2Q02A

Crystal structure of a xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 at 2.40 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
GMNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQLASWSEAEIEEQINRSVSLLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative cytoplasmic protein (NP_463296.1) from Salmonella typhimurium LT2 at 2.40 A resolution
rcsb
source organism Salmonella typhimurium lt2
molecule tags Unknown function
molecule keywords Putative cytoplasmic protein
total genus 97
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2q02A00
1XIEA 3LMZA 4J4KA 1BXCA 1QTWA 1XLBA 2OU4A 3BDKA 3IUDA 3M0VA 3UU0A 3XISA 4DVOA 4YTQA 1XIGA 1XYCA 3CNYA 3KCJA 3AAMA 3CWHA 1S5NA 3NGFA 1CLKA 5EMMA 1XLIA 2HK1A 1XIDA 1DIEA 3QC0A 3C0LA 2GLKA 1A0EA 1YX1A 3AYTA 3ITTA 4XSMA 1XLDA 5AVNA 3AYVA 2QW5A 2GVEA 5TNVA 1D8WA 1BXBA 3CQJA 4PFHA 2HCVA 1XISA 1XLJA 3QZAA 2J6VA 1A0DA 1XLCA 4QE4A 3FVMA 4X61A 3VNLA 4GJIA 3VYLA 3KCOA 1XLKA 3ITVA 3AALA 5EMLA 4DUOA 5XINA 1XLHA 1TZ9A 5AVHA 1XIHA 4XSLA 8XIAA 3KBVA 4Q7IA 4E3VA 3VNIA 5B7ZA 3KTCA 3JU2A 4XISA 1XINA 4ZB2A 3ITXA 5EMJA 3CQHA 3KBJA 3KCLA 4US6A 4K1GA 4KW2A 1K77A 2NQHA 9XIMA 4XIMA 1XIIA 3M0LA 1XLEA 5XIMA 4QE5A 6XIAA 3OBEA 7XIMA 3U0HA 4GLEA 9XIAA 1XYBA 5C9ZA 4A8IA 6XIMA 3KBNA 8XIMA 2QULA 3M0YA 4HHLA 5XIAA 2X7VA 2G4JA 4XKMA 4X60A 3XINA 1GW9A 4YTSA 3KBSA 2XISA 1XYMA 2I57A 4HHMA 3QXBA 1DXIA 3UA4A 5H6HA 4GJJA 3BZGA 4QE1A 4ZB0A 2G0WA 5I7GA 1XP3A 3U3HA 3ITYA 3XIMA 5J8LA 3BWWA 4YTUA 3BZJA 3CQIA 1XIMA 3DX5A 3UXIA 1XYLA 1XIFA 4PGLA 2GUBA 3GNXA 1XLAA 4QEEA 4A8RA 1XIBA 3IUIA 4W4QA 2QUMA 3ITOA 3WQOA 1XLFA 1S5MA 2NQ9A 3M0MA 5B7YA 3N4AA 1OADA 1I60A 3ITLA 3BANA 5EMKA 2I56A 2QUNA 3VNJA 4QEHA 3KWSA 2NQJA 3VNKA 1QUMA 2ZDSA 4OVXA 2GYIA 4YTTA 3TVAA 1XYAA 4HGXA 4A8NA 1I6NA 4EACA 5H1WA 4QDWA 4K3ZA 1MNZA 1XIJA 1A0CA 2HK0A 2Q02A 3L23A 3P14A 4X63A 5B80A 3VNMA 3DBNA 3UVAA 3KBMA 3IUHA 4YTRA 3M0XA 2XINA 2ZVRA 1DE6A 3KBWA 3M0HA 3TC3A 4EAYA 4LNCA 3UA3A 4QDPA 4ZB5A 3CQKA 1XLGA 3C0QA 4ZBCA 4GQBA 4A8LA 5FA5A 2X7WA 2XIMA 1XLMA 1O1HA 4XIAA 1DE5A 3C0SA 3P6LA 3QYSA 1DIDA 1MUWA 4HNOA 1XICA 4G56A 1XLLA 1QT1A
chains in the Genus database with same CATH superfamily
1TSIA 1N7KA 3FGCB 5FJJA 3QSRA 4EWJA 4HPNA 3IPWA 5CPLA 3V5FA 3ISIX 3VIPA 3ZR6A 4PBEA 5CGQA 5CEWA 4MZ8A 4B15A 5A5WA 1ZAIA 1SFJA 4XG1A 5CZSA 4GUFA 4AUBA 2O55A 2XWEA 4K37A 1J01A 2FGBA 4UFJA 5DCEA 4Q7BA 1JCLA 5E9XA 3PP7A 3EOUA 9XIMA 3WDRA 3HQNA 2PRLA 5TD4A 4Z2LA 1LWIA 4MB1A 3EA2A 4JIHA 2EF9A 3UZWA 1H1NA 5E1QA 1Q7MA 3P5ZA 1PIIA 4CQ9A 4RCXA 4GKTA 4CN6A 3R10A 4MMWA 2H3DA 5CSRA 1TCMA 2PWVA 3WEMA 5IBXA 5I3KA 3RXZA 1VPQA 1UP2A 2CESA 4RXGA 2QJNA 2OR2A 1MXGA 3BLDA 4A3HA 2F6XA 2OWWA 4DAIA 3Q65A 5CJNA 1G4EA 5I02A 3ZR5A 1RLDA 3LOTA 4GVGA 4K36A 1OIFA 3EOOA 4GQBA 4NZ3A 4B5TA 4MNKA 1E0XA 1B3ZA 1B2YA 1XDMA 4G7EB 2FFCA 2DIKA 4HIBA 1OGBA 4UQBA 1BSLA 1LZOA 2WSQA 1L9WA 5DX7A 4O50A 3NPVA 2XG9A 4WXZA 4DNMA 2VDGA 3LCXA 4W9TA 4ZMGA 3NYZA 4C6JA 3KCOA 5HJXA 1QXLA 2OLHA 4N4QA 4FNQA 3UZZA 2XYLA 2JEPA 1GJPA 2HISA 4K2SA 3A21A 1BG4A 4IQDA 3L21A 2WNQA 2QJGA 2YGYA 3VFCA 3WF0A 3VC5A 1TV5A 1P0NA 1YADA 4HNVA 1W1YA 3LNPA 1EWEA 1OSEA 1XYZA 5KZMA 1Q6GA 4ATLA 2WVTA 4A05A 1M5WA 2C1IA 4QITA 5C70A 2AL1A 1M53A 1HVXA 2WJFA 1XIMA 2RHGA 3L5MA 4AHPA 4DN1A 3CS2A 3LLDA 3PAJA 4HN4A 3RLHA 3BXWA 3MUY1 4C65A 2CBUA 3RMJA 4O57A 1YYAA 3CUFA 2YXXA 5DXYA 2A85A 1PAMA 3GRIA 3L2MA 3AICA 2CZFA 4LTSA 3UR5A 5IFPA 3LV5A 1S2TA 5AHEA 4O14A 2POZA 3SJ3A 4JAWA 3VABA 1HL2A 4LV4A 4LAUA 3UCDA 5HPCA 4GFSA 1TPUA 3WQPA 2VNCA 1XPGA 4J3SA 4JOMA 5AFDA 5BU6A 3WH6A 3PN8A 1JI1A 2RJHA 3TNBA 1KWGA 3S46A 3SCPA 4HU0A 2XZ9A 4HMEA 2F38A 1I45A 2GWGA 1CEOA 2YBUA 1TV3A 3MHUA 2D0HA 3GVWA 3VOFA 1SO6A 1W5PA 5I3FA 3W1XA 3NL3A 1YTEA 2DH2A 4FX8A 1DQXA 4WSKA 1O5QA 3SUUA 5E70A 4XSLA 4F0RA 4N42A 3LCHA 3MKKA 3LY0A 4WOQA 4ZB2A 3WMCA 1FWTA 3CJPA 4IMGA 1W3JA 1KV5A 1Z89A 4O53A 1AQMA 3L4ZA 3O1NA 1C29A 4FP1A 4QQ3A 2A6NA 1HP5A 3LPOA 5I7GA 1YXDA 1S46A 4UR7A 3W88A 1E73M 1UIPA 1M04A 3EXSA 4JNMA 1J6OA 4Q8OA 4FEZA 3FIGA 3E9AA 3LA4A 1AL8A 3VDCA 2OYLA 3SUTA 1UR8A 2IQDA 5F2GA 2FZNA 3GLCA 1R3TA 1GOQA 3T09A 3ZOAA 4TTUA 3GYCA 1DIOA 3CUXA 3BLKA 4MKNA 1QO5A 2D3NA 4JL2A 4PE8A 3SIZA 3TN6A 4RDZA 4LPCA 1RCOB 3MY9A 2YB4A 4JGDA 2D0FA 4F3HA 1IEWA 4HNCA 3FCPA 3SGZA 3RYSA 1IE7C 3DHPA 5I79A 3BLFA 4MVAA 1ZAJA 2YLAA 1THFD 1XH2A 1J0YA 2XH0A 3II1A 2P8BA 4D6CA 2A7PA 2BMBA 1POKA 3C0LA 1PS9A 5FF2A 1KFCA 3R94A 2XZ7A 3KLLA 4Q8NA 4HK7A 3VIMA 1AODA 1LROA 4I9JA 1W9PA 1QNSA 1A0DA 3SAZA 4Y2WA 1AFSA 1C8VA 4LC8A 3IJDA 5EMYA 1CBGA 5D2VA 1JI2A 3R4IA 3GHSA 2PDKA 2VMFA 2KZHA 5BCAA 2TRSA 2HV5A 4BEQA 3CYVA 2Z1VA 4FSAA 3U4AA 2G4JA 2GGJA 3APTA 2E25A 5CBBA 1FCQA 3N2CA 4HHMA 4JYEA 3TJ4A 2D73A 4DWSB 2POTA 4L9YA 1UIOA 2J7EA 3V3WA 4BHYA 2FGLA 1XIBA 3TTOA 4V27A 1EH9A 3ENLA 4NAEA 1X1ZA 1V93A 2GOUA 3AIRA 3S3GA 3RRXA 4EACA 4ATDA 5JQ9A 1MNZA 2F2HA 2Q02A 2J9XA 3HQPA 1LG1A 2YFNA 2D23A 4CCCA 1A5UA 1H5VA 2HXTA 7REQB 3DH7A 5DY3A 1O95A 4IQLA 3QY8A 1UR3M 3C0SA 1G01A 4M56A 3WH9A 3N9KA 1Z44A 4XVEA 2OU4A 5I00A 4PUKA 1SGJA 3CNYA 4WUIA 3WKZA 2ZX8A 8RUCA 