4JFWA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2s,3s,4r,5s)-2-[n-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
total genus 162
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jfwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jfwA01
1OWQA 4HMCA 4IISA 2G3JA 1FHLA 2JIWA 1GW1A 3NCOA 2BVTA 3AS0A 3BGAA 1NOUA 3WF1A 2E0PA 1ESWA 1GQKA 4E8CA 1E71M 2W67A 1OINA 4Z2HA 4YPJA 1SR0A 1HJSA 1MVYA 1UWRA 1KTBA 1ITXA 2UY5A 4B9YA 2CYGA 2EPOA 3VD4A 2YKKA 4K68A 3EDFA 3VGBA 2YDQA 2WVTA 2OSXA 5GNXA 1RP8A 2WXDM 4HZ7A 1TQVA 2CXGA 2EO7A 4QLLA 4HA4A 3OA5A 3PZ9A 4H8UA 5HBFA 1CGVA 2VCBA 1PX3A 4MPKA 1JDCA 1V3HA 1VFOA 4FNQA 4DWSD 8CGTA 2GUYA 3WBAA 1QNPA 1I1WA 2XVNA 1GOQA 1QNOA 4PMXA 1XYFA 1X1NA 2VOTA 2D23A 3AIRA 4NZJA 2Y4SA 8A3HA 4UQCA 2GJXA 3GXDA 2VL4A 4OUEA 3HG4A 3SEPA 2V38A 2VQUA 2XM1A 3SCSA 3D5HA 1M53A 2O92A 2DT2A 2W91A 3T0DA 3RM8A 5A6AA 1EOKA 4OKDA 4D1IA 3MUAA 4BQ2A 2YDRA 2XN0A 2VQTA 2VVSA 1KGUA 4DO6A 2Q8XA 5I2UA 4FNUA 1D2KA 3LRLA 1BHGA 3O6AA 1K9EA 4HP5A 1E73M 4M81A 2OW6A 4GKLA 4A3HA 4W7UA 1JL8A 2WNWA 2AMGA 1QWNA 3WY2A 4EKJA 1W9BM 1DWAM 3N04A 5HOSA 4BQ3A 1LG2A 4DWSB 1OIMA 4H41A 2QPUA 1BGGA 3MSDA 4BS0A 3M7SA 4XV0A 6A3HA 1OGBA 1XH2A 1VFFA 4CVUA 1ZBVA 1GVIA 1VF8A 3D52A 2YBUA 1XGZA 4AZBA 1Q6DA 2DSVA 3GH5A 5A8NA 1RD6A 4AXNA 3BAKA 2OWXA 2IGTA 3CHCA 4PUDA 3VNYA 5IHRA 3EJUA 5I77A 2VX5A 2F1BA 2DT0A 1JGIA 5CXPA 5HXMA 1GONA 1UKQA 4N42A 2CBVA 4XZWA 1CENA 4HOWA 4HU8A 2WMJA 1TE1A 4DWSC 5BCAA 1G0CA 2Z1SA 3VIFA 2WAGA 3ZSTA 2BV9A 3PZGA 4S3KA 3S6TA 1CGTA 1C92A 1QNSA 1J11A 1MW3A 2WHLA 3BVVA 2J7GA 4TVDA 3AISA 5BXTA 1EDTA 2D0HA 2WVUA 4W5UA 1HJQA 2ESCA 1H49A 2ZUWA 3BLBA 1KXTA 3BAIA 3WH7A 2G3MA 2CERA 3PZIA 4AEFA 4W84A 3PZTA 4ATDA 5D8ZA 4CD6A 5D4YA 4YHGA 2XFYA 3WD3A 4CU6A 2J75A 2WVVA 2VTFA 4HTYA 3DHUA 3N1AA 2VZOA 3THCA 2VR4A 4J3WA 3RJYA 3CZ8A 4IPLA 5ABFB 4QAWA 2RGLA 4PMZA 4KRUA 4EAMA 5CJ5A 1GQIA 3D4ZA 1MYRA 1UA7A 4JFSA 4XX6A 3PBGA 3VD9A 3AMCA 3BLPX 3UERA 4E4PA 1ISWA 3AZRA 3QHMA 3AYRA 3TTYA 3WH9A 1JFHA 1MWOA 3SCQA 4AEEA 1W3LA 4DM1A 3I3BA 3UG5A 3POHA 1ZBCA 4UQDA 1KWKA 4JCMA 3ZO9A 3AIWA 2QLYA 5ECUA 3II1A 3AMKA 6CGTA 4UFLA 3LXAA 3K8LA 1JI2A 1LL4A 4WK9A 2ZICA 4UQBA 1KCKA 3ALGA 3NSXA 1ZS2A 2DH2A 3SURA 2J7EA 3G6MA 3WDJA 2ZWYA 1EQPA 4CU7A 3MO4A 3B8SA 4PN2A 2X05A 1MQRA 4JHZA 4P7QA 1ISXA 2WC7A 3AHVA 2BHUA 3CMGA 1MQPA 4XZBA 1JI1A 3ZOAA 3PZOA 3ZSSA 1R47A 2VUYA 5JBEA 1BF2A 3F4VA 2YL8A 5M5DA 1S46A 2JEPA 3DYMA 3DX1A 1AQHA 1L0PA 1W9UA 2GK1B 1ZU8A 2JE8A 2OWWA 1UKPA 1TFVA 4PMRA 5ABGA 2ZIDA 1J0HA 1GZJA 4MAZA 2NSXA 1OM0A 5KEZA 4QCEA 1QPKA 1WPCA 1B3XA 4NZCA 3CZEA 1HIZA 1Q4NX 5EMYA 5JUVA 4ATWA 3CV5A 3VU2A 4FMVA 3WH5A 2WK2A 2XFRA 1C3FA 4OJYA 4ZE4A 4OZOA 2VMFA 3W0KA 4UFJA 4AZGA 3WUGA 4F9DA 3GXTA 2EABA 4JCLA 2G4FA 2F1AA 2WCSA 4OIFA 1Y7VA 1UH3A 4GO9A 4B9ZA 1VFUA 1A47A 1VRXA 2VJXA 2Y8KA 3WEZA 4TVCA 2WKLA 4MB1A 5GQBA 3BVWA 1NP0A 1WAWA 1KB3A 2VRKA 1O7AA 3EMCA 3AS1A 5GNZA 2OYMA 4OBRA 4WJXA 1EHAA 2EJ1A 1B30A 3TTQA 2V3FA 1V3MA 2Z1KA 1HWWA 1FP9A 3CLWA 3LRMA 1UR1A 4DWSA 1UR2A 3OIHA 1TA3A 1R8LA 4P7NA 1X6LA 4H2CA 5HPCA 3WQ5A 1BAGA 4NX0A 1YQ2A 1SMDA 1VB9A 3SCUA 1QW8A 3U7BA 5A2BA 4UOJA 4CN4A 1BYCA 1LLOA 3JUGA 4D71A 7CGTA 3ZR6A 4AISA 1JNDA 1E4MM 4JZ5A 3F5LA 4MB3A 1FH8A 3FNDA 1PX4A 2D1ZA 1LJYA 3K8MA 2PWEA 1WB0A 1UKOA 3CZNA 4AMWA 4KGJA 1R34A 2FHBA 1TVNA 4H8HA 3K1DA 1WDQA 7A3HA 2BVDA 1R75A 2W62A 2W5FA 4D6JA 2PC8A 1KCLA 1B3ZA 3D3AA 2WPGA 3VSVA 2WSPA 1OT2A 3QGVA 2G41A 3PTMA 4ZFMA 3AHYA 3MMWA 1O7DC 2ZE0A 1LG1A 1XD0A 2WC3A 4E2OA 5HDRA 1Q6GA 1UD5A 1V6XA 2DSZA 1JZ6A 1HT6A 1DEDA 1J01A 5TD4A 1Q6CA 4CCEA 4UNIA 7TAAA 4AMCA 1W3KA 2E3ZA 4W89A 1C93A 1EO5A 3GH7A 5DT7A 1WZMA 4UQEA 2WMFA 2VI0A 1R33A 1WP6A 3GZAA 2F2HA 4PMDA 1J0JA 1QI4A 4U2YA 3EDKA 1UQYA 1VJZA 2CBUA 1DHKA 3AIBA 4AZHA 3A22A 4UOZA 3PZVA 3ARVA 2ZXQA 1GVYA 4FLRA 3OGRA 3AIVA 2CHNA 5CGMA 1JZ3A 4HZ6A 2WWDA 4L4PA 3EMQA 1FOBA 4H04A 1CGYA 3O9NA 3W82A 1GHRA 3FAWA 3CPUA 2EPMX 1OGGA 4W93A 1CLXA 2VZTA 1QI5A 3VNZA 2EBNA 3N18A 3DX0A 2J78A 3WQ8A 5CQ1A 3VKKA 1NP2A 1H1NA 4Z2IA 3VO0A 2MANA 4AD0A 2OYLA 1H3GA 2X8RA 4CGTA 1JDDA 1CDGA 3M07A 2ZX8A 4PRWA 4M1RA 3WEOA 1QX1A 1OCQA 1EQCA 2DPEA 2JALA 3VMPA 1R7OA 1W9XA 3VSTA 1TCMA 5E09A 1YHTA 3CUGA 3VILA 1E40A 4N0RA 3NYDA 1TQTA 3ARYA 4W87A 3SCNA 3CGTA 4JKLA 1CLVA 1J12A 3HU7A 3O2LA 5EFFA 3PTKA 1CXHA 1UD2A 2BNJA 3CUJA 1L8NA 2J25A 3BVUA 3AICA 3CZKA 5DMYA 2YDSA 3AI0A 3RO8A 4F79A 1JZ2A 1VEMA 4LXFA 5F7UA 4UFHA 4AC1X 2VZSA 2FHFA 4NF7A 3W28A 4AZIA 4TUFA 3CMJA 4URIA 2XGIA 3OB8A 2J77A 1H5VA 1NOFA 1VFMA 4AIEA 5DEZA 1BG9A 3L4TA 2WMIA 1E56A 1G1YA 3J7HA 4ML4A 2XYLA 4U2ZA 1V0NA 3IK2A 2C0HA 3VX1A 3OLEA 5A1AA 1OGSA 3KLKA 1R86A 2DSKA 3KE0A 2C7FA 1OBAA 3HJEA 2F18A 4XB3A 1TVPA 1UKTA 5FKYA 3MUY1 2A3HA 1HN1A 3WY3A 1JF5A 1E72M 4AD4A 4JFVA 3VIGA 1UZ1A 4WKFA 2WSKA 4MB5A 3HZ3A 5A8PA 1CWYA 4F66A 1RH9A 4MTVA 2FH8A 3IJ9A 3SCOA 2ZXBA 2ZX9A 4J3UA 2ALWA 1IT0A 2WHJA 1ZJBA 1TMQA 2PWDA 1MW0A 2DEPA 2DQXA 1GOWA 5FIPA 2QF8A 1XCWA 3TA9A 3EMZA 1HP4A 2QPSA 1PX8A 2WHKA 3QR3A 3BUIA 1NH6A 4AIOA 1XC6A 3WF2A 4QDMA 1F4AA 3TTOA 1ITCA 2G8ZA 3ZQ9A 