2Q02A

Crystal structure of a xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 at 2.40 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
GMNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAVWAQQLIREAGSPFKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQLASWSEAEIEEQINRSVSLLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Crystal structure of putative cytoplasmic protein (NP_463296.1) from Salmonella typhimurium LT2 at 2.40 A resolution
rcsb
source organism Salmonella typhimurium lt2
molecule tags Unknown function
total genus 97
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2q02A00
3ITLA 4E3VA 3KBVA 4K3ZA 7XIMA 1A0DA 2QUNA 4QE4A 1DIDA 1XLLA 3CQJA 4X60A 4YTSA 3DBNA 3BZJA 1S5NA 4QE1A 3VNJA 1XYBA 1A0EA 4GLEA 1XYCA 3KTCA 1XLJA 4QEEA 1K77A 3M0YA 4XIAA 6XIMA 5XINA 9XIAA 1OADA 1S5MA 3M0LA 1I60A 3IUDA 3LMZA 3ITXA 3TVAA 2XINA 4XIMA 1YX1A 2NQJA 1MNZA 3JU2A 3NGFA 3AYVA 5C9ZA 1XINA 3KCJA 4HGXA 5EMJA 4EAYA 3M0HA 3M0MA 2HK1A 1XLDA 3AALA 1MUWA 3VYLA 8XIAA 3KBWA 1XIIA 3ITVA 4A8IA 1XIMA 2NQ9A 3BDKA 2X7VA 1XLGA 3DX5A 3VNLA 3P6LA 4A8RA 1D8WA 2HK0A 3L23A 3C0SA 2GLKA 4HNOA 1QTWA 4ZB5A 2GUBA 5J8LA 4EACA 4YTUA 3BANA 3IUHA 4QDWA 3ITOA 3AAMA 1XLKA 1O1HA 5EMLA 1XIHA 3UVAA 3M0VA 5AVHA 3KWSA 3XINA 4A8NA 5I7GA 1DE5A 2OU4A 3QC0A 1XIBA 1XLHA 1I6NA 1XIEA 3UXIA 1XYAA 1XYMA 3CQKA 4HHLA 5H6HA 3QYSA 2XIMA 3KBSA 1DE6A 4PGLA 3WQOA 5EMKA 3KCLA 3AYTA 3U0HA 5H1WA 3KBNA 1TZ9A 4J4KA 3C0QA 3M0XA 3P14A 1XP3A 4ZB0A 5FA5A 2Q02A 2I56A 3VNMA 6XIAA 4A8LA 4US6A 3UA3A 4XISA 4K1GA 1XLMA 2J6VA 4X63A 4DVOA 5B80A 3ITTA 5XIAA 2NQHA 3CWHA 3N4AA 4QE5A 1XIGA 1GW9A 3XISA 1XIJA 1XIDA 2QULA 3GNXA 4PFHA 4Q7IA 4YTRA 2ZDSA 4W4QA 1BXCA 4OVXA 3VNKA 1QT1A 3OBEA 5XIMA 3ITYA 3U3HA 3UU0A 1XLAA 5TNVA 2X7WA 3FVMA 1BXBA 1XLBA 4GQBA 5EMMA 3UA4A 3BZGA 1A0CA 1XICA 3KCOA 2GVEA 3CQIA 3CQHA 4YTTA 1CLKA 1XLEA 3BWWA 3VNIA 4XSMA 2HCVA 5B7YA 4KW2A 2GYIA 1XLFA 1DXIA 4QDPA 4X61A 1XISA 3C0LA 2ZVRA 2QUMA 3KBJA 3CNYA 4QEHA 4G56A 1XLIA 2XISA 4GJJA 8XIMA 4GJIA 4XSLA 2QW5A 9XIMA 1QUMA 5AVNA 3QZAA 3TC3A 1DIEA 4XKMA 1XIFA 3KBMA 2G4JA 4ZB2A 4LNCA 3QXBA 1XLCA 4DUOA 2I57A 1XYLA 2G0WA 3IUIA 4YTQA 4ZBCA 5B7ZA 3XIMA 4HHMA
chains in the Genus database with same CATH superfamily
3EXSA 1UP2A 4CNOA 4UQEA 4N6FA 4CD8A 3OQ8A 4A22A 3OVRA 1OK4A 3LZ3A 3T2PA 5JH1A 3YPIA 4NJJA 1EHNA 1OJXA 2D2GA 3N6QA 5AZ1A 3R11A 5BNKA 3TA6A 3J7HA 4O50A 3A6OA 1EQPA 2DH2A 3ISIX 1KRCC 1V5XA 4JEJA 4Q8PA 2FPYA 1F4HA 2DUZA 2OVLA 2NQZA 3LTPA 3VD3A 4DUVA 3A9BA 3SQLA 1W1YA 1I45A 1JFHA 1C9WA 2DIEA 3ZJ6A 3QSRA 2Q8XA 3HPFA 1AVAA 1MQQA 3D47A 1REQA 1XYAA 3TE9A 4BQ2A 4QHRA 1E5JA 4KWOA 3MQTA 4GNKB 2PTYA 3CMGA 3K30A 4C6OA 1ESWA 4Z1DA 6XIAA 2YR1A 4AXNA 2WOQA 5IBXC 5FJJA 1JYWA 1OFBA 3C2RA 4HU8A 5HK4A 5U4NA 5C5YA 3W02A 3IVTA 4GUHA 4NILA 3M0JA 5LIYX 3VGHA 2QW5A 5CPLA 4M7SA 4KWVA 2QCLA 1XH2A 4PL2A 2V3FA 3FS2A 2QQ6A 3E0LA 3QW3A 1LWIA 1GVSA 1WUFA 3N73A 2HBVA 1BXNA 2FGZA 2REQA 5JBEA 5ENLA 1Q85A 1TPC1 3BQ5A 3BCJA 4DX3A 4GO9A 1Q6FA 5CCZA 3R25A 1SZNA 5FJTA 4H8VA 2BTMA 2HVMA 1OC6A 1KKOA 4DNHA 4JQ3A 2DIKA 4PCSA 3ZJ7A 3B04A 3EWUA 4TU1A 2XTKA 1C8XA 2E6FA 3GH7A 3PWAA 4OECA 5AVHA 3K4AA 1FWCC 3VDCA 4DYKA 4E2DA 3B0VC 3N13A 2PMQA 3LRMA 4L80A 4QISA 2CHRA 3RN6A 3BG5A 3TTQA 2VUNA 2WHJA 1CGYA 3AMCA 3QTGA 2PDFA 3GZ3A 3AS0A 3DBPA 5DFAA 2YBUA 4O57A 4JX6A 3T0TA 3BOXA 3EDDA 3GXFA 2R9RA 4ZSTA 2DJXA 1LUCB 3GNXA 1AQHA 3ONCA 2Z1WA 1R86A 4L1WA 3QV9A 3NQMA 2AKMA 1I2RA 2F9RA 3VDAA 3U57A 3AC0A 2VCCA 1N7KA 4IXHA 2R1PA 3UD6A 4IQEA 3N2OA 5HMEA 1LP6A 5DX7A 3W7QA 4JNZA 4DNMA 3NSXA 2XPKA 4E3VA 1KFWA 1XKJA 2J7CA 2PRMA 1C7TA 3HG2A 1KCKA 4DO5A 3VDBA 3NQVA 3LLFA 1ZBKA 2YZRA 1JUKA 3ZLGA 4DXXA 3G1VA 1K7XA 3QF0A 1S2VA 4GK8A 2GQ3A 4PCFA 3M47A 1F3XA 3LXCA 3DG3A 4TVDA 2D2OA 4O18A 4GX9A 4GOAA 3P5ZA 2IQ0A 2J9YA 3CUZA 3UYIA 4JR5A 3WJZA 2ANUA 4FNRA 3TDFA 3OP2A 4JD4A 1OHLA 1AD4A 1E6QM 1SJCA 2ONEA 5HMSA 1I8JA 3MI3A 3W23A 4E38A 4NRSA 3MKKA 4A35A 1M1BA 2TPSA 3WELA 1FWBC 1ZLPA 4HTBA 4JS3A 3DFTA 2W6RA 1D8CA 1DP0A 3ARRA 3EYPA 4AD2A 3UGVA 1VKFA 5CLTA 3T0CA 1HF6A 1VQTA 3MDUA 2QULA 1KC7A 3FSTA 1ICPA 3FVMA 1OABA 2X1SA 3T0DA 5F4SA 4FXFA 4O0KA 1KA9F 4GZIA 3TN6A 4GJJA 3WNNA 2P50A 2H8XA 2NSOA 1BQCA 2YCEA 2JGQA 1UKOA 4JDBA 5CC6A 3IUIA 3F4CA 3RO6A 3VMOA 1V79A 3CL7A 3OHIA 1ICQA 3Q4DA 4L56A 5AY7A 5D33A 3STPA 4XKYA 3EOSA 1Z89A 3VKBA 3A3XA 1ONWA 3P2VA 4JNYA 3MCOA 3TXZA 1IIGA 4AIEA 1A53A 4Y2WA 4PRTA 3W3OA 3A5VA 1W2PA 2CKRA 4PBGA 3VYLA 2GFTA 1V0MA 3IPWA 5A95A 3MJYA 3P80A 3SY5A 4D6EA 1VEOA 1E1CA 3B9OA 3VKKA 2J79A 4ZVJA 3V16A 3PZVA 1B31A 1XBYA 3L4XA 2JKPA 1ENUA 3QMTA 2Q8LA 1PSCA 4Q4PA 1U5HA 5T26A 4WHBA 2VZUA 2DW7A 5GPRA 1TX0A 3SDOA 4MVAA 3TK7A 3KRBA 1W1PA 3H2FA 3BW4A 3CUHA 1PIIA 1AQFA 3S5YA 3L5MA 3GXPA 3VD9A 4DF2A 2WJDA 1IR1A 1Q5MA 3K13A 4PMXA 1W9PA 3W70A 5LA1A 5BRQA 1R2RA 3GTFA 5MHBA 2A79A 1J0IA 4H6RA 4S39A 3RU6A 1J96A 1F05A 1MXSA 4FOKA 2XSBA 2J8TA 2QCDA 1BYCA 4DWSB 5FESA 3PBVA 1IQ8A 1KQZA 3WBWA 1DIEA 1KXHA 3CZJA 2F61A 1PDZA 4DRSA 2X30A 3THCA 3UZYA 1Z41A 3WQWA 1R7OA 4ZQMA 5A1AA 2FHCA 4HYRA 1E5NA 4BQ3A 1E40A 3WLIA 3LBOA 3FHAA 3ZWSA 