4MWAA 1A0EA 3UJFA 4QLJA 1ZENA 2YBVA 3IGXA 2DSZA 3B97A 2YA2A 3HU7A 1W1IE 3MKVA 5D4YA 1VP5A 5DFAA 3GX9A 2W27A 3GW3A 5J5DA 1GG1A 2Z1BA 2ASHA 3EDJA 2C1HA 2QMKA 3RU8X 2WC4A 3UFYA 2ISSA 5E6ZA 4HTBA 1H4PA 1F61A 3CB8A 3UWQA 3UXDA 1B1YA 4BQ5A 4YTSA 4MY8A 2WSPA 1NP2A 2I5QA 4QE1A 4ZQNA 4M3PA 1K7FA 3N2MA 5LGZA 5D03A 3VFLA 3GVQA 3E5PA 4AIEA 1BVNP 3O2LA 4AQLA 4JQ4A 4AHOA 3KDOA 2XIIA 1TJ2A 4IPJA 3KS5A 2HXUA 3GFZA 3ARPA 2PCEA 1H7OA 4AWTA 4P7OA 1PYMA 3SFWA 2PCQA 1CCWB 5I3HA 4XD3A 4QJ4B 4JTAA 1U1JA 3CUHA 3DZ1A 1CLVA 2C15A 1P7TA 2EQDA 1RP9A 4RZ6A 1HKKA 2CZ5A 2PWHA 4URIA 3VILA 1MSSA 4BF5A 3H7UA 1DQWA 3W26A 2BOFX 4UTWA 1LUCA 3AQUA 1EDQA 3NNTA 1EEXA 1RALA 1HTIA 4FIQA 3S47A 1M7XA 5KETA 1R0MA 3SIMA 3RR4A 4B5UA 4YCPA 2JEQA 2YZ5A 1AJ0A 1WXZA 2HCVA 2REQA 2JKEA 4ZTYA 5HPOA 1Z3NA 3LTSA 3WNMA 3LS9A 2DZBA 3GXPA 1DJHA 4TMCA 2B7NA 1BAGA 2ZTJA 5AC5A 2ZVIA 2HDJA 4GVIA 3CTLA 2WC3A 4UQ9A 1KV8A 1EJVC 3WK2A 4QE5A 1FVPA 4L1GA 4LVAA 2GJXB 5HWNA 4K6AA 3DENA 4QG9A 2Y8KA 4PMNA 4IPLA 2WSYA 1SW0A 4XKMA 1JPIA 1O68A 3NQAA 1XDLA 1Q7QA 3ME3A 2WM1A 3EMZA 5A2CA 4JDBA 1SMDA 1KM0A 3DDMA 1H1ZA 2GL5A 1AUSL 4PUWA 4C90A 1AH3A 3WLIA 1RK6A 4XVDA 4JIQA 2QNEA 3UVIA 3MYOA 5AKQA 1BKHA 4YL2A 2E1DA 3W76A 3LPGA 3VOIA 5EFFA 3W83A 3ATYA 3OLEA 1AG1O 1G0CA 1UWRA 3C8NA 2X1UA 1OFBA 4ZTXA 3IEBA 5TQLA 1K6AA 5E0CA 3AIVA 1GTEA 2AMGA 3CMGA 1SYTA 3XISA 2HJPA 3H2OA 1JEZA 3HZ3A 4J3XA 1WZKA 3W72A 1XRSA 5LGXA 4HSNA 3HQ1A 2NT1A 2A3HA 4MYXA 1V51A 3S6TA 2YFOA 3OPSA 3VNLA 5D2WA 3F03K 3MC5A 1EEPA 3E38A 5EBUA 1FA2A 4ZOAA 3STFA 2WMIB 2Q6ZA 1TE6A 3W6YA 1MYRA 2C91A 4DO5A 3ZVHA 4UFLA 3GH5A 1GOIA 2ZA1A 1CXFA 2X7VA 1R7OA 4DM1A 3W3OA 1YKWA 1WZAA 3RR1A 3NPWA 1IEIA 3NEVA 5FJPA 4PUMA 3ITYA 4J3TA 3LMYA 2CERA 2XSXA 1CGUA 1OFDA 3VK5A 3S1UA 4N6EA 3CV2A 3SBFA 4MUZA 2NQZA 3VX0A 3EA1A 4UTHA 1H09A 1B5TA 4Q4SA 2Q3RA 4JTGA 2J27A 3K4AA 3KM8A 3CZLA 2DSWA 1KC7A 3FXGA 3P81A 3PBUA 1S39A 2B81A 4MF4A 1NVMA 4CQAA 2P1FA 4PYSA 2YKKA 4KF1A 2V3EA 5LZLA 4UZUA 3C56A 4ZSTA 3ZSSA 1MW2A 3QMSA 3PUEA 1IQ8A 3T42A 1E9LA 1W9DM 4OECA 3H2MA 3BW3A 4A29A 3LUTA 4NHVA 4OTKA 3A12A 3AYTA 1BGAA 1MWOA 3OIHA 4ADTA 1OWQA 1E9IA 2DJXA 5GQBA 3L68A 4R27A 4U2ZA 3DESA 2RH9A 3I7RA 4AD0A 5BRBA 1V6TA 2V68A 3GFYA 3PVFA 3UPBA 3VDAA 1XIHA 4HA3A 2EG7A 4B90A 3E74A 3GXDA 3ABSA 2WOQA 2FZBA 4KW2A 3QVQA 3GHUA 2DIEA 4YVVA 5E5CA 3AXIA 1HT6A 9XIAA 3DHDA 1LQ2A 2O92A 2CBIA 3PANA 1EOMA 3DU0A 2CBJA 3REQA 3CAKA 1LOSA 3R0UA 2R1LA 5ABHA 3VGDA 4GYJA 3PJXA 3Q94A 3GU2A 3UNDA 4UFIA 2XH7A 4X0NA 3OZOA 2VDIA 4QEHA 1JYXA 1ZBVA 1MFUA 1KBIA 3T9PA 2J25A 4WDWA 4EE9A 2DPEA 3SUSA 3TYZA 4RKAA 1LRQA 2XINA 3IK4A 5C7VA 1K03A 3W7OA 4PULA 4CEUC 3TTYA 4JS3A 3FHQA 2OOFA 3C2YA 1DBTA 3CZEA 1W3KA 3GTHA 3W7MA 3ZLFA 3BMWA 1JVNA 3K1GA 3EOSA 2YL5A 1GVYA 1LDCA 2O9RA 3G2GA 1X7IA 2WB5A 2X09A 3IIOA 1UR0A 3V5OA 5G4HC 2D20A 4HBKA 4C6IA 3WUBA 1UC5A 4MNMA 1GPFA 4NXSA 4XSMA 2PWGA 2QW5A 3W2LA 3WL0A 1UROA 3RPTA 2EJ1A 3NTYA 1Q66A 3E0WA 5BW6A 2OELA 4DB7A 3QGAC 4OV4A 2XFYA 2RDWA 1MNSA 3RJXA 1QNPA 1XBYA 2IMRA 2BHUA 3KXQA 1SMAA 1TPH1 4ADUA 3NQ6A 3A4JA 1UWQA 4JQAA 4YNGA 2HE8A 1TIMA 2CWXA 3AMLA 3F2DA 2ANUA 4IX0A 5CSUA 2FZ9A 2P53A 4UFHA 3GM8A 2DVXA 3ARRA 1W1ZA 1U1UA 4IM4A 4NIRA 3NIYA 2YCKX 3HB9A 2QZRA 1WZLA 4MLRA 1OK4A 1PEZA 4AW7A 3CLWA 2GVGA 3WQOA 2PBOA 3TYDA 1EJTC 4BF9A 1XUUA 1F4AA 4NNAA 2WCSA 2GYIA 5IXEA 2H9AA 3RO6A 2XN2A 4CN4A 1IYXA 1I0BA 5FF0A 3KBWA 3MUAA 2VVSA 4LNCA 4I8DA 5DT5A 5CG7A 3GTFA 6A3HA 4Q4OA 2RDTA 3RGTA 2NV9A 5HWMA 1OJXA 1E6XM 4ZQCA 3AAMA 4BJHA 3AUOA 2E5BA 1TRDA 4F0MA 5FEPA 2P50A 1T96A 2E5DA 2HROA 4CD8A 1S3TC 1RJQA 3V0UA 3W1TA 1ZFJA 5BMXA 3TA6A 3VO0A 4HOXA 4QG8A 3EAUA 3V0TA 2VEMA 4D6IA 4ZO9A 2WMGA 2NQHA 3NXFA 4XUYA 1W3LA 1QFEA 3H24A 3DAQA 2TYSA 4NAFB 2PGEA 4HYRA 4DUWA 4J3UA 1A49A 3EKGA 2SFPA 4QCEA 1TCDA 1G4TA 3L2LA 5F4SA 3SCRA 5AN7A 1UASA 4K8EA 5CXPA 2DJLA 1DWIM 3WLQA 4OFCA 1X97A 4AMAA 1EGVA 1KBBA 3SZ8A 2YSWA 3GNPA 1F3EA 2CPUA 5IRPA 3IJQA 5I77A 3MP5A 3HM7A 1XWYA 2B7QA 3VMPA 2Y5JA 4D72A 4GH1A 4AEEA 4AZIA 1UR4A 3U2EA 2ZZ4A 5BOEA 3TOPA 4E2BA 4YTRA 1SVDA 4Q4PA 4MJZA 1DE6A 5F1VA 4ORIA 4NZ1A 3TZNA 4NJGA 3W28A 4CU8A 5A6TC 1IGSA 3TZFA 1EPVA 5MKGA 4A8LA 3LPFA 1KO0A 3VIOA 1J5TA 3AYRA 1NJJA 4JDYA 4DM2A 1LWHA 2V8ZA 3CAVA 3MSYA 1ZJIA 3GTXA 3VC6A 4ECLA 2Y7DA 4R7WA 1E3XA 3T8QA 3W7QA 4F40A 4NAFA 2WPGA 1ECQA 2WKLA 2QT3A 2A3LA 1X8CA 2Y5SA 3TJXA 2Z0IA 3GNOA 3LHYA 3VD9A 5G2HA 3FNDA 3T4WA 4RNIA 4I7UA 4Z0SA 3BV4A 1TPWA 4UCGA 1GWJA 1GQLA 5I3DA 3EDFA 1LOQA 4Y96A 1WBJA 2QULA 2DFAA 1BTCA 1DJGA 3FDGA 4H2HA 1E0WA 4NU7A 1ZL1A 4EPBC 4LY4A 3BOFA 5AY7A 3CQIA 3EYPA 4M7SA 1NARA 3GKFA 5DMYA 1JAEA 3B05A 1TRIA 2CFFA 2R1PA 3H12A 1W17A 1SQ7A 3VMNA 1E1FA 2OSXA 1RHCA 5LNVA 2WWCA 3GS6A 3D3FA 1GVFA 1IR1A 1PXGA 1WDWA 3V35A 3SCUA 1VIWA 3G1HA 3QOMA 4LX4A 2E09A 1ESWA 1RBLA 3ARUA 4LB3A 4LYQA 3EB4A 3K13A 3IAQA 5BROA 3ARZA 1DE5A 3R79A 3R8HA 2A3BA 4UNLA 3FYOA 2NXHA 1LBMA 4XD5A 3DFYA 3FA5A 1M7OA 1C93A 2NQLA 1VEPA 3TDFA 3R7MA 1FWSA 2PE4A 1K3UA 1DWAM 4V33A 4WY0F 5T9BG 2DZUA 1MUCA 2PDBA 4HKPA 3OBKA 1XQKA 2YW3A 5XINA 3NL2A 2XUCA 4AZHA 2G50A 4XIMA 4ZE5A 3SCSA 1Y8BA 1JYVA 3B0YA 1E4MM 7XIMA 