA 4N9CA 4JTLA 3R2GA 3OLIA 1AK5A 1XBYA 1VYSX 1F6KA 1VFUA 1ZAIA 1ZJIA 2GQ9A 3KXQA 3ZWSA 5E0KA 1MXGA 4CKQA 2WOQA 2YA2A 1VZWA 3BW4A 3TW7A 1B3OA 3HGSA 3P61A 1A5SA 2YYTA 3W75A 5I3GA 3M5VA 1DL3A 1KFEA 3L4YA 4AWSA 3W76A 2OSYA 4DF1A 3KAOA 1O5KA 1SW0A 3RILA 3A23A 3ZO9A 4ALDA 1JRCA 5LNWA 3SR7A 3W7PA 2ZUSA 3OHIA 5BW6A 3IJ7A 4AEEA 2YPIA 2PCQA 1AL8A 2O7SA 3DI0A 3QC3A 2XN1A 2B7NA 1GVIA 3S5YA 3NPVA 1I75A 3BLKA 1TMHA 3C0JA 2C0AA 1BPLB 4ADTA 3NR0A 3DENA 3EWUA 1TRIA 3QPYA 1NFBA 1YTEA 5AHEA 5TIMA 3LCHA 2WKLA 3G1DA 2A6LA 5I3JA 4E2DA 4LT9A 3CWOX 3EDEA 1QO5A 2F2HA 2ZXDA 1UD2A 3GXIA 1AVAA 4CNOA 2CZDA 1XSKA 4U33A 2RDWA 4GWEA 1K3UA 4YXGA 1UBSA 1JQXA 3CIXA 5K9DA 1ZY9A 3O07A 3EXTA 5G2WA 3GBDA 1KFBA 4Y9AA 3V75A 1TJPA 1LBMA 2WSQA 3W2KA 2VXNA 1KXQA 2GUUA 3W73A 1I2RA 1I2OA 2FQIA 1CIUA 4IXHA 1XCWA 4LV4A 2VFHA 3TJXA 4AHPA 5F7UA 4AF0A 1UA3A 4CNNA 1EUAA 3CIWA 3BVXA 3W2LA 3UPBA 1LBFA 3SGUA 3CZEA 1OFAA 3LOTA 4LWWA 3W37A 1UKTA 4Y90A 5J5RA 2PC4A 1IXNA 4CN4A 4ZQRA 5A2BA 1WQ5A 1XBZA 5C2XA 1H62A 4QAWA 2ZCGA 4JICA 4K38A 4LY8A 5BMXA 1DTUA 4J28A 5J5DA 4Z0JA 3NQ7A 4KFPA 1NM9A 1QNVA 1XI3A 2CFFA 1YDNA 3K8LA 1OFOA 4O15A 4PL1A 3ZR5A 2VFGA 1MEHA 4MKNA 2E5BA 3QPZA 1TQVA 3UXDA 3HJEA 2YIHA 1ZJAA 1OT2A 2WCSA 3DU0A 4R34A 5CSSA 4WY0A 4U2YA 4TU1A 3W1TA 4NJIA 5CPNA 3C4UA 1ZJBA 2WSPA 2YFNA 1GVFA 1KGXA 3PSWA 3W88A 4PCTA 1PL9A 4FLOA 5GVJA 4LNYA 3CQ0A 1GTHA 4UFHA 3GBEA 1UASA 2QCLA 5LGXA 2ZUUA 4WXYA 2EADA 4D2JA 2QCCA 2YOCA 1AQMA 4UTHA 2FPYA 2C8NA 1KM5A 2V3DA 5K9XA 2OW7A 4CCEA 3RF9A 1ZHAA 4FHAA 2E6FA 5D09A 3SGZA 3IJ9A 1LLWA 3BVJA 1XGZA 4O10A 3W7QA 3BLBA 2JBMA 3QFEA 4LRSA 3BC9A 4OWGA 1SUXA 3T44A 3AJXA 2EACA 3C8FA 3G1XA 3LTPA 4JTFA 1AG1O 4N2YA 1PZ2A 2YDAA 1LWJA 4H8VA 3MW7A 1OX4B 1Z48A 2BY2A 1VAHA 4AVFA 1HXKA 3GIYA 1W1ZA 1RQEA 1XCXA 4O18A 1O5XA 1SSGA 1KLYA 3DFNA 3MP3A 4CLMA 3N73A 3QMRA 1Y0EA 1IZKA 2AQWA 4H8HA 3RK8A 3WEOA 4MY1A 3GVGA 2X2HA 1W5PA 5D03A 4N02A 3ATYA 3T40A 3PM6A 4UQAA 3BCDA 2BY1A 2GJPA 2XN2A 3DFPA 3LHYA 4MYAA 1SMDA 4NJHA 3CWNA 1Q6RA 1A5CA 5L9FA 3L4ZA 1EO7A 4RJEA 1F5ZA 3QH2A 2VENA 5E1QA 3GKAA 1GVRA 1CGVA 4N9EA 1MVYA 3WJWA 5DCEA 4UZSA 3LHTA 3VI2A 4X3ZA 3FYOA 1MFUA 1BVZA 3TC6A 3IIXA 3BCFA 3W86A 1F2JA 2WNQA 5HWNA 4UIOA 2NT1A 1FCBA 1K8XA 3TTYA 4LVFA 3UG4A 3DDFA 1EB3A 4I7UA 5BMWA 2BY0A 3W2MA 2BHUA 5H2ZA 5FF7A 2PWFA 2WVUA 4JYEA 4JTEA 3IJ8A 3THAA 2W0UA 4KKXA 4FNUA 2E5CA 2F7RA 4OT7A 3BLIA 3O6DA 2C15A 4JYDA 2QDHA 1W5NA 1WZKA 1HO1A 2EGZA 3G1HA 4G1KA 3K1DA 4RR4A 2X30A 4M8UA 3TE9A 4XTIA 3PSVA 4LU0A 3EKLA 3BW3A 4GI8A 5KITA 2R91A 1I2PA 1XFBA 2BZNA 4LC6A 4OKDA 1G4TA 1QR7A 1N55A 4NX0A 4PSPA 1V5XA 3MYOA 4S2BA 5AB3A 3E49A 1TV5A 1RZMA 3B0PA 3BW2A 2OYLA 4FLSA 5FESA 1K7FA 4A21A 3LCLA 5EYWA 3BMWA 5A6LA 2PRLA 4NJGA 2E9BA 4GI9A 5FF4A 1EP2A 1R34A 1R2RA 1TPC1 1VJSA 1BG9A 4LTSA 3L4TA 4LOCA 4H2CA 1CGYA 3PB2A 4UTMA 1JUBA 2NX1A 3TXZA 4DELA 3WNOA 4LRTA 3G18A 2QCDA 3H53A 1Q3NA 3FYPA 4K39A 1ZCOA 4BR1A 3O05A 2V0TA 4FB7A 3Q37A 4GBUA 1G7VA 1CYGA 1H1ZA 3TAOA 2NWRA 2VUYA 4IOTA 2FH8A 4YMZA 1KBIA 4AWUA 4JTUA 4OGZA 4J3UA 1D9EA 5CZSA 5G2IA 3VX0A 1QOQA 5F4WA 3U2OA 4CN1A 1PJ9A 4NVTA 2DORA 2A0NA 3NQ8A 1JCNA 4UTTA 1JGIA 2EO7A 2CLEA 3VM7A 1FUYA 4DQWA 4NZFA 1LDCA 1KTCA 3IK2A 1UD6A 4I7VA 3M1ZA 1TTIA 1TTJA 2F7QA 1UOKA 3FKKA 5F4SA 2FPTA 1GYNA 1X1OA 5MHBA 3I6RA 2ZWYA 2A7PA 1GZGA 2IGTA 3WFAA 5K3VA 4U31A 1QI5A 3LHWA 3RMJA 1BKSA 4O0KA 1KBKA 4IXXA 1DQXA 2CLKA 3NYZA 2V5LA 3PG9A 5I3HA 5AC7A 1IIHA 1XUZA 1SPQA 4AMWA 4LS2A 4AEOA 4AMXA 1SFLA 3SFKA 1EP3A 4WQ6A 5HJLA 1E43A 3LTYA 1C8VA 4GE8A 3ZFHA 2Y85A 4MAZA 4A29A 3W7RA 2F7OA 3OLEA 2FTPA 3ABOA 4UNLA 2Y61A 4HT3A 3B03A 1HWWA 4MB1A 3LB0A 4UTUA 2AAAA 3DZ1A 3W71A 2XWDA 3CEUA 2B4GA 3TCEA 1G4EA 3LI1A 4MZ1A 4WUIA 2CW6A 4A2RA 2ZXBA 1XSJA 1KXHA 3S5ZA 5KEZA 1VCFA 4FNQA 5HQEA 1JDCA 4AXKA 2NXGA 1JI1A 3L4VA 1QPOA 1P0NA 4ZQMA 1IXQA 1VS1A 1H51A 1VHCA 1RP8A 1EIXA 5CGQA 2QAPA 3O1NA 3W1AA 1TQSA 3M0ZA 3HIJA 4O52A 3STFA 1T0OA 2XVKA 2GOUA 2B7QA 3W7KA 2AAMA 1MO0A 1ICPA 5AHFA 1R2SA 3IVUA 2CZEA 3B4UA 2ZUVA 2Y24A 1KTNA 1VCGA 2Y7EA 4XKYA 2NLIA 3KE0A 3M5ZA 1HL9A 3R13A 3BLPX 1JULA 1HTIA 3C52A 3NO5A 5HINA 3HPZA 3DGRA 4K7YA 3WDJA 1WBHA 1KWKA 4CCDA 1I2NA 1VRDA 2WCGA 1AL7A 3NEVA 5A6MA 3TV8A 3TNOA 3WK0A 2ZA2A 4FNTA 2ZRYA 4UUIA 