4JFWA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2s,3s,4r,5s)-2-[n-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
total genus 162
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jfwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jfwA01
4B9ZA 1GQIA 5BXSA 3EDKA 2YOCA 4FLQA 1OGBA 3TA9A 4V27A 3RJXA 3WELA 4MNLA 1KXHA 1EDTA 1NOWA 4MNKA 2MANA 1XCXA 1TFVA 1BFNA 3T2QA 1U33A 2QPSA 1WDSA 5GQBA 1HN1A 3SCOA 1R8LA 2WHMA 2DDXA 2UY4A 4UOZA 3WBEA 4GINA 1OINA 1GNXA 1J11A 3TONA 3PBGA 4Z2GA 1M7XA 2WBGA 2ALWA 1UZ4A 1JYWA 3CC1A 1LWJA 1E5NA 1LG1A 2VZSA 1E4IA 4P7LA 4IPNB 1GHRA 3A21A 3IAQA 1WKYA 3K4AA 5EFDA 2D24A 1W9DM 1KGUA 4D6JA 1JXJA 4CUCA 1QBAA 1NWSA 2EPOA 4S3KA 5A8PA 2WC4A 2DSVA 3AIQA 2WC7A 1G5AA 3TTOA 1FFQA 4CD4A 4WK9A 5C8BB 1CYGA 1C92A 1AMYA 1WZLA 1GCYA 3IAPA 1W9PA 4M81A 5A8MA 3K4DA 5CZKA 2ZOXA 1E6SM 2PWFA 3O6AA 5BXTA 4F9DA 4HZ6A 3ZT7A 2VJXA 1Q6EA 3B9DA 2XVNA 1UKOA 2V3FA 4FNTA 2ZUTA 5A2BA 4CCEA 2XWDA 1VFFA 5BROA 2G8ZA 4WLCA 1ODUA 3U5UA 3VDHA 3U7BA 2A3HA 5AYBA 4EANA 1JNDA 3DX3A 2WSKA 4UQBA 2CKSA 3ZJ7A 1SYTA 2AMGA 2C8NA 2WMGA 3W82A 4NZFA 2X8RA 1GHSA 3GXTA 3A47A 1LWHA 1J0ZA 3BXWA 2XFRA 2EXOA 4HA1A 3VNYA 1E71M 4J3WA 4HMCA 5JBDA 3WD4A 2VX7A 3TTSA 5ABGA 3W26A 1MWOA 3ALGA 2EPLX 3B9EA 1BYBA 5FD0A 1BPLB 4HOZA 4GZIA 3GNPA 4MAZA 4M80A 4GI6A 4PUEA 1UASA 4DUWA 4MADA 2J79A 3DYMA 4AYSA 3MMDA 4PSPA 3IJ9A 5I2UA 3ZSSA 1BVZA 1GOOA 1UR1A 2F2HA 5I77A 3D3AA 1I1WA 4FK9A 2XSBA 1TVNA 1OB0A 3NDYA 4KRTA 1E55A 4AD1A 4FNUA 5JIWA 5A1AA 2V3EA 2X0YA 1BYDA 1BLIA 4DM1A 1FOBA 2DSWA 3CTTA 4JAWA 1V02E 1Q6GA 5DT7A 3VIKA 3AMDA 3AJ7A 3N1AA 4AIOA 4MB1A 3OGSA 4U3CA 1F4AA 3H55A 1EDGA 4PMOA 1WO2A 3WH9A 4DWSB 4FLOA 3DDGA 2FGLA 3MU7A 2WHJA 1PIFA 1ZB5A 1H11A 1L8NA 4AISA 3VOCA 2IXUA 4GO8A 3DYOA 3WD1A 2WB5A 5CPSA 3BCFA 4GXPA 2X09A 3CGTA 4ACYA 1TQWA 1FHLA 3SCPA 1TE1A 1HKMA 4NRSA 1MW2A 2YL8A 1KTBA 2WNWA 1UR4A 1J01A 3MUZ1 4BS0A 2E9BA 1HKIA 3CUIA 3BUIA 1QOXA 1PPIA 4MNMA 7A3HA 2V5DA 1B30A 3ZR5A 4AD4A 3TTQA 3W28A 3BVXA 1CXHA 3S2CA 1UKTA 1JFXA 3L4YA 1XCWA 4M29A 1BQCA 2XN0A 3WQ6A 1CWYA 3GXFA 3PN8A 2WAGA 2YA1A 3W4RA 3WNPA 3SCSA 1OT2A 1QI4A 1Q6FA 2QV4A 5CSUA 2OWXA 2E8ZA 2A3BA 3KWXA 1JD9A 2OSYA 2Y8VA 1QX1A 5A6LA 3WL1A 3PZQA 2DH3A 2VQTA 3VDAA 1JAKA 2NT0A 2W67A 2TAAA 4FNPA 3GNRA 2WZHA 3VIJA 2F7OA 2JEQA 2ZX7A 3ZOAA 2YJQA 1W3HA 3KL3A 2IXVA 3WH8A 3VMNA 5ABFB 3AYRA 3KL0A 3PZMA 2EAEA 4UFMA 4AC1X 4AZ7A 3WFZA 2PWEA 2EPKX 2J75A 2XPKA 4NI3A 4LYPA 3BSHA 5A8NA 3BLBA 4LXFA 4C7DA 1ZL1A 3CH9A 4PMRA 1EHAA 5A3HA 1E6NA 2CKRA 4QDMA 3T2OA 1B90A 4FNQA 1NARA 1V3JA 1JYNA 1GOIA 3LPGA 3WUEA 4HPHA 2W4XA 2J62A 2EPNA 2ZUWA 4TXEA 4W93A 3AYSA 1NWRA 5FL1A 1ECEA 1UUQA 3PZTA 4W7UA 2XTKA 1TR1A 5D9NA 5E0FA 1QHZA 3THDA 5A6BD 3WDJA 2V38A 4PSRA 1V6UA 5CLTA 2JEPA 3W24A 3HG4A 2XWEA 2G3JA 4J3SA 3F5LA 3VIPA 5E1QA 4AIEA 3M6DA 2BVDA 5JBEA 1WPCA 3OGRA 2VX4A 4HU0A 2BHYA 3UCQA 3VDCA 3H54A 4CU8A 2J7CA 4PBGA 4AD5A 5ABHA 3MV01 3OLDA 1HJXA 4Z2HA 4KGLA 4F79A 1VAHA 4JKLA 4AZHA 1R87A 3I3BA 1XSKA 1OGGA 1R47A 3RILA 4RE4A 5CXPA 3OLGA 1GPFA 4YHEA 1LLOA 2D2OA 2J4GA 3D50A 1W2PA 4Z2KA 3LPFA 1H09A 3MUAA 1UQZA 3NCOA 5FOOA 3WMCA 2AAAA 4PTVA 4MJ4A 2C7FA 1UKQA 2J8FA 2XSAA 1XD0A 4P7QA 3ARUA 1G9HA 1JDDA 1DWGM 3VO0A 3BMVA 1XYZA 4CD8A 4PMYA 3VIOA 2JALA 1CGVA 4TOQA 2CNCA 4Q7NA 1H3GA 2OW6A 3GNOA 4QCFA 2W5FA 4UZUA 2X0HA 3T2PA 5AC4A 7TAAA 1UD8A 4D6EA 2ZUUA 1X6NA 2JIWA 2RGMA 5BCAA 8CGTA 2PWGA 2HISA 1NH6A 5E70A 9CGTA 3RM4A 4UTFA 5BWFA 3ZT5A 3PZIA 2GUYA 1JYXA 2WMFA 1H1NA 2GFTA 1H0IA 2XN1A 1JZ3A 3EYPA 3RCNA 1J0IA 1KXVA 3W6MA 4NSBA 1KCLA 3PTKA 4JL2A 4GZEA 2YL6A 1C93A 1R7AA 2EABA 4HZ7A 3AHZA 1W9XA 1BYAA 4RL3A 3WQVA 3CZ8A 3L4ZA 3WNMA 1X6LA 1UR2A 1UR9A 2D1ZA 3VKKA 3DX1A 3VGHA 4OIFA 1QPKA 1V3MA 2J7FA 3NYDA 3WD3A 4W7WA 4W8AA 4OGZA 5ABFA 4JZ5A 3OLIA 1KQYA 2WMHA 3ALFA 3OG2A 2W63A 5A6MA 4A3YA 1KFWA 3ZR6A 3G6LA 5EFFA 3EDJA 2Q8XA 4UZSA 1KTCA 1UKSA 2CBIA 4W87A 4P8UA 1WP6A 1RPKA 3F4VA 1QHPA 4CD7A 2CCRA 1XSJA 5E9AA 4XB3A 1V6YA 1GOKA 2VT0A 3BLKA 2UY3A 5A94A 4U2YA 3M46A 4QCEA 3SCVA 4U2ZA 1SMAA 4AZIA 4H2CA 1SR0A 1DTUA 2D20A 1E0XA 1AQHA 2DT1A 1C91A 3VM7A 1GORA 1FHDA 4IISA 3T0DA 3AI0A 3EMCA 2WCGA 1LL7A 3K8LA 3MMUA 4UQDA 1JDCA 3SUVA 2VVSA 1GVIA 2OW7A 4JKMA 5DO8A 4CN4A 4UR9A 2GSJA 1GOMA 1HIZA 2XIBA 4PMZA 1UWRA 4W5ZA 3LRMA 5A6KA 3GXIA 4TVUA 4UQCA 2QMKA 3GH5A 1UD5A 3RDKA 3PZ9A 1BHGA 1IT0A 4A4AA 1JGIA 5E0CA 5BRQA 2G3IA 4LYRA 1GQKA 2VZVA 3G6MA 2Y2WA 3WKZA 4D6CA 1TQVA 1WDQA 3T08A 4E8CA 1B3VA 3GXPA 4QLLA 1Q6CA 1I75A 1QVBA 2VC9A 5I78A 1VEPA 4UFLA 5I5RA 1SMDA 4EKJA 2ZX9A 2A3CA 3VD5A 2E8YA 2XJ7A 1H4PA 5GNYA 1EOMA 1MQQA 3PTMA 1LL6A 4AZCB 3PZUA 1JNEA 1EIBA 2D3NA 2BFGA 4JL1A 1DWJM 2BVYA 2VO5A 1DP0A 3VIFA 1CXKA 1JIBA 3CMGA 4LQ1A 1ZU8A 1HWWA 2WM0A 2XFFA 3AS1A 4CKQA 1V6WA 1K9TA 2JF7A 4NXSA 2XVGA 4MDPA 5CGTA 1LQ0A 4YN5A 4WF7A 4DO5A 4EK7A 1MVYA 1R86A 4GKLA 3OGVA 4AY1A 4UNIA 4D1IA 2Y24A 1V6VA 4Z2JA 4MB3A 1GQLA 1XH0A 1KGWA 3OZPA 2WK2A 3DHPA 1HKJA 3DHUA 3QOKA 4PUDA 5HOSA 1EH9A 2YL5A 3QHMA 1QWNA 1CLVA 2VCBA 2WYSA 1HL8A 1NP0A 4AMCA 2VTFA 4W7VA 1NP2A 2NW0A 4JKKA 4QFUA 5AYIA 