2Q02A

Crystal structure of a xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 at 2.40 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
GMNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQLASWSEAEIEEQINRSVSLLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative cytoplasmic protein (NP_463296.1) from Salmonella typhimurium LT2 at 2.40 A resolution
rcsb
source organism Salmonella typhimurium lt2
molecule tags Unknown function
molecule keywords Putative cytoplasmic protein
total genus 97
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2q02A00
1XYLA 1D8WA 3DBNA 2Q02A 3KCOA 8XIMA 4PGLA 5EMKA 3M0VA 1A0CA 1DE6A 3NGFA 3VNIA 1XLKA 1XIMA 1BXCA 3CQIA 3GNXA 3P14A 3UA3A 4QE1A 4HHLA 5AVHA 3VNMA 1XLAA 4E3VA 3JU2A 2ZVRA 4QE4A 9XIMA 3ITLA 1XLLA 3DX5A 3BDKA 3U0HA 3CQHA 5B80A 3C0QA 3QXBA 5H1WA 2G4JA 1TZ9A 2I56A 1XINA 3ITOA 1XYCA 3CQKA 3IUHA 4G56A 1MNZA 1DIEA 3AYTA 3IUIA 3UU0A 4YTQA 1XLBA 4GJJA 4ZB2A 3KBSA 4PFHA 2NQ9A 3KBVA 4OVXA 1XIBA 1BXBA 4XSLA 4ZBCA 5B7ZA 4DVOA 1XLEA 4XSMA 3QZAA 1I60A 3XISA 4X61A 3ITXA 3AAMA 1XIJA 4J4KA 4EACA 1XIGA 2OU4A 8XIAA 2G0WA 4YTSA 4QEHA 2NQJA 3KBWA 3KCJA 4ZB0A 1DXIA 3LMZA 4A8LA 3CWHA 2GLKA 4GLEA 1XLMA 1XLGA 1XICA 2XIMA 3KBJA 3XIMA 1XLFA 3WQOA 1YX1A 1XYAA 5FA5A 5I7GA 3U3HA 5TNVA 3P6LA 1O1HA 2GVEA 3M0MA 2HCVA 4LNCA 1XIFA 1XLJA 3KTCA 3ITVA 3AALA 3CNYA 3QYSA 3XINA 1XYMA 3VNKA 4A8IA 2ZDSA 3M0YA 3M0XA 1XLDA 1XLCA 4QDWA 5EMLA 4QE5A 3TC3A 1K77A 5EMJA 3TVAA 4GJIA 5J8LA 4K3ZA 1XIEA 1XIHA 3BZJA 4QEEA 5AVNA 7XIMA 1QUMA 1CLKA 1GW9A 3KBNA 1XP3A 1XISA 1XYBA 2QUMA 3C0SA 3M0HA 1QT1A 4QDPA 4X63A 4YTUA 4A8NA 6XIMA 4XIAA 2X7WA 1QTWA 3FVMA 1DE5A 2HK1A 4HHMA 3UXIA 2I57A 5XINA 5C9ZA 5B7YA 1A0DA 4X60A 3CQJA 3VNJA 4EAYA 1XIIA 4US6A 5XIMA 4XKMA 1OADA 3M0LA 4Q7IA 2GYIA 4XIMA 2HK0A 2QULA 1I6NA 2QW5A 2NQHA 4KW2A 1A0EA 1DIDA 1XIDA 4A8RA 4YTTA 4HGXA 4ZB5A 3C0LA 4GQBA 2J6VA 2X7VA 3ITTA 2QUNA 3IUDA 2GUBA 3BANA 3N4AA 4K1GA 5H6HA 3OBEA 6XIAA 3UA4A 3VNLA 3L23A 3UVAA 4YTRA 3BZGA 3KBMA 3KCLA 9XIAA 5EMMA 4HNOA 5XIAA 3AYVA 3VYLA 3KWSA 4XISA 2XINA 4DUOA 1S5NA 3BWWA 1XLHA 4W4QA 3QC0A 2XISA 3ITYA 1XLIA 1S5MA 1MUWA
chains in the Genus database with same CATH superfamily
1B2YA 1V6YA 3WQFA 2J9YA 2J7CA 2GVYA 4DNMA 3K1GA 1BXCA 4CN4A 1ADOA 1X6LA 1F61A 3WBWA 2NQ5A 5KTLA 5I5RA 3PBUA 4ROQA 4GY1A 2ZRXA 3DBPA 2VR5A 1UH4A 3MUCA 5HUPA 4GO9A 3WJXA 4ADUA 2ZUWA 1RR2A 1TPH1 2WWDA 2IW0A 3W1MA 1RPXA 3T2PA 2BVTA 3W23A 1DWHM 3QSTA 1YXDA 3OZYA 3PVFA 4GIEA 4Z0JA 1J2BA 2Z7GA 3WMLA 1KKOA 1UD6A 1GKPA 2EKGA 2QLYA 1JCLA 5F4WA 2QAFA 5EMLA 4W8BA 2YCLB 3CWOX 3U2ZA 1FWTA 5A8PA 4JKMA 1KO0A 3VIIA 4LVBA 3T2QA 4V27A 3TAKA 2PP0A 2E5BA 4PSRA 5I00A 2ALRA 4NX0A 1L6GA 4HP5A 4H9XA 1JFXA 3UERA 2ZA3A 5DCBA 3KS5A 5AHLA 4BQ4A 4FOUA 5ECVA 1DIDA 1Q6GA 3BMXA 5AOUA 4FI4A 4LYRA 2HBXA 3VNLA 2F6UA 1AG1O 5FL1A 1JCXA 1W31A 1QAPA 2BLEA 1RBOB 1I9CB 4LVFA 1RJPA 2VM8A 3THAA 3RUBL 3GNXA 3UJSA 1KD0A 5K9DA 2VP8A 1VBHA 5FD0A 3DHUA 4MKNA 3W75A 1ADSA 1TWWA 3WQ5A 4RPQA 4HMEA 1PYFA 1Z7AA 3SEPA 2QV4A 4Q8PA 2YCEA 2YX0A 3C6CA 3Q45A 2V68A 3DKLA 1DXIA 3SCNA 3W2UA 5FEPA 3TW7A 3ID7A 4J2MA 2D22A 1VR6A 3D46A 1V7YA 3GC4A 2FKPA 2R6OA 1YPIA 3M6DA 5G1MA 4LT9A 3NL2A 5EMYA 2WHMA 4NZ1A 2PD9A 3UCCA 4L56A 1OBAA 1Z44A 1GW9A 1NOUA 1SZEA 3AZRA 2J79A 3CEPA 4DPPA 3TSMA 2YL9A 3C8FA 2WQPA 1PX4A 2IUZA 2F2KA 4CN6A 2PWDA 4LYPA 1UC4A 2OYMA 4L6HA 2ZICA 1ISZA 3WUFA 2GUBA 4D6FA 2Y1HA 4B4FA 3RPMA 2PTWA 1ZAHA 5EMMA 2V5LA 2PDHA 5LIUX 2NXGA 1FP9A 2XJ7A 2X30A 4B5TA 1DP0A 2VRJA 4PUNA 2G3JA 4F2TA 1GOMA 4AZ7A 5G2IA 2CPUA 3ZWTA 1QI3A 4BJHA 5C2CA 1QNOA 2VZSA 5KZEA 1LRQA 4E8CA 3PAJA 5EA9A 3GH5A 1W5QA 3WMBA 4EOUA 1ZNNA 1XSJA 2B4GA 2DIEA 4HOWA 1VAHA 5DO8A 1BVZA 1RY0A 4WHBA 2J25A 3N2XA 3GHUA 3WH6A 2X1TA 3MP3A 3HMCA 2QUUA 3W1RA 1F74A 1R5YA 1ZB5A 2C13A 2YL8A 1O4UA 2QIWA 5DMYA 2EJAA 2GK1A 1T8QA 1WE5A 1DTNA 1SJDA 1OF6A 3NL3A 1KFBA 1H7XA 2OSWA 2AL2B 1JI1A 1RK5A 4WR3A 2P10A 1OFDA 1YDOA 2RJGA 4LBSA 4C7FA 1XSKA 2OPJA 2OOGA 1L6YA 1FWNA 2PDCA 2VFFA 2EJ1A 1AVAA 2Y88A 3S1XA 1Q66A 4F0LA 2AL2A 3TUUA 2ZRYA 1YTEA 1G7VA 3TXVA 4JTFA 4GY0A 2VEKA 1EWDA 2ZA2A 3QV7A 5GQBA 3UR2A 4IIHA 3EDDA 4I7VA 5HANA 4QJ4B 2DJXA 3UYCA 3CL6A 3UXAA 4O1BA 4AEFA 2QJNA 2X41A 3DHDA 3VIOA 1GJPA 1RLCL 3MI3A 5A6JA 1L2QA 4Z2GA 2Z1KA 1M41A 4UMCA 1FWBC 4RKAA 3ALGA 3F4NA 2D3LA 4LUJA 1E71M 4IISA 3IK4A 4L1GA 3UZZA 1ME8A 2OEKA 4RDVA 2G8ZA 3NSMA 1OFOA 3RNDA 3MSRA 4DAIA 2ABBA 1TPVA 3H2EA 3MWAA 1NVMA 1AQHA 2VQTA 3N4EA 1J6PA 2DZWA 3IARA 2E4TA 3TJ4A 1G4PA 5GJMA 1IT8A 1VBUA 4LF2A 2POTA 3DFOA 2WC7A 5CPMA 4HYVA 5JU6A 1KM3A 3QV6A 1PCKA 1EP1A 4IGHA 1VEMA 4S39A 3S1VA 3HO8A 4RPPA 3TEVA 4PB3A 2BVDA 1OYCA 4C1NB 3HMJG 2VO5A 2J7BA 1MDLA 3SFWA 3QV8A 2QUNA 1XBVA 4NNCA 1GVFA 2CLFA 1BYBA 2PEVA 4E2OA 1ITUA 4S3DA 5E93A 1HJQA 3C2FA 4E2DA 1EHAA 1IEWA 2GSHA 2WZHA 3N6HA 3RYSA 4FXJA 5AC5A 3PR2A 4NZ3A 4FO4A 3S1UA 5CEWA 5HNUA 3ECQA 5HXMA 4Q8TA 4JFUA 2HNHA 3WLKX 2C14A 2GJRA 5CGMA 1CI1A 4Y90A 2A3AA 4DBWA 4O1DA 1FCUA 3B40A 3T9PA 1UD4A 3VKBA 1F2JA 1GOXA 1DQUA 2NQ9A 3EB4A 3E0IA 5I2UA 1OC5A 1RY8A 4Q8MA 4GXMA 4G2DA 1YNPA 3GNNA 4NP7A 4GH1A 