4O8RA 1Z44A 1L9WA 3EJQA 2X2JA 1ALDA 4RZ4A 1FBAA 4JNMA 4FNSA 3AXIA 5LSMA 3GR8A 5K2ZA 3A5FA 3UPWA 1LBLA 2EAWA 3W2NA 1H7OA 2D0GA 3W70A 3KX6A 4U2ZA 1XUUA 5TQLA 1WZLA 1ZFJA 5F2IA 1FWNA 3ZWTA 3QM3A 3UWWA 4N9BA 1LLZA 4CQ8A 1TPWA 2JKEA 3PC0A 3M7WA 4WF7A 4HSNA 3DFTA 3M5XA 4JTGA 3CHVA 2DZPA 4UFMA 1UUOA 1FY6A 3VNDA 3C2RA 2A7NA 3QF0A 4L4LA 1TJRA 1FX6A 2A85A 1EP1A 2PE4A 4ZL1A 1XV8A 3IGXA 4UC5A 3KRZA 1MW3A 3I65A 1JD9A 1RD5A 1XD1A 2W79A 1I2QA 1FCVA 2GJRA 1Q6QA 3CC1A 2RKXA 2VEMA 3PBVA 2ZX9A 3MHGA 3DH7A 3HF3A 4JY8A 3G1SA 3I68A 3LXBA 1ODUA 1KM2A 3LHUA 4WX2A 5FF3A 5DN1A 3LPPA 2A21A 3R12A 1L2UA 1QI4A 1HL2A 2FE0A 1ICSA 4GNJA 4O50A 5CG7A 2ALDA 4O57A 4EOUA 3E96A 1G67A 3TMLA 3HMJG 4WXZA 3VGGA 3NPUA 2P0OA 3OVPA 5DLCA 3D50A 4HSOA 4IX2A 4NQ1A 1L6SA 2WVVA 1TO3A 4IMDA 4JR5A 4NUWA 1NSJA 5A2CA 3BG3A 5A5WA 2ZQ0A 2Y62A 8CGTA 5AHLA 5C55A 4X0NA 4IWWA 2QF7A 2ZRZA 1L0PA 1TPUA 3M6YA 1FWRA 3L2LA 1H5YA 4HA1A 2P1FA 1W5QA 3WY1A 1V3JA 1LM1A 4W93A 4GIAA 1S5VA 3ABQA 4FXSA 3W7JA 1JF5A 2OW6A 3EJTA 3G0SA 1P0KA 4AIOA 4GKLA 2H3DA 4Z1DA 2NUXA 1KLZA 5BRQA 3ANYA 3SY5A 4E38A 2OYKA 3WELA 2Y7GA 4OBTA 2DH2A 3UY7A 2C13A 3OA3A 1JL8A 1ADOA 2H90A 3PUEA 2D2OA 5KINA 5K4ZA 1SU5A 1TQXA 2CLOA 1G69A 5IBXC 1UD4A 3VMOA 3P8IA 1YADA 5D05A 2H6RA 5CPMA 2ZZ5A 2DP3A 1MXDA 2G5WA 1B0IA 3OLDA 4UXDA 3L0KA 4RLIA 3STEA 2FHFA 4MUZA 3W7CA 4FLQA 2X1TA 3PBUA 4OIFA 3TA6A 2JGYA 1LP6A 3DFSA 5EY5A 3P60A 3GXPA 3G8EA 4R7JA 4ZQOA 1GCYA 7TIMA 1PS3A 1B4KA 1H7WA 3EX1A 5AC6A 2Y4SA 4GJ1A 1QMLA 2TAAA 1P4CA 1ZENA 3D0CA 2PWGA 1WOBA 5IBXA 1J0IA 4WSKA 3RU6A 3GDRA 5DO8A 3VGHA 4O16A 5D02A 1MSSA 1RQBA 3W7HA 1OB0A 5BNKA 3AMLA 5G2HA 3FIGA 1W5OA 1W0MA 1KFLA 4HNUA 2DZXA 3DX2A 4O4VA 5G1YA 4LVDA 4E2OA 4UQEA 4TMCA 1HVXA 2NSXA 5L6UA 3EX3A 3FJ6A 5LGZA 5AC8A 1XDMA 3L0NA 3FW6A 4CQAA 2Y7FA 3II1A 4YL2A 4JYFA 3ABRA 2G95A 2CWNA 2H3BA 4HP5A 2D0HA 4PCFA 2Q8LA 1WP6A 2FPVA 3UWYA 1KTBA 4UTKA 2ZXAA 1R30A 3L4UA 2V8ZA 3RIKA 5CLTA 2VFIA 2TMDA 2RDUA 1QI3A 2EEXA 4O1DA 3MMTA 1K7EA 2EJ1A 5HPOA 4JL2A 2H8ZA 1PE1A 3TSMA 4O1AA 1EX5A 1RQHA 5CPLA 4KWVA 2V5BA 1UKSA 2J9YA 3Q94A 2ATSA 3M41A 4WLCA 4NI3A 2OCZA 5I3IA 3FAXA 5CGTA 2P10A 2ZZ3A 1A5AA 1QCWA 3GAKA 4M19A 4O11A 1TPH1 1QFEA 4O28A 5FEWA 2EHHA 3VMPA 3DXIA 4MJMA 3ZR4A 4UTLA 1P1XA 2V9DA 2OSWA 4KFNA 2EAEA 1X7FA 3NXFA 2V3FA 4H8UA 1K02A 5D37A 3W72A 4UR7A 3HPXA 2ZTKA 3USBA 3QW4B 2VEIA 1JDDA 2VFDA 1GJUA 5T26A 4U4MA 1FXPA 1ICQA 3QGVA 1OFPA 1QHPA 1UH3A 1F6PA 1V7YA 4LS1A 5CSRA 3BVTA 4X9YA 3SI9A 1U2YA 3DFQA 4HN4A 3Q2DA 4R53A 3WK3A 4FO4A 1YDVA 1V3LA 1WZMA 2E6YA 1WV2A 1OGSA 1G4SA 2WSYA 3O15A 4LUJA 4ORIA 1CGXA 2G3MA 4ATWA 5HR7A 3HG3A 3A6OA 5U4NA 2F18A 3L5LA 3M43A 2QKFA 4OV4A 2B7OA 1XH0A 3TSBA 4UQCA 4MIMA 2YR1A 3PBWA 1IV8A 4LPCA 4AWTA 3R89A 1DJQA 2OJPA 3EEGA 1VHNA 3AMKA 1TIMA 2BX7A 3O8AA 1KW1A 8TIMA 3LLFA 1AW1A 2ABBA 4NNCA 5KZMA 3DX0A 1EWEA 3VGDA 5FEZA 4B9ZA 4LW7A 3ECQA 1T8XA 1BWLA 1BWKA 3W22A 4NX5A 1CXHA 1BVNP 4K6AA 1MFVA 1TCDA 3N2XA 1JXJA 2PRMA 4J3WA 2Y5EA 3KLKA 4NU7A 5D33A 3G3DA 4Y8FA 3O6CA 4DPPA 1H7RA 3KL3A 5HWMA 4NNAA 2D3NA 5D2VA 1LYXA 4ONVA 2VFFA 3BUDA 1G94A 2ZA3A 3NZ1A 3ZQ9A 2OSXA 5AHIA 3GXFA 1HFBA 3EXRA 2ZX6A 1F7BA 3TMQA 2VELA 1AW2A 2YW4A 1U33A 4QISA 3TOPA 3S9YA 5EA9A 4JFTA 3UNDA 1HT6A 4FLRA 4PA8A 4J3VA 2R94A 4QITA 2QUTA 2Z1BA 1JCMP 1LTDA 3T78A 5EKYA 1A53A 3FKRA 5DELA 1FWWA 4UMCA 2QMKA 1KM1A 3WJYA 2QAFA 3OLGA 1KGUA 4BI7A 3DC0A 4CGTA 4UQBA 3MP4A 2WVSA 3ZSSA 3NGJA 4GO9A 3GDMA 4O53A 2E6DA 4OV9A 2E68A 1TREA 1GJWA 1JVNA 2VEKA 3GR7A 3UCQA 1BF2A 1T99A 2VOMA 3OIXA 3OVQA 5H91A 3BUQA 4HPHA 4DXVA 1UCWA 4NZJA 4K36A 3UG5A 2NX9A 4M5PA 1SFJA 4BZYA 4YCPA 2QLYA 5F1UA 1G5AA 1PHQA 1TRDA 4XWUA 3IIOA 1OVDA 3B8DA 3A4AA 1GG1A 1M7OA 1SZNA 4DF0A 5EMUA 1WPCA 3W7IA 1JUEA 1P5BA 4PCSA 4Q4KA 1HUVA 3UWUA 5U7SA 2VRKA 3TFCA 1OFDA 2F61A 5CGMA 2ZRUA 4BWLC 1JAEA 5CLWA 3G1AA 4EIVA 3WNLA 3GAYA 1MW0A 1JI2A 1NAL1 1TQUA 3FFSA 2BXYA 1OABA 4PODA 1ML1A 1TTQA 3M44A 3JS3A 2Y7DA 2JKAA 4PFMA 1DOSA 1FXQA 1OG0A 3VSVA 3M9YA 5C54A 4J7RA 5E6YA 3INPA 2XIBA 3WDIA 5FEPA 3B0VC 3ZT6A 5I23A 3GB6A 3LTSA 2PURA 1E40A 1YYAA 2GVJA 3TFXA 4O14A 3MYPA 2FHCA 1SO6A 2EPHA 3W1UA 1ME7A 2X1RA 4GUIA 3EXSA 1EHAA 3N14A 4QIUA 4JCLA 3S0CA 4C1KA 3TX9A 4I9AA 3QEZA 4RK8A 1A50A 1ZAHA 2TSYA 4MFEA 