2Q02A

Crystal structure of a xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 at 2.40 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
GMNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQLASWSEAEIEEQINRSVSLLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative cytoplasmic protein (NP_463296.1) from Salmonella typhimurium LT2 at 2.40 A resolution
rcsb
source organism Salmonella typhimurium lt2
molecule tags Unknown function
molecule keywords Putative cytoplasmic protein
total genus 97
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2q02A00
5J8LA 4ZB2A 3QC0A 3CWHA 4OVXA 5EMJA 3QYSA 1YX1A 2QULA 1XLJA 3LMZA 2QW5A 3L23A 3BZJA 5H6HA 3VYLA 1XLIA 4A8NA 2GUBA 3CQKA 4E3VA 5AVNA 5B7ZA 3VNLA 4XISA 4G56A 4PFHA 4J4KA 1S5MA 1XLBA 2X7VA 3KCLA 1A0CA 3VNJA 1XLMA 4A8RA 3ITTA 1BXCA 4EACA 1BXBA 2GYIA 3ITYA 1XINA 3UA3A 3KTCA 4ZB5A 5I7GA 5B7YA 1XLLA 3GNXA 1XISA 2GVEA 2I56A 1S5NA 3KBMA 1XLHA 4YTUA 2GLKA 3KBNA 3WQOA 4K3ZA 4DVOA 4XIMA 4QDWA 5XINA 1GW9A 3BWWA 4A8IA 4KW2A 4YTRA 1XIMA 4W4QA 3VNIA 3ITOA 4X60A 1XIGA 1A0EA 1D8WA 3P14A 1I6NA 2QUNA 4YTTA 3KBSA 3M0MA 3CQHA 3FVMA 4QEHA 1O1HA 3QXBA 5H1WA 5EMLA 1XP3A 1QT1A 1DIEA 8XIAA 3XINA 3TVAA 2NQHA 4YTQA 3AALA 5XIAA 3C0LA 2X7WA 3KCJA 4QE4A 3IUHA 2XIMA 1XIBA 1XYMA 1XIJA 9XIMA 3ITVA 1XIFA 3M0LA 3BZGA 4HHMA 3AYTA 5EMMA 3M0XA 3M0VA 1MNZA 1XIHA 4US6A 2Q02A 4Q7IA 3U0HA 3AAMA 3IUIA 4LNCA 4XKMA 2G0WA 5XIMA 2G4JA 4X61A 3UXIA 4QEEA 1DE6A 4XSLA 1A0DA 3CQIA 3UU0A 3OBEA 6XIMA 3DX5A 4ZB0A 3DBNA 3C0QA 3C0SA 3KBVA 1QUMA 1XLCA 3BANA 3KBJA 5TNVA 7XIMA 3QZAA 2ZVRA 4GLEA 8XIMA 3VNKA 3ITXA 4HNOA 3UA4A 4QE5A 1XIEA 1K77A 3ITLA 4XIAA 1MUWA 2HK0A 1XYBA 2HCVA 3XISA 1XLGA 3CNYA 4GJIA 1XIDA 2J6VA 4GQBA 3XIMA 4EAYA 3N4AA 4HHLA 3KBWA 2I57A 1XYCA 2OU4A 4QDPA 3JU2A 4K1GA 2QUMA 2NQJA 3M0HA 4ZBCA 5FA5A 5C9ZA 4XSMA 1TZ9A 2NQ9A 3KCOA 3BDKA 4X63A 5AVHA 1XLDA 4PGLA 3UVAA 5EMKA 2XISA 1XIIA 4HGXA 1XLFA 1OADA 2ZDSA 2HK1A 3VNMA 3AYVA 1XLAA 3NGFA 3U3HA 1QTWA 1XYLA 1XYAA 4QE1A 1DIDA 2XINA 4GJJA 3TC3A 6XIAA 1XLEA 5B80A 1XICA 4DUOA 1DXIA 3M0YA 4A8LA 3IUDA 4YTSA 9XIAA 3KWSA 1CLKA 3CQJA 1I60A 1XLKA 3P6LA 1DE5A
chains in the Genus database with same CATH superfamily
4YCOA 4KFNA 2ZX8A 4IMEA 2EXOA 2ZRWA 5G2HA 3OVRA 1A5MC 3TC6A 2Z1VA 3BC9A 4MNJA 3T2PA 2FIQA 3N2OA 3MU7A 1YE4A 2FHBA 5JBEA 1JDDA 4PUMA 5XINA 2NLYA 1GOXA 5DF0A 5K4XA 3CHVA 3ZSSA 1HN1A 1K7XA 4Q8OA 2D3NA 1KC7A 1EKOA 2AGKA 4CQCA 2BY1A 4MLRA 3OO2A 2EG8A 2GJXB 4CVUA 4LVFA 2WO5A 3TROA 5D09A 4DQWA 1UIOA 4ZQNA 1OSEA 3WJYA 4LVGA 4E6MA 2V82A 3K2GA 5MKGB 2PBOA 3IVSA 1DE6A 3U7BA 4K37A 3NXFA 4TIMA 2WMGA 4R53A 3OA5A 3C0QA 5G2IA 4PUNA 1S5WA 3MWAA 1PV8A 4P7RA 3L7RA 1XIEA 1OG6A 1XSIA 1PZ0A 4ZE5A 3ZJ7A 2YBVA 4RW5A 4IJCA 1TPWA 2J77A 1VPYA 2QGYA 3CL7A 1EP3A 1J5TA 2A6LA 2QLYA 1VJSA 1VFFA 1A5KC 1TIMA 1NQ6A 4KIRA 2YXXA 1EX1A 1B1YA 5CC7A 4J3TA 1SFJA 1CWYA 3PZOA 2XH4A 1F07A 1EC8A 2E6FA 3CQJA 3WF3A 2C18A 1L6SA 1EPVA 5LA0A 2QULA 4GUGA 5A6TC 6TIMA 4A8NA 3E96A 4Q4PA 3T2QA 3VCRA 4O1AA 3NYDA 4UFHA 3VA8A 3WQ5A 1PIGA 4QHRA 3C2OA 3VX0A 4IZGA 4REQA 3S1UA 5C9RA 1GHSA 4QXIA 3TCEA 3E0FA 6REQA 2Y70A 5E70A 4PUKA 1H7PA 2YL5A 5AKQA 3R1ZA 2QF7A 1LUCA 1IWBA 1CGYA 5H8MA 5DCBA 1IXNA 2WHLA 1VJZA 1IEIA 5TD4A 4R3UA 4LWWA 1UJQA 4JTLA 1K4GA 3WMSA 4JFVA 3B06A 4C7FA 4Z1BA 1ZUAX 2YW3A 4UR9A 1YRRA 2DDXA 1BKHA 1ZAHA 3SN0A 2FZDA 4O1EA 1EHNA 2ZOXA 3OGVA 3N15A 2YL8A 5I3KA 3MMUA 3AROA 1SZNA 3Q4DA 2BASA 3W1TA 1HKKA 3BURA 5DANA 3GM8A 3IJ8A 1XRTA 2KZHA 2PP3A 3GXDA 3UPWA 1LYXA 2EPMX 1FWJC 1Z89A 1VBGA 4WIWA 4HQVA 1HJSA 4NAEB 4Z2HA 2XWDA 7ODCA 1ITXA 3ELFA 4IMGA 1JZ4A 5CGQA 1X39A 4URIA 2OT1A 3R0KA 5CCZA 1K9DA 1J93A 4LAZA 5C9WA 3AJ7A 2YCLB 3THQA 1BXBA 1EOMA 3A64A 3K8MA 4DJEC 1T8XA 3KL3A 1EDTA 2TPSA 3LNMA 1UPMB 5C2GA 3PF3A 2J7GA 2DSKA 1EOKA 1VKFA 4NG3A 2FZ8A 3A47A 4JTDA 3IIOA 4F0MA 4LYRA 4PH6A 1ZLPA 3FVMA 1UIPA 3SR7A 1CGWA 2W9MA 4BS0A 4UOQA 4C6EA 2WSRA 1YHTA 2A21A 3OIHA 3OLDA 3VKCA 2WANA 2E9LA 4AY1A 3EMQA 1CW2A 1EJXC 1THFD 1V6WA 1PKLA 1QAPA 3QFEA 3UZWA 3N9RA 1B5TA 2VNCA 3EWXA 3PPCA 4XAPA 3MUCA 3C2EA 4EOUA 1JZ8A 3W81A 2D0GA 2X30A 1LCOA 3CPRA 2FTPA 3N4AA 3VIKA 4M56A 1NFBA 4JCLA 1EIXA 4DUWA 3KM8A 3VMNA 5D30A 2PS2A 3GR4A 4KBXA 2H8XA 4AQLA 3WDPP 2P3EA 1HVQA 2OWCA 3S2NA 3SGGA 2WW5A 2A3HA 3I3DA 3KVMA 4YCPA 1Y5VA 3M0KA 4BKNA 1V6UA 4GQQA 3SGUA 3W1UA 1SZGA 1J0YA 5D2VA 1QPNA 1NF0A 1C91A 1S1PA 2V2CA 2ZC1A 4MPKA 2VXNA 4RW3A 1GOQA 4K39A 4GQ0A 1XLMA 1NQKA 1RP9A 4KS0A 3CYJA 4HYWA 5M5DA 2PP1A 5C2XA 3U4AA 3MTWA 4HJWA 4DZIA 4UTWC 3QBUA 3RLGA 1PO9A 1JFHA 2XFYA 3ZR6A 2B7OA 4IPLA 3QF0A 3DFTA 1FWGC 2B81A 3DYOA 4ICMA 1I2QA 1HKVA 1S39A 4LUSB 1Q6RA 3G3MA 4JQ4A 1OIFA 4WDTA 3AIUA 1VD6A 3G1DA 3PJUA 1MNZA 4W5ZA 3T42A 1O5RA 5D8ZA 3TN6A 3N6JA 4QEEA 3AUJA 4GYKA 1QI4A 1TJPA 3CZJA 1I2RA 3GE7A 3W7OA 3AHYA 3W23A 3WQCA 1XYBA 5ABTA 3VM7A 3EDKA 5ABFA 2SFPA 3CU2A 1QO5A 3M7WA 2H90A 3URQA 3MMWA 2X1UA 1FXQA 2GVJA 4KFOA 3WENA 1E15A 3LPPA 4L9XA 3GIQA 1J2BA 1CB2A 1PXGA 4YWIA 3A3WA 5IBXC 5M03A 2CLHA 4ZEPA 1MUMA 4A8LA 4LNYA 4S3AA 1DWJM 2RHGA 1XLJA 1EQCA 3LK6A 2BHUA 4H19A 3USZA 4O15A 1OFDA 1GEHA 