2Q02A

Crystal structure of a xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 at 2.40 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
GMNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQLASWSEAEIEEQINRSVSLLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative cytoplasmic protein
publication title Crystal structure of putative cytoplasmic protein (NP_463296.1) from Salmonella typhimurium LT2 at 2.40 A resolution
rcsb
source organism Salmonella typhimurium lt2
total genus 97
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2q02A00
2ZVRA 1TZ9A 1A0EA 5B7YA 3M0YA 3M0HA 4YTTA 1XLKA 4XIAA 3UXIA 1A0CA 4XSMA 3JU2A 7XIMA 2NQ9A 1XYBA 3BDKA 5EMMA 4A8NA 1XLDA 3LMZA 4QEEA 3UU0A 3BWWA 3ITXA 1CLKA 2HK1A 4A8RA 1XICA 4J4KA 3P14A 5I7GA 3CWHA 4GLEA 1XIJA 3AALA 3QZAA 3BZGA 3KTCA 1O1HA 4HGXA 2QUNA 3CQKA 4ZB2A 4A8LA 4XKMA 2HK0A 2HCVA 3N4AA 5EMKA 3M0VA 3VNLA 3DBNA 1D8WA 2XIMA 1XYLA 4KW2A 3KCJA 1XLAA 1XLBA 3TVAA 3KBNA 3KCLA 4OVXA 9XIMA 3VNKA 3FVMA 3KBJA 2QULA 5C9ZA 2NQJA 4US6A 1QTWA 4ZB0A 9XIAA 4K1GA 3AYVA 1XLMA 4QDWA 3U3HA 4Q7IA 2XINA 4GJIA 4QE4A 4EACA 3AYTA 3VYLA 3ITVA 4ZBCA 3IUIA 1XIFA 3DX5A 3AAMA 3VNJA 1BXCA 1XISA 6XIAA 1DE5A 5J8LA 3CQHA 1XIIA 5TNVA 5XINA 4G56A 3UVAA 3WQOA 1XLGA 3ITLA 1QUMA 2GUBA 4W4QA 3ITTA 1XIDA 3NGFA 3KBMA 2G0WA 1XIMA 6XIMA 1XLEA 3XIMA 3TC3A 1XLFA 2NQHA 2Q02A 3L23A 3UA4A 5XIAA 3QC0A 2J6VA 4QE1A 4DVOA 4YTSA 3KWSA 1XYCA 1K77A 1XLHA 1YX1A 1XYMA 5H6HA 3CQIA 1XIHA 1XLCA 2GLKA 5XIMA 2GVEA 3CNYA 3BANA 1I6NA 2XISA 3QYSA 3KCOA 4YTRA 2G4JA 4X63A 5EMJA 2I57A 3UA3A 5B80A 1XIBA 3ITOA 2X7VA 1GW9A 4YTUA 5AVHA 4HHLA 4QDPA 3P6LA 8XIMA 3XINA 5FA5A 3KBWA 1XLIA 4YTQA 3IUHA 1BXBA 1XIGA 3KBSA 4PGLA 5AVNA 2QW5A 1MNZA 2GYIA 4QEHA 3VNIA 5B7ZA 1I60A 1S5NA 3BZJA 3M0LA 4PFHA 8XIAA 3KBVA 5H1WA 5EMLA 3C0SA 3C0LA 3CQJA 3U0HA 4K3ZA 4HHMA 1OADA 3QXBA 4HNOA 1XYAA 4LNCA 3ITYA 4GJJA 3C0QA 4X60A 1XP3A 2QUMA 1MUWA 4EAYA 4GQBA 1S5MA 2X7WA 4XSLA 4E3VA 3VNMA 1XLJA 1QT1A 4XISA 4X61A 3XISA 1XIEA 3GNXA 3M0XA 2ZDSA 3OBEA 1DXIA 2OU4A 4ZB5A 4A8IA 1DE6A 4QE5A 3M0MA 1DIDA 3IUDA 4DUOA 1A0DA 1XINA 4XIMA 2I56A 1XLLA 1DIEA
chains in the Genus database with same CATH superfamily
4OBSA 4RDVA 2WVUA 1XLKA 3DFSA 3H2FA 2F61A 2WNWA 2P0IA 2XDFA 3D6NA 4GISA 3DC8A 4D1IA 4AMCA 2WAGA 1V03A 4CNUA 3T2OA 2V67A 4EF9A 3H2AA 2R82A 4FXJA 3H55A 1FBAA 1XS2A 1NAL1 2GUYA 3S5ZA 3NSNA 5JMUA 5JXQA 4LYKA 1XISA 3PPFA 3T2QA 3AXHA 3PTMA 4YHGA 3WUGA 4CQBA 1TJ1A 1EJVC 2PDWA 4AZCB 2NQHA 3IAPA 4Z1BA 3LYEA 2V9DA 3P81A 3BJTA 2P88A 2WHKA 2WCAA 3ZMRA 3M16A 1BQGA 3FHAA 4J5NA 2EKCA 4W93A 4AZ7A 2JALA 2YB1A 3VUSA 3H24A 3XINA 5A95A 3PFRA 4GI4A 5FA5A 2H9AB 5FJUA 4LAKA 1W8SA 2GYIA 4JHOA 1OYBA 4UTJA 3VILA 4L5ZA 2VELA 1IHIA 1XP3A 3VIJA 1GT8A 5T91A 2WMKA 2FFIA 3H4GA 5TF0A 2I16A 4G2DA 2AGKA 3GVQA 2D24A 3L2LA 4E5TA 3OVRA 3B8IA 1S2VA 4R7OA 4LUJA 1X6NA 3N6QA 1XYBA 2X1TA 2DFAA 4FO4A 1CXKA 1HQTA 2PWGA 1US3A 2OSWA 2QAFA 2JFEX 5FAGA 5BYWA 5ECUA 3MJYA 3KTCA 1P1XA 3KAOA 4AWUA 4H8NA 1GHSA 2OLAA 3NM3A 5J04A 3H2EA 3OGRA 2IKJA 3RF9A 1IT7A 3G1SA 4HSHA 5FF4A 1K8XA 1QHPA 2V0TA 3L4TA 4CQ8A 4WXZA 3AIEA 4DBWA 4O18A 1R2RA 4J9JA 4HIBA 4OECA 2BGSA 4JN7A 4UIOA 3CM4A 4LVFA 3HF3A 2PD9A 1TO3A 1WUFA 4JQ1A 4XKYB 1KM2A 1VPYA 3WJZA 1VCGA 3DIPA 3RLVA 4FEZA 3U5YA 1EQPA 4QQUA 1ZCOA 1LBLA 3R11A 2DVXA 1GPFA 3JR2A 2EPHA 4L4OA 3AXIA 1Y5XA 3W25A 1UR3M 5C2CA 3GU1A 3PB2A 4AIOA 1JCYA 2OR2A 5G4WA 5BW6A 4WHBA 3PJTA 1UKSA 3KP0A 5CSUA 1UB3A 2DVUA 3L0NA 2GSJA 2V6AA 3R2GA 4ZMGA 2YYUA 3CB8A 1LUCA 1Q85A 3VX1A 2VFFA 2ZRUA 3QOKA 1C91A 3CHEA 3MW7A 3RJXA 2G3JA 1GGOA 4QSHA 2VZOA 4PUUA 5KTLA 1ZCCA 4EWND 3TLLA 5BOEA 3GXTA 4MYAA 4PCPA 2UZ9A 4F0HA 2E09A 1FCUA 1YBQA 4IFRA 5DBTA 4Y9PA 2C13A 4IJCA 1NFPA 4MPQA 4YL2A 2RHGA 3T0CA 1JI1A 3U7BA 1O7AA 3PNZA 5DX7A 3AIQA 3KHDA 1PHWA 3DEQA 2P3EA 4WKHA 3N19B 4AB4A 3ES7A 1FDYA 2QCLA 3RPMA 1TB3A 2PGEA 4XV0A 1UZ4A 4HA0A 1W5QA 4DJDA 2NVCA 2FPTA 5DEZA 3MSRA 3P74A 1J11A 4JX6A 5REQA 3O7UA 1R87A 2R24A 5EBAA 3ATYA 5A6TC 2Q8LA 3BV7A 3HO8A 4F2TA 5TAOA 2XIBA 3ISIX 3PSWA 5F2GA 2YW4A 3QMRA 2TPSA 3MP4A 2XWEA 1JFXA 4EPKA 2GDQA 3BZJA 4U2ZA 1Z44A 2A85A 4NZFA 3VD7A 3PVFA 6A3HA 4IPLA 4JQ3A 3W27A 3THUA 3MVTA 3NJ3A 4K2SA 2NT1A 4GO8A 4LOCA 4O1FA 5HINA 4WDXA 4UQCA 4BCEA 1A0CA 1RHCA 1GOWA 4QEEA 4LRTA 4GFSA 3WEZA 1Q5MA 4CN6A 4IICA 1XH0A 1FWNA 3QKEA 3UWQA 1KFEA 3IVUA 2Y5EA 4GVGA 3STGA 1W8GA 4U3AA 1FWFC 1K03A 1K6WA 1XIFA 1EQCA 3TCSA 4DJFC 1XYZA 4PB5A 3CUFA 3MI6A 3M44A 1TV5A 2V2HA 1F4AA 4JXCA 4CKQA 5D2VA 1LRQA 4HPNA 4O0QA 3WLRA 3W7HA 4JTIA 2JF7A 3FGCA 3I6RA 1V0MA 4D6GA 2VEPA 5ECVA 1R0MA 2GLKA 1TWWA 3CNYA 4GO9A 1CGVA 4OKDA 2HWGA 4ERGA 3BW3A 5FJTA 3M46A 1ZBCA 2QV4A 4MFDA 2HROA 2OYMA 3PPGA 4IMAA 3SY1A 4I5XA 2HJPA 3ARWA 1HVQA 4IJBA 3ECQA 4LXFA 3GDMA 3OG3A 1D3HA 3R89A 2HNEA 2XN1A 5FIPA 2VR2A 5FCZA 1CLXA 4H9XA 4DUOA 2YIHA 2VO5A 3WBYA 1MFUA 1TPVA 1LF1A 1C92A 4KFOA 5D2TA 4EPEC 1UCWA 3WSUA 4GY0A 2Y89A 2DIJA 4ADSA 4HCDA 3K4DA 4K1WA 2WJZA 1W9VA 1P0EA 1S5VA 5JH2A 5LIUX 1FWGC 2WMIA 4IIBA 4B2DD 1XIJA 4XD6A 2BVTA 2XUCA 1ZLPA 4PTMA 3THCA 2OGJA 4JY9A 1WXJA 1L8PA 3LRLA 