2WMIB 3QOKA 3PTQA 3U7VA 1GOOA 5D9MA 5ABEA 3TONA 1UWTA 2C8NA 5CLWA 3AXIA 1FH9A 3L2MA 1ISVA 4CD5A 4P7RA 1XSIA 5A8OA 1QI2A 4JKMA 4ACYA 1TQWA 2BFGA 3VIHA 3DYOA 4CN1A 4A4AA 1CZ1A 4OGZA 3L4WA 2VZVA 4R5EA 2J7FA 2XM2A 1E5NA 4UQAA 3FHAA 3AHZA 3EDJA 1W2PA 5I6SA 4L4OA 3SCTA 3RIKA 1DWGM 2XPKA 1W2VA 2VC9A 4UCFA 5C8BB 4WKHA 2X0HA 3D50A 4MDOA 3CHDA 4B16A 4W88A 1HL9A 1ZL1A 2WVVB 1XV8A 3OLDA 3WUFA 5C70A 3N15A 2VX7A 1QHOA 3CIVA 4IPNB 1Z32X 4M82A 3EJRA 3WIJA 1E3ZA 1U30A 2ZWZA 3VM7A 3SUUA 3LMYA 2DIJA 4FF5A 4AZCB 1E70M 4AW7A 3W81A 4GINA 1KBBA 4ZEPA 3ARTA 3N17A 3LXCA 4PTWA 1TZ7A 2CBIA 5AYBA 2YL5A 3W38A 2WKGA 4DO5A 3K4AA 4YHEA 1W9PA 2BHYA 2BVYA 4V2XA 4U5KA 3GBEA 3A3HA 1JYWA 3WQVA 1C90A 2WYSA 4Q7NA 4PMVA 1E1FA 3CO4A 3WH8A 2CNCA 2X0YA 3SCRA 1LL7A 1GHSA 1E6NA 3EJQA 5IHSA 1BYAA 1LQ0A 3ZMRA 4Y7EA 3WF0A 2ZUUA 3QHOA 1US3A 2IXUA 1G01A 2YLLA 1V02E 4AD3A 3NIYA 2YOCA 2CKSA 5E9AA 4LYRA 3VM5A 1XH0A 1IZJA 2XJ7A 4B3LA 3WNLA 2GJPA 3G6LA 3SCWA 3B9AA 3WL1A 1QBBA 1DWHM 1SMAA 3GM8A 4JKKA 4P8VA 1E43A 2JFEX 1FH7A 3CH9A 3KWXA 4MNMA 3RPMA 2X2HA 2XGBA 3L4UA 5I23A 4FLQA 3BAJA 2QHAA 1CBGA 4P8WA 1HL8A 4D6IA 1EXPA 3K8KA 5BXRA 5D9PA 1PJ9A 1JAEA 3N11A 4IUGA 3TP4A 3WKZA 2WC4A 1Q6FA 1TQUA 3U57A 3AS2A 3HG2A 4FNSA 1B3YA 4J28A 4CKQA 4A3YA 3PZMA 1SZNA 4WF7A 3W24A 3BMVA 5DFAA 3WY1A 5JBFA 1J0ZA 3U5YA 3KLLA 1UD3A 1PIFA 2ZUMA 1E6ZA 5CGTA 1BQCA 1PZ2A 2DSWA 3UR8A 4D6DA 1UWUA 1W9DM 2E8YA 4UFKA 1G9HA 2GVYA 5I79A 1GUVA 2WWCA 1E55A 3CHEA 1NM9A 1U2YA 4UZSA 4DUXA 2YA1A 3VDAA 2XIIA 3ARXA 5HNNA 3WDPP 1V6VA 1US2A 4GZIA 1E6RA 1E3XA 4X0NA 5LA2A 1V6YA 5E6YA 2ZUVA 4QP0A 4EANA 2GJXB 2EPKX 1OIFA 4JHOA 3ZJKA 4V28A 4HOZA 1KXQA 3CBWA 1UD8A 1VAHA 1W1PA 4CCDA 3OBAA 5BXSA 1GCYA 2GFTA 2A3BA 2WZHA 4UOQA 4WLCA 2RGMA 3W25A 4RL3A 2J8GA 4QFUA 3CHFA 3WMSA 1XRVA 2G3NA 2BY1A 1GOIA 4S3JA 1UR8A 3WUEA 1CGWA 2E9LA 3VIMA 4UFMA 1UUQA 1J0YA 1UYQA 4MADA 3DX4A 1K6AA 3BC9A 1B3VA 5CPQA 3WNMA 2CESA 1W3JA 4GQRA 1JZ4A 4LGXA 2EXOA 2D20A 4PMUA 1V0MA 4OOUA 1V3LA 2EAEA 2E4TA 1XSKA 2OWCA 4QLJA 3W6MA 4D72A 5FCZA 1VIWA 3VIPA 4U3AA 3QOMA 1ODUA 3ARUA 5DO8A 2WLZA 3AOFA 2JIEA 3ALFA 2A3AA 4AZ7A 4R27A 2VCCA 1R7AA 2YL6A 3S5ZA 4CD8A 2AAAA 3EDDA 3OG2A 3H55A 1R87A 3E1F1 4KRTA 4D6HA 1JG9A 4W8LA 4D6CA 3BUDA 2YA0A 3SUSA 1V6UA 5CLTA 1H09A 4E8DA 1UG6A 2IUZA 1CXKA 2QMJA 1HKIA 5CPSA 3WQ4A 1JXKA 5D9OA 2HVMA 3CUFA 1E15A 1JD7A 1KQZA 4NRRA 1MXGA 1TQSA 1KGXA 2FHCA 3GXMA 3LRKA 4TX6A 4NSBA 3KL3A 1BVZA 3A4AA 3WNKA 3A4WA 3AQUA 3IJ7A 3WQ6A 2FYVA 4GXPA 5AC5A 3WD4A 4BCEA 1ZBKA 4P7LA 5D8WA 2UY4A 1VEPA 1BG4A 5FOOA 1RPKA 2F8QA 2OSWA 2Y5EA 3GNPA 3MUIA 4PMNA 3KL5A 1PS3A 1DWFM 1JYXA 2ZX7A 4AZ5A 2D0GA 1CGUA 4ACZB 1EHNA 2UWFA 4F8XA 4AY1A 2BHZA 3PHAA 4GO8A 4CD7A 3IANA 3S2CA 3VMNA 2VURA 3RJXA 3VTRA 1MFVA 1V02A 1GQLA 1KGWA 6TAAA 3NSMA 3POCA 3OLIA 2GDUA 3L2LA 3THDA 2NT0A 1HTYA 2W61A 3CTTA 5IDIA 3MI6A 4ZENA 3MU7A 4UZUA 3SUVA 3MKKA 1JF6A 2WB5A 3VIOA 1J0IA 2WHMA 1K9DA 1RP9A 3WNPA 5D9NA 2EPNA 4PTXA 1M03A 4V27A 3WELA 1E0XA 1D7FA 3K46A 3CZJA 2J74A 1V0KA 3AS3A 1TUXA 1UWIA 1JZ8A 1LL6A 4C7DA 4CD4A 3DX3A 2XG9A 1MFUA 1XYZA 3EJPA 3ZJ8A 1HNYA 1B9ZA 4D6EA 2DGAA 3KZSA 4HA1A 2BY3A 3L4VA 4UFIA 4GI9A 1AMYA 2GSJA 5BRPA 3T2PA 2VVNA 1G94A 3MSGA 3A23A 4WSJA 1TG7A 4J3VA 4AD2A 4TX8A 1XSJA 3A5VA 1WZAA 3RMEA 2YA2A 5ABHA 4WSKA 3ZT6A 5A6BD 5BWFA 4WIWA 1CNVA 4UR9A 3VVGA 1EOMA 1B1YA 2J79A 3GBDA 4XUYA 2Y8VA 1BPLB 4PEEA 1UKSA 2ZOXA 3AIEA 2V5DA 3HMCA 2GJRA 1BTCA 3VDHA 3BAWA 3WD0A 1GORA 4DUVA 3D4YA 1B0IA 3BLKA 1FFRA 1UZ4A 3NSNA 2Y24A 2JEQA 1B31A 2JF7A 4MNKA 1V03A 4GZJA 4PYSA 3AMDA 3F5JA 3EJTA 2F61A 3BUQA 4FLSA 3APGA 1E4IA 5I0DA 1BVNP 1XD1A 5CPTA 4JFWA 5JIPA 4HMEA 1WDRA 3VGFA 1M01A 4HPHA 1UA3A 1CXLA 3WL0A 1TA3B 1ZBWA 3ARSA 2WCAA 3AYSA 2FGLA 3U5UA 4EE9A 4AWEA 2V3GA 4OBSA 5IFPA 2VX6A 4JAWA 5EB8A 3KEHA 1WNOA 3AIQA 1H4PA 5E6ZA 3VIIA 2FE0A 3WEMA 3LPOA 4LYQA 2BS9A 2J7CA 4FNPA 4U3CA 5HPOA 3L4YA 3EDEA 5A6MA 4H7VA 2CHOA 1IV8A 4HPGA 1JXJA 2OYKA 2PB1A 2WZIA 4PCSA 3RCNA 3ZT5A 3VD5A 2DIEA 9CGTA 2CIPA 5FL0A 4CN6A 1NOWA 5A69A 1WCGA 1QVBA 3N13A 2F7RA 2PWGA 2W4XA 5LA1A 5LYRA 3VOCA 1MW1A 1WZLA 2WMGA 3UESA 2PF0A 1WO2A 2TAAA 2D24A 2J62A 1UD6A 3WN6A 3QHNA 3ARPA 3GXPA 2XWEA 2A3CA 4D6FA 4GIAA 2X2IA 1SFSA 2E9MA 2NW0A 4KMQA 3EYPA 1EIBA 3BVXA 1NWRA 1LF1A 4CCCA 4PMOA 2YFNA 1HVXA 1XHGA 4D6GA 2WBGA 3I3EA 1UH4A 1N82A 4W86A 3TV8A 1TR1A 1UWQA 2DT3A 4HA3A 2V5CA 1UQZA 5KZ6A 3AXXA 1CPUA 2CBJA 3VIKA 4MJ2A 3VINA 1C8QA 1UWSA 2X2JA 3MANA 3GXFA 4JIEA 5BRQA 3BXWA 3VGDA 1AVAA 3LX9A 2VRQA 2VX4A 2EACA 1W32A 1QBAA 3OLGA 1W1TA 4W8AA 1HJWA 1WZKA 1BFNA 2PBOA 3NJ3A 3N9KA 1BYDA 5I24A 1ODZA 1PIGA 3WMCA 1KXVA 3A6OA 1JYNA 3ZIZA 4PUEA 1UR9A 5ABFA 4MJ4A 5AYIA 5CSUA 2V3DA 3IGUA 3DECA 3EJSA 2PBGA 3TOPA 3SUTA 2J7DA 1MQQA 3T08A 4GPNA 4W85A 1T0OA 3WENA 5A2CA 3W27A 2Y2WA 4LX4A 1UH2A 4D1JA 3NDZA 1HF6A 4NXSA 1X6NA 5FD0A 1CXIA 1QI0A 3FN9A 3UEQA 3BAYA 1QW9A 3WF4A 3GH4A 5C71A 2AOSA 4HZ8A 3FAXA 2D3NA 1CIUA 3SCPA 4CU8A 1PPIA 3BVTA 4PCTA 1KBKA 4FNTA 4NXKA 1H0GA 3RDKA 4WKAA 1HXKA 5GPRA 2CPUA 3LXBA 2O9RA 3GDBA 1HKKA 4Z2KA 4Q22A 3WF3A 5A6LA 2ZUSA 3S5YA 5A8QA 1JAKA 