4DO4A

Pharmacological chaperones for human alpha-n-acetylgalactosaminidase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 130
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4do4A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4do4A01
1A47A 3LRKA 4FO4A 1TCDA 4K39A 3MP4A 3DDGA 1ZY9A 2D3NA 4MFDA 2TRSA 3HIJA 4UR7A 2YA2A 3G8RA 6ALDA 1TTQA 2QMJA 1OGSA 1MSSA 8TIMA 2QCMA 3QW3A 3STEA 1H7XA 4WX2A 3IVUA 2BWGA 4CGTA 4LUJA 4U3CA 3RIKA 1G94A 1PL9A 2X2GA 2QCNA 3BW3A 3EXSA 2C8NA 5FESA 4JDYA 1J0JA 3CZGA 5TIMA 1TQXA 4CLMA 4JTSA 1C8VA 3I7SA 4GE8A 3YPIA 2OSXA 3F4WA 4MZYA 1KLZA 1TPB1 2DIEA 2ABAA 3G24A 3GDRA 3K8MA 2QLYA 3BAKA 2G5WA 1L0PA 2Y5EA 1SPQA 2ZUVA 3HPZA 3BLKA 5HXMA 3E12A 1KM6A 1WA3A 3WNPA 1GG1A 4GQRA 1EUNA 1TIMA 1OABA 3WNLA 1W3IA 2YDAA 5DCBA 2B7QA 1XUZA 1DHKA 3PY2A 2VEKA 1P6WA 1HUVA 1PCWA 5CSSA 1GZGA 5D37A 1TQTA 5DXYA 1YPIA 1JFHA 4JTJA 1OFPA 2G3NA 2FH6A 2NXHA 1UD5A 4B9YA 4UOZA 4KFOA 4OBTA 3Q94A 6CGTA 1DTUA 1SMDA 2QCDB 4AHQA 2ALDA 2EKCA 5DY3A 2QUVA 5F4SA 4JTLA 3LI1A 2E6DA 2WKLA 5AHNA 2Y70A 5E0FA 3W7GA 4H8UA 1LLWA 2ZQ0A 2Y2WA 4JFWA 3CQ0A 1OYCA 3G1AA 4Z0JA 3WJZA 2D0GA 3THQA 1MVYA 3DFOA 4S1FA 4XBKA 2A2IA 5CPNA 1TPDA 3W74A 2Y88A 3KVJA 3BUIA 1AMYA 2XVGA 1ZAIA 2X30A 4UFLA 1AMKA 3EWUA 2QCFA 2QKFA 3B05A 1QO2A 2Y7GA 4YMZA 1RQBA 6TAAA 2F7QA 3G0UA 1VHNA 3R13A 3M5YA 3STFA 2V81A 4N9DA 1KBJA 3WY4A 3C6CA 1SW3A 1XFBA 1NFBA 2TSYA 2B7OA 4GC4A 3M43A 5H2ZA 1XCXA 1M7XA 2QUTA 5CGTA 5EY5A 1W5NA 1XUUA 1CXLA 1F05A 3TAKA 5FEZA 1KTBA 2P1FA 1NOFA 1KFJA 2C6QA 5LHEA 3K1DA 2QJHA 3BARA 4OIFA 2OSYA 4QAWA 5D2XA 2DP3A 1GVOA 2ZA2A 1V3LA 4PCSA 3NQEA 2NXGA 3VGBA 3OLGA 3B8DA 1CGWA 3QH2A 4EF9A 2ZRUA 3RK8A 4UMBA 5LNUA 4U4MA 2ISVA 1CXHA 2QV4A 2QCDA 2RKXA 5FEWA 3VM5A 3TK7A 2PE4A 1CX9A 3PBUA 1Q6QA 3G0SA 4AEOA 1SZEA 1EHAA 1TMHA 3EKLA 1O60A 1CXEA 3ECQA 1H7WA 1PHWA 4LS0A 2WSRA 3FIGA 3L67A 2P10A 4IMDA 3NL2A 1KBKA 1CIUA 4KFPA 4MOZA 4ZL1A 1BG9A 3TIMA 2ZRXA 4LVGA 5F2GA 2PWFA 4UMAA 2ZX8A 1OF6A 2PWHA 2E0PA 4IMFA 1MW3A 4K8EA 4JIQA 3NL5A 1KCLA 3VFLA 4JS3A 1S46A 5BRPA 4NUWA 3DI1A 2C15A 4DF0A 3ATZA 4NJHA 4M6QA 2OSWA 3VSUA 3ZSSA 2GQAA 3SGZA 4YXGA 3NAVA 2WPBA 2YA1A 3VMNA 4NX5A 4UTMA 4FLRA 3FS2A 2EQDA 1G6CA 2PCQA 3DGRA 4JX6A 2ALWA 3WK2A 2D0HA 3W2NA 5K4ZA 4MYXA 4AIOA 4JTTA 3MWAA 2JKPA 3GB6A 3B0VC 4QISA 2V8ZA 4CNPA 4DBDA 4X0NA 1M5WA 1X1OA 3BLBA 3NPUA 1KA9F 5G2IA 3SECA 4OWGA 1KBBA 2WNQA 1PJ9A 1TPC1 3B0PA 3QSTA 5LNWA 3VGFA 3A9IA 4AHPA 3WENA 1ME8A 2ZA1A 3G3MA 5FF2A 4H7VA 5LSMA 1YLVA 3W6YA 5EYWA 4GUFA 4CNOA 3LXBA 2DJLA 5L9FA 4HPHA 2R94A 3T7VA 2DZWA 4UQEA 4O1CA 4A21A 5CSRA 3WMSA 5HULA 1RPKA 3ZR5A 3WNOA 1FWNA 3DKJA 3KEHA 1ICPA 1D7FA 3TSMA 5U7SA 3W70A 3BUBA 1PS9A 4CCDA 3MUXA 2HTMA 2OYMA 4P2VA 1HNYA 3W2KA 3LI0A 4H6KA 3G18A 3S5YA 1R2TA 4U28A 3LCFA 4NQ1A 2V2HA 1PVNA 4EOUA 3TW7A 1OG0A 1B3OA 4W9TA 1PS3A 1SU5A 1CPUA 3BG9A 4FIQA 1L9WA 4E2OA 1OK4A 3EJTA 1GOXA 2B7PA 2ZICA 4FLSA 5A5WA 1FDYA 4BWLA 1E51A 4XKYA 2C0AA 3FEMA 5EBUA 1EIXA 2P0OA 2FTPA 2EAWA 1UJPA 4NXSA 4JN6A 3CGTA 4MY1A 5K4XA 4CNNA 2GVLA 3BVVA 3HQ1A 1JUBA 3W76A 3JR2A 1NSJA 3S1VA 3NPWA 4DXVA 3FKRA 4YCPA 4AW7A 1V5XA 5AN7A 1TJPA 2DZSA 4R53A 2GQ8A 3UPBA 1K7XA 4UNLA 4RCXA 2FFCA 2ZZ7A 1B0IA 1OFEA 1KXQA 4OV9A 1VJIA 3BC9A 5E0KA 3VE7A 4JTFA 3JRKA 3O8AA 1KWKA 1W5PA 1AL7A 1EP2A 2Q8LA 5KITA 3MP5A 2A0NA 2DZPA 2Q3OA 4HSOA 1V7YA 3S8HA 4DF1A 1P4CA 2PWEA 4WY0F 5AYXA 1D3GA 3QF0A 4BK9A 1W37A 4PEKA 1KTNA 1Q6RA 1UD6A 1LZOA 3S5NA 1Z42A 2WVVB 5AFDA 2R14A 1WBHA 3L2IA 2ISSA 4HPJA 1OFAA 1EH9A 2RDUA 3O05A 5I3JA 1JIBA 4H4IA 5HNRA 3CZLA 1KFCA 3L21A 4K8HA 1NEYA 3TH6A 2HS6A 1HG3A 1SO4A 1TSIA 4JD4A 3CPRA 3W1TA 2JKEA 1ADOA 4MUZA 3DI0A 3O6DA 1BPLB 4HT3A 3W7OA 4IX0A 2V3FA 2V0TA 1K7EA 2NV1A 5LHFA 3L4VA 3TUUA 1JCYA 4RXFA 1YPFA 1R34A 4LVBA 1G4EA 2VFFA 1K8ZA 2VNCA 2QUUA 2GQ9A 1O4UA 1JCNA 1MW0A 5F4XA 1LCOA 2ZFAA 1CXFA 2X2IA 3GDMA 2ZZ1A 1JDDA 3QEZA 3UWYA 5U4NA 5EMUA 4FF7A 4Z08A 5CGMA 1VCVA 4RZ6A 1I2OA 1HFBA 4JFVA 3BVTA 4X22A 1IZKA 2WQPA 1VYSX 2BY0A 3Q37A 3EKZA 3P82A 4AIEA 3WN6A 5TQLA 1JGIA 1FDJA 5G4EA 3NGJA 5MHBA 3CC1A 3DDFA 3L4TA 4UXDA 3DFPA 3LBCA 3M7WA 1TCMA 5GVJA 4GNJA 4AAJA 3IEBA 3BVUA 5KSWA 3GXMA 4LPCA 4IJBA 3W23A 3UWUA 1WV2A 1FQ0A 5F2MA 5AHIA 2H3DA 3W1AA 2ZZ3A 3PM6A 5E70A 3GDKA 2XWEA 1KWGA 3ZS4A 5BOOA 3M6YA 3UZJA 1W1ZA 4KWUA 4RLIA 3HMJG 1KCKA 3S9YA 4OGZA 2V5LA 4I7UA 3A24A 2QEZA 3CIWA 1SO6A 2YPIA 4Y96A 3M0ZA 2F7PA 4MY8A 1VB9A 1F7BA 1QO5A 3TXZA 4S2CA 5C55A 2B0MA 3PG8A 4UFHA 2XIBA 5SWUA 2QMKA 3L66A 9CGTA 1WZMA 1H51A 1T0OA 2FQIA 4N4PA 3EJSA 4ZQNA 5CGQA 4O1AA 3GAKA 3DX4A 2V3EA 1O5XA 7TAAA 2CHNA 4QITA 2VR5A 4UOQA 4FEZA 1L6YA 3RLUA 4AH7A 1BWLA 5HJLA 3MHFA 1XSIA 3P8JA 3W83A 4CVWA 3OEXA 1V3JA 2X2JA 3TU9A 1KV5A 4AVFA 3FAWA 2PRLA 4O53A 1W31A 3BG3A 1JF5A 1VFUA 1KM3A 3S1WA 1KXHA 1DORA 2QCCA 3HJZA 2ZXDA 1G9HA 4QM1A 4LNYA 3BPWA 1TRIA 3I7QA 3W2UA 4DO4A 4IUOA 1QCWA 4L4MA 4UQ9A 5G1TA 3BLEA 2CFFA 1UBSA 4EWND 3R2GA 3RLVA 3GXNA 2YFNA 2VEPA 1I4NA 3WFAA 1RP8A 1ICSA 1W9XA 3KLLA 2Q3RA 1HWWA 2ZUUA 4UTHA 1SO5A 2EADA 4RKAA 1F6KA 2PURA 2YW4A 2GVJA 2YR1A 3M41A 1WZLA 