2Q02A

Crystal structure of a xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 at 2.40 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
GMNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQLASWSEAEIEEQINRSVSLLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Crystal structure of putative cytoplasmic protein (NP_463296.1) from Salmonella typhimurium LT2 at 2.40 A resolution
rcsb
source organism Salmonella typhimurium lt2
molecule tags Unknown function
total genus 97
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2q02A00
1K77A 3M0HA 4K1GA 2ZVRA 1A0CA 1MUWA 2GVEA 5XINA 1GW9A 4X61A 3WQOA 3TVAA 3IUHA 4HNOA 4J4KA 3FVMA 1DIEA 2GLKA 3DBNA 4GJIA 4HGXA 4EAYA 3BWWA 3IUIA 4XIAA 1XYMA 3M0MA 4KW2A 3N4AA 3VNJA 1XIBA 4YTQA 1XIFA 3KTCA 2G0WA 3CQHA 4QEEA 4ZBCA 3UA3A 2QULA 2NQJA 3CQKA 3UXIA 2Q02A 1OADA 4Q7IA 8XIAA 7XIMA 3CQJA 1XLEA 4YTRA 1I60A 2HK1A 3BZJA 4YTUA 3AYTA 3XIMA 2HCVA 1MNZA 4W4QA 1BXCA 1TZ9A 4ZB2A 1QUMA 3U3HA 5TNVA 3KBNA 4G56A 1A0EA 2XISA 1XYCA 4XISA 4GLEA 1XIGA 3P6LA 4QE4A 2ZDSA 1I6NA 3AALA 1XIMA 1XLKA 1QTWA 3KWSA 3VYLA 3QC0A 4E3VA 4QE5A 3ITVA 5EMJA 4QEHA 5J8LA 3ITYA 1DIDA 3IUDA 5H6HA 4A8RA 1DXIA 4EACA 4A8IA 2OU4A 4XSLA 9XIMA 2NQ9A 3KCOA 3M0VA 4ZB0A 4GJJA 3QZAA 4QE1A 5XIAA 2GUBA 2HK0A 4X63A 1XICA 5EMMA 3QXBA 1CLKA 1XYLA 3L23A 2XINA 4LNCA 1A0DA 3BZGA 3CQIA 2GYIA 1DE6A 3KCLA 1XLGA 4PGLA 4A8NA 3U0HA 3M0XA 9XIAA 5FA5A 5EMKA 1XLDA 2X7VA 1S5NA 2QW5A 3VNKA 5I7GA 4YTSA 2G4JA 3ITTA 3M0LA 1D8WA 2X7WA 3AAMA 4QDPA 3VNMA 2J6VA 8XIMA 3KBMA 3UVAA 1S5MA 3UA4A 3VNLA 3M0YA 1XLBA 3GNXA 1XISA 4OVXA 5AVHA 3C0LA 4PFHA 4DUOA 1XLIA 3KBWA 4K3ZA 4XIMA 3TC3A 3DX5A 3VNIA 3KCJA 5B80A 4GQBA 3CWHA 4HHLA 4XSMA 5B7YA 4ZB5A 1XLAA 3NGFA 1XLCA 5C9ZA 1DE5A 1XLMA 2QUNA 3JU2A 1XIJA 3QYSA 1XP3A 4QDWA 3C0QA 1XLJA 1XYAA 3ITOA 5EMLA 3BANA 4A8LA 5H1WA 4XKMA 3ITXA 2NQHA 5AVNA 1O1HA 1QT1A 1XIEA 4YTTA 3UU0A 3P14A 1XIDA 3C0SA 1YX1A 2XIMA 2QUMA 3AYVA 3KBJA 1XLFA 6XIMA 3XISA 3LMZA 3CNYA 1XLHA 3OBEA 4HHMA 4X60A 3XINA 1XIHA 3KBSA 3KBVA 6XIAA 1XIIA 1XINA 4DVOA 3ITLA 4US6A 5B7ZA 1BXBA 2I57A 1XLLA 2I56A 3BDKA 5XIMA 1XYBA
chains in the Genus database with same CATH superfamily
5FD0A 4PTVA 3OBAA 3VILA 1QNRA 3KDOA 1C29A 3UZZA 4DPQA 1NQKA 1PIGA 3ZJKA 2XZ7A 1XYMA 1DWAM 4R3UA 3P67A 4LV9A 1O66A 4GWEA 4W85A 2VOTA 3DI1A 1FBAA 3ITCA 2P8BA 2F8QA 2GJXA 3SDOA 1MI3A 1NH6A 4IX0A 5H8PA 5E9AA 3WJZA 4B3KA 3AXHA 4IUGA 4NNAA 4YVVA 4GQ0A 3G8RA 3GW0A 1XIGA 2XGBA 2JEQA 1YQ2A 5AHIA 1OCQA 2BASA 4L9YA 4JHZA 1Q6RA 1FWEC 4E8GA 1UYQA 3B0UX 5FJIA 1ICQA 3KCLA 1NSJA 4CCEA 1SZFA 3TYZA 4HKPA 4N4PA 1UZHA 3KLLA 5FSEC 4JYDA 1A5BA 2B4GA 4Y8FA 4PL1A 3W1PA 4XZLX 3M41A 3QSRA 3WEZA 1JCJA 1OT1A 5B7YA 2CZVA 1OCJA 1UD6A 4QQUA 8TIMA 1EJVC 3R8RA 1LORA 3S4TA 3PTDA 1HL8A 3NYZA 4LH8A 1VZWA 3PUEA 4K39A 3OU8A 2B7OA 4D8AA 3PBGA 1EB3A 1QAPA 4AZCB 1HO1A 1KXQA 1OCBA 1NP0A 3EX6A 4EPBC 5KITA 1XIHA 5B7ZA 1RR2A 2YDAA 1K03A 4L80A 4PRWA 2VFHA 2PGWA 2F2KA 5FF7A 3B8VA 1L6FA 1BYDA 1OIFA 3ARSA 1ZU8A 3GIYA 3PB2A 2C16A 5DEZA 3RILA 4PB5A 1F3WA 2QQ6A 2YA0A 5TF0A 3GC5A 4WVXA 3ATYA 4DYKA 1IIGA 4DX3A 4Z1YA 2XISA 2PB1A 1AG1O 4DNHA 2OGYA 5EMJA 1EKOA 1XKYA 1DVJA 2OR2A 5EMYA 1Q63A 1NDYA 2BV9A 3VPLA 4ZB0A 3W2MA 2FPYA 2PRMA 2VZVA 2CHOA 3LTSA 4IMAA 3GAYA 1T0OA 5A6AA 3TN5A 5DMNA 3ZVHB 3FHAA 1O5KA 1QPQA 4YYFA 1AH3A 4UTIA 3VM5A 2E40A 3VNIA 3W53A 3JU2A 1UUQA 3R8GA 1BFNA 2BVDA 4XAYA 4RXFA 3RCYA 5DMYA 1UWQA 1AVAA 3MO7A 1YNYA 2VD9A 3IAPA 4KQNA 4KEZA 4PN2A 3KBSA 2XG9A 2ASHA 3E3HA 2P76A 2J7GA 4CVUA 3WD1A 2YDQA 2RJGA 3GD6A 3VIKA 3GHTA 2A1YA 1XH1A 5LNVA 1ZCOA 2VURA 1UR4A 4CQDA 3ID7A 3M0JA 1V6YA 4PUKA 4PFMA 2QYGA 3W6YA 2X1SA 2GDUA 2YSWA 4NUWA 5JIPA 4CUCA 3WLKX 1BHGA 5KINA 3H8AA 2OEJA 2DSUA 4MWAD 2VC7A 5FF3A 1NELA 3U8GA 4MZ8A 4G2DA 3PPGA 3FYOA 1P48A 2XH7A 5T91A 4P8VA 3DENA 3WNPA 1G4EA 3OW1A 3RLUA 2C19A 3UPWA 1DV7A 1RK5A 3SCRA 2ODOA 2VEFA 3MZ2A 7CGTA 2XPKA 3AUJA 7REQB 3W74A 2XIJA 2XVGA 2WLYA 1KR1A 4PB3A 1TZZA 3UCQA 3V75A 1QBAA 3EMQA 5LGZA 3CT7A 3A4XA 3RR4A 4AHOA 4HSNA 3T0CA 2QVHA 4AZIA 4UFIA 4DLFA 5GVJA 3GNDA 3IS4A 3RM9A 2XM2A 1V08A 4GY7A 1TPUA 3IJIA 1LWHA 1LUCA 1F4AA 3CEUA 1EJRC 3NXLA 2Q8LA 3K4WA 1R3VA 1BWVA 3BJTA 3WLPA 4MAVA 2HTMA 1J2BA 5DXYA 1XV8A 1M68A 1PCKA 4LXFA 2PDLA 1Y7VA 5HNRA 3ZS4A 4JQ2A 3LLFA 3NQFA 1OBAA 3VGGA 4HK5A 2ZKMX 4PULA 4QSFA 4IGSA 3ITGA 4ATDA 3FY1A 1UOKA 3W29A 3VNYA 2C14A 2OB3A 2NQJA 2Q02A 3BW2A 4C6QA 1ICSA 1K4HA 3LRKA 4JD4A 3U5UA 4MKVA 1R0MA 2VDIA 4A6GA 1ADSA 4PTXA 5GNXA 1F73A 2DSKA 1X98A 1SO5A 2H90A 2HS6A 3RPTA 3VYLA 4JICA 2WVVA 2QCEA 4W7UA 2JFEX 4A8IA 1XRVA 2ZICA 3JR2A 3H21A 3H7VA 4HNLA 3IJ8A 2W9MA 1ZZMA 4DYJA 2ZE0A 1ZUAX 4MTVA 3MDUA 1BLIA 2PE4A 3K1GA 4IGMA 2VGGA 1XX1A 2X0YA 4XAZA 3ZSTA 3M0YA 1EF2A 4XIMA 1Q8AA 2Z7KA 2HV5A 1UHVA 4LALA 2QCNA 4M1BA 4FXJA 1MDLA 2BLEA 2J66A 3C0QA 3FN9A 1LL4A 3KVJA 3WK0A 2P53A 2W3ZA 4MY1A 4K8HA 1XBXA 3B8UA 4J3VA 4I90A 4AU0A 4UQDA 1S1PA 2FGZA 2EKCA 2WVSA 3WQFA 1EJWC 3IVTA 2E77A 3DN5A 1UIOA 2PC8A 2D3NA 1E1EA 1MYRA 3QRHA 4REQA 2DJXA 4JTRA 4LRSA 4NU7A 2BVWA 4E4FA 5D2VA 4AZ7A 3B04A 1FWCC 2ACQA 4PH6A 1MQQA 3RYSA 