2Q02A

Crystal structure of a xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 at 2.40 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
b'GMNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQLASWSEAEIEEQINRSVSLLLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Crystal structure of putative cytoplasmic protein (NP_463296.1) from Salmonella typhimurium LT2 at 2.40 A resolution
rcsb
source organism Salmonella typhimurium lt2
molecule tags Unknown function
total genus 97
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2q02A00
2X7WA 4GJJA 3KTCA 5TNVA 2J6VA 1XLFA 2GUBA 3CNYA 3UU0A 1TZ9A 1XLCA 9XIMA 3XINA 1XLAA 3KCLA 3KCJA 1XIGA 3CQIA 3M0HA 4GLEA 3U3HA 5XIAA 1XYBA 3C0LA 3M0MA 2GVEA 4HHLA 6XIMA 1XIDA 3KBJA 2QUNA 4GQBA 4PGLA 3AYTA 4A8NA 3VNJA 4PFHA 3VNKA 1XIIA 3CWHA 3N4AA 4US6A 1MNZA 2GYIA 3XISA 1DIDA 5B80A 3QXBA 3JU2A 4XIMA 4ZB2A 4ZB0A 5EMKA 2HK0A 1DIEA 3M0LA 4A8RA 3ITXA 4Q7IA 4QDWA 5C9ZA 2NQ9A 4QEEA 3UXIA 3LMZA 3AYVA 4QE4A 5J8LA 3L23A 4DVOA 3TC3A 1A0CA 3DX5A 3OBEA 4ZBCA 3VNLA 3VNMA 1I6NA 1S5NA 3P6LA 3BWWA 5H1WA 1XLHA 3QZAA 3IUIA 3IUHA 1XIJA 7XIMA 4XIAA 1XLMA 8XIAA 4HGXA 3M0YA 5FA5A 2Q02A 1XIMA 1XIEA 2QULA 2HCVA 2G4JA 4X63A 1K77A 4DUOA 4GJIA 1XYAA 3VYLA 4X60A 4HNOA 1QTWA 4YTQA 1XLKA 2ZVRA 3ITTA 3IUDA 3WQOA 6XIAA 1DE5A 1XLBA 3CQHA 5AVHA 1OADA 3ITLA 3ITYA 4XSLA 5XIMA 3QYSA 3BZJA 1XLEA 1QT1A 1XIBA 2X7VA 3UA4A 4A8IA 2XIMA 5H6HA 3QC0A 3KBVA 5I7GA 4XKMA 3C0SA 1XLGA 1A0EA 3KWSA 3ITOA 2QUMA 2XISA 3DBNA 4XISA 4K3ZA 5AVNA 3TVAA 2NQJA 2XINA 2ZDSA 3BZGA 4KW2A 2I57A 3C0QA 3M0XA 3U0HA 3FVMA 4QE1A 1XYMA 3KBMA 2HK1A 3CQJA 1D8WA 3UA3A 4EACA 1XLLA 3CQKA 4LNCA 1XLJA 4YTSA 2NQHA 5B7ZA 1DXIA 1XYCA 4W4QA 3ITVA 3KBNA 3AAMA 1O1HA 3BANA 3M0VA 4K1GA 1XIHA 1GW9A 4J4KA 5XINA 2OU4A 1CLKA 3GNXA 4G56A 4OVXA 1BXCA 2I56A 5B7YA 1XINA 5EMJA 4EAYA 1QUMA 1XICA 3VNIA 8XIMA 3KCOA 4HHMA 3BDKA 1XLIA 1XLDA 2G0WA 4E3VA 1S5MA 4QE5A 9XIAA 1YX1A 4A8LA 4YTRA 3KBWA 4ZB5A 3KBSA 3AALA 4QEHA 1XYLA 4X61A 3P14A 1A0DA 5EMMA 2QW5A 1XIFA 3UVAA 1I60A 4YTTA 2GLKA 1XP3A 4QDPA 1MUWA 3XIMA 1BXBA 3NGFA 4XSMA 4YTUA 1DE6A 5EMLA 1XISA
chains in the Genus database with same CATH superfamily
3NURA 4MNMA 5TNVA 3WDRA 3VFLA 1QK0A 4I5RA 1VFUA 4N4PA 4I9MA 3VOJA 3ZJ8A 2ZWZA 3SUWA 3BSHA 2DSKA 4QITA 3E0IA 4L1WA 2E68A 3CYJA 1NARA 3PFMA 1RXOB 3P8JA 3OHMB 1OX5A 5BU6A 1M68A 4GRSA 2HK0A 4P7OA 1PTDA 3VGBA 4D6DA 3OLGA 3PHAA 3RLGA 3WX7A 3B0XA 3PJXA 1UR2A 4V2XA 3HG2A 3SN1A 1J93A 2WANA 2PDJA 1VH7A 6XIAA 1RAKA 3SECA 5C2XA 1EGMA 4KWSA 3UZXA 5C71A 3HV8A 2Y5JA 2YA1A 1FCQA 1E0TA 1RBAA 5H6HA 2DT0A 1FHLA 1A0EA 1VGAA 4P7RA 4KCVA 3ITOA 2CEQA 5D09A 4GIRA 4GXWA 1FWCC 4O17A 4J27A 4UFMA 2OO6A 1PCKA 4XQ6A 1MEWA 2IMRA 4C1KA 1OY0A 3K1DA 2CLOA 2HROA 3BW3A 5ABTA 1HO1A 1LLWA 2FKPA 2ZA1A 2W27A 2HJPA 3NOYA 1QK2A 4AZCB 1TQXA 1FWNA 1H11A 1DJQA 6ENLA 1ONXA 5M2FX 4J1OA 3SW6A 2GQ8A 3PWAA 3S83A 3HQOA 4GI6A 4JHOA 2OQLA 1E6RA 3WO8A 3W28A 3GBDA 3MUAA 1K3UA 2FFCA 2XH4A 2XZ9A 1GQLA 2ZC8A 1HJVA 1N55A 1SZFA 4DWSA 1B30A 1VCVA 3UNTA 1E73M 1EEXA 2IPGA 1MUCA 2QUVA 2V38A 3PF3A 3ES7A 1U1JA 4IMCA 1QW8A 3TCEA 2NQ9A 1FWFC 3C3UA 4OV4A 2C19A 3VM5A 4JOMA 1JFXA 4LF1A 2QPXA 3SDOA 3DFSA 3W29A 1I45A 3HPXA 4LAUA 1TTIA 1G7VA 1BFNA 1D3CA 4WOQA 7TAAA 1CGUA 1MEHA 1ONRA 1R30A 3LPOA 1S2CA 2XH7A 4IG2B 1QOXA 3APTA 3T4WA 3D3FA 3WD3A 1PHQA 3AXHA 4HMNA 3FVMA 1R7AA 4N6FA 4JTHA 3NG3A 4JTCA 1KBLA 4KCWA 3HQPA 3O06A 2ZE0A 3PK7A 4HZ7A 3GH5A 4KCTA 4Y6GA 1YHTA 3KRZA 3H12A 4XVDA 3TYZA 3WQDA 5KTLA 4MYXA 3THQA 5FF4A 4YLWA 3C2EA 1K03A 3EMCA 1F76A 4IMAA 1LL6A 3V0TA 2CZVA 1H5VA 2DZVA 5EPDA 4JEQA 2PDQA 4HMDA 2XVNA 1TWZA 3UD6A 2NQLA 3F5KA 4IF2A 4IIBA 3UU0A 3PBYA 4IGSA 4YS1A 3WQEA 3T0DA 3M0HA 3CIXA 5JBEA 3PTQA 1I0DA 1Q6EA 3TEVA 2Y89A 1OYBA 4H7CA 2VGIA 2ACUA 3UESA 1FWRA 4DWSD 5F2MA 4OUEA 3VCCA 3UG8A 4JY9A 3DHUA 3T2OA 1W5OA 1P6CA 4YIWA 3HJZA 1ICQA 4O1DA 3B9DA 2HMCA 2DZAA 2BB0A 3O16A 5AFDA 2BY0A 1F4HA 1ZB5A 4WVXA 1JQVA 3MKCA 1PSCA 3MUXA 4BI6A 2R1KA 4N0RA 2OKOA 5FF7A 1P0BA 3QLDA 4JAWA 4HVXA 3EYPA 2Z1VA 2A3EA 3GM8A 5FOOA 3EWXA 4GA8A 4D6GA 3C5QA 1KGWA 2OWCA 3GDTA 1YYAA 1AODA 2DORA 5FEPA 1XR2A 1XDJA 3TMLA 3QH2A 3GNPA 2SFPA 1N8WA 3KW3A 2HS6A 5JH2A 1DXEA 4ZR8A 2ZZ5A 2POZA 4HU3A 4HA4A 3G22A 3FXGA 5CC5A 4QEHA 3HMJG 1SJAA 4KWUA 1JD7A 4QP0A 2VGBA 2VZOA 4N4QA 3UXLA 2XU2A 5CG0A 4X2PA 3HM7A 3NIYA 5CC7A 4WZHA 2CU0A 1OBAA 1RUSA 2AL2B 4QXIA 1YNQA 4IMDA 4E0CA 1EHAA 4PGLA 3D0CA 1GVOA 4IPLA 2PDBA 4GIEA 4JIPA 3OODA 3QXBA 2DUAA 1IR1A 4Q33A 3LMZA 3SY5A 3DYOA 1A5BA 5PTDA 3PY2A 1WDPA 4GVGA 3TSBA 3BWWA 2ASHA 4LRTA 3RU6A 1LORA 3LX9A 4E8CA 3PBVA 4TUFA 5EMUA 1EJWC 2PODA 1N82A 1AD1A 5DMNA 1RR2A 2C1GA 4O53A 1CYGA 1GT8A 3VM7A 5BOOA 4AZCA 1CNVA 2DW6A 5C5YA 2OLAA 2OOFA 3TTYA 3ATYA 1ISVA 1OK6A 1PL9A 1IEIA 4FNSA 3C3NA 3VD5A 2FDSA 2CLPA 2JEPA 3C2RA 2J27A 5LHEA 5E6ZA 4IUGA 3SCVA 2NT1A 2IPFA 2MNRA 4GFIA 2JBMA 4BEUA 3KL0A 2WWCA 1XC4A 5A6BD 3WNKA 3O05A 1JDEA 5FAJA 3P93A 4IUOA 2YFNA 5FF2A 1EC8A 3NQ8A 3KOXA 3LPFA 3QN3A 3UG4A 4JIEA 2V9DA 3PPGA 1XUZA 1G01A 3WD0A 2XUCA 4PMXA 4NT0A 3GAKA 4X0NA 4E2OA 3F4DA 3M0MA 4HYWA 2YFOA 