3AIEA 4XAFA 1M01A 1LLWA 1L6FA 3CM4A 3NZ1A 5H6HA 2XH4A 4M82A 1VFTA 4QDMA 2ZE0A 2ZBTA 3GG1A 4FF5A 1LT7A 2WWDA 4GY1A 2WHMA 3OZYA 1EA9C 5AYZA 1M6JA 1TJ1A 4AVFA 3MZ2A 1KR0A 3GNDA 3UGRA 3F2CA 5IFTA 1GOMA 1E5JA 1LRTA 3N2XA 1T40A 2Y5EA 4NKCA 1A4MA 3A5FA 3FHAA 1U5JA 2CLIA 3AS0A 2FVLA 1JFHA 2A5HA 4XZNX 1W3TA 1OG6A 3PTQA 4TQTA 1CI1A 1Q6EA 2WO5A 3C4UA 3E2QA 4MY1A 3WD4A 4DBSA 4KWOA 4G56A 3DYMA 1YE6A 2VC9A 5L6UA 4HCLA 3C2VA 3K1DA 4O1DA 4FO4A 2WJDA 1HNYA 3SRFA 3WNOA 1IZCA 4HNTA 3QF0A 5F2LA 4WF7A 1JDCA 3W25A 1J0KA 2PLKA 2CHOA 3A9BA 3U4FA 3V16A 1GVIA 1JPHA 2ZX9A 3GVRA 2XN1A 4QGCA 3AHYA 5LIKX 2YL8A 3NQDA 5E0KA 1UZHA 3C52A 3OYZA 2RAGA 4NUWA 1ISWA 1SUXA 3QTGA 1V5XA 3NDYA 3ZJKA 3UERA 3P8IA 3ZLGA 4HU8A 3CC1A 1HXJA 5DBTA 1J96A 4WY0A 1Z8AA 3YPIA 2PU1A 3BL3A 3W87A 5AYIA 4R5EA 3MJMA 3H22A 3PSWA 1I2QA 4LBRA 2XU2A 1GKQA 4X2PA 5AB3A 1C90A 1DYSA 5HUOA 3KRUA 1RK5A 3VKAA 2YL6A 1T8XA 2PF0A 3H26A 3DBNA 1QR7A 1LL7A 4S1FA 3VDHA 2XVGA 4PUJA 1MVYA 1KGWA 2IKGA 2W79A 2Z26A 3POCA 1W3NA 3NO3A 3ZVHB 1BG9A 3B8DA 1UKOA 1QTWA 3VGBA 4LCQA 2ZICA 3NZPA 1W1TA 4FXSA 5G4EA 1D7KA 1HF6A 2QXWA 4QTGA 1SW3A 2GJPA 3CYJA 3LHVA 4QE4A 2JQXA 2PB1A 1P0DA 5FJOA 1FP9A 4PL1A 3FY1A 3L66A 3DYOA 1P0KA 2VEKA 3UYIA 4FA3A 3O6YX 2PP0A 1QJWA 2KAUC 1GHSA 4NZCA 2A21A 4DHGA 2EBNA 2E77A 4GZJA 2Z7KA 3BUVA 1EZWA 2C6QA 5TIMA 3EDDA 2ZUNA 2QCEA 4HN8A 1H51A 1ADOA 3UXAA 1G7VA 4REQA 2FZMA 1FWJC 3HA1A 2WZIA 1PHWA 3BANA 4O1EA 3CPRA 5D9MA 1K02A 3OA3A 3UQNA 2FTPA 4V1XA 4C1NB 4RW5A 5E09A 1HQTA 1ZQ5A 3GAKA 2QS8A 5B80A 1QNOA 2XIQA 4I90A 1GQNA 4O11A 1HJXA 3W6MA 2ZZ6A 1RV8A 3WEOA 4LCSA 1KLZA 1W8SA 2NXIA 4JHOA 1M41A 4A4AA 1UJPA 4ORMA 1E6PA 1O7AA 5AC7A 3RAOA 3QYSA 3KWXA 4JKMA 1BRLB 1TTPA 3F4VA 4B4HA 2JF6A 4Q8MA 4DZ5A 3CZ8A 3BDKA 3NA8A 4JTLA 3N15A 3NQBA 3UNTA 1PL9A 1OY0A 3VOGA 3E6EA 5C8BB 3PNUA 3CUJA 2HNHA 4Z1CA 1A5KC 1ML1A 1TJ0A 1RBAA 2Q8XA 3EKZA 1XLCA 3CIWA 1OABA 3KP0A 4WK9A 5DRIA 3LRLA 4G9PA 5AHLA 3WJYA 2AQVA 4NY2A 2Y0FA 4GQGA 4WHBA 3C6CA 4O13A 3GR7A 6XIAA 1E1CB 4J2MA 3SY1A 3LV6A 2A3AA 4H01A 4U3AA 4Y8EA 4Q8QA 3A5VA 4E6MA 3NQ2A 3UZYA 2PRHA 1TV7A 2PDWA 4EPDC 3URBA 5LIXX 4M29A 1K4HA 4QJ5B 1PWLA 3HV9A 2BV9A 4DY1A 3VNKA 1PX4A 1K70A 1DV7A 1EJWC 1UG6A 1XS2A 4A21A 4RE4A 3ANUA 5FKYA 5D05A 2A2IA 1TUXA 3I6TA 4Z2GA 1LG2A 4C7GA 4W88A 1F8IA 2QF8A 4UTIA 4YIWA 2BTMA 4XD6A 4GMEA 3RUBL 5C2XA 1KB3A 1XGEA 4P8WA 1D7FA 2X16A 3W07A 1ELSA 1REQA 3GXMA 4WRHA 4GXPA 1XCFA 1X8FA 4MNLA 2OPJA 3FYYA 1OIMA 3OEXA 5H8UA 4CNTA 1ZGDA 1BFNA 3EWBX 3WLHA 5EMLA 5CZKA 1IT7A 2EO7A 3SR7A 1PKNA 4XV0A 4ZQMA 3CT7A 2ISDA 1JZ5A 2ZQ0A 3LNMA 2DVTA 3DERA 4BQ4A 4IG2B 3NOYA 4GI6A 3O9NA 3LXCA 2Z4GA 3POHA 4JX5A 5ABTA 3ITGA 1GVSA 1TJRA 3H21A 3MVTA 2PFHA 1R38A 4CQBA 3OG3A 1QU4A 4QM1A 3GBEA 1K8XA 3S83A 3U8GA 4IPNB 4TUFA 5LHFA 3JZUA 4HOZA 5GJPA 1ZNNA 2WHLA 1ITXA 3LU2A 4GWEA 4AZCB 3AIUA 4M1BA 4KFNA 4KFPA 3UJ2A 2QDEA 3WJZA 3PPFA 1VLIA 4PH6A 4DPPA 4ZSUA 1D3CA 1NQKA 5A6KA 5LIWX 2ZYFA 3BARA 3EDEA 3MJYA 1ZP4A 5CG0A 4JTSA 3G1VA 5IDIA 4C6PA 4RR4A 1ISXA 4OV9A 3GC2A 1FKWA 3RILA 4PR4A 2FZ8A 4JPGA 1PKYA 2PDNA 3N6JA 4FK9A 1P5BA 3ARSA 3FJNA 3ORWA 4Q8WA 3INPA 4R53A 1QI3A 3NEHA 2NV2A 2D2OA 4MY9A 1B3OA 5A3HA 3TTQA 4EXBA 3NJ3A 5CC7A 4L4PA 1HZYA 2V6AA 1KWKA 2FDMA 5LNRA 3PPCA 2A4AA 4WVXA 5AVHA 3GXFA 1NFPA 5D8ZA 4K1GA 3S2JA 2HVOA 3TFXA 1IEXA 7PTDA 4GYFA 2PTYA 2PP1A 3OBEA 3ABXA 4FNPA 2PDXA 2GK1A 4F0SA 1QPOA 5HJLA 5LKYA 2CZDA 3T81A 8CGTA 4H8NA 3ANYA 1XFBA 2ZWYA 1BYDA 4PC8A 3NR0A 2EPOA 1POJA 3W1AA 3ARXA 4KETA 3AIQA 1NOFA 3MDWA 4K1WA 1Y0EA 4LNYA 4D6DA 1PB0A 4GQQA 2Q3OA 5M17A 5A6SA 2WLYA 1WCGA 1CIUA 2GSEA 3S5YA 2E1WA 2HK0A 1A0CA 4O16A 2G95A 1VFHA 4EANA 3WDQA 4EXQA 1GW1A 3FEQA 3S5OA 4YS1A 4BKNA 2D3LA 4JL1A 4IWWA 1O94A 3H4XA 1FWCC 4AB4A 3NGFA 1JCNA 1KFEA 2ZRUA 4DLMA 1C7TA 1EZ2A 3PBMA 3VVGA 1VEOA 1TUFA 5FEWA 2IUZA 3AXMA 2Z6JA 2NV1A 3UW6A 1UZ1A 3HMJG 1Q6CA 3QHMA 3GDLA 5JH1A 1IZKA 4J35A 1FWRA 4F2TA 4C6NA 3PR2A 1OFOA 2WAGA 1NWTA 5AOUA 1V02E 2C14A 4HPXA 1TZ7A 1QPNA 3R8GA 5EL1A 4B5VA 4PFMA 2QMJA 3GSMA 4NYYA 1H41A 3G1XA 5CBIA 3UWYA 3EWXA 1B0IA 1U33A 1HJWA 3CT2A 5HMDA 3PUDA 5EGRA 3SUWA 3PK7A 4PTXA 3FA3A 3KVMA 3W38A 5GPRA 3DG3A 1VRDA 5GJMA 1FDZA 2G3JA 4IIGA 2HPIA 4JTDA 1YRRA 1WYIA 1NDYA 1NTHA 3P3BA 4QX4A 1TWDA 1VH7A 3N13A 3OIXA 1D9EA 2OKTA 3H54A 3RJYA 4E2OA 1UC4A 4TX9A 2UZ9A 1VLWA 4C6LA 1FCVA 3FV9A 1B4KA 1V0MA 1YXYA 1FWNA 1R9XA 1H7PA 2B7OA 3W7HA 3L67A 1Z41A 5U4NA 5KZEA 1UP0A 5A6MA 1TTJA 2BHZA 4H9XA 4CU7A 3GIYA 3S6OA 1TWIA 3KCLA 4US6A 2PI6A 4PTMA 2VYOA 2V0TA 4P7LA 1KRCC 4R9OA 4JIPA 3BOXA 4I6KA 4TIMA 4A8IA 2R1NA 5C9RA 8XIMA 1EIBA 4IFOA 1I2OA 3OVRA 2VXNA 1FDJA 3ARWA 2PD5A 4LYKA 1NWUA 3G8EA 4E4FA 2Z28A 3OBAA 1HN1A 3GNXA 1V6YA 4G7EA 1K8ZA 2YDSA 3H6OA 1AQHA 2FH8A 2ZDSA 3PZTA 2ZZ3A 2X2GA 5IOBA 4QDWA 4WJXA 1UH4A 3MUXA 2GJRA 1FOBA 2XPKA 1F05A 5LXEA 1P0EA 1OCNA 4S3FA 1A3HA 1MRQA 2ZA3A 2PWDA 3BO9A 1FWGC 4GYPA 1QPKA 4P2VA 3QTPA 1TTIA 1EPXA 2CWNA 1TA3B 2DP3A 1US3A 1Z48A 1H7NA 3PY2A 1B3XA 2ISWA 5CPSA 1OD0A 3M0VA 4QXIA 1LBFA 2ZE3A 1F3XA 3PZOA 3B8VA 3EPMA 1W6TA 3C3NA 3IJIA 1SJCA 2O9OA 3B4YA 5EBAA 1V8EA 1KFWA 3BW2A 5JMUA 2XFFA 3DXIA 2QCMA 