4JFWA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2s,3s,4r,5s)-2-[n-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-L-fucosidase
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
total genus 162
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jfwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jfwA01
2Y8KA 2BHUA 4EAMA 2W5FA 4J28A 1R75A 3D50A 4CN6A 1LG2A 3TTOA 3VDHA 1K9TA 3RM9A 1C8YA 3OGSA 1JFXA 2ZWZA 3FW6A 2G3IA 2YDQA 4W86A 1W9BM 4LGXA 4AIUA 2F18A 4WKHA 4JL1A 5FCZA 3WUEA 5IFPA 3EJRA 3VDCA 2GJRA 4AZIA 3VM5A 2UY3A 3RCNA 4B16A 3WQWA 1KWGA 3BAKA 1BLIA 4Z2JA 3AXHA 1E56A 3II1A 3ALFA 2X2YA 2XUCA 5A6KA 2OWXA 3CUHA 3HG3A 2OYMA 1M7XA 3SCNA 1VRXA 4UQAA 1CWYA 3TV8A 1R7AA 3WDRA 1BVNP 3WEOA 4LQ1A 1W3JA 3J7HA 3BMWA 1JZ8A 5GNXA 3S5YA 4DWSC 3L4ZA 1W9PA 4FNSA 3DX4A 2ZUWA 1JZ7A 1E73M 1UR1A 1AQHA 3ZT7A 2BVYA 1Q6CA 1NH6A 4U5IA 3WNPA 3AHXA 1ZB5A 5I0DA 3AIBA 1JZ6A 2O9RA 3CZKA 5BXPA 1H41A 1UWRA 3EMZA 3GH4A 4P8VA 1XD0A 4AIOA 4MTVA 1FH7A 1BSIA 3TTSA 1B1YA 3PZTA 3VMNA 5LYRA 1TQUA 1J18A 1UWUA 1GOIA 3EJQA 4AXNA 3GM8A 1HJSA 3GDBA 1FFQA 3RM4A 4W8LA 1DWHM 4IUGA 3PTMA 2YFNA 2A3AA 2DDXA 3VGDA 5E6ZA 4X0VA 3WENA 2OSYA 4HU8A 2YDSA 2WHJA 3VMOA 1HJVA 1HKKA 4CD8A 1IT0A 1S46A 3WIJA 4J7RA 2BXZA 4AD2A 1GOOA 2VVNA 1WZMA 4UCFA 1W9UA 3VSUA 1J0IA 3PZ9A 1OD8A 4H41A 1GOKA 3O2LA 1E6XM 3N12A 2VVSA 1TQVA 1H2JA 2W67A 4GO8A 1JD9A 1E55A 1DP0A 1WDRA 3AYRA 3KZSA 1ESWA 3TOPA 4CU7A 1OIMA 4AD3A 2W63A 4V28A 2G41A 2CCRA 1J01A 1HP4A 2EAEA 1JIBA 4JKLA 4DO4A 3PZQA 4AMWA 2JFEX 1VEPA 2VI0A 2ZOXA 3AZSA 1PBGA 3N9KA 5A94A 5CPQA 3L2LA 4QP0A 4Z2LA 4GINA 4JL2A 2VOTA 3WFLA 1KXHA 3N17A 3VSTA 3PZGA 1J0HA 4AZCA 4ZXLA 1PPIA 3LX9A 7CGTA 1TUXA 2D0HA 4GKLA 1QNOA 3NSMA 1LLOA 3KL0A 1VIWA 1R8LA 3UR7A 3ZQ9A 4QFUA 2F1BA 5HPOA 4M80A 1ZJBA 4Q22A 2Z1KA 1UH4A 3GZAA 1L0PA 1AMYA 3MMDA 3WUBA 2XN0A 3VU2A 4DUXA 2PI6A 3W25A 3BCDA 2XIBA 1UR2A 3BCFA 1NM9A 3PZVA 1LG1A 4AYSA 3MANA 3VIPA 4CGTA 5FL0A 1XGZA 1EDGA 2J7HA 1U2YA 1EH9A 3CHEA 3GXPA 1VF8A 2G8ZA 2PWEA 1LWHA 5D9PA 3A21A 3CZGA 4AEEA 5AC4A 1HXKA 1VFMA 1B3WA 4W5ZA 4J3UA 2BHZA 4PMZA 2G3NA 1K9FA 5JIWA 3UG5A 2JF6A 4JZ5A 3CPUA 2WPGA 3WMBA 4AZCB 3VILA 1G1YA 4C7DA 1EDTA 1W1TA 2X2JA 5E0CA 1E6QM 4Z2IA 4N42A 3QHMA 1WB0A 1V6YA 1C7TA 3WEMA 1YQ2A 2EPOA 2ZUTA 2ZUNA 3AZTA 2F61A 1XCWA 2F2HA 1MW1A 1WCGA 4J3VA 3BLBA 1JF5A 4EANA 3NSNA 5A95A 5DT5A 1E3XA 4OBRA 4DO5A 4NI3A 3ARVA 2CKSA 1XSJA 4JFSA 4M81A 3VIJA 4NX0A 1SMDA 1E6SM 1QI2A 3ZR5A 4GZEA 2W66A 2ZX6A 3AS1A 4AC1X 1IZKA 3A6OA 4E8CA 2J25A 2ALWA 3LMYA 2WMHA 3L4WA 1HXJA 3ZJ6A 3MI6A 2VL4A 1BAGA 1QOXA 3ARXA 3QOMA 3D52A 3PHAA 2XM1A 1XRVA 3ZSSA 4CN1A 2UY5A 1V3IA 2PWDA 1V3JA 4W5UA 1JDDA 4N0RA 2YA1A 3CUGA 1CEOA 2JEQA 3WNLA 4XB3A 5A6LA 1CZ1A 4D6JA 2VNCA 1W1VA 4B9ZA 5A3HA 4DWSA 4L4PA 1SZNA 3VUPA 3WDPP 1KGUA 1C3FA 1CXEA 4P7RA 5I3DA 1PX4A 2JF7A 2D22A 3GNOA 3VVGA 1D7FA 1WKYA 3CC1A 4PTWA 1B0IA 1Q4NX 2X0YA 1WNOA 1E4MM 2CIPA 1WZLA 1EHAA 2V38A 2OSWA 5A8PA 4AZ5A 2E9BA 4FMVA 3THDA 4UQCA 1C91A 2D2OA 3ARSA 1T0OA 2Y24A 5GPRA 3IJ7A 2XSAA 3BVUA 1X1NA 1FFRA 3GH5A 1E3ZA 4UFJA 1H4PA 3FNDA 5JBEA 3W28A 1ISXA 1R86A 3RPMA 1RP8A 2WB5A 4MNLA 5A2AA 1NP0A 3WD1A 5E9AA 1KGXA 3OLIA 2VRKA 1NOWA 4YHEA 2VX7A 3T2PA 1SFSA 3AFBA 4TTGA 1XSKA 5GNZA 5A8NA 1R34A 2DSZA 5CGTA 4AD4A 2XJ7A 2WZIA 3CLWA 3K8KA 2YBUA 2ZUUA 1J0ZA 3VIGA 4DWSB 2YDRA 5A8OA 3GTNA 1EIBA 4NZCA 4PSRA 4D6DA 5ECUA 2W4XA 4LYRA 3U5YA 3N18A 3KLLA 1NOUA 2IGTA 5AY7A 3SEPA 1FH9A 1LL6A 2E4TA 1QI4A 2PWHA 3ZO9A 3GH7A 5A6JA 3PBGA 3E1F1 5KZ6A 4FLRA 1NP2A 4M1RA 4JFTA 1UOKA 1US3A 1HL8A 5M17A 2GJPA 4H7VA 3NDZA 3K1DA 3WQ4A 3EYPA 4UZSA 3GXIA 5M03A 1E9LA 2FHBA 3NYDA 1KBKA 3VGFA 2ZE0A 2WWDA 2G3MA 1EQPA 4S3JA 2VZUA 3I3DA 3SCPA 1I75A 1CBGA 2FH6A 3PZOA 3PZMA 3MSDA 3B8SA 2V5DA 4GPNA 5F7UA 2X1IA 2CBIA 4OJYA 2A3BA 2A3HA 3BUQA 1F4AA 1V6UA 1UD3A 3AHVA 1V08A 1VJZA 1PEZA 3L4YA 3CZSA 1QVBA 4AZHA 1H5VA 1JGIA 3BMVA 1E0VA 5A69A 1GOQA 1UWTA 4UFKA 2BY0A 1XD1A 4B9YA 1C7SA 4AZGA 5M5DA 2NSXA 2WBKA 1KXQA 3UETA 3VIMA 1B31A 5LA1A 1ZS2A 1C93A 2CNCA 2DT1A 2XWEA 2WHKA 3WY1A 9CGTA 3JUGA 2J7BA 1E71M 1UKSA 1BYCA 1JYVA 1G5AA 3SCQA 3W6LA 2WHLA 3H54A 1KWKA 1UZ1A 3WELA 4GO9A 1CXLA 4EKJA 4PEEA 1ISZA 2BY2A 3BGAA 1WO2A 2BY1A 1V0KA 4MB1A 2DGAA 4HPHA 2WKGA 2F7OA 1GJUA 4MB4A 2VZSA 3HG4A 4PTXA 2V3FA 4UNIA 2E8YA 1W1PA 5C71A 1NOFA 3WSUA 1OM0A 4FF5A 2EPKX 3FAXA 4Z2KA 3T08A 5IXEA 1JF6A 1AVAA 3VO0A 3AOFA 3MO4A 1PZ3A 4CKQA 3QHNA 1GUVA 5LA2A 3W27A 3VGGA 5EB8A 3EJUA 1KQYA 3BSHA 5C8BB 3HMCA 5D4YA 3K4AA 1I1WA 1VAHA 1PX3A 4MAVA 4IISA 3ZJ7A 4AIEA 1HL9A 5JBFA 2BY3A 4PN2A 3SCOA 1H0IA 1JD7A 3WBEA 4AYGA 2EQDA 4BF7A 2ZXQA 3CZJA 4A3YA 2EO7A 1DWIM 5A1AA 1IV8A 4BCEA 5CZKA 3RM8A 4HPGA 4U31A 1FA2A 3BVXA 1W2PA 3AXXA 1KCKA 3WH6A 1HT6A 3CZLA 4XZBA 1E0XA 5LA0A 1OB0A 2ZUSA 3ZIZA 1E4NA 1GNXA 4HU0A 3QOKA 2WMFA 2DSVA 3K8LA 1UH3A 2QHAA 4PMOA 3F5KA 1J0JA 1J12A 1SR0A 1HWWA 1UUQA 5I2UA 3K4DA 3SUTA 1UKTA 5GNYA 2YL9A 1E40A 1GVIA 3W53A 3WF1A 2XGBA 1SYTA 2G4FA 4DUWA 2RGLA 3PZUA 1CGXA 5ABGA 4F9DA 3WNOA 1E1EA 1HNYA 4HA4A 3MUAA 3ZOAA 5E1QA 2ZX7A 3VGHA 2VZOA 4JFUA 2XHYA 4M82A 