1RD6A 3BAKA 4JCMA 4TX6A 1HT6A 4K68A 1MYRA 1HKKA 4M24A 4OOZA 1VEOA 2YLAA 5GNXA 1EHNA 2V3DA 1ODZA 5I23A 3WF0A 2GJXB 3T0BA 1E1FA 4BQ5A 2JIEA 3GM8A 2CITA 3AMGA 2BS9A 1PAMA 4D6HA 2VRQA 1BGAA 2O9OA 1AQMA 3L4TA 4PTWA 3GBDA 3ZO9A 4XV0A 3UG5A 2J7EA 3DC0A 2D22A 3AZSA 3AMLA 3BLPX 1OIMA 1IZKA 1E40A 2WMIA 4OUEA 3BAJA 3POHA 1VJZA 1J0HA 4OBSA 2BY1A 1BGGA 3AICA 5FKYA 1MW1A 3WY4A 3WUBA 3WUGA 1KBBA 4DUXA 1E6PA 2VUYA 1V08A 5D4YA 4NZJA 2VX5A 1NOUA 2W62A 4H41A 3KEHA 1UG6A 3FAXA 3F5JA 1VIWA 1QI2A 2WMJA 3AOFA 4CVUA 1FH9A 5FIPA 4V28A 2YFOA 4B16A 3NJ3A 4BA0A 2RGLA 4D6GA 3BGAA 1CGTA 3WY1A 3CBWA 2FHBA 4D6DA 2C0HA 4DM2A 1A3HA 2QMJA 3EDFA 1ZBKA 4NZCA 3BUQA 1MXDA 2XIIA 1NOFA 4LPCA 2J74A 1JI2A 2XFYA 2GJRA 1BVNP 1CXEA 3VNZA 2X1IA 1V02A 2CBVA 1J0JA 1JF5A 1WDRA 4HA4A 1G0CA 4UQAA 1ZBCA 4F8XA 4WIWA 5A6JA 1B3WA 2F7PA 4OOUA 4TX8A 3WIJA 2Y4SA 5M03A 4GI9A 2DEPA 2VRKA 2J25A 1JXKA 2CHNA 1R46A 2CERA 3AS3A 1HP4A 3WY2A 1C3FA 3W53A 4AWEA 3WL0A 3ARQA 1HF6A 4CD5A 2VR5A 2G4FA 3FW6A 3LXCA 3KL5A 1EGZA 5DF0A 1M01A 5I3DA 2ZUNA 2EACA 1KWKA 3WH7A 1QNOA 4ATLA 1C8QA 5HPOA 4CVWA 2J77A 4X0NA 1J0YA 2D0HA 3AIWA 3HN3A 1R33A 2D0GA 3DYPA 2E9LA 1HJVA 3PZOA 2XG9A 1ZBWA 1O6IA 2GK1B 4JFUA 1ZJBA 3RM8A 1P6WA 4C7FA 1V0MA 4PN2A 1V03A 3CZLA 3MS8A 4H8UA 4MB4A 2E4TA 4PMXA 2F1BA 1GW1A 2VZOA 2BY2A 4D6FA 4JFSA 1HJSA 3EBVA 4UFHA 1EXPA 4HMDA 5LA2A 1US3A 4AMXA 3NSXA 2ZICA 1FH8A 1LL4A 2HVMA 3UETA 3BAIA 4J3UA 3WEMA 1XHGA 1PJ9A 5D9OA 3MUIA 1D2KA 1E4LA 4W89A 4M56A 4BF7A 3VSVA 2VZUA 3DX4A 2YFNA 3PTQA 4MPKA 3TP4A 1ZS2A 3BAWA 5A2AA 3AQUA 4PMVA 4Z2IA 2EBNA 3ECQA 5D9MA 3EJPA 3K1DA 1OIFA 4X9YA 1R75A 3MV11 4OJYA 4LYQA 5TD4A 3BUPA 4FLRA 4LGXA 4UOQA 1JAEA 2F7QA 2FH8A 3VUPA 1WDPA 4A3HA 2BY3A 3CUJA 2W91A 2ZUVA 3HJEA 4WJXA 1JZ4A 1O7AA 4WKHA 3SCWA 1MW3A 1VRXA 2FYVA 1H2JA 3SUSA 5JIPA 1RP9A 3L2MA 4N42A 4MNJA 2E3ZA 3N9KA 4BCEA 2AOSA 3CLWA 2CYGA 5I24A 1HVQA 2FHFA 3GTNA 3WDHA 2W61A 4AYGA 1BG4A 1J18A 2CHOA 2WC3A 3WH5A 1R85A 4MTVA 1UWSA 2VVNA 4W84A 3VIMA 1VFUA 1HJQA 1C7TA 3U57A 3SUWA 4ACZA 3VPLA 4ACZB 3EJQA 3VGBA 1PEZA 3WY3A 4GIAA 3WNOA 1TUXA 1UD2A 2Z1KA 3EMZA 3ARTA 1XYFA 2CIPA 1MXGA 1KWGA 7CGTA 1WAWA 2YA2A 6CGTA 1TA3B 5A8QA 3AMCA 3BAXA 4U3AA 1B3XA 3FN9A 1OCQA 2WANA 5CG0A 1KXQA 1XV8A 3II1A 3W37A 1XGZA 2J47A 3CHFA 1HXKA 4OZOA 4Z2LA 3VDBA 2ZWZA 4E2OA 1U2YA 4AZ5A 5A69A 1E3ZA 5A95A 1LF1A 2JFEX 1JDAA 1JL8A 4CCCA 4S3JA 3ZQ9A 4CGTA 3MSDA 1UD3A 3TTYA 1SZNA 1GOWA 3AHXA 3FNDA 2VOTA 5AY7A 3ARWA 1KR1A 2PBGA 4CCDA 5A6AA 2YBUA 1O7DC 3D52A 4KMQA 3NSMA 5I79A 4P7OA 3AFBA 3IGUA 1W9VA 2F1AA 3L2LA 2UY2A 3AZRA 1UA7A 1JZ7A 4P7RA 4R5EA 2DT0A 4QLKA 1WB0A 4ZFMA 1JZ6A 3BSGA 1GQJA 2J7GA 3TV8A 2J8GA 4M1RA 5M5DA 3WD0A 1EDQA 4HOWA 5C71A 1LJYA 2WBKA 2DGAA 4J27A 5IDIA 2OSWA 4WSJA 3ZJKA 1K6AA 3AIBA 3WEOA 3PHAA 5E09A 3FXYA 1R7OA 2E40A 4XZBA 3WF3A 4E8DA 3QOMA 2CETA 3VSUA 3VGFA 1UWQA 4AD0A 3VX1A 1W91A 1E3XA 1SFSA 2CXGA 4JFVA 4AEEA 3CZEA 2G3NA 2WVVB 3RIKA 3WN6A 2FH6A 3CPUA 1CEOA 3A24A 3AROA 3WH6A 1WNOA 2B31A 2XYLA 1TQSA 5CLWA 2WZIA 1HJWA 4M8UA 3HG3A 1K9FA 4UQEA 4WKAA 1OWQA 1C8XA 2ZUMA 2YBTA 5A6BA 3W27A 3A3HA 1CXLA 2X2JA 3SCQA 3OIHA 3AS0A 2WLYA 4P8VA 3U5YA 3VX0A 1E1EA 5BXRA 3I3EA 1E72M 3MMWA 3MUY1 3CUGA 2VCCA 3EJRA 5D8WA 2DIJA 1OM0A 3W38A 3A5VA 3K8KA 1QNQA 4UFJA 1ISZA 4W8BA 1TQUA 3ZT6A 1FFRA 1KGXA 2WVSA 4H7VA 4JIEA 2QPUA 1OT1A 3RM9A 2ZXDA 3K8MA 2GVYA 5IHRA 3CZKA 3L4VA 1CTNA 1UZ1A 2WCSA 3HU7A 2GK1A 3GYCA 2VZTA 1KB3A 5HNNA 5D8ZA 4W86A 3NDZA 2F8QA 2GDVA 1F4HA 1E70M 3WF4A 4DWSC 4AMWA 3U7VA 1A47A 3A4WA 4YHGA 3LXBA 3QHOA 4B3KA 1E9LA 1QWUA 5FL0A 3W6LA 3CV5A 1PS3A 4J3XA 3RO8A 3VD4A 3B9AA 2YKKA 2Z1SA 3BVUA 1ITCA 1W1VA 2WLZA 4MJ2A 1US2A 1PX3A 1DWFM 3EMQA 3OBAA 4PRWA 3T09A 1IZJA 3CZGA 3VGGA 1NM9A 1CENA 4FLSA 1J10A 3DDFA 3OZOA 4GI8A 1CGUA 2BXZA 3LPOA 3KE0A 1CNVA 3UESA 2G41A 4IM4A 3GBEA 4KH2A 1CLXA 2XVPA 3WFLA 2Y8KA 2FDMA 4D1JA 3WEZA 4U31A 4MDOA 2D23A 1G1YA 3BC9A 1GOQA 1FP9A 5M3WA 2DPEA 4D72A 1QW8A 4IPLA 1V0LA 1RP8A 4DO4A 4D71A 1ZJAA 3L4WA 1VBUA 1CIUA 4EE9A 2YDQA 4NX0A 3MKKA 3LPPA 1FA2A 1I1XA 4D6IA 3A23A 4R27A 1V3HA 3CIVA 2DSZA 3WDPP 1DHKA 1V3KA 3MO4A 5HXMA 5LA0A 3ZMRA 4GZJA 1TG7A 4HTYA 1WZKA 4AZBA 2O9PA 4UOJA 3THCA 1EQPA 2XGBA 5GPRA 1DWAM 4CU6A 1C7SA 4L4OA 2WSPA 3ARSA 1Z32X 3E1F1 1WCGA 2BXYA 4FNSA 3WBAA 3BVTA 4KRUA 4J28A 1M03A 3L4UA 3LRKA 4OKDA 1QNSA 2F61A 1W3KA 3ARZA 1UWUA 2O92A 1GJWA 3AXIA 5KEZA 3AIRA 5AC5A 2EEXA 1V0KA 1MW0A 3NIYA 4BQ2A 1W1TA 2O9RA 1B3YA 2OSXA 2X2IA 2OYMA 2DT2A 5M17A 1HL9A 3K46A 4JHOA 2ZXQA 2D0FA 1H0GA 8A3HA 3EJTA 4NF7A 3WQ8A 3CHEA 4H8HA 3OLEA 1GZJA 1OGSA 3SUTA 5KZ6A 2WXDM 2YDRA 1S46A 2PWDA 3VIIA 3DX0A 3UG3A 1PX4A 1UYQA 1DWHM 1PBGA 3CZNA 2GDUA 2CEQA 1AVAA 3M07A 1B9ZA 2QLYA 4H8VA 3WQ5A 4JFTA 5BRPA 5A2CA 5GNZA 2PBOA 3D4YA 2ZUSA 2PC8A 1H49A 3AXHA 3QR3A 3QHNA 1MFVA 2V5CA 2VQUA 2WHKA 3WD2A 4J3TA 1UR8A 1BYCA 4V2XA 2W66A 1PIGA 4JHZA 3KLKA 3AHVA 1E56A 1E5JA 3ZJ6A 1CPUA 3D5HA 4TTGA 4U33A 5I0DA 4XZWA 3A22A 1K9EA 1V6XA 3I3DA 1B3ZA 4F9JA 1W32A 1JD7A 1IV8A 3AHTA 2VI0A 4TVDA 5CJ5A 1E6RA 4XX6A 1CZ1A 1B0IA 1KQZA 3KZSA 1W1YA 4EAMA 1MFUA 4RE2A 2F7RA 4AZ6A 