4WGHA 3LGDA 3A13A 1B0IA 5IDIA 4RL3A 2QJNA 4KRZA 4P7RA 3PJWA 4DF1A 2E6AA 2V2HA 2QGHA 3E0WA 1PZ1A 5I3IA 3C61A 3CHCA 1LTDA 2GUUA 3CMJA 3G77A 3QY7A 4HYRA 1PCWA 4FLOA 2BGSA 3M0KA 4WDXA 2VUNA 1T99A 1V7YA 4QS6A 1XLKA 1ZQ5A 2TSYA 1DJIA 3O6CA 3RCNA 1P0DA 3QQWA 4AUBA 4NKCA 4MJ2A 4BHYA 2BGQA 5HBFA 1JRBA 1T40A 1C9WA 2VNCA 2OXNA 3DDMA 5LNSA 2REQB 1VKFA 2O0TA 3R25A 2YL6A 3PZTA 4JDYA 4R5EA 3KBWA 5HPOA 3V3WA 4S3JA 3W1AA 2PRLA 1U33A 1S38A 5DT5A 3CMFA 5CZJA 4ZCWA 2VX7A 3OA5A 4F0MA 1TX2A 2VEGA 3TR2A 1YTKA 2O7QA 4U2ZA 4GO9A 5HUPA 2PMQA 3ZR4A 5E6YA 3N19B 4GISA 4FF5A 4EOUA 3MP4A 4FOKA 2PDHA 1E0UA 3WDPP 5A2CA 3DHUA 3PAOA 4R88A 1HXJA 4HNOA 4CU6A 1J0ZA 4GCAA 2G4FA 3TZNA 2DEPA 2E9BA 5CJ5A 4M8UA 4J3SA 5J5RA 3S6TA 1M65A 1XS2A 3NQ7A 4H9ZA 3RUBL 1QATA 1IXPA 1JDDA 3VNDA 3O7UA 4GABA 3IJDA 1R87A 2DVTA 4YTUA 1ZRQA 3URQA 4EVZA 3SCPA 4D6EA 2JGQA 1LBMA 3BSGA 1KM5A 3GVGA 4IGHA 3SN1A 4JPGA 3GS6A 2EO7A 4LUSB 3M43A 1MUCA 4O57A 1WZKA 2VQTA 4GIEA 4FLSA 3CH9A 1KD0A 4P8XA 5AC8A 1T96A 4EPEC 4GXMA 2KZHA 5KETA 1XKJA 1GUVA 2C13A 2FZNA 3M0ZA 5CSYA 5ABFA 3AAMA 1EC9A 2DZXA 2EEXA 2YCLB 1VPQA 1DJZA 4J40A 2X2GA 4PODA 2YPIA 4GYFA 5I3KA 4UR7A 4MNMA 4NJHA 3TNBA 2XN2A 3IV3A 3W2LA 2ACRA 2EBNA 4FNPA 3AIQA 3NIYA 3PULA 1V3MA 1HZYA 2QDDA 3FDKA 1U5VA 3W38A 3HG2A 4ZMGA 1Q7MA 1TV7A 2YLLA 4AD2A 3PTQA 5C9UA 3GR4A 2CYGA 4X2PA 4BF5A 4X61A 4KF1A 2ZYFA 1OGSA 1GW1A 5C54A 1AQHA 3IVSA 2WV8A 1ZP4A 3BWWA 3LCGA 4CD4A 4KIEA 3PSVA 4HYVA 4JFVA 4CN1A 3U4FA 4JCMA 1CXHA 3WD2A 4CQ8A 4PMZA 4LB4A 3LTYA 1O1ZA 3QF0A 1R2RA 1TFVA 1HT6A 3W9ZA 3BJSA 3MKKA 1ONEA 3ZLGA 5D05A 2FIQA 2FTWA 3QR0A 3FAWA 3BCFA 4RK8A 5CLTA 2G8ZA 1KTBA 3QZAA 1DJGA 3HTWA 3T05A 4CQBA 1QW7A 1J2WA 3HGRA 7A3HA 3T6CA 2ZRVA 4EXQA 1EP2A 4WQ6A 1W1A1 1D8WA 2VCCA 1S5MA 4FXSA 3C0LA 2OYKA 1E6PA 1M6JA 3SFKA 4JNMA 4JX6A 3CWHA 2DSWA 1XLCA 3E0LA 5LIXX 1HNYA 4WLCA 4WK9A 2ZXDA 4J3ZA 1S5WA 3N34A 3UF9A 2WYSA 3MSYA 3EWDA 5LA2A 3N6JA 1VHCA 4HK7A 3G0SA 1LJYA 2XIMA 3KBJA 3QPZA 4S23A 5G4EA 4Z08A 1MO0A 3WJWA 1CGYA 4MFDA 1J5SA 5A8PA 3E0FA 2DVXA 5CZKA 4QROA 3LSBA 1XBYA 4KEMA 1UWRA 4EWJA 4IIEA 4GXPA 1GG0A 5A1AA 1J6OA 3TTEA 3VE7A 3KTCA 3MS8A 4PCTA 4ZBCA 3HOJA 4PEEA 3WH5A 4AXKA 3ZLFA 4UTTC 2PDFA 4NY2A 7XIMA 1VRDA 2ABBA 2J47A 1NEYA 1W5MA 4NNBA 4F0LA 3GM8A 5DY3A 3VINA 4DWDA 4F2TA 1V0MA 5CGMA 3W7GA 1ODZA 3AYRA 5JMUA 4FO4A 3A5FA 1RLCL 2RDWA 3LCIA 5J8LA 1TV3A 1L8PA 5C5YA 1UH4A 3B0VC 4IP5A 1DJYA 4PE8A 4GJJA 1VYPX 4X9YA 1E51A 5A5WA 3STEA 4LVFA 4M6VA 3SQLA 1PDZA 3TSMA 1KFJA 5HAOA 2YCEA 4KCTA 5HNTA 1ISVA 4WEVX 4RZBA 3GNXA 4AIUA 1VGAA 2PP3A 4D1IA 4FP1A 1J0HA 4QP0A 1PXGA 3QBUA 2Q8ZA 5BRPA 1R38A 3WL0A 2DZVA 1PO9A 4A2RA 1H7PA 1ZFJA 1VP5A 1KFKA 1NARA 2WC3A 3NGJA 3UU0A 4PMYA 3W37A 1KM3A 4H6EA 1MXSA 3NTYA 1D3CA 3DFQA 3QKZA 1E0WA 1A47A 1MZRA 5HNUA 4QQ3A 3T78A 4IIFA 2CLLA 2PA6A 1XF0A 4ICCX 2WHMA 3WNOA 1GJUA 1B4KA 2R1KA 5BCAA 2E9LA 3DBPA 4JTGA 4BZYA 3CQJA 4IG2A 3AYTA 3LHWA 3XIMA 2CIPA 3W84A 4RNIA 3VKBA 3GU9A 5IOBA 4UQBA 1E73M 2ZRWA 4TUFA 5FKYA 4O50A 4XD5A 4C1NA 2BHUA 3IUDA 3D6NA 5G5IA 5C2CA 3C2RA 4TX8A 2OCZA 1O12A 4GVGA 4JTUA 4L6HA 4QJ5B 3M07A 3UD6A 1OT2A 1S39A 2XH0A 3A3HA 3BG5A 3KVMA 4GYKA 4XO7A 4PUDA 4UFLA 5A8QA 4BJHA 1E43A 2ZC1A 4DJEA 2Y5JA 2Q09A 4A3QA 2ZZ3A 4UNLA 1XLIA 3AMKA 3N9RA 3LNPA 3P0XA 2ZRUA 3QYSA 2ZTJA 2AQVA 3FW6A 1JGMA 1JQXA 3UJSA 1E5JA 5AN7A 4Q8WA 3UP8A 4UTTA 2FVLA 1WP6A 4XBJA 1V3LA 3ITLA 1ENUA 2JGYA 4DF0A 4W89A 4QM1A 1I1WA 1QDSA 3CXOA 3FXGA 3M5YA 1EFZA 3C2OA 3N9SA 2EG8A 1EWDA 2PSNA 3LRMA 2HJPA 5I5RA 3AS3A 1OFQA 3VNJA 4QEEA 2R1NA 2VCAA 1XI3A 2DIJA 5KMYA 3MV11 2QPUA 1O60A 3ZM8A 3GHSA 5BZAA 3MSRA 3W6MA 3P6LA 1KM2A 2POZA 4H9XA 1F8IA 2VFGA 1AZ1A 5D2WA 3TW9A 1W1TA 1ADOA 1RXOB 3VAVA 2XIIA 2PCEA 6ALDA 2VWSA 4ML9A 3CHDA 1J8VA 4TO8A 3R1ZA 3AIUA 1FUYA 2A3BA 1XGDA 1V6VA 2FYMA 5F4SA 2C1GA 4PUUA 4DB7A 2R1MA 3GTIA 1PKLA 4JQ1A 1XP3A 2V3FA 4DLMA 1XYAA 1K3UA 5MHBA 4L56A 4LYPA 4ICNA 3SN0A 4XV0A 3P14A 1EGMA 3QHNA 2G3NA 1SZEA 5U7SA 3BJFA 4I9JA 2GL5A 2ACUA 1TE6A 1PZ2A 4Q7BA 4W5UA 1D9EA 4N9DA 3OTRA 3A9BA 4GVHA 4NZFA 2E25A 3CYJA 4GUIA 1H63A 2QDGA 2YZ5A 4WDUA 1OYBA 4LEQA 1GVFA 4QDMA 5K2ZA 3ME3A 1EZWA 4RPQA 3C0JA 2QMJA 2RUSA 4P2VA 3BARA 4EPDC 3HV8A 1MNZA 4W4QA 1TZ9A 3W73A 2D0FA 4O10A 1CNVA 4JFTA 3N6QA 5I24A 4QEHA 4LRTA 1PPIA 3ARQA 1G94A 2D23A 4A21A 3OIXA 5D9MA 1B3OA 2WMIA 2GSJA 3GFXA 1WB0A 2GUYA 3NL3A 3QXBA 1V6WA 7TAAA 2PRHA 4PGLA 3QTGA 1SSGA 2QW5A 4S3GA 3ZT6A 3W7LA 1I0DA 3G24A 3J7HA 2PF0A 2V2CA 3I4EA 1E4IA 4P7LA 5T9CE 3THAA 3B9EA 3W1UA 1UD3A 3ES8A 2ZUUA 2Y4SA 3AWOA 3AICA 2J13A 1W32A 3TWAA 3BLLA 3UZYA 4ZQPA 2ISFA 3NA8A 5HXMA 1QI4A 1XIDA 4MM1A 4OGZA 4O16A 1GZGA 1PHWA 5CJMA 1R7AA 2HE5A 5GJPA 1L2UA 2CWXA 1JGIA 3T09A 3FSTA 4M51A 3H22A 3TJIA 2RH9A 1HJXA 3DFSA 1XUZA 2BVYA 2NV9A 1VPYA 3GKAA 2J25A 1YE6A 3N14A 1NQ6A 2WSKA 3WDQA 3F5JA 1SW3A 1HW6A 2QT3A 4IZGA 4BI6A 3MUAA 3TSBA 1MEHA 3LS9A 2XN1A 1OSEA 1E9IA 3VI2A 3GDBA 3FGCA 3EB3A 2ABAA 2A79A 1GYNA 3WLNA 3L0KA 3PBVA 7ODCA 1JZ3A 3VK5A 1ZGDA 3N6HA 4ZVJA 4JN7A 1G69A 2Y89A 1QWKA 4S1FA 3R79A 4FNTA 2HISA 5BXRA 4LCQA 3WBYA 3SM0A 4WKFA 4RE4A 3FJ4A 1ME7A 1VHNA 3M5VA 1DP0A 1UZDA 3O1NA 