4HNVA 4DO4A 5D30A 3CB8A 1QWNA 1OX4A 1KXTA 5CPOA 1R47A 4MPQA 5F2GA 1HL8A 1F76A 1FDYA 4IUOA 3P84A 4JTIA 4J3XA 5LNUA 3M07A 2B7PA 4XTDA 3L2MA 3NM3A 4MJZA 3BAKA 4TO8A 3NQGA 3BV4A 2A7RA 3I7RA 2XVLA 1H1YA 4UFKA 5AOUA 5CKSA 1C8QA 3MBFA 2QJGA 4JY9A 3WDHA 1BTMA 1N7KA 3EJUA 1KFJA 1W3NA 3IVSA 3KRUA 1UJPA 1TQJA 3LERA 2CZFA 2ZFAA 1C29A 2GVLA 3C2VA 2Y89A 4Z1CA 1PEZA 2NXHA 3UEQA 3MO7A 1XKYA 1KA9F 1SO5A 3DI1A 2WPBA 1DEDA 3DKJA 5D32A 4JXCA 1NF0A 2E8ZA 3W1XA 5BRBA 3W9ZA 2BSLA 5EBUA 1CGTA 3TK7A 3K8MA 1DHKA 1ME8A 1TPB1 4ZQNA 3LRKA 4TR9A 2TYSA 4X9SA 5DCBA 1XH2A 1DV7A 1GJPA 4WJEA 4EF8A 1XL9A 1LZOA 3L66A 3IRDA 2C19A 3BAYA 4YWIA 2RDTA 4IPIA 1OFBA 1KCKA 3LX9A 3P7YA 2E1DA 3NA8A 2D0FA 4XBSA 1QAPA 2DZWA 2FB3A 1VIWA 4MZYA 4L4MA 1CGWA 1W3TA 1OT1A 3EJPA 3PR2A 3ZT5A 4RV8A 1KV5A 4LXFA 3WNKA 1KV8A 3SJ3A 4N4PA 3FAWA 2X2GA 1SQ7A 3KHJA 4JX4A 2ZRWA 1KCLA 2YCEA 3AJ7A 1C9DA 2WO5A 2Z6IA 3EKZA 2C7FA 3DAQA 4J9JA 4PL2A 1JCYA 6TIMA 1J5TA 1H60A 3O6YX 3EX2A 2QUVA 2ZUTA 2CZ5A 5G4EA 3CZNA 3NAVA 1MW1A 3BG9A 5I24A 3BAJA 3OVRA 4LVAA 1QWUA 2CLIA 3HB9A 4CNPA 1PS9A 4AMAA 2NV2A 3GLCA 4NT0A 3KWXA 4ORMA 3TW6A 1XXXA 4N9DA 3G0XA 4HPXA 2CU0A 1FDJA 3EWWA 4M7TA 2WNNA 2CXGA 1F74A 2J9ZA 4PEEA 3VSUA 4IMGA 3CZSA 1JRBA 4ZVJA 5I3KA 4UNKA 3MP5A 2XN0A 1PIFA 1QPRA 4GI6A 4UMAA 2X16A 3ELFA 3UQNA 5E9AA 3QRHA 4AW7A 2WQPA 1M53A 3VMNA 2H8XA 4UTWC 3DHUA 3EWBX 4O12A 3CZLA 3BGJA 2EF9A 4GRSA 3WY4A 3QSRA 1D3HA 4CQ9A 1EH9A 4OHQA 3WJZA 1TPDA 3NQAA 2Y70A 3LM7A 3T55A 4IQLA 1THFD 1SZGA 3KVJA 4PH6A 3SIZA 1KBBA 1VPXA 4JIQA 1S3HA 4NXSA 3BAIA 2ZYFA 1VGAA 3KL0A 4KWWA 4A22A 5KZDA 3DHFA 4J3SA 2FFCA 2VFEA 3UYCA 1VYPX 3A47A 5C6MA 3IGUA 1O95A 3LXAA 5A2AA 4RXFA 3BAWA 2PRHA 4POCA 3HG5A 1V3MA 4O19A 2FYVA 4O54A 4AHQA 3VM5A 3W07A 2YX0A 2UV8G 3TQVA 1JUKA 4B9YA 4JTKA 3DX3A 2DJLA 2YFOA 3CLMA 2Y63A 4WZHA 3G0UA 3H54A 1JCLA 3O06A 3PULA 3VNZA 3EWYA 3TROA 3WNNA 4BF9A 3EX4A 1E3ZA 1YXDA 2VRQA 1PV8A 1CDGA 5DXXA 2CLFA 3SECA 5D04C 2ZZ4A 2GPTA 3P81A 1ONRA 1TPEA 2YJQA 1VB9A 3HGOA 1G6CA 5AHMA 3GDKA 2BLEA 3TAKA 3VGEA 1JQVA 1LCOA 1OX5A 1A47A 2F7PA 3PAJA 2NUYA 3CGTA 4OU1A 4LQ1A 5DY3A 1KGWA 5DFAA 1HG3A 3UG3A 1RVGA 1OK6A 3TIMA 1YPFA 3S2CA 5LHFA 1I4NA 3AXHA 4FMVA 1GT8A 5I0DA 1EA0A 3MUXA 5A8GA 4AIEA 1S46A 1PVNA 3LBMA 3NL5A 3RLVA 4UTIA 2ATMA 1EPXA 5LNSA 1VFOA 2ZZ1A 4K8EA 3HG4A 3W7LA 3W87A 3DHPA 1IIGA 3ZSTA 3L5MA 1B2YA 1KBJA 4MOZA 2ZZ6A 3HJZA 3T4CA 1XD0A 4JFUA 1UD5A 1BSIA 1Z42A 2IQTA 3LLDA 4LUIA 1ZAJA 3S1VA 4NNBA 5CXPA 2V3EA 2QPSA 4WD0A 1TQWA 3BK0A 3LRLA 4ML9A 5F2MA 2GVYA 3QYQA 4IJBA 3BUBA 1JJKA 5DBTA 2QCHA 3R5EA 4JCMA 3P67A 3QQ1A 4QJ1A 4WOQA 3OBKA 3S1UA 4XB3A 4JD4A 4O4WA 3A24A 3VSTA 1K8YA 2J9XA 2ZZ2A 3FOKA 2YSWA 3W7EA 3PY2A 1R75A 5HUOA 2NX3A 4IMEA 1D7FA 1JCJA 3LHZA 3N2MA 3S8HA 1GOXA 3B0UX 1M5WA 3A22A 4UOQA 3WEMA 2V81A 4IMFA 1M6JA 3NPXA 2YYUA 1VLIA 3E02A 3FA5A 2ZWZA 1W54A 1JFHA 2XWEA 2D3LA 4UCGA 1IGSA 2A1YA 3W74A 4ZZ9A 3PUOA 3TTSA 3W1PA 4ADSA 2DZUA 1SW3A 2QR6A 4BI5A 3IIZA 4HOXA 3BVWA 3P5YA 4ZQPA 2Z2UA 3W38A 4JFWA 1WBJA 1OK4A 1W9XA 3CPUA 2ZRXA 3P5ZA 4PC8A 2DIEA 2GJLA 1L6WA 2FDSA 1UUMA 1WOAA 3NQFA 2I9EA 3IGSA 4Z0SA 4FEZA 4WSJA
chains in the Genus database with same CATH superfamily
1TZAA 1IAKB 3BLDA 2AJZA 3WL9B 3U7YL 4Y9FA 4E9YA 3WD0A 1P69B 3EUDA 5G55A 2AL2B 3I2CH 3L12A 3AFBA 5PCYA 4LHUD 3TA3C 3G7TA 2Y36H 3BW9B 1E6ZA 4BXVA 2ZYSA 3O3UN 3N0AA 1BFNA 5T1DL 2CO6A 4AF0B 1AKJA 3PWAA 2FJSA 2AI0L 2PZ0A 3GUWA 4AQAB 2WGXA 3BEVA 4GRWB 4WEUD 3TA3A 1RCXB 2PODA 3SQBB 4ZRGA 3TSDA 3TBWB 1Q7ZA 2CKRA 4XD5A 2PGRA 1YN7A 4B2DA 3PJWA 3MLUH 3MRLB 4RZCB 5L0QC 3RU8X 4DPQA 2YK1L 3LV3A 1CXFA 5IW1A 3HHRB 4OIBA 1WFNA 2NY7H 5IB2B 4A3UA 4IP5A 1ECEA 4S0HA 2NUWA 1R5VA 3NJLA 2AABH 5LXVA 3ATZA 1JCVA 5DVPA 2FEEI 1FOBA 4P59L 2WSRA 3DYMA 1TV8A 5K1JA 1MWOA 2LTQB 1QNZH 4NGHL 4OZGB 2YJLA 2YBVA 4W9EC 4B3VA 1IGJB 2Y7NA 3AO0A 5E00A 2ORBL 4LFHD 1TUFA 1PDKB 3N5AA 1YNLH 4M93B 2X1OA 1IE5A 2OLAA 1XLLA 4H0HB 3BANA 1QR1B 5C7VA 1QW8A 3SPJA 1DWAM 1W72H 2AV1B 4P9HH 4XPTH 1A7NL 1XMEB 4WTWA 3CUHA 3KPPB 4Z7UE 3HE7B 2YQGA 4TVPD 3HGRA 3CUPA 2EICA 1TCMA 3TESA 3LZRA 2YEQA 4HIPA 4Y1AA 1PTZA 4YDVB 3ES6B 2Z31B 1JTPA 3WUFA 4XIMA 1FWSA 3P30H 3U2ZA 4RNIA 2FGWL 3E9UA 3IJYA 5H8UA 4QNEA 5DC4B 3E1ZA 4QDWA 4ONHA 4Q8TA 5E03A 