1ICQA 4HSNA 2WSYA 1VPXA 3CHVA 2E68A 4UR8A 1JCMP 2QCHA 1Z48A 3PUDA 3QZEA 1MXSA 4TVUA 3UG5A 5BMXA 2Y4SA 3TTSA 1BAGA 3NL6A 4RR4A 2WVUA 2NLIA 5D03A 3LGEA 2YA0A 2WNWA 3CIXA 3PULA 1JULA 4Q33A 1JVNA 1W54A 2OYKA 4WXZA 4QQ3A 3TR2A 4JTGA 3R8RA 2J27A 2FGZA 2GUYA 2RDTA 2CZFA 4UTJA 1VAHA 4IMEA 1E3ZA 1DQWA 1VLWA 3N2XA 2J9YA 3M5XA 1G5AA 5I23A 5CZSA 4QIUA 3NZ1A 4D2JA 3W84A 1EP3A 3MHGA 1JR1A 1LWJA 1TPH1 3EDFA 4IX2A 3D4ZA 3D52A 4Y6GA 1GPWA 5DCEA 3G1FA 1T8XA 3WEMA 4AYGA 3FFSA 4O4VA 4MB1A 1YDVA 1XDMA 3W38A 5DXXA 1H5YA 1DOSA 3W1UA 3B06A 3A47A 4GI8A 1G4TA 3NEVA 4K6AA 4X2RA 4O1DA 1M7PA 4J28A 3PG9A 1UKQA 1QNVA 3NA8A 1AG1O 3N19B 1XBYA 1DVJA 2WVSA 4ALDA 4TIMA 5BMWA 1F2JA 1OK6A 2VFEA 4JTKA 3WJYA 3BMWA 3L9CA 4O14A 4WF7A 3QQ1A 4DBEA 1KXTA 3W1MA 2QAFA 3FW6A 4FNRA 4WSJA 1I75A 2ZTJA 4TMBA 2J25A 2ZX5A 3QC3A 4Q32A 4JGDA 3BVXA 1O95A 1TTJA 1FCVA 5F1UA 1GVFA 5DN1A 3LV6A 3WFZA 1PEZA 1DEDA 3NPXA 1X1ZA 1TV5A 5DBUA 3QGVA 1KW1A 1KV8A 1WZKA 3BV4A 2BSLA 3Q2DA 2BTMA 1L6WA 2ZCGA 3W75A 4LRSA 4PCTA 1YTEA 3AXIA 3I6RA 5TBOA 2E5BA 1TPEA 2ZXQA 1RR2A 3IVTA 3IGSA 3EJPA 1TV8A 4WJEA 3MJYA 1EUAA 3AMLA 4N02A 3VMOA 3UY7A 4JTHA 4PODA 3SI9A 3VX0A 3PF3A 3NZRA 3LRMA 3L65A 3W73A 3L4WA 2QF7A 3HPSA 3GR7A 3M1ZA 1K7FA 2QPUA 3KVLA 3BK0A 1TJRA 1Q4NX 2VXNA 1BWKA 4A2SA 2NT0A 3L2LA 1R2SA 3KRZA 3ABRA 3BW2A 2F1BA 1XSKA 5LNSA 3A21A 3W88A 4ZMGA 3NQ6A 3CU2A 1H3GA 3L4XA 5E6YA 1VR6A 4LV4A 4LOCA 4M6VA 2FH8A 3UWQA 4UUIA 1LBMA 1I2NA 4IWWA 3MI6A 3FJ6A 4GWEA 4M5PA 2ZUTA 4NNAA 1TPWA 1KM0A 2WSKA 3LPPA 4PCFA 3EB2A 4CN4A 4AHOA 3NQ2A 4ADUA 1V3MA 4M7SA 2CLKA 1H7RA 3NXFA 1VIWA 1KXVA 1WO2A 4JL2A 1IZJA 5K9CA 4UTLA 3AJ7A 1FY6A 3HBLA 3O1NA 4RZ4A 1HO4A 4CKQA 3L0NA 2E8ZA 2JBMA 3VU2A 1KM4A 1LOQA 5AYYA 3CV5A 4IXXA 4ZQPA 3BLPX 4UFJA 1A5CA 3IIOA 4M8UA 4PSRA 3C4UA 1QOQA 1RQHA 5DELA 1XGZA 4CQ8A 3LTSA 5BRQA 2ATSA 1ZAJA 4C1KA 1YDNA 2WOQA 4ZZ9A 1ZENA 3E0IA 1WOBA 3NG3A 4ADSA 4HOXA 3PSVA 4N6EA 2QCEA 3MP3A 4DPQA 4FNSA 4RK8A 2X2HA 2DZUA 3BGGA 3P84A 4IXHA 2R91A 5HWNA 1U83A 4N6FA 4JTIA 2WKGA 2C7FA 3LHUA 4QSHA 2OJPA 3BO9A 1H7NA 3Q58A 1D3CA 3W86A 2TPSA 1EA9C 3ABQA 3GAYA 1QPNA 4IPIA 1D3HA 2EGZA 2NX9A 3BAWA 1IIHA 4O4WA 3CLWA 1UUMA 1QI5A 2FPYA 4PFMA 1WE5A 3GK0A 2VELA 2J9ZA 4NX0A 5CZJA 1K8XA 3C0JA 3SY5A 5FEXA 3W7IA 4WXYA 3HGJA 3GXIA 5C2XA 4MYAA 1SZFA 1X8FA 3QW4B 3JS3A 1X7FA 1FWSA 1H61A 1KM5A 1VFOA 4ZQMA 3N73A 3MW7A 3BAIA 3O6CA 4J3SA 3IRDA 3QMTA 4J3UA 1TPVA 1CXIA 1BEUA 3OA3A 4IMCA 5E93A 1C9DA 4KWWA 2ZYFA 1TQWA 3VCRA 3NQVA 1VLIA 3HPXA 1B4KA 1W5QA 3W7MA 2CPUA 4ZQOA 1OFBA 1CGYA 4LW7A 4XB3A 2OX1A 2EO7A 3W1QA 1OYBA 4XQ6A 1KFBA 2QCLA 1XDLA 2J9XA 3QJAA 2ZDRA 5CXPA 1YTKA 4FB7A 1A5AA 2E6YA 4KFNA 4GQQA 3N9RA 3EDDA 3M47A 1GJUA 4PL1A 2YW3A 2VFDA 1SSGA 3A4AA 1GJPA 3THAA 1OT2A 2BXZA 1KM2A 1JRCA 2JK2A 2V3DA 1R75A 2BZNA 2GPTA 1XBZA 3LB0A 3R89A 3BAJA 3N14A 5EA9A 2O7QA 3BGJA 3LXCA 1B2YA 2VENA 1EB3A 2X1RA 2CLOA 3LCWA 2WCGA 3L5MA 1O5KA 1FXPA 3UY8A 2CWNA 1IXOA 5I0DA 3IIPA 2YOCA 1M6JA 3DH7A 1MXGA 3G0XA 1AVAA 2CLHA 3WDJA 3GR8A 1R47A 2G3MA 1E43A 2YIHA 2ZX7A 4K37A 1VHCA 5CPOA 1UKSA 2RHGA 1DQXA 3OVPA 3DHDA 1JUEA 2C1HA 4YL2A 2EPHA 3BH4A 1GG0A 1JQVA 1MEHA 3GNNA 1HTIA 1QFEA 3VSVA 3GZ3A 2E8YA 5HWMA 4HOZA 4ADTA 1G1YA 3CPUA 4MAZA 1TTIA 2C13A 1R33A 3TXVA 3CWOX 3QMRA 1O94A 2A6LA 5LNRA 1K03A 2V9DA 3E9AA 3KXQA 3TE9A 3R12A 3W85A 2A4AA 4Z0SA 3W07A 1ME9A 2ZRZA 3LHTA 4P61A 1OSEA 1UA3A 1YXDA 4O12A 3TJLA 3SR7A 2OYLA 2CXGA 1UH3A 3N34A 1DBTA 5F4WA 1U5JA 1H50A 7TIMA 1LYXA 4FLOA 4XTDA 4AWUA 1JJKA 3ZR6A 4J3XA 1OFQA 3TC7A 3TX9A 3W87A 4MY9A 2ISWA 3CZKA 1FCBA 2OZ0A 1OFOA 5HWJA 4PEEA 1J2WA 1SZGA 1W0MA 1JD7A 3FKKA 3QMSA 3F4NA 1V3KA 2F7RA 4CQ9A 4DF2A 1GVIA 2BLEA 3NQCA 3GXTA 5EPDA 1ZALA 1CGTA 4U31A 4HPXA 5F1VA 4DO5A 3GXFA 4JICA 1HXKA 5HINA 4A2RA 1B9BA 3BW4A 5D30A 3VKJA 3L0GA 1W3NA 3BLFA 3BAXA 4OJYA 2IQTA 4NNCA 2YYTA 4AYSA 1H1YA 4OKDA 1D9EA 1A5BA 3UG4A 4E2BA 3L4ZA 3T40A 3WK0A 1KGUA 5K3VA 1WOAA 2Y7DA 2X1UA 2A7RA 4FNUA 4GI9A 3DFSA 5HUPA 3W37A 2C16A 3TQVA 2F7OA 1JXKA 1A5SA 2YSWA 2CLEA 3T55A 4UMCA 3VM7A 4IGHA 4UTKA 1OFRA 4PH6A 4HNUA 1LM1A 1EWEA 3IK2A 2BXVA 4O54A 2E4TA 1YDOA 3TW6A 1FWTA 1KFEA 2Q8ZA 3PBWA 3EDKA 2C19A 3EXTA 3TSDA 3STGA 3TMLA 2FB3A 2Z1BA 3ANYA 1FWRA 3LOTA 2A1YA 4R34A 3L2MA 1QPKA 4DPPA 3TFCA 1CYGA 3VO0A 1IXNA 2XFWA 2VEMA 3P81A 4JX5A 5I5RA 1F6PA 1HL8A 4HIBA 5ABTA 1RQEA 4FNTA 5EKYA 2A7PA 2NXIA 1QWUA 4HNVA 3EDEA 4AMAA 4EVZA 2ZUWA 4UQDA 3LCLA 4BWLC 1QHOA 1HT6A 3G1XA 4S2BA 1J4EA 4MKNA 2OT1A 3W22A 3INPA 1QPOA 3AJXA 1AK5A 4UTTC 2H8ZA 1L2UA 1PCKA 3AMKA 3D50A 2IGTA 5E9AA 1EWDA 2ZXBA 1H7PA 3I7RA 4ORMA 4DEFA 3HB9A 5HMSA 3ZR4A 2C3ZA 2CLFA 4UTWA 4O10A 3C2FA 4WQ6A 3H55A 4WOQA 1VCFA 1LRQA 4PL2A 4H2CA 1MXDA 2AAAA 3BG5A 3PBVA 1MFVA 2YYUA 5IM51 3WNNA 1PIFA 4WLCA 1XD0A 4N9CA 3KWXA 3UWZA 2TMDA 1HO1A 3VNZA 4LY8A 1Z32X 1UCWA 3IGXA 2F18A 2VFHA 4NVTA 3W2JA 3WNMA 1OX4A 1I45A 3C2EA 1OB0A 2WANA 4X9YA 1BKSA 3K30A 3L4YA 4OV4A 5I3KA 4CCEA 1LOLA 3OHIA 4QAIA 2WNNA 3HZ3A 5FF7A 5BNKA 1SR9A 3VNDA 4OHQA 4J7RA 4IMGA 1VS1A 3D0CA 2ZZ4A 3AXHA 3HG5A 1G4PA 1K8YA 3GKAA 4GI6A 3LTYA 4HA1A 2C14A 