4JFWA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2s,3s,4r,5s)-2-[n-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
439
structure length
439
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-L-fucosidase
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
total genus 162
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jfwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jfwA01
5FL0A 1E9LA 2XPKA 4W89A 1QNPA 3BC9A 5AC4A 3K8KA 1BYCA 3WQ4A 1Q6DA 3IAQA 4NX0A 2O92A 2J8FA 4DUWA 1UD3A 2DEPA 3ARUA 3BLBA 2VCAA 1JAEA 1V03A 5I0DA 3HG2A 1FH8A 3N9KA 2GFTA 2V5CA 4X0VA 1AQMA 1PBGA 3BXWA 2WMGA 3SUUA 3RILA 2OSWA 1XSIA 3U5UA 3IJ8A 3TA9A 2W91A 1OSEA 3FHQA 2YL6A 3AMGA 3CIVA 1NWRA 2J8GA 1ODZA 3WDQA 3THCA 1B31A 1UQZA 3T0DA 1QVBA 1TVPA 1T0OA 4QFUA 3PZQA 2VCCA 2ZWYA 5A6BA 4RE4A 1DHKA 2VC9A 1NWTA 2VCBA 2DQXA 2WSPA 3GZAA 1DP0A 2G3MA 1BSIA 1OGGA 1QI2A 3PZVA 2BVYA 3SUTA 1U30A 3T0BA 2GJXB 4LQ1A 1S46A 4NXSA 1BAGA 2VX7A 1OINA 8CGTA 1UH4A 5I79A 3BH4A 4MJ2A 3WDIA 1BTCA 4JL1A 3F5KA 1PZ3A 4IPNB 2ZUWA 3WDHA 1W32A 2EPKX 2NT1A 3ZM8A 3BVUA 2A3HA 3NDZA 5C70A 2QPSA 4OOUA 3NCOA 2WHMA 1UH3A 2WYSA 4AEEA 1VEPA 1EHAA 1M7XA 3BAXA 2X0HA 5CLTA 2WB5A 3WH7A 6CGTA 2WANA 4NXKA 4AD0A 2VI0A 2FHFA 4AD5A 1V08A 5I2UA 3U7BA 4AD2A 2XFRA 2IXVA 3AZSA 3ARYA 1OB0A 3A5VA 1FOBA 3ZT7A 1E4MM 1UUQA 2CKSA 4HPHA 5DO8A 1UD6A 1WDQA 2D0HA 2VUYA 2W5FA 4PTMA 3W6LA 5I78A 1JG9A 2O9OA 3CZGA 1MW0A 1MQQA 4PBGA 4PMYA 1R34A 3K8LA 4XV0A 4NRRA 3O9NA 2O9TA 2BS9A 1GQLA 2XJ7A 1R7OA 2GDVA 3KZSA 2CNCA 1KWGA 1HF6A 1W9BM 4D6EA 4HMEA 2OSXA 1UKPA 3HG5A 5LA0A 3A4WA 3VDHA 2OYMA 2QLYA 4MNLA 1HP5A 3TTYA 2CETA 1B0IA 1TQTA 1LG1A 1D3CA 4PUDA 5E0FA 2WNWA 1ISVA 1JAKA 3ARPA 4UOJA 1JFXA 1CDGA 4UFMA 4W87A 4M1RA 4AZ7A 3GXFA 3VM7A 5AY7A 3RPMA 2WBKA 5DFAA 4JKLA 3VX1A 3WKZA 4JFVA 3BLPX 3A6OA 1ZS2A 3CUFA 4YHGA 3SCQA 5CJ5A 3VINA 1J11A 5ABGA 3AXXA 4Z2GA 3AHTA 3AYRA 3BMVA 5A2BA 3UESA 1UWRA 4PMVA 1XD0A 4CVUA 3CUIA 3FN9A 4P8UA 1OT2A 3BUDA 5E1QA 3QOMA 5HPOA 4J7RA 4M80A 1V0KA 3DX3A 3EBVA 4NRSA 1GOIA 3SUVA 4AZ6A 1C90A 1R8LA 4J27A 2CHNA 4HP5A 3WD1A 4DUXA 5CG0A 5HBFA 1HL8A 5IFTA 1EO5A 4TVCA 3VD3A 1UR2A 3WY3A 1PX4A 1ZBCA 1WZKA 2Q8XA 1RH9A 2E40A 4MNJA 4BA0A 1VRXA 2WMKA 1VBRA 5D9NA 4HTYA 2XWDA 1GOWA 1V6UA 4AWEA 1V3KA 4JFSA 1KQYA 4V27A 3MSGA 3RJXA 5D8WA 1SR0A 3L4TA 1GHSA 2MANA 1R87A 1BYAA 3BVWA 2NT0A 1QX1A 1JYVA 1OCQA 1PIGA 1LWJA 1OD8A 1W9UA 1XGZA 2XVGA 2YA1A 3HMCA 2BHUA 4W84A 1KTBA 5A6KA 1CTNA 3AYSA 4B9ZA 2A3EA 3GYCA 1E0WA 5JUVA 4PMZA 2WWCA 4PRWA 1UD2A 4XZWA 5IXEA 4JHOA 2XFYA 3VGEA 1BF2A 1JF6A 4UNIA 2A3AA 3O6AA 1HNYA 1CGUA 2J7EA 1HIZA 3UEQA 1VIWA 2ZUMA 4IM4A 4LYRA 2XVKA 1CYGA 3IJ9A 3L4XA 3EDDA 3A23A 3ZT5A 3GXIA 1MFUA 3WNKA 2O9PA 3CZNA 1VEMA 1V6VA 1R7AA 1XH0A 4OUEA 2XFFA 4AZHA 4PUEA 1VENA 1R85A 4M81A 2WHJA 5A3HA 4P7LA 4YHEA 2EQDA 1UZ4A 3VGHA 3AS0A 3W24A 4PMDA 1M04A 1MQRA 1Q4NX 4TXEA 3UG4A 3VX0A 3EYPA 2WM0A 4M56A 2WBGA 4TTUA 3A3HA 4DO4A 1X1NA 1JZ6A 1UR4A 5M3WA 2IXUA 1LG2A 3WD3A 4DUVA 2EACA 4J3WA 1OWQA 5BXPA 4GQRA 4W8LA 3AMCA 1V6XA 4D6JA 5DMYA 2YA2A 4H04A 1TMQA 3D52A 1H11A 3MUY1 1LQ0A 4CU7A 4CN4A 4ATDA 2Y8VA 3IJ7A 3A22A 3ARSA 2WKGA 3DX0A 3N12A 4ZENA 4CD5A 1M01A 3UERA 1V3JA 1GJWA 4FLOA 2GK1B 3OIHA 5BXTA 4PTXA 3DDFA 2VVNA 2XSAA 1O6IA 1NWUA 2ZX6A 1HXJA 4CCDA 5GQBA 2JFEX 4PSRA 3F5LA 4J3XA 4AZCA 1MW3A 1KXVA 4GI6A 1OGSA 2VL4A 1J0ZA 1CXFA 2OWXA 1ECEA 3MSDA 5F7UA 3VMPA 4HMCA 5C71A 1J0KA 4GI8A 3A21A 2WWDA 2QPUA 3NUKA 1QNSA 2JEQA 4QP0A 1HKKA 1CGXA 2DIEA 2E9MA 4XB3A 5HPCA 1ISYA 4ZE4A 1FHLA 1PX8A 1PIFA 3RIKA 3WF1A 4D1IA 2J77A 2DSUA 1FP8A 2VJXA 1ISZA 3IGUA 1C8XA 4WSJA 3CZKA 1B1YA 3QR3A 5JIPA 1J12A 2WLYA 1U33A 1LF1A 3A4XA 1QHOA 4OKDA 1QWUA 3VGDA 5IFPA 2X2YA 2VX5A 2VQUA 2V38A 4Q7NA 5GNYA 1JZ4A 3OGRA 4M8UA 1Q6CA 2D20A 3IK2A 4NZJA 5JIWA 4AYGA 1CXEA 1CECA 4UZSA 5ECUA 4UFHA 4B15A 1HVXA 3RM4A 2AMGA 4NZFA 4X0NA 4WF7A 1H0IA 2VX4A 3VIMA 1E70M 1B3XA 2GJPA 1BYDA 1WZAA 4JAWA 4HOXA 6A3HA 4U5KA 4F9DA 3UR8A 1MFVA 4PMNA 3GNPA 3LPGA 4TVDA 1TQUA 1M03A 5DEZA 5AYBA 4C7DA 3CZJA 1HT6A 1GJUA 2ZWZA 3D4ZA 4UFLA 3EDJA 2RGMA 1C93A 3POCA 2W62A 4YPJA 2WMHA 2VRQA 4DO5A 2OSYA 1B9ZA 2WK2A 4MPKA 3VIIA 1E4NA 3WQVA 5A69A 3GXTA 3SCTA 2XM1A 1LL7A 2D0FA 4JHZA 4L4OA 1RPKA 3WD0A 2XYLA 4HU0A 1B90A 1ITXA 4ATWA 1TA3B 5E6YA 4E8CA 3DHPA 3EJTA 4DM2A 1I75A 4C7FA 3IANA 2UY4A 1NQ6A 2WAGA 3VDBA 3LPFA 2YKKA 4ZXOA 3POHA 1K6AA 2UWFA 1KCKA 1HN1A 3QGVA 5ABHA 4MNKA 2D23A 4W93A 3CV5A 3GXDA 1BGGA 4TOQA 3AS1A 3S5ZA 1MWOA 4PEEA 4J3TA 2PF0A 1B3ZA 1VBUA 1WP6A 3WY2A 3SCPA 2B31A 5A8OA 3TTQA 4IISA 3MV01 4CUCA 1QI0A 2WVVB 5A6LA 2BNJA 2EO7A 2ZIDA 1JFHA 2E3ZA 4S3KA 3U57A 1WO2A 2CITA 3ZJ8A 1B30A 1CLXA 3DYPA 3GXMA 1EOMA 3VU2A 1NOWA 2CPUA 3GH5A 4AMXA 1JYXA 1UR8A 2YDRA 4M29A 2BY0A 4TUFA 4Z2HA 2F2HA 3PZTA 4UQEA 2FHBA 2J62A 4AMCA 4MDPA 4UQDA 3VTRA 1KGUA 4PN2A 3AIVA 2EAEA 3I3BA 1EXPA 5IHSA 2VZVA 1H1NA 2XTKA 4AIUA 3BUPA 1K9EA 1E40A 2F8QA 2C7FA 4UQ9A 2FH8A 3W53A 4OOZA 1HTYA 3VD9A 2Z1KA 1E6ZA 2VMFA 1QHPA 1H2JA 4AEFA 3ARTA 3TP4A 5BWFA 2YIHA 2DGAA 4EAMA 3O2LA 4AIOA 2YLLA 3ZJ6A 3T2OA 4P8WA 3OLEA 2J7GA 5A6MA 1US2A 