4JFWA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2s,3s,4r,5s)-2-[n-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
439
structure length
439
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-L-fucosidase
molecule tags Hydrolase/hydrolase inhibitor
source organism Bacteroides thetaiotaomicron
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
total genus 162
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jfwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jfwA01
5DFAA 2J62A 3F4VA 1C8QA 1XC6A 2WMIA 3NDYA 3VOCA 5AYIA 1QNRA 3AQUA 1RP9A 1EHAA 1ODUA 3ZR6A 3VGGA 1M01A 3QOMA 2WHJA 3VIPA 2NT1A 4P8VA 2WXDM 1BHGA 4NSBA 3RM8A 4D6JA 5A6KA 3QHNA 4ACZB 1HL9A 2E9BA 1DHKA 2ESCA 1EQCA 3EDEA 4OJYA 1GPFA 1EIBA 1MWOA 4ZEPA 4NXSA 1V3LA 1CZ1A 3VSVA 1GOIA 2EPMX 3HG5A 4EKJA 1HVXA 3ZR5A 1UZ1A 2WBGA 2VX7A 3QR3A 1NWTA 1W9PA 4P7OA 2X05A 3UETA 4UFKA 2ALWA 3G6MA 4N42A 5CPQA 4GI8A 3ZO9A 4AXNA 3MU7A 3GXPA 1UR0A 4Z2JA 4GINA 4HMCA 1CLXA 4W8LA 4XZWA 4TX8A 2XWDA 3IAPA 3J7HA 2F7QA 3QGVA 4W86A 4WIWA 1UWSA 5E09A 1WZAA 3UERA 1V3JA 5HPOA 1UD4A 3WQ4A 4HZ6A 4PMQA 4H8HA 4MPKA 1C91A 4ZXOA 2Y2WA 1UQYA 4PN2A 1CLVA 5IFTA 4UQAA 2J75A 3SCOA 1GQJA 1BPLB 2E9MA 1VFMA 4H8UA 3PZQA 1UKTA 3NSXA 1R34A 1S46A 3L4XA 5CGTA 3A22A 2CETA 2VRKA 5CLWA 2VQTA 2WMIB 1MVYA 3DX4A 3PZ9A 3T0AA 5AY7A 1TUXA 1BSIA 3VU2A 3LXCA 3PZTA 5BROA 2XN2A 2BXYA 3D4YA 3TTQA 8A3HA 1ISYA 1GQLA 1FH9A 2GJXA 2GJPA 3II1A 1G1YA 3WBAA 1HN1A 1JZ7A 2QLYA 4AD2A 1XCWA 5CSUA 2WYSA 3KL3A 2XGIA 3EDFA 5D9MA 3BAKA 4LX4A 1GQIA 5LYRA 2OSWA 3TTYA 1JZ5A 4GZEA 3JUGA 5EFDA 1MQQA 2DSWA 3D52A 3WDPP 4LQ1A 2OSXA 5CXPA 2JF6A 3L4WA 3AXXA 4IM4A 5CZKA 1VBRA 1E6QM 3FAXA 2ZE0A 2DT1A 6TAAA 2CKRA 1B3WA 1V0LA 2WNWA 1VENA 2PWDA 2Y8KA 3LPGA 3M07A 3K4DA 1Q6EA 5LA0A 5EBAA 1KXQA 3BUPA 2CCRA 1ZJAA 2J78A 4PMVA 3AYSA 2BNJA 3SUWA 2VX5A 4FNTA 1W32A 4PTVA 3CPUA 1ITXA 4C7DA 2CPUA 2QHAA 3RM4A 1QX1A 3UEQA 3IAQA 4DO6A 5JIWA 1UD6A 2WLYA 2J7BA 4OUEA 5C71A 1DTUA 1PS3A 2ZUNA 1BAGA 3WQ5A 3M6DA 4Y7EA 3SUUA 3TOPA 4PMZA 3L4UA 4AW7A 3WL0A 4UQBA 3VTRA 4D1JA 1J01A 4PMDA 1E0XA 4UOJA 2UWFA 4OIFA 5E6YA 1TA3B 1E1EA 1UZ4A 3APGA 3FN9A 1U33A 3VX0A 3S5YA 4HA1A 2EPNA 1M03A 3RJYA 3AZRA 1MYRA 1CIUA 1UWQA 5BCAA 4TTUA 1JZ3A 1B1YA 4RL3A 1E3XA 5A95A 3BMWA 1NWSA 3CH9A 4UZUA 3W0KA 1V3KA 1OD8A 4M8UA 2XVGA 2PF0A 4W7VA 1Q6FA 2ZXAA 1GJUA 3MUY1 2BVYA 1CTNA 1WDSA 4MNMA 4B3LA 2XG9A 3A3HA 1E9LA 3SUVA 1KR1A 4Q7NA 2F7RA 2VO5A 4QFUA 1IZKA 3BCDA 2D20A 3NUKA 1O7DC 3WKZA 1CGVA 4P8UA 3L4YA 1BG4A 4AZ7A 2W5FA 3VIIA 4PMUA 3VD5A 4AZCA 1QWNA 4B9YA 3N12A 3UG5A 1R33A 1HTYA 2WM0A 1W9BM 4PRWA 5CG0A 4DWSC 1PZ3A 2FDMA 3ALGA 1B3YA 1SMDA 1HJUA 1Y7VA 3EMQA 1HKJA 2C0HA 2WVVA 3MMWA 1BYBA 3OZOA 3VD7A 3KLKA 3VGBA 3VM5A 4KH2A 3ZIZA 2O9OA 2YBUA 3VO0A 1EQPA 4QP0A 2WC7A 3AIWA 2HVMA 3SCQA 4KWUA 3ZJ8A 4AC1X 2D0HA 5DMYA 1B0IA 3IGUA 1H4PA 1MFVA 1Q6DA 2YA0A 3KL5A 5IFPA 4H04A 1OWQA 1E3ZA 3AS0A 3GM8A 4JIEA 3MUZ1 2CYGA 5A3HA 5CQ1A 3W6MA 4NXKA 1X1NA 1CNVA 4LGXA 1KTBA 5HDRA 4W8AA 2JIEA 4UFMA 3ECQA 2QMJA 1UA3A 2DIJA 3QHOA 3W28A 1VEMA 3AIBA 2PC8A 2YFOA 3WQWA 1JXKA 1DP0A 4DO5A 1ZJBA 3ZMRA 4P7LA 2D24A 3PZOA 1WPCA 1RPKA 4E8DA 1UKQA 3GBDA 1V02E 4IISA 1QPKA 2WKLA 1B3VA 3VD4A 3ZQ9A 3WNOA 2CHOA 1R7AA 3N18A 5D8WA 3WH6A 1AMYA 3W27A 3H55A 1W3HA 4Z2GA 4ZXLA 2EAEA 4XB3A 4AZHA 3KEHA 3GZAA 1HP5A 4AWEA 3VMPA 3PHAA 3UR8A 4MAZA 1XSJA 4JFVA 2ZUVA 1W9DM 1EO5A 3T0BA 1IT0A 3VIGA 4BZYA 2GVYA 4GXPA 5D9NA 3UESA 1E6ZA 2JEQA 1QI2A 2O9RA 2ZUMA 4DUWA 4UFJA 5A94A 4GI9A 1XH1A 1CXKA 1LWHA 2VX6A 3U57A 3CIVA 3PTMA 1R46A 3D5HA 2WCSA 2DSVA 3RJXA 5JIPA 4B9ZA 3QHMA 4AMXA 2VR5A 1WZKA 2Y5EA 3EJPA 1LWJA 4ZE4A 2XHYA 2UY2A 5CJ5A 3AHTA 4JZ5A 3S6TA 2C7FA 2VVNA 1CGYA 5LA2A 4TOQA 2ZX5A 3CUIA 4AYSA 1EDGA 4WK9A 1TMQA 3GH4A 2NSXA 3BC9A 2OYKA 3DX0A 1UR1A 2Y8VA 2CHNA 1OB0A 4JL1A 1NM9A 1GW1A 4JAWA 1TVNA 3AMKA 4UQCA 2IXUA 1E72M 2F7OA 4M82A 2WCGA 1C8XA 3WSUA 3VDHA 3VIMA 3TV8A 1QOXA 3SURA 2OLHA 4QDMA 5EFFA 4PTMA 1FH7A 1MQRA 3ARZA 2X2HA 2C8NA 1PPIA 3WD2A 1BVZA 3DHUA 3S2CA 1E4NA 2OYMA 1ZBKA 5I2UA 2XGBA 4PBGA 1TVPA 3GBEA 3DYPA 1GHRA 2IGTA 3AICA 1E70M 1JFHA 4CUCA 2VC9A 3NJ3A 2DEPA 1P6WA 3ZOAA 4PMNA 3WF0A 4GPNA 1E71M 3CGTA 5A6LA 3BAXA 2JALA 3ARWA 4HPHA 1R8LA 2WWDA 4UR9A 3WIJA 2QPUA 1GZJA 3VMOA 3NSMA 2GJRA 2CBIA 2F2HA 1B9ZA 3BMVA 3WEZA 2EPKX 4FNUA 1ZL1A 2YLLA 4XV0A 4GQQA 4M1RA 2BY1A 1SYTA 2QMKA 1NP2A 1ISZA 3I3EA 3SUTA 4JFUA 7CGTA 3CZNA 4E8CA 3SCSA 4D6GA 5HNNA 3ARRA 2FH6A 5TD4A 1K9DA 3WMBA 1OINA 4UFLA 1QHPA 2XVLA 1E43A 4JL2A 1PIFA 4V2XA 5FCZA 4AIUA 1MW3A 1ZBCA 2XIBA 1TFVA 3AS2A 1VBUA 3M46A 2WVVB 3WY2A 3D51A 4QCFA 3SCVA 3K4AA 1V6YA 4AD1A 3N17A 4JFWA 3BGAA 1OM0A 2CXGA 2QV4A 4GKLA 4QLLA 5JBFA 1XSKA 4J3XA 4HA3A 3AHZA 1HX0A 1E5NA 4HPGA 3SUSA 5DEZA 3VIOA 1Q6GA 5DT7A 2XN1A 4NZJA 1HXKA 1UWIA 1WE5A 2X2YA 4S3JA 3FHQA 3DECA 4IPLA 3L4VA 2O9TA 1XD0A 1L0PA 3B9DA 2V3EA 1QW9A 5A2BA 1CDGA 1UR4A 3AZSA 4YHEA 5ABFB 4UFIA 4EK7A 1AQ0A 4PTWA 3UCQA 1E6RA 1CEOA 1UD3A 4JFSA 1WKYA 5HXMA 4MJ2A 4CCDA 2PWEA 3OIHA 3UR7A 3LRKA 2WSKA 1MXGA 5I79A 1AVAA 1KWGA 4AD0A 1US3A 3A4XA 4MNJA 1CWYA 3MUAA 4PMYA 2UY5A 2VRQA 