2XFYA

Crystal structure of barley beta-amylase complexed with alpha- cyclodextrin
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
486
structure length
486
Chain Sequence
NVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-AMYLASE
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
total genus 191
structure length 486
sequence length 486
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xfyA00
2QHAA 3TP4A 4Z2IA 4AZGA 1K9EA 2PWGA 4CCEA 1ODUA 2V5DA 3WL0A 1XD1A 1E3XA 1W1VA 1BFNA 1SFSA 4UQ9A 1C8XA 1W9VA 2D0GA 3K8KA 3WD3A 3L2MA 1HJSA 3VGBA 3DHPA 3MU7A 5ECUA 4QCEA 4HMCA 3MKKA 1DWGM 3AQUA 1K9DA 4PMOA 2ZXBA 4NSBA 1MW3A 4LYPA 1TFVA 5IXEA 1B0IA 3WDHA 3AS1A 2EPKX 2BHYA 3K4DA 5BRQA 1EOMA 4UZUA 2VOTA 3B8SA 2ZX5A 1B2YA 3WQWA 4AC1X 7A3HA 4UFHA 3CIVA 3EMZA 2UY5A 3WMCA 6CGTA 2YBTA 1BPLB 1CPUA 1W91A 3N11A 3WDRA 1SR0A 4MDPA 1JZ3A 1UD3A 1WAWA 2JALA 1VEMA 4UTFA 3VIOA 3WQ5A 4HPGA 3WUFA 1ODZA 2G41A 3WUEA 3CZGA 1NOUA 3ZJ6A 3FAXA 2FHFA 4PMNA 4J28A 5E6YA 1IZKA 3ZT6A 1WB0A 4LYRA 1JNEA 4ZXOA 3KL5A 4AEFA 4AZIA 1LG2A 1Q6DA 4KH2A 3AIWA 5AC5A 1HVQA 3RIKA 5FKYA 2W91A 3EYPA 3WNPA 2D0FA 1W3LA 1W9DM 3U5YA 1DTUA 3ZT5A 4KGLA 4UOZA 1X6NA 1LL4A 3POHA 4PUEA 3FW6A 1S46A 2CESA 3IK2A 1EGZA 4D6EA 3VX0A 3A6OA 3RM8A 2Z1SA 2YA2A 2XFFA 1UKTA 1JGIA 2JEPA 3KL3A 1VFOA 1GCYA 1UD4A 3TA9A 1WO2A 1XYZA 4Y7EA 3SURA 1VB9A 4JHZA 3GXFA 3E1F1 2VR4A 4PTWA 1UOKA 1MW0A 1CZ1A 2J8GA 2CKSA 1GJWA 1VFFA 1HL8A 1RD6A 5E09A 3W25A 1LL7A 3W26A 4D6FA 1D7FA 1H3GA 3BXWA 3AMLA 3A47A 1PJ9A 1RP9A 3UERA 4W87A 1WCGA 2O9TA 3VINA 1BYCA 1QHOA 2OSYA 3VM5A 4AZ5A 4PCTA 1MFUA 4TVUA 3MUIA 4U3AA 5FCZA 3N04A 1QI3A 3BC9A 2CETA 4J3WA 1V3MA 1E1EA 3MSDA 1US3A 2RGLA 1CDGA 1NQ6A 2FGLA 2DSUA 3ARRA 2CIPA 1KCLA 4AIUA 5FIPA 2ZICA 3BMVA 1BG4A 2OSXA 4CVWA 2DSWA 3KEHA 3MSGA 4PSPA 3MO4A 1BGGA 1E5JA 1GOKA 2CPUA 5IFTA 1CXFA 1UD6A 2EJ1A 3CO4A 3WQ6A 2DEPA 2WVUA 2XVGA 2DPEA 1JYWA 3FHQA 2VX6A 5A6BD 2XGIA 4TXEA 3T2OA 4D6IA 1UQZA 4C7GA 3CGTA 3B9EA 2XWEA 1FH7A 4D1IA 1TCMA 4XZWA 3B9AA 3TTOA 2F8QA 5DT7A 1QVBA 3S6TA 3VU2A 3AZSA 2GJRA 3BGAA 1NP0A 1JD9A 2ZUVA 4ZENA 1A47A 2V3GA 2DH2A 1GONA 1PAMA 4EAMA 1M04A 4DWSD 1V0KA 4HOXA 2V38A 3CUGA 1CECA 2WWDA 1OGSA 4H8UA 2D24A 3OGSA 1UD2A 1E55A 3OB8A 3U5UA 5AC4A 1WZAA 4AXNA 4PRWA 4W8LA 4C7DA 2EO7A 3RCNA 3FN9A 1FP9A 3RM4A 3VILA 2VX5A 1W3HA 4W89A 3RDKA 1WDSA 3BAIA 2WVSA 4NZCA 1E71M 3BSGA 4L4PA 3PZQA 4EANA 4MAVA 4MTVA 4HOZA 4B15A 2BS9A 2FHBA 5C71A 4M29A 3WY1A 1E3ZA 1CBGA 2WLYA 1PZ3A 3CZLA 3F5KA 4M81A 3VIJA 3D5HA 3CZKA 4XZBA 2GFTA 3CHDA 3SEPA 5IHSA 4MB4A 1K6AA 1LQ0A 1W9PA 2E9LA 2EBNA 2VZUA 1JIBA 1J9YA 3VIPA 3VKKA 4UQBA 3O9NA 3WQVA 3OZOA 4HOWA 4FLOA 3AOFA 3WL1A 3UR8A 2CYGA 2A3CA 1A3HA 3GH5A 1IV8A 3EDEA 1QI2A 2J4GA 3FNDA 2V5CA 3II1A 2YA0A 1OCQA 3CHCA 2DT1A 4D6JA 3WUGA 2F61A 2OSWA 2WMKA 2YL5A 4F66A 2VC9A 2PBGA 3PTMA 4D6DA 2GDVA 4JL2A 2JF7A 3UG3A 1W32A 4W84A 2RGMA 3WDJA 1PIGA 1V3JA 4QLKA 3NCOA 1OIMA 7CGTA 5LYRA 2J25A 2QLYA 1LLOA 1UZ1A 4UQCA 1C92A 1NOFA 2ZE0A 1XCWA 5CLTA 4AD5A 1CLXA 3WD0A 3W29A 4P7RA 3WF0A 1V02E 1H4PA 3AIVA 5A8MA 3SIMA 3EDKA 3VIKA 1TE1A 4DUVA 2BHZA 4ZFMA 1RP8A 2D22A 3A3HA 3MUAA 5EFFA 1W9XA 1B90A 4MJ4A 2PWEA 3BAWA 3W38A 3DHUA 1QHZA 3MS8A 5D9MA 3ARUA 3LMYA 1Y7VA 2G4FA 1C3FA 1DWJM 1W3KA 4JFTA 1WP6A 3VD4A 2YLAA 2BY0A 5JIWA 1UQYA 1HVXA 2WKGA 5A94A 1MWOA 1QNRA 3N1AA 4ACZB 4J3SA 5GPRA 4E8DA 5BRPA 1GW1A 2VQUA 1AQHA 2NW0A 1E15A 4MNLA 2BVTA 3M7SA 4AZBA 1HJVA 1UR2A 4H8HA 4W88A 1VEOA 5A6BA 1J0ZA 3RJXA 3GXDA 4UQDA 1AMYA 2VVNA 3WIJA 2WVTA 3CH9A 1EDQA 3N12A 3PZ9A 4EE9A 4GXPA 1KR1A 3L4YA 3QHNA 3WH8A 1ZU8A 4PMUA 3GM8A 1UKQA 5HXMA 2WSPA 1V6XA 1JZ5A 1XD0A 4GZIA 1GZJA 4NI3A 4GKLA 1I1XA 2CBJA 3GZAA 3UG5A 2YIHA 2EPMX 2UWFA 3ARQA 4D6HA 4OUEA 1UZ4A 3AS3A 4TOQA 4WJXA 1O6IA 5EBAA 5FOOA 1QNSA 1GVIA 4OJYA 1ECEA 1UR1A 4DWSB 3WNMA 4H7VA 4NF7A 1TMQA 2DT0A 2XIBA 3CHEA 4ZE5A 4ATWA 5CGMA 3BLPX 3TTQA 1VBUA 2WC3A 2E4TA 3NSNA 3K1DA 5TD4A 2VCBA 2ZXAA 1H1NA 4NRRA 3ZR6A 1FP8A 1W2VA 4WSJA 3CHFA 1E6SM 3K4AA 2EPNA 5BXPA 2VX4A 5A6AA 2WVVB 3I3BA 1H0GA 3WD4A 1L8NA 4MADA 3OZPA 5I2UA 2VCCA 3UEQA 3ZOAA 3KE0A 1J0HA 1QBBA 4DM1A 2G3MA 5HNNA 4PYSA 4U33A 5JBDA 4MB5A 1ITCA 3VPLA 5GNYA 2WHKA 1CGUA 4KMQA 3RPMA 5A3HA 3NIYA 1Z32X 5A6SA 2ZWYA 3L4TA 3VIHA 4AZCB 4IPLA 4HMEA 2NSXA 5M17A 3NDYA 1ESWA 4PMDA 2Y2WA 1QW8A 1EIBA 1HKIA 3PZNA 4FMVA 2VRQA 2Y8VA 1F4AA 1CXIA 1E6PA 1TR1A 4PTXA 2PWHA 4BS0A 1QI0A 3DECA 1TVPA 1GPFA 1UWTA 3UCQA 2OWWA 4P7QA 3GNPA 1E56A 3VMPA 3CMJA 2XG9A 2XVPA 3WQ4A 1J01A 4J3VA 3VGGA 2X2YA 4URIA 2X05A 5EMYA 3LPPA 2WSKA 1ZL1A 2W4XA 1C91A 1C8YA 3AMDA 3SCPA 2PC8A 4HPHA 1ITXA 3L4VA 2J7BA 4ATDA 1BVZA 4WIWA 5CZKA 3W24A 1MFVA 4IM4A 5D8ZA 3VIIA 3O6AA 5IHRA 1UD5A 3T08A 5CPTA 1E6RA 4F9DA 2VZSA 5LA2A 3SCSA 3MV01 1MW2A 1H09A 3RJYA 4PN2A 4UR9A 3FXYA 1UH4A 1V6WA 1AQMA 3WDPP 1R7OA 1EDTA 1JZ6A 1J0IA 3MV11 3ARZA 2DT2A 3SUUA 3WUBA 3BH4A 4UQAA 1VRXA 3MMDA 1H11A 3POCA 4L4OA 1CXLA 3M46A 1WE5A 4JKLA 5A2BA 3VIFA 3N17A 3GNRA 3ECQA 1EHAA 3OGRA 1KR0A 2PF0A 2J78A 1GOOA 2XPKA 5I78A 3AS2A 3WD2A 2YJQA 2WLZA 1ZBVA 1E6XM 1V0NA 1MXGA 3ZM8A 4CGTA 2VRKA 4BQ2A 