1TPB1 3KS6A 4M7TA 4UTHA 3MYPA 2WSPA 3A4AA 3S42A 1TTIA 4M80A 1KFKA 1SGJA 1SPQA 4IGMA 1B54A 2FTPA 3GXPA 4Q6JA 3TH6A 4NUWA 4W89A 3PUGA 4AXKA 3SUUA 1OCQA 5A95A 2J7FA 3R10A 3PWGA 2ZDSA 3N73A 4BI5A 1E6NA 1Q3NA 4PMYA 1I75A 3R1ZA 4IHCA 4E4PA 1EFZA 4EXAA 1M5WA 4AC1X 1RPKA 4F8XA 2FB3A 3H2OA 1IWBA 5FF2A 3C2VA 1E0XA 1ZTVA 4JDBA 3I10A 1E72M 1NF0A 1O60A 4GX9A 3WF0A 4JCMA 5LIWX 4DXXA 1GW1A 3IEBA 3LCIA 1F4AA 1MQPA 1D7FA 4OIFA 3KEHA 2FGZA 4E4FA 4GUFA 3VIJA 2PDUA 1YBQB 1SW3A 1FUYA 3BQ5A 1WXYA 1MUWA 3MDUA 5JQ9A 2PDGA 2PDNA 2XVGA 3A23A 3SW6A 4XUGA 2PMQA 4ZSTA 4IM4A 1LLZA 1FH9A 1XLLA 3W24A 1VC4A 2FB2A 4G7EB 1SMAA 3L66A 1FFRA 3KUMA 1PBGA 4G7EA 4X0NA 2OSYA 2E3ZA 3VKDA 4NAFA 2VFDA 1FWRA 4L4LA 2VCAA 3AHXA 3AXKA 4WY0A 1KC7A 2J88A 3B9AA 3WLHA 3OZOA 4DZIA 2X1SA 2TPSA 1EP2A 4IMDA 3S2JA 1AJ0A 1A5AA 4Q7NA 2X1RA 2Z0IA 5JBFA 4MOZA 3C2OA 2Q3OA 4WKHA 1XG3A 5M3WA 4I9TA 4IMGA 1R3QA 4WXYA 1A5SA 2L5HA 1OB0A 2FMOA 3GW0A 4C1KA 1Z6KA 4EPDC 3E2RA 1A53A 1P5BA 2D2GA 3SY1A 3UWUA 2CXGA 4K1GA 1IWPA 5D03A 5HULA 3KAOA 3NO3A 2RGLA 1XKJA 3KWSA 1B3OA 3G22A 4GE8A 4AY7A 1OFEA 3PHAA 3GDMA 4XAFA 5DQPA 1N8FA 3VGHA 4FX8A 5DRCA 3EWBX 4QQUA 4C6NA 2QUTA 3DC8A 2ZVRA 2J8TA 3TMLA 3SY8A 1R85A 1Y65A 5HJLA 3R0UA 5DMMA 1HN1A 3G3MA 4GINA 2BWGA 1TB3A 4FPSA 3AHVA 3HGJA 4X2PA 1VJSA 1W3KA 3UCQA 1LDCA 2QHAA 9RUBA 3H2MA 3PJWA 1TO3A 3KL0A 1DJNA 3UW6A 3HURA 3LHWA 2XIMA 3QPZA 4JTDA 3QC3A 1KCXA 3IJLA 3TLLA 5FESA 3CAVA 3FA3A 3NPWA 4WJ8A 3L5AA 4XWUA 3WQDA 3LPFA 2Z24A 5HR6A 4JN6A 2VQUA 2Q8LA 3S6DA 4S23A 1LORA 1XYBA 2OZTA 1PYMA 2CZEA 4KRZA 3WEMA 1S38A 5TBOA 4PFMA 2XVPA 4LFYA 3OPSA 4NSBA 1ENUA 2P53A 3QZ6A 1A47A 4D6GA 5U4NA 4TOQA 4ZFMA 3PFRA 1J0IA 2WC4A 4RW3A 3I4KA 1AD1A 5KITA 4JD4A 4JHZA 5BZAA 3SI9A 4OJYA 3QV9A 1HKMA 4PCTA 1GQIA 4GWEA 3W25A 3RIKA 7A3HA 5CC7A 1HP5A 4GIYA 5I3KA 3EZ4A 1Y0EA 4QSHA 4MWAA 1GK8A 3NQGA 1A0CA 1DE6A 2C0HA 3BSGA 3T42A 5FF3A 4IIDA 1A5BA 1RVGA 2QCMA 4UFHA 3MBDA 4TTUA 4HBKA 1ZSXA 2EPHA 3UU0A 3B8DA 3DG6A 1EIBA 1CB2A 3HN3A 1VFTA 1P7TA 2AKMA 5HBFA 1VGAA 4TMBA 4PRWA 2DZTA 1FHLA 3OB8A 2Y8VA 1OFAA 3RLHA 1H5VA 3W82A 5I77A 3OLIA 3A47A 3SN4A 8XIAA 1HTIA 5IBXA 1W1YA 3M47A 3NPVA 1EUNA 2J62A 3NZRA 4CNNA 1A5LC 1H62A 3BUVA 1KV8A 1UOZA 5AC8A 2QCHA 2ZQ0A 2ZYFA 1QT1A 1S2CA 1TTQA 1XBXA 4B2DD 3MCOA 4DELA 2X09A 2Z1XA 4DPQA 2ZC1A 3S4TA 4D71A 1W1IE 5DBTA 1XIDA 4AZHA 3W7IA 3G1YA 2IPJA 4UR9A 1C7SA 3HF3A 1VF8A 2Y7EA 3TTEA 4K36A 3VA8A 1V6XA 3A5FA 1U83A 4UBPC 4X22A 3BG5A 3S1WA 2R82A 1GQKA 3O6AA 2TYSA 3WNKA 1R6WA 4KQNA 1KB3A 4FLSA 5C55A 3G0XA 1W32A 1POKA 1AK5A 3TA9A 4D8LA 1WZKA 5AC6A 2PDXA 4EAMA 1NOFA 1R87A 3GXTA 2QAPA 1HJSA 4AWEA 2XVLA 5TIMA 1MNZA 2REQA 4QG6A 4LCSA 1U5JA 3T55A 1W0MA 2JEQA 1H7OA 2BOEX 1TWZA 4UTTC 4C6EA 4DWSA 4UOJA 5C9WA 4PL2A 2ZVIA 3CNYA 3C0JA 3HQPA 1JPKA 4RV3A 3W2MA 4PSPA 3HOJA 4M51A 3BZJA 3R79A 5DELA 4ILSA 1R3VA 3W7PA 3AFBA 5BXPA 3W29A 1DIKA 3W1NA 4DY1A 2Y89A 2F61A 4NVTA 1QU4A 4S1FA 1PPIA 3PJUA 3RM4A 5FAGA 4LVAA 2WZIA 3EXSA 5JIWA 3AZTA 4DM2A 2V63A 4AX7A 1JGIA 1JCNA 1KRAC 2PTYA 1ZAIA 4AMAA 5FKYA 5A2BA 1OK4A 4DJEA 2PAJA 4JICA 1JCJA 3TCEA 1OABA 3FK4A 2ZFAA 4U4MA 1OX4B 4PCNA 2A7RA 3KOFA 4D9PA 4TU1A 1HF6A 2IXVA 1D8WA 2R9RA 4AF0A 2IQDA 5EMKA 2GZXA 4IX0A 5DF0A 4H3DA 3KTXA 4QE4A 4XUYA 4AVNA 2WCGA 3S6OA 5A6KA 2XZ9A 4MY9A 1B9ZA 2PI6A 2XIOA 4XZWA 4G6CA 1I60A 5DMLA 4O8RA 1V0KA 2DUAA 3RK8A 1RCXB 5BROA 4O4WA 4ZB0A 4L9YA 2BHZA 3N2TA 5TNVA 3POHA 3QY6A 3FJ4A 2NLIA 1JF5A 3U57A 3A64A 2VFHA 4DO6A 4S3KA 2Z1BA 1KR1A 1IF2A 1R86A 4X63A 4MIMA 4X3ZA 3TIMA 2ZXQA 3IVTA 2FPVA 1MEHA 1S2AA 1Y5XA 3P8IA 2YB1A 1DWIM 3ES7A 3UEQA 4B90A 4NRRA 3W2NA 1J11A 1VB9A 4J27A 3WDPP 1J12A 5EMUA 5K4ZA 2C6QA 1DIOA 1XRFA 3GR8A 1OF8A 2E67A 1XPGA 1R9ZA 1TR1A 3G77A 4UTMA 3LK6A 3CL8A 1ME7A 1BWKA 1CXFA 1UWIA 4MF4A 2CERA 1LLOA 4JR5A 1PTGA 4C6JA 1GVSA 4ONVA 3WBAA 3M0VA 3EKZA 3TR9A 1THFD 1XC6A 3T40A 4GZIA 4HHLA 4FF5A 4XZIA 4N4QA 2ZADA 4AUBA 3AIQA 3QPYA 1XKYA 1AD4A 4MB4A 4LVGA 2ISWA 3N6JA 2X16A 6REQB 3WNNA 3V3WA 2EG7A 1CXKA 2Y6ZA 5I23A 3G1XA 3TYDA 3RMEA 1BGAA 1L0PA 1XLFA 5AYZA 3AROA 2UV8G 3RRAA 3VD5A 4IXHA 3Q67A 4D8ZA 4JQ1A 4CU6A 3WD1A 2PGFA 3HPXA 3RU6A 4DX3A 2AGTA 1V0NA 1WX0A 3ZJ7A 2R1KA 1ICQA 1OWQA 4UTWA 4AHOA 4TVCA 1G4TA 5K2ZA 1DTUA 2W6RA 3NVDA 3IGUA 3UR8A 5CSYA 3IRSA 1TE6A 5GPRA 2REQB 4JIHA 4XKMA 2YSWA 4JTEA 2WBKA 3B97A 5JIPA 1I6NA 5HMDA 2XZ7A 2HROA 5JUVA 2CKSA 2XH7A 1N8WA 2OTDA 3AI0A 3C86A 4QM1A 3ME3A 3VYLA 3EMCA 4PCSA 2R24A 3B9NA 1IGWA 1DJGA 2ISSA 2QMKA 4GZ7A 1GTHA 1Q63A 1W3NA 5T9CE 4NJHA 5D2WA 3GHSA 5H1WA 3TJIA 3K1DA 3VX0A 2DSKA 3LI1A 1UR9A 4ZVJA 2VUNA 3NGJA 4FK9A 2ACQA 1WKDA 3UJ2A 2GQ3A 3T4CA 1F3XA 4Q4MA 4FMVA 2NQJA 3FYPA 4GA8A 2ZWYA 1S5TA 2AQWA 4JFVA 3EX1A 3F2DA 4MAVA 2O9RA 4QBXA 5LA2A 3NURA 2ANUA 3GR7A 1TPDA 4JFSA 4BF5A 2ZXDA 4Y9PA 3S3GA 1Q5MA 5EMJA 3HA1A 1HNYA 4GKTA 3SIZA 1R2RA 3EDEA 4ACYA 3VMPA 2E9LA 2V38A 3CO8A 5LNSA 2DT0A 2JGYA 2GSJA 5E9AA 1P6CA 4XG1A 4MFDA 5A3HA 3VXGA 4RL3A 3WF4A 4ATLA 1JD9A 2VHLA 3C0LA 4S3CA 3R58A 3TYAA 1EGZA 2E5CA 3U2OA 2V5BA 4UNIA 6TIMA 2VT0A 1F5ZA 2JQXA 4ML4A 4CVWA 4AQLA 1TV4A 1JI2A 2JBMA 2YW3A 2YL5A 1RQEA 2JIWA 1GHRA 4DZ5A 4GIAA 