3RF9A 5A2BA 1QW8A 5I3HA 1BVNP 5AHEA 2J6XA 2A5HA 1B4EA 1CI1A 3KL5A 1Q45A 3M16A 3DZ1A 4Z1DA 1WPCA 3SJ3A 4MJZA 3MYOA 2QAPA 4GUHA 3G1VA 1LOSA 3LX9A 4O0ZA 2D73A 1TO3A 5HR6A 2ZZ2A 5C5YA 5E1QA 2J24A 1YXCA 3U2OA 6TIMA 4Z1AA 2E9BA 5D04C 2PC4A 1PPIA 3CTLA 3O6YX 4TO8A 2HS8A 4UZUA 3NO5A 3I68A 4MLRA 1FUYA 2I14A 1QWNA 3EX2A 3IGUA 3RFAA 2OCZA 3EWYA 4AB4A 1QWGA 4NJKA 3PSWA 4Z1CA 3C52A 3MBFA 2PWDA 3TROA 3DX0A 1IGSA 4XKYB 1VGAA 1JDAA 4AF0A 1BF2A 3ZQ9A 4RZ5A 3W1XA 2NUYA 2QPSA 3GBDA 5H91A 2CW6A 2DZVA 4WD0A 2JGQA 2GJLA 1FDZA 3ZWSA 2Y7EA 5BRBA 3GLCA 3MHUA 1T99A 4BI6A 1HX0A 2RDWA 1XCWA 5CLTA 2ZE0A 3C61A 4RXGA 4JYDA 4L4LA 4K7VA 1TB3A 1W3TA 4O11A 2Y85A 2ABBA 1CXKA 2ZWYA 4J3TA 1FX6A 1JI2A 3GDTA 2GVYA 3O63A 3GKFA 2ATMA 3F03K 1RP9A 5L6UA 1VRDA 2E6AA 2FLIA 2FB2A 3SIZA 1H62A 2TAAA 3K8LA 5FF3A 2BY3A 1TV7A 2CLIA 1O7DC 3LXAA 5KTLA 3EX3A 1VFMA 2GJNA 4LUIA 3BUDA 1FWWA 1LROA 1B57A 4HOWA 3GDLA 2PRMA 3PUEA 3UXAA 3P5ZA 4Y8FA 1LORA 2FIQA 3BSGA 4MZ8A 2E09A 2A6NA 3ABSA 3ZWTA 4X9SA 1HTYA 2JGYA 2ZZ5A 2VC6A 1FCUA 4UCGA 2H3BA 3LRLA 2OT0A 4LVDA 1WBJA 4RX0A 3BSHA 3EXRA 3LPOA 3ELFA 4JY9A 1SQ7A 5AYZA 1SFLA 4NJJA 4E0CA 3GXDA 3SW6A 3TV8A 3C2RA 4XBSA 1OX5A 5EL1A 2ZBTA 3WJXA 2AMGA 1BTMA 5G1YA 4H3DA 3KLKA 1TRDA 4OE7A 4BA0A 3WY1A 1JDCA 3R5EA 2NX1A 2Y7FA 4O16A 1QOPA 1W5MA 5AHLA 3VGHA 4PSPA 1GEQA 2ZRYA 2ZX6A 1XH2A 3BAYA 3LHWA 1YADA 1KTCA 1U33A 4MZ1A 2EJ1A 2GVGA 2KZHA 3UPWA 4AXKA 4K36A 1E40A 4U33A 1P5BA 3KL3A 1ME7A 4A29A 1GVQA 3MO7A 5CPLA 4BZYA 1WP6A 2ZTKA 3HGOA 3G3DA 4HNTA 3TTYA 1P1XA 1TMQA 5AC8A 2Y6ZA 5DLCA 4Z1BA 2F1AA 3MYPA 1EX5A 2G97A 2OMAA 3MI2A 5I3FA 2XN0A 1G4SA 3DKLA 4AWSA 3PB2A 3IIZA 1UD3A 1QI3A 1VC4A 3P74A 3EWBX 2X1SA 3M5ZA 1JI1A 4FX7A 5D2WA 2XVLA 2WO5A 3DENA 1JRBA 2HMCA 3KL0A 1Z41A 1RV8A 2VUYA 4FX6M 3P61A 2JKAA 1N8FA 1LP6A 3BLIA 1QI4A 3C56A 1TQUA 1A53A 1S5VA 2VEIA 4E2DA 1MEIA 3GXPA 2EHHA 1OF8A 3RNDA 5TD4A 1G69A 1UOKA 4K7YA 2BX7A 4UQAA 3AO0A 1Y7VA 4TX9A 3S42A 2B7NA 1GWJA 4B9ZA 5AC6A 5D33A 1UD2A 3LBMA 1ODUA 1J0IA 1QPRA 3G1SA 3NYZA 2NT1A 5HQEA 1CLVA 3FAXA 2XVKA 5AHFA 3O07A 4N9BA 1HL2A 3IVSA 2NZLA 1WQ5A 3QPYA 4GUJA 1JD9A 4GBUA 3WY3A 5LZLA 4UC5A 1UH2A 1KM1A 1XSJA 4XWUA 4FX8A 2ZIDA 2VRQA 3M07A 5A2CA 1I2RA 3PWAA 3FOKA 2WKJA 4I7WA 1TPFA 2YJQA 4WZHA 5FEPA 3PB0A 3N3MA 1OVDA 4LVFA 4A22A 3B4UA 3NPVA 3DFQA 1KBIA 1DKWA 4N2YA 4TR9A 5EMYA 4I9AA 4BI5A 1GCYA 1NAL1 2QCGA 2E6FA 2CZDA 1F76A 1AQHA 1JCJA 1KFLA 2GJRA 1S3HA 3SSJA 4UQBA 4WOZA 2ZRWA 3DAQA 3T78A 4BI7A 3W1NA 4EIVA 1XH1A 1G7VA 3A5VA 1G7UA 1OYAA 3UQNA 4FNQA 4NNBA 3P5YA 3CZEA 3WJWA 4BF9A 3NM3A 1GTEA 4J9JA 5I3GA 3TFXA 4O52A 3FLUA 1M7OA 4U2YA 1JCXA 1OT1A 1JAEA 3V75A 5D05A 1XKYA 4ORIA 3KVMA 1AW2A 4M56A 1I2PA 2RH9A 3W7KA 3I65A 3GBEA 3UERA 3TDFA 2QJIA 3GNDA 3IJ9A 1CW2A 4ICNA 4UFIA 3A22A 3ZT6A 2NWRA 5AHMA 4GIAA 3BVWA 2RFGA 4JCLA 5T26A 2C18A 3TJXA 3WELA 3QPZA 3BUPA 4NXKA 3ZT7A 3UG3A 1MEWA 3W7CA 4LS1A 5J5DA 4J27A 3LLDA 3EJQA 1QMLA 2ZUSA 1VYRA 3VNYA 2A85A 4MFEA 1ZNNA 4IQLA 2UV8G 1GYLA 5HDRA 3DU0A 3HJEA 2YZRA 3BMVA 1MFUA 1NM9A 2WV8A 4UZSA 1UUOA 3BUQA 2TYSA 1U30A 3W7DA 1GYNA 1DJQA 1ZCOA 2Y62A 4JCMA 3DHPA 2X16A 3B04A 1UKTA 5LKYA 1PV8A 1QPQA 4NU7A 3WK1A 3W3OA 1JF6A 2V30A 3M44A 1NF0A 3OBKA 5CZTA 4UTIA 3LHZA 3IIVA 1FCQA 3QM3A 1EO5A 2H8XA 4E38A 3UWVA 5D32A 3VGEA 1GVRA 3SGUA 3DXIA 4GUGA 3C2VA 2ZX9A 2QDGA 3B0UX 2WNZA 3D4YA 1K3UA 3S1XA 1CDGA 3TQ0A 4HP5A 3A23A 3FYOA 2E1DA 3EX4A 2WPGA 4X3ZA 3MBDA 4H8VA 3C2OA 3PUOA 5D2VA 1OX4B 1JXJA 4Y90A 5D09A 1BSIA 2FJKA 5LGZA 3SFKA 3F1QA 3DHUA 2AQWA 3OVRA 4QNEA 4HNNA 3WNKA 2DZXA 2E77A 1UA7A 1JCLA 4O0KA 1LRNA 3VMPA 4RV8A 3LDVA 1EO7A 5A6MA 2ZZ6A 1CGUA 3TKFA 4JR5A 1SUXA 2H90A 1XD1A 4NT0A 5KEZA 2NX3A 1ZJAA 2VFIA 3S5ZA 3IV3A 2DZTA 2DH3A 3K8KA 3VX1A 3N9SA 4ZVJA 2A7NA 3LHYA 3CB8A 3MI3A 3P67A 5K9DA 5CKSA 3L5AA 3A5FA 3S6DA 3LTPA 3V1PA 3C8FA 3LM7A 3NL3A 5KZMA 4O28A 1LRTA 1SFJA 1X6UA 3DFNA 4AMXA 4MVAA 5E6ZA 3RU6A 2NWSA 3HG2A 5CLWA 1VJSA 1ALDA 1DHPA 1IV8A 3S5OA 3LCHA 4I7VA 3W7RA 1OX6A 4GUIA 2OW6A 3T44A 1ZAHA 4AF0B 4FIRA 1I8JA 3UEQA 4O17A 3H53A 1THFD 2GJPA 4O1BA 4JFSA 3NQGA 4LV9A 2J88A 4ZQRA 1C8QA 2FDSA 2OW7A 3NVTA 3TONA 1YXYA 3QYQA 2QJGA 3W7PA 4FMVA 3W7NA 3NQFA 4O13A 1TQVA 4MPQA 4CN6A 3HF3A 5KZDA 2CU0A 2WJZA 5D2TA 1UASA 1JL8A 5DY2A 3HGRA 4GKLA 3ZFHA 3G1DA 4M6PA 3W1RA 4PC8A 5C54A 2Z6JA 2F84A 1EP1A 2V5BA 2W6RA 3EDJA 1NF7A 2WSQA 3QRHA 2D3LA 1WDWA 4UTTA 2E5CA 3FYPA 1OHLA 2BY2A 2D0FA 4ZQCA 3VGGA 4NJGA 4ML9A 1PIIA 1XCFA 1PZ3A 3KFTA 3UWWA 3OLIA 1LLZA 5K9XA 4JTEA 3PBYA 1WXJA 4JX4A 3CEUA 1TREA 1SZNA 2Y89A 3DHFA 5C6MA 4JYEA 5F2IA 4LQ1A 3GTNA 1MWOA 1SW0A 3OG3A 4KMQA 1JQXA 1I2QA 1R2RA 5LNVA 4UTWC 5DBTA 5DCDA 3ZT5A 1JUKA 4YLWA 2F2HA 5A2AA 1QDSA 5G4WA 2Z1KA 3UXDA 4JNMA 4JEQA 4G1KA 3HOJA 3TQKA 4B5NA 5IBXA 3MMTA 4PTNA 4FXSA 5G5IA 1S5TA 1VH7A 3ABOA 2YCEA 1K02A 2WCSA 3PS7A 1VCGA 3W7QA 3LCIA 1QAPA 4MLJA 4R7JA 1MW1A 4WY0B 3G1HA 5F2LA 2NV2A 4UIOA 5K2ZA 2BHZA 3N2MA 4JXCA 2BHUA 4UQCA 3P7YA 4TU1A 4JIPA 5CZ0A 8CGTA 1YTDA 5FI8A 1W8SA 1E3XA 3UNDA 7CGTA 4HHPA 2V2DA 1NVMA 5DFAA 1FXQA 4O19A 3G1YA 4KWVA 4YCOA 4NZJA 3HO8A 