3W7HA 3ABQA 3R6IA 2QVHA 2E5DA 4QDMA 4ERAA 4YYCA 1WBHA 4Z0SA 4DHGA 2FJUB 4JR5A 4QEEA 4HPHA 2WJZA 2QIWA 4S1FA 1TELA 5GJPA 2DIEA 1GONA 1DQWA 3EWZA 3H70A 1B9ZA 4WX2A 2ZZ4A 4DX3A 2DZWA 3WNPA 3IRDA 4X63A 1K77A 4QX4A 4N6EA 3W2JA 2INEA 1EOKA 4YTQA 1FFRA 1K9DA 4XZNX 2Z2UA 2NW0A 1X98A 4DWSC 3R2GA 3FDKA 3R58A 2VEMA 4L6HA 3IARA 1I1WA 2NQJA 1ICSA 3MU7A 1QBBA 1OYAA 5I03A 5I3JA 1KTBA 2V3GA 3N17A 1CB7B 3KBNA 5G1YA 3TR9A 1PKLA 3LHZA 5E0FA 4MZYA 3NDYA 4JNMA 3ZQ9A 3TROA 3ZZ1A 3B05A 3W7RA 3AS1A 3BOXA 3WQVA 4EVZA 2NT0A 2ZRZA 4RE4A 4A8LA 1OT1A 1PO9A 3S9IA 1FBAA 1VBHA 4UB9A 2V3DA 3F2CA 2HWGA 1US0A 5LHFA 2EF9A 3QY7A 4LUSA 4TIMA 1XGEA 4XSMA 3R8HA 4LS0A 1IXNA 1R9ZA 4TX6A 3UZZA 3SSZA 1C9WA 4F9DA 3QSRA 2OSXA 1ELSA 3WK3A 3SBFA 1W1IE 1YQ2A 4CN6A 3LBOA 1XKYA 5FEXA 1NM9A 3UQNA 2J6XA 3B97A 1IIGA 1Q13A 2WYSA 2PD9A 4AIBA 1Z3NA 5A69A 1NSJA 4DJEA 5J5RA 6TIMA 1C92A 2XFRA 3LBCA 1ZCCA 2J9XA 3AICA 3LTPA 4TU1A 4BK9A 3RMEA 4FALA 2EPOA 3LCWA 2OX1A 5K4ZA 2WNWA 3GXIA 1XLKA 3EWBX 1TWIA 5D2WA 5AC6A 3EMZA 5A2CA 2A21A 4NU7A 1K7FA 1VR6A 4WK9A 3VINA 1J18A 1T0OA 4MNJA 4PODA 1AMYA 1EXBA 2J7HA 4KW2A 1E9YB 1E9LA 2I57A 1IT8A 3W7GA 3LZ3A 4NSBA 3MT1A 3GO2A 1RP9A 1CB2A 1ZPTA 4PBEA 3FHAA 3WQ6A 3AIVA 4AZ6A 4QTGA 3BANA 4Q32A 5J04A 2J8FA 2A6LA 3CZKA 4HZ6A 1W2PA 3WDPP 4JL2A 2IKJA 2D23A 4HYRA 3BUVA 3BDKA 1VEPA 4FX8A 4W7WA 4KQNA 4AXKA 1REQB 1KFBA 1TJ1A 3QF0A 4Z1AA 2CWXA 3PAJA 2VVSA 4D8ZA 1JCYA 2JFEX 5TQLA 3WQPA 4A22A 7A3HA 3OG2A 1ME7A 2Y5EA 3HPAA 4GKLA 2VFGA 1V77A 1UD8A 4PR4A 4IT1A 3UXDA 3WMSA 5G2WA 3A5VA 1WKFA 3LPPA 1RJPA 1TZZA 4B5XA 4TV6A 2H90A 1Y7VA 4IXXA 2FZDA 4UTLA 1FHUA 2I16A 2OKTA 1D9EA 3B0YA 4DJED 3VOGA 2FGBA 4GWEA 1QATA 3L4ZA 1GVQA 3H7UA 3UG3A 1YXCA 2D20A 3E0LA 1LOQA 1XLGA 3I3EA 3S2LA 1TPEA 3HIJA 3T8LA 1QHZA 4OE7A 3D3AA 1FCUA 3MSDA 2QF7A 2VZVA 5T91A 4U5IA 4UR9A 2VC7A 4XZ9A 3VIMA 5I3FA 3FDGA 4F0HA 2P3EA 4RUBA 2HVOA 3QGVA 4JTKA 4XAYA 4A35A 3ITVA 5GPRA 3V18A 4PTNA 4AHQA 4JTDA 5CQ1A 1M3UA 3C52A 3VNZA 1K8XA 3GE7A 1FCVA 2QPUA 1LL4A 1OX4B 4GO9A 3VCRA 3W07A 2PCQA 1XRFA 4XKYB 4N2YA 2VENA 1FH8A 4IZGA 4ZA0A 1JZ3A 3OYZA 4Z2JA 1G67A 1FWJC 3TTQA 2NX9A 3H2EA 1GQJA 3VKCA 1H1ZA 3OZYA 3WNOA 3VKBA 2V5CA 4IIEA 1PKYA 2Y8UA 1UD2A 4GABA 2KX9A 4RK8A 4AIUA 1VFMA 5I77A 3N6QA 1GOWA 1PZ2A 8A3HA 3W3OA 1AH4A 1KTCA 3W7KA 4B3ZA 4UFJA 1A0CA 3EKGA 3UCQA 3G2GA 2GWNA 3V5CA 1KO0A 4M6VA 1GVEA 3CK5A 3TMQA 4MFEA 1E9IA 2PDHA 2NX1A 3M6DA 2OO0A 3W86A 1M04A 1XD0A 4S39A 3W27A 1JDDA 1BGAA 1R87A 5I07A 2DW7A 4GUGA 4I7VA 4XAPA 1R2SA 3ABOA 4S2BA 4IX2A 4Q7BA 1J0KA 3EKLA 4AWUA 4UNKA 1XBYA 3UPBA 2WSKA 4IFOA 3VFCA 3PNZA 5FF3A 2WMIB 4LB3A 4JD4A 1SJDA 4JKLA 6REQA 1E15A 1GW9A 1XCFA 2ZX6A 3LXBA 1E1CB 4PTDA 1S1RA 3KM8A 3WLTA 5HQLA 1BYCA 2BDQA 2FHCA 4GZIA 1H1NA 3GNNA 4YN5A 3BL3A 2QGYA 1UROA 4QROA 4JXCA 3UVAA 1MRAA 3UY7A 3I4EA 4MJZA 1E55A 3UGVA 3W0KA 1KWGA 4MPKA 3FCPA 1TJ2A 3MP3A 3ZT5A 1NY1A 3PWIA 4OIFA 3FKRA 6XIMA 1PTGA 1Y0EA 2WHLA 3N3TA 4IPJA 1WUEA 2FHFA 1UG6A 4V33A 1Q6CA 4HNTA 5H2ZA 3ARXA 2A3LA 1IZJA 2G95A 5D9PA 3KUMA 3GQYA 3UPMA 3ENLA 1XKJA 1H0GA 4M6PA 2Y24A 1QNVA 4D6EA 4CD7A 2AL1A 3M0IA 4G5DA 3TIMA 4FXSA 2CYGA 2ODOA 2GUYA 3CEPA 4DJEC 1REQA 4M56A 2Z1KA 3B4YA 3GTIA 4FF5A 5FSEC 3HG4A 2ZC1A 1IT7A 4B3LA 1VF8A 1XCWA 4AF0A 5C9RA 3N2CA 3RILA 5CPMA 3OBAA 3CT7A 4ERIA 4HCHA 2WVUA 3IIZA 4AZHA 3S4TA 4QBXA 5F2IA 4RNFA 3LCHA 5ECUA 4EF9A 1C29A 3AMLA 3GNDA 3LPGA 3AZTA 4JPGA 4EPBC 3TWAA 1ZP4A 1XYBA 5G4WA 1KRBC 2XIIA 3M07A 3L65A 1UH2A 3STEA 5GQBA 1TPVA 5C8BB 1CBGA 1D7FA 2GOUA 2EG6A 2XN0A 4P8XA 1V3HA 3CL8A 3DFHA 3DX5A 1XW8A 1KFJA 5D05A 4HCDA 4ZFCA 4C7FA 4LFYA 3PZMA 4NRSA 1VRDA 5K9XA 1TB3A 3KXQA 4IJCA 1DIKA 2Q8ZA 2O9OA 3TOYA 3SRFA 5CPQA 2E6AA 1LG1A 5KEZA 1DP0A 2GQ3A 1RD5A 3FYPA 1QOQA 3SUTA 2OZ0A 1PJ9A 4B92A 3URBA 3H2FA 5FF0A 2A5HA 2YLLA 4ZQNA 4RZ4A 3QR3A 2XGIA 4JTUA 1N8IA 3S1UA 4P8UA 3N29A 3CLMA 1O1HA 3RHGA 3AHZA 1E40A 2V2HA 4L65A 5K9CA 2VEFA 1J0ZA 2F84A 3SEPA 1VCFA 2RUSA 2PWUA 3BLOA 4ZO7A 4JFVA 5ABEA 4FZIA 3KS6A 4Z1DA 2VR4A 1V3JA 4Q8NA 1VS1A 1SZNA 2WCAA 3DOPA 2PDGA 4DPPA 2ZUWA 1H41A 4UIOA 2FB3A 3PSVA 3G0UA 1OVDA 1YDOA 3VK5A 4O50A 3P80A 4KETA 3IJDA 2HBXA 1QI0A 4MNKA 2CBIA 1PE1A 1WAWA 4WDTA 3WF1A 4IGMA 3TOPA 3WDHA 4KRZA 2WM0A 3UR8A 1EH9A 1IEQA 1E5NA 4KBXA 4LC8A 2V5JA 3MV11 4DF1A 3BO9A 1JCJA 3AJ7A 1MO0A 2JIWA 3E3HA 4GJIA 1VIWA 5HPOA 1UH3A 1RHCA 4H19A 2ZUUA 3DG6A 2ZX5A 1K70A 3INPA 4I9JA 4NL1A 2ALDA 2BFGA 3PC0A 5A2AA 3V36A 4QE1A 3NDZA 2ISVA 3MCOA 3TX9A 2NUWA 3PANA 4WDWA 4O1EA 5C55A 1NDVA 1MXSA 3I68A 2VD8A 2PTYA 3QVQA 4DN1A 3PZNA 1A49A 3M44A 2WMGA 2ZX9A 3GTNA 5FKYA 4F3HA 4O18A 1S38A 2UY5A 2DSVA 1YLVA 4Q4MA 2Y7EA 1BYAA 4RDZA 4XD5A 3MPGA 2X30A 3GD6A 5HMFA 2ZUSA 2KAUC 1VD6A 5DANA 1TV8A 2FJKA 3IGSA 4XTDA 1BKSA 5T26A 3WD4A 5C54A 2QPSA 2V67A 1RD6A 4C1LA 1ODUA 3GNRA 3ONCA 1VKFA 4MADA 6PTDA 1R5YA 3QM3A 4HA0A 1AJ2A 3AS0A 4PMZA 4E2DA 2OOGA 4NKCA 3K8KA 2WW5A 4JFWA 5LSMA 3IJLA 1NOFA 2QLYA 5DEZA 4YU1A 3QTGA 4L61A 4KRTA 3O8AA 4DLFA 3CS2A 2XJ7A 4S38A 1VFOA 2NSOA 3W81A 3QZ6A 4NX5A 3RM8A 1EJSC 5I3IA 3WLJA 4C6BA 2B7QA 4BR1A 4C7GA 4QLKA 4AX7A 2A2IA 2ZDSA 1US3A 5ABGA 1VHCA 1G1YA 2EPMX 