4XWUA 1JDCA 1CXEA 4ZENA 4ES4A 2GDVA 1I4NA 4LVBA 4XZHA 4KRTA 3LM3A 1O5XA 2OPJA 1XLBA 4ZL1A 3UETA 2E1WA 1LBLA 3FNDA 2CLPA 3WMBA 3ABZA 2CBUA 2FTPA 3EBVA 1OGBA 3SJNA 1XIEA 4H8HA 4QJ1A 2WM0A 3KVKA 3ABRA 1ISZA 1T7LA 2HROA 2ZRXA 3TTSA 1LG1A 5REQA 4ZXLA 3T7VA 5M1TA 1NFPA 3W1MA 4UNIA 2J9XA 4MDPA 1TPEA 3VMOA 2GDQA 5AB3A 3CLMA 4E8CA 3ARVA 4B5NA 1A49A 3KP0A 4GVFA 3S2CA 2CBJA 3KRBA 1DHPA 4I5RA 1H49A 2XU2A 5AHLA 5LKYA 5FAJA 4R7OA 2QF7A 3E12A 3VDBA 2NV1A 3MYPA 4H6QA 1ZPTA 4I9MA 1KC7A 3GXDA 2VO5A 2QCDA 2ZRZA 3E1F1 3A6OA 4EACA 3DGBA 3GXFA 3SUSA 2C8NA 2GVGA 3P81A 4TTGA 3R4IA 1JDFA 4W8BA 5CQ1A 1N8IA 1IF2A 3SUTA 3T44A 4J3UA 5A2AA 3WF4A 1XM3A 3PFRA 3F4VA 4KGJA 3TNOA 2BWGA 1YEYA 5LNUA 1IIHA 2JK2A 3P2VA 1GYMA 2WPBA 1ECEA 4RDWA 3QLDA 4JQ4A 3WQGA 3EA3A 5CPMA 2PDIA 1GWJA 2LLEA 1TPH1 1NWTA 1XDJA 1TELA 2WZMA 1L6SA 2BDQA 1LT8A 2Y2WA 3CL6A 1RP8A 2OKTA 4GQGA 1AD4A 1OX4B 4B2DA 4KWOA 1G5AA 1VCGA 4KFNA 5I06A 4IPJA 3BAYA 4N7QA 1BQCA 3L4ZA 1WAWA 1G01A 1JZ4A 1YE4A 3S9ZA 5CGTA 3UESA 2ESCA 4WKHA 2OZ0A 3UBPC 3UERA 1I2QA 1HJSA 3I10A 3GH7A 4H4IA 3H6OA 3WUBA 1UR9A 4G7EA 3DU0A 3NPVA 3STGA 4AZ6A 3C56A 3S2MA 1EZ2A 2EPKX 1JULA 2XFWA 4S3CA 4Q32A 3B8DA 1IGSA 3FA5A 1NF0A 3ZMRA 5BXSA 1HKWA 3H2EA 4O8RA 5C71A 1GVIA 3R0KA 1ALDA 5F2IA 5D9OA 2IQ0A 1A5UA 2VDGA 3BURA 1SO6A 4I9AA 3H7UA 1RUSA 4M81A 4AHQA 5EBUA 3TLLA 3PPCA 4XBKA 3BQ5A 4EX4A 3TFXA 3GNOA 2ALRA 3NZRA 1PUDA 5D9NA 4YXGA 4GX9A 2PZNA 3R2GA 3E0VA 1M1BA 3LHZA 5HA7A 3BXWA 4JDBA 5HWJA 2ZZ6A 3TV8A 4DBSA 1H5VA 1ONWA 4IGNA 5J04A 3LPOA 4IQLA 2FLIA 3T4WA 2PWHA 3ARTA 4NI8A 3KS5A 5CC6A 5XIMA 4XZMX 3EOSA 3GKFA 3R5EA 1ESWA 5EPDA 3TVAA 5M17A 1VJSA 3N15A 3VOCA 1MW3A 3KL3A 1XBZA 2J8TA 4M82A 4K2SA 4S2BA 1UBSA 4JHOA 4PCFA 3PUDA 2PDCA 2YZRA 2MUCA 3MUZ1 4RNFA 4YTRA 4L5ZA 1I60A 1V0NA 4B9ZA 4RZ4A 4P8UA 4LYRA 2H3DA 4UOQA 4Q3MA 3RPDA 4Q6XA 5CPOA 5DCBA 1ZAIA 2ZIDA 4LSBA 3UZXA 4TV6A 1RLDA 1FHUA 2V67A 1RQHA 3M47A 2FGBA 1IZKA 3TA9A 4HZMA 1OK6A 4LBSA 3QOKA 3A4WA 3CQIA 2QCHA 4Q4PA 1DWGM 1NOWA 2PDUA 5FA5A 3KAOA 3TIMA 1BQGA 2PDKA 2PLJA 1W9UA 2PTZA 4PUEA 4JTHA 5GJNA 2F6UA 3LLDA 1JPIA 1W1IE 1W5OA 2BXYA 1XSKA 2WVTA 4NI3A 4MYAA 4PSRA 3VIIA 4TVCA 3GDLA 4NASA 3I6EA 1GNXA 3BGAA 2WB5A 4DO4A 1VJZA 4UFJA 1V6UA 2NWSA 3W81A 4IIGA 4ZQRA 5E1QA 1XLFA 1EYEA 4MUPA 3W7JA 2WHKA 3CAKA 3L67A 4UTMA 1OFOA 2IQDA 3SUWA 5HWNA 3V16A 5A6BD 3QGKC 1JF5A 3PZOA 3I4KA 1BEUA 3EKLA 2YXXA 4UQCA 5JBDA 2GSEA 3RMJA 1M9HA 4LF2A 3VFCA 1OADA 2J9YA 4FOUA 1XLEA 2AAMA 3NJ3A 3W07A 3BH4A 4A29A 5CC5A 1LOQA 1WKDA 3WG6A 1SO4A 1YHTA 4MB4A 4DZIA 4GLEA 8A3HA 1K4GA 3A9IA 2I17A 3BOLA 5ECVA 4MPQA 4NHVA 4DZAA 1TRIA 4OBSA 3T8QA 4N4QA 3L66A 4F0KA 3LENA 3E2RA 4JNZA 1FCUA 4EANA 2VR5A 1DKWA 1A5CA 4CD7A 2ATSA 4E38A 2X16A 1TIWA 2TMDA 3UPBA 1JCLA 3ARYA 1CXLA 4Y9NA 2GVLA 1N82A 1DE5A 3HBLA 1J9YA 3WFAA 4LY4A 3LYEA 5TIMA 3E5BA 3L7RA 4YTTA 3CPRA 4GNVA 4EF9A 3HPSA 3V36A 3GU1A 4G1NA 3UY7A 3GYCA 1HIZA 4GH3A 1E1CB 3OBEA 1ODUA 5AHMA 1FDZA 1W3LA 4AZBA 1L0PA 1X96A 1S2UA 4UFKA 2GFTA 4H19A 2OGJA 4S3EA 1UA3A 2QCMA 2W6RA 4AD3A 2CZEA 2Y61A 4DHGA 1UCWA 2NQLA 1Z32X 1UWSA 1UKOA 4K38A 3V1HA 4UOJA 3UZJA 3FVMA 3PHAA 1PEZA 5FJRA 4BFAA 3DBNA 4NZ1A 2DZWA 3LPFA 1JZ6A 1BYAA 1K9DA 4HHPA 3GDRA 5DMLA 3WLLA 3C2YA 1FFQA 1CCWB 5FI8A 1V93A 4LBUA 4ZOAA 5I07A 5G2WA 5CPLA 3VIOA 3UCDA 3B05A 4KMQA 3MO4A 3NSNA 5XIAA 1O4UA 3WD3A 2RKXA 1HJWA 2R91A 3LK6A 5G1YA 2HVNA 2QDEA 3UW6A 2G41A 1WCGA 2XZ9A 4PFHA 4JY8A 2J27A 1V3JA 1X6LA 1AJ2A 3PNUA 2CERA 3LXBA 4CLMA 1P1MA 1BSLA 1T8XA 3LGEA 4D6HA 3ABQA 2WZIA 3WNMA 3NEHA 4FZIA 3WBWA 5EMLA 2DH3A 1PDYA 5T9BG 2R24A 3AO0A 4CN4A 2GGIA 2CLOA 2XYLA 3GXMA 1M01A 2B0MA 3VGBA 5AC7A 1OVDA 3SCWA 2RDXA 3DC0A 4IX2A 3VX1A 2KAUC 4AQLA 4JL1A 1ZNNA 4C1KA 1YPFA 4NSBA 2GVJA 2JF6A 2Z29A 3BAIA 4CCDA 3G1HA 5A6MA 3BVJA 1GVOA 1RP9A 2TYSA 1MRAA 4WR3A 3MHGA 4QITA 1GQNA 3DAQA 3W1QA 2IMRA 2HPIA 5E6ZA 1IE7C 5K7JA 1TA3B 1IZCA 3S8HA 3JVAA 4QXIA 4L65A 1WNOA 4AZGA 1BXCA 1V5XA 2A3CA 1TE1A 4OOZA 3KW3A 1DEDA 1MW2A 4JXCA 1LLOA 2CHRA 3CU2A 5D9PA 3EDKA 5DQPA 3RFAA 3GDKA 3TTQA 4JTCA 4B3LA 3CV7A 1OZMA 2E5DA 4YVXA 2J79A 3DFPA 4YHGA 2E09A 1DJQA 4ERGA 5DF0A 1Q6FA 3GNNA 1X39A 1VJIA 3CAVA 1DHKA 2ACSA 3NL2A 3VM7A 4PB4A 4LUYA 1VC4A 1JYWA 4ILSA 4X22A 1XLJA 2QKFA 4DAFA 3K8LA 3ATZA 1RY8A 4QIUA 1Q6EA 2J4GA 4X0VA 2FTYA 1AL8A 1O5RA 1EDQA 2HPMA 5HQEA 3M16A 1BG9A 5IHRA 2V5JA 3S1VA 4B5UA 4Z0SA 3EKGA 4DWSB 4C90A 4Q8VA 2P88A 2RGMA 4I7VA 2XJ7A 3WQOA 5C55A 1QCWA 2PDWA 1QU4A 3OOQA 3MP5A 2DSVA 4DBWA 1ITXA 1BKSA 3S6OA 2Z1WA 1Q4WA 3UA3A 1IXQA 4F2BA 3WX7A 2FFCA 1VFHA 3VDCA 2MANA 2V68A 1QUMA 2G3JA 3F2DA 3HPAA 1BXNA 4QGCA 2PTWA 1KWKA 2IKHA 1XJBA 3WLQA 4YJ5A 1FXPA 1WDWA 3M0IA 3R10A 1JD7A 5D8WA 4DRSA 4MPKA 3G6LA 4MLRA 3U0HA 2CBIA 3NVTA 1ZP3A 2NSXA 2OQHA 1JRCA 4I7WA 5BXPA 4I6KA 4CQCA 5C7VA 2IXVA 4LVDA 4PTDA 3TOYA 4CQ9A 3VD4A 2VC5A 2E4TA 2DIEA 2WKGA 1LM1A 2OKOA 1TUXA 2XFFA 3ITOA 1O1HA 3P7YA 2PBOA 4HOXA 2CESA 4IIHA 4JTQA 4DBEA 3DEQA 1KV8A 4G8TA 2FFIA 4U28A 4YYCA 2DW6A 4U10A 1A4LA 5DY2A 4AZCA 4PCSA 3RPMA 5EKYA 4BQ5A 1EA0A 3YPIA 3IK4A 4H9TA 4JTFA 4S38A 1TREA 4KEVA 1KFBA 1RY0A 2PZ0A 1J11A 3UXLA 3IEBA 4E4PA 