1FRBA 4FZIA 4Z2GA 3R13A 1TX2A 1W1VA 1XCXA 4OOUA 1EA9C 2PSNA 4QLKA 1G4TA 2O4MA 1F3EA 5HR7A 3S42A 2D2OA 3K8KA 1UJPA 3SCNA 5A94A 5DMYA 4O0ZA 1UHVA 3OPSA 5CBIA 4POCA 2OZ8A 1Q6LA 3TC7A 4ATWA 3KTSA 3M16A 2NSOA 5BOFA 4KCVA 3V1HA 3ATZA 5AC6A 2JKAA 3PK7A 2QMJA 4S23A 2R1MA 3QQ1A 4EWND 2DPEA 3QGKC 1K6AA 3KVLA 1K77A 1NWSA 3N2XA 1M7XA 3PPFA 3LG3A 3VIIA 1GOKA 4ORMA 2XHYA 3RGTA 3IRDA 4B3LA 5EFFA 4PB3A 2BGNE 3GUWA 3MB9A 4GFSA 1GVFA 3KCOA 1I45A 3PBMA 2DY3A 2DP3A 1XYAA 5FAGA 1EHAA 5CH9A 3DYPA 4TUFA 3T4WA 5GJNA 3WMCA 3STCA 3DECA 5A6BD 2QPSA 4ZSUA 2X1RA 3EOSA 1OD0A 2Z1BA 3W76A 2X2GA 4KQNA 3N6QA 5MKGA 3SGZA 3B8UA 2BX7A 2HE5A 3WELA 1MRAA 3WLMA 4EWJA 4ZB5A 1HX0A 2VYOA 4FNUA 5DRIA 3KBMA 2I56A 1VBRA 1VFOA 2ZUWA 2Z1XA 1XI3A 5AC7A 3GFZA 5CGTA 2ZZ6A 1OABA 1G5AA 1G01A 5CZTA 3CGTA 4XTDA 2WMHA 3VDAA 5FAJA 2ASHA 2C7FA 1O1ZA 5LGXA 2EO7A 4Y8EA 5E6ZA 3MI6A 1R3VA 3TUUA 2VGBA 3W82A 1U5JA 1AW2A 1XIBA 4MZYA 4V1YA 4WY0B 3WDIA 1IT0A 1CECA 2IQDA 1T5AA 2UV8G 1FWTA 1BSLA 3S1GA 5KINA 3QZ6A 4IF2A 4XIAA 3G0SA 1IEQA 5K9XA 5F1VA 4AIEA 3W6YA 1AUSL 4KF1A 2OU4A 5FSEC 4JIEA 3IJ7A 1JCLA 4PMJA 2BZNA 1KBIA 4HZ8A 2ZDSA 3GNDA 3H7RA 2R8WA 2PDCA 4JTJA 4AX7A 2DV0A 2ZWYA 3MW7A 4UTTA 3S8HA 2HPIA 4JIRA 1P6WA 4OWGA 3WJXA 4WJXA 4CEXC 2QKFA 4YTSA 3H6OA 3F5JA 3HTWA 3CWHA 1TSIA 2XN0A 3WQVA 4RZ6A 4PZVA 3O15A 4LCQA 2V5LA 3BAYA 4YVXA 2BY0A 4J4KA 4CU7A 1L8PA 3MCNA 3G1YA 4P8XA 1K6WA 3ARWA 1UYQA 1TZ7A 4NJJA 3PZGA 3V0UA 1E4IA 3BW4A 5EFDA 1H0GA 4M19A 3UJ2A 4WK9A 3B0YA 5DMLA 1A5AA 1E6RA 1IHIA 3DC0A 3CT2A 1ZFJA 3H2MA 3CL8A 3CB3A 5H91A 1MSSA 1SYTA 3GKAA 1EGZA 5DMMA 3AYSA 1V6XA 3KRZA 4W8AA 4Q7IA 3PTKA 3BV4A 1OM0A 2J25A 2BFGA 1Q13A 1ZPTA 2QJGA 6TAAA 3OU8A 1HNYA 1KM6A 3VIJA 1JFXA 1WDPA 2ZUVA 3C3UA 2WNNA 1XSKA 1WP6A 4DYKA 1CYGA 4JTGA 4NIRA 3H54A 1OT1A 2Z27A 3C2VA 1FHLA 2V69A 1R2RA 3JZUA 5CPQA 3R5EA 4BHYA 1Y5XA 3MP5A 3G1FA 3FCPA 1DIDA 1HG3A 1TKKA 1LL6A 4MWAD 3R43A 3TYAA 3O07A 1PYMA 1XLKA 2POZA 1EEPA 2HBVA 1POJA 3BG5A 4OQVA 4GBDA 1M65A 1KFBA 4J35A 1E70M 3VGBA 1REQA 5T8GA 3DFHA 3BSMA 1S5MA 3JS3A 2ALRA 3TDFA 3VKBA 1QFEA 1VIZA 2FGZA 4C6IA 1YLVA 4NZ1A 3UBPC 1VYPX 3WNKA 4AYSA 4LYKA 1FHUA 1C8VA 3IIVA 4RZBA 1ZRQA 4GXPA 4IPPA 2JGYA 4ENLA 1QJWA 3SSZA 4ADTA 4YTTA 4HPGA 4AIOA 4B2DA 3EXSA 4KH2A 3UXKA 4UFMA 1GKRA 2YCKX 4PRWA 4Q22A 3R25A 2VEIA 4AW7A 3RFAA 5G2WA 3EPMA 2WZTA 2VX5A 5EPDA 3ZMRA 2XGZA 3BAJA 3ICJA 1B0IA 3CIWA 4PUJA 2I5QA 3GSMA 4WXYA 2O7QA 1UR9A 4EP8C 5EB8A 3EX1A 2NZLA 2CU0A 4AAJA 3PB2A 2R1NA 5CJMA 2J7DA 4ADSA 3WFAA 5KTLA 2Y2WA 5A6SA 1UWUA 3CJPA 1GYMA 5HR6A 2C91A 3C2RA 3ALFA 1F4AA 4NJGA 2YOCA 4HK7A 5KZDA 2Z6IA 1US3A 5JXQA 1VH7A 5FF4A 3KZPA 1HFBA 4U2ZA 3NPWA 3ECQA 4V28A 4PBEA 3KEHA 4JIQA 1UH3A 3GIPA 3CQKA 1P1MA 3P82A 1RSCA 3LQLA 4H7CA 4BJHA 1FCUA 1EBHA 1RCQA 3W7NA 3GKFA 3OZMA 1VR6A 1A3HA 4W7UA 1IEWA 5T9BG 4F66A 3HPSA 3BLEA 1D8WA 3P14A 4TVDA 1R0MA 1GKQA 4QJ5B 3WLLA 1J8VA 4M8UA 2RGMA 4DM1A 4S3CA 1QK0A 3LCGA 3HO8A 4EVZA 5AYIA 1YYAA 2NUXA 3GXFA 2Q71A 2DZTA 4K36A 4S3GA 4Z0SA 3IV8A 1DOSA 4W89A 1U1UA 3HGJA 2OKOA 4O4VA 3SQMA 3TNBA 4NRRA 5HJLA 3TKFA 5I23A 1P7TA 3FJNA 3W7DA 3FIGA 1SO5A 3S0CA 3N2BA 1TREA 1KXVA 2Q3RA 2BVYA 4QSHA 3KLKA 4DB7A 3R11A 3VOIA 5D8WA 1PE1A 3WJSA 4Q4QA 5J8LA 1A4MA 2X1SA 2ESCA 4YVPA 4Q32A 4I8DA 2UWFA 5ECUA 2FZNA 4GPNA 2VZSA 4QAIA 1RPXA 3SUTA 3LGEA 4EACA 2J75A 4YN5A 1RBLA 3RO8A 1XISA 4AWUA 3PUOA 1BKSA 3H4GA 1PYFA 4ZO8A 3S83A 3GG8A 2FVLA 1WPCA 3N34A 3DXIA 4HVXA 2OELA 3O3RA 1XUZA 1C8XA 2D20A 5BXTA 2CLEA 5EMMA 3VFLA 5D9NA 4WOQA 4TU1A 2WPBA 4QGCA 4LAKA 4LAUA 3V7PA 1ZNNA 2EKCA 4QJ4B 3C0SA 4BWLC 3RIKA 1V3MA 3O6DA 4DF0A 4JQ1A 4FP1A 3BGAA 1XQKA 3HGRA 3L0NA 2CBIA 2V8ZA 2A7NA 1AH3A 5C9ZA 1OFEA 5LNWA 1FTXA 4X63A 4GRSA 4LUYA 3S2JA 1QR7A 4O1BA 3SUUA 1CENA 1QWKA 3KOYA 4KCUA 2PDXA 3GH5A 3P8JA 3BO9A 2FMOA 3PBUA 1TUXA 4EIVA 4Q7BA 3ARPA 3UQNA 2BG5A 3C8FA 4F0KA 2BXZA 2NT0A 4H6KA 1SR0A 4WY0A 4KRTA 4MZ8A 4GKTA 1J6PA 3LOTA 1UQYA 3INPA 1O5XA 4PB4A 3WBXA 4PL2A 1UH4A 4IFRA 4R85A 1K3UA 1YXYA 1Z6KA 3BWWA 1QNOA 4E2DA 3KX6A 3T78A 3VXGA 3TONA 2H9AA 2ZTJA 1LRQA 2ZUNA 4ZOEA 1ZCCA 2E8ZA 2PU1A 1WCGA 3AWOA 1F3TA 2Q01A 1H41A 3QC3A 3EA1A 1E72M 2CLPA 4MKVA 3ANYA 4TVUA 2PD5A 4MY9A 1MEHA 4IGSA 2QCCA 2QR6A 1EYEA 1E5NA 5GVJA 1TELA 2DEPA 2G50A 2OZ0A 3TW6A 1C3FA 2ZXQA 3UWZA 2RKXA 2TRSA 1TX0A 1LQ2A 4ZZ9A 4XTIA 4DF1A 3CTTA 1P48A 3A4XA 4HNLA 4IFOA 1KFEA 2J8FA 2QAPA 4WUIA 3E02A 1SJBA 2DZSA 4KWUA 4M5PA 2J62A 3NQ2A 4NAFA 1S2WA 2CNCA 2WV8A 3TN4A 1FXPA 3MJYA 3TYCA 5C9UA 1EXBA 5G1MA 3FA3A 3PTQA 4C6DA 3CAWA 3GZAA 3L4VA 4RE0A 3WQOA 1E3ZA 1H61A 2PDPA 1GOIA 4H9TA 2Z4GA 3CM4A 2NWRA 4DWSB 3SQLA 5IBXA 1UZDA 1UA3A 4IFKB 3LERA 1W5MA 1GVOA 4FO4A 2E40A 1JZ2A 4MADA 1KO0A 3GR8A 3URBA 1JQVA 3MP3A 4DBWA 1K7EA 3QV9A 4EANA 4Q4KA 3S5YA 4S38A 3EWZA 3VO0A 3W84A 3AOFA 1JZ5A 2FH8A 4CUCA 3QMTA 4MKNA 3KCJA 3WLIA 1FY6A 2VP8A 3U8GA 2XIJA 3UWUA 1VLIA 4X61A 3MV01 1OX4B 1GVEA 4GLEA 7ENLA 3W7IA 4HPXA 3WK3A 4DBSA 3W7RA 3SADA 4PMZA 3XIMA 2ISVA 3JU2A 3IIZA 3AXKA 2GJXA 1JNDA 1SPQA 4FNSA 3WQGA 3S6OA 3CUIA 1E4NA 3SIMA 5LA1A 3WNNA 1KM1A 4AD3A 5LNUA 1KBBA 3PZNA 5KETA 4DUOA 5C2CA 2ACQA 1X98A 1W1PA 3GAKA 