4WF7A 5I24A 1HJWA 2OYLA 3T0DA 3GXNA 5IDIA 2OWXA 1I1XA 3ARXA 4D6IA 4ML4A 4GO8A 1SMAA 2ZXDA 1Q4NX 2ZUWA 3O2LA 5D9OA 4D6FA 1KTCA 1BLIA 2UY3A 2EPLX 4ZENA 3W6LA 3N1AA 4U2YA 1HIZA 4ATDA 4YPJA 2ZIDA 4L4PA 2YA1A 1H09A 4J3SA 3VUPA 4HTYA 3PBGA 1JDDA 2D22A 3ARPA 1NH6A 4U2ZA 1KXVA 3L2MA 3WFLA 2D23A 3GNOA 2CIPA 2W92A 4HOWA 4PCTA 2J74A 3WQ6A 4AYGA 1FFQA 5FL0A 1JYVA 2XUCA 2VZUA 5E70A 2BY2A 3A23A 3T09A 5M03A 5I23A 2Z1SA 1KQYA 1PIGA 2XYLA 1R75A 4FNPA 1NWRA 1WDRA 2EEXA 1J0YA 3UG4A 1D2KA 2E8YA 2DDXA 3U5YA 2PB1A 2J7CA 1IZJA 3VVGA 2YA2A 2Z1KA 1FP9A 2VZSA 3SCWA 1W3LA 4U31A 1IV8A 1DWAM 3DYMA 2ZX6A 3NSNA 3M7SA 1B3ZA 1VFUA 4WSJA 1W91A 1OIFA 2XM1A 3W37A 1KCKA 1ZU8A 4HP5A 4HMDA 3RO8A 2FHBA 3BCFA 2WWCA 3PZGA 3WENA 1NQ6A 3N04A 3WDJA 2A3AA 4U3AA 3AIQA 1VEPA 5I77A 2DSZA 1ISXA 1W1PA 1MW1A 2BHZA 4ATLA 4AZIA 4FLOA 4U5IA 3EJQA 2WMJA 1FHDA 2G3NA 1WB0A 1Z32X 1GVIA 1CGUA 3EDDA 1OGBA 3VGEA 4P7NA 3LX9A 3T08A 1DWGM 4NRRA 3HG3A 5A6JA 1CXLA 2VJXA 4HU8A 1LL6A 1TQWA 4OOZA 3DX3A 3ZJ6A 1X6LA 1ESWA 2QPSA 5DF0A 2J25A 1H49A 1PX4A 4JKMA 4GQRA 2WHKA 2X1IA 3RM9A 3L4ZA 1J0HA 1TQUA 3VIHA 3VDCA 1EDTA 5D4YA 5C70A 1V3HA 1BYDA 5GNZA 3EJSA 1WDPA 4W88A 1KGXA 4X0VA 3GYCA 1JAEA 1JF5A 2D3NA 3HG4A 2OSYA 2VZTA 3AIUA 3AJ7A 3HMCA 3ZJKA 5LA1A 5FKYA 5KZ6A 5AC5A 5HOSA 5I6SA 1ISVA 4DWSD 2PWFA 3BLPX 3BXWA 1LG2A 3VILA 2BHYA 1TA3A 3WH5A 1KBKA 4V28A 1XV8A 2VURA 3PZUA 2J77A 4AD3A 3CLWA 2PBGA 4J3WA 2XFFA 1WCGA 3AIVA 1W2PA 2J8GA 1SFSA 4BF7A 4MB5A 3CHDA 1UKSA 1XD1A 2V5DA 2XTKA 2E9LA 1CGXA 5A6SA 3WD3A 1JGIA 4D6CA 4MDOA 4AY1A 2J79A 1UOKA 2ZWYA 1JF6A 1VF8A 2BS9A 2CEQA 1W9UA 3SCTA 4ZFMA 2WANA 3VIJA 2A3CA 3VSUA 1I75A 3AMGA 1CECA 3SCPA 2FHCA 4UQEA 3MKKA 3O6AA 3WY3A 4H41A 3AS1A 1XH2A 3SIMA 2XFRA 1B3XA 2XWEA 1Q6CA 1X6NA 5IXEA 1UD8A 3VNYA 2V3DA 2X2JA 2GSJA 3N15A 1V6XA 3DHPA 5D8ZA 1C7SA 5JBDA 5EMYA 1GOKA 2JIWA 4JHZA 2WMKA 2WZEA 2BVDA 4MNKA 2ZX9A 2VOTA 3AS3A 4AD4A 1GQKA 3MI6A 1W9VA 4MAVA 2O92A 3TTOA 3WH8A 2YKKA 4M24A 4AZ6A 4ZE5A 1DWJM 1PJ9A 4W7UA 5FD0A 1OD0A 4AZ5A 2WCAA 1ZB5A 1KCLA 5CGMA 2MANA 3CZJA 1UG6A 5ABFA 4WJXA 4F9JA 2EBNA 3W26A 4TTGA 1QNPA 4C7GA 1CENA 2JE8A 1WZMA 1XYFA 2WZHA 3AI0A 3IANA 3VDAA 4PMRA 3AYRA 1QI3A 4CCCA 4U3CA 3W29A 2G3MA 1FA2A 3N9KA 3BLBA 1H41A 4AMCA 3GXIA 1HVQA 1JYNA 3N11A 3DC0A 4IUGA 4AZCB 1QW8A 1W1TA 2W67A 4ACZA 3NYDA 3WFZA 2D2OA 5A2AA 1BQCA 2WBKA 1ZBVA 3B9AA 3K8LA 4YHGA 3I3DA 3LRLA 1CPUA 4AIEA 1M04A 3VGFA 2BV9A 3BAYA 3WUBA 1D7FA 3W25A 4MADA 4BQ3A 3EJTA 1V0KA 3O9NA 1FFRA 1T0OA 1UH3A 2A3BA 1KXTA 1HJQA 1UASA 1HJSA 2J47A 4U33A 1JFXA 3RILA 2DT2A 1PEZA 3WF4A 3OLEA 2CBVA 3BUBA 2EQDA 4D6HA 5ABGA 4UOQA 4MJ4A 1HJXA 4W8BA 4CD4A 4OOUA 2VQUA 1C90A 1JAKA 5M5DA 3ARUA 4B15A 1W9XA 1V3MA 1J9YA 4JCMA 3EMZA 2HISA 1B31A 4UCFA 5CPSA 4K68A 3EBVA 4X9YA 3KWXA 2VUYA 2D73A 3NDZA 3D50A 1UD5A 1JXJA 1HKMA 3WF2A 3GXMA 1VJZA 1GNXA 2ZX8A 4AIOA 2FE0A 1W3JA 1W2VA 2WLZA 2ZUUA 3WQVA 3SCUA 4FNRA 4W7WA 1H11A 3BVXA 1B2YA 4R27A 3FHAA 2FGZA 1QI0A 3A4AA 4S3KA 2YL9A 2FYVA 2F61A 2WVUA 4F79A 3AMDA 4LYQA 1J12A 1ECEA 4AMWA 1PX3A 1CXEA 4FNSA 3CZGA 2WC3A 4LXFA 1BYAA 1CXFA 4JKLA 3GTNA 4JCLA 1DWHM 2XFYA 4FMVA 4CU6A 1NOFA 2F7PA 4BQ4A 2YOCA 4KGJA 3PZVA 2WSPA 3BLKA 4J28A 1OGSA 1HJVA 3CMGA 1XRVA 4GI6A 3WNLA 4P7RA 3VNZA 1E4MM 1UWRA 2DGAA 3WF1A 5I3DA 5FOOA 1LJYA 5E9AA 3WD4A 2F18A 3AIRA 1VAHA 3POHA 1PBGA 3FNDA 3OLGA 1TZ7A 2V5CA 4J27A 3FAWA 1MW2A 2BVTA 3CZLA 4GO9A 1AQHA 3UG3A 1OIMA 3CUHA 4PCSA 2YBTA 4WKFA 1QWUA 5BXRA 4TX6A 4NF7A 3A24A 1VIWA 1HL8A 3GXTA 3BSGA 2DSKA 4RE2A 1JZ2A 1E5JA 4JHOA 1E56A 3VKKA 4D6DA 1BGGA 1G5AA 1VJSA 2E8ZA 4CN4A 1KXHA 2BFGA 2CBUA 2VCAA 2W4XA 5E0CA 4GZJA 3OLDA 3PTKA 3VD9A 2WHLA 5IHSA 4PSPA 2XVPA 5E0FA 1JZ4A 2J7FA 2CERA 3PZIA 1J0ZA 5HPCA 3OGSA 3CC1A 2VNCA 4V27A 1CXIA 5A69A 1YHTA 4WLCA 2GDVA 4Z2KA 4DM1A 2YJQA 3MV01 4UFHA 1NOWA 3CMJA 4WKAA 1I1WA 3BVUA 6A3HA 2PBOA 3FY1A 2YIHA 1KBBA 2YL6A 3MMUA 5FL1A 5E1QA 1BGAA 3K46A 4CN6A 1GVYA 3LXAA 3WUFA 2ZUTA 3WD0A 4DUVA 4A4AA 1M53A 5GQBA 4W85A 3CZEA 4DUXA 2DPEA 1BTCA 3EYPA 3OBAA 2VVSA 4LYPA 2ZICA 4XX6A 4H8VA 4BQ2A 2XSBA 2BY0A 2V3FA 3E1F1 4CD7A 2DT3A 1QNSA 4AEFA 4X0NA 1E6NA 3AFBA 4CU8A 4KMQA 4PMOA 3CUJA 2G3IA 5ECUA 2D0FA 3VX1A 2CITA 3MS8A 4P8WA 2VMFA 3WEMA 1A47A 2E0PA 2QF8A 1J0KA 5BRPA 2Y24A 7TAAA 1KQZA 2D0GA 2GDUA 1JIBA 1BVNP 5EB8A 3IJ9A 2PWHA 3OZPA 1HKKA 1LG1A 4P7QA 3BUIA 4QLKA 2EABA 4MDPA 3NCOA 1JG9A 3K8KA 2J7EA 4BQ5A 3WN6A 4WKHA 2F1AA 1AQMA 5I5RA 3WF3A 1UH4A 3PZNA 4NZCA 1KB3A 1MW0A 1HXJA 1UR8A 3GXFA 2WMGA 4DM2A 3GH7A 5E6ZA 1O7AA 1PX8A 4AEEA 1E4IA 2AMGA 3LPPA 1OT1A 4AISA 3U5UA 1JZ8A 3A6OA 4QAWA 2XJ7A 1R85A 4D72A 3OGRA 1PZ2A 2JEPA 1XHGA 9CGTA 4OBSA 1SR0A 1UR9A 2G3JA 4LPCA 2WKGA 2VTFA 3HJEA 4J3TA 1R86A 4HU0A 4Z2IA 3WH9A 4GZIA 1FH8A 4CD8A 5BYWA 1UWTA 1E40A 1JD9A 3WDQA 2UY4A 4UQ9A 3PN8A 1EHNA 4MTVA 2YDRA 3RMEA 4RE3A 4W84A 4HZ7A 2VX4A 1LL7A 3VPLA 1L8NA 2WPGA 3QOKA 4PYSA 1EGZA 2FGLA 3N13A 1MXDA 4RE4A 3EJRA 3FXYA 2FHFA 4BCEA 3CHCA 4HOXA 1HKIA 3VD3A 1E1FA 1K9FA 4AZGA 1BG9A 4OKDA 2OW7A 2EADA 3LPOA 1EOMA 5A8MA 2D3LA 5DO8A 1JD7A 3WDHA 2OWCA 2VZVA 3A5VA 2J7HA 5ABEA 4D71A 2DT0A 1OGGA 3ARSA 1JYXA 1QVBA 3VGDA 