1UQYA 4FF5A 2DT3A 3MSGA 1WZAA 3SCUA 3N18A 1BAGA 3W0KA 1VBRA 3QGVA 2ZE0A 4AZGA 2IUZA 3WQWA 1QW9A 1CDGA 2WWCA 1K9DA 4KGJA 2VRJA 2F18A 4IUGA 2NSXA 1D7FA 6TAAA 3GH4A 3WMSA 2PI6A 1BSIA 1VF8A 5C70A 4N0RA 1QI3A 1UKPA 4QLJA 5IFPA 3AZTA 5HDRA 1R34A 4CN6A 2BVTA 4ZE5A 2E9MA 1L0PA 5F7UA 2WMIB 4Y7EA 4WKFA 2EJ1A 2VNCA 4B3LA 4DWSA 2WKGA 3GZAA 3FY1A 1CECA 1JG9A 2XHYA 2CBJA 2FHCA 3GXNA 3IJ8A 1V3IA 2ZXBA 2UWFA 3RJYA 2WKLA 3ZSTA 1QNRA 4ZXLA 2DQXA 1DWIM 3N17A 3O2LA 3S5YA 2IGTA 2J7HA 3JUGA 5ABEA 1ITXA 2X05A 2BY0A 3PZNA 4AW7A 1QBBA 1XC6A 3MANA 3W81A 2ZX6A 2G3MA 2XUCA 4ZEPA 3AIEA 4PTMA 2WVUA 3VMPA 4YPJA 4GQQA 1V3LA 1UWTA 2ZX5A 1PX8A 5JBFA 1JFHA 1B2YA 3WENA 3OA5A 3CUHA 3ARRA 2WHLA 4HMEA 3N04A 1N82A 2CPUA 1WE5A 3RPMA 2D3LA 3DECA 1Q4NX 5HPCA 3UERA 4PMQA 2PF0A 4ZE4A 1GJUA 3ARYA 3SEPA 3WNLA 4Q22A 3D51A 1RH9A 1AQ0A 2NT1A 4ZENA 4UQ9A 5E6ZA 1YQ2A 4U5KA 2YDSA 2YLLA 4UFIA 5EBAA 1QI0A 4DUVA 4L4PA 2A3EA 3VGDA 2YIHA 5LYRA 4J3VA 3VILA 1CBGA 4BQ4A 1EA9C 4LX4A 4M82A 3UG4A 4W85A 5BYWA 4KWUA 2VX6A 4WSKA 1KCKA 2UY5A 3CZJA 3F5KA 1OD8A 4OBRA 3BUDA 2CESA 3WDQA 3RMEA 3VD7A 1UOKA 2X2HA 2J7DA 4URIA 2DSUA 1XD1A 1ESWA 3SIMA 2DH2A 3CHDA 2JE8A 3IJ7A 3S5ZA 2DSKA 4PCTA 5CGMA 4PMDA 3WNNA 1ZBVA 1FH7A 1HTYA 1E0VA 1Y7VA 4J7RA 3CMJA 5IXEA 3DX2A 1UWIA 1W9UA 3SURA 5DT5A 1OD0A 3OB8A 2ZX8A 1E6ZA 1NWUA 4MAVA 1UH2A 3GXMA 2YL9A 2OYKA 4XUYA 1H5VA 1FP8A 4NRRA 4PMNA 2W92A 1B1YA 1ISYA 3LMYA 5ECUA 1VFMA 3N12A 3ZIZA 4HPGA 3FHAA 3H53A 4TVCA 1ISWA 1YHTA 3ARXA 3SCNA 1M53A 1UHVA 4H04A 1KBKA 1J0KA 1QHOA 3EJUA 1U30A 3AISA 3VINA 3HG2A 5A8OA 4ATWA 3EDDA 4X0VA 1LG2A 1XH2A 1TCMA 5EB8A 3BUBA 1Q6DA 1J12A 3VVGA 1JYVA 3WMBA 2ZWYA 1X1NA 3T0AA 4PTXA 5E6YA 3VD9A 2D73A 3LXAA 2O9TA 3VD3A 2ESCA 2OLHA 3BH4A 3A4XA 3NUKA 3VGEA 1W3JA 4CD6A 3IK2A 1M04A 1W2VA 3VIGA 1E4MM 3GDBA 3POCA 5I6SA 2ZXAA 4F66A 1TQTA 3AS2A 4P7NA 1V0NA 3N15A 1CGYA 5A6SA 3BCDA 5DEZA 3ZM8A 3EJSA 1C8YA 5DFAA 1VENA 3LX9A 1T0OA 2WWDA 2WCAA 3WF1A 1ISXA 2FE0A 4ZXOA 4AD3A 4AD2A 1KXTA 3LRLA 1VJSA 3UEQA 3WNKA 1JI1A 1PZ2A 5IFTA 3O9NA 2EO7A 1D3CA 1JZ5A 2VL4A 1EO7A 3CZSA 2BV9A 3UR7A 5LA1A 2V3GA 3VM5A 2ZIDA 1W9BM 2QF8A 1WZMA 2WVTA 3W29A 4GPNA 3BVVA 4E4PA 2J7BA 3M7SA 1OSEA 2VMFA 3TOPA 1KR0A 1XRVA 4JCLA 1HXJA 3HZ3A 3ZJ8A 1UD6A 4RE3A 2JF6A 4PMUA 4HU8A 1E4NA 3S6TA 4UFKA 3EDEA 2OWWA 3A6OA 4FNRA 1CXIA 1VEMA 2EADA 3GXDA 3VMOA 6A3HA 5IHSA 1QI5A 1E6QM 1EQCA 3CO4A 2FGZA 1DEDA 1B31A 1CXFA 2PB1A 4JFWA 2BHUA 3WSUA 3VSTA 4ML4A 5CQ1A 2BHZA 3PZVA 3BVWA 3WUFA 1E15A 1NWTA 4P8WA 3MI6A 3NSNA 1UH4A 2CBUA 4W8LA 2QHAA 2J78A 5CSYA 1NQ6A 3BAYA 4GO9A 4CN1A 1G94A 1QNPA 3SCTA 1BG9A 2GJPA 3WDIA 4B9YA 4TTUA 2VCAA 1HJUA 1TA3A 2GJXA 3VIHA 3WQ4A 4NXKA 1E6XM 4HZ8A 4U5IA 1TVPA 5D9PA 1UA3A 4AIUA 2XM1A 2WZEA 1H41A 4HP5A 1HNYA 4BZYA 2A3AA 3UR8A 3BMWA 4AZCA 3KLLA 4AEFA 3FHQA 3VTRA 1VFOA 3L4XA 3AHYA 2EQDA 4HOXA 1CGWA 3AIVA 2OYLA 1HX0A 1UD4A 1ISVA 4AXNA 2XN2A 2E0PA 5FCZA 4W88A 3W25A 5HBFA 4HA3A 3WDRA 3SUUA 1JF6A 4QP0A 3HG5A 1HP5A 1JZ2A 1MQRA 3CHCA 1MQPA 4BQ3A 2WW5A 3A4AA 2VURA 4FMVA 1W1PA 1UR0A 1JZ8A 2XGIA 3AXXA 2WPGA 2Y5EA 3APGA 1UH3A 4TUFA 4ATDA 3GH7A 5CPTA 1E43A 1HVXA 3WF2A 1E0WA 1EO5A 3SCRA 3AIUA 5JUVA 3ARVA 1TMQA 4CU7A 4MB5A 4PYSA 1W3LA 4P8XA 2DIEA 3J7HA 2EPMX 2WMKA 1XH1A 1VB9A 2YA0A 5CPQA 2XVLA 2VR4A 1BF2A 1E73M 4W5UA 5EMYA 3VU2A 1XSIA 2BNJA 3PZGA 1GVYA 4PEEA 1PZ3A 3D4ZA 2PWHA 2XVKA 3ARPA 1OBAA 2OWCA 4UCFA 1C90A 3B8SA 1GUVA 3N13A 4QAWA 3HMCA 5BXPA 4DWSD 2X2YA 1BTCA 3AMKA 4PCSA 4GQRA 1G01A 1J9YA 4DO6A 3N11A 3FAWA 1EOKA 4C7GA 5DMYA 2XM2A 4B15A 1GONA 1TZ7A 3IANA 2WVVA 3CUFA 1CGXA
chains in the Genus database with same CATH superfamily
4X4XB 4GQPH 4XCYB 3W9DB 4MM1A 4LOVA 1V7NH 3DV6B 1GGIH 4LSTL 1L7IL 4A3QA 1ASQA 3DIFB 4OT1H 5ERWB 5HYJE 1PZ5B 4V27A 3RJXA 4AC7C 1XCQB 2YLHA 4ICXA 1OP3K 5TFSH 3T6XA 3L5IA 4PLOB 4XMPH 5FUCC 3D08A 2FGWL 3FTSA 1YTKA 5CEXB 3FQRA 5F96H 2IDQA 5AW1B 1EDTA 1NOWA 3BW3A 4HJIA 2YBGA 1E0TA 2Y0FA 2MANA 5CINL 5T1DH 2WLHA 1XCXA 4QDGA 4FEIA 3UTZA 4DP5X 4KUCF 5F6IC 1NJJA 3TOYA 1OAZH 3KPMA 4Z3GA 3ZL1A 2ON3A 3D85B 1S7WB 3NP4A 2CBOA 3KLQA 3QCUH 2JSFA 5GQBA 3UMNA 3G5YA 4ILSA 1BMGA 1VFHA 2AK1H 3IXAA 4NHCL 3HIJA 3DX7B 3HFFA 3IVSA 1T04A 2UY4A 4DIAA 4N8CL 3H7BB 3LAFA 2FL5A 4N2YA 4BINA 4IQDA 5CCKH 1BGXH 1GVOA 3WLHA 1THCA 4NAEA 3CU1A 3KPTA 5ID1A 2J8UE 2JJTC 2PPCA 3Q94A 3LIZL 1FL5B 1D9KA 1FL6B 4QTIH 4RGMB 4J2XA 1G67A 1S7VB 1Z5LA 2Z31C 1JYWA 3QYMA 3PWNB 2BSLA 3R8RA 2D69A 2X4SA 4NWUH 3QFDA 2V2WB 1YEEL 1XLHA 3CC1A 5C0JB 1FZJB 4GUQA 1LWJA 1NCAH 1O6VA 2BX7A 4L1XA 2YD0A 2X2GA 3UAJA 1ETZA 2BNQE 4OCRL 4PLJC 5CGQA 4WWPA 3WFHA 1DFBL 2B15A 5JW5B 1KBLA 4OFYD 1NGPH 2EH8L 3QZNA 4D0BB 1CN4A 4C83A 4F15C 4PBVC 4APQB 1W9DM 2D24A 2UV3A 4EBQH 4QS5A 4YHIB 4Z0XB 1FGNH 3O6LL 3B3IA 4CUCA 3FO2A 1GGCH 4ADUA 1RK0A 5C0GA 3PWVB 4MFEA 4MA8L 1K8ZA 4IGNA 4S3KA 4NZTL 1U91B 4PJGA 2IALA 1GTEA 2QJNA 4NKMA 4EJ1C 3TR9A 3IU4H 5DY2A 3WQPA 3FTUA 4PUNA 4YSAA 1E4HA 2O56A 3ZYIA 5EZPA 2WC7A 2AANA 1KUMA 5EOTB 3SBPA 2A2QT 1ITXA 4HKBB 4JY4B 4AH7A 4HS8H 4WK9A 4NJKA 1T04B 4XB8A 3R8BB 2P3YA 1CYGA 2YXWA 2AK4B 4HAKA 5AOJA 1WZLA 