4JFWA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2s,3s,4r,5s)-2-[n-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 162
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jfwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jfwA01
3WF1A 1W9PA 1W1VA 1U33A 3U7VA 1BQCA 4W85A 1KTCA 4BQ5A 5D8ZA 3LMYA 4FNRA 4NX0A 1GQLA 4M81A 4BF7A 8A3HA 2OYLA 1D7FA 1W9BM 1XYZA 2J7EA 3VIPA 2QLYA 3WD0A 4CVUA 1SFSA 1R8LA 3D51A 4W5ZA 1QI2A 1J11A 3ALFA 1H41A 1OD0A 2O9RA 2B31A 1CPUA 4ZXLA 2HISA 1JAKA 2D24A 3WNOA 1WB0A 1WZLA 3WDIA 5HBFA 1ZL1A 4AD5A 4YPJA 3WDJA 1FOBA 1VF8A 2BS9A 4DWSD 2ZOXA 3AISA 4PUEA 3N11A 3VOCA 2VR4A 3WNLA 3VIGA 5E6YA 3VDCA 1V02A 3H53A 3GBDA 1CXKA 2WWDA 2EEXA 3ARYA 3RO8A 5JIPA 1UR9A 2ZIDA 1E15A 5A6LA 3BUQA 4D6DA 3WD4A 3OLGA 2FHFA 4J28A 1W2VA 4IPNB 3EJPA 2XVPA 3GXPA 2DT0A 1E1EA 4UQAA 4HOZA 1C90A 1PX3A 1GQJA 1BYDA 3LPGA 1E40A 1KGWA 3ZT6A 3TTOA 2ZX7A 3MKKA 2EBNA 2E9BA 3RILA 1DWGM 1H11A 5CZKA 1PX8A 4Z2IA 2A3CA 1JZ4A 2J8FA 3DX0A 4RE4A 3TONA 3BUBA 4P8WA 2FDMA 2WHJA 4TX8A 4WKAA 5A95A 3ZT5A 4P7NA 2VX4A 2BHYA 1JIBA 4AD4A 2FE0A 3ARQA 5E09A 4C7FA 5E1QA 1FFRA 4Y7EA 3T08A 5ECUA 3FAXA 3WD1A 3GH7A 2BY0A 4JHOA 1VFMA 3O9NA 3AHVA 3HMCA 3L4UA 4CN6A 2ZX9A 3L4TA 2EPKX 2VCCA 2PWHA 3PTMA 3LPPA 2Y24A 4DUWA 2YA2A 4J7RA 1M01A 3GXNA 2VTFA 4IPLA 5A6MA 3QHMA 3AZTA 3ZJ7A 1SR0A 3WKZA 1K9TA 2YA0A 1CZ1A 2GDUA 1AVAA 4PCSA 4AWEA 4Z2HA 3VSTA 5CPSA 3WY3A 4R5EA 1H2JA 1NP0A 3CZJA 1BF2A 2WZHA 4QLLA 4XB3A 6CGTA 5E6ZA 4UNIA 4W8BA 1CXIA 3GZAA 1CGWA 2YDRA 3RCNA 3NDYA 3DHUA 3D4YA 1EDQA 3GH5A 1SMDA 1TUXA 5I0DA 2QV4A 3VIFA 1OM0A 2WCGA 4RL3A 1PZ3A 1UH4A 2IUZA 1G94A 1RD6A 1NQ6A 2J7BA 1H5VA 1TA3B 1TQUA 4AZ6A 1QWNA 2DQXA 3AHZA 1C92A 4PMOA 1WE5A 1K9FA 4LXFA 1MW3A 1GZJA 4UCFA 2X2JA 2D0HA 4QDMA 4U3CA 2EO7A 5E0FA 4ZENA 3WF3A 7CGTA 4OJYA 3WMCA 2XYLA 3VUPA 1TVPA 1GW1A 5FOOA 1GUVA 1AQHA 1M7XA 4ACYA 2J7CA 5AYBA 1UR8A 5ABGA 3T2PA 1EA9C 3OZOA 3ARZA 2VNCA 2UY2A 1UKTA 2C7FA 4PTWA 5A8QA 5GNXA 2Z1SA 3WL1A 1GQKA 3CZNA 1HJWA 1EHNA 4OOUA 3SUWA 2DSWA 1UKPA 3LX9A 1V3MA 1OT2A 1EXPA 1MQRA 1PAMA 4HA1A 5E70A 3IGUA 1B3WA 3AXHA 3SCWA 3DX3A 3AS3A 3B8SA 1V3KA 3GM8A 2G8ZA 3WIJA 1J0JA 4OZOA 4L4PA 3RPMA 1H49A 3IK2A 4GQRA 4F9JA 4OBSA 4E4PA 4QFUA 5IDIA 1UWUA 3ARTA 3TTSA 1SYTA 1FA2A 4Z2JA 1OSEA 1KBKA 1MFVA 1KFWA 4S3KA 1JNEA 3BCDA 1HX0A 1QHZA 1J0KA 2PBOA 1X1NA 1VEOA 3RM9A 2BXZA 1ODUA 1B1YA 2BHZA 4AZHA 4RE3A 2XVNA 2ZXAA 3PZTA 4XZBA 4PMRA 2XTKA 1UD4A 3FNDA 1JI2A 3VM7A 2GSJA 2WCAA 3EDJA 1E6SM 3K4AA 5D9MA 2X2HA 5BRPA 1BVNP 2F7RA 1V03A 1E3XA 1LG1A 1UOKA 1VBRA 1XHGA 1PEZA 4B15A 3WEZA 2AOSA 2WZIA 1OBAA 1LL4A 3WUGA 4AYSA 1C93A 1HP4A 2XWDA 1C7TA 3DYMA 1X6LA 1UWSA 4KRTA 1TG7A 3CMGA 1QX1A 2G4FA 4FNPA 1B3VA 4GPNA 1E6XM 3AZRA 1J01A 3S5ZA 2W63A 1EGZA 4JFUA 1XCWA 4JKMA 3PZUA 4R27A 3KL5A 1R7OA 5D8WA 1GJUA 4NXKA 4MB1A 4LGXA 5ABEA 3CHEA 1UKQA 4K68A 1PIGA 1TQVA 3KLLA 4WK9A 4V2XA 5LA2A 1EO5A 4AEEA 3LXBA 4MNJA 1BG9A 3KL0A 3UCQA 3BSGA 4N0RA 4QCEA 5DT7A 4HPGA 3MUIA 4B16A 2GJXA 3L2LA 5HPOA 4HTYA 3EMQA 5CGTA 1BGAA 1ISYA 1QVBA 5A8OA 3WH5A 5C8BB 2VQUA 4M1RA 1JG9A 2G3MA 3HJEA 3OA5A 4WKHA 1H0GA 4DUXA 3ZMRA 1NH6A 2DEPA 1GOQA 2OLHA 3I3BA 3A24A 1PZ2A 1V3HA 2V38A 2PC8A 2PF0A 4F66A 4D6JA 3WMSA 3PZVA 3O2LA 4MAZA 4V28A 2VVNA 4AMXA 2W91A 1UR1A 1NOFA 4URIA 4TTUA 5BXPA 1A3HA 3MO4A 2GUYA 2BVYA 4W87A 3NSXA 2CBVA 1IV8A 1UA7A 2XHYA 1ZBVA 3CH9A 3AHYA 1R34A 3A4XA 3HG5A 4ATLA 4J3SA 1VFFA 3PZNA 4QLJA 1RP8A 1X6NA 2X8RA 2IXVA 3EMZA 3N13A 1BYAA 3NCOA 2VMFA 5JIWA 3UR8A 5A8MA 1QPKA 2JEQA 3ECQA 1LWJA 5CGMA 1FHDA 3NYDA 2BV9A 3VILA 2WHLA 4PTVA 2VZUA 3CZKA 1QI4A 3M46A 3VGHA 4TOQA 2ZUVA 2VUYA 2YBUA 3BUPA 2WZEA 1KGXA 1GQIA 1KCKA 3ZR5A 3AOFA 1CBGA 1JDCA 1XH2A 2VCAA 4D6GA 3W82A 2O9TA 5AYIA 1EHAA 4FNSA 3AIUA 4BCEA 4UZSA 2W66A 3DX1A 2E4TA 2WMKA 3EBVA 1YQ2A 3PTQA 1HVXA 2E8YA 2XVLA 1G01A 2J62A 3AICA 3MS8A 4JHZA 5HNNA 2WKGA 5HXMA 1BYCA 4TVDA 3MSGA 4D1IA 1PBGA 1VJZA 2E3ZA 2F1BA 1TZ7A 2XG9A 2ZUMA 4EANA 1O7DC 1A47A 3ARXA 2FHBA 1MXGA 5IXEA 2A3EA 1VIWA 2BY2A 2JE8A 4GZIA 1BVZA 4UQBA 3AXIA 5CLWA 3A4WA 5FCZA 3QR3A 3AIVA 2D73A 3K8MA 4PN2A 3EDDA 4U3AA 2X05A 2X2YA 1W3HA 1WDPA 2DT3A 4UFLA 4GI9A 1DWHM 1EDTA 1QNOA 1DP0A 2VURA 4FLRA 1KBBA 3EJRA 4ZFMA 3L4ZA 3RJYA 1ZJAA 1XH1A 2ZUTA 1UD8A 4J27A 1XD1A 3MV11 4GXPA 4AD0A 3LPOA 1EOMA 3N17A 4HPHA 1V6VA 4J3XA 3WBAA 3EJTA 1XSJA 1MFUA 2QHAA 3D4ZA 1HL8A 4KGJA 1V6WA 2WWCA 2XFYA 1KWGA 1BFNA 3FW6A 3AIRA 1JFXA 3VIJA 1V3JA 1GOWA 1Q6FA 3J7HA 3CBWA 4Z2KA 3CUFA 3WH7A 5KZ6A 1WKYA 4WLCA 4WF7A 2YBTA 2VVSA 3ZM8A 3OGRA 2J74A 2A3BA 2GJXB 1MQPA 3VDHA 4XZWA 3VM5A 2D0FA 1TVNA 2J7HA 1R7AA 5A2CA 1K6AA 3BLPX 5AY7A 3SCOA 4TUFA 3VDBA 2WW5A 1WDRA 3WEOA 3SCVA 5M03A 4BQ4A 4UR9A 2Y5EA 1WDQA 5F7UA 3ZO9A 2D0GA 4H8VA 1H1NA 4F79A 4NRSA 3B9EA 2OYMA 3BCFA 3I3DA 3WY4A 3CZGA 2VX5A 4CD6A 1R47A 3VIMA 2Y8VA 2EACA 1K9DA 3WDHA 2PB1A 4ZXOA 3DC0A 1FH9A 4IM4A 2WMIA 