1WDRA 2A1YA 2VEGA 1F6PA 3TU9A 5DEZA 4NYYA 2OT0A 4MKSA 3TZFA 2DORA 4W85A 1YTDA 4JTQA 3LBMA 2A6NA 2VFHA 4R88A 1F61A 2E5BA 8TIMA 3UESA 4C1LA 2PDKA 3B8TA 3EX6A 1L8PA 3B9AA 3IIVA 3ABRA 3CO4A 1Q6LA 1JYXA 3W0KA 1VHNA 3KWSA 4YIWA 2VVNA 1ZY9A 5FCZA 3VIMA 1BQGA 2ZX6A 4PSRA 1YIXA 2P8CA 4P2VA 3TYEA 1GYLA 3GYCA 4B15A 2CLMA 4Q4OA 2O9OA 2VWTA 3VOCA 3DIPA 1I9CB 4JOMA 4LNYA 4CCCA 5B80A 3GR4A 1UJPA 3IAQA 4F3HA 1SZFA 4CKQA 2JEPA 4XAPA 4KWUA 3SN0A 1TVLA 4XD3A 3OLEA 3MKCA 1UG6A 1QO2A 1J0KA 1IEWA 1VYPX 4HA4A 2VRKA 1HW6A 2WVUA 1FWDC 2E28A 2ZZ2A 1VHCA 4D71A 4GVIA 3STFA 4TTUA 2E09A 3H2MA 3L4ZA 3PC0A 2FQIA 4AIUA 3W00A 1WNOA 3CAVA 4XZBA 3IJ7A 3LV6A 2VEKA 3SFWA 2YA0A 1R85A 1A5UA 4U3CA 3KLLA 1ISXA 1DWIM 2ZUSA 2BASA 2UWFA 5IHSA 2POZA 3PBWA 1OFAA 4LWWA 1EJVC 4LB4A 1GOKA 4BQ4A 1Q6QA 4W8BA 4WJEA 1DV7A 3CUGA 2A7NA 1XJBA 3LLDA 2X2YA 2QPUA 1AH0A 1SW3A 3VILA 1QTWA 3GG0A 3URQA 1CGVA 3W7PA 1JFXA 1O4UA 1QBAA 5K7JA 3FXGA 1EP1A 2E3ZA 1OFPA 3CTTA 1E0XA 1PUDA 2C79A 1GTEA 2FZBA 2VEFA 1PZ0A 5D8ZA 1W3KA 3KE0A 2HNEA 1H49A 1E73M 5AC4A 4MB4A 3GQYA 2I56A 3VNMA 2BSLA 3NO3A 1T8QA 5BOFA 1J01A 3ZSSA 4MYXA 3CZLA 5FIPA 2V5LA 3IGXA 1G01A 2X05A 3NJ3A 4C7FA 4QG6A 1P6WA 4O1EA 4FAMA 2CIPA 2DZUA 1DQXA 3PS7A 4BS0A 1UMLA 5I0DA 1I2QA 3AWOA 1CGTA 5HWNA 2O92A 4BKNA 3EOOA 1ZB5A 2QPSA 3ARQA 1DIOA 2Y63A 4KQNA 2P1FA 3CAWA 3QQ0A 3W76A 2GSJA 2FJUB 4PUDA 4K8HA 3BUVA 2BGQA 2QDGA 4GUGA 4AZ6A 2QXWA 1U33A 5GJNA 1W56A 3CH0A 3SCVA 4AY1A 1WKYA 2PFHA 1IIHA 3VC5A 3JRKA 3DERA 3NYDA 1JF5A 3TKFA 1US3A 3FA4A 4S3EA 4I90A 4HOWA 1S2WA 5DMNA 1XLGA 3VGDA 3H70A 1QW7A 1Y5VA 3MUIA 1IWBA 3POCA 5FJUA 4J3TA 1XD0A 3S5NA 2B81A 1S3HA 2YLAA 1XIHA 2Y70A 3DH7A 4JFUA 1PX3A 3T6CA 2GWNA 3WH9A 4ACZA 4UR8A 1QHPA 3G2GA 5T9CE 1JI2A 4JTJA 4BF7A 5LNVA 5F2LA 4ZB0A 3C4UA 1EIXA 1US2A 1UWTA 3UJRA 4L7ZA 4O28A 5D32A 2FVLA 5CSYA 3GXIA 5A2AA 4Q4RA 3O0FA 4C6QA 4H9MA 4JIHA 4HA3A 4AY7A 5E9XA 4L9ZA 1R8LA 1WQ5A 3K46A 4HZ6A 2Z4GA 4M0XA 1MSSA 2FFIA 3DXIA 3KCOA 3GD6A 1G7VA 3B0YA 2JK2A 4K36A 3EWBX 1JEZA 4ORMA 3SIZA 4F0SA 3IJLA 1O60A 3WNKA 9RUBA 3RLVA 3HQPA 5A6BA 4AHPA 2VM8A 3AHYA 4GJ1A 4WDUA 3RRAA 3OA3A 1E6RA 1EEXA 2RDUA 1DORA 2TSYA 2ON3A 3FVDA 2YZ5A 3W1MA 4JAWA 3LHYA 1LLWA 3WK0A 1KWGA 1BGAA 3OVGA 1M7JA 2PEVA 4LTSA 4NIRA 1H2JA 4CGTA 3ITXA 3IACA 1YDNA 2CLOA 4GCXA 4JTEA 3W1TA 2GGEA 2P8BA 2P3ZA 1YXDA 5HJLA 3NURA 2HK1A 2EAWA 2OLAA 3C2EA 1ZRQA 2WCSA 2J74A 3REQB 3TN5A 2J8GA 1XLKA 2ALRA 7CGTA 2IKGA 4P7OA 3EMCA 3ARXA 1XYZA 3SCQA 1QOPA 4DLMA 2WVVB 1H5VA 2QCNA 3UXKA 4G5DA 2BODX 3U48A 8RUCA 4QQ3A 5D2XA 4IL2A 1Q3NA 2J6VA 5HDRA 2V67A 3DHFA 3UJSA 3TC7A 1ADOA 3ITYA 4IMDA 3EPNA 4FZIA 3GVVA 1EJ7L 1OC5A 2XG9A 4M81A 3DENA 4PMVA 3L67A 3KW3A 2PWEA 1G7UA 1A5SA 4UNKA 3VABA 3W2KA 1FH9A 3M6YA 1EJRC 1C8YA 3EDFA 3AIEA 2QF7A 2PD9A 4GE8A 3VGBA 4QROA 4AZ7A 2EF9A 3A12A 4GNVA 1XYFA 2R1NA 3V7PA 3KWXA 2D24A 3MUAA 1DJIA 4V1YA 1FP9A 1RBLA 3L65A 3E12A 1WYIA 1LOSA 2YBVA 4BWLC 2A0NA 4M6QA 2PWVA 4XBJA 4DJEA 3JW7A 1CB7B 1V51A 1LG2A 1V3JA 4TVUA 1EYWA 3ZSTA 3BV4A 4LUIA 1OEPA 3S46A 4LYKA 1UD6A 4ZQOA 4GQRA 3WDJA 1XUZA 3CQKA 2DZXA 2RDXA 4PL1A 4IG2A 2VENA 2CLEA 4HOZA 2PURA 3M0XA 3GW3A 1TZ7A 4FNTA 3RITA 1ZCCA 1TV5A 2GVJA 4NZCA 1JDAA 1KM3A 4QE5A 1XXXA 2VX6A 1W1ZA 4S2CA 4REQA 1LDCA 3RCNA 4R7JA 2GGJA 4IFOA 1JUBA 4PTWA 1F3TA 5H8UA 3P82A 5A8PA 3WLTA 1V02A 4MDPA 2DEPA 4E2OA 5E0FA 3HA1A 3BLOA 4F79A 1Q7QA 3QXBA 4WZHA 3CM4A 1ZALA 1ISWA 3UF9A 1X8FA 3T2QA 1HL8A 3G1HA 3FW6A 3VA8A 3N34A 4N9BA 3WEMA 4LY4A 3NQAA 3E02A 3RPDA 2IQDA 1XPGA 4MNJA 1W5OA 2PRLA 1QO5A 3DHDA 1PCWA 3EWWA 3SCWA 2ZVIA 3VK5A 1KTBA 3SFKA 3TLLA 3RM9A 3KBWA 4DWSD 1HO1A 4OUIA 1UCWA 3PJTA 2FH8A 2CBIA 4IL0A 2WZIA 6TIMA 3DHUA 1MQPA 4C5YA 1F2JA 4AZCB 4DXVA 4NXKA 2DZPA 2YDAA 2QDDA 1H09A 3TN4A 5EKYA 4FNUA 1A5BA 4Z2JA 1RJQA 2WMIB 1FVPA 3UG3A 1OVDA 1XBZA 2Q3RA 2NQHA 3QFWA 2EO7A 2CETA 1E43A 2VX5A 3LXAA 5KMYA 3QRHA 3W81A 2OWWA 4PCPA 4IPPA 1CNVA 2IW0A 4CCDA 2OYMA 4XZHA 3HGOA 5HATA 5CZSA 1EOKA 4WOZA 2PGEA 2XFFA 2D3LA 1ZS2A 4PUWA 1VFLA 4K38A 2QGYA 4YVVA 1UKQA 5D2YA 2ISVA 4R7WA 1V0KA 1JR1A 3WH7A 5D09A 1XLLA 2BP1A 2Z28A 3BICA 4YL2A 5FSDC 1OYCA 4HQVA 5CSSA 2RUSA 1XDJA 4WD0A 2YXOA 2FKPA 3B06A 2W92A 1XR2A 4KGJA 4QAWA 3SUVA 4L61A 1XG3A 3V1PA 3GU1A 3HZ3A 1XQLA 1HFBA 3PTDA 2YDRA 1TSIA 4I3GA 5BXRA 3DDMA 1L6WA 3ZVHB 2Z0IA 3VNDA 1ZFJA 2GWGA 1V3LA 1UKPA 1JNEA 1R47A 3BGGA 1OG6A 4EPBC 4EX4A 4I6KA 5C54A 2Y89A 3WDQA 4WRHA 2XIQA 4O15A 3FOKA 4B5SA 3URAA 2VZOA 3LCLA 3A9IA 4OOUA 1HKKA 4TXEA 1QCWA 2ZRXA 3SURA 1OZMA 1ONXA 5KZDA 1UC4A 1PZ1A 4WVXA 2E77A 4WDXA 2YCJA 4DJDD 2ZVRA 4QGCA 4ML4A 4UTTA 4OKDA 3WBXA 4PC8A 1EF3A 2L5HA 4HHMA 3GVGA 4L6DA 3NSMA 4R34A 2VOTA 3UR2A 2QUNA 3S1VA 3T1GA 4GGBA 2WM1A 1TR9A 3K5XA 4E8DA 4R7OA 4AF0B 2X8RA 2PWUA 3EMQA 4FS9A 3RU8X 2PLMA 4JTAA 3L4YA 5BMWA 4Q8OA 2BY2A 3NG3A 1I75A 3ARYA 3GC4A 4PSPA 4D1JA 1AL7A 2Y7GA 1E51A 3FLUA 3NO1A 1KFCA 1TWDA 2DZSA 1SR0A 1AQ0A 1BWLA 1AODA 2VURA 3LMYA 4JQ1A 3CV2A 3W1NA 3S9IA 1HJUA 2AL2B 4LS1A 3G3DA 4ZODA 5FAJA 4UTMA 2TAAA 4U4MA 4O19A 3R89A 5A5WA 2YFNA 2DU2A 3WJXA 4KEZA 1X38A 4PB3A 2Q02A 4X2RA 1O5QA 4U28A 2PAJA 2QJMA 3FIGA 3S3GA 1GVOA 3TNBA 3T8LA 