3QKZA 3W7DA 4H0IA 3NQVA 2UXVA 5ESQB 3S1WA 5AOLA 4XNXL 1IC5H 4XBPB 4G8IA 3L17A 2IALA 3ZKXC 5FA3B 4MLRA 2HS8A 4K37A 2OKTA 1XM3A 3V0TA 3UTSD 4KH2A 2ZKHH 4DQAA 3B3IA 2OTUB 1YEFH 5DGRA 3EWDA 2X1PA 5C9RA 3D08A 1AZRA 3DLQR 3FMGL 3C9NB 5B1CA 3BPNC 3SUWA 1BD2E 5KBLA 2E09A 4JFDB 3U83A 2RHEA 1HHKB 3BARA 1RR2A 3SN6N 5BW7C 3OV6A 5E95B 4M6ML 1BYCA 3W6MA 4EVNA 4H7VA 3G6JF 2WINA 2W0FB 4TM9A 4GSUA 3WD1A 4XZIA 3QAQA 2HFGL 2P52A 4DP9X 5DD6B 2WSKA 1N18A 4UZUA 4RPQA 5F3BB 3FTGB 2F6XA 2HVOA 5CINL 3QJAA 2J7DA 4M8RA 4XAWH 1MFEH 4JG0L 2HJPA 3FN9A 3Q8CA 5DLMH 3EG9B 2CCVA 2X0SA 4QRQA 4L4TD 4FA3A 4G7QB 1QFWH 4FQXD 5DR5H 1KKOA 2VXTL 2R56L 1QVBA 2EIDA 4Z7OB 4G8GD 2XKSA 4Z7UA 3CUIA 4G59C 1DYZA 5EU3A 4UM9D 3MRFA 4NWTH 4F7TB 4KVPA 1RZ7L 2NX5A 5LWYH 4GFSA 5ISZE 4WJG3 1IC1A 1L9RA 5DJCB 5LGKA 2EPMX 2HJLA 5HYQA 2Q76B 3C3NA 3ZJKA 3FSZA 5FUCE 3STCA 3WX7A 3POCA 3NVQA 2YZRA 4IGBC 1SVDA 4N7QA 1L6PA 2FAUA 4QXTA 4BH7A 1GGIH 5A2LH 2C3GA 3FTYA 5TH2A 3I7QA 1YHPA 4XMZA 2MCMA 3QMTA 5F7DB 1XGUA 4QXIA 4R5TA 1RPQA 2YAFA 4YYCA 3N6QA 3FUEA 5F2LA 3CM4A 4W85A 3TLQA 1VJIA 1BQLH 1P4BL 1R3KB 3VGBA 3U2CA 5F6HI 5KVGH 1BD2A 3B9OA 3K30A 3L7EA 3UDWA 3W1NA 3KYAA 5HWJA 2CLHA 3UTTD 3HBLA 5LA1A 3C6CA 3KBNA 3AU2A 1MCEA 2AJ3B 3CIQA 1T2QH 3NJIA 5HVHB 3HS0C 3GMRB 4PRHD 2WYHA 4NHCH 2J8GA 1IGIL 5E0FA 4JFVA 4YHLH 2FHBA 1L9TA 1KBVA 1Z6KA 4AQ1A 3OO2A 3JXAA 3WH8A 1A22B 2DJSA 3QORC 4Y16C 4H00A 4TRPH 1KQYA 1UWTA 2D7NA 4QCIB 3C5ZB 3WY3A 4N0FB 1RJPA 4M7LH 4NHUB 5HDBB 2CDFB 3ZTJG 3P74A 2BDQA 5BRPA 3VD5A 5DXYA 3PF3A 3QORA 4X7SH 4Y16A 3MHUA 4AAJA 3OQRA 4IT1A 5FUCC 5G4WA 4G7YL 4NN7B 3U4AA 5I1EL 5FCUL 2OQLA 3WG7B 3O4LD 3H4GA 3MLZL 1FH7A 3KPLB 4W8LA 1B4EA 3CHQA 2OPCA 2BVUA 4A38A 4GRMA 5IP4A 5M94B 2A74A 2VDHA 4KK8D 4RE0A 4C4KT 3C60C 4JKPH 1K8ZA 5MEOA 4AK2A 1Q2RA 4I48A 3N34A 3S4SG 5FGBC 2NVAA 1RZGA 2J5LB 5C8JA 4ODWA 1E51A 4TLTA 1J8SA 1Q0YL 4WW2B 4Q4OA 1JN6A 1E1CB 1HZYA 4XAPA 5EWIL 3URBA 1EXBA 4N2BA 5IHZA 1VFUA 4C6NA 3INUL 2YA2A 3RRXA 4XCCH 2YYTA 1UP2A 3LNDA 2J47A 1ZLUK 3FTVA 4TLKA 3KLQA 2B2XL 1DJWA 3VKCA 2Z0BA 4HAKA 3CBKB 3T4AC 4P8XA 5GS1A 3NSNA 1FZJB 32C2B 2JB6A 4O02H 4PN6A 3S5YA 1I75A 4EWJA 3RWJB 3HE6C 4ZXBC 1WCQA 3TFBA 3GSNB 1B3XA 5E8PA 4E2DA 2F19H 3M7FB 4GKNA 4B9JA 1GJIA 1AZUA 2RDWA 1K3UA 5BMFH 1JQXA 5T1MB 1HH6B 2FQIA 1EUAA 3IKCA 4ANUA 3W2LA 5SWZD 3EA1A 2MSPA 2EXTA 2J75A 2PC4A 3DRQA 3BWWA 2J55A 4K38A 4LY8A 1XYCA 4WO4A 3DTDA 5DVKA 4FQIL 3H85A 4YHYC 3ARGB 4ZMOA 4YHZL 2CFFA 4XZUB 4LBEB 2VXQL 3DU0A 5BXFB 4KU1A 2KDGA 1G9MC 4PCTA 1C1EL 2CEQA 4Q6XA 3KZPA 4PUKA 1J5IA 1ZLWH 4NAEA 1FP9A 5JXQA 3GBEA 3P40A 2HVNA 4MSWA 1BVNT 2WLHA 1O6SA 4OD1H 4UTHA 3WG6A 4HYRA 1XGRB 4DPAX 3KOYA 2ZKXA 1HINL 4FKEA 1RZJC 4LRSA 1X9QA 2IGFL 5CS7A 2WBJB 2NY0C 4CJ1A 1IWAA 1JS4A 1QI2A 4Y4HC 6XIAA 3QV8A 4YSDA 1ND0B 4LVOB 4BGDA 1S9XA 1WDRA 2PDJA 1KRAC 5LA0A 1DQKA 3DOSA 3LKOB 3L95A 3TYFB 4F1ZA 1XTMA 5E99H 1EJUC 3KS0J 4Y4HA 5CPTA 1JNLH 3EJJX 2CK2A 3RB5A 5M03A 3JYCA 3O9WD 4LAQL 1LHZA 1MHCB 2FIKA 4F3FB 1E28A 4WVRA 3ZZSA 4A2FA 4KX7A 2VUOA 2X9YA 4NKOA 2XBZA 2E7CA 5C9UA 2MCPL 2R51A 1MCLA 1I8KA 4JQXC 3U82B 1EDTA 2CJUL 3REQA 3TJEH 4IF2A 3EKLA 1UFUA 1H8OA 3QPXH 5K59E 5HHPA 2CBPA 3R6IA 5FESA 5TE4L 4NQDD 3MCOA 3P69A 2OJEA 1XF4A 4FADA 2FSEB 1U6AH 1Y6NR 4DELA 5KVDE 1BXBA 3WNOA 1L8NA 4MMXB 2NOYA 3H53A 2XYCA 4XPHL 4GBUA 2Q8BL 3TAOA 4BFIA 1AJ0A 4HUWB 2Z29A 3KCOA 1SY6H 4H1LA 1J1OH 5JPMC 4JN7A 2WJ7A 1OE3A 4N5EC 2YLKA 3ZVHA 1U3HC 2ICSA 5E9DB 1TA3B 3NG5A 3QTPA 3KCPA 2F7QA 1OZMA 3ZUNC 3FKKA 3NH7L 3ZLHA 2IAAC 5DX7A 3CAFA 4KKNA 1PYWB 1DQXA 2DQIL 1IWPA 1B2WH 2PGFA 3LNEA 4LS2A 3O0RL 1YAIA 4WQ6A 3CYVA 2ZUXA 2ZUQB 1Z69A 3ZFHA 5CJ5A 4GZEA 4L3EB 5IMMB 1YJDL 4MB1A 1L7TL 3F58L 1I7TA 4C4UA 3KP0A 4OLVL 4TQPA 5I2UA 5HQEA 3IRSA 1IFRA 4U6VL 4DAGH 1QPOA 3HBPA 4ZQMA 4ANVA 3VXTA 1HI6B 1RP8A 3UZVA 5I7GA 4E42B 4O52A 2AERT 2DYSB 2XT1B 4P4RB 3PP4L 2ZUYA 2CZEA 1MDTA 2Z00A 2QHRH 3IGLA 4LSSH 5BJTA 1S7VA 1TCRB 1T80A 2PYEA 4LCWB 3ARFB 4JG9A 2K7PA 4NO0D 4FNTA 3RCYA 2VDQH 4MA7L 3P11L 5CD5C 4PWEA 3EAUA 1OARH 2IH1B 3F6LA 3W70A 4TPRL 3PBGA 4XWOC 3QG7L 4HMDA 1FWNA 2GJ6B 5FJPA 3QM3A 1YEGL 4HSNA 3XISA 3M5XA 1K6QL 4QEGA 2XXCB 3C2RA 4UC5A 2W92A 1TNMA 3SDDC 1YDPB 3OJDA 1U8QB 3DH7A 3RTQA 5ADPH 1M7DB 3LXBA 