1NWSA 4JKLA 3ARRA 1MW0A 2GJRA 1V6UA 3CUGA 2RGMA 5DMYA 1GORA 4FLSA 3DYOA 4EK7A 2VL4A 4UFJA 2XN1A 3HN3A 2J4GA 3VKKA 3PZGA 2YLLA 2EABA 4DO5A 3WFZA 4D71A 1E70M 3PN8A 5CXPA 3TTYA 5A3HA 4AEFA 1HJXA 2VR5A 1US2A 4D6HA 2V3GA 2G3NA 4JFSA 1GOKA 1UH3A 4CKQA 2OWXA 4C7DA 2WAGA 4BQ3A 5IHSA 4X0VA 1DWIM 4JAWA 1GNXA 2YKKA 4AZGA 1UWTA 4CVWA 3T0DA 2EJ1A 2CERA 3WL0A 3L2MA 3ZR6A 1CWYA 2WC3A 3EJSA 5I2UA 1HKMA 2CBUA 4EKJA 2DT1A 4HZ7A 2YOCA 2ZUNA 4DO4A 4HZ6A 4ATDA 4N42A 2VQTA 1W9VA 3PZOA 3VNYA 3VX1A 4E2OA 3S6TA 4WIWA 4PUDA 2D3LA 4F9DA 1LL7A 3N12A 4FLOA 2VI0A 9CGTA 4AIEA 4PSPA 4PBGA 1E73M 2WYSA 2ZE0A 3KWXA 1W91A 3WH8A 2BVTA 1KR0A 5IFPA 2EPLX 3ARSA 1JL8A 3L4VA 3SCSA 4H8HA 1JYWA 4KH2A 2WXDM 1JZ7A 1E0WA 3UETA 5I79A 1WZAA 4CN4A 3DX2A 1CGXA 3MUZ1 3MANA 4OGZA 3VGDA 2YFOA 2YL9A 1GCYA 4MJ2A 1UHVA 1HWWA 4U2ZA 1HJUA 3T2QA 1T0OA 1V3LA 2ZX8A 5CPTA 1UR0A 3W28A 2VZTA 3VTRA 1Q6GA 5A2BA 1HN1A 5BRQA 3BUIA 4UFIA 1Z32X 3THDA 4JFVA 2QPSA 3K1DA 2WLZA 1XRVA 4EAMA 1UWQA 4UOZA 5CJ5A 2CHOA 2YDQA 3OB8A 1W1TA 4AZCA 1E6NA 3U5UA 2V3FA 4UQDA 3FY1A 4L4OA 4HZ8A 1OGGA 2J77A 3M6DA 2UY3A 3POHA 4LYRA 4FLQA 2FGZA 2CBJA 1OB0A 1XCXA 3OLIA 2E0PA 3CZSA 1NWTA 2WNWA 3MMWA 2QMJA 1ODZA 1B3XA 2BFGA 5HOSA 3GH4A 1TFVA 2DPEA 1HKKA 3VD5A 2CPUA 2J7FA 4H04A 2OWWA 3L4YA 1UG6A 2FH6A 1FH8A 2WPGA 4J3VA 2E40A 5I3DA 2NW0A 1VBUA 4MTVA 2OSYA 3AMGA 3HG3A 2WMIB 3W53A 3OIHA 4D6EA 4UQ9A 4KWUA 3WF4A 3ZSSA 3EYPA 1ITXA 1LF1A 4JL2A 1J0ZA 1HXJA 1JZ2A 3ZSTA 2CXGA 3DHPA 1DHKA 2BHUA 1VFUA 1W9UA 2QF8A 4OBRA 3ZJ6A 2ZXQA 1WCGA 2WBKA 1E4NA 4AXNA 3BMWA 4CCDA 1XYFA 1KQZA 4JKKA 2EAEA 3UG5A 3RMEA 2WKLA 3W27A 2XIIA 5DF0A 3WEMA 2PWEA 5E9AA 1DWFM 1VENA 1B9ZA 1J18A 2Y8KA 5A69A 1V0NA 4D6CA 3KE0A 5FKYA 2VZSA 3H54A 1C8XA 1EO7A 1U2YA 5GQBA 3QOMA 1HVQA 3BGAA 4CU7A 2WMJA 4HU0A 2WBGA 1KXVA 1IT0A 4PTMA 4D1JA 2X09A 2ZWZA 3ZT7A 1CGTA 4PMNA 1UYQA 3VGFA 1MWOA 4W7VA 4GZEA 2BY1A 3HU7A 3SUTA 1NOWA 2CNCA 5A6KA 3VSUA 1R85A 4AW7A 1J0HA 1Q6CA 3SUVA 1HJVA 4AMWA 2OWCA 3W37A 1XD0A 3CTTA 3CMJA 3AYRA 1F4HA 4W5UA 4HA4A 1JXKA 1E6QM 3TOPA 2YL8A 4JL1A 3DX4A 3WD2A 2WLYA 1DWAM 2DSUA 1E6PA 1FP9A 3WDRA 4NI3A 5D9PA 4CD8A 3GNOA 2E8ZA 1EDGA 4MB3A 3ALGA 2W92A 2WVTA 3ZOAA 1EQCA 4QP0A 3VD4A 3W81A 3SEPA 3ZJKA 4HU8A 3NJ3A 2XFFA 2AAAA 5DFAA 3W6MA 1I1WA 2XGIA 1QNRA 1QNSA 3MUAA 2UY4A 1JDAA 1V08A 3QGVA 1US3A 2TAAA 2W67A 4AIUA 1Q6DA 4CGTA 4FF5A 2Y4SA 3N9KA 4OKDA 2XWEA 3T09A 1HP5A 5A6BA 1KXQA 5A6SA 3AS1A 1GHSA 1JYNA 4M82A 4BQ2A 4AZCB 4OOZA 5D4YA 4AISA 5A8PA 1HTYA 1KCLA 4GZJA 1E9LA 4CD4A 3WQ4A 3BVXA 2DH3A 4C7GA 1W3KA 1J10A 2WANA 1CTNA 3VD7A 4ZEPA 1L0PA 3ARUA 3UESA 2BVDA 1ISWA 4J3TA 2YA1A 1KXTA 1NWRA 4IISA 1GOOA 5AC4A 3GXMA 5HPCA 1IZJA 4F8XA 2XM1A 1RH9A 6TAAA 1OIMA 2V5CA 4YHEA 5ABFA 4XX6A 3VSVA 3OBAA 2XM2A 5I6SA 2CITA 4DM1A 4P8VA 4D6IA 5M3WA 2J7GA 4AD3A 3WELA 1ZU8A 2C0HA 2V5DA 3DYPA 4YN5A 3BAWA 1BAGA 3CZEA 1UD5A 2PWDA 1CGYA 1SZNA 3KL3A 4X0NA 2ESCA 1JZ6A 3IANA 2WVUA 4AZBA 3M7SA 1E0VA 3VVGA 2ZX5A 3AI0A 3WY1A 4AZIA 1HL9A 1QBAA 4ATWA 5I77A 1ISZA 2WVVA 3JUGA 1L8NA 1B0IA 1BYBA 3VPLA 4PCTA 5EB8A 1UD2A 2DIJA 1UQZA 1U30A 1ZBCA 4H8UA 1UZ1A 2XJ7A 4UFKA 2ZUUA 2WCSA 3TTQA 3VMNA 1AQ0A 1E56A 4HMEA 1J0YA 4IUGA 2FH8A 3AIQA 3CUJA 1CXHA 2GDVA 3CUIA 1JZ3A 4CD7A 2XUCA 1OCQA 4MPKA 2VZVA 3N15A 1R33A 2D22A 1ZJBA 1MW1A 1MQQA 1ZBKA 1CNVA 4H7VA 1CLVA 4X9YA 3MSDA 2CKSA 4AZ7A 1FFQA 4DWSA 3GXTA 2WC7A 3NIYA 3KZSA 1V0KA 1UKSA 2YFNA 3SCUA 1RPKA 4HOXA 4NXSA 4WJXA 2JF7A 3SUUA 1R75A 1C7SA 1LJYA 1V3IA 1ZBWA 4HA3A 3WF2A 1ZS2A 1C3FA 4MNLA 5CSUA 2XN2A 3H55A 5A94A 3SCTA 4WSKA 1K9EA 4WSJA 1E5NA 3F5LA 3LXCA 3ZJ8A 1EIBA 1UD6A 1UASA 2JFEX 2WMGA 4M24A 1XH0A 4ML4A 4UOQA 4P8UA 3PBGA 1OWQA 1GPFA 1HKJA 2DT2A 4HMDA 4XV0A 3SCPA 3WSUA 1CXFA 1TQWA 3L4WA 3AS0A 4E8CA 4JFTA 4MADA 2VX7A 2JEPA 4P7OA 1C8QA 1NWUA 3SCNA 1J0IA 1UWIA 4D6FA 4A3YA 4P7QA 3IJ8A 1BSIA 3BVVA 2F18A 4W7WA 1E6ZA 4AC1X 2XVKA 1UWRA 3N18A 1WO2A 1OGBA 3WNPA 3BLBA 2FHCA 3S5YA 6A3HA 3A6OA 5C70A 2F2HA 4CCEA 3BH4A 1MYRA 2IGTA 3BAIA 1JD9A 1QBBA 1TQSA 2MANA 3G6LA 3K4DA 3AZSA 1E43A 5ABFB 3K8LA 1KTBA 1JZ8A 1W9DM 1QW9A 1G9HA 1UZ4A 3WENA 4FNUA 1HJSA 1WDSA 2J7DA 4BA0A 4FNTA 3VIOA 1VRXA 4LPCA 1E3ZA 1W2PA 5JBDA 1W1YA 3WH9A 1H09A 2CETA 3WMBA 4HP5A 2VC9A 1M53A 2OYKA 4GIAA 3LRMA 1W3JA 4CD5A 1R87A 1YHTA 2F8QA 2WC4A 4E8DA 3VU2A 1XSIA 2XGBA 3QOKA 1GOMA 1QWUA 3MMUA 3CC1A 3CIVA 4U33A 2F1AA 3W24A 3BAKA 4M56A 5A1AA 3VX0A 5DO8A 1QNQA 4ZE4A 3S2CA 3EJUA 2X0YA 3EMCA 1G1YA 2WVVB 2OW7A 3WDPP 1W32A 2DIEA 5CSYA 1LL6A 1CGUA 3UERA 4W89A 3VIHA 3GNPA 1VJSA 2ZXBA 2ALWA 4Q7NA 3OGSA 3QHOA 2WHKA 3WNKA 1OINA 2XFRA 3VDAA 3EDEA 3AIEA 2ZX6A 3IAQA 1CXLA 5M5DA 1VB9A 1QOXA 1W9XA 3PZQA 5GNZA 1JZ5A 1E4LA 2UY5A 2PWFA 4J3WA 3WFLA 4J3UA 2WB5A 1JYVA 3W4RA 1KWKA 3ZIZA 3VD9A 4UFMA 1CIUA 4M80A 1ESWA 1PIFA 3BXWA 4DWSB 3TV8A 3PZIA 4GI6A 3FXYA 3VGGA 4AZ5A 2WHMA 4YHGA 1GVIA 2ZUSA 3MI6A 3PTKA 3MU7A 2WK2A 3WBEA 