3S6DA 3KS5A 1UD5A 2OEMA 4FX7A 4B5VA 3IS4A 1XLBA 1A5MC 1HGYA 4QX4A 2HS8A 1CEOA 3IIZA 1BF2A 3HQOA 2Q71A 5IRPA 4A3UA 3W2JA 4TV5A 3PJWA 1P0BA 3ONBA 4HNLA 1U22A 4L5ZA 4E2BA 1DWAM 4W8AA 3CT7A 1C92A 3GG8A 4JKMA 2BVTA 2QJHA 2OLSA 1UD3A 1F07A 5F1VA 4AQLA 1OD0A 1V6YA 2VCBA 2RDWA 1RALA 2FMOA 3RDKA 3DGRA 4MKNA 3IV3A 4Y9PA 4NU7A 2QCMA 4S3DA 4C6NA 2Z27A 4OV4A 4O8RA 4XK2A 5CG7A 4QS5A 1TJ1A 1TVPA 2H9AB 3W72A 4A3HA 5TIMA 3TA9A 1B9ZA 3QHOA 4XUYA 2ATMA 1HJXA 4J1OA 2ZICA 8A3HA 3KOFA 1PXGA 5H6HA 2PP1A 5EU9A 3MHUA 3DC8A 1Y8BA 1P1MA 3VUPA 3T05A 4K1WA 3HG5A 4WQ6A 2PDYA 3SQSA 2VGGA 4IIBA 1V6UA 3DHPA 4P61A 1XPYA 3IEBA 4JY8A 1JPDX 4ADUA 2YYTA 4FOJA 3CIWA 1Z6KA 4A6GA 3HFYA 3UU0A 5TNVA 3F5KA 5CG0A 2NV2A 2B7PA 4K2SA 1D9EA 5I07A 3I7SA 1UR2A 5HQEA 3BARA 4FK9A 3AJXA 1XLIA 3ENLA 9XIMA 1IYXA 4MB1A 3G0XA 1IEQA 1QK2A 1TJ2A 3GHSA 1JDDA 1X7FA 1AG1O 1X39A 4IPNB 1VFHA 4QE4A 3AI0A 3ERPA 1XYBA 3PP7A 2FIQA 1WV2A 1MZRA 2BZNA 1WP6A 3M7WA 4JL1A 4QP0A 1K3UA 4C6JA 2NQJA 3NQFA 4GI6A 1OGGA 1QHOA 1KV5A 4Q8QA 1K6AA 3CZGA 3QYQA 4HSOA 3VM5A 5EFDA 2NXGA 3M5ZA 1SFTA 1PIGA 1R0MA 3XINA 4E8GA 1VEMA 2PGFA 3GUWA 1QI0A 5FJRA 1RCOB 4DI9A 2E9BA 2GVYA 2QR6A 2GK1A 2C13A 3EMZA 2R94A 1BVZA 1ZTVA 3QHNA 1HKJA 2HJPA 1MI3A 4PFHA 1IZJA 4AFYA 4MJ4A 2EPMX 4MWAA 5CJMA 4PUEA 1MW2A 2F6UA 3CPGA 4HP5A 1TTQA 1TV4A 1IF2A 5I3HA 4Q4QA 3G77A 1YTEA 1QPQA 3QEZA 5TBOA 2W0UA 5AB3A 3WLOA 2ZXQA 4UFMA 2CITA 2VDIA 7XIMA 4C60A 2R82A 5LA0A 1JYVA 1HVXA 3E9AA 1K77A 3VE9A 3FY1A 5E5CA 3S0CA 3PAOA 3OBKA 4M80A 3ELFA 1XW8A 1RD6A 3HIJA 3GU9A 1A5NC 1L0PA 2QDHA 3RILA 1P43A 1ITXA 1R2SA 3MWAA 2VFFA 1D8WA 1NELA 4QNWA 4J35A 4P8VA 1NU5A 4Y96A 4PRRA 1LUCA 5LNSA 4KERA 1TQJA 3T44A 3T0AA 3QC0A 1EXPA 1HG3A 3PY2A 3M64A 3SUSA 4M19A 2G3NA 1DWGM 2D73A 1V02E 2W9MA 1IWAA 3KVLA 4O4VA 2YX0A 5TAOA 4U10A 3A3WA 3IK2A 1NSJA 4AIOA 4YWSA 3PZGA 1K9DA 2CXEA 1EJSC 4AWUA 3U3HA 3C2VA 1IZCA 2FMNA 1A47A 1IXOA 1RVGA 3AIVA 3LX9A 2W27A 2PDQA 3V0SA 1XLFA 4KEMA 4YLWA 2PU1A 3VNYA 3M0IA 1L6GA 2VEMA 3P60A 2OZTA 5DF0A 3S2LA 1TELA 3WBAA 3HPAA 4ZO6A 3N4EA 2FGBA 3UWWA 1KLZA 5E09A 3ANYA 3E0VA 3AIQA 5A94A 5AHEA 4BA0A 4GNJA 3G6LA 1J18A 6XIMA 1N8WA 4P8UA 3OB8A 5EY5A 3O07A 3NL3A 3TWBA 4LFYA 1SO3A 2J7GA 5AKQA 3WK2A 3DG7A 1CW2A 3UJ2A 4HMEA 1S2UA 3BQ6A 1RPXA 3M0HA 3A13A 2YGYA 3ANVA 4JEQA 2GLKA 4PTDA 1JZ4A 1HVQA 1I2OA 3AAMA 1TYGA 2FTWA 3AMGA 3JVAA 3UWUA 1FWHC 4RPQA 4FEZA 2Y7FA 2OFJA 3WLNA 5I23A 2PWGA 1YMYA 4NX0A 2ISSA 4XWUA 1A5AA 1BD0A 3LLXA 4RW5A 4HU4A 2NV1A 5AN7A 3SUWA 4O11A 3TMLA 1FHVA 1TCMA 3KFTA 2V5KA 3L4TA 1LROA 3G1XA 3MDWA 3VD7A 1ZGDA 4MZ8A 1W9DM 1HKMA 2PDNA 1HKWA 4ZOCA 2EBNA 1TIMA 4XO7A 3UG8A 3O6AA 5FF7A 4GY7A 1XDLA 1R6WA 4MKVA 4FIQA 3QC3A 3UGRA 3WQFA 1ZAIA 2QUVA 5CQ1A 4ZB2A 5LNWA 1TTIA 5A2BA 2WBGA 1XRVA 2O7SA 4L4OA 4MYAA 3VUSA 3W6LA 4CVWA 3E2RA 5D04C 2XVGA 4GIRA 5L6UA 2VMFA 2I7GA 1AJZA 4CNUA 4HMCA 1Q8JA 4JTDA 3DFYA 1OWQA 2E67A 3EX2A 4E8CA 3C8FA 3LPOA 2PDGA 3H2OA 1M68A 3QBUA 2PBGA 3WJWA 4MF4A 3U2CA 1YE4A 5EL1A 4DAIA 1D3GA 1RQEA 4B90A 2C1IA 1L2QA 4BEUA 1A4MA 3B4YA 4X2PA 3CZEA 2E0PA 4AHQA 4H9ZA 2YXXA 5DCBA 3ZLHA 1OIFA 2JKEA 2NVDA 1CPUA 3KP0A 2NQ5A 3NL2A 4ICMA 1SM9A 4NAFB 4DWSA 3NPWA 1QR7A 3RCYA 4OGZA 4DUWA 1RSCA 2ZZ3A 3WLRA 4Q7IA 2Y61A 3RMJA 4NZ3A 3F4DA 1ME9A 2X42A 4JICA 3RM8A 3LGGA 4A4AA 3VDHA 3BZGA 3SW6A 3LHTA 4UTWC 1LYXA 3COTA 1RJPA 1UJQA 2NLIA 3WNPA 4HT3A 4TX6A 3MCMA 4E5TA 4Q4MA 2NV9A 5AC8A 1YTKA 4H9VA 3U6WA 2J66A 3CHEA 2JALA 3QR3A 1ML1A 1EYEA 1GK8A 1TPFA 4TVCA 1KD0A 2ZA1A 4IIDA 2JF6A 1T6MA 1D3CA 3VIJA 3Q45A 4W86A 2OO6A 1UD4A 4LALA 1PZ3A 1S5MA 3SSJA 3L5LA 4ILSA 1O5KA 3BCDA 2PSNA 1KRBC 2BOEX 4UWMA 1QOXA 3NPXA 4NNBA 3VX0A 1WDWA 3PG9A 3VD5A 1K1DA 3P7YA 4GUFA 2DT2A 1H50A 1GQNA 2CU0A 3JUGA 4YHEA 2CLPA 1ODZA 3T2OA 3FAXA 2X41A 1WCGA 3I7RA 2FFCA 2QCCA 2W91A 3WQOA 3JS3A 3FDGA 3SY1A 5A2CA 3GXTA 4EXAA 1MFVA 4QJ1A 2IMRA 3PFRA 3TCEA 1GOXA 3AYSA 4NUWA 5CZJA 3IIPA 3AO0A 2V3EA 1H60A 1HO4A 4CNSA 3PBYA 2V0TA 3WF4A 5CZ0A 3AHVA 3IJIA 3B3DA 1TRIA 4H6KA 3WLKX 3LD5A 3TQVA 1QNSA 2GVEA 5REQB 3M43A 1G4TA 2OLHA 5CPQA 3NIYA 3QZAA 2DSWA 3QM3A 5K2ZA 1JZ6A 3PF3A 1Y0EA 4O4WA 5J5DA 2XN2A 1UOZA 2W61A 3N9RA 3PZMA 1MEIA 4H7CA 1MYRA 1DWHM 3APYA 4QE1A 1XX1A 3LB0A 4DJDA 1QMLA 1X1ZA 1OADA 3AU2A 2C0AA 3WD3A 4LY8A 2V9DA 3D0CA 3H22A 2YL9A 1JF6A 3FJLA 1W5MA 2Z1VA 4CU6A 3SUTA 1X1OA 3LSCA 3H4GA 2E8ZA 3CV6A 1OBAA 5ABFB 1PX8A 4GX8A 3MUY1 1UR0A 1TJ0A 4Q8MA 3R1ZA 3RX2A 4OHQA 3NZGA 4H9YA 3AYRA 5CC7A 3EDEA 4Z2KA 2Y5SA 1SSGA 5G2IA 5XIAA 1C91A 2Z1XA 3W7KA 4DZHA 1E3ZA 1TTJA 1LT8A 1E15A 2DZVA 1M04A 5A6SA 4NJKA 3F5LA 3QKZA 1NWTA 2PC4A 3PFMA 4DQWA 3VNIA 2ALDA 1FUYA 3RX3A 4QDPA 1XISA 2J62A 4I9TA 1R3TA 1F3EA 3QHMA 3TYDA 5FOOA 3N19B 4ZZ9A 4K39A 4KRTA 3B8VA 1PYMA 2PTWA 5IHRA 3LPFA 4ZQCA 4KIRA 3VIIA 5AHMA 2WO5A 1GJWA 3CWOX 3GKFA 4UFJA 4M51A 2ZZ6A 3M0LA 4RNFA 3KL5A 2CHNA 4XBKA 2BXVA 2J25A 4RDZA 1QPRA 3R0UA 4AWTA 2C3ZA 1XLDA 4C6IA 2FHBA 1NM9A 4GKLA 1SZRA 2EG6A 3KZPA 5IBXA 4C7DA 3V75A 3MT1A 5IXEA 2VFIA 3S1XA 4ROQA 1KO0A 2OELA 1XIBA 5I3JA 3UZWA 3WUBA 4V15A 4HZ7A 2WJEA 3EDKA 1WE5A 1SR9A 3T08A 2VQUA 1VB9A 3C3NA 3FFSA 1NEYA 4WJ8A 1FA2A 4M5PA 1GVYA 2XYLA 