4D71A 4C6DA 1AQ0A 2GJPA 2EJ1A 4NZJA 3ME3A 4PMNA 1G94A 4LUTA 3SAZA 4ATWA 1CLVA 5HPCA 1TZ7A 3VC6A 2Z4GA 3BXWA 3BLKA 1UJPA 1FKXA 3TAKA 2BXYA 4HNCA 1KCKA 1GEHA 1BVNP 1VJIA 3GZAA 1OFEA 3WLSA 1AH3A 3R7MA 3FFSA 1MW0A 4C1NB 5T8GA 3BGGA 3RO6A 4CVWA 7REQB 4AD2A 1X7FA 3W1TA 4UMAA 4PTVA 3R5EA 3FEQA 3CHVA 5HMSA 2X7WA 2C1IA 2GOKA 1JPMA 3H21A 2H8XA 4U2ZA 3IVSA 2Z1SA 1O7AA 1RJRA 4HHLA 3W83A 4MZ8A 3GXPA 1H51A 1XS2A 2QIIA 3FJNA 2POTA 4OOUA 1YRRA 1O5RA 3P81A 1VC4A 4R7OA 3NOEA 3PVFA 3KOYA 1OZMA 2XSBA 4LBRA 1EX1A 1AZ2A 4PUMA 1J4EA 3OU8A 1S5VA 2PDIA 4QSFA 4LAKA 3G1XA 5AC4A 4U10A 1WXJA 3NL6A 4WXZA 3BZGA 1ZCOA 2OZ8A 2PZ0A 4LJ3A 1VPXA 2F6KA 2J7GA 4RLIA 2CPUA 3STCA 3KVMA 4E3TA 1W3HA 3PZGA 2ATSA 1W3KA 1IWAA 3VKKA 4Q8OA 3H2CA 4M82A 2R6OA 4E2VA 3TV8A 3W7EA 1ZBKA 4J4KA 4DBDA 1G6CA 2Y1HA 3TA6A 4DY1A 1DWJM 3CWNA 3DZ1A 4ZMGA 3B9OA 1VFSA 2YDAA 3WDJA 1EDTA 4GISA 1EUNA 3OO2A 3IIVA 3NTYA 4H04A 3LMYA 1PIIA 4UXDA 3WMLA 3COTA 3GG7A 2P1FA 1TV2A 1D3HA 3KCLA 3I6RA 1XV8A 4PRTA 5DQPA 4CNNA 3B06A 2VUYA 3OLIA 3LYEA 4I5UA 2GJRA 5E1QA 3M4HA 2P10A 4PBGA 4HNLA 3E0FA 4PUDA 1L8PA 4H4IA 3AHTA 3EB4A 3A24A 3W25A 3W26A 1P0EA 2A3BA 1LBMA 1LROA 1HN1A 2BVYA 4UTJA 8RUCA 2VCCA 3H7VA 5SWUA 1ME9A 4DUWA 2VZSA 4AD4A 1Q8JA 1PX4A 2P50A 4EF8A 3ABZA 5A6AA 3W2NA 2OQYA 4MWAA 2F2KA 1ZAIA 1PYFA 4HJFA 3QY6A 4FIRA 3N11A 1O60A 2PDMA 1HL2A 3T08A 1LUCA 4FS9A 5JIPA 2WMHA 7ENLA 2PF8A 4YYFA 2QVNA 3PB0A 5FJIA 1P0KA 3N12A 1TWSA 4HTBA 4O19A 2VEKA 4GCAA 3L0GA 3NQ7A 2PLKA 2GSEA 4D6FA 1EQCA 1AD4A 1QHOA 5HJLA 3VDHA 1EWEA 4E4FA 3S1WA 1P6WA 2HVMA 2WQPA 4ZQMA 4AD0A 1XC6A 3NXFA 3SCWA 2E09A 2D2GA 4WR3A 1RCOB 4RKAA 3D47A 2NQZA 3L23A 2PGWA 4O1BA 3VNMA 1S5WA 2XN1A 2INFA 4I3GA 2JF7A 3V35A 2PLMA 3EXRA 4O10A 5AHIA 1Z69A 4S23A 2VT0A 4CD4A 2PP0A 3D6NA 3WQOA 3LCIA 2ZXBA 3TONA 3M16A 2F6UA 4FOKA 4X0VA 3WF2A 1T8XA 3W7OA 3SADA 2AAAA 2YBUA 4EXBA 3ZO9A 2ZA2A 3VIHA 3OTRA 4B5SA 3CC1A 2FMOA 1HFBA 3WSUA 3WMBA 3UA3A 1JCTA 1HJQA 3WH6A 2J13A 3LTYA 1E9ZB 4S3FA 5CZJA 1IGWA 4GGHA 4GIYA 3EWWA 3W1MA 1ICPA 4MWAD 2UZ9A 3IEBA 2BOGX 2WLZA 3BAIA 4Q8WA 3SO7A 3F2DA 4XAZA 2Y85A 4LC6A 4JEJA 1LBLA 3K2GA 2GGHA 4HSNA 4QDPA 1HO4A 1A3XA 2CKRA 3N25A 2YCLA 1VENA 3W9ZA 2DVXA 3QMTA 3H24A 1L6FA 5BMWA 1HJUA 4Z2GA 4H9XA 1DYSA 3BLDA 2ANUA 2Z0IA 1I0BA 5H91A 3WQGA 4RE2A 3D5HA 3OOQA 1BHGA 4Q7IA 4QDWA 3MW7A 5EBUA 4C6NA 5LZLA 2V68A 3V5FA 3V7PA 3ZMRA 3BMVA 3CZEA 4JYEA 3F4NA 2FZ8A 1M7PA 3BLPX 4B5WA 1B3VA 2JGYA 2J7EA 1EC9A 5CZKA 1A5SA 1GYLA 4DF2A 4QLLA 1ME8A 3MQTA 1RH9A 8TIMA 3LBMA 3N34A 4X9SA 3U0HA 5EMYA 2A1YA 4LAOA 3UETA 4LANA 1Q6LA 3P7YA 1DXIA 3HB9A 3KRSA 4HK6A 1SFTA 1DXFA 4XV0A 3V1PA 1QVBA 4HB7A 3C2VA 3QMSA 2YL6A 1FH7A 1NQKA 4AD1A 3A4WA 2FPYA 1W9PA 4OZOA 2AMXA 4E2BA 1AA1B 4ICMA 3H54A 1DVJA 2H3BA 2YDQA 3W75A 1Y8BA 4AWEA 3CXOA 4HK5A 3NZRA 1X97A 4H01A 1YDVA 3SUSA 5A8OA 1CPUA 1X1OA 3WH8A 5J5DA 2QS8A 4LW7A 4DAFA 3SCPA 3AU2A 1BTMA 5AZ1A 2GQAA 1W3TA 4JQ4A 1U5JA 2OPJA 2PDFA 3DFQA 4EXQA 3U3HA 5JU6A 3B0VC 2XZ7A 3MP5A 1J5SA 4XAGA 4ZEPA 2CWNA 1BRLA 1H49A 1T40A 4JICA 1B57A 1IQ8A 3WBXA 5J8LA 3V0SA 4M24A 5FJOA 1TV5A 2VEIA 1EB3A 1VLIA 5FI8A 2X2GA 2G41A 4J3UA 3NDOA 8XIAA 4PRRA 4A6GA 1SR9A 4CCDA 3GDKA 4H41A 1UHVA 1EDQA 3TYAA 2PB1A 3EKZA 3T0CA 4ZOEA 1M41A 4RNIA 4ZOAA 3AIBA 5EL1A 4L64A 1W5QA 2AQWA 4Z1CA 3A4AA 2CHNA 2DUXA 3AZSA 2QCEA 5CZTA 2FYMA 5D9OA 1S2AA 3FX4A 2O55A 2OSWA 1RALA 3AAMA 2VDIA 5A6LA 3SCUA 1G9HA 4G7EA 1LCOA 2CXGA 2QQ6A 4DXXA 3THUA 3VDCA 5B7YA 3CUFA 4CN1A 4LUIA 3LRMA 1GVSA 4CQBA 3KBSA 3ZR6A 2DZTA 4DXKA 2TYSA 1IZKA 4P7NA 2VTFA 2V5BA 3PJUA 4OBTA 2GLKA 2AKMA 3ERPA 1TV4A 3NL5A 3HFYA 3NGFA 1H60A 1K6WA 5I23A 1KQYA 4QHRA 4FHAA 4MKSA 1EZWA 4MWAC 2WHKA 3FGCB 1B3ZA 5IHSA 3WF4A 2ABBA 2VQUA 1IIHA 4JFTA 2RKXA 2A3HA 5XIAA 1XPGA 1EJRC 2XH0A 2Z6IA 3T4CA 1E3ZA 3N2TA 3VIIA 1QPKA 3HGSA 4MWAE 1RJQA 4AY8A 3P60A 4B9ZA 5CPLA 3BH4A 2I1OA 3OA3A 1LBFA 3WL0A 4IGHA 1SZEA 4W9TA 4CNTA 1S5NA 4MB1A 4UMCA 1JYXA 3W2LA 4MMWA 4LT9A 4X2RA 4RZ6A 2PP3A 2EBNA 1J96A 1QPRA 5I78A 3CQHA 2HE8A 4IM4A 3W7MA 1QXLA 3ZFHA 1XD1A 2FGLA 1OX6A 1F3WA 2E4TA 2X1IA 2UY4A 2FZMA 4JTJA 3C0QA 1J6PA 2NUXA 1X8FA 1X1NA 3IWPA 4LYKA 1GG1A 1DWFM 5D8ZA 5LNSA 1B0IA 3BVJA 3UXKA 4LVAA 4AVNA 1IXOA 1LLOA 2I5IA 1PX3A 3VZYA 1H1YA 1JDFA 1CGTA 3DERA 1MI3A 3UNDA 1K1DA 1SZGA 4ACZA 3WYZA 1WB0A 1A0DA 1VBGA 1SSGA 2X1TA 5EMMA 1SU5A 2G3FA 4ASTA 3CZLA 3JZEA 3VU2A 4ZSUA 3O6DA 2GPTA 1PZ0A 3NVDA 2YA0A 3SJNA 3BCFA 3R8RA 5C70A 5BXTA 4US5A 2Z24A 3BC9A 1V02A 2QCLA 1Q3NA 3E0VA 5C0QA 3L67A 3EWDA 2XIOA 1MDLA 2WNQA 2DQXA 3ARVA 2J77A 2WCSA 1MNZA 5BRPA 1V3IA 1K4GA 2X41A 1TKKA 2YA2A 2DPEA 3T1GA 1VP5A 4FNQA 2WVVA 4ZBCA 3WNLA 3MYPA 1EJXC 2VI0A 1F9CA 1X96A 2QHAA 3KP1A 1E51A 4GZ7A 3GTHA 5IM51 3KP0A 4C60A 1DV7A 2OQHA 3B4UA 3DFNA 3WK1A 2XM1A 1F3EA 2HQAA 1MXDA 4M6QA 4IFKB 5CJNA 4H9TA 4WD0A 4A8IA 3GR8A 1MW3A 3P0WA 1U30A 3BARA 1Q6OA 1QJWA 5F7UA 3IIOA 3ARPA 1V6YA 4HJWA 3PWGA 3TN4A 2XGZA 3M47A 1SFSA 1FVPA 1EWDA 4YL2A 1HJXA 1BXCA 1GZ1A 3H4WA 2WSYA 2Z26A 1BSLA 1LG2A 2XYLA 5HWMA 1U1UA 3UF9A 5REQA 2OWXA 1J2WA 3K4DA 1NU5A 3GDRA 5LA2A 1L6GA 3KL3A 4YNGA 4EKJA 2EXOA 4F40A 3H4GA 2WMKA 4L6OA 3C2FA 1A5MC 