4A3HA 1GJWA 4S3JA 3IAPA 1WZKA 2UWFA 3CHFA 3U57A 4DWSC 3N04A 3O6AA 2NSXA 4AIOA 5I23A 3VIIA 3F5JA 2J75A 2J25A 3SURA 4GKLA 4H41A 2DDXA 1EH9A 1ISXA 5C71A 2Y2WA 4HMCA 1QNPA 1TCMA 1QI0A 1R86A 3CGTA 3SCRA 2EPOA 5FL1A 5FIPA 2ZWYA 1BLIA 2BY3A 4LQ1A 4OIFA 3MUY1 4HOWA 1CLXA 1E4MM 4GQQA 3WNMA 1O7AA 3GNRA 5LYRA 4ZE5A 3TP4A 1KXHA 5CPQA 5JBEA 1NM9A 3AROA 5AC5A 3L4XA 1TQTA 2CBIA 3AMKA 3EDFA 1CXEA 1VFOA 5BYWA 4CU6A 5EMYA 3GTNA 1LWHA 4PSRA 1E0XA 1DEDA 4U2YA 4MB4A 2NT1A 4M8UA 5EBAA 1BGGA 4PMDA 4H2CA 4BS0A 1GHRA 2A3HA 2X2IA 4JCMA 1G0CA 4PMXA 4P7RA 2GK1A 2IXUA 3W26A 7TAAA 3AJ7A 3WY2A 2W5FA 1B3YA 1PPIA 3DECA 2XSAA 1UH2A 1KR1A 4MNMA 3MMDA 5A6JA 1BTCA 4PMQA 1WP6A 3AMLA 3W0KA 1LLOA 1AQMA 5EFDA 2GFTA 3AIWA 2OSWA 2VZOA 1XC6A 3K8KA 2WM0A 2JIWA 3F5KA 4DUVA 2CYGA 4JZ5A 3WUBA 4MJ4A 1B30A 8CGTA 1WAWA 3WQ8A 3VGEA 2EPNA 3VD3A 4GI8A 3ARVA 1KGUA 3A4AA 2OSXA 4PTXA 3AHXA 1EQPA 2ZICA 1OD8A 5KEZA 4TVUA 2VCBA 3BVWA 3W38A 3AHTA 2VT0A 1B3ZA 1E72M 4NSBA 2CKRA 3W25A 4AY1A 3FAWA 2O9PA 3NDZA 3THCA 3NSMA 3RM8A 1NOUA 3IJ7A 1D3CA 4W86A 2W4XA 3HG4A 3B9AA 1W1PA 1O6IA 2QMKA 2X0HA 3WN6A 4MAVA 3WF0A 4Q22A 1I75A 4CCCA 1Q6EA 3OGVA 5BCAA 2F61A 2EXOA 4PRWA 1CYGA 2QPUA 3T0AA 4PEEA 2BXYA 3U7BA 1JXJA 3VNZA 4JFWA 1Y7VA 1CEOA 2DH2A 3TA9A 1GVYA 3BAYA 2F7PA 2CHNA 2WVSA 2W61A 3VIKA 3SCQA 2YJQA 1DWJM 4W8AA 1UR2A 5CLTA 4FMVA 4PYSA 1E6RA 3OG2A 5FD0A 2GJPA 3AQUA 1GOIA 3ARPA 4AMCA 3CV5A 3KLKA 4TTGA 3AYSA 4PMVA 3CZ8A 1M03A 3WQVA 1QW8A 1NP2A 2EADA 2OW6A 1TMQA 3WUFA 1V02E 1J12A 1MXDA 4KGLA 1HT6A 1KB3A 1G5AA 2Q8XA 1DTUA 3K46A 3SIMA 3T2OA 1Q4NX 3CZLA 3HZ3A 1UR4A 3A47A 3IJ9A 1CENA 3II1A 1FP8A 5A8NA 2HVMA 1H4PA 2A3AA 5CG0A 4UTFA 1V0MA 2DSKA 4LYPA 1BPLB 4EE9A 2DSVA 4NZJA 4FNQA 1UD3A 2DGAA 4M29A 4QLKA 4W88A 4ACZA 1PS3A 1MW2A 3LXAA 1ISVA 3NSNA 1WNOA 3WQ5A 1OT1A 1QI5A 1JD7A 3A23A 1UUQA 5M17A 4NRRA 3CUHA 2WSPA 4KRUA 1WPCA 3W6LA 1HIZA 3M07A 7A3HA 3GXIA 1RP9A 2J79A 3SUSA 5I78A 2Z1KA 4U5KA 2E9MA 4QAWA 1V0LA 2YDSA 5TD4A 4UQEA 2F7OA 1E5JA 2D1ZA 3UEQA 2BNJA 4W93A 2VRKA 1F4AA 4A4AA 4MB5A 2WMFA 2YIHA 2GK1B 1BG4A 4V27A 1PJ9A 3RIKA 1H3GA 5FL0A 2PWGA 3RDKA 4UOJA 1H0IA 2VJXA 4D72A 4W8LA 1VAHA 3ARWA 4TXEA 3BMVA 2JALA 1NARA 1I1XA 1VEPA 1ZB5A 5CQ1A 1TE1A 3EDKA 3A3HA 4WKFA 2J78A 2WSKA 3DDGA 3LPFA 3WQ6A 4NZCA 4TVCA 3PZ9A 2PI6A 3OLEA 3I3EA 2X1IA 1BHGA 3UR7A 4P7LA 3NUKA 2ZXDA 2CIPA 3CPUA 2XIBA 3FHQA 1JNDA 5D9NA 5IFTA 3WDQA 1UKOA 2CESA 3AMDA 3BVUA 3APGA 4LX4A 1AMYA 3E1F1 1HKIA 1M04A 1OIFA 2VRQA 4TX6A 1HXKA 3FHAA 1JF6A 2XPKA 5HDRA 3KEHA 3BVTA 2YL6A 1E1FA 3UG4A 1E55A 3AIBA 2V3EA 4NZFA 4PMYA 2XN0A 1UQYA 3DDFA 1CDGA 1JGIA 3A21A 3G6MA 3PHAA 3VO0A 1LG2A 3CHDA 1B2YA 4GO8A 3AXXA 3GXFA 4CN1A 3WNNA 5A6AA 3FN9A 2O9OA 1UA3A 2YL5A 2AMGA 3BC9A 3A5VA 3VGBA 1ITCA 1VEMA 4UZUA 2DSZA 1JF5A 3B9DA 2GVYA 2RGLA 1PX4A 3T0BA 1QHOA 5BXTA 4MDPA 3HG2A 2D2OA 1E71M 4RE2A 3ZQ9A 3F4VA 3W29A 3GBEA 2G3JA 1B31A 1KQYA 5BROA 4B3LA 3BSHA 5A2AA 1XV8A 2PBGA 4QCFA 1P6WA 3WH6A 3GDBA 1V6YA 4DM2A 2EQDA 4BZYA 5LA0A 3OZPA 4W84A 3CO4A 1FH7A 4NF7A 2E9LA 2VO5A 5JBFA 4LYQA 2JF6A 5D9OA 3WD3A 4Z2LA 2G3IA 1TR1A 1N82A 1V6XA 3CLWA 4OUEA 4XUYA 5LA1A 3LRLA 2EPMX 5I5RA 1FHLA 5A6BD 1JAEA 1WZMA 1CGVA 1D2KA 3CHCA 3A22A 4KMQA 2NT0A 1IZKA 4U31A 2XVGA 4B3KA 4JCLA 3VMPA 4GO9A 4ACZB 1HNYA 1GONA 2XSBA 3BUDA 5BXRA 1R46A 2VRJA 3EJQA 1QI3A 1MVYA 2VOTA 2YLAA 1C91A 2G41A 5BXSA 2FYVA 2J8GA 2C8NA 3RJXA 1HJQA 4FK9A 5EFFA 3WUEA 4MNKA 1C8YA 4PMZA 3D5HA 1J9YA 3RM4A 4UFHA 5GNYA 1OGSA 5E0CA 3BAXA 4DO6A 3LRKA 2JIEA 2W62A 2WMHA 3D52A 3N1AA 4AD1A 1E4IA 1EOKA 2D3NA 4AD2A 3QHNA 3VINA 1S46A 5I24A 3AMCA 4UQCA 3MV01 4U5IA 3D50A 4PMUA 5DT5A 4MDOA 1SMAA 3D3AA 3GYCA 3WQWA 4GINA 1JFHA 1XGZA 3OLDA 5JUVA 1XSKA 2FGLA 2VX6A 2CCRA 4JIEA 4B9ZA 2V3DA 1LQ0A 5GPRA 4CU8A 4B9YA 3PZMA 3BAJA 5IHRA 1QHPA 3BLKA 4W7UA 1ECEA 2D23A 1HF6A 1TA3A 5DEZA 2O92A 4CUCA 4Z2GA 4AYGA 3POCA 1JYXA 2F7QA 3UG3A 2D20A 3VMOA 3AS2A 1W3LA 3AFBA 2ZUWA 3GXDA 1CECA 1JDDA 2CEQA 3U5YA 5BWFA 1B90A 4P8XA 1JI1A 5ABHA 2J47A
chains in the Genus database with same CATH superfamily
4AGPA 5TQ2H 4LCVA 5DO2D 1KTCA 3V4PH 3EOEA 3E9AA 1P7HL 3VIPA 4WWKD 2APXA 1S6NA 4DAGL 3OG6B 1NUFA 3MDJA 4FP8L 5CEYA 1FOBA 3LHUA 4YEFA 4C1NA 3RWDB 1ITUA 4DPAX 4WFFE 1TU2A 2F7IA 2OTPA 1BZEA 5BWAA 2IDTA 4LP8A 4BDVA 3Q1SL 3QUMB 3NIDE 2ZIDA 2Y7GA 3O0LA 1EJXC 4BKLA 4NN7B 5LIXX 3QZBA 5BQDA 2YPVL 4QRPE 3W2DH 2CHXA 3KAOA 4O11A 2CHZA 1I1YB 5D2TA 2Q87A 1GQJA 4X61A 4M8QB 2DWYA 5DHXB 3WMPA 5ABZA 5D02A 2CGZA 1YPZE 1DWGM 1A21A 5GRWA 4Z2IA 2XN9A 2FLBT 4LF2A 1PTDA 1TCDA 1E9YB 1JIBA 2BSEA 3C8NA 2DM2A 3GH7A 2J88A 4JO2L 3AHVA 5C6TL 3IGKA 4AF0B 3F2DA 3TO4A 5I6OA 1P69B 4JE0A 3GFZA 4QMEA 4X4ZA 2HEJA 2OZTA 4HU3A 2DQHL 3IUDA 3EGXB 1SOKA 4O50A 1PY4A 4PJEF 1I82A 1ZPTA 3GWJA 2X5PA 2HJKA 2P5WE 4YZFF 3FO0H 2CXEA 3CFDA 2IKGA 1VQTA 1T99A 2L4OA 1MCQA 2C1GA 3FLUA 2H47C 4OF0A 4AZ6A 4YHOL 2I56A 4ZNEA 4XN5A 