3RMJA 5KMYA 2YXGA 4U2ZA 1KGXA 1HVXA 5AB3A 1U2YA 4JL1A 1F73A 4N4QA 1CGXA 3O16A 4IOTA 1OJXA 1UH4A 3GVGA 4C1LA 4OU1A 2W0UA 4O50A 3WDHA 3EX6A 4NJIA 3ZSTA 4UNIA 3KE0A 4OT7A 5AOUA 1QX1A 2VKZG 1PAMA 1P0NA 4EF8A 2AGKA 1ZHAA 3G8EA 3D51A 3BCDA 1QW9A 3W7LA 1Q6LA 3USBA 3T4CA 1LDCA 4YWIA 2Z0IA 1QHPA 5KZEA 1TTPA 2Y63A 3S2CA 1ZS2A 2FYVA 2VOMA 4LS2A 4LVAA 3L0KA 1Q6OA 3UZ5A 1MW2A 3NR0A 3PC0A 3UYCA 1SW7A 2CLLA 1H7OA 4Y9AA 1H63A 5D38A 4H8HA 3NQAA 1N55A 4A3UA 3DX2A 2PRHA 4N9EA 3ZO9A 4WY0A 4POCA 4RJEA 1JG9A 4NZFA 4LC6A 2D2OA 1IF2A 2QR6A 4UFKA 3CM4A 4HN4A 3DFTA 4DELA 2FPVA 3QQ0A 2CZEA 1F5ZA 3E96A 3NNTA 2NUXA 5G2WA 1KGWA 3QFEA 4ATWA 1ZFJA 3H54A 2GUUA 3KOFA 5CPMA 1UB3A 1PZ2A 4HKPA 3L4UA 2CZ5A 3L5LA 4K38A 4M19A 2NUWA 1XBXA 4GXMA 3WJSA 3ZOAA 4KKXA 3CEPA 3CZNA 3CLMA 4AEFA 3KAOA 4JYFA 4LT9A 4O15A 5HUOA 3NOEA 1XC4A 1WAUA 1SMAA 3EWXA 3QSRA 2DH2A 3M9YA 1Z44A 2BXYA 2EAEA 2YGYA 3KVKA 2F7FA 4IPJA 2DU2A 1C29A 3LV5A 1XM3A 3DC0A 1AQMA 4O57A 1QR7A 4M7TA 1IXQA 3WDIA 3NDOA 1EA0A 4CN1A 2EABA 3BCFA 1XV8A 3KRUA 2F61A 2FHBA 3II1A 1EPXA 2YKKA 1TYGA 2X1TA 4LRTA 3W2LA 4DQWA 1ML1A 1M53A 4W93A 1LWHA 3E49A 3GIYA 2LLEA 4XTIA 5I3IA 2VT0A 4JFTA 3P62A 1FBAA 5D2YA 3CWNA 3C3NA 1SSDA 1H60A 1LTDA 3W7JA 5A8GA 1CGVA 3WEOA 4PA8A 4R33A 3LLFA 5LGXA 2AAMA 3W1LA 2Z2UA 1WYIA 1VQTA 4CQAA 3VI2A 2XN1A 3TA6A 3HGSA 1J0HA 4J3VA 2R8WA 1N7KA 3GX9A 1RVGA 1KLYA 3ATYA 3KRSA 4UNKA 4JFUA 2XN2A 3RILA 4AMWA 4XZ9A 5K7JA 1GT8A 3DX1A 1BVZA 3EEGA 2WSPA 1MZHA 3TNOA 4GJ1A 4QNWA 2I1OA 1KFKA 3LERA 3PAJA 4TMCA 3W2MA 1R30A 2G95A 2G96A 1VZWA 2VFGA 4O18A 3UD6A 4GINA 3TC6A 1GJWA 2NSXA 3GYEA 3E02A 5FF4A 2H6RA 5A6LA 4J3WA 2WC7A 2FHCA 3LCXA 3DX3A 3W7HA 1G67A 4FLQA 5G2HA 2YFOA 1RZMA 3TSBA 2WVTA 1J0KA 1PHQA 2ZRVA 3KX6A 1RD5A 3CZSA 4AWTA 5FF0A 3IIXA 3NQMA 3FJLA 3KHJA 5IBXC 2DORA 3W1PA 3G22A 2DIJA 3HG4A 4ONVA 4LXFA 3DBPA 4MIMA 1IXPA 4WUIA 3WY2A 3S1UA 1ZJBA 3OLEA 3EWWA 4AEEA 3IJ7A 3O15A 2E5DA 3NQ8A 3P60A 3TOPA 2DJXA 1UD8A 2ZWZA 1GQNA 3W7EA 3EX1A 2XWDA 4NI3A 1W5OA 5I24A 1DV7A 3FA5A 1XBVA 3P8IA 3OLDA 1LBFA 4XUGA 2FHFA 1TQJA 3VGDA 3SZ8A 1WX0A 4UCFA 3PR2A 3O06A 3WK3A 3VE9A 2YX0A 1LBLA 2EEXA 4JY8A 5HPOA 1AL8A 3S0CA 2GOUA 1IIGA 1A50A 3TAOA 1F74A 2CLMA 5CG7A 3L68A 4BR1A 2XIIA 3P80A 3TCEA 5D02A 4UTUA 3OVQA 4GO8A 4DO6A 3BVJA 1XH0A 2HSAA 3A6OA 5KINA 4FNPA 4FXRA 2ZXAA 4UFMA 2PWGA 3W9ZA 2FE0A 4QJ1A 1AW1A 2W79A 2A21A 2FPTA 1OFDA 1P0KA 1PIGA 4LC8A 4LU0A 3UCQA 1XL9A 4Q4KA 3IJ8A 1W56A 4JDBA 4MJMA 5J5RA 1H1ZA 5BW6A 3LCGA 1DJNA 1YYAA 2I9EA 3U8GA 5AC7A 1GVSA 4LWWA 3NM1A 1ONRA 3OIXA 4GFSA 2EACA 4GRSA 3NQ7A 1J5TA 4GO9A 2QDHA 1VYPX 2BY1A 3U6WA 1HL9A 4OQVA 1R46A 3LHVA 1RPXA 3TMQA 3EJRA 1DL3A 1PE1A 1Y0EA 3W72A 1TQSA 1GTHA 1SO3A 4LTSA 4O8RA 3EJUA 4CCCA 1XI3A 3CT7A 1TPUA 3CTTA 4BFAA 2V2CA 1UD4A 3NQDA 4JTUA 1KB3A 2V82A 1S5WA 4WSKA 1AW5A 2VRKA 3VSTA 5DO8A 1ZJIA 1BLIA 5F7UA 1T96A 2Y24A 1WZAA 2BHYA 1EEPA 1XXXA 3M5VA 1Q3NA 1MO0A 2Z6IA 2B4GA 3PVFA 2WVVA 2O7SA 3B03A 4FHAA 2EF9A 1L6SA 3W71A 2Y61A 3EWZA 5HR7A 2ZA3A 3HG3A 3STCA
chains in the Genus database with same CATH superfamily
1A47A 3FT2A 3LQAH 3NGBB 2GBUA 5JNYB 3CD4A 2Z4QA 1ZY9A 1ELSA 3WLJA 3WUEA 3T8LA 2N1KA 3HMCA 4PJ5E 3QI9D 3SQBA 2J6EL 1PKYA 2KKQA 4GI4A 1SY6H 4GX8A 4XZWA 1OAZL 4NO3B 3HZYB 3SD5A 1SDDB 2C3GA 5H2BA 5JTWA 2EEDA 4Q74A 3G8RA 5EMMA 1ZJHA 1OGSA 5E5MB 4YVXA 2GSGA 1MSSA 3PUCA 3CNKA 8TIMA 5BJTA 4PB3A 2W27A 3QW3A 2OMXA 2ZOXA 1Z69A 2IH1A 3U0PA 4M3PA 3MLXL 3IVUA 2BWGA 1F18A 5DURB 1IAIM 3RIKA 1PL9A 4ZMPA 2VO8A 2XDFA 1G6RH 2IMNA 4NQQA 2Y8UA 2Y69B 3GZAA 2QCNA 4G6FD 4M02A 4I0CC 4NQTA 2C8NA 3F4VA 1M05B 5I66A 5DS2A 4PRDB 2EYRB 3QPXL 4IYKA 2E7HA 3AIVA 2JK5A 4DJFC 3IBEA 2PU0A 5I1KL 4QG8A 5KBKA 3X11A 3TA3A 3X3FH 1OWQA 2VGFA 1PZUB 3ZTJG 3K6IA 4E9WA 4PR5A 4M6NH 1C8VA 1BGGA 5GJNA 4F1ZA 3QDJD 1QOXA 4PJIE 1K8IB 1FO0A 4N0FA 3AXLB 4OB5L 3FQYA 5D7SH 3EFFB 1JMXA 5IB2B 3E0LA 3G24A 2BNQD 3ESMA 4MRCA 3PFQA 1LEKB 4GQ9H 1BA9A 1ZD6A 3QG7L 3S3BB 3ASWA 2XWZA 4F9LC 1SPQA 4N8PA 4JKPH 1A4AA 2ZUVA 4YDMA 4EPDC 5AVTB 4GBXA 1FG9C 1UB5B 3QULB 2R4RL 4EDWH 1W3IA 3B9KA 1OABA 2IW0A 5FJPA 3PY2A 3VNJA 2VEKA 3SQOL 1CFTA 1P6WA 3WQ8A 1XLGA 4L4TA 1HUVA 1PCWA 4CQCA 5D37A 4GRMB 2QJNA 1QA9B 4GY0A 5DXYA 4Q6XA 4GNVA 4NT6B 2CR6A 3BOVA 2F7IA 3QRGH 5HJBA 3T77A 4M3KB 1JK8A 4PRBB 5AOIA 2MANA 3DPBA 1NCAL 3N2JA 2FH6A 4IK7A 4PWEA 3WSQL 4B9YA 1L3NA 4UOZA 4Z7AA 3EOLA 6CGTA 1QRNE 3KYOB 3ARPA 3TO4A 2J21A 3BGFC 4AHQA 5HP5A 3SGJA 4KUCD 5KSVB 3O45A 3S2LA 4LP5A 1T7WA 4GKTA 4EK7A 4BUHA 2V2WB 4ZMLA 4YR6A 2FR4B 2E7DA 1X8CA 1IM9A 5HYQB 4PMQA 2EIEA 2WKLA 4Z7VF 5AHNA 4MDJB 5E0FA 6A3HA 3ZL1A 4MA1B 1DEEA 5LCVA 1LLWA 2ZQ0A 2Y2WA 5JHAA 5MKGB 4KGJA 4PULA 4JFWA 4X9GA 2ESVE 4JANA 4YQXL 1M41A 5F6HJ 2DTML 5M7QA 1D8CA 3TX4A 3JUZA 1NICA 4P2RE 1Z5YD 1S2UA 1FVCB 4OD2B 1U8PB 4BH7A 4HMCA 3TA4D 1TPDA 4QEHA 2Y88A 1XTMA 3CFMA 3KVJA 2BDNH 4IIEA 4MKVA 1ZAIA 2RBLA 1L9PA 2X30A 4K36A 1AMKA 4Q56A 2XN9D 4LPVA 3GVVA 3K4WA 3B05A 1XX1A 1NFDB 4HPOH 3MO1B 4LBSA 3MBXL 4K73A 3G0UA 4GYFA 1VHNA 3WOVA 1P4LB 1TVHA 3L9RB 2J56A 4M7JH 2ED8A 1WFJA 2YARA 4CKQA 5SWSA 1T80A 