3PNUA 1C8VA 3VKJA 4PMOA 1GUVA 2A3AA 2YXXA 3OA5A 4BI5A 3UWQA 4BCEA 1R46A 4XZLX 4JN6A 3N4AA 4C6EA 4DZ5A 3RCYA 3M0LA 1I4NA 3LRLA 1VFLA 4H1ZA 4KFPA 3C4UA 3TLQA 1GOMA 3G0XA 3GH4A 2ZADA 3LI1A 3WJZA 2RJGA 1CW2A 2VUNA 3P6LA 2RFGA 3CJPA 4NNBA 3GKAA 2YZRA 4RV3A 4H2CA 4W5UA 1YW1A 5IHRA 5BRQA 4HIBA 3BJSA 5CZSA 2A0NA 3C0SA 4I9AA 3ALGA 2FVKA 2G50A 5A8MA 3OW1A 4O1FA 3VGDA 1F3XA 2AKZA 5LGXA 2X42A 1YMYA 4HPJA 4CNUA 4LVFA 3SZ8A 3AS3A 4K8HA 4W8LA 1TUFA 2ADAA 3FJ4A 4YWSA 3WQ5A 3RM4A 4AY1A 1ECQA 3ATZA 4IHCA 1A3HA 3LS9A 4MIMA 4LY4A 4YCOA 2PDPA 3E2SA 1KLYA 4KIEA 4N7QA 1B4EA 1XX1A 1NWTA 4C6LA 1ZGDA 2YIHA 4S3CA 2HZGA 4RDWA 1JCMP 3LI0A 2G96A 3WUGA 1GEQA 1H7WA 1D7KA 2PRMA 2IKIA 2PDKA 4G1KA 1B3WA 1RQEA 1V8EA 3L12A 2X09A 2BY1A 3QR1A 5GJNA 4AWSA 2Y62A 5D33A 3U9IA 3STFA 1MZHA 2PWGA 5EMKA 4JTEA 4KS0A 1UP2A 1QU4A 3AHVA 3BTNA 3K46A 4FK9A 1Z41A 3GR7A 3B3DA 1O66A 5HUPA 3EDKA 1OM0A 3GVRA 2CLFA 1SGJA 1KQZA 4XSLA 2CZ5A 1RLCL 3CH9A 4WSKA 3CT2A 2VO5A 4HU8A 3MJMA 1OCJA 2G3JA 2B31A 4N9BA 2RDWA 3UERA 1C91A 4U3AA 5KZDA 4IPPA 1JL8A 4DM1A 1WBJA 1BGGA 2C18A 3NQCA 3SY1A 1M03A 1J0HA 2ZX8A 4LNYA 1GQIA 5D2YA 5EFDA 3IIXA 3WH9A 1NELA 3KWXA 4M29A 1A5OC 1CCWB 4MY9A 3RAOA 5FEWA 2BP1A 5E0CA 4O0QA 1PVNA 3GU2A 1Z44A 2QUUA 5G1TA 5TAOA 2ZX7A 3KLKA 4Q3MA 4HOXA 4FNRA 1OD0A 2C15A 3S1XA 3RJYA 4XBSA 1H7XA 1WYIA 4M81A 3N2OA 3KTCA 4PE8A 4DO6A 3TNBA 4NAEA 2I5QA 3OQEA 1MW1A 1GPWA 2O9RA 3CUIA 3DBPA 1FFQA 3K30A 4RJEA 4IFKA 1DKWA 4XG1A 1YTEA 2YLAA 4UTIA 3HPFA 2OZ3A 3PULA 5MKGB 1W3NA 3G1AA 5KETA 1ZRQA 1FTXA 4ICCX 3IUIA 1XIJA 1HKMA 1FQ0A 3U2OA 2GVJA 4AISA 4DUOA 1IXPA 5BROA 2XPKA 3O6YX 1FWGC 5KINA 3POCA 2RGMA 1XLEA 2PBGA 2QT3A 4NZFA 3WF0A 2WKLA 3OZPA 3KZSA 1QWGA 3P84A 3TTEA 4FNTA 3R1ZA 4PUJA 4WSJA 1GTHA 3LXAA 1SUXA 3TU9A 2Z6JA 2XM2A 3GS6A 4BQ4A 4F0SA 4H9ZA 1KM4A 3F4WA 2PTDA 4IL2A 1HX0A 4UTKA 1DWIM 1GNXA 1MNSA 3EOUA 4Y96A 3ID7A 4WXYA 1LWJA 1G0CA 1IT0A 3W7PA 4JGDA 3WLNA 2FDMA 2DSZA 1C93A 4GQRA 4B5NA 1I75A 5FD0A 2YXOA 5JUVA 2O92A 4JHZA 3TXVA 4AZBA 7TIMA 4DUXA 1A53A 2AGTA 5CLTA 3VILA 4PCFA 4TTGA 5DELA 3A21A 5BRBA 1UR1A 3CPRA 2PSNA 3WZ0E 1C8YA 2TSYA 5LYRA 4YPJA 1H61A 4JS3A 2NV9A 5GVJA 2PC8A 4YVVA 3A3XA 1SO4A 1F5ZA 3ANVA 2V82A 1Y5XA 4DYEA 2ZRYA 5DCEA 1M5WA 2VC9A 2WSQA 2WMFA 2A4AA 4JTQA 3LM3A 4MJMA 2VJXA 5C2CA 1NDWA 3URNA 1K7EA 3A12A 2XIMA 2WB5A 1X6UA 1OSEA 3MSYA 3WJSA 2DSUA 3CHDA 5AVNA 5C2GA 1QI4A 4XO7A 2X0SA 1P1XA 1GHRA 3NZPA 4LVGA 4HK7A 5M1TA 2XTKA 2R1NA 3U2ZA 1M01A 3MDWA 1V0LA 4W4QA 4JFSA 2D22A 4HMCA 3IVTA 5HMDA 3W37A 1NWSA 1XLIA 1XLDA 1H3GA 3GG0A 3HN3A 1U5VA 3A23A 4UQ9A 2FMNA 4WHBA 4X61A 3G3MA 4JIQA 4W8AA 4I7UA 3F2BA 2VL4A 1DORA 2E8ZA 3DC0A 1BQGA 4N42A 4WY0B 3U4FA 4LS2A 2FTYA 2OG9A 1TWWA 3DU0A 1TIMA 4WOZA 3ARWA 1QI3A 4XAFA 2CLHA 1R3QA 3I6TA 2V3FA 1K8CA 3IK2A 3FAXA 9RUBA 3VGFA 2VFHA 5D03A 1CXHA 1DIEA 1VCGA 5HINA 4TMCA 1MWOA 3ABXA 3WUFA 1U22A 3WN6A 4IMFA 1W0MA 3W02A 1UKOA 1JRBA 1IEXA 3F1QA 3T07A 3VOIA 2Z1WA 2DZXA 1XBZA 3M5YA 4WJEA 4NILA 3VYLA 2VOTA 3HA1A 1VB9A 1YEYA 1PB0A 3ITYA 5HAOA 1SVDA 5C7VA 5M3WA 1UR9A 4NAFA 4E4UA 3GDBA 1VPQA 1LJYA 3ZVHB 4DIAA 3GW0A 4K6AA 1R8LA 2VR2A 3GHSA 1E5JA 4V28A 3T0BA 2GZXA 1HVQA 3AIEA 5FEZA 3MDUA 4S3EA 2XVLA 1X6LA 2WHMA 3DG7A 4JDYA 2V2CA 3ZIZA 3L2LA 4D6CA 1L0PA 2BODX 1UZDA 2O4MA 2J9ZA 2EGZA 1QUMA 1OCBA 3ZSTA 4V1XA 3MMTA 2PDXA 4D8LA 1EF2A 1DJXA 1TREA 2HNEA 4D6HA 4GNVA 4DYJA 3GTXA 4MLRA 3IJ6A 3W7JA 4M51A 4RDVA 1Z8AA 1JCNA 1OIMA 2QCMA 3CO8A 3FA5A 1IHIA 2BY3A 5LXEA 4C5ZA 2RJHA 1UCWA 4IOTA 4EOUA 3EGJA 3GZ3A 4UTUA 1UMYA 2JKPA 2GL5A 5D02A 4O57A 1Y5VA 4FR1A 4B3KA 4DBSA 4XBKA 3C86A 3NSXA 4JDBA 3NYDA 2YDSA 4MLJA 1RPXA 3GVWA 1GOKA 2ATMA 3K4AA 4X9YA 1BYBA 3STGA 1CT5A 4NG3A 2Z7GA 2PUZA 4ZODA 4L9XA 4IGNA 3SRKA 3M0YA 4JX4A 1NIUA 3E6EA 3GW3A 3O0FA 2QDHA 3P5ZA 2JE8A 4GFSA 3PZIA 2D24A 4H6RA 1GKQA 1GZJA 4HT3A 1B31A 2CIPA 3GG8A 1RCQA 4CU6A 2BVWA 2X40A 3HGOA 4FPSA 4RL3A 1FHDA 5LA0A 3WDIA 5CGMA 2XH2A 4WSHA 4F2TA 2ZZ7A 5CC3A 2A7NA 1XCXA 4HU4A 3W1PA 1WDDA 2DY3A 3G1HA 1YNYA 2W61A 1XH1A 2C1HA 2PWFA 1YTDA 3C0JA 3LENA 1ECEA 1UR8A 1W37A 4GINA 2PLJA 3H6OA 2YJQA 2P5NA 3W1QA 4LF2A 5U4NA 3ZLFA 4JHMA 3B8WA 4DXVA 4XD6A 3BQ6A 1VBUA 3PM6A 2YSWA 2W92A 4XZHA 1NH6A 3W76A 1P7TA 3GU1A 3EBVA 1I2OA 1TRIA 2CLIA 3AXMA 5JBDA 3PG9A 2QCDA 1J6OA 3NNTA 5C7HA 3N18A 5A6MA 2NX3A 4KH2A 3W84A 2C16A 4JTFA 3UT0A 3VX0A 3GYCA 1OADA 1E0UA 2IKHA 1SFLA 5I7GA 4GI4A 4P61A 4YXGA 5I2UA 3LZ5A 1YBQA 5E70A 1KBBA 1ITQA 1D8WA 4UOQA 3LV6A 3MO4A 3MO7A 4Q4QA 4WKHA 4XD3A 4G6CA 4Q7NA 1XBVA 2BHYA 1KFCA 2WKGA 1ZS2A 2PCEA 1WAUA 2VZUA 1I2PA 4QAWA 3F5LA 1EBHA 1RCXB 3QV6A 1SW0A 3LCFA 2BTMA 1IXQA 1TX0A 4CU8A 3W1XA 3RIKA 1XIFA 1JPIA 4DZIA 3W7DA 1G4TA 2TAAA 3QMRA 4ZL1A 1QW9A 3LGEA 1XISA 3LHVA 1NFBA 4NZ5A 3S5OA 2WC3A 3ZYZA 4R33A 1TZ9A 4QJ3B 4MY8A 5JIWA 2EJAA 4XZBA 4EWJA 2GJXA 2GYIA 2DGAA 4LXFA 3CUGA 3ITXA 3WQFA 1R85A 2QMKA 3VD4A 5DMYA 1S2UA 2V81A 2E7FA 3GTFA 2WXDM 3S47A 3VXGA 5DF0A 2XIBA 2OCZA 1RA5A 3GSMA 4IIHA 4X60A 4C7DA 1W1YA 2Y2WA 5AYBA 1UWTA 3E38A 2QUMA 3IS4A 3AWOA 3DEQA 4PA8A 4PB3A 4LWWA 5DXYA 3CAVA 3AOFA 3HG3A 2QV4A 5I09A 1MFUA 1DTNA 4Y9NA 2PZNA 1OC6A 1UKSA 