4PMOA 3H3PH 4OZ4B 4YOKA 4AENA 7CGTA 2XXCB 2ZWLT 2Z6IA 3FVMA 3VUPA 1B6UA 2WTRA 5JIQA 1I2OA 2RDUA 3GSWB 3MRPA 3HJ0A 4Y6GA 3DFNA 3HCVA 5D2NC 1V3MA 1AY1L 3M1BB 4AVKA 1YMMD 3SCWA 2F6UA 4LMQI 1V3KA 3M0LA 5IW1B 3QEQD 1J0JA 2YGOA 3S1UA 1UFGA 4F9JA 3W2UA 4MD0A 4S3KA 3NPSB 5ID0A 2HKHH 4H88L 3U36B 2ZXAA 3NACH 1AE6L 4XZBA 4YE4H 1JQVA 2BNQA 3E2VA 3W7CA 1I1AA 2JTYA 3CFCL 1V79A 1IKOP 3QJXA 3UTPE 3U7AA 2YX0A 2PO6B 1SJHA 4JO5A 1SXBA 2VEPA 4YX2L 3NPSC 1JK9B 1F76A 2WM1A 2DQGL 4PJAF 4JFHE 1TG7A 1K6WA 1OK8A 1CIDA 3W83A 4X99A 3RYMA 1E9OB 1SVZA 1ZRUA 1EGZA 4JKMA 2PO6C 2VEGA 4XP1L 2EDBA 4H6EA 1GJUA 1AC0A 2EKSB 2CC0A 3R06A 3N42F 2ZUXA 3VKAA 4N0RA 3WJJA 3QUMH 3K80A 4FQHA 1RUQH 2RD0A 1QFOA 2OJZH 2E27H 4S0TD 5FYJD 3ESNA 1YO4A 3VXRA 3QDAA 2PDYA 4LLQB 4GRLB 3DGRA 1BXVA 2ESVA 1MJJB 4QWWC 4UQ2B 2XPZA 4MAZA 3B2MA 4JO1L 4XCNA 4QHLA 1MRFH 1WTLA 4C6BA 3LMJL 2OMUA 4HKJB 1FNSH 1IGYB 3WCYA 3MFFA 4ATLA 5LJYH 1XI3A 4QY8B 4GRLC 3GSXA 1HSBB 3EMZA 12E8L 1X5GA 3H70A 1FORH 3FUKA 5FJTA 2JEQA 1WXZA 3VNLA 2I07B 2VZUA 1Q9KB 1ZE3C 3MZGB 1PHQA 4WUUE 3GFXA 2EIZB 1JDEA 3FTVA 5I19H 1M7DA 2O9TA 3AIUA 1LE5A 5I28A 1EAJA 2E68A 1EEYA 5BO1H 5D32A 1BYCA 2CLIA 4N4YB 3WLLA 3OX8A 1O7DC 1MXGA 4BZ1H 3ARGD 2A3EA 3EH2A 1VIWA 2JE8A 2FATH 1SVBA 4H6RA 3MOAL 1ADQA 3QNXA 4YXHH 4J4PA 3QSTA 2D73A 4EXKA 3GSOB 2X2YA 3G77A 4PLKC 5E56A 5J11B 2HKAA 3L4ZA 1YC7A 2YD1A 3MV11 1JR1A 1YSOA 1BGXH 1UEYA 5K9KA 5LB1A 4H25B 3UWUA 4I77L 1D6VH 2VDPH 4W9CC 2WMPA 5GS0D 3WFBL 5KS9E 3UZ5A 3WYRA 5J11C 2QVMA 4O4VA 4WEMB 3V0VB 2F74A 2YXFA 4MJIA 1MRDH 2IPUK 2P0OA 5IJKC 1RJQA 4JDTH 3VM5A 2ENYA 1LLWA 4YTRA 3PUUA 2CZVA 4TUFA 2WW5A 1CYWA 3O15A 2AABL 2XLLA 3SCVA 2V5RA 3CVHB 5F7UA 3F8UB 3ISRA 2FJUB 5T3XE 5FOJA 1S7WB 3SPCA 3BV4A 5LGHH 3Q67A 4FL4B 2ZONA 5I1JL 4WK2B 3CZGA 4DW2H 5I8KH 5IB2B 1DL7H 4XCEB 2FSDA 2OJPA 2EH8L 3QC0A 3UYCA 4YHKH 3QI9D 5D37A 5L9DL 4LFHD 1WUNT 2VFDA 5DMYA 2DMCA 3N2XA 3ZKXC 2PD5A 1S7TB 3SQSA 4PTUB 3MV9A 3HN3A 4FL4C 4N9GA 4PJDA 2C79A 3TW6A 3GR8A 2XTJE 1M7OA 2D4FA 1OAYL 2XZAH 1F3WA 2VE6B 2D2CC 3VNJA 3VC5A 2DL2A 5D03A 3TQKA 1Q9WA 4IRSB 2CPCA 5D7HA 5HQEA 3GC5A 3NPWA 2WB7A 1WGVA 3WL0A 5EEVA 3BPNB 2WC3A 4XNYH 4AOFA 2EEFA 2UY6B 1VPYA 5TK4A 1OF8A 2QPFA 1GYWA 5GS3A 1LO2L 4DKTA 1FJ1A 1DQXA 3UYRL 4ATDA 3ULVH 3WE6A 1ZE3H 1RZIA 2VLLB 3R7MA 4DP2X 3WV0A 3REWA 3SGJC 4TMPA 4PBGA 4PSPA 5JQ6L 2K4AA 5GZND 1KR0A 4N2IA 3GG1A 4R7JA 1YXCA 5E9XA 2HJPA 2BO0A 5ANHA 4Q3MA 2MQCA 3RTQB 3DFTA 1RZ7L 2CLPA 3FFCD 3QKEA 4ETQA 4ZG1A 3G5ZA 3REVA 1YNLH 1T0OA 4LASH 3UBPC 2UWEF 1G7MA 1W1B1 5A2BA 4DKEH 3B97A 1U3HA 1B2WH 3THDA 4U1SA 3KHDA 4AV5A 2WN3A 2WUBH 3TC7A 5CJ5A 2XISA 4GA8A 1G6RB 3C0SA 3I9GH 3M6DA 4GXFA 2AKZA 3IJQA 2N7SA 1FL3B 4XNQA 4PW9A 5LUMA 4Z7AA 5BZDB 3PDDA 2H6PB 2H8ZA 2B08A 2O5YH 5KSUA 3QUZD 1FH2A 2YMOA 3EOLA 2OWWA 3L4YA 2WPGA 4R3UA 1GGTA 3VDGA 5D1ZD 5B1AB 4X6DB 3RWGB 2QVTA 1HXJA 3ZSTA 3CBRA 1VFUA 3SE8L 5GGQH 1UIOA 3HS9A 5E1AB 5L6YH 1XDTT 3PXHA 4O58L 3T4AB 4GIOA 2B9AA 2WXLA 4KDTC 4B2DA 4Q6JA 2IWKA 3N25A 4YAQA 3CVHH 4PB5A 4W6XB 1GW9A 4K1WA 4NAQA 2OMWA 3UBHA 5BS0B 4ZOEA 3NEEA 2H0PA 5EO0B 3UC0H 4HU0A 2X09A 3V4BA 3F2BA 4PJIF 2WIIA 4RFOH 1XZ0A 3HZKB 1NOWA 4WDIA 3OAZH 4PUKA 4AW7A 5AG8A 4ZMTA 1Q6CA 3TFBA 1JXKA 1E6QM 3BUVA 4E9RA 1LBLA 2AV7B 1IGIH 1XKJA 1QLFB 3V5KB 1Z9AA 1EQCA 4QT5B 1B4RA 2XFFA 1A5FL 4J39A 4UTMA 5ITBL 1IEBA 1RLWA 1UYWL 2I5IA 5GJSH 5A6BA 4A1RA 2E6FA 2QR0B 2YBVA 3QQ3B 1A6WH 4XNAA 4OOZA 3P69A 3UT0A 1W3KA 3V7MA 2OL3B 1ZTVA 4LEOB 1MCPH 1V4YA 3CXOA 1UZ6F 4F8TA 4A05A 2YA1A 2R23A 3MBXH 1FP5A 4XCFL 3OTRA 4DVBA 4NZRH 2WINA 3FHEA 2G3FA 2CITA 1U9KA 1XIWD 4DZHA 3BW9B 5JPNA 3DYPA 3CZEA 3KWUA 3INOA 2PWDA 3KHJA 2F19H 3JQOB 4WI2A 3MRHB 4HQQL 1A3ZA 1AS6A 2ESCA 4D8ZA 1JZ6A 2R2CA 3V4UL 2ZX5A 4ZB0A 3E6EA 3WY1A 1TOXA 2I26N 1G6RH 3BDXA 5E99L 2CMRL 5SWUA 2WVVA 3IJ6A 3LZ3A 2FQFA 3GHPA 1R2RA 3VPLA 2XNAB 1NEZA 4MNGE 1KBPA 5EB8A 1VCGA 4M4RA 2XJ7A 4UFKA 3QW4B 2ZUUA 2EC9T 3TTQA 4LLUA 2IWGA 3FRPG 4Z17A 4F8LA 1M05B 5MI0B 2VM4A 3NIFB 5HVFB 2A9DA 4PL2A 2VR9A 2PP7A 4X4MA 2JJUA 4H7VA 5EF0A 1PLCA 2NY5L 2LE9A 1X7FA 1U4EA 4NCC2 3KJ6H 4PBEA 1GY2A 1SRDA 3VWJB 3TIEA 4YL9A 4TSBL 4QDWA 5FXCH 5MI0C 1BYNA 3ZMNA 4BFNA 1PKYA 1ZGLA 1PYMA 3P3UA 3ZR4A 3RU6A 4GVGA 2DLFH 2ICWB 3FH8A 3VWJC 4M24A 1H1YA 3W2NA 2BGSA 4CQ8A 1GPFA 4FQ1L 4C1KA 3FOMB 1NIAA 2R82A 5GRUL 4CNIB 4V33A 4F2UA 1YN7A 4DH2A 4MADA 4PJ9B 4DP8X 3CZUB 3UCDA 4Y19A 3KWSA 1TR7A 2XT1B 2HKFH 5CO1A 1OABA 1AKJD 2O6CA 1JPIA 4DZ8B 4RAUB 3C5ZA 4HIBA 1FCCA 3GIVB 2E47A 5ABFB 2WQ8A 4ZT1A 4RZCA 3RX8A 1CDCA 1G9HA 1E50A 4F7TB 5B1BB 2A9ML 3D8MA 1M9SA 5LDSA 4U3XA 1A3XA 1INQB 2X1OA 1CU4H 4B4FA 4J1UB 4JHBA 4KF1A 3TN0B 1AL8A 3TZNA 5DQ9A 2BGNE 4LDLB 1D8WA 4XAKE 5FUZL 5IMKA 4F9PA 4WW1B 1S5NA 2WXGA 3EJUA 4WY0B 3DFPA 3LKNA 2GJ6B 1KB5L 2XPGB 3W70A 3EFOA 3TN0C 3OGSA 4TIMA 5EZOL 1KBVA 4ZK8A 1XF3A 5FW6A 1LEIA 1JZ5A 2UY5A 4KNTA 1XQ4A 