3EDKA 2E40A 3F5JA 3CZKA 5JBEA 1J0IA 2W61A 4FLSA 3AHYA 3DDFA 2TAAA 3VDBA 1LLOA 3KZSA 3ZSTA 3OGVA 4Z2LA 1EDQA 3ZM8A 2NT0A 3AXHA 4PUEA 1QHZA 3EDJA 1CGWA 1BFNA 3AISA 2X0YA 4MB1A 2JF7A 2PWGA 3ARVA 1WP6A 3CUFA 5A8OA 1E0WA 1V03A 1JZ6A 4M80A 2RGMA 5A6BD 3KE0A 3AXIA 3VINA 3AZTA 1GOQA 3MSDA 3W82A 1OSEA 3PZMA 1KGUA 3CBWA 4J7RA 1C8YA 3OG2A 3AIEA 2X09A 4P8XA 1C92A 1DEDA 1ITCA 1N82A 1MQPA 1TQVA 2E4TA 1MFUA 2F8QA 4FF5A 4IPNB 1E73M 2XIIA 4QCEA 3TP4A 2YLAA 1D3CA 1EOKA 1C3FA 3ARYA 3MV11 2GJXB 4DWSB 3F5KA 3CV5A 3MANA 2GFTA 3AHVA 4F9DA 1CYGA 1H0GA 2Y4SA 2IUZA 3OB8A 1H5VA 2WC4A 3WD1A 5A8QA 1GHSA 3WNPA 4ACYA 1LF1A 1G94A 5M17A 3SCRA 3THDA 3ZT7A 1QI4A 1W1YA 3AROA 3TTSA 1UHVA 4D6EA 4NI3A 4PSRA 1WO2A 2XPKA 4W93A 4W89A 1R7OA 3GXDA 1H3GA 2AOSA 1JDCA 2FH8A 3DDGA 3VMNA 3ZJ7A 5HBFA 1V0NA 1EXPA 3DX1A 2A3EA 2EXOA 3H53A 1E55A 2DQXA 1F4HA 3B8SA 3WBEA 1PAMA 5C8BB 1HNYA 1UYQA 4LYRA 1FP8A 3HZ3A 3I3BA 1UUQA 4EAMA 4E2OA 2WMFA 3RIKA 5GNXA 3D3AA 4BS0A 2XN0A 4J3VA 1E6PA 3L2LA 1XH0A 1TR1A 1UQZA 2ZOXA 3MO4A 3BH4A 2YFNA 1G01A 5A6BA 4A3HA 2WVSA 1TQSA 3BVWA 1V6WA 3F5LA 2VCBA 3EMCA 1JL8A 1ZBWA 1KR0A 1WNOA 5BWFA 3BUDA 1NARA 2X2IA 1VB9A 2WW5A 1J10A 1ZS2A 4HA4A 2XM2A 4TVUA 4HOZA 1JYWA 3AHXA 2F1BA 3HG2A 4NZFA 2ZXBA 4N0RA 4KGLA 2J7GA 1QHOA 1JI1A 1XCXA 2O9PA 3WNKA 4UQDA 1V6VA 3WNNA 1WAWA 8CGTA 1GCYA 3WQ8A 1WDQA 1LL4A 3W24A 2BXZA 4DWSA 1DWIM 1UD2A 3BAIA 4C7FA 1E15A 3W38A 4L4OA 4EANA 3FW6A 3RCNA 2ZWZA 2WHMA 4CD6A 1C7TA 4M29A 2YDQA 3ARQA 1R47A 2VRJA 3DYOA 3WH7A 4TVDA 4CN1A 2Q8XA 2WK2A 2E3ZA 5CLTA 5CPTA 4CCEA 3CHEA 3W53A 4DO4A 3ARTA 3GH5A 1NP0A 4FK9A 1US2A 1CBGA 1HP4A 1TE1A 1W3KA 5A2CA 2IXVA 3BAJA 1B30A 3WL1A 3KLLA 1UH2A 3EJUA 3BUQA 4GIAA 3ZT6A 5CSYA 3KL0A 4OBRA 2DH2A 3CO4A 4J3UA 2CESA 1BYCA 3K1DA 4MB4A 4CKQA 2DSUA 1QI5A 1ODZA 3TONA 2VZOA 4XZBA 2DIEA 3A4WA 1G9HA 1GJWA 4HZ8A 3OA5A 4F66A 3H54A 1R87A 2WAGA 1CGTA 3WEOA 1UKOA 3RPMA 3VSTA 1F4AA 1K9TA 1H2JA 3U7VA 1TG7A 1XGZA 4Z2HA 2YL8A 1OBAA 4NRSA 1KFWA 3PTQA 2GK1A 2EACA 1BF2A 3NIYA 4CGTA 1FHLA 1YQ2A 5GPRA 2CNCA 3WDIA 5A8PA 5F7UA 7A3HA 1JNDA 5A1AA 3CHFA 1OT2A 3CZ8A 3GNPA 3SCNA 4PTXA 5BXTA 4PEEA 5M3WA 4H2CA 4U5KA 3U7BA 3BVTA 3LPFA 3BAWA 3VIFA 1K6AA 1UWUA 1XSIA 3LRMA 3TA9A 1J0JA 1UR2A 4YN5A 5FIPA 1G0CA 1JI2A 2DH3A 4R5EA 4OGZA 5JUVA 3K8MA 5I0DA 3IJ7A 1OCQA 2BHUA 4FNQA 4CD5A 3MMDA 5KEZA 3WMCA 1EH9A 1RH9A 2XSAA 2D1ZA 1K9EA 2YL5A 2VT0A 2W62A 1J18A 2OWWA 3MUIA 3WY1A 1EO7A 1UKPA 3WMSA 1QBAA 4F8XA 1DWFM 4MB3A 4ATWA 1V08A 1JNEA 4EE9A 3GNRA 4TVCA 3GDBA 1GORA 2WVTA 3VIKA 4BA0A 1GONA 1H1NA 2VR4A 2CKSA 4KRUA 4CU7A 4TUFA 1E4LA 4B3KA 3AMCA 3CUGA 1RP8A 1B90A 3BVVA 1GOOA 1E6XM 1WZLA 1VEOA 3B9EA 3WELA 2GUYA 1J11A 3D4ZA 2X0HA 4PMXA 1U30A 4H7VA 1U2YA 5AC4A 1LQ0A 1FOBA 2VI0A 2BY3A 1V02A 2WZIA 2AAAA 3DX2A 2WB5A 1HWWA 2W91A 3OLIA 5A6MA 4NX0A 1VRXA 1M7XA 3HU7A 3AOFA 2NW0A 3T2PA 4Q22A 4JFTA 2JFEX 3WDRA 5ABHA 4B16A 2XVKA 1H0IA 4M81A 1NOUA 5D9PA 1QNQA 2CBJA 2G4FA 5I78A 2J7DA 5AYBA 1O6IA 3ZT5A 3WUGA 3IJ8A 2X8RA 1ISWA 4UZSA 2WMHA 1JDAA 5DT5A 1QBBA 1XYZA 2XVNA 3BSHA 4AD5A 2G41A 4UNIA 5BXSA 2OW6A 1EA9C 2G8ZA 2A3HA 3CZSA 2J8FA 3WNMA 4FLQA 4URIA 3T2OA 4A3YA 3IK2A 2ZUSA 3A47A 2ZXQA 1SZNA 5A6AA 3T2QA 4W5ZA 3G6LA 2J4GA 3W4RA 3ZSSA 2W66A 4HMEA 4FLRA 1V6UA 3HN3A 4E4PA 4CVWA 3THCA 1GUVA 1GOWA 4TXEA 3W81A 4PUDA 1A3HA 1QNOA 3SEPA 3RDKA 1HF6A 4M56A 4CVUA 4WSKA 3L4TA 3CTTA 1HT6A 3VM7A 1CXHA 1VFFA 1E0VA 2W63A 1KWKA 3WY4A 1VFOA 5GNYA 5IHRA 1RD6A 3LMYA 2ZX7A 1C93A 4D1IA 1KGWA 1V3IA 1W1VA 1V0MA 4JKKA 2EO7A 5A8NA 1E6SM 3AMLA 2YDSA 4AZBA 1TQTA 3LXBA 4QLJA 3S5ZA 4W87A 3POCA 2GK1B 4W5UA 4MNLA 3WUEA 4XUYA 2B31A 6CGTA 2RGLA 3A21A 3MSGA 4KRTA 2V38A 2VCCA 4OZOA 4UTFA 3ALFA 3VGHA 2EJ1A 5BXPA 2EPOA 4UOZA 2VL4A 2PI6A 1UA7A 2V3GA 1TCMA 1NWUA 1GOMA 5BRQA
chains in the Genus database with same CATH superfamily
3H42H 4QF1A 3SDAD 1MQ8A 5BUAA 1AKPA 4DN4L 3CLMA 4ZO7A 3S37H 2FYMA 3SGZA 2VABA 5DFAA 1AS8A 2J62A 4U0QB 2WMIA 3NDYA 3VOCA 2EDWA 3QRFM 3M1ZA 4FKEA 1GSKA 2Z31B 4HK6A 5AOZA 3VXUE 4OCWL 2EH8H 1DQJA 5HHVH 1O5QA 3R4RA 4YL9A 5HHNB 3M0XA 4GCAA 3W73A 2GUOA 3LCHA 1I3UA 5T5NG 4OFCA 3ZR6A 1T20A 3VGGA 2EDEA 3ME0A 3U1SL 1M01A 1ZCRA 3QOMA 2PCFA 5DLCA 1CBVL 3JVGA 2YCLB 1OAKH 3L45A 4JHAH 2OZNA 4U6TA 1YY9D 2I9UA 4GUHA 3CU2A 2IS7A 1G7LA 4NSBA 4UTBH 4G8FA 5D7LA 3ZPDA 4HAFA 4PV8B 4YHNA 1JZDC 1R3KB 4D6JA 1XVSA 4LKCB 3QHNA 1EBAA 4QDPA 5A6KA 5DK2B 1POJA 2E9BA 1DHKA 2ESCA 3MWCA 4UNLA 4IUGA 3KP0A 2FL5A 2R29A 5B39A 4IBVA 2ZBTA 1U8PB 1DVQA 3GHTA 3Q43A 2FZ3A 4YC2C 4G6FD 5AEAA 2EEAA 3DU0A 4NXSA 3HG1A 2BSRB 1I3RA 1JWMA 3KWWB 3LN9A 2IQ9H 5JPNC 4G83A 1IM9B 1GKOA 2Q7AA 3VSVA 2GCYB 1MZZA 2J2ZB 3ASNB 4IRJB 4N9GA 3WS3B 2EPMX 1VBHA 4IOSD 4DVOA 1XR8B 43C9B 2WBGA 4AITA 3P81A 2UZPA 1E27A 1G7JA 2WO5A 4OD2A 3S35H 3VWKA 5SWUA 1W6TA 1CL7H 1XF4A 3HI6H 1W9PA 2DJXA 1ZD6A 3V8OA 5I17A 3UETA 4N3TA 4UFKA 3TZVB 2AXFB 3EFOA 4L3CA 1SSDA 1YMYA 1B0RA 1S5HB 2DYSB 3LPWA 3DESA 5K4ZA 2CE6A 3FT9A 3KBPA 1UR0A 2FKPA 4Z1AA 2RACA 2CKBH 3F7PC 2Y7LA 2P5EA 4PJIF 1TV4A 2YAPA 3S3PA 1J6PA 2HJKB 4TX8A 3M64A 1YEWA 5DI8A 3NQDA 4IJCA 1VGAA 1NCTA 5C07A 1SJEB 4IK7A 4XHJC 5D7JB 1J1OL 