3K4DA 3LMYA 2ZZ3A 1BF6A 1SW7A 1MEIA 1F8IA 4XO6A 4AVFA 2BVDA 1GJUA 2PRLA 4U10A 1LRTA 3KCLA 3UNTA 3EMCA 3RMEA 3FNDA 3UA3A 2WK2A 3UGRA 3V0TA 1JCXA 4R7WA 2FDSA 5BWAA 3OBKA 4PMQA 5KZEA 4N9BA 4S3DA 1W9XA 3AWNA 1R7OA 5I3GA 5TAOA 2I1OA 1JRBA 3V36A 4FS9A 2Z00A 1KRCC 2WZEA 4HCDA 4XVEA 5H1WA 5BXPA 4JD4A 3PVFA 1BYCA 1C29A 3AXIA 3PG8A 3W70A 2DIKA 2B4GA 1JYNA 3VIMA 4CNTA 3U2OA 3TV8A 5BOOA 4WKAA 2VUNA 1TPEA 1PDYA 4QROA 1TRDA 1S2VA 1G4SA 3AS2A 3NL6A 4H00A 3UR5A 4ERIA 4ROQA 5JH2A 1TCDA 3DH7A 1L9WA 3PPHA 2AAAA 2J9YA 5D04C 2CXEA 2AQWA 3F4DA 4H9YA 4MMWA 1TV4A 3TC3A 1RA0A 3SCWA 1DJIA 3FV9A 1D2KA 1KV8A 1AZ1A 5A5WA 3P67A 1TV2A 2EBNA 2QW5A 3VNZA 3W1QA 4OU1A 1B3ZA 1F73A 4CQ9A 4HD5A 4A8RA 5AHEA 3E0IA 5B7YA 4QISA 2OODA 1OFAA 2O7SA 2W92A 2NW0A 4D8ZA 3GTFA 2V5BA 4E4PA 1UCWA 4A8IA 1GZ1A 3FKKA 1PHQA 3CQ0A 1NDWA 1LWIA 4TQTA 4ZSTA 5XIAA 3MHUA 2POTA 4M80A 3COTA 3CLWA 1Q6CA 1XIHA 1OB0A 4NILA 3VZZA 4PBFA 4B5XA 2OYLA 1OK4A 1RAKA 4B3KA 1V4YA 3PWAA 2HPMA 3NVTA 3IK4A 4PULA 5IHRA 5E6YA 3LNPA 2B0MA 3RPTA 1MXDA 1DQUA 4HJFA 2F2KA 4A6GA 3QQ0A 3VUPA 4PGLA 1V5XA 2NXGA 1G94A 4MPQA 2YSWA 4QJ3B 4GZEA 1A80A 3ARRA 4AF0A 3WH5A 3A23A 5C9XA 3L9CA 2Z1KA 2PDLA 3W71A 1KXQA 3BL3A 3BMXA 3UESA 3PSWA 5H6HA 2H6RA 2OYKA 1FWCC 4GNVA 1XLBA 1FP9A 3QM3A 4BWLA 5F2IA 2F6XA 1XW8A 1ZAIA 3A13A 3ZJ6A 4A3HA 4RPQA 3AIQA 2Y7GA 4JY9A 4AHPA 4HTBA 1BRLA 2TSYA 2OVLA 1PAMA 4AD4A 3KRBA 5I78A 4ATLA 3PZMA 1XIGA 4IQDA 4AZCB 1B3OA 5DEZA 1TV7A 3L5AA 3U2ZA 1ZHAA 1GJWA 4E3TA 2GVLA 2GK1A 4QSFA 3GUGA 2DH3A 2UY4A 1H49A 2G95A 3ZT7A 5AHMA 5I5RA 3MHFA 4Q33A 4GO8A 2BP1A 2JBMA 5CJ5A 1DJGA 4QITA 1CXEA 2EHHA 1W3NA 3G5EA 1F05A 1GQKA 1JCYA 3M0IA 3EEZA 4S39A 3EXRA 3HB9A 1D3CA 2HEJA 3ZIZA 1HJXA 4O50A 2YCEA 1V7AA 3CC1A 3T2OA 3LA4A 4MZ1A 4CVWA 3FLUA 4CNSA 3L66A 4S3EA 1E3XA 1DXFA 4RNFA 3E6EA 1KGXA 3THAA 4C7GA 3IS4A 3QSRA 3HIJA 1US2A 1IZJA 3I65A 2HSAA 4AD2A 2QVHA 5FJTA 2C71A 1W1IE 2PLCA 2FGBA 1EJ7L 2CIPA 3UJFA 1E0UA 2WVSA 1RVKA 5F2LA 4BF7A 1HGYA 4CQ8A 2ZE0A 3R94A 1MVYA 1W9PA 4I9TA 4JEQA 4BCEA 1ME9A 2VDGA 1AW1A 4LB3A 1BGAA 2CBVA 1GW1A 1YXCA 1RQBA 3W9ZA 3CQHA 2XJ7A 4L61A 2GUYA 1QNRA 4AVOA 4GD0A 4HP5A 1XYMA 3WF4A 5A95A 1FUYA 4M82A 4CQBA 4UOZA 1W8GA 5I3FA 1ADDA 3CZGA 1RP8A 4DM2A 3C86A 3LLFA 2H9AB 4HPNA 2G3JA 2WYSA 2XDFA 3HPZA 1SMDA 1XBYA 5I6SA 1Z48A 3OYXA 1HL2A 1M3UA 2YXGA 4AHQA 3N19B 2MANA 5GJMA 4MAZA 4PTWA 2WHKA 4OIFA 1FH9A 3TYBA 4HNVA 5C71A 1YTKA 1KA9F 1OEPA 3BAKA 5A69A 3F7JA 3MMTA 3T81A 3TAOA 4CD7A 3DDMA 3W26A 5FF2A 4M7SA 4QIUA 4ML9A 1KWKA 3LCXA 4JPGA 1Y5WA 4PTVA 4ACZB 4F2TA 2PDMA 3CBWA 4HZ7A 3II1A 3BCDA 2ZXDA 2V68A 1YBQA 5ABEA 2XN2A 3LMZA 3IV3A 4WGHA 4PMDA 3VGGA 3IRSA 1J5SA 1JZ7A 1EUNA 3CL6A 3UJEA 4IIBA 4E8GA 1PTAA 3EDFA 2PRMA 1DWGM 1RD6A 4L9YA 3TLLA 2OSWA 4HU0A 5REQA 1O68A 1OFRA 4D6DA 3CWOX 2XZ7A 3E3HA 4DO6A 1DWFM 1QPQA 3ES7A 2VELA 1UKOA 2MNRA 1GVIA 1H1YA 3GRIA 1L6GA 2UY3A 3SDOA 1HW6A 3W28A 1VHCA 4AWEA 8XIAA 1KWGA 2ZA1A 3SY8A 1B3YA 2Z7KA 4FK9A 1HUVA 3PUEA 2CESA 4XSLA 1MW3A 1UD8A 4XB3A 1ZY9A 1M53A 4FNRA 1A5CA 3WBYA 1YXDA 1JDAA 3SCVA 3H70A 4Q8PA 3D47A 2JIWA 4ZVJA 3REQB 2IS7A 1ZZMA 1UBPC 3SRKA 4JKKA 3GW3A 4F0SA 1UASA 1Z9AA 3S2CA 3BOFA 4UB9A 4LSBA 2O9OA 2V3GA 3GDKA 2G8ZA 3PBVA 1XCWA 2B31A 3MUY1 3IARA 2FZBA 4OVXA 2J6XA 3ZFHA 1G4EA 5MHBA 2C0AA 1DIKA 1RA5A 4O1FA 1CPUA 3VABA 4B5WA 4JFSA 5CC6A 1OC6A 3K1GA 1CXHA 4J28A 1J0IA 5M2FX 2P10A 4DRSA 1W1YA 3W74A 3MS8A 3MQTA 4GZIA 5M17A 4ALDA 1KNWA 5HULA 1TFVA 3LV5A 5CJNA 2JE8A 3IAPA 1RCXB 1PS9A 3L0KA 3THDA 4JTFA 1GJPA 5K2ZA 1FH7A 3WJZA 4GJ1A 3IVUA 5KZMA 3KL5A 3SAZA 3B9OA 5AYZA 3WUBA 2DORA 2G0WA 3G1AA 4FI4A 5XIMA 1LTDA 3TFCA 3ZVIA 3TQKA 3WEOA 4XZLX 4QG9A 4UTLA 2ZX6A 1UWIA 1DWAM 2PODA 1VGAA 1TA3B 3ITGA 4D2JA 2QPUA 3R10A 3TYUA 3BDKA 4KKXA 4O54A 1LBLA 1EX5A 2TODA 2WMIA 3GU2A 4D8AA 5HBFA 3TTSA 4AISA 1BD0A 4PC8A 2OXNA 4GI4A 2VD9A 2X09A 4DZAA 3OB8A 4P8WA 3UP8A 3W2MA 3TQVA 3T6CA 4FLOA 4G56A 4HTYA 4NJKA 5DN1A 3UJRA 2NUYA 4Y7EA 4ICNA 3NQ7A 3NOYA 1FOBA 4CN4A 5JQ9A 2GOUA 2DZXA 3ZR5A 4JZ5A 5JMUA 2RJGA 4JN6A 4LW7A 4ZA0A 4MSSA 1YPFA 4GXMA 4Q7NA 1B2YA 3B03A 4BI6A 5DXXA 2DQXA 2Y88A 4NUWA 3ZLGA 2BLEA 3U7VA 1H11A 3OGSA 1PIFA 4GUHA 5EMLA 3CTLA 4MFEA 2IXVA 1TPUA 3GFXA 1BG9A 4Q8QA 2YJQA 1I0BA 1DVJA 2OB3A 3I4EA 1WDQA 5FF3A 1MO0A 8CGTA 3I3BA 1UWRA 3ONCA 4LANA 1ISYA 4LXFA 8RUCA 1JUEA 4N9DA 1PWMA 1K1DA 2JEPA 3RM4A 3LYEA 2NX1A 1XIDA 1LT8A 1DXEA 3GLCA 3BTNA 1ZJAA 2PTZA 4BQ5A 2E09A 1GVSA 1XLDA 2HRWA 3W75A 4LPCA 2V2HA 4PMUA 3IK2A 5JVLA 5D2TA 1AMYA 2PGEA 1ISZA 4M1RA 2Y61A 2PCEA 3BSHA 1DE5A 1QVBA 4MTVA 1RXOB 3OZPA 3DGRA 5D38A 5I77A 2A6NA 2E6YA 3GG0A 1TJRA 4O11A 5D2WA 3F2BA 2ZA2A 3IJ9A 3C56A 1HJWA 3LGGA 1J11A 3AMDA 3VIHA 2Y7DA 3VNYA 1LROA 4XAFA 3AFBA 3TLQA 4CNOA 3TOPA 3VGFA 3NQDA 4ZQCA 1IEVA 4QS5A 1IXOA 3AJXA 2A3LA 3M43A 1TB3A 3N04A 3STGA 5F1UA 4F0HA 3FGCA 4WJ8A 3ZXWA 2G4FA 2ZX7A 5DY2A 1QW7A 1R2SA 3RMJA 1B4EA 2J7EA 3B0UX 3EWDA 1XWYA 5HMEA 4F9DA 4GVFA 2OQLA 3MUIA 1ZGDA 4QX4A 2WOQA 2PD9A 4ZB0A 4O57A 1XJBA 2WLYA 4PCPA 2BDQA 3C61A 4FOJA 3BGJA 4GC4A 1VEPA 3EOUA 2VR4A 5HWMA 4F40A 3NYZA 4W88A 3FEQA 4WX2A 2LLEA 3URNA 3RRXA 5F7UA 3LN3A 1S2TA 4XSMA 