43CAB 3STZB 2Y2YA 4IQDA 1UP2A 4D94A 2J3SA 4Q8WA 4DWSB 5D71L 2XV0A 1W16A 4GG9A 5FLUA 1ONQA 3U0PB 4QITA 1AO7A 3ELFA 4OJAA 1U93B 1GVIA 3RVTD 3ZTNH 4A3HA 3FCSA 1UMLA 3IAPA 1N6QL 4DWSC 1RZKH 3CN0A 2NSXA 4NT0A 4JREB 2J75A 3SURA 1U91A 4MX7B 3MMEA 2Y2WA 1QR7A 2LVCA 1MUWA 1HHJA 1HAUA 1E4MM 1A66A 5HQLA 1HKVA 4LK4A 4G82A 4JREC 5KVDE 2OCJA 3S36L 3WN5C 2GL5A 3SZ8A 2ITCB 3GTNA 1PF3A 5HYEA 3NTCL 3VWKB 6PAZA 2DY2A 3DFOA 3LTSA 4M5YL 4OZIA 5CU9A 2NYKA 3G5VB 3QRGL 4RDVA 4HUXA 4MJJA 2PP8A 1WFNA 3MNDA 4N6QA 2XSAA 3V95A 3S3PA 3VWKC 4JX5A 2GJJA 2BS71 3V1PA 1WZ1H 1N8FA 3HQ1A 3UPRB 4JZ5A 4ODHL 3EZ4A 1NKGA 2Z25A 2VQ4A 2I25N 3L21A 1YX1A 2VYRE 4BE5A 4PUBH 1E6JH 1ZLVH 4RLIA 5JH1A 2D7TL 3L5AA 2WNNA 4X7TB 4M6AA 1WD9A 3T44A 5F1IA 9PCYA 3LLFA 1AZBA 4CDHA 3QO0A 1NDZA 1Q72L 4Y1SA 4LWWA 5E6SB 2O26U 1UWXK 2WBXA 4L4VA 4A22A 3FUMA 5F2IA 1QSFD 3PTDA 2Z8VC 3U2IA 5H8MA 3T0AA 3GUGA 4IMKA 1Y7VA 1EVTC 5FF0A 4GYPA 2V7HB 3TA9A 2P5PA 2EEAA 1NFIB 3M0XA 4JQXA 1VFAA 4KQNA 4PD4J 3AO0A 4W8AA 3DIVA 1WFUA 1OHQA 3QXWA 2LAAA 3AQUA 1MHPL 3CV5A 1UCBH 2ADFL 3AYSA 2Y89A 4HIEA 2DQJL 4Y5XA 2FVLA 3ARBB 4XNXL 3W1TA 4IKLA 3IKCB 3VSQA 3WUFA 2FX7H 1HT6A 4MKTA 5DN1A 3PNWB 1X5HA 2FKPA 4ZQNA 2EVGA 3NZ8B 2X4RB 3AT0A 3C2AL 1F73A 3A6BL 3JUYA 2JV6A 3QZMA 3IWUA 4EE9A 3ARBC 1AZZC 1UD3A 2DGAA 5F9JB 1LOSA 3IDYB 4P23A 1ZSDA 1XLBA 4LSTH 2WKJA 4JR9L 4HPXA 3M07A 3RKDC 5FF4A 5SWQB 1IE4A 4MYXA 2W0LA 3BWZA 2B1AL 2BSRB 1GOXA 4HIQA 2H90A 2CHRA 4NJAH 3HMXH 3QFGA 5T26A 4PWJA 1J2WA 1MNZA 5DYOA 5HHME 3OQEA 1MCNA 4WKFA 4HB7A 2JH2A 1K3ZA 4Y16A 4WZ9A 3NUKA 4X3ZA 1F3XA 4L6OA 4QR7A 3SDXA 3APGA 2VW7A 1K8DA 2W0FB 3U0TB 2DWDB 4KO5A 3IVUA 1UM6L 3GKAA 2OX5A 4HC1L 1UQYA 2KHAA 3A21A 1TTIA 3E8UL 5C0AE 6ALDA 1B4JL 2XBZA 2AJYH 1HGYA 5DVOA 1JHLL 3W1NA 3TW9A 2DSZA 4ABVA 5MENE 1IBZA 1XLEA 3Q6GL 3QC6X 1ZP4A 3VXNB 1XWYA 1SYVA 4JE4B 5DRXA 3ZQ9A 5IGXH 1IL1A 4HWZB 1EZLA 3BH8B 2UZYB 1EPVA 5BRZE 2OK0L 4U1JB 2Y7QB 5GGTL 3VRLE 3DO7A 1DQWA 4G9FA 1FH7A 3MMTA 5JBFA 1M7IB 4LYQA 3NJIA 3I4EA 4Z2LA 2R51A 1AUSL 1AFSA 4ZGYA 3MUXA 1LK2B 4S39A 4MGXA 3STGA 2KT6A 1E1CB 3MT1A 3CHCA 3QDJA 2V2TB 5EU4A 2YMXL 4U31A 4IIFA 3VQLA 5EMLA 2BMKA 4ZXBD 4ZQMA 3UBXI 3FF8A 4Q56A 1RZMA 4AX6A 4MQ7B 3H9SA 4K9EL 2C8NA 3Q2DA 2SFPA 2IAAC 4LPWA 3T3MF 3RM4A 3L2IA 5G1MA 4KJPC 4P2RD 1EOKA 2ZTJA 5CN3A 2PRMA 4RMQA 1AH4A 4GAGL 4ZX6A 2YPIA 3OJGA 1NGYB 1ICSA 3D3VA 4JR5A 2QR6A 1W5NA 3CUXA 3EGJA 5F89A 4ZQRA 2PFHA 2C9QA 2RH0A 4DRSA 5EU6B 2ZCZA 1NMAH 3N34A 1A2YA 2ZTBA 5ITFB 4EI5D 4Y1AE 5DJCB 4WJ8A 2GWGA 4YU1A 1B90A 2B8OT 3QZOA 2ARJB 4QDPA 4AU0A 1DEEA 4BQ5A 4PYGA 3IK4A 4KZDL 2QHRL 2OYLA 3FJTA 5E08L 4Z1PA 2CIKA 2HFEA 1SFSA 5KYYA 4O4WA 4C55A 1RUMH 1CPUA 4AD5A 2VL5B 1K5WA 4ZMOA 5F96H 1PFCA 5I1HL 1KFEA 4D0CA 5BZXA 1BVKA 2BHFA 2EVIA 4C5ZA 3BZEB 4NC0B 2J6VA 3OLGA 3U6XA 3AU1A 2IOMA 2MQGA 3U83A 2DI8A 4KU1A 3EJZC 5A3ID 4BRVA 4F33B 4X50A 3TF7C 1KGWA 4PJ8A 2V37A 1TPVA 2ZX7A 4ZUTA 2XFWA 3R89A 25C8H 3BUBA 4P8WA 3CC5B 2CGRH 5E09A 4O5LH 5E1QA 3H9YA 5I73B 2M26A 2REQA 2BY0A 5L2JB 4R85A 1N55A 4M6QA 1AH0A 5DRIA 3STPA 3U6RA 2H2SD 4JAMA 3L68A 4YLWA 4X6FB 4Z3EA 5IQLA 1SFDA 1BXCA 4ZSOB 5I73C 4Y5YB 3PJNA 5EOTA 5B7MA 4AH2A 4JHWL 5I6NA 3HHSB 2OZ4L 3CNYA 1D5XB 2ZBTA 1NQ6A 2J7BA 5MEOB 2C9SA 1GEQA 3DBSA 1EWHA 3JWOC 2O5ZL 2D0HA 5FGCE 4QDMA 3CEUA 4RZ6A 4I4WA 5AWNL 5E0FA 1JPSL 1K4HA 1YEKH 4JN6A 3H3BC 2Y5TB 3OWEA 5BOFA 5F7YC 3E0LA 3QFDB 4J3OH 3FT2A 3WLHA 4XN2A 1OPGL 2OVLA 1GQKA 3QRHA 4S3CA 1SY6A 4PH8A 5D2NE 5KBDA 4Q8VA 1A53A 2FQIA 1RIHL 1XGPA 3NJXA 2G5UA 1OHLA 2BWDA 3WIJA 4JFOB 4A6YA 1ND0B 5MHBA 1H49A 4GQRA 5CBAB 3GEWB 3QQ9C 4NNXB 2V33A 5CCGE 3U0WH 2YW4A 1DBMH 4POCA 4ZX3A 1RPQA 3VRIA 1G84A 2H26B 2OAAA 3D0AA 2IPKA 5HHOD 3UZEC 3P11H 2Y1AA 3FB5B 1NGPH 3L7FA 1MJ7L 1FRGL 4G9DA 1C93A 4WI7A 5EO1B 4RGOL 4KKXA 3FXGA 4JRWA 4DXKA 3CMGA 1MDAA 2V8MA 1NGXA 3QQ1A 3S8FB 4JG5A 3VNMA 4XZUA 4L5FL 5I71B 4QKXB 1T2JA 3ME3A 3TJ4A 1REQA 1L0XA 1F42A 5CN2A 3CHEA 4K68A 3QZWA 3LXBA 3UO1L 3IBOA 2BZDA 2BLFA 1S9YA 3MUIA 1D5ZB 3LG3A 1UFUA 2DZSA 1CDUA 1QVBA 3TEVA 5C8BB 3SQLA 1BFSA 2G3MA 4UDTA 4LAOA 3PG8A 1XB3A 5EBLA 1NBZA 1RIUH 1EJUC 2DP3A 3QO1A 3S0PA 1DDHA 4Q0XL 3THML 1M3JA 4Z1BA 1K72A 4TKWA 3AHYA 4IIEA 3A4XA 4QLJA 3IFNH 2EDTA 2Z2UA 4E3TA 1UMYA 1AR1C 3SPIA 2OXGA 4H8WC 4X42A 3W00A 2R56H 1TYEB 3FU5A 4I88A 3VILA 3EADA 1GGYA 3ETBF 3TIMA 1UACL 5HYQB 5J1AA 2VUYA 3K6SB 2OKTA 3VH8A 1A50A 3ZR5A 4PAZA 3O3RA 4FNSA 2PYFB 3FJLA 5FKPB 5DDHB 4GQ0A 3FONA 1IIIA 5HXMA 5G4WA 1FC2D 5IB1A 1KJVB 1O7DE 4X83A 2YZRA 1PWMA 2WXMA 5FI8A 4AXKA 3R8QA 1BVZA 4UQBA 3HC4H 3K71A 4TV3A 2XA8H 4ZS6C 4X6CB 4AE0A 1NL0L 1INEL 1W3HA 1DWHM 1EDTA 4NENB 5RUBA 4FLRA 3FTGA 4FS9A 2Q8BH 1EJOH 1PQZA 3QV9A 1UD8A 4IU2B 3D2UB 5JOEA 3MY9A 4ALAH 4POZD 5D1ZI 3RUBL 1XSJA 4ODWB 3D4ZA 4KGJA 3GVWA 2WWCA 2XFYA 1OG0A 4XXCA 4NO2A 1UQSB 2ZOLA 4LHUG 4NFDA 1WKYA 3C5JA 1DPMA 5I8OL 2UBPC 3L2NA 1U8QB 