1AQ0A 3WNPA 4P7OA 3MMDA 4CD6A 2JE8A 3W29A 4N42A 1KBBA 1JDDA 1OBAA 1DWFM 5CPQA 2YOCA 1UD5A 4QAWA 5BCAA 1W91A 1W3JA 1LWHA 1HJSA 3WSUA 2QMJA 1VFMA 2QF8A 3H53A 4P7RA 3LPPA 4D1JA 2F61A 3AI0A 4AYSA 2WMIA 3G6LA 3RO8A 1Q6EA 2DDXA 3ECQA 4FNQA 3QHNA 3N1AA 3AJ7A 1TG7A 2VZSA 1W2PA 3UETA 2YLAA 1D7FA 1L8NA 3NSNA 1XH1A 2BHYA 1OGBA 2F1BA 1B2YA 2G4FA 2WKLA 3PTMA 1KFWA 4DWSA 3EMZA 4AISA 3VPLA 2ZOXA 1HWWA 1JD9A 2D3NA 1JF5A 2XVLA 2AAAA 2XN1A 3AS3A 4EKJA 3PZNA 1H41A 5FCZA 2DPEA 1X6LA 3ALFA 1E56A 3M46A 4GXPA 4FNPA 1A3HA 3BCDA 1ZL1A 4L4PA 2W67A 1GNXA 2VTFA 4U5IA 4RE3A 1MVYA 3L2LA 2EADA 4PCTA 2OYKA 3QHMA 1W9PA 4AZ5A 1W2VA 4LYPA 2CBJA 1UKTA 3PZMA 2YJQA 1V3IA 3VIJA 3FY1A 3LPOA 4H8UA 1H5VA 5A8NA 3MMUA 3MUAA 2W63A 3VGGA 3NIYA 2ZXQA 2CIPA 4TVUA 1KXTA 3WQ5A 3HJEA 4P8XA 4F8XA 3VSUA 3CO4A 1CGYA 1GOKA 2J79A 1BVNP 4MB5A 3WQWA 2WCAA 1GVYA 3ZJKA 4HA3A 1JIBA 1QPKA 4AXNA 5LYRA 2EJ1A 5DT7A 3BVTA 3W38A 3B9AA 3BGAA 1E71M 3GH7A 2JEPA 2YL9A 3ZQ9A 1E1FA 3ARQA 2GJXA 2DIJA 4CGTA 3ARZA 1CBGA 3I3DA 5E09A 1E0XA 1K9FA 3PTQA 4W5UA 3CZ8A 3EMQA 1JYWA 1MXGA 2ZXDA 1P6WA 4GI9A 1TVNA 3WMBA 5JBFA 2ZE0A 2WCGA 1WDSA 3CHEA 2BVTA 1W9VA 3SCSA 3WEMA 2F7RA 4PTWA 5DF0A 4JFWA 1RP8A 5BXRA 2PWHA 1V3LA 2CBIA 2V3FA 1IV8A 1IZKA 2GUYA 3BVXA 4WSKA 2DSVA 2ZUVA 1GOMA 3N18A 3MMWA 5CZKA 2GSJA 2ZUSA 1HJVA 1SMDA 5JBDA 4ATLA 3M6DA 1KWKA 4M24A 3FAWA 5ABFB 3RCNA 4AZIA 3TONA 4J28A 3VM5A 4LXFA 1QNOA 2XN2A 3EJUA 3EMCA 4PMQA 1J10A 1QW8A 3VVGA 3NSMA 1UWIA 4F79A 1VB9A 3SCUA 4D6HA 1VAHA 4HPGA 5FKYA 1UASA 3PHAA 3NJ3A 3VKKA 4JL2A 3HG4A 2A3CA 3T2QA 2F7PA 3NDYA 4XZBA 1J0YA 2ZICA 1W3LA 5CGTA 4H2CA 2G3JA 3BAKA 2CHOA 1B3YA 2D24A 2CERA 4PMXA 4UFIA 3WUFA 2FH6A 5CLWA 1V0LA 3CBWA 4CD8A 4W5ZA 7TAAA 3WF0A 2VNCA 1NOFA 2X2IA 1UHVA 3LXCA 1MQPA 1KQZA 3N04A 4D6GA 2D22A 1G9HA 3DC0A 3OA5A 2XIBA 1JZ2A 1C8QA 4JCMA 3EDKA 2J7HA 4MTVA 1YQ2A 2YDSA 1UA7A 1VJSA 1VJZA 3VD7A 2FGZA 1R47A 3J7HA 1U2YA 1CZ1A 1FFQA 3FHAA 1QNRA 1WDPA 1F4HA 3K1DA 1QNQA 3MANA 3DX4A 4DWSC 5CXPA 1K9TA 4RE2A 1M53A 1SYTA 2V3DA 3D5HA 1Q6FA 1MW1A 3II1A 3BUQA 5A2AA 2UY3A 1XSJA 4FF5A 3RDKA 1G94A 2NW0A 3VIOA 5CSYA 4RL3A 1GPFA 3SUSA 4LYQA 1EH9A 2VOTA 2WMFA 2ZUNA 1O7DC 3AMLA 3CHCA 4W86A 4CD7A 5EB8A 1HX0A 2CBUA 4M82A 3EDEA 2F7OA 3K4DA 2OW6A 4GIAA 3VNYA 2WZIA 2FGLA 3HN3A 1G5AA 3LRLA 3CZLA 1ITCA 3K46A 1UR0A 3CZSA 3B8SA 1NP0A 3OGSA 2DH2A 3KEHA 2HISA 1LL4A 4V28A 4UQAA 1SZNA 2X2JA 5CSUA 5LA1A 2PBOA 1OIFA 1NARA 3WFZA 3N11A 3WEOA 1WZLA 4W7UA 3RM9A 1GW1A 2GJRA 1W1YA 2WHLA 3KL3A 4XUYA 4D6FA 2D1ZA 3SCRA 1XCWA 3HZ3A 2BV9A 1Y7VA 3CPUA 4TX6A 3BUIA 1BG4A 3SUWA 2J7FA 4ZXLA 5A6JA 4D71A 2WC7A 1ZBVA 4X9YA 1VFOA 1E5JA 1KB3A 1WKYA 3AROA 5EFFA 4P7QA 4FNTA 4AD3A 3VIHA 3CZEA 4B3KA 2J75A 1A47A 1H3GA 1BHGA 1J18A 1TQWA 1HJWA 4J3UA 2V5DA 2DSZA 3ZMRA 4R27A 2WVUA 1XHGA 2D3LA 1C92A 3T2PA 3AISA 3DYOA 1BYBA 3K8MA 3THDA 1LL6A 3FAXA 4U31A 3CMGA 4AD4A 2YBUA 1WZMA 1E6PA 4IPLA 2J4GA 1XYZA 1D2KA 2IUZA 3VGFA 3A47A 4JZ5A 1E43A 3AICA 3WL1A 4E2OA 4BQ5A 5C8BB 1JZ3A 1EGZA 3WH5A 2EPOA 3NYDA 1C3FA 1JI1A 3WELA 3KLLA 1KXHA 3WY4A 4E8DA 2QMKA 1VFFA 1E72M 2F18A 3PZGA 2GK1A 2CCRA 3TOPA 3AIEA 3AFBA 4EE9A 3U7VA 2JALA 3WL0A 1GZJA 2YFOA 4Q22A 1JZ7A 3WH6A 2JF6A 1C7TA 4PCSA 5E0CA 5E6ZA 2Y5EA 1V3HA 1YHTA 5I3DA 4GPNA 3MUZ1 3WNNA 4JFUA 3W6MA 4ACZB 3KL5A 3WMCA 4WK9A 3H55A 3LX9A 3B9EA 4Z2IA 2X2HA 4U33A 3PZUA 2YDQA 2W61A 3WBAA 4KWUA 5D9OA 3AHZA 5BYWA 1L0PA 3GBEA 1UKQA 4W7VA 2E9LA 3W25A 4FNUA 4OIFA 2FHCA 3EJPA 2EXOA 3WNLA 5A94A 5E9AA 3OZOA 4PMUA 4AC1X 1CXIA 3CUGA 5A2CA 1XSKA 5A8MA 3BLKA 2DSWA 5FOOA 3W27A 2YL8A 4OZOA 3GM8A 1QOXA 1UWTA 3N17A 1GONA 2XWEA 2PB1A 1CENA 1B3VA 3GXPA 4BQ2A 1CXLA 2PWDA 2GVYA 1XV8A 1CGVA 1VFUA 2XGBA 1JL8A 4Y7EA 2C8NA 3ZO9A 2EBNA 1CXKA 2OYLA 3WQ8A 3ZJ7A 1KBKA 3VNZA 2X0YA 1HVQA 4W85A 4BQ3A 4OBRA 4HMDA 2WVTA 3ZOAA 2QV4A 4PMRA 4H7VA 3BSGA 3GNOA 4W8BA 1GCYA 5I6SA 3BMWA 3MS8A 4OGZA 4U2ZA 5FIPA 2BY2A 3WBEA 3UCQA 2PWFA 4NSBA 4AIEA 3VSVA 4D6IA 4FNRA 4KGLA 3N13A 4GKLA 2OWWA 1QBAA 1E6RA 5D9MA 2UY2A 1J0JA 3VGBA 2G3IA 3S5YA 1R46A 2RGLA 4QLKA 1R33A 5IHRA 2ALWA 1EO7A 1PX3A 2OWCA 1JNDA 1KGWA 2XIIA 5AYIA 3AZTA 1TA3A 1NM9A 1CEOA 4BS0A 1BVZA 4HOWA 9CGTA 3W4RA 4NZCA 5JBEA 1DWHM 4DWSB 1E4IA 4GZIA 4LPCA 1W1PA 4UCFA 3AZRA 4P7NA 3CHDA 2XUCA 5EFDA 2TAAA 1GOOA 1O7AA 1J0IA 4FLSA 1OM0A 4WKHA 1WE5A 4DM1A 1R75A 2BY1A 4B16A 3WUGA 1ESWA 3AQUA 2QHAA 4E4PA 2VO5A 5D9PA 4J3SA 4FLQA 1WPCA 3SCNA 5HOSA 4MB1A 3GBDA 3LRMA 1E0VA 1OD0A 1JDCA 3W37A 1E3ZA 4HZ8A 2WVVA 3TTSA 1VF8A 3CUHA 1W3HA 4BQ4A 1JZ5A 2VR5A 1BG9A 1MXDA 2D73A 4CN1A 3L4UA 2ZX7A 2CESA 1SMAA 4V2XA 2PWEA 1TFVA 4UQBA 1KGXA 1G1YA 1HXKA 1UOKA 3OLGA 2ESCA 4HU8A 4HOZA 1CNVA 1CWYA 3ZR6A 4MNMA 4XX6A 1E6QM 3AIUA 2EPLX 3OBAA 5KEZA 3EDFA 5A6BD 2V3GA 2E9BA 1XRVA 2VQTA 4KRUA 2V3EA 3PN8A 3H54A 4DWSD 2AOSA 3L4ZA 3WN6A 1UYQA 4DO6A 1UA3A 3ZR5A 3WMSA 2WVSA 3PZOA 3WQ6A 2XGIA 5D8ZA 3T09A 1H4PA 2CYGA 1UWSA 1WAWA 1V3MA 3WEZA 2ZXAA 1GQJA 3PZIA 4WKFA 5FD0A 4W7WA 1QI5A 3PBGA 1FH9A 1XYFA 2YA0A 1E15A 1NH6A 1QBBA 1W3KA 3VIFA 3EJRA 4UOZA 1GQKA 4F9JA 3SCWA 1W1TA 3BUBA 1J0HA 3TV8A 4HA1A 5ABEA 1I1WA 4F66A 4BF7A 4AW7A 1V6WA 1CIUA 