3T78A 4H9ZA 2WKLA 3LENA 3BMXA 3WELA 4R53A 2EEXA 4DUWA 1QW9A 2AQWA 2E9MA 3MSDA 4ML4A 3WQCA 3QVQA 4ZCWA 2VOTA 1ADOA 2PTYA 2XGBA 1JQXA 1YE4A 5XINA 2IKIA 3ITLA 3BOXA 4H00A 3WK1A 2Y6ZA 1GVRA 1X6LA 3W1MA 3B8WA 3CQIA 3P60A 3UD6A 1XLCA 5F4WA 3KCOA 3QGVA 6TAAA 3BGGA 1RQBA 1A5OC 3TOYA 2F6XA 2VNCA 1JZ3A 4I9MA 2BVYA 4UFHA 1UOZA 4HK6A 3WL1A 2WHJA 4UFIA 1KD0A 3C2VA 1LQ2A 3KW3A 1GVEA 3TCEA 2ZXQA 4MY1A 3HTWA 4K3ZA 4IP4A 2X2GA 4DRSA 2CZVA 2X7WA 1GOOA 1Z48A 1CXLA 3OBAA 1VFOA 3UXKA 1DIDA 4ZE4A 1SMDA 2BS9A 4HU4A 5D2WA 5D32A 4IQJA 4O54A 3DC0A 3PP7A 1X7IA 3F5JA 3GAKA 2E3ZA 2GOKA 1A3WA 1EDTA 1NP2A 4LSBA 1R86A 2NLIA 3W1QA 4HYRA 1M04A 3W75A 4AH7A 2FQIA 4DO4A 1DJHA 1K6AA 3ZLFA 3G5EA 3E2QA 3GY1A 4W8AA 2VGIA 1UWIA 2ODOA 2X41A 5BU6A 3I4EA 4AQLA 1TG7A 4KCTA 2BX7A 3WJSA 3W2JA 3OBKA 4L6HA 3ZWTA 5CPOA 4EPBC 1DXFA 4UQAA 2OSYA 1VR6A 1UQZA 4PRWA 2AL2A 3H2NA 2ZQ0A 3CV7A 3ZR5A 2WC3A 1FHVA 4X9SA 2ZZ2A 4GWEA 3L5MA 4U4MA 1H41A 4Q8MA 1XX1A 3KS5A 1MSSA 2X1UA 4H9YA 4PUMA 4GYKA 3ZXWA 4R7WA 1Q8JA 2CBUA 3VIKA 1MQPA 4QAIA 1FHLA 4JX5A 2YLAA 3VMNA 1LBMA 2GVJA 1PXGA 1RH9A 3TIMA 3G6MA 3OBEA 2BLEA 5BOOA 2XIOA 1OGBA 4TVCA 3T0DA 5LSMA 4DWSD 3HZ3A 2DV0A 3GR4A 4AU0A 1GOKA 2A1YA 4XAGA 1DP0A 1A5KC 2PDQA 4UTLA 3VD9A 4KEZA 2VR5A 4K68A 4UTFA 5HWMA 4Y9MA 4YJ5A 1GUVA 4TTUA 4UB9A 3L4VA 1VIZA 3NPVA 2EG8A 1F3EA 1EZWA 3NPWA 1VFTA 3VM5A 1WZMA 4QE4A 3K2GA 3R0DA 2WMJA 4C6JA 1UOKA 3CT2A 3E5PA 2FFCA 1E4IA 3OYZA 4N2YA 1J93A 1OG6A 3AIVA 2PMQA 2EQDA 1C7TA 2V5BA 3B9NA 3GIYA 4NIRA 2VEGA 4RZBA 2FHFA 1K1DA 4LW7A 2XJ7A 3NQFA 1XCXA 3BICA 2J9ZA 1JZ5A 1OB0A 4E3TA 2X42A 3DERA 1S2AA 4JIRA 4EF8A 2Z29A 4DYJA 3RPTA 3EMQA 2CITA 1O68A 3B8DA 3WBEA 4A3QA 2J75A 1KFCA 5EMLA 5CJ5A 2QCFA 4OBRA 4HBKA 2C1GA 2QPSA 4DNMA 1K4GA 1EGMA 3MS8A 1LTDA 2EPKX 2H3BA 4AZGA 3S8HA 3SEPA 4UOQA 3TYAA 4X61A 1R5YA 2BXYA 1EEXA 1E9IA 4RDWA 1V0NA 2XH0A 4PL1A 5AC7A 3E38A 3A24A 2JE8A 2PDFA 6REQB 4XUGA 2D1ZA 2XVLA 3SO7A 5BU9A 4TOQA 4MADA 4QS6A 1B57A 2IUZA 3MO4A 1SUXA 4JTRA 1OT2A 1S5TA 1ZPTA 1XDLA 3ATZA 3LG3A 2X40A 3U2ZA 2C3ZA 5LA2A 3WH6A 2RGMA 3OVGA 4AD4A 3WLNA 2FZBA 1E9YB 1YXDA 5HMEA 3M6YA 1OC6A 3GFXA 3KVJA 4L64A 1HUVA 3VZXA 3TWAA 1PDYA 4PB3A 2PE4A 4DX3A 3WK0A 2Y7GA 3W26A 2PTWA 2YFNA 5CJNA 4RE2A 3W71A 4M24A 3UYIA 5E0CA 1TWIA 3QN3A 4EK7A 1MUMA 1AK5A 4BI7A 1T40A 4EANA 2Q01A 3GC2A 1XPYA 1QO5A 2OELA 1IR1A 3O8AA 3URBA 1KB3A 2BDQA 4YTUA 1ITUA 1EDGA 2DZAA 3TAKA 4GACA 2E1WA 1PJ9A 3C3UA 4IGHA 3EEGA 3LMYA 3QR1A 1XBVA 3F4CA 1ZJAA 3NVTA 3IJ8A 3CQJA 4PMRA 4EVZA 1IWAA 1RPKA 3T8LA 4UTIA 3MMWA 2RDWA 2X1SA 7A3HA 2JK2A 4D71A 4LANA 3QY8A 3S6OA 1GHRA 4PFMA 1TJ2A 3TYZA 3OOQA 4ZB5A 1Z8AA 3BAIA 4UOZA 2A3CA 4O17A 2RJGA 4IT1A 3CEUA 3LSCA 1A0EA 5SWUA 3QPZA 4KWUA 3M0YA 2PTDA 4LTSA 3NTYA 5AZ1A 3T42A 3B04A 3STCA 1K7FA 3LGEA 3CZEA 3CHVA 4IPIA 3GDBA 2WO5A 1BTMA 2PWEA 3BWWA 1YDYA 3ABRA 2VDIA 3TW6A 4M56A 1VRXA 1AQHA 1V6YA 4XKMA 2HS8A 1VD6A 4HYVA 4IIHA 1D8WA 2BVDA 2WVSA 4DXKA 4CCDA 4HVXA 4Q7IA 4RW3A 5A6JA 4TX6A 1DWJM 2QCMA 1OY0A 4QNWA 3U9IA 3RU6A 1RLDA 1DTNA 1S2WA 2C1IA 4PN2A 1EZ2A 4RPQA 1EP2A 2PAJA 2PC4A 3QYQA 4BF9A 1E3XA 4ATWA 3QV9A 1JRCA 3WQ8A 1W1PA 2E8ZA 5HUOA 2YDQA 2BY2A 4P8WA 3RO8A 1MNZA 4PL2A 3AUOA 3D47A 4W5ZA 3I7SA 1QOXA 3VIHA 1V3JA 4GCXA 1GYMA 3W4RA 1WZLA 1JUBA 1U1HA 5M5DA 1XIEA 3D3FA 1G9HA 4XWUA 3OLIA 2CHRA 4MTVA 4IMGA 3ZVHB 3N3TA 4IM4A 1UBPC 2PCEA 3PM6A 3ZIZA 4JEQA 3C3NA 1F9CA 4DJEA 1GVFA 1IZKA 4IZGA 5FJOA 1EHNA 5LNVA 3UG5A 4RNHA 1QWKA 3BLPX 3GNDA 1V3IA 1EOKA 2YA1A 3LBMA 1KBIA 4HA3A 3UZ5A 1O12A 4WRHA 3P0XA 1XUUA 2NX1A 2VM8A 4WY0F 1M1BA 4UUIA 4DXXA 1K3UA 4J3TA 2NT0A 3IV3A 4Z1CA 4Z2KA 2UY4A 2XTKA 3GG8A 2JF6A 1EGZA 1CGTA 3E0FA 4H19A 3AUJA 4UCFA 3GNNA 3AICA 4PCNA 3CAQA 3Q45A 3RYSA 1UR1A 4GYPC 3FKRA 3O15A 2YZ5A 4KWOA 5F2IA 3GXPA 4H9VA 4QJ1A 1V6XA 2D2OA 3R94A 4NF7A 1X38A 4I7VA 4F0KA 3CZJA 1KR0A 2GWGA 2V5KA 3P6LA 3PZMA 1KFWA 2GDUA 3FYPA 4QXIA 2HEJA 3CU2A 3RIKA 4NZJA 1KCLA 1JNEA 5M17A 3PF3A 1FRBA 4OOZA 1JG9A 3SN0A 4ZO6A 1P0KA 1XCWA 1NP0A 1S3TC 3LX9A 3URQA 3C6CA 3VDHA 5MF5A 1W1A1 2F7FA 1DJIA 2AGTA 1T6MA 5A2BA 4GZIA 4O19A 3IJ9A 4A8NA 4RDZA 2C6QA 2YCIX 5JIPA 3U2EA 2VCAA 3TLQA 5IM51 1PTDA 2QUNA 1HO1A 3SUUA 1M03A 3HG4A 5A94A 2XSAA 3STFA 1IZCA 2G37A 3VINA 4QG6A 4AD0A 3W74A 4L4LA 2PTXA 4A4AA 2XZ7A 5HR6A 2BBFA 2D0GA 1JDEA 4UCGA 1JJKA 5FL1A 4PUEA 2YSWA 1Q2SA 1AQMA 4O10A 1XIDA 1OX5A 3PJUA 5J5DA 5IHRA 4GD0A 7TAAA 2A7NA 4JN6A 2YCLB 2FMNA 4F66A 2BY1A 3JUGA 3UXDA 2VMFA 4JDYA 3TTEA 8A3HA 1UIOA 5CPQA 4C90A 2XM1A 2NWRA 3UWZA 3GKAA 4MB3A 1BD0A 3UPWA 1W9UA 4Q4PA 1QMLA 4M6PA 1GW9A 1OFOA 4W88A 4PB4A 5KITA 4H3DA 5CGTA 2CLKA 1EX5A 4ZQPA 3VTRA 5I02A 3KX6A 1KV5A 4B16A 5FF7A 3AHZA 3U4AA 1IEXA 5D2XA 3O6YX 1YKWA 2XYLA 5K9XA 3GNXA 1W5OA 1UMLA 5DCEA 1N55A 4D2JA 4E8CA 4GZJA 2WVVA 3WJXA 3WDHA 1M7OA 2JKAA 4DBDA 2W67A 1EFZA 4EP8C 3APGA 4CNOA 3HPZA 3O3RA 5C9XA 2HK1A 3VU2A 1JFHA 4OFCA 4AIEA 1B2YA 4JNYA 5AB3A 4P7NA 1Q4NX 1JD9A 3T0BA 5EMUA 3SCVA 4B2DA 2F84A 3SJNA 2VX4A 3E3HA 3WD4A 4H1ZA 1RCQA 5CPMA 1WKYA 2CZDA 2GK1A 3C86A 1FP8A 3FSTA 1XWYA 4URIA 1KRMA 3QF0A 3SCQA 3WYZA 1XFCA 4OE7A 1PTAA 4DZHA 3CGTA 3GVVA 3MBFA 3V0SA 3UPMA 