4KCUA 2ERJC 1WDDA 2VM9A 1T2QL 3FT4A 1GRWA 3OJMB 1T1ZA 2J5LB 4C56B 1R9FA 4BQ4A 1AHWB 5HI3C 3F01A 3L6FA 2ICES 5F97E 3TV3L 3TZVC 4CD6A 2UZXA 1FXPA 4RMRA 5IFAL 1NCAL 1FVDA 2J5LC 1DFBL 1UA6L 4PRAA 3L65A 3C6CA 4NL1A 1AHWC 1V6UA 1ME7A 3RKPA 4AT6A 4PPTA 5HDWA 3N6YA 3QR2A 2Y8UA 2YLLA 1EWDA 1W8GA 4LOUD 4N0YH 3BKJH 3VFPB 1AXSB 4HIHB 4EPEC 3KOWA 3WKML 3QNZB 2VLME 4HNVA 5KJRL 4WHCA 5F1SA 2GEQA 3EFDH 3XINA 3VD2A 1R9XA 4OF6A 1M1XA 5JOPD 2EIEA 2ZYSA 3UADA 3KLHD 1X5LA 4NYYA 2ZYFA 3LZLA 1ZT7A 4S23A 2FIRT 4E2OA 5T1DL 4GNKB 2R1LA 4PUDA 2D3LA 1CLCA 4S1RL 2DKMA 2QULA 4XH2B 1JRCA 3ULSB 2GQHA 2R2EA 1JL8A 1FO0H 4PRHE 1AJ0A 4IHBA 3IJSB 2WXDM 1X3DA 4P57A 2YSSA 4YO0A 3P4MA 4G7VL 4F57H 4BWLC 2ZE3A 1ENUA 3VGDA 1N3NB 2J73A 4OCYL 3GLEA 1JGEB 4EVZA 1HEZA 3PPCA 3C6LA 4Z0XB 4NILA 2C18A 1JHTB 4WD0A 3NOYA 3ZTDC 4HNLA 3LGDA 2CWRA 3K6NA 2BP8A 1ZCRA 3KBPA 3ILEA 3W9EB 3G6AB 3OB8A 1NINA 5EIIB 3H4WA 4KQ0A 3GSNL 1XCXA 2OBGA 2E0PA 1U8OB 3FN3A 3GH4A 4G3YL 3FQRB 1BEXA 3LS5H 1B3OA 2B20A 3CMOL 1M6OA 4OGYL 3M0VA 2EYRB 1I3VA 3WF4A 1XL6A 4HU2A 1J0ZA 2L7UA 1IIGA 3BMXA 1JF1A 3BARA 1IQWH 1BQSA 5EU5B 1QPQA 1I4FB 4YTQA 2GTWB 4LP4A 3AG4B 3JV6A 3QUXB 2F54E 1JNHA 1NC4A 1K03A 3FQ2A 3C12A 2MQ3A 4LC6A 3SE9L 2ODOA 1IC0A 1XLFA 1Z8AA 1U2YA 3SDDC 3B2VL 5I6XC 1FLTX 1S38A 3RY6A 1AG6A 2L0DA 4UDUA 1XRFA 2R0LH 1A4JA 1NCNA 4P46C 3MYPA 5AVQB 3T0EB 2AGJL 1R85A 3TXVA 3DRTB 1NANI 3AYRA 4ADSA 2C1PB 1ZY9A 3F64A 1R0AL 3TBWB 2XN9D 4HG4K 3KDOA 3T0EC 3ZOAA 2GIMA 4LANA 4JDZB 2Z92B 1I1WA 4OT7A 4Z8FL 3UXDA 2BSED 1V7YA 1QNRA 3MUAA 4UTTC 3BKYH 2XACC 2W67A 1AD0B 2D7MA 1Z3NA 1BVWA 2CKNA 4AIZB 5GGUB 2VITB 5HYSG 3TO4D 2LLNA 2PRLA 1IAKA 4PZVA 3FU7B 5LNSA 1K1DA 4GMSH 2ATSA 1ZXQA 5LBVA 3PV6A 3NJLA 1H63A 4KUZH 1FZJB 4ZQKA 1VSCA 2WANA 3BJ91 4YSTA 4QQ3A 5T8IA 4P4RB 3QR1A 4KRLB 5KVFE 3Q5OA 3TYGL 4KQ4L 4X0KB 2VDML 4MJ5B 4NP4H 4GK8A 3VUSA 3ULAB 4XX6A 1L9QA 4AE1A 3TMLA 1POJA 1S9VB 3N1MC 2YRBA 5FYKU 2A3LA 4AMKL 4U3SA 4M9OA 1BAGA 1JOIA 1JWSA 2E7MA 4QE1A 3ID7A 1CB2A 3OYZA 5HMSA 5AZ2H 2R1PA 1YTDA 1R24A 2WVUA 3W73A 4AZIA 3IU3B 3KGTA 5IHZB 4C59B 3SPHA 2ISVA 2FAUA 4LDOB 4OF7A 5KYXB 4R5TA 1UZ8B 3MOBH 5AW3B 1XBZA 4HMEA 4GUIA 3O45A 5AW6B 3CUJA 4HFUL 2A73B 1FVEB 4JANB 2LFGA 5EOCH 3BW2A 3VI4A 3O8XA 2G5BB 4GSQA 3QH3B 4E2BA 1CGSL 4XBGA 4AEIL 1T41A 3HAEH 2NY1D 2EG8A 4TNVF 1A3WA 3NIFE 4JDVA 4EP8C 1WIUA 3VYPA 3BWWA 3WF2A 5D2WA 4NJHA 4PV8A 5DK2B 4ZMLA 4WO4B 5IREA 1EIBA 2QCDA 1I9RL 2QJIA 2H8PA 4U1HA 4Z7NB 1R9YA 5FKAB 4GW4A 3MYZA 5DZVA 3L4WA 4L3EA 5DSCA 1GC1L 1C8QA 4DEWA 1VHPA 1OYBA 4WO4C 1ZLPA 4XZIA 2KC0A 4N2MA 4P7QA 3VXRD 2JLPA 2XVKA 1UWRA 1MY7A 1NVMA 3SRDA 3B8DA 2ESVD 2FHCA 5G1YA 1KCBA 3ILQD 4UU9B 5T1MB 1RJPA 5FECA 3C56A 1U8MA 4WXZA 4MMZB 1QW9A 2JELL 3ZUCA 4NRYA 3LQZB 3NZPA 3U4BL 2CETA 2VC9A 1J2BA 3UTQB 4N90E 1AMKA 4QNPE 5FEPA 2C19A 3W7LA 3RNQB 5E1GA 3N40F 5AL0A 4U33A 3NAAL 3VX0A 2C26A 1XG3A 4TNGA 4GKTA 2DTMH 4ODTL 4YJZL 1EBAA 3T1FA 4M62L 4MA7L 1DVXA 5FUOH 4N8UA 3O9WB 5IP4A 2V9DA 1PG7W 4HNNA 2PWVA 1MFEH 2GJ6E 5F7NC 3F7VA 3PSVA 1ZHNB 4O2CB 1U36A 4J4PD 1PSKL 2AL2B 1PIFA 4QGTA 5L88L 4KNUA 5EDSA 1T89A 1JZIA 4UQ3B 4H4IA 3CDCA 1BFVL 4OLVL 4YNYA 3MI6A 3S2AA 3BQUB 4A04A 2XQBH 1J9RA 4KCWA 1JPFB 1RCOB 4MBRA 3W9ZA 4AIOA 3LIZL 3QDGA 3QCUL 1X7QB 1W8NA 5AB0A 4ONGL 3SCRA 3OF6D 2GUUA 4NN7C 4MJID 2DQDL 3MUGA 3MNVB 4XP4L 1EQWA 4QEGA 4ZB2A 2VHLA 2Q8ZA 4H19A 2ZZ4A 2PCQA 32C2A 5DLMH 3QF0A 4EOWL 2XY2A 3J07A 3T3PE 4C4KT 1UXSA 3NL3A 1J05B 3VFGL 3KLSA 4NKIL 3UJFA 2QTEA 3GJEB 4KHTL 1D2PA 2IPFA 1ED3A 4G7SB 1A3QA 2DU2A 4PP2A 3MMDA 1WP6A 2EO1A 3NESA 3MV9D 1AQMA 3BE1H 2GFTA 5ID1A 2YOAA 3GD1C 2WV3A 4P4KB 3GPEA 3LV3A 3F5KA 1QXLA 4JG9A 1HCZA 4WFGD 1G7QB 3M0ZA 1EQPA 3ROOB 1OWWA 1E51A 4PREB 1OP5H 4YDKH 2QSVA 3ML8A 2X4QB 1PCWA 2PSNA 4P4KC 2XH4A 3QIUA 4C4BA 1DYSA 2AI0H 4JM2F 1I53A 3NSMA 2QGCA 4HCIA 3G6JA 4O4YH 4HCGA 1A4LA 4ODSL 2VDLL 3SQOL 4G8AC 4Q22A 1I75A 4UTBA 5TGBA 2DWTA 3I50H 4IBYA 4UTIA 1S7XB 4HXBL 1JXJA 2IOOA 2VDPB 3L5WB 1DSFH 3RWFA 4MD4B 1SU5A 3HPLA 5JU6A 3NFSH 5DJDB 2YJQA 4PG9A 4QXIA 5HDOA 1JUKA 3Q6FB 4G2AA 3FK3A 3TCTA 3D5OF 4W9HC 4JDEB 3CCHA 4YS4A 1AH3A 1FFTB 5K2ZA 4I0PA 1B0WA 1S3RA 2OPJA 4LLDA 4LCYA 4KK5C 1CVSC 2EECA 1FV1B 1U3HD 1W56A 3JXAA 5A8NA 1K8IA 4LYPA 3O6MH 4QLKA 1MW2A 1WNOA 1RL1A 1HJBC 5HGAA 1UUQA 2FJKA 4U4BA 7A3HA 3GXIA 4J8RB 2GQ8A 1Z9OA 1T1YB 2PGEA 2E9MA 4HKPA 4WTQA 2YDSA 1R2TA 2O4MA 2FWSA 4NQXB 4EAEA 1QUMA 5LIKX 1JK8B 4XMPL 4AX7A 2VGBA 1H7WA 4LAJH 1ZB5A 1FDLL 1IGSA 3QUHA 3UTZB 3KTSA 5EA0L 2VDOH 1EXUA 3PWAA 1KCVH 3V6OC 1B0GB 3UR7A 2ZAIA 1BJ1H 1CW2A 3O2WH 1SFLA 2TRSA 2ZXDA 4LVNB 1KN2L 5CZVH 1ZOXA 1RALA 3NDYE 1UKOA 4W4QA 1P9MC 4JY4B 2D2JA 4HCRH 4AQ1B 1YXDA 1I1RA 4JN7A 4P06A 4BUGA 1HHHB 5I17A 2QZRA 2YN5A 3ULVC 4PMYA 3KPMA 5I2IB 2VDRL 1LG2A 3WFEL 3IJYA 5KVMC 5LXEA 4QYOB 1Q7QA 3MUJA 5HHVH 4ELMF 4BFBD 2O9OA 4HKXB 1BSLA 2AK1H 4AQ1C 4GEIA 2FR4A 