2WCGA 2D1ZA 5CGMA 2BHYA 2EACA 3U5UA 1GJWA 3WMCA 4OBSA 2WC3A 1R47A 4HOWA 4C7GA 4P8WA 2DT0A 4HZ6A 5AC5A 2WAGA 2XVLA 4W84A 1HN1A 3EDDA 3FHAA 2Y4SA 4IPNB 2YIHA 6CGTA 5D9OA 1GW1A 2Z1SA 1V3MA 4R27A 1W3KA 4PTVA 1CYGA 3BUBA 1JAKA 1OGBA 1CXHA 4OGZA 1W9VA 1MXGA 4PCTA 2X2HA 3BSGA 1TCMA 1K9EA 5I6SA 2F7PA 1JDCA 2XGIA 1WDSA 4UFMA 1Y7VA 3HU7A 4W7WA 5CLWA 4PMVA 1M01A 4J3TA 2UY4A 2F8QA 1VBRA 1QI5A 4XZWA 5A8QA 3DYPA 2D23A 3WDJA 2JIEA 3W26A 2PB1A 4Z2GA 3AYSA 3VNYA 1TFVA 1UWQA 3OGRA 1ODZA 1RP9A 1HP5A 2JEPA 4UZUA 2W62A 3VX0A 4TX8A 5ABHA 2OW6A 1K6AA 1US2A 1F4HA 2F7QA 2HVMA 3IAQA 4ATLA 4AZBA 1DWFM 4P7NA 2FHCA 4AW7A 4NRSA 1B3YA 3MUZ1 4D71A 3A4AA 6A3HA 3SCTA 5JUVA 4NF7A 3GXFA 4BQ4A 3N1AA 3N04A 1YHTA 4U3CA 1WZKA 1O7AA 2CBJA 1TMQA 4R5EA 3VD5A 1CXIA 1CNVA 1FHLA 4DM2A 1UKPA 4A4AA 5KEZA 4CVWA 3LPPA 4W8AA 1R46A 4HMCA 2PC8A 2YL6A 2VJXA 3HJEA 2J8FA 2WK2A 1B2YA 3SUVA 4M29A 3CGTA 1V6XA 4XUYA 5ABFA 3U7BA 3W6MA 4CU6A 2ZXBA 4WSJA 1ZL1A 2XTKA 1HVXA 3VDAA 2F7RA 2ZXAA 3LPOA 3EDFA 1WPCA 2CEQA 2VCAA 4HMDA 3VNZA 2B31A 2C7FA 1JYWA 4AEFA 2VQUA 3W29A 1NARA 4W89A 2WZHA 5BXTA 1TVNA 2FHFA 1W2VA 1H3GA 4NZFA 1J0KA 3G6LA 1IZJA 2D20A 1WAWA 2QPUA 3KEHA 3UEQA 2J47A 1BYDA 3BAWA 4FNUA 1ISVA 3NJ3A 2VRQA 1VFFA 3EJPA 1KQZA 2DH2A 3S6TA 1EDQA 3BAIA 2J8GA 4URIA 1JG9A 3HZ3A 3VX1A 4D6HA 4W8BA 2XN1A 4MJ2A 3H53A 3THCA 4NXKA 2VCBA 5DF0A 3BVTA 3HG2A 3MSGA 2J79A 2XFFA 3L4VA 3O9NA 4MPKA 2QMKA 4B3LA 2O9TA 3NIYA 3N11A 3WH7A 1VJSA 5ABFB 2EXOA 1DTUA 3ARYA 4OOZA 3B9EA 3UCQA 3A24A 4ATWA 4TVUA 1LL4A 2VR5A 3CHDA 2EPMX 2ZX9A 3W37A 2PBGA 3F5JA 4DUVA 3N15A 4FNRA 3AMDA 4UQDA 3WL1A 1O6IA 3L2MA 1X6LA 4LXFA 4PTMA 3AIUA 4PCSA 4UR9A 3PTKA 3BAYA 1UD2A 3LXCA 1W1YA 5A6BD 1BHGA 4PMQA 4CD6A 4AMCA 4CU8A 3EBVA 1M53A 1WE5A 4ZXOA 1H09A 3AJ7A 1W91A 1QI0A 4QLJA 3ZMRA 1CLXA 1MQQA 4U33A 4CCEA 3F4VA 3SCWA 5A2BA 2WMJA 2J78A 1AQ0A 1CGYA 1GORA 1BQCA 4QLKA 3A47A 3ZT6A 1M04A 1E43A 2WMKA 4D6IA 4J27A 1NWTA 4MADA 5BRPA 2JE8A 3SCVA 4GI6A 4LX4A 1JFHA 1GVYA 2VZTA 4ML4A 4H2CA 5IDIA 3PZIA 2J7GA 1V02A 3EMCA 3UESA 4UOJA 4U2ZA 4W93A 1B90A 3OLEA 1UQYA 5D9NA 4RE3A 4TX6A 1MWOA 3WF4A 1JZ5A 3D3AA 2ZICA 2E3ZA 1M03A 3W0KA 3ZSTA 2FGLA 4F66A 2F1AA 3T09A 3U7VA 4B15A 2GFTA 3WFZA 1J10A 2YLAA 3WQ8A 3CUIA 5D8WA 3IK2A 3WDQA 3LXBA 2WBGA 4XV0A 5FIPA 1QHOA 2BS9A 3OG2A 1QNPA 1H49A 2J75A 3AS0A 1TQTA 5HPCA 4LPCA 1QX1A 3LRKA 2FDMA 3MUY1 4WKAA 1OIFA 2ZUMA 2YA0A 2YKKA 1NWRA 2XG9A 1X6NA 1H11A 1RD6A 1PIFA 5DMYA 5DT7A 1GPFA 3GYCA 3MS8A 3WNNA 4OKDA 3WQ6A 2WVTA 3WDIA 4UFLA 1Z32X 1EHNA 4EE9A 5JBDA 3VIHA 3FHQA 1HX0A 2WC7A 1HKIA 1KFWA 4MAZA 1FP8A 3W82A 3TP4A 4GI9A 2BFGA 4DO6A 3D5HA 5IFTA 1E4LA 4PMYA 4CCDA 3K46A 3KL3A 1BTCA 3TTQA 5FKYA 3WL0A 6TAAA 1W3LA 5I78A 2YBTA 4QLLA 3GXTA 4GIAA 1VFOA 3SCSA 4JFVA 5A6MA 3RDKA 1C92A 5BCAA 1JXJA 3BUIA 4D6GA 1GCYA 4D6CA 1UD6A 2QLYA 2GVYA 3WF2A 3T0BA 4J3WA 4UTFA 1OBAA 3S5ZA 2XN2A 3WD3A 3WUGA 4JHOA 3GXNA 5IHSA 5D9MA 2D0FA 3UERA 1ZBCA 2FGZA 2YLLA 2ZXDA 1XYFA 1DWJM 3VD3A 2E9LA 3SCRA 4KGLA 4AZ7A 1CECA 2A3CA 1EQCA 3DYMA 4TOQA 4BS0A 3WQVA 4AMXA 1WDQA 1P6WA 4AD5A 2BV9A 2GDUA 1R7OA 3WH5A 2J74A 4MNMA 4QAWA 3FAWA 4RE4A 1Q6FA 4J3SA 5HOSA 4NXSA 5JIPA 3LRMA 5BXRA 4QCFA 3SCUA 3VIOA 1PIGA 2XVNA 4OIFA 2DIJA 1JAEA 3KWXA 1HJWA 4HZ7A 1TG7A 4BQ3A 2XVPA 3OZOA 4PRWA 4TUFA 2ZX5A 2WVSA 3GNRA 3T2OA 1LWJA 3VIFA 1BYBA 3OZPA 1XH0A 1GOWA 3W4RA 3ALGA 1NQ6A 3DX2A 2VURA 4BA0A 2X8RA 2VX6A 4JCLA 1C8XA 2DSWA 1ZBVA 2VRJA 3HN3A 3VINA 2C8NA 2G3JA 5CXPA 5E09A 1QBAA 4P7QA 5E70A 3B9AA 1MFVA 3ZM8A 3N13A 2QF8A 1G94A 4H8VA 3WF0A 2Q8XA 1HJXA 1HTYA 2XVKA 3WN6A 3AMCA 3LPFA 4U2YA 4UQBA 1VEMA 2GUYA 2OLHA 4PUDA 7TAAA 4GI8A 2J7DA 1QNQA 3S2CA 2NT1A 3PN8A 3WY3A 3OLDA 4JKMA 1ISWA 4MDPA 2WSKA 1CLVA 5EMYA 1CXFA 3OGVA 3MV01 1XHGA 2GJXA 4F9JA 2CHOA 1HVQA 2GK1A 1JZ4A 2E0PA 2WNWA 4AISA 3LRLA 2ZIDA 1QW9A 5BRQA 1UR4A 1R85A 1FOBA 3ARPA 4C7FA 1UH2A 3EDKA 3AMKA 1JXKA 1GQLA 1ECEA 1G01A 3VGEA 1BG4A 4CD5A 5GQBA 3POHA 3UG4A 3IAPA 3SUUA 4CD7A 3A22A 1UD4A 5BWFA 1MFUA 4HA1A 3EDEA 2EPLX 2J7CA 2J77A 2AMGA 2V3EA 4EK7A 1XH1A 2FE0A 4MB5A 5BROA 1O7DC 3NDYA 2NT0A 1HF6A 3VDBA 2EABA 3VMPA 1SMAA 3GXDA 4B3KA 4H8HA 2BVTA 3NSXA 1E1FA 2VMFA 3ECQA 4PMXA 2WC4A 4KRUA 4X0NA 1JI1A 3PZNA 1XC6A 2W61A 1KGWA 4W87A 4CD4A 3W81A 4UQEA 1OWQA 2A3EA 4DM1A 3AXIA 5A2CA 1D3CA 2WLZA 1OCQA 3OIHA 3AZRA 1QI3A 2AOSA 2OYKA 3NCOA 4JCMA 1E5NA 3WEZA 1B3VA 1PAMA 4HMEA 2CHNA 3AIWA 4PBGA 3AI0A 3MV11 1EO5A 1Q6GA 3L4TA 3ZJ8A 2GJXB 2GK1B 3DECA 3TTYA 2XIIA 2FYVA 3OLGA 5CQ1A 1VFUA 3K8MA 4GZJA 2EADA 2WCSA 1GONA 4BQ2A 2IUZA 4U5KA 3DDGA 4GZIA 4GQQA 1CIUA 2IXVA 1J9YA 1GZJA 1V0MA 3KL5A 1G9HA 2XVGA 3CMGA 2D3NA 1BFNA 5DEZA 5HXMA 3T0DA 4FLQA 1UG6A 1UHVA 4OOUA 2WM0A 1JI2A 2BVDA 3T2QA 2W92A 4D72A 1LQ0A 4L4OA 4TTUA 3GXMA 3IJ8A 2OSXA 3WD0A 3CIVA 1EGZA 3A4XA 3A23A 3BC9A 2VX5A 3RILA 1U33A 4YN5A 4HZ8A 5HNNA 1QWNA 1CGUA 2VO5A 1CGVA 2DPEA 4IPLA 3FXYA 1HKJA 3VPLA 1Q6DA 1JZ2A 3O6AA 4NZJA 1ZBWA 4AY1A 3I3EA 2WZEA 1DEDA 2GDVA 5C70A 3AMGA 4GXPA 2D3LA 3CHFA 3ARQA 1E6NA 3BH4A 3L4UA 4KWUA 4HOZA 2ZX8A 3CUFA 2E8ZA 1QWUA 4D1JA 2W91A 3AHTA 1QHZA 2DSKA 3M7SA 1QNSA 1UA3A 1B9ZA 