5A94A 2HISA 3N12A 1E1EA 1GPFA 2ZUTA 1P6WA 3ARWA 4Z2LA 3H53A 2WANA 3VD7A 5LA0A 1I75A 2CEQA 3A47A 1CYGA 4U31A 1OB0A 3T0AA 4AD1A 3WDHA 4F9JA 4MNJA 1W1YA 2D0FA 1QHPA 1NWUA 3MMUA 2DSUA 4M29A 1JIBA 1GNXA 3ARQA 3WNNA 3I3DA 1E9LA 3AIUA 2PI6A 4KWUA 3FXYA 3CZLA 4NZFA 1WKYA 3A24A 4RE4A 4Z2GA 3CUIA 3OZOA 1K9FA 1BGAA 5JBDA 1UR0A 4B15A 3H54A 1GOMA 4ZXLA 1VEOA 4P7OA 5I78A 2WW5A 3VUPA 3VD3A 3ZJ6A 1V0LA 3A21A 1GJUA 3B9EA 3WDQA 4MAVA 4LPCA 2YL9A 1BSIA 1PEZA 4UTFA 2W92A 5E0CA 2BXYA 3EBVA 5A6SA 2WVSA 1VBRA 4TTGA 1PAMA 3CC1A 2ZX6A 1EH9A 2E40A 2O9TA 1JZ5A 1JZ7A 3NUKA 2B31A 2XSBA 2FDMA 2JF6A 1DWJM 2G3IA 1UD4A 1M04A 3AHTA 4KH2A 4J3XA 3LPFA 3W53A 4P8UA 2E8ZA 3IAQA 1ECEA 2XFFA 3AMGA 2VO5A 4KGLA 5A6KA 3GYCA 3BCFA 5IFTA 4AZ6A 4GQQA 1HJUA 1W1VA 2WZEA 3UCQA 3UG3A 1W91A 2WMKA 4J3TA 2EPLX 2VZUA 1UOKA 4X9YA 3WY4A 4C7FA 3TTSA 3L4XA 3VX0A 2UY3A 1FP8A 2VR5A 1HKMA 1R85A 4X0VA 3WD1A 1UR4A 2W63A 3RM4A 1U33A 5EFDA 1UASA 4Z2JA 4PTVA 2J47A 1E6QM 5BXPA 3AROA 1FHDA 1WDPA 2FGZA 1CXEA 1NARA 3WDIA 4W7WA 4PSPA 2A3EA 2J7BA 1HKJA 4U5IA 3CZSA 1EGZA 3AJ7A 2WM0A 4QLKA 4W7VA 2DDXA 1V08A 1E6PA 1VJSA 1HXJA 2BY0A 4ZE5A 4BQ4A 5A95A 4AZCA 2XSAA 1V3JA 3ZR5A 1NQ6A 1EO7A 1KTCA 2D22A 1PBGA 1BYBA 4EK7A 5IXEA 3WBEA 3SIMA 1UHVA 1H0IA 5AC4A 1F4HA 4BQ5A 4RE2A 1QNQA 5A6JA 5I3DA 1V3KA 3CUHA 1DP0A 1H2JA 4J7RA 1W3HA 4HU0A 2V3EA 1V3IA 4MB4A 3GNRA 4PMYA 4U33A 1JYVA 3BCDA 1KXHA 3VIJA 3HN3A 1ISYA 3BUBA 3PN8A 4CVWA 3ZJ7A 1J0KA 2EEXA 3BMWA 2F7QA 2GDVA 3OZPA 4JL2A 3AFBA 1HJXA 2J8FA 4M80A 4MDPA 1DTUA 2XTKA 5E0FA 1ISZA 1EDQA 2PWFA 3HG5A 1FA2A 1H41A 4PMQA 3DDFA 1GJWA 4GI8A 2XWDA 2J7HA 5DF0A 2YIHA 1KWGA 3W26A 1C8XA 2X09A 1G5AA 1WE5A 2ZXDA 2DT1A 1SYTA 4BA0A 3WUBA 3VGGA 4JL1A 1CXFA 2UY2A 2D2OA 1E0WA 3WSUA 2EADA 3KL0A 3VGEA 2XVLA 1CTNA 3A4XA 3W29A 4RE3A 2XN1A 3NDYA 1C7SA 1J18A 3VMOA 3WQWA 4HOXA 1FFQA 3DDGA 1D3CA 1KFWA 1MXDA 1E6XM 3MS8A 1I1XA 1MW2A 1CECA 3ARZA 4MNLA 1OD8A 1IZKA 3M46A 4TTUA 5GNYA 3GNOA 4ACZA 3D51A 4PTMA 3MMDA 3ECQA 3ARRA 4AYSA 4P8XA 2XHYA 3AZTA 4H8VA 3T09A 1O6IA 3VPLA 2IXVA 2F7PA 2O9OA 3T2OA 3DYPA 2YFOA 1JD9A 2ZXAA 3WMBA 3VDCA 2E9BA 2GK1A 3AMLA 1B90A 4HMDA 3CZGA 3OGVA 1HVQA 1EDGA 4BF7A 2OW7A 1K9TA 4ATLA 3RM9A 4UQ9A 1H11A 2ZX5A 1J9YA 4M56A 1QI3A 3K4DA 2X1IA 4B3KA 3FW6A 1CGXA 3FHQA 5JIWA 3GXIA 1EA9C 2XN2A 5M17A 1C7TA 2OLHA 4CUCA 3L4ZA 3OGSA 1AQMA 5CZKA 3UETA 5A2AA 3WFLA 1KQYA 1DWIM 5A6BA 5EBAA 4PSRA 4QCFA 4TXEA 1C91A 5BROA 1C8YA 4C7GA 1JDAA 4PBGA 2EQDA 2CITA 3UR7A 3VSUA 1R46A 4DM2A 5E1QA 4DO4A 1QNRA 1VENA 1HX0A 3VDBA 2CKRA 4JFTA 3AHXA 1VBUA 4ZXOA 1Q6EA 2OSYA 3M6DA 1NWSA 1HJVA 3SUWA 5CG0A 1B3WA 3W6LA 1QHZA 3AZSA 2D3LA 4AMXA 3GXNA 2X2YA 3PZQA 3IJ8A 3WFZA 1WDSA 5CSYA 1W9VA 4M8UA 4IM4A 3SCVA 5M03A 3DHPA 3F5KA 2VNCA 4NI3A 2YBTA 4YN5A 5I5RA 1BLIA 2PWHA 1KR0A 3PZNA 4LQ1A 2VCAA 3T0BA 1J10A 3MV11 1GOKA 3T2QA 2CCRA 1M7XA 2XVGA 3AXHA 3LPPA 1CEOA 2WCGA 2BY2A 3WNOA 2VT0A 1OT1A 2NT1A 4FLOA 1JNEA 4JFUA 1QOXA 4OOZA 4GZEA 2WLYA 5M3WA 4FK9A 1B2YA 3GTNA 3ZM8A 1LWHA 1HP5A 3ZT7A 2DH3A 3RILA 1A3HA 2XVPA 4W5ZA 2CETA 3LPGA 1QWUA 5DT5A 2XVKA 4DUWA 2YJQA 3MV01 5FL1A 2J4GA 2XUCA 3PZUA 3DC0A 1E4LA 4BZYA 5A3HA 4M24A 2WMHA 3WD2A 1E5JA 5A8MA 4NRSA 1ZB5A 5AY7A 3BUPA 3BSHA 2XIBA 2ZUNA 1E6SM 4AIUA 1E0VA 2WBKA 2QMKA 2F7OA 2O9PA 3W4RA 1ZJAA 1V6WA 1PZ3A 2BXZA 4J27A 3BH4A 1E4NA 4LYPA 4TVUA 5BYWA 1OD0A 4GI6A 1XCXA 3MUZ1 3UG4A 3W37A 4W8BA 3IAPA 2QV4A 3BAXA 1XH1A 1AQ0A 5E70A 1LWJA 3WH6A 3WDRA 4J3SA 1NWTA 3VGHA 3FY1A 2D73A 3B9DA 2YLAA 2VRJA 2FH6A 2W66A 1OSEA 1KR1A 4FNRA 3DX2A 4AYGA 4TOQA 1JFXA 3BSGA 4AD5A 3HG3A 1GQJA
chains in the Genus database with same CATH superfamily
3SE4C 2MH4A 3NT0A 4K94H 4UQIM 4HMCA 1EZUA 1RQHA 4K1WA 3R13A 4LESA 2BXVA 4PL1A 1Q2RA 3LHWA 2JIWA 3F58L 2BVTA 2PW2B 1YEFL 25C8L 4LSUH 5KOMC 5IB4B 4NASA 1F6AA 2VLJB 1UZ8A 3OR6A 4HK0B 1W1ZA 3V0UA 4XTDA 5D1XA 3W1MA 2QIIA 5B7ZA 1ZT1A 1RI8A 3TV3H 5K9OB 2QUVA 1Z7AA 5FUZH 3SRDA 4E8CA 2W67A 3VE9A 5JW3L 2I7GA 2EYTA 4ZUWB 3HE7A 3N4EA 4IIDA 4Z2HA 4PWKA 4YPJA 4X7TA 1HJSA 1MVYA 3UO1L 1UWRA 4P2RB 5EBGA 1KTBA 2VR6A 1Y5WA 1Q8JA 1NPNA 4FG6D 3RGVA 1FV1A 4M00A 4ZT1A 4B9YA 3RLGA 5ILTL 3GS7A 3LEXA 4AM0A 4BI7A 3BKML 1YN7A 5JDSB 4PUBL 4MNGB 2VLKA 4K7FB 2Y1AA 4C57C 1EAPA 4XISA 4DO7A 3VGBA 3T0EB 4AF0B 4ORZC 1G9MH 5GNXA 5KVDH 1ETZA 4HZ7A 1TQVA 3ZHKA 5FW6A 3EXJA 3R1ZA 1F97A 4HA4A 4PUJA 5HQEA 3P02A 5D96C 2VISA 5AD0A 3V55A 2YQ2A 5DUPL 4P4KA 4ZTXA 3P8JA 4FAMA 3KP0A 5T3ZL 1RV6X 3V4UL 4PCFA 5EU3B 1JS4A 1N8ZB 2YAEA 4NO0A 1X8FA 1KLFB 3IJLA 5G1TA 4ILDA 2GUYA 2FWOA 5GRYA 3T3PF 4LZKA 1NAL1 3ZVVA 4P04A 1RZIA 1TZAA 5JW4R 4Z6AT 1QNOA 4PMXA 3NZHH 4KNTA 1LWIA 1XYFA 3P3RA 3RU8X 5KTLA 4G71B 3TBSA 1VFBA 5C0IA 2N0MA 2XTLA 3TSDA 3VXRE 3P0VH 2DQHL 2IPKA 2Y22A 3MGOB 4Y4FC 2IKHA 2FFIA 4DHLA 3WJLA 4NZJA 4O50A 3N9RA 3QFDA 3O9WD 3N4AA 3IJHA 1ZEAL 3GXDA 4KMLB 3DJSA 1G6RH 5AW2B 2BOCA 3HG4A 3KXFA 3VWJA 5IBLD 3CX5J 2E9GA 4GW4A 2VQUA 4RFOH 4WFEE 3U1SL 3WIHL 2V38A 2OZ4L 4K8GA 4XE0A 1HHJA 5CMAA 3ROLB 4LWWA 3CZUB 2LVEA 4Y9FA 5D8JH 4WFFE 3V6FA 4TV3A 4DPBX 4KQ0A 4MASA 3CLFH 4K9EL 3WBDA 1LO4L 4JTSA 1U8OA 1YSOA 