3NJNA 4PUWA 4YHZH 4V1DB 5KZEA 3LTPA 3S1GA 1TVHB 1O1HA 3DA0A 4UILH 1KQYA 4HAFA 3KXFE 2P43B 4B3LA 1XV8A 3E6HB 1RR2A 3NN8B 4Y4KA 4W84A 2YPKB 4Q6KA 1A7QL 3MRBA 1OAXH 5EOCJ 2H3BA 4TQIA 4M43H 4A7VA 4NDMB 3S6OA 2HT4D 5A6BD 3GG8A 5I0VA 5IBUG 4JCLA 4KROD 4D9LL 1XGTB 1KENH 2XSBA 4NG3A 2Z3FA 5BXRA 1IC4H 3RVWD 2YKLL 5HHNB 1K6QL 4RA0C 4YYFA 2B2XL 4CADB 2YLAA 1TJGH 2J8GA 1HJQA 3S35X 1WFOA 3ECBB 1DQQB 1SO5A 4XOCA 2W62A 2WMHA 3D52A 4TV6A 2BIIA 3FZUC 1N2VA 4G7EA 3FFDA 4HWBH 3SYPA 4ZTXA 5CINH 2XV6B 4ZNCD 4Y9EA 3C8FA 5EH1A 4GABA 2CBMA 2H3DA 3WQWA 1U8NA 1JFHA 3BIBX 5SWSE 2MWCA 1OCOB 3CFTA 5HYJA 1O5QA 4J2PA 1GK8A 3PZMA 4HSAC 3LOTA 4OVUA 5DQDH 4TPRL 2Y7MA 3TBSB 1P1VA 2GQ3A 3ZKND 5D30A 3AREA 3FQXB 1KJMA 2D3VA 3GC2A 1U8IB 1GGCL 5EU6E 3UAJA 4ONOA 4BF7A 1NIUA 4XBEL 4JHAH 2FTWA 4HK7A 1G7JA 4RA3A 1QZNA 5JHLA 5LGXA 3ALFA 3B43A 4AM0B 4Y88A 4FJYA 1WZLA 3JTSA 3SOBH 2AXWA 3WDJA 1I9IH 4C6PA 3W71A 3AISA 2Z7YA 3WNLA 4G43A 4IRSC 3I75A 1J96A 1ICTA 2VRAA 3SDAD 3BQ6A 1AYRA 3BPNC 3IAGC 1S7UA 3R13A 2ZYHA 1DJQA 1RBOB 5FHBL 3OD3A 5DVMA 3W7GA 2GITA 5JW5A 2WJZA 4CA4A 5JDSB 2EBNA 1PYWB 2XGZA 1JUFA 2CDEB 4HCFA 3FQUB 3HGRA 1JVLA 4Y19D 2VX4A 1NSNL 1ZK5A 4C7FA 1TELA 3A4JA 5ECUA 4JCWA 3EYUL 1ZDQA 3O9NA 4TRPH 3C5ZD 3RTQC 5G2NA 4H9VA 3MCKB 3IT8D 5T9CE 1UWFA 2XWJA 2VTFA 4IPLA 1MCWW 3AZTA 2GHWB 3WJLC 3BAEH 3GW3A 4S1SL 3WY3A 3K2GA 5HDLA 1J8VA 4HT1H 4IOFC 3BTNA 3MUCA 2P53A 3L7RA 3IIZA 2AGTA 4C83A 3PAJA 3PANA 4DP0X 5D7IA 3FOLA 1ZS8B 3BLOA 4ZDHA 3FO9B 1MZHA 4ZSOE 3NZHL 2NTSP 2AJUL 2AHIA 5AC6A 3BUYA 1T04A 1AIZA 1BZ7A 1IKFH 3L4CA 5CEZE 1SHWA 2I17A 2F2KA 1RUAH 4PODA 3TCLB 1D6EA 5SWZE 3T2PA 4HLZH 3EF4A 3GB6A 3BP6B 5DBTA 2X4UB 5I18L 1HHGA 4AH7A 2NUTB 4F7KA 3AY4A 4D7BA 4LO9A 3CAKA 1B3WA 1RBLA 3QWOA 3T4AC 1T1XB 1AO7D 4GC4A 1TZ9A 1F90H 3W86A 2E77A 1YDPA 5LO7A 3NCCB 3GK0A 2P24A 4PV1C 1QHZA 2WBJA 3RM9A 4M7LT 4N7QA 3GJFK 4WUIA 2RHGA 2I85A 3ZZLA 5C2CA 4B9CA 2X2HA 1LRTA 4B5UA 3P67A 1E3XA 5KZCD 5J6SA 1WYIA 2WJ7A 1E9PB 3HZYB 5LDUA 5GGVL 1MH5B 4AY0A 5CJNA 2G96A 3PF3A 1VCBC 2G4FA 4FNPA 3PCYA 3QS2A 4PRIA 4JFPB 2W0UA 4XGZB 4UUJB 3QG7L 1S1PA 1FQ9C 3D39A 4WW2B 1C12B 4KXCA 4PHXA 1LDPL 2OR8A 4ZAKB 5DT7A 4W9GC 4WSGA 3HR5A 5I1IH 3AY2A 3FEMA 5GGRA 3LZRA 3O07A 1ISYA 2IOIA 4FG6D 5D2XA 5AHLA 3S35L 4FZEL 5B8CB 2XX1A 4WW2C 3GRIA 3KCOA 5D7LB 4OQTL 4ZAKC 4EEEA 7REQA 2EINB 4I9TA 1QCWA 4B90A 2BVYA 1L2QA 4KH9A 4XVTL 1BEYH 4IKIA 1MIEL 5B8CC 5D5MF 3DIFA 4IJ3B 2X8RA 3VI3B 2CLRA 1GS8A 3GSQB 3LHZA 5M94B 1ZHKA 1AJ7L 4PJHF 4UIOA 1N8ZB 5EV7A 4AZUA 3PB0A 3S46A 4IJ3C 3HNVL 1BJ1J 2WZEA 4P61A 4JTDA 1H62A 2V9QA 5ALCH 4EJ1C 1EHAA 3TYBA 3I9PA 2X41A 5C9JB 3PTQA 1W8OA 4QOKA 1HVXA 3WBWA 4ACTA 3QLDA 4GNVA 5C6MA 3FTYA 3ZTCC 1RZKC 2A6NA 4QTGA 1G7LA 3ARXA 1OKEA 1L6ZA 3A4WA 3UCRA 3UJEA 1I6NA 1CCZA 6REQA 2CQVA 3AM8A 3BGGA 3VW3L 3GKWL 5FO9B 2PYEA 2XG4B 5EIQA 4HJ0D 3ABXA 2QJGA 4PHZA 4J27A 3LKOA 4P23D 4IG2B 4K23H 3A4FA 3Q1EA 4PCPA 4X6CE 2WYHA 2C9PA 5AVZB 3WBAA 1A7RH 2G4JA 1XQKA 2YARA 4L29B 4WLCA 5AW1B 2P5NA 3X17A 3L9BA 2C91A 1TTCA 1GYLA 3C08L 2J7HA 1F02I 3AZUA 2VDQH 1EZVX 1WDRA 1KIPB 1KPUA 4QEEA 2IO5A 1H7XA 4UR9A 1WDQA 2R29L 4PJ9C 2K6WA 1PJWA 4UNTA 4G1NA 3O81A 3TSMA 1HWHB 4DVRL 1QR1A 3TNMB 1V55B 1A5LC 5LHEA 3N9RA 1GVEA 2IQ0A 2UXVA 3MXWH 3CAFA 3O3AB 4IKNA 2EEDA 4MZ2A 1EYEA 3GZPA 3PK7A 4L4TB 3MJ7B 3TF4A 5MEQB 2J1ZA 3APTA 4C65A 1EBHA 3WD5H 4HEMA 2VSKB 5IHSA 2H3NB 3L5LA 5DQJB 1S7QA 5F1NB 2GSEA 4OR1A 5TPWL 3T0DA 5BJTB 5CJMA 2R2HA 1SZRA 1KCRH 4X7FC 4Q9RL 4G9FD 5D6DC 5H2ZA 2EH7H 3N12A 4Q8TA 2WXNA 2KQNA 3HA1A 1RU9L 2P7TA 1BQHA 1S2UA 1JGDA 4H8HA 1IT9L 3UA3A 3VXSA 5I79A 3EOAA 2OLSA 1S5IL 5BOPA 5A7EA 3LUTA 4XBPA 4S1FA 4U2ZA 1RJZB 1U2CA 3H9SD 4HDIB 1MJ8H 1UR0A 2C71A 1ZLUK 1UWGH 3T1GA 4R9OA 3V5HA 3LZOA 5BRQA 3PP7A 1GZGA 1DVYA 5ACZB 5B3SB 3T6CA 4G80B 2RR3A 5DEGA 2W07B 4UOZA 4JJ5A 2CHOA 4JY5H 2OGYA 3VKBA 5HSFA 3L12A 2P42B 4GSRA 1BTMA 4FLQA 1EXBA 4F24A 5EZJA 3W7DA 3ZN6A 2W9EL 3C9NB 3D3VD 2ZG1A 5ICZB 3BO8A 2BFGA 3GRWA 3QZNA 2FZ3A 2CPUA 4HZ1A 1N0LB 5I3DA 3VG9B 4N9OB 4N0FA 1HSAA 3EG9A 4D6EA 1ITXA 4LCUA 4M6VA 3B8WA 4AAJA 1W9UA 4WFEE 5KTLA 4AGOA 3U7YL 1M6UA 2JKIS 2PP1A 3GIPA 3CHVA 4ODXA 3UU0A 2NY6B 3WEMA 2HN7B 1POKA 4GQ9L 4DPQA 3WIHL 1FBIL 4U6HA 3FUJA 1I1CA 1E5AA 1YQVH 3VOGA 4G1EA 4MYPA 1M2VA 2QVKA 1F07A 4MRBA 1DQJA 2CLMA 4R90L 4ICMA 1DSWA 2XVBA 4OJCA 3EPOA 2K78A 4NQCA 1UOLA 1SXAA 5GS2D 2OLDA 2YRZA 1FAIL 4FFZA 3ES6B 4Q7IA 1CE1L 3M6YA 5DXXA 3JUZA 2BRRL 2YC1A 3LHTA 3EYQC 1J0HA 2KPNA 4LAZA 3HN8A 2FJFA 4A6GA 4L18A 3GMMA 2HWZL 3LSCA 4Z7WA 4Z7QE 1I7UB 2Z34A 4PFEA 3ZDWA 3QP3A 3QB7C 3T0EE 2W92A 1P7TB 3VD4A 1B4LA 4PRPD 3IRSA 2FJHA 2AAAA 3VE7A 5DFAA 2ZJSH 5KSAD 1JDAA 1E27A 1V08A 3CUZA 1XF2B 4EUPA 4AIUA 1VPXA 1FGVL 4P5TB 3ZUNC 3OKOA 1EX5A 5DRNB 3QVQA 4FYTA 4AZCB 4FXFA 4MNHA 4O02B 1FHGA 4LTSA 1J10A 3G1XA 1QKZH 4GKNB 4WKZB 3WNJA 5TDNB 2MCAA 2AVGA 1R2SA 3KM8A 