1ZE3H 5TPWH 5DMKB 1UWSA 3M5YA 3SJVE 1IQWL 4MUPA 2V5RA 3IETB 2JKSA 1ZLVK 3ABKB 3UERA 4NVTA 5KWYC 4A29A 1UD4A 5KBKA 5CILL 3QHZL 3LEYL 3CDCA 4KTDL 3A4FA 4H8HA 3PJUA 3K13A 4JBRA 3S8WA 2IIJA 2DWSA 4I0PA 4ICMA 3BW3A 3LZPA 1JCYA 1CX9A 4PN2A 3FOMA 4UQAA 1AY1L 1C12B 3QJFB 2EIMB 1U9KA 3BH9B 4HIPA 3MHFA 2GGJA 4U1HA 4Z5RA 1GQJA 5A5WA 4N0YL 5EUOA 3OZLA 4XPTL 3X1EA 1AQKL 2E9MA 2L7EA 2OT0A 3BE1H 1DCEA 4ODWA 2NX5B 2AJZA 4LF1A 5HJLA 4H8UA 2YN5A 4X4KA 3B03A 2X4OB 2X87A 4FQHB 3SY0A 2APSA 3PZQA 3DRQB 4LUSA 3HFML 5CBIA 5DWPA 4ELMB 5LXEA 3RWDB 4KKQA 3L23A 4LSVL 4H5SB 3L9RA 3L4XA 1ICTA 3OJ2C 1A3ZA 1CR9L 4D9QD 2ZZ7A 1CFTA 3QDMB 1P6BA 2VQTA 2A83B 2P5WB 1JJUA 1L2UA 4R97C 3T0AA 2IWFA 2AS5M 2F9RA 2D3VA 2XV0A 4NQXB 2XRAL 1YEJH 1VPXA 3FRUA 1BP3B 1TYRA 5CBEA 1NAMB 2OP4H 4POCA 5HDQL 3LD5A 5BROA 5D38A 3NA9H 4E68A 4H8WC 1LK3H 4OQTL 3QGKC 5E4EB 1Q7QA 3M5VA 2GJXA 2VLRA 2WXLA 3G3MA 1NUFA 2RFXB 4IXHA 2E6QA 2K8MA 3QP3A 1SY6L 1G1YA 3QBTB 1WX0A 1GSMA 4O11A 5KBMA 1JZ7A 5D4JA 2HBXA 4KNUA 1YCSA 2UXGA 2JTYA 3L95B 4N0UB 4QD2E 2R0WL 5ALBH 3FV9A 4H9MA 1XCWA 3RJQB 2AGJH 4NLAA 2EXYD 3J2PA 3V0JA 2OX5A 5LN4A 2Q10A 3EO9L 3KL3A 1AGCB 4YBQC 3KCPA 4MJ6B 4N6QA 4YHIA 5LWYL 2YGPA 3EDFA 5DVMA 1RERA 5D9MA 3S0CA 4YZFE 2HJLB 3IFPA 3O6FA 1E4KA 1H0DB 3BAKA 3H7BA 2V67A 1TJPA 2R23A 1GQIA 4OGYH 4LX4A 1IAOA 3FB8A 4BFJA 3CSYA 4LHUD 3EOUA 2IFGA 4MNQD 2O4QA 2EYSB 1UCBH 7REQB 1CD0A 1WD9A 5B7YA 3CC5A 3D52A 3ONCA 4IG2B 4PS8A 2Y7NA 3FN0L 4AQAB 2VDHA 4YXGA 4RRPA 5FCSH 4ACTA 1PY9A 4GUQA 2GGGA 1J1PL 4MNJA 1BZQK 3DV6B 4RAUA 2JF6A 1OF8A 3ECBB 1I1AC 4KKLC 3T8XA 3C61A 4PULA 1YMMB 5ALCH 4WY0A 3UTSE 4NJHA 4PR4A 1XQ4A 3ABLB 1H6FA 3VXOA 4NI8A 2DQUL 3INUH 2IKIA 2ZE0A 1FDYA 2AQ1A 2A7BA 3W9EB 4R7NB 3NCMA 4KBXA 3LQZB 3RUGB 4KHXH 5F9OH 5LGJB 1EFQA 4HJUA 4HJWA 4FFZA 2PCPB 2G30A 3EXLA 4YAQB 4GKSB 3DSNB 3R58A 3VC5A 1DVSA 1MCCA 4YVXA 5IMKA 3M07A 1HH9B 3CFMA 5C54A 2ILLA 4JYFA 3DVFA 2OX4A 4LRSA 5EBAA 1D7DA 3BUPA 2J8UB 4RDQG 2IMRA 3VB9A 3P3RA 1ZALA 2F7FA 1YDVA 1ZJAA 4BKNA 4FQIL 1EC7A 4Y8EA 1N7ML 1P5UB 5LVEA 1XIFA 1PZSA 2BNJA 3D3VD 4JMXA 1F6AA 5T1KB 3SUWA 4MCNA 1EBHA 4FNTA 1AJ0A 3SDYL 3ZKMD 1GVQA 1XRFA 3HIJA 4PTVA 4X2RA 4W4OC 2F58L 3BVDB 3RFZC 4HHAA 2P8PA 3CAFA 4N0CC 1FVCA 3KJ4C 1UC4A 2NNAB 4OCMC 3ETSA 2PD9A 1YY9C 1QASA 1P0SE 3FN0H 4Y8DC 4YZFF 5BZXA 5DWUH 4UMAA 1MRAA 3IAQA 2XUWA 4F2MB 1UCBL 4I2XE 4JHBA 5DRZB 1A4MA 3JTTB 4PU2A 4K8EA 4HMNA 5JIWA 1M7IB 2WLYA 3SGUA 3BO8B 4KU1A 1I7TB 4K07A 2VDLH 3Q5YA 2LTQC 1PS3A 4PCYA 4X63A 1BAGA 4TIMA 5AYUH 1MEWA 3MO7A 4KRLB 1KN2H 4JTRA 2ZZ6A 5DHXB 3MRFA 4JHWL 1TMHA 3H12A 3HNSH 4NZ3A 4HCRA 3SUUA 2UYLB 4KZ0A 3O15A 4Q0XH 4B6ZA 5ALBL 1DUZA 3L4UA 4AW7A 1XBYA 5DEFB 5DLMH 1ZY9A 4D1JA 1R3HB 1GVFA 2X42A 3SPJA 4PMDA 5C9UA 2APTA 2H2PC 1W16A 2VSMB 3WIFA 2UWFA 2XIOA 3QUGA 2NUPA 3HI1A 4Z7VF 3DIFB 2X0WA 3ZY7A 3GS4A 1TA3B 4ANUA 1UZ4A 4Z9KB 1ZCCA 3MFGB 2XNAA 2KLSA 1NCBL 4WV1C 2XX0A 4X6DA 4FQ1H 4QRBA 3DSFH 3S5YA 2DW6A 3H6OA 1NGZA 2O5XL 3DBPA 3U2EA 4LCCB 4ZSTA 3PRZA 1FGNH 5GGRY 5CF3A 3M0IA 3E1ZA 4NYLB 1NCIA 2ZCKL 3C60D 1QPQA 1MWAA 2CW6A 3C8FA 3EKGA 4GZ7A 1S9WA 5I1GH 2IBZY 4GW4B 1MUMA 1I9RH 3DIVA 4ZMNA 2CXEA 4HALA 4HWNA 5C0RL 3ARFC 2P7TA 2ICWA 2H4EA 3GKAA 5A95A 1U58B 3R11A 1M57B 4XHJD 1BF5A 3L9BA 1J5IA 2Y1VA 3QQ0A 2XIJA 3ZL4H 2A0NA 3W0KA 3IKCA 3WLTA 5ANMB 2DZVA 1LE5A 2WKOF 3V6ZB 5IEKB 1E5UI 2FZ3B 5EOQL 2PURA 5C6PB 3RGVC 1Z3NA 1LNUA 1IEAA 4CMMB 1TWZA 2E5DA 3HQPA 5JQHC 5EIIA 2EO9A 5I6OA 2Z65C 4MQ7A 5I2IA 3OX8A 2QKIC 1JUBA 2PP8A 4IIQA 1EUAA 5E8NB 3MUY1 2BVYA 4XOEA 1LO5A 3UR2A 1EK3A 1AHKA 4MNMA 4B3LA 1YDPB 3RB7A 2Y07H 3CPGA 4LUJA 2ZFAA 3Q1SL 1DORA 1PIIA 3DOPA 3QHFL 3QG7H 2DM3A 1ZGLP 5EBMB 1HOCB 2I5YH 4L4TE 4LCWD 3G22A 3H4WA 5EOTB 4Y16C 4R7OA 5I17B 3BCDA 3FU3A 2D20A 1O7DC 4A8LA 1G7QB 4OUOA 3DBXB 4P59L 5TPWL 3TZVA 3WK2A 4NILA 1CGVA 1A9VA 4FJ6A 1DFBH 5EBGA 3RL2B 2C18A 2BSDA 3STZA 4IFRA 2YBRA 2HN7A 4LEOA 1O66A 1BOGB 4LNCA 4MMWA 1QWNA 4QGYA 5IHUH 1RPXA 1LO0H 1TIWA 2RH9A 4GRLC 4IHOB 4YTUA 3INOA 3KXFB 4RQQB 5D7HA 5DD0H 5GGRB 5KYWA 4HKPA 4GRSA 4RAVA 2XJ7A 2WZEA 3TYEA 5CG0A 4UYQA 2FDMA 2QQNH 1B3YA 2NY4D 4L18A 1SMDA 1PTGA 1QMUA 4S0SD 1HJUA 1U6AH 4POUB 3EMQA 4M1DH 4YMZA 5GJMA 4AGMA 1TG8A 1HZYA 3OZOA 1JNHA 2YQGA 1NBVL 3QJQB 5DMIL 3C3UA 3KLKA 3VGBA 5F88A 1T1YA 4HKBB 1IMHC 4FFZL 1S7XA 1HKLL 4XKYA 1OFDA 2IQ9L 5C2GA 3U48A 3MNZA 3EXJA 1KDIA 2J6EL 1VFAB 4OM0H 5KANI 1ACCA 3SGDI 1M2VA 4AC1X 2H3NB 3HG1B 2IGLA 1IEXA 3IGUA 4HFUH 4LU5L 1ADOA 1H4PA 3CHQA 4W6WB 1HW6A 1A5FL 4WTZA 3HZVA 4D9RE 4H04A 1U3HB 3KH3A 3ROOA 1CFMA 4JIEA 3OOQA 2WYZA 5IVXB 1M7DA 4DCQA 3CV2A 4BEQA 1VADA 5INCB 4E41D 4CJ0A 4YO0B 3W1MA 4LC6A 1KTBA 3MDJA 4EEEA 1XIEA 1GS6X 2DQDH 3ECQA 4ALAH 2P80A 5BW7A 1UA3A 3RDTA 2DIJA 2HRWA 3QHOA 1ICSA 2JKIS 3EFOB 4WGVB 5GVJA 3CV1A 2HKAA 5FESA 1GC1H 3EJYC 3H23A 3WE6B 1I7RB 3WMQA 1SUXA 4RBPK 2YGVA 5H8DA 4DPBX 5IB4A 4FQLL 1MCWM 2C9SA 1XFCA 2YFOA 5DRXA 2VWTA 4FXSA 3WQWA 5FA3A 1NC4B 3SKUD 4ADGA 3W70A 3NQGA 1DP0A 1RVKA 3QV6A 1W1B1 1HO1A 3H42L 3ZMRA 1UWEH 3WLBB 4MWAA 1WPCA 3QAQA 4JQIA 1M9HA 1Q7ZA 1UKQA 3GBDA 3NCWA 3MSRA 1QPKA 4P49A 4G9FD 1P7QD 4U3SB 