2CETA 1UA7A 2OYLA 1BG9A 4RL3A 3WF3A 4W88A 3UR8A 2VCCA 2WLYA 2DEPA 1V0LA 1GOMA 3TA9A 3L4XA 2CBVA 2WVUA 2DT3A 5EFDA 1H1NA 4OZOA 3FN9A 3UG3A 4JHZA 2RGMA 3BUPA 1E70M 4WKFA 4F79A 3DYOA 3WNKA 2VR4A 2EBNA 3IANA 3DHUA 5A6AA 2D73A 1KR0A 5CPTA 2EJ1A 3WDHA 2VX4A 4FNTA 3CMJA 2QV4A 4M56A 7A3HA 1EOMA 4W85A 2O9OA 2V3DA 1CGTA 1JL8A 2XPKA 3EJTA 4WIWA 3BAJA 1BGAA 4KRTA 4CVUA 5EBAA 1V6WA 3AIQA 2CESA 1UKQA 1ZJAA 4KGJA 2XYLA 1GQJA 3IJ9A 1UZ4A 5AYBA 4JAWA 4YHGA 1TQSA 3QHOA 5FD0A 5ABEA 4P7OA 2VC9A 3AICA 3WQ5A 3WKZA 3AS2A 2OWWA 2UY2A 2CXGA 1KXTA 3A3HA 3LPGA 2WKLA 3VOCA 4Z2HA 4QDMA 1CTNA 3SIMA 2VTFA 1E6RA 3M46A 4PMDA 3DC0A 4M8UA 4MB3A 1KTBA 3DX0A 5BXSA 1K9DA 4J3XA 4D6EA 4QCEA 1LJYA 1JNDA 4V27A 4WJXA 3RJYA 1XV8A 1V02E 2XSBA 4WF7A 3MU7A 4PSPA 2PWGA 3A4WA 4M24A 4TVCA 4S3KA 4PMUA 1C8QA 2WMIA 4AWEA 1ODUA 1E4IA 2NW0A 2QPSA 1XCXA 2YJQA 4H8UA 1R33A 2ZUVA 1OSEA 4JIEA 4V2XA 1FP9A 2OW7A 5DO8A 3OA5A 3MKKA 3WMSA 1LL7A 3GNPA 3OB8A 2ZWYA 4Q7NA 4E4PA 4E8DA 1PS3A 3M6DA 5IHRA 2WSPA 1AQMA 1PZ2A 1QW8A 1V0NA 4K68A 4OUEA 2XFRA 2FH8A 2Y2WA 3CZ8A 4MNJA 2EEXA 1OGGA 3AROA 1CPUA 2CKRA 1FHDA 1I1XA 1W9XA 2WXDM 4LYPA 1A47A 4E2OA 2VQTA 3BVWA 4H04A 1MW2A 1UKOA 3APGA 3WUFA 4DWSD 5TD4A 1CGWA 2X05A 3SUWA 1QNRA 3BLKA 5CLTA 3VIKA 1OINA 1J11A 4NRRA 1BPLB 1GQIA 1CDGA 3ZR6A 3AQUA 4ACYA 1GHSA 1D2KA 4JKKA 5E6YA 1E72M 4LYQA 2CYGA 3WD2A 2WMIB 2O92A 5FOOA 3WH8A 1QHPA 1JDAA 1HIZA 3PTQA 2YA2A 4CN4A 3M07A 1XH2A 4Y7EA 4ATDA 3VKKA 2WVVA 1B3ZA 1MQRA 1OT1A 4UQ9A 3FY1A 4YPJA 5D8ZA 1RPKA 1BF2A 1CXKA 5CSUA 1V3LA 1EA9C 2JALA 1BGGA 1UR0A 3AIEA 3VD7A 4P8XA 4TXEA 1KTCA 4AZ6A 5A6BA 4ZENA 3VGBA 1GHRA 4BQ5A 1MW3A 1U30A 1WP6A 1J0YA 4XX6A 1CENA 4FK9A 3WY4A 4FLSA 4WLCA 3G6MA 2E9MA 1E0WA 1ZBKA 2C0HA 2ESCA 5EFFA 5CSYA 2O9PA 4JFWA 1UD5A 1V6VA 3U57A 4HP5A 1JYXA 2CITA 2DIEA 1ZU8A 4TVDA 1B30A 1EXPA 3AMLA 1OT2A 8CGTA 1TE1A 3WY2A 3W24A 1TVPA 3GBDA 2CERA 3ARTA 2X09A 3RIKA 1TR1A 3MUIA 2WVVB 1E5JA 2DT2A 3B9DA 5A6SA 3QGVA 1H0GA 1KB3A 3AHZA 4UOQA 1KBBA 3CTTA 4AD1A 3EJSA 1MW0A 1MVYA 2D0GA 5I24A 2BNJA 5I77A 3ARRA 4P8UA 2WW5A 5CPSA 4WK9A 1XYZA 2YFOA 4FLOA 1QBBA 1LF1A 4MNKA 3AIRA 3ARUA 3D4ZA 2VUYA 3DX3A 3EDJA 3BVVA 1XSIA 1G0CA 1TQWA 3CH9A 2PF0A 1V03A 4UOZA 3VIIA 2PBOA 2VT0A 1GQKA 1W32A 4MJ4A 1OD0A 3SUSA 3AHYA 1UR9A 1NWSA 1PJ9A 3SURA 3BUDA 1HJUA 4UFHA 3GBEA 4WSKA 3RMEA 3CO4A 3NUKA 2XWDA 2AAAA 5BYWA 4D1IA 4W7UA 2Y5EA 4W7VA 4NSBA 1BYAA 3AISA 3I3BA 4HTYA 1TA3A 2VZVA 3BXWA 1UD8A 1HJQA 1UYQA 4F8XA 2YL8A 2WHMA 3CZNA 2V3GA 3CV5A 1VB9A 2E40A 4CCCA 3BAXA 5DFAA 1FH8A 1C90A 1UR8A 1PX8A 2MANA 1N82A 1BVZA 2PWFA 1L8NA 3KLKA 1B3XA 3OBAA 3EMQA 4PUEA 1A3HA 3BLPX 5A8MA 1EO7A 3MMWA 1WZAA 4ACZA 5I5RA 3CHCA 2JIWA 2QMJA 2DH3A 2CPUA 5AYIA 2WYSA 4KH2A 1V3HA 5M3WA 3VD4A 4X9YA 3H55A 4BZYA 4HA3A 4RE2A 5FL1A 3D4YA 5HDRA 4ZFMA 4CUCA 2IXUA 3WD4A 4KMQA 4HOXA 5CG0A 1VBUA 2V5CA 3KE0A 1ISYA 1W3HA 1UASA 1HKMA 3QR3A 1QPKA 2EPNA 2GSJA 3WBAA 2UWFA 5HBFA 5I79A 4MDOA 1V3KA 2WANA 2WMGA 1DWGM 2Y8VA 2DSUA 3ARZA 3W38A 1WDPA 1TA3B 4UFIA 1KCLA 4PYSA 3DDFA 3CZEA 2J7FA 1JYNA 2XM2A 2D24A 1KXVA 4GQRA 3ARWA 3VD9A 4PMRA 3DHPA 3AS3A 3AIVA 3ZJKA 3VTRA 3T0AA 1VEOA 1OGSA 1DWAM 2DQXA 2BXYA 1EOKA 3HG5A 3RO8A 3F5LA 4A3HA 3CBWA 5CJ5A 3IGUA 3D51A 2J4GA 1JNEA 3TONA 3A5VA 1ITXA 2WCAA 1E6PA 2WWCA 4FNPA 1R87A 4ACZB 3LXAA 1RH9A 1VENA 3WH9A 1TZ7A 2YOCA 1Q6EA 2J62A 1DHKA 4IM4A 4D6FA 2J7EA 2YL5A 5E0FA 4ZEPA 1UWIA 3DX1A 4AD0A 4P7LA 1JZ3A 2TAAA 4PMNA 8A3HA 4U3AA 1ITCA 3VSVA 2X0HA 4ZE5A 1W9DM 4ZE4A 3MMUA 1KR1A 3CUJA 3WNMA 1MQPA 2X2IA 2HISA 2OWCA 2XFYA 3ZT5A 3RJXA 3VM7A 4FNQA 1UWSA 1MXDA 1MYRA 1UQZA 5I23A 1E6ZA 1E15A 3POCA 2CBUA 1NWUA
chains in the Genus database with same CATH superfamily
2Y8KA 2ICCA 2OMWA 1TJMA 4NSKA 2YD3A 3ULVD 3MT1A 4P04A 4WVXA 3LPWA 3Q7JA 4AIUA 2BSTB 3MLZL 3HNSL 3BWSA 3PQYB 4F2ME 2V5SA 3HQOA 5MP6L 1KWGA 4OV4A 4XNBA 4KS0A 5SV3A 5EEVA 3V52H 1R7AA 5T3ZD 1KPVA 4APQA 2DWDB 1ZANH 5FO8B 3A3WA 3PL6D 1CICC 3IDYC 4GH3A 3TE9A 1ACXA 4LCVA 3GTTA 4LLDB 2APVA 3G7TA 1QEXA 2YEVB 4J2XA 2CWRA 2Y61A 1A1NA 4NLAA 5HQLA 2OMWB 1QSZA 4NSKB 3B1UA 5I18H 3ZKSD 4C4BA 3RM4A 4LOVA 3LB6C 4TSCH 3VGDA 2GITA 4QS5A 5FLUA 1JMZA 2VM9A 5HHVH 1WLHA 5C9JA 1K8IA 5DD5H 3UR5A 1GOOA 1M7IA 2GQHA 3BPLB 1GOKA 4KO7A 1OLZA 3O2LA 3HTLX 2WJFA 1KPVB 4APQB 5JO5A 3TOPA 4UT9A 4AD3A 1XF1A 3HMJG 4V28A 2WPBA 3TUUA 5EC1A 3VABA 2OAAA 4Y8AA 2X6UA 5A94A 2Z31D 2Q3XA 4Z2LA 1A1NB 2VOTA 1I53A 4DERA 4UTBL 2BOLA 4JW3A 1ILSA 5GXBB 1OF8A 2A21A 2HVKA 3WK3A 3NSMA 4OF7A 1CE6A 2GITB 3NIGE 1H62A 1XF3A 4B97A 3QZLA 2VQ4A 5C9JB 2OLDA 4MXVE 1F56A 1K8IB 4N0CD 2MKLC 4XMTA 3DGRA 3MUUA 1M7IB 3EUDA 2UWEF 2VM8A 4NZ1A 3NPSC 3PZVA 3PM6A 4CGTA 4GAYA 5JO5B 2HVBA 1EH9A 3H24A 3A21A 5EC1B 3DIFA 2YO3A 4FE9A 1XDLA 1UZ6E 2QVHA 4A2LA 5H8UA 1Z69A 3GO2A 4EE2A 4L2YA 4LF1A 4O2FA 3UBFA 2Z91A 3NZ1A 2FX7L 3C9NA 3BGGA 2HVKB 4C4KT 3SI9A 1CE6B 2ZUTA 1XF3B 1A7QL 1P7BA 2ZADA 1AQFA 4CLMA 3B4NA 3WN5C 3WSQL 1D7BA 4JS3A 5JXQA 1XSJA 4WHCA 6FABL 1A6VH 2V63A 1QPPA 4HWEL 4GAYB 3QRBA 5EA0H 3HKZA 1M7DA 4DHLA 3TQVA 3DIFB 2OZ0A 2BNUA 3SECA 1S7XA 5GRVK 4M6PA 2DQUL 5I6XB 4V11A 5D7JC 1RAKA 