4GKTA 4XSLA 3IDIB 3H7VA 3W2UA 2WXQA 4NKDA 1CZ8H 3R6IA 1JERA 2ALAA 3MFFA 4FFWC 3V0WH 1J5HA 4P23D 4JXCA 1M05B 2HX8A 4K8RL 4I18C 4P2RE 1YMMD 3S4SG 3ZE2F 3MCLL 4IIQA 5EO1A 4Q7IA 2B1AL 1BFOB 4LCIH 5K9CA 3G5YA 4Y2DD 1TV8A 4AL8C 3DTDA 3P11L 1SUHA 2I60H 4X6CE 1TJGL 2MFNA 3N43B 5FPIA 1D2KA 3FU5A 1FDYA 1RAKA 4L8DA 3HE6A 2QJNA 4RWYL 3AWNA 2JQAA 4PB4A 3I75A 3MTXA 3VXSA 5F21B 4ANXA 3B0UX 5H94A 2RMNA 3SDAD 2AK4E 1E73M 5AAMA 2CKNA 3HMXA 3DVGB 3RX8A 5BW7A 3PAOA 4M81A 3E80A 3M17B 4GKLA 4N87A 4HWEH 2E9IA 5HHNA 3UTSD 4PWEA 1XBZA 3QDMD 1EAQA 3EZJB 5AW3B 4OLUL 3VVGA 4MVAA 1JL8A 1I1CA 1AS8A 4TVPE 2A1WH 3QZWA 4H5SA 3WY2A 1T89C 1W9BM 1DWAM 1G4TA 1FWNA 4QCIB 1FNAA 4PIRF 5D38A 4MXWL 5KYUA 1W6TA 1XF1A 3DSNA 5FWRA 1NUDA 1T5XA 2A6KB 3VXNA 2W80C 4BS0A 3SQOH 2DM3A 1H5BC 2VXQL 5FLUA 2I9LB 4NN7B 6A3HA 4ESKA 4EPSA 5HHPB 1NGQH 1JPSH 2UX6A 1GVIA 3MRFB 5LZLA 1KCUH 4P2QE 3QJVB 3TN4A 2HK1A 4UV7H 4YGVA 1YXDA 5GRJL 4Y1AA 5T1DH 3MCKA 4HFUH 4DTGH 4K0OA 5FFGA 3W1LA 3GH5A 1BXBA 1T20A 2PMZA 3OKLA 4MWFA 3P0YL 4F7TA 3GD6A 2OWXA 2IGTA 1TYJA 1KLGA 4HGXA 4IBTA 4A3RA 4MJ6A 1KC5H 1I31A 5FW8A 4ZW7A 3KWTA 3L12A 3V0VA 1UWYA 2K8MA 1A6VL 1SLUA 2XY1A 3GHEH 5ACLA 1NSNL 2VMEA 4ZXBD 4ECLA 3P0VL 5AZEL 1SXNA 5A5WA 3WTWA 4S1RL 4Z0BL 2XOTA 2ISFA 3VK5A 4HOWA 1NUGA 1MREH 2C71A 3CH0A 1EXBA 4JS3A 3FCPA 3IJSA 1MDTA 3Q65A 3JXAA 5CP3A 1XR9A 4UDUB 1FWIC 2BMBA 2BCMA 9XIMA 1BA9A 4MD5A 4ELKA 3FXGA 3ZS4A 4G9FE 1NLBH 1EYWA 3F7QA 3VIFA 1H51A 4A7TA 2E76C 2BV9A 4PJGA 3THUA 3FN0L 2O6PA 3UROR 4MM1A 1GVFA 4NY2A 4CQ9A 3US1A 3SKNB 3PNWA 1U3HB 2Y7OA 1SF3A 4ZQKA 1C92A 1CBJA 2Z35A 1Z3GL 1E28B 1ICPA 1E90A 1MW3A 2RCSL 2HX7A 4DW2H 4L5ZA 5I28A 3W1TA 4DF9A 2HE8A 3C2AH 1FPTH 3CPLA 3JZEA 1EDTA 4TVDA 2D0HA 5CINH 1S39A 3DHDA 1HCFX 1RSFA 3AM8C 3KCPA 3WSQH 2NY6D 3C60A 3D2UD 3E6EA 4H8WL 2INFA 2F38A 2A4CA 4GLRH 2AKRA 3BAIA 4BA8A 1SSGA 4I5UA 3WH7A 4LAKA 3QH3A 5IROC 1UWXK 3WJMA 3QNFA 3JV6B 2PW1B 3BP6A 4OZFA 2ACUA 3PZTA 1INQA 5JXEA 1QEXA 2QAPA 2NUWA 1OAQL 2A1WL 3IAGC 3SGKC 4CU6A 3WD3A 3F7YA 3KPTA 3OHMB 5GS1A 3OQ8A 4GCAA 2VTFA 1Q6RA 4O51B 4JZJC 3DDMA 1MVFA 3OAYK 5DX7A 1IWBA 3RLUA 3BQUB 4JBRA 2I9TB 4JG9A 4UOW0 2WNQA 3IJYB 4IJRA 4YE0A 2C3GA 2EVGA 3MJYA 4J3WA 4FXJA 1AY1L 1KCUL 5IMKB 1B4KA 1J9QA 5CBAA 3GG0A 3GR7A 4IPLA 5KS9B 4Q32A 3QWNA 2YRPA 5F9JA 4EAMA 1UA7A 4JFSA 5DSCB 3B6SB 3BLPX 4D0CB 4Q89A 3UTTB 4K3ZA 4YVVA 3AZRA 4E4PA 4EX4A 1G9ML 3QHMA 2YC1B 3TTYA 4UT9H 1A0QL 3MZ2A 1B0WA 1NL0L 2FIKA 4K55A 4LBAA 5IZ7A 4JNXA 1XRTA 2GPTA 2QVMA 1QFHA 1FKWA 2VWTA 2WTRB 1DSFH 1MWOA 2CBPA 5FECA 4BH8B 3QG7H 4AEEA 5CCKH 3FLUA 4IHCA 5BRZB 3U7WH 1PL9A 1GKEA 1K77A 1VSCA 3CFCL 3ALWA 4KUCF 1BW8A 5E94B 4EVNA 1PY0A 4X2UA 4UQDA 4TL4A 2EC8A 4P4KC 1ADSA 1HO1A 3EBGA 4ZXBC 4ANKA 1CIDA 1DE4A 4PTTA 1UOWA 2FWLB 3TNNA 1FA4A 4Z77A 1JI2A 3W7OA 3DH7A 4WK9A 3VXMB 1AHWC 3SO5A 2ED8A 3ABKB 3NSXA 4Q8MA 5T26A 1W3NA 3VKCA 1GYVA 1A7NH 4HPOH 2J7EA 3ONCA 1P7QA 5AOZA 3WMPA 3C5XA 3G6MA 1S9WA 4JKPH 1ZEAH 4QXIA 3TXAA 2ZWYA 1F86A 4CU7A 1EQPA 3MAWA 4O16A 4D8PA 1KXTB 2BSTB 4A2LA 2DLIA 5EOCL 1MCWW 2OZ4H 3R94A 3ZUNC 3BP4B 1G7IB 3C12A 4XOEA 4CMHB 2BHUA 4LL1A 2O5NA 2YGVA 1A9EA 1JI1A 5J89A 3ZOAA 2RD0A 3ARFD 5DFTA 1EHLL 4P05A 4OF3A 1J1PH 3F5WA 1DUZA 1PZBA 1ZVSA 3ZSSA 1R47A 1OB1B 2GIMA 3BPCB 4WV1A 4LBUA 5CZTA 5JBEA 3V5FA 2BNRA 1BF2A 1R4XA 3S36L 3NJLA 3JVGA 4KZDL 2BGSA 1MUMA 1EJOH 2PPFA 1CR9H 1U2CA 3QDGB 4HIBA 5A8GA 5DK2A 2GCYB 2X4TB 1L0PA 2VXQA 3HAEA 3K72A 4L8SC 1OW0C 1YNTF 5HHXL 4KDTC 1ZU8A 5BRBA 1JWUA 2BMKA 3TT1L 3STZB 3WU1A 2NY5L 3SKJL 1EMTL 4QEGA 1TPXC 1Y0LA 1WKEA 1XRSA 4PMRA 3KPNB 1HXYB 3NESA 4HXAL 2CLRA 5F1IA 3TMLA 4AMKL 2R0ZH 2IANA 1L9MA 4RZBA 3IU4H 3CZEA 4NC1C 1Q4NX 3UTSA 3FQUB 5EMYA 2V2XA 5FC9A 4ATWA 3RWEB 1ET7A 4FR1A 2HK0A 4P48A 4S0TD 3E2HB 1TO3A 4JHWH 3UABA 4NRZA 4BQ8A 3WH5A 3W0WB 3LHAA 5CEZD 4R5VA 2F2KA 4GIYA 2XFRA 2DJXA 3Q6GL 4OJYA 1TZIA 4WXYA 2WWMD 1JOIA 4Z95H 4OZGE 3NZ8B 1ZKAA 2ACQA 2QXWA 4U1JA 1Y6KR 3GJFA 5D1XE 4DP0X 1P0SE 4PS8A 1P84J 2XN9B 1FXQA 2BTMA 3C2FA 3IIVA 1YMMA 4PWFA 4JUTA 1R9YA 3SBWA 4PRBA 3RHWF 2IEPA 4H1ZA 4Z3HA 3H0TB 4F9DA 5INCA 4DKFL 3QS2A 5J5EA 1TIWA 2XWJA 3SPVB 5FYJD 1SJHB 4LC6A 4Q2ZA 2V67A 4YZWA 2VFFA 3GSRA 3HOGA 4YTTA 4NNCA 3QBUA 4XC1H 3DMMC 4KJWD 4ETYA 1RJYB 4AKOA 4ODVL 3LZOA 1IO4C 2DWYA 5IHZA 1BZ8A 4P57B 4O1DA 1AD0A 1Q0XL 4NJ9L 2CHDA 3TVMC 1W5PA 3BH8B 4G8GE 2VJXA 1HTIA 2OJ1A 2KS0A 1KGCD 2XCMC 2Y8KA 3GR8A 5TH2A 5J3HD 4BWLA 4OD3L 1A49A 5DHMC 2RB8A 2O5YL 2IG2H 4P46B 1G1OA 3D1MC 5GQBA 1WAWA 1NP0A 1XBYA 4JYDA 3GMPB 1A7BA 1KB3A 3OAZH 4CSSA 2AV1A 1EEZA 3QFJA 5IGXL 2PGRA 3K6FA 5LCVA 2K7PA 4YXKL 3BPOB 2A7RA 1T2QL 3GNXA 5E8PB 1E42A 1KJ2H 5CILH 3TL5A 1JFQL 3TURA 4OV5A 1ZA6B 2DORA 1UR1A 5ERWB 1UXLA 1UPPA 1UR2A 2YSSA 1TA3A 3OIHA 3QQ1A 3FT0A 2WJZA 2C4FU 4P46D 3O0RH 2GT9A 1XDMA 1LJMA 1BAGA 2BOLA 4YDNA 1RJPA 4GABA 3OJGA 1N0XH 1RBAA 2NW2A 1YQ2A 4MZ8A 5KVFL 3OX8A 4G8GD 3EOAB 1CFTB 1JHKH 1CFSA 1QW8A 4EIBA 5F1KC 5BJTB 5KVEL 3BAEL 3FB6A 4UOJA 5HHXH 1HYSD 3OA3A 4RV8A 3GSNL 1LLOA 3L65A 1IEBB 5GGRY 3ZR6A 2PCEA 3QIUB 4NU7A 4D9LL 1B5TA 1UXMA 1XCFA 4FO4A 1JNDA 1L7TL 