1B3VA 3LQAH 1EDYA 3ARBD 5E2UH 4KVCL 3VFOA 1HHIA 4CSTA 2P3EA 1UZ6F 1MZHA 2X40A 2PU0A 2VN3A 3V9FA 3WNOA 3ZQ9A 1EEYB 1H6UA 2HZHA 3NIDE 2CHOA 3N18A 4FEZA 5D8WA 1IC1A 2HG5A 2NSQA 3NABL 1W3HA 3FYPA 4PUWA 3UZ5A 4EIZC 3UBXG 3LNEA 5JIHA 5LAXA 1AP2A 3IJDA 5CLXA 3GZAA 5TAOA 2XPZA 1UYWH 3NH7H 2R1YA 1OAZH 3IJYA 3PHSA 4IIBA 4TO8A 1FX6A 3W2NA 3UR8A 2AAVA 2IBBA 1U95A 2NY6C 5C0JB 2ZUVA 4JS7A 4KAQH 3OHMB 1EO5A 3QA3B 4I3GA 2KZBA 4LVNB 4ZFOB 1IT8A 3T55A 2HWZL 4IBUA 3W1UA 1KJ3H 1DVXA 1RUMH 3VIGA 4BZYA 5D9NA 5D1ZC 3BJSA 1UJQA 1RHCA 4MXWL 4UM9A 3C0JA 4OUUA 1UWGH 1SVZA 3LB6C 4UFJA 1ZHAA 3E6FB 4M1BA 4RZ5A 1XIDA 3QUHA 4HKZB 3X13A 1TZIA 4Z3TA 3IV3A 4XMUA 4K5OA 4U1IA 3X3GH 2PCPA 3SO3B 4ZQMA 4WDIA 3RYMA 2MFNA 3WEXA 1XCQB 2Y70A 2Q0ZX 5CSZB 3OKNB 3HBQA 4EOUA 4G42A 3TVAA 3GBNL 3CWOX 2MKWA 3C6LC 3KXQA 2ZAHA 3QHMA 1D5BB 4Y9PA 2GJ6A 1XGQB 4I3RH 3MNMA 4BUGA 1R3YA 1X3DA 4JG5A 3GBMH 3JW7A 1OP9A 3PWNB 1JGUH 2XWZA 5L0QC 3ZJAA 3VXQB 3S83A 3SW6A 3E74A 3WFCL 4ZE4A 2UY2A 2PTVA 4IRJA 5CZXD 2Y9RT 2CO7A 4DGWC 4HJ0C 4AXWB 2C7FA 4H6KA 1WBXA 2DQFB 1CGYA 4PJ8B 4XO5A 4ZUTA 2ZX5A 3C12A 3G5VA 3LVEA 2KHAA 3GC4A 4LCRA 4Y96A 2V0TA 4P5RA 4GFIA 5MI0B 2ZRWA 4PJHA 3BC9A 3KP1A 3SCMB 1Q8JA 3PF3A 1TPXB 3DX0A 3QR2A 3PFMA 1B54A 2PO6B 4L23A 2Y8VA 1KN4H 1T6VN 2XSKA 3LIZA 3PQYA 3NOYA 4DTGL 3RGVD 5JHAA 4GAJL 3UBXA 1G6CA 3N2XA 4XAFA 1EJRC 1HIMH 1GW1A 1TX2A 5I1CL 3P2BA 4UQCA 3MA9L 4JY5L 1I1YB 4KZCA 2XTJE 4GSQA 1Z3GL 3LZFH 4HS3A 1SHXA 3SPIA 1CFNB 4R8WH 4OW6A 4RGOL 4WJKB 3PUEA 4QPEA 3OR6A 4IFKB 5G55A 3WSUA 3KR3L 5D7SH 3SODB 1QOXA 4IMDA 3QNXB 2PU1A 3SURA 5EFFA 4H00A 3TGXA 2BP8A 3KBSA 3ALWA 4RX4D 1QLRB 2BG5A 5B7EA 3V6BR 1NGZB 3OPZL 3CHSA 3N2JA 4XB7A 1HAWA 1MFAL 5D5ME 1CLKA 2B5IC 1MUWA 1OYBA 3NL6A 4GXWA 1G4SA 3SOBH 3KPLA 3ZIMA 1CURA 5GGUA 2O7SA 5BZDB 2XGBA 4PBGA 3UGXA 1TVPA 3GBEA 5E6IC 3WKNA 4ZXBD 3KVLA 3M5XA 2C4FU 2IGTA 4GRLD 4JFZH 4Y19E 5GGQH 1OEZW 2RDWA 3AICA 3HO8A 3V6OC 2WOQA 2WB7A 5LAPA 4CUCA 2VC9A 4K7YA 4Z3JA 5AFAA 2REQA 1A1MB 3FDKA 1KCUH 1A14L 1R3JA 3OZ9H 3V4PH 2QGCA 1BPVA 3LN4A 4XN2A 5BRZD 5A6LA 2E59A 2BSSB 1XX1A 2ODOA 1PKOA 2Z0IA 3BL3A 2RKXA 4K5NA 4UR9A 3WIJA 1T4WA 2QPUA 4DLFA 4HLZG 3ITLA 4MYPA 3ZVHB 4HGXA 1RIVL 4MKNA 3WEZA 4A21A 1EFXB 1K3IA 4KK9C 1RLCL 2CGZA 2ZXEB 4FNUA 4GQZA 1YADA 3AO0A 2ZG2A 1Z0MA 3DJSA 2BSTA 1ROWA 3AWGA 1JZFA 3CN2A 4GQQA 4ODTL 1QLEB 1SF5A 4RISH 1SYVA 1KB5B 1ZT7A 2MPAL 4Q89A 4Z0XB 3MLYH 3US1A 3WMLA 4ZAKB 1QYGH 4DW2H 2NQZA 1ISZA 2RFXA 1ET5A 3BGMA 1U8CB 2BFVL 2OULB 3LKOA 1AMKA 4JFUA 4GC4A 3SUTA 7CGTA 3GBML 4JFHE 1XLJA 4F8PA 4GG8A 4GMEA 4N0UA 2AK4E 3P1VA 2FH6A 2GSGA 3B9KA 4ZYKA 4GVHA 2XVLA 1ZZMA 4U4BA 4XPGL 3IXTA 1PIFA 2ICES 2E76C 1QWKA 5D03A 3CG8A 1NDVA 2ITDB 1Y65A 1BQLL 1ZBCA 1Z89A 4P5SA 3GMQB 1KTKE 2BCKA 5F96H 1TELA 3W9DA 3EJYD 3H2CA 2Y25A 3FMGH 3UYOD 4NENB 3AS2A 2IBZX 4DF1A 2OOGA 4OLVH 4Y4KA 3TEZA 2B7QA 1XBXA 1WXZA 3V0AC 4KBPA 5EPMB 2ZZ2A 2BNUB 3QUXD 1KJVA 1IAMA 3OMNB 3QHTC 1F61A 3SCVA 1KGIA 1YQVH 3NG3A 3K4AA 2FWOA 2EDOA 2Y23A 3F6JA 5AG8A 5B7MA 2YR1A 4IKIA 3A3XA 4LAOA 1BIIA 4N8VG 3JWOC 3QW4B 3RWFB 1UZ8A 4XI5D 3KWTA 1NC2D 2DMGA 3DPDA 3ZE0F 4N8VB 4KJYB 5EWIH 2GJNA 4JQVA 4LESA 5C0AB 4Q8OA 2G50A 1T80A 2CXGA 5IVOA 3PHQB 5CD5D 5F6HJ 2K3HA 3U1QA 4RDWA 1FNEB 2DLFL 2KMWA 4GXFA 1OPGH 1KXTB 1XSKA 2VLLA 3VG9B 4J3XA 2VGGA 1F00I 3VXRA 2W60B 1ND0B 2OMYB 3MV8B 4J4PA 1KV7A 4DKEL 1GTHA 5IQOA 2J9YA 1OGAD 4PAZA 4F7EA 2OPJA 4HCHA 5K2ZA 3WQOA 2NY6D 2NYYC 2ESVD 1E6JH 2PYEE 1HX0A 2UY7B 3B5GA 3N0PB 4N2CA 3DFYA 2PLKA 3RUBL 3SUSA 3I2CL 3P3SA 2QGBA 5AAMC 3KGTA 1H61A 2HJFA 3WO4B 1YECL 1Q5MA 1Y18A 2IH1B 4N0UE 4YH6A 3B3IA 1T4KA 3A67H 3ZUNC 2AL1A 4DKFL 4QS6A 1M9WA 1ZTXE 4PJGB 1FZMA 1HSBB 2WB1A 3DETC 4P4KB 2VGIA 1HXKA 3UZXA 3LB6D 3MZTA 1WE5A 2X2YA 5EEXA 4XNAA 5J6SA 5JIDA 3T7VA 4RSYA 4XP6L 3PTDA 3MR9A 5AHNA 3WJJC 5AAWA 5L88L 2JBMA 3QNZA 1F2JA 3N5AA 3FT3A 4WFED 4CSPA 1U83A 3UXIA 3I6LD 2HVJB 2XZQH 2YCIX 3UGRA 3ET9F 4E9XA 1Q85A 3ZS4A 4YHEA 1CDGA 5IJDC 1UR4A 1WBYA 3PPEA 5DVLA 5EORL 4M19A 4E41E 2OZ3A 4UFIA 4GT7A 3L5HA 4OJFH 2WXFA 5EZJB 2JKJA 5A6IA 4P2RE 2ZPKL 4NJKA 1MELA 1P2CA 4JFSA 3TA3B 1G6RA 5DD5L 5HXMA 2X4RB 4D9RD 4Q6YA 2J57A 1IGML 2PWEA 2V37A 1BSLA 3OIHA 4GHRA 4HJ0D 1D6EA 3PFQA 1MHEB 2YSTA 3R19A 3GSUB 1FP5A 5FA4A 5JHLA 3L6FB 1BZ7B 1JCJA 3UR7A 1G9MH 4JKWA 4GRWH 3MAWA 2PKDA 2WSKA 3T4YB 4EXPX 3C86A 1SXNA 1W8NA 1ADQL 1DVFC 1HH6B 1W80A 4IQHA 1RIHH 1AI1H 3VRIB 4L2LA 5ISZB 1CWYA 5CEYA 4XO3A 1QT1A 4PGCA 4L4TB 2CJUL 3TJHC 3GWQA 5A6TC 3KAOA 4WF7A 3BW4A 3P77B 4C4KO 1YTKA 1OZTG 2NDFA 2CRIA 4GW5B 1PYWA 1Q94A 1ULVA 3C5ZC 5H37G 4J3OC 3T0DA 3GXNA 2YEZB 3TVMD 1G7IB 2EEFA 4GBUA 3HLKA 5IB3B 4D6IA 1QZ1A 1A49A 1TEYA 4OF7A 3BTNA 1OOWA 3QIUC 4FTDA 1MCIA 3D2UD 2AJSH 1HQ4B 1Q4NX 2ZXDA 2ZUWA 1VPOL 1AE6H 2PF6A 2W9EL 3OQ3B 3P4LA 5H35A 5LQBH 3H6AA 3VYNA 5I66B 4LC8A 4HFWA 2C6QA 1QOQA 4HCLA 4I5XA 4XKMA 5T9BG 2EPLX 3DPBA 4S3GA 4AYFA 2KLRA 3V6ZA 5IEKA 4U2YA 3LZ3A 3N1AA 4FSAA 4O53A 2KPWA 4NJJA 3E2HC 4CMMA 2ZIDA 4EPSA 1E9PB 3T3PB 1I2OA 4L4PA 2K70A 1RY7B 3AY4A 4PJ6A 4GMSL 4HPOL 2Q8AH 2RDUA 3PP7A 1LO5B 2P3YA 1I1AD 4KKLD 2BH0A 5E6ID 4K3DH 3T6VA 3O6FC 