3FW6A 2G3NA 3MUIA 2J74A 4N0RA 2X1IA 4P8VA 3AXIA 2EABA 3L4WA 1NWSA 2WHKA 2WXDM 1QWNA 1JDAA 2J78A 3GH4A 3APGA 4NI3A 4R5EA 2Y4SA 2W4XA 5BROA 3ZSSA 2X8RA 4OBSA 1OT1A 2XN0A 1AVAA 3ZSTA 3ARRA 1AQHA 3M7SA 3DECA 4MAZA 1GVIA 3DX2A 4PTVA 3FNDA 1FH7A 2WC3A 1CLVA 2ZUTA 4EK7A 1JZ8A 3BAYA 2CEQA 1UWUA 5EBAA 2CBVA 3WNMA 2XG9A 4BCEA 4D6CA 4JFTA 5M17A 2W66A 5A6AA 4ML4A 4ZE5A 4LX4A 1G01A 3LMYA 3WD2A 3DDGA 4OJYA 5E70A 1ZJAA 5HNNA 2DT1A 1PZ2A 3SCVA 6TAAA 3DX1A 4GZJA 5TD4A 2Y2WA 3AS2A 5DT5A 3FXYA 3LXAA 2J7DA 1UG6A 1UD8A 1GHRA 1C91A 3D50A 1WNOA 1CGWA 3WF2A 3AIWA 3MO4A 3CGTA 3A24A 4NF7A 3VMNA 3BAJA 1J9YA 1ZJBA 2D0GA 1I1XA 2FYVA 3L4VA 4D72A 1ODUA 1MYRA 3DHUA 3ALGA 3WDJA 1US3A 1QI4A 1WDRA 3AIRA 3GXNA 5A6SA 3M07A 3RM8A 2DT2A 4BZYA 2X05A 3ARXA 1LJYA 3AXHA 3SURA 4UFJA 5GNZA 3AMKA 4U2YA 3DYMA 1DWGM 4PMOA 3TTOA 4UR9A 3BVVA 3CLWA 1E73M 3SCOA 5M03A 3AHYA 2DSKA 2YL5A 2EEXA 3AOFA 8A3HA 2VT0A 1JNEA 1TR1A 4UZUA 4MB4A 2Z1SA 2JF7A 1CXHA 3B9DA 2E8YA 3CTTA 1ZU8A 1Z32X 5KZ6A 3D4YA 1E3XA 5CPTA 1EIBA 2VZUA 3RJYA 2XHYA 3UG5A 3IAPA 4A3HA 4QLLA 3OLIA 2WMJA 1PPIA 1ZBKA 1IZJA 1TZ7A 2HVMA 3VIGA 1BPLB 4W88A 4H8HA 2E0PA 3S6TA 5GPRA 3QOKA 1EDQA 4CD4A 1KCLA 4CVWA 1UD4A 1EOKA 3CHFA 1BQCA 4U3CA 1KTCA 2X09A 2BFGA 1UR1A 2IGTA 3W81A 1CPUA 4PSPA 3BCFA 3GDBA 2BXZA 4Z2KA 1TQSA 3WD4A 4ZEPA 3CMJA 3F4VA 3VOCA 1J01A 4AMWA 3L4YA 5A8QA 3A4AA 4WJXA 2VZOA 3CUJA 3WH8A 5ABFA 2XVPA 3VD5A 2XM2A 4AZCB 1KR0A 3VDCA 2WPGA 3GTNA 1XC6A 1PS3A 4A3YA 3D51A 1JD7A 2YBTA 3ZIZA 1E6XM 1KR1A 3SEPA 4J3VA 1HJXA 3AHXA 4HZ7A 3QHOA 5AC5A 1E4LA 5HXMA 1F4AA 3EJSA 1CGTA 1PEZA 2FDMA 3AIQA 2WCSA 1DWJM 1DEDA 3OG2A 1RD6A 2GDUA 5CQ1A 2VRKA 3UR7A 2EPMX 3OLDA 1V0NA 4KGJA 3HG3A 1C8YA 1FHDA 4D6DA 4UOQA 1HKIA 3WF4A 4WIWA 3G6MA 3VUPA 2WW5A 2WLZA 3VMOA 1V02E 2JIEA 4B3LA 4MDOA 1XCXA 2PWGA 5A8PA 1UR9A 1SFSA 5I5RA 2JIWA 3HU7A 4TX8A 2VVSA 3W26A 4EANA 2ZUUA 1GUVA 3RMEA 1UZ1A 2EPNA 4GZEA 1QI3A 5BRQA 3PZ9A 1WB0A 2PBGA 4CCEA 3WDRA 1JYNA 4AY1A 3ARVA 1GOQA 3AMDA 5D4YA 2C0HA 4A4AA 1V02A 3K4AA 1JGIA 1HKJA 4KRTA 3VO0A 1EQPA 1WCGA 1HJUA 1N82A 2ZX9A 1UWQA 1FP9A 1ZBWA 4FK9A 2E8ZA 4H8VA 4PYSA 1JXJA 7A3HA 1B3WA 2WZEA 5HDRA 4CKQA 2PI6A 4JKMA 1UKOA 3BAIA 3WFLA 2O9RA 1EDTA 2ZX8A 3NSXA 3I3EA 1IT0A 7CGTA 3PTKA 5IDIA 1E1EA 3KLKA 4C7GA 3OZPA 1V0MA 1TE1A 4KMQA 3VSTA 4FNSA 2G41A 4UQCA 1ZB5A 1W9DM 4LGXA 1H0GA 1X6NA 4QLJA 3BSHA 4JCLA 4WKAA 1FA2A 4ACYA 4QDMA 2VZTA 3WY1A 4GO8A 2BY3A 3MU7A 4GINA 3U5YA 2NSXA 2E4TA 1H09A 2DH3A 1MW2A 3VILA 3WENA 3UG3A 2XVNA 4CU8A 2ZX5A 4KH2A 1LLOA 1E5NA 1R86A 3KE0A 3BAWA 2G8ZA 4JKKA 3CC1A 1RP9A 4U3AA 3T0AA 4K68A 2DT3A 1PAMA 1DWAM 1G0CA 4GO9A 1UQYA 1EQCA 4FLRA 1E55A 1AMYA 3SIMA 2BXYA 2WSKA 5M5DA 2XSBA 4JIEA 3W82A 1HKMA 1OIMA 4CCCA 5I23A 3S2CA 2WZHA 3F5JA 5EMYA 1NP2A 3OB8A 3T08A 1XH2A 3ARWA 2WC4A 1W1VA 2YFNA 4Z2JA 3WF3A 3VDAA 2BHZA 4HZ6A 3WDPP 2ZXBA 3KWXA 1DTUA 2W92A 1BGAA 3MV11 2FE0A 1DWIM 3CH9A 1JXKA 5A95A 1TUXA 4IUGA 4MAVA 3WUEA 5I24A 3MI6A 1XD1A 1BFNA 1EHNA 2VR4A 1Q6GA 4ZFMA 3OGVA 4MJ4A 1HP4A 1H49A 2F7QA 4TTGA 2D2OA 4B9YA 1EDGA 4AD1A 4CU6A 3EJQA 4H41A 2Y24A 3W0KA 2OW7A 1JI2A 3D3AA 1E6NA 5GNXA 3VD4A 2PC8A 1BLIA 2A3BA 4QCEA 3WNOA 5CPSA 2BVDA 4Z2LA 1GQIA 3VIPA 4AZGA 2CKRA 1PJ9A 1HJQA 2F1AA 1UKSA 5I77A 4ACZA 1W9XA 3AHVA 4YN5A 4UTFA 3JUGA 3N15A 2VURA 3L2MA 2WMIB 4HA4A 1ISWA 1FFRA 3W28A 5FL1A 2UY5A 1GORA 5A1AA 1VEOA 2J7CA 3VIKA 4W8AA 1ISXA 4MB3A 3LXBA 5BXSA 4WLCA 2CXGA 2Y8KA 1HL9A 2J47A 1K9DA 2J25A 1KXQA 2VX6A 4UFKA 3LRKA 2OLHA 3MKKA 1EA9C 1E6SM 1V6YA 5LA2A 1TQVA 5BRPA 3E1F1 4MADA 1UH2A 4CN6A 3WH9A 1NOUA 4URIA 1QW9A 4QCFA 5CGMA 3GNRA 1C7SA 3ZT6A 4AZBA 3WIJA 4GQQA 1QHZA 2VRJA 3KL0A 2DT0A 3AIBA 4FMVA 1TCMA 3WUBA 4S3JA 2J7BA
chains in the Genus database with same CATH superfamily
2UY6A 4XCCH 4WV1B 2G2RB 3BC9A 5EZPA 3MJ8B 4OQVA 4MJIB 5IV2A 4FXKB 2CCLA 2FVMA 3R8RA 2OM5A 2GFTA 2HJFB 2GGHA 1IILE 4PY8I 3RZCB 2KDGA 2CLEA 3U5UA 2P47B 2VB5A 1IFHL 4YHKL 3VXQB 2ZG2A 1OAJA 3VFOA 1EEZB 3LV5A 1P0NA 4NRXB 4QRRA 3RWJA 2WSPA 3GZAA 4X6DE 2NUXA 1A3LL 2CZFA 3APDA 3KH3A 1TPXC 1JVNA 3OMIB 3SDOA 4P4KC 2PDPA 5LNWA 2PCEA 1UM4L 4KVCL 4FX6M 1I1AB 3WTXA 1YN6A 1U8JB 3GLZA 4NPYB 2NT1A 2HG0A 4G6CA 1OHLA 4ZPVB 3V0SA 3NCOA 3PUDA 3CIQA 4PJ6A 3OJGA 2WYSA 5GZOD 4ORGA 1JGVL 1EHAA 2BC4A 5ENLA 5EU5B 4Y2DB 3GSRA 3AZSA 2W6RA 2DQJH 1GZ1A 3A5VA 2AV1B 3T8MA 3LQZA 2XC8A 2ARJQ 4K8RL 1L9PA 1KYFA 2HK1A 4UTUA 4TKWA 4C91A 2Z29A 4DZAA 2JB5H 3GR4A 4Y19B 3U2ZA 4YDVB 1CZ8H 4JY4A 4AMAA 1E0OB 5G5IA 1A3XA 3KOXA 4PU2A 3N42B 2EDDA 3PWPD 3TIMA 1BBDL 3TW7A 1JAKA 3ARPA 3ZUNC 1FNSL 2I9TB 4BSWA 3H23A 1JRCA 1DJNA 2YLHA 1TPWA 4Y5XA 3A6OA 2O4QA 5ABGA 5IQLA 3RKDC 2E9WA 4I4WB 3ECBA 3MCMA 3WAKA 1M41A 5KSUB 1F3TA 5BNXD 1L9MA 3KPSB 4G5AA 3UXKA 3IV3A 3MMEB 3U4AA 3OAZH 1S9YB 3D3VD 5FA4A 3CFJB 4HGKC 1C5CL 4Z7NB 2H1XA 1MEXH 4XPGH 3UO8B 4AC2A 4V27A 4ACPA 5D8WA 2L8AA 2WLMA 2XUWA 1KJVB 3FJNA 4NNCA 3NRPA 3W86A 3WXVH 3C08L 4GBDA 1KTBA 1G1CA 3B7RL 3DXAD 5JOFA 4JTSA 1LZOA 3NO5A 1UXMA 3CX5K 1EFXB 1HIZA 3OKNA 4AE1A 1JRHL 1N4XL 3WNKA 1U5VA 1VEMA 1O7VA 4OUEA 4M81A 1LT7A 3I85A 5D7KD 2EQDA 1FWXA 2Q7NA 5B7MA 4CMMA 4OH2A 