4NDMB 4MMYB 5T1KB 4JZ5A 1XL4A 1RK0A 2V8MA 3F5LA 5LDUA 4Z7WE 3C60C 4MB3A 1H3PL 4U0RC 3IMRA 4LAQL 2ZZ4A 1VHPA 1LJYA 2ZXGA 5FF2A 2EP6A 1BEXA 3K8MA 3KPSA 1A1OA 1I7UB 3T8LA 1U4EA 1UKOA 2OXNA 4ONVA 1XUUA 5L7XH 2I26N 2XU9A 4OFYA 4FOKA 1TVNA 3M1CA 4C83B 1WAPA 3L95A 3K1DA 5I1CH 3NPZB 4NM8L 1JRCA 4C55A 1PO9A 2BSCA 1G9NC 3KS6A 2VIRA 5GGRB 5CEZE 2Q6WA 3QZAA 1CK0H 3RU8L 4YS4A 4E4UA 3FH5A 1MXSA 1KCLA 3SN6N 4D6JA 3QORD 3TFKC 4HSHA 2NNAB 2NY7L 4MD4A 4JFHE 5K1JA 4ACTA 2Z31B 4QLRA 3D3AA 3NQAA 3VFGH 3VSVA 2WSPA 2H47C 5D2TA 4UF7C 3UY8A 1NGWA 5EBLB 1JEZA 5HJLA 1PD0A 2NTFA 1T0NA 1UIOA 2ARJA 2DFAA 4ZFMA 3NA4A 3FFCD 3DRTA 3GC2A 5K39B 1NGPH 2R2HA 4HHWA 3P67A 4ZFCA 3ZY7A 4HX1A 4OWGA 4AV4A 5H2BB 5LO7A 5FESA 2OMZA 2W0LA 1Q6GA 1T21A 2LU5A 2E1DA 1UD5A 1LEKA 2VEPA 4HHHA 2X1TA 4QJ5B 2C18A 4YWGH 5CGBA 3OAUH 1DVQA 1K2DB 2E86A 4GW5B 3P3UA 1JZ6A 3VFTA 1NA8A 1RMFL 1OG6A 1J01A 4KZ0A 2OTPA 5CN3A 3IUHA 4AC4A 4LB3A 3NPSB 4ZSOA 1M56B 3HNTL 4KTEL 4M43H 4LUTB 2VM4A 1W3KA 3ZKQD 2B4CL 5T8IA 3UTOA 3QPQD 3QXWA 1JQXA 2OP4L 1I3UA 4CC4C 1GKRA 4ZNCD 1LO2L 1C93A 1KUMA 3O4OC 3VB8A 5DT7A 3S3JA 4F0RA 4EDWH 1QPXA 1NGXA 5DTFB 3SQOL 3V7MA 1WP6A 4PQXA 4AWTA 3GZAA 5J8OA 3FO9B 2CLFA 1JZHA 1QI4A 3GZOA 4H25A 2YD3A 3EDKA 1IKFL 5JO5B 2AABL 3BIAX 4V1DA 5E2JA 1DHKA 3MLVH 4PTDA 2ATKA 4M4RA 4JG5A 4UILL 2WNGA 3LM3A 5SX5K 3M6YA 1MPAH 2EIEA 3H3PL 1Y5XA 3MFGB 1NCCH 2VABA 3DPBA 5K1NA 5IDZA 3T3PB 3KM1A 1D7CA 1VDGA 1OFEA 5D2NB 1JPTH 1YEYA 2CDGA 4UYQA 5E4OA 3EA1A 1X7SA 1JZ3A 4WRHA 2F84A 4JIQA 4Q8BA 1ITQA 2WWDA 3MRLA 4HCFA 4KTDH 5HYJE 3NL5A 1YPXA 1UWGL 1NTDA 1ECQA 5I9QC 3W7EA 1RU9L 1CQYA 3LK6A 1CGYA 2TRHA 4OM1H 2VDKB 4HIIA 4PJGE 4V1DD 4X5XB 1GHRA 1BD2A 3WAKA 3QORB 1WBJA 3QJAA 5JHDA 5HJYA 3F6LA 1QFPA 5ENWA 3EGDB 3G1AA 2ZOKB 4FTVB 4FR6A 1GKQA 3SHSA 3S98A 3VNZA 4F9PA 2MMXA 3U36B 2VH5L 5C07B 1EFXA 1O5PA 4PJXB 5JDJA 1G6CA 2R1NA 2HCZX 3M9YA 2DYPA 2ZSWB 3TCLB 2C1IA 3VKKA 4LDOB 3QR1A 2R1YB 2ACSA 2YCIX 3VO0A 3N73A 2WQUA 5TE6H 4YSQA 2I07A 4KI5C 3JTSA 4YR6B 2OYLA 1T1WA 5MENB 4A35A 2Y23A 3B03A 5JU6A 1NSJA 1H3GA 4RDZA 4JKWA 4CQAA 2X8RA 4PWJA 3QI9B 3TSMA 1DCEA 3LBOA 2HAZA 4L9LC 3KEDA 4KO5A 2J1KA 5EA0L 2C5DC 5JMUA 1BJ1H 3V7AE 1SDDB 1DVTA 4OD1L 5D71H 3WEOA 4UT6H 3W2MA 4HC1H 4D7BA 2JALA 3B8UA 2BVWA 4X6CB 3O8XC 1ML1A 1HZYA 4L29B 2HRPH 5DA0B 3P80A 1AGCB 2IXQA 4WJKB 4TRPH 4LSQH 3NQ2A 1NCHA 2IOMA 1KTJA 4R90H 1H7WA 1S7UA 4UT6L 2I9UA 4WNSA 3OGOE 4PGDB 4YK4B 6PAZA 3DESA 5HHVH 3DXAB 2CXKA 4FHKA 2QCLA 1DBMH 3MP5A 3D69A 4EPBC 1RY8A 1YECL 4PRHB 3LOWA 1W5OA 3D9AH 3GHBL 5FYKL 3SCNA 1L0QA 3CFBB 2AXGA 1KPVA 1U8CA 4R2GD 5KW9H 4JKLA 3ETBF 1J12A 1F4WH 1E5CA 1SGJA 3HU7A 2ZOWA 4N2MA 5HNRA 3C86A 2V2WB 4URTB 2C4XA 2CO6B 1VYPX 1NC2A 2ISSA 3PTKA 3UZQA 1N5AB 4TVPL 2OMXA 4ZOAA 3CUJA 3ARFB 4JTFA 1BX2B 4GMEA 1P2CA 3UBPC 3AICA 2AJUH 4NP4L 4G8IA 3BEWA 3C2SA 1B4LA 2YDSA 4KRNA 1JSYA 2XPYA 4Z7OF 1WBXA 5BUPA 4F79A 3H2PA 1YIXA 4LXFA 3RY4A 4AC1X 2VZSA 5EGRA 5FF3A 2APXA 4PVBA 5IQ9B 2FZDA 5FCUL 1Q72L 3OB8A 4NP4H 4JTCA 1PGRB 1S7WB 3F4CA 1NOFA 3N41B 1VFMA 1W37A 2VUOA 2BWDA 3DWTA 5AOUA 2ZCZA 2WMIA 3N1QC 4I9MA 4QTGA 3N40F 2ZKYA 2Z91A 3HNVH 4X6DE 1EF2A 1AQKH 4ABWA 4JPVL 5HGDB 4ZG1A 4WTZG 3J7HA 3GMQB 1BLNA 2V5RA 1OKEA 1F5ZA 1TPB1 3WFHB 4I0PC 1NBYB 3T4CA 3S2NA 1IEHA 4U2ZA 5B3JE 3ASOB 4JZNA 3MLYH 4RQQA 3QJZA 1PDKA 2GK0A 2R0WL 4MXQD 5A1AA 4JREB 1FLRH 1Z2KA 1R5WB 3VXSB 1WZ1H 3HQNA 1OHZA 3BT2H 3GO1H 3B06A 3CUXA 2GWGA 3GHPA 3QEZA 3ARFC 3WS6C 2BNRE 2Q8BH 3R7RA 5I66A 1OBAA 1S5HA 4G8GB 4WFHD 1Z9MA 3IT8D 3U6XS 5TQ2H 4OM0L 2XPGA 4NKCA 1B0GA 3T05A 4MSSA 3N4FA 2MCPL 4XCFH 3V6ZB 4GXUM 5DZOA 1DN0B 1UB5B 4GP5B 4XVTL 5GGQH 5LWYH 1EZ2A 1SJXA 1PD6A 2QQLH 4ZO6A 2YGNA 1HN1A 1VADB 3WY3A 3IDGB 4X7FC 1JXFA 4JBSA 3F05A 4K5PA 2VDMH 2YD7A 3VIGA 4RWYH 3VA2C 5T3ZD 4A04A 1E1CA 3HPFA 2WSKA 2DRUA 4WKFA 4WU7A 4KY1L 4LLMA 2DMKA 4F66A 5EIIG 1ZV9A 4TVPD 1RH9A 3TIEA 2FH8A 4REQA 3SCOA 3IV8A 2ZXBA 2R2BA 3QDME 4PRID 3K6SA 1FTXA 3L3OB 4J3UA 3LCWA 1YEFH 2ALWA 3UTSE 4H9YA 1DQDH 2WLLA 4HG4J 5TF1H 1QWKA 3KBPA 2ZUQB 4FFTA 1NGPL 2B9BA 4UTAL 1GOXA 1ZHNA 3K0YA 4FMFA 4HKBA 2X16A 5C0CA 4GC3A 4O28A 2D9CA 3I6LD 3O6LH 5F9AC 3EWYA 1ZJBA 2MJWA 1TMQA 5FF6A 5CZSA 3ARED 4LAJH 1DBBH 3UAJD 2DEPA 4DNMA 2DQXA 2E5CA 5E4AA 3U79A 3APMA 1KYAA 4WVRA 2WQ8A 3WMQA 1I45A 2H3XC 2VXQH 3HAEH 1FE8L 4G1EB 1AP2B 4IDJL 3TJEL 3SGUA 1YMME 4AYID 1OX6A 4ELME 3O6ML 3K91A 2P0IA 1EBAA 5GHWH 4BZ2H 4AIOA 3WF2A 2NY6B 4QDMA 1F4AA 4UQ2A 1IGIL 2VDNL 3HBGA 4M5SA 5EWIH 1VKXA 3LV6A 4F24A 2GW5A 4KZEL 1IC5H 4OUUB 5E2WH 2YPLD 3QZOA 1GOOA 1XYLA 2G9HB 5D9MA 1ZK5A 3FB8A 2OFJA 4OTXL 4DP4X 1UWTA 4XVDA 1CD9B 4NKMB 5HD8D 3UCDA 2A9ML 1G4MA 4WKZB 2OZ4A 4J12A 2GAZB 3F7RA 3L2MA 1ISVA 4RNRA 2L7JA 4Y16C 2GQ9A 3O9WB 1HCYA 3V0JA 2PODA 1Q4WA 4F0MA 1GW6A 3LNMA 4JKMA 2QVHA 4ACYA 2EC9T 1KRBC 1VESA 5IVXF 1ONQA 3VIHA 4P2QD 4DGIH 4HU2A 3RE0A 2UWEA 2AL2A 1VFTA 2XV2A 4A4AA 5FGCE 3HB3B 1UM4L 4QXUH 3QUYD 1MHCB 3UAFA 3VE0B 5I6NA 1MWAL 2J7FA 2L5HA 5H8PA 3QO1A 1CE6B 3DOSA 4HBCH 4HD9A 4JHBA 5C0EB 1DANT 3EDJA 1Q13A 3B2DC 2ZTKA 3AAMA 1NC4D 5AD0B 1ADOA 3L23A 2HT2C 3IETA 