3EX4A 1MMFA 2AKZA 3CZLA 1XLIA 3QW3A 1QJWA 1SW7A 3DBNA 3M5VA 1PZ3A 3R25A 2DP3A 2WO5A 2XSAA 4LV9A 3VUPA 1R7OA 2YBUA 4NXSA 3TCSA 4H7VA 3QMTA 2FHFA 1R2TA 1WZLA 1S46A 1VP5A 3HG3A 5D9MA 2W61A 5CC6A 5AY7A 1UJQA 1FDJA 4DVOA 4N6EA 1OJXA 3VD9A 1YHTA 1FVPA 2EO7A 2E6FA 5MHBA 4S3FA 1V3KA 2H9AA 1EC9A 4NZCA 1CDGA 2W63A 1ICPA 2J77A 4IPLA 1ML1A 2V6AA 1KLYA 4QE5A 2GJPA 3NAVA 1IIHA 3MCNA 4X2RA 3MZ2A 2WMIB 4LY4A 3CS2A 4JFWA 4AYGA 1KCLA 3C0SA 2OZ8A 2V8ZA 1LTDA 3UESA 4RV8A 9CGTA 2O7SA 3U7VA 3O3RA 3W28A 1QRQA 1R8LA 3IIOA 3BCJA 1DWJM 4QRNA 4NZ4A 1J9YA 1EJWC 3MBFA 1GVQA 4CD6A 2DT2A 3SQMA 4D6DA 1KNWA 3O15A 4JYEA 3VAVA 2NSOA 2P3ZA 5F1UA 2QPXA 1TV2A 5C9RA 5CZSA 4TQTA 3CHDA 3F4DA 5I6SA 4TXEA 1Q2SA 1BG9A 3NGFA 1NWUA 4H8HA 1X7IA 1ZBKA 1RHCA 3FFSA 3WSUA 3ES8A 4XBJA 4L5ZA 4IQEA 3C0QA 1FDZA 1KM0A 1Z41A 4NZFA 5D30A 3H8AA 1YDNA 1EGVA 3ARZA 1BGGA 4LX4A 3L2LA 4R34A 4YLWA 5ABTA 2DUZA 2DDXA 3MWCA 4AZCB 2YZRA 3E5BA 1WOAA 1SR0A 1XX1A 3ARUA 4QP0A 4FNQA 1VCVA 5KZDA 2CIPA 3FOKA 4O11A 5RUBA 4LAMA 3H53A 2BXZA 2ZE0A 3NM3A 4MDPA 2P0OA 3DFPA 1JXJA 1CXIA 2PE4A 3IJ9A 2QCNA 2FH6A 3P60A 4H6EA 1GOIA 5C8BB 1XGDA 3DXIA 2OWCA 1W56A 2NQLA 1FXPA 5T9BG 3ICJA 4EAYA 1H1ZA 2BBFA 4GUHA 4JHOA 4CCDA 4REQA 1EQPA 4Q7IA 3DC0A 2OYLA 1JF6A 2CW6A 1NFPA 3PWIA 1T99A 3ARVA 3MTWA 2CLKA 3WK3A 3LG3A 2P5NA 3G1SA 1AH0A 3OVQA 3QHOA 1BPLB 5CPOA 2F6XA 4H9MA 3SRKA 2D0HA 2ZX5A 2BODX 4PGLA 3UXLA 1J01A 3SY5A 3WDRA 5HNNA 2AMXA 3ITLA 5JMUA 1J0ZA 5BOEA 2RDWA 1SJBA 1ZCCA 3W7LA 3WBEA 5LGXA 3GZAA 2YCJA 5U7SA 4YN5A 3E5PA 1EXBA 2VZVA 4EKJA 4DI9A 5BNKA 1T40A 2GJNA 2A2IA 4Z1AA 1KTNA 5A8QA 1HIZA 1QK2A 4MSSA 4FLRA 3UFYA 3WH8A 3EWZA 4NI8A 1V3LA 3V18A 4EE9A 3GZ3A 4MZYA 4IOTA 4NAEB 1VJIA 2ZUSA 2CLPA 1H0IA 3E2QA 4MB1A 3M6YA 1OM0A 3AMLA 4HYRA 1LRTA 1A3WA 5G4WA 1MWOA 2R1MA 8CGTA 4QAWA 4IIFA 2OLSA 1EYWA 3QR1A 3LLFA 1OX5A 2D1ZA 3IAQA 2C19A 4ICCX 4BEQA 1P4CA 4HNVA 3V0TA 1Z42A 4EF9A 2O9PA 3VK5A 3OIXA 4KWSA 4Z17A 5T26A 4K7VA 2X42A 2QCDB 3AISA 4GO8A 3MMDA 4L9XA 1KBBA 5DMNA 5REQB 3FYOA 1WAUA 3NEHA 3OYXA 4FNUA 2XIQA 2DT3A 4HKPA 4AD0A 6REQA 1ZALA 1JFHA 1XLKA 3TFCA 5DXYA 2G50A 3CUIA 2HVOA 1E6ZA 1H7PA 4UOZA 4HOXA 3DG3A 3CV2A 3KDNA 4O57A 2F6KA 3VKCA 4GK8A 4L9ZA 1QVBA 2CLLA 3NM1A 4DYEA 5FOOA 2IQTA 4A05A 2W9MA 1UA7A 3AIRA 1VPYA 3GHRA 4J35A 1XXXA 4B5VA 4M19A 3EPMA 1R3TA 1RD5A 3ELFA 2ZDRA 2H6RA 2PTXA 3SUTA 3QHMA 1UKTA 4F0SA 4N6FA 1K6AA 1MZHA 4LEQA 5A8GA 3QYQA 1XQLA 2J13A 5K9XA 1QPQA 3E0FA 3I3BA 1KM4A 1O7AA 4ZE5A 4DYJA 2NXHA 3VNJA 1YMYA 1X38A 2EGZA 2IPWA 3CQ0A 5TF0A 5A8NA 1QBBA 3PB0A 2E40A 4QTGA 3CYJA 5HQLA 2GDQA 4A22A 1W91A 4YTRA 3GU1A 2BASA 2YYTA 1UKSA 5IFPA 1QI2A 3OIHA 2J75A 1UBPC 5H2ZA 5CJNA 3UETA 1NQKA 3LXCA 1H5YA 7TIMA 2ZZ3A 5ABGA 3TTYA 4U2ZA 1XLAA 1E1CB 2OCZA 2YBTA 4PL1A 5M03A 5FIPA 3AO0A 2VEGA 3CQKA 3AHZA 4V28A 3USZA 1PX3A 3C2RA 1UH3A 2NW0A 3SCVA 1XLBA 4YWIA 2W66A 2HVMA 5LXXA 1BFNA 2BHUA 4QSFA 2C8NA 2PUZA 3IJ7A 5BYWA 4J4KA 2VX7A 4NNBA 1S2VA 4LAKA 4A8LA 3B8WA 2F38A 1V93A 3BLKA 4PN2A 5A2CA 1TJ0A 2OEJA 3WK0A 2CHNA 3IGXA 1X39A 4I6VA 4RCXA 1C8VA 1C91A 2W3ZA 1UWRA 5J8LA 5AVNA 5I78A 3V16A 4B5WA 1OCJA 1HP4A 3DYOA 3IJ6A 5CZKA 4R3UA 1CYGA 2FQIA 3LD5A 2DIJA 3T07A 1SSGA 4LBUA 4GBDA 3CIWA 4QROA 3TFXA 7ODCA 3CIVA 1QFEA 3UR7A 1HW6A 2R91A 4D6JA 3BMVA 4QITA 3RLGA 4HJWA 1XCFA 1WO2A 1H7RA 1DV7A 4MWAB 3VZZA 1KXTA 4DWSD 1ZP3A 1JG9A 3PTKA 1YXCA 1GJWA 1J0KA 2FGLA 1K02A 4A8IA 3QW4B 3BLPX 4KCUA 1YDVA 1K9TA 3LOTA 4W8AA 1E3XA 1TPUA 3POCA 4QCFA 3WF3A 3RAOA 1TPC1 1ISYA 1GVRA 5I3FA 2XTKA 4TVDA 4JKLA 3OQEA 1JDDA 4GACA 1KBLA 4CQDA 5J04A 3HPAA 5F2MA 2JK2A 3ABOA 1V0MA 3RJXA 3W6MA 2XIJA 4ZEPA 3VOGA 3IK2A 5HMSA 3UPMA 3KCJA 3GS6A 1F7BA 2RAGA 3VZXA 5ABHA 4IIBA 3ANYA 4K37A 2E1WA 1W9UA 3T7VA 1LOSA 3NG3A 4Z2IA 4FEZA 3QBUA 1VFUA 1N8IA 3AXIA 4ZO6A 2QCEA 3OZMA 2VZTA 1TZ7A 3IIXA 2BOGX 1VLWA 1TE1A 1BAGA 4P8XA 2QJHA 4FAMA 2UY4A 3DFYA 4FNPA 1EJRC 1WDQA 4A3YA 3LA4A 2ZXBA 1V08A 1M3UA 4UFKA 2WW5A 9XIAA 2V2CA 1Q6CA 3EKGA 4NL1A 2EPOA 3DUGA 1F6KA 3SFKA 4Q4QA 8A3HA 3UXDA 3H4XA 1M65A 3UWWA 3CB3A 3S5ZA 4DJDC 2C79A 1N82A 3URBA 5C5YA 3CT7A 5E09A 2I5QA 4CEUC 4ADTA 3W26A 3TYUA 4PR4A 2PLKA 3WNLA 4IMFA 1NSJA 3IVSA 4C7DA 2O7QA 4ECLA 3T0DA 4JOMA 2WNWA 3TNBA 1G9HA 3AMGA 3HG5A 1E9YB 3JR2A 3GK0A 2DZVA 4ZOBA 4LRTA 3R8HA 4PYSA 3VKKA 5CJ5A 2DSWA 3RF9A 4Q7BA 4L4OA 4R7OA 5LIYX 1E6QM 2YLAA 3FHAA 5HPOA 4LH8A 3BOXA 3APYA 2VENA 1GKRA 4YXGA 1K6WA 3TX9A 3O0KA 3W7EA 1IZKA 3LLDA 4TIMA 4DLFA 3EGJA 1KTCA 2X1IA 5LNRA 4YCPA 3N13A 2WZTA 3F5JA 2QCGA 3MY9A 2FFCA 5F4SA 4XTDA 2FVKA 4HHHA 3EAUA 1UP0A 4W7UA 4C65A 3G1VA 3MMWA 2R14A 1I2NA 4JTUA 2A21A 1PAMA 4AIEA 3BQ6A 2P76A 1UD8A 3EOEA 1TUFA 4ZO8A 1OK6A 5H6HA 3WG6A 3SDOA 3CAWA 3R8RA 3PM6A 1E1EA 5F2IA 4RR4A 4NJJA 3OHMB 4TV5A 1B1YA 3GX9A 1RZMA 3QGKC 2GQAA 2HEJA 3A22A 3PBMA 1OHLA 1KXQA 2J27A 2JEPA 8XIMA 2VCBA 1PKLA 4HU4A 1UH2A 2DZAA 2NT0A 3TV8A 2JIEA 3IWPA 4J3VA 3V5CA 1WZAA 3O8AA 3ZS4A 4AH7A 3VZYA 5HK4A 4GPNA 4NASA 3EWCA 4AZ5A 4X9SA 1S5WA 3CXOA 3P0XA 2WXDM 3UWVA 2G97A 3WQEA 1TV3A 7REQA 1J2WA 1PTAA 4WDXA 1TIMA 4X61A 2PDIA 2WSQA 3EXRA 2ZUTA 1Q85A 3WJZA 3M46A 5D09A 4F48A 2JF6A 1SW0A 1XF0A 4YCOA 