4HTYA 1KB9K 2NX5D 1E42A 4Y2LA 5TH2A 3ARPA 1IFHH 2AGTA 4AQZA 1DL3A 3LCXA 2E5EA 1UWXH 2CJSA 2ZOWA 4OLZH 2OLAA 2EYTA 4HHLA 2W92A 4UQ2B 4UU9B 3ZDYE 1I2QA 1GAFL 5DFTA 1G7QA 3FXIC 3DBXA 3KPPA 4JQ3A 2PSNA 1IAIM 1VD6A 3WQ6A 1FFQA 1UEMA 2R0KL 5F1KC 2E09A 4M5ZL 4BSWB 4IPJA 1ONWA 4MY9A 4FB7A 4M4PA 3IFOA 1KQYA 1PIGA 2C9RA 1PCWA 4KK9D 4XAZA 4YX2H 1AZ1A 2V2HA 1R75A 6XIMA 4EIVA 1BLNB 1HQRA 1JRHL 2VH5H 2B4GA 2NVAA 1RJZA 2H0FA 4TF4A 3MLSH 4X5PA 4KQ4H 3ZKMC 1FIEA 1SF3A 2VDRH 5J06A 5M95B 1D2KA 5ADPL 2FX7H 1PB0A 3W7PA 2E8YA 1E50A 1ZHBA 1N5YL 4RMVA 1A3WA 2LAGB 2WD0A 2PB1A 3MXWH 1AZZC 1FGNL 3HBLA 1IZJA 2ERJB 4ZX5A 3VVGA 1FP9A 2Z1KA 1KW1A 1NWPA 5HAOA 5GRZA 4KROD 1PKQA 3RN6A 1X9UA 4MGXA 5DZPA 5CN2A 5GIRA 3GKZA 1F8MA 3N2OA 5E03A 5T1MB 1EBPA 2FTWA 3MJYA 2VXQL 5BUPA 3OVPA 2D8KA 1XXFC 2OQJB 4IH3A 2D7NA 2H1PH 5D1ZI 5EIVA 4CKVX 3DG3A 3KBNA 1B3ZA 5SWQB 3VOIA 3CXDH 4KRNA 3G18A 1A3RL 4ODUA 1XYLA 4YVPA 3W86A 4Z7UE 2PW2B 1IEHA 3FN3A 1KCKA 5FYJD 2AI0L 2X4QA 3KJ6H 2X1PA 3S2AA 1US0A 2BOEX 3SQOH 4IMEA 3NL3A 2YRPA 5BVJA 2WWCA 4FXGB 2DIKA 4B95C 2ABAA 4NUJB 2FGWL 1GG0A 3BPOC 4XBKA 4ZSOA 4M8VA 3CM4A 4OGXL 4IX2A 3QUXC 4XC3L 1DLHA 3WDJA 1YNQA 3OBKA 3UZVB 1NFGA 1REQA 3TBYA 1YUHA 1ICPA 4IMFA 4RDZA 3IIZA 1VEPA 3MMEB 2ED8A 3HNTL 3WJWA 1QFHA 4OSUH 1ISXA 1DDHB 1U22A 4FI7A 1TZAA 2ZNWA 3FTGB 4Q58C 1W1PA 2FTYA 1MW1A 3B4YA 4WZ9A 4U5IA 1FNHA 4GRMB 1WB0A 4TKWA 4AIZB 1A0EA 2WSQA 1RZFL 4Y1AA 5DS8B 3RURA 2Y62A 3TCLA 1IGTA 1X7QA 2D31A 5J89A 1U92B 1GVIA 1Z32X 4B9KC 4MKVA 1M68A 2P3ZA 5AHLA 4P7NA 4W9EC 1UC5A 2XWTB 2E7CA 4FQIH 5BS0B 3LHVA 3H4HA 4MZ8A 3RX9A 5A6JA 1MKFA 1CXLA 2V5MA 1OAUL 5DJAB 4K36A 5IG7A 1PE1A 2OTPA 1SLXA 3GB7A 2R8WA 1LL6A 2FBJL 3UTSA 4NO2B 2BOLA 3HAEH 3LEXA 4JNYA 1LT8A 3KS5A 1P0KA 2HG5B 2IOIA 3ZJ6A 1JGLL 2RIKA 2I14A 1DJHA 4OLYH 2F38A 1F5ZA 1A6VL 1N26A 5TDOB 3OVQA 3PBWA 5DSCB 1PZDA 1YNLL 1PX4A 3R18A 1N9PA 4YQXH 3U4EB 3VXUB 3ULUD 3SBWC 4KY2A 3KVKA 3PHOB 5EPMA 2GHZA 5FDYA 4GYPC 4NPJA 1J0HA 2CDGA 1TQUA 4NSKB 5C0JA 3IGLA 3L0KA 4O5LH 4JPIA 2PP1A 1V3HA 4EQ2A 1VFTA 3MLSL 3JYBA 3KYNB 2P44B 4QY8B 3VNJA 1WDPA 1AO7B 1PG7W 1F9CA 1ET8A 4UM9B 2AJYL 3HZMB 1JK9B 3O2VH 3W2KA 1PTZA 3FJ6A 3INPA 3BH8B 4IQJA 3CZFA 4XBMA 2Z92B 3GS7A 1CVRA 2HCZX 1FWCC 1Z5HA 2XG4A 1H7RA 3SFKA 5LA1A 3D25B 4HUKB 2R0KH 1N6QL 3NQIA 4QTFA 1MI3A 1SQMA 4QYOB 1PD6A 2DWXA 3ULVF 3PWJA 4I85A 2ZOTA 1WD8A 1UROA 1KRAC 4NLHA 3BLPX 4LP4A 4LPTA 5D1XC 3VILA 3W85A 1KB5A 5EF2A 3FB7B 2BP0B 2VR6A 1XV8A 1A6PA 1A6WH 2ENSA 5GGVY 4F1SA 2VFHA 3KOWA 4KNQA 5HGBB 3PZUA 4L8DB 3B3IB 3V9CA 5AVYB 2V2DA 5F1VA 3UTQA 3LKPA 4NASA 2BVWA 4HIEA 3VE7A 3SGKC 1W2PA 2CKNA 3RWEA 4MB5A 1F3DJ 1UKSA 1USQA 2VC2L 3AU0A 3C5ZD 2XETA 3GSVB 3HZKB 4JO4L 4X8JA 5FFLA 5FECB 2IPWA 3BOXA 5A6SA 1KCSH 3WXVH 4CBZA 1IE7C 4NJAL 4YNYB 3QIUD 1FHUA 4GK8A 1E9QB 2O61A 4GY7A 1CFBA 1X5JA 3PANA 5DT1H 5TE4H 1VF8A 1FNGB 2Q87A 3G6JE 2CEQA 1JPTL 1TF4A 1W9UA 4Y7MA 4ZQKA 12E8L 2VSKB 4AQ8A 4REQA 1AIFB 1BW8A 4LSVH 3X1GA 1AACA 5I75C 2YJLA 2IKGA 1UZ6E 3MRBB 1F73A 4GUJA 5DDHB 4H26A 1O7SA 5GRVK 2OXHB 1R1CA 5D93B 5C09E 3AMGA 4IGBD 3RAJH 2INZA 2FHCA 4JUSA 1HAUA 1BX2A 2YD2A 1QLEH 1SDDA 2X4RA 3W07A 1CLZH 4I5BB 3DUUB 3G6AA 2W95A 3G1HA 2OMXB 4UQEA 5AW4B 5G2WA 2QVMA 5GZOD 5G1YA 4LLVB 2X1RA 4WDWA 4A2SA 4DPAX 4PV1C 1RIHL 1UB5A 2O55A 4KJYA 4WW2B 4YPGB 3NIFB 1YN6B 5HYSG 3PJSB 4C6EA 1HCYA 5FKPA 2D4DA 4QOKB 4AKQA 3GF8A 5CH9A 4BBWA 3V7AE 1VFSA 4BE5A 1SO6A 1B3XA 2XWEA 5GS1A 5L9DH 1FG2A 1OQOA 3ESPA 5HJBA 3ZE1E 3QUMH 1JTTA 3NJNA 1ML1A 5F2MA 2CBOA 5KMYA 2XLLA 4TNWK 4TSBL 4LAQH 4F37F 3G8RA 4AGPA 4FYSA 5D8ZA 3W1LA 3P77A 5D6CA 3F65A 4KI5D 1LDCA 3N9RA 1GOKA 3URBA 4XCFH 4AEIH 1I9IH 3I9GH 4P5KA 2WMKA 1Y18B 2IH1A 4NUQA 5HHOB 4JG0H 2ZX9A 2LU7A 5JUEH 1RD5A 4MRCA 5JXED 4NRZB 3UYRL 3CDZB 4AGOA 4PJGA 5MEND 3AS3A 4PG2C 4XBEL 3RRAA 4GKNB 4DAGL 2FB2A 1FO0L 5EA0L 3NTCH 4QIUA 5JHLH 3WD5H 4E0CA 3MI6A 3V4VA 1W9VA 4LARL 3L68A 2ALRA 3NPVA 4QKXB 3JWNH 1GZQA 5C86A 2HS6A 4ZE5A 3RNDA 4KROC 4PLOB 3QNZB 1KT2A 3EOLA 1PJ9A 3UXFA 1FWBC 5FD0A 4XHQA 1BFOA 3TROA 2OBGA 4U7MA 2GGEA 1H15B 2FD6L 1KJ2A 1KIUB 3NZGA 1EPXA 5LHEA 1MUJA 1CGSL 1Z7AA 3RP1A 3IJSA 3FA4A 3FHEA 3LEPA 2ZWSA 4N8UA 4X42A 5FGBC 4WO4D 2PTDA 5AOUA 4K5PA 1OVZA 4C4KT 3EYOA 1JZIA 5T33H 3VVVA 3TFCA 5KJRL 2PDMA 2XY2A 1R5VB 1XYFA 2X30A 4ORGB 2OR9L 2Z7ZA 2WZHA 2BVOA 1W0VA 5AW1B 3VDAA 5TDPA 4M5YL 5K9JH 1NQKA 1L9OA 3UOAB 2A85A 3BLLA 4YDIH 5AN7A 3AYRA 4K3EH 4KXZH 3H9SA 3V0VA 2YXOA 1WQVT 2HFGH 4MDJB 1FKWA 3D6NA 3G6DH 5BO0D 4FOUA 1HH6A 4U3CA 4TPRL 3E9AA 4WJG3 2JK5B 1CG9A 3ME0B 3BCJA 4WJ5A 3DENA 2FO4A 4UMCA 4AMCA 1NCCH 3GMQA 2I17A 1WRFA 3LD8C 3GAYA 3TN5A 2FDSA 4P23A 1CD1B 3WOVA 2IQAA 5I1HH 1GYAA 4JDTL 3PIQB 1W0WA 1HVQA 1JYNA 4O58H 2XJKA 4MCYA 1I31A 3N11A 4YLCA 4MJMA 4GH3A 1QW8A 2W67A 1RKRA 3NYDA 2D2OA 3RWIB 3RMJA 5A2AA 1WV2A 4MCZB 3I3DA 4ONOA 3TBTA 1CPUA 3GR8A 4P2OC 1MCPL 4QRPE 4HG4J 5DRCA 1IVLA 3BV7A 1WAPA 2CDEA 3CZUB 4RMBA 5HSFA 5AYTA 4PJIB 2BOBB 2AXWA 3UQNA 1FZKA 4JY6B 3UTPD 3JWDC 3OKYA 1FFRA 3GLAA 1T0OA 3MV7B 4RFOH 4YXLL 2A3BA 1KXTA 2VLLB 3QXWA 4BQ9A 3MW7A 1HJSA 1GVOA 2X4SA 1TQCB 1RZ7L 2PXYB 2VR2A 2C3WA 