1UOKA 4QE5A 3WQWA 2R8WA 1I1XA 3MBFA 1L2UA 1F8MA 1E43A 4Y9AA 4PRWA 1HGYA 3VIOA 2DV0A 4GBUA 4Z08A 5HUOA 3AMGA 3BSMA 4MHBA 1Z48A 2QJGA 4EIVA 2W9MA 3BMXA 4K7VA 5AECA 2YB1A 1JZ6A 1V0NA 3UJEA 3QR0A 4A8NA 3PBGA 2VGGA 4ACYA 2V5LA 3XISA 4XIMA 5G1MA 2DU2A 3ZR5A 3UVIA 4DZHA 1AW5A 4I6VA 2W63A 4HGXA 5H8UA 2VHLA 3ARSA 3NPUA 3BPWA 3HQNA 1UASA 1WNOA 3MKVA 1NTHA 4MDPA 4B16A 4MYAA 1XIBA 5C9XA 3UA4A 3USBA 3W82A 1HW6A 3QC0A 1BQCA 3KWSA 1WKEA 3DBNA 2VEGA 4QJ5B 5FL0A 4REQB 4O4WA 2VVNA 3CQJA 1MSSA 5CG7A 2QAPA 4U28A 2PDWA 5LIUX 5FACA 4H7ZA 3WEMA 2Z29A 3BLIA 1TJRA 3TFCA 3L5MA 4BF5A 4G56A 4E38A 2FVMA 4HA3A 4GY0A 5E6YA 8XIMA 3QOMA 3LXCA 1P6BA 1W5MA 4J3XA 3RF9A 3TK7A 2Q09A 5AC8A 5TD4A 3IACA 3CQ0A 3PUDA 3MP4A 5KZEA 4PULA 3VMPA 1KXVA 1FHVA 2J9YA 4GQQA 1F05A 3SJ3A 2VRJA 4WLCA 4AYSA 1UP0A 3DHPA 2WO5A 2VQTA 5HULA 4NZ1A 3IVUA 4FNPA 3MMWA 1PXGA 3KE0A 4QCFA 5A6TC 4W5ZA 3I65A 2OZTA 1CDGA 4DJDA 2WZHA 4JCMA 4AVFA 3FIGA 4JTTA 4GYPC 4CGTA 2PEVA 2KZHA 4WUIA 2QGHA 3UWEA 1QPQA 3N19B 2W6RA 2VURA 4URIA 3QPYA 2NVAA 4G2DA 5IFPA 3MV01 1GOXA 3AJXA 3CMGA 2GGIA 1IEVA 4JKKA 1HF6A 2NQHA 3FY1A 4GX9A 1QRQA 3PZVA 3ZR4A 3RLHA 3U2CA 3RLUA 1TVPA 2ALRA 3IJ9A 2EPKX 2QJJA 1XICA 3KCOA 3WMCA 1EA9C 1C8XA 3DG3A 1L6YA 5EBAA 3UG5A 1R9YA 3IAQA 2Q71A 1MQPA 4LPCA 4D6IA 2O4QA 1KRAC 4QNEA 2XDFA 4ATLA 1ZALA 1XIGA 4FA3A 5D30A 4DJFA 3B40A 1SSDA 2DIJA 4TOQA 3CV1A 4ZO8A 3HOJA 3VNKA 3ZJ7A 3B0UX 4LU0A 2DUZA 2EPHA 3REQB 1C7TA 1IEWA 3L4TA 4CD8A 2BWGA 4XX6A 4XIAA 1KR1A 1G4SA 4J40A 5D37A 3W7CA 3EXSA 1Q6GA 3MA8A 1W6TA 2V8ZA 3QSTA 1YPXA 2QXWA 2L5HA 3PB2A 3R25A 3CHFA 4MY1A 2Y63A 1Z9AA 3KBVA 1BPLB 3MKKA 1XQLA 2DT3A 1UKTA 1BEUA 1OT2A 5L6UA 1SQ7A 2P76A 1CTNA 3VZXA 1HKJA 1J10A 3AMDA 4DI9A 1OIFA 2W66A 4KMQA 5ABFB 3NPWA 1R3VA 4F48A 3GAYA 3WY1A 5E5CA 3PTDA 5LKYA 2H6RA 2HVNA 2ZRVA 3TW9A 1ENUA 2P8BA 3LNPA 2REQB 3ABRA 1BKHA 2WPGA 3V0UA 3EPOA 4XZIA 2PDYA 3JRKA 3K13A 5AC7A 1UH4A 5G4HC 2JF6A 4ZFMA 1OC5A 1HUVA 4IXHA 2Z2BA 4A3UA 3MCNA 2HXUA 2GSHA 1F7BA 2QJNA 2F38A 1RY8A 4C6IA 2OYMA 1UC5A 1BF6A 1FWHC 1XBXA 2DEPA 3ECQA 3OVQA 4OJYA 3U5YA 3MSGA 1J79A 1KW1A 1H5YA 3W6MA 4DJFD 1DBTA 3W74A 1C9DA 3MY9A 1OFRA 1H0IA 1FWTA 2PF0A 5DBTA 3AYVA 5HQMA 1SW7A 4U33A 1JF6A 3LD5A 4QAIA 3LSBA 1W1B1 4XZMX 4J35A 1XRSA 3A5FA 3LEPA 4Y2WA 3VO0A 5CJ5A 4IICA 2O7QA 1TX2A 4IQJA 2V2DA 3MUCA 2NSXA 4ZQPA 2QDDA 1AQMA 4QR6A 4HN4A 1KBIA 3RR4A 3Q2DA 5HBFA 3H55A 3L5AA 3TVAA 3UJFA 3N15A 3PJWA 1P4CA 3NM1A 3PZUA 1E56A 3FS2A 1KFLA 1R3SA 4N9CA 4JIRA 2W67A 4IWWA 2PGRA 4ZTYA 2YB4A 3S6OA 4RW3A 3O07A 4C5YA 3FA3A 2GUUA 4P7QA 3MC5A 2E77A 3GC4A 1GHSA 1HL8A 2OELA 2WSRA 1LRQA 2QW5A 3NSMA 3XIMA 1CWYA 4IG2A 3S3GA 1MUWA 4BKNA 2GDQA 4AMCA 4PC8A 3AO0A 3N13A 1H7OA 1WCGA 2QJMA 3EX1A 3OVRA 3QYQA 3GR4A 2VM8A 1TTQA 5CSUA 3TAOA 1PX8A 4RPQA 4IMGA 5E9XA 1BAGA 1JAKA 3H2AA 4PUUA 5JBFA 1E71M 4H2HA 2A79A 3BLLA 4UNLA 1A4MA 4H8NA 1DJIA 1SO3A 1MW2A 1RQBA 1KXHA 4LH8A 4HOWA 2D69A 2OMAA 1XLBA 5CGTA 2G37A 2NWSA 5IRPA 3LHUA 4BS0A 4DRSA 1A5UA 4AH7A 1JUKA 4GMEA 1XHGA 1PZ1A 1W9VA 5CCZA 3GVGA 4PYSA 4DPQA 1CXKA 3HO8A 4K7YA 5I3KA 4PMJA 3N6HA 1EPXA 2FB2A 4GJ1A 1KFKA 4EACA 3UWZA 3KFTA 1XYCA 4M7TA 4WKFA 3HURA 3OPSA 1S2TA 3A13A 3T7VA 3WLPA 1JUEA 2QUTA 3OZOA 4ILSA 4Q6XA 4KGLA 1ADOA 1ISXA 1S2WA 4PBFA 1JIBA 1OQFA 4XD4A 1THFD 2OJPA 3MWAA 2RGLA 3CM4A 2WZIA 4BY3A 1GOOA 2VOMA 3EPNA 2I17A 2QCHA 4HCLA 1SO6A 3OP2A 3UJRA 2RHGA 1R2RA 3AS2A 5DT5A 2W3ZA 1M7XA 3UFYA 4AHPA 4ZO6A 5DXXA 3RRAA 3P82A 5F1VA 4PB5A 2I14A 3MZ2A 3N2BA 5HNUA 2GWGA 4E8DA 1FOBA 3WLHA 3NZGA 4J2PA 2Y0FA 3GDMA 2GGJA 4CNSA 4KEMA 1NQ6A 2PDNA 4GK8A 2DZUA 4JX5A 3UJSA 1MUMA 1W1ZA 1V93A 3TYEA 3A3WA 4UNIA 2ZUTA 1UWSA 5FAGA 2ZXDA 1BSIA 1WKYA 2E9LA 3JR2A 4NXSA 1EJTC 4DJFC 1X1ZA 5KZMA 4FLQA 3K4WA 4XZWA 1OZQA 1V79A 3GHUA 5DMMA 3U7VA 2J47A 3WL1A 4RDYA 4XWUA 3BK0A 7ODCA 4Q4RA 1TPDA 1HKIA 2AL2A 1BF2A 1Y65A 1HIZA 1B3XA 5CLWA 5A8QA 2CZFA 5AYIA 1UR0A 3W2UA 2D2HA 5DRCA 2YX0A 3SSJA 1X6NA 3ARUA 3KVJA 1XPYA 3NSNA 3VMNA 3OLEA 4RZBA 3GLCA 2HV5A 3S2JA 2C79A 1J2BA 4EX4A 1HTIA 1YPFA 1VJSA 4KEVA 2BSLA 5EKYA 4ZE4A 2Y70A 3FA4A 2B7OA 3GC2A 4ERGA 1CLXA 4JYFA 4UTMA 1J8VA 2C71A 3QBUA 4AEFA 5CPTA 3G6LA 4O12A 4M19A 3BLEA 3FSTA 3CWHA 3RO8A 2GGEA 3U7BA 2VEPA 1V3KA 3A64A 3UWWA 1EFZA 1UD3A 1XG3A 1UBPC 4I8YA 4H6KA 2WBGA 4WDUA 2Y8KA 1YXDA 3TXZA 5BCAA 2C14A 3G8RA 3CZGA 1DE5A 1Q6DA 1YADA 1LOSA 3VIFA 4MKVA 3W2KA 1WZLA 3KRBA 5KZ6A 1A3WA 1E6XM 4QFUA 1TA3B 5BYWA 5D9NA 4E4PA 1DHKA 3S1VA 2J25A 4ZSTA 1CXEA 4QQUA 1J12A 1F6PA 1BVWA 3BOLA 4H6QA 3RITA 2OU4A 2EG8A 1R2TA 4Z2HA 1NF7A 3E12A 5EMJA 3MANA 3NWRA 4HZMA 4HHMA 1VPYA 2QCFA 1EC7A 2IS7A 3W00A 4M6UA 1DJNA 1OFAA 3HGJA 3T78A 2RDTA 5D32A 1YX1A 4ZOCA 1UA7A 2ON3A 5D9MA 3MTWA 2OSYA 3WH5A 5A5WA 4OQVA 3CO4A 3AIRA 4UOJA 2A6NA 4OWGA 1DE6A 1GVYA 3EX4A 4J3WA 3PPCA 5D8WA 5KMYA 4D72A 3FJLA 4WDXA 5AZ0A 1EXPA 1TPWA 3UCCA 3LSCA 4AFYA 1CIUA 3M7WA 3FJ6A 4NQ1A 4OT7A 3FLUA 1AZ1A 3T44A 3AXIA 3POHA 3DGRA 3DCPA 5A6KA 4Q8VA 5MHBA 1O12A 3W2MA 3GFZA 2FHBA 1EUAA 1KBKA 1Q45A 2W0UA 1EOMA 4NF7A 2ZOXA 2E1DA 3W87A 2TMDA 4AB4A 5LIKX 3GHRA 3NR0A 4NYYA 3IUDA 5A95A 3B9NA 4BEQA 4P5UA 1EIBA 3T09A 4QCEA 3AMKA 