2QJDA 3VCNA 3QFEA 4LCUA 2DYRB 2XWCA 2YA2A 4B3ZA 4H04A 4LRNL 3ZR4A 4QF1B 2OBGA 3UXLA 1AGDA 2Z2AA 4DWHA 4V11A 4XP4H 2OLSA 4CQDA 4XOAA 1CD8A 3DN5A 3MRMB 2ZA1A 1EP3A 1WRFA 4MJZA 4YXKL 3B0YA 5C71A 3VMPA 2DL9A 1L7IL 1WAAA 4FHKA 5K9KA 1MCPH 2VSDA 1OY0A 4NYLA 5IOKA 3IXTB 1T96A 4LF1A 1VDGA 3QEZA 1MHCA 4I48A 4P2VA 1UURA 1N55A 3QI9C 1BIHA 3PUGA 4NRZA 2W9EL 3JWOL 4JFXB 4S3AA 1NFIB 4AJWA 3DMMC 3ATFA 3FT3A 3DH7A 3UA4A 1NC4B 4IXHA 2VX4A 3WJLA 3A6CL 3BZDA 4X5RA 1MJUH 5DQJB 4GH3A 1DBML 4KXBA 5LBSA 1T5AA 3C09C 3LKSA 4G8FB 4CGUB 2CFFA 3OMZA 3MV9D 3BE1H 1TTQA 4C7DA 2PXYD 4XN7A 4ZODA 4NN5B 4C1LA 3FTUA 3JT2A 4PTUB 4MWAD 1UWXK 4MPKA 2V5LA 2P1FA 1D9KA 4ZMOA 3UBPC 3UNTA 1CFQA 4JHZA 4WUUE 1F00I 3FFDA 4LCQA 1ORSA 3MRRB 1VADA 5ANMB 4NC1E 2IWFA 3F7PC 4MQTB 1GYWA 4LIQL 4WGKA 2IKHA 1Q0XH 2VMEA 4MNKA 3ZTJG 4ETQB 1EEYA 4W93A 2NV2A 3WK2A 4GP5B 3S48A 4DEPC 2PF0A 1BD2E 2RFXA 3RYMA 3IJEB 3QV8A 1HEZB 4UTKA 4GCXA 4QHNA 1YPZE 2E3ZA 3DZ1A 5IB3A 4X7SL 4JPWH 4OFIA 4KQ3L 4UDUA 4JNYA 3A12A 3EUUA 1CLXA 5FO9A 1G6RA 4DNHA 2C1IA 1JNHA 1W5PA 2WNKA 1NJ9B 2VERN 4KX9A 3QNFA 3MJGX 1GS6X 3I3BA 1XX9C 1OCCB 4PRIB 3IKCB 4HLJA 2H3NA 2VZVA 3BP7A 1E6ZA 4I2XB 4QXGH 1L9NA 4GUPA 2X2GA 4HK0B 4Y16A 5J5EA 3L5MA 3GK0A 3QIUA 1E6OL 5I71C 1PHWA 3ZO0A 3UEZA 5E99L 4F5CA 3FO1B 4HULB 4OLYH 5D1QB 3U1SL 3SPIA 5E6IC 2YD2A 4MIMA 3C87A 1QKZL 5IZ7A 2MOVA 1CFVL 3RN6A 2OR9L 4UXDA 1UT9A 3HG1D 4QPEA 4LSDA 4F7KA 2ZAHA 3FU6A 4LMQE 3GIZL 2BOLA 4LVAA 3KVLA 5SX5H 2AAAA 1A50A 4QKXB 1GGTA 3P4NA 3ALFA 3SBWA 1U22A 5LAXA 3APCA 4AQAB 2DQCH 2W67A 4GXUM 3LD8B 1K77A 2H7WA 4RNFA 2LU5A 4XVDA 1AKJB 5CZVL 2B7QA 1I9JL 3QI9B 4G80B 3CU2A 1A3RL 2Z92B 4GQPH 2YJQA 3MLSH 1H5VA 4DYJA 2Q87A 1A6ZB 4YL4A 2EVIA 1CL7H 3THML 3LN3A 3S5LB 3FT9A 4OV5A 5LDUA 5BW7C 4MB5A 4RMTA 5CU5A 4UBDD 1ACXA 2TSYA 2XFXA 4UIMA 3ZYJA 2ZZ4A 5B39G 3GH7A 2NCMA 3MNZB 3DO7B 4A7QA 1DBKH 3C09B 2DIJA 2N1KA 3I3DA 5E09A 3E02A 2P26A 4N8PA 3JUYA 5AD0A 2BVTA 4JDVB 1NGWB 3CBRA 4NNYA 5A2FA 4MKNA 2YPLD 3BVDB 5IR1B 4GEJA 3MGTA 3T78A 1SMDA 4ATLA 1TNMA 5EIVA 3UJRA 3TVMD 2BO0A 2GGEA 3ZTNL 4AZIA 2QCDB 1QNOA 3NPUA 1GOHA 4MNGA 3ULVD 5GGUB 1VAHA 4CADB 4DEPB 3T0CA 1BJ8A 4HIXL 4JL2A 5CHNB 2B5IB 1J0YA 2XZAH 1X39A 1G7MB 2QKIA 1NDMB 3EKCA 2K4WA 1SJAA 3W39B 1B3YA 1OFOA 2EYRA 2Z0UA 4HWBH 4H0LC 3MTWA 1QSFB 5PCYA 3BMXA 2X2IA 3ASWA 3L5AA 2D22A 1SXSA 1N19A 5JHLH 5B39A 2V9TA 3AT8A 5C9XA 3FKUS 2PYEA 3S36L 2KH2B 4O9HL 3D0LA 2BNQB 2DWSA 2NZLA 2W60B 4M6AA 1QYGH 5IMOB 3H9ZA 1WDPA 2B39A 5A6TC 1HESA 5EN2A 3WJYA 1WV2A 1GG0A 3RDTC 4I0CC 1OP5K 1MW1A 4KKLC 4AZ8B 3S5OA 1O7DC 2J6EH 4V33A 5EH1A 1AHWC 3REVB 3TKFA 4LV4A 3VQ1C 2EDKA 2JKAA 4NBZB 3BOXA 4QNEA 2FJGB 5CSGA 5C08B 4NNPH 2HBVA 2D9QB 3FB8B 4A2EA 5E6IB 3BSZH 1AZ1A 3GXUB 3DK0A 4K8RC 2ZXWB 3HMXA 4K5PA 1XF4B 1LP9E 4YLCA 1XCWA 1LDPL 4K94H 1KRCC 1XQKA 1Y7VA 1AOZA 3HS0C 3CC5B 3N1FC 4ZXLA 4GS7C 1PSKH 3CQKA 1ORQB 4I77L 1F8MA 1LCOA 4IZGA 1MNUL 1J6OA 2FJHB 1I4FB 3CZEA 1NLBH 1DBJL 2CLOA 4GG6E 3L7EA 4HUUA 1JNJA 4D9LH 4DIAA 5JW3L 3DETD 2IEPA 3QJHB 4FQCL 4Q6JA 1D5XA 1BYPA 1E6PA 4IPLA 3L9YA 4GVIA 4YXHH 1EBAA 3F62A 4RFOL 5B22A 4JFED 3EXJA 3DROB 1W56A 1F3XA 5DBUA 2QKSA 2E7LA 1VFFA 2QNEA 3S4SG 3BOLA 3LN9A 4LBAA 4D9RE 4QSFA 4NM8H 1UWGL 2VN4A 2JALA 3E7JA 1HCFX 3PPSA 5HJGA 4ZMQA 4Q22A 3MCG1 3DARA 4MBOA 1UROA 2X4QB 1HHGB 4PCSA 1VH7A 1XIGA 3OGCA 4PLKD 4MZRA 3W6MA 3FA5A 5C0IA 1KJ2A 2XPGB 3H55A 2CIKA 3B9EA 4JDZB 3DO3A 2X2HA 1FXPA 3C3UA 3LKOA 1NFDA 1U8OA 4L1WA 3SJVE 5CJXA 4G6KH 1RZ8A 1XGTB 3QG7H 5D96C 5KVEL 4QHUB 5AYQA 3ARFC 2QADC 1CBVH 1G84A 1IVLA 2OMYA 4MSSA 5A2CA 3V5DA 1VJIA 3GM8A 3G04A 2YBRA 4FXGC 4LSPL 3SD5A 3APFA 4E9TA 1XLBA 4ONGL 2Z6FA 2FX8H 1H63A 1PFOA 1XPYA 2XICA 4F20A 3ZO9A 5DD3H 3VNZA 5AKVA 1DBAH 3EJYC 4YE0A 3O6FD 1PCWA 1ERNA 3E0FA 1EUAA 3DLQR 5LXGL 5F9WC 4CVXB 5ISZE 4UTJA 3NVDA 2G5WA 4QHLA 4OGZA 4Z0JA 3BPOC 1SEBB 2ETWA 2EILB 1GYLA 1EUNA 1DDHA 3RL2B 2ZOOA 1OSPL 3MFFA 3ZU8A 2Y62A 1YECH 3WLPA 1KGWA 3TEWA 2OXHA 1I8MA 4AX6A 4K2UH 2BP3A 1GGOA 4GZIA 4ADTA 4UT6H 3RDTB 4G6FB 1F4WH 1YE6A 1V10A 2CC0A 3WK1A 4XWGL 2GSMB 3PXLA 2QHAA 5K33A 3N2BA 4GQ0A 4OZHA 3WQOA 2AEOA 3GSNL 4NI8A 5K9JH 5HOSA 2HH0L 4JTLA 4G7SB 1Q94B 2UZXB 1OD0A 3W37A 1UEYA 3IE4A 3F7RA 1L6XA 3JWOC 3CUHA 2VR5A 3QORC 1P9MA 1IMHC 1Y0LB 3AGVA 1OGPA 1XF3B 3MOBL 1DORA 3UJTL 4LRSA 3NIFE 3IFNL 3HAEG 3OVGA 4B7IA 1G1YA 3GI9H 1FNEA 5AW5B 1CWYA 4ZXBB 4JY5L 2HX8A 1ZS8B 1Q2SA 3R4DA 1BLNA 4BQ9A 2NNRA 5KEZA 2EGZA 5L2JA 2V3GA 3GYRA 5DJ8B 4V1DA 4G8AC 4QRRD 5EYWA 5F7FA 1KMGA 3T71A 3S6DA 1NM4A 2V3EA 3HS0B 4GS7B 3WLHA 4N2LA 3PZOA 2XGIA 4H8QA 3FPXA 3AJXA 4GUIA 3WEZA 1T3FB 15C8H 4C6NA 3FKRA 3IV8A 4W7WA 4HAKA 4Q6XA 4ZZKA 3V1HA 4XO4A 1Q1JL 3MA9L 2DWTA 1VBGA 1IEBB 2G3NA 4FQLH 4N0RA 3BQ6A 2C19A 1DUYB 2MNJB 4DK5A 4FNLH 3BGJA 5C3TA 2Y4SA 3VFTB 5IHZB 2W4XA 4UTBL 2Z31A 5HP5A 4LAKA 3IJLA 4XVOA 4RZ4A 1T89C 4IWWA 2XG9A 4PM1A 4LNRA 4BCEA 4D6CA 5M17A 3HAEA 5REQA 4WCYH 1I60A 1UJTA 5FGCB 1HHHA 3NQKA 1A9BB 3RWHB 2A7NA 5MI0B 4TSAH 2GYIA 4WJEA 1Q72L 2ATSA 1GHRA 5KYWB 3GBNL 4R7DA 5C9WA 1PG7H 4XMLL 2H3DA 5GS0C 5E5UB 5D96B 5LHDA 3N3MA 5K4ZA 4PP1D 3ARFB 2QADB 