1TA3B 1OWQA 1OD0A 3VDCA 1ISVA 2G8ZA 4HA1A 3UESA 3ZR5A 3S2CA 4W93A 4AWEA 4LXFA 3AXXA 5BCAA 3QOMA 2XM2A 1UHVA 3VGHA 3CZ8A 1EO7A 3GTNA 1TUXA 4DUWA 1EQCA 1LWJA 3THCA 5DO8A 1WPCA 5HPOA 2C8NA 1ISZA 4MJ2A 1JNDA 2BNJA 1J0KA 3NSXA 1B3XA 1UKPA 2OWXA 2VX7A 1X6LA 4GZJA 3UETA 3AHTA 1VJZA 4BQ3A 1MYRA 1UA7A 3M07A 4JHOA 4J7RA 5D9OA 1HKMA 3FHAA 4N42A 4B16A 1EO5A 3QR3A 3VD5A 4DUXA 1QBAA 2WZEA 1JDAA 2QPUA 3CBWA 3ZJKA 4TUFA 1VFMA 4W85A 2BFGA 2E9BA 2CHOA 4B3LA 1PEZA 4BZYA 4X0NA 2ZUNA 1OIFA 3LPGA 1ZS2A 2G3IA 5C8BB 2EPOA 4GPNA 1EXPA 1PBGA 3T2PA 4AMCA 4H04A 2ZX7A 2J79A 4HA3A 4GZEA 2XFRA 4U2ZA 4BCEA 1KQZA 1HNYA 3OLIA 1GHRA 1NH6A 1HP4A 4TVDA 2TAAA 2J7HA 1KCKA 2E9MA 1XSIA 1WZLA 2XVNA 3W37A 1DWAM 4WKFA 5BYWA 3AZTA 2XM1A 4F8XA 1FOBA 4ML4A 1XHGA 3FY1A 4EKJA 3WD1A 1G0CA 3B9DA 5D9NA 1OBAA 1PX3A 3PTQA 3WNKA 2MANA 1TVNA 4UOJA 1C90A 2IXVA 2WPGA 3GNOA 3IJ9A 1HF6A 1XYFA 2C7FA 4HTYA 2Y4SA 1U30A 2YBUA 2VT0A 3VDBA 3L4XA 2BY2A 1C7SA 1JYXA 3ARVA 4CUCA 2CNCA 4F79A 1W3JA 2XVLA 1UR4A 4MB1A 2O92A 1PX8A 2CEQA 1BYAA 1V6YA 1JYVA 3ARXA 2ZUSA 2HVMA 5GQBA 1NM9A 4JKMA 5AYBA 3MMUA 1HX0A 1US2A 3AHVA 3WMSA 4UOQA 4F9JA 1G9HA 1CEOA 3GH7A 4CKQA 2VO5A 2J75A 2D0HA 3RM9A 1PZ2A 1H49A 2ZX6A 4M8UA 4IUGA 2WCAA 4LGXA 4KWUA 2VRJA 1CGVA 2GJXA 5CJ5A 2DIEA 4B3KA 3UR7A 2VI0A 4D71A 3BCFA 4HP5A 5FL1A 1CGWA 2CHNA 4CD5A 1NWUA 1U33A 7TAAA 3W0KA 1KWKA 2W62A 3F4VA 3WH6A 2X0HA 3DC0A 5D8WA 3ZO9A 3LPFA 5A8QA 2DGAA 3RO8A 1OGBA 1GQKA 1JZ7A 4PMZA 1W9UA 4KRTA 1KWGA 2YDSA 1BHGA 3SCTA 1E6ZA 4ZXLA 3SUSA 4FK9A 1W1TA 2O9OA 3APGA 1HP5A 3VM7A 1ZBKA 3WDIA 4AW7A 1E6QM 4U31A 1X1NA 5BXTA 1JF5A 1LJYA 2O9RA 3F5LA 5CQ1A 1D2KA 2WHLA 4W8AA 4CD7A 1UA3A 2D3NA 1R8LA 1NP2A 4HZ8A 4FLSA 1E5NA 5F7UA 5I24A 1V6VA 3OLGA 3U7BA 4PMRA 4Z2JA 2D2OA 4B9ZA 4CD8A 4AEEA 1UKOA 4AD4A 5M03A 2D20A 4OBRA 1DWHM 2EPLX 2JIWA 2X09A 3WEOA 3NJ3A 3OLDA 4P8XA 3A4WA 5IDIA 4JKKA 3L2LA 1UD8A 2EXOA 1GHSA 4A3HA 2JIEA 3IAPA 1GQIA 4JL1A 2WZHA 1E0XA 3T0BA 4GI8A 5DT5A 4PMXA 2XWDA 4CVUA 1CXKA 4OZOA 4E2OA 2BY1A 2NT1A 8CGTA 2VZTA 2VCAA 1J0JA 3PZOA 3IANA 4W7WA 2OYKA 4QP0A 5D9PA 3G6LA 3PHAA 3MMWA 2FH8A 4UFLA 4GO9A 2GVYA 2J74A 1Q6CA 3AXIA 1RPKA 3K8MA 5I23A 1CTNA 3WQ8A 3ZJ7A 5CPSA 2WKLA 1H41A 4YPJA 1OD8A 2BHUA 1GVYA 3N13A 4CCDA 1NWTA 2CXGA 2B31A 1HKJA 4CD6A 1E73M 1MQPA 4P8VA 4ACZA 5HDRA 3WF4A 3W82A 1SMDA 5E0CA 5I5RA 3WFZA 4TTGA 3WH9A 3A4XA 2J8FA 4UFKA 3ZMRA 1ZBWA 4JFVA 4D6GA 4UQEA 2OYMA 4ZE4A 5IFPA 2BV9A 5AY7A 4RE4A 2J7DA 3WNOA 5AYIA 2WHMA 4UCFA 2ZX8A 1XSKA 4KGJA 4RL3A 1EQPA 3AMKA 3VDHA 3BLKA 5A8OA 4OBSA 1VJSA 1UR0A 1G5AA 2WXDM 2VJXA 5A2CA 9CGTA 3GXIA 4PUDA 2WMJA 1XH0A 2XTKA 1K9FA 1V0LA 1V08A 3PZGA 3VX1A 4OIFA 4JAWA 1BF2A 1JF6A 4OKDA 1Q6GA 3T09A 2YL6A 4P8WA 2ZXQA 3BSHA 2DQXA 1J10A 4U3CA 4W5UA 1IT0A 3AXHA 3GXMA 5A8NA 4DWSA 3HMCA 4NRSA 1E9LA 3RILA 4Z2HA 2WB5A 4MB3A 4GI6A 4LQ1A 1R7AA 3CUIA 1XGZA 4CU7A 1DWIM 2CCRA 1I1WA 4GQRA 1KBBA 1KGXA 3GBDA 3G6MA 2BVDA 2WCSA 2WMHA 3WNNA 4MAZA 2XIIA 3IJ7A 2WVVA 5D4YA 2J47A 1E4NA 1XCXA 3PZVA 5LA1A 3SCUA 3VGFA 4CD4A 5A8PA 1BGAA 2XHYA 1GQJA 5I3DA 3NYDA 2YDRA 1QHPA 2ZWZA 4A4AA 3LPOA 4M1RA 4AYSA 2HISA 1E70M 3SCOA 1E0WA 4W7VA 4M24A 3QHMA 3EDDA 2VZOA 1W1PA 2OWCA 1E4LA 5KZ6A 2E8YA 2ZUUA 1HN1A 3ARSA 1G1YA 1CENA 1ISWA 3PBGA 2VMFA 3BAYA 1GOWA 1JI1A 4WSKA 1GUVA 1CXEA 1XSJA 1QNQA 2W63A 4YHEA 1J11A 2A3EA 3AYSA 3MANA 3BAKA 4IISA 1B30A 4Q7NA 4TTUA 4P7OA 5ABFA 1E72M 2ZUTA 1AQ0A 2QMKA 2WCGA 2D23A 2CBUA 1Q4NX 3T0AA 1F4HA 1OB0A 2PI6A 1V3IA 3PN8A 4QFUA 5E70A 1DWFM 1H0IA 3KWXA 3QOKA 1UWIA 2G3NA 4MNJA 1JDDA 1UUQA 4BA0A 2Z1KA 2ZIDA 2V3EA 4X9YA 1OINA 3WNLA 1JAEA 4AD0A 5A2AA 2VZVA 2FH6A 3AHZA 1CWYA 2OYLA 3SCVA 1E6NA 3VNYA 2E8ZA 2PBOA 2ESCA 1KB3A 1XV8A 1ISYA 3EDJA 1EH9A 1FH8A 1H5VA 1WDQA 1C8QA 1UWQA 1VF8A 2NT0A 5I6SA 5E6ZA 4YHGA 4DM2A 2E3ZA 1GNXA 4W8BA 1M7XA 4CN1A 1UH3A 2BXYA 5A1AA 2WMGA 4HZ6A 2GK1B 2BVYA 3OLEA 4V28A 4UFMA 1B3WA 1LG1A 1K9TA 3SCNA 3WEZA 3PZMA 2GSJA 4V2XA 1Q6FA 1HXJA 1V0MA 2WMIB 5ABHA 2UY2A 3HJEA 1R86A 2D1ZA 1O7AA 5JBEA 4BQ5A 2DSZA 1EDGA 1BVNP 1BYDA 4Z2KA 2G3JA 1FH9A 3AIQA 3WN6A 2DIJA 1E0VA 2YLLA 1ZBCA 2VQTA 4XX6A 3PZIA 3OGVA 1I75A 5M5DA 3L4UA 1HJXA 2PWFA 1Q6EA 5E0FA 1FHDA 4OOUA 1AVAA 4R5EA 3AHYA 1NOWA 4EK7A 3W53A 4YN5A 3VDAA 3OA5A 2JFEX 4V27A 2J7GA 4W7UA 1WDRA 1LL6A 2D3LA 1B3YA 1TA3A 2QV4A 1B9ZA 4AZHA 1UH2A 3NDZA 3PTKA 2A3BA 1HJWA 2J7FA 3TTYA 3IAQA 5HOSA 4JFUA 5LA0A 1VFUA 1N82A 3AIUA 2J62A 2YL8A 1WNOA 3AISA 5A6LA 2WWCA 5ABGA 4WLCA 3QGVA 1C93A 3VIGA 2XYLA 2YKKA 3AFBA 3I3DA 3QHOA 3D3AA 3VGEA 5DMYA 4P8UA 3WBAA 1FFQA 2VURA 4TVCA 4RE3A 5C70A 1UR9A 2A3HA 3ZT7A 1RH9A 3WELA 3AICA 2AMGA 2W61A 1KFWA 4M56A 3VD3A 1NWSA 2J7CA 1VBRA 1E43A 4HMDA 3MUY1 1EA9C 1KXQA 6TAAA 4D1JA 3ALGA 1KXHA 1GORA 3VTRA 1MXDA 4QCFA 2QF8A 4J3XA 5ABEA 4QLJA 3WENA 1E4IA 1NWRA 1UYQA 3AIBA 4U5IA 1SMAA 4J27A 4MNMA 2V3FA 5I0DA 2WBGA 3WKZA 5HBFA 2Y5EA 1YQ2A 1B1YA 3I3EA 1BYBA 5A69A 3WSUA 1CXHA 4LYQA 4W86A 1QW9A 1JFXA 2VUYA 1FHLA 2QPSA 3CUHA 4JCLA 5FD0A 1BTCA 3VD7A 4AD3A 1DHKA 3AI0A 4Q22A 1PIFA 2VVSA 4BQ4A 1UG6A 4AIOA 4J3UA 4PTMA 3KL0A 4ATLA 3CLWA 2CKRA 3GBEA 1CGYA 2WC4A 3ALFA 1JZ8A 3WMBA 1EOKA 1BLIA 