3C6CA 5J1SC 2JQMA 2B7OA 4RA0C 2XY2A 3FT1A 4HIJB 4KFMA 2E3VA 1YEEL 5DJCA 2BS71 1MLCA 3D6GA 4XBGB 4A7QA 1XCXA 3K2GA 1JS4A 5FHAH 4C1NA 3KWUA 5CGTA 2YLHA 4C5ZA 1WEJL 3HB3B 3HPFA 5EY5A 5H91A 3BGAA 3QULA 5DF0A 5I8EB 4KOBA 5DZVA 1F05A 1S3KH 3VXQA 3DO7A 2ZOKB 4F7EA 3VXME 2P1FA 2HRHA 1NOFA 4KY2A 5ICZA 2G3ZA 3OKLB 3K1DA 4IJ3B 1ISXA 2QJHA 5LIYX 4Y2OA 4NLAA 4L1BA 3CZFA 2K6ZA 4XP5L 4QAWA 4MNQA 4ZAKC 4FE9A 1R3YA 2DP3A 3NL2A 1SMOA 4M51A 4QDMA 3MLRH 4D0BA 2UWEA 4ODTL 5FGCE 2ZA2A 3CPLA 2OLSA 1YHTA 3DPBB 5HHQA 2P5WE 3OLGA 4X6CB 1C9WA 1DXIA 1CGWA 2PR4H 3BQUC 4LHUB 4AG4H 3QH2A 3IDNA 4EF9A 5IFJA 5G1MA 2CKNA 1CXHA 3LN4B 4M43H 3M6DA 4ELMF 2J72A 3TO4B 5FR3A 3A3HA 2QCDA 2RKXA 3T81A 1CICC 5IHWA 4DGUA 4XMUA 3MN8A 4I0PC 2PE4A 1AODA 1CX9A 1H4PA 4CNIB 1HKVA 1EHAA 1PCXA 3GSUA 2CHZA 3EKLA 4G5DA 4L6HA 2FR4A 5FJOA 1O60A 5EUOE 4JFPB 3T2NL 1PHWA 3AAZA 1T5XB 4MMWA 3FIGA 3WFEH 3L67A 2QQKL 1LM8V 2ZTBA 5HYEA 2J13A 1KBKA 3OKKB 3G5XB 4AYID 4QO1A 5AQ0A 2VUNA 4KH9A 4PJ8A 3QZWG 5IMLB 2GI7A 1AO7D 3ULSA 2YUVA 4ZA0A 5KZ6A 1ZGLB 4HUNB 4GACA 2AQNA 1GZJA 4ONFL 2MPAL 3RWGB 4LVGA 3VFUB 4U49A 1RVKA 5M3WA 3ELQA 3HBGA 5LWYH 3FU0A 1OF6A 2CKBB 2BP3A 3GGWA 1MW3A 2YPVH 4FCAA 2G4EA 4JY4B 1L7IH 3NL5A 1XLIA 3N40P 3B5TA 4Q6IA 4XG1A 4GIEA 4HK3J 1NGWB 1RZIA 3DYPA 4IOSD 1S46A 1BQHA 3MUCA 3DI1A 2VDLB 2UZPA 3GSRA 5FKAB 1MRQA 3H85A 2C15A 2PP3A 4UNVA 3ATZA 2JMRA 4YXHL 3FZUC 4REQA 1JPEA 3MDUA 1BOYA 3PWNB 4G1MA 3KOYA 4L29B 4NPYA 1E2WA 3KDMB 4HEME 4HMNA 5GGTH 3BP4A 4GYBA 5TQ0L 3DXAB 2BOEX 4ODWB 2BP1A 4J1OA 1F6LL 5L6YL 4QRBA 3I6LE 1W72A 3RU8L 5DXWA 4ZUTB 3N42B 2R27A 2ZSWA 3TYGL 3TEUA 1JSYA 4Q8WA 1KACB 2OXGA 2J5WA 5FOBB 5M03A 3FUKA 4JX6A 4K7PH 4IFKA 3OKEA 5FV1L 2DBLL 5K4ZA 3QCUL 1N19A 3WJMB 4AIOA 4JTTA 1O7AA 1VFHA 4B97A 2CR0A 4V27A 4W8BA 4QISA 4P8WA 2OAAA 3QDMD 1U3HB 3LNMA 2LW3A 3Q5YA 1YRKA 3DMMA 5G5DA 4OZIA 1XGEA 4XN5A 3BLBA 3IARA 5G2IA 1JMZA 1UUSA 1MHHA 3TJIA 5H1WA 2VOTA 5B39B 1TENA 1V55B 2ZNWA 2WNQA 1TPC1 2HT3D 1SLWA 3B0PA 5LNWA 5GRJH 5CHNA 3VGFA 3A9IA 4AHPA 1PQZA 1AKPA 1BFNA 5LGKA 1ME8A 3DRTB 1ORSA 4H7VA 1FH8A 1HKIA 2ADFH 2OMVB 4IRZA 2ZWNA 1MJ7H 4MPKA 3RPTA 2AEIT 3ZHFA 3WU1A 5ABGA 3B2MA 5D7LA 5HNNA 3LXBA 1KPRA 4GABA 3C5JA 1CF8L 3N0AA 5E8EA 1GOIA 3MMEB 1PY0A 1NCNA 3O0LA 1TR9A 2WHMA 4WTXA 2A2QT 3ZDYB 5K9OA 4LFHG 4O1CA 3V6FB 2N7SA 2NTFA 5DA0B 2I07B 5EWIH 2YK1L 1PDKB 5F1OB 1QRQA 2YCLA 5BROA 3I6KA 3UR5A 5JH1A 5C3TA 4PLOB 1U8OB 5KBPA 3ULUE 1M9WA 3NYKA 4GXVL 5EN2A 5C1MB 1GHSA 5HULA 1FWDC 3L9EA 4U6XA 4I1RA 1RZ7H 5GRUH 1FRGL 2I60L 3KEHA 4TKWA 1ICPA 4IDLA 2IG2L 1OD8A 4US5A 3ZXWA 1M7JA 4JTDA 5U7SA 3EZJB 1B2WH 2O61B 5E8OA 2OK0L 1FZMA 1CBJA 2DIBA 3L3JB 1YPZA 2J7FA 2HTMA 2OMZB 4AC4A 5DD0H 3GSVA 3KBSA 2QSTA 1EAPB 1TZ7A 4MSWA 1BM7A 5DHYB 5CJ5A 1E5JA 4WJ8A 4HS3A 3MRQA 3T2QA 2CKSA 4XVDA 5FB8B 4NQ1A 3IKKA 4KKLC 3GO1L 2BK8A 3F85A 1C8PA 4QRPE 2GFBA 4U05A 3N13A 4XMPH 1Q90A 4Z8FH 3AYSA 1E9YB 3TW7A 2B3RA 4H88H 1PZDA 4HS6B 1A0QH 1UT1A 2CIKA 5FK9B 1I7RB 4MWAC 3RLSA 1O1ZA 3N1AA 2VCCA 1KLUA 2PDMA 2UXVA 1H5BC 3SKOB 4ZTXA 2VDKL 3AU1A 4IBWA 3HNSL 1XF4B 3CDFA 1J12A 2UXGA 2IDUA 1HQ4A 5INCB 4QWWC 2ITDB 4BEIA 1FDYA 1U93B 2C0AA 3QHFL 2CA4A 2VD9A 1ZHLB 4P7RA 3QIWB 2W65B 3RGTA 4Q9RH 2EAWA 3QPEA 2EYSA 2PDWA 5AKQA 2H6OA 3CGTA 3PZQA 1MAMH 2W07B 4TUOA 2EE9A 3HQ1A 2IDSA 3B3IB 1JUBA 1XQKA 4PB9H 15C8L 3NG5A 2EXSA 2R9HD 4U3SB 2VDNL 3S1VA 5DURD 8XIMA 4BA8A 2Y1VA 5D93C 5A95A 2V6HA 5ACZA 2XSXA 2ZYRA 3MGOB 1LO0L 2A4EA 2C1PA 3ARBC 2WWOA 1TZGL 1E4WH 1WISA 4N2CA 5AOJA 4B7LA 1V5XA 5AN7A 3MMEA 3XIMA 4RPQA 3DMMC 4X6EA 4C6LA 3F62A 4BFKA 4L1DA 4PJ8C 1TJPA 4WI0A 2DZSA 3GHTA 3ZVHA 2GQ8A 4L9LA 1N68A 5IM7A 4U6VL 5T5NG 3VRIA 4ZRGA 3UPBA 4PUBH 1K7XA 4LF1A 4AD4A 1AC6A 4FKHA 4Y5VC 2PDXA 4IHBA 4M7ZB 4PUJA 1DUZB 1Q1JL 3W39B 3HE6C 1OFEA 3FC8A 3ALWA 1REQB 3BC9A 2YSTA 1KENL 4RMSA 2X1PA 4H0IA 3D4CA 2YAMA 3MLUH 1TITA 1H2JA 3OSVA 3M1BB 2OFJA 3O8AA 4YUEL 1QFUL 2QBWA 4YAQB 1RSCA 3MP5A 2FYYA 2A0NA 2Q3OA 2YDSA 4HSOA 1V7YA 4JQIH 2EUVA 5HD8C 1P4CA 5DJXA 4QXWA 3RNQB 3QF0A 4BK9A 2YAQA 4EIBA 2ZAHA 2PGFA 4GJIA 3S5NA 2ZCHL 1SN2A 1R6VA 1GR7A 1ID5I 3MVIA 1DYZA 4KVPA 5EEUA 4ZFZA 5AFDA 2ZG2A 1S9VB 1ZT4A 4OUIA 1BEXA 4HPJA 4P46C 4FA3A 4MAYC 3MOAL 5IBUG 3O05A 5I1CL 1XO8A 2UWEF 5E2WH 5C0GA 5IHUL 1HAUA 4JFXB 3PN8A 4H4IA 1QTSA 4AY0A 5F3BA 2EVGA 3WBWA 5BRZD 3CXDL 3CZLA 4LQFL 1KFCA 3L21A 4RL3A 4LF2A 3DCPA 3TH6A 3DVIA 2HS6A 2W9EH 4J5NA 3JWOC 4Q8MA 1FFPB 1SO4A 2HBXA 1UR8A 1HH9A 5IKCA 4HD5A 2ZWKA 5IEKA 1NCCH 5F8RC 4ZFOA 5IB4B 3GNXA 1T2JA 4DP9X 4GIRA 2PTVA 3TIEA 1H8NA 2C7UA 3KYNB 1SJDA 3E5PA 1TJHL 2WWKT 4TUJB 3NTYA 2DEXX 2EEBA 2W0KA 2YN3A 3WV0A 1YX1A 2AJVL 3ULUF 1A5NC 1AE6H 1Q0YL 2VNCA 3S35L 5F7LB 2VDKB 2XTJD 1NA8A 3CVBA 1O4UA 4QCEA 1MW0A 2XBZA 4X6DE 3VFWB 3EUUA 1HESA 3QIBD 2ZZ1A 5I19L 3ATBA 4YDZA 3MX0A 4Z78B 1H0DB 2GGHA 1OW0C 1QRNB 1BFVH 2Y2TA 1KNWA 3AIQA 2H3BA 4D6GA 3TYFB 3AYVA 4Y19E 5C2CA 1QLEH 2QJMA 2Q6WA 4NKCA 1F3RB 2C4FU 3E2HB 1E90A 3P82A 2F08A 4ZX3A 1BFVL 3KG5A 1HJSA 2PXYC 3V2AR 2GZXA 1QVBA 5KS9F 1FDJA 3CUXA 3T1FA 2QSCH 2FJHA 2GAZB 3KPPB 2P7TB 4HZ8A 