2QVHA 3TWBA 2ICSA 5D8ZA 3A24A 3R0KA 1OT1A 4CD4A 1WOBA 1W5PA 2YCIX 1AW1A 3E0LA 4P8WA 2OX4A 3DIPA 3VKAA 3VGEA 1XIHA 4TO8A 3M0HA 3GC5A 2HK1A 5E9XA 3CAQA 4XAZA 1MDRA 2P0IA 2WB5A 1XGZA 3QKEA 3B9OA 1LRNA 4PE8A 4ZB5A 2GFTA 1IZCA 1S3TC 1VJZA 1GOWA 2DH2A 1FHDA 4F0HA 4L61A 3ISIX 2BHYA 4AVFA 4W88A 4HSNA 2WMIA 3B0YA 2ATSA 3QGAC 3W1XA 3BMWA 3D47A 4IP4A 1PZ0A 4HPNA 1K8YA 1SZRA 3M9YA 3ZWSA 2ZOXA 1BQCA 3WL0A 3ORWA 4JQAA 5DN1A 9XIMA 3WKZA 1AJZA 4LF1A 2TRSA 1DL3A 1XINA 2PC4A 3MUAA 2CLOA 3DCPA 4HYWA 4H8VA 2ABAA 4UZUA 3S6TA 3K30A 4EANA 3F2CA 3VOCA 4XZ9A 4FNRA 3LI0A 4A21A 2GGJA 4X9YA 2FDMA 2XH0A 4UTWC 3GNDA 1C8YA 3GXFA 2PRHA 4FIRA 1DVJA 4Z2JA 4BEUA 1K8XA 1BXNA 1M7JA 4GUGA 1TMHA 3RJYA 1LT7A 5FACA 3UXIA 3H7RA 2RJHA 4L6OA 1WBJA 4YYFA 4GABA 3SR7A 4GFIA 3KRSA 4PCFA 4AZCA 1GORA 2XFFA 5CCZA 3L7RA 2X7VA 2WKLA 1SZNA 1K7XA 4ZQMA 3HGOA 4NI3A 2WHKA 4JTRA 3JS3A 3KBMA 3PJTA 1KR0A 4QGCA 4JTLA 3DDMA 3FGCB 2A4AA 4W8LA 2O92A 4P7LA 3ZR5A 3W83A 1SSDA 5F1VA 1OC7A 2WJEA 1EB3A 4D6EA 3KRBA 2OT0A 4BQ3A 4W7VA 5ECUA 2G37A 1J93A 3UPWA 1Z3NA 1LWJA 2MANA 2J9XA 5C71A 3GXDA 3NSNA 1JUBA 1WUFA 1XH0A 2PC8A 4OVXA 3Q58A 3N34A 3D6NA 1LQAA 1POJA 4OGZA 4GXPA 2A3HA 3DFHA 4Y2WA 5GVJA 5IDIA 4DF2A 3GW3A 3IIVA 1UZ4A 4GMEA 3VIPA 3PN8A 2BNJA 2JF7A 2HPMA 5EPDA 3MZNA 5DT5A 3WFAA 4N7QA 1TV5A 3WL1A 1PIIA 4YWSA 4LS1A 2W79A 1I2PA 3SSZA 1VLIA 2ZX8A 4Z2HA 1UA3A 2R1LA 5AN7A 4US6A 1V3MA 4DHGA 1KXVA 4WCJA 2G3NA 4CGTA 5J5DA 5C0QA 4UTJA 2ZRZA 4UTUA 4JTCA 3EYPA 1GVYA 4AG0A 2GPTA 2XIIA 3EWUA 1QNSA 2XM2A 1GYNA 1OG0A 4BKNA 2V2DA 2WLYA 3CB8A 4DWSC 3LCWA 1A5UA 5C2XA 2Q6ZA 4A4AA 3WQWA 2W27A 1XW8A 4V15A 2INEA 2JFEX 4JTJA 4E38A 3B05A 1B9BA 3VMOA 3YPIA 4IFRA 3QGVA 4W84A 3WBXA 2QDGA 3IJQA 1FWHC 5DX7A 4CQ8A 3EPOA 1A3XA 3TN3A 1BWVA 1TQJA 5LA0A 5CZTA 3U5UA 2VDGA 1VBRA 2GK1B 4RZ6A 1GZJA 5CBJA 3WZ0E 4O50A 3THCA 4IP7A 3NQMA 2G0WA 2Y63A 2G3IA 3KVJA 4GLEA 5H91A 3CHEA 1BRLB 3AYRA 3VKJA 3REQA 3W2KA 3PBGA 2DT1A 3RU8X 3FVDA 3G1RA 1XLDA 2NT1A 1A4MA 4URIA 2V0TA 1MW0A 1IQ8A 3TQKA 3P3BA 2OX1A 1CENA 4GI9A 3TMQA 1KFWA 3VIHA 1PXGA 3HQNA 4B2DA 1W1PA 1E0WA 4RW5A 4N9DA 3KLKA 2WMJA 3SUSA 1KRBC 1H09A 3V7PA 3DU0A 1K70A 2X05A 4D6IA 2V5JA 1WA3A 2BY3A 3FDGA 3MKVA 4HPXA 2PBGA 5E1QA 4H2HA 4HOZA 1BKSA 4M29A 2QVNA 3TQVA 5HUOA 4K8GA 2NUYA 4A2RA 4YMZA 2QJJA 4GOAA 4ORIA 3OLGA 2XISA 2CU0A 4IGSA 5FJOA 1DORA 4RXGA 1F3TA 4MNMA 3MT1A 3DEQA 1UD3A 3VIMA 3RLVA 4WLCA 3AXMA 5CPTA 5LHFA 4B15A 1W9PA 3W84A 4JNZA 3STPA 3QZAA 3S47A 1TWIA 3DHPA 3N1AA 3O6CA 2I9UA 1LWIA 1TELA 1BYAA 2A79A 2VFEA 4KH2A 4M6VA 1ZU8A 4RDYA 1WB0A 2X2GA 1DJHA 1KM5A 4JFTA 5EBUA 3TROA 1X6NA 2H3DA 4MYAA 3U2CA 4AWTA 1H7WA 1P0KA 1VYPX 4H00A 3OBKA 2D69A 2DQXA 4CKQA 3ARWA 2YXOA 3CMFA 1Q7ZA 4WKAA 4B3LA 2WNZA 3H4WA 2A6LA 1HKVA 2D20A 4ZE4A 4FOJA 5BXSA 3BLIA 4PODA 4F9JA 3W0KA 2R1NA 4S3BA 1JPMA 1NQ6A 5D05A 3G1HA 5AHNA 5BRQA 2EKCA 1VBGA 2WPBA 2CBIA 3R4IA 4HNOA 2PWFA 3GG8A 4RE0A 2QIIA 3PFMA 3GG7A 4YJ5A 2MNRA 4FXSA 1YXYA 1M7OA 5CG0A 4XZHA 2CYGA 3UF9A 3VNMA 2VEPA 3KZPA 1UR1A 4UR8A 4HA3A 3WD2A 3B3DA 3VPLA 1OFPA 3VCCA 4Z08A 3W9ZA 1GZGA 1FKWA 1XBYA 4K1WA 2VKZG 4LUIA 3DGRA 3XISA 3W38A 2WVTA 1KRCC 1XIJA 3AQUA 3S2NA 5HINA 4PBEA 1UP3A 3TYBA 2I1OA 3W88A 4O15A 2VCCA 2FGBA 4OQVA 4H1ZA 1F05A 3VD7A 2WBGA 1JAKA 1E43A 1YTDA 3T81A 2Z29A 1W3HA 3PNUA 1RP9A 3IGSA 3S2LA 2QDDA 3AIVA 4XIAA 2CHRA 2OKOA 3ZSTA 3NDYA 1J96A 3BICA 4XV0A 5H8MA 1QOPA 2YW4A 3NYZA 2DY3A 3EXTA 3TN6A 1EC8A 1OINA 1QNRA 1KCKA 5FJRA 1L6FA 1NOWA 5AHEA 5REQA 2WOQA 3TR2A 3BV7A 4DM1A 1SFJA 3PPGA 1VPQA 2J7HA 2XINA 2XG9A 1YTKA 3TYEA 2F2HA 3GTHA 2PF0A 4F3HA 1ZBVA 2YB4A 5C9UA 5FJTA 3LXAA 2PWEA 2XGZA 3S5SA 2DW7A 2UY3A 3GM8A 2VUYA 3IUIA 3O63A 1CZ1A 3PTDA 2CZVA 3TE9A 2QF7A 4F66A 1MO0A 3PF3A 3FLUA 4TX6A 2OU4A 1H7NA 4GHRA 1HKJA 4J5NA 3NNTA 1GEQA 3KE0A 2G41A 1R3SA 4JS3A 2GUUA 1TJ2A 1JZ4A 2BFGA 1XYMA 1I2OA 3DG7A 1S1RA 3KOYA 3PJXA 3H70A 4R88A 6PTDA 1ZS2A 2QPSA 1NTHA 1W8SA 2HBVA 2GWNA 5AC7A 5DY2A 1OZMA 4Z2LA 4I9AA 4MWAD 3WMCA 3IACA 2PCEA 4Q6XA 5IOBA 3CZGA 3ARXA 1JL8A 3GBEA 2JE8A 1YADA 2P50A 1Q6DA 4J1OA 1U1JA 3DZ1A 2OO6A 4JCLA 3Q37A 4LU0A 3LX9A 3M0JA 3CUGA 4JYDA 4XO7A 4A29A 1B90A 1XFBA 1JDFA 1W9XA 1HJXA 2FJUB 3GIQA 3WEOA 5D32A 3S46A 2SFPA 1NJJA 3L2MA 3RM9A 2V9DA 4WJEA 2BGNE 2A7NA 4S3JA 4S38A 4B3ZA 1UPPA 1WDDA 3C3UA 3LPGA 5E0FA 1LOQA 2PDMA 4OBSA 2BB0A 4LQ1A 3UY8A 2H90A 4EWND 2Y70A 4KRUA 2X0YA 5CGTA 2DZBA 4BI6A 4D72A 2OOFA 4H9ZA 2Z28A 3A5VA 4HU3A 4BS0A 3ZVHA 5LHEA 4K8EA 1GWJA 3QTGA 1KWKA 2F8QA 3B8VA 4WIWA 1BVNP 1IGSA 1SFTA 3I7QA 1JUKA 1XLJA 4I3GA 4WD0A 3AIEA 1DBTA 1E4LA 3QOKA 4DJED 2J66A 1EA9C 3PP7A 3U7BA 4PB5A 3KP1A 4K38A 3V4BA 3GTXA 3NDOA 3LHYA 1LL7A 3UXKA 4EX4A 3H2AA 4CVUA 1R3WA 1V5XA 2C3ZA 2V67A 3QM3A 2Y8KA 4Q4OA 3RCYA 1KFEA 3PC0A 1EO7A 4YIWA 3W7MA 4G9PA 3SB0A 2BMBA 2ZXAA 5FJUA 1PL9A 3SCWA 2BS9A 1FCVA 2I9EA 3D0CA 3NQDA 2QR6A 3STGA 1W2VA 2QJGA 1M6JA 5JH2A 3N2BA 1IT7A 4U3CA 5G2HA 2AGKA 4YYCA 1VFFA 3AS0A 3E0WA 1QPKA 3W27A 3OHIA 3GFYA 3NIYA 4AY1A 1YQ2A 3NO1A 1T8XA 2YA0A 4QX4A 2OYKA 3BOLA 1A5KC 1EJXC 2OLHA 4J3TA 2P3EA 2VR4A 3LZ5A 1FTXA 1Y7VA 2QUVA 4HZ6A 1KTBA 1VFOA 4OV9A 3URQA 2WJFA 2X1UA 