1KM2A 1YPZE 5DUMH 5FYLH 1OG6A 3R12A 5MI0C 3BMXA 3EKGA 4HIJB 4PG9A 1G67A 1KCUH 1CZ8L 1U8NB 2E74C 4IX2A 3SDDA 1X97A 3LH2H 1MYRA 3BURA 1ZLSL 5AQ0A 2FZ9A 4XPGH 4PLJC 4GUPA 2QF7A 2ZRZA 1TJGH 1N0LA 5BRZD 3L2LA 2BVTA 5HANA 1U8CB 4HU4A 1JF5A 1XYAA 3HA1A 1KPUA 5EBWB 3CVIL 1ACZA 2W60A 5FYKL 1R6VA 1NCHA 4WW1A 4GT7A 2AK1L 5C0ND 5TTRA 4QRRB 3QXAA 1BEYL 3C09C 4MQXC 4BKLB 2JGYA 1LP6A 3AIEA 4PRRA 1DUZB 7TIMA 5L8LB 1N59A 3EX1A 2Y4SA 2WLMA 4AZ7A 2KC0A 2IDFA 2ZWNA 3QDGB 2GSHA 1Q6GA 4HNUA 1J8HD 3DJ9A 4O4VA 3NA9H 5DVMA 1B3IA 3V1HA 3NFNA 2XY2A 5GJPA 1F4XL 3KWTA 3BFWA 4HPYH 1V54B 3TWYA 1KTBA 2DSKA 2CYGA 4F24A 3AQXA 4DGIL 2DZEA 1FGVH 1K7EA 4AV0A 1PX8A 1KCXA 1INQB 4KWVA 1UKSA 1TU2B 2HWGA 2P10A 3AUOA 1QFEA 4BRVA 3B7UX 5C0JA 4EANA 1W9PA 4P04A 1P1XA 2GFTA 2CIKB 1XZ0A 3REWA 4HA3A 3SDYL 4RH4A 3QJXA 3O3EB 2JQXA 3ABLB 4XVUD 2LU3A 4IMLB 3WE6B 5CSRA 3EJZD 3KYMA 3RPIA 2AJYH 1B9KA 4ODTH 4KWSA 4FO4A 3N40F 5F1NA 4LEOB 2MCG1 3R79A 3T0TA 1HSBA 4AD4A 1V6UA 3GQFA 1A4MA 3WCYA 3T81A 5F6IC 4Z7VB 3CZ8A 3SCWA 2Z91A 5KANI 1WH0A 3AMGA 4GYPC 4W9IC 3H6JA 3H9SD 2OODA 4WWKC 1H7RA 4OIIL 2HX7A 5K1NA 3H26A 2FVMA 2APXA 3VXRE 1NFAA 3TQPA 1U33A 2BNRE 3BP7B 1D7CA 4G6KL 2ICWA 1LO3H 4WWKA 2QMKA 1ENUA 4MD4A 1JPSH 2BOBA 1OO2A 4Z3GA 5D71H 4LO9A 3RI5F 1PAZA 3GEFA 5EZLB 2ACQA 2CH8A 2ZOLB 3N91A 1E5AA 2RAGA 1TRDA 3A4AA 3PJNA 1QYGH 1UOWA 4EN2A 3TFCA 4HISA 4GVIA 3EOBB 2PCFA 1YQVL 3ELAT 3DJTA 1R5IB 4PFMA 2I69A 1FXQA 3EGSB 1NGZA 3IGFA 4R26H 3GJEA 1RUML 1B4TA 3Q6FA 1EYWA 2GVJA 2AHIA 2EPHA 1EHAA 2VQ1B 4C1KA 4PJAB 1FH5L 3SPVA 2R0WL 3EH4B 4I8DA 1G6RA 3WOVA 4ZSOE 1HJUA 5HQLA 1LEGA 3H2EA 4OVUA 1HK6A 1H1YA 1IWBA 3A4WA 4F9JA 1RHFA 4LLMB 4V1DD 2R83A 4DJDC 1TQJA 1U8JA 2EXWC 1ISWA 2IXQB 1A3QA 1B54A 5INCB 4GSDL 5FSDC 1ETJA 2A9CA 4P9ML 1KA9F 1BWWA 1IBHA 2OJZL 4YFLF 1MEXH 3AQUA 2A1WH 3K13A 1AIZA 3E2HB 1I3UA 1T0PB 1MY5A 2P5PA 4DJDA 4EF8A 3T0EE 4GG6B 3L66A 5FA4B 3IT8D 3BAYA 1P43A 4A6GA 1TWZA 2AVFA 2E1DA 4FOMA 1ONXA 1KENL 4RV8A 4NI6A 2Y6SD 4MXVE 2X2GA 4JX4A 2YCEA 3AJ7A 4NZDA 4UIKH 3DAQA 4JM4L 4UINL 2JIXB 5ESAA 2CZ5A 1G7HA 2JEPA 3BG9A 4UBPC 1W1YA 3QIBD 4FR6A 4ZTEA 4AMAA 4NRSA 3TW6A 3FT4B 4N9DA 4Z5RA 1RU9H 3BP6A 5DJYA 3TYGL 1RHHB 2XFFA 3N4AA 4Y9OA 4H20L 1WKYA 1YNTB 4UTWC 4KW2A 4IMKC 2R6OA 2OI9B 4XTRC 2IWFA 4PJFB 5FUZH 1XYMA 2FJFB 4A2GA 1THFD 4PH6A 4JIQA 2UWEF 4YIQA 1OQFA 2ZXWB 3VFVB 5A2AA 4LEFA 2PRHA 4PCKA 3U48A 3S35H 2YX0A 4IMKA 2UV8G 5I79A 2WIIA 2HH0H 2YWZA 4LKXA 1OAUH 4HCLA 2L8AA 2AEOA 1KD0A 3PNZA 3TROA 3RWEA 3IJ6A 3ARTA 3MOAH 4NJAL 3LKPB 1ONRA 1VB9A 2O5YH 4JPWH 3W11C 5JPNB 3NDYA 3RCMA 3CGTA 5JHAA 2LT9A 4TSCL 4DHGA 5IEHA 3SB3A 1UB6B 2P8BA 4AIEA 3NL5A 5JW5B 3F7LA 3GD6A 4KVNH 3DHPA 3HJZA 4U6HA 1Y1DA 2X44D 3RAOA 3HAEH 3M0XA 4WD0A 1TQWA 3GRWH 2EJAA 4IJBA 3T0EC 3GBNH 2QIIA 3BD5A 4WCJA 2BCMA 5F7HA 1MRDL 3PY2A 2WZIA 3G6LA 2NX3A 5I17A 4X6FB 5FWQA 1MY7A 1FJ1A 2AP2A 5LHDA 2YYUA 5HVFB 3H3PL 4D6CA 3FTWA 4AUYA 5FO7B 4PWFA 3W74A 1MJJB 1XSOA 1WBJA 3QLDA 4IUGA 3P5ZA 1MHEB 4ZSUA 2FKPA 1FWXA 1L6WA 4Z0SA 4FEZA 2QADB 4JO5A 2ZG3A 1SYSA 3TBYB 3U46A 4JTSA 3EYSL 4Y5XB 3U7YH 2LVCA 4H1LG 4UI2A 4AY1A 3WS6C 3FL7A 1C5BL 2EC9U 3CHDA 3VWKB 3S3JA 5D5ME 1GVOA 3P0XA 3RX4A 1FHUA 4IG2B 5T1DH 2IDSA 4OKVB 1XLFA 2GC7C 4PIRF 7PTDA 3ZKSD 2O7QA 3AREA 5EUOB 2VD9A 2YD0A 3HPFA 4DI9A 1I1FA 3AXLA 2F1EA 3WS6A 5ENWA 4E8CA 2PDCA 5D1QE 5DZVA 4FTVE 2M2DA 4MCMA 2VABB 2A38A 4K3DL 2EKSB 4MNGB 3D3VE 2EEBA 3PCYA 4UQDA 1SJAA 4KPLA 3NL2A 1YMMA 1CDYA 3RGVB 4DZBB 2YK1H 1V6WA 2PTUA 3QNFA 3B2XA 3JT2A 3MRJB 3T2NL 3MBXL 1IE4A 2WSDA 2QV5A 4LCCA 2I5GA 3AZSA 4MAYD 2XZ9A 1KELL 4H3DA 1TQBB 3QUYD 1M01A 4MY9A 1ZV2A 4O2CB 3VFOA 3IIVA 3M0HA 4QLKA 4P59H 3VGAC 3T7VA 5D38A 3VFLA 3T3PF 4NKQB 4NGHH 3P3TA 3LCXA 1ES0B 1RK1A 5EDSA 1FN4A 4LSRL 2VVNA 5JW4Q 2ORBH 2W67A 3OKLB 2K45A 3UT0A 3FHEA 1IBGL 1IGML 4FNPA 2Y23A 1QX1A 5LKYA 2E27L 2XNAB 3THCA 5MHSD 5FOJA 3IFOA 5DZNA 1A7NH 3B8IA 2A3EA 2V2TA 2X4RA 3AU1A 1YTDA 3MT1A 5A3IC 3CV7A 1M3JA 2AZUA 2K7QA 1RCYA 1OCNA 1PDZA 3GWQA 1KGCE 1ZPUA 3L54A 5I28A 3UWEA 2XG4A 1JZ7A 2FGWH 3DHDA 3WJJA 1B0WA 4NRRA 4EI6A 3MNWB 1MFMA 5CZ0A 4BIKA 4XNXH 1G9EA 5D1QC 4G56A 1R24A 3O16A 5D5MA 4E2BA 1C8XA 2ZF8A 2BV9A 5I9QC 4JG5A 3LVTA 2APTA 3WH5A 3O3BB 1HHHB 1DQJA 2GJJA 2BOLA 