1MFBL 2KUTA 4NZTL 1QSFB 3L4TA 4UXDA 1GAFH 4FQJH 5GVJA 3NA9L 4HGKC 2Z7YA 3ZTJH 1G7IB 1V54B 3CK5A 2VITB 1M68A 5D6DA 3IUDA 1ZGDA 2N7AA 1U1HA 3NQIA 4A7VA 3RGVC 5IJVA 3MCG1 4Z7OB 2DQGH 2AK1H 1BEYH 2XFXA 1R3HB 4D9LL 2VLKE 5DWUL 2EKJA 2C1OA 4KRPB 3I9IA 2XWEA 1ED3A 3ZS4A 2QYGA 1A0QL 2VN6A 2DQEH 4PP2B 4RLIA 4JHAL 1Q72H 1H6EA 5DK0A 3HQPA 5IVZB 1S9VA 1YEKH 1U0QA 1FL6B 1T1YB 1YDPA 3X3GH 1B30A 4Z7NB 3O45B 5TE6H 4RRPG 1DE6A 2V2WA 1XGQA 3S9DB 3WDPP 3FA3A 1JTTA 4A6YB 4ZX4A 4MMZC 2XPZA 5J5EA 4LE8A 4QHKJ 5IDIA 2BVUA 3K6DA 3M86A 5PCYA 5KBLA 5C55A 3EYUH 1O9WA 3KYKL 3AWNA 4UFHA 2QMKA 2YWYA 3BVDB 2FT6A 4P9HH 3KPSB 3BHBA 1LDPL 2B1AH 1NDTA 4PV9B 4Q7BA 3EJSA 3EOSA 4LY4A 2O0TA 5CGQA 2AABL 4PCPA 4R0LB 4AH7A 1NLBH 2VR5A 3SDXE 5IVXB 4FEZA 4AZ7A 3LU2A 4ZR8A 1A4MA 4JHUA 4EAYA 2RJHA 1BWLA 4JQ3A 4KZEL 5DI8B 4JRYD 2HDJA 2QDWA 1TZIA 3CE1A 5EU5B 4CVWA 4PW4A 3W83A 3OEXA 5BWFA 2X2JA 1NMBH 5EZIH 4H9TA 3H42H 4AVFA 3FAWA 1HCZA 2X4QB 1XCTA 4P4RB 3LCYA 4P8QA 1JF5A 3UCDA 5CPQA 1WWWX 5A8MA 4TQEL 4KROD 3LV3B 2HQAA 3EIFA 5F96H 3NBNA 3W2UA 1BFTA 4KVNL 4WI4A 3P0XA 4HBKA 5DJCB 5JUVA 1DBBL 2VN7A 1CLOL 1O5DT 1T89C 3AACA 4DO4A 3OVGA 3UBPC 4EUPH 3WEXA 4UQ9A 5D6CB 2G41A 2A5UA 3U0TB 2QVNA 3CH0A 3TLRA 1S5IH 2GIMA 3E0VA 4WO4D 1NDWA 1F58H 4TSAH 1MJJA 3L3DB 5E94B 3R2GA 3RLVA 3GXNA 2VEPA 4JKMA 1ICSA 2YGOA 1CR9H 2D7TH 1FL3A 1TETL 2X4SA 3IJYA 5IJVB 2Q3RA 3NWRA 4PGEA 3V0UA 2O5XL 3BPCB 4ADGA 1HWWA 2KX9A 1OCZB 1FZOA 4I5BB 3OKMB 4PMFA 2EADA 1SO5A 2DV0A 2OZTA 5D9OA 2UWEB 2VM9A 2O4MA 1JPKA 1F8TH 2WSYA 1TA3B 1K4GA 2EIBA 1PKMA 3NDYE 1JCMP 1DVXA 3JT2A 3F6JA 1R3KA 4Q4OA 3VOHA 4L8BA 3BZ5A 2WWMD 5LBSA 3BT2H 3L1EA 3RWFB 1MXSA 2QCHA 3LB6D 2XSAA 2D1ZA 1QSFE 3IPWA 3R0DA 1IL1B 4Z76A 4URIA 1LUCB 4KTEH 1NMAH 3EJYD 4P2QD 1IE4A 1TWSA 1Q1PA 4K3DH 4XAYA 3RHGA 4QRTA 5AYBA 2YAOA 2XETA 3LH2H 1LHZA 2XG5B 3MA9H 4BFGA 5J13B 1G9NL 1B4JL 4XCFH 2OYKA 4BCYA 4P5KA 1B1YA 4LEOB 1XGRA 1WLHA 2XWBB 4L9ZA 1EPFA 3TS8A 1D5ZB 4WXZA 1JK9B 4AVOA 5RUBA 1YEFH 3XINA 3TEVA 2J27A 3QUZC 2V7HB 2XA8H 1Q7MA 3P4LA 3V9EA 1TJXA 3E6FA 4UILH 3QC0A 1UXWB 3V0DA 2GJ6A 2D2CC 3DBXB 1YMMA 1CICD 3OKDB 2PPEA 4L7ZA 5E0CA 4YN5A 4N28A 3OZYA 4PVLA 1GKQA 1NGWA 1RZIB 1ZVYA 3BKJL 4G80B 3GMMB 1KN4H 1G1KA 1KGYE 1WBZB 2XQYG 4HCRL 3SGDI 3D30A 4WWPA 3QZMA 1ET8A 3K5XA 4N2BA 3NZ1A 4GIPD 4MXVF 3ITVA 3W84A 1OTUC 4HZ7A 3IXTB 1JR1A 1TPH1 4HCRH 3MRGB 2NW3A 4Y6GA 2BNRE 1AQKL 3BZEB 4MNLA 3NAAL 3C5QA 4HK6A 4NZ5A 3KWVA 4NC1C 5CFHA 3BP4B 3QUXD 2QF8A 1A80A 4MB1A 1I8IB 1YQ2A 2WINA 3KJ6H 3U36A 4G56A 1OE3A 1XDMA 3W38A 3LBOA 2ZSVA 3FPXA 1YKWA 3EYVB 1U5VA 1K4DA 4QHRA 1MJJB 3L3DA 4MJ5A 4BQ9A 3QORC 1G4TA 4NQDB 1ANUA 4NRXB 5LXXA 2D7OA 3O0KA 3ZE1B 3PG9A 4BQ3A 3CSBA 3DX6B 1UQYA 5DJAA 1JWMB 1IU1A 2IFGA 1U58B 3KS0J 3ITYA 3TBCA 5E24E 1QNVA 4ANXA 1QFPA 4CU8A 3BGMA 4H1LB 4EN3C 1T41A 3BDXA 1AG1O 1TO5A 2I7GA 5F7AA 3N19B 2WVSA 3GSNH 5IMMB 2BMBA 4H00A 1OAKL 2DQIL 3I75A 3U2IA 5IB5A 5GS0D 1C8YA 4DAGH 1F2JA 1NOUA 3ML9A 1OK6A 3LH9A 3WJYA 3BMWA 2ORBL 3RVWD 4CW1B 4OECA 1DSWA 1A02N 4N9OB 1X5AA 1ROWA 1MKFA 1FHVA 3KLHD 2E3ZA 3SAZA 1W0VA 3CMOH 3CVCA 5DD6A 2XQ0A 4YHYC 2Y1HA 4X7DC 1P1MA 4DFHA 3ARWA 1US2A 5FYJH 2DQFA 3WTVA 2DMHA 3VOFA 4Y88A 3DO3A 5E2WL 2Z1SA 3C60C 5GGRY 1RBLA 1KPUA 1J6OA 3BVXA 5K9JH 5F8QC 1XGRB 1O95A 1S78C 2OTWA 1NSNH 2CM6A 3S8FB 5L8JB 4F2UA 1XIDA 5FUCE 3AMCA 3CJJA 4NL1A 5DN1A 1G7PA 1KRMA 3LV6A 5D1QB 4XP4L 3WFZA 4IBSA 3B97A 4GSQA 3NPXA 5M1TA 1BAFH 4YHLH 5GJPA 1BZ9B 5DBUA 3QGVA 1L9TA 4R3UA 1L6ZA 1SXSA 3FTGA 4ZW6A 2BERA 1BF6A 2X8RA 3IXAA 2IALB 3PLYA 1L6WA 1R0MA 2PU1A 3T0VA 3T8XB 4FG0A 1XCQB 7ODCA 1E5YA 5BXTA 2YMXH 2XGBA 4YTRA 5KZCD 3I6RA 1B3JA 2NXYC 5ADOH 3MDJA 1NGXA 3QEUA 1F86A 5I1KH 4DWSA 2KERA 3ARGD 4WJEA 1MEXH 3O2DL 1XB3A 3AHYA 3UY7A 1E9QB 2YQBA 3WMQA 3MJ7B 3SY1A 1WTLA 1XHGA 2FGWL 1XLCA 4JHWL 5HPCA 1DLHB 1ESOA 3B9KD 5IRPA 2JH2A 3IRCA 2V7NB 5CILL 2HH0H 4L4TD 3NZRA 3LRMA 3ZE0E 3L65A 3LKSA 4D8PA 3W73A 4B5XA 5E6ID 3VFGL 3V0IA 4Y2NA 1LP9B 4QIRA 2BX5A 5CO1A 1IWPA 2XN9A 3B8YA 3HAEB 4KK8C 1AXTH 4P4KA 4RGMC 5EBLB 5L4JA 5A6BA 2RALA 1M6UA 4YHNA 4UINL 4AIUA 1Q4NX 3G5ZA 5E2UL 1UVQB 5HI4D 1DDTA 2OMBA 1RZJH 4CSPA 1BWKA 3QHMA 4A2SA 1AHWC 3HB3D 3Q8AA 1VRXA 3FBKA 5D7JB 1V79A 1TJ1A 4U1SB 4GMTL 2OLDA 2F1BA 1BX2B 3BW2A 1XSKA 4PJHB 1ECYA 1BAWA 4DBWA 5HYSB 3LKPA 4N90E 3TJHD 3OB8A 4JKPL 4TVPH 4G7SB 3WSQH 4AGMA 5B80A 5A2KH 3WD5H 3T09A 1XYMA 4LV4A 1SJHB 4LOCA 2GGGA 3RM4A 1LBMA 5L88H 4NYUA 2DQEL 2C9VA 2ZUQB 1I2NA 3AC0A 1CU4L 1WBXA 3EFDL 3R06B 4F9DA 2ROYA 3EADA 3L3OB 4D9QE 2DT2A 4GWEA 4NNAA 2F5BH 1KM0A 2K8MA 2XPGB 3CXHJ 3QWQB 2BRQA 2YO3A 1M7DB 3THML 3UO1L 1U3YA 3WFDH 3CX5K 4BWWA 2XT1B 3HC0B 4XWGL 3AG2B 3JYCA 4GVFA 3GLEA 4HHWA 1N3NA 2CLKA 5IHUH 2HLAB 3O6FC 3SE3A 3NXFA 3ENEA 4JL2A 5D4YA 1IZJA 4NKIH 2HKFL 1FY6A 3HBLA 5EOTB 4UTLA 3UA3A 4LSQL 3RIAF 1TU2A 3O1NA 4Y2DD 2GJZB 1MCIA 2G0KA 4PMVA 4FD0A 5ALBH 4LOUC 3VXUE 1HO4A 3KW3A 4C7GA 4DWDA 5BVPL 2I25N 2E8ZA 4CAGA 2VJ8A 2BDNL 4JPIA 3VU2A 4M6MH 1B0RA 3DUHA 4P9MH 3CV5A 2RFXA 3FUNA 4K3JH 5FM5M 3AXMA 4AXNA 3S5LA 5EORL 3O9WC 3IIOA 4M7LT 4UU9A 