2PWGA 3WNOA 5EU9A 2FZMA 2IKJA 4EPKA 1OCBA 2C16A 1XLAA 4NASA 1WBHA 4JTQA 2EKGA 1E51A 2I5IA 2WC3A 3AIWA 1KKRA 3MT1A 4GXWA 2PGWA 1AQHA 3CWNA 4G7EA 4GH1A 4GY7A 2GFTA 1NVMA 3VYLA 3NQBA 3JRKA 4HA4A 2Z26A 5A8MA 4QQUA 4S3JA 3JVAA 1BXCA 1L6YA 1RQEA 4H9ZA 2XM2A 1TTQA 4GI8A 2C0HA 4PYSA 4JR5A 1A5LC 1UC5A 4E38A 1Q45A 4D71A 3G1RA 2F7FA 3V5CA 2J79A 1TPB1 2D1ZA 3N6HA 5FACA 1NDVA 2V63A 3UXLA 3FDKA 2WKGA 4AZ7A 3BE7A 3HQNA 2E67A 1SSDA 3TTOA 1TR9A 3G1SA 4L1WA 2XIMA 3AHZA 3UVIA 4ERGA 1JPDX 3AAMA 2B7QA 1VQTA 5JBDA 3KXQA 4UQDA 4W8BA 2I5GA 5TF0A 4TTGA 1CZ1A 2BOFX 4MM1A 1HKIA 4RCXA 3FVDA 3AU6A 1YW1A 1PX8A 5A8NA 3A5FA 3TZFA 3D6NA 4RNJA 4ZCWA 5LNVA 3LXBA 3UG4A 5CAHA 2A79A 1TMHA 2QJNA 3DN5A 3LPOA 1RBOB 4B4FA 3V5FA 5AECA 4YHGA 3WUFA 3RXZA 3PFRA 4L1GA 1XFCA 3M0YA 1ZS2A 4GACA 2DUXA 2A2IA 3T07A 2GDQA 1O4UA 3PULA 5IHSA 2MUCA 3P93A 1ELSA 4X3ZA 7TIMA 1JXKA 3H2AA 7TAAA 4UIOA 4HYVA 3AMKA 4N6EA 7REQA 3GNPA 4OUEA 3RX2A 4B3ZA 3TK7A 4OKDA 2QPXA 2E5BA 2YA0A 4IQJA 1FWHC 5D05A 3VNIA 3IPWA 4D72A 3QMRA 1E55A 3MI2A 4NZJA 1E0XA 1HF6A 3WQDA 2O0TA 3WZ0E 3C2FA 2RDXA 2C15A 2QIIA 1EP1A 2WM0A 4EXAA 4GGHA 1W91A 1QO2A 2V5DA 3M9YA 3RJYA 4OECA 3WFZA 1QATA 3C0LA 3Q65A 3CK5A 3ZO9A 3MSDA 3PFMA 1TUFA 2CZVA 4IUOA 5H8PA 1WAUA 4AYGA 1FWDC 1TCMA 2CFFA 4MUZA 3QV6A 1DORA 3OGRA 3UA4A 3H22A 3N9KA 1UR0A 1Q5MA 4NZ4A 1IIGA 3WF2A 4JX5A 3LM7A 2L5HA 4HA1A 2O56A 5FKYA 2QDHA 1QCWA 3SCQA 1HVXA 1UA7A 4P7LA 1B9BA 2WSPA 3ES8A 4HGXA 2Z7GA 3HJEA 4HNCA 4FSAA 1A49A 2CBJA 4X0VA 1C7SA 1UUOA 1UKTA 4F79A 1H09A 1R3TA 4FEZA 4P7NA 3KRSA 3TR9A 4ZB2A 3IANA 3QZEA 3B97A 3GNRA 5PTDA 2JKEA 3A21A 4ZQRA 3T0BA 2E9MA 4HK5A 2ANUA 1XR2A 2HZGA 5I7GA 3ARYA 1FWSA 3UZZA 2V9DA 4I9JA 5E1QA 3SN1A 3DFOA 2DT1A 1JDFA 2YCIX 4P7QA 3B8SA 3CB8A 4LBRA 4Y9NA 3SB0A 5LHFA 1W3IA 3ZM8A 4C5YA 1ODZA 3N3TA 2OSXA 2GVGA 3RCMA 3M0ZA 2NV2A 5CGMA 2WKLA 5FEXA 1PB0A 1NH6A 2PGFA 1EJTC 3OHIA 5BXSA 1JDEA 1X1NA 3OBEA 4PMNA 1KRMA 3V4BA 1MW0A 1W1A1 2C79A 4UQBA 5I3JA 3LPFA 1I2PA 2OLAA 4P7OA 5I3DA 3FHQA 3OEXA 3EX6A 4ACZA 3GHTA 3KBWA 2QDDA 1BQCA 3OBAA 1JYXA 1RHCA 4I5XA 2CYGA 5C6MA 1W17A 2BVTA 3PHAA 4J27A 3A4AA 4OFCA 1C7TA 3G6MA 3LCLA 2ZZ4A 5HUPA 3P62A 2VFEA 3KS6A 1CXLA 1V02A 4BF5A 4ZGYA 2YA2A 3CUFA 4ZQMA 2WMIB 3T0CA 1H7WA 2BTMA 1UOKA 1DKWA 2PWDA 5CLTA 2ZUTA 3B8WA 3QMSA 5EA9A 1JPHA 3BW3A 1FFQA 3OVPA 3NIYA 3K1DA 3KDNA 1JD7A 1VCGA 1SW0A 2GYIA 4HA0A 3HPAA 3GVRA 1CT5A 3KHDA 1U83A 1XLHA 3BAXA 2CHRA 4UWMA 1YE6A 3LV6A 1OD8A 1W8SA 4J2MA 3ITOA 4MWAC 2WHJA 4RDVA 3WNMA 3DFNA 2ZBTA 3H4WA 5EMUA 1Q6EA 1LOSA 1XBXA 5LA2A 3B8VA 2VKZG 2WVTA 1OFOA 1O12A 1FKWA 5DMNA 3OOQA 4I7UA 3WF0A 4O53A 2B7PA 2BOEX 4JXCA 3TOYA 2ON3A 3AHTA 3L5MA 2WPGA 5EBAA 3STFA 3WYZA 3W88A 4GO9A 1TWZA 3IJDA 5T91A 3NM3A 2OZ3A 1YNYA 4HNNA 4RK8A 2WVUA 3I7QA 1VRXA 4FXJA 2A7RA 1SO3A 1QASA 3ID7A 2A3EA 2DJLA 1S2UA 1PDZA 2R82A 2R24A 3B3DA 4GI9A 4UTJA 4AWSA 3OLGA 4FOUA 3VZXA 2WB5A 3OZYA 3FXGA 1XV8A 5IFPA 2UY2A 4P2VA 4BY3A 3ISIX 3FY1A 4ADUA 3ZQ9A 2BXVA 1XLLA 4JX6A 3RX3A 1CCWB 3NQCA 1J10A 5HA7A 5CSRA 1E4LA 3QY6A 2GWNA 2AMXA 4X60A 4US5A 2I14A 2YCJA 4JIHA 4MB4A 4UMCA 1MZRA 1XFBA 4Y9AA 1O5QA 3QXBA 3UXAA 1PZ3A 3PTDA 4NZ3A 2AL2A 2VFIA 1JI2A 3W7QA 3QY7A 2X0HA 1W1ZA 2CEQA 3DENA 2FPTA 4P8UA 4IXXA 3E49A 1KKOA 2QCLA 2YBUA 1W5QA 2BY2A 4JTIA 4O1CA 2R1KA 2P5NA 1VZWA 3U6WA 2GSHA 4IPIA 4UZSA 4DO5A 4M6UA 2PDHA 2ZFAA 1WOBA 3WLSA 1EPXA 2VDIA 3UD6A 4O28A 5FESA 2E1WA 3S5NA 3GYEA 4HMNA 2PTXA 1ZJBA 2J8GA 2OX1A 4YWSA 2PMQA 2XG9A 1P0DA 4KWVA 4C6NA 2RJHA 4HB7A 3RM8A 1TPH1 1Y7VA 1M5WA 3NXLA 3DG6A 3QR1A 4AIUA 4U4MA 4IMCA 1R46A 3UF9A 4NNBA 4I9MA 4AG0A 1N2VA 3IJIA 2F6KA 3R0DA 4OUIA 3EB2A 1FWNA 3OZOA 4H9MA 1PX3A 3TSBA 1ZQ5A 3VK5A 4FNPA 1K7FA 5DO8A 3H23A 3IIPA 5FIPA 3RDKA 4AB4A 3OA3A 4M81A 3E0VA 4A3QA 1Q7MA 4ECLA 5MF5A 4WR3A 2A3CA 4EXQA 3KBVA 5H2ZA 4EF9A 2D2HA 1TMQA 3NTYA 2G37A 3U2EA 1GKPA 1AH0A 1QOXA 3HM7A 4TXEA 4AZHA 5EMYA 3EA2A 4D1IA 2F2HA 4QQ3A 1YEYA 4G9PA 5I79A 4X0NA 2I57A 4L5ZA 4Z42C 4N02A 5U4NA 2WXDM 5JIPA 2DZVA 2PRHA 1OADA 5KEZA 3RLUA 2HDJA 1V51A 3K8LA 4PRTA 2O9PA 3CS2A 3GH4A 2D24A 3W7EA 1MQRA 3FA4A 3TA6A 1CI1A 3BCFA 5I09A 4MGGA 1I1XA 2XU2A 2AGTA 1E43A 4XAGA 1XX1A 3NQFA 3W27A 3LEPA 3LRMA 4MJ4A 4H8NA 3VOHA 4YYCA 6ALDA 1AVAA 3HA1A 3NEVA 4O52A 4N6FA 3NQMA 2PI6A 3DFYA 3TIMA 2OR2A 4WDWA 4GX9A 1FBAA 1NDYA 3TWAA 4AMAA 4OGZA 2OQHA 3GG1A 4UFIA 2Y8KA 3ARSA 4S1FA 4ZO9A 4LCSA 5BRBA 1I6NA 3STPA 5HATA 4A3YA 4MNKA 2R14A 3H2EA 3EWYA 1M41A 1XP3A 2OWWA 3MSGA 4Y90A 3NDOA 4F3HA 4C6OA 3MBDA 3LM3A 5ABFB 3O9NA 4Y2WA 1QK2A 4K2SA 1OFQA 4C90A 1BF2A 3HU7A 1DWIM 1XLCA 4AH7A 2DT2A 2BS9A 1VIWA 1A5OC 2HNEA 3DESA 5DFAA 1PX4A 4OTKA 1SGJA 3WMLA 3O05A 3ONBA 1Z32X 3KOFA 2FTWA 3GXPA 2C14A 1H2JA 3W3OA 1VB9A 3BMVA 1IXQA 1R38A 3GDBA 3SCSA 1L6WA 2PB1A 3TX9A 1UD3A 2BSLA 1OWQA 3C0JA 4PCSA 4ZXLA 2XIOA 1WBJA 1QHZA 3SECA 1X38A 3MYOA 3R89A 2GWGA 2YIHA 4H3DA 3UWQA 3R8GA 1ITQA 2REQB 3WH6A 2PBGA 4Q8UA 4U31A 4GVHA 4GI6A 1KBLA 3GNXA 1AMKA 1W3KA 1VBUA 3WCZA 4BZYA 1OQFA 4L64A 4GQGA 2Y0FA 1RJPA 4D6JA 3TMQA 4O17A 3WLRA 1H5VA 3BG9A 3CHEA 1Q8AA 5AZ0A 5CG7A 2ACSA 1TPFA 5IOBA 3AIEA 3I3EA 2GQ9A 3E2SA 2BOGX 1LQ0A 5BU6A 