1U8NB 1QI4A 4XX1G 3S2MA 3RM8A 4PW4A 3M86A 4GIPD 3MTXA 3SURA 1DWGM 3ESPA 1YXYA 2QQLH 1R3QA 1XIIA 5FHBH 1KGCE 1UWFA 1TR1A 2W0KA 3FRPG 1MCNA 4EAEA 5CBEA 2VSKB 2QVNA 3CH0A 1SOSA 1EIBA 4ZUTA 1YIXA 1CCZA 2IC2A 1CO1A 3CSBA 5F9WB 2YR3A 3U0WL 1EAQA 1MDRA 2R7EB 2V82A 2AXFB 4G43B 3KPSE 3BPOB 4K5OA 3MJ9A 3C5JB 4IEFA 3ZVHA 2XNAB 1MCJA 4U3CA 4XVEA 1DQKA 4AQEB 1EP2A 1CPUA 4Z7NE 4M6QA 5IB4B 4LNYA 3SGKC 3A4AA 3BG9A 4DOHB 2V5RA 3TJ4A 1W72H 2WXQA 4TS6A 5KAQG 1D9EA 1EJTC 5EOQH 5D55A 3K6FA 4Y7MA 1DQMH 1XKYA 4EIBA 3EPMA 1F4AA 5E0KA 3IU4L 1T1XA 3MRQB 5KZDA 1DEDA 3E9TA 4XP6H 3O3RA 2P44B 5EDSA 3L7FA 2PWUA 3FUNA 3FRPA 1C8YA 3R0UA 1KCUL 1X5HA 4OFPA 4YJZL 5AC6A 4F0HA 3QQ4A 1MEWA 2AANA 1W0VB 1F97A 4G1MB 1DFBH 3H42L 4RMVA 3B5TA 3B2PA 1UZ1A 3KJ6L 1YYLL 1A7OH 5GSVA 2V81A 3SQOH 2VLLA 5E2TL 1U91A 3OG6B 4KK6D 4KRTA 2B4CH 4IBVA 4S10A 4HKXB 2IG2H 4OZIB 1W3NA 3PDDA 2WO3B 1UKOA 3LZPA 1S3RA 3OR6A 3GDCA 2YEZA 2Q7YB 1I3RB 1CE6A 5GS1C 3GNMH 3QZWG 2WV8A 2DV6A 4U1MA 2WKOF 4A37A 2FAUA 4JGNA 5C0GB 2GSIB 3ESOA 1SM9A 2EDXA 5DK0A 5AALA 1AXSB 4KH2A 2ZCHH 5E00A 1KCSL 1DQDL 3UIZA 3U0HA 3UTOA 5J3HD 4D8PB 2X4TB 2KQNA 2FBJL 1WUFA 3FJ6A 3S34H 1E55A 3TZVA 3P1VA 3P2DA 4O52A 5IJCC 1HNFA 2H90A 1XIJA 1ZDQA 2O6DA 3NTYA 2PLTA 1AYRA 3GSXA 1D9KD 4WFGE 2VDKL 3V6OC 1B4EA 3TAKA 4H8NA 5E1IA 4NAFB 1ADQL 4IUGA 2HLAB 3EXTA 2OMUB 1JCKA 2Y06H 1KYOK 2CDFB 5E1HB 5DXWA 2BWQA 4DIXA 3W1AA 4LEFA 2EIEA 4R7JA 2V5BA 4XT1C 5DI8A 5DHVH 3U2EA 4DBUA 2X87A 4XOCA 3T3MF 3QZWA 1C5DB 1E6NA 3VKJA 5AVRB 1TTJA 1E9PB 4XO9A 4PFEA 4S2SB 3VACA 5F7DA 4Q32A 2CKRA 1AGBB 5ANME 4IGMA 5D2LB 4CQCA 1TVHB 4XZ4A 1QFPA 3RLSA 1XBVA 1A6TB 3R8BB 1L9TA 1E67A 4MB3A 2Y8KA 1S9XA 2J47A 1K9DA 1AI1H 1UXLA 1RIHL 5LA2A 4CN6A 3DVGA 3TESA 4YLWA 4XQ6A 2ZRXA 3QVQA 1YEIL 2DZTA 4PJIE 4JDEA 2K45A 4Y0GA 4NAEB 1BQHB 2J7BA 4Y16D 3VCCA 4OZFG 2VSCA 1RJLA 3QIUD 2A38A 5JNYB 3DK2A 1NCAH 1UEMA 3N44B 3DTXB 1EFQA 3NEEA 1IBDA 1UWEL 3O0RL 1M9HA 4FD0A 1FBIH 3HG2A 4IGNA 3GJFB 4LGSB 5FYKD 1HKWA 1Z9LA 2YD7A 1WCBB 4OD2A 1J1OL 1NBVH 2DUAA 1ZLSH 1B31A 2XU2A 1RIVH 1CFSA 2Y63A 3DVFA 5HI3D 4JGUA 1DHKA 2VC9A 2PZNA 2DQXA 1QUPA 2G3MA 3T6CA 3SUTA 2IANE 4UTMA 3EUDA 4FP8H 4NXSA 3VTMA 3OODA 1I3GH 4HKBA 1PMYA 3WDIA 3GKFA 3BESR 5C9RA 5KBNC 4HFWB 4IPNB 4N6EA 1L9RA 1TU2A 4X6DA 4KK8C 2A3HA 4MMZA 4IMEA 2J4WL 5GS1B 2ACRA 3PJNA 4WKZA 3S3SA 2W59A 4OZFA 5CFAA 4PRBA 1R3HA 5EWIH 2WANA 3APYA 4ZMYA 3PAYA 4XP1H 2FHFA 4ANVA 4Z95H 3DURB 3STLA 3ARYA 3NQMA 1XCTB 1IXNA 3C0QA 4P2QB 4JRWA 3S5NA 3UWUA 4IOIB 1F0LA 2AKRA 1ONXA 2DW7A 1JMZA 2O56A 1R34A 1KFCA 3EPOA 2ZOTA 3UPRB 3QXAB 1W9BM 3LKNA 5DQDH 2W07B 1KFEA 3PM6A 5KVDE 1CURA 1UBSA 2YW3A 4QLRA 2GI7A 1L7TL 2X4PB 4W87A 4AZ7A 3OVUB 1AMXA 2OTWB 4M51A 3P0XA 3ATEA 4M8QA 3K2UL 4GSUA 4JRYB 4XWUA 3VYLA 4O10A 1HSBA 3ITGA 3ILDA 4FL4C 4Y2OB 3C60B 5AZ2L 2P24A 1WFNA 1MCRA 4QNPE 2P3ZA 2EG6A 4PAZA 5FUOH 1KCXA 1AO7B 1OSZA 5G4HC 4TVCA 5D70H 4O1FA 4UV4H 2IKJA 2Y1HA 1VRXA 3QZ6A 4XO7A 1LO2H 4ENED 1G7VA 4I9WE 3EYSH 1AD0B 2B1AH 5LGZA 1R87A 1QX1A 4N90E 1TR9A 2R1WA 3GO1H 5L7XL 1XGPB 5IEKA 3C5ZA 4WWID 2PYED 3FFCB 4AJ0A 4K3JH 1X7IA 2D3JA 3LSOA 2J2ZA 2WWCA 2O4EA 4YSTA 3SYCA 2QDVA 3BP5A 2QCNA 4J3BA 4NN6B 1YNKH 1QSFE 3EDDA 3ZT5A 1AC6A 2I9UA 3CZNA 4RMBA 2ZVRA 3V9EA 1VENA 1R85A 2WHJA 3QJUB 3PPFA 5BRZE 4C8XA 2XG5A 3R89A 1M04A 4FEMA 3WUWA 3KTSA 1TKKA 4UF7C 3WE6A 4TTUA 2O7QA 4ZW6A 3MRLA 1S3KL 4NKMB 1U8PA 4YFLF 2WIMA 1K8IB 1NICA 5SV4A 4X9IA 2HFGL 4M7LL 3X2QB 4OLXL 3HFMH 3MYJA 1BOGB 2X4RA 3PULA 4KPHL 4YVNA 3VRJA 2BSBA 4DP8X 2ZX6A 1NCBL 1HXJA 4BFIA 2EKSB 4PSRA 5DMJB 2V2TA 3TTEA 3ARDA 3UTTD 2FL5B 5ICXA 3O45B 3CFBB 3FCTB 3A21A 3C6LA 3TA3C 3NUKA 5I1AA 1QNSA 4QP0A 1HKKA 2R29H 4ZO8A 2FUTA 1N0XH 4GMSL 4WFEE 1A7NH 5IBTH 4Z7UA 5AB3A 3WF1A 4D1IA 2VMDA 1XPGA 4M5ZL 4WW1B 3QR3A 2OYPA 1U33A 1J6PA 3OPSA 3FTGA 2X2YA 2VX5A 5F44A 35C8L 3K7UA 1HILA 1CECA 4BWWA 2Y69B 3HCVA 1O5PA 3FO2A 5GS3A 3CHRA 1JMXA 1YJDH 2Z35B 1K7EA 1S9KC 1E70M 1F6AA 3KJ4B 4UM8A 4PLNC 3N9SA 3M0YA 1A2YB 5GRUH 4G5DA 3W2MA 1DANU 5AYBA 4DXVA 4LLDB 3T4YA 3U9UA 2VC6A 5I30H 2B77A 4HPXA 1L6PA 3QQ3A 1P1MA 1JZDC 4PRHB 4YTUA 1MH5B 1DJYA 4KI1A 3D18B 1NUNB 4JGJA 2FMNA 1I8IA 1FZOA 2V33A 5LIUX 3CYJA 1EEXA 4HBCL 1WCQA 4TUJA 4FQ1L 5CIPH 1L8PA 1X5GA 3ZGHA 1AGFB 2EH7H 4HW6A 1GTHA 2WAGA 3GHBH 4KY2A 5E2UL 1KCKA 4WJ5A 3V6ZA 3QGVA 4CC0A 3MCOA 4XBGB 2YCIX 3QAQA 1X8FA 2A0LD 2HYMA 3VRIA 2CWNA 3VNMA 4AEHH 4XVJL 2HQAA 4OQTL 4IISA 1FH5H 2P8MB 1S78C 3P3UA 2G50A 1LILA 2R8SL 2A2QT 1KDJA 3SYPA 1KC7A 3OHMB 4MDRA 1S9WB 4ADGA 5K9CA 3NFNB 4M29A 1REIA 2YPKA 3FRUB 4GY1A 4JX4A 5I15L 2HCVA 1YPZA 1MY5A 3ABGA 5FYLL 4G42B 4BZ2A 1NWOA 3GSNA 5CEYB 1UOWA 1SW3A 4GSXA 5B38G 5IHSA 1TPFA 4O53A 4PRAB 4KRMB 4FZIA 4OOZA 2GTWB 1R5IB 1YLVA 1O5QA 3DPDA 3WLQA 3PAOA 2DGAA 1BM3L 1ML1A 4OJFL 4JN2B 1S5HA 2D2HA 2XKNA 3L66A 4HD9A 5EF1A 1OBAA 1OYCA 2DLFL 5CPQA 5CCKL 5EBWB 3CDCA 1I2QA 2BX7A 2BP8A 2OPJA 5J0BA 4KXDA 4OJDH 1DJQA 1Q6EA 1AGCB 3QHNA 1O7DE 4V1DD 2VYRE 2R0LH 3WLWD 4WFFD 4DZIA 1QLRA 2SEBA 3SDYH 4AISA 2J1YA 5B1CA 1QEWA 3BW4A 2I9LB 4ZFZA 1FBAA 4XODA 3TA3B 1FNGB 4FNPA 3VG0H 1GOXA 1KW1A 4URTB 4IMDA 