1W1A1 3VD5A 4GBUA 3WQ4A 1H5YA 1MQQA 4INFA 2DUAA 4OHQA 2VGBA 2PWFA 3K30A 4E0CA 1K8CA 3WLLA 4GUGA 3RNDA 3CL7A 3W73A 3JRKA 4D8AA 4GHRA 5EMJA 4RLIA 3BAWA 2X0HA 5I78A 1F9CA 6ENLA 2V2DA 4DNHA 1EC8A 2O9PA 1R3WA 4LVDA 1LP6A 5KSWA 2Y7FA 1Q45A 2G3NA 2W91A 5C2CA 2J13A 5K2ZA 1XBXA 3GFXA 5LIUX 3CTTA 2EPHA 4LUTB 1D8CA 1RP8A 1DJYA 2INFA 1Z6KA 3AS1A 3WL1A 1J18A 1JCXA 3WQ6A 3OP2A 2PDPA 4QSHA 3M5ZA 5G2IA 2O7QA 3VDGA 5I3IA 4H9YA 1EO7A 3LCIA 1B3YA 4IUOA 1GEHA 2XFRA 2ZVRA 4WJEA 3H7VA 4X9SA 2D2JA 3TNOA 4ZZ9A 4NZ4A 2VOTA 4E8CA 4IISA 5A8PA 1JXJA 1VR6A 1F76A 1XD1A 1EJXC 4JIEA 2E0PA 2YDRA 4QROA 4WKAA 1KBLA 4KESA 1KFJA 4HZMA 3FYPA 1OFQA 2FHFA 1HJUA 2OMAA 2V69A 3TWBA 1SU5A 3G18A 2VJXA 1BKSA 3VNZA 3LI0A 1O5RA 1E1CA 2BWGA 1DKWA 3MSDA 4REQB 2E8ZA 5GVJA 5B7ZA 5DN1A 3MQTA 5CLWA 1GJWA 1N8FA 3R58A 4AZ5A 3N11A 3TE9A 5BWFA 1R3VA 1TG7A 3GIQA 2ESCA 4QJ1A 3BAKA 1V03A 4FXJA 2A1YA 3M7WA 4UMBA 1AW5A 4TTGA 5LXXA 1TV8A 1QNQA 4CCDA 1R3RA 4GABA 1MZHA 3VCRA 1A5BA 2VQUA 3TVAA 2ZX6A 4MJMA 1XRTA 2VGIA 3W7IA 1T6MA 4WR3A 2BY1A 3RCNA 3RF9A 3DI1A 1BYCA 2GJNA 3PJTA 3ANVA 1GKRA 4IUGA 4JY9A 2TPSA 4AAJA 1PBGA 3Q45A 1AH0A 2D24A 5BOOA 3PG9A 4RNJA 2VX4A 2QUUA 3B9AA 1W0MA 1H7XA 4LALA 2CU0A 5EMMA 3KVLA 1PDYA 1TKKA 3GY1A 3QPYA 3REQB 4CVUA 3B0UX 2BXZA 3AO0A 3A3XA 4B2DD 2X40A 3SM0A 1MQPA 4O8AA 3M9YA 1H60A 1PPIA 4IMFA 2C7FA 5CKSA 1WNOA 1WB0A 5CQ1A 4HYWA 3SCVA 2VRJA 3W7EA 1VS1A 4WY0B 3FX4A 1SJAA 2FJUB 1GOXA 1AVAA 4KMQA 3QOKA 2HWGA 3O6DA 3WF4A 3GVVA 3NL6A 4E4UA 1VJSA 4RNHA 1EOKA 4U3CA 1X38A 2CLOA 2I57A 4GJJA 3BZGA 1XP3A 3P82A 5EPDA 1Z9AA 3UZ5A 4E8GA 4IMCA 4AZBA 3CEPA 3TQVA 4QEEA 3WNPA 2C16A 4NT0A 4EPKA 3ZJ8A 2FVMA 1I60A 1ONXA 1L0PA 4KGJA 4QAWA 1VCFA 1O66A 3GR8A 4XZIA 3TN3A 1TTQA 4NSBA 4B2DA 2C0HA 4UTFA 4XZWA 1XXXA 3QV9A 2QCFA 1UJQA 3I3BA 4J28A 1XIJA 3VXGA 4S38A 5FD0A 1CXLA 2CLHA 1F8MA 5D09A 1PHQA 4JY8A 3BC9A 4ICNA 3QSTA 3O8AA 1UUOA 2W4XA 3E96A 4UTJA 3P7YA 3VM7A 2FDSA 3G5EA 2Y70A 4IQJA 1TQJA 2VT0A 1S38A 2V3DA 1KQYA 1DQUA 4LRTA 1ZCOA 3H23A 2A79A 2FPVA 3CUZA 2J8TA 1OC6A 2IPJA 1KTCA 4Y7EA 2FLIA 3WQ5A 4EPEC 1T0OA 2Z27A 3G1YA 4B3LA 2ZUMA 1HO4A 5LYRA 1KRBC 2AKMA 4BWLC 3QM3A 4JTEA 3L0GA 4L61A 3RFAA 4UBPC 3UA4A 5HNUA 3L4TA 3OJGA 5K3VA 1E6ZA 1P48A 4BI6A 1RUSA 1Q8AA 4J7RA 3B40A 1G5AA 4PEKA 2Y88A 3I4KA 2G5WA 1UMLA 4BZYA 4GUIA 2W61A 4RPPA 2O4QA 2O4MA 2R1MA 3QW4B 1FFRA 4AISA 1FH8A 1LYXA 2QYGA 3P60A 4AX7A 1MRAA 1AH4A 3KRSA 3P84A 1HP4A 1JPDX 3OGVA 3CB3A 1T41A 2P3EA 3FN9A 3IJLA 3TP4A 3BCDA 1E3ZA 1XLBA 1TWSA 2PDYA 4DI9A 5D2XA 3AUJA 1Q2RA 2CKRA 3GH4A 3QMTA 3VYLA 1MDLA 3WY1A 1QWGA 2XSAA 3NL5A 3ZIZA 4W7WA 3JW7A 4J40A 2CLLA 2VUYA 2I5IA 1LQ0A 3BG9A 2REQB 2OLAA 2VEPA 3WJXA 2PC4A 3F5LA 2P10A 4M51A 2JK2A 4MADA 3SEPA 1XYMA 4QNWA 4GC4A 2HS8A 5CGTA 4J3WA 2EAWA 1ONEA 2QCHA 3BZJA 5D9PA 1NAL1 2NVAA 1W2VA 3UY8A 1TREA 3TW9A 2ZRZA 3T8LA 4DF0A 1P7TB 4FLRA 2Q71A 3P14A 3UWZA 1WOAA 1BYAA 1KCXA 1QRQA 4N0RA 3NQFA 4DQWA 3TJLA 2DH3A 2J8FA 4ADSA 1X39A 1RAKA 4LUJA 3HJEA 3QY6A 3RDKA 4K8GA 3HPZA 4M6VA 1MXSA 3TK7A 1DWHM 1QT1A 1VENA 4ZVJA 3FK4A 5AC4A 3ONBA 3WIJA 4AZGA 3RRAA 2GZXA 3W71A 2AQWA 4LS2A 3DKJA 3O0KA 2AAMA 2XTKA 2OLSA 4HQVA 2VFHA 1TR9A 3U5YA 3COTA 4LF2A 1B57A 4ZEPA 3AU2A 1XBZA 4DUOA 1VBGA 3TSMA 3IJ9A 4Z1BA 3WUEA 3VAVA 4MJ2A 2QV5A 1JPKA 4FR6A 4XZBA 5J5RA 4G6CA 1VHCA 5I09A 5D02A 2GVLA 2W67A 4PSPA 2FPYA 3PBVA 3GDKA 2BX7A 2D22A 4FALA 1QDSA 1S5TA 3L9CA 2JE8A 3EMCA 1SZNA 2NVCA 1Y5WA 4FR1A 4ROQA 2EEXA 3CBWA 1LL4A 1RY0A 4GIAA 4MDOA 2XN0A 2OZTA 1X1OA 1K7XA 3N19B 2OYMA 3FVDA 1XW8A 3N14A 5FF4A 4OJYA 2W0UA 3SO7A 4GXWA 1LORA 3UZJA 3G1SA 3NVDA 3EOEA 5D2TA 4ZCWA 4AVNA 1XIEA 3LMZA 1IWPA 3RX3A 4H9MA 5K9CA 4O1BA 5T91A 5HNNA 3PG8A 1CW2A 1C7SA 2XVKA 3L65A 1VYRA 4LBSA 5DF0A 4AF0A 1UA7A 4EIVA 3TN4A 4RPQA 4IMDA 4N02A 3TYAA 3MP4A 4KCUA 4HMNA 1S2VA 1GVEA 2YLLA 4S3CA 3QZAA 5GNYA 1E4LA 2ZIDA 1DXFA 2EPNA 4Z42C 1TVNA 4ROPA 1LJYA 1CGYA 3GW0A 3R12A 4JQ3A 3P93A 2WVVB 1FCUA 3CZJA 3CIVA 3NQ8A 1VFFA 2H9AB 3ITXA 3IGSA 3C0JA 3LHZA 1MEWA 2Q09A 2EHHA 2YDAA 5C9ZA 4C6FA 1C92A 4OOUA 3UYCA 3QZ6A 1ITQA 2VFEA 1JL8A 2Z1WA 1Q6RA 3MTWA 4H8UA 4DJDD 6TAAA 2WVSA 3VGFA 3NYDA 1E0UA 3VIFA 3RX4A 1VPXA 4GYPC 3RN6A 3FFSA 3WD2A 5D2YA 1V79A 3VOJA 4NZFA 3BG5A 1UWTA 3KLKA 2EGZA 3DFPA 1Z32X 4ALDA 4UQAA 4HGXA 4AIOA 2WZEA 4H9ZA 4X63A 5D8WA 1E70M 4N6FA 1BXNA 4M19A 2PDLA 3FSTA 2E5CA 3TC3A 1EBHA 3LGGA 1FXQA 4DWSD 4QR6A 3N6HA 2YXOA 4IFKB 1GHRA 2J9ZA 4TO8A 1E71M 4HA0A 2E6AA 5LNWA 4J2PA 3QC0A 5I23A 2VR5A 3WNNA 4EXAA 2L5HA 2WW5A 1UKTA 2BB0A 2PTDA 4ZO7A 1MW1A 3SDOA 1Q6OA 1V0KA 4PEEA 2D2HA 1MW3A 1Q6DA 3L5AA 2WNWA 1A5CA 2JKPA 4W7UA 1W2PA 3LBOA 1ZRQA 1PZ2A 3SADA 1XRVA 3ALFA 3UWEA 3PJUA 4X0VA 2ZDRA 3UWWA 3LX9A 2ALDA 3VUPA 1TV4A 3BAJA 3U3HA 1KTNA 3VD7A 1ZCCA 2DEPA 3WQGA 3EX3A 5G1MA 1R5YA 1UOKA 2YCIX 3EPOA 4W4QA 4JCLA 2NW0A 2TSYA 3PULA 3M43A 4WOZA 1TJPA 4OWGA 1VZWA 5KITA 5CZ0A 4HPJA 3LQGA 1PTGA 1IWAA 3OGSA 4GPNA 3ZM8A 2Q8LA 5EMUA 4PBFA 4MKVA 2Y61A 4F0KA 1EQCA 4JFWA 3HGJA 3CHFA 3CZGA 1TYGA 7ODCA 4LXFA 2ON3A 1NOUA 1XJBA 1ITUA 3L4YA 2J4GA 3RG6A 1IR2A 3GTNA 1XSIA 1XD0A 3W70A 1QI4A 4QLKA 4AD2A 3CQJA 2OEKA 3K8LA 4H2CA 4GNJA 