2V5JA 4PSRA 2EXOA 1QOQA 5DELA 4CQ8A 3ZZQA 3C6SA 5SWSD 4TTGA 4PJ8D 3QC5X 3VFRA 3SE3C 4C1KA 2XX1A 5TQ2H 4PLNC 5D55A 4RGNB 3P73A 1AO7A 4ZMTA 1WOBA 2Z29A 3NG3A 8FABA 1IWAA 5LNEA 4F3HA 4ZS7H 3JZUA 1H3UA 4KX9A 2NY2B 4BQ6A 1HDMB 1ZTXE 3CT2A 2QCEA 3PP3H 1QSED 3N15A 3DTXA 2DZUA 4XNQB 1IKOP 2ADGA 5HWNA 1XL4A 2VX6A 4NAFB 1BIHA 3D39D 4JTIA 3DHMA 2D9QB 3LHUA 1DQDH 2NPLX 2AHIA 1DWGM 4GYKA 3F65A 3QUYC 3Q58A 1D3CA 3W86A 1X5KA 1C1EH 1PZ5B 4E4PA 2UY4A 1QPNA 1J1OH 4IQEA 1Q7QA 4IPIA 1D3HA 2EGZA 2VH5H 2NX9A 2Z4GA 3BAWA 5DYFA 1IIHA 3MUHL 3KYNA 3CLWA 5B1AB 2VM8A 2FPYA 3OKYA 2AXGB 3NZUA 3V5CA 5IREA 4I8YA 3AY4A 2J9ZA 3L6FB 3FO9A 3QCUH 1J5DA 3X12B 4PW3A 4YSDA 1RFDH 4FFZH 1K8XA 1MFDL 3T08A 5FJTA 3F7VA 5J56B 5J1AA 4IJRA 4GMSH 4K9JA 3C08H 2HZHA 3STLB 2FEEL 1JGUH 2RTTA 3ROOA 1MG2C 4PGBB 5LBSH 5C2XA 4XBJA 5AW1B 1YNYA 1XF3A 1OGAD 1PY9A 2N1TE 4HEPA 1X7FA 3F6LA 4F7CB 1Q72L 4WRHA 3CX2A 1FHUA 5DK3A 4XISA 1JE6A 1VFOA 2A6IB 5KSBE 3O0RL 1I0BA 3HC0A 1K70A 3PWJA 4J3SA 1GA2A 3G6DL 4EI5D 2Q09A 5ACLA 1CXIA 5KSBB 3OA3A 2IDCA 3MRKB 5ILTL 3IE4A 4KWWA 4KWOA 3AFBA 3NQVA 3GBNH 4OVXA 3IGLA 3TLQA 3HPXA 2WZHA 4EDXA 4N3UA 5A3IC 1TU2B 1H5VA 2HXUA 2R1NA 2PR9A 4XX6A 4NRYB 5BO1H 1WWAX 4IQHA 1BW8A 1CGYA 2R2BA 4C7FA 4NM4L 3WHXB 4XB3A 2OX1A 4HKJA 3EOBA 2FL5A 2H8PB 4TV3A 1OCCB 1SDDA 2YPVL 4Q8BA 5DQ9B 5H2BB 4HKXA 4XMVA 1OYBA 2BGQA 4XQ6A 4FFVC 1CCWB 4X6CE 1B3WA 3QIBC 1XYCA 1PZCA 5REQA 1DQKA 3SPGA 3SDDC 2J9XA 2A38A 4FB7A 3VFOB 2XX0A 1I9IL 5F7HA 1A5AA 4S3FA 3PABA 3BMXA 4GZEA 4KFNA 4DZBB 4PTUB 1ADWA 1XGPB 2MPAH 3HI5H 3T6ZA 5H35A 4EPKA 2HRWA 1OAZH 2AJXL 5FHBH 4ZENA 1EC9A 2CBQA 1LMKA 4BYHA 2PXYD 1LG1A 2VDIA 2YW3A 5GRYA 3B4NA 3I6SA 4HJGB 3PWUA 3MCNA 2P5EA 3BD3A 1M1XB 3OKOB 3QDHA 4MBRA 1UYWL 2BIOA 3KPOA 4N6RB 4O51A 3SKMA 2R82A 1WD8A 4HCHA 4FP1A 4FI7A 2PPCA 4BHUA 5E5MA 5D8JH 3N29A 3WYZA 3D5OF 2DBJA 2XV6B 1A4LA 2BZNA 2B2XH 4W9KC 2WJ5A 3APFA 5L9FA 3BAJA 5EEYA 4L5FE 5EOQL 1XZ0B 4BKLB 1OGAA 3WNIA 1EHLH 2CKBL 4QRRD 3N44B 3WJJC 2MUCA 4FFYH 5I1DA 1B2YA 3FKUS 1YAIA 5D7IA 1EB3A 1TIWA 2X1RA 1GZHC 2W88A 3MV11 3LCWA 2FZ3B 4PJ9B 1AR1D 3P69A 5I1AB 2Z1XA 4KMTH 1FXPA 3B9KB 4L4VB 3WMLA 1ZHKB 3IIPA 5I0DA 3N4AA 4R4NC 3PNRB 4JY5H 5CZRA 1MXGA 3VAEA 1RZ8B 2W94A 3WL9B 4CGUB 4LQFH 3G0XA 2CLHA 4OFCA 4MGGA 4GQ9L 4IOFD 1QA9A 1UJ3A 4Y4KD 3WZ0E 3ECBB 1UKSA 3DVFA 2OPJA 1N5YH 1CC3A 2VLME 5FGBC 4JHVA 3TVMA 2EPLX 3H9HA 3OZLA 3OZPA 3E8UH 5F3FA 3WKNA 5IGXH 1N0XH 1NCBH 2QPFA 3EHBD 3MKGA 2C1HA 1N4XL 1YSOA 3FT4B 3UJEA 5GHWL 2EDRA 1AD9B 4HD9A 4WENB 4MA8L 4PJ9D 4WSGA 4JPQA 1OIFA 3WMBA 1Q2SA 3APYA 1J7VR 2CRMA 3GBML 1GG0A 1JQVA 3ALFA 1R5IB 3GNNA 4X4ZA 3V5DB 4QUOA 5IY5B 5GS0L 3VU1A 3FFOA 1KCRH 2EDWA 2D4DA 3MSPA 1QASA 1EERB 4JB9H 3D0LB 3TZNA 5HWMA 3N1QC 2X4UA 2XKNA 1R5WB 1G1YA 3AM8A 1TTIA 2C13A 3TXVA 2Y7NA 3KVDD 2QADB 4MKMA 3LLXA 4AT6A 1O94A 5LNRA 1K03A 4O2CB 3GKZA 4WUUE 5I8KL 3TE9A 2CGYA 2IPUG 4B41A 2PLJA 3SN6N 4QTFA 4NIRA 4Z0SA 1CDUA 3HE7A 4HDIB 5CKAA 2X7WA 3IMRA 3LHTA 4HPYL 3GKWH 4K07A 4O12A 4N2AA 2CXGA 1UH3A 1ML0A 1Z2KA 5BV7B 4AM0A 3C5ZB 1T20A 2KZBA 3N0PB 1DBTA 5C9UA 5K9KA 1KC5L 1E7VA 1U5JA 3NO5A 3WQ5A 1NIEA 4OQTH 1LYXA 3MYZA 4RGNC 5D7IE 1IGML 4M3JA 4FLOA 4WO4C 5E5RB 1WBYB 3FQ4A 4MJ2A 3FXGA 4DKFL 1HEZA 1I9EA 3ZR6A 1ISWA 3E0WA 3CO8A 3S46A 5BS0E 2IH3A 3O3UN 4KKCC 1OFQA 3AREC 3N2BA 5SWSE 3L5WB 3IAPA 5E9DD 3ZKMC 3RDKA 1OWWA 2PCYA 1RJLA 1AY1L 1MELA 5D4JA 1MLCB 4Z7QE 2DV6A 4W87A 4C6JA 3WKPA 5I1DB 4H1LG 1O5PA 3V4UL 2X0UA 1BXVA 2CBPA 2YD1A 1GIGL 1J2WA 4XOAA 1JD7A 5E5UB 3FKKA 4KKNA 2VUKA 3F05A 2XWCA 3T0EA 4Y1TA 3G5VA 3SE4A 3LNIA 4OOUA 1G7HB 2F7RA 4DF2A 2Z64C 1GVIA 1NCTA 2HVJB 2V68A 4PJBF 1CN4A 4GKSB 4FYTA 3VFMB 2XH2A 4X8CA 1LF1A 1FO0L 2F58H 4UIKH 2F6AA 5IBLC 5FOOA 4R2GB 1JRHI 2F74A 3DIFA 2R7EB 1XTLA 3GXFA 1RCOB 2VLJE 4AX7A 3MBEB 4A2RA 1I8KB 1B9BA 1ZV9A 3V0WL 2WQVA 4A35A 3FJNA 3BLFA 1GGIH 4PTMA 3DIVA 5C0IB 3C0LA 4NNCA 1IFRA 3BQUB 2XXGA 4MDPA 3WCZA 2G2NA 3GO2A 3EUDA 1H1YA 3CHXA 4OVVA 5HYFA 1K4DB 4MD4A 1A5BA 3W2DL 3AAZB 1N82A 5T1LA 3VXUA 3HI5L 4M3HA 4H26A 2X10A 4Z0XB 4QO1B 2A7RA 2YLKA 2IPWA 2V2XA 1Q6DA 2X1UA 4KHTL 2IDTA 4GI9A 4E0RA 3GQYA 2D31A 1G6RL 2FWLB 4E36A 4OCMC 2FECI 2F7OA 1JXKA 3FN3A 5CCKH 4H1LA 3H4GA 2YSWA 3ITTA 4ZDHA 3T55A 3TN4A 1S39A 3VFUA 3T2NH 4IGHA 4KHTH 1BQCA 4FYRA 4XXCA 4H0HB 5HGHB 4PH6A 1MY5A 3MLZL 1PKNA 4URTB 2R2CA 1EWEA 5LSMA 1JGDB 4AM0B 3VKKA 3TW6A 4UMSA 4TQTA 2HT2D 1WDSA 5FO8B 4RZCA 5D5MF 5ADOL 1FWTA 4EUPG 1KFEA 3FTZA 1U3HC 1B54A 3R19A 4ROPA 3TMLA 3U1SL 3SCOA 1AG0A 3QORD 2GB2A 1BXCA 2Z1BA 3TJPA 3V8CA 1YUHB 3D3VE 4DGYL 4QJ5B 1IBYA 2XYCA 1KJ3H 3LOTA 3L2MA 2X0SA 1XF5A 2FLRT 3IDIB 1M4KA 3CFEB 4KRPD 3HKFA 5FCUL 5LBSL 3K0WA 5I5RA 1XF2A 1F6PA 2OQLA 3M0JA 2XXMB 3OWRA 3SKNA 1NOAA 4FNTA 4ZQTA 4NWUH 4J6IA 5LQBL 1W72B 3UZZA 3BIKA 2A7PA 4P7LA 4HFWB 4ZGYA 3EAUA 4PD4J 4WI7A 1IAKB 3EDEA 3QE5A 4C57C 2CNCA 1DVFA 4CRPA 2AQQA 2EDHA 1XS2A 3R11A 3MDWA 1DN2A 1UCTA 3RA7L 2VLRD 1T7YA 1XCQA 1S6NA 2W9EL 4LPUA 4NJ9L 1NCAH 3ISWA 4RWYH 3LCLA 4NY2A 3FNDA 2YBTA 4XXWC 1R3QA 4Y9MA 4PB0H 3V0GA 1J4EA 1TR1A 4MKNA 2GSIB 