4LAOA 1E9YB 2QIIA 1Q7ZA 3VFCA 1HKVA 4D2JA 1CX9A 3KRZA 4H3DA 9CGTA 2AMGA 1VAHA 4INFA 2GGGA 1YNPA 1OFOA 2VC5A 4E2VA 5LGZA 3VZZA 1UOKA 3MP5A 4XG1A 3GAKA 4J27A 1NFGA 2PLJA 5I02A 4LAMA 3WL1A 3QKEA 1UW9A 1QOQA 1R87A 3REQA 1JQVA 4N7QA 1TA3B 3AISA 4OBRA 3K8LA 1HJVA 1ZUAX 1UWRA 4KRUA 3H53A 3WNMA 3UPMA 2WVVA 4B2DD 3GRIA 1Q65A 3U4FA 2YW4A 2X7VA 3PPHA 3TP4A 3PJXA 1PIFA 4KFOA 5LNRA 3EEZA 1FXQA 1HIZA 2FYMA 1MRAA 1VJZA 2VEIA 3UNTA 3M0VA 1POKA 5I7GA 5HINA 4O54A 3HGJA 3GTXA 1W3LA 4NZ4A 3W6YA 2QV4A 2I16A 3QYSA 4NZJA 4PGLA 2AAMA 3UR8A 3BVJA 2AGTA 3DKLA 4NSBA 3ZLFA 2VGFA 3TIMA 5AYYA 2Y8KA 3I6RA 2WB5A 1CWYA 2BLEA 4JHZA 1GKRA 1RR2A 3JZEA 3WQDA 4DZAA 3LXBA 1VIWA 3SCRA 4LV9A 1GZGA 1H5YA 3MBDA 4AU0A 3SGUA 4Z42C 4ES4A 1T96A 1MO0A 1GOQA 3V1HA 1DKWA 1PVNA 2HQAA 4IGSA 3WQ4A 4GI4A 3N2MA 4CN4A 1E9LA 3GFXA 3BGJA 1PBGA 4XV0A 4Y8EA 3QV7A 4RUBA 1MDLA 1UH2A 5JUVA 4JTCA 1DYSA 4HMDA 4POCA 1V6XA 1GONA 1PCKA 4KF1A 4MPQA 1OB0A 1TX2A 2C14A 2VXNA 2VC7A 3GNRA 2VR2A 5LNUA 3ZJ8A 3OODA 5EA9A 2BGSA 1FHDA 3GVRA 4RDYA 1IEVA 1OFEA 3BSGA 4JIQA 4HD5A 3RR1A 1QI2A 5DO8A 4C65A 3W7NA 1JD9A 1ZJIA 5AZ0A 1Q6DA 1QNRA 4IZGA 5EPDA 3WF3A 3Q65A 2FH6A 2XVNA 1HP4A 4ZOEA 1DJZA 4L9YA 3RLUA 5E9AA 4PCNA 3A4AA 3LUTA 4IMFA 1SQ7A 3UA3A 1OFQA 5BRPA 3T7VA 1XIGA 1XIDA 1TR1A 1NQ6A 4KIEA 1H3GA 4OBSA 2GJPA 2ZIDA 4IUGA 4M29A 5D30A 4GQBA 3SI9A 3GB6A 2F6KA 2BB0A 3OA5A 3EWZA 3CQHA 1BHGA 4GA8A 5TQLA 2VO5A 4UMAA 2I5GA 4FIRA 1VFSA 4R33A 1V08A 1XDMA 3BTNA 1OD8A 3EXTA 3THDA 1WDSA 1TPDA 3E5PA 4XD6A 4YCOA 1QPOA 5DRCA 3U5YA 3TW7A 2FZ8A 3W4RA 3LM7A 3WQVA 1M01A 3PHAA 4PE8A 4KGLA 2FZMA 3WUEA 1YDYA 1MMFA 4QR6A 4AZCA 1HX0A 4GABA 2OYLA 2O9TA 5LIWX 4GYPC 4BY3A 1CXIA 1W91A 2CNCA 4G9PA 1C9DA 4YYCA 3WQ8A 2OOGA 3FA3A 2WMIA 3WH8A 1GVQA 3PUOA 3DI1A 1ZAHA 4PMDA 3MJMA 2GSHA 4YN5A 1FX6A 5F2MA 4HCHA 1B0IA 3VGFA 4QS6A 4Z0JA 4JTUA 3H8AA 1EHAA 1Q45A 5E6ZA 1F73A 3OEXA 1W8SA 1GVRA 3CUXA 4B4FA 1PTGA 1UR9A 3U7BA 1XLMA 1V3MA 5K9DA 4BEQA 2ACSA 1Q2RA 3THQA 3CL8A 2WKJA 2QUTA 4JTGA 1JZ8A 1VLIA 2J6XA 4X9SA 2YL8A 1QNOA 3SCNA 2QCGA 1P7TB 1XLEA 3BWWA 4LAUA 2EEXA 1KFBA 5LYRA 3EB4A 2NT1A 2ZWZA 5DANA 4QEHA 3M44A 1QK0A 3DEQA 3MSDA 1K8XA 4HYWA 3G3MA 1W17A 3NEHA 4QAIA 3LZ5A 2GJLA 4BZYA 2ZXAA 4LJ3A 1W5PA 1V77A 3O16A 1ODUA 1X6UA 2PDHA 4I9MA 4UNIA 4K3ZA 4PODA 3ZYZA 4Z17A 4CU8A 1RXOB 2WJZA 1M53A 4M24A 3L4VA 3P62A 2EXOA 3VKCA 4KESA 4HTYA 1SO4A 2YA2A 2J13A 3ZVHA 1B54A 1XCXA 3RJXA 3N3TA 4GUIA 1WBHA 4G2DA 4U33A 2PWFA 3BPWA 4RK8A 3CC1A 2CLIA 2ACUA 3NQ2A 1LRTA 5FI8A 3NZ1A 4YNGA 1FFRA 4AD5A 1UASA 2GUBA 1SO6A 2INFA 4XTDA 3H6OA 3L68A 4AYGA 3SO7A 2ZE0A 2Y24A 4QDMA 3IARA 4GGHA 4L4LA 3ALGA 5H1WA 3FYOA 3W7DA 4B5NA 1UP0A 4R3UA 5KEZA 3P14A 2CLKA 1POJA 2NVAA 3F5JA 3G8EA 1B57A 2GQ9A 2GSEA 2ZC1A 3NA8A 3IJQA 1GQKA 1BPLB 2J7DA 4W4QA 3VI2A 4JIRA 2QCFA 4NRRA 4DPQA 2X7WA 1BWKA 2FTPA 2ZTJA 1CGUA 1GOWA 3CIXA 1R30A 3DFHA 1A3WA 5BZAA 1PEZA 1CECA 3TQPA 1KRAC 5HMFA 5C9WA 3TH6A 3M7SA 2DJLA 3AS3A 5IM51 1ZU8A 3STGA 3NZRA 3WQPA 3WLLA 1R3YA 2QGHA 1KM2A 3GW0A 3WQ6A 1R3WA 3NQDA 1EZ2A 3AZTA 2KX9A 3UXLA 1A0EA 3M0YA 4OV9A 1SFLA 5AYBA 2DZAA 3UZ5A 2XSXA 1W5QA 4PN2A 1QWKA 4B3ZA 2AL2A 3K8KA 2J88A 4HK6A 1NP2A 5KETA 4JFVA 3LERA 1R2TA 4YWIA 4D8LA 2V6AA 2P76A 4GXPA 4CCZA 2QUUA 2WVTA 1PYFA 1XS2A 3QPZA 1EJTC 3PZUA 3WSUA 1ITCA 1AD1A 1H7NA 2OSYA 1JUEA 5LKYA 3HTWA 3WF1A 4GXWA 4IGHA 1KFLA 1VBHA 4KBXA 1NH6A 2CC0A 5AYXA 3AYTA 1AW1A 1W1A1 4IGNA 2OWCA 3CV1A 1LWHA 3MMTA 1F8MA 4NI8A 3EZ4A 3N2BA 3W1AA 1RLCL 3RM4A 3GWQA 3KX6A 1YKWA 4KETA 4JZ5A 7ENLA 2DIJA 4X9YA 3W83A 4ZO7A 3OW1A 1FCBA 3CHFA 3DI0A 3WMCA 2BV9A 2BGNE 1UIPA 2HCVA 4WDTA 3CNYA 4HA1A 3FX4A 2Z24A 3NO5A 5LSMA 3QLLA 4P7QA 1A0DA 1MEHA 4DYEA 3ATZA 5D02A 2IPFA 3A3HA 3LQLA 3SRKA 3KTSA 1XL9A 1ONRA 2DH3A 4BCEA 4I7WA 4XUGA 2H9AA 3LV5A 3Q58A 3S5SA 4PUMA 3T09A 3URBA 4HNVA 3CU2A 4ZXOA 4MNLA 1BTMA 1Q13A 4H8HA 2G50A 1L6YA 3ZO9A 4FXSA 1ZBCA 4O14A 3P93A 2VYOA 4MJZA 4LXFA 2F7FA 4EACA 2HSAA 3VVGA 4DM1A 1XKYA 3HOJA 1WAUA 5FEXA 1W31A 3KOWA 4OE7A 4LVFA 3W82A 3ZFHA 1EQCA 1NWUA 3R58A 3AROA 3T4CA 2D69A 4GVGA 6ENLA 3S9YA 1W32A 1K6WA 3H7VA 2ZQ0A 2GGIA 1V6VA 1XV8A 3N04A 3WLMA 2E8YA 3MA8A 5C2GA 2WCAA 4KWSA 2CZEA 1XRTA 3GFYA 4RNIA 1DOSA 3TFCA 1AK5A 3KHJA 1DXIA 4UQDA 4JTTA 3LGEA 1SZEA 4IIGA 1OT1A 4QM1A 3VOFA 2ZUMA 1JCNA 5HWJA 3VOGA 3TLQA 1IXNA 1EDGA 3H2NA 5HBFA 2VFDA 3IRSA 3WMBA 5AOUA 1RZMA 3PTKA 5ECVA 3I4KA 3W7CA 2XJ7A 2YIHA 1W3IA 2A7RA 1S5WA 4ML9A 1S5NA 3D46A 1TWWA 4XZWA 3R0KA 5LIXX 4XB3A 3F4NA 4UTHA 2WLZA 2XM2A 4M8UA 2XUCA 4UZSA 4Q7NA 2FPVA 2D23A 3AIBA 1J79A 1YNYA 2VFGA 3TWAA 1RVKA 2EPHA 2O9PA 5E0KA 2GQ8A 3BOLA 1EC9A 1JXJA 2Y1HA 3PNUA 1FBAA 4A8RA 3SBFA 5T9BG 4B5UA 3OJGA 3O6DA 2YDQA 2FB3A 3MC5A 1FXPA 2OU4A 3K4DA 1AZ2A 1UPPA 4IUOA 3SM0A 2BWGA 3B8WA 5C0QA 2D1ZA 2AKZA 3CTLA 3KCLA 3L2IA 5JQ9A 3NQEA 1LT7A 1FH8A 3HJEA 1RY0A 1FRBA 1HNYA 3GDLA 4KCTA 4S2BA 3AS2A 5EMUA 1NJJA 4O13A 1EX5A 4Z2LA 4TIMA 2G8ZA 1BXCA 4LF1A 4CN1A 2YOCA 1TTPA 1PAMA 5U7SA 1AH3A 3E0FA 3AU6A 4GY0A 4L4MA 4XSMA 2J9ZA 5K3VA 3RUBL 3NM3A 2B7NA 3OZOA 1BGGA 1K9EA 2PS2A 2FGLA 1GG1A 2PLKA 4DUOA 1LBLA 1J6OA 4BWLA 3QV8A 2GUUA 4PMQA 4GBUA 4W7VA 3W1LA 