5LBSH 1UC4A 3D9AL 2ZRXA 4O2FB 1I2RA 3BSZA 5SV4A 2Z91B 4XISA 3KWUA 4O1DA 3C9NB 4A7VA 1AJ7L 2CBQA 1MRCH 4UQ2A 2FVKA 4A63A 1D3GA 1NGXA 3D4CA 3URNA 2X0YA 2ZKHH 3NIGB 2EDRA 1WNOA 1XLGA 3UJFA 3NIFF 1ALDA 5F1SA 2FEDC 3P54A 1ZA6A 2XZAH 2A9DA 4FQCL 3T3PE 1ONXA 4ZW3A 1M7DB 2IW0A 2BNUB 2ZUQC 1S7XB 1E8YA 3KRZA 2BASA 2GQ9A 3NQBA 4JX6A 2VRKA 1TUPA 3W1RA 4H3DA 5IHUH 4HYVA 2R1XA 3S3CB 1R34A 4L1HA 4XNQA 5C2XA 2F9BT 1YYCA 3DUGA 3MLUH 3VIGA 4ERSH 3RDTC 1W3IA 3FTYA 4UQ2B 1NGXB 2F74A 5DJ8A 1EUTA 3TO4C 2PO6D 1GGIH 2RFXA 3TVAA 4P3CL 4D9QE 1MNUL 4JFTA 1UOKA 4L65A 1QKZH 1J1OL 1ZA6B 1N6VA 2J27A 1E9LA 3QV8A 5FF7A 3NYDA 1JRHH 4MD4A 4XCCL 4I18C 2MH4A 3HE6C 4QGCA 1RQBA 2FH6A 1WUNT 3JU2A 1B54A 5F7UA 2X1IA 2FQIA 2HDJA 2R1XB 4HZLA 4DK6A 3W2JA 4XNQB 3OPZL 4H19A 2YPLE 1Q66A 4AG4L 4FZ8L 1GW6A 1I3VA 2CKBL 2MCPL 1ZS2A 2F74B 1BWWA 5DJ8B 2RFXB 3D3FA 5E1HB 3PHSA 1TPXB 4HVBA 3U2EA 3U2SA 2BY1A 3VRLF 4F0KA 1CF1A 3PBWA 3QWRD 4MNHA 4MD4B 5GZOD 1HQ4A 4WVRA 4PCPA 3TC3A 5J04A 4MJMA 2IPFA 3WSUA 1YY8A 3F6IA 1VLXA 1GKQA 1NAKH 3VGGA 5EB8A 6PTDA 4YLBA 4PMEA 2FFIA 4HZLB 5FOBA 3ZJ7A 1IM9A 3ZGHA 3QUYD 1LQBC 2DORA 3ERPA 3KM2A 4TR9A 5A1AA 2YPLA 4I1PA 3IDGA 4P59L 2ICES 1RA5A 1HT6A 3CZLA 5J8OA 4IIDA 1OAXH 3EH2A 1GTNA 2NVAA 3QOKA 5FSDC 2KS0A 2VR7A 4WTZA 3TPUA 3U2SB 5TFSH 3HB9A 3K2IA 1VCAA 4YLQT 3SUTA 4MNHB 1DVZA 1HQ4B 2G4FA 1E5ZA 2C14A 3UYIA 1EWHA 1YY8B 1DYZA 4A1RA 2G3ZA 4ZFOA 2XHYA 4NJJA 1GJWA 4JO3L 5HGGS 4LVNC 2VD9A 4XOAA 1CDYA 5FOBB 1IM9B 5EMUA 4P2QA 1CDUA 1Q9LA 1HN1A 4X6CA 3FCGA 2UX6A 2ZNXA 4MNQD 3FU6A 1GIGH 4QGYA 2YPLB 3PJSA 3BZGA 3IDGB 3GVVA 1IFRA 1WA0X 5CFAA 2YKLH 3K6SA 5C8JA 3OKDA 5KTEH 3BSGA 2X10A 1GKOA 2G5UA 2DYSB 2Z7UA 4HBQA 2VDLH 2Y62A 4I8DA 3WDJA 4R8WL 5CAHA 3VNYA 4ZFOB 3UTOA 1B4RA 1G43A 3DJTA 1BXVA 1K6AA 2HVMA 2XIMA 1O94A 1EAJA 4AW7A 1H51A 4DKAA 4W68A 1J4EA 4P2QB 1Q9LB 4X6CB 3TURA 4FQHA 1KNWA 4U3CA 3B7RL 3O7UA 1TMQA 1KD0A 4DY1A 3PJSB 1L9SA 2ADGA 1UKPA 2AAVA 1A7OL 1U6AL 3ECWA 5JU6A 4BFOA 4YEEA 3K6SB 5C8JB 3OKDB 4JHUA 1DVUA 4GXWA 4CU6A 1GVRA 2XTKA 2AJSH 5CPOA 3EDFA 3L66A 2TRYA 2NUXA 3CCHA 2N0KA 5HHMB 4WUKL 1FCGA 5D7KE 4UCGA 2ITDA 3TN4A 2D20A 4ZJ9A 1WAWA 2C3HA 3P30H 1AE6L 2O26U 5FYLE 3HC0A 3GR7A 1XLHA 3K6NA 4FNUA 1GKRA 5DQDL 2PC4A 2XWJA 4FQHB 1JFQH 2M1KA 1OANA 3VA8A 4YJZL 2H8XA 1S5IH 4BXSV 1H1YA 2ADGB 4AM0Q 4Y9BA 1FHGA 2J79A 1XLAA 4CA4A 3WQOA 5GGTH 1BXAA 2QSCH 4HAGA 3NIYA 1VJSA 3ZVHA 1JDFA 3RZCC 3O2VL 3ARYA 4F80A 3CCHB 4KKBD 3L7RA 5A2KH 4O1AA 3V4UH 2P52A 2PBGA 4EAYA 2ITDB 2R0WH 1UZHA 1XQKA 3LZPA 4LXFA 4F5CE 4JM2D 3VOIA 3G1FA 1N26A 5A6BD 4OAWA 3HC0B 4KUCF 3HBZA 1EJVC 5MENE 4Y4FC 2NZ9C 2Z93A 1CLXA 1KCUL 3SZ8A 5CR8A 4OLUH 1BQCA 4TULL 5LXGH 4GS7B 1VH7A 2WMKA 4MADA 3ABGA 4PHXA 4URKA 4QUOA 4XIMA 2H47C 2DVTA 4KZDL 5IDIA 5MHSE 2V5JA 3ZVHB 1E9IA 5ADOH 1EJ8A 3H6OA 4X63A 3EEGA 2WMPA 4Y5XC 3FEQA 2E3ZA 1M03A 3ATYA 4JIIX 5KAQG 3H4XA 4HKZA 5D8WA 3L6FA 3OG2A 4UT6L 3MLSH 3AS0A 4OAWB 4F5CA 2YC1A 3LDVA 3M44A 3IMWA 1RIHL 1UACL 2Z93B 1FN4A 1BKSA 3MLXL 3WD5H 5DMYA 4JRXE 3CFCH 5JVLA 4ZMWA 4NHUA 5MENA 4UFLA 5HK4A 3HRZC 5L8JB 2YD9A 4Z3GA 3VIHA 1F97A 3NQ7A 1HX0A 4LPYA 1FP8A 2O93L 3IM1A 3H7UA 5ITFA 1TR9A 1GY2A 3GG8A 1RZKH 3HE7C 4BGDA 3B7YA 1MELA 4ZGYA 2WMPB 1G7QA 4AM0A 3FVDA 1A3XA 3U6XA 3NCFB 2I57A 1AKJD 4HKZB 3VI2A 2MNJB 3L6FB 4KZCA 1JVLA 3LS5L 1INEH 1EP1A 4ANUA 3N9SA 5HQMA 4URTB 2YC1B 3NZ8A 4DPAX 3SZ6A 4BF5A 4JJ5A 1FN4B 5A3ID 2ZKXA 3QNZA 2VXTL 3WLQA 2F58L 4NHUB 5MENB 4TOQA 2WBJC 4FQ1H 3PDOA 2VSDA 4JRXA 1J5IA 4AD5A 5ECGA 1G84A 4ROPA 5JIPA 2BC4A 2A4CA 5ITFB 2WN3A 3DV4A 1TZGH 4DJMA 2XVPA 3FKKA 1G7QB 4AM0B 1NQ6A 1BA9A 2VR3A 4KK5D 2ISDA 4WFED 3S35L 4E2VA 3GRGA 1CGSH 1G94A 2YN5A 2Q8XA 4YVVA 4S39A 1OG6A 4NWUL 2BDNH 3KDPB 3NZ8B 4WJG3 1JNNL 1G7JA 4JJ5B 2WM1A 4K7PY 3QNZB 1NFDF 5GGVY 2HVNA 4LEQA 4M62L 5B1JA 3PDOB 3QXVA 1EUNA 1BQKA 3AABA 4CBPA 4JRXB 3PULA 1TYJA 4ZSTA 1CLVA 4O1EA 1CXFA 2PD5A 1E67A 2EZ0C 2BC4B 2GK1A 2E0PA 3DV4B 4JG1L 4WXZA 1ECEA 1ICSA 3ZZ1A 2HPOA 1XF0A 4FXGC 2P50A 4M5YH 1KCBA 2ZP8A 1UUOA 4OCYH 3DBPA 3UAJA 4XOBA 5HYIA 5AENA 4Z1AA 2MWCA 3SB0A 2F9RA 3H12A 4PJFE 4P0DA 4AX3A 1G7JB 3PZNA 5DVPA 2VDIA 3DESA 1T1WA 2CZDA 4PGCA 2J9ZA 5IMKA 3W1PA 3AIWA 3VE0A 3MV11 1Q6GA 4MA3A 1PLGL 2GK1B 5GRZA 4G3YH 1LTXA 1MCIA 3QORD 4LASL 4WCJA 1YC7A 4TUKL 2J5LB 3WQFA 1WBHA 1FE8L 1Y5XA 3EAKA 4M6MH 2P49B 3CXDH 2DY2A 4WSHA 4N24A 3NQGA 3H7VA 1IJ9A 1JPHA 2KMWA 4MXQC 4HQVA 3KLQA 2Y3AA 1OAQL 5CGYD 2HJKA 3DKJA 4QTHA 1DVQA 1T1WB 4Y7OC 4MX7A 1CGVA 2VXQH 3SPJA 1W56A 2WO3B 1M42A 4H8PA 5IMKB 3AJXA 4LAJH 3VE0B 1KRCC 4MA3B 2Q2LA 2EDFA 4LV4A 1QHZA 4DH2A 1UA3A 3ARFA 1I8AA 2V37A 3AWGA 3CM4A 2XPZA 1F4XL 3P74A 4HPYH 3LKNA 4UV4L 3QRHA 2V4LA 1AD4A 3MGTA 3WDHA 2HJKB 1QYGH 4M8QA 4XCFH 4XZ9A 4QTHB 3VD2A 1WS7A 3WHXA 4MX7B 3L3IA 2B8OT 4KETA 1PGRB 4C6PA 3ITTA 4XO3A 3IJ9A 5E1AA 3SO7A 3QSKB 1TO5A 4EF8A 3ARFB 3MKVA 3MQIA 4ICWA 1U3HD 4PP2A 1RU9H 3SIMA 2V5TA 2QDWA 2VTFA 1U2CA 1T7YA 4MB3A 1TTUA 4ML9A 4MWAD 2WLJA 3LKNB 3RJYA 5CAYB 1YNQA 3MGTB 3MTRA 4KKRA 4PSPA 3IFLL 3CU1A 1V4YA 1G7HA 4GMEA 5IVOA 1E4IA 2FB3A 2NY0C 1W1ZA 4M8QB 1D8WA 3WHXB 3L3IB 