1F73A 1I8JA 1V7AA 3G1RA 1CZ1A 4NI3A 2ZRXA 2D0GA 5G2HA 3FKKA 1UPMB 1V3LA 2YL5A 3NQ6A 4DBUA 3WLLA 3UCDA 2OT1A 3NEHA 2YCKX 4DNHA 1XINA 4XUGA 4DYKA 3GNOA 4MUPA 1JUBA 3WD2A 1Q4NX 4GUJA 3FSUA 3M5ZA 3P14A 3S1GA 2XGBA 1XF0A 1OHLA 5BWFA 3SCSA 3KDNA 3L4XA 2E6YA 4WKAA 1Q6FA 4CQ8A 4ICNA 3I4KA 2Y61A 5AB3A 4AEEA 5I0DA 4IMEA 1UW9A 1F4AA 3Q65A 4GQBA 3R0DA 1DIDA 4JQ2A 1K9EA 1EA0A 3PPFA 4HHPA 2ZDRA 1VHNA 4IQEA 1UC4A 2CNCA 2QKFA 3CB8A 5A8NA 1E72M 1X38A 1LLZA 3QTPA 1L9WA 4MVAA 2GSJA 2FPVA 3UEQA 3TNOA 5CH9A 5K9DA 4OHQA 1K4HA 2X7VA 4GY1A 4K36A 4B90A 1XH2A 1C90A 4Z17A 4P8VA 1QCWA 1W56A 5K7JA 4R5EA 3GUWA 1K6AA 2WAGA 2XVGA 1TPUA 3LQGA 1SMDA 3R12A 5CSSA 4DWSB 3CQKA 1DOSA 4OV9A 3N04A 3CUJA 5CJMA 4R88A 3A4JA 4C6MA 4LEQA 3UYIA 4FXRA 2R1LA 4AD3A 1N2VA 1R3TA 4KT2A 4PMDA 3SGGA 4C91A 3CWOX 4KERA 1JZ2A 5CPNA 3SQMA 3A47A 4W86A 4AAJA 3HZ3A 2CLKA 3PFRA 4GH3A 1EHNA 1OK4A 3E2VA 2VFDA 3S5NA 4L56A 3YPIA 2WC4A 2QYGA 4LUJA 2J6VA 1XLFA 3DKLA 3VNDA 1KKRA 3DUGA 1B54A 1E4MM 2XHYA 4GUIA 1F6KA 1R3RA 2BS9A 3MJYA 3VNJA 3AIWA 1S5TA 3EX3A 4AYGA 3UR5A 1OGBA 4A2SA 4PMRA 1KV5A 2X0HA 5DRIA 1IZCA 3NYZA 3VIKA 2A3CA 3QGKC 1OX4A 3TC6A 3KDOA 3WENA 1UWQA 3SY8A 4XKYA 3JW7A 1DQUA 3ITTA 1OYCA 1R86A 4XVEA 3KZPA 4R7WA 1MZRA 1T99A 3HMCA 3P2VA 1CGWA 4DF0A 2DH2A 3CTLA 1W1PA 3WDQA 4O15A 3L4VA 1BLIA 2YR1A 1XYMA 1V0KA 4TX8A 4H3DA 2OLHA 1TMHA 1MXGA 1TVLA 3NXLA 5HNTA 1GTEA 3PTMA 1WE5A 2VRKA 3R43A 3WNMA 2RDUA 3AHYA 3RPTA 1XIHA 2VDHA 4TV5A 3W24A 1CLKA 1CGVA 3QJAA 4PB4A 2OT0A 4IISA 4LVDA 2PS2A 4AU0A 1PBGA 1W54A 2RAGA 2DZSA 2V63A 5KSWA 1I2NA 4K38A 4M8UA 1DEDA 3P3BA 4B4FA 4W7UA 5CZ0A 1NWUA 4UR7A 4NUWA 2ISSA 4DM2A 4AC7C 4CCEA 4DBWA 3VAVA 2WMIA 4R9XA 3EX2A 3W88A 2ZUNA 5I24A 3T42A 3RJXA 5B80A 4HYVA 4KPLA 1E1CA 3N4EA 2GVLA 4ZZ9A 1DWGM 1JR1A 3IK4A 3L7RA 3VGGA 1CGYA 4JQAA 3MZNA 3TJXA 1UKPA 1SW3A 3WUEA 2CKSA 2J4GA 3IUHA 2DT2A 2IXUA 3ONBA 4GPNA 4HBKA 4NZ3A 1OGSA 4W88A 2Z25A 4B9YA 1OABA 1H62A 4KWVA 4PUWA 3FW6A 2WQDA 2GVGA 2NV1A 3B8UA 1XYZA 3TQ0A 3BSGA 4UFLA 3RMJA 3WBWA 1JDCA 1PDZA 2HK1A 1KXTA 1XDMA 3GY1A 1S1PA 4CVUA 4A3QA 4XTIA 3PS7A 4RNHA 5F4WA 3RX2A 2PU1A 4O1CA 1AJZA 4JTGA 1AUSL 3TJIA 5A94A 1O5XA 3TYCA 2MANA 3CBWA 3NL3A 3RUBL 2G0WA 4FX6M 5LIYX 3QPZA 4RE3A 1HG3A 1MVYA 3R4IA 1FRBA 4OKDA 1E0VA 3TSDA 1UWAA 3W4RA 1JZ8A 3CL6A 1KBJA 2I5GA 1TPC1 1TMQA 2G3NA 1N8FA 1H63A 1NP2A 3DYMA 1HJWA 1ZNNA 2D73A 1PHWA 3M46A 3HFTA 1JYVA 1NDYA 3CTTA 3NZ1A 2CZDA 3VZZA 1RZMA 4JIHA 4HP5A 4UTTA 1J9YA 3CIVA 1WOAA 3VDBA 4PUEA 4NRRA 1CGXA 1OFBA 1DJHA 4GQ0A 2J75A 2DVUA 1O4UA 3THDA 1HXJA 3BG9A 2ZUMA 1A80A 4PL2A 4YWIA 1WOBA 2C8NA 5TBOA 2BVTA 3BOFA 1G7UA 1C7SA 4PFMA 4DB7A 1ITXA 3GXDA 3QHOA 4JNZA 4AD5A 1XH0A 4QG6A 4S3AA 1VQTA 3CUZA 2CESA 5HNRA 1F61A 4C6FA 2WK2A 3MWCA 1U5HA 3PBMA 4FOUA 3EDJA 3H7RA 4IL0A 3LLXA 3DHFA 4EAMA 1OGGA 5BOEA 1V08A 4AMAA 2BGQA 4M7SA 4A29A 2F8QA 3EEZA 1BYDA 3S5YA 4X3ZA 4QJ4B 3RG6A 3CH0A 1CEOA 2PTXA 4CLMA 4IQLA 3G18A 1ML1A 1O94A 3EA1A 1QOPA 4FLRA 4PCPA 3MYOA 1T96A 3BGAA 1R3YA 4CQ9A 1JYWA 3RR1A 1W91A 3H2NA 4ZQCA 1Q7MA 1AL8A 5I6SA 3E0WA 3NVTA 1LZOA 1QI2A 3GX9A 4AQLA 5HANA 4D8AA 1RK5A 3ICJA 1J0JA 5M5DA 1X7IA 3PUGA 4DWDA 4FMVA 2V5KA 4PCNA 2CBVA 4W93A 2PA6A 4W89A 3IANA 2YKKA 1VBJA 1XJBA 2O56A 4DEFA 1AW2A 4HSOA 4GXPA 5I3HA 1PIFA 4ZB2A 1RVGA 4F66A 3SGZA 1QNSA 4I9TA 1JCLA 3ZJKA 4CQCA 3TZNA 3WEZA 2OTDA 3EDDA 1VFHA 1EX5A 4A2RA 3CGTA 1LL7A 3KHJA 5FSDC 1OD8A 4OUIA 3SI9A 4GVFA 1BD0A 1KM6A 1J11A 5A6SA 2EEXA 3PUOA 1M9HA 2LLEA 1EYEA 4LUSB 2FH8A 3BV7A 4MB4A 4MJ2A 3LV5A 3AFBA 3RNDA 1HT6A 3M0XA 1E4IA 3QKEA 3WLIA 3M7SA 3ZM8A 4AZIA 3KOWA 2VZTA 2PAJA 4TTUA 1JD9A 4QNWA 1KV8A 2DVTA 4LUYA 4UZSA 5EB8A 4UR8A 2P3ZA 1YKWA 2CETA 1NWRA 2WOQA 5ENLA 4EXAA 1FWBC 1UA3A 2A85A 5GJMA 4ZQOA 1K02A 1JZ4A 3NZQA 3UGRA 5A6BA 2Q6ZA 1UUQA 5F4XA 1TV3A 1MEIA 5A6JA 1YE4A 4NJIA 4HTYA 1WQ5A 1KB3A 1ALDA 3Q58A 4IFRA 2FH6A 2NUYA 2G4FA 2JEQA 2ZRWA 1JG9A 5EFFA 4BJHA 4H8VA 3W73A 4JL1A 1PYMA 3ZWTA 2FQIA 5C9ZA 1M53A 4J3SA 5CBBA 1NDZA 1TV7A 3IGHX 1QWKA 1E1EA 4MDOA 4LAMA 2RDXA 1JULA 2VFFA 1T6MA 4A05A 3LGDA 1XIEA 2PWDA 3NQVA 1EPVA 4L80A 3CZJA 1R7OA 7XIMA 1UD6A 4AG0A 3F7JA 3OB8A 2AAMA 3VUSA 4XISA 3GIQA 5TF0A 5GNXA 5EA9A 2BNJA 4FR6A 2BZNA 4JYDA 4GZJA 4AZ5A 5E93A 3CEUA 4K1WA 2YPIA 1KGUA 4BZYA 2EQDA 4GG9A 1N7KA 4GD0A 2VYOA 3UPWA 1HVXA 4QSHA 1PUDA 3P67A 1UR3M 3VOFA 4B5UA 4CNPA 3ZT6A 2Y5SA 4MAVA 2XWEA 4D2JA 1K7XA 1ISYA 3MSRA 4PEKA 3SCTA 3UZ5A 4YCPA 1SJBA 4GH1A 3W53A 4ORIA 3BAKA 4D9PA 2QJHA 3AROA 1GPFA 6CGTA 4NXKA 3AHXA 4GJJA 4OU1A 2VR5A 1LWHA 3PZTA 2W4XA 2BY2A 3GC5A 3G1FA 1V3MA 3SCNA 2FPTA 3FVDA 3GKFA 4RXGA 3SB0A 4W8BA 5CEWA 1ZHAA 2HBVA 3BG5A 1ZAHA 3RFAA 3UW6A 4GY7A 1P5BA 2VD9A 3WIJA 4UQCA 4EPDC 3S8HA 2IXVA 4DVOA 3SCOA 3OBEA 4L5ZA 3B8TA 1NFGA 1QMLA 4C1NA 4DLMA 4AIEA 7REQA 2VDGA 2ZZ2A 5T9BG 3FK4A 4JCLA 1B90A 5LGZA 5EY5A 3P8IA 5XIMA 2EG7A 1IWBA 3H23A 1UD5A 4UTTC 1GOIA 2X05A 4IH3A 2PRHA 2CLLA 3AWNA 3H2OA 3VNYA 1PS9A 3GIPA 2WNNA 4LNCA 3OGSA 3G5EA 3ARTA 4A21A 5U7SA 4V15A 2ISDA 1LWIA 3C2OA 3BW4A 3ABSA 4M1RA 2Y8VA 5C9UA 3CPGA 4LYPA 2J24A 4AX6A 1MDRA 3APGA 4UFIA 3MHFA 1W9BM 1NOWA 4P7LA 1WX0A 4YTUA 2PDCA 