1R3WA 4DUXA 4YU1A 3BZGA 3AYTA 2VURA 4TMBA 3I68A 5A6LA 4J3ZA 3EDEA 5A2AA 1SJAA 5HINA 3BLDA 4PODA 4U5IA 4LV4A 4LC8A 1M01A 5G4EA 1GG1A 3PM6A 1LG2A 3UWVA 4B5VA 2A3BA 5EY5A 3CEUA 3KUMA 3AZSA 5FA5A 3ANUA 3L4TA 1L2QA 4MKSA 1KCLA 4MDOA 4UOJA 4NNCA 4GIAA 2CZFA 1QOQA 2QJIA 3PNUA 1XICA 3FSUA 2VFHA 3EPOA 3MSYA 2VJXA 1V6TA 3BG3A 3SCOA 4RXFA 2XGIA 2VZVA 4CQAA 4E3VA 4S3FA 1FWWA 3ARUA 1W3TA 4BI5A 4WLCA 4PTDA 3WDJA 1GG0A 4Y9MA 1IZKA 3NZ1A 2ISWA 3W22A 3B4YA 2GLKA 4JDYA 3RN6A 3R6IA 4ORIA 1G67A 1XPGA 1D3GA 3A6OA 3GK0A 4DPQA 1ISXA 1JPIA 2GGIA 3QHMA 2YKKA 3ERPA 2VX6A 1VCFA 2R91A 4WCJA 1XHGA 2OGJA 1NJJA 2NQHA 4BK9A 1QBAA 4B4HA 1NWUA 1QRQA 1S2AA 1R8LA 2PEVA 1DL3A 1CLXA 4JFTA 5DBUA 2XSAA 1H1ZA 4PUWA 1XD0A 1RY0A 3EOEA 5FI8A 1LBFA 2WC4A 1P0NA 1MWOA 1Q66A 2D2GA 2PC8A 1YDVA 4GUFA 3UYIA 1NOFA 4LS1A 1UQZA 5HQLA 1P6CA 1YTDA 3HGOA 1PTGA 3LZ3A 1XLEA 2A4AA 3VU2A 3M46A 1BPLB 3EWWA 3LCFA 3NWRA 4HU4A 4AY7A 4D6HA 1ECEA 4S2CA 1B3XA 1OFBA 2DIJA 1VRDA 4IQLA 1XYFA 1XLIA 3UY7A 1FDYA 4JNZA 1ICSA 4JYDA 4OBTA 4D1JA 5JH1A 3E1F1 2ZUSA 3THUA 2CBUA 1KXHA 3CO4A 1UZ4A 2X41A 5KZ6A 3LENA 4E4UA 1E9LA 4L4MA 2ZTKA 1NWTA 3AIBA 1RCOB 2PDJA 4H1ZA 3O06A 1S2CA 3KTXA 2PWFA 1XSJA 4Z08A 1EQPA 2XFRA 2QDEA 2CLFA 1QHPA 3LD5A 3GNOA 4GZJA 4NXKA 3IIXA 4IM4A 3PTMA 5F4XA 3KL0A 5HXMA 5DBTA 1R30A 2OG9A 2ATSA 4XV0A 3PZQA 4K7YA 3NL3A 3MO7A 2HNHA 2V38A 3MKCA 3V16A 3SUSA 2J7BA 3GC4A 3VKKA 4PUEA 4LVAA 4RJEA 3TYZA 4AZIA 3MHGA 2E0PA 4NVTA 4WHBA 2WNQA 3NPUA 3WQWA 1W3LA 4MY8A 1R6WA 1UWQA 3T44A 4EXBA 5A6MA 3ZOAA 1Q6DA 4B91A 1E9ZB 2VTFA 6PTDA 1TJ1A 4DAIA 3BLOA 3UCQA 4I7VA 3B8TA 1UBSA 4LEFA 2G3IA 1LLZA 1Q7ZA 2XFFA 4IIEA 4TX6A 2WKJA 4LY8A 1IYXA 1TO3A 2PTYA 4GHRA 4U3AA 4PMRA 2V67A 3UPBA 3WNPA 4C1KA 5HQEA 4DI8A 3W7MA 1VP5A 2DIEA 1NDZA 1O6IA 7CGTA 3LBMA 4M3PA 4ZTYA 3N3MA 1P4CA 2GJRA 4AD0A 3M64A 2OMAA 3R8RA 2NLIA 5D32A 1QUMA 1PZ1A 5HNUA 1GGOA 4X22A 5LKYA 3OODA 4FX6M 3FYYA 4MNLA 3LQGA 3G8RA 2PWVA 2QCDA 1XDLA 4MJ2A 4H9VA 4MF4A 3I7SA 3DAQA 3SCPA 2Q8XA 3GX9A 3T09A 4HHLA 1TQJA 3VD5A 1L8NA 1PKNA 1SR9A 2BVWA 2HJPA 3V75A 4FLQA 3WUEA 5K7JA 3AYVA 4F8XA 1UR3M 2O9RA 3N11A 5K3VA 1ONEA 2OOFA 2ZYFA 1NM9A 3S5ZA 3STEA 1JEZA 1HP4A 3VGEA 4QLLA 3UT0A 5I2UA 4DAFA 2CC0A 2OEMA 4A29A 3LRLA 1EC9A 4I8YA 3F5LA 2WJZA 4H6QA 4LB4A 3M44A 3ZS4A 5GQBA 5DCDA 2AL2B 3VUSA 2P76A 1VAHA 2PDIA 4KWOA 4IG2A 5E0FA 3H7VA 3OQEA 4BEUA 1I4NA 2XVNA 1MFUA 3TXVA 4CCDA 4GVIA 2DW7A 4YPJA 4GQRA 3EAUA 3RM9A 4KWSA 4LU0A 4V27A 2E6DA 2DH2A 3W2NA 2QYGA 5HWNA 4GCXA 3TA9A 1RD5A 3M0VA 2PLJA 1MZHA 4KMQA 4HCLA 2XYLA 4M6PA 1VPQA 4FOKA 1U30A 1WXYA 3TJLA 3QGVA 3G0UA 4PCTA 2R9RA 1TTIA 1GQLA 3P0XA 3KAOA 2I9EA 4W84A 3VIFA 1I0DA 1KFCA 4K1GA 4I6VA 3PN8A 4HN4A 5A8OA 4GIYA 1EWDA 2PTDA 2YL6A 2WNWA 2QCGA 3GTHA 2OCZA 1HJVA 2HK1A 1BXNA 1R3RA 1XS2A 2YDAA 3AUOA 4DUVA 1OFPA 4INFA 1DIOA 4HMDA 3I6TA 1W1B1 3TN3A 1GWJA 1IWPA 4JCMA 3AU2A 1A5NC 2AMGA 2P8CA 4R9OA 4WY0F 2Q8LA 1UKQA 2WSYA 4Z1DA 2BB0A 1V3KA 3H8AA 2NVCA 4AXKA 3BICA 2GPTA 2VFFA 2Q3OA 2NUWA 3ALGA 1A3XA 3M6YA 4N42A 1WZLA 2VZTA 3NZQA 3Q45A 5CSSA 4JEJA 3KP0A 1BFNA 2EPKX 4UUIA 3WSUA 1JUKA 3L21A 3KBSA 4FALA 2BY3A 3ZVHA 4LT9A 5DQPA 4ZR8A 4XKYA 1XIJA 4JIPA 3EX4A 4MIMA 1D3HA 1GUVA 1PZ2A 1IT8A 4AEFA 2GJNA 3N13A 2QT3A 2D3LA 1JF6A 1L6FA 3LBOA 5HJYA 5ABGA 1IE7C 1BHGA 4JBRA 2W91A 4LEQA 3XISA 5TQLA 3C5QA 2OLSA 1X1OA 4WSKA 1F76A 2Q6ZA 3FAXA 3W73A 2XVGA 3ZJKA 2CLOA 3M4HA 2JGQA 1YPXA 2PDFA 3WUGA 1J4EA 5EMKA 2NQ5A 1I9CB 5LIXX 1JR1A 1KFWA 4G1KA 3LTYA 2YA1A 3SCUA 2TAAA 5E0CA 3QH2A 1Z69A 3VMOA 1F6YA 3RU8X 1BG4A 5C5YA 3LCIA 2AQOA 3B05A 1BWKA 3O16A 5A2CA 3QQWA 3SURA 5D02A 3AHXA 3AQUA 1W9DM 1ICQA 1R3YA 4EX4A 1KXTA 3E2RA 3LPGA 3PB0A 4X2RA 3W83A 1EWEA 4A3UA 3RR4A 1R9YA 4HU3A 3DKLA 4MB5A 4B16A 3VILA 5CZJA 3F5KA 3M6DA 2OT0A 3CUHA 2PUZA 5CPNA 2ZRYA 1YMYA 2WZMA 3CPUA 2J7CA 2PP0A 3UW6A 2BHZA 2XSXA 1G9HA 3ITCA 3C8NA 2VFGA 4MHBA 4V15A 1KGUA 7XIMA 3QZAA 2FVKA 3IJLA 1KLZA 3F1QA 1MUWA 3P81A 3WO8A 3SBFA 2GJPA 3WLOA 4RUBA 4U3CA 1CXIA 3OIXA 3VD7A 1CGUA 5U7SA 3UNDA 2PWHA 4PTNA 3PNZA 2A1YA 1H5YA 3K13A 4DY1A 3V1PA 2J78A 1JNEA 3VZYA 4QE1A 3O6CA 3BARA 1S38A 1TE6A 1LRNA 2V5JA 4PEKA 4XZNX 1QPKA 4HNUA 4IJBA 1ECQA 3P6LA 4R27A 3EWUA 1AA1B 3I10A 2Y5SA 4HOXA 1P7TB 1WUFA 3QYSA 4DHGA 3BUVA 2QJMA 4GKLA 4IP5A 2DVXA 5HMDA 4XUYA 2VX7A 2GQ8A 3VD4A 4OOZA 3POHA 4M51A 4NKCA 4TOQA 3R58A 1SO6A 3QVQA 1TA3A 4ONVA 5D9OA 3F03K 4EKJA 1FDJA 2INZA 2QUNA 3MPGA 1UD4A 3T1GA 1CDGA 2G3NA 3UETA 2R1LA 3EXTA 4EF8A 5BXRA 4WKHA 1UZHA 1YKWA 3ME3A 1CB7B 1REQB 4RZ4A 1W9VA 3VC6A 2PDYA 1M9HA 2Z29A 4M1BA 1N8FA 4J3UA 4C6PA 1N8WA 3KBJA 4C1LA 1WDRA 1DEDA 1AH4A 1KFLA 3FW6A 4IGNA 2QNEA 4NXSA 4QLJA 2C1HA 3UZJA 2NQJA 4LYQA 2D0HA 1IR2A 1NIUA 2YR1A 5D03A 4I9AA 2X0SA 3RO6A 4IHCA 3AISA 1BRLB 4ZO6A 3K4AA 3NPVA 3VNMA 1MXGA 2J9XA 3NDYA 4XBKA 4MNMA 2O4QA 4ACYA 2FB3A 1K8XA 3OQ8A 3MSRA 3UZXA 3A5VA 3AS3A 3W4RA 3W02A 1VLWA 3R4IA 4C1NA 2QCNA 3QPEA 3UZ5A 3W2UA 5AC4A 3N9SA 5HJXA 1XINA 4W85A 4LFYA 4DEFA 3PWGA 3N18A 5CQ1A 1DPMA 1GOOA 2VEFA 2NQLA 1AJ2A 2YYUA 3L2IA 3QPZA 4MLJA 4PRRA 3CPGA 4TX8A 4DIAA 1TE1A 1F9CA 2DSWA 3H24A 3MV11 3RHGA 2IPJA 4L6OA 1WQ5A 