1YEDA 4G8AC 4N9CA 1LL7A 4J6RL 3BIBX 4HUMB 3GZPA 4K7YA 5E1AB 1U58A 4K68A 4NWTH 2G0KA 1LZOA 4PWJA 4AY8A 2QGYA 4PP2B 5HNUA 1OWRM 3BV4A 1OW0A 3L3JA 3BVWA 3PP3H 2OKTA 4DFIA 4LW7A 3UH8A 1BFTA 1KFJA 3DV6A 4AGPA 5FJRA 4HZAA 3WIIL 5KUMA 5B7ZA 1MAKA 3ZR6A 3L5IA 4GRSA 2CYGA 1UOWA 1G7HB 4CW1A 4U1SA 1QHPA 2YA2A 5DGQA 4DF2A 2HFGH 3A6CH 1YEDB 3B37A 3QHFH 3W86A 1NM4A 3DTUB 3LS4H 5BPPA 1U58B 3UJ2A 3NIGF 5EZOH 1VGAA 1F18A 4MXVF 5MEQA 3H8NA 2KDYA 3L3JB 5G4NA 3DV6B 5T1KA 1F58L 5MHBA 4Z1PA 4IXXA 2WXHA 1TRIA 1LXMA 3G1AA 3JZYA 1N7MH 2AABH 4CW1B 3JT2A 3ABXA 4U1SB 5DZNA 3I7SA 3G9AB 1UZ6F 3B4YA 5JOPD 1AQ8A 5LQBL 1TPC1 1T5AA 4TV6A 2R29A 4C47A 1IXPA 3QMSA 1W0MA 5IBUG 4HGXA 5FHBH 1ONWA 3SIZA 5I26A 1X1OA 3UGUA 5MEQB 4YSCA 4EXBA 2JELL 1K2DA 3QIBD 3D4ZA 3DX3A 5T1KB 1X5FA 3P62A 2AZUA 1G0CA 1UOVA 5JDJA 1V03A 1NFAA 3AM8A 5T3XH 1DVSA 1W32A 2E7CA 1M56B 2XXMB 1P5BA 5ACLA 2XX1A 4H4IA 3I50H 2YMOA 5CBEA 1UYQA 4R2GB 3MRRA 1RVFH 3SDXE 2D7QA 4UTWC 3S96A 1TWIA 3BZ4A 2DM7A 4YCPA 1NTDA 4L1LA 1B3XA 3EMQA 2ZNWA 3BLPX 3F64A 2V0TA 3CHCA 1UATA 1OAKL 3EB4A 1XVSA 5EBMA 4XO9A 4WU7A 2Y7DA 2AJXL 1K2DB 3BLLA 4ZFMA 3LRGA 3ZKMD 3T3PF 4PWEA 5HBFA 1ETA1 1V3KA 4LTSA 1DANT 3RY5A 4H8QA 2Y8VA 3ARZA 4UFIA 1E65A 2XRAH 4FQIH 5CBEB 4DWDA 1RZJC 3WI9A 3THUA 3MRRB 4B5EA 3UVAA 2XNAA 4LGPB 4ZW5A 3VD9A 5HI3D 3DHPA 5GGRA 3VCNA 3T0AA 3S96B 3O11A 3BZ4B 2BXYA 5E8DL 3ZL1A 2EC9T 3WFBL 4DIAA 1TZZA 1PDYA 1R87A 1LMKA 5TF0A 4LIQE 2JF1A 1X7IA 1B4TA 2BGQA 3BE1H 5EBMB 5D7LD 3SO3B 4C1LA 3TA3D 4WU7B 1KN2H 3DXAE 1QO2A 5D70H 3IGKA 1JZ3A 2YPVA 3WIHA 1WFMA 1XCQA 2C5DC 1KBGH 3CUJA 1G6RH 3V55A 3O6CA 5AHLA 3SODB 1YNKH 1RL1A 1MXDA 1O5QA 1E6ZA 1E15A 2CBUA 1FYHB 5PTDA 4L0ZA 1TETL 2IQ9L 5GS3A 2XNAB 5AZ0A 2L3BA 3ZPDA 5GGRB 3OGSA 1I4FA 3O11B 5D2YA 3WBDA 4ABVA 4UINL 2KI6A 5FCZA 1OAZL 4HQQH 5ALBL 3RCNA 1CJYA 5K1NA 3CAVA 3LZQA 1UWYA 5C7XH 4YFDB 5ANME 1AHWA 2Q8AH 12E8L 1M7XA 5KYNA 1DIKA 3DXAA 3Q58A 2CLLA 1XCQB 1O6SA 1B4JH 2VRAA 4DXKA 2F54A 1NH6A 1BZ7A 3D12B 5A8GA 1W15A 1D9KD 5M7QA 4MTVA 5IB3A 1XZWA 4X6CF 3FQWA 3VMNA 4WW2C 1UWUA 1I4FB 4JE4B 3GDBA 4HJ0D 4KZEH 4LVBA 2DDXA 2DDQH 3VWKC 1ONEA 4AY7A 2OSYA 4HWBA 3MCYA 4NZTH 2GI0A 1A64A 4XPTH 4G6JL 3W7GA 1K5NA 1MAMH 1AHWB 3WIAA 1O6VA 7ENLA 2R4SL 3A4DA 4NUGL 1E6XM 2VVSA 3DXAB 5ANMA 4HYRA 1DP0A 3NCYS 4O1CA 1O6SB 4L3AA 3AYRA 3KZSA 2JCWA 2W63A 3SPGA 2F54B 1BZ7B 1YJDH 1ZVHA 1A7RH 1H9DA 3RXZA 3KBFA 4UAOB 5IB3B 3Q2VA 2LHAA 2AJUL 4DBDA 3FQWB 5I06A 3BW2A 7CGTA 5C9ZA 2GPZA 1LLOA 1VIWA 4HIXL 3ZQ9A 3UBGA 2F1BA 1J93A 2C13A 4MIMA 3RDJA 2PCFA 4LGRB 3GZAA 1K5NB 2Y1VA 2JKWA 1O5DT 5HWMA 4JXCA 3ULUF 1ETB1 3BQ6A 2QCGA 4K2UH 5JXEA 2PWEA 1ERNA 2OTDA 4I3SH 2N7BA 1G5GA 2MMXA 5AC8A 3EJZC 4C7DA 2DQGL 2I26N 3LNPA 5T1MA 4IX0A 3QG6A 2FFCA 1WFOA 1KBVA 4CVZA 1QW7A 4NVTA 5TK4A 1NBYA 4ZQNA 2PCFB 1T1YA 1I8UA 1JPTL 5DYOA 3CU7A 4EANA 3SE4A 2DS4A 2GB2A 4G6AC 5IOKA 1RZ8A 4K3GA 4K8EA 5C0RH 1BQHA 2WY3B 4BEIA 3S88L 3S6OA 1ESOA 3GJEA 3MI6A 1BAGA 2QIWA 4YHKH 3PHAA 2I5YH 1XLBA 4ZQTA 2XQYA 5T1MB 2A1WH 3QG6B 5A6LA 2HH0H 1U91A 1W1VA 1WISA 3WDPP 1GTHA 4DPCX 4CVZB 3WLWD 1JCYA 3W1LA 5REQA 3GNOA 1NBYB 1IU1A 1Q4NX 1T1YB 3INPA 3MRGA 4XIAA 3QK0A 5DYOB 4QAMB 3LIUA 5D09A 4IF2A 1RZ8B 5A8PA 5FUZL 1NWOA 1SJXA 4X7TA 3MRCA 3IRCA 1BQHB 1LE5A 3S47A 3BVUA 4KRPC 3GJEB 3GH5A 1H4PA 2XZZA 5F4WA 1NP0A 3OLIA 4AE0A 1J1PH 2HRWA 4YHEA 2VEPA 1FNSL 5C55A 1M71A 5TDNA 5F72S 1U91B 1DANU 1OTSD 1X7QA 3ZVVA 5A8OA 4D3CL 2C3ZA 2ZCGA 4NKIH 4X5RA 5REQB 5F3FA 2C3GA 5AY7A 3MRGB 4DGUA 3NJJA 4W4OC 3IWPA 3FULA 5AYQA 4D8ZA 3MWAA 4X7TB 3MRCB 4LGSB 4A22A 3E6EA 3QJQB 1LE5B 2G3MA 1P0DA 3SE9L 1UW9A 1WITA 5HDQL 1UD3A 2Z3FA 4GK8A 1PEZA 3V3WA 2AQPA 3BHBA 3L16A 1YLBB 3BMVA 4DO7A 4S38A 1UWTA 1M71B 5TDNB 4UFKA 1OY3B 3Q4DA 3O3AA 4PW4A 1X7QB 4ZSUA 1C93A 4RE0A 1YAIA 3RA7H 4NB7A 3H54A 4M8VA 4IKNA 2VM3A 5B39A 2FGWL 1F00I 1UWGH 1T6MA 3JRKA 5HVWA 2P9RA 2D3JA 1CR9H 2GJLA 2X2UA 3M16A 1OM0A 1CS6A 1F2XK 4KROC 4TNWK 3VO0A 5E5MA 4NQCD 4ORMA 4P23D 1NFGA 3BHBB 2DYRB 1HL9A 3ATAA 5L8KB 3O3AB 1BZ9A 3MNWA 2PUQT 2FPVA 3JBG7 3TS8A 5IKCA 1Q4WA 4HJJH 4E41D 4NASA 2JTYA 2QDVA 5B39B 4ODHL 2GBVA 4XD4A 2DWXA 5FR3A 2IV8A 2JIXD 1S7RA 3SDCA 1TITA 1SYTA 2NY1C 4BY3A 2Z9TA 5DMKA 4LFYA 1HNYA 4I8YA 5E5MB 2F68X 1CL7H 4FFYL 1I85A 4W84A 4IPNB 3NO5A 1BZ9B 2Z1SA 3MNWB 4UV7H 1MDTA 5IKCB 4H9MA 4OGZA 2A73A 3TA4D 1MCPH 4LUTA 2DI8A 3OJVC 4K8GA 5I6SA 3AGVA 4GRLA 3VFVA 1AGDB 1S7RB 3SDCB 1Y7VA 4PMVA 1JJUA 4HPOL 4HSQA 5AWNL 4F58H 4ODXA 1NUDA 1XGDA 2PB1A 5DMKB 4QCIA 2WXLA 3P2TA 3OTTA 1T5WA 1RP9A 3GTFA 3UVIA 1JRBA 3B04A 4P7NA 5E8NA 2VFIA 1HCFX 4Y4KD 1KM1A 4D71A 4MHHI 3T4AA 2BSSA 1ZP4A 1A4BA 3EYQC 5IB2A 2CNYA 3T9PA 1HEJC 2B81A 2PTZA 4L3CA 2A73B 2FO1A 4LUTB 1XKYA 2WK2A 3SUVA 1MOEA 2CUIA 4XUYA 35C8L 5T1LD 1WGVA 3T78A 5I75C 4WSJA 4GRLB 3VFVB 1EEZA 2VCAA 3VNZA 3MBFA 4CNSA 1GS6X 1JK8A 4RFEA 2WZHA 5DA4A 4ODXB 3X14A 4Z0BL 2CLPA 3O6FD 4GUGA 2UZXA 1NJ9A 4QCIB 4RETB 3G6LA 4NJGA 3QUZD 3KS6A 1T5WB 3IS0X 1QMUA 3HMXH 3H2QA 3M1OA 5DVMA 4TU1A 3O6MH 5E8NB 3T4AB 2BSSB 3NABH 2H32H 4YSOA 5IB2B 3X3FH 2OCCB 2ZZ1A 2I56A 4MJ2A 3Q05A 3TYCA 2INZA 2XFFA 