1DJWA 4QFUA 3I6TA 2W61A 3QQ0A 3V5FA 1PZ0A 4LAMA 2PF8A 1Y7VA 3HM7A 3SB0A 4EXQA 1A4MA 4F40A 2HE5A 1OC7A 4FX7A 3ZR4A 3MU7A 3GDTA 4Z2IA 3F2CA 1DQUA 2G3FA 2EF9A 3IGUA 2VDHA 4HU3A 2E9LA 4E38A 2GWNA 2ZA3A 3OLGA 2GPTA 3OHMB 1AH0A 1KRBC 4I6KA 2ZX7A 2Y1HA 4WIWA 1S5MA 3PY2A 2Y5JA 4WDWA 1TMQA 4NRRA 3REQA 4Y6GA 3B9OA 2EG7A 4S3AA 4AIUA 5CBIA 4H8UA 3K13A 3S3GA 5IBXA 2CFFA 2B4GA 3S5SA 3HQNA 1KM6A 3WF1A 3S0CA 1WOBA 3CASA 1YDNA 3BURA 4AF0B 4H2HA 3QM3A 3KEHA 3TYUA 5AC8A 3IVSA 5U4NA 3IAQA 3G3MA 1FHDA 4ZO9A 2ISDA 3R1ZA 4MNMA 3SCSA 1SJBA 3ZJ7A 3WQOA 3G2GA 3LZ3A 3EDFA 3MI2A 3SI9A 4N9DA 4MG4A 4MJ2A 4LVBA 5IDIA 5HQLA 3TMLA 2HXTA 5JU6A 2W9MA 4S1FA 3QC0A 3VI2A 2VEMA 5D38A 2WSRA 4X2RA 4PTWA 4S3GA 3GTIA 3G8RA 1ISZA 3BGJA 3CJPA 4WJXA 1BEUA 1QI0A 2Y0FA 2YPIA 2ZZ7A 3PTDA 3W7OA 3Q58A 3W1XA 3F5KA 1NARA 1HKMA 3AMKA 3GTHA 2NUXA 2X0YA 3U0HA 4Q4KA 1VCFA 3W1RA 3RLGA 1N7KA 3KOXA 3KVKA 5C7HA 3WD0A 3SCUA 2AKMA 5LGZA 3OZMA 4R27A 4F4RA 1XINA 1HJUA 3FCPA 2HNHA 4K7VA 4Y9AA 4RV8A 1WDSA 4FIRA 3L9CA 3TSBA 3TN5A 4DWSA 4UTUA 3A4JA 2A6LA 3RMEA 3H2OA 4H9MA 2NWSA 4J35A 1Q7MA 1ME9A 2WWCA 3LXCA 3KTXA 4RUBA 2ATMA 3GDLA 1H60A 1YMYA 5DQPA 2OWCA 3KBNA 1UASA 1IEVA 2WZTA 4MM1A 1FH7A 5JUVA 3UPBA 4GIYA 4U31A 1L6WA 3GQYA 1NDVA 4NU7A 2V5LA 3H8AA 1OHLA 3TR9A 3WH8A 1QUMA 1C3FA 3RDKA 3O6CA 6TIMA 4M6VA 3CL7A 2BY3A 5TQLA 2VEKA 3S6TA 2W66A 3NZQA 2ASHA 5IOBA 2VWTA 2J7HA 1H1NA 3JVAA 1GYNA 1CECA 3UCCA 1XHGA 5CEWA 2A21A 1W3HA 3A47A 4FB7A 4UTHA 3IK4A 1UZDA 3TXZA 3LSBA 1V5XA 1YNPA 3UY8A 4C6MA 1J0YA 1XCFA 4Q4QA 3ARRA 2CKRA 2QUVA 4E2OA 4GQBA 4ZO8A 3EB3A 1F61A 4L9XA 4OTKA 2OX1A 2Z1XA 4BWLA 3ARZA 3HURA 3W0KA 1E6XM 4ZGYA 3GH5A 1EWDA 5L9FA 2VVNA 3GXNA 3B4UA 3TW9A 4JEJA 2VYOA 4C6FA 3ORWA 3IJDA 4GLEA 4TXEA 2W91A 3QZAA 3EWDA 1B5TA 4L6DA 4V33A 2HCVA 2PDLA 2REQB 3AXXA 2INFA 4KW2A 3GVGA 3USZA 2KX9A 5DANA 5CG0A 5BWFA 4AEFA 4J3ZA 1QPRA 3WLTA 1EXPA 2BOFX 3OA5A 1GG0A 1L6SA 3LI1A 3EDDA 2BGNE 7ODCA 2J79A 2E28A 5AN7A 3ARXA 2B81A 1I45A 5IBXC 2ZZ6A 3CV2A 3QZ6A 1TIWA 1CEOA 4HSOA 4B5TA 1CIUA 1GEQA 2Y85A 3PZNA 4ICMA 2QCNA 5LHFA 2X30A 4Z42C 3QYSA 1WDWA 3R8GA 1ZY9A 3TA6A 2J66A 5AYBA 3OW1A 2DT0A 1FY6A 1XXXA 3LERA 3NQBA 4FX6M 5H91A 3LQGA 3RCYA 1JUEA 4B5XA 3TN4A 1UWQA 3A12A 1FTXA 4J2MA 3UZXA 3TYDA 4YWIA 5CLWA 1XPGA 2VR4A 3NL2A 3FK4A 3V1HA 3CLMA 4G8TA 3WUFA 3F2DA 1FDZA 1AH3A 2PDYA 2RAGA 4CVUA 4YMZA 1V7AA 1H0GA 1K4HA 4I9TA 4XAYA 3LQLA 1S2UA 1W3TA 5A6MA 3UXIA 3NNTA 1XLDA 4NZCA 4XZIA 1MQRA 1MVYA 2VEFA 3MY9A 5KZMA 5A2AA 4NQ1A 1BG9A 3DH7A 3Q4DA 3TFCA 4P8UA 2QKFA 4OJYA 3CK5A 3W7DA 1J18A 4OU1A 1SR0A 4GY1A 3CLWA 3FVMA 3EOUA 4GVIA 3GTXA 3NXLA 3N04A 3QLLA 2XM2A 1AD1A 3CQ0A 3V4BA 1LP6A 2CLFA 3AU2A 4BFAA 1QNOA 1VQTA 1T8XA 1Q6EA 3W6MA 5EGRA 4IX0A 2IPJA 3WDQA 3WBAA 5I5RA 4S3JA 4RNIA 3EAUA 2VZVA 2ZWYA 1XKJA 4GNJA 2P5NA 3GBEA 1POKA 2PU0A 1AH4A 4PUNA 3HQOA 3U57A 2F2KA 2W63A 4MWAD 3EA1A 4WR3A 5C9RA 2WC4A 4GRSA 4US5A 1QI2A 1FCVA 3OIHA 5E6ZA 4XZ9A 4E2DA 3EWXA 3FEQA 3PWAA 5A6SA 4B9ZA 3BARA 4ADTA 2G5WA 2WLYA 4KPLA 1QOQA 3NO5A 4J3UA 1WCGA 2E6YA 3V75A 2AMXA 3GC4A 2FTYA 2FGZA 1OGGA 3DFTA 4LYQA 1TREA 4JTCA 4GPNA 2CW6A 2XGZA 2YL9A 2XFFA 4O4VA 1LOQA 4HGXA 4KESA 2BXZA 3FAXA 2XSBA 1Q6GA 4AIBA 4WUIA 3HMJG 1EO5A 4DYKA 5BXTA 1PKLA 2IMRA 2ESCA 4H8HA 9CGTA 1UA7A 4MLRA 1UP3A 3GZ3A 3IJIA 2DIEA 2DU2A 4HPHA 4NZ4A 1VFMA 1BXCA 1XDJA 1WOAA 3DHDA 1QNSA 8CGTA 1O5QA 2BVWA 4RK8A 3TYCA 2OZ0A 3DFOA 1MQQA 4YYCA 3CL8A 1XRSA 4F2BA 1E1EA 3AHVA 3CIWA 1UWRA 2V38A 3AXKA 3BANA 3EXTA 3WH5A 1GORA 1JCJA 3V5CA 4HHLA 4P7QA 1QVBA 4FF5A 1EC9A 1CTNA 3LCLA 3QJAA 3DENA 2ZIDA 3NFUA 4GNVA 3R7MA 1Y65A 3W02A 2PWHA 4EAMA 3PULA 5FESA 4X60A 2PRHA 3GDRA 3UZJA 1J6OA 1T96A 2Y2WA 3R5EA 2E25A 1EF2A 4MAVA 4INFA 3SGZA 3U4FA 4ZXLA 4YTTA 2C15A 1HL8A 3VXGA 3TZFA 5HATA 3VIFA 1V4YA 1E4MM 3MUZ1 4JIHA 2A7RA 1E0VA 2V8ZA 3SW6A 1R9XA 2NV9A 3DZ1A 1C29A 4Q7NA 4FNPA 3WLPA 4NAFA 4B3KA 4H7ZA 2ISFA 3FW6A 1ELSA 1BTCA 3VVGA 1IIHA 1LROA 4ZO7A 1C8QA 3W1TA 4BF5A 1HF6A 3PUEA 3WCZA 1PSCA 1MEIA 4M1RA 3W00A 4TTGA 2WHMA 2FHBA 1XYCA 3BLEA 4UMBA 1TX2A 3KM8A 1V6UA 2PDIA 3WO8A 1IXQA 2PDGA 4R3UA 4ZXOA 4GVFA 1O4UA 4LUSB 3ZJ6A 2VC9A 2VRJA 3HOJA 3I3EA 2EGZA 1Z42A 1EDQA 4GBDA 4R7JA 1R8LA 4NJJA 5A6BD 1B3ZA 3UXAA 1ICQA 3L0KA 4XZWA 3FXGA 1JZ7A 1E15A 3QR0A 1HJVA 3ALFA 4UQBA 1A50A 2OEKA 1K8YA 2OQHA 5HPOA 4BKNA 3GG0A 1ZP4A 3PR2A 3MHGA 4K37A 2OB3A 1QNVA 3C61A 5HMDA 2VFIA 4A8RA 3APTA 3P14A 3L4XA 3W37A 3QV8A 1IXNA 4LPCA 4MB4A 4XAPA 3N4AA 2BP1A 2BWGA 1SMAA 1YNYA 4AG0A 2OWXA 2Z7KA 1YPXA 5DCDA 1NIUA 4RKAA 1OC5A 1VCVA 4S23A 4GFIA 3UWUA 4BR1A 1EYEA 5E9AA 4G1NA 4LF2A 4O28A 3N11A 1KLYA 1BF2A 4LGXA 3CIVA 3VDCA 1IEQA 4NVTA 2A2IA 2ISSA 2OJPA 1KBJA 5AC6A 1XLFA 3IV8A 5H2ZA 3GU9A 4I5UA 6PTDA 3UR5A 2IQ0A 4L1WA 2C8NA 3EA2A 4HCHA 2DEPA 3UBPC 3LI0A 3Q94A 4HK7A 3ARQA 1F7BA 3AS1A 3WJYA 4ERIA 2QDEA 3W22A 1GEHA 3BGAA 1FP9A 4WX2A 2VTFA 2BOGX 5G2WA 1S5NA 3W29A 5HDRA 1WQ5A 1RQEA 1XQLA 3B97A 3F7JA 3LS9A 3FDKA 2HS6A 1TV7A 1NY1A 2PDKA 4GKLA 1W31A 3VOJA 2YKKA 4GH3A 1OZMA 1DXIA 4KH2A 4D8AA 2VKZG 4JQ4A 4KGJA 1TV2A 1KM3A 1TTJA 3BUVA 1LLOA 2I56A 3NXFA 1BVWA 3TJLA 5A8MA 3T7VA 4DLMA 1R2SA 