1GCYA 3TBVA 2RR3A 4ZUTA 2ZOXA 3R18A 3IGSA 1EAPA 2QKIC 1PKYA 1KXVC 1UWEL 4KUCD 1KLGB 3BQVA 1J05B 1WQ5A 5ENWB 3W2DL 1ET7A 1IGWA 3DGGB 2NY5C 4JJ5A 2WOQA 4PBWD 3ZE2B 1D5BA 2C18A 3STFA 2EO9A 1U8OA 3IJIA 1Y1UA 3KPRA 5EZJB 6XIAA 1TTIA 2XVNA 4B9IA 1UKOA 1QNIA 2XG5A 1NJ9B 1FBIL 3NTCH 3DUUA 2K4AA 4JM2F 4N24A 2XWDA 5DHYB 1J5TA 3CJPA 3NIFB 1NCCH 4EI6B 3L5LA 3QRHA 3QNXA 1WD9A 2P8MB 4MYWB 1VFFA 3TJ4A 2G8ZA 4WLCA 1ODUA 1XF4A 3VDHA 5DRCA 4ZMVA 4MX7A 2ENPA 2DWDB 4XZ4A 4JYEA 4GO6B 1S2EA 4HKZA 2CFFA 3INOA 2Y06H 4DJMA 3ITOA 5FF3A 4EANA 2YUXA 2QJGA 5FOBA 1CS6A 2CJTA 3F5WA 1UT9A 1MHCB 2AQQA 2NY1B 3NIGF 1CUOA 4HIHA 2AMGA 3ARBB 4KTDH 2AV7A 4HIIB 1SYTA 2CKSA 3OJ2C 3S2JA 3FTXA 3SY6A 2ACSA 3BI9X 2ROXA 4QXGL 5C2BH 2NTFA 3MV8A 2DJLA 4XKYA 3W82A 3NVQA 2IDSA 4NZFA 1VZWA 4JGJA 3KVLA 3TW6A 1DL3A 1Z69A 1BZ9B 3AQYA 9RUBA 3EKCA 2X9WA 4PJAE 5AWNL 3ZDWA 1LWHA 2R1KA 4O8AA 3GZKA 2RBLA 2VN7A 3VACA 4BGDA 5C9RA 3ESVF 5KYYB 1ZS8B 3MV9E 4HA1A 2LT9A 1AQDA 4LFHD 1QAWA 1KBPA 3VWJC 5DZJA 3Q2VA 1OKEA 4MMZB 3UO1L 4EQ2A 5IQMA 5MKGA 4I0PC 3RAOA 3F7QA 4NENA 5HMFA 4PVBA 3NZSA 5IJCC 3FMGH 1Q6OA 3MBDA 4F33B 1FNSH 1KTLB 3BZ4A 3KR3H 3W26A 2ZOOA 2P8LB 3B9EA 4JUTA 1EWEA 5CPNA 3BWWA 3FSVA 4WY7H 3BGFC 4R5XA 2NQ3A 4GI6A 3BJFA 1FVDA 4HMNA 4DUWA 4S3BA 1IM3D 5CEYB 2J79A 4KCUA 1AZZC 1JGDB 1XZ0B 3DYMA 4YWGH 4AYSA 3LCYA 4AKQA 1P6BA 3LOTA 3MMDA 3DOSB 3INUH 4PSPA 2HS8A 4CNSA 5C9ZA 3ZSSA 1BVZA 2R2BB 1LTXA 4IIEA 3TF4A 1O1HA 1QFWM 3NJXA 4ADGA 3D3AA 2ZJSL 2ZONA 3B8YA 3U4FA 4FK9A 2QIWA 3K7UA 1EWHA 3LDBB 1U21A 3MRJA 1KYOK 4LDLB 4DSYA 1R2TA 3NDYA 5CPLA 4N1EA 5ICYB 1E55A 3JZEA 3UR2A 2YSTA 3FBKA 4AGPA 1R38A 2J43A 1BA9A 2HK1A 3MJ9A 3QIUD 2NX1A 3C2EA 4IXXA 3LKPB 2MCPH 5FECB 3B8UA 1BLIA 1RIHL 1TJIL 1FOBA 2BOBA 2Z0BA 4PGCA 4U1NA 5E2UL 4YHPB 2PCYA 2VABA 4G6JL 3LZRA 2EVHA 1XLJA 3KS0J 3TJHD 2C9RA 4Z5RA 1Y1DA 5IKCA 3BZDA 2HPTA 2EE9A 4RRPG 4GOAA 3VIKA 5IOPA 5I26A 4MB1A 4CMMB 5FYJH 4FG4A 4AVNA 3BEVB 4NAMA 3BGFB 5FO7A 4B50A 3D9AH 5JU6A 4EACA 4URKA 4N2MA 4OUOA 3CSGA 1G7QA 4I6KA 2Y25A 2XRAH 1H6UA 1WZ1H 4HUWA 2KI6A 3DBXA 3GZPA 4JDVA 4MS6A 5HGHA 4W9FC 2CK0L 3QDGB 1Q45A 2WHJA 3TQ0A 5LGXA 4J3OC 2IH1A 3N06B 4NT6A 1H11A 2KERA 5IBXC 4AXWB 3D18A 1DBJH 5CZVH 4P04A 4GO8A 4HWEL 2GJZB 2E7MA 4N0UA 1YECH 4P4KA 4P2YA 2WQXA 2JXMB 3CAFA 5IR1B 3V7PA 3WD1A 3FHEA 3BCFA 1FZMA 4ACYA 2ZOLB 2DJ4A 5D1QA 4Q9QL 1TRDA 1AY1L 3IDJA 2BP8A 2DY2A 4LSRH 3PQYB 5J1AA 1TQWA 5FOJA 5E5MA 3CL7A 4NN7C 1TE1A 2CHZA 2UY6A 2WB1A 5D1ZI 3HHSB 2VAJA 3US1A 4OD3L 5E1IA 1AGEA 4QXUH 1RXOB 4WQOA 3US0A 1VHCA 2ZVRA 3BOVA 4M4RB 4PRNB 4RNRB 4NRSA 2VLJA 5DHXB 1CK0L 4PFEA 1S39A 3TBYB 3TPUB 3F03K 3LQZA 2E6QA 1JZJA 3DA0A 3QXUA 3M0VA 3WOVA 1UR4A 3ETBF 5M95B 3MUZ1 1NBYB 3P11H 5KW9H 1JRBA 5K2ZA 1H8LA 1ZTMA 5T1LB 3EPNA 3AWFA 4IICA 3B9KB 8FABA 1ECQA 4L18A 5C09D 2V5DA 4LCVA 5HNUA 4L1TA 4A63A 1KIQA 1SJHB 3PXJA 3S8HA 4HXAH 3M45A 3W28A 2A6KA 3H9ZA 5IT2H 3BVXA 5D1ZD 2R1LA 1CXHA 2ED8A 1G1CA 4P5MA 3DJZA 2Y1HA 2A2IA 2RIKA 4DGUA 2P8CA 1JNNH 1AKPA 1RUKH 1SDAB 4LARL 1VHNA 4YVXA 3U9PH 3X3GH 2CLHA 2ODIA 3NZUA 1CWYA 3GSQA 2C4FT 1ALDA 5DI8B 2OZ4H 3SODB 4FQLH 3WNPA 2WXMA 5AB0A 3W4RA 3OQEA 4XXCC 3QM3A 3PDOB 4U6TA 5CSUA 1GEQA 1HHIA 1NFIA 4BDVB 2BVWA 2O5YH 4TNGA 2EDLA 3RU8L 1DJNA 3QYSA 2GK2A 4A2MA 4H20H 2MOGA 4FSAA 4UIOA 2OSYA 2BWQA 1BM3H 2HWZL 5I18L 4UNTA 5A6LA 4K5PA 3BIAX 3WL1A 2NX5D 4HNOA 3T0EE 1NEUA 4WI0A 4WUUA 1CI1A 2X5PA 2DH3A 3KM2A 4K7PL 2EZ0C 1RBOB 2NT0A 1MNNA 1A14L 1Z2KA 2OL3B 3U0TA 3MOBH 3U1PA 4Z1YA 1E9PB 4OT7A 2JELH 4G43B 3W87A 1NUNB 1ZPLA 2ZKHL 4CNOA 2CCWA 3GWJA 4LIQL 5IMOB 1FWFC 3QE5A 3GNRA 2WZHA 2OMYB 5EV7A 2PP0A 2F7OA 3H4XA 2ZX7A 4P3CL 4UF7C 5H2BA 1U8CA 3MTXA 1PO9A 5EU3A 3QV9A 3EFOB 4IHOA 3VFRA 2GZXA 4E41D 4DKAA 2V5JA 3FT3B 2VMCA 2J66A 1HXYB 2EKSB 2VQ4A 2VWEC 3FT4A 3TYFB 1IXNA 2CLPA 2OQLA 2ZQKA 3BT0A 3A64A 1EZUA 1XINA 2PDIA 3WO3B 5LGKA 1Y07A 4LCCB 3P8IA 1KV7A 3PZMA 1LQAA 2ICEB 1CB7B 1EJVC 3EKGA 3RHGA 5LWYL 4HK0B 2O61A 1F18A 3NPXA 4DYJA 3WFZA 4B9PA 2ZWKA 3NQ8A 4K55A 3HKFA 3DETD 4EXPX 2EE2A 5G2NA 4CLMA 2QSVA 3UCRA 1Q9WB 1LO0H 3TCEA 5A8NA 4G9FA 4P5KB 2E5CA 2MH4A 5FKAB 4R7LA 2ABAA 1K2DA 4LXFA 4O15A 4WSGA 2Z92A 4KKCC 4CC0A 1QW7A 2I32A 1OQXA 5I1AB 1SJBA 2X4RA 3LNMA 1SQMA 2P5EA 5H8UA 5A3HA 5ABDE 3F4DA 2QUVA 4NUMA 3FT3A 4QHKI 3PQYE 5I19H 3OPZL 4FNQA 4LSUL 4LVFA 3LPGA 4OZHA 4HYVA 3JRKA 1J5OH 5CGYC 1FWAC 1IIHA 2AEIT 4PBFA 1UC5A 1CTOA 3II2A 2J62A 3MWCA 3GRWH 4XO5A 2OMYA 5LZLA 4HFWB 1Q4WA 1JNLL 2X89D 5IOBA 4UV7H 2CMRL 1KN4H 3ZLGA 3CLEL 5FL1A 3BPNB 5CR8A 1HL4A 2QHRH 3OHXC 2QIIA 3CX2A 2QCEA 3GMOB 4GW1A 3VD0A 1V10A 3K72A 1INQA 2Q8BL 1N6VA 3CFNA 3H3PH 3TO4A 3PNWA 4Z7WB 1TR1A 1DJWA 3NT0A 4IDJL 4HQVA 1E8WA 2EC9T 4Z9KB 4XC3L 1QHZA 3S2NA 3LZFH 5GJTL 1OD7A 4Y8AA 1F1DA 3CMOL 4I2XE 3CK5A 2OQHA 2VYOA 1W80A 4DETA 2DY3A 4CQBA 3RTQC 1E4WH 4PSRA 2EF9A 5C0QA 3D2UB 1KIPB 4O9HL 5HYEA 3UPBA 2ZG3A 3AZUA 2N7BA 4XN2A 4PJCF 1LYXA 4X9HA 3T1GA 2PXYA 3MA7B 5DJYA 4XI5C 2QPFA 3V7AE 5FLVA 2JEPA 2VR2A 3NQVA 2YSSB 4Y2DD 3Q37A 2QQKH 4YS4A 1Q63A 1OAYH 3GLEA 2GSEA 3UY7A 5E1QA 3LRGA 1OF0A 3M6DA 3OR7A 4NQVB 3VXSE 