2DQ6A 4L3CB 2FUTA 3M1BA 4J8RA 1KCRL 4GY1A 4ZB2A 4HS8L 5DZLA 3VXMD 1W5MA 2ICEA 1EEZB 4JZJC 1R3TA 3CBJB 1TLKA 1JK8B 4RFEB 3FQNA 3X14B 3SGEI 3WMPA 2UZXB 1NJ9B 4YBHA 2VYOA 2BWIA 5CZXD 5D1ZA 4I9WD 4AMCA 4DJEA 5B3NA 2AKZA 3VXPA 4OJFL 3IEBA 4IJBA 3LZRA 4A3QA 3GBLA 2J8TA 3A4JA 3O3UN 3LZ3A 4D0CA 5B4MC 3SCVA 3M1BB 3IFNH 2VOMA 2L4OA 4J8RB 1E0OB 1T6VN 2VFEA 1S9YA 2QCDA 3UESA 3QQ9D 2IPKA 1MWOA 4KCUA 5J3HC 2ICEB 2IG2L 2F1AA 3QBUA 3T09A 3FQNB 4HA0A 4B15A 1QLRA 2QQKH 2I1OA 1J5OH 1RHFA 1X8CA 2WBGA 4L9YA 4ZNEA 7FABL 5D1ZB 2ZUMA 2BNRD 4GJIA 4ENED 1X44A 3WJJA 4JO5A 3VXPB 3KOWA 4TN9A 1OP3H 3WNNA 3WQ6A 3WDIA 3L1EA 4EIGB 5CS7A 4OM1H 4D0CB 4UB0L 2Q8ZA 3V0DA 1DVFC 5JHLL 1S9YB 4WO4A 2QCDB 5FC9A 5HHPA 2IPKB 1TDQA 2E9IA 1Q13A 3T1WA 4A7UA 5I78A 1WT5C 1D6VL 5K39A 2VDKB 1OARL 4Z7NE 3C12A 2EGZA 4ANWA 1EP2A 1QLRB 1AXTL 3EFFA 1MRFH 4DJDA 1KY7A 2ERJC 4UTFA 2IGFH 2VR6A 2FGZA 2IV9A 5HA7A 1RUQL 2RFGA 3NZGA 2XV0A 2AEPH 3FSUA 2CWNA 1GVSA 5JORA 4FXFA 2HRPL 5IJVB 4UTJA 3IIPA 2EIBA 4HCRA 5HOSA 4NXSA 5LIYX 4WO4B 1QZ1A 2ZG1A 5HHPB 4DI8A 4OVXA 2WVSA 4FKHA 5K39B 3QUMA 1XGEA 3H9SD 2DSWA 2FKPA 3EFFB 2MFNA 3LZFH 2GSIA 3P3RA 2CU9A 2ATPA 1HTYA 5IMLA 5AZ1A 3LM3A 5IHHA 4XMKL 3RWCA 4LAMA 3RITA 4BK9A 5CKAA 2WXFA 4QWWC 4MZ2A 4HISA 3RAJL 1K3UA 5JORB 1H5BC 4I6VA 4MDPA 2ZPKH 4QXWA 2WSKA 3C86A 1MJ7L 3JSSA 4E36A 2WNWA 5CCKH 4AISA 3RTLA 1TREA 1R85A 3GB6A 2GGGA 3IB4A 3HZYA 4ASTA 1P53A 5FJJA 1RUPL 1LILA 3QUMB 1RJCA 4MA1C 1UD4A 1MFUA 3LN9A 5E0QA 5F7BA 4Y16C 5LGHH 1I3GH 5AN7A 2CDEA 1EEQA 1WK0A 3LV5A 3LHYA 5BROA 2GSIB 3QZBA 3V7AE 2ATPB 4YWIA 2H2SC 4MMZC 5IMLB 3G1VA 3RWCB 3EGJA 1XC6A 1Y0EA 1VBJA 1ADWA 4DM1A 2BK8A 2X7LA 3SDXF 1OL0A 2QV5A 1XG4A 2WUBL 5JHMA 3OLGA 4ZDHA 3FA4A 2VSCA 1A5AA 1DQJA 3HZYB 3C5ZC 2YUVA 1FWGC 1SJMA 3RIAK 3VQ1C 1G9HA 2WZPA 1AOHA 3PPHA 3WFCL 3T0DA 5TE4L 2CDEB 1E42A 2APFA 1O75A 4RDQF 2WXRA 4PVNA 3H42H 1I2NA 5F0MB 2X1WL 1O60A 4BSWA 4JQVA 1FFTB 2X7LB 1JZ2A 4G7SB 1ZP3A 4JKNA 1BVNT 3WQDA 2OOFA 3Q5YA 3HLKA 3PXHA 4HOZA 2ENYA 4ZDHB 1FCBA 1B9ZA 1K85A 1DQJB 4WFFE 4RA0C 1BG9A 5E8PA 1PL3A 4AIZA 5HQEA 3UTQA 3UQNA 1R0MA 4F7TA 3ANYA 1GWJA 2BVUA 4F2MA 5L7XH 4BSWB 3U9WA 3RU8H 1G4MA 1KR0A 5CEZL 3WHE0 4HCGA 4PA8A 1Z5LA 2E1DA 2XPKA 1RBAA 4NP7A 3D39D 1DBTA 1J6PA 4M6UA 1IXQA 1AD9A 2O7SA 4Y9EA 1WZ1L 3GLDA 3SQBA 2WO4A 1VRDA 4KQ3H 3QAZC 2OWWA 2NY7L 1AAJA 1HE8A 4XPAL 5E8PB 1BVWA 4AIZB 1W54A 4K5NA 3CL7A 2K3TA 2Z35A 4YBQD 3UTQB 4X7EC 2CE6A 4RDBA 2NQ3A 1OSPH 4DF0A 4WJXA 1X9LA 4F7TB 2KT6A 5K9OA 1CO1A 4F2MB 4RPQA 1TWSA 5JTWA 4AEHL 2XWTA 4GYPC 1Z5LB 1E9PA 4H8UA 4H8WC 1OSEA 2PAJA 2AQNA 4BUHA 3QULA 1BXNA 1XQ4A 4TX9A 1YNLL 1PS3A 4BRJA 1N2VA 4IBUA 1AD9B 1AQMA 3SQBB 1DVTA 2H0EA 2X9WA 4OUEA 3MREA 4DB7A 3K6FA 4CILA 3RHWK 4X2PA 2OXGA 3BDKA 5C07E 3D5OF 2Z35B 3P81A 4NCC1 3IK4A 3MHZA 1TCDA 1URLA 3FT9A 5K9OB 1CDGA 3AQUA 5DU7A 4DK3A 3OMZA 4H26A 2QCEA 1MZYA 1FBIH 1NGPL 2XWTB 1E9PB 3VFGL 4DVBA 1JZDC 1RJRA 1IVTA 3QULB 2NYYD 1B3ZA 2HSIA 4Q9QL 5DVLA 1BF2A 4JFPA 3V0JA 4Q2ZA 4K9EC 1VBGA 1T6WA 3H2AA 3SBFA 3MREB 4NKDA 1E4JA 5INCA 3VQ2C 4BQ5A 1U30A 2OXGB 3E2RA 4GYBA 4AVFA 4FLSA 3V5KA 5C07A 5EFFA 2ALDA 1IILE 5FF6A 4H26B 2G75A 4JM4H 5BNKA 4AG0A 4OM0L 4DVBB 2VEMA 5AZ2H 4Z95L 4ZMVA 1EEYA 4JFPB 4Q2ZB 2Y69B 2Y23A 4OR1A 4N22A 4NKDB 1W1IE 4PWKA 4WK9A 4JLRA 5INCB 2XZCL 1F2QA 4UI2A 1QBBA 2ARWA 1ZXKA 3AWEA 1TJRA 1MFCL 2RJGA 3V5KB 4IMCA 5C07B 3SUSA 3AHYA 3U0TA 1FQ0A 1WA3A 3RMEA 4KHTH 1VKXA 5FF6B 4GLRI 2PDXA 2G75B 3BXWA 5IROA 4KK9D 1HJQA 2QKSA 1ZOXA 1OOAA 3E80A 3FQ4A 4EP8C 2ZYFA 5I6LA 5D37A 1EEYB 1SOXA 3NEEA 1O7VA 4M93C 4JLRB 2CLRA 4UT9H 4TNEA 2YXGA 4I6KA 3QAQA 3TN0D 4Z7WE 3ESNA 2W9EL 3G0SA 4DELA 1QBML 4N2MA 3U0TB 2P48B 4XHJD 4S0TD 1VKXB 2VWSA 1M57B 1XL9A 5CLXA 4MJJA 4PYSA 3DDFA 2R69L 1IRAY 1KW1A 5JW4Q 3ZN6A 3MJ9A 5IDZA 1BOYA 3RWFA 3PBUA 4IIQC 3T3PB 4BI7A 3GD1C 4Q8QA 4M9OA 3TT3H 4X9BA 4IBQA 1N68A 2CLRB 5F7MC 4S2SA 5TQ2L 1J2WA 3P80A 5JMRA 4ESKA 4YTQA 4N9EA 4ZE4A 2PETA 1A0QL 1IX2A 3FQYA 1XIGA 2UY6A 1MYRA 4IPIA 5E08L 3EOOA 4QAIA 3TW9A 4S1RL 2Z7YA 3NRPA 3O0RH 5F1VA 2NQCA 3RWFB 5FHAL 3PABA 1F6AA 4U10A 3GK8L 2UXTA 5G1YA 1QPXA 1X5GA 4E5XG 1EMTL 3GI9L 3WQWA 1C1EH 3AXHA 1NIDA 1XUZA 4S2SB 2A6JA 2AQQA 4NYLA 2GT9A 3I2CL 3P3TA 1BVNP 1W3JA 1JZ8A 2FATH 4GAGH 2NLIA 3L4ZA 2GCYA 2ZUWA 4MS8D 3UTZA 4GEJA 4PY8J 2UY6B 3TPUB 3WLPA 3EMZA 3BESR 1V55B 2YRLA 5ICYA 3Q43A 3JYCA 2EH7L 3P67A 4QRRE 3PABB 1F6AB 3OZKA 1RSYA 4H88H 1J9QA 3JTBA 2WTPA 2ZC1A 3VMOA 3NA9L 3E8UL 3N2OA 4G7VL 2A6JB 1FRBA 2OGYA 1XGPA 4FD0A 3YPIA 4NYLB 3FVMA 2GT9B 4DJFD 2Y7MA 1DBJL 1HZHL 4B9KC 2PW1A 3ARDD 2BS71 2GCYB 4MDJA 1WIPA 3UTZB 5E2TL 3PZQA 2BVOA 4QP0A 1KIUA 5FESA 4DGWC 1V7NH 5ICYB 1UWEL 4GY4A 2EDJA 3SYQA 1I1AA 1A3LL 1CFNA 4EMZA 2FGBA 3UR7A 2JKXA 4AVOA 1BFVL 2D7OA 2OZTA 2DAVA 1XGPB 1U95A 3M8OH 3MWCA 1XIFA 2PW1B 4KKAD 1MIML 4AZUA 1LG1A 2AJYH 3DH7A 4MDJB 4D7PA 1PCXA 3CBRA 2P5WD 1VFMA 5KANG 1K9FA 2BVOB 3LRSA 1KIUB 1ANUA 2M2DA 2FJHA 2BINA 3VILA 3NT0A 1E6QM 1F76A 4L5FL 2QZ5A 4GBXA 3ZLFA 1I1AB 1CFNB 3O0KA 2Z0UA 4NJHA 2ACRA 5IJKA 2F2HA 2P5EE 3IMRA 1MW1A 4FFZH 3LEVH 3ZTCC 2XWJB 4NI3A 1U95B 4EPBC 