1X7IA 2ADAA 1IGSA 4IQEA 3GC5A 4IH3A 4LGXA 4XKMA 1W3HA 1F8MA 1ZB5A 2PFHA 3AZTA 3LHUA 2QUUA 3DFSA 4QE5A 1ZP3A 2GK1B 1RR2A 4JAWA 1MFVA 3OLEA 3SZ8A 3ZSTA 1T40A 8A3HA 3DCPA 2OZTA 3TU9A 3WLQA 4AXNA 5CAKA 4W7WA 3EYPA 3QKZA 4LALA 3FYOA 1Z44A 4CCEA 2E1DA 3S3GA 3W1AA 5BU9A 2D22A 1UR4A 1UR2A 3FJ4A 4LVDA 4HN8A 4TMCA 5JU6A 2CWXA 1MXSA 4J9JA 1W2VA 1BYAA 1GTEA 3S1XA 1FX6A 3HV9A 1AODA 4Q8MA 1ZJHA 4GIRA 4CU8A 1FHDA 2HWGA 4KEUA 4EE9A 2DGAA 3ITYA 3WK0A 1ZAJA 1T6MA 4W8LA 1YIXA 1MW1A 1QPRA 3I7RA 4GUJA 3CUGA 4CNNA 5DRCA 3W25A 4C7DA 1PHWA 3ABSA 3GTIA 1W0MA 4JFUA 4QR6A 3WQFA 1QMLA 2OQYA 2WLZA 4PTMA 2KAUC 2VWSA 1JZ3A 4NL1A 2FFCA 5AB3A 1GT8A 4D6CA 3W1XA 4NX5A 5FL0A 2DQWA 1RALA 1N82A 1CEOA 3GVGA 5BWFA 1XCFA 1JVNA 2GL5A 4Z2LA 4K38A 3BLKA 3L68A 1XH1A 1ZU8A 3ITVA 4PSPA 1JULA 1Y65A 2XUCA 2QCEA 4PCNA 1M04A 4Z2KA 1POKA 1D7KA 1FWIC 1Z42A 1MW2A 2WSKA 3W72A 1I2OA 3UYCA 1JAKA 2W5FA 2XIQA 1X6UA 1E0WA 2XWEA 3G22A 1N7KA 5AHNA 1ITCA 4MJMA 2QZRA 3VKDA 4B5UA 1F74A 3ZLFA 2PDUA 3SCRA 2FB2A 2QXWA 1KBKA 3LX9A 4GYJA 1I2NA 4Y9OA 4D6EA 1TV5A 1EFZA 3LHWA 2VMFA 5G4WA 1LZOA 3DHDA 5A3HA 4UFKA 3NQAA 3RG6A 2VZOA 4L4LA 3S4TA 3MJMA 1FWEC 4YLWA 3O0FA 4TTUA 4RE3A 2YZ5A 3A12A 4IL0A 4Q3MA 1E1CB 3CV7A 3CLMA 3QPYA 1C92A 1RH9A 3NO3A 2QUVA 4MWAB 3MUZ1 1NEYA 3VD9A 4LUIA 5JIWA 3VDBA 2XH7A 1ZALA 5JBFA 2PURA 3DZ1A 3VMPA 4JTHA 2HMCA 3BVJA 3P2VA 2D2JA 4Q8TA 1XXXA 2WMFA 1JJKA 3EKZA 1VFLA 3F2DA 1B9ZA 1Z3NA 1KTNA 4LVBA 1W1TA 2W63A 4B9ZA 3UPMA 4FIRA 3E5BA 4ZFCA 4BQ3A 3ENLA 1A5BA 1P5BA 3GC2A 4UC5A 3NDZA 4LS0A 1UH2A 4DO7A 2CETA 1AJ0A 4XD6A 3CEPA 2F6UA 4S3BA 1UC4A 3VFCA 3TP4A 2WJFA 1HP5A 3KOXA 1VENA 1E9IA 4DXXA 4O0QA 4A05A 3IJQA 4W86A 3WL1A 1CXKA 3HMCA 2UBPC 1PCWA 3WD3A 4JTRA 2J74A 3CASA 4R5EA 1QNPA 4O19A 3N4FA 2CHNA 3G77A 5D9MA 2VC9A 3ARTA 2XH2A 3V5OA 1LUCB 1UP2A 3GAYA 2PWEA 3GDTA 3L4UA 2CLLA 2JEQA 2YFNA 4DJED 4PR4A 5CZKA 3H53A 2V3DA 2X7VA 3CYVA 4L65A 5ECVA 3SI9A 3PBGA 3SJNA 4HA3A 5AHIA 4GBUA 3PZVA 1AW5A 5D37A 3PUDA 2D69A 2INEA 3N4EA 3L0GA 4NNAA 3AMCA 4QTGA 5I24A 3W2LA 2Y1HA 1KFKA 4IIDA 1Q6OA 3H2FA 3ORWA 2GDVA 3NQ6A 1CGXA 4NJHA 3VKAA 2IPFA 2XN1A 2NV1A 3GYCA 4HMEA 1G0CA 3IWPA 1EGVA 1RUSA 2PLKA 2J9ZA 3KS5A 2DUZA 3EKGA 9XIMA 4GZ7A 4J7RA 4LAMA 3M0XA 4AD1A 1WV2A 1XGEA 3ZJ8A 4J3SA 4QDMA 3BANA 4NAEA 3H4XA 1WDSA 3DBPA 2EPNA 4H4IA 3I4KA 1K70A 1Q6GA 2WC7A 4Q6XA 3QR0A 5FOOA 2YLAA 4YL2A 1XLGA 2X42A 3WD0A 5M3WA 4BF9A 1UR1A 1E9YB 4V2XA 4L56A 1TZ9A 4NSBA 5LIUX 3CAVA 1OJXA 4G8TA 2GJLA 1VYSX 2FGLA 1YDYA 1HL8A 2X40A 4FXRA 3NQ8A 4LH8A 5C7VA 2Y85A 1FA2A 4A2SA 4IGHA 3DHPA 2DJXA 5HNTA 4KPLA 3W53A 4FX8A 3TZNA 4K1WA 3L23A 1GPFA 5REQB 2DW6A 3S47A 2ABBA 3BK0A 4AC1X 1W5NA 1U2YA 4ZXOA 5CG0A 3CUZA 4X9SA 2VR5A 2VCBA 3BOXA 4G1NA 1B30A 3AIRA 1CGVA 1DJNA 3N25A 3UEQA 2OFJA 2ZA3A 4FMVA 4KW2A 3RITA 3K4WA 2J13A 4GGBA 3NSMA 4Y9PA 4LY4A 3L4WA 2ZDRA 4RZ5A 2CLIA 2DFAA 1TMLA 3GR7A 1KQZA 4KGJA 1QHOA 3WLPA 3MYPA 3WIJA 4DJDC 4N7QA 3MP4A 2J66A 2YGYA 4WKFA 3BCJA 4E2BA 3O2LA 1N55A 2Z1WA 3O7UA 1NY1A 1J0JA 3MCMA 5K9DA 5I02A 2OJPA 2OX4A 4DZHA 4JKLA 2FFIA 5GNYA 2GDUA 1EEXA 4QS6A 1FWBC 3SY5A 4RNIA 4I3GA 3N29A 2PF8A 3VPLA 2P50A 4W9TA 3UVAA 1N8IA 1AFSA 4FX7A 3MKKA 4H41A 1XRVA 3E0WA 4DPPA 5B80A 3UCCA 3FGCB 2UY5A 3GQYA 1A53A 4DWDA 2FDMA 3DYMA 3PBWA 4B90A 2HV5A 4F48A 1NFGA 3T9PA 4UMAA 1S5VA 1K9FA 3FSTA 1NOWA 4A3RA 1V93A 1OCNA 3DGBA 3PZIA 2E6AA 3WEMA 1IIHA 1EF3A 3TSMA 4DF2A 2XVPA 5M1TA 1IZCA 1TPDA 3O1NA 2XH0A 3ITTA 2Y89A 4ATDA 4H83A 2W3ZA 4F0LA 1EP2A 2YB4A 4DO4A 4KFPA 4CD5A 3UZYA 4D6GA 3RILA 2EG7A 4Z1YA 4ZE4A 1V8EA 2Z6JA 1GQJA 4J3VA 4MWAE 1TV8A 2VHLA 1JF5A 3CAQA 2VRKA 2R6OA 4YTQA 1M1BA 2VENA 1BVWA 1EB3A 2W6RA 1XIFA 1YNPA 2DVUA 2FPVA 3L12A 5L6UA 3WQEA 2VRJA 1TTPA 3ARXA 3WLKX 3DERA 3UXIA 2VC6A 3UU0A 4OV4A 3H2CA 1H7OA 5TBOA 3AICA 1DYSA 3U48A 2I7GA 5F2GA 1ICPA 3VIGA 1TPC1 3GU9A 1V0NA 1XC4A 1F6KA 5LXXA 1WYIA 3APYA 3NL2A 1QPOA 1O94A 1GVRA 1HO4A 2IKGA 4MVAA 1U33A 2C19A 2J47A 4IISA 3PUGA 2NT1A 4O13A 2E5CA 1QTWA 2W0UA 1C90A 3GXTA 1ISWA 1ZBCA 3W1MA 1Q8JA 3HMJG 3NQEA 3R0UA 1QI3A 3EB3A 1KCXA 2HE8A 3U57A 3RYSA 1MEWA 3NA8A 3C4UA 5HMSA 3SUWA 2PA6A 3GZ3A 1P0KA 3EA3A 4ICCX 5FJUA 3EX3A 2GGJA 3ZZ1A 2DT0A 5HWJA 3ZT5A 1BTCA 4G7EB 3B0PA 4AWTA 1VF8A 4UCFA 2QF8A 4GUIA 4N4PA 2ABAA 4B2DD 2FPYA 3WQ8A 1MI3A 2BWGA 4GE8A 2P0OA 1XD1A 4H7ZA 2HVNA 1U5VA 4ERAA 1KRAC 2XVLA 1FDZA 1AJZA 3SRDA 1WDDA 4GOAA 4M6QA 1AG1O 4CGTA 1ONXA 3VGDA 3PJWA 1GPWA 2XSBA 4CN1A 3G24A 1J2WA 1HJUA 4JYFA 3AYRA 3GBEA 3WD2A 1T0OA 3QSTA 3W7JA 1SM9A 1GVQA 3GU1A 3LXAA 1WX0A 4HOWA 1GOMA 3G18A 2IXUA 4GQBA 4GG9A 3RU6A 5LIKX 4Q8NA 3EPNA 4UTIA 2WCSA 3WDRA 2YXOA 1KLYA 2FLIA 3L65A 4JHMA 4ZODA 2QGHA 2J7HA 5DY3A 3CIXA 4RDWA 2XISA 4Z1CA 1XLFA 1NTHA 2NSXA 2ACRA 3LU2A 3LXCA 1XQLA 1XH0A 2X0YA 1RV8A 1W3JA 3KRUA 5FJIA 3QLLA 3FFSA 1ZP4A 3QC0A 3LLDA 4HSNA 3TYDA 3MUAA 4D6FA 1W6TA 2ZRZA 4HK6A 1GZGA 4R9XA 3ZLHA 1V0LA 3VDHA 4CD8A 1PWLA 2WHMA 4GYFA 4OBRA 2P0IA 4DYEA 4LUSA 3ATYA 1JCJA 3UR8A 2HQAA 3BQ6A 1BVZA 2E3ZA 4LRSA 1UWAA 1NF7A 4IPJA 4R88A 4JICA 1V7YA 3W24A 4OT7A 1WE5A 4LJ3A 1LLOA 1NOUA 1FHVA 2IPGA 4QEHA 3LSBA 2NV9A 3MANA 1YDNA 5FJPA 3T08A 4H9XA 4F0RA 