4Y89A 4AX3A 3O6FD 1TJXA 1E9QA 2K3HA 1J0JA 4GG8A 4ZUVB 3OEXA 2HG0A 1KPRB 3U57A 3FMGH 5C2UB 1R9YA 4YEFA 4D7BA 1H63A 4Y1TA 1JZHA 5EBMB 4R7DA 1Z9SA 2V5KA 3SJVB 4O1EA 3NP4A 1GPWA 2OQJB 4M6MH 2Z7UA 1OXYA 2XGZA 2HKFL 3BI9X 5AZUA 1IO4C 4ADUA 1MCOL 4L64A 2FGBA 5BNXD 2HFGH 4RZ5A 3QVAA 1LOQA 4HJGB 5KTLA 4OFQA 2DICA 4NRYB 5CINH 1K5WA 3PWJB 4DIXA 4JG0H 5TE6L 1OAKL 3QUXC 1T7XA 1HP4A 1P7KA 1MZHA 1ZOXA 5HDLA 3RVTC 2BP3A 5D2NA 4U3XA 3ZOAA 2HVJA 2ED8A 1HX0A 1ADDA 2JI3A 4E0CA 3NPWA 3Q44A 2VXTH 2R56H 2DI8A 3GH4A 4KRLB 1NOFA 4KUZL 3MLWL 5EEYA 8FABB 1QLEB 3TT1L 5L4FA 3IU3B 4GUJA 4MTMA 4ZFOB 1WAUA 3BP5A 4D1JA 2NXZC 4HK7A 5AENA 2FEJA 1E4KC 1RZ7H 4AYSA 5D2LE 1EOMA 2Y2WA 4B4FA 4O13A 3C87A 2WWDA 4EXBA 4XBGB 2DV6A 4PMYA 1V4YA 4QHMB 5DC0A 2NRDA 2XN9B 1OB1B 2P24A 3NIGE 1SDAB 4IOFD 2ZADA 5HY9B 5F7YC 3QJQB 2WP3O 2XH4A 5EF2A 5HQMA 1XGQA 2BCKB 5K1VA 5D6CA 3QULB 1TZIA 1R46A 4QDPA 3BVUA 4IMCA 5IM51 3KL5A 3SY8A 5CP7B 3TXAA 5D7IF 1XBXA 1P4BH 4F9LC 1B5TA 5EEWA 5D93B 4CD6A 3LOWA 4DO6A 2W07A 1KJ2A 3N41F 1VCVA 1BFSA 3GTNA 3BKYL 5C97A 4Q3MA 2BWQA 3G22A 1WAAA 5EU6B 5GGRB 4OV6F 4JDYA 4PMEA 2V2DA 5CQ1A 2ZX7A 2GJXA 1IGIH 3E9AA 1J2WA 1MKFA 3CZGA 1VFSA 3RIFF 4Q9CA 1XINA 3X14B 2C3VA 4Y4FB 2P8PB 1WWCA 2NXYB 3K80A 4GC3A 1JYVA 4JTRA 4BWTA 1P7QD 3PL6C 4F7EA 3U2IA 1M7JA 2X4UB 5HNRA 1F3DH 2GSJA 4D0CB 2X4TB 1SLUA 4Q9QL 3ZE2B 4FULA 3WU1A 4G7YH 1NCDL 3KPMB 4DK5A 5I1EH 5FCUH 3PL6A 5DUBB 1D7BA 3IJEA 3HUJF 4PH8A 4C7GA 3NVTA 3G2GA 1WBZA 3VFWA 4NT6A 1CU4L 2NNXA 3HG0A 1X7SA 2IC2A 3SYQA 3ANUA 2D7PA 4L8DB 1F6AA 2GTZB 1Q0YH 4PRIE 3DFOA 5EWIH 3GSNL 1H0GA 2WAQA 2Y2YA 3ZWSA 3IMBA 3KXQA 3DV6A 5ICZB 3KPSA 3P9MB 4P5KA 3INUH 1VADA 3AUJA 4HFUL 5FF6B 5HPMA 2WBKA 2B2XH 1JRCA 3OYZA 3W7PA 4KS0A 3HZYB 1GOFA 2Z1SA 1X6LA 4UANA 3UCRA 3NR0A 3ARBC 3UTZA 3LCHA 2WYIA 4JANA 2UXTA 1JPTL 1CQKA 3PWUA 3EBHA 3CIXA 1HEZA 1ZY9A 4LOVA 1DN0B 1E4MM 2WSQA 4DYJA 2PCEA 3SE6A 1XTLA 5FK9B 5C0BB 2VFHA 3DTXB 1ISYA 4CNNA 3F7VB 1OK0A 3FJNA 3IDYC 3HW7A 1AE6L 1U58A 2IQ0A 1LP9F 1DTUA 3AS3A 1V55B 4FQIH 2YLAA 1YDNA 4YHZH 3GFUA 2VFGA 1BZ8A 3QJFA 2VXQH 3UXDA 1SQ2N 4L7ZA 2NY6D 5CUSL 2YPLB 4RFEA 1ZJBA 4EAYA 5J5EA 5HYIA 3WF1A 2PLMA 1C1EH 4FLHA 5GGVY 1GC1C 3IS1X 1JK9A 3GSXA 2F0CA 2F54E 3UBXB 4DGUA 1JV2B 1FFPB 4G8FB 1JTTA 3RF9A 1VCBC 4FHAA 4JMNA 2FZNA 5J12B 1HINH 4YS1A 4M24A 2IGFH 3H7BB 1DCEA 1V0LA 1R9XA 3M45A 2FZBA 4ML4A 1KCRL 1RY8A 3MXWL 3V5KA 1EBPA 1NLBL 1SQMA 2MTPA 2YDRA 3TLLA 5FW7A 5FFLA 3LHYA 1FKWA 2RGMA 3C6SA 2V7NA 1IEWA 2YGNA 4LAQH 4NAMA 4CILA 4FF9A 1FCBA 4BUHA 1O66A 5EU4B 2R69L 1UT1A 2BY0A 4CSPA 3NCYS 5FGSA 3OSVA 1T4KB 5KBDA 1UYQA 3ZXWA 4JRXB 5E2JA 3RYSA 3KPRA 2XIDA 2J6WA 2MCPH 2EG8A 3A3WA 2CJUH 5I6XB 2ADYA 4HGKC 3BISA 4QTHB 4XTIA 3BW3A 1IBZA 1TV5A 3BOFA 5TE4H 1WUNT 4ZFGL 4YOKA 2P5WE 2YKLL 4MZ3A 3BZGA 4C6OA 3GYCA 3DPDA 1NGPL 3UYPB 2FO4A 5IQ7L 2AGJL 2VGFA 4ZTYA 4XPHH 2Q8BH 4H9VA 4D0BB 3BJLA 5G2IA 2F53A 1UR2A 2VLKB 3FY1A 4HZ6A 3DV4B 5AYTA 2NQLA 4JFXB 5C0GB 1UOKA 3NH7H 3O0FA 4PTTA 2YQ2A 4FQ1L 3ET9F 3RPTA 3N50A 1QTYT 5DD0L 4QJ5B 1PZCA 2C3HA 2CO2A 2DQIH 1ULVA 5HBBA 5LDSA 2QVFB 1OTSC 3WLKX 5E1AB 3TN5A 3SFKA 3O0RH 3Q7JA 1XVSA 4PW9A 1ITUA 1RZKL 4PGJA 1RJYA 3P3BA 4A29A 3TZFA 5C0AB 2CERA 3F04A 3MRCA 1HWWA 1YJDH 4BGLA 3U30B 1L7TH 3V4LA 3KHOA 2WYZA 3NSJA 3F58H 2H0FA 5H35A 4PJ8D 4MZ1A 4QI3A 1UYWL 5GGSA 1MCWW 4Z7OF 4OLVH 5BZDA 3U9UB 1JDCA 5CH9A 2HRPL 4U6VH 3KOZA 4X6DA 4D8LA 3N9GL 3RX7A 2FYYB 3TYBA 4AISA 3PP4H 5ISZD 4L5FL 3HZMB 4KTYA 1R3WA 3OX8B 1IJNA 4MA7H 3P11H 4H7CA 4JNMA 2JXMB 4RISL 1CTMA 3AS1A 3C86A 4CW1B 1WITA 3UXLA 2D0GA 4QRTB 4TPRH 5TQLA 1ZFJA 3QG7H 1W2VA 3IGAA 1YEGH 5T1LB 3PWPB 2YB4A 4JTGA 4ZX6A 1K6QH 3UXKA 4HUNB 2CMRL 4P4KC 4PRNB 3ME0A 3C60D 4L0PB 4JO3L 4LCIL 5SX4I 1JD9A 3VDGA 1BIHA 1W3LA 3U7BA 2EKGA 1AGCB 1BYOA 3ZJ8A 5HAOA 1KEGL 4S0SD 3B43A 1CZ8H 4OGXL 4MD5B 1NGWB 4DZ8B 2JKTM 4GISA 1ZLSH 1G7QA 1UXMA 3RVXD 3BIKA 4H2AA 1L0PA 3QV9A 5I1LA 4W93A 3ABQA 4JM2D 1OP5K 3DX6A 3MLTB 3BLLA 3BIBX 3CVIH 4Y1AE 5FYKH 2B15A 1QLFB 4WHBA 2E6JA 2H90A 4BCEA 1BJ1J 4FEIA 2AK1H 5C2CA 4NSKB 4OM1L 3FNKA 3NZGA 2CE6A 3C08L 4YHKL 1BEYH 2WOBA 2R23A 2ENYA 3WUWA 4AJWA 3I74A 4B5ZA 1NPJA 2ESVA 1RLWA 3NCYP 3GH5A 5EDXA 5GS3A 3PP3K 3TJHC 5ECGA 4NZ5A 5JIQA 5C0IA 4UQEA 2NSXA 