5C9UA 2CIPA 1PO9A 1DYSA 5FSEC 4YCPA 5HMSA 2Y7EA 2YCKX 5IXEA 4PH6A 2PWFA 1V51A 2MANA 2C7FA 5ABTA 1ONEA 3NO1A 3OZPA 4JTKA 1XYLA 1XLBA 5DT7A 1UP0A 9XIMA 4RCXA 4KCWA 4RE0A 1YIXA 4HOWA 2OQYA 2OEJA 4WSKA 1B3YA 1CX9A 3HBLA 1UC5A 3VKCA 1DE5A 3W76A 1SW0A 4JZ5A 3I4KA 4ORIA 3RM4A 1C90A 3VFLA 3BCFA 4RXGA 2XVNA 1E6PA 1PV8A 1NFGA 1BVNP 1FWIC 1E3ZA 5CC7A 2C16A 2UY2A 4QSFA 2J8FA 3GXFA 4ECLA 3CZKA 2PS2A 3PFMA 3AMCA 4R85A 1WKEA 1L9WA 3FA3A 3BG5A 1Q7ZA 4GQ0A 3UT0A 4DUXA 5A69A 3I7QA 3S2NA 4K38A 1DQXA 1EJWC 5I00A 3KWXA 1Q6OA 3IIVA 3QBUA 1JF5A 4PC8A 2GZXA 1XSIA 1EJRC 4I6VA 3NEVA 1PDZA 2YDAA 4DAFA 1DV7A 1X96A 5D4YA 4C65A 4D6HA 4M29A 2OODA 1EKOA 2WB5A 2R94A 3SSZA 1KKRA 4AFYA 1OCNA 3WDRA 1VFUA 1VJSA 5I7GA 2PDMA 3OHIA 4YHEA 4TX9A 4LWWA 4NJIA 5E70A 2ZUMA 3K1DA 3N6HA 1M6JA 3HPXA 2ZUUA 3KL5A 3CB3A 5C9ZA 3MZNA 2Y61A 3W7KA 3C2FA 3KRSA 3K8KA 3TN6A 4CCCA 4O1CA 3BSHA 4L56A 5LNRA 2Z2AA 2CWNA 1FWJC 4NYYA 1VGAA 3TSMA 3LBOA 3MWCA 4GIAA 5C0QA 1PIGA 3AROA 7PTDA 4AX7A 2QCDB 2WVTA 3CHCA 5G2IA 2E6FA 2XN0A 3HFYA 2CWXA 3VNYA 1E1CA 1MEWA 3ITOA 1JCXA 3BXWA 4LB3A 4QLLA 1PKNA 1BYDA 1FHUA 1BRLA 1XLIA 1RY0A 1YDOA 1TTIA 3WLHA 1QBBA 4QG9A 3LV6A 1XDMA 4WSHA 2ACQA 2ZXAA 3L67A 4QX4A 4O16A 2QVNA 4E3VA 1XYFA 3OB8A 2E6DA 3A5FA 4QR6A 3IVTA 3RX2A 4D6CA 3LHWA 2PDUA 3W24A 4Q4MA 3IJLA 3S2MA 2O4MA 3PJWA 4E4UA 1AUSL 3VDGA 4HHHA 2ZX6A 3SCWA 1F07A 1H4PA 4Z17A 5MKGA 1BXNA 1TPB1 2PPGA 4TR9A 1R85A 2DQXA 5I09A 4J4KA 4QLJA 3A5VA 1GOMA 4PCTA 3VMPA 3BL3A 1RVKA 2XIMA 1JL8A 4D6EA 1V7YA 4M0XA 2QQ6A 1J0IA 2WNNA 3WF3A 5KSWA 3KRBA 1ZL1A 4PUDA 3CS2A 2D2JA 1P6WA 3SFKA 1JEZA 1J12A 3EBVA 4F0LA 1WP6A 4FPSA 2QJIA 4C6CA 3UY7A 1DJZA 3MMUA 1E70M 3HG5A 1L2UA 5DLCA 5TNVA 3MUY1 4A29A 2PBOA 3KL3A 1ISVA 1REQB 4C1NA 3MUIA 3V3WA 1J0ZA 3T1GA 1F05A 2E40A 4N9EA 4ZZ9A 1E56A 3NIYA 1QBAA 3L66A 2R9RA 4KRUA 3CUZA 4AZ5A 8RUCA 2JEQA 4ZA0A 2RDXA 3KZPA 3E0WA 2CERA 1QW7A 2V5CA 4Q8WA 5HR7A 1UYQA 2CLEA 2OO0A 3EEZA 1EWEA 4JTUA 2ACUA 3BE7A 3V16A 1QHZA 2A0NA 2B7OA 3GKFA 4IL0A 4AXKA 1PKYA 5FF0A 1X7FA 3H22A 1D8CA 2J6XA 3ZR6A 2VCBA 3EZ4A 1QK0A 4DF0A 2OOGA 2AAAA 1CB2A 1ICSA 4YXGA 4U5KA 1MYRA 3LEPA 3PBYA 4GIEA 4LS0A 4HA1A 2Z1WA 3G3DA 4CCEA 2VCCA 3CWHA 1WXYA 4M7TA 4KGLA 4UWMA 3LHUA 5D9NA 1Q6DA 4GZEA 3TDFA 2CHOA 3HJEA 4QGCA 3YPIA 2GGHA 1LRTA 4A35A 1GVSA 1UIPA 3B8SA 4HP5A 3PG9A 1PWMA 3QW4B 3WMBA 4UR9A 4ATDA 1M65A 4C7DA 3EKZA 1B3OA 3PTKA 2YR1A 4JY8A 1NDYA 3CQHA 2YBUA 2XFYA 3G77A 3VPLA 2DDXA 4DF2A 3W7JA 1BKSA 5DRCA 5DXYA 4KT2A 1KTNA 3VABA 1FWEC 5DT5A 3CAWA 1YQ2A 1HGYA 4KEVA 1NM9A 2QJJA 1XLHA 4KEUA 2HSAA 4UFLA 3RX4A 4NX5A 5A1AA 1SPQA 4AC1X 1TV3A 1B4EA 1UWTA 2W3ZA 1XIBA 2OZTA 5EU9A 2PTZA 1Q45A 4DBEA 1MW1A 2GDVA 4KEMA 1ZSXA 3FN9A 4MWAA 1US2A 2AOSA 3TNBA 1E4LA 4FMVA 3MCMA 1ADSA 2PB1A 2Z00A 3ITYA 3LXBA 5EFDA 4CEXC 1KGXA 5M03A 3GH4A 2X16A 1NELA 3MCOA 2YCLA 1XBYA 4KCVA 2VVSA 1LZOA 1ZRQA 3T0TA 1HIZA 5EMMA 4ZL1A 2X1IA 2HPMA 2GFTA 2J7CA 1WV2A 4FXRA 3UJSA 4B91A 2FZ8A 2XU2A 3HV9A 4ZFMA 3BZGA 3ARYA 4ILSA 4UZSA 1XKYA 2A4AA 2DUAA 2FYMA 1HG3A 3WFZA 3ZJ8A 3LCIA 4XTDA 2INEA 4JNZA 5AZ0A 4F0SA 2ZX8A 2J62A 1BFNA 5LZLA 1AW1A 1TE1A 1RP9A 2WZEA 2QF7A 2FH6A 3A21A 1OCBA 5GPRA 2EG6A 2G0WA 4BEQA 3AI0A 4W7WA 3UJRA 1H0IA 3UA4A 3W23A 3TH6A 3BLFA 2A3EA 1AQFA 3N2XA 2QCCA 1R3TA 4ACZB 4C6OA 3V35A 1UZ1A 5FJJA 1J2BA 3QFWA 1J79A 3WQ4A 8TIMA 7REQB 3KBWA 5DMLA 2YXGA 4CNNA 4YYFA 3C0LA 3KOZA 2FZ9A 2P53A 4C6PA 3S4TA 4DIAA 1F74A 1V0LA 3I65A 2VHLA 2YCEA 1NQ6A 4Q3MA 3EPMA 2IXUA 1QI4A 2J25A 4JL2A 4CN4A 4XSMA 3IARA 3VIMA 3M7WA 4LUYA 3NO3A 3MYPA 7TIMA 1B1YA 3DKLA 2QMKA 3K30A 3W84A 3W88A 3ZSTA 1U22A 1SJCA 2D3LA 1Z3NA 4K36A 4GOAA 2INZA 3NA8A 1PZ1A 1BYAA 1R7OA 2CLIA 2YZRA 1I4NA 5BRQA 3TVAA 5A8PA 5KZ6A 1IV8A 2ZZ4A 4QISA 5I3IA 1LL4A 3N14A 3H6OA 1WDRA 3W1PA 4F0MA 4CD8A 3VNJA 4MZYA 1UC4A 1PYMA 4JCMA 3AMLA 4W9TA 2O0TA 1C8XA 1PTGA 2Q02A 1EP1A 2ZDRA 3GNPA 4OQVA 4GABA 3DKJA 3TTOA 3NURA 1W37A 4FOJA 3BW2A 4JOMA 2GOUA 4RL3A 3BSGA 1I2NA 4S3DA 2YXOA 1R2TA 5AHFA 4PGLA 3CMJA 1AZ1A 1D7KA 1JXKA 3UP8A 4CN1A 1CPUA 1H49A 4I90A 4YU1A 1XRTA 4DZIA 2VFHA 5T8GA 1E6SM 5A6BA 2P50A 4IHCA 4RZ5A 1RALA 1Z41A 3O9NA 4KMQA 3UXLA 1ZAIA 1TCMA 3UETA 4KWVA 4MKSA 2Z1VA 2ADAA 4YS1A 1VJZA 2PDBA 3Q2DA 2QR6A 3WH7A 2QYGA 1TPFA 1UA3A 1VF8A 4NAEA 4V28A 4MDOA 4O11A 4REQB 1D7FA 5BWAA 5A6KA 3Q67A 1R6WA 5EMKA 4QJ5B 4GUHA 3SSJA 1RP8A 4FF7A 4A05A 3RU8X 3LM7A 3UCQA 1Z32X 2OX4A 3WKZA 4NNAA 4J28A 4CNSA 1FWWA 5HQEA 2FB2A 4MY8A 3GIQA 2FGBA 4A2RA 3FJLA 5GJMA 3BAYA 1EIXA 2VL4A 1OX4A 3TSDA 2QHAA 2WM0A 5KZDA 1CGYA 3W85A 2HRWA 4Z1DA 5AHEA 4A22A 4Q8OA 1KRCC 3W7MA 2FJKA 3G0UA 2DSWA 2CKSA 3GDKA 1RZMA 3W72A 4N9CA 3S5OA 3UA3A 1JPDX 5BRBA 2Z24A 5F7UA 5DY2A 1NWUA 3MI3A 3BAJA 1IWPA 4LVDA 3PZGA 4LUTA 4B9YA 2O7SA 2QW5A 4GH1A 4AD5A 1RVGA 3AIUA 3KOYA 1QXLA 1W3JA 3CMFA 4ONVA 1P6CA 3POCA 1XLJA 3WDPP 3R4IA 3ZO9A 3KDOA 1DE6A 1XG4A 3C2EA 1LRNA 4CQDA 2WWDA 1K02A 4PUWA 2B7QA 4WXYA 2DGAA 1UMYA 3B9DA 4L6OA 1V6WA 5JIWA 2Q8XA 2Z28A 3N25A 1GVQA 3MCNA 1CLKA 3HIJA 1JULA 1HP5A 3DYMA 1ONWA 1JD7A 2XH2A 1VLWA 2XWDA 1QAPA 1XLAA 2HZGA 3VE9A 2VRKA 3GBDA 1W1VA 4JFSA 5C8BB 4H2CA 2VOMA 5AYZA 2KAUC 2VWSA 