2BGQA 2OYMA 4BEQA 3QN3A 3F4VA 4K8HA 2JF7A 3CO8A 1IGWA 4LAOA 4J3XA 2G4JA 1SW3A 1EO5A 4QNWA 3MA8A 3H2NA 3MBFA 8XIMA 3U4FA 5CBBA 4J1OA 1BSIA 1UW9A 2QAFA 3MUXA 2YDRA 4DWSC 1RY8A 1FKXA 2OSYA 1GZJA 1H62A 1O5KA 2CXGA 4JKMA 1V08A 2Y24A 2BODX 4JX4A 5A1AA 1UWSA 3C6CA 4UQ9A 5JUVA 2GGEA 3WK2A 4IWWA 5G4HC 5E0KA 3CAKA 4GC3A 2E4TA 3HV8A 3DG7A 3FAWA 3GHUA 4QAWA 3NAVA 4YXGA 2OTDA 3TN5A 1J9YA 3L67A 2XZ9A 1V3JA 3GO2A 3GVWA 3PWIA 2WM1A 3TW7A 4E0CA 1FWFC 1V3LA 5B7ZA 5IDZA 4MOZA 5I0DA 3NJ3A 1Q63A 3MZ2A 4PB5A 4E8DA 1JXJA 4B5NA 4Q8VA 3SY1A 3TQ0A 2H3DA 2PZNA 3HG4A 2XVKA 2ZRUA 1W56A 1QBBA 2GSEA 2Z25A 4IMAA 3G1HA 1KB3A 4KESA 1XKJA 4A4AA 1DV7A 3VOGA 1J96A 3NR0A 3OP2A 1DHKA 3OVGA 1PVNA 3CZKA 4RE2A 1L2UA 1OZMA 2CWNA 3DHFA 4G6CA 3JZEA 3PSVA 4AC7C 4C6QA 1GQIA 4IICA 4AFYA 1GYNA 2ZWZA 4FPSA 3WNLA 3DKJA 2WZIA 4IFKA 4DI9A 3A3HA 2BHYA 1ZBKA 2GUUA 2V3EA 1NAL1 1FP8A 1NP0A 1W9UA 3B9EA 2G41A 4PBGA 2YW4A 1W31A 3NGFA 4JS3A 1J01A 3Q37A 3EMZA 3QTGA 5CPMA 1E1CA 3VKJA 1UOZA 5BZAA 1E1FA 3AO0A 3OVQA 1D8CA 2A0NA 4MWAA 4NY2A 3BLIA 3LHZA 5BCAA 1WXZA 1PIIA 4OZOA 3L2LA 1GYLA 1TWSA 3CHFA 4QNEA 3IVTA 3S6DA 2GVEA 2WQPA 1X7FA 4XIMA 3BSGA 4YTRA 1B31A 1LP6A 3VVGA 3T55A 1XGDA 4XZHA 2OO6A 3WKZA 4WF7A 1WKEA 3HJZA 1T7LA 2V5KA 4LQ1A 5CKSA 4C6KA 4GINA 3QLDA 2PDKA 1F3WA 2ZE3A 5K4ZA 2YFOA 2OLHA 3N2MA 2R94A 4D8LA 2WBKA 1RK5A 3D0CA 1HKMA 4LRTA 3CZEA 2A7PA 1IXPA 4J5NA 4K8GA 1JDCA 4CD6A 2JIEA 2ISDA 4HSHA 4KEVA 4GH3A 4PUUA 2CLMA 4WD0A 5LNRA 5FEPA 2VX4A 3W2KA 3QV8A 3E74A 4XK2A 1K9EA 1ZTVA 4JHOA 5AVHA 4UFLA 3P5ZA 1L0PA 3LI1A 1PEZA 4LBUA 5LNSA 3QYQA 1ONRA 3B9NA 3CUJA 1EJRC 4RV8A 9XIAA 4U28A 1TYGA 3RCNA 4HSOA 1IT7A 3CMJA 2GUBA 3W37A 4O18A 1EL3A 3GXMA 1OX5A 4UTMA 2VOTA 4CLMA 5BRPA 1LF1A 1LBMA 4QRNA 4C91A 3WK1A 3D5HA 1HL9A 3V35A 2ZX9A 3QW4B 4RPPA 4C6FA 5A6BA 4Z0JA 4QFUA 3F2CA 4XAYA 3K30A 2ZCGA 1D9EA 2JALA 3O6AA 1FCBA 4EK7A 1XKYA 3FYPA 3VINA 3S2MA 4GFIA 3OJGA 5DT7A 3M0MA 2E7FA 4XD4A 1US0A 3HQPA 3AC0A 1BVNP 2VGIA 1V0KA 3ANVA 2J27A 1S1RA 3MVTA 3BAWA 4U33A 3VDCA 2WZHA 4XAZA 2ZRXA 3GNNA 3AXHA 4CD4A 3PAOA 3S1VA 1E6SM 1W32A 4YIWA 2W62A 4JQAA 1R2TA 3SIZA 4PE8A 4G2DA 3ITLA 4LV9A 1C9WA 4XX6A 4V33A 1X8CA 4D9PA 2DU2A 3RLVA 2J6VA 1VCVA 4KIEA 3E0LA 1JGIA 3CMGA 3IGHX 3N73A 2IW0A 2OO0A 2YBTA 4H04A 3B40A 4C6LA 3NCOA 4UBPC 2QV5A 5CSYA 4B5TA 4UTKA 5D2XA 3VNDA 1KQYA 4CNPA 1CXFA 3NL5A 3TCSA 5IM51 4YJ5A 1BTMA 4NX0A 2C1GA 1KBJA 1V3HA 3CXOA 1NU5A 4ZOBA 1Y0EA 4YNGA 3KVJA 4ZL1A 2EG6A 1V79A 4TR9A 1VBHA 1XL9A 1FVPA 3DFPA 3FA5A 3KBNA 3YPIA 3A9BA 2WNZA 1XRSA 3V0SA 3PC0A 4BQ4A 7REQB 3CMFA 3QV7A 3SRFA 4ZENA 1W37A 4DLMA 4KERA 4Q4OA 1KM5A 3WLTA 2J7FA 4XG1A 3VX1A 1WKFA 3G3DA 1QI2A 3IUIA 4FNTA 4XUGA 3EWCA 4A35A 1FWRA 1EA0A 4MYAA 4IGMA 1LL7A 4JTAA 4WDUA 1M03A 3NSXA 5HK4A 2QIWA 1GVYA 1PCKA 1H4PA 2W66A 1M7JA 1AQ0A 4GNKB 3A4WA 3IGUA 3W85A 4U5KA 2PE4A 4C6BA 2X16A 3C3NA 5LZLA 2DT3A 1EIBA 3LBCA 1NP2A 3OG2A 1WNOA 4TVCA 5D2YA 3ARVA 4TV6A 4DBEA 3FK4A 4Q8WA 6XIAA 2IQ0A 5KMYA 5BNKA 4OBSA 1OYAA 1DQWA 5EMJA 3BLLA 1UKSA 3S9IA 2Y6ZA 1A0CA 1JG9A 4D6IA 3Q2DA 2QUTA 2VGGA 1VS1A 4JN7A 1I75A 5BMWA 1SMAA 2PGRA 3UWWA 4AZGA 1A0EA 3M5YA 2WQDA 5LSMA 1KM4A 1SJCA 4IIFA 2VZUA 4DJFC 2V3FA 3A4JA 3U5YA 3L4YA 2XFWA 5DCEA 4NAFB 2DZWA 1GCYA 5A6JA 3JR2A 3QRHA 4IMFA 1V6YA 1AQMA 1R7AA 3MDWA 4NHVA 5DT5A 3PS7A 3TJIA 3BQ5A 4IP4A 1SZFA 4R7OA 3VIOA 4NU7A 1X6NA 4LUTB 5AYYA 4JHZA 4FIQA 1QW9A 3KZSA 2NVAA 3LLXA 3S9YA 3QY8A 3TNOA 1TVPA 4H6RA 2ODOA 5T9CE 1A47A 5F2MA 2NQ9A 2B7NA 3WEZA 4LUJA 4H9UA 4DBUA 1LM1A 1XRFA 1O95A 1UG6A 4L7ZA 6ENLA 1F6PA 2W67A 5LGZA 3B9DA 4GJJA 4XBSA 1WDWA 2QQ6A 3IEBA 4WOZA 3SW6A 3B8DA 1UD6A 2WBGA 2VEGA 4B15A 2DSZA 3KWXA 4ZMGA 3GTNA 4I5RA 2W79A 1TWDA 5AVNA 3T0DA 3K46A 1BAGA 5CPSA 3EZ4A 2QJJA 3GHRA 1X8FA 2IPWA 2RGLA 4JFWA 2AQVA 2Y63A 2FHFA 4XQ6A 4DJDA 2DSUA 1R87A 5EGRA 3CV2A 3VE7A 1C93A 4JL2A 3FJ6A 3AXMA 4LS2A 3E38A 2REQA 2XIIA 2BXYA 3RF9A 1H3GA 4RKAA 1DBTA 4M24A 1P1XA 2WMJA 3CZLA 1QT1A 2CCRA 1SVDA 4JY8A 1OGSA 2X8RA 1JPKA 2VVNA 3B9AA 5K9CA 1DJXA 4JN8A 3QHNA 4O0KA 4IIGA 3MWCA 1KCKA 1TPVA 3QW3A 3HQOA 3TH6A 4IMDA 2FQIA 3V18A 1QDSA 2HTMA 4E5TA 2HK0A 4WJEA 1HKWA 3UXDA 4GJIA 3S1WA 3W86A 1K8CA 4EAYA 2OGYA 4AY8A 1WUEA 1OX4A 5FF0A 4RNHA 1PPIA 3WQPA 3TXZA 2ZKMX 1SZRA 3VD3A 4PCFA 1IWAA 3HFTA 3B4UA 2E8YA 2BV9A 2W61A 1T99A 5LIWX 1W5OA 1AK5A 1OIMA 1CLKA 4QCEA 3T8QA 3ABRA 4Y8FA 5IDIA 1VC4A 1EJSC 4Y6GA 2FHCA 3LTPA 2PAJA 2E68A 3CT7A 1IV8A 3PG9A 2XGBA 4JTEA 4PL1A 5HNNA 2V81A 4RL3A 4S2BA 1BWVA 3SJ3A 2Y4SA 3O0KA 3MO4A 3TJ4A 3ABXA 2Z2BA 4YTUA 1OT2A 5C54A 3UR2A 1RJRA 1KTCA 1AL7A 1AD4A 2PF0A 1A4LA 4XVDA 4GY0A 4N2YA 4JTTA 1X1ZA 3AHVA 4OE7A 2OOGA 5HANA 3LDVA 1KV5A 4JQ2A 2NXIA 2Q09A 4GNJA 1Q6QA 2VEKA 4NYUA 2Q02A 1R9ZA 2RDTA 3SCTA 2CZEA 3T8LA 4IUGA 1M6JA 1H7RA 3WH8A 1PKMA 5G1YA 1OVDA 3L4XA 4N9EA 2CZDA 4UQAA 2ISFA 3CV1A 3TFXA 4F9JA 1EXPA 5E09A 1TWWA 4ES4A 1TQXA 3H12A 3W7HA 4QP0A 3W7KA 3FN9A 3WQ6A 5AOUA 1EH9A 3QFWA 1Q7QA 4JTUA 3HBLA 3Q94A 1UB3A 1RZMA 2DZPA 3DUGA 2O55A 4XZ9A 3C52A 3EDDA 2WJEA 4GX8A 1FCVA 4UTHA 1LORA 1Q85A 1P0BA 3WF1A 3LB0A 2W4XA 5FL1A 5T26A 4JTSA 1UP0A 1VHNA 4PTXA 2Y62A 3P3BA 1G1YA 1DHPA 