4O02L 2QBWA 1IQ8A 1INDL 2V17H 2UY6A 2Q7NA 3IM1A 4NO0B 2OMAA 5JO5A 1OARH 1X44A 2LTQB 1QTYT 3NZ8A 1CT8A 2NTFA 3M7OA 3MLRL 4ANXA 4GS7B 5JOPE 5CSGA 2FR4B 1NY1A 3SDCA 3MLTB 3MV9D 3NFSL 3R06B 3K6DA 5FJJA 2PCXA 2ZXWB 4BXSV 2KDGA 4ZPVA 2VC7A 5REQA 1RIVH 4OOUA 1B0WA 4JN1L 1LP9A 1RURH 2O93L 1IRAY 4QGTA 1QKZH 1RSCA 5SWSA 2X7LB 3OAWA 4ZXBC 4QITA 3ARUA 1COBA 3A4DA 4LLYA 3FO2A 2K6ZA 3CVHH 1GS8A 4S2SB 4KCVA 2GT9A 4JE4B 4PLJC 3CTLA 3UPCA 3H22A 4J3ZA 4PGEB 3V0GA 2I5IA 3WJXA 2Y3NA 4U49A 3LH2L 4S1RL 4JPWL 1B31A 1F90H 3X12B 4LCCC 3ETBJ 3KWXA 1A3XA 3DNKA 3FK3A 3SQBA 2ZTKA 2VUYA 4M48L 4O16A 1F8IA 5J6HB 1KLUB 4HT3A 1WUNT 3D50A 4JPKL 2XT1B 3MRLB 5DJ8B 2IAMB 4ORIA 4G9PA 4X5RA 1JXJA 3MP3A 1QABA 2QZQA 2YPVH 2FZMA 3EZ8A 2CA3A 5AW8B 3T2LA 4X6DE 4PZVA 2J1XA 3QDGA 2Z0BA 4NSKA 4AHQA 4WWPA 1DJGA 3PQYE 1GNXA 2IO5A 1SO4A 4JPIB 1CU4H 4JIIX 2VDOB 2YAHA 2FE0A 3R94A 1R38A 1W3JA 4YJ5A 3KZ8A 2UV3A 4YS4A 3PNWB 3EB2A 2ZSVB 4TX9A 2AEOA 4RMSA 1TVHA 2ARJQ 4BFAA 4C58B 4W7WA 5I1CH 1OK8A 4XXDB 4XN5A 5LG6A 1W0YT 3FHAA 5AOMA 4UDTB 3A4AA 4GXVH 5KYUB 1JPMA 3LKRA 1N59A 3BSZA 4R2GC 1DQVA 2GG1A 4M3JA 1S7UA 1P0BA 2XH7A 3HC3H 1ZV2A 3TYAA 5C5YA 1KN4L 4U3HA 2WVUA 1CB2A 5T26A 2QJIA 3AMDA 1J12A 2R82A 4F79A 3TQKA 2PGFA 4E9VA 1ECEA 3E0IA 4W6YB 5LBVA 3QFDB 1BAWA 4BGDA 2I5GA 2J13A 4FS9A 2IDUA 3NZPA 4UR8A 2ZKYA 4O51B 4I0PC 5DS8A 3AAMA 2I69A 1D9KC 1ZSXA 2JJSC 1S5IH 1GHFL 5SWZE 4Y19A 2OX5B 4JKLA 3GTNA 4V1DB 5CP7B 3LV5A 4TS6A 3ZHLA 4KWSA 3B56A 2Z2UA 5GJSH 4QNEA 4FMVA 5FAGA 4CU6A 2CLFA 4BQ4A 4OFYD 3GB7B 2CG9X 2MQGA 2YOCA 3QFGA 4I3RL 3HV9A 3MLUL 3PZVA 4CNOA 1AA1B 1B4JL 2EYSA 1MI5A 5JXEC 1OGSA 5IMMA 4L0PB 1DLFL 3TN0A 4M7KH 1SW0A 1IIHA 3IGSA 2NXZC 2F8VA 5KYXB 4KI5E 3VGAB 3ZRCC 4P7RA 2OZ4L 3BISA 5EZIH 4B60A 1DV7A 1WBHA 3BJFA 3F3HA 5IESH 3HG1E 4P5TA 3DV6A 4P0DA 4YWGL 5I3DA 2OJ1A 1KFLA 1B6UA 3O0KA 3IBEA 1GZGA 2B9BA 2F18A 3L3GB 3E8UL 1NGYB 2EZ0D 4Q8UA 2LHAA 3H2WA 4A2LA 3V18A 5EY5A 4MXWH 4KFPA 3O8AA 3OLGA 2V5CA 4WR3A 1DQQB 4J27A 1O4UA 2TSYA 1AKJB 4XWGL 2FO1A 3DETD 3GK8H 5F3FA 4ALDA 2WBJB 4QRUA 2F19H 3AM8C 5K33A 4IOFC 5F1NA 1JPSL 4WO4C 1D5ZA 4R7DA 3TH4T 4ML9A 1KTJA 2P52A 3KGSA 1TJIH 3NCFB 3Q13A 1QWUA 4M7ZB 3TA4D 3LOWA 4YAQA 4ZS6D 2GK0A 1G7MA 5E1AB 1NDTA 5E9XA 2VD8A 5ICXA 1BVKA 1C8PA 4NF7A 1HH9A 2D7TL 4L8BA 2H2PD 2VFDA 4GT0A 4OGAC 3O4LD 3VOJA 3R0KA 1AC0A 1MFCL 3ML8A 3O3BB 1PLGH 2DSKA 4KPLA 3K6SB 3TR9A 5KZEA 5PTDA 2PDCA 4RE2A 2YD8A 1GGIL 2ZKHL 4N25A 5E56A 3C60A 4YDJB 4OQVA 5JNYB 4RFOL 1U8NA 2B1AH 4RPQA 3LKQA 4XMPH 4IMLA 2QUMA 4Y5YA 5F7NC 3ZKXB 3UBFA 4X4XB 1WIOA 3IU4L 4JTAA 1QSEA 1JCTA 4FXGA 4CN4A 3LHZA 4IU3B 1JHLL 4PJXE 5BU6A 1SPQA 4YHLL 4Q3MA 3UVIA 1VPQA 3SE8H 5EFIA 5HI4C 1YJDC 3NZRA 5KSUB 3EFFB 3CSPA 2WHLA 1IKOP 3OGCA 1YUHB 4JG1L 1T7WA 2QUNA 4MCMA 1UENA 3LRSA 3NVQA 3OG4B 4Y88A 1DVFD 3FT2B 5C09B 3WXWL 4YLQT 3B2DC 1KM1A 2X2UA 2CERA 2FB3A 1R3IH 1UFUA 3W1TA 1MHHA 2VNCA 3EPNA 3L5AA 4WTZG 1CXIA 3LLFA 4F33A 4U1SA 5E2WL 3VJ6A 3KYKH 3C8KA 4X80L 4BYHA 5C7VA 1GGYA 4PI0A 2XACC 3D85A 5J5EA 4C6CA 2AV7A 9PCYA 3TT1L 2OFJA 4J3OD 4L8CB 3WZ0E 4PRNB 3TVMC 1OTSD 3BAEH 4DM1A 2YJQA 3WFDH 3P4OB 2Q6WB 5FUZL 5B3JF 3DZ1A 4UNKA 4LSPL 2DYPB 3FQTB 1GR7A 2YIHA 4GBXC 5HHPA 2J88A 2Y8UA 3KLAB 5E1QA 3K46A 4MF4A 4Y16D 3LS5L 4Q6JA 2G2RA 4YBLB 5MEQB 4I88A 2ZUTA 4DUVA 1TLKA 1QEXA 4PRID 5T3XD 3MA7A 5C0QA 5GQBA 1SJHB 1JQXA 3L21A 1CD1A 5F7LB 4DUXA 2DPEA 2BC4A 3QISA 5HI5C 4TNVF 1ZIBA 1HKVA 2EVJA 4LKXB 2WW8A 4XX6A 4UMSA 4UTTC 4IJRA 1IM3A 2NUTB 1H7OA 2IH3A 4K2SA 1V7NL 3L3OB 4JQIL 3RWIA 1YNTA 4WGWB 3SOTA 4PLJD 1E4XH 5E2TH 3L7RA 2H7WA 1JN6B 5GISL 2UV8G 4XVDA 1J9CT 5C2CA 5DMLA 5K9OB 4G7SB 5CZRA 3OXSB 2GOKA 4X0NA 3LIUA 2W9MA 1K8YA 3UJRA 4OIIL 1RUQL 4ZTPL 3REQA 3G1SA 2JJUA 3OAZK 3AFBA 5KTLA 1IFGA 2C1IA 3JR2A 5E8NA 5IHUL 3EOBB 1GY1A 3NTCL 3O16A 2VWSA 3TWYA 1E28A 4D8AA 2EC8A 3CBKB 3MJ9L 3K3QA 2CITA 5IGXL 1E1CB 5F21B 3TWBA 4JDZB 2QF8A 5T3ZE 1J0KA 5BRPA 2P28B 3PWJB 5KITA 3MJ7B 3QZPA 5EIIG 3TL5A 3A3WA 4WY0F 1QTPA 3TX9A 4G6ML 2BZCA 1BVNP 1S9KC 5CO1A 2B7OA 2AQNA 2CLVA 2IMNA 3IN2A 3WYRA 1J2WA 3WUFA 5FYJL 1BQKA 1THFD 3IMSA 3OZPA 4L8DA 1T04B 1HKKA 1NBZB 1LEIA 1PAZA 3PXLA 5ELIA 2PDIA 2EABA 3UCCA 4HNTA 5C0AE 3NCOA 1JG9A 3ZRFC 5HHMB 4QHRA 3E12A 4NUWA 3HE6A 4BQ5A 5DJ0B 3WN6A 5FUZH 3SYPA 2IFFL 5DD1H 4R2GD 1DQDL 4LB4A 4IMKA 1UADC 4M6NL 2XFGB 5HUOA 3PZNA 4D0CA 5KYWB 3KPNB 4YVNA 3MYOA 2WMGA 3WFBH 4HGWA 3GH7A 4EOWL 1H5BB 4ZQOA 2B5IB 3DGGA 2YMTA 4REQB 1ZSHA 4PRHE 5SX5H 2AMGA 4ZNEA 3QEZA 2HMIC 1TU2B 5JORB 5DT1L 3N42F 4JG1H 1AOZA 2K9FB 1EEZB 5E6IB 2J4WL 1KULA 3LPPA 1KLZA 1JPIA 2QR6A 4GUFA 1OX4B 3U5UA 4AISA 4QAWA 5TF1H 4S11A 4KXCA 1GY2A 3UJIL 2G5RA 1R85A 2BNRE 2O5XH 3ARBC 4JO4H 1S2TA 2A1YA 3BSZL 2P5EE 3MNZB 4XNYH 4GISA 1TWWA 1NCBH 2HROA 3RB5A 3IACA 5CZJA 4DKAA 3I6EA 4ZTXA 5KJ4A 4HCGA 3TO4A 3AZUA 2NXZD 1BOYA 3LZRA 1FLRH 3BWWA 4WJ8A 5T3ZL 1GGIH 4LPCA 4W4NA 3PNWA 1QXLA 2VLKD 1NFDE 3WCZA 5I6KA 2JB6A 2ZXGA 4JZJB 3DUGA 1F11A 5FEBA 2NY0C 3PWVA 1NDZA 2D7TH 2RHEA 5AKSA 1NGQL 2IPGA 5DD6A 4UDTA 5KYUA 2ZRVA 4XP9L 1HGYA 1EP3A 3I6KB 3WFHB 3EWCA 4FMFA 5HA7A 3UF9A 4IRSB 3UPRB 2R51A 1L8PA 4BRJA 