4F15C 1NC4B 4JBSA 4X0KA 4QG6A 1F4XH 2D4DA 3RL2A 1RXLA 2G95A 5IKCB 1SJHA 2GTWB 2Y3AA 2RFXA 2JFEX 1AD9B 4DGIH 2H8ZA 5GGSY 4BYHA 1HJWA 1BQCA 5CJOL 3LK6A 1EEXA 2XYBA 4MMZA 2R0ZL 4IIHA 2PP3A 1WTGT 3TX4A 4IRSB 2VCBA 2FFIA 4NLAA 1I8UA 1ET8A 3II3A 1GYWA 2ZTKA 1MQPA 3SDYH 3RR4A 3Q6GL 1FIGL 3P9WB 2B8OT 4XCYB 3SI9A 1GKEA 3QFGA 2XIOA 1JZ6A 2NW2B 1WV2A 4S2SA 4NY2A 1FZMB 3ETTA 5KYXA 2G3MA 1CL7I 4LUSB 4AC7C 2J79A 2V5JA 1JEZA 5F89A 3KVPA 3HZKB 3ETBJ 3I9AA 4HVBA 5ETUB 4JPIA 2E3ZA 3BSZA 2XIQA 5L2KB 1SBBA 3ZE0B 5FEZA 3AIQA 2XSBA 5FM5M 4R4BA 2XWBB 3MR9A 3B83A 1MZRA 4OIIH 1ZHNB 1OY0A 2NX5E 4ZX5A 1OADA 3ZQ9A 2E1WA 1E4HA 5DT5A 2GB2A 3QV6A 3SO7A 2DRUA 3GXFA 4KQNA 1NU5A 3SEPA 2GT9B 1A53A 4XVDA 4YO0A 4JKWA 4G6KH 4ZFZB 4K8GA 4YHEA 5H94A 1B3ZA 3OLGA 5C7XL 1MWAA 4UQBA 2ZKWA 4N9OB 3QEHA 4GO9A 5IFTA 2VOMA 5JDSB 1TVBB 4ZR8A 4F80A 1A7OL 1Q1JL 1UIPA 4K3ZA 4JRYA 3B40A 4W84A 1YQVH 3SGJA 1AOZA 3OGCB 2CO4A 3B9VA 4GY1A 3VTMA 3KBPA 1ITXA 1RUMH 2RA1A 3S36X 5IHUL 1BPVA 1MPAL 1ME7A 4GUIA 1VPYA 3B9KD 1FH5H 2R0WH 2FQDA 4PGCA 5IQOA 1IAOB 3FB7A 5JXAL 4OJDH 2NZ9D 1E5JA 2DJUA 5F2GA 3KHDA 2VIRA 3II2A 3MRDB 4FQHB 4J3XA 3NM3A 3V6OC 4TO8A 3LQLA 3O3AA 1ZIBA 1EF2A 2QSCL 2QJGA 1N7KA 4TOQA 3EJUA 5C0RL 2OELA 3VFMB 1W3NA 3ZMEA 1ZSDB 2QPXA 5FO8B 5CLZA 3TN3A 4GSDH 2NXHA 5PTDA 2HDJA 5IMOA 4WV1B 3DI1A 2A6JA 4P9MH 3VACA 3V6OA 3DKJA 2OJZH 3MBWB 3M64A 3W1XA 2JI2A 3TK7A 1B3YA 4J5VA 1E0XA 5M95B 4KKCD 2VWSA 3F2BA 3LN3A 2IQ9L 3VTAA 1CF8L 4KV5F 3ROLB 3MZTA 4ADGA 9XIMA 3Q2LA 1OT1A 1KENH 5AVRB 1ASOA 2Z8WC 1UP0A 4J9JA 2PTYA 4ROPA 1DVSA 2CLRB 4JM4H 4AKPA 4UINH 5IOPB 3SCMC 2YD4A 1XXXA 4JREC 3AALA 1M9WA 2DSZA 4TNEA 4NQVA 4PEEA 4N3UA 4WFGD 5BYWA 4H20H 4YZWA 1M53A 3SY0A 1NANI 3EWBX 3SCMA 1TPDA 2ADIA 3UDWC 4RRPM 1DE6A 4YN3A 1VYPX 1O95A 3KM2A 2CHDA 1WCBA 3PULA 4X5QA 3RL1A 3WNNA 3R4RA 4NJAH 2ZZ4A 2VH5L 3ME3A 2YOAA 4QT5B 2QGEA 1FC1A 3MRPA 1AY1L 3FSOA 3PAJA 1MFCL 1EZLA 3V4PA 4AQ1C 4TSCH 1RVGA 2BGSA 1OK6A 2IADA 3E38A 1IM3B 2WCPA 4UTIA 3SB0A 1KBWA 4PJHF 2KH2B 1EPXA 2SFPA 1XGTB 1KBJA 1Q72L 2HQAA 3S1VA 1ETZA 4L1LA 4HLEA 1V6YA 1J9RA 3CQPA 1MRDH 3WO8A 5MEPB 2ZZ2A 2VSDA 1R75A 4M80A 4IEFA 3S8HA 5EZOL 1ZV5A 3H4HA 4JLRB 4HB7A 4B9GA 3H3PH 3QDMA 4FG6C 5T3ZE 5F7MC 4ZZ9A 2JNZA 4BFBD 5IDZA 5I82A 1F00I 4NYUA 2XTJB 1AG6A 1TZ8A 2A74C 4BSVB 1AS7A 1UB5B 1PYMA 4XBEL 4GRWH 4LEXL 3K4AA 4X99B 1FP8A 3EYSH 1KM0A 3KZSA 5I16A 3QQ0A 1H49A 1C5BH 4TYUA 5F0MB 4ODUB 4RBPH 1G4PA 3W39B 5DK2B 2XKNA 3VXQB 2ODIA 2X4OB 3TWAA 3W83A 1UZ6E 3HB3B 1WDPA 1P5UB 3TEXA 3ORJA 1XH1A 3HG1B 4AWEA 5JXEC 4K3DH 3CASA 3UADA 3U6XS 3WLHA 2HRHA 5GS1C 2V38A 4WY7L 4B60A 1TWWA 2IWKA 5TDPB 3D52A 1GONA 1XB6A 2C1OA 3EX6A 1ICTA 1PZAA 3T2NH 1I82A 3MBXH 3AQZA 5JXEA 2FBJL 3L3IB 2D22A 4UFIA 1M65A 5SWSE 2GK1A 4FIQA 1MDAA 1FHLA 3HPJB 5CR8A 1KELH 2HE5A 3ECVA 1REQA 4HTBA 4MX7B 3GR4A 4AVHA 4J27A 1CR9L 2PWVA 4JUSA 3QRFM 2C16A 4FXKB 4FG2A 3GXMA 3NGBC 4PJXB 4AC4A 2XZ7A 2X6CA 5EZJB 1FAIL 4LSRH 5K9KA 4PHZA 2DZTA 4IRZL 2ODHA 3NQMA 3L3HB 4WO4C 2NMSA 2WLIA 3W7GA 1IBGH 4S3KA 1ETA1 4GRLB 1IGMH 4YNYA 3IJSB 4P2OA 3VW3L 3OZ9L 4NCC1 5ERWB 2E27H 4AXWA 1A66A 3WF0A 1LO5A 3TH6A 2KZHA 4UAOB 4EIGB 4I90A 5HDRA 1KB5B 2DZVA 2CXKA 2KPWA 4HBCL 2VMJA 1EGJL 5FEBA 1OF6A 2VZSA 2FR4A 4LSTL 3CFEA 1U1JA 3GKFA 5DMJB 3QQDB 1L0QA 4US5A 3GKZA 3W02A 3U3HA 3UZQA 4KNQA 3ZZQA 3MJ9L 1BGXL 4AUBA 3QXDA 3H8AA 2DYPD 1W0WA 4O8AA 4OE7A 3DWTA 5JH2A 3H3BC 2CDEA 4Z7VF 2QQQA 1ZUAX 3NEEA 4GAJL 1TX2A 1QOKA 3DVFA 2FTWA 2NLJB 4F91B 1CW2A 1OPOA 4U1GB 2VX6A 2I14A 4L65A 3B05A 3NSYA 1EAQA 4CRPA 1CFNA 2FO8A 2PYEE 3KFTA 2HTLD 3TC3A 3ZDYB 2IBZY 4MD0A 3WUWG 2G3ZA 2PDMA 3CAWA 4P2CG 1EHXA 3SW6A 5GJSL 2HKFH 1L9PA 5SWSA 1VERA 1MCOH 3GSUA 2J6XA 4C55A 3NL6A 4DWHA 5JORB 1CDJA 1CPUA 1QLEL 4IGHA 3PN8A 1ITBB 3RKPA 5FSEC 4ZFOL 4N2HA 5TE6H 1OAKH 5FDYA 3KNBA 1W5MA 4JHUA 4M7SA 1SOQA 3WQEA 4XAKD 4NENB 3QEUB 2DUAA 5CHNB 4X5XA 2XFWA 4YHML 2V7HA 3I75A 4NRZA 3EB4A 5BOOA 1FRGL 4KUZH 2CSPA 3MLWH 1KNOA 1TQTA 1QLRA 4N2OA 2OQYA 4WI2A 5DC9B 3TT1H 4AEHL 4GUGA 2F1AA 4Z7WB 1P7TA 5HJXA 1IF2A 3WLMA 1N4XL 3FEMA 4QHNA 5I15L 4AZ6A 1NEPA 2XQYK 4MJ6B 2Q3OA 1HU8A 2QVTA 2ZYRA 3ATAA 5BU6A 3IF1A 2G60L 1YYML 3Q8BA 3HI1B 1KJMB 3WXVL 2CHOA 1DANU 4LVBA 2CLMA 4HS3B 1XAUA 3KM8A 4EVZA 1WDWA 