4MB3A 4E2OA 1XIBA 4E0CA 2GQAA 1WDRA 4QAIA 2FH6A 3P5YA 3SQSA 4LCRA 1P5BA 4UCGA 1EQCA 5JU6A 3S2LA 1J0JA 3NM1A 3P93A 4C6CA 2WCAA 3NL6A 1A3XA 1M53A 3NZQA 5K9XA 3REQA 2ZDSA 4IP4A 2CC0A 2JEPA 2CKSA 5CC3A 1R85A 1ML1A 2Z24A 2X0SA 4TVDA 3L65A 1RA5A 2DT3A 3WUFA 3SCTA 1GJWA 3N17A 3HQOA 4IWWA 1GTEA 2YGYA 1CZ1A 3VX0A 6REQB 4TIMA 3DFHA 1B3YA 2JKPA 3AXMA 3VDGA 4ZB5A 3CB8A 1VB9A 1OC6A 3DUGA 5FIPA 4NT0A 3ZVHA 1PTDA 2NSOA 3SRFA 3ITXA 3L4YA 4ZEPA 5HMFA 2PODA 1DJHA 4E2BA 1OQFA 2D24A 1FWHC 1KRMA 4LAKA 2PGFA 2CEQA 2WWCA 1XINA 1JAKA 1P7TA 3NUKA 5JXQA 2GVEA 1W31A 2J88A 4S3KA 2PLCA 5I00A 2Z1BA 4JTTA 3IARA 5MKGB 1J96A 1XWYA 1Z48A 2OTDA 2NXIA 3GG0A 1YPIA 3THDA 2VC6A 4TOQA 3CQHA 4GC3A 2BY2A 4MY9A 4DNMA 3EOLA 2XTKA 2AL1A 1Q6QA 3KZPA 3VGEA 2GWGA 3W87A 1W1PA 3U3HA 1PIIA 2FB2A 4XD4A 3MVIA 1V3IA 1TMQA 4ERIA 1ZB5A 3BO9A 2PDPA 3NO5A 1H7RA 3MDWA 3VOFA 1WKEA 1MNSA 1ZHAA 3NO1A 3GG7A 2O9TA 3F4DA 4BK9A 2G3IA 4L1GA 5F1VA 1UUMA 1LROA 2Q71A 5BW6A 4AYGA 1KCXA 3LNMA 2C15A 4GE8A 1FWTA 5IBXC 1Z89A 3WEMA 1E5NA 2CKRA 4XB3A 4UBPC 1PHQA 1U30A 7REQA 1JZ8A 2NVAA 5EB8A 3KS6A 4XZWA 3D3FA 3C8FA 2FHBA 1UC4A 1JR1A 3W7IA 1IGWA 1PX3A 4NILA 1E9LA 2QIWA 1TTJA 3JUGA 1E3XA 1MQRA 3AI0A 1V6TA 1ZL1A 2WAGA 1GOIA 2QCLA 1F61A 1GZ1A 1EH9A 3MY9A 2DH2A 3G8EA 3QV6A 4PMQA 1VYRA 3LPPA 4FALA 4A3YA 4PTNA 2QJGA 3EB2A 2V5DA 3H54A 4XD6A 1AQFA 1DJXA 1DWJM 4DIAA 1TCDA 4IICA 3I3BA 3WYZA 2C91A 4OOUA 4JY9A 1EIBA 1Q65A 3NSMA 3W7HA 3INPA 3DG6A 4PBFA 4WCJA 2Q8XA 1V3KA 3LSCA 3AHVA 1CB7B 1OFEA 1FWSA 3TQVA 2VDHA 4AIBA 1C7SA 4GY1A 3P60A 4ZO6A 3B8SA 2X1IA 1TPB1 3DZ1A 3GHUA 4O0KA 3ZSSA 1PWMA 4JIHA 3W02A 2R14A 5G1TA 4GMEA 3KOWA 1R3WA 4K8GA 3A4AA 3G2GA 1FWWA 1LWIA 5AOUA 3STFA 3M44A 3MSDA 3WBAA 4J5NA 3QHOA 4LS0A 1FWFC 4K7VA 4AYSA 3W7RA 3FK4A 2W4XA 2DT0A 3N04A 1W3NA 2VZTA 3VZZA 1JUBA 2Z2BA 4O13A 4DUWA 3TYDA 4FEZA 1D7KA 4X0NA 3PZVA 1AW2A 1G67A 1TRDA 4L4LA 3II1A 6CGTA 4LAUA 4I8DA 3KEHA 3R43A 1DXFA 1XLHA 2QZRA 2RFGA 3UJFA 1Q2SA 3RAOA 3VKKA 2NT0A 3CYVA 4PUJA 2W92A 1LUCB 4GUHA 2PWUA 3HIJA 4WJ8A 3T8LA 2HMCA 4IPIA 1F05A 3CUHA 3OVGA 4TVUA 4DO7A 3TYEA 3U2OA 1PE1A 3UWQA 5C0QA 2O56A 4X2RA 2OX1A 3W0KA 4ZOEA 1U83A 1DQXA 1NWSA 2V82A 4MY8A 3UXDA 2IS7A 3PSWA 3DH7A 4BQ4A 2BY0A 3WNNA 5HQMA 1IEQA 3U9IA 2EG7A 2BOFX 3DFOA 5I3JA 3HFTA 3K30A 3BUVA 2QAFA 4KT2A 2P50A 3LCFA 3RNDA 3OODA 2HZGA 1BSIA 4L4OA 3EWWA 3HF3A 1US2A 3CTLA 2WVVB 3V7PA 2QUTA 4ZQCA 4NRSA 3QY8A 5A95A 4WGXA 4MYXA 4QG8A 2PDBA 5I7GA 4YTSA 1FP8A 1UH2A 4YLWA 3WMLA 3TOPA 1WE5A 3S5NA 4AY1A 3EAUA 2I14A 1AH0A 2Z28A 3QVQA 4ZQOA 3FIGA 2XWEA 2REQA 1LT7A 3VIGA 1VFFA 2QCGA 4LV4A 3B3DA 4GUJA 1E40A 3LMZA 3FYYA 1VD6A 2V3EA 4UOZA 4W8AA 3OLEA 4GFIA 3B9DA 3EPNA 1KBBA 1EPVA 3MUXA 3V0TA 1SFLA 2CLEA 1WQ5A 1ITCA 1CENA 1YBQB 2WM1A 2A3HA 1FKWA 2OWXA 1VEPA 3PJXA 1AW5A 4U4MA 4IIDA 4RXGA 4E3TA 1J01A 3N2OA 5I3HA 3HV9A 3IIVA 3QR1A 4TMCA 3UWYA 3UJ2A 4Q8PA 3G1FA 2BFGA 2VEIA 4A35A 3BW4A 4JTSA 1MEWA 1U5HA 4YL2A 2Y24A 3U7BA 4WUIA 4YWIA 3PPFA 5FCZA 1IV8A 1RQEA 2ZFAA 5F2LA 2C0HA 2HE8A 4ZGYA 2YDSA 1JCXA 8RUCA 1ZJHA 4A8NA 1AJZA 3V0UA 4LUSA 3DCPA 2BZNA 3LZ5A 4H9UA 2PDGA 1EJUC 3NQBA 3ITTA 4U31A 1JPHA 4LBRA 1H11A 1KKRA 1ONXA 2X41A 2QPSA 3NZPA 3CPUA 3B0PA 3SCNA 4C6KA 1P6WA 3IWPA 4KEUA 3VZYA 1A5NC 4FAMA 2DGAA 3TWBA 5AVNA 4EWND 3R11A 2O9PA 2ZA2A 3KDNA 3W22A 3VOJA 4KWSA 2B31A 3M0HA 2HRWA 4TR9A 4PRRA 1QJWA 2DZTA 2ZX8A 3LBOA 5F4WA 2VWTA 4RW3A 4N42A 1TWZA 3TROA 4EAYA 3CJPA 4FIQA 2HNEA 3BL3A 5EMUA 1NOUA 5CZSA 3OLIA 3NWRA 1PKMA 4RDVA 3LXAA 4LTSA 3SCSA 5HINA 5EGRA 1OABA 2PEVA 3BV4A 1ZALA 1XCFA 2WBGA 5D4YA 3ITVA 2W66A 2NLIA 1IWPA 4QSHA 3L68A 2FVMA 1PX8A 3VFLA 3UQNA 1X7IA 5E0FA 4JFSA 5I78A 4EP8C 1QHOA 3ICJA 3IAQA 3L23A 1JYVA 4PMUA 1ME9A 1TMLA 5CPTA 1W17A 3MMDA 1J10A 3MW7A 3PN8A 4LVAA 3KBMA 1RBLA 4TMBA 4MJ4A 3S46A 2UZ9A 4C65A 3KCJA 3TJXA 3ONBA 3QZ6A 4HA4A 3TQ0A 1NU5A 4M1RA 2VZSA 3QW4B 5DBUA 4F79A 5LA1A 5BWFA 3DHPA 5G4WA 1IT8A 4TTUA 2D20A 3CWOX 4KPLA 1P0NA 4JIQA 6XIMA 2VHLA 4M80A 3OVPA 4O53A 3RU6A 1AUSL 3R7MA 1EJ7L 1UP3A 1UJQA 3MHUA 4XKYA 3WK2A 3OZMA 3H12A 4IT1A 3MMTA 4XTIA 2RJHA 4RR4A 3M0MA 2F7FA 3N29A 3O0KA 1IEIA 4IMEA 5L6UA 2VC9A 1DOSA 3BZJA 3LDVA 4FX7A 4BR1A 1TV5A 1LBFA 2CXGA 1XYCA 1D3GA 4JIEA 3UYIA 3EEGA 2A6NA 2O9RA 3HPZA 4H6RA 1WKFA 3MV01 1RBAA 1ZTVA 3O15A 3TCSA 4QE1A 2V0TA 1Q7ZA 1QR7A 4N9EA 2QXWA 4DXXA 1QRQA 1JCYA 4IXXA 1QXLA 3NFUA 2D0GA 2EXOA 1TVLA 4C6JA 2Y1HA 1UROA 4XAPA 3GWQA 2QCCA 3SAZA 4UTFA 2GOKA 2ZWZA 4TQTA 3SBFA 1NDZA 1XDLA 3QM3A 3WD4A 3HG3A 1Q6CA 1EL3A 1Q85A 3OGSA 1E6SM 3CWNA 1AMKA 4QCFA 3NDOA 1ISWA 1XGEA 3T55A 4LYQA 4L4MA 4PMNA 3AMLA 4LC8A 1YNPA 1W1YA 1SMDA 3HO8A 3B06A 3G6MA 3ALGA 4QISA 5DELA 1E1FA 3VUSA 4YWSA 4PMJA 3T42A 1HG3A 5FJUA 5LIKX 1VH7A 2JIWA 4CD6A 1A0CA 1MUWA 1ZSXA 5XINA 3N3MA 2BY1A 4DI9A 3MUIA 2ZXQA 4AVFA 4PA8A 2VM8A 2Y5EA 3W27A 2UWFA 3NM3A 2BXVA 3CS2A 3N2XA 1UJPA 3SQMA 3SI9A 2BS9A 4JOMA 1Z9AA 4BI7A 1NDVA 1MSSA 1JEZA 1FWDC 3ANVA 4H01A 4JKMA 1NM9A 2INFA 1UR8A 3EDEA 4F9JA 4C6PA 4J7RA 1HQTA 1BVNP 4NXSA 9RUBA 1VAHA 4W7WA 3B4YA 3T08A 2Y8VA 3KE0A 1FH7A 3MVTA 1ZY9A 4D72A 1Z42A 1LOLA 2YDRA 5EL1A 2CBVA 1REQB 2QJMA 3DIPA 