3EMQA 3DYOA 4D6CA 1SYTA 2PB1A 1JYNA 1JG9A 1P6WA 1YHTA 3WF2A 4CCCA 4XV0A 3ZSTA 3NUKA 3BMWA 2C0HA 5CLWA 4PSRA 1UWUA 4PMVA 1FA2A 3T2QA 3ZIZA 4PMQA 2YOCA 2W92A 2BY3A 5EFDA 3VUPA 5EB8A 2YL9A 1V02A 3CUJA 1WZKA 1XH2A 3CPUA 5BXRA 1QNOA 4KRUA 4S3JA 5JIPA 3HU7A 2Q8XA 1GOIA 3WF3A 4AY1A 3TTSA 4QAWA 4MNKA 2DSVA 2X1IA 3ARWA 2FGZA 3WF1A 1JAKA 1BG9A 2ZXDA 3VNZA 4PBGA 4FF5A 4D72A 1CLVA 2WM0A 2X0YA 4CU8A 3EDFA 4XUYA 2IUZA 2ZOXA 5DF0A 3WBEA 2JEQA 4FLRA 4JFWA 4AZ7A 4N0RA 2O9PA 4TX8A 4XB3A 1TG7A 1DP0A 2UY3A 4GO8A 1E4MM 3W6LA 1TZ7A 1BSIA 2F2HA 2WK2A 1B31A 1H2JA 2XUCA 1WKYA 4AD2A 3AMCA 1V3KA 1G01A 1MW1A 2DT3A 3M6DA 3EMCA 2GJXB 4U5KA 1CIUA 1CYGA 1E1FA 4P7LA 4JCMA 5A95A 3WFLA 2YA1A 3VIMA 4E8CA 2E0PA 4H8VA 1J0YA 4ACYA 3CZJA 2WZIA 3RMEA 1J12A 2WANA 4PCSA 2VNCA 5JBFA 4W5ZA 1W2PA 6A3HA 4X0VA 1XH1A 2UY4A 1MVYA 5CPQA 1B3VA 3SUTA 2JF6A 2W67A 2WYSA 5GNZA 3PZTA 2BXZA 1R85A 1V3HA 2WNWA 3OG2A 5E9AA 3AIEA 3W27A 4P7NA 3GH4A 4IPNB 1JXJA 2XGBA 3ARPA 4HA4A 2A3AA 4H2CA 2VL4A 2ZUWA 3SCRA 1KGWA 4B9YA 3WH5A 3ZQ9A 1OGGA 4AIEA 4GI9A 5CXPA 3VVGA 2WHJA 4LX4A 4QLLA 4WK9A 4FLQA 2ZUMA 3KZSA 3VGDA 3VMOA 3CMGA 4AD1A 3AS0A 1OSEA 1UKSA 3TOPA 4CU6A 4UNIA 3SUWA 3W6MA 1B3ZA 4WKAA 3DYMA 1W1YA 3AIRA 2Y24A 4BF7A 2QMJA 2CITA 3VD9A 1JFHA 1GQLA 2W66A 5JUVA 5A6JA 1JDCA 4S3KA 4CN4A 1OT2A 1HKKA 1VENA 1VEPA 2FHCA 5FL0A 1BAGA 3W81A 3N9KA 4A3YA 3BAXA 3AHXA 3AMGA 2XFYA 3VO0A 2EQDA 4HZ7A 5CGTA 5BXSA 5CG0A 1PPIA 4JZ5A 3J7HA 3VMNA 4HU0A 3W4RA 1CGTA 3SUVA 2X8RA 1M01A 3FAWA 4JFSA 1JD7A 1ZJBA 2EEXA 5I79A 3MUZ1 4E4PA 1V6UA 1CGXA 1J18A 1EHNA 1MQRA 3THDA 3OIHA 1U2YA 3VOCA 3UG4A 1D3CA 2W5FA 4C7FA 1UWRA 1FFRA 2DDXA 2XSAA 1M53A 2GJPA 3T0DA 3K8LA 4WKHA 2Y8KA 4J3TA 1IZJA 1V03A 2J7EA 4GQQA 3IJ8A 2WW5A 3EBVA 2FDMA 1ZB5A 3L4ZA 1HL9A 1JZ4A 1QOXA 1LF1A 4MDOA 2E40A 2GUYA 2WC7A 3A4AA 2DH3A 1LWHA 1OT1A 5CSYA 4R27A 3NSMA 3GYCA 3K46A 4PTVA 2CERA 5DEZA 5A6KA 1W9BM 2XJ7A 1G94A 3ARYA 4ZEPA 2IXUA 2WAGA 4PEEA 3ZJ8A 1VIWA 1QI5A 4LPCA 5GNXA 1XC6A 4MPKA 2AOSA 4WF7A 5BROA 4UFIA 1QNPA 1UR8A 2VR5A 4HU8A 2OLHA 3OBAA 3BCDA 3W28A 1JI2A 3TONA 3GDBA 2YDQA 4M82A 1DEDA 3N18A 2ZX9A 4QDMA 1QI4A 1JZ2A 1CNVA 1KXVA 3ARTA 4Z2GA 5KEZA 3O2LA 4GIAA 2CBVA 4RE2A 1HIZA 1XRVA 4AZCA 1QPKA 1R87A 2CBIA 1KQYA 1ZJAA 4UZSA 5M3WA 1M03A 1L0PA 3U7VA 4M80A 2WMFA 1E40A 2VTFA 2JE8A 3WH7A 1VAHA 1HT6A 1KBKA 1UWSA 1WZMA 3L4WA 1HJQA 4JIEA 1BQCA 1JL8A 4TX6A 3F5JA 3SCQA 4H41A 2PWDA 2V3DA 2WBKA 4U2YA 1GOQA 3BAJA 1NARA 3HN3A 1JXKA 1HJUA 3AJ7A 3U57A 2AAAA 4PMYA 3N15A 3CUFA 3AZRA 4UFJA 2XSBA 5I77A 1GJUA 4CN6A 4K68A 3WEMA 1WDPA 2GK1A 1MQQA 4DWSC 1V3LA 1GOMA 2XVKA 5HPCA 1KXTA 5CSUA 3DYPA 2GDUA 4OOZA 2WMIA 3JUGA 5ABFB 3WDQA 3CTTA 4GINA 1C7TA 3AROA 4AZ6A 3CZEA 8A3HA 5A6MA 3AYRA 4Z2LA 5DFAA 4AISA 3ZSSA 1OM0A 1KGUA 2DSKA 3SCWA 3PZUA 2J77A 1PX4A 1ISXA 5BWFA
chains in the Genus database with same CATH superfamily
4HPNA 4CQDA 1V4YA 1AZ1A 1X38A 3EB4A 4KEVA 3WL0A 3DHDA 1XD1A 1BFNA 4H00A 3W7DA 1W8GA 1F61A 3AYTA 3EOLA 3NVDA 3VGBA 1LRTA 4F2UA 1XLCA 3MKKA 1DWGM 4NSBA 4WSHA 4OV4A 4JXCA 3QR0A 4LYPA 5IXEA 3WDHA 2EPKX 3O0FA 3K4DA 4ZFCA 4UZUA 1ECQA 2VOTA 1TMHA 2PP3A 4AC1X 4UFHA 5F2MA 5AYYA 2UY5A 3WMCA 3EPNA 1BPLB 2ZTJA 3B9OA 3CHVA 3BG9A 1WAWA 1F3EA 5I3IA 5HQMA 2Y61A 3VIOA 5LHEA 5U4NA 4Z1AA 3G0SA 2G41A 3WUEA 4FXSA 1GZGA 8RUCA 2AKMA 2KX9A 1NOUA 2B7QA 5EMKA 4LYRA 3GW0A 1GTEA 3KL5A 1LG2A 1Q6DA 4RR4A 2YZ5A 3GWQA 2INFA 1LBLA 5AC5A 4MMWA 5FKYA 2VELA 1RK5A 4NKCA 3EWZA 3U5YA 2YCLB 1UROA 3BGGA 3LS9A 2PZNA 1ZQ5A 3POHA 2RAGA 1EC8A 1S46A 2CESA 1SJCA 3G24A 1FWTA 4HHHA 2YA2A 3QV8A 2XFFA 1UKTA 1JGIA 1KFKA 4A2SA 1GCYA 4FR6A 1UD4A 3TA9A 4DUOA 2HS6A 2ZRWA 1MW0A 4V1XA 3WMLA 2RDTA 2GPTA 3H24A 1HL8A 3JR2A 3W25A 3R8RA 4DNMA 5FA5A 3OVQA 3PWIA 1VS1A 3AMLA 3L21A 3RF9A 3UERA 2DQWA 2O9TA 1BYCA 1OEPA 1QHOA 5C2XA 3VM5A 4AZ5A 4PCTA 1MFUA 3DAQA 3RXZA 5LNUA 3N04A 3BC9A 2Z6IA 1MSSA 1DOSA 2G96A 4G7EB 3FJLA 1CDGA 2DSUA 2CIPA 5FIPA 2ZICA 3BMVA 4R3UA 1F8IA 3WCZA 2DSWA 4JX6A 4G7FA 3MSGA 4PSPA 5E1QA 1BGGA 4IIGA 3O63A 4L4LA 2V5BA 1K70A 4QDPA 3HZ3A 3WQ6A 2WVUA 5G1YA 4XISA 1HTIA 3FHQA 5D2XA 5A6BD 3SN4A 5EPDA 3B9EA 2C1IA 1FH7A 4I6KA 4D1IA 1TCMA 3ME3A 4I7UA 1ZP4A 2Y7DA 3VU2A 1SO3A 2GJRA 3CYJA 3PNZA 4XVDA 5HMEA 2ZUVA 2V3GA 1IHIA 3IV3A 2GWNA 3DG6A 4DJDD 3PJXA 1V0KA 4DLFA 4KETA 2V38A 2PDPA 1OK4A 3SDOA 3V4BA 3CUGA 2NX1A 3V36A 3B04A 1H5YA 1FCUA 4GISA 3ISIX 1HKVA 1RK6A 5D33A 3PVFA 3QH2A 2C79A 1WZAA 4W8LA 3IJ6A 4C7DA 3QLDA 3PB0A 4ZB2A 3WLTA 3S9ZA 4HN8A 4FA3A 3RDKA 1WDSA 1WKFA 2WV8A 4NZCA 2BZNA 3G3DA 2FTWA 1OFPA 2BOGX 3UWEA 4L4PA 3WJWA 4MTVA 4MZ8A 3E5BA 4S3EA 3WY1A 1CBGA 2BASA 2WLYA 1UIOA 1X6UA 1Y8BA 2GZXA 3LHUA 1SQ7A 1PHWA 2V2HA 3F5KA 3N2MA 3B0PA 3SEPA 3R5EA 4MB4A 3BZJA 3NL3A 1LQ0A 4M7SA 4RZBA 2WJFA 1TUFA 2VZUA 1EBHA 1JIBA 1J9YA 5J8LA 3O9NA 2ICSA 4HOWA 4FLOA 3UR8A 5MKGA 2TYSA 4L4MA 3I6RA 2ZVIA 1OFRA 2J4GA 3M44A 5L9FA 4RJEA 1OCQA 4Q3MA 4DBDA 4D6JA 3WUGA 3FV9A 2WMKA 1OYCA 4F66A 4A8RA 2PTYA 2VC9A 4H9ZA 2GGEA 4LAKA 1IIGA 4W84A 4E3TA 2OT1A 2Y89A 4CNPA 1V3JA 5CBIA 1OIMA 7CGTA 3RU8X 2QLYA 2HCVA 3MA8A 3W7KA 3I4EA 2WQPA 4C6CA 1I2RA 3BJFA 1EJWC 