3VIJA 1SMDA 2FQEA 1R3KA 2IQTA 1W0YT 3QH3A 3F5WA 3LMYA 5FWQA 2OULB 5I8OH 4KEUA 2L7UA 4HGMA 2XQ0A 1N19A 3LRSB 4MHBA 1V3IA 3FUJA 1Q8JA 3T4CA 4CNPA 1EHLL 2FJHB 1PEWA 3LN3A 1AI1L 2LE9A 1AO7E 1GOHA 2UZIL 1BF5A 3R6IA 4S3DA 3STFA 4J1UA 4TPRH 4GX8A 3QT2A 5A3HA 2NY3B 4GBXB 1DQKA 4O53A 4BIKA 1MFAH 2WSRA 2JF7A 4PTWA 1LK3H 2JQZA 2RD0A 2P5EA 3DVFA 3TWCL 4LS2A 5LCVL 4QLWA 4BKTC 3VXOA 1R3KB 3C60A 4GO6B 3QH3B 3V0UA 3F5WB 3UA3A 3IS1X 3ZS4A 5A2AA 5E9AA 1BQSA 4TNGA 4J1UB 4H0LC 3QXAA 4PZVA 2QDDA 4NZCA 2W4XA 3U5YA 4E2BA 5SWZD 4DP2X 5JIQA 3SEPA 3SDDC 3WFEL 2P5EB 3RX4A 2WXKA 4R0LC 1AMXA 3EYPA 4J40A 1KBKA 3VXOB 1IC4H 3EKCA 2ZE0A 4OCRH 4KOCA 3C60B 5J57B 3L17A 2O6DA 3B8SA 4GAFB 1DJZA 5BMXA 3LG3A 2WSYA 1VJZA 3RUBL 3ULVL 4CQBA 2OP4H 1SM9A 3FO0H 4ZS7H 3QXAB 2WTOA 4FXSA 2NSXA 1ZRUA 1NQKA 2C16A 2I5QA 7XIMA 4XPFL 2DJMA 4US5A 1LO0H 2EDEA 3ULUH 2ZONA 1PSKL 5T3ZL 3KJ6L 4Z1YA 1KELL 4Q4RA 4KXZH 4BEUA 1UP3A 3K5SA 4Z7NF 5GJMA 3WBXA 1W1PA 3CFBA 4NNCA 3QW9A 1FA4A 4UMGA 1UUNA 2K7QA 1O7SA 3SE6A 3IJSA 4F9PC 5I5JA 1R6WA 3BZFA 3R12A 5K9XA 4HIEA 3OSVA 1ZTVA 5AAWA 1RZGA 4BCEA 4TSBL 2ATAA 1OCBA 1XYLA 1E3FA 3NGBC 4S3BA 3PCYA 4MZRA 4POZC 3SD2A 4PY8I 2X4TA 1XI3A 3T8QA 3M88A 5E6SB 3NVTA 1ZLUH 1KCZA 5HINA 1M3UA 2K6YA 1FX6A 5KG9A 2XGBA 3IFOA 3RCYA 1OAYL 1DXIA 2ADJA 3CFBB 3MUAA 3TKFA 4L6DA 4KTGA 1CLZH 3OVPA 1GL4B 5CGMA 1Y5WA 3IJSB 4LSPH 4Z7QE 3KPLA 2Y4SA 3BZFB 4HWZA 4JY5H 4HIEB 4NN7B 4DWHA 7PTDA 3EYUL 3MOBH 1Z9PA 4FQXC 2I27N 1RZGB 4R27A 4JDTL 3ZKXC 3VWJC 4V2CB 4B0MB 3U0WH 1FTXA 4DIXA 1CXHA 1NLDH 2PEVA 4X2RA 5IBLD 4JGNA 4LJ3A 4WCYL 5E0KA 2ZYIA 2X4TB 4PJFA 1X7TA 4MAYC 1TCMA 2QTVA 4NUWA 3TH4T 2XGIA 2C91A 4PGCB 5KUKA 2J21A 3HU7A 4YWGH 3ILQD 1M01A 3ZHNA 5KG9B 2Z1XA 1X5XA 3MOAL 3IFOB 4X9HA 4LZKA 1ZHAA 2ADJB 4ORIA 4QRSA 4TX8A 4NFCA 1M5WA 4WGKA 4K6AA 4DYKA 3HOJA 3KPLB 2ZG2A 4HWZB 1O7AA 2CBJA 4JO2H 5EV7A 4UTWA 5AB1A 4LSSH 3H2CA 3TWAA 1GS8A 2YK1L 1PKQE 1R46A 1DFBH 4XAYA 4WNSA 3W7PA 2ADFH 1Q7QA 3JTTA 4GJTB 1LQSR 2XH0A 4C5ZA 1BBDH 4PJFB 2IWGA 4B7IA 4IGBD 4R33A 4MKNA 1JYWA 3BDXA 3F04A 1NARA 3GSMA 1BYPA 1OYBA 2AGJL 4W9TA 2Q9OA 1FVPA 4KXBA 5I73C 1EZUA 4QRSB 3APFA 5T5FA 4PD4J 3OD3A 2IANE 4M02A 4J3OH 4N4PA 4NP4L 1DVXA 1TYGA 2NTFA 2A9AA 1W72A 2EXWD 5GJPA 5F1IA 4HKJA 3W7NA 1S2CA 5CZVH 4Q4QA 2QMKA 3JTTB 3SY6A 3F4CA 2NNCA 3CQFA 4HHPA 1PKQA 1G6VK 3BLDA 3TJIA 3NEHA 3JWOC 2PPAA 2SODB 4FA8A 5D71H 4ATWA 1RUML 4K7FA 5MF5A 4DUVA 2ADIA 5SX4H 4FG0A 2N56A 4IKLA 3W01A 4H0IA 1M1XA 1LORA 3KOZA 2JQXA 1N6QH 3UEZA 1FDLH 2E46A 5A2BA 4Y4HA 4OT1L 2IANA 2NTFB 3NJMA 3KTSA 2IDQA 1W72B 3WQCA 3L67A 5F1IB 4HKJB 3IUIA 2XZQL 5IGXL 4H2CA 4PRTA 3RZWA 3PZIA 2J7GA 1IT8A 1PKQB 4TX6A 1DL7H 3U7YH 5DDHA 4JCWA 4XP4H 5HHNA 4K7FB 5FM5O 2ADIB 2NR6C 4LVDA 4ONVA 1TQTA 1M1XB 3RY4A 2HMID 4L1XA 2XG9A 3TFCA 3R2GA 3MR9A 4RFOH 4A04A 4IJ3B 1J8HD 1KSRA 4Y4HB 1RAMA 3ITLA 2IANB 4YFLI 5JQHC 3VAVA 3V7MA 1JNHA 1GOGA 4MAZA 3UACA 4Q4EA 1YEFL 3P60A 1INQA 4V1YA 2VDMB 5FUOL 1KYUA 3I65A 2MOGA 4YHYC 5DDHB 3CTLA 4XO5A 1QSED 5HHNB 3LTSA 4DKEL 3ICJA 1YEYA 4J3WA 1KTKE 4FEMA 5H37A 2VN4A 3WUGA 5AW8B 5D04C 3FYIB 3GJFH 2MCAA 1DWJM 3VD3A 1DIEA 3MLWL 1CECA 3W11C 3GQFA 4KKCD 3UTSD 4RWHA 3W2DH 2P5PA 1EQCA 3MR9B 3HC4H 4Y2DD 2ICWA 4XPGH 4P5KA 1R7OA 4MNMA 1JNHB 4QAWA 1NBVH 4G82A 1INQB 4KERA 4PRID 1D7CA 3VIFA 1G9ML 4XZUA 1OYAA 4LEBA 3V0AC 2ZYHA 5E09A 5KSAA 4MJZA 4MA7L 3QFJE 5C1MB 3OAUH 2CH8A 3AMCA 4R7DA 1ONQA 5D7IE 4DP0X 1FWWA 3WLLA 5BW7A 2QZQA 3ARBA 2CA4A 3C2AH 2Y7FA 2YAQA 5ABZA 4L9XA 3UXKA 2ICWB 4P5KB 4ZTOL 1KNOA 2IDUA 1FSKB 1A1OA 4UM8A 1UR4A 5I1IL 1GQLA 4BZ1A 3FTGA 1OJXA 4XZUB 4ZNCD 4GUQA 1EO8L 3LCLA 3KUMA 2HKHL 3SDXA 5I28A 5M95B 5KSAB 3URBA 3LNDA 2C9XA 2ORBH 3MUHL 3PAYA 3PGCA 4F0SA 2K6ZA 5IVNA 2VMFA 1ZLWH 4R7DB 3PGFL 1Q90A 1ONQB 3QFJA 4KRUA 3L5WA 3NL2A 3ARBB 3W81A 5D7IA 4IW4C 4JPQA 3GDCA 3OIHA 3IV8A 2OI9C 3QG7H 1KNOB 4D2NA 2DMBA 1A1OB 3UTPE 3NAAL 4UM8B 1SY6L 4AMKH 3MRKA 3QR1A 3FTGB 3PHOA 2PRHA 5AW2B 1XQLA 4IRZH 3KL5A 3SDXB 4AENA 2GY5A 2BWGA 5HXMA 4C54A 2WM0A 4H9UA 2J7LA 4Z7WF 3PGCB 4MOZA 1N10A 2DQIL 4MJ6A 4FQ2H 1AQKH 3BC9A 3QFJB 1IO4C 3L5WB 4NQSA 3SGKA 2ED9A 5JW4R 5D7IB 4R90L 1G6CA 3AU6A 4HLEA 4ENLA 3UD6A 3N6JA 2E25A 3S2JA 1IGML 5C70A 3KPOA 2D3LA 1W6TA 1TT6A 3ARQA 3EBIA 2WOQA 4ICXA 2PS2A 1NMBL 2E6FA 2CO2A 3M7SA 2IVFC 3MRKB 3IBEA 3RX5A 3PHOB 3W2MA 1MG2C 4XVJL 1V0LA 4AENB 2DB8A 3BH9A 3QDHA 3DETC 5E2UH 3KJ4B 4PN6A 5D30A 1GGCL 4JHMA 3B3DA 4MJ6B 2CJ3A 2XA3A 4QHLA 2R29H 4ANKA 3D0AA 1S78D 1MCJA 4NQSB 3CMJA 1ZV9A 4LCRA 2DQEH 4KH9A 2V3DA 1C5CH 3KMDA 5C54A 1HINH 5F6IC 3KPOB 4F8OA 4KGJA 2EH8L 3QJUB 1P5UA 2VMEA 2VC5A 3W7IA 4P3WA 4GGHA 4XVDA 3ALPA 4XP5H 1J7VR 1N4XH 4N1CA 3BH9B 3R19A 4M3PA 5C0IA 4OQ1A 4XPHH 1BZEA 1PDKA 2GGEA 1DLFL 4MWFA 5T8IA 3A4WA 4INFA 4XI5D 2YJQA 5CIPA 4JIEA 3IKKA 3FB5A 4FG6C 5ANMB 4V2XA 2OW7A 4KK6C 5B1CA 4IRJC 2SEBA 1JPGA 1P5UB 1DIOA 1BKHA 2H7WA 4QEGA 2R91A 3B05A 1LM1A 1OP4A 3CJJA 1XX1A 4RR4A 3FCBA 4XX1G 1UVQA 4O2CA 4BWTA 1JXDA 1ZVNA 3MUJA 1UKOA 4QIUA 3CSPA 4DWSD 3W88A 4M6OH 3NMEA 1XL6A 3MBXL 3OR7A 5C0IB 2FWLB 1UYWL 5I1DA 1PDKB 4EXQA 1L7TL 4MWFB 5L9FA 