3SRDA 4I7WA 3GE7A 3BARA 4M24A 3QY7A 3JRKA 1X1ZA 1XLCA 3WD4A 5A8OA 2PDBA 4KRTA 3MP5A 1W1ZA 1WDRA 1UWQA 1QTWA 3OO2A 5C7HA 5C9ZA 2ZKMX 4R27A 1G0CA 1S2WA 3PBWA 3VDHA 3K8LA 1FQ0A 1KGWA 1K9FA 4XD6A 4GUIA 1VQTA 3MHFA 1R38A 2B7OA 2OGYA 3OU8A 1OD8A 4CD7A 3HV9A 2HDJA 1QATA 3ABXA 1AODA 3I3DA 2VFIA 5EY5A 1PZ2A 4N4PA 2IMRA 2PDLA 2WJZA 2AQVA 2A85A 1E55A 1P0NA 4MWAC 1KKRA 3P93A 4CCCA 3G6MA 4UTTA 3OW1A 5IRPA 2J78A 2Z26A 3BTNA 1G01A 5G4EA 1W37A 1ZJAA 3CQHA 4QLKA 4CCZA 2FLIA 4U28A 2WHLA 5LNUA 2EF9A 6A3HA 1A5OC 1JR1A 2VC9A 3QMSA 4NJKA 4UFLA 4C91A 1CNVA 3CK5A 4JKKA 1FWEC 3BAIA 1HG3A 3SUVA 6ENLA 3DHFA 3LHZA 1CLVA 2PRLA 4PUJA 3BAJA 4LOCA 5LGZA 5FA5A 4F79A 4WOZA 2PP1A 4M1RA 3LY0A 3FNDA 1E6XM 4UQEA 2C1GA 1TPEA 2GDUA 3TC7A 2V81A 3FCPA 2WZEA 3ENLA 2EQDA 4JQ4A 1GNXA 3MI6A 1E6RA 1OSEA 1JPIA 3MMTA 1PJ9A 5B7YA 3PBVA 1LQ2A 2WNNA 4Q4RA 3M0LA 1O68A 4QAIA 3N9RA 4I5XA 1REQB 1OIFA 1V7AA 3S8HA 3UGRA 1B5TA 2C1IA 3W22A 4INFA 5CSUA 1JUEA 3TQ0A 4HPHA 2JALA 3ZQ9A 2DSUA 1ZUAX 4IPJA 1IEXA 3N2MA 3DI0A 7CGTA 4HPGA 5DT7A 1EBHA 1K7EA 3M5XA 4EPEC 3HTWA 1J4EA 1RSCA 2WMHA 3OEXA 4UMBA 1OT2A 3CV6A 2WVUA 3R12A 1WKEA 3DERA 4E2VA 3PSWA 1RH9A 2Z6JA 1QR7A 3GTIA 2VDHA 3EWYA 1TUXA 4WGXA 3VOFA 2GJXA 3U8GA 4JIQA 1P48A 1ADDA 4MJZA 5KEZA 1EF3A 1MQRA 1FCBA 1UKOA 2BZNA 3GNOA 4J40A 3SADA 3BW2A 3ZSSA 1XYAA 4OOZA 1JDEA 4HNUA 2WCAA 3AXHA 2DJLA 2XFYA 4Z2KA 4BWLA 2YDSA 4ZQCA 2O56A 1DXEA 5I02A 4C60A 1OYBA 1LJYA 1RXOB 3MP4A 1HL9A 4C6IA 2EPLX 3WJWA 1TSIA 3TTOA 1B31A 3R94A 4O0QA 3JZUA 3PG9A 1QO2A 4D6HA 1AFSA 1PZ1A 3WDHA 5D04C 3BC9A 5IHSA 3C61A 3N4FA 3WBYA 1NWSA 5CXPA 3D5HA 5ABFB 1ZBCA 1XS2A 3NXFA 3B0XA 2PDYA 3TP4A 1ONEA 5KSWA 4HK5A 2OZ0A 1E1FA 3WQCA 2NV9A 3CLWA 1VYSX 3URNA 4WY0F 1QBAA 4EP8C 4NILA 1B3YA 3SGGA 2PDQA 5I3DA 4MHBA 5A6SA 4E3VA 1W2PA 4IMEA 2ZTJA 1O94A 4GQQA 1YPXA 1K9DA 4AHQA 1DOSA 3KHJA 4HSHA 3VIFA 1RBAA 2FVMA 3W6LA 4GFSA 4S3GA 1WV2A 5EFFA 1E0VA 2OKTA 1DJYA 4E5TA 3CGTA 2PDPA 3QY8A 1FH7A 2YZ5A 4DUVA 2H3BA 4FALA 2VGFA 3KBJA 3NZPA 3G6LA 1UD2A 1JZ6A 1V51A 2WNQA 3QSRA 1B3ZA 5M17A 1YLVA 1PKYA 3B8IA 2QT3A 4LYQA 3AIBA 4Q33A 2OQYA 2W0UA 4DIAA 4ENLA 2OSXA 4DO7A 2R94A 1C9DA 1AMYA 3DKJA 1ZL1A 5FCZA 3GIYA 3HQ1A 4ATWA 2QULA 1P43A 1JCMP 2WMKA 5D9PA 3H23A 1JULA 1V8EA 5BRPA 4DO5A 3H6OA 1KRMA 1CB7B 4KPLA 1ZCOA 3DYPA 3GKAA 3TC6A 2PWVA 2Y7DA 4R7JA 3BWWA 3V75A 3VMNA 1H3GA 3ARSA 4GKLA 4I9JA 3B8UA 2AL1A 4OTKA 1PUDA 4O19A 1NWRA 4FP1A 2E25A 3PULA 1V03A 1XV8A 4IUGA 3OGRA 4LALA 4AF0B 4P8VA 1WNOA 2VX5A 3ZVHB 2C91A 1DPMA 1K3UA 2G95A 1TV7A 2WKGA 1CGVA 3W7KA 1MVYA 4KBXA 4IPIA 1OQFA 3LPPA 2VI0A 4L1WA 1H61A 1W5MA 4PC8A 3FA5A 4RE3A 2XWDA 3R43A 4TUFA 3AHYA 2B0MA 3K2GA 1TR9A 3C52A 1A50A 3MPGA 5EFDA 3RR4A 1EDTA 5I7GA 3PTQA 3UBPC 3A9IA 3M0YA 3RXZA 4WKFA 4IP5A 4LUTB 4Q4KA 1LLWA 3JVAA 1CXHA 3QR0A 3M1ZA 2OWWA 1PDZA 1E15A 4FOKA 2GJXB 3L67A 3GDBA 5HJYA 4PMNA 3MSGA 2HMCA 1NDYA 3B9EA 2GVJA 3LCHA 4XQ6A 3F7JA 2HK0A 1W3LA 1KM1A 4WVXA 3N12A 1V79A 4UQBA 1J5SA 3A4XA 3LCGA 2WC3A 4WXZA 1UR8A 5HWNA 1YBQA 5CLWA 1S2UA 2GGHA 3KX6A 2XH2A 2CZDA 2D0FA 1JZ7A 1FWIC 2WAGA 2ZUMA 4RZBA 3RITA 3UA3A 5CZ0A 3S9ZA 1R0MA 4B5UA 4WX2A 3KWXA 4IXXA 1YNQA 3SZ8A 1HVXA 1H0GA 3PUDA 1H49A 3QQ0A 3QFEA 4JPGA 4YTQA 3H7VA 1AMKA 1SM9A 3GTNA 1UQZA 2HE8A 1BG4A 3O0FA 5HR7A 1KLZA 3THUA 1I2QA 1W5NA 2PLCA 3QPEA 4YTSA 5FAJA 3OZPA 3AJXA 4MLRA 3UG4A 1UJPA 1D8CA 4MVAA 4TR9A 2HXTA 4ZQOA 4US5A 3M0MA 1E0TA 3VGDA 3VINA 4H8NA 4LPCA 2B7NA 3VNKA 4O53A 2OMAA 4NZJA 3M44A 3TC3A 1E40A 3WLRA 3WDIA 4KF1A 1MQQA 5I3IA 3WX7A 1GVIA 1QOXA 1UPMB 5BOFA 2ACSA 1JYXA 1HZYA 3F4CA 3BJSA 2PLMA 3MSYA 4H01A 1A0DA 3FX4A 2Z1WA 4U3AA 3KHDA 3W71A 4FS9A 2F7FA 4ZO7A 3IJ8A 1QPNA 4NQ1A 2AOSA 3ITTA 2XN2A 4HIBA 4QG8A 3ZZ1A 4PMXA 4C6FA 3PUEA 3UJFA 3EWWA 5CBIA 4DN1A 5LKYA 1LP6A 5CBBA 1FHUA 3AYVA 1R9YA 2YLLA 3F4VA 4O10A 1CXEA 5CSRA 1PIFA 1A4LA 4L64A 1BXBA 3IJDA 4EXQA 3UZWA 5DRIA 1GTEA 1L9WA 5AECA 4DWSB 1E56A 4NZ5A 1H50A 2HQAA 2O9TA 1I2RA 3V0SA 4N9EA 4UIOA 1JQXA 2G4JA 3LTYA 4QHRA 4UXDA 4PMUA 3W7GA 1TKKA 4CQBA 1JQVA 1SJCA 2CLHA 4IFKB 1GJUA 2BP1A 1H41A 1V6WA 2GJLA 1FWJC 3DYMA 3CH9A 1P6WA 1OVDA 3H22A 4CNUA 4IFKA 3FSTA 2C71A 2CXEA 1XLGA 4TV6A 1GZ1A 2E6DA 2V3DA 3FS2A 2WM1A 3P62A 4QJ5B 5F2LA 1UUQA 4GCXA 2VC7A 1S5VA 4KGLA 1VH7A 1US3A 1NDVA 3N11A 4KFNA 2ODOA 3GY1A 3W7CA 3FEQA 4OFCA 4IWWA 5FI8A 5HWMA 3V1HA 3EOLA 3VGBA 5CPQA 4GQBA 3ABRA 5DFAA 4B5NA 3ZLGA 5K7JA 4CNOA 3NQVA 3R2GA 3GVRA 1W5OA 4U31A 4NRSA 3CAKA 4OKDA 4UR7A 2X0HA 4ERIA 1S5NA 1R7AA 3BSHA 4HVXA 4FZIA 3P80A 2Q3RA 2WJDA 3GU9A 2Q02A 4LUTA 3F2BA 3HFYA 3ZT7A 2ON3A 1L6WA 3FHQA 4MLJA 2VGBA 5BRBA 3AS3A 3UGVA 1LCOA 4A6GA 3K13A 1JDCA 3W1QA 4U5KA 3BGJA 3LSBA 3VOJA 1ZJIA 4HMDA 3MYOA 3FKKA 2RHGA 2XFRA 4ATDA 3ITXA 3VDGA 1J0JA 4FB7A 4H9YA 1UR2A 4FLOA 1BSLA 1EKOA 1W3IA 2ACRA 5FF7A 2J8GA 4GI8A 1TREA 4AD3A 1CGUA 4IZGA 2GVEA 4YPJA 1L6SA 4EIVA 2GOKA 4WSJA 1Q7MA 3QHNA 1Y5VA 4KESA 2NVDA 1TA3A 3TZNA 4ERAA 1QUMA 4XZNX 2CZFA 1X1OA 1TVPA 4HHPA 2PSNA 2Z1SA 2FZDA 4J3XA 2GWGA 4QDPA 1U1UA 1JEZA 1MI3A 4HNCA 1XIIA 3FAXA 2VX4A 5CSSA 2ZZ6A 3I65A 2FPYA 3B9DA 4B91A 3CV1A 5MF5A 2NQHA 2QEZA 1FX6A 2A1YA 3O2LA 4EF8A 