1DQUA 5CLTA 3SY1A 4AD5A 1CLXA 1TPB1 1KTCA 3XIMA 3CU2A 4XD5A 4XSLA 3G1XA 1UC5A 1O60A 2DW6A 4S3CA 3UWQA 1TE1A 3GTFA 1XLLA 2HXUA 2OQYA 2BHZA 1RP8A 1VD6A 2BMBA 2H3DA 3TV8A 3A3HA 5EFFA 3WX7A 4IQJA 1DIDA 2Y5SA 3E0WA 1DVJA 1C3FA 1A4MA 1W3KA 4JFTA 1WP6A 3VD4A 2BY0A 3KTXA 4YMZA 2WKGA 3O07A 3VKJA 1XUUA 3M5YA 1QNRA 4S3AA 3VOHA 4ACZB 1U1JA 5AECA 2VQUA 5E93A 4C6NA 2NW0A 1E15A 2BVTA 3W1XA 4ZB5A 4JICA 5HJYA 1VEOA 3C5QA 3VK5A 2VVNA 1PS9A 3DFYA 7PTDA 1EDQA 3PZ9A 3FJNA 1XIEA 2O56A 3APTA 2G95A 1WOAA 3ERPA 2JKAA 2X41A 3H4GA 2GUUA 2D2HA 2R1MA 1V6XA 4TX9A 4JIHA 3H2NA 1MUWA 4GZIA 3MZNA 4LH8A 2CBJA 4Q4MA 3NA8A 3BV7A 4JYFA 1T8QA 1FWFC 3EWCA 4PFHA 1XQLA 1V5XA 4LB4A 4OWGA 3UXAA 1KBJA 2I16A 4BI6A 5CBJA 4NF7A 4DWDA 4AUBA 2AQOA 2PLJA 2Y0FA 1EP2A 1VBUA 4XTIA 3FLUA 2E4TA 2CU0A 2C1HA 3KUMA 3NSNA 5TAOA 5TD4A 2ZXAA 1H1NA 4NRRA 3ZR6A 4WSJA 1E6SM 3K4AA 5A6AA 2VX4A 3I3BA 3UCCA 4IP5A 3W07A 1WXJA 3EWDA 4WJEA 3OZPA 3NZ1A 3OA3A 1OG6A 3TDFA 1FWSA 1S5MA 5CZ0A 3MCNA 4DM1A 4A8NA 2G3MA 4RDYA 5IBXA 4JPGA 4OU1A 4QG6A 3LDVA 1M5WA 3UR5A 3RPMA 5A3HA 4CQ8A 4FAMA 3NIYA 4KKXA 1Z32X 4WDUA 2XGZA 3DG7A 3VOGA 1TJRA 3L4TA 3V1HA 3H8AA 1G4SA 4AZCB 4X60A 4GUGA 3NFUA 5M17A 1ESWA 1Z89A 1HKIA 4DJFA 3LV6A 3Q65A 1BQGA 4N6FA 2PD5A 5K3VA 2PWHA 1QI0A 1VBJA 4NASA 1UWTA 3UCQA 3GIQA 4P7QA 3R58A 2D69A 3TSDA 1P4CA 1ADDA 4NY2A 1ZL1A 2W4XA 3P60A 4Q8WA 2PC8A 3XINA 2PDUA 2J7BA 2D2GA 2AL2A 4LBRA 2RDXA 5D8ZA 2FDSA 1UD5A 1PWLA 3UJSA 3GYEA 4NL1A 2VZSA 4LCSA 3FXYA 2DJXA 2QAFA 1JZ6A 3ZLFA 3ARZA 3L5MA 3SUUA 5D09A 1XM3A 4UQAA 1H11A 3E0FA 2E28A 4LANA 3D46A 2JGYA 3TWBA 3SJ3A 3S2LA 2QUVA 2NX9A 4HSOA 3GAKA 1KR0A 5AC8A 4PA8A 2CZFA 2PPGA 2XPKA 5I78A 4GY7A 2Z0IA 4LOCA 3B40A 2WKJA 1MXGA 3UZZA 4K8GA 2I5GA 3ZM8A 3LN3A 5AHIA 4DJFC 4BQ2A 3E2RA 1VCFA 4ORIA 1OD0A 3BARA 1ISVA 3UPMA 1YMYA 3GVGA 1OFAA 1JRBA 3H2MA 1IR1A 5GJNA 3S47A 3LZ5A 1TUXA 1X7IA 4XVEA 4DUWA 4JTFA 3TYCA 1EQCA 1XKJA 2PGWA 2GQ8A 3CT2A 5HPOA 1E51A 4ZTYA 1HQTA 5DRCA 1JNDA 3NR0A 2PAJA 3UETA 1KD0A 1VJZA 1Q66A 1L8PA 3WLNA 1K7EA 3NM1A 3U3HA 1N55A 5D9OA 4B16A 3DIPA 3CL7A 4TUFA 3BDKA 3DFNA 2BFGA 4L9ZA 4PL2A 4O0QA 1ZS2A 3LPGA 1I6NA 3DFSA 5D2TA 1AW2A 4H04A 2X1SA 3MHGA 4HA3A 2XFRA 3AXKA 3EAUA 5D2YA 3WBXA 1NDYA 1JGMA 3R94A 1KCKA 5G4WA 1EXBA 1DWAM 3KHJA 5C0QA 5BYWA 3FY1A 4EKJA 2V5JA 1PX3A 5ABTA 1TVNA 3GNOA 4XZNX 3H70A 1VIZA 2Y4SA 3F2CA 3B9NA 3VDBA 2IPFA 1WKEA 2NUXA 4CUCA 3W1NA 1C29A 2CNCA 3ICJA 4ADUA 1UR4A 5HMFA 1EGMA 4IFKB 1PX8A 3KHDA 3R8GA 1BYAA 1TYGA 1V6YA 3ARXA 3KXQA 2CZDA 4DO6A 1B5TA 4FPSA 3DOPA 2YSWA 1S38A 4UB9A 3AHVA 3BICA 4BEQA 2AGTA 2OB3A 4TO8A 3GH7A 4CKQA 1A53A 4GVIA 4KEZA 2CW6A 4G56A 3CMFA 1S3TC 4LV9A 4M8UA 4IUGA 2WCAA 2EJAA 2VRJA 4DRSA 3SBFA 5CJ5A 1TZZA 2OODA 5JQ9A 2J8TA 2VI0A 3DFOA 4D71A 1Z41A 4J4KA 4K37A 2CHNA 2PDYA 3KVLA 3M0JA 4MFEA 2FZBA 2X0HA 3DC0A 3H23A 2QCDB 5AHEA 3ZO9A 3LPFA 2DGAA 1OY0A 1KRMA 5AHNA 1JZ7A 1R0MA 4Q4RA 3N29A 1Z69A 4B4FA 1E6ZA 3S6DA 4UTMA 4EIVA 3IVSA 5K4ZA 3PM6A 4ZA0A 4D2JA 2O9RA 8XIAA 4W8AA 1LBFA 2D3NA 2F6UA 1ZAIA 4PZVA 1NP2A 4HZ8A 2Z2UA 2Q8LA 5G2IA 5F7UA 4IMFA 3U7BA 3G22A 1NFPA 3UJRA 2J24A 2YCEA 4NQ1A 2ZZ5A 1M41A 3BV4A 4HHLA 1NEYA 1DE5A 3H7UA 1F05A 2HRWA 2EPLX 2JIWA 2V67A 4US5D 4PUNA 3R8HA 5IDIA 4FXJA 2R1NA 3N2CA 4YXGA 1RA0A 3L2LA 1HUVA 2PTDA 2QT3A 3GUWA 3REQA 2ON3A 1HKWA 1Q6LA 1FWEC 2ADAA 1E0XA 3IPWA 3HB9A 3WFAA 1CCWB 4HTBA 4PMXA 4B5WA 1YPFA 3CWNA 3P81A 4GVGA 4CVUA 5IDZA 1TIWA 5FJTA 1XW8A 1VKFA 5FJIA 1ZAJA 4IJRA 1ONWA 3QZ6A 3U2CA 1RSCA 4UFLA 4GO9A 3SY8A 1SW0A 2QCLA 3F7JA 3AXIA 5HK4A 1C9DA 3WQ8A 2WKLA 3O1NA 3QPEA 4EP8C 4YPJA 3HBLA 3W1AA 1GVYA 2I56A 1SZEA 3BOXA 4CD6A 3KBVA 2FZ9A 1XLMA 4LS0A 4I9JA 4L6HA 1SMDA 5E0CA 4TTGA 2WM1A 1UP0A 4G2DA 4ZODA 5KZMA 3HURA 2DVTA 1XYMA 5AY7A 3BVJA 2J7DA 3GDTA 2FGBA 4JQ2A 4RL3A 3CL8A 5A8OA 3S6OA 4GY1A 1DYSA 1IGWA 1THFD 4DI8A 3DBNA 2WXDM 2VJXA 2X2GA 5A2CA 2WQDA 3GXIA 4XAPA 3ID7A 4YVXA 1XH0A 1K9FA 1JCMP 4F48A 1DV7A 4ROPA 1BF2A 3NGFA 3GZ3A 4P8WA 2ZXQA 3NZPA 1W54A 2DQXA 5CZSA 2QCFA 1QOPA 1YPIA 4GY0A 3MCOA 1R7AA 4B5TA 1TJ2A 4GQRA 1BKHA 1YTDA 1U1UA 3LCLA 1EX1A 4N9DA 3G6MA 1XIDA 2BVDA 1Z48A 3FXGA 3WNNA 1HW6A 1YTKA 3S2NA 2POTA 5D4YA 1E4NA 1MRQA 1XCXA 4DVOA 4B4HA 5A8PA 2XHYA 4HSNA 1PTDA 3NYDA 2YDRA 1QHPA 3W86A 3LXBA 2ZWZA 3LPOA 4AYSA 1E70M 3SCOA 3TW6A 1D3GA 4H01A 3GU1A 4J1OA 1W1PA 1PB0A 4DBWA 3CM4A 2E8YA 2ZUUA 5BOFA 1ZTVA 2AMXA 4GC3A 1AMKA 2GL5A 4YHEA 2BDQA 1J11A 3AYSA 3FEQA 4TTUA 3NTYA 2QMKA 5BW6A 2YXOA 3C2EA 2CBUA 3MW7A 1OB0A 4F0SA 1CW2A 3IWPA 4QFUA 1H0IA 2PSNA 2PRHA 4KWSA 4MNJA 3JVAA 4JEJA 4X9YA 3MTWA 3WNLA 1TX0A 3M4HA 4HCHA 7XIMA 3PFMA 5A2AA 2PBOA 5D32A 1XV8A 3UNTA 5I3GA 3NQGA 5ENLA 3QPYA 1W1A1 1C8QA 3W00A 2NT0A 2IKGA 5E6ZA 5DY3A 1PDYA 1RQHA 1UH3A 2BXYA 4Q4QA 3STGA 2BVYA 3F4DA 3OLEA 4V28A 3VAVA 4TV5A 1B3WA 1XBXA 1XJBA 2CLKA 1DIEA 3PBMA 3SCNA 3HG3A 2QIWA 3PZMA 1HXJA 4US6A 3WLQA 2UY2A 4HU4A 2RUSA 4HKPA 3WLLA 5TF0A 2B7PA 5JBEA 2DSZA 4MLJA 1ZCCA 1VHNA 5AC7A 2YFOA 1BVNP 1BYDA 3S2JA 3U2EA 3HQPA 3GFZA 1AJZA 4KIEA 1TIMA 5HULA 3TCEA 1ZBCA 3PZIA 1I75A 3QYSA 2ZDSA 1FWBC 1HJXA 3L4UA 4OHQA 3SGUA 1S5NA 3UF9A 3AHYA 3ATZA 4EK7A 