1CNVA 4KFNA 4P8VA 1ZZMA 3RG6A 1CGXA 5CC6A 1HKWA 3RRAA 1XLEA 4CQ9A 1E0WA 4Y2WA 3BPWA 1G7VA 4HOXA 3H26A 2YL6A 2HTMA 4RLIA 3TC7A 1C9DA 5A3HA 2Z2BA 3K8LA 3WY1A 4LYRA 1CGUA 5AVHA 1UW9A 2J4GA 1H2JA 3WD3A 3W53A 2RDTA 1N82A 4YTQA 5AVNA 1H62A 3KBVA 4MKVA 2TSYA 3I3DA 4ZENA 1V6VA 3EWZA 3F5LA 1UH2A 1ALDA 1T99A 3ABOA 4UTTC 3TR2A 1J0JA 2V5DA 2QIWA 4ZR8A 3APYA 1TZ9A 2P8CA 2PA6A 3IACA 4JICA 1BKHA 3FJ6A 4JFWA 2BMBA 4MYXA 2HMCA 2CBVA 4WY0A 2NQZA 4HNUA 3KXQA 3BSMA 2O9OA 3EX3A 2V5JA 3EX2A 2JKPA 4ZOCA 2R8WA 4ZQRA 4O1BA 1H7XA 5JBEA 3GVWA 3SBFA 2YW3A 9XIAA 1RV8A 2E6AA 3AYTA 3E96A 2A3LA 2ZXBA 2HXUA 4JHZA 1PL9A 5REQB 5CH9A 2D2HA 1VBGA 4IIDA 4U33A 4RNFA 2QNEA 3LN3A 1LM1A 4CD7A 3MO7A 3CAVA 3M6DA 2ZX5A 3LCWA 3GS6A 3CWNA 3UWEA 4IOTA 3DYPA 3FJNA 4DJFA 3R25A 4X63A 1IXOA 2WNQA 2ZTKA 3W2KA 5DCBA 2X7VA 3RJYA 5IRPA 3WDJA 1A5AA 3PZ9A 3W83A 3C5QA 3RPDA 1BXBA 3W70A 1TPEA 1KM5A 1A5UA 4JIPA 4Y96A 3ABXA 3L12A 2B0MA 3SCOA 1TWSA 1I2QA 4M8UA 1EL3A 2QUMA 3N29A 3LLDA 3T9PA 3WNPA 2LLEA 4BQ3A 3KE0A 2R6OA 1IYXA 3HPAA 1H7PA 4Z0JA 1TZ7A 4AMAA 3CC1A 1HJXA 1M68A 1EF3A 3ABSA 9RUBA 3H23A 3JW7A 1Q6QA 1WDQA 1MZHA 1WB0A 3L5LA 1HKIA 3O63A 3KLKA 1GG1A 2C14A 2XG9A 3VUPA 4IFKA 5LIXX 1W9PA 4H6RA 6ENLA 3S1WA 3BQ5A 4DXVA 3WMSA 4H8VA 3I3BA 5EL1A 2WZHA 3M0VA 1KWGA 4DY1A 4M82A 5JBFA 1XH2A 3B8TA 3G1HA 3JZEA 2DSUA 2A7PA 3IANA 5CSRA 1WA3A 2P10A 5EBUA 3ZLGA 2QT3A 3AYRA 2VENA 4JKMA 5IFPA 1YTKA 3QPEA 4Q6XA 4JQAA 4XO7A 2E5BA 1G7UA 4YIWA 1CW2A 2HVMA 4IH3A 4PMZA 3QRHA 1ODZA 3UJEA 4WDUA 3L4UA 1YXYA 4F2UA 1Y5VA 4YTSA 5BNKA 1E0XA 5AFDA 2W79A 2DVTA 4Z2GA 1EYWA 2YJQA 3AHXA 5HJYA 1PZ2A 3B9AA 5HXMA 2VZSA 3AJXA 2OZ3A 3N2OA 3KLLA 1H5VA 1FKWA 3GXDA 4GHRA 5EYWA 3E02A 1BQCA 1A5MC 3TN3A 1WZAA 1UPMB 1E51A 3W1UA 3E5BA 4DI9A 1OD8A 1D3GA 2R1PA 1W1TA 2CETA 1EOMA 2FZDA 5D8WA 5B7YA 1SZRA 3PBMA 3WQDA 1FDJA 3CO4A 4C6EA 1K7EA 1OEPA 3AU6A 2GVLA 3UESA 1MUCA 3T07A 3AIBA 1W9BM 1SFTA 1XICA 4IXHA 3CMGA 1LDCA 3USBA 4HZ6A 4YLWA 5D33A 1UUMA 1ISWA 3H4WA 4KWWA 5D9OA 4IMCA 2FDSA 3A13A 4L80A 3UERA 1ZB5A 5F4XA 3ARPA 4CU6A 1SR9A 2WKGA 3LGDA 2VP8A 1WAWA 2PBGA 3VK5A 1TSIA 1Q2RA 3LD5A 2I5QA 1V3KA 3RITA 1AJ0A 2CPUA 1TTPA 1EJXC 5D02A 4AUBA 2QEZA 2I5GA 3ERPA 4JTJA 2RJHA 3W6YA 4JTAA 4PYSA 2QJMA 2Q8ZA 3GH7A 4OT7A 3NAVA 1NJJA 3CTLA 3DHPA 4B90A 3SADA 2WV8A 5B80A 2XGIA 5A2CA 4AD1A 2WMFA 3TE9A 2ZUVA 3H7UA 4OZOA 4NNCA 3FYOA 1HT6A 1GPWA 2R1KA 2ZX9A 1WDPA 3EX1A 4LUIA 4H7VA 3MYOA 3W86A 1FH8A 4OOUA 3BCDA 3OGVA 3LTSA 4V27A 4WKAA 2G3MA 5FD0A 1IWBA 5JQ9A 2VC5A 4MAZA 1XLLA 1YNQA 4MB5A 5HAOA 3W38A 4O1EA 3W7LA 1GJPA 1FVPA 2Y8KA 4V15A 3M41A 3ARTA 4G7EB 4P7LA 3LHTA 4JR5A 5IFTA 4J40A 1W32A 3QMSA 4C6NA 3WNOA 5KMYA 1D9EA 5CSSA 3I10A 5E6YA 3RR4A 2OKOA 1VBJA 3OJGA 1XD0A 3U2OA 3QH2A 3GIPA 3AZTA 4LBRA 1F8IA 1SO6A 3I68A 2Y8UA 2NQJA 5GVJA 4M1BA 1QJWA 3G1DA 1P0DA 1EIBA 2WBGA 1DWFM 2UBPC 3SRHA 2Q6ZA 1SO4A 4MJMA 3VMOA 2ZRXA 3GRIA 1Q6RA 2AL2B 1PPIA 4PEEA 3AWOA 3PBWA 2QIIA 3F03K 3C4UA 4C6BA 1AMKA 3OQ8A 3BAWA 1PCKA 2TYSA 5TIMA 1O94A 4O1DA 1DWGM 3WLIA 1JAKA 3O07A 1GQKA 3LPPA 1W3LA 5C55A 1XRVA 3ZS4A 4BQ4A 1ZGDA 4QDPA 3SIMA 3IPWA 4Q8TA 1B3XA 3INPA 3OP2A 1XGEA 3Q37A 3HQ1A 4NNBA 4Y7EA 3WX7A 3C0QA 1IT0A 4D6JA 5EY5A 3VIIA 1EJTC 3VKKA 3OODA 5AHLA 1KXQA 2EO7A 2OXNA 2Z27A 1H1YA 2BHZA 1UPPA 4FA3A 3T55A 3MB9A 4AYGA 3DECA 4MFEA 4L65A 1UJPA 1Y5WA 3DFNA 3MKKA 4O13A 5AYXA 3DXIA 4HMNA 2PRLA 1J0HA 1F76A 2WSKA 4O0KA 4PMDA 2XVKA 1DPMA 3AHYA 3NQ6A 2ZUTA 1AW2A 2O4QA 1X6UA 4I9JA 4PBGA 4NHVA 2PLJA 1EUNA 1RPXA 2NVDA 2OT1A 3S5NA 2AQOA 4GI6A 4PEKA 3VD4A 3AAMA 1OCJA 3BMWA 3FEMA 1E5JA 2DJXA 2I9UA 4NJHA 3QEZA 1ZENA 1P7TA 5EB8A 1L6YA 2D0HA 3B0VC 1T41A 4DAIA 1JCTA 3EOEA 1U5JA 1S2CA 1CXIA 1W1IE 2XPKA 4QHRA 1R3WA 5E5CA 4L1XA 2DUXA 2PP0A 3IIOA 1S3HA 1ONXA 4AY7A 2GGJA 3SR7A 3IIPA 3NYZA 1XYAA 2WANA 1MUWA 3UG4A 2O55A 3XISA 3F1QA 4MUZA 1SW3A 2X1RA 3B0XA 5DF0A 4TQTA 1TPWA 2G4FA 4FX8A 2ZE3A 3MT1A 3THQA 5AHIA 3LMZA 4AWTA 4YVPA 2J8TA 4DPQA 3OLEA 3HGJA 4BQ5A 3KDNA 4IPJA 4Q22A 3TXVA 2TMDA 4LEFA 4KIEA 4HCLA 1GVYA 1YTDA 1Z89A 3K1GA 2TRSA 1HTIA 2YCJA 1VIWA 3A23A 1ZS2A 3GAYA 3VYLA 5T26A 1VC4A 4UTKA 4LCRA 1FQ0A 2WJFA 3VFCA 2FMOA 3HQPA 3NGJA 1XL9A 2E68A 2VDGA 4LC6A 2WXDM 1OQFA 3A4AA 5LNUA 1RA0A 3NSXA 5LGXA 1M5WA 4FAMA 2J9XA 4NILA 1I6NA 3EB2A 4S3KA 3BO9A 1HKKA 3VX0A 4IQLA 4PMUA 1UUOA 4GNKB 3CXOA 3WBXA 4HHPA 1TCDA 2RFGA 3RMJA 3GHRA 3P5ZA 5BROA 1Q6LA 2ZA1A 3GE7A 3HGRA 1M7PA 1G01A 3JZUA 3LRKA 4NG3A 4HPJA 2ZBTA 4HNCA 1UWUA 1ML1A 1VRDA 1CYGA 2DZWA 1TVLA 1Q13A 3SUTA 4GXPA 4K8GA 1E6RA 1M41A 1Q6CA 1KWKA 1HXJA 3M5YA 3UEQA 4IMFA 3M5VA 4DF1A 5LIKX 3ALGA 1UKOA 3FA4A 5IHSA 1KM1A 2HK0A 3VNLA 3IS4A 3DBNA 5LIYX 1KGUA 3O16A 1JI2A 1E4NA 3A3HA 3TTSA 1C7SA 1XLMA 3EWYA 4HMDA 4QDWA 2XINA 5E0KA 4K6AA 5LA0A 1CCWB 3NZPA 4JCLA 2NV1A 1D3CA 2WQPA 4GKTA 1O66A 4LCQA 3WJWA 3MHUA 5K9CA 4H9UA 3WLKX 1U5HA 1YTEA 4AVFA 1F6KA 1M7JA 5XIAA 1UD3A 3SCNA 3SECA 3MANA 3LGGA 1S2TA 4BQ2A 1KV8A 2CZEA 2ZZ5A 3PB0A 3D5HA 4B4FA 4PE8A 1TV8A 2WPBA 1LLZA 1MXGA 2QJGA 3TJIA 3EA3A 5A6AA 4GYPA 5H1WA 3VNZA 3GSMA 4IPPA 3W7RA 4FALA 4DELA 2QDHA 2Z25A 1J4EA 1KTCA 1REQA 3QSTA 1KFKA 1TUXA 1PIIA 