4JCMA 3S2CA 4UXDA 4W8AA 1YDVA 2J78A 1PZ3A 4LAMA 3WJSA 1XLEA 3PPHA 3V4BA 4IIFA 4BI7A 4MKSA 3ZSTA 2Z7GA 1VBUA 4C6KA 4MB4A 3S5ZA 4M6UA 4PRWA 1QNRA 5DMNA 5I24A 3GO2A 1SR0A 1E0VA 3WDHA 4CEXC 1OGSA 2DT2A 3M4HA 3S1GA 4ZOEA 3TJIA 5JBFA 1JCTA 1B31A 1ZPTA 3CAQA 3AYSA 4EOUA 1FDYA 3M47A 2PDMA 4UTMA 3L23A 3TTEA 4RDWA 1AL7A 1UQZA 3OGRA 2FH6A 4H7VA 2CITA 3NO5A 2X0SA 1MZRA 4GI8A 4OUEA 2AMXA 2E67A 2E9MA 1GORA 1U30A 3W23A 2J47A 2QPXA 3GC4A 4RZ5A 3ABRA 3U9IA 1CLXA 1T7LA 1VFSA 2HVNA 5E93A 2WVVA 4UMAA 2WHJA 2VR4A 3BLLA 2W5FA 4O1CA 3CMFA 1XISA 5FIPA 3AI0A 2OZ0A 3O15A 3PZIA 2C13A 4DYKA 4GJIA 2CHNA 3WF1A 1OINA 2DV0A 3O16A 3CPUA 3NPUA 1LUCB 1TPB1 4MFDA 3LN3A 2XIOA 3T2PA 1XRFA 4M7TA 5REQA 2FMNA 4PB5A 2PP3A 1OFEA 1EGZA 1O5KA 3U48A 4BS0A 3TQPA 4LY8A 2ZTKA 4LVGA 4ZO8A 2QCGA 1OYAA 4N4PA 4OE7A 3V7PA 4PN2A 4OBTA 4DO7A 5FESA 3ZT7A 3WELA 2NZLA 3D3AA 4G7FA 4AC1X 5BXSA 2I9UA 3WF2A 1GG0A 1HKVA 4XZMX 4MNJA 3GVGA 3KOXA 1RVGA 1F7BA 4C6OA 3ARQA 4UFMA 3TXZA 3DFNA 4JBRA 1B9ZA 4O4VA 3ES7A 4HNOA 1KM6A 2ISFA 1TIWA 1PTAA 3CQ0A 1KNWA 3IUDA 5I0DA 4OBSA 3MYPA 4HZ6A 1O12A 3MSRA 5A6BA 3NFUA 3UG8A 2J9YA 4MWAB 3G22A 4ZQPA 3WFLA 1H50A 3N17A 3KS6A 3AIWA 5HR7A 3QGKC 1CNVA 4Y9MA 2V5LA 4FXFA 2JF7A 2C0AA 3PSVA 2DT3A 3PC0A 3CH0A 1JQXA 2E4TA 3S4TA 3LDVA 2VL4A 1JF5A 3KBNA 7REQA 1CENA 4HZ8A 1EGMA 3QR3A 3ZS4A 3MHGA 1KGUA 5LIYX 2DW7A 2NSOA 3AHZA 4H6QA 3MMUA 7A3HA 1JDEA 4Q8PA 4ERGA 2PA6A 2DW6A 4HK6A 4F9DA 2XSBA 5BU9A 2WPBA 2FGZA 3O3RA 2IPWA 3MKCA 3N6QA 1M03A 4E3TA 3RITA 3IS4A 3N4FA 5I3JA 3NSXA 3THCA 4DJFA 3IJ6A 4Z1YA 4NX5A 4GISA 1MUMA 2AL2B 1LWJA 1YTDA 5AHNA 2GVYA 1YBQA 3M6DA 4QQUA 1BWVA 4AWSA 5HMEA 1QASA 2ATSA 2BG5A 1R47A 4D6FA 1S1PA 4ZQRA 1SFSA 4Z1AA 4LUYA 1OX6A 4XO7A 4Q4RA 5DCDA 4CLMA 1WPCA 3MBFA 1LQAA 3N04A 4RZBA 1S2AA 3WMBA 4KWVA 1FHLA 3TXVA 1CECA 3CXOA 3FEMA 3NOEA 2G8ZA 3R25A 2ZUTA 3T0AA 4FLSA 2H90A 1QAPA 4UTTC 4GC3A 4DJEC 4DJFC 3W1NA 3Q67A 2TAAA 1BGGA 3FDKA 2GSHA 5CC3A 1A80A 2RUSA 1UBSA 3W7NA 3M0LA 1EJSC 1UD2A 3B8SA 1UPMB 2YBTA 3NZQA 2HPMA 1RH9A 3S1XA 2B31A 3KL5A 1I8JA 3RIKA 1EDTA 3A4AA 1NF7A 2OG9A 1FWHC 3URNA 1YDNA 1PSCA 2QJHA 4UZSA 1KGXA 1XLAA 1TMHA 3SB0A 1DPMA 2EG6A 2VR2A 2BGSA 5A95A 3RM8A 1QUMA 3LQLA 5TF0A 1GTHA 3GDTA 2IKJA 2DIJA 4IX2A 1CXEA 4HTYA 3SQSA 3OVGA 4F0HA 4N2YA 4B9ZA 4WKFA 3USBA 3UJRA 1BVZA 3U2ZA 4BK9A 1W56A 3DG7A 2F61A 3MWCA 4H83A 3TFCA 2XIJA 4CNSA 2PDCA 4PSRA 3A64A 4JKLA 3NQVA 3D5HA 3LTYA 5HJYA 2IW0A 3C61A 3R1ZA 2YYTA 3EXRA 3GUWA 4GQRA 1CLKA 1T8QA 4DZIA 1KM4A 4LV9A 3TR2A 3TYEA 3WEZA 3WBAA 1VJIA 4PFHA 3DG6A 3O0FA 3K8KA 4PCFA 3QGVA 3AALA 2C8NA 1VCGA 3LB0A 5BWAA 3MT1A 3VMOA 3P62A 4PCPA 2PU0A 2RJGA 5CJMA 4KQNA 5JVLA 3ZJ7A 5G4WA 3W7GA 4KEMA 1I0DA 3L4VA 2J75A 3GWQA 4XO6A 4ZL1A 5T26A 4AD5A 1JULA 3NUKA 4JEQA 2XGIA 2FB2A 3WDIA 2BODX 3IACA 1RPXA 3ZFHA 3T0BA 5I03A 3U5UA 2HS6A 2YYUA 2NSXA 4GNKB 4AYGA 1ZJBA 4YN5A 1XBVA 1AW1A 3C2FA 4EK7A 3K4WA 2ZUWA 4IZGA 1W5MA 3M0ZA 1OHLA 5AZ0A 1X6UA 1ISYA 4O1AA 3STCA 1LBLA 3KBMA 2YXGA 1UR9A 4HHPA 1PIGA 3GQYA 1XLGA 3EWUA 1NWSA 4PMQA 3URQA 2GFTA 4Y8FA 5DQPA 4DUXA 1TB3A 1DIDA 1I9CB 4UFKA 2YCLA 4HNUA 3AMCA 2ADAA 4BFAA 1YTKA 3B04A 3OHIA 4JN6A 5H2ZA 1FP8A 2VCCA 2VC6A 5T8GA 2NQ5A 3SJNA 2Y4SA 3GU9A 1O60A 1JFXA 1QOQA 3RHGA 1EHAA 1OX5A 1VYPX 1EC7A 4NJIA 4GGBA 1J2WA 1FHDA 4C6BA 2GUYA 4DJED 1PIFA 1XCXA 5HOSA 2DORA 3WMSA 5CPNA 1WDSA 1C9DA 4GI9A 4XTIA 1O4UA 5JU6A 4PUDA 4FI4A 3ZLHA 1F73A 4AXKA 1OCBA 4N9EA 2FTYA 4OKDA 2QLYA 3MHFA 1ZP3A 1EUNA 1W9VA 1MXDA 2ACUA 1V0NA 1RQHA 3QPEA 1EA0A 3N25A 4B5WA 2XM1A 2UBPC 3N4AA 4QJ3B 4Y6GA 1XC6A 3BVJA 2NLYA 1EP1A 1L6YA 2PS2A 3UESA 5FF7A 2YJQA 4GI4A 3QKEA 3QRHA 1DJZA 3UXKA 2R82A 3AWNA 4B3KA 4WDTA 1Q13A 1QBBA 4FOUA 2VC7A 5I06A 4QDPA 2PWUA 3B8TA 4QG6A 4Z0JA 4AU0A 1Z7AA 1E9ZB 2V81A 3N1AA 3RCMA 2MANA 1WZMA 1HKWA 3R11A 1TX0A 2F6UA 1FBAA 3BW4A 3VX1A 3PHAA 1R7AA 1F6YA 4HPHA 1JPMA 4S3AA 1R9ZA 5CC5A 3GG8A 4CKQA 4LANA 4GD0A 5BRPA 1MDRA 1BQCA 4Y9NA 2JKAA 1Z69A 4X22A 2DUZA 1V3HA 1UHVA 5ABFB 4JTRA 4C6CA 1K6WA 4F8XA 3HF3A 3W1LA 2ZZ2A 3G0SA 5LNUA 1V7YA 4CQDA 3MB9A 2CC0A 1TZZA 2OGYA 1TR1A 5FJUA 4DIAA 2CBVA 2QIWA 4HNNA 1UW9A 3KVJA 4QAIA 4WSHA 5EMKA 3W02A 4AEFA 3HQOA 3SUVA 1AK5A 4CUCA 3R0DA 4KEZA 4PTWA 4XQ6A 3AU6A 4DYEA 3W7CA 1YXCA 1R30A 2WNNA 1REQB 3UGVA 3KP1A 2G97A 3UCCA 4BA0A 1W1VA 3THDA 3HFYA 1XHGA 2CLPA 4NNCA 2ZOXA 5CJ5A 4ZB5A 2MUCA 1ECEA 4TXEA 2QUTA 2F8QA 4MZ1A 1IT8A 2Y7EA 3BH4A 3CASA 4CCZA 3D46A 4XZHA 2D0GA 1JYWA 2J24A 2HQAA 3PTKA 3N2BA 1UWSA 4FXRA 1L6GA 1DP0A 2I17A 2Y2WA 2ACSA 4O15A 5JXQA 3AJXA 3V1PA 5MKGB 3PS7A 4Q33A 1EJ7L 3CH9A 4MDPA 1W5NA 4E2DA 4MAVA 1NIUA 1VFLA 1UWIA 3IVSA 3OZPA 4XZLX 4LAZA 2VFGA 2ABBA 3OLIA 1JUBA 3DC8A 3AS3A 1UUMA 3BAXA 3QZEA 1CX9A 3HURA 4LT9A 3UR8A 3UWUA 2X05A 3RM4A 1ONRA 3LM3A 3WSUA 4PUEA 1J11A 3OLGA 4W93A 1F07A 3G1FA 1KKRA 4GX9A 4IIEA 5F4WA 4WEVX 1JF6A 1V6VA 1Q6LA 4R3UA 3A47A 3ITCA 3CGTA 4OBRA 3WLJA 5F7UA 5CAKA 1V7AA 4DLFA 3WQFA 3DC0A 4IPPA 3I6EA 3W1RA 5FACA 3UVAA 3M46A 3NPXA 3NXLA 3KL0A 4XAZA 1KLYA 3THAA 5LSMA 4NX0A 4DJDA 4K68A 3SCWA 3SECA 1S3HA 3VIJA 1IIGA 4B9YA 4AIBA 4KIRA 4BI5A 2GGGA 3G1AA 4WKHA 4MIMA 1B30A 1PWMA 