1J9SA 4WEBH 4AJYV 3WH8A 3QW4B 3FHEA 5CIPB 3FB5B 4PWIA 5E9XA 1A6WL 3MTWA 1HZYA 2SEBB 3LYRA 1JPGB 1N5YL 5AOZA 4OZ4A 3IGFA 3Q8AA 3FY1A 4YPJA 4FQLH 5E93A 3BFWA 2YPVH 2JALA 3WIHH 4FJZA 3QPXL 4ZI8A 1UVQB 4O2CB 1MW3A 3UZEC 3PG8A 4L3EE 4ZD3L 3ENLA 3ZDZE 1T7ZA 3S1GA 4X6EA 4JGDA 3P5ZA 2VB5A 5HI5D 2VGGA 4KCVA 2EKGA 4WY7L 3OR7B 3WXWH 1ZQ5A 2AQSA 1YG9A 5I1DB 3Q45A 2VXVL 2VWTA 4HP5A 3K3QA 2VEIA 3DSFL 4BFAA 3GIYA 4LF2A 3NJKA 2W9DH 4NNAA 1CWVA 3H22A 4R97C 1TR1A 3H9ZA 3KYKL 1YMHA 3I9GH 4OZ4B 2X0UA 2GEQA 2DQDH 5I30L 4OLWH 5CJBA 5H94A 1CLOL 2XQBH 2BNJA 5EO9A 5I77A 4ZOAA 3KPTA 3V6OC 4LLQA 5F2MA 4Q6YA 4MNKA 2BOCA 4JHWH 4P9HC 2JK2A 2YXOA 4X6EB 3H6AA 3HNVL 2CJSA 4L3EA 2HWGA 2BIQA 3I6LD 3TX9A 2HJLA 1PJ9A 5AUMA 2B39A 2HK1A 3NQ8A 4IMLA 2Y5EA 4NSBA 5DD1L 1BYAA 3LOTA 3QTGA 4LE8A 1UD8A 2YL8A 3EPMA 3AZUA 4N2GA 4HWBH 4P5TC 1FH8A 3BANA 3L2IA 1YMHB 2HCZX 5DS1A 3ZWTA 5FCUH 5KZCD 3TVMD 5H94B 3MMWA 1QRNE 4A8IA 5I1EL 5EO9B 3L7EA 4LLQB 5DQ9A 3P40A 1BRLA 4JKPL 2BOCB 3FZUC 3HHSA 1IC0A 2CLVA 4DZBA 1RUAL 1GZHA 2QR0A 4L3EB 2XWCA 5CG0A 5HDLA 3HB3B 4Z7UE 3PS7A 5IT2L 3CPRA 2HJLB 3PNUA 4IHCA 4XNYL 5AUMB 5KVGE 5C92A 4IMLB 3OGOE 2PDIA 1JYNA 1Z9AA 2XM2A 4PG2C 4NPKA 1QFOA 5I8KH 4PMRA 2PR4H 5DUMH 1VEOA 2HXTA 5CBAA 4QX4A 2YOAA 5KVFL 4X3ZA 4KJYA 3HURA 1Q0XL 4QYAA 4ZR8A 1MRAA 1SHSA 4WU5A 1NCOA 5EOQL 1VQTA 3KPRE 3WH9A 4JGUA 4UMBA 2YOCA 4FIQA 2PDQA 3L7EB 1Q6EA 2J62A 1KM6A 5DQ9B 1QRNA 3UT0A 1BFOA 1BRLB 1UWIA 3HHSB 2CLVB 3NPUA 4JFFD 4DZBB 1Z42A 4WI9A 4TQTA 3RU8X 2QR0B 5CJOL 4HJTA 2R1LA 3US0A 3NZPA 1B9KA 2C3VA 2WHVA 4GABA 3VI3E 3ZT5A 1TVLA 1SO3A 4MGXA 3FUNA 2ZXGA 3T77A 2IF7A 3OA3A 4LSVH 3W9EA 1LVEA 2PGRA 2N4IA 3EX6A 1JV5A 2DZWA 1NKRA 1AG0A 1H6TA 5C0FA 1F90L 4KJYB 1EPFA 2XA8H 1GOFA 4A29A 4LB3A 3SSGA 1JRHI 4WU5B 3EJRA 2GQ3A 4IM8A 4NJ9H 2LU3A 1BLIA 4JFEE 1QRNB 1BFOB 3KPRA 4JKWA 1L9MA 2OWXA 1TTJA 3HG3A 1N67A 1MCQA 1WT5A 5G5DA 4UQAA 4WGVB 1MVFA 1DVJA 3FT4A 2WXJA 3GPSA 4GP8B 2NY6C 1IT9L 1JZ7A 2C3VB 3Q06A 3ZT7A 4FTVE 4GOSA 1C9WA 3M5VA 2IOOA 3VI3A 4O5LH 1OAUH 3T77B 3N2CA 3DA0A 3TYGL 5AOIA 3W9EB 1JV5B 4PS8A 5C0FB 4W8LA 3S5LG 4XO6A 3DOHA 4UM9A 1TV7A 3A67H 4YAQA 1BQLL 1T89C 3CSYA 3V5CA 1OTUD 1QFEA 1J5HA 1ILUA 4G5AA 4K3ZA 4PJFF 3KPRB 3MCNA 2F19L 5G5DB 2BP8A 3P4OA 3VG9B 4QOKE 3FT4B 4LY8A 2NTSP 2A85A 2W67A 3R8BB 2ZVIA 1XYMA 3UGEA 1SYVA 3VXTA 2CCRA 5DUPH 1HP4A 2WJZA 4U6VH 3EWWA 3N9KA 4G83A 4K38A 3NK3A 3MBDA 3VI3B 2P1YA 2I60H 4FTVA 3CB8A 3L1FA 4JL2A 4JG9A 2EC8A 4PUMA 3ZBMA 2CK0L 3C0LA 4Z7QF 1ZMYA 4MMXA 4JUSA 1RK0A 2WQSA 3FH5A 4UM9B 1MPAL 4PLNC 2WN2A 4YAQB 3SJ3A 3CSYB 2APBA 3E0GA 4HN4A 3W25A 2BP8B 3IRPX 3UBXI 3P4OB 3CNKA 5AVXB 3K2GA 3NN8A 1IBDA 4XBMA 5L6YH 1KUMA 4J2QA 3OXRA 4QOKA 5D6CA 1SYVB 2GJJA 2PZ0A 3QQXA 3VXTB 5D9PA 4W5ZA 2BHZA 4EZKA 4PMZA 1EBHA 3V5HA 4MMZA 3F85A 4FTVB 3VYOA 3MC0A 5EWIH 2AFNA 4RGNC 4JFZL 4XP9L 1ITBB 4MMXB 2F6XA 4P2CG 3TCLA 1V6YA 1RK0B 4DTGH 4FABL 1XF4A 1WCGA 1G87A 1BBJA 3G2GA 4C58B 2QSVA 4LVHC 4DO5A 1OE1A 2N7SA 3C5ZA 5EU6E 4PL2A 1BM3L 3QIWC 3ATZA 3NN8B 1ZE3H 5JPNC 3OXRB 4QOKB 5D6CB 3TXAA 3B97A 1CBVH 4XB8A 1T21A 4NO2A 4QKXB 3OKNA 3V5HB 4QHMA 4MMZB 4N2DA 1OPOA 5EBGA 2UY5A 1F8IA 2A9ML 2VNCA 3TCLB 2YS4A 1KGUA 3MZTA 5HJYA 1OX4A 4ZTYA 1CICA 2VGBA 4GP5B 2XDHA 1XF4B 5BW6A 2CM5A 1BBJB 3GW0A 2E9BA 3THDA 4JTHA 2XC8A 4KBPA 2JB6A 2O6EA 4ALAH 1KCSH 1K4GA 5EU6A 3SRKA 1JGLH 1A5FL 4YGAB 1T21B 1YEEL 4NO2B 2E7HA 2B0MA 3BG5A 4DEWA 1K02A 2WB5A 3OKNB 4QHMB 4K8RC 4LU5L 4KHXH 1NOWA 2HP4A 3CVHL 4JR9H 4O18A 3UL4A 4WW2F 4F15C 3R79A 3K71A 2O5YH 1OX4B 4QF1A 2EIEA 1CICB 3IDYB 3GNXA 1SOQA 5GZNC 4AB4A 4WJKB 5FJTA 3ZY7A 4K3DH 2JB6B 3WAKA 3NPXA 5EU6B 2BRQA 3P7YA 2LFGA 5EMJA 3CX5K 4IT1A 5FFGA 4FKEA 1RJPA 4NX5A 1F4AA 5TQLA 4QRUA 5LNDA 1GXEA 5LLIC 3EB3A 1GGUA 3HAEG 3K71B 1WOAA 3QXUA 1YMYA 4QF1B 3SRHA 1UZ8A 3LGEA 1UKSA 4G8EA 5JIMA 1CXLA 1U8MA 2P8PA 2R2EA 4HPHA 3CX5J 2ZDSA 3GSQA 4MZIA 2X6MA 4F2EA 2H45A 2R4RL 1IWAA 1U8KA 5IXEA 3WN5A 3OGCA 3BSHA 3TEWA 4QRUB 3K4AA 1I1WA 1FWNA 3AXLA 2CALA 1SLXA 4KVPA 2OX1A 4UU9A 4PJ8D 3RKDD 4AYGA 3NPSB 4EUPA 4N0YL 2FX9H 1DWIM 1KTLA 4Z7NB 1YPIA 1OHLA 2PDPA 4U31A 4RW5A 1UZ8B 2JLPA 2ILLA 4XXCC 4G8EB 2ZUSA 5D7JA 1FNLA 4HJ1A 3HQPA 4RWYL 4QHRA 1P43A 4Y0GA 1U8MB 4I89A 2P8PB 2R2EB 3OEXA 2VLLA 1UOZA 4S1QH 4N6RA 4OQTA 3GSQB 3FTSA 1S3KH 4ADJA 3ATDA 5E5UB 4NQED 5A6IA 4LOUC 1U8KB 4LEEA 3WN5B 2GK2A 4JFUA 4FCHA 1BD2D 1PKMA 1F4YH 3OGCB 4XWOD 2EACA 4OBSA 2QPDB 1T40A 1E9YB 3MW7A 3AXLB 5DC0A 3PFRA 3QJVB 5D7IF 5AYUH 4UU9B 2RA1A 4EUPB 3TEVA 1KTLB 3UXAA 1H6UA 3LZLA 2VDKH 4OIAA 2QADD 4HXBH 5D7JB 4YXLL 4I88A 1GHFL 2PDWA 1BYNA 4ZMNA 3KGSA 2VLLB 4AGNA 2Z0IA 3JWDC 4N6RB 2FZMA 1TR7A 3OZ9H 1KB5A 1SSGA 3RDTA 4J4KA 2HT3C 4JQIL 1ZV2A 3TO4A 2ED8A 5HYSG 3II2A 3ME3A 1DPMA 3UCDA 2GYIA 4N0UE 3A4AA 4KAQL 4XVUD 2AXFA 1SW0A 3LHPL 4I18A 4IPJA 3HE6A 4R5EA 2K8QA 1NC2D 1TENA 2HTMA 2ZUQB 2PC8A 5BV7C 3C5JA 4M29A 1AGFA 3Q0HA 4XP6L 1RFDH 1WPCA 2CEQA 1NBZA 2C7FA 2WXQA 3OZYA 4JTCA 1BW8A 3U9PL 1KV7A 3C2SA 1KB5B 4EQ2A 3K2MC 2VKXA 1E1CA 3RDTB 2YQ3A 3TO4B 3E0WA 3R5EA 1TSIA 5LNGA 5C9RA 1OEPA 3MA8A 4GUCA 3VRIA 3VVWA 2VDRL 1VFFA