2PDMA 5M1TA 2ZZ7A 4AB4A 5CJ5A 1KFKA 2HPIA 3R79A 3S1UA 3WYZA 3M9YA 4WJXA 1ECQA 1I60A 3TTYA 1UWIA 2J7FA 3RO8A 3ABXA 3M6DA 4LUYA 1R46A 4L4PA 3BLEA 3S9ZA 2XGIA 1VPYA 2DT0A 1XIMA 3O7UA 3N2CA 2A5HA 3MHFA 3GVWA 4RDWA 4I9JA 1F6KA 1WO2A 3PG8A 2NZLA 1OK6A 4FLRA 3GH4A 3ABSA 4F9DA 4M1BA 2Z25A 4RZ4A 1AH4A 5DBUA 1NOUA 3W38A 3R43A 1KR0A 1N8IA 1R3VA 3PTMA 4L64A 4RNHA 4LYPA 3AIWA 4XKYB 1PKMA 2D2HA 1O68A 2X16A 3RHGA 1HT6A 3NQ7A 1A4LA 4OU1A 5CSUA 1GZJA 2ZWYA 5D9MA 2ABAA 4H6EA 3E0IA 5GJPA 3H54A 1V7YA 2A85A 1VFUA 4I5UA 3GU2A 4HPGA 4AEOA 3MUZ1 1S5TA 2Z6JA 2GJNA 2NX3A 4X22A 2QEZA 4QSHA 3UCCA 4GRSA 3NQCA 4Q7BA 2Q8ZA 3WFAA 2Y8UA 3GTHA 3EPOA 1P6BA 4YTSA 3INPA 4IF2A 1G4PA 3QFEA 1JJKA 3QQ1A 6CGTA 2YB1A 2V2HA 5HA7A 3IUDA 1TB3A 2WMHA 3W7HA 4AEFA 4PMRA 2UY5A 5C55A 1XINA 3QN3A 2PTXA 4M6VA 3A4WA 2VR5A 1GQLA 1I4NA 3UVIA 4QG9A 4YMZA 2E6YA 3NOEA 3BW3A 2JBMA 2JFEX 4HN8A 3E96A 4JN6A 2XGZA 4IPJA 4IMAA 5CGQA 3R8HA 5I24A 1QWGA 2AQOA 5DMYA 1X1NA 2HISA 1CT5A 3SR7A 1WX0A 3WD4A 4DUXA 2V2DA 4J3ZA 1CTNA 2PC8A 4AC7C 1V6TA 3S2MA 2V68A 4QCFA 2VI0A 4S23A 4IISA 2WZMA 2VWSA 2VELA 4Z08A 1OZQA 4AXKA 4C6MA 3LDVA 1UYQA 3TTEA 5I77A 3GG7A 4KCWA 4AWSA 1YPFA 3DESA 1P1XA 4TV6A 4MY8A 3SQMA 2OOFA 4C5ZA 3WD1A 2QNEA 2XN1A 1SSDA 1W9XA 3AQUA 1KWKA 4XVDA 4Q6JA 7A3HA 3CK5A 3BH4A 3TAOA 5I3KA 2DW6A 2GOKA 1T8XA 1NDWA 1Z8AA 1E4NA 2WV8A 2HE8A 3HMJG 1XLJA 1ITUA 4I7UA 1TO3A 2G3FA 4Y8FA 3BMVA 2DUXA 4MFEA 3UNDA 3GUGA 3BSHA 3QY7A 4DEFA 4Y9OA 4N0RA 4YXGA 4PBEA 5HUOA 3LPGA 3RG6A 7TAAA 4U3AA 2PODA 3VOHA 3QR1A 1PO9A 1UWQA 1GHRA 4H7ZA 1QI5A 4NAFA 1V3HA 1GPWA 2OMAA 4FHAA 5EB8A 3HV9A 3OYXA 3O05A 4S3BA 3W07A 3GNOA 4F4RA 1UPMB 2BY1A 4I8DA 1UWUA 3PBUA 3BLFA 3GYEA 3CEUA 2WHMA 4KFPA 4J3UA 4QBXA 3NDYA 3F2CA 3AHZA 1P0DA 1HP5A 1Y7VA 5FA5A 4LUTB 4TTGA 4JN7A 5K9XA 2NUWA 1GW9A 3MB9A 5I2UA 4ZQRA 1Z9AA 2C8NA 4ADTA 3OG2A 2NUXA 5M5DA 3H7RA 1FWAC 3AHTA 1BXBA 3GVQA 3OTRA 5CAHA 1EJXC 4ZE5A 4N4QA 2MANA 1G4SA 1UZDA 1EDQA 3QH2A 1KBLA 4N02A 3PR2A 3D3FA 3W7IA 1UUQA 3HF3A 4ZEPA 3TJXA 1NIUA 2I17A 1W9BM 4XVEA 2YLLA 4MADA 3G1AA 3PAJA 1LCOA 1YLVA 4F0MA 3WIJA 2DVTA 4DYJA 3K1GA 4FF7A 2ZX7A 3A47A 4I8YA 2CZFA 4PUJA 4LV4A 5EBAA 1BYDA 4MIMA 4DO6A 3B8DA 3CH9A 4XAYA 3N6JA 2QT3A 1G94A 4MNMA 3RRXA 2E5CA 2OXNA 1UH3A 3TUUA 3W9ZA 4B9ZA 3CL6A 3PSWA 4ROPA 1EF2A 3OZPA 3LU2A 2NLYA 3FNDA 1VBUA 1ZZMA 4ERIA 2XU2A 5CBJA 3MYOA 4GVHA 1CBGA 2JIWA 5REQA 3G24A 3LHWA 4U31A 1XP3A 1JCMP 2HDJA 3GTNA 4XISA 4D72A 4AH7A 4XZIA 3LRKA 3H2CA 3P0WA 3GDTA 5LA2A 2CZVA 1GQIA 3LYEA 3O3RA 4B5XA 3FKKA 1XH0A 3CO8A 1K7EA 1JDCA 2WNWA 4F48A 4IICA 2O4QA 3UJEA 1EP3A 1ZP3A 2A3LA 1U1UA 4BI7A 3V5OA 3B40A 4ACZB 4EPEC 1CZ1A 4DELA 3IVUA 2IPWA 4BI5A 3URNA 4Q4SA 4U2ZA 3EPMA 2Z26A 5G2WA 3RAOA 3EDJA 4W7WA 3AXKA 3KLKA 1EP2A 3LRLA 1JIBA 1MRQA 1KQYA 4L6OA 1HTIA 1P4CA 1XD1A 3RX4A 1OGBA 2PBOA 1XWYA 2GGHA 5FACA 3DFPA 3G22A 4RZBA 1G5AA 4HNTA 4O10A 4WY0F 4XZMX 2WMJA 2UY4A 2ZUUA 1WOBA 4FXJA 4J9JA 1Q8AA 2GVGA 5H2ZA 2IKIA 3MMDA 4J2PA 4F2BA 4MDOA 3WBYA 2PGWA 3GIPA 4UMCA 1B3XA 1W9VA 2WJFA 1KCZA 4NAEB 1L9WA 4AW7A 4IFKB 4PEKA 3VIKA 5AC7A 1P5BA 4GYKA 3TONA 1RBAA 5AC5A 2VX7A 1ADDA 1BAGA 3C8NA 3LCHA 3MANA 4GACA 3QOMA 2FDMA 1ZSXA 3ID7A 1TREA 3BAYA 3WF0A 2GYIA 1EKOA 3C3UA 2EPLX 4KMQA 2JQXA 3SZ8A 4UIOA 1B3WA 4IPIA 1T99A 2H3DA 5HAOA 2ZBTA 3RLHA 2YXGA 1YRRA 3PPGA 4H7VA 3O8AA 3O6YX 3BAWA 3RXZA 4HK5A 3W74A 1LBMA 4U2YA 1RLDA 3IJ8A 1RA0A 4XIAA 1BRLB 3P67A 3HMCA 1UBPC 4IP7A 2VC9A 3G1YA 4QG8A 1JNDA 5CBBA 3DOPA 1EA0A 3WH6A 3PPCA 2YCLB 3E49A 3CUJA 4JPGA 4Q6XA 1ITQA 5HR7A 1FKWA 1HZYA 1JG9A 3F4VA 8XIAA 1ALDA 1FDZA 4O8AA 3WENA 5JXQA 1FDYA 2Z7GA 4H4IA 5ABTA 4LGXA 2WBKA 3H2EA 1LTDA 1U1JA 1F3WA 3S2NA 1KM4A 3T8QA 2ZZ5A 4ZE4A 5A6KA 2PB1A 4TOQA 2WWDA 4DJFC 4PA8A 1QPKA 2RKXA 5A69A 1E72M 4FSAA 3EOUA 3PTQA 4NI3A 2PDPA 3EWCA 2I9UA 5BCAA 5DELA 3PBGA 4Q4KA 4ZMGA 4AYSA 3CYJA 2VNCA 2WZEA 3OGRA 4JX4A 1MNSA 4IMCA 3MW7A 3P74A 3OOQA 2ZXDA 1TUFA 2VHLA 2ZA2A 3M46A 3L5AA 2G3MA 4G7EB 1SPQA 1TA3A 2NX9A 2XIIA 1KNWA 1KR1A 1BVNP 4D6JA 1JPMA 4AWEA 2AGKA 4UCFA 2PGRA 4NL1A 1JPIA 3T81A 2H6RA 1S2TA 2ZRUA 4W88A 1FHUA 2ZADA 1WZMA 6A3HA 4DLFA 5I3DA 1YADA 4JCLA 1J93A 4UOQA 2P10A 3VNZA 3BLPX 3SAZA 3KL3A 9XIAA 4O1DA 4AIBA 4LVAA 4XQ6A 2XINA 3DU0A 1XGDA 1UR1A 3KVJA 5A6AA 6PTDA 1GHSA 3TTSA 5FSEC 1C8QA 3MTWA 4UFHA 3UCQA 3GNPA 2GJRA 1R9ZA 1ELSA 3LNPA 1Q4WA 3TEVA 1SW0A 1VC4A 2I14A 4WCJA 4JYEA 4O52A 3I6TA 3PB2A 1SMDA 3L21A 3W1PA 1DPMA 5F2GA 1JCJA 2ZYFA 3FN9A 4ZQPA 2VD8A 3LBCA 3UWYA 5FJPA 3BAJA 4H2HA 4KCVA 2XN0A 1ISYA 1XGEA 3BMWA 3GFZA 3BOFA 1NP0A 1FWGC 4B92A 1SFJA 2J24A 3VNKA 2V82A 4RW3A 3CZ8A 1H4PA 4LAZA 1H0IA 1TPH1 2WC7A 2GDQA 2YJQA 4KW2A 1F6YA 3OG3A 4GYFA 5CAKA 1W1TA 1XCFA 3AS1A 3QMSA 4HPNA 3CB8A 4LQ1A 3V0UA 3WFZA 4AZBA 4IX2A 1LOLA 1QNVA 1MW0A 4GYJA 5HQLA 2CWXA 3TR2A 2Y88A 4UTJA 5C9UA 2R24A 3EWYA 4D6GA 3ARTA 1Q6EA 5IDZA 3GNNA 1W9UA 1ZNNA 5LIUX 4CN6A 1UUMA 2XHYA 2Z1KA 1G69A 2XDFA 3AZSA 4P5UA 1W3NA 2QYGA 1YDOA 2Y6ZA 3WQ5A 5C70A 2YL5A 3LCXA 4GI8A 3B0XA 4J28A 4CQ9A 3BW2A 3WX7A 4UQ9A 3L0KA 3ITCA 4LPCA 3IUHA 1O1HA 4NASA 2WNQA 5JBFA 3FEMA 1SW7A 4O0QA 4U5IA 4O0ZA 3A4JA 2ZX5A 3A4XA 4V27A 1K7FA 