5G55A 5B38A 2NXZC 1E5ZA 4UTTC 4PCTA 3FJTA 4JZNB 3K6IA 4FQXA 1MCWM 3UC0H 4BHUI 4DAGH 2Q76A 5CH9A 3UPWA 1NGQH 3TFBA 5A8NA 2Y22A 2Z31D 1TFHA 3QC5X 4IJBA 4WU5B 5E7BA 4Z3HA 1GXEA 4KHXL 1R3JA 4P8XA 3HZVA 5EIIG 4YL2A 4OKVA 3W23A 2WCAA 3QH2A 3VFSA 4HA3A 1JIBA 4HD5A 1QPKA 3TNNB 2EJ1A 1FCCA 5DT7A 4PJXB 1SJVA 1FAIL 1E71M 2PGEA 3KLDA 3NCBB 3H2MA 1CBGA 4AGPA 2X3BA 2G4EA 3EMQA 2MRYA 3ILQC 2ZE0A 3SJNA 4JUTA 1WFOA 2FVNA 1JGUL 2GEEA 3OKEA 1NGZB 3NA8A 3KDPB 3PNWA 1FVEB 3MMWA 5CZKA 2IBZY 1JF1A 3M6DA 2QCFA 2BSRA 1OB1A 1IT8A 4GAGL 1XTLA 4JM2A 1MFEH 5A40E 4KCVA 1WFTA 1QW8A 3DFNA 1SLVA 5IM7A 4YHLH 4HPGA 4MJ5B 5KVDL 4ERIA 3MCKB 1FCUA 2HK0A 1OEPA 1PYWA 4MXQD 5KWYC 3PWVB 3BG3A 5EIIA 4FFVD 4N6FA 5AW2B 2A5HA 4GQ9L 2EIDA 1EDYA 2JJSC 1QFHA 3LZ5A 1JNNH 4F7PB 4HHLA 1KN4H 1DVQA 3GB7B 1RK0B 4J35A 2KERA 4GXFA 1XLJA 1A66A 5F7KC 3K74B 3FHAA 5FSDC 1M53A 3WIHH 2V3DA 2A1YA 4FF5A 1ZAIA 5HGHB 3E2VA 2OELA 5CSYA 1G9ML 2E6FA 1FHNA 2ZUNA 3B83A 2HT3D 1MVUB 2E6QA 3UPAA 4TR9A 2ZCZA 3CV1A 2OGYA 4G8GB 3CNKA 1OC5A 4DOHE 4LUYA 1G5AA 4RW3A 3SQBA 5B4MC 1FA4A 3KEHA 5AHMA 2ZRVA 1KULA 2PBOA 3D2TA 3WZ0E 5JW5A 4HT1H 5HI5D 5CBAB 3GZPA 3KL3A 4XUYA 2ZZ7A 1RERA 1XWVA 2XWTA 5CSBA 3RTQB 1P7BA 4I90A 1QEXA 4XNMA 4XWOC 5A6JA 3OZMA 3OX8A 3DFTA 1VFOA 12E8L 5E23A 4GAJH 4HH8A 4GRSA 3NZHH 4M7TA 4A2SA 3LZQA 1LP9A 1SHXA 3TZNA 1RXLA 2F8OA 1NGXA 4JTQA 2EDEA 3RAJH 1Z5LA 2ENJA 1I1AC 1LEGA 2EDNA 2F9RA 1MAJA 3QXDA 3WL1A 1MNZA 2X7LA 4BQ5A 4YJ5A 4G1KA 4GG6A 2PP0A 1FLRL 1QLEB 4OZIE 3U3HA 4B53A 1SDAB 4MZIA 2FIRT 2AJYL 3DKLA 3U8GA 2ZRWA 4OIBA 3PY2A 2AQSA 1V6TA 3U7VA 1CK0L 3V0WL 5I0ZA 4FG4A 4AW4A 4ZQKB 1JZ7A 2OP4L 3WH6A 1NL0H 1BFOA 3QNXB 4LIQE 3CFIC 3TZVD 1TSRA 3VNDA 1Q9KB 1GGYA 1IIIA 3MUZ1 2PSNA 5CJOL 4ZNEE 3KL5A 4IU3B 4PJEB 4QEGA 2PW2A 1X5IA 4QYAA 3ES6A 4KROC 4TULH 4AEIL 1UJPA 2V5JA 3MRKA 4LAQL 1IX2A 1LLWA 2WXGA 1SJCA 1TCRA 3OC8A 5I1DA 4WW2F 3OAUH 1DQJA 1PKOA 1CXLA 5ALCL 2GVYA 3HN8A 3FOKA 3H7UA 2Y6SD 1PD1A 1BEYH 4QJ4B 2X0YA 4NQCD 4YX2H 4BQ3A 6ALDA 4JQ3A 1WTGT 2HPOA 3OKKA 3I9PA 4QX4A 4KEZA 3N19B 4N8CL 3I7RA 1T7YA 4HZMA 1TZGH 4G6JH 5IMLA 1MCDA 4NSBA 3DVNB 4OGAD 1I7TA 1COBA 3N13A 4D0DB 5D9MA 3ZHLA 1XG3A 1WJ3A 3O2DL 3IJYB 2UXTA 1MWAH 5JW4Q 1A4JA 9CGTA 2HV5A 5JBEA 4NZCA 5E0QA 4L8CB 3BZ4A 3TFKC 5D2LE 4RISL 4UC5A 4TU1A 4Y2WA 2A21A 4LUTA 2RAMA 2AXGA 4FLSA 1GL4B 5EORL 5EF2A 3AQUA 3HPAA 4JDTH 1CFBA 4XPAH 3UWYA 1WPCA 3GMPB 2BBFA 3UGXA 1E0VA 1IC5H 1LYXA 3N85L 4YEEA 4HXAL 3UZEC 4FG6C 4LSTH 4AENB 1XZ0B 4R96B 3ET9F 4ZR8A 4UQBA 4DELA 4DO7A 1UOKA 2XJLA 4HOZA 3MACH 3X14A 4ZTYA 3UROR 2CJUL 4JQXC 1NBQA 3V4VB 3U9PL 5I6OA 4XZHA 5D7LA 5AFDA 4ODSH 1ZLVK 3ZR5A 4PPTA 2EXSA 3CWOX 1MPAL 1OGAB 4MYPA 1OPGL 2Z34A 1JV5B 3IUHA 3E8VA 1V3MA 4WV1A 1EZVY 2IALA 2G2RA 1Q9LA 3MJ8A 2H8PB 2OX1A 2WTPA 4FXKA 2NUPA 3CVHB 1WZ1H 3K5RA 4B90A 3UXAA 4L3CB 3C5SA 3BD4A 4AIZB 4AW7A 5KW9H 3RZCA 1J5OL 4Z7OE 2W80C 4J12A 3FO0H 3GH4A 1ZP3A 3IFLL 3VXQA 3QWRA 3GPSA 1RCQA 4R26H 4HB7A 3B2VH 3RJDA 4JY6B 5IBXC 5ELIA 5C0DA 4PTVA 3FNDA 2ENYA 2JI3A 5DD6B 2XRAH 4ERSH 1YDPA 1IVTA 2D7QA 1U8MB 1YDVA 4IICA 4L3EB 4OJYA 5LCVH 6TAAA 2P88A 4Q4EA 5CP3A 2YGNA 4UB9A 2IGLA 1P7TA 3FSUA 4MNHA 1P7HL 4NPYA 4GOSA 5DRXB 2OQJB 4KROB 5T3XL 4NN5C 4P2QE 4ZPVA 3IRSA 1NFKA 5IQ7H 4JOMA 3CGTA 2LLEA 1Z3GH 5C7ZA 2H3XC 1MG3C 4D72A 3B03A 5EU5A 4WDIA 2NY1B 5FJJA 1XBXA 1R2SA 3LS4L 1IFGA 2AV1A 3W07A 3KYNB 4L6DA 4BBWA 8A3HA 2VITA 3V6OE 5I76A 1N8OE 4ZQNA 4GYBA 4XP5H 2J88L 3C86A 5EA9A 4ATTA 4JRYE 3KBHE 2Q01A 1DV7A 3GHEH 2WMJA 3MLWH 1KRAC 1DXIA 1J9RA 2IQDA 3HB3B 1A64A 3EADA 4NJIA 1AO7E 4YWSA 4F7TA 3CHFA 3KPNB 1EX5A 3PCYA 1T4KB 1VKXB 3HGJA 4TM9A 4Y5YC 5GGSB 4X8JB 3LQLA 4YTRA 1EGJH 5KSUA 1QABA 5I6XB 3KM8A 3MRJB 2ZTJA 1LBFA 3WH8A 4EOWH 2Y25A 1KR0A 5T3ZD 1CI5A 1BQSA 4RK8A 1HGWA 2P49B 2WO5A 3CFJA 4IUOA 3EKGA 3FFCE 5B1JA 2DJUA 4KV5F 1MFMA 2YHGA 4WI0A 5HHPA 4UMSA 1B9KA 4RW5A 5EEYA 5FO2A 2CLRB 4X83A 3OLDA 3VXME 5EOTA 3E49A 3BO9A 3LIUA 2H8XA 3VQ2C 2MMXA 5D1QC 3GRWH 1XCXA 5F2GA 1RVGA 1J5CA 2JIWA 2AJ3B 5CSSA 1IE7C 3C9NA 2X88A 4AY1A 3AMDA 2JKWA 3ARDD 4QRUA 4MKTA 3PDOA 3C6LD 1O7SA 3RAOA 3DGBA 3P11L 1H7NA 1KIQB 1SLUA 4BUGA 3HI5L 2VKXA 3EH2A 2ZX8A 3H7BA 1XL9A 2F8VA 1QASA 5IDIA 1C5BH 3RCMA 3LD8C 1W37A 4KMQA 3R1GH 3P8IA 1J8HA 4LGXA 3QVAA 3BSHA 4DW2L 3VI3F 3MNVB 3P73B 1WOBA 2C1PA 3RX2A 3QUKA 4HT3A 2IH1B 4QDMA 3MJYA 1M3JA 4B95C 2BY3A 5I6NA 3VILA 3SFKA 1W80A 1E5NA 4MF4A 4XMXA 5KVEE 1O6SB 2QGHA 5E2VL 3NQAA 3U2JA 5BO0D 3BKCH 4GO9A 2RGSA 4K8GA 1JHLH 4P4KA 4MZ2A 1M6OB 5CEZH 2WSKA 4IS6A 3UADA 4DTGL 4QR7A 5FDWA 2QFRA 4I3SH 3VFGL 3Q5YA 3T08A 5J4MA 2Q7AA 4ECLA 4HZ6A 3HC4L 4KTEH 4JE0A 3CH1B 1LDCA 3KWXA 5BVJB 4BXSV 1N0LB 1NFIA 3D6GA 1BXNA 5LBGA 1C9SA 1V7ML 2UVEA 4PL1A 1GHFH 4ZFMA 3OGVA 5F1NB 1NAKL 2J5WA 3H9HB 1HP4A 3L17A 3O6MH 1NC4A 4JFQB 4CVZB 4HYTB 2P5NA 1G9MC 4OCSH 4A29A 3QZLA 3TAOA 4ABVA 1JDEA 2V5TA 3MUGA 2HJKB 4HIHB 4O13A 3KPPB 2APSA 4PS7A 2WXMA 5CCJA 4G8FA 1AHKA 3HQ1A 4Y9BA 3SDXE 2B5IC 1GTFA 3DI3B 3WYRA 4PTUA 3L9RB 2EH8L 3LERA 3I6SA 2I69A 4XMZA 2IWEA 1YW1A 5BXSA 3R1ZA 4Y5YB 3I74A 2ZRUA 2VDRH 5E9DE 3V9CA 4KCUA 3LRKA 3K71B 5BRPA 