2QJIA 3B4UA 3CZKA 4R7OA 5CH9A 1A5NC 4YWSA 3HN3A 2BVTA 5CAHA 3LGEA 3B0VC 3VZZA 1WOBA 2VRQA 4PMUA 3R0KA 5DLCA 2E9LA 2FHBA 5HK4A 3QN3A 3TC6A 3F4WA 1YE4A 1UP3A 3W7KA 5DCBA 4WGHA 3WNLA 1K7EA 3QV7A 4YHEA 3CHDA 4K8HA 1O5XA 2VQTA 1FY6A 4WLCA 1D2KA 2Y63A 2CNCA 3AXHA 1CDGA 1FRBA 4ZODA 4Y9AA 1XR2A 3W37A 2Z29A 3W1QA 3QW3A 3XINA 5C0QA 3FJ4A 1SW7A 2Y89A 5HNTA 4HVXA 1P43A 3H2AA 3VNDA 3G0XA 1IWBA 1KCZA 1H49A 3VPLA 1XF0A 2R94A 4JTIA 3SRDA 2CLEA 4OVXA 1US0A 3C3UA 1TV2A 3H70A 3IIXA 1VGAA 2PZ0A 4WCJA 3GZAA 4JQ2A 4ICCX 4Q4KA 4MZYA 1S2WA 3R43A 4O4WA 4P8UA 1GGOA 4FB7A 2PDGA 4IHCA 3WG6A 4H19A 4KERA 2X41A 1HO1A 4HMCA 3QKZA 4IGMA 1UCWA 3GE7A 5CSSA 4D1IA 1ME9A 1S2UA 5AYXA 5L9FA 2YOCA 1CB2A 3C86A 2OOGA 4CU6A 4L80A 4ENLA 3I7QA 4D9PA 3ZT6A 2XJ7A 1XH1A 2OSYA 4HB7A 3W2KA 1WAWA 2VGFA 5DANA 3VINA 4PMDA 3NURA 1DL3A 3NSMA 3TYUA 2OEMA 3W7RA 4E3VA 1R87A 3TTSA 2VC5A 1V3MA 4CVWA 4XISA 4HSOA 2OODA 5JIWA 1TPC1 2P8CA 1JNDA 3QQ0A 1TPEA 2IXVA 3KOFA 3NDZA 3PPGA 4PTDA 4JXCA 1PDZA 3AOFA 2V5JA 4MUPA 3T05A 4AZ7A 5DMLA 4JTCA 1Q6FA 8TIMA 5A6AA 2UV8G 3GIPA 5A6JA 3RLUA 2E7FA 1SPQA 1Q7ZA 3NQEA 1J0JA 3SY8A 3G6LA 4L1XA 3N3TA 1XX1A 4DJFD 3WJWA 2Q8ZA 3P74A 3A4WA 2VVNA 1KXQA 3ARVA 4UIOA 2GVJA 3BLIA 5E6YA 4YTTA 1J6PA 3KAOA 3WN6A 3CWOX 7ENLA 1JZ8A 1Y5VA 4KWUA 4KS0A 5GNXA 2CZEA 4PMOA 5KTLA 3SQLA 1T5AA 4EF8A 3MCOA 4GINA 3SGUA 4Q7NA 4IIBA 4UOZA 3B03A 3HO8A 3A24A 2VX7A 4M8UA 3EMQA 3P80A 1SZRA 2G3FA 4RE2A 1P4CA 2B7PA 3BOLA 3FOKA 1MO0A 3ABQA 3WH8A 2CLFA 5A94A 4IP4A 4N7QA 4RXFA 2ZZ7A 1E51A 4LH8A 3F5KA 4RJEA 1TWWA 1OC7A 1B9BA 5LA0A 4RNFA 1EWDA 3ZYZA 1K9DA 3KTXA 1KCKA 1RCQA 3JU2A 1U22A 4CD5A 4O12A 4JFTA 5DT7A 4ZA0A 1R9YA 4OT7A 1EC9A 4LOCA 3TX9A 4Q8TA 3GDBA 5C55A 4J3VA 4KRZA 3B3DA 2V3GA 4IIHA 2P88A 3L0KA 4JFVA 1KM3A 3LCWA 1US2A 4PODA 5ENLA 1C8QA 1R6WA 5IBXC 3BPWA 1KRMA 3HMCA 3USZA 4XWUA 2DQWA 3STGA 2D1ZA 4RL3A 1ZBWA 5A8GA 4JQ1A 4C5ZA 4B4FA 1R2RA 3WQCA 3EWZA 4YYCA 3K8MA 4A3QA 1LT8A 1Q6QA 2ZX7A 4ICMA 5HMSA 4PUNA 5JH2A 3I6RA 1KKOA 4ATWA 1NF0A 5IHRA 3CEUA 5I6SA 5GNZA 1JRCA 3LGDA 1NFBA 2QR6A 4IG2A 2AL2A 1BWLA 5BOFA 4AD3A 4YLWA 5A8QA 3VIIA 1HUVA 4IOTA 5D30A 4AVOA 4Q8UA 6CGTA 4H8HA 2ODOA 3AWOA 1XSJA 4C6DA 3TR9A 2Q01A 3KRBA 2HSAA 1EQPA 3T78A 4LJ3A 4HYVA 3V18A 3B9OA 1EJUC 5CLTA 4TVCA 4UTUA 1EX1A 1W3HA 2OX1A 2ACRA 4EX4A 3UZXA 2INEA 4UQCA 1J5SA 1W9BM 3UG5A 4DRSA 4FX7A 4AH7A 2G96A 1VIZA 2VZOA 5MHBA 4GBDA 3OLDA 4QISA 4F9JA 3ITOA 1WV2A 3MUZ1 1OCJA 4A3YA 3KOYA 2NQJA 2GJXA 4OUIA 2YPIA 3F4CA 1F2JA 2BVWA 4B3ZA 3FJ6A 1ZTVA 2DZXA 3BMVA 2XVNA 3LBMA 3MBDA 3OO2A 4F4RA 1MFVA 1CWYA 3T0CA 2BASA 2ACQA 2PGWA 3VNYA 2Z1XA 2RGMA 1U83A 5K4ZA 4ZOCA 4FF7A 3CU2A 3E5BA 3FSUA 1I2PA 2P3ZA 3A4XA 2WM0A 2BVDA 3HG2A 1JAKA 3L0NA 4MJ4A 3MANA 1N8IA 2ZXBA 4U31A 2OXNA 4D8LA 4YTQA 4IIDA 3CWHA 4R9XA 2PDJA 3FKRA 2ALRA 4XAYA 4BF7A 3JUGA 2OT1A 3ALGA 4DI8A 2A7RA 1TQXA 1HVQA 4LUSA 2FKPA 2C79A 1GJUA 1EXBA 3GXTA 2WZMA 4ERIA 3PM6A 3DGBA 2Y8UA 1QBAA 3CQHA 2HNEA 4QIUA 2HZGA 3H8AA 1BF2A 1XIIA 2VOMA 1BVWA 1V3KA 2OQLA 3SRKA 4A6GA 3S8HA 2NX9A 2BY2A 4Z2JA 3DGRA 3IGHX 4P5UA 3VIKA 2PTWA 3DECA 3UXIA 3LK6A 3BGAA 1G7UA 3RO8A 4KBXA 2ZXDA 5B7YA 4QS5A 2QUNA 1U2YA 1RQBA 1M9HA 1W54A 3WBEA 3M64A 3OVQA 2XH2A 2BXYA 4LAOA 2A3EA 4K39A 3M0XA 3OTRA 1G4SA 3EX6A 2QPUA 1I75A 1C91A 4HMDA 4H4IA 3FJLA 4NAEB 2OX4A 5ECUA 2NUWA 1CTNA 2E6DA 3O06A 2ICSA 4IH3A 2V2HA 4L65A 2X0YA 4I9AA 3WENA 1LRNA 4IPIA 4D8ZA 3BV7A 2YA0A 3SN0A 3AHTA 3APYA 1U1HA 3KTSA 5CZTA 3S1WA 3W22A 5AVNA 4QLLA 2BP1A 3RMEA 3PAOA 1J2BA 2H3BA 5F4XA 3APGA 5AC6A 2QDGA 1WA3A 3MV11 3NZGA 5D38A 1EYEA 3W29A 2V67A 4WX2A 4CNUA 1EP2A 2NUXA 4M6QA 3PWIA 2E40A 2Z1SA 3R89A 3PZQA 6XIMA 3N18A 1O6IA 1FXPA 3ID7A 1OEPA 3A3WA 2ZXQA 3VKDA 1EHNA 1PYFA 3ERPA 1H0IA 5A1AA 3EWCA 2AGKA 2WNZA 2WZTA 4GKLA 2DQXA 1ALDA 2C1GA 1IEVA 4W8BA 1YQ2A 4CQ8A 1JUEA 1VBHA 1TWZA 1CXIA 1NDWA 1TE1A 4UNKA 2OGJA 3LERA 1XCWA 5CZJA 5FAGA 1XL9A 4L64A 1UA3A 3TYCA 3KZPA 1Q4WA 3TW6A 1CGVA 3WYZA 4H6EA 3EEZA 4AMCA 3ARTA 4PB3A 4KGLA 2QJMA 4JX6A 3QC3A 2Y62A 3MDUA 1H63A 1J0ZA 2W92A 1BEUA 5C9WA 1E6NA 4WJ8A 2C19A 2WQPA 4BY3A 3S42A 5FI8A 4IP7A 2NUYA 3CK5A 5KMYA 2J7HA 3W0KA 4M80A 4NZJA 2VFDA 3GU1A 1KD0A 5HWJA 1OK6A 5CCZA 2TODA 1PCWA 2GVEA 1JDAA 2OTDA 4GG9A 4X61A 1FH9A 4P7NA 3PWAA 4ZFMA 1RJRA 3OW1A 3VU2A 1OX4A 3IVUA 1L8PA 1TMQA 2YCLB 1WKDA 4V15A 4XKYB 4O54A 2IQ0A 1QO2A 2R8WA 3OZMA 5A2AA 1ICPA 4IICA 2ZUUA 3OODA 4KCWA 1AMKA 3MCMA 3UG3A 3D47A 3HGSA 3QXBA 4QCFA 4RZ4A 3QFWA 5DBUA 1JZ3A 3DX5A 3KDNA 1V3LA 2PPGA 4IGNA 1I4NA 1SZFA 4XAGA 4IF2A 4MM1A 4JIIX 3WLRA 4D6GA 4L6HA 3OB8A 2J7CA 1Y65A 5SWUA 1JZ6A 2J79A 3AMGA 3HBLA 3AZRA 4H6KA 1SJDA 3TROA 2O0TA 4H9VA 3MI6A 2FTWA 1JCJA 1HW6A 2NX1A 2ZX5A 3S9ZA 1R85A 3B06A 4AIUA 3ECQA 5LHEA 2H8XA 2DT0A 3WD1A 1OZQA 1ME8A 2RDXA 2WJEA 2WK2A 2QHAA 3QQ1A 3KRZA 4F2UA 3WUFA 4A3UA 2I14A 1TVLA 3WQDA 4TX8A 1WKYA 4L4MA 2YA1A 2PDUA 5D37A 1BPLB 1YX1A 2E68A 3LM7A 4RDYA 4KH2A 4PL2A 4MHBA 3WBXA 1E9YB 2J6VA 1ZSXA 3DFHA 3ITVA 1E4NA 4LGXA 4DUVA 1K1DA 3E0IA 3TKFA 3BAIA 2BXVA 1ZY9A 4HA1A 2QQ6A 1RVKA 4FHAA 3TUUA 1BF6A 3HOJA 2V63A 4HHLA 2EKGA 3W4RA 1OYBA 2Z2AA 5J04A 4H7ZA 3PZNA 1H0GA 3MI2A 