1SW7A 3PF3A 4JIPA 5G1MA 4PC8A 3MT1A 2A7NA 4CN6A 2WNWA 2PFHA 1RHCA 3QMSA 3VIFA 3MHFA 4PMDA 4GNJA 1BYBA 4FK9A 4NZ3A 4KWWA 1E6NA 4CNOA 3BMWA 2ISSA 1KV5A 4GPNA 1W54A 3L9CA 2IKJA 1OFDA 2EGZA 4O12A 3SURA 3GE7A 3RLGA 1EYWA 3S2JA 4US6A 1FWGC 2OLAA 4HPNA 2PCQA 1G7VA 5T26A 1SZRA 3KL5A 2J77A 1KWGA 3O6DA 5DCEA 1JFHA 3NDZA 3D3AA 3GO2A 3GU2A 4LPCA 3VO0A 5FL1A 4AB4A 3OP2A 2E9MA 4KGLA 2D2HA 4B5SA 2G0WA 2A4AA 1W8SA 3TW6A 4NZ5A 3W88A 1SJAA 2AMXA 5CCZA 5FEXA 1CGVA 1GYLA 3URBA 4F9DA 2ZZ1A 4QTGA 4K37A 3COTA 1ITQA 4IG2B 1HUVA 2OOGA 3LUTA 1NFBA 2Y63A 1PSCA 1E3ZA 2J9ZA 3PZ9A 1UH3A 3UY8A 1NWUA 5BMXA 1GOOA 1JFXA 2B7NA 4Y90A 4XAFA 2ON3A 3BQ6A 1DTUA 4WJEA 2BBFA 4G1KA 3R89A 1JVNA 3MJYA 5HANA 3PC0A 2ZRYA 4J35A 3GUGA 5A6LA 1UMLA 3NGFA 4Z2GA 4M56A 3EA2A 5LHEA 1CWYA 3BAKA 2YXOA 4KETA 1Q45A 1Q5MA 3CHEA 2V5CA 3AXXA 3RR1A 5TQLA 2V63A 1GCYA 3T40A 2VENA 4HN8A 3TJ4A 1WDQA 1GEQA 5CAKA 5C9RA 3QOMA 2BNJA 3TC6A 4DAIA 4KBXA 3S5YA 4MIMA 3UWZA 4MNLA 1M7OA 1IR1A 4HCDA 1HKIA 4IMFA 2QGYA 3TX9A 4AWSA 1Z6KA 2V3DA 1CEOA 1IEVA 3BMVA 4ZTXA 3OPSA 3CQ0A 5KEZA 2A7PA 3KOFA 1DIOA 5A6JA 4LOCA 3H4GA 1K8YA 4Q4SA 4MWAB 3SCVA 3LM7A 4XTDA 1HTIA 3FA3A 5TNVA 3KBNA 4FSAA 3FSUA 1RH9A 1LWJA 1P0BA 4P7NA 4BKNA 5E93A 1DPMA 4HD5A 5H6HA 2VJXA 4FI4A 3HPFA 1F6PA 4Z2LA 3RM8A 4DJED 1K7EA 4KCVA 4AC1X 2PI6A 2PURA 3MI3A 4H04A 4LFYA 5EYWA 1POJA 4WSJA 2DORA 5AYZA 1WDSA 4QRNA 3UYCA 1FOBA 2VX5A 1KQYA 3OA3A 1JF6A 4D6FA 3DI0A 3R6IA 1RVKA 1S2WA 5C6MA 4AC7C 3AHXA 3GC4A 5C9ZA 4B3ZA 3AWNA 5HWMA 2AAAA 3G1VA 5BU9A 3QFWA 5FEZA 3IGUA 1GPWA 3UR8A 1HP4A 1FXQA 4R7WA 4NJGA 3E74A 3WIJA 1PYFA 2WHJA 5D8ZA 4NXKA 3L2MA 4DVOA 2O4QA 3WDJA 4GA8A 5H1WA 4QS5A 1XC6A 3A64A 1MVYA 4J3XA 4TU1A 2CLHA 3AZSA 3CL7A 2I7GA 4IHCA 2AMGA 3WK3A 2AL2B 1WKYA 2W63A 1L9WA 3AHZA 3ZLHA 3IIPA 4EE9A 1TSIA 1X1NA 1Q8JA 3SCQA 3ZJ6A 3MKCA 1FY6A 1YPXA 2PTDA 4YS1A 3ENLA 4R9OA 1XG4A 5KZMA 1XSJA 2EG6A 2OG9A 1E4MM 4GG9A 3O05A 4GI9A 4FNRA 4IL0A 1KXVA 3T0TA 4H1ZA 1H4PA 3V5OA 2DU2A 2P3EA 1XPGA 5BU6A 4LGXA 3WN6A 1J79A 3EOOA 4MG4A 4B5WA 1XIMA 1X38A 3PBMA 4CU8A 4NAEA 3SGGA 4ZO7A 2ZA3A 4KWVA 4O1AA 3RDKA 3HJZA 3T0BA 2WOQA 1GPFA 4ZSTA 3M0VA 1QO2A 1VFTA 3EPOA 2PTYA 3AXIA 3R12A 5U4NA 3CZ8A 1XCXA 4Q33A 3ORWA 2D2JA 4YVPA 1TTIA 3OLDA 1OF6A 1V3HA 4GH1A 1I2PA 3EPMA 3IK2A 2CWNA 4P5UA 3FLUA 3F03K 1E4LA 2YFNA 5BMWA 1F4HA 3LN3A 2P0IA 3VKCA 1SUXA 2G95A 2WLZA 1CDGA 2RAGA 2V2DA 2WMGA 4XKMA 1KRAC 1UB3A 5JBFA 5HQLA 4WY0F 3FJ6A 1Q6LA 1B3WA 3EXTA 5EA9A 4ZFCA 3AJXA 3L4XA 2Y70A 3W24A 3I3DA 4UQEA 1JXKA 5CEWA 1KFLA 1IXNA 1W2VA 4J4KA 3I6RA 1W2PA 5JQ9A 2F2HA 1B4EA 5CG7A 2WCSA 4AH7A 4RZ5A 5AYXA 6ENLA 3M64A 2UBPC 2DZSA 1IR2A 1Y5XA 2CETA 1DIKA 3W85A 5HK4A 2CLIA 2BG5A 2EF9A 3W72A 3VC6A 3S1UA 4UB9A 2JE8A 3W83A 2HVOA 4QR6A 1JNDA 2W62A 3QV9A 5JH2A 1DIDA 6TAAA 4HMEA 5HJLA 1Y0EA 4Y6GA 2L5HA 2BOEX 5AECA 4HTYA 4HU3A 1UR3M 4HOWA 4WY0A 2OLSA 3UJEA 2ZCGA 5KTLA 4M3PA 2WCGA 3EXSA 2AGTA 3TN3A 3DKLA 1JL8A 1E15A 4PBEA 2CITA 4O1DA 1AD1A 2IPJA 3F4WA 4DELA 3VCNA 2UY4A 3GB6A 4NVTA 1LLZA 5CZ0A 5TD4A 3AOFA 4WHBA 4NJKA 4LUTB 3OHMB 2QJIA 1GT8A 1VFLA 4EXAA 3OYZA 2ZTKA 2Y8KA 1MW0A 1FRBA 4FS9A 3WLTA 5IRPA 3KZSA 2G37A 4H3DA 1C7TA 5ECUA 1F3EA 2QV5A 3KWXA 3K4AA 4XBSA 3CV2A 1R9XA 3VOGA 2H8XA 1B57A 1SJCA 5D09A 3WUEA 1NTHA 1OJXA 3RN6A 3DOPA 2C1HA 2BY3A 1MQPA 1OX4A 4XK2A 1UPMB 3T0DA 4WXZA 2GVYA 3TJLA 2KX9A 1EBHA 4MNKA 1J0YA 4UC5A 1SFSA 1UKSA 2DUZA 1A5AA 2O7SA 4G56A 4LS2A 3VA8A 2G3FA 1PBGA 1IQ8A 2Z1XA 3QC0A 4TV5A 4D2JA 1V03A 3DGRA 2I16A 3SO7A 3G1XA 1HVQA 5I77A 1H0GA 3U48A 2I1OA 5GNZA 3ZJ7A 3WQDA 4KRUA 2WSRA 2XINA 2WNZA 3KLKA 1DE6A 2WMHA 3CL8A 3KL0A 1RJRA 4GVIA 4IQDA 1HFBA 4E8DA 3IJ6A 3F1QA 4JTEA 2XWDA 3SECA 1H41A 1QNVA 1QNSA 1PL9A 3EXRA 1RD5A 3B4UA 4C6BA 4YCPA 2WBKA 3F5KA 1UZ1A 4WOZA 2ICSA 4PMXA 7ENLA 5HJXA 3L5AA 2HXUA 5CSRA 4NNCA 2XFRA 2PS2A 4PEKA 2FMNA 2V5LA 2ZVRA 2UY2A 1FWBC 5HATA 5C2GA 3G1RA 1KB3A 1OB0A 3IUIA 1QI3A 3WF3A 2E0PA 4JTAA 4JKKA 4GIRA 4O11A 3QH2A 2C18A 4EK7A 2NQZA 3PG8A 3C8NA 1VIZA 2QAPA 3ALFA 3BAXA 1X6NA 3HU7A 3ISIX 2J78A 4AIEA 5I79A 3GC2A 1QPOA 2INZA 1UQZA 1XFCA 1XDMA 3S3GA 3QZEA 4LF1A 4Z2HA 4O1CA 2X8RA 1QPKA 5C70A 4E3VA 4ERAA 3HN3A 1DXIA 3WQ4A 4O18A 4AWEA 2E8ZA 1EO5A 4G7EB 2DJLA 3GIPA 3H2NA 1OF8A 4DM1A 2ZUMA 4R7JA 3CC1A 3WLSA 4IQJA 1E0VA 3UR7A 3RGTA 3GYEA 3IRDA 3BAJA 1A5LC 3D47A 3L4TA 3LU2A 5BROA 1PTAA 1OY0A 1K1DA 3IACA 4HB7A 4EPKA 2YKKA 3WENA 4ACZA 3MCNA 3APGA 1XLMA 1W5NA 3W7PA 4D6GA 1OD0A 3GTNA 1QW8A 1W9XA 4LAOA 1YXDA 4O4VA 3P61A 1UC5A 4YIWA 4B2DD 5BRBA 4GBDA 3FX4A 2B81A 2OLHA 4M7SA 1E70M 3OBKA 3CT2A 3T1GA 3H55A 2C7FA 3R58A 2FMOA 4A3RA 4DPPA 1T5AA 1XD0A 5KSWA 3EX4A 3DERA 1FHLA 2X1RA 3TSDA 1PX4A 2ZX6A 1YNQA 3SY8A 5I2UA 1AK5A 5D03A 2DDXA 5JVLA 3AYSA 3VZXA 2WHLA 2INEA 2QIIA 3KTSA 3HJEA 1VFUA 2PU1A 4Z42C 1G0CA 3TMQA 1JG9A 1OIMA 3EX1A 3FVDA 2J24A 3P5ZA 3RF9A 2H9AB 5JH1A 3CHFA 3O0FA 2X42A 4Y96A 2ZZ4A 1Q66A 4NJJA 4UTLA 4NQ1A 4F40A 2ATMA 5SWUA 4FXRA 4XX6A 4CEXC 5CBBA 2WNQA 1EIXA 3OG2A 2F6KA 3NG3A 3V18A 3IV8A 4QDPA 4CCZA 3VU2A 4KESA 2VRQA 1BKHA 3UG5A 3PWGA 3PTKA 2F38A 2C71A 4OWGA 4DJEC 1BVWA 3VABA 2GGGA 1NF7A 5M2FX 1GOKA 2VEPA 1E6ZA 