2ESVA 2PDIA 3PUEA 1K4HA 4JHVA 5IV2A 3RIKA 1NFPA 1O68A 1TTRA 1ZHKB 4B3EA 1UZHA 2VC9A 4P2OB 4UCFA 4F1SA 4G43A 5H37G 1KJMB 3MA7A 3D34A 3OM3B 4QKXB 4YPGA 5DD5H 1TJ1A 1XI3A 4HG4K 3MV7A 1J8SA 2L7QA 2LFGA 4OSUL 4B16A 4W88A 1N8WA 4M3JA 4M1CC 5FFOA 3VI3A 4FQ2L 2WVVB 1OCCB 1XV8A 4FIRA 1IU1A 1PLGH 5D7JC 1QTYT 2C34A 2QDGA 1RJLA 3SY0A 3NZQA 2F15A 4QAMB 4DPCX 1XGRA 1DL7H 2IDFA 4MG4A 4O02B 3HRPA 3CIVA 4JQ3A 5ABFB 3BRFA 4P2RD 3GBML 2FO4A 2YXGA 4AXKA 1GZHA 2IDUA 4A37A 2PKDA 2NX1A 3CHSA 1IAIM 4GW4B 2ZWZA 2X88A 2XH2A 3TN5A 4K3DL 1LNUB 3DSFH 5LN8A 2DIJA 3N1GC 3EX3A 4KQNA 4AZCB 5DRZB 1E70M 4FQPA 4L4TD 4XMXA 4UT9A 1E4HA 4JRXB 4AEHH 1SJBA 5F0PB 4QM1A 1A7PH 4IQJA 1IL1A 3ZGHA 1NELA 1T1ZB 1FZKA 1KBBA 5FX3A 4AIZB 4S1DC 4LBEA 5AAMC 3NJKA 1OGAB 2BVPB 1A6UH 3OVQA 1D2OA 2Q7AA 4LAQH 5D2VA 2P52A 4GRWE 4TL5A 4OIAA 5ACZA 4AEHL 1PHQA 5GIRB 3RWIA 5JQ6L 3LLDA 4LH8A 4YMPA 4GSDH 1AL8A 1SYVB 2O5ZL 4P3WA 5GGSY 4EVNB 2YL5A 1MF2L 3AACA 4KPHH 5AVWB 4TIMA 1JGVL 3K4AA 5I30L 5AQ0A 1I9JH 2AJXL 4HEPA 1W9PA 3FQYA 1ADDA 2QR0A 2VFEA 4WI5A 5BRZD 5B3JF 1Q38A 1F2XK 1BYOA 4NUJB 3T6VA 5HSFA 4LSSL 5KBDA 4PTNA 3QEUA 3SYAA 5AALA 2A9DA 4RESB 3SKOB 3RWFB 3GBEA 2AMXA 2O4EA 3EYQC 5IREA 1DSFL 2PSNA 2XZQH 3HS0C 4IJCA 2F58H 1W1B1 2FEEL 3U7WL 5J6HB 1U6AH 1D3HA 4GAAA 1E1FA 2MTPA 4HUMB 4LO9A 2X0YA 1GHSA 2R4RH 4FI6A 1H8NA 5CS7A 5T1KD 2HTLD 5IHSA 1PIIA 3LKNB 1KCZA 5F3HB 1RH8A 3LQZA 5C8JA 2C3HA 4F33A 2E6AA 3EO9H 2HXUA 2JLLA 2X3BA 1M7IA 2XT1B 1HL2A 4I1PA 3QHOA 4YWSA 3KVMA 3SY8A 1BQKA 5AZEH 1YDPA 2WZMA 2PDHA 4XBSA 1RERA 2HDJA 2YLLA 1ZHBB 1X7QB 3GSQA 4PPTA 4AZ8B 1L6WA 5CZXC 1B4TA 5G2IA 2QADC 2CKSA 3KGTA 4X8JB 3WE6B 3RZCB 1AR1C 2CJ3A 2BP1A 3VM5A 4HZAA 3HFYA 1H3UA 1QP1A 2H32H 4DN3H 3FYEB 1IZJA 3EUDA 4NZDA 4UXDA 3WNLA 2PO6D 2A0LC 4E41E 2GJPA 3SCWA 2GJ6E 4I5BA 4J5NA 5I15H 4HS3B 4I77H 4OIIL 4YSSA 5IM7A 4FG0A 3WL1A 5LXEA 1V8HA 2F6XA 2FPYA 1DJXA 2BMKB 4I0PA 4S3EA 3NL3A 2M2DA 2MQ0A 3TESA 3IGXA 4XD6A 2C19A 3NH7H 3OVUB 5CEXB 3DOIA 1BBDL 4EF3A 4N02A 4UTAA 4F57L 2DKUA 1BPVA 4P8VA 5J13C 1N0LA 3GIVB 2I9EA 1NCCL 4FERA 4L4LA 4O0ZA 1FH7A 1KB9J 2E6JA 4ZMZA 6XIMA 1FPTL 4QQUA 3W1ZA 5HATA 1O9ZA 4XVTH 2GVLA 3NFNA 1BKSA 4DUOA 5A2JH 2YXMA 3KWXA 4S11A 5D5MA 3P73A 3ZKND 3M0LA 3RY5A 1UIPA 3RPMA 5D7IE 4LDLB 3TMQA 3AB0C 2XGBA 2IH8A 3L4UA 5KSAD 3FTSA 1C5CH 1KJVB 1KIPA 3V16A 3W24A 4G7FA 3MOAH 3SD5A 5BVPH 4B5XA 4YSDA 5FYKE 4RW3A 1TRIA 4ZJ9A 5FYJU 2QHAA 4Z18A 1IT8A 5IK3A 1QG3A 1YDNA 4M8VA 4UU9A 3IFNL 5TQ0L 3XISA 4Y5YB 5JTWA 5GVJA 1RZJH 3PV6B 3H2CA 5BQDA 1EXPA 4ZPTB 2WO2B 3B83A 1HNGA 5I3HA 1B2WH 3K8KA 2W94A 4AKPA 3DKHA 3MNVB 1HJCA 2F8VA 4UTAH 4M93C 5BXRA 3PV7A 2HSAA 1G5GA 2R94A 4JFXB 1HCZA 4HCRA 2H9AA 3BW3A 2JB6A 3N85L 2A9AA 4HWBA 1XF5B 3WKZA 3U0TB 3LTVA 2JXMA 1WAAE 2PLCA 2WC4A 2ZUXA 3U57A 2PTTB 4RZCA 3SDDD 4P57A 2IO5A 3BP6B 4EI5D 3X14A 1INQB 5I09A 3VTMA 1HQRA 4E0RA 4BUGA 1OAKH 3AWOA 3MHFA 2DQGH 1R3SA 5JH1A 1UD3A 4ZQMA 3QQ3A 1I53A 2WAHA 1R6WA 4BR1A 4HN8A 4PJXE 5CGTA 5ECVA 1ZCOA 4K94C 4I3SL 2QSQA 1YN6B 4NUPA 4POZC 4NZUL 3BFQG 3B3BA 4P4KB 2C3VA 4X6FA 5I19H 1DXFA 2DSWA 2NVCA 4QXTA 4MA7L 5GISL 3DGCR 5IWLC 4NI8A 1LM8V 2WXHA 5KUMA 3FJ4A 1ADWA 1ZV5A 1UCBH 3LHYA 3FT4A 5EUOB 3EEGA 3EW3B 3PAZA 4JZOA 1ZA6A 1DQVA 1CDCA 4C6QA 1O5XA 3LI0A 3GLAA 2PD9A 3CHEA 5DSCA 1NM9A 3BLDA 1U2YA 2RGSA 2NPLX 4XCNA 1MIMH 1PZSA 5KSBA 1URZA 1SZEA 2TRSA 3CL7A 2YA1A 4OZHF 3DC8A 3G1YA 3S0PA 2XIIA 1NCUA 1XIIA 5D4HA 2QV5A 5FAJA 5HNNA 1V6VA 1US2A 3SDXB 5SWZA 4N28A 4JTUA 5D7LA 3T4AB 1N9PA 2X4RA 4OBTA 5E6YA 2ZUVA 4QP0A 2DWEB 2E5DA 2WYIA 3S48A 2GJXB 1FFOA 1U0QA 4NC2B 4WI8A 3VH8B 1SO3A 1ZTVA 3HMWH 4JHOA 3MNWB 1KCBA 1JPST 4BIKA 4JFYB 5DVPA 1F7BA 1XGTA 2Y88A 4HIJA 3CQKA 3OYZA 3L1OL 5I3KA 1BBDH 1UD8A 3CBWA 1A1MA 1BYNA 3EF7A 3EXTA 2GFTA 3C6EA 5D2LA 4NX5A 4A7QA 1LQAA 1U8HB 4DI8A 4EBQL 8XIMA 2YOAA 1CLOH 1AQFA 3Q06A 4MAYD 1YBQB 4DGVH 4AAJA 1O7DE 2QFRA 2IIJA 4IBZA 4LRTA 5L0QB 1XF2A 1TWIA 2COVD 4QFUA 5DHDA 2CBQA 3WMSA 2XH7A 4JPWL 2VZ1A 5E5MA 1DIDA 4N9DA 1W72B 3FSTA 1OD7A 2C7UA 5FCUH 3UWEA 2G0LA 3IVKA 3IUIA 1ZDSA 5FGRA 3GI8L 4M3HA 3SDXF 4RGNE 3AU1B 2FLBT 5IQOA 1X38A 4S3JA 2HUEA 2FB4L 2GUOB 4M7ZC 1UR8A 3W2LA 3WUEA 3FKUS 2PCPB 5D96B 5E4EB 4UFMA 3GSUA 5GZOC 4X9IA 3S6OA 4ZAKB 1VQTA 2E7HA 1HWGB 1EYEA 2ZQ0A 1IR2A 1B3VA 2UZYA 4HNUA 3TVMB 1TR7A 4ZX6A 3WNMA 1U42A 3GI8H 4KDTA 4OJFH 4X99B 5G2NA 3TNMB 1W3JA 4GFIA 2PTDA 5HJXA 3HHMA 1JVNA 4LGXA 4FXGA 5FUOL 2DL9A 4DX3A 4LU5L 3CAVA 3QQNA 3R06A 2Y1YA 4DKDC 1V0MA 5EU6E 3BZDA 3KPPB 3THMH 2ALDA 2WXPA 2EAEA 1RURL 2QADD 5AENA 5JOPE 1DIOA 4YSRA 2C3ZA 3W6MA 1KCRH 1FO0H 5BXFB 2P7TA 3VIPA 1OFBA 3QOMA 3OJMB 4BKNA 3N2TA 3UAJC 1PJWA 4ES9A 7REQB 2FZ8A 1QSZA 4K23H 5L4JA 4Q74A 2P8BA 1FL3B 4YAQB 1ZVYA 4WEVX 5BO1L 2H1PH 3CLFL 5C0AE 3TEXA 5D72L 1FQ0A 3Q37A 3FSWA 3ARGD 4MJ5A 2Y2TA 5C9JA 5AYUH 4N0YL 1DBJL 4Z7NE 1T5AA 2A3AA 3BUVA 1OOWA 1HHHA 1UWEL 3GMLB 4LVHB 1R7AA 4AZ7A 1YUHA 1A2YB 2J27A 2X7LB 2X87A 2F58L 4JJ5A 4NZTL 3EDDA 3FQUA 3T44A 4XO7A 4TOYH 3H55A 3RWEA 5LVEA 1R87A 1F18A 4EI5A 3O2DH 4HIEB 1ED3B 3SDDA 3BUDA 3W3BA 1OSZA 3L2IA 4RFEA 2AJSL 5CLTA 