5SWZE 2AJ3A 4AIEA 4UINH 4OFQA 4MNGA 2VX4A 4U3XA 3VI4F 5D93C 5D30A 4HNTA 4KI5D 1H15B 2ZWSA 3HI6H 1DUZB 4Z7WF 4Y9PA 4BIKA 1S7QA 1TJGL 4I89A 3D0CA 4X5LA 3LKRA 2VDML 3SDOA 1AJ0A 1BIHA 4JDEA 4NRZA 4APXB 2FIKB 2EE3A 2ESVD 1WKFA 1NCDL 3UGRA 3GW3A 4ORGB 3QR1A 1DSFH 4FXKA 3KPSE 4YDLC 5C86A 2A6IA 1X1ZA 4GC3A 1Z3GL 4S3AA 5ABHA 1I7TA 1QQDA 1HJXA 4GSRA 5B39B 5JHLH 3FB7B 3HC3H 1P69B 2Z31D 2V5BA 4MASA 2L7JA 4K8EA 3WEBA 4ZTPL 1EZLA 1G5GA 4WGKA 1QLFB 2BGSA 3O0FA 1H0DB 1T99A 1K02A 1DE5A 2ZYIA 1DL7L 1KIUA 3FSAA 3JXAA 4PJFE 3ZKMC 1MCBA 5L7XL 3ZVHA 5REQA 1KULA 4HEPA 1GPFA 4LCSA 1ORSA 2D2OA 4MSWA 1N19A 1LLOA 3LTPA 1PAZA 2VDRH 3P3UA 3T8QA 4TSCL 4HG4J 5PAZA 4HK3N 2C91A 2PD9A 1ZLWH 2X9YA 2OOGA 5MEND 4XE0A 3IWPA 1DE6A 3MUAA 4RMSA 4ETYA 5INCB 3ABLB 3GC3A 4UTMA 3FQNA 3I6KB 4HFUL 3LS5L 4MJ4A 4F24A 3F2LA 2J8FA 1XD0A 4KDTA 5TE4H 2EUWA 2XSAA 3TT3L 4QF1A 1JDDA 2I69A 2NMSA 4YAQA 3VO0A 4F2EA 4DYEA 4K38A 3QR0A 4WD0A 3RWHB 3BMVA 4R90L 1XGUB 4UT9L 3ZQWA 4OIIH 2XIOA 3NEVA 2D7TL 4ZNEA 2XSKA 1PG7W 2YXXA 4ES8A 1AL7A 3EPMA 2HKHL 5ANME 3O4LE 3JVFC 2H2SD 5DD0L 4S3GA 4KX9A 2AJZA 5E1GA 5FJIA 5F93C 1EHKB 5EU3B 1WG3A 4E9TA 5BXFB 4Q6KA 2E28A 3TYEA 3RYSA 4AIXA 2DZEA 4O02L 2W5FA 2OTUA 4UZUA 3ESUF 4QY8A 4PYHA 4JKPH 1DUYB 4AIZB 2ZUUA 1E9OA 5C0CB 3SSJA 1S7UA 3E8VA 8CGTA 1JPSL 1E90A 1WS7A 2HLFC 1C1EH 4G7QB 2HISA 3Q6FB 3G1DA 5HQMA 1XB8A 5D2NC 5C9WA 1JHKH 1PCXA 4UTFA 2EDEA 4LBRA 5BWFA 4GRLB 2BW5A 5F2FA 1IIKA 1NUGA 2F7IA 3BZJA 1U4EA 1ZVYA 4QRUA 1I0DA 4HU4A 3OKKB 3HUJE 1PY9A 5E56A 1FF5A 5I1KH 1FUYA 1S3HA 1GSKA 1A3ZA 2VL5B 3BARA 3N55A 4Y2DB 3LVEA 2WMFA 3KHJA 2B7DT 2IO5A 4QG6A 3S96A 1IC4H 3W7RA 5DZPA 4X5WB 4ZOCA 1JZ3A 2PCFB 4UQ3A 5AAPA 5C9KA 1J9TA 1X5JA 3I2CH 2ADYA 3EYPA 5EGRA 3VFMA 1TE6A 2CW6A 3L1EA 3PWUA 2DUZA 3LGGA 1UJ3A 2GQHA 3OJMB 5LBGA 2QXWA 3RCNA 4ZTXA 2RTTA 1OB1A 4ZBJA 5DVOA 4NSBA 4GZEA 2OMXB 2WINA 2YL6A 1R7AA 4HH8A 5ESVA 3EG9A 4QYAA 3R6IA 3WBXA 2EDBA 3BFWA 3IFNH 1KRBC 3O6MH 5KVGL 3TLRA 3VQ1C 3CZ8A 4LS0A 3WE1A 4MLRA 3APYA 1DVTA 4GAYA 4FX8A 4HUUA 4XNAA 1SFTA 1WYJA 2D1ZA 1HHKA 5GJSH 1WWAX 4FHAA 4GISA 3TYDA 1WBYA 3ID7A 1N0LB 3RUGE 1O7DE 4Y1AD 4OLUH 4B9GA 2G60L 1V3MA 5HI3D 3URAA 1NKOA 2KZ1B 1D8CA 1I8JA 2FVMA 1YEDB 5E4EC 5HJYA 5ABFA 2GOUA 4X6BB 4PRID 1N59B 1RZGB 2VAAA 4JY4A 4DW2L 2WMHA 1OAQL 1AI1L 1OB1B 5HI4C 4RDQF 2VE6B 1XF4B 1MI5E 1BZ7B 1QO2A 4QOKA 4HISA 5AAWA 2QPXA 4YCPA 2PD5A 2OJZH 2BP8B 1O5RA 1FJ1B 4RH4A 4IG2A 3EDJA 2Q8XA 1FZMB 2O4QA 3SO5A 1NPNA 4Y4KC 1XPYA 3IGAB 3FO2B 1ZLVH 1TZ9A 2H32H 1RJRA 4KFMA 3F00A 3VWJA 2DQWA 1I3RA 1TREA 3IRSA 4ALAL 3QMTA 1HHJB 4TU1A 4DTGL 5I66B 2NUTB 4AXWA 1KCWA 2APBA 4TL5A 1KXTB 4MCZB 3MLSH 4G1KA 3MRFA 2BWGA 4RAHA 2QQQA 3RVUC 2F54E 3DHFA 3MMTA 4D9LH 1XSJA 3N6HA 3Q67A 1I3VA 2EKGA 3MZ2A 4FE9A 1ADQH 1JPIA 3MV7A 1OHZA 1IAIM 2KMWA 2VT0A 3H9SE 3KWTA 4F5CA 1MUMA 2VOMA 3MTWA 4G9DB 3QY6A 1AGCA 1MFEL 5DCCA 4OLZH 4Z78B 4I5RA 3UNTA 5KVEH 4OFDA 1N18A 1QFUH 2BZ7A 3T3PB 4HTBA 1WQVT 2PDBA 4PRPB 2OZ4A 3STLA 4OCNC 3MDWA 5CCJA 2D20A 5CJXC 4NAJA 1TT6A 2AK1L 1AQHA 2BSRB 3L3IA 4EWND 4GEJA 3HW7A 4ONGH 3STCA 4AQ8C 4JFQA 4NFBA 1C91A 4L4PA 4I3RL 1X4XA 1A6AB 4NOFA 3VM7A 3UXDA 2X6UA 4Y0GA 2FPVA 3ZJ7A 4G1EA 1RV6X 3HQ1A 2K0RA 3FK3A 1GY2A 3MRKB 3LIZH 5B1CA 4MWAB 3HR6A 3AI0A 2GT9B 1NIEA 5HNRA 2QSQA 4PRBA 4UTHA 4M3PA 2GC7C 1IMHC 5EPMB 5L4IA 3B83A 1MQ8A 2R56H 5CEXA 5INCA 4Z3FA 5EF2A 5D04C 1JDCA 1S2AA 1WAEA 2FWOA 4JKMA 3T0ED 3VXOB 1JDFA 3VXTB 5DYOA 1J8HA 2JKLA 2EH8H 1A80A 4BI7A 4XN7A 2PTYA 4F1ZA 5LIXX 2DM7A 2XIBA 4B5SA 1E1CB 4JQ4A 3LRMA 3O6LH 2AXGA 1JWUA 5DD3H 3SN4A 5BS0E 4GSDH 1YUHB 1P6FA 4MA8H 2J71A 4KKPA 3WIHH 3UTSD 4K8RC 1FC1A 4OIBA 4TVUA 2YUZA 3FQ1A 3O9WB 4YE4H 4NN7B 3IU4L 1V77A 2ADGA 3F7YB 1EGVA 1OK4A 1YPFA 1BQLH 1XRSA 1AG6A 3CWOX 2VKWA 3BQUC 4FG6D 5CZXC 3FEQA 3RDKA 4NO5B 3FS9A 5BRZB 4A4AA 3NR0A 4Q6JA 4P46A 1U6AH 3ARDC 1FY6A 3VTAA 4DK6A 2CHRA 3FKKA 1P7QD 4MBOA 3IJYB 3WO4B 2P80A 4LYRA 3NWRA 3HB3C 4Y4FB 1G6RH 3BPOC 1LNUB 1UWEH 3G6MA 2YGQA 3N14A 3QR2A 4HUVA 1RSFA 3HI1A 3TA3D 5CS7A 4HPOL 1TQVA 3ZTNH 1S2TA 2C16A 4G9PA 1AHKA 4CAGA 1A0DA 4KX7A 2WNZA 4E8CA 5EBWB 4QNWA 1WBHA 4I5UA 3MROA 1HIML 1GHFH 2RCSL 3S3JA 1YEHH 1Q6CA 1XIDA 3TA3B 4QLLA 5J04A 5FFLA 1I75A 1RJPA 2VC9A 4NAFA 1VEPA 3C6SB 1P4IL 3EOAB 3IIVA 5AN7A 2ZKMX 5DUPL 2OXGA 1OW0C 2ZX9A 3HFML 3GSNB 3S83A 2I25N 2Y6ZA 3B6SA 2ZYSA 3O4LB 4FQPA 3HZMA 4GPVA 3MRNA 4ZFZA 1PDYA 4IRSA 2A3CA 4M61B 3KBEA 5GJMA 1SLXA 1L2UA 4KPHL 1BMZA 1U8LA 4ZI8A 1GYUA 3PTMA 3BMXA 2XA8H 3PZUA 5D72H 3AACA 1JNEA 2D3NA 3RDJA 3U2EA 1UJPA 3M0KA 1AP2A 2BVYA 1JS4A 2YGVA 1W8EA 4K8RL 1UPMB 3GDMA 3TSDA 1CXKA 3L3OA 5AHMA 2AL2A 4CCZA 1P5UA 4KFPA 4CGUB 1ADQA 3B9KC 3FUNA 3PREA 2HVBA 1V6WA 2H8XA 3NQDA 1K9TA 1MO0A 4FG0A 4FL4B 2ZBTA 2XVGA 3N29A 3ZKNC 4XHJC 4G82A 2WWNA 4LHUA 5CGTA 4FP8L 4YN5A 3RPKA 1S5VA 4PBXA 4LU0A 2R24A 3KPLA 4R7XA 4E0RB 1TVHB 1AL8A 3CNYA 3GFXA 3FU9A 3DKJA 1U8IA 3ARED 4EDWH 4MLSA 5DRIA 3P67A 3GG0A 5FEPA 5DMLA 3D3VA 4AY1A 4C5ZA 2AQ3A 5CBAB 4EEEA 4MWAD 4O28A 5CC7A 1U2HA 1V6VA 2XYCA 4AV0A 1NVMA 1FPTL 1VADA 4ABUA 4Z2JA 3CLFL 4JHAL 2VDIA 1T21B 2BNQA 