3K1DA 2V69A 3VCCA 5AFDA 2HMCA 2CFFA 1B3ZA 1E6PA 1GT8A 3IJ6A 1IZKA 3SCPA 4C91A 1FH7A 3Q37A 3CBWA 1Z69A 3LHVA 4UTLA 2QMJA 4C6CA 1NWSA 3DFOA 4RE4A 5GNYA 2BVWA 3MMUA 1PKLA 4LEFA 1CLKA 3IIXA 4GIYA 3H4WA 4GZJA 3ZS4A 4X61A 1G67A 3ABZA 2Z7KA 4O1AA 1JZ3A 3P0XA 4PEEA 4WGXA 3ECQA 4PMYA 5D2TA 5CC3A 1LL7A 2E9LA 2NVCA 3DG6A 2YKKA 4JY9A 5D37A 1I0DA 3OHMB 2YL6A 5D8WA 2VP8A 1EO5A 4N4PA 2ZFAA 3ZR5A 4C1KA 4QEEA 3HB9A 4OTKA 3U9IA 5DN1A 2VCAA 1DQWA 2HE5A 1F8IA 1DHPA 1WKDA 2J78A 1YEYA 3W2LA 3BV7A 2AQWA 5I00A 3CAQA 1GJPA 1JI1A 1CXFA 1FWTA 3B0UX 4O12A 1FP8A 4DAFA 4F66A 4ICNA 1YXCA 4YU1A 5J8LA 1WZLA 4ZTXA 3VTRA 4FXRA 1VH7A 3BJFA 2PZNA 4HZMA 1IT7A 1G4EA 3A21A 3QJAA 4DI8A 4UTWA 1P7TA 4GFSA 4DBDA 1MUMA 3AZRA 1KGXA 4A8LA 2WMKA 4G1NA 4W5UA 3OVPA 1F9CA 4D6CA 4C6LA 4CD4A 4LH8A 3UG4A 1T40A 3HPSA 2XM1A 3P8JA 3MBFA 2ABBA 3TTOA 1UQZA 3R94A 2E9MA 3SRDA 4QFUA 1AFSA 1HL9A 4PB5A 3RPTA 4RR4A 5G1YA 1M03A 3LG3A 2PDUA 3UEQA 4E0CA 3NXFA 5F4WA 5B7ZA 3QLDA 3BSMA 3VIGA 3WBEA 5AHNA 1FFQA 3G0UA 4H04A 3SSZA 2TODA 2WSYA 1DJYA 4MB3A 3S8HA 1KB3A 2W63A 4A3RA 1UC5A 3TVAA 3NDZA 2W3ZA 4HHHA 1YX1A 4F2TA 4XAZA 3PZOA 4G8TA 3ATYA 4BHYA 1XSJA 2C15A 2QZRA 2A21A 1BWVA 2X2GA 1F76A 4H6QA 3M07A 3EKLA 3JR2A 3EBVA 1Y5WA 3MO7A 1J11A 3H7UA 3GDMA 4DXKA 4MLJA 3GY1A 1UB3A 2OYKA 1PWMA 4EANA 3N11A 4E3TA 1EUAA 1JPHA 2OZ0A 4WOQA 1SGJA 3A22A 1V93A 3TSDA 1HQTA 1DHKA 1IXPA 2C19A 1O95A 2I5IA 2VRQA 1T0OA 1TG7A 4M56A 2V2CA 4L9XA 3BCFA 4CNTA 3BJSA 2EPOA 3WFLA 1UR8A 3N17A 3TJ4A 2Q01A 1B4KA 1WBJA 3STCA 3PK7A 1XYLA 4QLKA 4FR1A 4NG3A 1EXBA 5A8OA 2DVXA 1DEDA 1X6LA 3GTIA 1J0HA 2Z1SA 1AUSL 4UCGA 1MEWA 5HJYA 2UY2A 2QIWA 4QCEA 4ZR8A 1FCVA 3EXRA 1H61A 4CVUA 4I6VA 5KINA 3ZWTA 3ARSA 2PA6A 3UG5A 5CJNA 5FL0A 3H23A 2V30A 3TROA 2X40A 1K9TA 4HB7A 1GNXA 4JL2A 4PCTA 2QJNA 4PUKA 1BYBA 1JXKA 2CZDA 2DSVA 2EKGA 3L23A 1DBTA 4Z1YA 3WLSA 3HG3A 4F0HA 1JL8A 2QVHA 1E4IA 1FY6A 3SCUA 4FB7A 4EVZA 2YPIA 4K8EA 5A6TC 3MWCA 4TQTA 3R0DA 3SRHA 3AUOA 1FWEC 3WKZA 4A3QA 5JBDA 1GTHA 1HJSA 5DMMA 1X7IA 4NKCA 1PWLA 2VEPA 2BNJA 2R14A 3NQBA 1LLOA 4F8XA 1YNQA 3A64A 4M3PA 5DQPA 3RLGA 3SGGA 1W1B1 1BLIA 5HR6A 1J2BA 2VT0A 3WO8A 2VDHA 8XIMA 4NVTA 2GZXA 1TMLA 1XFCA 1J10A 3DFSA 3GR7A 2YW3A 2OKTA 4NNCA 3M0KA 5ABEA 4JNMA 2Y4SA 1BTCA 2XZ9A 3FGCB 4FP1A 1HXJA 5CPMA 2GK1B 3L4WA 4GBDA 1EA9C 1W6TA 5CGMA 1VS1A 4Y9NA 4LBUA 5F1UA 3PULA 4MWAB 1ECEA 4URIA 5BWAA 4UB9A 4H2CA 2ZRWA 4DJED 3SEPA 4RCXA 1H11A 2QJJA 4NQ1A 3PZTA 3D5HA 5I3IA 2G37A 1JDEA 3MVIA 3VU2A 5RUBA 1QASA 3LHZA 3W7OA 5KTLA 5AHIA 4CUCA 2J77A 5FEWA 4OJYA 4AD0A 1EBHA 3LK6A 1KV8A 2PDBA 1Q6RA 1PPIA 4UUIA 3S1GA 1L6SA 2X1TA 3R6IA 2A6LA 4WEVX 3G5EA 4LC8A 2VZTA 2ZRYA 4ICCX 5GNXA 5L9FA 3W2NA 1UHVA 3OZYA 3VIPA 4QITA 3VOJA 1TV7A 3R8GA 4GC3A 2BS9A 3EA2A 3PBMA 3SCTA 3LSBA 4FNPA 1E6XM 1J12A 4JQ2A 1PB0A 2A3AA 3ES8A 1GQJA 2W4XA 1RCQA 3H55A 3CPRA 1TFVA 3AXXA 2XZ7A 3PJUA 4XAFA 2C7FA 3V36A 3QQWA 3EKGA 3BLDA 4TO8A 4RV8A 2QCEA 1RAKA 3CT2A 1H7XA 1VEPA 1XYCA 2DZTA 2Y7EA 4BFAA 5XINA 4FNQA 4KEUA 3UZZA 5A8MA 2CLFA 4IMEA 3W25A 1PZ2A 1K8YA 4WSJA 1R9XA 1XM3A 1R38A 1LZOA 3B8SA 1EH9A 3BGAA 3B03A 1LG1A 1QW8A 3NDOA 4LCQA 1RBOB 2VJXA 2WXDM 3QMRA 5HNRA 5I3FA 3FXYA 1ISVA 3PWIA 4QJ5B 3R8RA 3ITOA 4O1BA 1WZAA 2JGYA 5FF2A 4D9PA 1A80A 3GE7A 3LCFA 1B4EA 1TRDA 3HG4A 5J04A 3LENA 5HXMA 1OIMA 3VIHA 3GDKA 4LANA 4MHBA 3MKVA 3L7RA 1E9ZB 4DO4A 5AYIA 3L2LA 3C0JA 4EOUA 1VGAA 4X63A 3PWGA 2R91A 4HPXA 3SJ3A 2Z2AA 1WZKA 2NWRA 5D03A 3NUKA 1BSLA 5C6MA 3W7GA 1W5NA 1DJWA 4G7FA 5BRBA 3CQIA 1X6NA 2TYSA 3W7RA 3I65A 4Y7EA 4Q3MA 4OUEA 1HJQA 2HNHA 4GJIA 4PFMA 1J8VA 3E2SA 5CZKA 2Y5JA 1K9FA 4H9UA 5DXYA 2PWDA 4FX6M 4EF8A 2UZ9A 5FF0A 2H90A 1GKQA 4JN8A 2QAFA 2C91A 4IJBA 1ZBVA 5E93A 5A8NA 2QAPA 4FR6A 1EC7A 3HU7A 4QJ3B 5LXXA 2VZSA 3E2QA 3FAWA 3R10A 4AX7A 4MG4A 3WN6A 2J47A 5EMJA 4WKFA 1WDDA 3B0PA 1UZ4A 2D0GA 1UH4A 1OX5A 1U1HA 1TWZA 4OOZA 4BI6A 1T5AA 1GORA 1OX6A 2CBVA 4J3SA 1VCVA 4PTMA 3WLJA 3AXIA 2XIMA 3NQGA 4C7GA 2W66A 3FJ6A 3GBDA 1LQ2A 4PTXA 1AMKA 2PWHA 1QVBA 3L9CA 3W7MA 3G0SA 1GCYA 4P7LA 2OQHA 2D22A 3UA4A 3EB3A 3WUFA 2Z6IA 1JDFA 6TAAA 1VLWA 3VZXA 4EIVA 2PD5A 1FWJC 2BOGX 3OLIA 4IM4A 4GHRA 3EAUA 2W79A 5M17A 2TMDA 1B5TA 2P0IA 3N18A 3OYZA 4WXZA 2JEQA 4GYPA 4C1NB 2OSXA 5EMYA 3WZ0E 3FYPA 4NY2A 4Z1CA 3ITLA 4OWGA 1JGIA 4NNAA 3P61A 2PTDA 1E9IA 1TUXA 4FPSA 3W88A 2R6OA 3BL3A 1J6PA 3TJLA 3GH5A 2PU0A 4UTIA 4JKKA 2WSRA 4H83A 2XSAA 4NJIA 5HOSA 1N82A 4TX9A 4TX8A 1W3TA 5I03A 2OSWA 3GM8A 1K03A 1JVNA 4HNOA 1QAPA 2ZUTA 4HVXA 4PMUA 2D3NA 3GAYA 1Q6CA 1DJHA 2LLEA 3W85A 3GHUA 3RJYA 4WY0B 4K8GA 3CJPA 3N2XA 1OYBA 5D38A 3D3AA 1CCWB 2Y0FA 3PZQA 2ZXBA 4UNLA 5XIMA 5ECUA 2C1HA 4EXQA 2ISFA 3HO8A 3A23A 3WK3A 1WA3A 1XICA 1XSKA 3KOXA 4KRZA 5MF5A 4W93A 3KBJA 1JAKA 1HN1A 5BOOA 5AVNA 3WEOA 1U5JA 1PV8A 3N4FA 3V5FA 4E6MA 3KL0A 1XH1A 3MP4A 5C7VA 1EIBA 4AVFA 4DM2A 3WNLA 2VGBA 4AVOA 2NQLA 3RPMA 5G2HA 4IOTA 4D6HA 3TW9A 1EBGA 1TV2A 2ZRZA 4ZGYA 5JVLA 2HRWA 2EG7A 3GG1A 4AHOA 2QPXA 3GC5A 1DTUA 1MXGA 2EPKX 4PH6A 3W1UA 3ABQA 1QHZA 3GLCA 3DYMA 1OC7A 3G1DA 1Z42A 3QY6A 3UR7A 3VNLA 4A3YA 2CESA 4IPLA 2PDLA 1D7FA 4LUTA 3MHGA 3SY8A 4YCPA 2QF8A 1DXFA 