3USZA 2VXNA 4QQ3A 4QG8A 2J8GA 2DSWA 4F79A 1DPMA 1R3WA 4FXJA 1EGVA 1QPOA 1RBLA 3P74A 1KM2A 3Q45A 4H6EA 4RV8A 5A8PA 3WK2A 3BAXA 4Y8EA 1IWPA 2VELA 2ZQ0A 2E40A 3L5LA 4Q8UA 6REQB 2HXTA 2X1UA 1O5QA 2ISWA 2NXHA 1QO2A 4PCSA 2E6FA 3QQ0A 1F74A 1OFPA 3N1AA 1ZL1A 3HF3A 1QTWA 4FIQA 1VEOA 5FJJA 1UUOA 1KCLA 3ES8A 7PTDA 3DGBA 2ZTKA 3LN3A 2B81A 2Y7DA 3VA8A 2ZICA 1JPKA 4Q22A 3VE7A 4AXNA 3VTRA 2OWWA 1R47A 5C9WA 1XM3A 1XLJA 2OEJA 3QLLA 3T2PA 3DDMA 3EDEA 3UR2A 1GJUA 4O4VA 3WG6A 4GYKA 1GWJA 1EL3A 4WGHA 4IIFA 3OGVA 4YTRA 2WM1A 1UR4A 1KM0A 3NQ2A 3UBPC 4GI8A 3O9NA 3MVTA 5AN7A 4MB5A 1A5LC 3L66A 3MHUA 1UMLA 1YIXA 3FOKA 4ZOBA 1OFDA 1TG7A 4IX0A 4N02A 1JNEA 1KNWA 2J66A 5GNZA 4UQEA 3BLFA 1KRMA 4JY8A 3BCJA 1TJ0A 1XIDA 2E5CA 3NA8A 1VAHA 5H8PA 3VPLA 2O0TA 4ZXOA 3TH6A 1L6SA 2XN2A 3OLDA 2WJEA 4PTMA 1MQQA 4GGBA 2R14A 1TPFA 2Z1BA 5K4XA 3CHEA 4AF0B 3SUUA 2ZFAA 5ECVA 3BMWA 3LCXA 4J3ZA 1W9DM 3V75A 4KF1A 4Z2IA 4ML4A 3T05A 3R89A 3T0TA 2XFYA 5BOFA 3URQA 3C6CA 4ML9A 1PWMA 1Q63A 4ZCWA 3SRDA 5K3VA 2XISA 3TP4A 2DIKA 3G3DA 3M9YA 2GJLA 1P0NA 1ZAJA 4Q4OA 1W9XA 3B8VA 3WFAA 2BOEX 2CCRA 4HHHA 4PUKA 2C7FA 2CHOA 1V6UA 3M5XA 3T8QA 4I5XA 1S3TC 4K1GA 1AW1A 1VYSX 3UP8A 2UY2A 3SRHA 1EJVC 5IDIA 1WDRA 4Q8TA 5HDRA 1RP8A 4KWWA 1FH9A 3L0NA 3WLRA 4UQDA 4OECA 3LG3A 2R9RA 4K68A 1D3GA 4JN7A 2PU0A 2Q3OA 1XGDA 1F2JA 1ZUAX 2C13A 4UTHA 4FLSA 3NM3A 3SUVA 4CEXC 4OOZA 3S5ZA 3FHQA 1V4YA 4GO8A 3TW6A 1EGZA 3GUGA 4K8GA 3KEHA 4R3UA 1O68A 1XDLA 3TA9A 3GVQA 2XFWA 4ZENA 1XSIA 3B0PA 3LTSA 4OGZA 1PCWA 3I3BA 4BF9A 3WELA 1PTAA 4ROPA 3F03K 1ZTVA 2VP8A 4LYQA 3WH7A 4HNVA 3PZQA 2P8CA 4LX4A 1RA0A 4B5TA 4G7FA 2YZ5A 3TR2A 3N9KA 1HZYA 2GGGA 4UTWA 1US2A 3IJ8A 4KGJA 4Q4PA 4M1BA 2J7CA 3TW7A 1UWRA 1P1MA 2XINA 3NCOA 4QG9A 1KLZA 4LAZA 3TZFA 3O63A 4BI7A 4QIUA 4ZE5A 1E70M 2E9MA 3WFZA 4AUBA 3OVGA 4IP5A 1M65A 4LVBA 3G0SA 4HOZA 2IQDA 4OVXA 3MVIA 3ITGA 3VE9A 3TYBA 3BJFA 1LQ2A 4FOJA 4FAMA 4ZB5A 2EKGA 2CERA 2Z2AA 2VRQA 1TPB1 3ZSSA 2JGQA 3TN5A 3BW2A 1G5AA 1FXQA 2BHZA 3GK0A 3W7NA 2FZNA 3A9IA 4YMZA 1GG0A 2CXEA 2A7PA 1PV8A 3ARRA 1TQJA 2G3MA 2HTMA 1LDCA 4JTSA 4AW7A 3LERA 2WV8A 1EZ2A 2QDEA 3DESA 3S2CA 4KWOA 3T2QA 3TQPA 1JQXA 4DQWA 3TDFA 3RCMA 1XI3A 3DH7A 5DLCA 4M3PA 3WBAA 1FWSA 1XLMA 5FA5A 2Q02A 3LK6A 3BURA 3EOLA 4JZ5A 1O95A 1R9XA 3H4XA 1JAEA 2F7FA 2P0OA 3QV7A 4UUIA 3ITLA 3W7QA 3DECA 2DQWA 5LNUA 1UQYA 4TQTA 4H83A 2B4GA 4GE8A 1EF3A 1NJJA 4KKXA 3HPZA 1TSIA 3OQ8A 3SCQA 2UWFA 3C56A 3MHGA 4IJBA 4ROQA 5HMEA 2OLSA 2Z7KA 1OCQA 1UIOA 3PG8A 4EE9A 3BJTA 1ZJAA 1L8NA 4RXFA 2HPIA 3LGGA 3H2MA 1LRNA 5M03A 1OB0A 3A22A 3TWBA 4ORMA 4R85A 3NQDA 3KOZA 4GX8A 1KKOA 1GW1A 4NZCA 4US5D 1QNOA 5BWAA 1LM1A 1U83A 4PMVA 2BHUA 2D0FA 3FYOA 3NUKA 1QNQA 4FI4A 9XIMA 4Z2LA 3E96A 2G8ZA 3VMOA 4KRUA 4KESA 4U5KA 4BHYA 5AHNA 5DBUA 3E9AA 4LUTB 4J9JA 3JU2A 2WJFA 4Q8QA 1DWAM 3V3WA 2P88A 3AMCA 3N9SA 3R11A 4GZEA 3KVKA 4GVHA 2TODA 1V6XA 1W9UA 5IFTA 5HR6A 4F0KA 5E09A 3B9AA 4LALA 3HU7A 1VZWA 2XG9A 4LTSA 2Y7FA 1XWYA 3EAUA 1B5TA 1CX9A 1DJGA 3FGCA 1KM5A 3F4VA 1ZQ5A 2JIEA 3P62A 2CLEA 3WEOA 1W3JA 4WGXA 4EPKA 1Q4WA 3AUOA 4TMBA 1EKOA 1XLLA 3MMUA 3G1DA 4AZGA 1GKPA 5HR7A 3DKJA 1Q7ZA 4PTWA 1EO5A 4AHOA 2G5WA 3O3RA 1FA2A 5FIPA 2I56A 4WF7A 4CQDA 4L4OA 4DNMA 3CPUA 3EOOA 2J8TA 3KBWA 3RPMA 4FF7A 2OXNA 1XG4A 2J7DA 1ZBWA 2J62A 4Z2KA 1PPIA 2Y6ZA 9CGTA 4OBRA 4O16A 1BVZA 2WCGA 3UWYA 4KFOA 3QW4B 1LQ0A 1W1TA 3W6LA 4P8WA 3O2LA 4PFHA 4NP7A 5ABHA 2BBFA 2E25A 2XFFA 3IV8A 1DJZA 4QRNA 2V3EA 4E5TA 2X1RA 1W32A 3PPHA 3FXYA 2YCIX 3VIJA 4WIWA 1UD4A 1Q85A 3LM7A 2WNZA 4O0ZA 4UFHA 2YCJA 4RW5A 3WJYA 2VFIA 2DT1A 3S5SA 5I5RA 2VC6A 1RPKA 2XSXA 3LLDA 2G3IA 2Q8LA 2OODA 1VYRA 1IGSA 4MB3A 3OIXA 3Q67A 2BGSA 5HK4A 5HWNA 1V7YA 1JGMA 5GNYA 2E0PA 4LRSA 3MCMA 5XINA 3GNXA 4TXEA 3UWUA 4S3JA 4WRHA 2JKEA 4UTWC 4AY7A 1SM9A 5DCBA 1OFOA 4DUVA 1NP0A 3WLKX 1XYLA 3K8MA 4UBPC 3MI3A 3MBDA 3CMJA 2D0HA 2R91A 5CGQA 3CV7A 3CMFA 2ZE3A 5EMLA 4J5NA 4CNOA 1VRXA 1G4PA 2H8ZA 3WLMA 1KM1A 1GGOA 1CENA 2AGKA 4H9MA 2Y7GA 2GVYA 4L1XA 2PWHA 3L21A 3UXAA 4ADSA 2O7SA 1TCMA 4MWAB 1FWIC 4QGCA 1TFVA 3KL5A 3MS8A 4MG4A 1V02E 3WF3A 4BQ3A 1LUCB 5FESA 1QDSA 3DXIA 2QULA 3ANUA 5DO8A 1SFJA 4HNOA 3MUIA 2BOFX 2YW3A 1LYXA 3MB9A 4NJKA 4Q8PA 3HGRA 3K8LA 3GB6A 1AQFA 3OBKA 4X22A 5IDZA 3T9PA 2ZWYA 3Q94A 1NEYA 5F2GA 1PKMA 3DI0A 1E0XA 1DQXA 5DY3A 1J5TA 4LCSA 4PUNA 5DT7A 1QFEA 4G1NA 1PWLA 2DJXA 3ARZA 2QEZA 3EOEA 2ACSA 4BF7A 3M43A 1DIOA 2PTZA 1ZLPA 1V03A 3ELFA 3WNNA 4S2CA 5I3DA 4E3VA 3OGRA 5BXRA 3V16A 3E2QA 3AALA 3S2MA 1P0DA 1POJA 2JQXA 1JZ7A 2F2HA 4AZ7A 4OTKA 1GQNA 3W85A 4HN8A 5H8MA 3CNYA 1CECA 1UYQA 4NX0A 2R24A 1JEZA 2ZBTA 4ONVA 3IJIA 3TTSA 1POKA 3AYTA 2OGYA 3KTXA 3N4FA 2ZXAA 1H2JA 1W8SA 3BAJA 4L7ZA 2F9RA 3TC3A 3WD1A 3T0AA 3QFEA 1I6NA 1ZENA 4QM1A 1P48A 4B2DA 3WLOA 4GNJA 3QZAA 1VJZA 3Q37A 2WJDA 3RLVA 5JVLA 3ISIX 3WBYA 1HNYA 3L0KA 4F4RA 2FZ9A 2QZRA 2YCLB 1YDNA 1DL3A 3AISA 2Q8XA 3O0KA 2EHHA 4JQ1A 3GVVA 3VGHA 1XFCA 3W01A 4OBSA 3LDVA 5RUBA 3WFLA 1TWDA 1TR9A 3ZLHA 4ZO9A 2ZTJA 4PN2A 3BQ5A 3WUBA 1QBAA 2C6QA 1ZBCA 4MZ1A 1ONEA 1S5MA 1TO3A 1H50A 2EPLX 2EKCA 2OB3A 3VDAA 2P53A 2FGZA 1GK8A 4J3TA 3TC7A 4PMUA 