1YY8B 1A0QH 3X14B 5I66A 1UVQA 2RA1A 3F85A 3HHRB 1W54A 3HMJG 4GYPA 1MFDH 2IAMA 4C56A 3OZPA 3NAVA 4O4VA 1U8QA 2ZJSH 2A83B 2LU3A 2NY5H 2WK2A 2X4SB 2XN9B 3ILDA 4JM2C 4S0TD 1HKJA 4ES4A 1ZD6A 1FG2A 3JV6A 4HAGA 4IIQA 1HK6A 3R4RA 3QOKA 4PUDA 4N1HB 1WT5A 4O0QA 4R7JA 3QH3A 4UTBH 2IPGA 3BV7A 1TG8A 1R3YA 2J8TA 2WYSA 1NP0A 4LCIL 3EX3A 3EYVA 2A79A 3TW7A 5DVKA 5E6ID 1AGBA 3V5KA 3O6DA 3EOSA 1A7RH 3QSRA 1NCNA 3INPA 3NNTA 4L56A 2H3DA 4LF3A 2VXQL 1LP9E 1LP6A 4L9LB 3IGHX 4GVIA 1T03L 1OSPL 1RZJL 4K23H 4UTAL 4JCMA 3R4DA 4MA7L 5DZOA 4N2FA 1VFTA 3GVRA 1J1XL 3W74A 4TUOA 4U1KB 3D9AL 1GMEA 4H13C 3UZQB 5LBSL 4DGYH 2HRWA 3LSCA 3ASNB 1MYRA 1ADDA 2DV0A 4MYPA 4HWBL 2J1ZA 4LFYA 4OOZA 1VEOA 4OVXA 4N2OA 1MCRA 1HHHA 1KNOA 5GNXA 3FDKA 3W0WE 2V3DA 4MCNA 5E6RB 1U58A 2Y0SA 5H8DA 3GSXA 1FDYA 2HWGA 3USBA 4MS8C 4AVKA 3SB3A 2HJLA 1ODZA 2EIKB 4BKNA 1LDPH 3MGAA 4JFOB 3HGOA 1YECL 1D9KC 1P84J 2H6OA 1GTFA 3SKMA 5JO5A 4X6CB 3FC8A 1PAMA 4D6HA 5IVXB 3NL2A 5AZUA 5LNRA 2DKUA 4JPVH 4LSRL 2O9OA 3NDZE 1N12A 3M5VA 2AI0H 3SGKC 1Q7ZA 3MUCA 5TNVA 3GBDA 4PJFF 4IK6A 2J7EA 3M5XA 1FWXA 1KB5A 3HF3A 2L7EA 3AMLA 3B5TA 5JUEL 1GGOA 3V4UH 4IP5A 4E5XA 3V9CA 1IZKA 1E40A 2DOCA 2WXJA 4G8GB 3F6IA 3C5SB 5FM5O 2WZPD 1QSED 4QG8A 4P2RB 3POHA 4TNWK 1EGJH 3C60C 4L3AA 1XZWA 2J88L 3T8VA 2B7OA 3BQUB 3WUBA 5FAGA 3Q01A 4OHQA 3BYTA 4N2KA 1UZ6E 5IT2L 4YWSA 1KBBA 1MCFA 2JQAA 2CRIA 3WUZA 3O9WC 2YN3A 5D4YA 2PU1A 1IRAY 4WK4B 4ZMWA 5F7KC 2CUMA 4N3TA 3ELAT 2WZ5A 4KKRA 1N8IA 3CLMA 3HJZA 3FAXA 3BKML 3H7UA 5D1XC 3U36A 4XO7A 3IDJB 3ML8A 4LSPL 3RKDD 1VIWA 3WEAA 4ZMLA 4NYLA 1C9WA 2WMJA 1R4XA 4YDVB 1IT9L 4QT5B 2XQYK 3VFVA 4CVUA 4M43L 1W1IE 4PU2A 3AG3B 1NL0L 1NEZB 3QHZH 4NZDA 4V28A 1IBHA 4GG8B 4X5XB 3A6CH 1NGZB 4XNXH 4BA0A 1I85A 3G8EA 3CHXA 3ZKXC 5I15H 5I2IB 3BGAA 5DTFA 3TBTB 3N2TA 3QJVB 2E7FA 5I1DB 4MAYB 2PYEA 3DOHA 1FKXA 1ML0A 2XA3A 3VZXA 3R1GL 2I07A 1KB5B 4XCFH 5FYLE 2WV8A 3CBWA 4FQXD 3OMNB 3K6SB 1JCYA 2HNEA 3FJNA 2VDOH 5EY5A 5ACLA 2WM1A 2LLNA 1ZBKA 3ARGA 3FOMA 3PHOA 1IT7A 4NZCA 2CLZB 3EFDL 4BWLC 4RNHA 3VFMB 12E8H 4ZFOB 1JI2A 1ZXQA 2XFYA 2ZKHH 4PJCE 3C2AL 1BVNP 2X1IA 1R9XA 2Y72A 2WW8A 4UTBA 5IIEB 3OBEA 3QC6X 4QKXB 4UQAA 2ZNWA 3ZIYA 1KB9J 2PCPA 1JGUL 5CN1A 3NSJA 3PUDA 4DN4H 1CICB 1M42A 1XF3A 1OZMA 3HS8A 5DHMC 4HGWA 4XZUA 4OOUA 5TAOA 2OMWA 4DAFA 5JDSB 1TETH 4CQAA 1VCFA 5M03A 1OOAA 1SM3L 2CHNA 4JHUA 3EOBA 4NP4H 4QNEA 3BLLA 3IVUA 2AXFB 3BDYH 3UZEC 2PUZA 2NSQA 4M03A 4XNMB 2BS8A 1IXQA 1G69A 1IZCA 1KJ2H 1T66C 2YQ2A 3ARQA 3UYPB 4JZJB 3QVQA 1XR9B 2OJ1A 2VR5A 4XAWH 2G4FA 1EANA 1LO0L 3FW6A 1E0OB 4OD2A 3EWUA 3M41A 3FRPA 4JRYA 1PB0A 5I3DA 5LB1A 4LHUB 1TYRA 2BCKA 3K80A 4H2AA 4KVNH 2ZUNA 3U4EB 1S7TA 4GKTA 4J35A 5ABEA 5CEWA 4WIQA 5KSBF 3WJYA 2XPGB 1T1WB 4Z76A 2C1IA 2OR9L 3ALXA 5FSEC 5XINA 4IOSA 2EXWC 3LEXA 4B5ZA 3QV8A 4XZHA 1XYAA 4ATLA 1Q94A 4QI3A 4CVXA 3E0WA 1S6NA 1J5OL 4A3RA 2ID5A 4I18B 1B0GB 3ESPA 2K7QA 1R3LA 3TZNA 5JVLA 5E8OA 4CVWA 3RVTD 5C1MB 1J0YA 3RY6C 3DHDA 5KG9B 1UWXH 3MX0A 3R19A 4Y5XC 3VJ6A 3AIWA 3OXRB 4G7EA 1SNRA 3V0WH 4F8TA 2ATAA 2R0KL 3N1GC 2I9TA 1HQRA 2D0GA 3N3MA 4S39A 1TZGL 3EB4A 1HJVA 3U2SA 3BW9A 4DPCX 2V2XA 1O6TA 1QBMH 1UJ3C 1WS8A 4JO3L 4QRTA 1O6IA 3D0VB 3NJVA 1ZBWA 1IBGL 3HGSA 3VFOB 4XBGB 4DYKA 3GTVA 5I1CH 3IMBA 3VXRD 1BEUA 4XC3H 1V03A 3F83A 3NZ8B 3EHBC 1V8EA 4WHCA 4UQIM 1PF3A 3EYFA 1NDZA 1JPGB 3P73A 5EO9B 3L3HA 1OCRB 3VSQA 4M7ZB 5D4IA 4OLWL 4PL2A 4D6FA 4ZZ9A 5DJZA 1T5WA 5A6IA 4BZ2L 3WL9A 2Z6IA 2YPLB 1A8JH 5A3IC 5E1AA 1US3A 4DCQB 1EXUB 4HWBA 1NJ9A 5TGBA 3I7RA 4NZUH 1XFCA 2ZG1A 2GK0A 3SBWC 1Q0YL 2QL1A 4Q89A 2HVMA 4FAMA 1AOHA 1GZHA 4G9FB 4L23A 3MGOA 3WEMA 5JLZB 1UATA 4A2HA 1QXLA 1XHGA 5D9OA 3MUIA 3FJTA 4QCIA 3VFUB 1D2KA 2VCOA 3HI6L 1E4LA 1R3SA 2GVGA 4M56A 2AC0A 4BHUI 2Z34A 2NPLX 3T0EA 4KCWA 4RDWA 4RGNB 3KUMA 3VFSB 1F58H 5F7AA 4CW1B 1XKYA 2Z91B 3Q5OA 4AYID 4CVXB 4AG0A 1AK5A 3IDGB 1ORQA 2EBNA 2WJ7A 5SWZA 5C7VA 3PP4L 1F02I 3EJPA 1Z3GH 3K1DA 4NNXA 3UTQA 1ZXKA 3HE7B 1OIFA 4MNGE 4PJ7A 4AJYV 1EERB 2VM8A 3CAKA 4KJPC 3BN9D 4LF2A 1S7TB 2IBGA 3HC3L 5FYJU 3OKYA 5IJBC 5AVWB 1QWHA 3PRZA 1S5TA 3BUPA 4OZGB 3V5FA 4JO2L 3N41B 1JAEA 5HDWA 3D2UA 4ZFQA 4LS1A 2QVHA 1ONEA 4RE0A 1VDGA 1AXTH 4V33A 2B14A 2GKIA 5L7XH 1KM3A 4QRRB 4Z3JA 1W3NA 2YS4A 4A3HA 5I17A 3CUJA 3MUHL 5FK9A 2W91A 1HEZA 1PD6A 2Q0ZX 3VZZA 5DZAA 2DS4A 4OFKA 5GZOC 1FNAA 4TTDD 4UDUB 4N8PA 5A2LH 5K39B 4LBEA 3W56A 3WIFA 1KCSH 5I71C 1O7AA 4WU7B 2VHLA 4WKHA 4HPYH 3T2NH 1H2JA 3GMLB 3IRDA 1U8HB 1ZGDA 2F6AA 3L2MA 5D96C 5F21B 5F9DC 4MNJA 3WJMA 1LGVA 4HFUH 1GWJA 3N9KA 3CLWA 4NB7A 4N4QA 5IEKA 4NNBA 1CB4A 1R1CA 3ULVD 4MWFB 1THAA 4H83A 3WK2A 2DI9A 5EHFA 3WU1A 1H3XA 3L9YA 4PG9B 2CBQA 3LN4A 3PWLA 4ZFOA 4GLEA 1CDIA 2HVOA 4OU1A 5DD0H 3WH5A 3HAEG 2VDLB 4PUBL 1OX4A 4PZVA 3MCYA 5ICUA 3VIMA 4Y16C 1T4KA 1HJQA 4F7TA 3KPSD 2GVLA 1AANA 2ITDB 4HIEB 1QZ1A 5DTFB 3L66A 4IIDA 1YNLH 4OI8A 1BP3B 4ZRGA 4X2RA 7ODCA 3VGBA 4F7CB 3NQGA 2B39A 4GIAA 4IPJA 2CKBH 2FUQA 1C1EL 1UD2A 1NAKL 2FZMA 3UPCA 2VLME 3F01A 1KCUH 2OMBA 3Q7JA 4HIJB 5KZCB 1DIOA 1RCXB 1JHKL 5J11B 2UVFA 4ZMYA 4QHPA 3F8UB 1XYFA 5J12B 