2IS7A 3MMWA 5SWUA 3F1QA 4OQVA 2PDIA 1AZ1A 1NWRA 4IGMA 4FLOA 3Q94A 5AHLA 2RJHA 2DPEA 5C8BB 2YBTA 3T55A 3M0ZA 1XBVA 1H7WA 1E1FA 4KCUA 5E6YA 3OZMA 1IE7C 4MB5A 4H8NA 3WCZA 1LF1A 2PP0A 4FF5A 1SYTA 1WDPA 3MU7A 3E1F1 1GVIA 5HJXA 2ZX9A 2E68A 4YTTA 4PUUA 1M9HA 4GD0A 5B7YA 1B3VA 1CDGA 3TMQA 3EB2A 2J4GA 6REQB 1S46A 1JAEA 3WEZA 4H9TA 4JTSA 1XLCA 4LVBA 3TQ0A 3TXVA 1K02A 4C6BA 4HPHA 4DPPA 3KBVA 4N9DA 5FEZA 3W1QA 1E55A 3PB0A 4N42A 3TYUA 4ZOBA 1I2PA 2F2HA 2J8FA 1KGUA 1V0LA 4NX5A 1JYNA 4AX6A 4ZA0A 1KTNA 1NVMA 3V18A 4JBRA 1SZGA 1QXLA 2ZX8A 5CBIA 1MNZA 1O7AA 3AYVA 2PDWA 3DAQA 1MW1A 1S1PA 1TPWA 1XFBA 5G4EA 5DY2A 4ZOAA 4LVDA 5K9CA 1WDQA 4XTIA 1E56A 1J0ZA 4OBTA 3CWNA 2DQWA 7REQB 4X0NA 3OGVA 2GVLA 4D1IA 4EXBA 3LOTA 3QVQA 4G1KA 4FI4A 1WKFA 2P5NA 1EUNA 3WF2A 1S1RA 4LUSB 3T9PA 2HBXA 1TZ9A 1XUUA 4EWND 2AAAA 4ATWA 5CLWA 3BAIA 5EGRA 1G6CA 4GISA 3SN1A 1VPQA 1JRCA 2GOUA 3G8RA 1K8ZA 4MWAD 4WUIA 4GO8A 4A2SA 3AICA 5H8MA 4D6FA 1J0YA 1KW1A 3AIRA 3LN3A 3B05A 2CHOA 2WYSA 1PS9A 3TN3A 5HWMA 2EGZA 4ZO8A 4QQUA 3GIQA 4B5WA 3O9NA 4IJCA 1KXVA 2DZWA 5I79A 3W28A 3ME3A 3XIMA 3LQGA 4DJFD 2VC6A 4QTGA 1P0EA 1B9BA 2CKSA 3DBNA 2C16A 1M7OA 1LQ0A 1V4YA 1A5LC 3QGVA 5HQMA 5GVJA 4DN1A 1W1IE 4RZ5A 1PL9A 2J75A 1N8FA 3HGSA 3KHDA 1VF8A 4Q22A 4YPJA 4EAYA 1KCXA 2V5JA 1H1NA 3GXNA 3UPBA 3LY0A 3EX3A 3PM6A 3BAXA 1RK6A 4NAEA 4HSNA 5M3WA 2ACQA 4IFKA 3PUDA 3RIKA 1SVDA 3UPWA 3MO4A 1E0WA 3CLMA 2VDGA 1SJAA 2VUYA 4RLIA 5DT7A 2FZDA 4DBWA 5EMKA 1UR4A 2MNRA 5MKGB 4UC5A 3EA3A 4HU3A 3W73A 5LXEA 1DJXA 2FJKA 3ZXWA 3C5QA 2Y2WA 2WVSA 1B90A 2Z29A 3ZZ1A 2WKGA 2WPBA 5DMLA 5CXPA 1BRLA 3UZJA 4JX5A 4EK7A 2EJ1A 4PTNA 3ABOA 1IR2A 4J7RA 1R5YA 2EKCA 1G1YA 2ZOXA 3VKDA 2YCLA 3GDRA 2VTFA 2QV5A 2NXIA 3PANA 2VRJA 2CXGA 4HJFA 3S1WA 4FA3A 3TX9A 3MCNA 3U2OA 3EWXA 1EWEA 2BOFX 2YDSA 4CEUC 5DT5A 3H24A 4LUJA 2JE8A 4DZIA 2R8WA 2GJXB 1PHQA 2PUZA 3DYOA 2H8ZA 3TOYA 2ISDA 1GKPA 2F84A 2B4GA 3OVQA 2YYUA 3GIYA 2PCEA 5KZMA 4H8UA 3SN4A 1CXEA 4YVXA 1WXJA 2D2JA 3NM1A 4YTUA 3AMLA 3CS2A 3PZNA 1CYGA 1H0GA 4N9EA 1E6ZA 3WLPA 3S6TA 4YS1A 3UWZA 2OJPA 2NWSA 4KKXA 2G96A 4JHMA 4J4KA 3V0TA 4DWDA 3N6HA 4G7EA 3TSBA 1TQXA 4WLCA 3UYCA 3KS6A 1JULA 3F7JA 1OM0A 4AMCA 3KRSA 3CAKA 4M7TA 2Y62A 4X3ZA 1KCLA 3N14A 3CHCA 1SFSA 1YBQB 1FDJA 3U8GA 4L1GA 1RCXB 1CI1A 4ACYA 3KUMA 1F7BA 3MI2A 4UTFA 1BSIA 3IK4A 4KFNA 3UWQA 5I5RA 4H19A 1GWJA 1PDYA 1O5RA 2OKOA 3WG6A 1RPKA 1V7AA 3U4AA 1RQHA 1GOMA 1EGVA 3W1RA 3NQ6A 4KT2A 4AVNA 4R27A 2Z00A 1TZZA 3NZPA 3UXAA 1RY8A 3F2DA 3B4UA 2ZUWA 2DDXA 3SCSA 1CXLA 2X1IA 1XGZA 3HQNA 5IDIA 1LJYA 3ZVIA 1NF0A 4D6IA 2X0HA 5H91A 3HM7A 4GG9A 5CPSA 1QNPA 1KTCA 2CCRA 4WX2A 2D20A 2OGYA 1NDYA 3OLGA 3R2GA 4HSHA 2WQPA 3E3HA 1TJPA 3CHVA 2X09A 1GOIA 1E70M 1I6NA 1XIEA 4IIEA 3UXIA 1CGWA 4F0LA 1HKIA 1JGMA 4HJWA 3NR0A 1VR6A 2WKLA 3ZJKA 3E0WA 4ZFCA 4PR4A 3LTSA 4O1CA 4S3GA 1O6IA 4PRWA 2WCGA 4LAKA 2PI6A 3W2UA 5HMDA 4ENLA 3PUEA 1FCQA 3BLKA 3LNMA 4AG0A 4WKHA 2WNNA 2I9EA 2ESCA 2ZDRA 3CYVA 3S2CA 5A8GA 1EPXA 5C2CA 5C71A 3EX1A 5CPOA 1P48A 2XH2A 2CERA 3DUGA 3CLWA 3NTYA 2V5BA 1O66A 1DTNA 3WMSA 1ME8A 1H7RA 2XWDA 1IEIA 3CPUA 1R3SA 4ATDA 3GX9A 1VBJA 3BMXA 2D0FA 5I78A 5GJMA 4AMAA 2IUZA 1QFEA 3GR8A 5IOBA 3UBPC 4RV3A 3G1RA 4W5ZA 1J5SA 2EJAA 2KAUC 4IWWA 1JCTA 4HYVA 4MJMA 1M5WA 1P0KA 1GG0A 3MPGA 4QNEA 1D3HA 1KBBA 5KITA 1S39A 4AD4A 2OGJA 4V28A 1QATA 3LCGA 4LBRA 5HNTA 2FLIA 1SMAA 3C0SA 4MLRA 1E4LA 2AL1A 1PKYA 3W27A 2KZHA 4A2RA 1PTDA 4MAZA 1KLYA 4J3VA 4H41A 3I6EA 5AC6A 4R53A 5DBTA 3WMLA 5J5RA 4IQLA 2ZZ4A 1K70A 2V63A 4FO4A 4GIEA 5BXPA 2DSKA 3NPUA 1H7OA 5BROA 4AC1X 2WM0A 2HVNA 3C2YA 3B8IA 1IHIA 1ZJAA 4QLJA 5EBUA 3VAVA 3KZSA 4UXDA 3DGBA 3WL0A 4V33A 4LC6A 2CBJA 2FHFA 1BEUA 1XIFA 1RA5A 2QS8A 1WB0A 1RH9A 3FJNA 4IFRA 1DJGA 3GK0A 1WXZA 3MV01 1UMYA 3VE7A 1YW1A 1ZL1A 1ZENA 5BOEA 2XIOA 4XD4A 3P8IA 2DY3A 3VNJA 4GLEA 1KRMA 1ZBWA 2R1KA 4P7NA 2CEQA 3EGJA 2XVKA 5T8GA 1NF7A 3PUGA 1L6FA 3S4TA 2Y7DA 3N9KA 4W7UA 4RNJA 3NGFA 7TIMA 3PN8A 1EPVA 1W37A 3W29A 4A8IA 1XQKA 1LBFA 1UR3M 2GL5A 4ADSA 5I06A 3AIUA 2AQVA 2JKAA 1GJUA 4LS2A 4QLLA 1E0VA 2ZE3A 3MSGA 4UR7A 3ZMRA 1O94A 2ZUVA 3C56A 1SO5A 2OWXA 4ALDA 2I5QA 1NOFA 2XIJA 3E74A 3FSUA 4JTHA 4Y9MA 2ATSA 1M7PA 2RGMA 1BFNA 1OFDA 2Y8VA 1VFTA 3N25A 4NZ5A 4CQ8A 3TYZA 4NP7A 3W84A 3AWNA 1T41A 3ITGA 3B9DA 4ASTA 1R3RA 2XFRA 4XX6A 4DBEA 3HURA 4IH3A 4Q8TA 1VFMA 4IIFA 2YSWA 4E4FA 1XLAA 3CGTA 1JD7A 3DZ1A 5AYZA 4EKJA 2BDQA 1M65A 1ZCOA 4IQJA 2IKHA 1J2WA 1NY1A 3GXMA 4GCAA 5CPTA 3CASA 2XISA 4KWWA 1VIZA 4CNNA 3VMPA 2WAGA 4US5D 1XG4A 4RL3A 2X1RA 4ZENA 3M5VA 4MPKA 4JQAA 3VXGA 4B3LA 4IP4A 1W1VA 3E6EA 1FWFC 3BZJA 1J5TA 3W7LA 4GQ0A 3AOFA 4MAVA 3I3DA 2R1LA 1MVYA 4NHVA 5HNUA 1YYAA 1O5XA 2Q6ZA 1I1XA 2FB2A 1AL8A 4HNCA 1MXDA 1S2CA 1DXEA 1FQ0A 1GEQA 2IKJA 5EYWA 1B30A 3I3EA 2DUAA 3L12A 3MSRA 4H1ZA 4BF9A 1BG4A 3OPSA 1KFJA 1KXQA 2B7QA 1SJDA 3IGUA 5A6LA 1MWOA 3M5XA 4HHLA 1NOWA 4I5XA 4AZIA 4BJHA 3BK0A 3C86A 4HPJA 1IXQA 3S2JA 5HPCA 1JZ2A 4F9JA 3CWHA 2XVPA 4MZYA 1TMHA 3W01A 2ZDSA 5E0CA 5K4XA 1ISZA 1BF6A 4HHPA 1F4AA 2P53A 3FYYA 4BQ5A 5FJOA 1H7PA 1I1WA 2DP3A 1JCLA 1B3OA 4S1FA 3KRUA 1CENA 3GZAA 3NVTA 1YPXA 3DFQA 4K7VA 