2YD1A 3SDCB 3CYVA 1BQ5A 1CCZA 5L88H 1A3QA 1INDL 2DVTA 4E8DA 3REQA 3V75A 1EEXA 4PG9A 4HFWA 5ES4B 3VOHA 2QMJA 5EH1A 4BH7A 5GRWA 5T5NG 1A4JA 4EDWL 3JWNE 4GFTB 4HUWB 3D3VB 1TVHA 3MO1A 1G4SA 5D2WA 1I2PA 2NQJA 3GSNA 3UGVA 1KQZA 3L3DB 2ZKHL 2V30A 2OQYA 3PY2A 2O5YH 3FO0L 5FF4A 4RGNB 5CSGA 1OFRA 5DY3A 3EHBC 3CDGB 4OCNC 1J1OL 4A7VA 5K69A 1CURA 3ZE0F 2UXFA 4PS4H 1AG6A 3AQUA 2Z93A 3P40A 5EN3A 2K3HA 3GLEA 3IJ7A 4QR6A 4PMEA 4QHUA 3S1UA 2ZOKA 1J8RA 3LQLA 2ZYIA 3IGFA 4MRCA 4FFZA 2H0JA 3QXTA 1FWHC 4PH6A 1JNLH 4TVSa 4P7LA 5D8WA 1QLEH 3CX2A 4E9WA 2VKZG 5EBWB 5FF7A 4DTGL 3CPLB 4TTDD 4ELMB 2F8QA 3GNPA 1M2VA 2WWKO 3RTLA 4NJIA 2VXVL 4R97B 4OT1L 2XIMA 1TE6A 2YDAA 4N2LA 4JRYE 2Y07L 1PS3A 1DWFM 4UIKL 1H3VA 1M71A 2CJTA 3OB0K 3PGFH 4ODTH 1CGUA 3B1TA 3CVHA 3FFDB 5FHBH 2GUUA 3G8EA 1EHNA 3KPRE 4RISH 3HW7A 1NFDA 5E9NA 1CFVH 3T1WA 1C5CL 4XO6A 2UWEF 4ZUVB 4G56A 3MLUH 4XBJA 4Z08A 3BGFC 3GM0A 3JV6A 4GO8A 2OT0A 2JI3A 4PS7A 3VA6A 4P3DA 4X7SL 4M6NL 1MFVA 3VMNA 5GS0H 1T66C 3M0VA 5AVRB 3B9KA 1V02A 1D7KA 4UBPC 5FYLD 2VEFA 3O6KH 1P53A 2NV9A 3ZFHA 3CFNA 4XMKL 3QUXA 3NSMA 2HZHA 3VCNA 5CKAA 3BQVA 3W2NA 3G0SA 3OLIA 3QCUH 3IDJB 3DXAA 1PNDA 1C12A 3L2LA 2PLMA 4JTJA 1HTYA 2DQDH 1NEZB 2DVXA 3N42B 4RFNC 1RZGA 5HI3D 1YTEA 4OV4A 3PPSA 1L6ZA 4NQCD 3T4YB 4WTXA 2OJEA 1LBLA 4R26H 5DDHA 2WMPB 3VFGL 2UZ9A 3NR0A 3WNPA 3ML9A 1AYRA 1QSED 4IGBD 4Z7QF 1SFTA 1LT7A 1X5MA 2CR6A 2JCCA 3HZKA 2J71A 1UR3M 3ORWA 3GVGA 2XWTA 3ES6B 3U8GA 3IRPX 5IW6A 1R17A 4NCC2 3WI9A 1E0XA 2RQEA 3LHPL 2AZAA 4PS3A 2V9RA 3P81A 3K46A 3TQKA 3FYPA 4NQEE 1AC6A 5C0BA 1MAML 3UCCA 3AS3A 2IH3B 2Q6WB 4WJEA 3NSJA 3RJQB 1LL6A 3E49A 5E56A 4DAGL 1GVSA 1ZAHA 4HTBA 4C7DA 2YEQA 3BVNB 3DX3A 5TDOB 4PWHA 5I1HL 2BJML 3KRSA 2FMOA 4X22A 3MXVH 2FPTA 1DE4B 5G4NA 3BVDB 5EN2A 5IWLA 1XYZA 3RX7A 2OMYB 1HNYA 3LTSA 1MAMH 4D6EA 2YD2A 4Z77B 3VI4A 4PS4L 3RWCB 5K39A 4GKNB 5LLIC 4UTWA 5AHFA 4WWID 2IKGA 4GXMA 1KG0B 1ZTXE 3CC5A 4HDIB 4TNGA 4WUUB 2VKWA 3GJEB 1ZQ5A 4ABUA 2X7VA 3I6RA 5DCEA 4QDGA 5CKGA 3SJ3A 1LD9A 2FEJA 2QJDA 1J4EA 1MMFA 1F3EA 4UB9A 3G5XB 4E6MA 1MUWA 1AMYA 2XIJA 4Q9RH 5DCBA 5J7CC 5J11C 4GW5A 2O55A 4Z1BA 2PP7A 4NM4H 3UDWC 5MP6H 4Z7WF 5CJOH 3NYZA 4FF9A 5GSVB 4GXUN 1TG7A 1XLLA 2OGYA 3M5VA 4XAKE 3NG5A 4MSWA 2H3BA 5D1QD 4Y9MA 5DEJA 4AD2A 3RURA 5MHBA 2HFGL 3O81A 3IJDA 1J6OA 2TSAA 1KV3A 5D1ZD 4BKLA 2YK1L 2NUXA 3WLRA 1WZAA 1IQDB 2WJEA 1JTTA 4PRNB 3RGTA 3RMEA 3GHRA 3I7QA 3LLFA 2IV9A 3IF1B 5C08D 5CJOL 5GGTL 4GYPC 5ANMB 1FVPA 4GH1A 5EO0B 2OZNA 4YX2L 3GC4A 4YWIA 4TYUA 3LQAL 1CNVA 1YNQA 1A5FL 2NRDA 3S5LA 1EOMA 1B1YA 4F8OA 2B7DT 1KSRA 3GBDA 3AWEA 4Q9QH 3ULSB 4PMJA 1BPLB 1UKSA 3AIEA 3SGEI 4GYBA 1JWUB 4NC0B 2PZ0A 3W2JA 3STZA 2V5DA 4O1BA 4I2XB 2GJRA 5ABZA 4AENA 2HVBA 5AKQA 4FULA 1MAKA 3QNYB 4U1IB 4W9GC 1QQDA 3K71A 4LVNC 4OZIE 3BLKA 1MZRA 1UZ4A 1XP3A 3NSNA 4MKSA 3NPXA 1QBMH 2XTSA 3V6OC 5E6UB 4XAFA 4FLHA 3EFOB 1XF3A 3NACL 1IC0A 4LU5H 3UPCA 3W0WD 5C1MB 3S1XA 3DOHA 4HIIB 4PYSA 1QLFA 1EUUA 2JGYA 1A7OL 1IEAB 2VQ4A 1OY0A 1FVDA 4QRPE 2B81A 2F61A 4EXAA 4H8WC 3KDNA 1EXHA 5F9WC 3C56A 1XLCA 5I3DA 1UA6L 2WZ6A 3CFUA 4LARL 4YHIB 1G9NL 1JDEA 4KRZA 4KOCA 4Y8DC 4XN7A 3VFUA 2Z92A 1J7VR 2ZSWA 4RA0C 3T81A 1BEUA 1S3HA 1BMZA 3Q2CA 5FA4B 5TF1L 5JIPA 3U0PB 1J1PL 1AO7B 5K59E 1TTQA 3GLZA 5IJDC 1ODAA 1AUSL 1WDRA 3VGFA 1CFQA 1KM4A 2EG8A 3W73A 2X4PB 3LZPA 4NZTH 4R4NC 2IDQA 1L6YA 2PU0A 3MSRA 1UXSA 4M7LT 4ML9A 3WL0A 5F2LA 1MFEL 4H8NA 2Z1VA 4MCMA 4NQXA 1POJA 3MDWA 2BLFA 3ARSA 4FQ1L 5GS2H 2WCAA 3ARDC 3MV8D 1K5NB 1SRDA 4OLZH 3H21A 5IB3B 3K2UL 4CC0A 4NAEB 5L88L 1UJ3C 3GTFA 3L6FA 3PABA 4EE9A 3T0WA 1JVLA 2WZPD 5E08H 2O4MA 4WEEA 2I1OA 3CU2A 4H9VA 3OC8A 3PB0A 5ISZD 2Q7NA 4ETQB 3Q5YA 1BQHG 4K7PY 4BQ9A 2ZRVA 2EIZA 4PJAB 3ABSA 5IFPA 3B37A 1NIUA 4FYQA 4IRJC 3IPWA 4IJTA 4JAWA 3C2RA 3AIQA 3OW1A 3VIIA 3WEMA 3ZBMA 4XN4A 3X3GL 4M9OA 5KS9E 4AUBA 4AHPA 2VHLA 3MBEB 1ZHKA 3T3PE 3BDXA 2Z7YA 3R12A 3QNZA 4P2OA 5DZLA 4HNTA 5C7XH 1XINA 1KPVB 1U8CB 2JMRA 5I74B 4KCWA 4MCNA 1JGEB 4FNPA 1R9FA 4UT7L 8PAZA 3H70A 1NEPA 4H7VA 4GSRA 3ZZQA 3I50L 3E2HC 2BDNL 3QP3A 4YDJA 1IGSA 3O07A 4S2BA 4Z0SA 1IV8A 1DDHB 1F1AA 1ZLEA 4YBQD 3QG6B 1CD1A 2O6EA 4F2MA 3MPCA 3P4LA 2OR2A 4O8AA 4H9MA 3M47A 1KB9K 3UPWA 4PG2A 4PCSA 4ERSH 2N56A 1BX2A 5M2FX 3O7UA 4BD4A 1K3UA 4MBRA 3UJTL 5SWZD 3QC3A 5LNSA 2RR3A 3UC2A 3H9ZA 9CGTA 3GNDA 2EC9U 1NOWA 1K4DA 2BSBA 3OPUA 4U1NB 3MRRB 1WCGA 3N13A 4JNMA 4GAGL 4DOHB 5I1EH 2WOQA 5JHLA 4LHUB 1UXWB 5KBMA 4OF6A 2MKWA 3VOCA 2YHGA 2WMGA 1B4JL 1ID5I 2AK1L 4BFIA 4HJJH 4JRXA 3QXDA 3N2MA 1QSFB 4NKIH 2HTKD 1KV5A 3TEYA 2D24A 2J62A 4UTKA 3NDOA 4PJIA 1KDIA 3WZ0E 1KM6A 5C5YA 2X2IA 5HVGB 5LIXX 3MBEC 5E03A 4ZMQA 4UINH 3GS6A 4N5UA 1F73A 1EIBA 3GMQA 1TWDA 1IKOP 1E9OB 3QUZB 5CIPA 5T3ZH 5BZDA 1LF1A 2QPXA 4IQDA 3WLSA 1U5HA 1GRWA 2DIAA 1XHGA 3I6LE 1H3TA 3I3EA 2J88H 3C2AL 4F91B 2ZTJA 4IFKB 3M44A 2YD6A 1FL6A 5BOZG 4MA3A 5HJGA 1AD9B 1WBZB 4QUOA 1A5UA 1RA5A 4HA3A 3NABL 5DFWH 4PRIE 4RAHA 5CJMA 2VOMA 2C9RA 3MA9H 4WY7L 2EPHA 4HCDA 3EKGA 1SYSB 1BZ9B 3NDYE 2J55A 2B1AH 3GPEA 4LCIL 2EG6A 2JJSC 3QBTB 3WCZA 3U2CA 5MHSE 3VINA 1BWWA 