2QDHA 4FLOA 3NAVA 2BOGX 2VELA 4HT3A 6REQB 3VA8A 4IFKA 5HXMA 3EB3A 3M7SA 1KQZA 2G37A 1E4IA 3OG2A 5FSEC 1QPRA 4F0LA 2QCLA 1W31A 4L9XA 3BSHA 3PBGA 4UNIA 2BVYA 2GGEA 3ABZA 4US5A 2Y6ZA 4GIRA 4GY7A 3HFTA 3PZVA 2X1RA 6ALDA 1U5HA 3AZTA 3KZSA 3TIMA 2I1OA 1OB0A 3B0XA 3TONA 1FUYA 2GUUA 3V75A 5EFDA 3W82A 3EX2A 1SZGA 3QV8A 1QW7A 4CNNA 3UPMA 1KTBA 3CIXA 1GKPA 3S6DA 1RD5A 3T4CA 3M1ZA 1XKJA 5D32A 3FAXA 4CD6A 3LLFA 4LW7A 4KKXA 3WBYA 3D0CA 4QSFA 3VOHA 4S2BA 2OSWA 1KW1A 3W6LA 4GCAA 3PBYA 3LHTA 3ES8A 4NF7A 4RE3A 2J77A 1OCQA 3QHNA 1ZZMA 3CMJA 3HPSA 2EPLX 4DWDA 3OHMB 3BICA 4R88A 1JD9A 4J27A 4Z2HA 2VZVA 1NM9A 3QPZA 4IXXA 4XAPA 1J0IA 1AZ2A 2J74A 4MWAC 1RPKA 2VGGA 3OA5A 5C9UA 3M0YA 9CGTA 4H8VA 1YNYA 2QUVA 1WAUA 4ZB0A 4D1JA 5C5YA 2YR1A 1LF1A 2P5NA 1KM5A 2P76A 2Y8VA 1XGZA 3KEHA 1W3IA 4Q22A 2D69A 2QUMA 4PA8A 5JBEA 1HKIA 1UZDA 4OU1A 3FXYA 2PMQA 4O52A 1H1YA 3LI1A 5U7SA 3UJEA 4Z2IA 4OOZA 3EXTA 1NY1A 1CT5A 1MEHA 2CYGA 3W85A 4LQ1A 1DHKA 1VJZA 1WXYA 1QOPA 2VP8A 1Z42A 4LC6A 4DEFA 3DI0A 2WVUA 2QCCA 3NQGA 4W85A 1QNVA 3UY7A 3SCOA 3G6MA 1NSJA 4U4MA 2VDHA 3SCQA 2GQAA 2DSKA 4Q6JA 3PZUA 3LRKA 2A6LA 1HIZA 1EP3A 2EPMX 3M0KA 1DWFM 4QP0A 2OO6A 3HGRA 1QOXA 4JHZA 3EBVA 3QMRA 4C6MA 1GOWA 3HG4A 2LLEA 1NELA 4UB9A 4HCDA 3W2MA 1ITCA 2J7BA 2WANA 3LXAA 3MSGA 2Y1HA 1XLKA 1WDPA 1R86A 2CW6A 4RV8A 1ONWA 3BSGA 2B4GA 3NGJA 2W62A 5ABEA 1FHUA 4OGZA 1M65A 2J7GA 4A2SA 3U0HA 5HULA 3IV3A 4YMZA 2F2KA 2XISA 1GCYA 1QW9A 3BJTA 2X8RA 3WLMA 2FIQA 4YTUA 1EL3A 3G0UA 2GPTA 4W86A 4KEVA 4O17A 2FYMA 1A53A 4MOZA 1UOZA 1X96A 1X6LA 3ZQ9A 1I1XA 4ZE4A 1E1EA 4J5NA 1RSCA 1KA9F 3MVIA 2JIWA 4B5NA 2W6RA 2RDUA 4KCVA 3P8JA 3TYBA 4LAKA 3KX6A 3EOLA 3BMXA 4W84A 1KR1A 4DO4A 4BWLA 5F2IA 2XFWA 5FL1A 2R91A 3MU7A 5HQMA 1XG4A 3EA3A 4IT1A 2FFIA 2NLIA 1NOWA 3A22A 3LG3A 4AY8A 2JALA 3R2GA 1WXJA 2V2CA 2O9TA 3EX4A 2DGAA 1EF2A 5BRQA 2HRWA 4UUIA 9RUBA 3E0FA 4TOQA 3UETA 3T7VA 1QK2A 1BHGA 2QCNA 3NQMA 3ITTA 2VTFA 2FHCA 3T2OA 3EEGA 2V30A 1H62A 4S3GA 5TAOA 3S9YA 1VFOA 1WDQA 4C60A 5FJTA 4DX3A 2QDDA 2AOSA 5HA7A 3M44A 3PNZA 3GB6A 3EWWA 4GJ1A 5EU9A 3G3MA 4XBJA 3LZ3A 4FOKA 3VIGA 1SFLA 4I5XA 2JFEX 3W1UA 3BURA 1W5OA 1WQ5A 1HKMA 2Y24A 2OT0A 1RZMA 1Q3NA 3WK1A 3BLEA 4JN7A 4U5KA 1A3WA 1N8WA 5DEZA 1DWJM 3S5SA 1EX5A 3T6CA 4AXNA 4FMVA 4XZ9A 4A3RA 2VX5A 1V3JA 4I7WA 1G6CA 1XDJA 3H2EA 5IDZA 3IUHA 4HU3A 2HMCA 1ZAHA 4DZAA 4DZHA 1XG3A 1UKQA 5LNSA 2J6XA 1WKEA 1GQJA 2E28A 4W89A 3QYQA 2NWSA 3LZ5A 4O8RA 1NQ6A 3GDRA 5G5IA 3VGEA 4YXGA 2ZC8A 4Y90A 1UPPA 2WLZA 3ZWSA 3MPGA 3BQ5A 1CGTA 2XVLA 1JXKA 2OO0A 5AHFA 1NFGA 1HJQA 2QPSA 3ELFA 2R1KA 1OC5A 1WKFA 4TR9A 2ABAA 2HBVA 3RK8A 2V38A 1Q2SA 3GAYA 3QQWA 3C2RA 2OJPA 2YW4A 3BG3A 1R2SA 2IXUA 3O6AA 3VKBA 1ZALA 1XYBA 3GK0A 3OQEA 2ONEA 1TX2A 3STEA 3E12A 3MW7A 4HJFA 1ZJHA 2ZRXA 4UQDA 2VZSA 4AD4A 3GG0A 2H8ZA 5RUBA 2P0OA 1GONA 4GGHA 4H41A 5HANA 3WCZA 3ITLA 4BQ3A 3CV7A 3TCSA 4XTDA 4NL1A 1OGGA 4PTVA 4A8NA 3N4EA 3AIBA 5H1WA 1JD7A 2HVMA 3LTPA 2PD9A 2HE5A 3CL6A 4RDVA 4NASA 4D6JA 1ME7A 5I5RA 5BYWA 3URAA 1FQ0A 2FZDA 1KFLA 4IMEA 5CC6A 1EFZA 5C6MA 5BXRA 2AAAA 4U5IA 1B54A 2P0IA 3O63A 7TAAA 5A6BD 3W75A 3VCNA 4I9MA 5EB8A 3ZWTA 3F4DA 4F66A 1FWIC 4UTKA 3HTWA 2ZRVA 1IT0A 4IL2A 3V5CA 1R2TA 4WSJA 3W7JA 1ZU8A 1PZ0A 3PZMA 2DT1A 4PMZA 1A47A 1WE5A 1OBAA 4PMVA 5D33A 1TZ9A 1UYQA 4JR5A 3UP8A 4EAMA 2GDVA 3MI3A 4S3EA 1AD4A 1SSDA 1VB9A 2O56A 3IIPA 5A6LA 1OVDA 1AJZA 1W91A 2ZRWA 5FJRA 1KFBA 3ZO9A 5C2GA 4Y9PA 4Z17A 5CPQA 5KEZA 4L56A 3DCPA 1HGYA 3WX7A 1SZEA 3WFZA 4M81A 4KCTA 3BWWA 3F2BA 4RW3A 4HD5A 3MUIA 3T44A 2VEFA 1BD0A 5FCZA 1OADA 2GK1B 2CCRA 4O28A 4BCEA 2I56A 1NH6A 3MP3A 3QHOA 2R24A 1X7FA 3ARYA 3ZR4A 2ISVA 4NRRA 4XK2A 1JQVA 1BQGA 3QBUA 2PBGA 4I9TA 1GEQA 1MMFA 3M0HA 1QI5A 4O1FA 2BY0A 4FPSA 1TFVA 3W1PA 3QR0A 3BGJA 3LENA 3T2QA 3IRDA 3BSMA 4S3KA 4UTLA 2EJAA 1EKOA 1PV8A 1JIBA 2VO5A 1ADDA 2R6OA 1HL8A 4DAFA 3P61A 4GXMA 3U2OA 1A3XA 3DIPA 2DUXA 1PZ1A 4JTKA 3NDOA 4K7VA 2NVDA 1D8WA 3IRSA 1FCBA 1OYCA 2J88A 3NZRA 3CHEA 4O18A 1RA0A 3Q58A 2UY4A 5FF3A 3O7UA 3CAWA 3VI2A 2PLMA 3AHVA 3A13A 1G69A 1J0HA 3MO7A 3U7VA 3UF9A 1RD6A 4L6OA 4UC5A 1Q4NX 2PSNA 3PB2A 4AZCA 2V3FA 2BDQA 4V28A 1Q5MA 3AFBA 5G1TA 1VF8A 2J8GA 5FAJA 3S1VA 3AMDA 3L12A 1C8XA 4IGHA 3TSBA 1TPDA 3E3HA 2ZA2A 5C71A 3QLLA 3D6NA 1R3YA 2E3ZA 1YPIA 1UH3A 5D04C 4U2YA 4HA4A 1ZB5A 1V6UA 4C5YA 1CPUA 3OU8A 1SM9A 4XUGA 5PTDA 1J9YA 4G8TA 4S3DA 2DZWA 3FAWA 5JUVA 4AF0B 4KWSA 4GUJA 1E6QM 4UR9A 3SSZA 3F4NA 3IWPA 5HNRA 2E8YA 3V36A 3RX2A 3LCLA 4Q4QA 3A23A 3DYPA 4YU1A 2VCBA 2I7GA 3QEZA 4C1LA 5CGMA 3UEQA 4TVUA 5HQLA 3GH7A 3BLPX 1KXVA 3VKCA 5KINA 4GA8A 3IIVA 4O10A 1KBJA 2FJKA 3W7PA 2AQOA 1AD1A 3CUGA 4V2XA 1V02A 3CLMA 4O0KA 3B8IA 3V1HA 2YB1A 1K9EA 5FL0A 4A2RA 1XFCA 4EKJA 3KTCA 5AECA 3KVKA 2J7DA 1UKPA 4N9DA 4R33A 4UTWC 3NM3A 4GZEA 1IXQA 2WKJA 2QJJA 2NWRA 1GW9A 4HCHA 3PZGA 4Q3MA 2G0WA 1E6RA 4WZHA 1HJVA 2ZZ5A 4LUSB 1M1BA 3CWNA 2QV4A 3EDKA 2ZWZA 3Q4DA 4I6VA 3SRHA 1A5AA 3MV01 4L1WA 3W74A 3VD3A 4L4LA 1XM3A 4YJ5A 2VURA 3UT0A 1PE1A 2J7FA 2QAFA 1UKSA 5H8PA 3VD4A 4L5ZA 3EX1A 1AW2A 3VNMA 1W32A 3ABOA 3CL8A 2VEIA 4CD7A 1A4LA 3CUIA 4XX6A 1QHOA 3IK2A 5F2MA 3C0QA 