3CV6A 4Q8VA 3MP5A 1VP5A 1I9CB 3VGEA 2JIWA 3IJ7A 4DNHA 3LPOA 4MJZA 2OYKA 3O6DA 1H11A 1JF6A 1VBUA 4RV3A 3ONBA 2QUTA 4EOUA 3NUKA 3SCTA 4UMAA 1GZGA 4B5UA 3EDJA 3SQLA 5AY7A 1TELA 4DQWA 4V2XA 3EXSA 1K9DA 1VBHA 2BTMA 1UP2A 4US6A 1KM4A 3DGRA 3AXMA 1A5CA 1KNWA 1UUQA 2O9TA 3LTYA 4H83A 2DP3A 4TX8A 1XFBA 1W54A 3S6DA 1I0BA 3H4XA 5CG7A 3RILA 2JGQA 2GJRA 3SIZA 4FNTA 3LBCA 4CLMA 1RD6A 2PGRA 4PBEA 5C7VA 3NOYA 2A6NA 3IGSA 4PMJA 3MSGA 4FLOA 1ICPA 1FFRA 2WMHA 4GZ7A 2QGHA 5FJRA 4JHMA 3LPFA 2X2YA 1IEWA 3CHDA 5E0FA 3S2CA 1V3HA 1G1YA 2WC7A 3M0LA 3ZT6A 1CI1A 2ZADA 3OYXA 3S9IA 1NEYA 4GGBA 4GJJA 2EJAA 4TVDA 1MW0A 1WBJA 1OK6A 4AWEA 1UH3A 3M0MA 2V3GA 1OABA 3DCPA 3GUWA 2G3NA 4LFYA 3UZYA 3UWVA 2D23A 2NQ9A 1V02E 2A3AA 1CDGA 2V69A 1BSIA 4HPXA 1US0A 1R3SA 4NI8A 3TV8A 3RM8A 3SN4A 3CEPA 3P2VA 1JYXA 2BZNA 3LU2A 3CUJA 4C1KA 1JUKA 1O5RA 4G9PA 1V8EA 1NOFA 2JGYA 3LCHA 1TRDA 2OFJA 4IUOA 3G1YA 4EACA 1E43A 1UR0A 2OZ8A 2L5HA 2GQ8A 4DPPA 2VRQA 4RNJA 5CPSA 2EBNA 4MF4A 3MUAA 1WYIA 3WFAA 3W9ZA 3UVAA 4DN1A 5CBBA 4L1GA 3QQWA 1KFLA 3TMQA 2WBKA 3L7RA 3TYEA 1OIMA 1XIMA 3COTA 4MY9A 4M6UA 2R1NA 1XM3A 4M7SA 3TNOA 5IDZA 4HNNA 1WXZA 3QC3A 3WNNA 5DBUA 4PUJA 1KA9F 4K39A 1JPHA 4JIIX 2XIIA 2P1FA 1SQ7A 4XZHA 3VGGA 1VFLA 1XH1A 5HWJA 3U7VA 1NDWA 3QGAC 3QTPA 1FCQA 1JDDA 1S1RA 2PDPA 3HA1A 2E8YA 4ORMA 3FX4A 5JH1A 3WK2A 5BOFA 1WNOA 1OFEA 5CLTA 1TFVA 3LHYA 4ZTXA 5HWNA 2ZDSA 4UBPC 3BQ6A 4K8EA 3VOHA 1R7AA 1CT5A 2CYGA 2Z26A 5I3GA 3EKGA 3WUEA 1O5KA 3NZRA 1G4EA 1F3TA 4LY4A 4GUGA 3M9YA 2X0SA 3QHNA 4B92A 3RFAA 3WG6A 4HPGA 4UXDA 3NOEA 2QDDA 3NWRA 7REQA 4ZQOA 3LPGA 3AC0A 2F2HA 2GK1B 4LY8A 3HU7A 2GQ3A 3ANVA 5L6UA 2XVPA 1A5SA 2V3EA 3GU2A 1OFAA 1U30A 4DUVA 1F8MA 1MRAA 4F9DA 5I3DA 3ZQ9A 2VZUA 3R6IA 3IWPA 3PZVA 4RPPA 3P93A 2ACSA 1MNSA 1RAKA 3ABZA 4Q6JA 1VAHA 2WJDA 3QKZA 3CT7A 2OVLA 5F4SA 4C1LA 1Q6FA 4MIMA 4KFPA 5DO8A 4NZ5A 3PZOA 1POJA 4H4IA 4Q8NA 3ZSSA 4F9JA 1TJRA 1R9YA 1AJ2A 4GI8A 2QMJA 3VOCA 4H01A 4A2SA 3PNUA 1RD5A 1GQIA 1TR9A 1JDFA 3H21A 3IRSA 5CJMA 4IGSA 3CIXA 2WJEA 1FFQA 5A5WA 2Z1SA 1OM0A 3RLUA 3N9RA 1GQJA 2DT3A 2P3ZA 3QR3A 4JTSA 2J74A 3S5YA 2DUZA 2F6UA 2FIQA 4JTFA 3N9KA 3DGBA 3HN3A 2O9RA 3GM8A 2WPGA 3C2RA 3L21A 3VGFA 1YPFA 4IQEA 1BYCA 1MWOA 1FWSA 4DEFA 2BNJA 4FR1A 1LLWA 1KKOA 1FWCC 3A6OA 1U1UA 1J01A 1IQ8A 1T8QA 1RJRA 3PAJA 3QY7A 3NL6A 5GNZA 2OG9A 4I8DA 3BG9A 4OGZA 1W1YA 2JKEA 1YEYA 3L0GA 5ABFA 3VOGA 4O14A 2IW0A 4G6CA 4O8AA 1IE7C 1R3QA 1F3XA 1KXTA 1U83A 4I8YA 3N6JA 3N2BA 4E2VA 3P62A 3M47A 3K5XA 5CKSA 3WQGA 2VGFA 2FTPA 2CNCA 1EH9A 1QI5A 3RAOA 4XUYA 4REQA 1F3WA 5XIMA 2CLLA 1NH6A 3UNDA 3LUTA 3GR7A 3G1AA 4NZ3A 1ZUAX 3OGSA 4WJEA 1MO0A 2G8ZA 1UZHA 4M80A 2C18A 1J8VA 1KW1A 2PWVA 4PFHA 4GMEA 1UQYA 2D0FA 4D72A 1RLCL 4RZ6A 1GTEA 4HZMA 2PU1A 4F3HA 2HQAA 3G1VA 3GLCA 4DWSB 3RCMA 3HG2A 3DFPA 3WZ0E 2FPVA 2VXNA 1MZRA 1TA3A 3IJ6A 4N9BA 1DIEA 3SGGA 2ZVRA 4XTIA 3PN8A 2FGLA 1QRQA 3M4HA 1TX0A 3AIWA 4HTBA 3KVLA 3UQNA 2J13A 3BDKA 1VZWA 1WAUA 1P1MA 3UU0A 3D0CA 3UGVA 4ZSTA 3DYOA 1AW5A 4BI5A 4WVXA 3O1NA 1I1XA 1P4CA 1CLVA 4A8LA 3N4EA 3NR0A 2OWWA 4M81A 1UWSA 3ARVA 3T6CA 1AG1O 5C71A 3T0AA 4I3GA 5I06A 1JGIA 1HO4A 3NQDA 2RH9A 3G1RA 3BJFA 3LRMA 1E6NA 3FHQA 6ALDA 2VUNA 2TODA 2Z7GA 1OSEA 6XIAA 1OIFA 3WIJA 3L4YA 2ZFAA 1KFJA 2V30A 1VHNA 3NG3A 2DH3A 5HQMA 1JPKA 3B8VA 3PZIA 1KC7A 1H7WA 1MXDA 1FWDC 3TW7A 1OFQA 1XYMA 3IGXA 4X3ZA 5D9PA 2A5HA 3DI1A 3EWUA 4WGXA 1OFRA 5AHMA 4NXSA 5EA9A 2YL8A 2PSNA 5LXEA 1UKPA 4HJFA 1OVDA 4PRRA 5H8PA 5BRPA 1G6CA 4XD4A 3GXIA 5I23A 1K7XA 2G50A 4B15A 5D04C 5EPDA 3KL0A 4DBUA 1W2VA 1V0KA 4EAYA 3T05A 1YHTA 4XISA 4RR4A 5GNXA 4QE5A 3VO0A 4JKLA 5G4HC 2GGGA 4WEVX 2NQ5A 2ZZ1A 2B7NA 1TYGA 3W7CA 1Q3NA 1DIKA 2PDXA 1J10A 1N2VA 3W2NA 1U33A 4CQCA 3CTTA 5TBOA 4NI3A 1JIBA 1VFFA 1E5NA 3VNKA 3B06A 3N12A 3S46A 4DJED 1JZ2A 3GVRA 4ES4A 3ELFA 2PF0A 3MA8A 1BVZA 2DZUA 1W5PA 2DW7A 2AQVA 3MWAA 4L4MA 1OWQA 2MNRA 4NXKA 2WLZA 3II1A 1DJNA 5HJXA 1G94A 1ESWA 1M53A 4PR4A 3GX9A 4GQQA 3H70A 3B40A 4KF1A 4LT9A 3IGHX 2WCGA 3TJ4A 3TP4A 1AODA 5I6SA 4MZ8A 1K77A 1MXSA 2QDGA 3GW0A 3FOKA 3CPRA 1HJQA 3KTSA 4QNEA 2WCSA 3PUDA 4EIVA 3OA3A 3L2MA 4AZCA 5LKYA 4MNKA 3FIGA 1G67A 2W27A 4ATLA 1DL3A 3QW3A 1DVJA 4TU1A 3CH0A 5LNWA 2P76A 1C93A 4Z2JA 5C70A 1I60A 1IGWA 1EEPA 3CUGA 4H7CA 3BLDA 3SGUA 5CZ0A 3WUBA 3E0LA 3FY1A 4O57A 3T4CA 2H9AA 2FH8A 3DFQA 1YYAA 3IUDA 4M19A 2B31A 1A0DA 4NZ1A 3POHA 3KZSA 3QHOA 4PTXA 3G1XA 3SN1A 3WEOA 3OG2A 1MFVA 2QCGA 4B5VA 3ARUA 1F6PA 1XSKA 1B30A 1LG1A 5FEWA 3FJ4A 3OO2A 2P8BA 1JRBA 2EAWA 3NZGA 3LLFA 3NZ1A 3L2IA 2I9EA 3EDKA 1T7LA 4N6FA 5HBFA 3TA9A 3M0JA 1W17A 4K1GA 2YDRA 3A4WA 4CD6A 2GSHA 1GNXA 4J3XA 3H53A 4IISA 3AWNA 4WOQA 2WNZA 2C0AA 2YBTA 1WZKA 3E0VA 2NUWA 2ON3A 1AFSA 1K9TA 1XBXA 2RUSA 4S38A 3TC6A 3NM1A 1AL8A 5HA7A 1QFEA 4ALDA 1PX8A 1SJAA 4Z0SA 4CQAA 4YN5A 4XKYA 3PUOA 2QF8A 3FFSA 2NX9A 3EPOA 2PEVA 4HN4A 1QPOA 1KGWA 1I75A 2DZSA 3THDA 1QPQA 2G41A 5BMWA 1EBHA 4TVUA 4YNGA 1GKPA 3SY5A 3N2CA 3MKVA 3JS3A 2VEIA 2E1DA 4W8BA 1O5XA 4DO5A 4S3CA 2PUZA 4C6DA 1W3IA 3CYJA 1FH9A 3H2MA 5I78A 4C6QA 3K46A 4MZ1A 4FP1A 1T5AA 2QLYA 4KWSA 2BV9A 1GJWA 1DORA 1CENA 3T8QA 1DHPA 2D2GA 