3MUCA 4EF8A 2IQTA 3DXIA 3I7RA 3E5PA 3EWZA 5DXXA 3LCLA 3NNTA 4IMGA 3PZUA 5CC7A 4G6CA 4Y8EA 1XIIA 1UWTA 1KM0A 1KNWA 1Z44A 3R0UA 1E0TA 3CBWA 4O0ZA 1Z41A 5FACA 1RAKA 1TIMA 1W3HA 4UQAA 1JZ5A 1E1CA 5PTDA 2H6RA 3DFYA 1XUUA 3PJUA 3TTOA 4ONVA 2X05A 2P3ZA 1GKQA 3HZ3A 4GGBA 3CH0A 2GGHA 3CPGA 3H2FA 2XSBA 3QY6A 5TBOA 1KM6A 2HCVA 3T2OA 2XSXA 1CLVA 2IUZA 3VD7A 1AMYA 3WFZA 3P80A 4GC4A 2ZXBA 2YOCA 1OX6A 3PUOA 5FOOA 1TPC1 4AVNA 2VTFA 3IIXA 9XIMA 4H8NA 4F0SA 1F07A 1POKA 1PWLA 4DWSC 4E5TA 3UR2A 3VD3A 4F8XA 2C1IA 3QC3A 1XYLA 2ZZ5A 2GYIA 4HP5A 5HOSA 2V8ZA 1GK8A 4UMCA 3AMGA 3M0LA 2XIBA 3VTRA 4O15A 4N02A 4C6IA 2VZUA 3BE7A 4C6EA 1EHAA 1M03A 1G4SA 5CPSA 4B5VA 4IISA 2XN0A 4ML4A 4F3HA 4MWAE 2OSYA 4ATWA 5AC6A 2DIKA 1HF6A 4RKAA 4M7TA 3LEPA 3K4DA 1S2AA 2D3LA 4GYJA 3GXPA 4MGGA 4F0RA 4FNUA 5K3VA 2PWEA 4J2PA 4GD0A 1G4PA 1JUEA 3PBYA 1XSIA 3S1XA 4HOZA 3A3WA 3FYPA 2D1ZA 2WW5A 4HA1A 4D9PA 1X1OA 2VRKA 2OT1A 3QN3A 4HNVA 1Y8BA 2BVTA 3AZTA 1CTNA 3LBMA 5E9XA 1GONA 3G0XA 3IRSA 1V7AA 2Z1SA 1S1RA 4CNTA 3DYMA 1N55A 4ZODA 5DO8A 3OZPA 1VQTA 1TA3A 5HPCA 2VUYA 1SFJA 3VXGA 1Y5VA 1IWAA 3WNKA 1JAEA 2QF8A 2X1TA 1RALA 3MZNA 4B90A 4RDYA 4UQ9A 3HQ1A 2CFFA 1WZMA 3NR0A 1OFBA 4O1FA 4JBRA 5DFAA 1EF3A 4K1WA 4YMZA 3N12A 3W1NA 1O6IA 4AEEA 3A22A 3OB8A 4DUOA 3UG8A 3TC3A 1K8ZA 1OFRA 1FDJA 3V35A 3P62A 3L4WA 4WOQA 2ZUSA 3GTFA 4K8EA 4ZE5A 3EEZA 4GX8A 1M3UA 4BQ3A 3FA4A 3GG1A 4JQAA 2OSXA 3TTYA 4QCEA 3AYVA 3ERPA 4FR1A 4DUXA 6XIAA 3NEVA 3USBA 2ZZ2A 4QHRA 4C6MA 1QHPA 4B15A 3W7KA 1D7FA 4PUMA 3JZEA 2QNEA 3GXIA 4ZQMA 4HU8A 2YYUA 4DWSA 1CLXA 4IP7A 2QULA 3BTNA 4JNYA 5AFDA 3UXIA 5HJYA 1E4NA 2V6AA 1KCZA 4W9TA 1BYCA 1SR9A 2CU0A 3RIKA 4WD0A 5CSUA 1KCKA 4Y2WA 3PNZA 2PLMA 5HULA 4A4AA 2JKEA 1S2CA 4IIBA 5ENLA 1RCOB 1JZ7A 4U2YA 2V5BA 1ZBKA 3EOEA 3GK0A 4A2SA 3RX4A 4Q4MA 3EWCA 1R6WA 4GGHA 1ZBWA 4HCHA 3W82A 5LXXA 3VGFA 4S2CA 4I9TA 4HU4A 4XAGA 4PUNA 2WZEA 8CGTA 3LY0A 4HT3A 1EBGA 2Z7GA 3G1YA 3GUWA 3CGTA 1S5TA 3VNMA 3W6LA 3ZO9A 3B97A 1O7AA 4LUJA 1LP6A 1FQ0A 4HCLA 2FPTA 4OQVA 3I68A 1UD5A 3N73A 1X8CA 3FEQA 4UTUA 4WSHA 3O6AA 1V77A 2YFOA 1OWQA 3MCMA 3VIPA 1RJQA 3WL1A 4AEOA 2EJAA 1Q4NX 4TX6A 1OZQA 1UWAA 4UTJA 3WJSA 3OQ8A 3QV7A 2CHNA 2E6FA 4NYUA 4LT9A 2O9OA 2NQ5A 4JTKA 4KW2A 3URAA 2Y5SA 1EUNA 3TP4A 1E6RA 1FDYA 4I5XA 4Y7EA 3WQ8A 3LBCA 3W26A 1UPPA 1U2YA 3TFCA 2AGKA 2QV4A 1KXTA 3TAKA 1UP0A 1GOQA 3WO8A 1VCVA 3H2AA 1HKJA 5RUBA 2H8ZA 3LQGA 1BAGA 2J7FA 1KA9F 4N6FA 3RLHA 4FMVA 3AXKA 5LZLA 5L9FA 4JIIX 1M5WA 5EMMA 4ZTYA 3O06A 2PC4A 1A0DA 3S0CA 1K9TA 2X0HA 3F5LA 2BGNE 4Q22A 1AJ0A 1JPDX 1DL3A 1QPRA 4C6NA 5IHSA 4D8LA 2GJLA 1OK4A 1XLAA 3UZWA 3M1ZA 4P7OA 3D46A 2WC4A 3W86A 4WSKA 2NLYA 3QGAC 4OHQA 4GYPA 4IJRA 1ECQA 2XGIA 6REQA 3DHFA 2XSAA 1R2SA 2ZBTA 1B3ZA 1FTXA 1W37A 3UCCA 4O19A 1XL9A 5BYWA 2AOSA 1KBLA 1GQLA 5HR7A 4S3DA 2TAAA 4L1WA 1R7OA 3N9KA 1UD4A 1J0IA 2O55A 3FJNA 3VIJA 1XH2A 1EOMA 2NVDA 2V5KA 2FZBA 3RLVA 4ECLA 1JIBA 5DLCA 2WANA 1L6WA 4W7VA 3UXAA 2WO5A 4PTWA 3W23A 5MKGA 3GZAA 2Y7EA 2UY5A 3ZXWA 2XVLA 3QGVA 1VFMA 1WUFA 1B31A 3KOYA 1DJWA 3STPA 3FV9A 2Y7DA 4HA3A 1QPNA 3EB4A 1GVYA 1KW1A 3LCXA 4CCCA 1EX1A 3REQB 1ZJBA 2NZLA 5A8NA 5GNYA 2DUXA 5LA0A 1MEIA 3A4JA 5HR6A 4IMCA 1KTNA 2WJEA 3C2FA 3Q37A 4DF2A 2G4JA 1W9VA 2FVKA 3D5HA 3AHTA 1Z7AA 4FIRA 1LQ2A 4DJFA 5M3WA 1H7OA 4O1EA 1B30A 4A8LA 3RITA 2CZ5A 3BLDA 2YBTA 1SSDA 1LZOA 2WKJA 3M5ZA 2RHGA 4Z2KA 4OECA 2ZZ7A 1D8CA 3HGSA 2G3MA 3F4CA 3B0YA 1XLLA 3SFWA 4DO5A 1T6MA 1C3FA 1XCWA 2VD8A 4V15A 5C8BB 1N7KA 2HXTA 4CEUC 4J2MA 2D22A 1F76A 4LWWA 1P7TB 1GQKA 4IFKB 4RE2A 5D02A 3PK7A 3HGOA 1EEXA 5I3GA 4UTHA 4EAMA 4N2YA 3W7OA 4LB3A 3UT0A 2XVPA 2OWWA 4XQ6A 4CQAA 3CUGA 3AALA 3N4EA 2P8CA 4UFHA 2FHCA 4F0HA 3U57A 2FZ8A 3W7EA 5IDZA 1CXIA 3ANYA 3ZT7A 1GVRA 2BHYA 3E6EA 5F2MA 3TLQA 3G1SA 1HJQA 2F6XA 2WKLA 3M0XA 1Q6GA 1QASA 3LB0A 2I5GA 1J4EA 2BX7A 4HMNA 3A47A 1JYXA 4DBDA 3AS2A 1PTGA 1EWEA 2AKMA 4AD1A 1RSCA 2MNRA 2P1FA 1KXHA 2WSQA 4HHHA 3PAJA 3Q2DA 4JTJA 2CLMA 3CZEA 3WF2A 4C7GA 4GRSA 3BC9A 1NP2A 4XD3A 5I3DA 1E6XM 5AZ1A 3E9AA 3NAVA 4P61A 3WDRA 5DRIA 5F4XA 2O92A 4DN1A 1YXCA 2ZQ0A 2DVUA 3GVWA 2XIQA 1W1ZA 3TN4A 4GKLA 1LL7A 3GQYA 3N1AA 2I56A 1XXXA 4ZQNA 2OWCA 2RDTA 2DT2A 4GBUA 3KOXA 1XHGA 3VDAA 1OG0A 4HN4A 3WQPA 1EDGA 3EDJA 3M7SA 4ZR8A 2J7HA 2PP0A 4H2CA 1T8QA 3KRUA 2WSPA 3EMZA 4DZHA 3QMTA 4DM2A 1Q2RA 3RO6A 4INFA 7PTDA 4OZOA 3P0WA 3CUIA 1UR0A 1GHSA 4RX0A 4K6AA 3MANA 3DG7A 2W27A 4MF4A 2J74A 5G4HC 1LG2A 1H5YA 1XQLA 3EZ4A 1FHVA 4XO6A 4R27A 1EPXA 2V3GA 3N18A 3PWAA 1P0EA 2PWDA 2Z0IA 2WJDA 3LG3A 1RCQA 3CM4A 5D04C 1W3JA 4CGTA 1CLKA 3AU2A 5LIYX 2HWGA 4UR9A 3CB3A 1WX0A 3GBEA 1EEPA 1GGOA 4C91A 1K6WA 1K8XA 5DT7A 3ZFHA 1UWUA 1H7WA 1TJ2A 1GZJA 1MFVA 4L1XA 2NVCA 4ZA0A 5D2XA 3VIMA 5HMSA 4YN5A 5LIUX 4D6IA 1M7XA 3B8WA 4DJDC 1H51A 5D33A 4NX5A 3W1LA 1IT7A 4MB5A 2CXEA 3SGUA 4A22A 1OG6A 3UNDA 3UWEA 4HNTA 3K1DA 4LEFA 2VGFA 2SFPA 4HVXA 3SUVA 4DZ5A 1RBOB 5E0KA 1UBPC 1EGZA 4HMCA 3WD0A 1KR0A 9CGTA 2WZHA 3ABSA 3DECA 3K2GA 1WXJA 1KBJA 4OE7A 4NZ4A 1FA2A 1G4TA 1GJPA 3MWAA 1TZ7A 4ZOBA 3TQKA 4Q7IA 3AMDA 4JEQA 1FWIC 2BHZA 3CIWA 2E6DA 5K4XA 3S5ZA 1TWIA 2VL4A 1V4YA 3QHMA 