5GS0L 4GZ7A 3E8UL 4NJAL 3WH9A 4WI5A 1ZCCA 3GNRA 1CW2A 4ETQA 2Y5SA 3ZT6A 2IFFH 4A8RA 3EOUA 1C1EL 1QPQA 3V6FB 3O3EB 3W7GA 3ROLA 2BCKA 1IF2A 5D2NB 4P5TA 1QNZL 4CNOA 1LO3L 3QZAA 4AXWB 2GWGA 3FYOA 1T22B 3BXWA 1DJZA 2Z7WA 4UMCA 4PJIA 4ZUWB 3P2VA 3IJ8A 1EYWA 3TBBA 4GJJA 4QFUA 1QO3A 4J23A 2PN5A 1F11A 3IKCA 4KZ0A 4LPTA 4OF8A 2FR4B 1BSIA 3QZEA 1QK0A 1S46A 3VCLB 1KSRA 4UTAL 3U2SB 3PGCB 1NVMA 4QOKA 4HK0A 3BH4A 4JL1A 1ESOA 3ASNB 3S5LG 4NNAA 1AQFA 2XIMA 3WDHA 1W32A 1JN6B 4FQXD 2Y0SA 3L3OB 4MY9A 2IANA 3V1PA 1T7ZA 1SJHB 4DKEL 4JTEA 4MA7H 1BF8A 4C6KA 4XI5C 2QDHA 2V68A 5D1ZD 2YXMA 2Y6ZA 4AD2A 3MT1A 2FTWA 3ES7A 4G3YL 5LGJB 1ZFJA 3D33A 2DQDH 1PYMA 2XXFA 2DM3A 1YN7A 3QDGB 4PMYA 3B9KC 4EWND 1GQLA 1HQ4B 1RY8A 2QCHA 1KEGH 4FXTA 3WHE1 3A4WA 4IOFC 2LFEA 3PQYB 2TMDA 4BQ6A 3M0KA 3FUHA 2NY6D 1GC1L 2WNWA 3MXVH 1JPSL 3KWWB 1K8XA 4KI5D 5I6KA 5DMGC 4NZUH 4PJXE 3BLPX 1DIDA 3DMMA 1Q6RA 4XCNA 4NKOB 3S5LA 3FK3A 2QQ6A 4E2DA 4JM2D 1XD0A 2EZ0C 5IMMB 3L1GA 4LSBA 1N3NA 3B7YA 1IEWA 4Z76A 4A63A 2BOCA 2FVLA 2HCZX 2VABA 1V77A 5IJKA 3WY3A 2NQ5A 5CLXA 1RCOB 5BOEA 3USZA 1I8AA 2TSBA 2XWDA 2EE6A 1EC9A 3PHOB 1A5CA 4KZEH 4JFSA 1MFDL 3L4TA 4JG0H 3IWVA 4JDVA 1E3FA 5J1AB 5C92A 1PIGA 3VZYA 1GAFL 3Q9QA 3TYCA 4G5ZH 4LJ3A 2PCXA 5FXCH 5IR1A 2BSTA 2YCJA 3GYCA 1IM9A 4LEOA 5GGTL 1VLXA 4K15A 4WI7A 5JIHA 2Z7ZA 1P1VA 4PGDB 4KK5C 2VFDA 3DUHA 2CKBL 1FC2D 3ZDYF 5K69A 2VD8A 2IJ0C 4R4BA 1R7AA 1OAXL 4LY8A 1U8CA 1W15A 2CIIB 5GGUA 4CADA 2QJJA 5KVMC 1RZJH 3QJFB 3F6JA 3EYQC 2VMJA 3EYPA 4HC1H 4FFWD 2PTZA 3W39A 4DN4H 1R3RA 1ZVSB 1QSFA 1TFPA 2I17A 4FAAB 2L04A 4IGBC 3MO1A 4DKFL 4AIXA 4ZUUA 1EAOA 5BRZA 1ZE3H 2HDJA 4PJDF 4AV0A 5A7EA 1QOKA 3U7YL 3CCHB 4IIBA 1GJWA 5LGHL 5IMOA 1LXMA 4ZXBC 3CEUA 3W84A 4DVOA 4IHBA 1EMTL 2XSAA 4G8GE 5CN3A 4YLQT 5D04C 1XS2A 3L3IB 1IEVA 1ZD6A 3RUGF 3REVA 4IRZH 2JJWA 4P3CH 2DIEA 4HQVA 2CO3A 3ILEA 4RBPH 5DCEA 2DSUA 1Q13A 5KS9F 1CE1H 3FB8A 1WISA 3UJJL 5E6IA 2OL3A 2BSDA 1JPDX 4S1QL 2JQMA 2H2PC 4HKJB 1N7ML 4MCYA 4UFHA 1O9ZA 4NZFA 3KBFA 3B9KB 2QJMA 1GW0A 4JAWA 4HOXA 1PHQA 1PF3A 1A7PH 1ORQA 2GKIA 5EEXA 3O0LA 1PTZA 4M5YH 1I4FA 3W88A 1WDWA 4MZ1A 5J9PB 1RULH 2PUQT 3UZJA 2WJFA 3PGDA 2HX7A 3TYFA 1MHHB 1H62A 5DUJA 5MI0C 3QJHA 2OSYA 4PBVC 4U6TA 1P5BA 4PGJA 1LNUA 1TQXA 2XM1A 4LSUH 4JYEA 4JHAL 1ZAHA 3LNDA 1RPKA 1WGOA 3V5CA 1A0QL 3DROA 4XNYL 4ATWA 3S37X 3ZTCC 4ROQA 3FUEA 3EFOB 1GA2A 5BW7A 2EDQA 5LNDA 5BV7L 5F1SA 4PJEE 4HWNA 5I18L 4NZ4A 1U3ZA 3BGGA 1TZAA 3IN0A 2YR1A 2XV0A 4I85A 1VBUA 1KM3A 5C0AE 2B31A 1OT4A 4G11A 1YMMB 3TTQA 4FS0A 1U8KB 2BNJA 1H15A 3KPQB 2XPGA 2ICEC 2HROA 1ZHLA 2MOGA 4MDJB 2WINA 4BE5A 4OLZL 2BY0A 2FLBT 4N9BA 4TUOB 5KZMA 4OIIL 3BLDA 2HTLC 5I0VA 5IESL 5A16B 3P0WA 1NCDL 2GFBB 2VMFA 4AEFA 2BRRH 3BISA 2YLLA 1T1YB 4IMCA 1R3WA 4IGBB 3QHZH 4MHHG 2BZNA 2DORA 3GVGA 3R8QA 3PGFL 1G9EA 1W0WB 5BCAA 3VFLA 4KKBC 4XN1A 3E80A 5CBBA 1OWRM 5DHDA 1BKHA 4FF7A 3KVJA 3LM3A 3NJNA 2FPYA 1UPMB 3HUJB 3ECQA 4G1EB 2R2BA 1TG7A 4RFEB 1W2PA 4N2AA 2MUCA 4GW5B 4U1HA 5D7LD 3GFXA 1KIRB 3PTMA 1DSWA 4MJIE 1Z6JT 3RDTA 2ZRZA 5AVNA 1LTXA 4JNXA 2CW6A 3CFDB 4G9DB 1AHWA 1NDTA 2A73A 1EAPB 4EXBA 1Q94A 2UZXA 3N4FA 3RZCD 4BEIA 1Y0LA 4AZ5A 1Q0YL 5BOPA 1XF3A 1UKTA 4ZK8A 1R2RA 5IUCA 3NQDA 3QWRD 3MMUA 1YADA 2JKRM 4ALAL 4K3HA 4HIIA 4GRWB 5EU7E 4QGTA 3KYKL 2WOBA 3H0TA 2NUTA 3RX4A 3HS0A 4K36A 2H2SD 1A53A 3FULA 3IXAA 1T3FA 4B3EA 5JZ7D 1JJUA 1H51A 1A6WL 1HFBA 4TUKL 1K9FA 2CH8A 3O8AA 1JGMA 4TLKA 4GYFA 5G2HA 1IEBA 2XWBA 2V3FA 3OOQA 2D69A 4LVEA 4DLMA 3GVQA 4AVNA 3CAKA 4WSKA 4LOEA 4G9FB 2YAHA 1IEIA 5IJDC 3SR7A 4M24A 5EU6B 4Y19E 1TTCA 2XN2A 4HQQL 1EHKB 1TTPA 4LF2A 5CPOA 5HVFB 2YO3A 3CXOA 4OVUA 3N55A 3HRPA 3GY1A 3RWHA 3W56A 4PMXA 1O94A 2M2DA 4PR5B 7TAAA 1FP5A 4Q7DA 2A9DA 2ICEB 4G9PA 2FFIA 2A6IA 3VFMB 1G9HA 2LVEA 3HS8A 4XN4A 4U1LB 3GR7A 5H6HA 3ARFA 1U8NA 3IDXH 2DEYX 1ID5I 4X98B 2AL2A 2EYSB 4X4ME 1BZ9A 4FXGA 3GHSA 1F4HA 3RR1A 4S3DA 3IE9A 3BOVA 3D5HA 1AY1L 1UB3A 2XG4B 4S0HA 2GTZB 1M71B 1GPFA 2WMFA 1DQLL 4ZDHB 1J4EA 5C0RL 4ADSA 3EDEA 2CLZB 4LLVA 4YHOH 4DGIH 3LKRB 1ME9A 3HN3A 2E7DA 1NP0A 4JN6A 4IQEA 2GGIA 2Z8RA 2DH2A 2XNAA 4UB0H 5D1ZI 3VXRB 3ZKND 4AQEA 4BFBD 3RXZA 1TO3A 1SZNA 1FCGA 2O6FA 2AP2A 3M0VA 3RU8H 3ILPB 2D1ZA 1AYOA 2BV9A 3VUSA 2G5BB 3BUIA 1BG4A 3GHRA 3SUWA 4FX7A 4YSDA 2NTFB 2E56A 4O19A 1UB5B 1GC1C 2DZBA 2FNBA 3FVMA 4B3KA 4A2GA 2HZGA 4QTHB 1J18A 1HJWA 2GJNA 4N2YA 2EPHA 4LAJH 4LOUC 2D3LA 3QORA 4M62L 4XO8A 4PJHF 5AZUA 4K7PX 1RSFA 1J8HD 3N0AA 4UUJA 2VZ3A 2J4GA 1E43A 2VDQH 1CD1A 2D03H 2EPOA 2DRUA 4MRBA 1C3FA 4E0RA 3F5WB 1W0VA 4G1MA 1TJ0A 3CG8A 2WXNA 4ODVH 4WI2A 2OMBA 1P5UB 4FKEA 1D5MA 1BQUA 4P4KD 5I1IH 3CVCA 4OZIA 2DI7A 2VDMH 4WK9A 4R53A 4N8UA 2HMIC 2CNZA 1AS6A 5K9XA 4QS6A 5F1IB 1IEAA 3AHZA 3H2OA 1VR6A 4YE4L 5AW7B 1R0AL 4ENLA 5DO2D 4OZOA 4KIEA 1NC4D 4WFGD 1AXSA 5CLYA 1U8HB 2VZ1A 3MLTB 5DEGB 3C60C 1B3VA 1T89A 4YS1A 5L9DH 4UI2A 2YK1H 1XXXA 1F4XH 4K6AA 5FYLE 1N5YH 1JSYA 1QLEL 5CZRA 3D69B 4MZYA 3WK0A 2D31B 4QE1A 2FBRA 1URIA 1EJ8A 1OJXA 3LUTA 4POUB 3A67H 2G4GA 3AU1B 4C4KT 1KA9F 3FB7B 4TSBL 2FATL 4IK6A 3RKDD 4KGLA 2WJ5A 4YHIB 4IMGA 3NRFA 2OMUA 3OHXC 