4PB5A 2XXFA 3NFPB 5GSRB 4RE3A 3IE9A 4DZAA 2XU2A 4WW1B 3WBWA 3CNKA 1TPFA 1IU1A 3E3HA 2J5WA 4RRPM 4R85A 4Y2WA 4L37B 2YXXA 3QUYA 3VFWB 4M7LT 1FC1A 1XGPA 4BD4A 3QORB 5KS9B 3KZPA 1XL4A 3IPFA 4D7BA 2Y1YA 1A7RH 4O1CA 2ZA3A 2N3JA 4PGEA 2M8XA 2HVKA 3EGJA 3FSAA 4PRHA 1IEVA 1F18A 5D2YA 2XFXA 1MXDA 2J5LB 3EJRA 1OGTA 3GSOB 3H9SE 2Y1HA 4DKDC 4R7VA 2B39A 1WTLA 1MDAA 4YQXL 1N7MH 4NQSB 3KBMA 4KWWA 1RULH 4XK2A 1KKRA 3K74B 3MCKB 1U8MB 1Z44A 5CAKA 3RKPA 1PHQA 4TU1A 1UB6B 3BEWA 2ADIA 2QJDA 1LWRA 1TWDA 3FLUA 3DFQA 1JGDB 1UMYA 5CZXC 4OKDA 4PFEA 1BZ9A 2OW7A 3JWOL 1P4IH 3GUFA 3LPOA 4MD5B 2PDHA 3IGXA 1JGEB 1EOMA 3U2OA 4HISA 4XP4L 3PPFA 3EEGA 3TE9A 4L3FA 1JD7A 3MPCA 5FO9A 3WDHA 3QEQD 2P43B 4F58L 4UIKH 3BOVA 5JR1H 1OG0A 2VZVA 3A5VA 4MMYB 4WQOA 3T3ME 1BXNA 1MSSA 5C6MA 3FF8A 3BGJA 1AKJA 4Y5VB 5KS9F 4M9OA 4A3UA 4KNTA 4P23B 4P2QB 1JYXA 3LV6A 2EH7L 3VGDA 3D39E 3WEXB 3MCOA 4RFEB 3S47A 3V5CA 1UPMB 1TZIB 3CZKA 3D4GA 5JBEA 3IMRA 5LCVA 1S7UB 2VUNA 4JAMB 1KNWA 3VDBA 1KM6A 2YYUA 3KZSA 4O0ZA 3WUWA 3ZSTA 4Z2LA 1EDQA 4JO5A 3TQ0A 1LILA 4HF5L 5F2FA 1MLCB 3S36L 4LAKA 1CGWA 1BFNA 2V81A 2HJLA 2ENQA 2V4LA 3IFPB 3O2DL 3AISA 1T3FB 2X0YA 3STCA 3F62A 1LWIA 1IAOB 2PWGA 2IGFH 3FB8B 1VFHA 3M0YA 2CLMA 4JRXA 4LS0A 3ZHDA 1MRCL 1V03A 3E9UA 3K4ZA 3KVPA 4PJ8A 1RALA 3IFNH 5HQLA 4IGBC 4M80A 4HHPA 5C0FA 2WCPA 5A6BD 3PPSA 5DJCB 1PLAA 1KTNA 4KWOA 3KE0A 3AXIA 5T3ZH 4ODHH 1E6OH 4Z7UB 5BQDA 3SCMA 3TASA 3K1KC 5A3ID 1JDEA 4C83A 4FQXB 4HZLA 3MSDA 3GC2A 3SKJH 4P57A 2X53A 2B0MA 1MI5B 3P02A 2ZZ4A 1EEQA 4XC3H 3QPEA 4G7RB 1JCMP 2FUQA 4GUPB 3UBXB 4M7TA 4JVUA 3BZGA 4TMBA 2I60H 5TBOA 3WQPA 2NQDA 3PWGA 2O56A 2CBMA 2DQIH 4FFWC 5KANG 3DSNA 3OAUH 4V2BA 4RWYL 5EU6E 5BMWA 3ASOB 1ID5I 5FW8A 1CR9H 1CFNA 4KI5C 3TP4A 4QCEA 4ZFZA 1QUNA 2VH5L 1WAAA 4P5MB 1FE8H 3RBSA 3UBGA 4J9JA 4JQ4A 4FA7B 1KLGA 2JGQA 32C2A 3ULAB 1EOKA 4DN3L 2TYSA 4WI3A 3VCLB 2IALA 5JYLA 5XIAA 1KZQA 3JV0A 4LASL 4YYFA 1KBGL 2OO6A 3GPEA 3AHVA 2PR9A 4NAFA 5CN1A 2WC4A 3B2PA 2ED9A 1QLRA 5A8QA 4LIQE 1UUNA 4ACYA 4KX7A 3N1MC 4MMZC 5DEGB 3BRDA 3NFUA 3GSXB 5M17A 5C9XA 3SCRA 3THDA 1B2WH 2A1WL 1M6UA 3TJ4A 4KT2A 1FPTL 1IFHL 5I5IA 1D5IH 5LO7A 5GJPA 3QHZH 3QIUB 5F9JB 5KVFE 3C2FA 4YR6A 1T1XA 4AXKA 4W89A 2EIZB 4KVNL 2B2XL 4G6MH 3NP3A 3HUJF 1GZ1A 2QHRL 1SFHA 2OTWB 1ZXQA 1OF2A 2HLFD 4UILL 1JDCA 3W1ZA 2WWKT 3TN3A 1MNUL 3VRLE 2NW2B 2ON3A 3BDYL 1NFPA 1EZVY 3KCOA 1N64H 1V0NA 1HINH 4UT6A 4TQEL 1EXPA 2HXAA 4XP1H 1KDJA 1TZZA 3JZUA 3IANA 4LYKA 5DMGC 1EXBA 1FSKC 1G4RA 4AEHL 1E28B 3HFFA 1E55A 2DQXA 3ARGB 3B8SA 1KLYA 1R0AH 2EG6A 2N01B 4GG6E 2YPLE 1UYQA 5D7EA 3MUUA 1YRRA 5LCVH 3I3BA 4LVBA 3TIEA 4BFOA 3UAJC 3O45B 5IWLC 1JHKL 4NBZB 2WMFA 1M1SA 1G9EA 3TDFA 4FQJL 1A64A 1E4XL 2YQ2A 1HU8A 2FQFA 5KUMA 3B2XA 2ROXA 5IMOA 5TDNB 4ZTOL 1VYPX 2K45A 1MREL 1UQZA 2VENA 1IGCL 1N2RB 4EN3B 2RJGA 4LLUB 5T5NF 4DGYH 2YFNA 1RLDA 4RESB 3Q2VA 5JOEA 4A3HA 3QLDA 3D39A 3BVWA 5E9DD 1OADA 1KV3A 1ZT1A 3F5LA 3LCIA 4EO5A 1LO3L 5BRZE 4NNBA 4FIQA 4DNLA 3NXFA 4ZYKB 2Y85A 3D3VB 5JVLA 2V9QA 2XIDA 4MA3B 3WKQA 4R88A 4NQEA 4OD1H 4H8NA 5FWQA 1W3IA 4WWKA 5PCYA 2X2IA 4GG9A 5DD5H 1KZYA 1JK8A 2FPVA 3S1UA 1Q9LB 2WW5A 4UINH 2NLYA 5KSBA 2CC0A 2ERJC 1XGUA 3MLZH 1FY6A 3BT2L 4QXUH 3ABRA 4HHMA 4G8FB 4L1HA 5C08B 5EORH 5EIIB 2I7GA 1E0TA 2XM2A 1K7XA 4TVUA 1JYWA 3K6NA 4TSCL 1XIJA 4N4PA 4U4IA 4AL8L 3HPLB 2ADJB 5E5UB 1E3FA 3D0VB 1AXSB 4B0MM 5B39B 1JN6A 2ZXBA 2VEIA 4DAIA 3LIZL 5IQ7L 2QVTA 4P3DB 4WNSA 5BZAA 1G7VA 2Y36H 3KAAA 4W1TA 4JHMA 3BUYB 1FO0H 3MHZA 5EA0H 3F4WA 2AQVA 1ND0A 1BJ1J 5IW3A 1OALA 1WAWA 1TYJA 1XR8A 2OJEA 3FKKA 4DKFH 1KFAH 4N2AA 4AF0B 1WDQA 3E5PA 3THUA 1LL4A 1UUMA 3MA8A 3W24A 2OJZH 3DIDA 1G7MB 2BXZA 4QHKJ 4HG4K 3W01A 1WCQA 3F5WA 3LQAC 4HNLA 5D37A 3TOYA 2YEQA 2FEEI 2AERT 4K55A 2AXGB 1PWMA 1D2OA 3RJDA 3BDBA 3U7WL 1UD2A 1EGVA 1M65A 1ANUA 2O5YL 3O06A 1PD0A 4PRIA 5ITFA 2V5JA 3F2CA 4XSLA 4FQCL 1E15A 4L4OA 4KTGA 1VLXA 3V0FA 2VELA 2YW3A 3BKJL 3C60B 4YDJA 1AHWB 3TMLA 2R0LH 1KPUA 4EDXB 3BE7A 3AREA 3FW6A 4MJIB 2ZUYA 2WHMA 1MWAH 1XYAA 1QSEB 1R47A 1F3EA 1JNHB 2NYKA 4IFOA 4QRPB 1FUNA 4CN1A 5IUCA 4HIXL 1QR4A 2MJWA 2UUDK 3FOLA 4P46C 3VFGL 2Q8XA 3EH3B 3CNYA 3UZWA 5JTWA 1S7XB 4NP4H 3IT8D 2HE8A 4XKYB 1S3KH 5CLTA 4IMGA 4CCEA 3F7RA 1EZWA 3ARTA 4JEGB 4DO4A 3CHEA 3QFEA 2DVXA 3W53A 2UBPC 1NP0A 4DWSA 3O2WL 3FQ2A 3U9PL 4GW1A 2EF9A 3MDUA 1IFRA 4BWLC 5JXAH 2JTDA 5K1NA 2J43A 4F7CB 4DP8X 3BZJA 3F64A 4RE0A 3MSPA 1O94A 3EPOA 5FIPA 3F05A 3PV7A 2JMRA 1UFGA 3EJUA 5CSYA 4LB8A 5AB1A 3ZT6A 2JI1A 7PCYA 4IQDA 3KL0A 4HUVB 4XN8A 1OC6A 3ZTEA 4JDEB 5TE7L 4BXVA 5G5DA 4YDNA 5KZCB 4UBDC 1HZHH 2K4WA 3UFIA 2CESA 3LHUA 4XZMX 3O6FD 1PZAA 1ZNNA 1L9QA 2ITEA 1NCOA 3PL6A 4GSUA 5F7EH 2KBGA 4F2FA 1J5CA 1GQNA 1PCXA 1ODZA 1IGIH 1U21A 3SGJA 2QUVA 3UWQA 5TK4A 4XZBA 2JCWA 1L7TH 1Z69A 2J6WA 3A4WA 4H0IA 5IJCC 1G9HA 2VN4A 2DORA 4XZ9A 1VLWA 4F66A 3ILEA 4NZDA 1SJHA 2A9ML 2WQVA 4WSHA 3SYOA 1R87A 5E24E 4RFEA 5E8OB 3WLLA 5J11C 2NRDA 2BRRH 4NHUA 3KPRD 5FYKU 3MVSA 1NIBA 4QHNA 4EDWL 1UKOA 2FX9L 3UABA 3VSTA 3JTBA 1MJ7H 5BUGA 2Y0FA 3G0SA 1VBJA 2Y5QA 1H2JA 3U7VA 1MO0A 4G59C 5E4OA 3IWUA 1TG7A 1XGZA 1T6BX 1OBAA