2ZZ5A 3WLMA 2BDQA 5CKSA 3O9NA 3L12A 5D9NA 3MI2A 1C8QA 1LG2A 4UQDA 3M4HA 3WDQA 1U5HA 1XYLA 3SUWA 3ANUA 5MKGB 5HQEA 3M7SA 1E9LA 1SVDA 4C1LA 4WOQA 3A6OA 1W8GA 2CNCA 4W93A 4WEVX 2J6XA 2Q71A 1EQCA 3GVWA 3W7JA 1JD7A 2DZUA 4JQ2A 1CIUA 2VZOA 2PGWA 1O6IA 3O1NA 3B8SA 3W74A 3G8EA 1XLEA 4P5UA 3VNYA 3CZEA 2IPGA 4WF7A 2OGJA 1VFHA 1X98A 3CWHA 3GR4A 5A1AA 2HNEA 3S5YA 3VC6A 2W62A 1VRXA 3KTCA 1P6BA 1WCGA 4PZVA 4HK6A 4KT2A 4MPQA 1GOQA 1R46A 2Y7GA 3ZJ8A 4O1FA 4WK9A 7ENLA 4Z1BA 1LM1A 3EDJA 3QQWA 3LSCA 3WLIA 4OOUA 1XISA 2DU2A 3C8NA 1HX0A 2BY2A 2XVNA 3FKRA 3LBCA 2GDVA 5HNRA 1QMLA 1RJQA 2Y8UA 1SO4A 1P0BA 2ZIDA 4AEEA 5D2XA 6CGTA 3LQLA 5D02A 4A8RA 2Z4GA 4C1NA 2IXUA 1FP8A 5LZLA 3OA5A 4BI7A 1KBJA 3SURA 3P81A 5D9OA 5E0CA 2ADAA 4Q4PA 4CNSA 5M1TA 1D2KA 3PTMA 5A8MA 3NCOA 1OD0A 1ODZA 1DQWA 3FW6A 2GUYA 3UD6A 2PBOA 2IS7A 1CTNA 4A35A 3UR5A 1LT8A 4GVIA 3TW6A 4KEMA 3VM5A 3ZOAA 3EA1A 1MYRA 4H04A 5E0KA 3WLLA 1BSIA 3GUGA 1QOQA 4JXCA 5I03A 1OX4A 2A3CA 4DF1A 1XCWA 4RK8A 3TN4A 4UFJA 3GXIA 4QCEA 1QNQA 1UZDA 3O07A 4XVDA 3IPWA 1LQ0A 2VNCA 4C6OA 1KA9F 4IX2A 1RA5A 4ZENA 3LCLA 3C2EA 1EF2A 2HRWA 3GDRA 3KW3A 4R9XA 1AL8A 2CETA 1YW1A 1QNPA 1ONXA 4Q22A 3KL5A 1U22A 3GD6A 2B7QA 1E3ZA 4ZTYA 1EJ7L 4LYKA 4B16A 5DXXA 3RM8A 4ZO9A 3G1AA 1TV8A 1NWTA 1LROA 3H24A 4I90A 4J3UA 1UB3A 2XN1A 4C6KA 1TMLA 3UPBA 3HPZA 2WSRA 1RUSA 1UBSA 2DEPA 3CHVA 1GEHA 4NAEA 1PV8A 4O52A 2PFHA 2PZNA 1OCNA 3EOSA 4HZMA 1EDQA 1PS9A 4JL2A 4PBGA 2QW5A 3HG4A 2C1HA 3ARPA 4HK7A 1S39A 2Z7KA 4FF7A 5BW6A 1KBIA 5AHFA 4XD3A 2OB3A 4DBDA 4AD4A 3SM0A 1AL7A 2V3FA 4NHVA 1Q6QA 3G8RA 4GYKA 3L0KA 4HTBA 4Q8OA 3BDKA 1O95A 3BG9A 4XKYA 3SCOA 1OGBA 3VNZA 3K4AA 1WUEA 1DWFM 3HJZA 2XGIA 3M5YA 1VIWA 4R9OA 4I8DA 1FXQA 2CZ5A 1KCZA 1TWDA 5C7VA 2LLEA 4XSLA 1BQGA 5JH1A 1K1DA 2VMFA 2NV1A 1E70M 1EH9A 3LCXA 4G1NA 4ACZB 1JGMA 3GU2A 3XIMA 3M0KA 1J8VA 1LBFA 2WZMA 1JVNA 2ZBTA 3TSDA 4ACZA 4AZGA 5DCDA 1K8ZA 3UZ5A 3AOFA 5L6UA 3E2SA 3HB9A 4Y7EA 1PKNA 1CW2A 4MFEA 4IG2B 3FJNA 4LXFA 1F76A 3TLQA 1B3WA 3L21A 3D3AA 3GFXA 3VX1A 5XIMA 3W85A 3RLUA 1G94A 3TQPA 4MMWA 1DJXA 5F2GA 4XX6A 4MUZA 1CECA 4V1YA 1K8CA 4IL0A 5FEXA 1YPFA 2PU1A 2PLJA 1E73M 4ZODA 3FY1A 1OY0A 5A2AA 4QS5A 2NUXA 1CT5A 1W3JA 4ZMGA 1G1YA 4OUEA 3P14A 4YHEA 1UWUA 4JTIA 2RDUA 1WKYA 3QXBA 2CLIA 2VGIA 3S2MA 1EDGA 2AAAA 4RE4A 4NXKA 3WLSA 5FSDC 2PURA 4H41A 3UWEA 4KCWA 2G3MA 5IFTA 3ZR4A 3VE7A 3RFAA 3I4EA 5M5DA 3NL6A 1CXLA 1ZAJA 1FWWA 4REQB 5HMEA 3GNPA 1H63A 2O9OA 4BF7A 3NOEA 3UVIA 1QI5A 3OGVA 4E4UA 1K77A 5CZJA 4MKSA 4JN7A 1L8NA 5CC5A 3OA3A 3OGSA 1LYXA 4DJFA 1XH1A 3W6YA 1JZ5A 2VGGA 2X7WA 3OTRA 3EX6A 3EOOA 5FF0A 2QKFA 1C29A 4IJRA 1DJZA 3WK1A 1GG1A 3RGTA 4PBFA 4AU0A 3UA4A 1E9IA 4GYPC 1LG1A 4OWGA 4U33A 3R89A 1IEVA 1C8XA 3ITCA 4Q32A 1PVNA 4ZXOA 1I4NA 2VEMA 1HKKA 2WVVA 5AYIA 3PZGA 4O28A 3E3HA 1LF1A 1QDSA 5IXEA 3BW4A 3N9SA 5I3JA 2JGQA 3VNDA 2Y24A 3PPFA 2E9MA 1W1TA 4F0MA 4JX4A 3WLJA 3UZYA 4AD5A 5KZ6A 3W7DA 1EJSC 2HWGA 1Q65A 3IV3A 4GC4A 3VC5A 1XYCA 1L8PA 1ZY9A 2E9BA 4XD5A 3C2YA 4PFHA 1EJTC 1V4YA 2Z1VA 3BJFA 2P88A 2ASHA 3WJSA 3OQ8A 1G4SA 3S1GA 3VO0A 1W1B1 3L65A 3SGZA 3FYYA 2H9AB 4GISA 5G1YA 3S5NA 3CT2A 3EMZA 3WQOA 3GAYA 2HJPA 2QCDA 3ITVA 4EXBA 3TNOA 1JRBA 4LUSA 3WF1A 2PGEA 3PG8A 1BYCA 4UFMA 5DCEA 4K68A 1XBZA 4GY7A 3ZM8A 2VD9A 1TZZA 5AKQA 4LUSB 4AIUA 4PMDA 2RKXA 3WH5A 2QCLA 3MUZ1 4LAUA 3WLNA 1PSCA 1VEOA 3F5KA 1F73A 2YCKX 3QLLA 3ZLHA 4KFPA 5EGRA 3MO7A 3WLTA 3TZFA 1M7XA 2BX7A 3NTYA 1AJ2A 2GGEA 2WYSA 4N0RA 1TPWA 1WBHA 4K8HA 5HPCA 4RNHA 4M6QA 1FWFC 1GOOA 1WKFA 4LC6A 1A80A 2EPKX 2CKRA 3E38A 2XU2A 4GNKB 1C9WA 4LS2A 2UWFA 1PDYA 2WVSA 2FVLA 2PTZA 2J4GA 4OECA 2PS2A 2B7PA 4Q8UA 5BU9A 5CH9A 4KMQA 2E28A 1XYZA 3P7YA 1E4IA 2YBVA 3HGRA 3P61A 3EB3A 2CLMA 2AAMA 3NWRA 1O66A 5EYWA 3M64A 4HCLA 2D73A 1QWGA 2E6YA 3I68A 3KZSA 2R8WA 4OBRA 1PE1A 1WQ5A 3V5OA 4IMAA 1XRSA 1Q8JA 4PRRA 3CLMA 1B57A 3F1QA 1VFSA 3AC0A 4QDWA 5HAOA 4GJIA 3B0UX 4AFYA 2QJIA 3CBWA 3TDFA 1XGEA 1XM3A 4G8TA 1JPHA 3EX3A 3AS1A 4ZQNA 3NPUA 4QNWA 3MUY1 3TOYA 1A0EA 2OEMA 2D2OA 2V30A 2E6AA 3II1A 3LB0A 3GVVA 4UQCA 5JVLA 3EB2A 1O12A 1Q13A 1W6TA 3GDKA 4M56A 5XIAA 2E8ZA 1MUCA 2MUCA 2WANA 3NEVA 5I07A 5D4YA 4HA1A 5ABEA 3JW7A 4EK7A 3N25A 4GD0A 1XDJA 3P8JA 1RLDA 4XAGA 5JXQA 2FH8A 3W37A 1GVEA 3U0HA 1WXZA 2VYOA 3BLEA 3WNMA 1UIPA 1R47A 5D2VA 1TJ1A 1W9VA 4LV4A 2PF8A 4CNTA 2IKGA 1D3HA 1OX6A 5I09A 1JYVA 3LXBA 5BWFA 5BXTA 1Z48A 2E0PA 1VHNA 4RX0A 4NX5A 1W54A 4N9CA 3TAOA 4D8AA 1GG0A 4GXWA 3LHTA 1BF2A 1FRBA 2A0NA 5JBEA 4CUCA 2PDJA 3N04A 3N3MA 3TKFA 1IZJA 3W07A 1XL9A 1SQ7A 4H8UA 3KRUA 3ZYZA 2I57A 3CJPA 2WHJA 4MJMA 1LBMA 3EDFA 3QFWA 3BW3A 1OADA 1Z9AA 1KWGA 1QW8A 4I5UA 4S2CA 3ZLFA 3WLOA 3R11A 1MUMA 3N4AA 2DVUA 3E2VA 4J9JA 3BLLA 3OBAA 3WQ4A 4GJ1A 2GVLA 3NR0A 1S2TA 1GCYA 1EGMA 1QHZA 4NKCA 4O1CA 3HBLA 4W86A 3EWDA 5FEZA 1T6MA 4XSMA 2DGAA 1DKWA 2G4FA 1J18A 3GB6A 1ZJBA 3SJ3A 2A6NA 2FYMA 4K39A 4B5SA 5AVHA 5I3GA 3WH7A 5B80A 8RUCA 2O55A 1WDWA 3G0UA 3FJ6A 3WCZA 1LUCA 3PY2A 1CCWB 3SCPA 3LRKA 2VX6A 3AUOA 5G2WA 4XBKA 2PRMA 1UMYA 2XH4A 3FN9A 2V3GA 2OT1A 1IEIA 3PUOA 2C0AA 3W7QA 4PEEA 3U6WA 4E3TA 3TYZA 4US5D 4MAZA 3I7RA 3BE7A 4GQRA 