3IKKA 2CDFA 1HJCA 2XIIA 4ZW5A 1EVTC 5FV1L 2B0SL 4HOWA 4PYGA 3W9ZA 1E4IA 4NN6C 3EO9L 4KVPA 1PZCA 4FJYA 1C5DA 1VHNA 5GJTH 6XIAA 2FEDD 4P5TD 1E9PA 3HBZA 2VFGA 1ODAA 1YLBB 5TPWL 3VXSB 3L7RA 3LRMA 1VF8A 4J8RB 2VXVL 5D2LA 1RSYA 4RWHA 3VK5A 2BOEX 1TVHA 1SMAA 4WSHA 4PRIE 3PWUB 4NQDB 1WICA 5I17B 3W7QA 2UV8G 4I2XE 3SGKA 4NO5B 2BFVL 1YNTF 3V3WA 1Y1DA 1QSEB 4L1HA 2PFHA 4QOKD 4NAEA 3HI6L 1AP2B 5D1QE 5JNYA 3LMJL 5L0QC 4QM1A 1Q6LA 5AVHA 3VIFA 5JPMB 3SCWA 1R3TA 2DYPB 1UA6H 1URZA 3N1MC 5B21A 2IAND 1KRBC 3HMJG 5FF2A 2EABA 1AC0A 1RR2A 4O58L 2IV8A 5A5WA 1MLCB 5BV7C 3AB0B 5BROA 4YO0B 4O1EA 2XN0A 4NENA 3VFNB 1JZHA 3KUMA 3IDIA 1RURH 2CEQA 5LO7A 4OUUA 3V5HB 4QG6A 1LMIA 2RAGA 3HTLX 3MYPA 1IBZA 2J5LC 3KJ4C 3V4VL 5FO7B 3H4HA 3DX1A 3UY7A 2BNRB 1EERB 4A68A 3OWEA 4ZW3A 1QR7A 4Q6KA 2IPWA 3D50A 5GS1A 1JZFA 3S83A 1RSCA 3UXDA 3TJEH 1GVFA 3DMMD 2BS8A 3CVHL 1ODUA 3ULUF 2ZXGA 3FCUB 3RR4A 2CKBB 2MHAB 1US3A 3WNJA 3PP4H 4GT0A 1TV3A 3O3UN 1LJYA 3DURA 3WUWG 2P0OA 1XCTA 3LKQB 3PQYE 4O11A 2CZDA 5EBUA 5SWZB 2E46A 4P2QA 3MGOB 4IOIA 2REQA 5JR1H 1H50A 3N2CA 1TMCB 4Q7IA 3UPRA 3V0GA 4F9LC 4OM0H 1ZSHA 4IIFA 5CFHA 1AZZC 3UG5A 1ITBB 2DFAA 3VOIA 5GGTA 3LI1A 1GVOA 2XA8L 3V6OA 3SPJA 4E2BA 2OTWA 2NVCA 3OGOE 1IM9D 1RL1A 3H2EA 1I9IH 3OHXB 1BWKA 1UUOA 4Z2KA 3AY4A 3BCFA 3V0FA 4X6EB 3QC3A 3EOSA 1SBSL 5GGQL 4Y2OA 5GRJL 4ZD3H 3VWKC 2YSTA 5FYJL 4M3HA 3HNSL 1X9LA 5F88B 3ZIZA 2PGFA 4LBRA 5FA5A 1OIOA 1W1A1 1LEIB 3N2JA 1AD0A 3TMQA 3GDRA 4PV8A 4ALAC 2L3BA 2BNQE 1XGPA 5BRZD 3M8OL 4NZDA 3P9MB 1FE8L 1FHDA 2OZNA 2BVQB 4YDJA 3WXWL 4O14A 1YSOA 4C54A 3VMOA 1TDQA 3FTSA 4F91B 1Z41A 3EKLA 1OVZA 3VXOB 4A38A 3LNPA 1AJ0A 3T0XA 4EVNA 2A3LA 5TF1L 4YIWA 3KX6A 3ME3A 3ZX1A 2WIIA 2CLVB 3VXMA 4OI7A 2QR0B 3WDRA 2DUZA 1FAKT 5JXAH 4Y8DC 3P0YL 3MNMA 5C08E 1Z7AA 5BZDB 4PV9B 1RJYA 4X4XB 5L0QB 1B3WA 3QULB 3STBA 1IGJB 4C59B 4E6MA 1WDAA 2YBGA 3I3EA 4C7GA 5E6ID 3NSDA 4AOFA 5E2WL 2G97A 4QLJA 3MLRL 1MFCL 5BV7B 2CRMA 9PCYA 3CFTA 4WFED 1QTWA 5J6HA 3WY1A 4MGGA 3WENA 4IBSA 2XVNA 5FSEC 3C3NA 3N91A 1LLAA 2J43A 1RP9A 5MEPB 3P67A 3LLDA 5FAJA 2WGXA 2CO1A 2J5LB 1GOGA 3O45A 3CFBA 3FCTA 3SKUD 5GRYA 3W82A 1TJIL 4NO3A 3EWYA 2KLSA 1GKRA 1EFZA 5LZLA 5IOBA 2O93L 1G0XA 2DQUL 2F5BL 2BHZA 3WDPP 2DJMA 2AZUA 1TV2A 1DTUA 4A8LA 2VM3A 3MV11 3P60A 1X9UA 4NOBA 2FJUB 2RH9A 3TC6A 3WGUB 1H49A 4TTGA 3NQVA 1UBPC 4P48A 3NL6A 2JELL 3SKJH 3UZ5A 2Z35A 5AOMA 5C9KA 3W0KA 2V5YA 4X60A 4XUGA 4WUUA 5FO8B 5DK2A 2CO6B 1PJ9A 3BPNB 4LLDA 3K6DA 3SIKA 2YC1A 1M7IA 2P10A 2DOCA 3Q5TA 1A4AA 4H8WH 1MH5A 4N2CA 4XZIA 5IHUH 1YEYA 3D18A 5CCZA 3GB6A 1BD2A 1IFRA 4JFZH 5AYYA 3SDXA 2R4RL 1AGFA 3S8WA 3F64A 4LW7A 2W38A 5GGRB 3VWKB 1UH2A 4WO0A 5I26A 1YEGH 3WIJA 4FS9A 4XBGA 2VRJA 4S3JA 1THAA 1VHPA 3K8KA 5E9DA 1BYCA 3WQCA 4LBUA 4M7KH 4HPOH 1ED3A 3U0TB 3A13A 1V03A 3L6FA 3O6LL 3KD4A 2BWGA 3ERPA 1TMHA 2R56H 3NFNA 5CD5C 2YL6A 4I0PC 5DWPA 4JTGA 2AJVH 3BL3A 5KBMA 4G42A 3QEGH 4ICXA 3B9VA 3ZDXB 1DIEA 4KKLD 1U30A 2H9AB 5DZJA 2Z1WA 3B9OA 3RTQC 2CJTA 1OINA 2FLIA 4QGCA 1C16B 5EEUA 2DS4A 3IMVA 1ETZA 1MY7A 2PGRA 3MZGB 4B0MM 4FABH 1YMHB 2Z8VC 4UTBA 1YNYA 3UG8A 2X1RA 2A5UA 4S38A 3SPVB 4K8RD 4WGWB 1NCWH 2VI0A 5T3XE 1G7QB 4W1TA 3HR6A 1WT5C 1D5ZB 1WQ5A 8PAZA 3RVXC 3RWIB 5C86A 3S0PA 3CFKB 4K7YA 3L68A 4DESA 2I9LA 1TZHB 5HJ3B 5B3JF 5FF0A 4D9QE 1FNGA 4RAUA 2NYYC 3ETTA 5FACA 2NXYD 3EEGA 4GRWE 2DQIL 2NY0B 2CETA 2P8BA 2HP4A 1NMBH 3VYOA 3H2AA 3PVFA 1X8CA 4M1RA 4I7ZC 2IOOA 5KYUA 2FJFB 3WKZA 3EHBB 1FWGC 3G6JB 1EO8H 4ONFH 1P0KA 1F5WA 2PD9A 3DFHA 5FGCE 2XACC 4M19A 4M80A 2ZT9C 1V0KA 2JJUA 1CDJA 3OF6A 2O30A 3NQBA 4J27A 4A7VA 3OPZH 5HBFA 3TNNA 1WWCA 3SN6N 5FECB 5FHAL 1E5YA 1UZ8A 3HA0A 2MOQA 4HHHA 4G9FE 3E2HB 1FORL 4AWEA 3D12B 3PFRA 5EU6E 3EWBX 4JKNA 1JYVA 1XGZA 2BHUA 4TNWF 4JO1H 2OCFD 3M5YA 3KCJA 4B9CA 4PRWA 4KJYA 1VYSX 2XFYA 3VGEA 1J5TA 2P53A 3SO5A 4IM4A 3TO2A 4C6QA 1IGIH 1OF2B 4KX7A 2E47A 2G9HB 2UVFA 4ZUVB 2O9PA 4TRPH 1BZQK 3ORJA 1GZPB 4OFQA 1I45A 3IFOA 3WIIL 3U4BL 1BW8A 3EJYD 4LPUA 4UYQA 4ZCWA 1D2PA 3PWVA 1AJ2A 4JR9L 5IRPA 4LFHG 2F74A 1SQ2N 2NLIA 2HKFH 3VW3L 3TQ0A 3W7KA 1X6UA 3GKAA 4I0PB 4X2RA 9XIMA 1TKWB 4TUUA 3ZWTA 3B4NA 4FLOA 3GSWA 3OZKA 4DGVL 5CAYB 1E7VA 4PTXA 1PDZA 1FNLA 4WNJA 4C1NA 2MCPL 3F5LA 5IHWA 4GYPC 1PGRB 2JF1A 2OWXA 3KLSA 2MSPA 3WO3B 4Z42C 1EHXA 5DCBA 2E9MA 3QORD 3UVIA 5H37G 1XFBA 4BCZA 5EU7C 2VGLM 4FI4A 4G8GA 4N4PA 2EE3A 1FGNH 3LZLA 3G6DH 2X70B 3IK2A 5I75C 3W71A 4E5TA 4AYGA 1GYNA 3QPQD 1S4IA 5JQHC 4X6BB 1RUAL 5EG6C 4Z8FH 6PCYA 2K8QA 3BN9C 4M6ML 1QFUL 1C8VA 2ERJC 5E6RB 1HT6A 3TR9A 3MW7A 2ZWZA 1ADQA 1KLFA 3BZEA 3QFJB 2YCLA 4PUMA 1H6EA 3TPKA 2DWEA 3BUTA 5IQMA 2ENPA 3W72A 4PB9L 4JTHA 3QY7A 2WSYA 2D7OA 3G5ZB 1ITXA 5KG9A 1NSNL 1JWSB 5H37A 5EFIB 4DM2A 2NY1C 3IANA 2ESVB 5D2TA 3EXLA 1XRSA 1SM3L 5TTRA 5CJQH 1E6JL 3SJVA 4ZOCA 1R4XA 4ZQKA 1DCLA 5IB1A 1DBBL 4BXVA 2PPGA 1WP6A 2B3RA 4WGXA 1Q9KA 4HDIB 1EJ6A 5C3IA 1LUCB 5IDZA 4L2YA 1WO2A 4IU3A 4PJEA 1SN5A 3VU2A 5F2MA 1BMWA 4GXMA 3HB3C 1V7NH 3UTQB 5C0AA 2OEJA 5JHDB 5AEAA 4P9ML 5I9QC 5E9XA 2ZP0T 1E50A 3B2MA 4DKDC 3ITCA 2FHBA 3O07A 4MDPA 5IG7A 4N2EA 3DHFA 4F15C 4FQHB 2WBJC