4YBLC 3LD5A 3PBWA 4ZB0A 4U1LA 3TXVA 1E5BA 3A6BL 2YA2A 6CGTA 4ZNCD 2OTPA 2HTKC 1RPQA 4BK4A 3BJSA 4DAGL 3BAXA 3ZVVA 4LAQH 2D7QA 5HNTA 4FQQA 5E8EA 2YBRA 3FN9A 4HLZG 1XX1A 2CR6A 1JTPA 5TPWL 1KXQA 1O9VA 2PP8A 4DJFD 3TO4C 1LO5B 2BSSA 3BYYA 4YHZL 2R39A 4FFTA 4NM4H 1Q66A 4GEIA 3W11D 3CHFA 1H7RA 2B9BA 2BNUB 1A9VA 4GFXA 3CIQA 2ITFA 3TVMA 2IBBA 3O6KH 5F1KC 4DK3A 4Z2LA 2ADFL 4JVUA 4ZQKA 3UU0A 3T0TA 4E2OA 1MG2C 3MJ9H 4NYYA 1KCVL 4F93B 5BNKA 1SJVA 1QLEL 4OZIA 4UYPA 4NKDB 3US9A 3PNZA 4KO9A 1E3ZA 4A29A 2NW2A 4HUNB 1ZA6B 1JR1A 4CMMA 4CCCA 2HRGA 1LO3L 5ISZA 2DVXA 5IB3A 1XF2A 2OO6A 2IANA 4S3JA 4X4YA 1ZLVK 2G60H 4LDEB 1M6UA 1A6VH 3CFEB 3HAEH 3VGAB 4CGTA 3GSOB 2W0FB 3MYOA 2V17L 5HDBB 1QK0A 1DEEA 1TPEA 3VFTB 2VOTA 3FNDA 3GSXB 3QZLA 1E9QA 4RISL 2Z0IA 3C2SA 4P5MB 3LCXA 2V0AA 3QQ9D 4LPWA 4CCDA 2AZUA 3EGSB 4UB0L 4CSZA 4MJHA 5D70H 1N6QL 3MUGA 5AALA 1L4IA 3RUGA 3VG9C 5I79A 3IGUA 5C2UB 5K4XA 1I1CA 5D8JH 3RPIB 1FNGB 4G1MA 2F1AA 3DTUB 1H3PH 2HKFL 5D7JA 4BUHA 4POYA 2WO5A 3AZRA 2EDHA 2R0WH 4NGHH 5AW5B 4ISVA 2B8OT 5I8KH 3DURB 1XJBA 4US5D 4TLSA 1WB0A 1BM7A 2AFNA 4KRPB 2GITB 3KS5A 2Q09A 4N5UA 1NOAA 5DGQA 3SPJA 5L4MA 5J3HD 2YZRA 4J3ZA 4DI8A 3FBQA 4HKJB 3V35A 4CMHC 4U7SA 1ET8A 5DRZA 4ODWB 1E5CA 2GHZA 5BU6A 5ICXB 3OC8A 3TV8A 3SGJA 3GM0A 4XGZB 1F3EA 4LLWB 2X0VA 1EDQA 3IJHB 5EOCH 3SYOA 4Z3IA 2JKRM 3SZ6A 3BLFA 5J3HC 3LS4H 4WSJA 2PFHA 1K6AA 2YAMA 3ECBA 3AWNA 2PPAA 5CFHA 3PE9A 5E09A 2IAMC 3QDMB 4WUUE 5E6IB 4M6PA 3TNOA 3PAVA 4JIQA 3MRGA 4KRNA 4ZSUA 1O5PA 3ECVA 5JIIA 2WQWA 4I7VA 4Y9GA 5KSVA 2F53A 3C2OA 4XZBA 3QOMA 2O0TA 1ZHBA 5E2VH 4ZGYA 4AD0A 2ZZ5A 1BD2B 1W91A 1ZEAL 5A16B 5DDHB 3ZBMA 3U6XA 4JY6A 1PG7H 3LGDA 3TMLA 1T0NA 4M7KH 4FXRA 5D5MB 2R2HB 5HHPB 2NLIA 3WLKX 3OKMA 1DUYA 3QQ9C 4F7KA 1ZSXA 3MAWA 3CZEA 3PG2A 2WVVB 1C5CL 5FYLH 4ZDHA 3V5HA 5F8QC 3WN6A 4AZUA 1IT8A 4LLWA 1CEOA 1EJ7L 5D32A 2HH0H 4FFWD 2CLOA 2XH7A 3W76A 2A7PA 5AHNA 2Y7QB 1MWAH 2PDKA 4PN6A 4DZBA 2N1KA 2HTMA 3WXVL 3VYPA 1RZFH 2FK9A 3NCWA 3EFFA 4XCCH 2XYLA 2AZAA 4A8LA 4OGYH 5D7KD 5CLWA 4GX9A 2FWSA 5FFGA 2Y63A 5GXBB 5KVFH 3UWQA 2UX6A 1CLZL 4UDUA 3RU8X 5C09E 1IX2A 1OWQA 4K73A 1X9QA 1C8XA 4XK2A 1EC7A 5F2MA 2I5YH 3QORB 2K8MA 4MKMA 3RZWA 2CLRB 3TBVB 3QUML 3OR6B 3S36L 4TYUA 2ZXEB 3I6SA 3QG6A 2IF7A 1MRFH 3AS0A 5AD0B 1Q6QA 4DJFC 5D7HA 4N6RA 4N90D 5JHAA 3W5NA 3QUMA 2X87A 1G6RL 2YMXL 1MHHA 1XAUA 2ORBH 3I3EA 3MACH 1HG3A 3M0ZA 4O1CA 3VNKA 1A3QA 4C60A 3MUY1 1ZP4A 1OTSD 2IALB 5D8WA 5T9BG 5E9XA 4HJ1A 4RMWA 3VNMA 2R0LL 4S1QH 2HT4D 2J6XA 2X4PA 1GHFL 2RCSH 3R0KA 3AJXA 3QRLA 4K3EH 4Q74A 2O72A 3W38A 3K8KA 1QNQA 2PR4L 4LOUD 1QA9A 1P4IH 4YTTA 2CG9X 4PRHD 2E9GA 3NFNA 4DN1A 4W8BA 2NY3D 4TOYH 3QI9D 5C0DB 3JWNE 4JZOB 1AFSA 3ZW3A 3T04D 1WAAE 1ZHBB 1EEUA 3H2CA 3W2NA 1N64L 4P46B 2JKIS 1UXLA 2H6RA 4Y1AE 4XP4L 4XWGH 3BZEA 3NABH 3RWEA 2VC7A 2QPUA 3GSVA 2Y22A 1MRAA 2NSOA 3O15A 4G5DA 3MNVA 1Q72L 4YJZL 4IGMA 4B96A 3QAZB 4K8RH 2XTJB 1OP4A 1TTUA 3EKLA 3GR4A 3AUWB 5CC6A 3BO9A 4Z76B 43CAB 4JX6A 5AW6B 2C3XA 4FOMA 2V63A 2WCSA 2GSIA 3IXAB 1L7TL 5EEXA 4PJBF 5B8CB 2NNCA 5LNUA 1O6SB 2GJ6D 3GYCA 2VZTA 1KB3A 3SYPA 1G84A 4KK8D 4X7TB 1ZGLA 4W86A 5HNNA 4HJEA 1U8OB 2NY4C 3HG0A 3CIXA 2GDVA 2FO8A 1F4HA 3DX6B 4LLMB 5G4MA 4FERA 3RFZA 1S78C 4NZ8A 4F7EB 2Z9TA 3FQRB 1MHPL 5I74B 1DQWA 1L9OA 3CK0L 4HWNA 4AQZA 5K3VA 1KYOJ 1NLBL 5T1KA 4EZKA 1QWUA 1FPTH 4K3GA 5LXXA 3NDOA 4M5YL 2D2GA 3QDJA 3VD4A 3IN2A 4R3SA 5H94B 3TH3T 3SZ8A 3K6IA 5E9DD 1BW8A 2YKKA 3UIYA 2CJSA 2VC2L 2NY5L 1W1VA 4H9MA 5E99H 1XB6A 4KKZA 1WIOA 2OQJA 3ITYA 1FNFA 4YDIL 5D02A 1G7IB 1HSAB 1O12A 4ZYKA 4KW2A 3PWVA 4XVUD 3CX5K 1DPMA 4PRWA 1J7VR 1HI6A 3MJ8A 3L9CA 1GQNA 4ANWA 1E8ZA 1VPOL 3KGRA 3KPQB 3VGGA 3UGUA 4F7PA 1XFBA 4ENLA 3GWQA 1NM9A 4WU7A 1M71B 5L8LB 4APQA 3W70A 3KDOA 1OTTD 1WWCA 3HGJA 3LSBA 3Q9PA 1YMME 4IRJC 3WS6A 2ZCHH 4WJG3 4OZIF 3FA5A 2FO1A 4YVPA 3DDFA 3FF8A 5ID0B 1SW0A 3EYUL 1AGDA 5CBJA 3ULVL 3RDTC 3VE9A 1U92A 4GI8A 1ZA3B 2AF2A 1CGUA 3CCHB 2BXZA 4U6VL 4JQXA 2PCQA 3KOWA 3PULA 1J1XH 2J1KA 4LAOA 3C5JA 3RLUA 2AJUL 4GE8A 4DH2A 2MOQA 4U0RC 5IW3A 2VZ3A 5ADPH 3UF9A 3KLHD 1RUSA 1MPAH 1S5WA 2WCPA 4KQ4L 4IM4A 3RHWF 1R24A 1KB9K 2V6HA 4PGDA 5MENE 1TV5A 3WFLA 3C5ZC 4OVVA 4ZO6A 1R3JB 5FUOH 4OT1L 4POCA 1R3IH 4HJGA 1QATA 3P2BA 3LI0A 3OAZK 3UCDA 4K3HA 2Y8KA 1LDPL 2A9ML 2WLLB 5DK3A 3MRQA 5C0FB 1T7LA 2FDMA 4XMPL 1XEUA 2WBJA 3QPQD 3JS3A 4PYGA 5GGTL 5JR1L 4U31A 1DORA 1E51A 4L4VE 1SJHA 4EF3A 3ABRA 3IXTB 2AKZA 5XIAA 2R1YA 3DHMA 4A68A 1GOQA 1HC1A 2FATL 2VLRA 2CA4A 2DPEA 1CURA 3HZKA 1XTLA 4C6KA 1SW3A 1V0LA 1RP8A 4HIEA 3VB9A 2COQA 4FLHA 5DQDH 1DJZA 4IYKA 3HHMA 1VBUA 4KROD 2HJPA 1DYZA 5D2VA 3ME0B 4RGND 4XWOC 1DJXA 4XNYL 3TH2T 1QRND 4RWHA 5I0XA 2NY7L 2QULA 3NQMA 4YVVA 1CD9B 4NX0A 4BWLA 5F2GA 2C1PA 3EO1A 1U8PB 4YMPA 3K6OA 1FWRA 4D6IA 3T78A 3CC5A 3A23A 1V3HA 1WA1X 1KCRH 3IEAA 4LVAA 3W7HA 1Q1JL 1CVRA 3WDPP 4WQ6A 1TZHB 2XJLA 3RB7A 1V54B 3MO4A 2CR3A 4BBWA 1RJYA 4L48A 2PXYD 4N0UB 2MQ3A 4QHLA 3TXZA 1YNKH 2I9TB 4GX8A 4RFOL 2ONEA 4KH9A 3LD8B 3K6FA 4LTSA 9XIMA 1IAIH 3PFMA 3GIYA 4AX6A 1BD0A 3LHVA 1GGCL 4UOJA 2AEOA 3FCTA 4M43H 