3L4WA 3T1GA 1H2JA 2NX9A 2NUWA 3DFNA 2FPTA 3GDLA 2CBUA 3OLDA 1X1NA 3R0DA 4AMCA 2DFAA 2QQ6A 3O6YX 1NF7A 4HMCA 3AYSA 3DECA 3GYCA 4DUWA 1PX8A 5TD4A 1WYIA 5AYBA 5XINA 3KTSA 1YKWA 3CQJA 2QZRA 3W2LA 4NNAA 3CIXA 1OFRA 5IM51 3CHFA 4LANA 1ZPTA 3KXQA 3WQGA 2WMFA 2W5FA 2ZX7A 3MS8A 4ZZ9A 1S1PA 4C6CA 1W1VA 1NP0A 3IVUA 1E6SM 5T91A 3CEUA 3ARYA 2VJXA 4I5RA 2YXXA 2YIHA 3H12A 3BVJA 4FIQA 3S2CA 4AZ6A 4ZL1A 1TMQA 1EJVC 5GNZA 4P7OA 5FF4A 4JGDA 2RH9A 4HQVA 3ABSA 3CHCA 4GVFA 1UUMA 3GHTA 4Y8EA 2OELA 2VWSA 4LB3A 1R9XA 3QF0A 1RD6A 4EPBC 4UUIA 2KZHA 3AIWA 3LRLA 1WAWA 3INPA 4ML9A 3SRFA 1J10A 5LIXX 1ECEA 4O17A 3RPDA 2WWCA 1XPYA 4C6DA 1QW7A 3DFSA 4JYFA 1O1HA 1IXOA 1VZWA 2BXYA 3XINA 1TX0A 2Y7FA 3QOMA 3HPFA 3P82A 4L6DA 3EEZA 3GIPA 3B0VC 1YYAA 5HATA 2ZTKA 1MRQA 5ENLA 1Q8AA 4LGXA 2OLAA 3HQOA 2PU0A 3SRHA 3D3FA 4M81A 3RR1A 4XAPA 4C6LA 2VEIA 3VM7A 2DSZA 5CC3A 2JKAA 4XIMA 1ESWA 1OFBA 2ATMA 4O16A 1US2A 3O06A 4M3PA 3V0UA 1QPOA 4YTTA 2A3LA 1AUSL 1ZHAA 3V5FA 4KIEA 2P8BA 3BSMA 3KRZA 2I16A 4V33A 3PPCA 3STFA 3NQ8A 3WNPA 3IANA 1B3XA 4IIEA 4ERGA 4KIRA 4JTQA 3SCUA 4L4MA 4I8YA 4U5IA 3EEGA 3ARQA 2VOTA 2NXIA 4RUBA 5D8WA 3NDZA 2D24A 4HMNA 2NWSA 3MCMA 3IAPA 3E9AA 3G2GA 3WUGA 1ITXA 3LEPA 3EX2A 3G0SA 1LWHA 4HSOA 2GLKA 4MADA 4FXRA 3PB2A 4KCTA 3P5ZA 4DJFC 3LZ3A 4XB3A 3PNZA 1KFLA 1TA3B 4A3QA 4PUKA 4NG3A 3VTRA 4V2XA 4JNMA 4AD2A 1RV8A 1YE6A 3P67A 1TPFA 2VL4A 4PTVA 4G1KA 1EHNA 2X2YA 3EOUA 4KS0A 4JAWA 3SCTA 3V1PA 5A69A 3SBFA 3L0GA 2YA2A 4HZ8A 2YR1A 4O12A 4JEQA 2P8CA 3GO2A 1KQYA 4ZOEA 1V3JA 3R8GA 3ZT5A 4E6MA 3GVQA 3HZ3A 2ONEA 2I5GA 3T6CA 1NEYA 1UKPA 2YFNA 3BCFA 1ZRQA 3H26A 5GNYA 2WQDA 3I6RA 3UP8A 4W4QA 4D1IA 3PZOA 3WK2A 3BH4A 3VNIA 1BKHA 2YYUA 3N6QA 2PTDA 1VFMA 2NVCA 1KFJA 1FWCC 1VCGA 1ONWA 3HGSA 4UTLA 2XGBA 1BD0A 3UYIA 3L4VA 1DEDA 1JIBA 3MC5A 1DIEA 4I9MA 2CBVA 2Y5EA 1MXGA 1Z8AA 1X6UA 3MQTA 2FTWA 4H9TA 4MKVA 4AWSA 1AZ2A 2OQLA 3QR3A 4HT3A 2Q8ZA 1BWLA 4YVVA 4D1JA 4GVHA 2GGGA 3MHGA 1G6CA 4IQDA 4AZBA 1XIFA 3PS7A 2J8FA 2YL6A 3DFTA 3LNPA 3CUHA 4I6KA 3WDJA 4DYKA 1F07A 4EVZA 1G7UA 5AHMA 4MM1A 1UIOA 1EUAA 2XUCA 1J6OA 1B4KA 2VD8A 4BZYA 1XP3A 1DXFA 2RGMA 1DJIA 4YTUA 2OR2A 4JY8A 1E1CA 4B3KA 5GJNA 2GVGA 3UWYA 1H60A 2ZZ4A 1OFQA 2DZSA 2D2HA 1VIZA 4DRSA 1T0OA 4ZA0A 2I14A 4R53A 1TQXA 1CX9A 4YNGA 4GRSA 2OWXA 1F3EA 2C7FA 2KX9A 4PMVA 4XISA 4KEVA 3CO4A 2Z2BA 2HPIA 4RLIA 3MHUA 4YS1A 4IQLA 4UTFA 3GKFA 3LGDA 4GVGA 1TRDA 3L5MA 3DOPA 4ICNA 3E12A 1J5TA 3QRHA 4GQGA 3LENA 1SZGA 2IQ0A 1K03A 1GVOA 3M7WA 4OBTA 3TW9A 3GXMA 2EBNA 1GONA 3LHUA 4GJJA 3U5YA 3B4YA 3ATZA 2YOCA 3GVGA 2YA1A 1TFVA 4O8AA 1TYGA 4AZIA 2WM0A 4KERA 3WO8A 4CLMA 4LTSA 2VURA 2GL5A 1XIGA 4HNNA 4Z1DA 4GNJA 2PB1A 3Q65A 1MXSA 2Y2WA 1FHVA 1DHPA 4M8UA 5A6AA 1YE4A 2FHCA 1F4HA 3NQ7A 2H8ZA 4AISA 3WH9A 1E4NA 4OV4A 4S2BA 1IT0A 1QW9A 3L4YA 4ZQRA 5EL1A 4H9VA 2FIQA 1XR2A 1CBGA 4QISA 3GG1A 3UJRA 3SIMA 3VOHA 3P84A 4IQJA 3W1AA 1XWYA 2J24A 2QGHA 5LSMA 3VDBA 3I6TA 3PZNA 1RALA 4JQ3A 3ZJKA 3AWOA 4IL2A 5HNTA 2INZA 3NPXA 1G67A 4LVDA 4PA8A 1JZ2A 2ZWZA 1P1MA 3VCRA 3CUZA 3E6EA 3DI1A 2E1DA 1JDAA 1RVKA 4OT7A 4QG9A 4K6AA 5AFDA 3PANA 2C15A 3VDCA 1H1NA 1BRLA 1H11A 4UTKA 2YKKA 4YL2A 3JZEA 1M1BA 4DBUA 4HNTA 3A3HA 3O16A 1KXHA 3AYTA 1W17A 1M7PA 3AIUA 3WLQA 3NQEA 1I0DA 3HIJA 4RE2A 3SSJA 3TU9A 4Y9OA 1YDYA 4YVXA 3L2IA 4MY8A 4Q8VA 2YCLA 5HJXA 4DAFA 4UCGA 2ISDA 2XFWA 4GZJA 2GOUA 2ZCGA 3ITGA 1WDPA 3CTLA 2R1PA 3OLEA 3VFLA 3H4GA 1TVLA 2DZPA 4NIRA 4MGGA 2QYGA 4IJCA 4QNEA 4WSKA 1ISXA 2OJPA 1X97A 4UWMA 1HFBA 3W4RA 4GYFA 4WGHA 1RQBA 4W7WA 3TTQA 1NELA 3CC1A 5M2FX 1V6UA 3L4XA 4JBRA 4PTMA 2G3FA 5L9FA 4P2VA 3OVPA 5BU6A 2W92A 1NAL1 3OBEA 5C6MA 3T2OA 2PODA 1Z69A 1FA2A 5CAKA 5AYXA 1B0IA 3IS4A 1UKQA 3NFUA 4PMZA 5CLTA 1I1WA 3PZVA 4PB4A 3ITYA 4O4VA 4AXNA 4EPKA 1F6YA 3FSUA 1XH2A 3CUXA 4HD5A 5C9XA 5FJJA 4PMOA 3WLPA 1CGTA 1E51A 1ZBWA 3RHGA 1SR9A 5H8UA 4GGBA 1VCFA 3IJIA 3WYZA 2XM1A 3N9KA 1U33A 2GQ9A 5E5CA 4LUYA 4AIOA 2DQWA 1MW3A 1E4MM 4JTSA 1TG7A 3A13A 1XC4A 3LYEA 4QDMA 1KGXA 1CLXA 3P5YA 4XZLX 1UWAA 3LBMA 2BV9A 3TJXA 1VKFA 2HCVA 3LTSA 5H8PA 5LXEA 3O05A 3UT0A 3EKLA 2C18A 3IGHX 4Y6GA 4KWUA 5G5IA 2QUMA 4A8NA 4RNFA 3CPGA 4KCVA 4FLQA 4UTIA 2NLYA 4JX5A 2HS8A 1BYDA 3BJTA 1HO1A 4NF7A 2Z25A 4B9YA 3S83A 1GPWA 1TCDA 3MV11 5CPNA 2ZC8A 4JIPA 3RRXA 1IXPA 1L2UA 1DWGM 3MKKA 5A6TC 4IF2A 5HWJA 3BV4A 1K9EA 4LBRA 3MA8A 1FDYA 1EX1A 3NSXA 3T4WA 4C6BA 4B92A 3R6IA 5EB8A 4H7CA 4LEFA 3KCOA 5F4XA 4QLJA 2EHHA 3PWAA 1VS1A 4H6KA 4K2SA 3VOIA 4BF9A 4GC3A 1SUXA 4M6PA 2H8XA 4CQCA 1T5AA 3BK0A 3CZKA 3W01A 1EEXA 4DZAA 4GH3A 3G1FA 5I06A 2IPFA 4CQ9A 1HT6A 1J0HA 4JIEA 3ZR6A 4KETA 3M0ZA 4KWOA 1TTJA 5A6MA 4IT1A 1G5AA 1OC6A 3BLDA 4DXKA 1AZ1A 4S3EA 3AMKA 3W02A 1IWAA 4FXFA 2ALDA 3WD0A 4W85A 2O4MA 4FNSA 3W7HA 3NQBA 3MVIA 3U48A 1NFGA 3V35A 1M01A 1SFLA 2D23A 1WXJA 5AB3A 1LUCB 1XIEA 1M9HA 4E8DA 1FWAC 2X0SA 3R5EA 4WUIA 1QNVA 3F4WA 3DN5A 2DUXA 2PDKA 4HA0A 3K46A 4DUXA 3O6DA 1JPDX 4LNYA 1FWGC 4BQ2A 4ORMA 2D2JA 4KKXA 2DH3A 2YDAA 4MJ2A 1X8FA 1XCXA 4QQ3A 3F5LA 4J3ZA 1GGOA 4IG2A 1QI4A 3CV7A 2G5WA 2A7PA 1AH4A 3QTPA 1VRDA 2IKHA 3AICA 4BY3A 1HJVA 1I45A 2Q8XA 2VVSA 1UMLA 4GGHA 3SN0A 