3AFBA 4E4PA 2RDUA 2XFRA 5CAHA 5FACA 4BA0A 1O95A 3S1UA 3HGOA 1BWKA 5T9CE 3DBPA 4XAZA 3BAXA 1NVMA 1SZEA 1TE6A 2HISA 1L6FA 5CC5A 5ABEA 3R79A 5M3WA 1EX1A 3GUGA 3GR8A 1NWRA 4HD5A 4MMWA 3VKBA 4JTHA 1EA0A 5C6MA 2DZBA 2PODA 5FI8A 2XH4A 1QPKA 1JQVA 3W28A 3M5XA 4PMXA 1K8CA 2XZ9A 5MHBA 4ZOBA 3OPSA 3WH9A 3D46A 4FNQA 1EUAA 3GG7A 1F73A 4TMCA 1IXPA 5F1UA 4JL1A 3JRKA 1QCWA 2GQAA 2ZUNA 5CXPA 4HYWA 3PZQA 5AECA 3CZGA 3BLKA 4B3ZA 1VFHA 4S3FA 3VE7A 3SDOA 3QOMA 4H41A 1SVDA 2ALDA 3RRXA 3E9AA 4NAFB 4MLJA 1ZNNA 4IG2B 4IXXA 3SRFA 4DO7A 4FHAA 2JQXA 1ITCA 5G1YA 3MHFA 4ML9A 3OU8A 3KCLA 3SUSA 1G69A 4DJDC 3FS2A 1OINA 4CUCA 4GYFA 4OWGA 2NXGA 2FTWA 2H8ZA 1ECQA 3EXRA 3DAQA 1OBAA 2ZYFA 1JAEA 4FOKA 2CXGA 1H63A 5K2ZA 3P8IA 4G7EA 2YBVA 3U48A 1H7OA 1AQ0A 3NQAA 4DZAA 1QOPA 3W7GA 3RGTA 1VS1A 4YTRA 3EMCA 4UFKA 5HNNA 1HKJA 2PC8A 4A3HA 2NUYA 3SFWA 5G5IA 1ITXA 3P84A 2ZRYA 1LT8A 4UZUA 4BEUA 4NJGA 5CZKA 4LYPA 4F48A 1OADA 2OT0A 1HZYA 4ICNA 3SRDA 5F1VA 1TZZA 4AXNA 4WGHA 4HNVA 4N42A 3NQCA 1V6TA 3KHJA 4DBSA 3PZTA 3M0HA 3NQ2A 1V93A 3FVDA 1KRAC 3AZRA 4Q8UA 7XIMA 3B0YA 1DHKA 4DM2A 3RK8A 4WD0A 3TTYA 1XC4A 2ZUWA 1XG3A 4XG1A 1VYRA 5GJNA 3WENA 4AY1A 4FLSA 4JIQA 2QULA 2W92A 4EXBA 4Z2HA 2PGWA 1ZAHA 3LB0A 3VNDA 3ICJA 3TEVA 1MMFA 1BAGA 1PS9A 5ENLA 2VQTA 1W9DM 2ABBA 1DWAM 2J24A 4WF7A 3G0XA 3NGFA 1LOSA 3CPUA 1PEZA 2BHYA 2WQDA 2GL5A 2GVEA 2RKXA 4JGDA 3BAKA 4LEQA 1TPDA 5DMMA 3I7RA 2WYSA 8XIMA 2PDNA 4IL2A 4AD3A 3HG3A 3PPCA 4UOJA 1JCNA 4N6EA 4XZNX 1KQZA 1UHVA 1MI3A 1XRFA 1RBLA 3MPGA 2CLHA 4LV9A 4UNIA 3EPNA 1X97A 1FKXA 3LHZA 4IGMA 3G24A 1WUEA 4C91A 3QSRA 1CGWA 2GGIA 3RUBL 3C8NA 1BSLA 1YE6A 3IJQA 1P6BA 2J77A 3UFYA 1B3VA 1OF8A 1XI3A 3LHVA 3W82A 3N13A 4RW5A 4MNJA 2ACRA 1TMHA 3S42A 4MKNA 1J5TA 6CGTA 3AS2A 2ISVA 3V5OA 1P48A 4W84A 3S47A 4LBSA 4JTTA 4PTNA 3NL3A 1S46A 2WKJA 3BTNA 3GW3A 4PMQA 3A3WA 3BOFA 3S1GA 4LU0A 3VM7A 1ME8A 4O0ZA 1TJPA 3QPYA 3DFYA 3ZLHA 1KXVA 2Y24A 3E74A 3S2JA 3ZZ1A 4PMOA 3WD1A 4W8LA 2PDHA 4HT3A 4X2PA 4FI4A 1YDVA 3NVDA 3ARSA 3TZNA 3QMTA 4S2BA 4ROPA 3RX3A 1HX0A 4CU8A 5LA1A 1DXEA 2E9BA 2NSXA 1LWJA 3SUWA 3BK0A 1LL6A 1GOXA 3C0JA 5EFFA 4CNPA 1OYCA 1EC8A 4PTVA 4JPGA 4DM1A 2JEPA 3L65A 2CESA 4KETA 4TO8A 1NOUA 3V0TA 4EWJA 2D22A 1GCYA 2YA2A 4LAZA 1A53A 3W6LA 2GVYA 4PCFA 5D09A 3VC6A 3F4WA 3CQKA 5CZSA 4JTQA 4L9YA 4L9ZA 3B8UA 4R34A 5CGQA 2UY5A 1GKQA 1RJPA 4J7RA 3PBVA 3N15A 3B4YA 1F4HA 2BGQA 4HQVA 3ENLA 3WDIA 4O12A 3SJ3A 4QITA 4X0VA 4KIRA 5HNUA 2DH2A 2YX0A 3ID7A 3QY6A 3G8EA 2PRMA 2V3FA 3T44A 4DHGA 4PTDA 1E1CB 3ZM8A 1JYVA 4L4PA 3GC5A 1SW7A 2P0OA 3LA4A 1BRLB 5FEPA 3PJXA 5AKQA 4H6EA 1PX4A 3THAA 4GE8A 1P0BA 1ZBKA 2E7FA 1TTQA 1QATA 4LAOA 2QCEA 3KBSA 2G96A 5D30A 2QVHA 2XIQA 2J7FA 3HMCA 3A22A 4C6KA 3N9SA 1OCQA 4PULA 1D2KA 1QT1A 4N4QA 2NSOA 1UR9A 4A3RA 5MKGB 2H3DA 2FJUB 4US5D 3STEA 4QRNA 3VCNA 2VX6A 2IKGA 2YLLA 3WNLA 3W1AA 3RR1A 2QUUA 1SGJA 4GY7A 1SU5A 1A5BA 3E6EA 4DYEA 3PG8A 1VEPA 4ZB2A 6REQA 3QGKC 2IQTA 1K9EA 3EOSA 4MSSA 4U3CA 3EDEA 3C52A 5I24A 1PZ3A 3QHMA 3TX9A 4C1NB 1TPH1 2XFWA 4WCJA 1LWIA 1OZQA 5K7JA 3BV4A 2GUBA 4FNSA 3NQGA 4FXSA 2FKPA 3OEXA 1S39A 3UF9A 3RNDA 2D20A 2ZE0A 1EBGA 3EB4A 1YX1A 1SSGA 1E72M 1H50A 4RXFA 4D6IA 2W6RA 5FF3A 1TPUA 3Q65A 4IJRA 2GJXB 3OLDA 3LTPA 1G0CA 3CYVA 1O60A 1RQHA 2Z6IA 3OZYA 1EJSC 3WQ6A 2DQWA 2BODX 3E0IA 4L7ZA 4JX4A 3GG1A 3NQMA 4TMBA 1FOBA 3GO2A 1NF7A 4AHOA 3LK6A 1PVNA 3A9IA 1J9YA 5FF2A 3PBGA 4FOUA 2J27A 2VGBA 5KINA 1GYLA 1VH7A 1RSCA 2JBMA 3P82A 3AALA 2DW6A 4UQEA 4MPKA 3ZWSA 1HN1A 3EGJA 3H7RA 4ZQMA 4E2BA 1JNDA 1AD4A 1TIMA 4FNRA 1K70A 1ZJIA 2BG5A 4JAWA 4UTWA 4XZLX 3AYVA 3EWBX 5HMFA 4XD3A 2SFPA 2PI6A 2VGGA 1UR2A 5DN1A 2X0HA 2OCZA 3MMDA 4G56A 4BHYA 4WQ6A 1TUFA 3O0FA 1GK8A 2WW5A 2J6VA 3FYYA 1R9ZA 5E9XA 5CAKA 3PUGA 3DESA 4O52A 4MWAB 2XH7A 4C6IA 1CXEA 4J27A 3P3BA 1XQKA 4FR6A 4Z1YA 5LYRA 5G4EA 4CD4A 4JBRA 3AYSA 2BB0A 5B7ZA 2A79A 4QP0A 1JDAA 3T81A 1VLIA 3MC5A 3OVQA 3WQPA 3VNMA 1L2QA 1RR2A 4JTLA 4GJ1A 4NJKA 4JTGA 1MDRA 4U10A 2FPYA 4O8RA 2CBJA 5CZJA 3VDBA 3W2LA 2ANUA 4JDBA 1KLZA 2BSLA 2V81A 1EXBA 1H7NA 1LBFA 3CBWA 4GQGA 2WSYA 3SZ8A 4AZIA 3N3MA 1BF6A 3E12A 3QQ1A 2BASA 1VKFA 4FNUA 3ANYA 3ZVHA 3R13A 3U6WA 3BLOA 1PIFA 1QASA 1RUSA 4U5IA 2ALRA 1JVNA 2FZNA 1E6QM 1UD2A 3O2LA 2FLIA 1H51A 4GC3A 1QTWA 4UFMA 2W5FA 3A9BA 2E5DA 3CUXA 3DHFA 3C56A 2ZTJA 4ZVJA 4B4HA 1TQJA 3EMZA 4N4PA 1JPIA 3DG6A 1PBGA 2C1HA 3NSMA 3EWCA 1PE1A 4CD5A 4XBKA 3M7SA 4ROQA 3ZVIA 1N8IA 4CCZA 2TAAA 3PANA 3VKDA 2EJ1A 5LIWX 1KCKA 2G97A 4NSBA 2IPWA 3W2UA 3QXBA 4W7UA 4HNOA 4FIQA 3HGSA 1A5LC 4DJEC 4LH8A 2OOFA 1E9LA 2ZUSA 1YRRA 2PDJA 1GOIA 1UWAA 3ZT5A 1B54A 4M51A 1RJQA 2BOEX 4PBFA 4A3UA 1OFDA 4FS9A 3FNDA 3DN5A 3DOPA 3VKAA 2NV2A 3CHFA 3WN6A 2Y5SA 5C2XA 1GWJA 3GB6A 1RA5A 2HBVA 4LS1A 1BWLA 4QAWA 5U7SA 4N0RA 2VI0A 1GQLA 1SFLA 1ZHAA 3WD2A 3T2PA 5LNSA 2AL1A 3K4WA 1NSJA 3N2TA 3GD6A 3PK7A 1DEDA 4X9YA 1CB7B 2PZ0A 1B0IA 4P2VA 4Z1AA 1FCBA 3O6AA 4AD2A 1Z9AA 1H5YA 1ZTVA 1H1ZA 2FZMA 4FK9A 1U2YA 4A3YA 1VEOA 3KVMA 1JCMP 3P7YA 5HUPA 3WNMA 2DT2A 4ZFCA 4QE1A 1JDCA 3LNPA 3AS3A 3LLXA 4P7OA 1KQYA 2QV5A 1JZ4A 3IIXA 4B3LA 4JTDA 1JZ8A 4CNTA 2VX7A 3G18A 4JQ2A 