1YBQA 4ZB2A 1HKKA 3E02A 1UOZA 3TUUA 2YX0A 4WDTA 1DYSA 3VKJA 4BY3A 1A5OC 3OLGA 3WMCA 1OYAA 4E6MA 2G97A 2DZBA 1SZNA 1TCMA 4XSLA 5EU9A 2DZUA 4O28A 3TW7A 3WQWA 1NWRA 1VEOA 4D6JA 3CHVA 2PD5A 5LYRA 4LNCA 4M19A 1EC8A 4GQQA 4YU1A 2GSHA 1CXKA 2R82A 2HSAA 4D6DA 4AAJA 4RV8A 2F61A 3NQEA 3UJRA 3UXKA 4WKAA 4JS3A 3TQPA 1CGWA 4S3BA 1MUMA 3S83A 4HPHA 5C7HA 1EXPA 3EWXA 5BOFA 3W75A 3RJYA 3WK1A 1F3TA 2VFDA 2OSWA 3E49A 3P8JA 1H50A 2QR6A 2DUAA 2V9DA 4QJ3B 4FA3A 3MKVA 2A6LA 4JL2A 1P1XA 4ORMA 5K9CA 3FS2A 2IKGA 4LS1A 1BWKA 5ABGA 4Q4QA 4D71A 2ZWYA 3UG4A 4HSOA 1K9EA 4Y9MA 1KRCC 1NJJA 4YHEA 2BODX 3LHUA 3NL5A 4WZHA 2VXNA 2PDMA 5AYBA 4CNPA 3BGJA 3GR8A 1XC4A 3PG9A 4HBKA 4AF0A 1NDWA 3UR5A 1BWLA 2Z6IA 4WIWA 2PWFA 3TE9A 1AQMA 1CIUA 4BA0A 1WBHA 4Z1DA 4DJDA 5EFDA 2Z6JA 1TPFA 1TX0A 2BMBA 1OC5A 4LY8A 4PCNA 1BRLB 2VGIA 3CIVA 1OGGA 1UR2A 5EMKA 1YKWA 1XLDA 3FXYA 1YW1A 1Y5WA 1F7BA 1IXOA 1FWRA 3BLEA 1JI1A 3DG3A 3N2BA 2VFFA 1AZ2A 1CGTA 4HTBA 3RM4A 2VMFA 4H41A 1VFSA 4NX0A 5G2HA 2OELA 3CV1A 1A3HA 3Q45A 3NQGA 3WQ6A 4LUIA 5DMMA 3PZIA 4XZ9A 1ZBVA 2I9UA 3ZWSA 4XG1A 2ISDA 1IZJA 4BEUA 3R94A 4LAMA 1NFGA 5A69A 4IOTA 4H9YA 2J8GA 1UKQA 2Q6ZA 1F2JA 1X7FA 4IPNB 2NUYA 1ISYA 2OEKA 4I7UA 1F8MA 3D0CA 4O8AA 1XIFA 2WK2A 1KFEA 3AIVA 1VBRA 1H62A 2X2YA 2YL5A 3TC7A 2NX9A 3NSXA 4GI4A 5CLWA 4FX6M 3I3EA 5FJJA 1B5TA 1RPXA 1TTQA 3C4UA 3WH8A 4AIOA 4IF2A 5ABEA 5H2ZA 3S5SA 1DWIM 1KBKA 3FJLA 3GX9A 4IJCA 4AZ5A 1YIXA 3CASA 1W9PA 4O17A 1GG1A 3T4CA 4U3AA 2E5BA 3C6CA 4ADTA 2DQXA 4MSSA 3W00A 2VCBA 3V4BA 3ZR5A 2HEJA 1KQZA 3OYXA 3PP7A 4Z2IA 3QLLA 1U1HA 4Z0JA 3WDHA 3VVGA 2X7WA 2IW0A 3L0GA 1FFRA 2W67A 1WYIA 3LXCA 4M24A 3N13A 1KCLA 4US5A 3K8MA 3MP3A 3VC5A 2FKPA 4JEJA 5I09A 1Q6DA 2PWGA 3BANA 4K68A 1HO4A 4DYEA 3BG9A 3H70A 4AVOA 2WSYA 3C0SA 4W84A 2VVNA 1G9HA 4Q4OA 1V8EA 1BGAA 4G9PA 3N2CA 5HMDA 4BWLC 4UZSA 2YR1A 2EJ1A 3SN4A 4FLQA 4JX4A 2EPNA 4OIFA 1TR1A 2JF7A 4NZCA 4B16A 3BLFA 3PWIA 1X97A 4I5UA 1SQ7A 4KWUA 3E2QA 3NOEA 4UNKA 4XKYB 4EKJA 2PGRA 4UFMA 1ADDA 1EDTA 1SMAA 4IFOA 3GFYA 4S3FA 2GK1B 4QLJA 1I2RA 1P43A 3GVQA 3WJYA 1US0A 3CO8A 4R34A 3ARPA 2DQWA 1AQ0A 1W5QA 3NPUA 4Q8TA 1KO0A 3GZ3A 3GW3A 1BF6A 2OQLA 4Z1BA 2OU4A 3NPWA 1QBBA 2EKGA 1GTHA 1R9YA 1WXZA 3KCOA 5AC4A 1D2KA 3ABXA 4AWTA 1LL6A 3UNTA 1FKXA 4ADSA 3OIHA 5D30A 3W2KA 3O07A 1US3A 1XRSA 3M6DA 2BTMA 4OU1A 4OUIA 2X40A 2OOFA 1REQA 3OJGA 1KLZA 4QAWA 1A3WA 3THQA 2TRSA 4RJEA 1YLVA 2YW4A 4IH3A 1W3TA 4N9BA 2FDSA 3W01A 4QDWA 2VRJA 6PTDA 1PVNA 4MWAC 2NQHA 4GNKB 5D2TA 3MCOA 1HX0A 3OG3A 4C6DA 4G5DA 5I03A 5CJNA 1F5ZA 3F2CA 1XPYA 1BXBA 2WMJA 3WMSA 4XUYA 2E1DA 4H7VA 3WLHA 1UIPA 3VCRA 1DIEA 1PV8A 2O4MA 4YTQA 3GLCA 4GJ1A 1SYTA 5ABHA 1F6YA 1VYSX 1XD1A 3KRSA 4J9JA 2YJQA 2VGBA 3BLOA 4Y9OA 4PR4A 5AHFA 1TVPA 3UGRA 1AW1A 3E96A 4DY1A 3A12A 3EDFA 3POCA 2CCRA 3AZRA 2OO6A 1PJ9A 3F7JA 2J8FA 4HK6A 4ROPA 2DW7A 3IANA 4E2VA 3ANUA 1UWIA 4BWLA 2Y0FA 4NAFB 2C6QA 2FJKA 2ZE3A 3TR9A 3AMCA 1EJSC 4ADUA 1KBIA 1MMFA 4B4HA 2GJNA 3EGJA 1W9BM 1OYCA 1I8JA 2C3ZA 4XVEA 3BLPX 2Z2UA 4IL2A 4AHPA 1YX1A 3HMCA 4EXBA 3KXQA 3Q58A 3OHIA 4X60A 3UVIA 2AKZA 2OVLA 3B40A 4C7DA 2GJXB 5M5DA 4W87A 4GJIA 4HGXA 2V38A 4QNEA 3SY1A 1HL2A 4XIAA 4PUWA 1VFOA 5AKQA 1PYMA 1QOXA 4F66A 3R0DA 3FKRA 5FESA 3PUGA 1V02A 3PPHA 2FZDA 4S3AA 3FDGA 1TVNA 3OGVA 4E4UA 1K70A 3KHJA 1BD0A 4UUIA 2VELA 3NZGA 1I1XA 4NF7A 2G50A 5D32A 3O2LA 4CU7A 4WRHA 3GR7A 3MB9A 4MWAA 2W79A 1QW9A 3LHVA 3O6YX 4O1BA 4OJYA 5D37A 1HL9A 1W5PA 3CMGA 3PBUA 1UW9A 4RNHA 3L12A 4GZJA 1W9DM 4C6LA 2BOGX 3GFZA 2ISVA 1G7UA 4M6PA 1QK0A 3MUY1 4Q8QA 3BW3A 3PFMA 1YYAA 3A21A 4MLJA 1VRXA 1OD8A 3S42A 1E9YB 4HZ7A 3LV6A 4ZXOA 2QDHA 1EHNA 1FP9A 2FPVA 5LNWA 4LNYA 3R13A 5F2GA 5EBAA 4QBXA 2JBMA 2E5CA 3L21A 1OC7A 3FKKA 3WKZA 3WH7A 3MWCA 1ELSA 1LYXA 4WX2A 1I0BA 1R3YA 1M04A 3IJ9A 4QJ4B 3VNZA 3CUJA 3R8HA 1WUEA 2BB0A 1VLWA 1A53A 3LCWA 2UV8G 1C91A 1H1NA 4DQWA 3HB9A 2QUVA 3L2LA 4DXVA 2AL2A 3APTA 3H4WA 4OT7A 1NIUA 1QO5A 5A6KA 3NQ6A 2C79A 1GHRA 3ZQ9A 4QX4A 1TPWA 3OEXA 1H1YA 2XVKA 3A24A 1VEMA 3M9YA 2QS8A 1P6BA 3WEOA 4B9YA 4FNQA 1B9ZA 4PBGA 1UUOA 3P82A 4UR8A 5H91A 4C6FA 2YA2A 1XYZA 2J6XA 3ARZA 2HK0A 2ALDA 4OV4A 5E70A 1W1VA 1L8NA 3VGHA 3W1RA 2OJPA 3CV6A 4GFSA 3WQVA 3T2PA 1SM9A 2OYLA 3FAXA 2QVNA 2YB1A 3UA4A 1XISA 1SZGA 4GO8A 4M0XA 4XZBA 5C9XA 4DI8A 3K46A 3HMJG 3WBXA 3SUUA 1TO3A 4HPJA 2AQOA 3M46A 3QQ0A 1GVQA 3XINA 4RLIA 2NX1A 1D3HA 4TX9A 4FLRA 1NVMA 1YTDA 4NG3A 2OZ8A 4AD5A 1J18A 2WJZA 4PL2A 4JFWA 1K7FA 5I3FA 4F2UA 3GG8A 3WNLA 1CW2A 3EDDA 1A5KC 3HFYA 1SW0A 3S47A 1H61A 3F2BA 3H4XA 4Q4KA 3RX2A 4JGDA 3P84A 1OFPA 3PS7A 3POHA 2IXUA 4NYYA 2OYMA 1I75A 1GVSA 3NXFA 4GXWA 4KFPA 4GUGA 3BOXA 4JTIA 3G18A 2E8YA 3QPYA 1MFUA 1EXBA 5HDRA 1J12A 1WBJA 1V51A 3NVDA 4N9CA 1UKPA 4D6CA 4AD4A 4L9XA 3KX6A 5CPQA 1UZ4A 5CXPA 4NAEB 1YXYA 4B4FA 1VPXA 3O16A 4JYFA 2Z1KA 2PLKA 2VT0A 3VNKA 1SJBA 3DYPA 4GZ7A 3LV5A 4AMCA 2B7QA 5B80A 2VFEA 4GQBA 4XSMA 1ZJIA 3T2QA 2HNHA 3OGRA 3I7SA 1NAL1 1QT1A 5FF0A 1NY1A 3WH9A 4F48A 2D73A 1EP1A 3TYCA 4J27A 1EX5A 3LX9A 2P0OA 3CZLA 5C9WA 3SRHA 1P0KA 4A3HA 3L5LA 4NJIA 4H8UA 4LUTA 1C8QA 5EFFA 3WSUA 2Y85A 1KKOA 1U1JA 3N4AA 3RX3A 