1C8QA 2G0KA 4I1NB 3BQ6A 4XP4L 2NXGA 3PAJA 1NDGA 1U8QA 3TJXA 2A74B 1GC1L 4L2YA 4PGZA 4ZW5A 2P3EA 3DIFA 3CHVA 1HHJB 2UZPA 3I9IA 3ROLA 3RPKA 5KJRL 1ZMYA 1YE6A 5DZVA 3VGDA 3C0JA 3QDJD 4I7VA 2Z7UA 1IE5A 3Q05A 2UZIH 2EACA 3FONA 4LVGA 4O1AA 4ZZ9A 2YPKA 4HQQH 1RHFA 5E8NA 2BNRD 2KHAA 2EKSA 1EV2E 2O26U 4IK6A 4X50A 1QBAA 5ETUA 1K8IA 2JB5L 3IFOB 3VXUD 2EE2A 4LIQE 4YHNA 3WNIA 2AQSA 1ETZB 1QTSA 1EL3A 4BELD 1MCFA 1IXOA 4YNGA 2XGZA 2C9SA 3QZLA 2X6VA 4Q9CA 4WCJA 4R96B 2X5PA 5TTRA 4HSAC 3N9SA 2CSPA 3HNSH 1ZHNB 2GBUA 5I24A 1ODZA 4LTSA 3LU2A 1PIGA 1I9EA 3WMCA 4DZHA 2IQ9L 3A6OA 5FF6B 4JGDA 1JYNA 5F2GA 1SU5A 1JK8B 3SODB 2QQNH 4EDXB 1NGQL 3CFDA 3MUGB 2NNXA 1UR9A 4QOKB 3KVJA 2J4WL 1ILSA 1EZLA 2AF2A 3NQIA 1IM3B 2D7TL 5IOKA 5ICYB 1NF7A 5CSUA 2F8XC 1E5YA 4MAYB 4Z1YA 3DECA 1H3XA 3Q9PA 3WO4C 5LKYA 3CXHJ 4UZGA 1FCVA 3B8WA 1HI6A 2A74C 4LL4A 3VRJB 4KO7A 3JZYA 1GSMA 3BZ5A 5BU6A 2PMQA 4BF9A 3DV4B 4JM4L 1NBZA 3DJ9A 4J8QA 3UDWA 4DEWA 1EJXC 3CWNA 4JEJA 1MCLA 4HOMA 4W85A 1RJQA 1IGWA 3FT9A 4F7EA 5IMMB 3VDGA 3LIZH 1VS1A 2LV4A 1SZRA 4MLRA 3O11B 3FB8B 5KYWB 1K7XA 1DVUA 4ENZA 1SOSA 4Q6IA 2J2ZB 1PDZA 3NDZA 4NQVA 1XICA 3FSAA 4IIQC 3I2CL 4LPTA 5C09B 5CMAB 1X6NA 1S9YA 2F19H 3GINA 2AEQL 2AXFB 3P4NB 2YPIA 5FD0A 4JRLA 2HKHH 4NQDD 2WJ5A 2LAGB 3GPSA 3CHPA 1XM3A 1BJ8A 3DGRA 1OAUH 4G5AA 5I75B 3FN9A 3KOWA 3C87A 6ALDA 2L7UA 3WKNA 4ZUSB 4BFKA 1PQZB 2VMCA 1WDWA 2WQDA 5TE4L 3GH4A 4IX0A 4C6KA 5AOKA 2GCYA 3N9GH 2DMCA 3FAXA 2NXZB 1CIUA 1XMEB 3TBBA 1XQKA 3CBKB 3GSMA 2QHRL 1HAUA 3BKYH 3IETB 3ME3A 3HS0B 4AE0A 1XF5A 4F58H 3ULUH 5FYJL 1NDVA 4NN5B 3CFKA 5CLXA 1HXKA 1MFBH 2CPUA 4M7LL 4OCXL 3GDBA 1HKKA 5FSEC 4P8QA 5EC1A 5IBLC 4K3DH 3PE9A 2F08A 1O4UA 1H5BA 5TPWH 1JNJA 4UTIA 3G1DA 4XIMA 3VXPB 43C9B 2X42A 2AV7A 1XB6A 3EYUL 5A8QA 1JAKA 3ENEA 1RIUL 2CK0H 1E1EA 1SUJA 4GY1A 1WKDA 1VACB 3OJVC 4ZQKB 1P6WA 2N3JA 5BZXA 1UEYA 5IB4A 5DQJA 3C61A 1Q9KB 1AZNA 3B7TA 3FQTA 3FN0H 2ZCKL 1XPYA 3NIDE 4JNYA 1MUJB 3A67L 1QKZH 2XWRA 3CFBA 3QQ4A 5EUOA 3AABA 3IGKA 3QO0A 4G83A 5IMOA 4IL2A 4JEQA 3WLNA 3B4YA 5CD5C 5C9ZA 4XD4A 2AJXH 4U1MA 2YUXA 1CYGA 3EH5B 3MPGA 4LVEA 3LZFL 5JIKA 1USZA 3NNTA 1T1XA 4X7TB 4AD1A 3HQ1A 3ARDA 2HWZH 3GZPA 1W1YA 5KSAB 4Q4SA 2DY2A 1NWUA 5SWZB 3MMUA 1RZKH 2JIXB 3GQFA 1OGAA 2BVPA 3CFJB 5GGSA 5FAAA 1JGUH 3QPYA 3S83A 5IVNA 3ARQA 1J8HA 3TW9A 4QRBA 4QT5B 2ISDA 1EVUA 1UM6L 4BFJA 1E9LA 1WV2A 2K4WA 5E4IA 4KWUA 3UTQB 3NQ7A 3B04A 4NPJA 1QFOA 2CUIA 4JFFA 4NZFA 4UT9L 1WKYA 1PZDA 4BUHA 2EYSB 2X12A 1KM0A 3CUIA 3EO9L 1TJRA 1K9FA 5JORA 1CI3M 5HJ3A 4P0DA 5DS2A 1M57B 3VI2A 2Q71A 4UMCA 4TUOA 4WUIA 5KS9A 1YEKL 2CJUH 3DIDA 1NC4A 1VGKA 2GSEA 4IJ3C 1WWCA 2BJMH 3RKDD 3ZMNA 4AC2A 1NBYA 2CRMA 3NJXA 1C8PA 1D5BA 2J1ZA 1AHMA 3EOTL 3VD3A 2C16A 3DHFA 3ZJ6A 4FSAA 5RUBA 3MBXH 3RDJA 3CX5K 4ZW3A 2FIKB 3B9EA 5I76B 4MAVA 5G55A 3QJFB 1GPOH 1AZUA 1OQOA 4GKZB 5IROA 2HX9A 5EZOL 5IQLA 3LRGA 3U4EB 4RZ6A 4I8YA 4TUKL 3M43A 2G60H 5JXEC 1D9KD 4MAUL 3SE3C 1TJIH 2BWQA 3U6XA 4DGWC 4O00A 1X5JA 4BWWA 1GT8A 4UTLA 1B0GB 2ZRYA 5F0LB 1ECZA 2DJMA 1RK0B 1XIDA 1NICA 3DBNA 2VXTL 2MPAL 4N2HA 1W8NA 5KINA 2X4NB 4M5ZH 2C14A 5HPMB 5K93A 1NMBL 3FTYA 3ZDYB 2JF6A 5KVFH 4G7YL 1DWJM 4H0LC 4J35A 3HIJA 2Q3AA 4RMSA 3DFYA 3ROOB 5L4IA 2TYSA 4WU7B 2D2CC 3REVA 4XRCA 4LLMB 4DEUA 5J5RA 3IVUA 1YAIA 2CDEA 5JH2A 1BFOA 2E8ZA 4WY7H 2W1NA 4YX2H 1Q0YH 1I8KB 3MXWH 4KAQH 4OKVA 3AGVA 3NO1A 1KNOB 3Q2NA 4M5ZL 1NAMH 2XKNA 3OHXB 2X9WA 1V7NH 2VO5A 2WXJA 5EORH 3VFMA 1LEIB 1WT5C 5E2VH 2E68A 4V2BA 2YB1A 4PJ9C 5IJKC 3DUGA 3GYCA 4OF5A 3NGBB 1YUHB 4U1HB 2FJKA 4ZGYA 4YDMA 1IILE 2MNJB 1A25A 3NFNB 3OKYA 5DC9B 2EXYD 1HJUA 3S8HA 5AW8B 2WZEA 3M17A 1KEMH 2I24N 5CBAB 5DBTA 4XCYB 4AEIH 3P9MA 1PLCA 1A6AB 1QEWA 4TUUA 5I0VA 3IV3A 5IFAH 4ZTOL 4LPUA 3WY4A 4D8ZA 1E30A 5EORL 1AGEA 1ANUA 2P47B 3OKOB 3OSKA 1FLRL 2GSIA 4GPVA 4K23L 3SDCA 3LEPA 4R88A 4DJEC 4F2BA 4GX8A 4LANA 2NY4C 1FWXA 2PYFB 1R85A 1JGUL 1AH0A 2CLLA 3GGWB 1UR4A 5HVWA 1D9KC 3BH9A 4PJEA 2JKSA 3D0VB 4QTHB 3MNDA 1J5CA 3MLRH 1RL1A 2X9ZA 2R9RA 1KBJA 4JFXA 3LHTA 4H2HA 3PDDA 4RDQF 1FNLA 4ZNEA 4KFNA 1DQIA 2Z7ZA 5B38A 8RUCA 2YYUA 2XZCL 4OB5L 5TDPA 5HYSG 1WDPA 3MCKB 3VABA 3P9WB 3NVTA 3GBNH 3QM3A 3URAA 1D5IH 4GACA 4W7WA 4U1SB 4APQC 2AQWA 2J7BA 3B3IB 4CGUB 5E4EC 4E0RB 1HKJA 3B2VL 3CZSA 3A9BA 2VN5A 2O0TA 2ZP0T 4I7UA 2IAND 4MD0A 4XQ6A 2DQCH 4QD2E 3BE1L 3EPMA 1YX1A 3QHZH 2DDXA 2FTWA 3FO0H 2WQXA 2N1KA 1G87A 5GJSL 3TC7A 4KRPB 2E25A 1PBYA 3H9SE 3SQRA 1I1YB 4X6FB 1F3RB 4FG4A 1V3JA 2F9RA 1PYWA 4EUPA 4JDVA 1RY0A 3ANUA 4G5ZL 5EA9A 4ZA0A 5I6LA 1EO7A 5ADOH 1KTCA 1UG9A 1K8ZA 3M4HA 3N2BA 4EK7A 1VFAA 2F19L 1X3DA 2HLAA 3HB3D 3M1OA 3OJ2C 3QULB 4PJXF 1FHNA 1S4IA 3SIMA 4LPYA 4F48A 1UHVA 2QGYA 4H7ZA 2VXSL 3VCLA 4LV4A 2HFEB 4RE2A 1UCTA 3BXNA 3OJDB 1IGIH 2VDNH 4IBYA 3V8OA 4GI4A 3FUDA 5A6JA 5CAHA 3YPIA 4FTVA 4TM9A 2XISA 4XVEA 5MKGA 4TSBL 1VGEH 3RGBA 4AUYA 1H2JA 3RWDB 1TLMA 1W3HA 1M5WA 2ITCA 5F9OL 2BFVH 4U7KA 1NC2D 2H3DA 1NEZA 3LIUA 4CVXA 4JVPA 4U4IA 2AJYL 2DW6A 2XPZA 3GNRA 4OZFG 1KGJA 3I65A 3MI2A 1UJQA 5DHVH 2BERA 3QEHB 2UZXA 4LPWA 3QT2A 2FZNA 3PULA 3PWJB 4H4NA 3SJVB