1MQQA 3POCA 2INFA 1X96A 5FSDC 1UMYA 2IMRA 4XD5A 2PU0A 4BA0A 1U5HA 5AN7A 2C13A 3P60A 1E5JA 3M41A 3NPXA 4UNIA 1QOPA 2HS6A 4EPDC 2P88A 2YYTA 4S3KA 3L2MA 2ZRVA 2E25A 2F38A 4C1NB 2DUAA 2HROA 4LNCA 4AF0B 3VGHA 3DG3A 5LYRA 4FLRA 1HQTA 3FS2A 1SQ7A 1O60A 3PANA 4PSRA 4JIIX 1BYDA 3MVIA 1ME8A 3S2LA 2NX9A 1C8QA 4IT1A 4TX9A 2JQXA 5CSUA 2PDBA 1PSCA 5HUOA 3LS9A 2OEJA 5A8PA 4DNMA 2I17A 4H7VA 1GHRA 4FF7A 4Z17A 5I06A 2JF6A 1IQ8A 4R7JA 1ME7A 4XO7A 1V02E 3MZNA 2D73A 2VCCA 4C60A 1OY0A 2VQUA 2PCQA 1K02A 3MY9A 1MDRA 1B4KA 3B04A 4UXDA 3VNLA 1Q2SA 2C3ZA 4KCTA 4HYRA 2EQDA 2AL1A 3FHAA 4ILSA 3W07A 1LDCA 2G3MA 1S5NA 2CHOA 2WWDA 3A24A 3P80A 3HQ1A 3OW1A 3TMLA 1LLWA 3TAKA 4J3WA 4V1XA 5GPRA 2JKPA 3M5XA 2ZQ0A 3GW0A 3UCDA 3I6EA 1O1HA 3S5SA 3D3FA 3IAQA 4AUBA 3W1RA 3W1NA 4LC6A 4M0XA 1YNQA 3DOPA 2X1IA 5BROA 3W7PA 1SU5A 1OC5A 2J4GA 2V6AA 2VO5A 5AFDA 3GBDA 3N12A 3W1LA 3BMWA 3DX5A 1MUCA 4MAVA 3EX2A 1VFTA 1YPIA 1VBJA 2KX9A 2Y5EA 5KSWA 1WB0A 3GH7A 3MCOA 1H7XA 1GQNA 1ADOA 3IGSA 4DJFD 2RDUA 1OF6A 1DWHM 3P74A 3M5VA 1J0ZA 2XPKA 2WWCA 2YZRA 5RUBA 1XYLA 1NFPA 2PDGA 4PMOA 3GIYA 1RBAA 4PA8A 3UERA 4IJRA 1R3QA 1ZBVA 1UR8A 3N14A 3N2TA 5CEWA 1TR1A 4DZ5A 4AZBA 3IACA 1K8ZA 1C9DA 4FAMA 1FQ0A 2XIBA 1T8QA 2EF9A 1HIZA 2RH9A 7PTDA 1E6ZA 4NF7A 1JD9A 4J2PA 2ISSA 2GQAA 2ZZ7A 4NI3A 4WEVX 1EJWC 3P5YA 2EJAA 1X97A 4DVOA 3SM0A 2JFEX 5HDRA 5LIYX 4AVNA 2YL9A 1P6BA 3SO7A 4X2PA 5ABHA 9CGTA 1E71M 3LCWA 3ZR4A 1EDQA 3WD1A 1E56A 3TVAA 3KFTA 1F2JA 1WAWA 1HO1A 2NVDA 4B92A 5J5RA 1B3WA 1PTDA 4W93A 1MYRA 4RE4A 1VFSA 2WSQA 4YMZA 3F4CA 3U5UA 4GCAA 3NO1A 3UG3A 3DBNA 2EEXA 1LWJA 3ITXA 3HPFA 5CXPA 3H55A 4CN6A 2RUSA 1GORA 2BGSA 3RLHA 3G6LA 3G1XA 3E5PA 1UP3A 1TJ2A 1OHLA 4QDPA 2ZC8A 1DJWA 4AZ5A 1M68A 5G1TA 4DXKA 1E6NA 5D4YA 2E77A 1V0MA 4JL1A 3KVKA 5IRPA 1K4HA 1JCNA 5AYXA 2BMBA 1I1WA 1GK8A 5E9XA 1JCTA 2J8TA 1NSJA 1MMFA 4LYPA 2F84A 1J18A 1VJIA 3LHTA 3IUDA 2FH6A 3UWYA 3PR2A 4AMCA 1JI1A 3SQSA 3SUVA 5LXEA 2HXUA 4NJIA 2I16A 3W7CA 2BBFA 3BZJA 1XH2A 1E73M 1BYBA 2DZAA 2HS8A 2EPOA 5HOSA 3FEMA 5AC5A 3KDOA 5CPLA 3TW9A 1YBQB 2P8BA 4BI7A 1VFHA 4X9YA 3GHSA 4HCHA 1XIMA 2GQ3A 4U2YA 3TWBA 2E9BA 2Z1SA 3Q58A 2QEZA 2YLLA 1KD0A 2Z24A 3KE0A 2FMNA 4FXFA 4AZ6A 1ZCOA 4QG8A 2VC7A 3MC5A 1TIWA 3QGAC 3N17A 4Q4MA 3T7VA 4US6A 3LY0A 5HPOA 1QNSA 1WKDA 1E6XM 1VEMA 3O63A 5IXEA 1WZKA 2A3AA 5IFTA 2ZVRA 3T4CA 5A6AA 4KGLA 3WBEA 2UZ9A 3S9ZA 1PL9A 4GIEA 1RVGA 2GGGA 3UY8A 1CX9A 3WY1A 1MDLA 3GD6A 2ZADA 3U2CA 3WBWA 2QJHA 1BLIA 4AIBA 5CC5A 1HJQA 4GMEA 2P53A 2VDHA 4I6KA 1HTIA 3REQA 4CCZA 2P1FA 5LHEA 2ZXAA 1AD1A 3VC5A 4LF2A 3KOZA 1MQPA 3UG5A 5E9AA 1SFTA 1TWIA 2NWSA 2WCGA 5DELA 3PPGA 4NZCA 4HHPA 1KFJA 4YS1A 1DJQA 4FB7A 1H51A 3EEGA 1E6PA 4J40A 4KCWA 3W6LA 1Y8BA 4IX0A 4DNHA 3HG3A 4JQ3A 1GW9A 3D46A 3TYEA 5FCZA 2QCFA 4W4QA 4JDBA 1UPPA 2V0TA 5AHFA 3FDGA 2VEMA 3APTA 4L6HA 3AXXA 1MRQA 5FJRA 4KEMA 2F61A 4HBKA 2FVMA 3AALA 5H8UA 1XPYA 1G7VA 3G8EA 4C5ZA 3F4WA 2ZZ2A 3CQIA 4MB3A 4DWSD 1J6OA 4ZFMA 1DTNA 4K8EA 3CIVA 3BAIA 1IEXA 1VPXA 3GFYA 4XWUA 4W87A 5FJJA 4NQ1A 2VQTA 3NFUA 2YDQA 5AHLA 5C7HA 3GTXA 4QG6A 4DJDD 3UR7A 1ZENA 4G7FA 4ZBCA 3NZGA 1X6LA 1YQ2A 2G3FA 2PTWA 3CUXA 5DLCA 3VM5A 3WN6A 4WVXA 1K8YA 2XTKA 3G2GA 2ZZ1A 4HKPA 3RNDA 1EDGA 1T96A 1RQHA 2FZ9A 1XGZA 3ARZA 3KWSA 1W2PA 3T05A 4K7VA 2CW6A 5KITA 4CEUC 3GVQA 3G0XA 1EYWA 5I00A 4O8AA 5FEZA 2FJUB 4PMXA 2NXHA 9RUBA 1JYVA 5FEWA 4GK8A 4L80A 4HPJA 5DXYA 4CCCA 1EBGA 5D9PA 3NVDA 2OWXA 4PMVA 1GTHA 2YPIA 1ML1A 3BW2A 3RK8A 1GEQA 1R5YA 2VEPA 2EAWA 3AIVA 3IGXA 3W1PA 1C8YA 1KM3A 5AC8A 1MNSA 3A9IA 1OG0A 3M0JA 4LF1A 4ZQOA 2ZVIA 1V03A 3PBYA 1DTUA 4HU8A 1QU4A 2ONEA 3EWBX 1A0DA 4IOTA 6XIMA 4UNLA 5TNVA 1IR1A 3TTYA 1OF8A 2X1TA 3WX7A 1OGBA 2Z2UA 2HCVA 3CNYA 4WSJA 3VAVA 3LTSA 2IQTA 1TVNA 4JOMA 4PMYA 4GY1A 1U1HA 1QNQA 5E93A 4RX0A 5BOEA 4RDZA 3H21A 5HMFA 1SZEA 1AQFA 2YX0A 1WO2A 3HOJA 2DZUA 3WLHA 4YYFA 2RAGA 3E2VA 1ZBWA 2Y8UA 1EUAA 2OPJA 4XZBA 4EPEC 1LOQA 3EBVA 3HURA 4GYPC 1JQXA 1JCMP 2AKZA 4W7VA 2VL4A 3TQPA 4AEEA 4F2BA 1SSGA 1YX1A 5C8BB 3VI2A 4FF5A 2QMKA 3QHOA 3RJXA 6REQB 3EOLA 3THCA 3HZ3A 1SFLA 3PZUA 1FCQA 4MB1A 2VRQA 5I03A 1OCQA 4UTWA 2GOKA 1JL8A 4XZIA 4OHQA 4MY1A 1EZWA 1QW8A 3AS1A 3I6RA 3RRAA 4A2RA 4H8HA 1OBAA 1Q4NX 4QBXA 1JPMA 2R1PA 4F4RA 2HVMA 1VFMA 4UNKA 1JAEA 2G5WA 1E0VA 2X2YA 2Y7FA 1K9TA 4UR7A 5TIMA 3U0HA 1PBGA 2H3BA 1V77A 2V30A 5EKYA 2ZUMA 4TO8A 2AKMA 1ISVA 3QEZA 5AY7A 4DBDA 2G96A 4HNOA 5ENLA 3WG6A 3N1AA 4KEZA 5A8GA 1R9XA 4IL2A 4CKQA 4UFJA 3W2JA 1HZYA 1P43A 3G1VA 2WVVB 3MDUA 4JNMA 1TRIA 2D0FA 2A5HA 3V3WA 5FF7A 3U3HA 1UKPA 1B90A 2ZXBA 4F2UA 3GWQA 3WH7A 2CITA 2E28A 3EKLA 4IP7A 3WLNA 3LI0A 3LHYA 3CZ8A 2PC4A 4DYJA 3NGJA 1KGWA 2EJ1A 3FOKA 3JW7A 3KW3A 4YVVA 1XYZA 4Q4SA 4AZCA 4IXHA 1JIBA 4DJEA 5F4SA 1KW1A 2TMDA 1J12A 1TG7A 3RR1A 6A3HA 1GONA 2O92A 3CV6A 1ADSA 1V3IA 3GY1A 1R86A 1G6CA 4MYXA 2ALDA 3NO5A 3C2YA 3TTEA 1E1EA 3T40A 3W6MA 1J0KA 2QCDB 3M07A 4DN1A 1HKJA 3DFQA 4NI8A 3RUBL 1W54A 3TE9A 3OG3A 4H2HA 4JGDA 3W7LA 3QTPA 4M6VA 4UQEA 3DIPA 4XD3A 4NYYA 1ESWA 1H0IA 1WZMA 3MKVA 1UWTA 5A2BA 4JNYA 2CLKA 2VI0A 3BLFA 1B54A 4RR4A 3U9IA 4G5DA 1S46A 1G4PA 1RLDA 1TZZA 3SSJA