1SPQA 1DWAM 1C7SA 1X96A 2PABA 3ARSA 4IS6B 4ANXA 1LO5A 3E1F1 4I1PA 4JIIX 3O3EB 5C09B 4JQAA 4ZFGH 5FPIA 4ZQMA 2VGIA 3EIFA 4Z7QF 3TPUA 3DRTA 4HT3A 3BVTA 1M03A 3SE9L 4WI2A 3LRKA 3FCSA 4OKDA 4P2OC 5C0AA 5T3ZH 4RGMC 2FTYA 1NC4A 2F61A 3QEQE 3ARZA 1W3KA 3NAAL 3GFYA 5TJWK 1XLDA 4Y2LA 5AKSA 4UU9A 3DJRA 5LNEA 2Q3ZA 3C8KB 4NN6B 3GMQB 3IDIB 1ADSA 5IK3B 2FUTA 4PREB 3C2AH 3W2DH 3CVHB 3SIMA 5IBXA 4ZX5A 1Y8BA 2XC8A 3W3BA 2YXGA 5K1NA 5EUOF 2VDQB 3FCTB 3QUZB 4ZFOL 3CQQA 4P4RB 3FQ2A 4AHPA 3JYCA 3TV3H 3X14A 4DN4L 5I6LA 1LEKB 3EJJX 3OBKA 2OYMA 2DZSA 1MCSA 1RMFL 2WIIB 5D7IF 5HGDA 3KW8A 1SFDA 1NPUA 4KXZH 4CSSA 5HYQA 1TETL 4LSSH 1XW8A 6XIMA 2PNDA 2GL5A 1N3NA 1H0GA 2Y6SD 2L04A 4TUKH 5CWSA 4K36A 3WQ8A 4NP4L 5HJ3A 4H8HA 3MCLL 3BDYL 3T05A 5EIIA 3L48A 3SUTA 5FGBA 2WXDM 3PAZA 4O4WA 1S46A 1NFDE 3BH9A 3DO3A 3UTSE 3VIIA 3EH5B 4XAWL 3O9WD 5KBLA 1PX4A 5BS0D 5B8CC 2VJ0A 1OP3H 4AV5A 2X1UA 4GCAA 4DZHA 1WEJL 3TN0B 1A6PA 2H32A 1WF5A 1HAUA 3EYOB 2FVKA 6REQB 2IPKB 2WWKO 4KXCA 4ELMA 2GSHA 4YFDB 1AVAA 4PI2A 3QNYA 2EG7A 4H8VA 4ZUWA 3BICA 2WSDA 5A2CA 4IEFB 2PBOA 5KVDE 5GS3A 3G8RA 3MW7A 1FVEB 1YEGL 2V5MA 4GQBA 1YBQB 2PC8A 3K6DA 4LE8A 2HJKB 2CDGB 3UPRB 4WHBA 3BSZH 4MNQB 1Q0XH 4L4TB 5DEFA 4WI9A 5FUCE 3DFQA 2BHFA 4NG3A 5EEWA 4XD5A 3M16A 4MNGB 1MFVA 4XVTL 2FR4A 3B37A 4ENEC 4Z7QB 3DO7A 4AF0A 4FMKA 2E7LA 4JO3H 3GVWA 4IMGA 3WD2A 7FABH 1UR8A 1BYCA 1F3WA 1IBGH 4V2XA 2J1XA 2FT8A 4OZGE 1L2QA 4LSBA 1X9UA 4M93C 3U4EA 3R7MA 2GSGB 2DI8A 1ZAIA 3KLKA 4KO6A 1DBAL 3GRWA 3NN8B 4ODVH 4BK9A 1KIPA 2NZIA 3HQOA 4H26B 4MS8D 4NBYB 4FZ8L 4E8GA 2Z7KA 4MMZA 4QJ4B 2H1LM 4TSAL 3GNDA 3FZUC 3R0UA 4GMTL 3PM6A 5I0DA 2AXFA 4GXFA 1XLGA 3TC9A 4G8GA 4BZ2H 5BJTB 1YBQA 2KL6A 1JSYA 2AQOA 2GQ3A 4KCVA 5LIKX 3F7VA 3IS0X 1MH5B 4NZUL 3A22A 1AJ2A 1PLCA 3LLDA 3SDCA 2QPEB 5BRZA 1B4RA 2HNHA 2HN7A 4ES9A 1V6XA 4N2BA 4GH7B 2VQ1A 2Q10A 1MJ7L 3KH3A 3H3KA 4N9EA 2OR2A 1HI6B 2H32B 3I3DA 4G11A 3LNFA 1B3ZA 6REQA 5FHBL 4QAMB 5FYJL 3S36X 5EZIL 3WQFA 2ZOKB 5T1MA 4JM2A 2TMDA 3V0SA 1OC5A 4EOWH 5DJ8A 5T5NF 2DWDA 1P53A 3FTYA 3NZ8A 2PZ0A 1ZHLA 5CJ5A 4PJCA 1XIEA 4Q8PA 3GJFA 2B7PA 4XX6A 5HHNA 3SKNA 1BYOA 2ZOUA 5D7JC 4WGXA 1B0IA 3ZLQC 1MFUA 2ZRZA 3G5XA 4RE2A 2R29L 5GSVA 5HVWA 4Z7UE 3D85A 3V95A 4MDIB 5JYMA 4AZ6A 4QXVA 5CH9A 3HZKB 2OXHA 1P7KB 3NQFA 1YXYA 4JEJA 4JFFB 4YO0A 2DP3A 4LNYA 4N2IA 1LVEA 3SCUA 1UZDA 2A74A 1NGZA 2TSAA 1SJDA 2IUZA 2HMIC 1QW9A 1BZ8A 4B7LA 1RK6A 4KNUA 1KEGH 2VXNA 2ZA1A 1C5DB 4O10A 4YSPA 4OD3H 3LEYH 4V2BA 2P3ZA 2GSIB 3BKYH 3LRHA 3FNKA 3FT4B 3U36B 3PANA 2FTPA 2WUCH 3QZAA 2VP8A 5K9CA 1CK0H 2YK1L 4Z1PA 2VGFA 3WNJA 1RXLA 3N43F 2A9NH 4ODXA 1U1JA 4IUGA 3V4VB 4M3HA 1BJ1H 3O3UN 4XHJD 1F3XA 1D7FA 3L5WB 4H8PA 3STLB 3FCSB 4B5TA 3P11L 1KFAH 3U2JA 3VH8A 3WMSA 5HI5C 3PU7A 1VF8A 3MNVB 4HXBL 5C70A 3QZWG 1U8QB 3B2PA 4OZHB 3T0VA 1UKPA 4PY7A 3A4FA 4XMLL 3HC0B 1U8HA 3WJJA 4CMHB 1X38A 4CN6A 1OK6A 4JN7A 1L0PA 1R3RA 5FA3B 2WMIB 3TWCH 1F4WH 3K1GA 5EO1A 3VA8A 2VNCA 5TQ0H 1CR9L 3ARGC 2WKGA 4AE0A 3GZAA 3IFOB 3S2MA 1ZWIA 4FZEH 4PJ9C 1CECA 3BFOA 3RGHA 4PJ5D 3L3GB 2CBJA 1KW1A 4E0RA 2PCPB 2NYYC 1H5YA 1JULA 4GUFA 3HO8A 1V3IA 2IADB 3CV1A 2UWFA 3RJYA 1K72A 2ZOKA 1UGNA 2WKLA 4IM8A 1XVSA 5T1MB 5MI0C 2ATPB 1S7SB 1AC0A 5IVZA 5T5FH 1ZAHA 3N17A 1VRSA 5AUMB 4OGQC 2DQIH 4FTDA 4R5TA 1O5QA 4N7QA 3RWGB 2DQCL 2IGTA 1J87A 3QDJB 5AAMA 5FSDC 4A7GF 1FVCA 5IHBA 4CEXC 2DUAA 4WGVB 1C5DA 2NY2D 3GMPB 4LAQL 3ZZ1A 1SO5A 4ZSOA 4KO5A 3MPGA 2FO4B 3PZNA 3TQKA 2EILB 1XC6A 1A5FH 1FCQA 5DLML 2FLBT 3HRZA 3HB3D 4KQ3H 5TPWH 3OYXA 4TO8A 4HVXA 5E2TL 2XUCA 4L6OA 5CKGA 1NGWA 1Z5YD 3UZQA 5I8OL 4YHZH 1GC1L 5TDOB 2FECL 4P3CH 4HW6A 4M7JH 4NERA 3UBPC 4JQ1A 1NBYA 1V3LA 1V93A 4JZNB 4FDWA 3K2KA 3B04A 2Y1VA 1SUJA 1EXUA 3UNDA 1P4LB 3VE7A 5JBFA 4N2DA 4WFGD 4UILL 3C60A 4GKZA 5TK2A 3WENA 3MRQB 5C0FA 2HS6A 4HYWA 4K8RD 4NAFB 1IE4A 3ARRA 4NNYB 2VDRB 1NFDF 3BEWB 2WQAA 3LKQB 1CWVA 1DR9A 1WE5A 3SRHA 1NTDA 1A5MC 3RPMA 2ENSA 1F11B 3RF9A 3QUZD 2Y8UA 4PJ6A 2PCFA 4CA4A 4AJVA 1LO3H 1UB6A 3TIEA 4LPXA 3NRPA 5D7LB 1RHHB 3W0WB 3FJ6A 3ARYA 4UB9A 4XBEL 3WNLA 3D51A 4H40A 5D4JA 3D05A 1TYGA 1N3NB 3BTNA 2GIXA 2GTQA 5D7LD 2NT1A 4WWKA 2ISDA 5JZ7D 1RH9A 4S3CA 5F6HJ 5GRVL 3GG8A 3HR5B 1I8IA 5IESH 4U5KA 4UFIA 4R6UA 1F05A 3FU8A 5I1GL 1EL3A 3B7SA 1QI0A 5CM1A 5I5JA 4M3KB 1M7IB 1WT5C 5BJTA 4OZ4B 1HTIA 1WA3A 3KRUA 1UYWH 4FXLA 2WBJD 2ZNXA 3FVDA 4KJQC 1XF5A 3OPZH 3KWUA 5SWQB 3LKSB 5CILH 5CBAA 1CBGA 3GVQA 3WLQA 5D8JL 2V4LA 1EA9C 2YD5A 3BPCB 3TN0A 3NK4A 5CLZA 1FHVA 4KT2A 4LX4A 1VF5C 4M82A 4Y4FD 2DQEH 4BFAA 5BYWA 3GRWL 3MLWH 3H24A 3EOLA 4IMKC 4NKOB 3O05A 4UNKA 1I9IH 3KPLB 2G0KA 3O45B 1OIOA 3F62A 1KCKA 5BOJA 2O26U 6ENLA 2CLFA 4U1NB 3WYZA 4IU3A 5E9DB 4R88A 5HA7A 1JF1A 5G1YA 3Q8CA 5EU5B 3BUDA 1MEXL 2NYYD 3LH8A 2MUCA 2PLJA 3OA3A 2DJMA 4HS6B 4F9PA 3RX9A 4RIRB 4ISVB 3PF2A 4ZUSB 2WZPA 4B0MM 5M94B 4NZ1A 1NSJA 5KBDA 2BVPA 5KJ4A 3EXTA 4HNCA 1JPKA 2UBPC 2AJSL 1TENA 1XIIA 2D31A 2YGNA 3AABA 2AABL 2JE8A 1BBDL 3D48R 3FQNB 3I6KA 4R0LB 2JCCA 4JG5A 3QC5X 2DSKA 4PCTA 2QKFA 4L1WA 3LB6C 2ZOWA 3EGSA 4KVCH 3WNNA 1ZBVA 3RJQB 3S34H 4O8RA 4PCFA 4PMDA