2AQWA 5J5DA 1V0LA 4Q8OA 2R94A 3CQKA 1MDRA 3AIWA 3H24A 3LA4A 3MU7A 3W3OA 2OMAA 2NX3A 2GGJA 1THFD 4WJXA 3N11A 3QPEA 2ZX7A 2WQPA 5BOEA 2ZX5A 3E38A 1PKYA 5IFPA 1ZJAA 1QTWA 3LERA 3QR3A 2A0NA 3MSGA 3MA8A 3WLMA 4V2XA 2PP1A 1AFSA 5FJPA 2A85A 4NRRA 5CG0A 1TQJA 4XVDA 3Q67A 4UMAA 3NDYA 5LXEA 1F6KA 2ZC8A 3M7WA 4IMDA 1O68A 2QLYA 3W7MA 3LHYA 2W61A 3SRDA 3WY1A 4WY0B 4B92A 4Z1AA 2YYTA 3S6DA 4RE0A 1JPKA 3UFYA 1XIJA 1YDYA 1JCMP 3AISA 4N0RA 5AHNA 4NL1A 2E3ZA 3G1AA 4HNUA 1OEPA 1QNOA 3SIZA 4REQB 1OCNA 4W86A 5BNKA 1CBGA 3DC8A 2CW6A 2Y8UA 5CSSA 2J7CA 3USZA 4QG9A 3THUA 3U2EA 3T07A 1I45A 3FFSA 3KOZA 2OFJA 3TKFA 3L4UA 2GGEA 3ZWTA 1ZBCA 3AQUA 1GW9A 3W1XA 2PDYA 1DXEA 3RCMA 1A80A 4CD5A 3H23A 3BICA 3OZYA 1B3XA 2FHFA 1OINA 4W8LA 5A8GA 2ANUA 2NXGA 1L6YA 5K4ZA 2GQ3A 3S1WA 3M6YA 1RVGA 1UQYA 2HDJA 3U2ZA 3G5EA 3W70A 2WXDM 3NOYA 4W88A 3RRXA 5AY7A 2YCJA 3ABOA 1S3TC 1JI2A 1HN1A 2Y7GA 2Z1VA 1H1ZA 1NOFA 2GWNA 1XLGA 1JNEA 3IPWA 9XIAA 1HJVA 2YCLA 3VDHA 1HP5A 3G1DA 1WO2A 1R8LA 4J3WA 1CPUA 3SADA 1WOAA 1QMLA 1WV2A 3SGZA 1C93A 3BSHA 4RPPA 3SCUA 1JCTA 2A3AA 3GTXA 2YL8A 1KGUA 4HZ8A 4Q8MA 6A3HA 4MDOA 4Z1CA 1JDAA 3MTWA 3C3NA 5FSDC 1H09A 5CPNA 4B5XA 2GOUA 1W6TA 3ONCA 3WCZA 2BXZA 2NUWA 2JALA 5KZEA 3QEZA 1CT5A 4GI8A 1VBGA 4HZ6A 1Q7QA 2HS8A 4QLKA 1HKVA 2W91A 1ZCCA 1KGWA 1C92A 3NQDA 1ZAHA 4FXFA 4QG6A 3L2IA 1GOMA 1H7NA 3C52A 4XZNX 4OBTA 4KCWA 3KHDA 4MADA 3UGVA 4C60A 5I23A 4RV3A 3ECQA 1DQWA 3IVUA 1TR9A 3O8AA 1RCXB 2EPLX 1A0EA 2P5NA 5MF5A 5G2IA 2DFAA 2E6YA 3KWSA 3U4AA 2XVNA 4R9XA 2E67A 2PUZA 4GCXA 3RJXA 1Z8AA 4H83A 5ABFB 3EYPA 2H9AA 3UEQA 3LI0A 2X7VA 1QVBA 1OHLA 1VLIA 1R30A 1F3XA 2NUXA 3IGXA 3VNLA 3M5XA 3U6WA 3TXZA 2ISWA 2V69A 3C2EA 1YDVA 1WDDA 3BCDA 3GXTA 1J6PA 4ACZB 1FHDA 1RQBA 3ARRA 1EQPA 1LRNA 3LRLA 1E56A 2Z4GA 4QLLA 3RK8A 4ZO8A 4HHMA 3K5XA 3KBVA 1EJXC 2FQIA 5HUOA 2D69A 4F4RA 5AYIA 2DSZA 3AS0A 4LX4A 4K36A 4POCA 1K77A 1TWWA 4V28A 3FCPA 2WMKA 1PB0A 2WZTA 2F84A 2WC7A 2WQDA 2PAJA 4CVWA 4L4PA 3WQCA 4GIAA 3RU8X 3SIMA 4ACYA 5H8UA 3HQNA 3WQ5A 4V27A 4PMVA 4NP7A 1C9DA 3VOIA 3PZMA 4B5TA 5FF2A 3TXVA 4I6VA 3CZKA 3KFTA 3SCOA 1K6AA 1OX5A 1KFCA 3K13A 1SVDA 3H53A 2HQAA 1TB3A 2J7DA 3MJMA 1SO3A 2NT1A 4XZIA 4DEFA 3CTTA 4P7QA 3GNPA 5FF4A 4R53A 3W2UA 3URNA 4U3CA 4IXHA 1FVPA 4ZZ9A 4M5PA 4AEFA 3ZVIA 3CK5A 2ZXAA 2GJPA 2CNCA 3GH4A 4MZYA 3FOKA 1IWBA 4W93A 3RO8A 2XIOA 3AHYA 3OO2A 4G7FA 1QHZA 4HHLA 3NURA 2D2GA 5I02A 3H2OA 3AIEA 4BF9A 2VVSA 5CZTA 1R3TA 3VD9A 5EY5A 2PDQA 3GXNA 4J3TA 4AMAA 1F74A 1TG7A 1RPKA 3GH5A 2VX4A 5F7UA 4C5YA 3SB0A 1M7PA 2TODA 2R1PA 1XYBA 1VBUA 5T8GA 4Z2JA 4V33A 4Q7NA 1EP3A 1MRQA 3GIQA 3PB0A 5JUVA 1CXFA 3W4RA 1DWFM 3GHRA 1LF1A 4ZE4A 3WELA 1VENA 4ORIA 2X1UA 3NO3A 4UTWC 3NQVA 1TJ0A 3V1PA 4ZSUA 3ZZ1A 2HBXA 3LHTA 3TAOA 3RMEA 1BG4A 1FCQA 4MKNA 5CBIA 1XG3A 3AUOA 4QE4A 4Q4RA 3Q65A 4MVAA 1VS1A 4MFEA 1B2YA 4ZOCA 3B8IA 3WLIA 4ENLA 4Z17A 2PDNA 4QNWA 1EA9C 2V30A 1CI1A 1PIFA 4PYSA 2NV2A 4OUEA 2XHYA 4AW7A 3JW7A 1B54A 3PANA 3AFBA 2EPOA 2GPTA 1TWDA 5AVHA 2A3LA 1HKMA 4K3ZA 3LGGA 3HG4A 4JFUA 4RUBA 2Z25A 3W7DA 3EWBX 1PAMA 1SPQA 3P74A 1E72M 2QUMA 4H7CA 1QOQA 3NQ2A 1CGXA 4V1YA 1TMHA 4IPPA 5BWAA 3MQTA 2Y7FA 5C2XA 2J7EA 4BF7A 3CUXA 3PR2A 4K1GA 2FH8A 4DUVA 3EWYA 4JTDA 4LC6A 3IJLA 2Y62A 2PD9A 1X1ZA 1H3GA 1YTEA 3UPMA 2VEMA 3U2CA 2Y6ZA 3GDMA 4OV9A 4KCUA 2XM1A 3IIZA 5FEPA 2VKZG 4UXDA 4GI6A 4RDZA 3NYDA 5AYYA 4C1NB 1R47A 3T9PA 3VKDA 8XIAA 3QQ1A 5DANA 1JDEA 1GOWA 4AY7A 3BLIA 3VIHA 1WPCA 3IGSA 1V79A 2ZUVA 2WJFA 1I6NA 1ZAJA 2A3EA 3CIXA 1H0IA 4HPGA 1K7XA 1ME8A 3ITYA 1H2JA 4GKTA 1Q13A 3GSMA 5IM51 1KM4A 3EX3A 3QW3A 4HNNA 1RA0A 2OO0A 5DCDA 2Z26A 4JX5A 4JYEA 1XICA 3N2TA 1R5YA 4OFCA 2WNNA 3GDTA 3NZ1A 1AH4A 4KKXA 4JIRA 2R6OA 5CKSA 5E5CA 1J93A 2J62A 1DORA 1VBJA 1R3RA 2E28A 2EHHA 1YMYA 5DX7A 4HIBA 1V0KA 3ARXA 1R86A 1J5TA 1S46A 1LQ0A 4HA0A 4Q8UA 5CBJA 4JR5A 3LI1A 4FPSA 4JTLA 4M6UA 5I0DA 4UTWA 1MXDA 2QCFA 2GJRA 3V0SA 3B8TA 3S5OA 3TYBA 1SFTA 5HMEA 5FJOA 5BXTA 3O9NA 4MUZA 1XR2A 4HMDA 2I57A 4FHAA 2A2IA 4UMBA 3QJAA 3Q94A 3T0AA 1JCNA 1UR1A 3QTPA 2BP1A 3TA6A 2PPGA 1WXYA 4L9ZA 4UIOA 2C0AA 3W7CA 2EPHA 1HGWA 3SJ3A 2I5IA 4JHMA 2JIEA 5A8MA 3IGHX 1A5MC 3RG6A 1VIWA 1V6XA 1EGVA 2FDMA 4KH2A 1IT0A 4HJWA 4QFUA 3ES7A 3GTHA 1R46A 3RRAA 1ICPA 4B91A 4MJZA 3EA1A 4AZHA 1BF2A 5FL0A 5IXEA 2ZOXA 5CH9A 4BCEA 4YCOA 3H26A 5LNRA 4PRTA 5F1UA 2QJHA 1RD6A 5A94A 1ZENA 4OBRA 1TJ1A 4DO6A 2J6VA 1W56A 1S5VA 3GNRA 4MOZA 1VCFA 3TDFA 5KZDA 1R2TA 1XRTA 3W2NA 2OT0A 3G3MA 1GVEA 3KVLA 3ZYZA 1BVZA 5TAOA 1BTCA 1KM1A 2XGZA 1RK6A 1WZAA 4PSPA 3SRKA 3JRKA 2DZPA 3E2VA 2XH4A 2OQYA 4LW7A 1GQIA 3U7VA 2PDXA 2DY3A 1JXJA 4DWSD 3JZUA 2EAWA 4GHRA 3A3XA 3MBFA 2ZUTA 3PTMA 1FX6A 3G22A 1TPVA 3UG3A 4MNJA 2DT1A 2VR2A 3PM6A 2GLKA 1YRRA 1BGGA 4Y9AA 1BTMA 4H8VA 2PU0A 2OODA 2E68A 1N8WA 4UCFA 4JAWA 4R33A 4RW5A 2OZTA 3M4HA 5I6SA 1TJRA 5BRQA 4UTKA 1JUKA 3F4NA 1XBVA 3WZ0E 4LYKA 2WMIB 1QI5A 1B3VA 4H00A 1N2VA 4WF7A 2A5HA 4KERA 1ZLPA 4QE5A 1FWJC 1H7XA 4CNSA 1JQVA 5A6SA 1EO7A 2DPEA 5LIWX 4HPXA 3CAWA 1Z69A 4NZJA 3BZGA 1G6CA 1QK2A 2BSLA 3NQCA 3BG3A 3GY1A 1SGJA 3KM8A 3L5MA 5HNNA 2PGEA 3VE9A 1HJUA 3SSZA 1DWHM 2I9EA 2YLAA