5EMUA 3SADA 3VDAA 1PZ1A 3URNA 3LLXA 3KCOA 2B0MA 4YLWA 4GI4A 5C2CA 2QV4A 4I5RA 4AXKA 2ODOA 1B9ZA 3IK4A 1HJWA 2J7FA 3IJDA 5HOSA 5BWAA 5FEZA 1VFUA 4HJFA 1N82A 3AIUA 1WNOA 3HG4A 5A6LA 4O10A 4S39A 2WWCA 3LX9A 4ZQCA 2FPTA 3QGVA 1C93A 4RUBA 4XBKA 1K8CA 3MSYA 3VGEA 4P8UA 4IQEA 1GYLA 2J9ZA 1PVNA 3QTPA 4TVCA 4M6UA 4RE3A 3KVKA 2VM8A 2A3HA 5G4EA 3ZT7A 3WELA 2QCCA 3H2AA 2CLPA 3E3HA 2Z28A 7REQA 2W61A 5T9BG 4M56A 3VD3A 1NWSA 4Q4OA 3GDMA 4V33A 1E43A 4HMDA 4Y9PA 3MUY1 1K3UA 4D1JA 4LF1A 4QSFA 1K02A 1MXDA 1TRIA 4UNLA 1GYMA 4HNVA 1TPEA 1UYQA 4MYXA 3AIBA 1XGEA 3GDRA 3W7CA 4MNMA 3WKZA 1YQ2A 5HJXA 1BYBA 3UXDA 4HGXA 1JQXA 3PWGA 2PS2A 1ZJHA 4O8RA 1W5NA 4JN8A 4GZ7A 3S3GA 2F7FA 4HNOA 1JFXA 1FHLA 2ACSA 2BTMA 3E2VA 3VD7A 4AD3A 1DHKA 2ISFA 4DBEA 4Q22A 4BQ4A 1UG6A 4GJJA 1QNVA 5DCDA 3GNXA 3UWUA 3GBEA 2WC4A 1DJNA 1WOBA 4QITA 4S3DA 5FAGA 3R11A 3NQBA 3C4UA 1T96A 4D6CA 1JYNA 4LVGA 4AB4A 3G1FA 1OFDA 4TMCA 1K6WA 2C0HA 5D37A 1GZ1A 1A3XA 1E9IA 3ITGA 5K9DA 2ANUA 2V2CA 1H7NA 3DCPA 2YOCA 3BURA 1EB3A 5EB8A 1M1BA 3CUJA 3FDGA 2OVLA 1QNOA 4KRUA 1EJUC 5C7VA 1Q2SA 3P8JA 2FZ8A 1GJPA 4V15A 3S5NA 1NQKA 4UTTA 5JIPA 1GOIA 1TB3A 2V30A 3FIGA 1EX5A 3TTSA 2WNZA 1OG0A 4RNJA 2VGIA 3EXSA 2X1IA 4NUWA 3OHIA 4DYEA 4FF5A 1CLVA 2X0YA 4AVOA 4GYFA 1J2BA 1J6PA 1PZ0A 3IVUA 4KWWA 5CPOA 1DP0A 2UY3A 1TZ7A 3UZWA 3BTNA 1B31A 1H2JA 4EWJA 2PCQA 4R7OA 1XRSA 2P3EA 3FKKA 1MW1A 2DT3A 2GJXB 4LNCA 1CYGA 3RNDA 1E1FA 2HV5A 3INPA 4F0LA 3C2FA 2YCKX 2A85A 1LWIA 3RLVA 1B4KA 1DQXA 2V68A 3RMEA 3H2OA 3ITVA 5JBFA 1W2PA 4JN6A 6A3HA 4X0VA 5BNKA 1RBLA 5C9RA 1VFSA 2UY4A 4JQAA 1TQJA 2PWUA 3P84A 4O8AA 3NQDA 1R85A 1Y5VA 4HPJA 1VCGA 3OG2A 4ZL1A 6PTDA 3HM7A 2XGBA 3ARPA 2A3AA 4H2CA 3EWWA 4Q32A 4JTAA 3ZQ9A 4PFMA 5CXPA 1LP6A 2D2JA 3H2CA 4IMCA 1JPIA 4FLQA 2ZUMA 3KBNA 2DU2A 5BZAA 1OSEA 1UKSA 4UTTC 3KDOA 3BGJA 4X9SA 2NWRA 3AXMA 3W71A 3NQMA 2VUNA 4FIRA 2Y24A 4J2MA 5A6JA 1JDCA 3M0MA 4S3KA 4CN4A 1VENA 1VEPA 5C6MA 3C2RA 1BAGA 3BAXA 3QV6A 2NV9A 3R43A 1Q7ZA 2V5LA 5CGTA 1O95A 3SRKA 2QEZA 3D47A 5CG0A 1PPIA 2YW3A 3CEPA 3RO6A 3LNMA 1SSDA 4H1ZA 3W4RA 1CGTA 3SUVA 1J5TA 1M01A 1JD7A 1LUCA 1WKDA 2EEXA 3EA1A 4IPPA 4E4PA 3B0XA 5RUBA 3GXNA 3EXTA 4KS0A 1U2YA 2PLKA 1A5BA 1D3CA 4ONVA 3I65A 2GJPA 3W70A 3K8LA 5D30A 4J3TA 1SZGA 1IZJA 2J7EA 3FDKA 4MKVA 2WW5A 4JDYA 4DN1A 2NQ5A 4NNAA 3EBVA 3T07A 4BEUA 1QOXA 4UBPC 4HNTA 1LF1A 4NX0A 2GUYA 1FKWA 2WC7A 4TR9A 1R3VA 3A64A 4JQ1A 5CSYA 4IGSA 4AEOA 3GVRA 3VNIA 3U8GA 2CERA 2RKXA 3KP0A 4HA0A 4Y96A 1G94A 3ARYA 4A21A 3ZJ8A 3NEVA 4Q8VA 1VIWA 3PTDA 1D7KA 5GNXA 1XC6A 1XIHA 4I9AA 2WSRA 2XZ7A 3LHVA 3G1AA 4H83A 1SZRA 3MP5A 5BROA 4UFIA 4IMGA 5I03A 1GT8A 4G6CA 4HU3A 1QNPA 4HU8A 3QN3A 5H8MA 5TBOA 3W28A 3BWWA 1XUZA 1OFOA 3EX2A 3GDBA 4WJ8A 1LM1A 5A8GA 3LCWA 1OZMA 4GGBA 4PRRA 3QW4B 4IXXA 5KEZA 4KRZA 1HIZA 3E2QA 3VCRA 1YYAA 1XDLA 1L0PA 1C8VA 1DXEA 1AH4A 4M80A 3U7VA 1G69A 2VTFA 3WH7A 1VAHA 2TODA 3TAKA 1ALDA 3L4WA 1BTMA 3F5JA 4R34A 3A22A 1KRCC 2PWDA 3C2YA 4JIPA 5EKYA 3BAJA 1IGSA 1XLKA 1KM3A 1GKQA 5FJRA 1ZAHA 4PMYA 3TTEA 4JTUA 4MY9A 5G2HA 1AL7A 2YCIX 2ZC1A 4GQGA 2FJUB 2P76A 3WEMA 1H7XA 1POJA 1WDPA 4XQ6A 2GK1A 4DWSC 1GOMA 4FNPA 5HPCA 3H2EA 4BY3A 1KXTA 3BCJA 2GDUA 4OOZA 1W0MA 4GACA 2WMIA 1OX4B 3CQKA 4MZYA 4QG8A 3M5XA 4C6JA 3QMRA 5F2GA 3VABA 5E9XA 4QIUA 2VDIA 1XIBA 2RJGA 3T42A 1E9YB 3B4YA 4N9BA 2PDJA 3AUJA 1TRDA 3T0TA 1ODUA 2V5DA 1E3XA 5CH9A 2AL2B 1W1VA 3TQKA 3DH7A 1V51A 1W9VA 2DZPA 3OHMB 4MJZA 3NEHA 4OE7A 2PRMA 1TV3A 4Z0JA 4QCEA 4HMCA 1DJHA 2C15A 2PLMA 4PMOA 4QEHA 4ICMA 1TFVA 1OQFA 4QNWA 4GUJA 2BHYA 1EOMA 3WQWA 7A3HA 3CIVA 2XDFA 6CGTA 3SO7A 1CPUA 2QPXA 2I9UA 3N11A 1ITUA 1UD3A 2OEJA 3PP7A 1VEMA 3WQ5A 4KCUA 3T81A 2MNRA 2VGGA 1QCWA 1DQWA 3CZGA 1HG3A 4UXDA 1D8CA 3FAXA 2FHFA 4PMNA 4DZIA 3ABZA 2GVEA 5E6YA 4DPPA 4E38A 3ZT6A 4ZXOA 1Z8AA 1HVQA 3RIKA 3UVIA 5B7ZA 1W9DM 4GE8A 3TC3A 4N02A 2XZ9A 1X6NA 4NJJA 1I60A 1TCDA 4XD3A 2VGBA 4PUEA 3OU8A 5JH2A 4GYJA 1EGZA 2ZZ7A 2X1RA 1UBPC 3B03A 2ISSA 3KL3A 3PNUA 3T4WA 1XYZA 3VZZA 3TLQA 1H51A 5HWNA 4DZHA 4GFIA 1YADA 4R7WA 1JPMA 3V1PA 1GJWA 3EEGA 5AVHA 3SW6A 4B90A 3NL2A 1JDEA 4D6FA 3QY6A 1H3GA 2VD8A 4FP1A 1YTEA 2TSYA 2EPHA 3CB8A 1PJ9A 4YTSA 5FJPA 3VINA 4MWAB 1PKNA 2GVJA 4TVUA 5FCZA 3VKDA 1VFHA 5LGXA 4J3WA 1V7YA 1AG1O 3MSDA 4NX5A 1US3A 1H60A 2GSEA 1GK8A 1EEXA 1NQ6A 1PWMA 2FB2A 3ARRA 1KCLA 2REQA 1BG4A 2OSXA 4CVWA 3KEHA 1J6OA 1DJIA 1UC4A 3NL5A 3SFKA 2OZ0A 1TTPA 4JR5A 5DMMA 1CXFA 3S83A 1UD6A 3RUBL 3CO4A 1XIIA 4DO4A 1NY1A 2XGIA 3RX3A 5K2ZA 1UQZA 4C7GA 2XWEA 2ISWA 1R9YA 1H1YA 1MNZA 4QQ3A 1T40A 3TTOA 2TPSA 5DT7A 1QVBA 3RRXA 3BGAA 1RPXA 1A47A 2DH2A 4EAMA 1NELA 2VEIA 1M04A 4DWSD 2PDCA 5AHMA 3E49A 4HOXA 3B97A 4M6PA 4EX4A 1XGDA 1CECA 3TYUA 2OXNA 1OGSA 4H8UA 2D24A 2WNQA 5DRIA 2PRLA 4DJEC 4FXRA 5C7HA 2CC0A 1EF2A 1H7WA 1X96A 4JIQA 1GG0A 4RW5A 4IG2A 4QNEA 3RCNA 3M16A 1FP9A 4ICCX 3VILA 4B2DA 1XKYA 3LCIA 3O15A 1F6PA 4W89A 1XXXA 2QDGA 4LS2A 3BAIA 2DORA 1I9CB 2CWXA 3BSGA 4EANA 4MAVA 3M5VA 3NM3A 2Q09A 5C71A 5E0KA 3CZLA 3W2KA 1FKXA 2OEKA 4GH1A 3VIJA 4NZ5A 3ITXA 3CZKA 1TPH1 2E9LA 2E25A 2R6OA 3ZYZA 3VIPA 3FCPA 3MQTA 1AH0A 2B7NA 3AOFA 2DV0A 