1X1NA 1XDLA 1FBIL 4NXKA 1G7UA 5K7JA 5E7FA 1WVZA 4I9XA 4DX3A 3ILDA 3FUMA 1CCWB 2F6KA 5E94A 3K5RA 2F58L 4JIHA 4JVUA 3L6FB 5T1JA 2J25A 1O60A 3QFWA 2B0MA 4OQTL 3L21A 2EUXA 4Q7NA 1KACB 4ZMQA 4LMQI 3NQDA 5GJNA 3N1AA 2C9PA 3U4EA 4QWWD 4XNUL 2ICWI 2FIQA 3LI0A 4HPOL 4QTFA 1A5BA 2B1HL 2C7UA 4LAJH 2OZTA 3BKYH 4PJBE 4ICWA 4EUPB 4KK9C 2OPJA 4NCC2 1EA9C 3BZEB 3RTQC 2BTMA 3IBEA 1Z8AA 3R8BB 1VR6A 4KY2A 5ACZA 1LJMA 5GRVL 1XIWD 3QQXA 1VFMA 3EZ8A 1OX6A 1HQTA 4WI3A 4P7LA 1M05A 4MASA 1XRVA 4IIGA 2UUDK 2G3IA 3NNTA 4ICNA 1TTGA 3KRBA 1SLXA 3UA4A 1A9BB 3LPOA 5KVFE 1A7RH 4QHPA 1A0CA 3CSFA 3KZ8A 2XWTA 4M5TA 1NP0A 2Z6JA 1MUJB 1OJXA 1SF3A 3SOTA 4Q9QH 2KLRA 2Z7WA 1NCDH 2BNQD 5TBOA 1BZ7A 2R0LL 2OZ3A 4KWUA 4S11A 3P2VA 1JNJA 1ZT4A 4LMQE 4QNPE 3KJ6L 4YPJA 2QCGA 5E5CA 5FJOA 2YD8A 4PREA 5KSAD 1CU4H 3TW9A 1KFCA 3NPSB 5FKPB 3DG7A 4P2YA 3P4MB 3KVDD 4UQ3A 3WIFA 3LCFA 3CNYA 3I6KA 4HAGA 4NJKA 1X4ZA 4ERSL 3GSNH 3OLIA 1AK5A 3I85A 2DWTA 5FYJU 4LLWA 2I16A 4CU8A 4A7UA 2IMNA 4HFUH 1YNKL 3X11B 2YD2A 4OV5B 3F4VA 1YEJL 5DQ9B 4JJ5B 3PPFA 3NVDA 5DF0A 5F3FA 1O7SA 3SR7A 4QTIL 1IT8A 3GNRA 4HIIA 3RX5A 5KSBE 1JZ8A 1NFGA 3BN9C 3K6FA 4XN9A 1U2HA 4HEME 2JQZA 4FALA 5EEZA 1J05A 4PJBA 4DKAA 1AJ7L 1TRIA 3W56A 1JPTH 5L7XL 1FCGA 3DERA 2A99A 1IGTB 5D1QD 1UBPC 2GUUA 2WD0A 1YEYA 1UR1A 4QRUA 3PJUA 1K3IA 2FWSA 2PETA 3GMOB 4DOHE 3MO1A 3MZ2A 5GGTA 5KYWB 5H1WA 1AE6H 5E6IA 4CN4A 1NGXB 2JJSA 5LGJB 4HXAL 5J5DA 1NTDA 5JDJA 4WDUA 2BSTA 2WN3A 4FOKA 1XQKA 5CUSH 3R11A 4WY0A 1IBBA 1IEBA 3PSWA 4Q4PA 4H9TA 1GMIA 3U5YA 4JKNA 3CXFA 1DFBL 4OW6A 3LN5B 3O7UA 3WAKA 3T44A 4JTFA 1AG1O 1LWJA 1OAYL 3OBAA 3T71A 2G4JA 4KUCF 5I6OA 1KCRH 3MXWH 4MNQA 2Z1PA 1N19A 4CLMA 2D69A 1LQBC 1NLBH 4H8HA 4JFEA 3B2DC 3T40A 4N0YL 3T6QC 4WI9A 3RVTD 2X8RA 1E50A 3DETD 3I6EA 3UGRA 3RG1C 5FO9A 4HK3J 2C0HA 2VAAA 4NOFA 2AQSA 3SDCA 1T04A 4UZSA 4X3ZA 3FYOA 1K8XA 1IM9D 3LA4A 2AV7B 1Q13A 2R69H 1KGCD 1XIBA 1CICA 5JOPD 4YVXA 1PCXA 2HJKB 3B6SB 4YR6A 3FVDA 2VEGA 2RTTA 4XISA 7PAZA 4MB3A 2CWXA 5KSBA 2QDHA 2V69A 3CDGA 4HEMA 3PAUA 2I07A 5I1DA 4ETQB 3ZDZB 4TULL 1KB9J 1HXYB 3HS9A 3LN4A 4OKDA 3NDYE 4HKJA 1N55A 3QFJA 3MYOA 2XGIA 3B0PA 4J8QA 4AH2B 3PYCA 1CTOA 4EXPX 5MENB 4PGEA 2K4AA 1BZQK 3DUUB 4JHWL 5FF4A 1K1DA 4ZFGH 1BG9A 1VHPA 2YKLH 1CGYA 2WZ6A 1JUBA 4P5UA 1NGPH 2A6KA 5IQ7H 2AGJH 2A83B 1F4YL 5DXWA 5HJ3B 1KN4L 3VTTA 4J5NA 4KC3B 3SGDI 4QBXA 4WNQA 1PJ9A 3W0KA 1D9KC 2ICEC 2Z2BA 4UTTA 2CLEA 4BWWA 4JZOA 4QSFA 2Q01A 4U49A 4FQ1H 5DD0H 3ULUE 1D9KA 2ICEA 2CLKA 1MUWA 4AZ5A 3TIDA 3HTWA 3HPLB 4MDPA 1RZKH 1TYJA 2F7OA 2FTPA 3B03A 3QZNA 2DQEL 1G7LA 4GXVL 1YUHB 4AK1A 2XWDA 4BEUA 1TELA 3MRRA 3JQOB 2HLAB 1UYWH 2CW6A 5IIEB 1AGBB 4S1DC 1UPPA 4C6EA 2HRPH 4G2DA 1LL1A 4EQ2A 1K4DB 3N9GH 2XVKA 2GOUA 4KRMB 2CO7A 3OKNB 4NAJA 3ALFA 2ID5A 4YHIB 4XKYA 1GZHA 4L5FH 3GVQA 1WAPA 1YPXA 1YMME 4CCDA 3PGDB 1FDLL 4LOEA 2O1AA 4MHHG 2PDFA 1AIFB 3EJQA 2X2JA 1ALDA 1U36A 4RISH 2VC9A 1OTTD 1N26A 3TH4T 3WLJA 4H13C 4C6IA 3PC0A 5FHBL 3DFTA 4JS7A 4UFMA 5CC6A 1UUOA 2VM4A 2CMRH 4C7DA 4PVLA 4JO3H 4LCIH 3VZZA 2BP1A 3QZLA 1Q6QA 3MHGA 2HNHA 3ITXA 1T21A 1HF6A 5I06A 3JWDL 4AWJC 4O57A 3HMJG 1KEGH 4GY0A 3AIWA 4OGXH 1T7WA 5IQNA 3MV7E 3ULUC 1A4KA 2Y62A 1JPGB 1QSFB 2H8PB 3BZFB 4HWZB 3M6YA 4TLUA 1W5QA 1LM1A 4Z17A 3UJSA 3UJFA 4AIOA 3NK3A 2ITFA 4HSAC 3ANYA 1OP4A 1OE2A 2VLLA 2BB0A 1SU5A 1OTUD 4WK9A 2OYPA 1AP2A 4P5TA 3RGBA 4OM1H 4UXDA 3JV0A 1FWFC 5FAGA 3QPQC 3C08H 4R9XA 3AREC 4O2EA 3FX4A 3OAZH 3BXNB 4DVOA 4JIEA 4R6UA 2MQ3A 3FU3A 4ZDHB 1XF2A 3N2BA 1G7MB 4H8WL 1OB0A 5BNKA 1DIKA 5C09B 4H26A 3ZE2F 2AI0H 5IBLD 1S9VB 4MHBA 1F6YA 1ET5A 1Q9LB 3LM3A 1KC7A 4LCCC 3PAVA 3RIKA 4R7NB 4G42B 4XX5A 5E2WL 3FQNB 4KKPA 5C9JA 4NBXB 1XLCA 4ZMVA 2J9YA 3MNZA 5CJOH 1N6UA 2R0ZH 1WA0X 3FQXA 1IT0A 3ZR4A 4MDRA 1I9RL 5LIXX 2J66A 2V2WB 3USBA 3WLBA 1DLFL 4ES9A 2ZOXA 1FXPA 3Q6GH 3RE0A 1FIGH 2G5BA 4LS1A 1U2YA 1IR1A 1QUNB 3U6RB 1NEUA 1OIOA 2CCWA 3HG3A 4IIFA 3KD4A 4AXNA 5D2NE 4LF3B 3M43A 4J2QA 4UQCA 4CVXA 4LPCA 4HKBA 5JTWA 5CCKL 4KKQA 5I1HL 5D96B 5JHLL 8TIMA 3MV7A 5T5NG 3PDOB 5EOTA 1U8KA 3SPGA 4OR1A 4WK2B 1N10A 2HSIA 2XVNA 3I9GL 3OZPA 1VFBA 3CN0A 2BP5M 1JXJA 4J3WA 2Y5EA 3WJJC 4B9IA 4NU7A 3MV11 5DRWB 5T3XE 1LYXA 2FB4L 4M0XA 4JFFD 1CBJA 3QC6X 1N70A 2ZX6A 2PU0A