3E49A 1VAHA 2QGYA 1XLMA 5HATA 3PFMA 4FX6M 3H2FA 4JYFA 4JYDA 1BLIA 2WBKA 4ML9A 1GVOA 3AXKA 2CXGA 3QLDA 3AC0A 4HK5A 5CPMA 4MPKA 4PRTA 3G77A 5K9XA 3WUGA 4KFOA 3BQ6A 3F7JA 1CB7B 3P5YA 5LA2A 3LCGA 4D2JA 1HG3A 2BSLA 4M5PA 5M03A 1B4EA 2C18A 4D71A 3G3DA 4B16A 2X1IA 4H9TA 4JTJA 3CV6A 1SSGA 4GLEA 1F3TA 3VCCA 2Z2BA 1S1RA 1PJ9A 3W01A 1XYFA 1VHNA 4LVFA 4PUUA 1DXIA 3TWAA 4LRSA 4Q6XA 1PKLA 4YHGA 2ZFAA 4FNRA 3WO8A 4GX8A 4HU4A 3W2NA 4K7YA 4KRTA 1A5LC 4H3DA 3MZNA 2G3MA 3NG3A 1XSKA 4GO9A 6REQA 2C3ZA 3O05A 4K3ZA 2FB3A 1DJXA 2VFIA 1ODZA 1B3WA 4GQ0A 2NX3A 4YVPA 5FA5A 4PBGA 2UY5A 4MG4A 4S3JA 4UQEA 5M2FX 1KCLA 3VE7A 2OCZA 4G5DA 1UWUA 4DXXA 3FA4A 1CGWA 5I2UA 2CZVA 3RM9A 1RR2A 3UU0A 3WD0A 4Z08A 1XIDA 2EPKX 4HSHA 4GIEA 3MA8A 1VC4A 2BY3A 4Z1DA 3H2CA 4JFSA 4R34A 1F4HA 4ACYA 4L9ZA 3AXXA 1JCYA 5ABGA 1VPYA 3M0IA 1G9HA 8XIAA 4HNLA 4LVBA 4EF9A 4AD1A 1GYNA 3TQKA 2V9DA 1L2QA 4GZ7A 1VRXA 1R3QA 2RKXA 4AZ6A 5K9DA 4GY0A 5C54A 4ZENA 4E8DA 2VD9A 3N29A 3SN1A 3KW3A 3W86A 3TAOA 1XKYA 1P6BA 4DJDC 1RXOB 3VKJA 4AWEA 2Z6IA 1CXKA 3XIMA 4ZOBA 2BGNE 2JBMA 3SW6A 3UJSA 2DZPA 4S2CA 4I5RA 4DF1A 1PVNA 1SO4A 3QFEA 3IARA 3LHWA 1HL9A 4JTQA 1H61A 2BS9A 1L2UA 2HEJA 4W5UA 3LD5A 4AHQA 2IPGA 4DJEA 2FVKA 1YIXA 4NJKA 3CQKA 4ZBCA 1V6XA 4N9CA 2XIMA 1KFKA 1X98A 1E0TA 4CCEA 1MEIA 3P6LA 2BHYA 2XHYA 1JNEA 4Z2KA 1IGWA 1R8LA 3MMWA 3S5NA 1M68A 3B8WA 1YPFA 2OEJA 3GUGA 3THQA 1XLIA 3AJ7A 4JIRA 1XLDA 1AA1B 1QCWA 4PTNA 5LA1A 3P2VA 2IQTA 2G3IA 4MLJA 3V0SA 4PCNA 3LBCA 4IQEA 2ATMA 1NDVA 3O07A 1YPXA 4IGSA 4HZ7A 2OZ8A 3M5YA 2QAPA 1UZ4A 1ODUA 5HBFA 1K4GA 4YWIA 1RY8A 3BE7A 5AYYA 3E0LA 3GBDA 1TMLA 4BR1A 2E9BA 2RGLA 5HDRA 3G1RA 3KL3A 3VGHA 1F6KA 4R85A 3W9ZA 3ZT5A 5AHMA 1EJRC 2WMIA 1OFRA 4S23A 3H2NA 1UMYA 4AX6A 1FFQA 3GHRA 2JGQA 4AWUA 5BNKA 1JYNA 2WHKA 1KRAC 3SCNA 3K46A 1I2RA 1VKFA 1XYLA 4LU0A 1VQTA 2AGTA 2WMKA 3S9IA 3OOQA 3VM5A 3W27A 4L4OA 3GTIA 1UH2A 4BEUA 1K9FA 3BCJA 2X1TA 4IMAA 4EWND 4A22A 3A6OA 3WLSA 1WDRA 3KHJA 3OQ8A 5JIPA 1H7RA 3W84A 2YIHA 3GXNA 3JVAA 4PMJA 3UBPC 3DBPA 2V82A 1RQEA 4WGXA 1Q65A 2PLCA 1NWRA 1QMLA 2A7NA 1DOSA 5FJIA 4IXHA 3WDPP 1TELA 2CETA 4LB4A 3HV8A 2ZCGA 4Q32A 1DJNA 3UD6A 5EYWA 3TH6A 1DJQA 4UOJA 2IS7A 4TX6A 4F2BA 3P0WA 3FKKA 4FIRA 4KIEA 2DZTA 1OQFA 3MCNA 3FGCA 3BGGA 1XINA 2W9MA 1H7WA 1F74A 5FEZA 1J8VA 1K77A 3TV8A 2V5DA 3KFTA 4MSSA 3BJSA 5XIMA 4CNPA 3L7RA 4DF2A 2Y7GA 2YL9A 3GNNA 4LSBA 5EY5A 4W7VA 3R6IA 4M6PA 1LLOA 3NQ7A 4RE0A 4FLQA 4H6RA 2VI0A 1LL6A 1VFMA 3SCTA 1E72M 1WUFA 2V5KA 3W24A 2OQHA 1A5MC 1GQKA 1OD8A 2PTZA 2PURA 1JJKA 3RPDA 1W9XA 4JX4A 4GK8A 2GGHA 2BLEA 1JGIA 4AYSA 3TSDA 3TA9A 4QS6A 3TLQA 2WBGA 2WMJA 2FQIA 4MPQA 4AFYA 3DN5A 3W00A 3I68A 3WK3A 2DZVA 5FOOA 4XIAA 3EPNA 3LSCA 1W1B1 4LUTA 4D6HA 3RU6A 3CO4A 2GWNA 4L7ZA 4U33A 4NP7A 3C2OA 1WX0A 3E1F1 4JHMA 4LWWA 4NI3A 3PTDA 2WZHA 4NVTA 3WQWA 3NCOA 1JGMA 1Q8JA 3F1QA 4MWAD 1N2VA 2CLMA 3L4WA 3NVTA 4TMBA 4LS1A 1KXTA 4G1KA 1A50A 4JTFA 2W3ZA 3SURA 1OF6A 4H04A 1TA3A 3LCFA 4YVXA 1WUEA 3WLTA 3GKAA 4B5SA 4GFIA 3TQ0A 2KX9A 3TLLA 4UCFA 5G1YA 3H7RA 4JTTA 4E2VA 5AZ1A 4MYAA 3VZXA 3MMDA 2VWTA 3UPWA 1ADSA 1IEQA 4POCA 2ZXAA 3TU9A 4O0ZA 4JEJA 5K7JA 2E6YA 3HG3A 4FNSA 4FNUA 4AC7C 1PX3A 3AISA 1ZS2A 4H9UA 3SN4A 1DWGM 3VKKA 4FAMA 4IP5A 3RPMA 3TMLA 4P7RA 1B3VA 1EXPA 3T1GA 1R3SA 2Y85A 1SR9A 2D2GA 5M1TA 4UMCA 2X7WA 1W8GA 1O1HA 2CIPA 3S2LA 1YNQA 4JNZA 2WKGA 3I3DA 4Y9OA 2BOEX 3GDMA 3F5JA 2VEGA 4RV3A 3UXLA 2CHRA 3JR2A 4AEOA 3AROA 1VBRA 4UR8A 2HK1A 1DXEA 1E40A 1GZGA 1JZ2A 1P0BA 5TNVA 1WP6A 4HHHA 4GIYA 2CXEA 3R5EA 2R14A 2YCEA 4KEUA 4QRNA 2UY2A 2VM8A 1JDDA 2VD8A 1GOOA 2ZC1A 1GZ1A 2OZ3A 2JIEA 4GNVA 1IXPA 1OZMA 1PCKA 1FWDC 3PJWA 4NXKA 3FW6A 1D3HA 3TW7A 3DUGA 3PBWA 2UWFA 1S2CA 1RBOB 3N3MA 4YCOA 1WO2A 3GXIA 4N9BA 3JS3A 4L6DA 2W66A 4DBDA 1F5ZA 2VUNA 1W37A 3WD3A 1D3GA 4KPLA 2NQ9A 3M0MA 1FWWA 1V3IA 2XM2A 4NI8A 1ENUA 3KHDA 2EXOA 3BK0A 5CPTA 3IJ7A 4PCTA 2WCAA 3UCQA 4C7DA 2QEZA 3CV1A 5D9NA 4ERAA 1L8NA 1JCMP 3U2CA 1G4PA 3E2RA 3PTMA 1P6CA 4DWSA 1LM1A 4JN8A 5GJNA 4EAYA 2PGRA 2HBXA 1DORA 3JZEA 3DFTA 4P61A 1GVRA 3NSNA 4F48A 2GGIA 3W53A 1FWAC 5DRCA 4LFYA 4MAZA 3TOYA 1PKMA 1XI3A 2VZTA 1JUKA 1LCOA 1XGDA 1RA5A 4D6EA 4US5D 3UR7A 1S5NA 2Z2UA 1LOLA 1TPVA 2J62A 1Q85A 1FTXA 4I7VA 4HPGA 4GZIA 4JICA 1UB3A 4WIWA 1J79A 2RFGA 2FMOA 1UD6A 3KBVA 4Q7IA 4DWSC 4GVFA 1P6WA 1GPWA 2H6RA 4DPQA 4C6QA 5H8MA 1AQ0A 3DHUA 5F1UA 7TIMA 3STPA 4TU1A 4XB3A 1QHZA 1FH7A 3NQCA 4KWWA 4JKKA 4NZ5A 1YDYA 3PB0A 5BMWA 2JGYA 4I5UA 3C5QA 3J7HA 1XIFA 3WH7A 4FS9A 1OX4B 4LBUA 4NJJA 1QI2A 4LCRA 1NEYA 3QJAA 1SO3A 2F84A 4NYUA 1EDGA 3SGGA 3HG5A 4JD4A 1I6NA 4HOWA 2DDXA 1S5VA 2VENA 3ZJ6A 3QY7A 4ZQOA 3W81A 1B90A 2BBFA 2I16A 3PUOA 1HKJA 4LF1A 5EA9A 3K5XA 5A8NA 1UWAA 2I9EA 2QF7A 1AJ2A 3WLPA 3SFKA 4GCXA 4YYFA 4P7QA 4DXKA 3R8RA 2A3CA 1IZJA 1EO5A 3H4WA 1OT2A 1GOKA 2PUZA 4DVOA 3KOWA 4GH3A 2DZAA 3CPGA 1N55A 3WQ8A 1TO3A 3I3EA 3EGJA 4H00A 5HQEA 1JZ4A 1JZ7A 2PTXA 2PODA 3EB2A 2YZRA 2F6KA 2PGFA 1PTDA 1EBGA 1IV8A 2R9RA 4FNTA 1YNPA 1J10A 2WCGA 4XKYA 1CYGA 1K9TA 4MB5A 5M5DA 2TMDA 4MTVA 3KBJA 3U6WA 2F9RA 4DBWA 1VD6A 4O0QA 4EVZA 1M7PA 4X2RA 3A3HA 5A2BA 3WZ0E 1H11A 4S3BA