4JFSA 4LNCA 1UD8A 1S38A 4ZCWA 3SRFA 3WQEA 1VD6A 1OX4B 4CD5A 4C6DA 4HNUA 1UZHA 1EJWC 3U7VA 1ZQ5A 5DXXA 1WAWA 4S3KA 1RV8A 4Y90A 3V5CA 4JTIA 3OGSA 1RQBA 5FAGA 2QMKA 1NAL1 2B31A 4HBKA 4OFCA 3MUCA 1UUOA 4JFTA 2NQ9A 4OZOA 2E5DA 3FCPA 3VINA 3CIVA 2WW5A 5IFTA 4JTKA 2XGBA 5C9XA 4QDWA 3N12A 4AEEA 1TIWA 4DHGA 4DB7A 2W5FA 1XLHA 1RP9A 1D7KA 4OIFA 3WUGA 3P5YA 3TSMA 3I3BA 2ZC8A 1ZPTA 3OU8A 4GIAA 4R5EA 4AF0A 4K1GA 5I09A 1UKTA 4GY1A 2IQTA 4LX4A 4GZEA 2RGLA 3PSVA 3FDKA 3NNTA 2WK2A 4YTRA 3NVDA 3AXMA 3B97A 1CIUA 4JCMA 5JU6A 1KM1A 5EMMA 2O9RA 2EG8A 4GZ7A 4F0KA 3FGCA 3O0KA 4M6PA 1OT2A 4N2YA 2E25A 1AW2A 1YPIA 1FWSA 1VZWA 2J27A 2Y85A 4CQCA 3L4UA 3L0NA 1S2AA 4RE3A 2G4JA 3LA4A 3B9EA 5CC5A 3SIMA 3LPPA 2OPJA 3VPLA 4EF9A 2OB3A 4UQAA 2WLYA 1C3FA 4MGGA 4PMJA 1W54A 5JIWA 2YCIX 4FX8A 2XFYA 1QDSA 3NAVA 3GS6A 2C71A 4RKAA 3SADA 3BLLA 1ZP4A 1C93A 4EPKA 2XH7A 3IRDA 2IXVA 1EC8A 2VZVA 4WGHA 4RXFA 3IANA 2WSPA 4YHGA 7ODCA 4Z1BA 2X0SA 3M0MA 1FWRA 4DJFA 2E6AA 2OQLA 4ZL1A 3QOKA 1WPCA 1RUSA 2GPTA 1A5KC 3DYPA 3FK4A 3VM7A 3DKJA 4P7RA 2E40A 5LGXA 4RDVA 1WUEA 1E71M 1EO7A 1EZWA 4CQDA 4P8XA 5CKSA 1BYAA 3O15A 2WMFA 2NUYA 4DVOA 2O56A 1THFD 3WJSA 4EAMA 4GQQA 4LT9A 2BX7A 4TMCA 4JIIX 4WK9A 2BHZA 2E1WA 4BF5A 3WH5A 2TRSA 1REQB 1UIOA 1L8NA 1SJBA 5LHFA 3R13A 2OQYA 2OEKA 4GUJA 4MUZA 5D2VA 3OBAA 2FVMA 3P81A 1SUXA 2Z1BA 1LORA 5G1TA 4XSLA 1K8CA 2INZA 1NFBA 4MY1A 3KBMA 1UP3A 5CPNA 1R3QA 3UW6A 5F2IA 4ECLA 2W62A 3CHDA 3MV11 3TYCA 4E4PA 4DIAA 1GW1A 1BVWA 5FKYA 2A3EA 5D4YA 1TPVA 2BY3A 2DSZA 4ONVA 3VFLA 1OCBA 1UZ1A 4I5RA 3O06A 1ME7A 3NYZA 2BHUA 3BO9A 3EEGA 1MQRA 5TF0A 1LM1A 4MNKA 3AFBA 3F03K 1NDZA 3BDKA 1HGWA 3E38A 4D8AA 5C2XA 7PTDA 4CEXC 3NOYA 2REQB 3UT0A 3W2MA 3N3MA 2I1OA 3BURA 4HMNA 2V8ZA 3LS9A 2X1UA 5JIPA 3G1FA 1C90A 1W3JA 2V38A 3UWEA 4ZXLA 1KM5A 1EJUC 4HN4A 5G4WA 3KBNA 4W87A 4AUBA 1VBGA 4RE0A 3DFNA 1ADSA 2NT0A 2HPMA 1XRFA 4FLSA 3XISA 1TCDA 1QT1A 3OBEA 1NFPA 4N9CA 4R9XA 3OO2A 3G1SA 4CQAA 1Q2SA 3N15A 3WLQA 1OCJA 3PNZA 2CZ5A 3UXDA 3E2VA 5M03A 2ZTKA 3UETA 2FDSA 1HJWA 4HCLA 3ANUA 4Z2IA 4PMOA 1RP8A 3M4HA 3M1ZA 1M7XA 3MVTA 3CQJA 4LRSA 1DWFM 1Z32X 1TE6A 3W7JA 2A7PA 3KTCA 1QNQA 2G95A 1QBBA 3GO2A 1U83A 4XZLX 3LCIA 2F8QA 2OO0A 4NJGA 4FLQA 4JXCA 3NL5A 1IGSA 1QRQA 1LWJA 1JPKA 4UZUA 3BE7A 5KZ6A 2VL4A 1OINA 4H00A 4S38A 2PDCA 2HZGA 5A3HA 1GPFA 1IWPA 5E1QA 3O63A 3OLDA 1A50A 2RH9A 1AJ0A 4LYRA 4AZ5A 3HFTA 3O6CA 1K4HA 2Q09A 5BXTA 3VX1A 1E1EA 4UBPC 4UQCA 4DJEC 2GUYA 1V6WA 3C0QA 1E6SM 4J3XA 2PE4A 4YYFA 4M82A 4C90A 4CU7A 3NEVA 4A05A 4C1NA 4WSKA 1P0NA 1JCYA 4LOCA 4OVXA 4CLMA 4WDWA 5H8PA 3EA1A 3PPFA 3TYBA 5G5IA 1UROA 1GGOA 5FJIA 2P0OA 2NXHA 1X98A 2PTZA 3ORWA 3L66A 3I10A 3T4WA 1VFFA 5BW6A 5CH9A 1A3HA 4JFWA 1LOQA 1U2YA 2HTMA 2CLLA 8CGTA 3CMFA 4L65A 3WNOA 3CZKA 4IP5A 4FALA 3LM3A 3LCWA 2CBUA 4F0RA 3T78A 1G0CA 4MFDA 3ZT5A 3W75A 3IWPA 3FV9A 5D9NA 1X96A 1DQUA 1ZJBA 1KBKA 5C9RA 4CD6A 2FZ9A 3RMEA 3KCJA 4B2DA 4WY0A 3AMDA 2ICSA 4Q8UA 2NSXA 3GXDA 2HK0A 5GQBA 4KH2A 2ASHA 3VZYA 1OY0A 1DL3A 4DZ5A 4FNSA 5A6JA 1PE1A 1AA1B 2G97A 3S83A 2OG9A 1OSEA 3NWRA 3V4BA 4TUFA 5A8QA 4X0VA 4ERAA 4LEQA 1X8CA 3TW6A 2DGAA 3TC6A 4I9AA 3W6MA 3SB0A 3WDIA 1E1CB 3GHTA 4JYFA 3SECA 3WY1A 3PZ9A 2BHYA 3HN3A 2DQXA 3I7QA 2B0MA 4PTVA 1Q66A 1O12A 1CGXA 3MY9A 3UQNA 2CLHA 3VC6A 3P3BA 3H26A 3DECA 1OGSA 4MTVA 2D0HA 3POHA 3H4XA 5BYWA 3HPZA 1IGWA 4UQBA 3WDRA 3H21A 4ZBCA 1VRXA 1C7SA 1FOBA 5BXSA 1R9YA 3OQEA 1I2NA 4MOZA 3AHXA 2QCDB 5HUPA 5I6SA 3WJYA 5A6MA 1D2KA 2OCZA 4NF7A 3TYAA 1TWSA 2WC3A 3I4EA 1V8EA 5G4HC 4FOUA 3T07A 3I68A 1US0A 3ZQ9A 4JGDA 3THAA 4J2MA 1G9HA 3AALA 3NFUA 4LW7A 4AY8A 2RHGA 3KM8A 5CGTA 4NZ1A 3UR5A 1RD5A 4C6EA 2BG5A 3GNDA 4LVGA 4LRTA 1KXTA 4H9XA 4TR9A 3UVAA 1QU4A 4M6UA 2QVNA 1PJ9A 3BC9A 1V0NA 2E6DA 4PYSA 3H12A 1XYMA 3MUXA 5K4ZA 1R7AA 2HVOA 3DN5A 4LF2A 4EP8C 2RFGA 1W8GA 4HCDA 1AMYA 1NTHA 1EB3A 4Z2GA 3OIHA 6REQA 5BU6A 2OX4A 3VOIA 4LSBA 1XIJA 1HUVA 3MZ2A 1GYNA 4O17A 2MUCA 1FHLA 1J4EA 1QPNA 3EWDA 4WXYA 2YB4A 3LI0A 3HBLA 2WSQA 3QV6A 2J9XA 3SUUA 4B16A 2HXUA 2QDEA 1OFRA 4JQ4A 1Q63A 3B8UA 2CPUA 6ALDA 1FWIC 3W1XA 4Y9AA 4WSHA 3TV8A 1EGZA 1GVEA 4H01A 2OT1A 3UP8A 4D8ZA 4GXMA 2DT3A 4W89A 2F38A 1FWNA 3IGHX 4WIWA 3S6OA 4AZGA 7REQA 1Z7AA 1PKNA 1Q7MA 1NDVA 4K68A 3SJNA 3FKRA 1TJRA 5BMXA 4US5A 3UZXA 1Q4NX 4GH1A 4UTTC 1FTXA 4W9TA 4RE2A 3WD2A 3FHQA 3WD0A 4LUSA 1XIIA 3S5ZA 4GFIA 3GSMA 4NZFA 5JMUA 1W0MA 2A2IA 3VIOA 4EWJA 2OX1A 1QJWA 2OEJA 3HV8A 1I0BA 3T40A 3ZR4A 3LHUA 1LRNA 1Z3NA 2WC4A 3IV8A 3U2ZA 1PHWA 2INEA 4XAGA 1EX1A 1B1YA 3U0HA 5KZEA 2XFWA 4IQDA 4US6A 4UMBA 1PX4A 2ZUNA 5HANA 3N2TA 4JHOA 1UKSA 2QHAA 3BLIA 4MWAE 2XIBA 1IEXA 3ZOAA 4UFKA 3KXQA 4XZ9A 4B91A 2O55A 1YXYA 3ZM8A 2OZ3A 2QJIA 3M16A 1L2UA 3CQ0A 2F2KA 1AW5A 1TKKA 2BBFA 3VCNA 3ARZA 4EPDC 1RHCA 1UA3A 3HQ1A 3WK1A 1TPEA 5F4XA 3W37A 2ACRA 3P84A 2VOMA 2O7QA 4WR3A 3TNOA 4B4HA 2VKZG 4OT7A 1XF0A 3B9NA 3LTYA 4XZNX 4UFIA 1E3XA 2FVKA 5PTDA 4ZO9A 2G3IA 2O0TA 1LQAA 2OTDA 5F7UA 3S5OA 2A3HA 3MS8A 2XWEA 1QW9A 3STEA 2CYGA 3EOLA 4BK9A 2QLYA 1XSIA 3P6LA 3W24A 1VYRA 5MKGA 3QW4B 3BG9A 4MM1A 1AJ2A 3BANA 3VGGA 1KGWA 4GINA 3FJ4A 4A8NA 1DE5A 4GQGA 4Q8NA 1GUVA