3GC2A 3IACA 2E5DA 3CAQA 5EMJA 1NF0A 1Y5XA 2F61A 3OP2A 4ZVJA 2E09A 4H6EA 2PBGA 4D6DA 4JL2A 2RGMA 1OCBA 2FPVA 5LYRA 1YLVA 3QY7A 1W17A 4KEUA 1EZWA 2YBVA 2EF9A 5G5IA 3CS2A 1V93A 5DCBA 3REQB 4H19A 1C92A 2J6XA 2QUTA 4B92A 1LOSA 2E6FA 3ZZ1A 3TLLA 4O54A 4ZB0A 1F2JA 3RLGA 2VKZG 4C1LA 3EDKA 1JPHA 3BW4A 5BOOA 1S2VA 2HQAA 4FOJA 5FF3A 5DX7A 3WBWA 3PJTA 2D22A 4REQA 1B90A 4PULA 3TQVA 3BAWA 3W38A 1KLYA 2FMOA 5D9MA 1WBJA 3LMYA 4OGZA 2G4FA 3AU6A 4RV8A 2G37A 2GUBA 1DWJM 2OZ8A 4QISA 3CAWA 2F84A 1PTAA 2G97A 1HVXA 3EXRA 2OKOA 1MWOA 3QMSA 1ZJIA 1XBVA 4E8DA 5DXXA 2VFFA 4HYWA 1AQHA 2BX7A 1J8VA 2R9RA 3M7SA 5A6TC 4ECLA 4AZBA 4W88A 1K4GA 2QCHA 3OJGA 2XSXA 3JW7A 1VJIA 3CH9A 3HPZA 2C91A 3N12A 1LYXA 1KR1A 3QHNA 4NAFB 3NNTA 4DX3A 1UKQA 2B7OA 4UC5A 1GVRA 3BL3A 1XD0A 4LUIA 4XZLX 1GZJA 2Z24A 2A7PA 3GZAA 3U6WA 4YIWA 2UWFA 4D6HA 1G7UA 3ZFHA 2TRSA 1QNSA 4AYGA 3T1GA 1UR1A 3TC7A 4FXFA 2E5BA 4Q8PA 1XLDA 3LMZA 4ZE5A 3BLPX 5I02A 3OQ8A 2EKCA 3VA8A 4MWAD 4PCPA 4UWMA 1SSGA 3BJSA 1W37A 3JZEA 3WZ0E 3ZOAA 2X1TA 5U7SA 1W31A 1FWAC 4FIQA 2GQ9A 5HNNA 3I6EA 4U33A 3LSCA 2ASHA 3G3MA 1QFEA 1IF2A 1W56A 1XI3A 2WHKA 1CGUA 3LCGA 5A6SA 4ZOBA 3VIHA 1RHCA 3QV9A 2NSXA 4JNYA 1UW9A 4XZIA 1EIBA 1UB3A 1W3NA 3KRZA 3PUOA 1E6PA 2FZMA 3IGSA 2X16A 2VC7A 4PTXA 4BS0A 1AW1A 4RNFA 3PJWA 1RA5A 2QF7A 4PGLA 4Z1BA 2FLIA 3W1LA 1JCLA 3VMPA 3E38A 4GX8A 5AHLA 3DN5A 3V18A 3WQ4A 5BMXA 4XBJA 4KQNA 5EMYA 3LPPA 1B4EA 1TWWA 3AMDA 4MZ1A 1TPFA 4IX0A 3U2ZA 1ITXA 3QR1A 2Y62A 1BVZA 4WIWA 1AW5A 3W24A 1MFVA 4IM4A 1YNPA 5IHRA 4ZO9A 5XINA 4EOUA 4AHPA 4LS1A 1BSLA 1TWSA 3RR1A 4WVXA 1EWEA 1KRBC 1MW2A 2IKHA 4PN2A 2CZEA 4QJ3B 1V6WA 1ONEA 1R7OA 1EDTA 1CI1A 4O53A 5FF0A 3BH4A 3W7IA 3MMDA 2VEFA 3POCA 3WLRA 5G1TA 3ZWTA 3E0IA 4NJGA 4JKLA 1KFEA 1SJBA 1Y5WA 3ECQA 2XH2A 2X40A 4WRHA 2PGEA 2J78A 4HHMA 4NT0A 1I4NA 4H7CA 4I9TA 3T05A 1ENUA 2Q3RA 2UV8G 4K2SA 2YJQA 2WLZA 1E6XM 2O4QA 5C5YA 2EKGA 3VDCA 2G8ZA 3ZR5A 3KFTA 3N2OA 4W93A 3N14A 4LXFA 3MDUA 2BGQA 3QOMA 5LIUX 4KFPA 2XM2A 1UHVA 3VGHA 1P1MA 3LCFA 5DO8A 2C8NA 4IIBA 4Q7IA 2XH4A 2OWXA 4GZJA 2VX7A 3SM0A 3UXKA 2ZRXA 3QJAA 5HMSA 1MEWA 1JUEA 3M9YA 4JHOA 4J7RA 1HKMA 3MI2A 4AIBA 4F2TA 1KTNA 4AF0A 3WK1A 2CZ5A 3QR3A 7REQB 3VD5A 3EA3A 1CX9A 2QPUA 3CBWA 3ZJKA 2FKPA 3C0QA 4FSAA 4B3LA 4IGNA 2W6RA 4LEFA 1OIFA 1GEHA 4MJMA 5C8BB 4N6EA 4GPNA 1EXPA 3N4EA 3NG3A 3SZ8A 1G4PA 2F38A 2IKJA 2ALDA 3HPXA 4GZEA 3V7PA 2ZZ6A 2NVAA 4BCEA 5M2FX 1HNYA 1R2SA 3ABRA 1LBMA 4JTSA 3HGOA 2TAAA 1GVFA 2J7HA 4DXVA 3IGUA 1JCNA 1XSIA 2ZA1A 2XVNA 4QAIA 5CC6A 1YBQB 3MYPA 2Q01A 4L9XA 4F8XA 4ML4A 2A6NA 4XKYB 1G0CA 2YB4A 4JTDA 3PTQA 3WNKA 4MY1A 2IXVA 2WPGA 3IJ9A 2W9MA 4HTYA 2CLIA 1LORA 2YPIA 4DF1A 1U30A 3NZGA 1KKOA 1FBAA 3STEA 3L4XA 3DFPA 2BY2A 3TJLA 3ARVA 2VEMA 3NPUA 4Q8MA 3UJ2A 1W3JA 1OC5A 1KA9F 3GE7A 3GTXA 2QUNA 2O92A 3A3WA 3E96A 3DI1A 3VKBA 4LWWA 2ISDA 1NM9A 3ABXA 4O16A 2QV5A 2W0UA 3ES7A 3NQ8A 1CEOA 4NZ4A 3ANUA 3K5XA 2D0HA 3RM9A 4JTLA 2I17A 2ZX6A 3OYZA 3GR4A 3M64A 4LT9A 5LNVA 1CGVA 3TA6A 1QU4A 2NQJA 1BEUA 3UR7A 4B3KA 3ZVHA 1DJXA 3B3DA 4C6DA 1VBGA 2ZQ0A 3BCFA 4HP5A 1R9XA 1EPVA 1NWUA 2PU0A 1KBLA 1GPWA 2W62A 1KV8A 3C3NA 5D8WA 2Q6ZA 3NOYA 4UTKA 3RO8A 1OGBA 1GQKA 5CSSA 2INEA 3F4WA 4KRTA 2HBVA 3SCTA 2IQDA 3VE7A 3SUSA 1W1TA 4FK9A 4RDVA 5LNWA 3PBVA 1X1NA 4FHAA 5CQ1A 4C6EA 4JS3A 1UA3A 4UR8A 2Q02A 4LVBA 4Y8FA 1Y0EA 1R8LA 2R91A 1XP3A 1YDYA 4X2RA 3GNDA 2DJLA 2QGHA 3RITA 5AKQA 1KCXA 1U83A 1EL3A 2C71A 4AC7C 3K4WA 2QJJA 5EYWA 4M1BA 2EAWA 3TMLA 2HROA 5I3HA 1YX1A 4OBRA 3OOQA 1T6MA 3P74A 3OLDA 4P8XA 1R30A 2YYTA 3PJUA 2FTYA 4A3HA 2JIEA 3IAPA 1GQIA 1X7FA 5I07A 2WZHA 1XRFA 1TR9A 4GI8A 3KLKA 1UJQA 4YWSA 2FMNA 4OZOA 2BY1A 1EEPA 4MIMA 2V81A 4GRSA 4M7TA 3WJXA 2VCAA 2I7GA 4FX6M 3PZOA 2PDLA 3G8RA 4LALA 1PIIA 5D2VA 1YE6A 4E2DA 4UMBA 3MMWA 2FH8A 4N7QA 3LCXA 5E5CA 3V0TA 2PFHA 3K8MA 1OX6A 5I23A 3WQDA 3NAVA 3TYDA 5C55A 1H41A 4PEKA 2BHUA 1HFBA 4ZR8A 3NQ2A 2CXGA 3LQLA 1J4EA 1E73M 5IM51 1IIHA 4ZQNA 4QQUA 3G1HA 3JZUA 3UY8A 1D3HA 4DZAA 2PF8A 2J8FA 1ZBWA 3MWCA 4D6GA 2HS8A 4ZE4A 4FB7A 1RVGA 1PKMA 3EKGA 3WQFA 1LUCB 1SGJA 1EQPA 3VDHA 1G4EA 3BLKA 3UVAA 2EG8A 1A0CA 2FYMA 4NAEB 3WQOA 4JTRA 1LQAA 2C3ZA 5ECVA 2ACQA 1SJAA 1G5AA 9CGTA 4WY0A 4PUDA 3G8EA 5FACA 2OLAA 4FNSA 3FSUA 2I1OA 2ZKMX 2ABAA 4OIFA 4OKDA 1Q6GA 3AU2A 4JYDA 3IRDA 1AUSL 4U3CA 1IE7C 4C65A 4TIMA 2GGHA 1E9LA 3RILA 4Z2HA 3WLJA 1ZPTA 3LZ3A 1QRQA 2CCRA 1OFBA 5EL1A 1KBBA 2J88A 4O18A 3UYIA 4L7ZA 4ES4A 2PDIA 3TCSA 3TYZA 2WVVA 2J47A 3N3MA 2ZC8A 2OTDA 3SCUA 3VGFA 1GKPA 3MHUA 1ADSA 1FHVA 3L12A 3UD6A 1S2UA 4JYEA 3QM3A 4A4AA 5M1TA 4R88A 5XIAA 3N2BA 3IGXA 1TV8A 3ABOA 3EWYA 5J04A 5A5WA 5CAHA 1HN1A 1SO6A 3PBGA 4IXHA 3BAYA 4LAMA 1EC9A 4WSKA 4O11A 1GUVA 4NZFA 1V79A 3G1SA 4E0CA 3GB6A 2W63A 4XAYA 2A3EA 3O05A 3UGVA 3RYSA 4Q7NA 1E72M 4GYPC 2WCGA 3SY5A 3JRKA 5F2LA 1Q4NX 3QV7A 1F4HA 3C0SA 1TTJA 1FY6A 2BP1A 1TTIA 1REQA 3KWXA 2G3NA 4Y2WA 2ALRA 1UUQA 4C6IA 4BA0A 1VYPX 2ZIDA 3COTA 1JAEA 2W79A 2XH7A 4AD0A 2FH6A 3AHZA 2OYLA 4DJDC 3VNYA 3BG3A 1EH9A 2VYOA 1H5VA 3EOSA 1UWQA 3UBPC 4YNGA 4DM2A 3T40A 4DBSA 4W8BA 1M7XA 4CN1A 4KERA 2GK1B 2OJPA 2G5WA 3VKCA 