4GYJA 1BXNA 1JDAA 1I60A 4E8GA 1TYGA 2XSAA 2EAWA 4Q4KA 2GQ9A 1OG0A 1MYRA 1WA3A 4L4MA 3WQ8A 4H9VA 2J7BA 4FP1A 3EPMA 4I90A 5CSRA 5I06A 3UXIA 1UQZA 1NOUA 4Z1YA 5AKQA 2FTWA 2BXZA 2WZEA 1KFEA 3G8EA 4PSRA 4O54A 2R1PA 4Q6JA 2E5BA 4O8AA 5FJTA 4ATDA 2W91A 1S46A 3ORWA 1FDJA 2IQ0A 4B2DD 4GI9A 4R34A 5BNKA 1UUMA 3U5UA 1JGIA 3VD9A 1RLDA 1E6QM 1GVFA 1Q2SA 4F9JA 4V1YA 4DO7A 4FB7A 1ZU8A 1CXLA 1J0YA 1ZP3A 2QJIA 2W79A 3S46A 3T6CA 1BWKA 4K8EA 5KITA 4U31A 3DFOA 3WLQA 1MQRA 1UJQA 3QQ1A 3S9YA 3A4XA 3JS3A 5LA1A 4NI8A 5MF5A 2ACQA 3P0XA 1RQHA 1BRLB 5MKGA 1M7OA 2GFTA 3RN6A 1FDZA 3KHDA 4CU7A 2NXGA 4HD5A 4ZQRA 3BV4A 3LA4A 3ZVIA 3L2MA 1TCDA 3HQ1A 2V0TA 1WXZA 3NO1A 1XP3A 6ALDA 2IPJA 3J7HA 4JIIX 1QNPA 3WBEA 4MGGA 3T55A 2R82A 4FO4A 3NL2A 3RYSA 4HPNA 5I00A 1Q65A 1TRDA 4GYFA 2WKJA 1JFHA 3M6YA 3EB3A 1RV8A 3C8FA 4IIGA 2H9AB 1F07A 2X8RA 4A3RA 4QE4A 2J79A 4I6KA 4G7EB 3DIPA 3W38A 4L9ZA 3TJLA 1A5CA 2JKAA 3URAA 3O6AA 4LBUA 4WJ8A 4INFA 3ITCA 2ZKMX 1DWHM 4O8RA 3W6YA 1R0MA 4RCXA 1GYMA 1LF1A 1M6JA 2BX7A 3EWYA 2VMFA 4NJHA 4K2SA 2HNHA 3MUZ1 1GYNA 4V27A 4UCFA 2E1WA 1KGXA 2PLCA 1LP6A 1Z7AA 5G2IA 2DZPA 2WZTA 4ZGYA 2OR2A 3SR7A 4LY8A 1EIXA 1GOQA 1ZY9A 3HPSA 3QFWA 4UFKA 1XSJA 1KC7A 3ZS4A 1A5AA 3T40A 5HWJA 2IPWA 2J74A 2R94A 1NAL1 1HKVA 1KA9F 1S39A 2HEJA 1W5NA 3GXNA 4C90A 1DJYA 1S2VA 2D1ZA 3QKZA 4D6JA 4JN8A 5JH1A 2YCEA 1BXBA 3NO5A 4U3CA 4MTVA 4UZUA 4F0LA 3SFKA 3MUY1 4FEZA 4MKNA 3QHNA 1FKWA 2V30A 4JFUA 3TTOA 4FSAA 1WP6A 1ISZA 2AQVA 3KBJA 4BA0A 2QUNA 4L6DA 3OJGA 1HJSA 4GKTA 1A4LA 1KWKA 3T81A 1J01A 2Z27A 1V6WA 3E02A 4RZ5A 1IV8A 3GH7A 3RRXA 2GDVA 1PAMA 3RPDA 3AI0A 2ICSA 3PAOA 1XL9A 1AG1O 5LIWX 3EOSA 3VOHA 1EP2A 4GACA 2O9PA 3AYSA 5EGRA 1FP8A 4ACZB 1GVIA 4IIDA 3MMDA 4W85A 1O5KA 4LCQA 4WY0A 2CBJA 1OEPA 3G1SA 3A9BA 1UIPA 4M80A 5HJYA 4Y8FA 1VBRA 3THCA 2FIQA 4NNAA 1G4EA 3GDLA 3U57A 4ZTXA 3CHCA 2BG5A 3V4BA 4C6CA 1TPH1 1UKQA 2CLMA 1SJCA 4PMQA 4F0MA 4LOCA 2I7GA 3TKFA 4RE0A 4UWMA 3VGEA 2WVVB 4JKMA 9XIAA 3AYRA 3CL7A 3OVPA 1B9BA 1UZ4A 4O0KA 4EANA 4YTTA 2IW0A 4DBEA 2WVTA 4C6QA 2B7PA 3ZVHA 1MFVA 4GNKB 4G9PA 4ADTA 3KCJA 4XB3A 1RVKA 2OFJA 2VX7A 3EMQA 2PURA 3M0ZA 2CITA 1H4PA 2HISA 2PE4A 3U8GA 3CAKA 3VOCA 2W5FA 3SQSA 4ZXLA 3ZWSA 3DAQA 2YYUA 3H26A 3PUEA 2HDJA 2ISFA 1XLHA 3CIWA 1A50A 3L4UA 1GJWA 2BGNE 3LQLA 3TJ4A 3FAWA 5REQB 2V6AA 4AVOA 5BMXA 1T41A 3PR2A 3PBWA 1YNPA 1VEMA 4D1JA 1TMLA 3RX4A 1HGWA 1AMKA 5K2ZA 3TYDA 2PGEA 3KTSA 3I7RA 2PI6A 3GXTA 1ZFJA 3VX1A 4MUZA 4JTLA 5CXPA 1U33A 4JX6A 1WZMA 3A3HA 1WZAA 2UV8G 2H3DA 1XRTA 5DY2A 5BW6A 5BXPA 1RK6A 5JXQA 1A5KC 4MF4A 4TR9A 2ZCGA 3UZYA 3BCDA 4C6JA 1QI5A 1ZBVA 3CAWA 4NVTA 2ONEA 2QCGA 3S6DA 2QDGA 2WLYA 3QC3A 4PTXA 4XBJA 3CYVA 3CAQA 1B2YA 4UMBA 2H9AA 4KEUA 5I3GA 2AOSA 2EO7A 2PGFA 1HQTA 3XINA 1AL7A 3II1A 4LGXA 5D4YA 1EJ7L 4I8DA 4HNUA 1U2YA 3NQFA 1L2QA 5LNVA 1MRQA 3CASA 1GVRA 1XIIA 2OEMA 3B8SA 4K39A 4NASA 4CKQA 1V51A 4JQ3A 4Z1BA 2C91A 5H1WA 4ADUA 4O11A 4ECLA 3F5JA 3LOTA 1ZJHA 3QZEA 1KCZA 3HBLA 4YJ5A 1K9FA 2YXGA 2ZYFA 1EDGA 4J2MA 3NGJA 3Q4DA 1FWEC 1ZJBA 5A2BA 2YGYA 1T7LA 3OYXA 5JQ9A 4HQVA 1Q6RA 3KS5A 1YDYA 3N3MA 3E1F1 4JNYA 2ACRA 4ES4A 3TQKA 3U2EA 1K8ZA 3DI1A 1GJPA 5DN1A 1JI2A 3LLFA 1E1FA 5FCZA 2PFHA 4UQBA 3M0VA 3SIMA 2D3LA 2BV9A 1E6ZA 2I9UA 3QV9A 2IUZA 1W1A1 3E2RA 1PDYA 2JALA 4PSPA 3IJ7A 2ZRUA 2PC4A 1H7PA 4WCJA 2V69A 1OWQA 3R8GA 2HSAA 1ESWA 3K1GA 3GXMA 2YL9A 1JPDX 3EWCA 4GXMA 4POCA 1XLAA 2OGJA 1C8QA 4PH6A 3GG1A 2BVDA 3STPA 3FYYA 3F4CA 3AIQA 3VD3A 2WZMA 3NQAA 2NZLA 1JXKA 2VWTA 1H7NA 2HE5A 3KOFA 3QOKA 3S2NA 1W3IA 5LIXX 5FL1A 1TR1A 2V5DA 5JMUA 1UOZA 3W1LA 3RGTA 1FWAC 3LNMA 4LYRA 2OEKA 2VWSA 4PMYA 4DAIA 3MI6A 2NLYA 2X16A 3WJXA 5D2TA 2NXIA 4JBRA 5AHLA 1QHPA 1SMAA 1HP4A 3W1AA 2OYKA 4K3ZA 2B0MA 2J88A 1HKKA 2DJLA 4FX7A 1JVNA 4NAEB 3KBMA 2OVLA 4LB4A 3VABA 3BE7A 1LT7A 2ABAA 5B7ZA 3I10A 2E6DA 1CXFA 1BWVA 1SZRA 4MNLA 1QNRA 1EP3A 3GBEA 4EP8C 2BLEA 4S3BA 3LY0A 3RCNA 1QW7A 3EZ4A 1K8YA 4HPGA 4O52A 3MI2A 3NQMA 4Y9MA 1T8QA 2J78A 1WDSA 3C8NA 4WEVX 3C61A 3TN6A 1OFQA 1J0IA 1Z6KA 3DFYA 1A47A 2QCNA 3ALFA 3EA2A 2GJNA 3G6MA 3UWVA 4NNCA 3TFXA 3EWUA 3G24A 4D1IA 1UB3A 2E67A 4OFCA 1FCBA 1SPQA 1XYFA 4WQ6A 5TIMA 3EB2A 2QF8A 4DJDD 3IAPA 3CU2A 6TAAA 2PMQA 1ADDA 3AZRA 4A8RA 4H7VA 4IPIA 5D2VA 1RY0A 4IP7A 1LOLA 1QASA 1VLWA 3I7QA 3SN4A 3VNLA 3W70A 4QS6A 4NHVA 3GYEA 3GRIA 3IRSA 3ARQA 1F8IA 4TVCA 5CAKA 3SGUA 4RR4A 1W8GA 1E6NA 1HL9A 3ARYA 3PSWA 1B3OA 5DCDA 3GU9A 4F0RA 2CBUA 5HJXA 4FLOA 2Y88A 2QMJA 2CC0A 5DFAA 3KVLA 4CD5A 1Z89A 1O1ZA 2YYTA 4HSHA 4W84A 4IPNB 4KFNA 2I9EA 2GDUA 3R13A 2D3NA 2PTWA 3R79A 4UC5A 5DMLA 2X2YA 3WK0A 1VFFA 3QPEA 4L9YA 5FJUA 1GQKA 4GVIA 4I7WA 4R53A 3BAWA 1LT8A 1KD0A 1L6WA 1YPIA 4KIRA 4REQA 4CQAA 2PPGA 4LS1A 1CI1A 3AXXA 3C0LA 2GVEA 4NJJA 3W22A 1HP5A 2IQTA 5CC6A 5L9FA 1Q2RA 3O15A 3CV6A 4ZB0A 3VCNA 2PWEA 2PBOA 1OCNA 4A3YA 3TYUA 1OF8A 1XRVA 4C6KA 2BASA 5HATA 2AMGA 3RX3A 4B5VA 4BWLA 4ALDA 4M5PA 3JUGA 1XIMA 2VX6A 2HCVA 3B03A 5FJPA 3FNDA 5G4EA 5AVHA 1QT1A 1E0WA 3N9RA 1FDYA 5AY7A 4O28A 3I7SA 1UWIA 3M0KA 2BMBA 5IBXA 2QV5A 3TCSA 3GHTA 3G1YA 4TVDA 4NJGA 2X0YA 4XUYA 1IF2A 5CSYA 3U6WA 4QJ1A 2Q01A 3FN9A 2PWV