4O0ZA 3VFCA 1RCOB 4JY9A 1WP6A 3S0CA 2NSXA 4Z1YA 1O5XA 4H6RA 3SQSA 2W91A 2I56A 3CM4A 4PRTA 3UNTA 3ZFHA 3ITOA 2PGRA 3F03K 4RZ4A 2VC5A 1ZGDA 1JRCA 4UC5A 3W1PA 4M1BA 2BGSA 4UQAA 1GPFA 5LNVA 3ARRA 4FR6A 4QR6A 1CGWA 3GXNA 4EACA 3FDKA 2NWRA 1ECQA 1UASA 3UWZA 3T08A 3WQVA 1EXPA 4WDUA 4ZR8A 3P6LA 2NZLA 4M5PA 1B4EA 1JYWA 3SECA 4KEZA 6TAAA 2V5CA 4QEEA 3EWXA 4PMRA 2Y5JA 2TSYA 3APGA 2WLZA 1NDZA 3PBYA 3MMUA 1A5NC 4IMCA 2Z00A 3LGEA 4GG9A 1XG4A 2CFFA 3H7UA 1E5JA 3WQPA 4MJ4A 3VIKA 1S3HA 4C6PA 4L1XA 5F7UA 2GYIA 1Q7QA 1TRIA 1N7KA 4HGXA 3BANA 1IHIA 3GBDA 3A4WA 4J3WA 2UZ9A 4ZOCA 3BGGA 1ALDA 2F9RA 4R33A 3KDOA 3APTA 1EZWA 3W1LA 5HOSA 2NVAA 3ZJ6A 3QZEA 2ZZ1A 3LM7A 2YXGA 2BSLA 3LU2A 5I79A 2DZXA 1D7KA 2E77A 3L4UA 5A94A 5C2GA 3A9BA 3AMCA 3JU2A 7PTDA 2PZ0A 3EPNA 4KGJA 3GTFA 4QS6A 3E1F1 4JTGA 3IUHA 4P7RA 3LN3A 4GX8A 3PZIA 4H4IA 2HZGA 1BEUA 1UZHA 4ZCWA 3WFZA 1XD1A 2QS8A 2YDQA 3AJ7A 2NX3A 3OG3A 1QO5A 4ZBCA 5B7ZA 2Y0FA 3N15A 3CMGA 3G24A 3KVKA 1RA0A 1MXDA 1HKWA 1X8CA 3RMJA 1HUVA 1UR3M 4FA3A 2ISFA 4BWLC 3J7HA 3VILA 1XICA 3E02A 2OQHA 3KVLA 2VRQA 3NJ3A 3QJAA 4EWJA 2NV2A 4Y96A 1EX5A 4ZFCA 3A3XA 1ZLPA 4R85A 1F9CA 3BXWA 4M0XA 3NYDA 4DXVA 3LTPA 4ROPA 3QLDA 1EL3A 3A3WA 4UNKA 1KW1A 4GYJA 3N17A 4CCEA 3T0BA 4WJXA 1VBJA 1HXJA 1DWAM 1I0BA 4F2BA 2J6VA 1P0EA 3BG3A 7TAAA 2VC6A 2GQ8A 3MB9A 4WSHA 3GH4A 1OCBA 4U10A 3NO5A 4OZOA 3VGGA 3SGUA 5TAOA 4DUOA 3TK7A 3K4WA 3LUTA 3FA4A 1FY6A 1VFLA 4QIUA 2RDXA 3W7OA 4NJIA 2TODA 3FIGA 1W1A1 2YJQA 1LZOA 3NL5A 2IKJA 2J9ZA 3QKZA 4XK2A 4A3HA 3THDA 1HL8A 4JTHA 2X8RA 1IR2A 4HU0A 3KVMA 1UOKA 3LMYA 3NZGA 1FOBA 3CPUA 1QPRA 2VZUA 4B5XA 1XDLA 1Q45A 4H7ZA 2RDTA 3W3OA 3AAMA 4DBEA 1G4EA 2ZRUA 2WSYA 1BF6A 4C6QA 4MWAE 1IEQA 2DVXA 3G1DA 2QCFA 2BG5A 3U2EA 3TVAA 3TOPA 4BA0A 2Z2UA 4BFAA 1FFQA 2OFJA 3QVQA 3UG5A 3W72A 1MEIA 1ZENA 3T8LA 4ICMA 1TJRA 2V2HA 3U4AA 2TAAA 4TVUA 4YHGA 2Y61A 1SFSA 5T8GA 2ZUNA 3IV8A 4O14A 3UWQA 2HISA 3BAXA 3HV8A 4HU8A 5BWAA 3OYZA 1GYLA 4O1AA 4AHPA 1CEOA 3LV6A 1ITQA 3MU7A 1LL4A 1YNYA 1CGXA 5FSEC 1H4PA 2DV0A 4HTYA 4IIGA 4Y9AA 3IIZA 2FMNA 2CLEA 2B81A 2J7GA 1OYAA 1R3YA 5CPLA 3USBA 2YGYA 4AW7A 3ATYA 1QI0A 1XI3A 5AYYA 3ZMRA 4HJFA 4S3AA 3STCA 1JYNA 3PZQA 4IFOA 2O4QA 3DAQA 2ZUVA 4N9BA 4NJGA 1E6PA 4AVOA 3QH2A 4MZ8A 4MYXA 3THQA 3URAA 3VD3A 2Q09A 3MW7A 3KP0A 1OZQA 2VWTA 3L9CA 3HG2A 1NARA 3LNMA 4KWVA 2VTFA 4L4PA 5IDZA 5FJIA 3RX4A 3FAWA 4AAJA 1EA0A 3P74A 1GQLA 3T0TA 2YDRA 3TSBA 1T41A 1O5QA 2WMGA 3W70A 1ITCA 5CJMA 5I24A 4FNTA 3MANA 1Y8BA 1I8JA 3MV01 5EKYA 3GAKA 5K3VA 3DESA 2HE5A 3AS2A 4HHMA 2XPKA 2ZRVA 4AC7C 1XDMA 4HNLA 3H2NA 5D2TA 4DI8A 4FX7A 1MEWA 3EDKA 1NU5A 4A3RA 3QEZA 3GWQA 4O1EA 1HGYA 1KM2A 3CPRA 3L23A 4DBSA 1IV8A 3A12A 5E6ZA 1Q6EA 1EBGA 1UWSA 3CTTA 4E8GA 5KETA 1AQ0A 4P7QA 1XJBA 1Q6RA 1EZ2A 1EOMA 3BURA 4N02A 4XTIA 3LLXA 3CQIA 4D6CA 4GZEA 1P7TB 3AHTA 2XHYA 2VDIA 4PTDA 3PZMA 4DWDA 3VI2A 1V3HA 4C7GA 3ANVA 4CQAA 4OUIA 2CEQA 1FCQA 1OGSA 3OVRA 2EG6A 2QCCA 3AWNA 1GHSA 3AU2A 4KEUA 4O13A 3LM3A 2V82A 4C5YA 2V5KA 4PCPA 4XKYB 2VXNA 4DLMA 1WDSA 1EEPA 1UC5A 3E0VA 3EA2A 4MUPA 1IIGA 4ZTXA 1SO6A 4L7ZA 1UCWA 1OG6A 2J74A 5AZ0A 5SWUA 3HU7A 1Q4NX 4NAFB 3T44A 3M0XA 3MJMA 1IXNA 4Q8NA 3B03A 3REQB 1E0UA 2V5DA 4W9TA 3GNRA 2W4XA 4QLLA 4IGNA 2FZ9A 4WDTA 3C5QA 2D3NA 2GGIA 1A5MC 4ZSUA 1DE5A 3MUIA 5DBUA 4ZXLA 3W81A 4TTGA 5KMYA 4D2JA 3UJEA 3CWNA 3LBOA 1GYMA 4HPJA 3OG2A 4OHQA 1SU5A 1JXKA 3DGBA 4GCAA 3PPHA 3SO7A 1P0DA 1SO5A 4MDOA 4PTWA 1LBLA 1TCMA 4C90A 3B4UA 1IXQA 1T96A 5FEWA 3CUJA 2Z27A 4MNKA 1I1XA 1UROA 2WV8A 3Q4DA 1ICSA 1P1XA 2F84A 3RDKA 1C3FA 3LRMA 4UFIA 3WF2A 2J47A 3PAOA 3DX5A 2QDEA 3MO4A 2ZZ2A 3RO6A 4ADSA 1O1ZA 3GDTA 3GSMA 3U4FA 1MNSA 1ZZMA 2W67A 4JDYA 3B06A 3NZ1A 2E09A 2A3BA 1O5KA 3N14A 4LC8A 1W9BM 1Z32X 1NH6A 3S9YA 1YX1A 5BMXA 3M43A 4BK9A 4P8UA 5DEZA 2FTYA 4NYUA 3TTSA 1AW5A 2AMGA 3BL3A 2AQOA 3TONA 3GLCA 6XIMA 3H2CA 3SCRA 4DF0A 4X60A 3K8MA 1JCYA 3EMQA 2FZMA 2XVKA 3LV5A 4DQWA 4J2PA 4TMCA 3GUWA 1MFUA 4P7NA 2UBPC 1KM6A 1E5NA 3KOXA 2VOMA 4WRHA 1Z89A 1XHGA 4XBSA 4P61A 2ZZ7A 1CWYA 3QQ1A 1XLHA 4XVEA 4PUEA 4Z1CA 1S5MA 3W7NA 5C54A 1FWDC 5HQMA 1JJKA 4PMJA 4V1XA 1OGGA 3GH7A 5K9CA 2XDFA 5CAHA 2XIBA 2G96A 2PP3A 1FH8A 4F2UA 4CD8A 3N2CA 1D3GA 1M03A 4LAZA 4H9UA 3MJYA 1XIBA 1AW2A 3SCSA 1WZMA 3W1UA 1KV5A 3C3NA 3T0AA 3WQ8A 1JCTA 2XSBA 2OG9A 4Y9NA 4FX6M 3KBWA 3OJGA 3UG8A 3PK7A 4LAOA 4Y9MA 1IE7C 2FJKA 5CG7A 1X96A 2C16A 1V02A 2UY2A 5BOOA 1QCWA 3ARTA 1RAKA 1IYXA 1W3TA 5I0DA 2ACUA 2EPMX 5DLCA 4UMAA 3UCDA 1HO4A 3GG0A 3VABA 1MRAA 3RPTA 3FVMA 1JNDA 1A49A 4O0KA 2P1FA 4Q8WA 3W87A 1ZQ5A 2NX1A 1Q6LA 3RN6A 2FZ8A 1TWSA 2CBJA 3AMDA 4DZHA 1TX2A 3KLLA 4TX8A 3K4DA 3TJLA 2INFA 4IUOA 3OOQA 5CPSA 3WELA 3BLOA 3RX3A 3SJNA 5C70A 2PA6A 3W53A 1N55A 5DY3A 4J3SA 4F0KA 5TQLA 2QDHA 5AZ1A 2JKEA 1J0YA 3T05A 1UUOA 4RDZA 4GYPA 2HTMA 1UHVA 5D38A 5CQ1A 4CU7A 2QNEA 5MKGA 1RQHA 2QJMA 4YU1A 4Y8FA 3BAKA 3S9IA 3HFTA 4NY2A 4G56A 3NVTA 2BXVA 4Q4SA 3KBSA 4GUJA 4ZGYA 2PDFA 1W9DM 1DHKA 3UY7A 3L68A 1PHWA 3TXZA 1BLIA 4QEHA 3L4TA 2DPEA 2WKJA 4L80A 2KAUC 3GQYA 1CPUA 1HGWA 4LY8A 4RNIA 4LCQA 1U2YA 3WIJA 4IJBA 3TA6A 4K3ZA 1PKMA 1XFCA 1AH3A 1FBAA 3WUBA