3HRPA 2OT1A 3RPMA 2CDGA 3W22A 4DCQB 4EVNB 2VXTH 4MJ6A 3S4SA 3AMKA 5AZ2H 3O3BA 1DIDA 3R7RA 3MLTB 4A2GA 1S9XB 1MCFA 3C60D 1I8KA 2UZYB 4BFRA 3I7RA 4ZE5A 3ES6A 3OHXB 1MHPH 1J2BA 3V79C 2PYEB 5HMSA 2O5ZH 3OIHA 5HHME 1NEUA 5D5MA 2ACSA 1ROCA 4TTUA 2Q20A 3QYCA 3SOTA 5HHXH 2CLFA 3FK4A 3MMDA 3HMXH 3H55A 2DY3A 4UTWA 4GUPA 5EU6E 2WBJD 3RJDA 4FGMA 5IQ7L 4WTQA 4TUKH 4F7MB 5EG6C 4QGTA 1HHIB 2AAAA 3OJMB 3HPJB 5D93B 5CIPH 4ZFQA 5CEZE 3T0WA 1FH7A 1SVDA 1BBJB 3HM7A 3SGDH 4QRAA 4WLCA 1S9YA 4AQ1A 3MRNB 3QCTH 4IL2A 5DHVH 2R1XA 3U30C 4IGMA 4UDUA 1HO1A 1WUFA 3GB7A 4NM4H 3VNZA 2OZ3A 3KXFB 3NAAH 1NBCA 5GGSA 5KYUB 3BD4A 4WI3A 4Z7QF 1UCWA 1OF2A 1VSCA 4NVTA 1AGCB 3H9YA 2X4NB 3QNZB 4N0YL 2QUMA 2PCPB 1YEWA 4G43A 4JKLA 3DBNA 3AQZA 4N9GA 2FJFB 5IQ9B 1Y07A 3C2EA 1BKSA 1O6SA 3T6WA 4KBXA 3RJOA 5I3KA 2EH8H 2NNCA 5JIIA 3WH6A 1QEWA 4WU7A 4EI6A 3UOAB 3MTWA 5J6GB 1XFPA 5BNKA 1V10A 4TTDC 4ES8A 1CT8A 5B38G 4J7RA 4OHQA 4IMGA 1VS1A 4FQLH 4YDVA 7FABH 5IP4A 2GEQA 3UYIA 3D0VB 3SUUA 3QV6A 4W7VA 1F3DH 3QG6A 4KQ3H 4ZOAA 3VINA 3GKAA 1QSFD 2G3XA 3RWHA 5EEXA 4U7MA 3RF9A 5FUOH 3WE6A 5MERB 5I71B 4N42A 1A7QL 2PUZA 5AHEA 5I3HA 5DRNB 3FQNB 1KBWA 5FYLH 4LESA 3KL5A 5AKRA 2YUWA 3M16A 3LG3A 3IRZA 2F5BL 4KOCA 4UF7C 3SJ3A 3O8XA 2BNQB 3FCTB 2HROA 4JGMA 4JO1H 3TZVD 2QAPA 5F0MB 3K2IA 3V4VL 3U4FA 4NN7C 3MV9E 1OARL 4GW5B 2WLIB 4O0ZA 1T7XA 1BQKA 3O6KH 3FCSA 2FMOA 2ZZ2A 4M4RB 3DJTA 3EYOB 5ISZA 2J24A 2Y7QA 4GP4B 1YXCA 3U2OA 3K5RA 4PS3A 1ZIAA 5CF3A 1ZGLA 2NUPA 4Q14A 5H94A 2ZAGA 3LYEA 2UVEA 2CDFB 4MLRA 2Q1EA 4L8DB 3R58A 3NA9H 1QWNA 2I14A 3KPQB 3B5HA 4D6DA 3HZYA 3NSDA 2VDML 5CCKL 3EWYA 3IFOA 1YMMD 5GS1C 1LQSR 3H6OA 1JPFB 2MH4A 1DQJB 2HG5B 4HCGA 3C52A 4JFZL 2HUHA 3DVNB 3DX0A 3P93A 1IGMH 4RGMB 3WAJA 1VGAA 1R3IH 3MLSL 2EZ0C 2CJUH 4RZ5A 3C8KB 2JJSC 3OJDA 3VRIB 2EG7A 1TJ0A 4I0KA 2EH7L 1X7IA 3F5JA 2X42A 2BHFA 1DUYA 1H3TA 1IFHH 2GBAA 1FDZA 3PNZA 2XH0A 5GS2H 3F2BA 5BRBA 5DJYB 3X11B 2WWKO 3K46A 1LO3H 1T99A 2FJGA 5HYJD 2AQ2A 5DD3L 4LSSH 2JTYA 4NPJA 3H2FA 3BRDA 4PYGA 4U7SA 5CUSL 4RXGA 1PBYA 2Z8WC 3GJFB 4JYDA 1TB3A 5IM7B 3T77B 5JXQA 4LAKA 4EI6B 3VI3A 4PJXE 1RHCA 1T0MB 1Y0LB 1FX6A 4N8VG 5ETUB 5IW6B 4JKNA 1ID2A 2GWNA 4AMKH 3D0VA 2JKLA 3SE9H 5L6UA 1VRDA 5DJDA 4NQCD 2UXFA 1KOAA 3SIZA 4JKWA 2FWOA 2K6WA 4Y19B 2HMID 1NPNA 4GMSL 1UPPA 3A3XA 1TV7A 2CLIA 1K5NA 4QNPF 2AJSH 2GQ3A 1T7ZA 1VFMA 5C07D 2R2BB 3GRWL 2APFA 1LROA 1XG3A 1I7TA 5A6AA 1RY7B 3VG0L 4HOWA 2EKGA 3GDLA 3F7YB 4X6FA 1L9RA 2ZPKL 5DJZA 3P5ZA 3PUEA 1OSPL 2YR3A 2J88H 3RQ3A 1LORA 1BBDH 2AXHA 2FIQA 1NGZB 1UQSB 1VPYA 3H2AA 4MZ8A 2WLIA 3LAFA 4JN2A 2HKHL 3ABSA 2F8QA 3BZJA 1PX4A 4DQOL 3ZWTA 4DZBA 1VLXA 2M1KA 4V1DB 1BYNA 3D18B 2E9MA 3NACL 4NYYA 1XR2A 3GYCA 3BANA 3IGHX 3QHZH 3V7PA 1KCBA 1MCBA 1WBJA 2VABA 5EIQA 4GG6F 3WFBL 1Y6MR 3U48A 5AYZA 3UYRL 1SFLA 3AALA 4AZ8B 3O2DH 5F9OH 4B60A 1E6RA 4E0CA 3MKVA 1UM5L 4XBSA 4UTAA 2BRRH 4LRNH 2WQDA 1TV3A 4QRRB 5BCAA 3QWOB 2QVTA 2R23B 3OTTA 2H26B 4FFVD 4HALA 3P0YL 4L1HA 4A39A 2HXTA 4H3DA 2UY5A 4N26A 4WI6A 4AC7C 1GGYA 1TPXC 1T5WA 3FXYA 4OIAA 4D9RE 4E6MA 1BJ1H 5AHLA 4FYSA 3FO1A 2Q02A 4H4NA 3AZUA 4JZJC 1GEQA 2ZRYA 2BC4B 2OODA 5BS0A 4NFDA 3W6YA 4K4KA 3O41B 1YADA 1U33A 5C0BE 2EJ1A 1H0DA 5ICZB 2KZHA 1PSKL 4XOEA 1P5BA 4F24A 2ARWA 2WLLA 1RJZB 2KZ1B 4E3VA 4JS7A 2ZKYA 1ME7A 2WUBH 3QRFM 4MSSA 3ATEA 4KNQA 2Y07H 3DG7A 4OTXL 3UAJA 2BMKA 4FJZA 4ZOBA 4XPAH 2ZTKA 2W91A 5E2VL 2NY2D 1HZYA 3G3DA 2FJHB 5B3NA 3B8TA 3TTYA 1P1XA 1TMQA 3NCOA 5AC8A 3MOQA 3QRGL 3WH5A 1R24A 3ZQXA 1ZDQA 4JRXA 1GY2A 3CN4A 3GMNB 3MCOA 3RRXA 2DVUA 2VITA 2XN0A 4TF4A 3RDTC 2YS4A 3VA6A 1G4SA 1CU4H 2VMFA 3EFDH 4YVUA 4UV7L 1RA0A 2XZ9A 1EANA 3ICJA 4B3KA 2NY3B 5J6HB 4TV5A 2WP3T 4HWBA 5LIKX 4JDTH 5C7ZA 2G3JA 4NIYE 5KBDA 2X1SA 1F02I 2XIDA 1K6QL 2XVLA 3O9NA 4LOFA 2WO5A 1FF5A 4A67A 5B7MA 4B4FA 2VUYA 1KRCC 4FX6M 2WJ7A 1MREL 1EJWC 6REQA 5FO7B 3UROR 3QARA 4CVZB 4GVHA 1ZA6B 2MHAB 3TFKD 3RX7A 1LP6A 3SQLA 4DWSD 3D9AL 4Q2ZA 5IJDC 1TQUA 3BRGC 4OLWH 1P7KA 2ETWA 5D71H 2BJML 2EHHA 1KF9B 3S98A 3IDJA 1EAJA 1L7TH 5TD4A 4O2FA 5GRWA 4F66A 1P0SE 5JXAH 1T5XA 1DXEA 2BX7A 3LZ3A 4M7JL 2IVFC 1T7VA 4PS8A 5JZ7D 3BOXA 4RFEB 4TM9A 4Z77B 4Y2DA 1Y7VA 3SBQA 4TL5A 4CMHC 4WJXA 4G6ML 2HH0L 4GW4A 4CQDA 2DKSA 4W85A 4TSBH 1UD2A 1CBVH 3BCJA 3CL8A 3LBMA 4EAEA 4UT7H 5CD5D 2ZCKL 2DN7A 3ISYA 1W6WA 4OZHF 1JGMA 3RWGA 3KP0A 5T1DH 3BO8A 4YL9A 2I5QA 2XVKA 1HYSC 3O07A 3QZWA 2D7NA 4NNYB 3IVSA 1X9QA 4GPNA 1JD9A 1U8HB 3QVAA 5IJKA 1L9NA 3OX8B 5I0WA 4QHKI 3U2SB 2IGFL 1EFXD 2ITCA 3QIWD 1IQWH 4B9PA 3U83A 3ECVA 1N59A 1XSJA 1KM1A 4XWUA 5JOFA 2W80C 1FZKB 4FX8A 1GKOA 5CEXB 2PLCA 4E2VA 2VRQA 3RY5A 4IDJH 1QSEA 2C9UA 1G7HA 1AH3A 5AYIA 2APVA 4KS0A 1IGIH 4WZHA 2AJYH 2EEAA 2QVKA 3SM0A 1P2CA 4JZNB 1FNEA 2MRYA 1BD2E 2OR8A 3KDOA 2XV0A 4KPHH 4MWAE 4N2YA 4Y16D 3FTYA 4KKCD 4NC1E 5C71A 2YXFA 4BI5A 2Z1VA 3C6LC 4X2PA 5JHMA 1A0EA 4EQ3A 1U8MA 2CZDA 1F76A 4GFXA 1PX8A 5LHDA 1KFLA 1NMCC 1Q5MA 3AW5A 4U4BA 1NCHA 4UQBA 4WOZA 3T78A 4WI5A 2R1KA 3EAKA 2X4SB 3IJYB 3KPMB 4JFFA 3GUTA 1GONA 1F8TL 2WB7A 4B9GA 5J6HA 2I26N 1UZ1A 1L0QA 3A5VA 4ZPVA </