2H6RA 1HNYA 4ZQCA 4A6GA 3OVPA 1N8FA 2EPLX 1RBOB 1WX0A 5CGMA 3K4AA 4UTWC 1RK6A 1LYXA 2V3DA 4EX4A 4JFTA 1EB3A 3ZYZA 3BW4A 3SM0A 3W7EA 3GYCA 4AX6A 4UNLA 1W3NA 1THFD 4NAEB 3BLIA 2GSEA 5T9BG 1P0NA 5GJPA 2VT0A 3W2MA 2GGEA 1DJQA 4C5YA 1M9HA 4C60A 3AO0A 4CGTA 1XSJA 4HMEA 4JYEA 3FKKA 4C7FA 1JPMA 4OHQA 1AVAA 3P67A 1W5NA 1YPIA 3BC9A 1SFJA 1XGDA 5ABGA 5FAJA 5HOSA 1OX4B 1KBKA 2GVGA 4M6QA 4ZEPA 3PAOA 4Q32A 1JR1A 3HB9A 3MQTA 3O06A 5CPNA 2GQ9A 4D6FA 1Q66A 5D2YA 2WSQA 3UG3A 3R58A 3SUVA 6XIMA 5DY3A 1PX3A 3BH4A 3TQVA 5DMYA 1OD0A 2E4TA 1T0OA 4LUTB 3WQVA 3UR2A 3M07A 3AMDA 4ZOEA 4MNLA 3TJXA 3DG7A 4XB3A 3MMTA 5FKYA 1NU5A 1E55A 4F79A 1EPXA 3ZOAA 2VURA 3WQFA 1JYNA 3DUGA 4XQ6A 4HU0A 2Y4SA 4QQ3A 4QROA 5DELA 3CUIA 2ZRVA 4XK2A 2OSXA 4TV5A 5D37A 1UD8A 4E6MA 4U2YA 3V36A 4PA8A 2HPIA 1UKTA 3WF4A 3PWIA 3TFXA 1W56A 4WK9A 3TU9A 1DJXA 1NWTA 5I3JA 3IIZA 4H9TA 4Q33A 5D03A 3V7PA 2O56A 4E8DA 4UTTA 3LOTA 4PMYA 3NQVA 2Z0IA 5M1TA 3WMCA 1OFBA 3TK7A 1C8VA 4W85A 2WK2A 3R12A 5HANA 1DJGA 4AF0A 2OKTA 2CCRA 1IZJA 1SFSA 4WOZA 3L5AA 3AZSA 2VD8A 1VFSA 2WZIA 1L8NA 3BG3A 1CBGA 1QWGA 1XJBA 1KM0A 4RE3A 3ITTA 1VB9A 3R43A 1ME7A 2OTDA 2EPNA 4LBUA 3FXYA 4I7WA 1HL9A 2CBIA 1UKQA 4V1YA 1EHAA 4GC4A 2CLPA 1NQKA 2W62A 3GTFA 1DJYA 5J5RA 2I1OA 2Z1BA 2ISWA 2ZOXA 3T4WA 4Q4OA 3GNOA 1MW3A 3MP3A 2FDMA 3E49A 1ZQ5A 4UR7A 4MJ4A 4P8XA 1AL7A 1YW1A 4UQDA 5BCAA 1GZ1A 2V2CA 2WSPA 2XVGA 4X22A 4XSLA 5AOUA 4WY0B 3AJ7A 3RCNA 1JXJA 2VUYA 3F4VA 1Z6KA 4GUIA 3IK2A 4LCSA 1WPCA 2DZPA 3AOFA 1KO0A 4AEOA 5AYYA 3FAWA 4QLKA 4LV4A 1R47A 4QIUA 3VDAA 1KBLA 1O1HA 4WJ8A 4LX4A 3P8JA 2BHUA 3U2CA 4XD5A 4ZE5A 1TJ0A 3V0UA 1IIGA 4PSPA 3R8RA 5BZAA 2IPFA 4D9PA 3DI0A 1DWHM 3LDVA 1M7XA 2Q3RA 1A4LA 2Z2UA 4R88A 3CO8A 4ZBCA 3M5ZA 1IEIA 1B9BA 3P61A 4PODA 3WLLA 4KRZA 5K4ZA 1OFPA 3F4DA 3SQMA 1J2WA 2DJLA 3VGDA 4HNTA 2GJPA 1KBBA 3ITGA 2NW0A 1LL7A 3TKFA 4KQNA 5EMJA 2H8XA 3HJZA 3UNTA 1J5SA 1LQAA 3EOLA 1P43A 2DY3A 3VNIA 3N34A 5K3VA 4DWSC 1H09A 1E0TA 3PHAA 1E9ZB 3U8GA 1QK2A 3FA5A 3O0KA 3SAZA 4AVNA 2ZRZA 3WF0A 3W07A 3TQPA 2ZCGA 4IFKB 1EGVA 1RBAA 5CBJA 3GHUA 3PSVA 2G95A 3JU2A 4LVAA 2BXVA 5TD4A 3MV01 4S3BA 2C79A 4C7GA 1TR1A 3W7NA 2QPUA 3KOFA 2UV8G 1KFBA 3NQEA 1FWBC 3E2SA 3HV8A 4DI8A 4AC7C 1QU4A 1OYAA 2PLKA 1A80A 1U5VA 4Y9NA 1VYSX 5DMNA 1QR7A 4FXFA 3T08A 2R1LA 2C91A 2VC7A 2VZTA 2Y70A 2REQA 4TIMA 2QS8A 4GCAA 4J1OA 1JYWA 1GOQA 3I6EA 1LUCB 2ATSA 4D6DA 4HMCA 1FXQA 3NQ7A 3BLLA 2J9YA 4WSJA 3GYEA 3B03A 1L0PA 4IGNA 2HE8A 2YFOA 2DZVA 4Z2LA 1XIHA 1BYBA 3MTWA 2IPGA 4B5SA 2KZHA 1EO7A 2POTA 5K9DA 1X8CA 1TV4A 4NYUA 1V79A 1EJ7L 4BWLC 1W1B1 3QTGA 1YBQB 2O92A 1MEHA 4UC5A 4HU8A 1ODUA 1VPQA 3IUHA 1XIGA 4BF7A 2PP1A 4CU7A 3G0SA 1HL2A 2XSXA 4RDYA 3AISA 1X8FA 3K8MA 4S2CA 4CVWA 3KP1A 3A3XA 3UGRA 3TTQA 3LCXA 2NX3A 4I9AA 4GVHA 1S38A 2Y62A 3CV1A 3LNMA 3URNA 1OT1A 4XIAA 1ZALA 4L61A 4KRTA 3R0UA 4QJ4B 4YPJA 4C5ZA 3AS0A 3B3DA 3OZOA 2CZFA 5DXXA 1X98A 1KR1A 4GYJA 1F6YA 2EPMX 3KBJA 4I7UA 4YVVA 4ZB0A 2OQLA 3AHTA 2Z4GA 1MDLA 3KOWA 3M0ZA 1NFBA 5D05A 3DX5A 5HNRA 3TAOA 3C8FA 2HDJA 4IIFA 1SSDA 4EE9A 3ANUA 1G4TA 5AHNA 5H8UA 2AMGA 3P0WA 5CPLA 1MW2A 4QBXA 4H6QA 3NCOA 1IR2A 2PURA 5I2UA 4IG2A 1DWIM 2CU0A 3W1NA 3UWYA 1VYPX 3MJMA 3QFEA 3L68A 1HFBA 4F0RA 4OBTA 2Y7DA 4QJ3B 5GNYA 2PDCA 1LJYA 1Q65A 1QW8A 2OO6A 4HK5A 1ISXA 4R9OA 1G5AA 4GI9A 4GX9A 4E8GA 1BHGA 4IFOA 3R0KA 1VEMA 1FWHC 2VFEA 3UCDA 2EKGA 3UYCA 2DSZA 2F38A 1YLVA 3EKLA 4QG8A 2YOCA 2YYTA 4AISA 3DG3A 4R33A 2CZ5A 3UZWA 4Y9OA 2D73A 4Q8QA 4QS5A 4LAUA 3S9YA 2FVMA 3FGCB 2J7EA 3HPFA 3T40A 1W6TA 1O1ZA 2X8RA 4IP7A 1SZFA 3UR7A 5BXSA 1Q63A 1DKWA 3VCCA 3M0KA 1LG2A 2OGYA 1MRQA 1XV8A 2DPEA 3MSYA 1A49A 3PS7A 3KS6A 4JN8A 1IF2A 4UTMA 4ZODA 5JVLA 3IUIA 3PC0A 4W5UA 2DSVA 2XIJA 1B31A 3MZ2A 1M3UA 3WLQA 1G4PA 2QAPA 5J8LA 4MGGA 1KTBA 1XLGA 3FV9A 3DFHA 5A8QA 3KBMA 1ZP3A 3CPGA 2ZVIA 4EKJA 3GFYA 4I5RA 2J78A 5AC4A 5I3KA 5C5YA 1JGMA 2OYLA 3WFLA 1OF6A 2NLYA 2I57A 2ABAA 2PGFA 3M64A 3E1F1 2VC6A 4KS0A 2WMIB 2W0UA 2QZRA 2B7PA 4GGHA 3VA8A 3TONA 2UWFA 1HVXA 2Y88A 1W3KA 1SZNA 4AYSA 4LJ3A 5HJLA 4POCA 2CXEA 1EP3A 1GTHA 4KERA 1ISYA 2E0PA 4GUFA 3TROA 3VOIA 1GKRA 4QDMA 1SO5A 5LHEA 2FHCA 5CPTA 3EOOA 5RUBA 4HSNA 3WL0A 2FVKA 2OLHA 2R91A 1K8ZA 3KRUA 3ZFHA 3RO6A 2AKZA 3TQ0A 3BJSA 3OIXA 1UD6A 4R5EA 2EHHA 4F8XA 3VIPA 1QNRA 4OV4A 4AY8A 1QHOA 3VZYA 3H54A 1PAMA 1I8JA 4LVGA 3R10A 1QI3A 4X0NA 1WKDA 3VZZA 1OGSA 1GQNA 3W7PA 1Q7QA 2FVLA 1P7TB 1FX6A 4PMNA 5E1QA 3E2RA 4GA8A 3B0PA 4MDPA 3W7IA 1V77A 4OUIA 4JYDA 2MUCA 3KWSA 3A64A 4XBSA 4XZMX 4XVDA 4NKCA 1J0KA 2R1MA 1U1JA 1I1WA 2G4JA 1GZJA 3SQSA 3WLOA 1GJUA 2WHLA 1YXCA 2D3NA 2YDSA 3PBUA 1PUDA 3W81A 3N17A 2BFGA 1RCOB 1NF0A 3LCFA 1BGGA 2PLCA 1PKMA 3LY0A 2JIEA 4OUEA 3ZT7A 4LNCA 2ZC8A 4LUSA 1SYTA 3WQWA 1LOLA 3VCRA 2Q71A 4GK8A 2WZMA 2GJNA 5FSDC 4ERAA 3AIRA 1E73M 2IQDA 4KKXA 5D9MA 4MOZA 3PWGA 4DWDA 2Q09A 4HA4A 4O4WA 5BMXA 5I3HA 2IS7A 1HKVA 2QXWA 5A6LA 1XBZA 2NQLA 2F9RA 2ONEA 1BG4A 4O15A 4IMEA 4DLFA 1OG0A 4UR8A 3VIGA 5JBDA 4AZ6A 4LB4A 4PUKA 1A5NC 3H12A 3VIOA 3FDGA 2C71A 4AEEA 4N7QA 1KCXA 4PSRA 5LXXA 4IP5A 1QO2A 4EPDC 1UG6A 3UG8A 4W4QA 1X1ZA 3O05A 5BXRA 1QDSA 2QJHA 2Y7FA