2YFNA 1LG1A 1K9TA 5LIYX 2POZA 2VWSA 2VC6A 2GSJA 1Q6FA 1V0MA 2WMIB 5ABHA 3DC8A 4IICA 1R86A 5BMWA 1O7AA 1W3IA 3Q58A 3GHSA 3UZ5A 5T91A 4QS6A 1PO9A 1WDDA 2G3JA 3P6LA 3RMJA 1P7TA 2G3FA 2YLLA 3GDKA 4XZMX 1PE1A 1TWDA 5M5DA 1XLAA 2VENA 3S46A 4E2BA 1NOWA 4YN5A 2OR2A 3S1VA 4W7UA 1TA3A 3G5EA 5K4XA 3GS6A 3WLKX 4AZHA 3M0IA 4NYYA 1UH2A 2A3BA 2A7RA 4LVDA 3UXLA 1TPDA 3TTYA 1IXPA 3A9BA 3CTLA 5LA0A 1Z44A 3NQEA 4IIHA 5ABGA 1NFGA 4H8NA 4NJHA 2YKKA 3LHYA 3I3DA 3G1YA 1U22A 3WBAA 2VURA 4WXYA 1A5AA 1UR9A 2X1UA 1XWYA 1RH9A 3IUDA 3RR4A 2R1PA 5BRBA 2AMGA 5LXXA 3C61A 4MG4A 3DGRA 3TYEA 2HEJA 6TAAA 2FTPA 3ALGA 4HBKA 1KXHA 1GORA 2IS7A 4QCFA 4QLJA 1KM2A 3MYOA 1E4IA 4C6LA 4I7VA 4U5IA 1FWRA 3MP4A 4F2BA 2R8WA 4UR7A 2DZTA 3H22A 5DBTA 4KBXA 4OQVA 5FJUA 2Y5EA 1B1YA 1TPVA 4TQTA 5A69A 2AGKA 3P61A 3AO0A 2P10A 4RXFA 1IT7A 4Y6GA 3I7SA 4QS5A 3WSUA 1UWAA 1CXHA 4LYQA 4G7EA 4RZ5A 4AMAA 1SUXA 4AY7A 2VUYA 3WQPA 3CUHA 2WJDA 4H9XA 3D0CA 1FWNA 1NAL1 1BTCA 1P0DA 1RBAA 5REQB 1PIFA 4H9MA 3B05A 3TAOA 5HANA 4G5DA 4LUTB 3P67A 2V8ZA 2C0AA 3ALFA 3DERA 5IRPA 2VP8A 3DU0A 5DCEA 1JZ8A 2I5IA 1KFJA 1MXSA 1F3XA 3CV7A 2GVGA 3SI9A 2VD9A 3EMQA 3DYOA 4Y9OA 4PB3A 2PB1A 2PZ0A 1ZCOA 2ZZ2A 2DZXA 4XV0A 3ZSTA 5C9WA 3BMWA 3UGRA 4UTWC 4PMVA 2IW0A 3GVVA 3N25A 2HNEA 4PMQA 2BGSA 3R0DA 3FS2A 3MKCA 3CXOA 1EJ7L 3CPUA 2WJEA 2YXXA 3URBA 1ME7A 4S3JA 3MI3A 1DJQA 4MFDA 2Q8XA 3WF3A 1RLDA 2HE8A 4QAWA 3QRHA 1JCTA 3ARWA 4XO6A 4PBGA 3M0XA 2WM0A 3WBEA 2JEQA 2YX0A 4FLRA 3L0NA 1DL3A 2P8BA 2O9PA 2DP3A 4TX8A 4XB3A 3GNNA 3S2MA 3W6LA 3SN0A 2XUCA 3E2SA 2RJHA 3RCYA 1KM6A 3ELFA 4PTNA 1G01A 2CFFA 2Z29A 3DENA 4Z42C 3GC4A 4P7LA 5A95A 2HVOA 3WFLA 3LRKA 3L2IA 1VR6A 2E0PA 4E8CA 1UIPA 1DHPA 1QAPA 4ACYA 1FWHC 3U4FA 3CZJA 1XIJA 3ITOA 2WZIA 4IG2B 1J12A 1VPYA 2E5CA 3DI0A 2ZRVA 4W5ZA 2QR6A 3CUZA 1B3VA 4FOUA 3SUTA 2W67A 1IEVA 2BGNE 1V3HA 4LUSA 1UP3A 3AIEA 3W27A 3EA2A 1O68A 2GGJA 3FA5A 3LOTA 5FESA 3GH4A 1JXJA 2X0SA 4HA4A 1TVLA 3W88A 2R94A 4MKSA 4QXIA 1XLIA 4HCLA 4I7WA 2CLHA 3W74A 1NFBA 3A3XA 4LX4A 3THUA 1UUMA 3VMOA 3EEZA 1TWIA 5CC7A 3C8FA 4AD1A 4TMBA 4NZ3A 5CPMA 3LCHA 3AS0A 4C6KA 2Y6ZA 1T0OA 3GDLA 4CU6A 4GNJA 3SUWA 4CNUA 4D8ZA 4A35A 3DGBA 2R82A 2QMJA 2CITA 3VD9A 1J79A 2XH0A 2QCGA 5HATA 2F6KA 4EPEC 1OT2A 4HYRA 2FHCA 4ZQMA 1V7AA 5FL0A 2H9AB 3G2GA 4B91A 3W81A 1X8CA 2DIKA 2P0IA 3AMGA 2XFYA 4QDWA 3PUGA 4HZ7A 4PE8A 3V5FA 4YS1A 4POCA 2OLSA 4BK9A 4JZ5A 1A5LC 1KRAC 4LC8A 5HUPA 4F0HA 1OC7A 4O1FA 1MEIA 3MUZ1 2O55A 4WY0F 4CQBA 1TQXA 2QGYA 1R6WA 2QS8A 3ZLGA 1EHNA 3THDA 1AD1A 3OIHA 4BJHA 4L6OA 4ZOCA 2E6DA 3NPWA 4XD4A 4C7FA 1UWRA 2DDXA 2XSAA 3MVTA 2CZVA 4WKHA 5F4WA 5AYXA 1V03A 1PV8A 4JTHA 3OO2A 3IJ8A 1R3QA 1RD5A 3LBOA 4A3QA 2PC4A 2FDMA 1ZB5A 4M5PA 4GNKB 1LWHA 4Q8UA 1OT1A 3TN3A 1XISA 3CWHA 3NSMA 1GOXA 4PB5A 7TIMA 4J3ZA 3HPAA 4C6PA 3GG7A 4P2VA 1X97A 4IL0A 2OPJA 1VFLA 2WAGA 1EBGA 4PEEA 1RR2A 4ZOEA 1QI5A 4L61A 2IPWA 1BWVA 3TQPA 3RN6A 3SECA 2YXGA 4LBUA 3HTWA 1HGWA 3G1RA 3CJPA 4FOKA 1JI2A 3TONA 3K2GA 3BSMA 1DEDA 4PMJA 1R47A 3N18A 4WGXA 2Q71A 3W84A 1GYNA 3O2LA 4GIAA 2CBVA 3ORWA 3EX4A 3TYAA 1XRVA 4GG9A 4AZCA 1QPKA 3BPWA 1SZNA 4UZSA 4AX6A 3BO9A 1FDZA 1W8SA 5D05A 3S1XA 2WMFA 4O52A 1UBSA 3HG2A 4BKNA 1HT6A 4LF2A 1EJXC 4GNVA 4LAOA 1KBKA 1VBHA 1WZMA 4I8DA 3EB3A 1PYFA 5CG7A 3SCQA 3BW3A 4H41A 2INZA 4IMDA 2V3DA 5F4SA 4F3HA 3KRUA 4KF1A 4Y90A 1P0NA 1NARA 1JXKA 3T9PA 3ZXWA 1HJUA 3P5ZA 3MBFA 3V0SA 4A2RA 3W2NA 3C52A 3TC6A 3H7RA 2XU2A 5I77A 4JTGA 4EACA 4CN6A 4EF8A 1MQQA 4K8HA 2ACUA 4NILA 1S5TA 4ZQPA 4LY8A 5CSUA 3DYPA 3LB0A 4PUWA 4C6FA 5ABFB 3WDQA 3CTTA 3PUDA 1W1IE 2Z7GA 3O6YX 3TYBA 3PUEA 1KFLA 1O5RA 3HGSA 4H6RA 1EP3A 2CHRA 4LB3A 5A6MA 2HDJA 1QW7A 5DFAA 1POKA 1ME9A 3ZSSA 1OM0A 4LAZA 4MPQA 1KLZA 2DSKA 3SCWA 2J77A 3VI2A 3ANYA 4Q8TA 5BWFA 2HK1A 1SJDA 4O14A 3Q4DA 2BWGA 2ZE3A 2QHAA 4C5ZA 3TP4A 4Y9AA 6XIMA 4U4MA 2PWGA 2PODA 3K30A 4UQ9A 2DUAA 2Y7EA 2ABBA 2OOGA 4YVVA 4E3VA 4NJKA 3WD3A 1XINA 3KOYA 3STCA 4FF7A 1K9DA 2ZXBA 2CLMA 4GBUA 1QASA 3QMTA 4NNBA 1EP1A 3AS1A 2RDWA 4IJBA 2BOFX 3B8SA 3W23A 2ZX5A 1B2YA 4PL1A 3G1VA 3EMZA 2B4GA 4BWLA 2P5NA 1W5OA 4HYVA 2YBTA 4UCGA 3WDRA 2JALA 1QO5A 1SO5A 4UTFA 4GGHA 4HPGA 3WUFA 4IQDA 4HCDA 1CLKA 3ZJ6A 4MHBA 1QMLA 1DXFA 4J28A 1IZKA 2WJZA 5LIWX 1JNEA 4AZIA 4KH2A 4JTIA 1XFCA 3AIWA 1XIMA 5DMLA 1K8ZA 1XBZA 3EYPA 3WNPA 1AJ0A 1DTUA 3ZT5A 3FW6A 2X7WA 3VX0A 3RM8A 1K1DA 1KO0A 3BZGA 1VFOA 5CCZA 2GOUA 1PUDA 1WO2A 4Y7EA 1ZLPA 1VB9A 4JHZA 3E1F1 1DJGA 5CEWA 1UOKA 4ERAA 4AF0B 1CZ1A 1O5QA 1Z3NA 2DUZA 1PKYA 2R24A 1GTHA 1RD6A 1UR3M 4FZIA 1LLWA 3FJ4A 4Y9MA 4J35A 1H62A 3GG1A 3BXWA 3TSBA 4BR1A 2Y7GA 3TJIA 3HGRA 4W87A 1JCJA 2H3BA 2GJNA 1QDSA 3OVRA 2OSYA 4I90A 3KBJA 3MUIA 4U3AA 5F4XA 3CEUA 1M6JA 2CETA 1W5QA 1V3MA 2G4JA 3TNBA 3C0LA 3QVQA 2FGLA 4BWLC 4YTRA 4AIUA 5CZTA 4OVXA 3MO4A 1E5JA 3OBKA 1GOKA 1A3WA 2CPUA 5IFTA 2PE4A 1ICSA 1I2PA 2XVGA 2DPEA 1JYWA 3TXZA 4TXEA 1TJ0A 3A24A 1LRQA 4B3ZA 3KOXA 4FR1A 4XZWA 3B9AA 3AZSA 3V16A 2HE5A 3RU6A 1TJPA 2HPMA 3KWSA 1JD9A 2UBPC 4XKMA 1GONA 3DXIA 3GU2A 3B8TA 3CQJA 3EOEA 5KETA 3THQA 1H63A 2QAPA 4K8EA 2WWDA 1GQNA 3UPBA 3M1ZA 1UD2A 2XIOA 1E55A 4H9UA 3U5UA 2AL1A 3PWAA 1W1B1 4AU0A 3FOKA 1M7JA 1QWKA 4PRWA 2YDAA 2CLOA 4JTQA 3FN9A 1Q8JA 4K6AA 3ZVHB 1W3HA 2QULA 1PYMA 2WVSA 2I9EA 2W3ZA 5D38A 3QSTA 3WK2A 2FHBA 4IIFA 4PUUA 4M29A 3P80A 1E3ZA 3WLMA 4S23A 5CGQA 1S3HA 3I7RA 1DKWA 2ZDRA 5HA7A 3LGDA 4M81A 3D5HA 4MWAE 3PANA 2GFTA 3CHDA 5IHSA 1K6AA 2GJLA 2EBNA 3QQ0A 1Q45A 2PA6A 1RAKA 4UQBA 1KV5A 3OZOA 1GEQA 2A1YA 3S9YA 3WL1A 3OBEA 3MC5A 5KSWA 3WJZA 1A3HA 4L56A 3EDEA 5FEWA 1QI2A 5EU9A 3FNDA 3V0UA 1VFTA 2V5CA 4TU1A 4E4UA 3EOUA 1EJSC 3CHCA 3RAOA 1T41A 2DT1A 2NVCA 2XINA 6ENLA 1HZYA 2V0TA 5DMNA 2YL5A 3CLMA 2XIJA 3LI0A 1M7PA 2JF7A 4L5ZA 3UG3A 3FGCB 2NQLA 4INFA 3BUVA 3CC1A 2YB1A 3M0YA 2HSAA 3NCOA 2Y70A 2QJHA 1MZRA 2J25A 4UUIA 1UZ1A 3LSBA 3SQLA 4WGHA 3OTRA 5I3FA 3VXGA 1NOFA 1XCWA 1P5BA 1MEHA 4YTQA 1JJKA 3WD0A 1PCKA 1GGOA 1XCFA 4P7RA 3IUIA 3H4XA 1H4PA 3FA4A 5A8MA 3GG0A 3SIMA 3NVTA 1H61A 2Y7FA 3VIKA 5FEXA 5BU9A 4JTCA 4DUVA 4HNUA 3KOZA 3WBYA 3KM8A 3PBWA 2PWEA 1PSCA 3L5AA 3QBUA 1QHZA 3CK5A 3RK8A 4M6QA 1VH7A 3ARUA 5C9XA 2GYIA 3GQYA 2YLAA 4PBFA 3ZR4A 5A94A 4GJ1A 1XFBA 3AWNA 4B5UA 1XLJA 4J3SA 1EA0A 1RUSA 2QDDA 1GW1A 4J40A 3M47A 3V3WA 3ITYA 1J5SA 5HNUA 1U5HA 1UR2A 4H8HA 3CL6A 1HO4A 4UQDA 1AMYA 5KINA 3TROA 2WVTA 4PBEA 3CNYA 4GXPA 4MVAA 1MNSA 3CASA 3WH8A 1FXQA 3GM8A 2FVLA 5HXMA 2WSPA 1YRRA 4XD6A 3VNLA 2GVLA 3SAZA 4HN4A 4NI3A 2V5KA 1Q4WA 4GKLA 1I1XA 1R9ZA 3GXTA 1JPDX 2YIHA 2EPMX 4BFAA 4IMAA 4K1WA 3AS3A 3CB3A 4WJXA 5EBAA 1UMLA 5FOOA 1EYEA 1GVIA 4OJYA 3CO8A 3M0ZA 3UFYA 4YJ5A 2FFCA 4HSHA 1TMQA 2XIBA 5CGMA 3CHEA 4CLMA 3TTQA 5DN1A 1YE4A 2PDQA 2WC3A 1SZFA 2YR1A 3K1DA 3UCDA 2VCBA 2J6VA 2P1FA 1JUBA 1FP8A 1W2VA 4ML9A 2NUYA 2A2IA 3P0XA 2WVVB 1H0GA 3WD4A 4KEMA 3NO5A 5AHFA 2VCCA 4AHOA 1J0HA 3RPDA 4PYSA 3LTPA 4MB5A 3T7VA 1ITCA 3VPLA 3SIZA 4KMQA 4O50A 1IXQA 1F7BA 5HAOA 4OT7A 2ZWYA 1ZSXA 1G7VA 4IPLA 4HMEA 1CT5A 3NDYA 3S5YA 1EKOA 4X61A 5TQLA 5H8PA 3PZNA 4FMVA 4K39A 3LLDA 2VRQA 2Y8VA 3QQ1A 1TR1A 1BXCA 1K8YA 1AZ2A 1TVPA 3LTYA 4L1XA 1MUMA 3H55A 1OF6A 1IXNA 3ONBA 3GNPA 1E56A 1I0BA 1OABA 3CMJA 1ZNNA 3UYCA 2O7QA 2XVPA 4ADTA 1XBYA 4J3VA 2X2YA 4URIA 2X05A 3FX4A 2WSKA 1C91A 1IWBA 3WQGA 3SCPA 5K9CA 3N19B 3T55A 4HPHA 1R3TA 5CZKA 3VIIA 3O6AA 3A21A 4JGDA 2CLLA 3T08A 1GVQA 1U5JA 1YDNA 5LXEA 4TV6A 1NDZA 1X98A 4LV4A 2XN2A 3W01A 4F9DA 4O57A 3OVGA 3MV01 1H09A 2A4AA 3RJYA 1JCYA 4UR9A 5CC5A 3KCJA 1UH4A 2Z2AA 3W7QA 3LD5A 4XWUA 3WDPP 3CAKA 4HK7A 1J0IA 3MV11 1L6SA 3WUBA 4B5XA 1N7KA 1VRXA 1XG4A 3M46A 4NI8A 1P0EA 1WE5A 5F1UA 5A2BA 3VIFA 3N17A 3AAMA 3GNRA 4JHMA 4HNNA 4X63A 2PMQA 2GQ3A 3DUGA 1P7TB 1JQVA 2FFIA 3EKZA 2C13A 4ZQRA 3AS2A 3WD2A 4IGHA 2XFWA 3TFCA 5H8UA 3TOYA 4HIBA 4CGTA 3N2TA 1TA3B 2PURA 4BF9A 4ROQA 3UESA 4ZGYA 3MO7A 4AWEA 4XZHA 3AXXA 4AVFA 4EPBC 1IQ8A 4HNLA 3THCA 4C6QA 1JDFA 2IQ0A 4MJ2A 3UW6A 4K3ZA 1B3XA 1UKPA 1X6LA 4KFNA 2DZBA 4PCFA 5EY5A 4BQ3A 1IXOA 1MYRA 3M07A 1RLCL 2QZRA 4L65A 4FO4A 5I06A 2V2DA 3TVAA 1LT7A 2WZEA 4MOZA 4W85A 1PEZA 4X0NA 2ZUNA 3OODA 1DPMA 4JOMA 2ZRYA 2X7VA 5JU6A 1A5OC 1KM4A 3T2PA 4ZCWA 4AMCA 1R3RA 2C16A 4CQAA 2J79A 2CWNA 4U2ZA 1KQZA 3P14A 3OLIA 1NH6A 1GHRA 1HP4A 3W1UA 3OPSA 3TWAA 2E9MA 4JEQA 3APYA 3W37A 4WKFA 1HL2A 2XIMA 1FOBA 1XL9A 3EWUA 1FWWA 3E12A 3WD1A 5FAJA 5D9NA 3CIXA 5MHBA 2A5HA 3W83A 1ZFJA 2MANA 4UOJA 3M0KA 1YW1A 1TMLA 3L9CA 1YIXA 3CUXA 3L68A 1HF6A 4FNQA 4CQ9A 4RPPA 1VYRA 1VQTA 2YBUA 4FI4A 3VC5A 2VT0A 3NO3A 3VDGA 3PULA 4S2CA 2ZYFA 4F79A 3MP3A 1QJWA 4DEFA 4K7VA 3ITCA 1JYVA 2O7SA 4IPJA 3N6QA 3LBCA 3HFTA 3KOFA 5GQBA 1A4LA 3H26A 5AYBA 1LRNA 1W6TA 1M3UA 1HX0A 3SQSA 4QJ4B 4UMCA 1US2A 2YYUA 4HK6A 3BE7A 3WMSA 3SB0A 1OYBA 5PTDA 2ZCGA 1G9HA 1OK6A 1PZ2A 4ALDA 2PDHA 4KWUA 4QEEA 1A50A 2GJXA 3BLEA 1M68A 4S38A 4GA8A 3W7EA 5FL1A 1TELA 3EZ4A 7TAAA 3W0KA 1MDLA 1KWKA 3OYXA 1AODA 4I8YA 4JX4A 5BOEA 3S9IA 3F4VA 4I9MA 5DXYA 3B8WA 2H8ZA 4DO5A 1VP5A 4PMZA 1W9UA 4G8TA 2GWGA 1KWGA 5KZEA 1PCWA 2NLIA 1L6WA 3CV1A 5D2WA 4ZXLA 3WDIA 1LCOA 4QGCA 3VFLA 1EIXA 1X39A 1OCJA 5BXTA 4LUJA 4MGGA 1LJYA 4NZJA 3F5LA 4CD7A 3STFA 1LZOA 3CPRA 3VOIA 2DZVA 4GD0A 4MYAA 2C19A 5I24A 2RHGA 1V6VA 4Z2JA 4PMRA 4B9ZA 1EF3A 5DBUA 4CD8A 1O5XA 4AEEA 3FVMA 2PTWA 5HMDA 4AD4A 3R12A 3IVTA 3R0UA 3W6YA 1P43A 3LLFA 2R1KA 3RLUA 4UTLA 2E1DA 3CV6A 3WEOA 3PAOA 1AL8A 3NJ3A 4LUSB 4DZ5A 3HQOA 3TN4A 3A4WA 4JIIX 1TE6A 3FJ6A 4UIOA 1Q3NA 1GVSA 3UR2A 4DO7A 4JL1A 1OCNA 2WPBA 5MKGB 4XTDA 4MLRA 2FVKA 5FEPA 1CXKA 3RRAA 3PS7A 4E2OA 2NT1A 3P3BA 3WLPA 2VZTA 3AC0A 4YVPA 4OV9A 3IANA 4W7WA 1W5MA 4MKNA 3G6LA 3PHAA 3CYVA 2GGIA 1Q6CA 3MMTA 3QGAC 4A8LA 4JQ4A 1LDCA 3WJYA 3CWOX 1FTXA 3VUSA 3E0LA 3N13A 4CCDA 2B31A 1HKJA 1PXGA 4P8VA 2WOQA 2RH9A 5GJMA 1YEYA 5HDRA 4E8GA 3WF4A 3W82A 1R3WA 5I5RA 3IUHA 5CPNA 3A4XA 4PODA 4UFKA 4IPIA 1YXCA 3LM7A 4P5UA 2OYMA 4JNMA 5IFPA 2BV9A 4E6MA 5K7JA 5AYIA 2WHMA 2ZX8A 1FCQA 3AMKA 1TPC1 2P0OA 4JTKA 1KW1A 3NQFA 3LRMA 1UR0A 4B5NA 1T5AA 3FFSA 2EG6A 2V63A 3UA4A 3O16A 2ZTKA 1EJTC 2XTKA 4KCTA 1TJ1A 1V08A 3PZGA 3VX1A 3VC6A 3UY7A 3T09A 2FIQA 4AX7A 1TTQA 1O94A 2KAUC 4C6BA 2G50A 3AXHA 3GXMA 5A8NA 5H6HA 3VE9A 1J96A 4OECA 4DWSA 3QPZA 4CEXC 3UWWA 1I0DA 4GI6A 4JX5A 4CU7A 2DZUA 2IKIA 2HWGA