4IISA 3SJVB 1YEJH 2DI7A 1JGVH 1RULH 5KVDL 3IDYC 1KNOA 4S3BA 4YHEA 4DN1A 3DX7B 2APFA 1KLUA 3SYAA 5I74B 3RDTA 4KJWD 2OTUB 3KBVA 4PP1D 3DVNB 4GNJA 2TRHA 1IAOA 2V5DA 2X6CA 5I1AA 4LV9A 1UD5A 1ETJA 1IGMH 4PBDA 3ITTA 5DHMC 1ECYA 1ILSA 1H9DA 3DUHA 3OZ9H 4OZFG 2IEPA 5EORH 2NR6A 2BSBA 4ATWA 2OMTB 3D85A 5CPNA 2M8XA 1S2VA 4AYBA 2AERT 2NW2A 2Q3ZA 1UD2A 3P3TA 2Y6TE 2V5BA 3VMNA 2AQSA 3HPFA 3OKEA 1QFWM 2IANA 4JGJA 3WFHA 5IBLC 5I9QB 4K3DL 4JN2A 3N85L 1MSPA 3QPQC 1J9SA 5E93A 2NQCA 3AUOA 4ZTOL 4PJ5E 3JS3A 2NY0D 2E5CA 4QRUA 3B2PA 3DBNA 2FX9H 1ZBWA 4GXUN 4G5DA 4OLYL 3B9NA 1SO6A 5ENWB 3RWJA 4HNOA 1EUTA 1HZHL 4WSJA 1KM1A 2VOMA 2AJSH 5ABTA 4QO1B 4P8UA 5K33A 4HMDA 1XCQA 1KG0B 3B40A 1NLBL 4LV4A 5BXFB 3TBCA 4I9AA 3N9GH 4JPIB 4MCZB 1CQYA 1I3GH 5IOPA 4NYLB 1PTGA 3N18A 3A4DA 5C0RH 1E0OB 1X5MA 1ILUA 2ZF8A 3ULUC 3C61A 3HBLA 4JUTA 3A6OA 1KFCA 1QBBA 1P5UB 4O9HH 3OGCB 2MANA 4HH9B 4M6UA 4YHLH 1FL6B 2W1NA 4YK4B 3DN5A 4AY8A 4LCCA 5CSGA 4NKOA 1H6TA 1ZJHA 4OLEA 1TKKA 4K8RC 1WQVT 1W2PA 1OW0A 1W1YA 1SO3A 3WMBA 3HQNA 4U1KB 4J3OC 1P5UC 4GIAA 3GY1A 3JZEA 3KRSA 2P5EE 1KN4H 4YK4C 5GSVB 1WA1X 1DUYA 1CD1B 4R26L 4WU5A 2F1AA 3K1GA 3DGCR 1PY9A 2FX8H 5DO8A 4MYAA 1BXUA 4O02H 2Z93B 1FHVA 4LESA 1CL7I 5FC9A 4APXB 4QGYA 3W1XA 4XC1H 3NJJA 2QQ6A 4WQ6A 2WHKA 3D0VA 1OINA 3EYVA 1GZQB 5M5DA 3I9AA 3LRSA 1NDTA 5CWSA 3WUWG 4ERSH 5GNZA 3QKZA 4XPTH 3HI6H 4J3UA 4WHYH 4UTUA 5IW3A 4UMGA 1CLYL 2Z7ZA 5D9SB 5HWNA 1SFHA 2KX9A 2VD9A 4ICXA 1KC7A 2AKRA 3CQFA 3HTLX 3O2VH 1JHKH 3L1OH 1JPGA 5D2LF 4YHGA 3SDCB 2FT6A 1IAII 4H0LC 1C8PA 3WO4B 5I23A 4ZYKB 1VRSA 2J25A 3TW7A 5AKQA 4HWEL 4HJJL 3O2DL 3SDCC 3TH4T 1FPTH 2FD6L 4ZQOA 3BYYA 3U2EA 2I57A 3WO4C 1YEWA 4DLFA 2CBIA 2VLKB 2A6KB 3AMKA 1YJDL 2Y7DA 2MOGA 1F6AB 5L7XH 4NWUH 5EMYA 1T0NA 3M88A 3I6GB 4JQIH 1DQLH 2J6EH 3VE0B 2G0WA 3GG7A 4ZA0A 1SBSH 5AYZA 1OTSC 5B1JA 1HH6B 2ZWSA 2JQMA 2YQ3A 3CPLA 2QGEA 3L08A 3DECA 3BN9D 5J4MA 4QHUA 3IM1A 4JX0A 4X5WB 3ULUH 3NCWA 1IEAB 4F8OA 4UTHA 4DUVA 5JQIB 2V81A 2HVKB 1Z1WA 4Y5YC 1BXBA 3MYJA 1OTTD 2Z9TA 2YEZB 1VGKB 3GHTA 2VT0A 1QUNB 2CKRA 1HK6A 3TQPA 4UYQA 4I18B 1J8KA 4K8RH 4ANXA 4R9XA 2YBRB 3BUTA 4W86A 4XVDA 1L9MA 4FPSA 2EXWD 3WF0A 3L0GA 4IMGA 5E2UH 2EXOA 4OLZL 5IMMA 2Q01A 2A74B 4XSMA 4MXWL 3RHWK 2GGHA 3DHMA 3HRPA 5C6PB 4JQ2A 4IGMA 1OAZL 5CLTA 3BPCB 4QXTA 1SDDA 4Z3JA 4ALAC 4N4QA 1T7LA 4R7NB 4PJ7A 3KYKH 1RK1A 2NQ3A 2YD0A 1M41A 3C6LD 1MNNA 2JKSA 4KGLA 3FGCA 5FDWB 1ZA6B 1KYFA 4PQXA 2AJZA 3A47A 4YC2B 4WVXA 3PFQA 3SDOA 4CQAA 1V0MA 2X2GA 9RUBA 3LB6D 3R8RA 3S9DB 1QRNB 3ARDB 1JD7A 4GP4B 3KOXA 3EA3A 2I60L 4YC2C 4KKBC 1EC7A 3MSYA 4FXKB 4LAUA 2GAZB 4YFLF 4U6XA 3TU9A 5AAMC 4PIBA 4TOYH 2YIHA 5L8JB 4HJUA 5IKCB 1ML1A 1JSYA 4FX7A 1CG9A 2XXFA 1BG4A 5I71C 1Y0LA 1FYHB 4NEHB 2DZAA 1VAHA 5C86A 4XQ6A 4P2OB 3ML9A 1VEPA 3SKUD 2W81C 1J5HA 4ZO7A 1H3PH 3V6OE 3ATEA 2X42A 3SPVA 3OIXA 4NZCA 3F6IA 4TVCA 1DZ0A 2PI6A 3B8VA 3TXZA 3NQGA 3Q43A 4PWIA 2IWFA 5H35A 4HT3A 2F1EA 2CIPA 2ZDRA 1JNDA 3AAMA 5D9NA 3WDQA 1IKNA 1NC4D 3AMDA 2J8HA 4NZ3A 3FHAA 4MA8H 4DPCX 2WWNA 1LEKA 1FO0B 2R69A 3DXAA 2YL6A 3ULVE 1E1FA 4YVUA 3OR7B 2XN0A 2D8KA 2PRHA 3SKOA 4ANKA 1UWEH 4R3SB 1UA3A 2V5KA 5C07A 3RL2B 4S3FA 4QCIA 4XKMA 4Q8QA 5E9DD 1K5NA 1JGLH 3T0BA 1QHOA 1ME8A 3KS0H 5EZIH 1FWTA 5FO2A 1E71M 3N44F 4Y4FD 1YEHH 3LPWA 4JFFB 5BVPL 5LCVL 1F3JA 3HS8A 3OA3A 5D72L 1TCRA 3SQBB 3BL3A 3PABB 3SODB 2HTLC 3GHRA 5D9OA 3UJTH 2QJMA 3HGJA 1NELA 3ZLFA 5C0JA 1RK0A 3IN2A 5HHQB 2EYTA 4NAMA 3BOFA 4DPRA 2OEJA 2XVGA 3NQKA 2AEQH 2NOYA 5JQHC 3O3BA 3CJPA 2VFFA 4XX1E 1P7QD 3P0GB 5GISL 4AITA 4S10A 5IT2H 1ZAJA 2JJTC 4WJ5B 4UFHA 5E0CA 4CNOA 5B38B 5GS1B 3TNNB 5IVZA 3VXMB 2D3NA 3QHNA 3X11A 2J1WA 4QNEA 4G1KA 4UQCA 3FJ4A 2OTWB 4HIPA 3FK4A 4FFWC 2FEDD 5F9OL 4R8WH 5HQMA 4GINA 1UVQB 3OLDA 2VLJB 2DEYX 5GS1C 3CFKB 3C60B 1MI5A 1KYOJ 1PW3A 4XVJL 1ECEA 4JN1L 1RSYA 3EW3B 4LNRB 3DROA 5D7JB 4JY8A 5ACMA 1JDDA 4PGDA 1M3UA 1V7MH 1UC5A 3C60C 1F8TL 3HQOA 3PFUA 1QEWB 5EU3B 5JW3L 4K7YA 1GKQA 3EO9H 3O6LH 5CEXA 3OAYH 2OZNA 4UINL 1GAFH 3O8XD 1XF4B 3UJJH 1X7TA 1GSMA 5HBFA 4F0RA 4DYJA 1Z69A 4PUEA 4LEFA 4LBAA 3IV3A 1KBLA 4ZMYA 1A1OB 3VA8A 3H53A 3GMQB 1CXKA 1L3WA 5A40E 3OC8A 1DXEA 1KM3A 3R12A 3L23A 1UCWA 4ZB5A 4HIIA 2PD9A 1Q94A 2Y61A 5CEWA 2VN6A 4HBQA 4J28A 4AJVA 3NIDF 1T3FA 4BWUA 5JXED 2OO0A 3ATYA 3K2UH 4L8BA 4L3ED 4MY9A 1HL2A 3EGSA 4OTXH 2FDMA 3EXLA 4JQ3A 1V54B 3RCMA 1YPZF 4WDUA 3QHFH 1XXDC 3KPRB 3QORA 3CUPA 1S78C 4PMJA 1VFMA 4IBZA 3HMCA 1FIEA 3VACA 4CW1A 3LPPA 4OT1H 3F3HA 3PDOB 2A4AA 1AW2A 3PHQB 3THAA 1FVCA 4IBUA 1BBJB 5JUEH 1XQLA 2BG5A 2EDEA 1E9ZB 3QXAB 4RWYH 3GH5A 2ILLA 5I0DA 4IRZL 4P0DA 2WCGA 4RL3A 4LLWB 1PZ3A 4NPYB 5GZOA 5EB9A 1T5KA 2JSFA 2WBWB 2ZA2A 4GG8A 3RIFF 4L9DA 1RV8A 4IS6A 3BEWA 2F5BL 1MFBH 1Q7ZA 4HPYH 1NEUA 4HK6A 3HAEB 2N7BA 5K7JA 2XQ0A 3T6QC 3QM3A 3WMCA 3CIAA 2HUEA 2XI9A 1CE6A 4UT6H 1O5XA 1V51A 4ACYA 4X6DE 3K7UA 5HJLA 5GGSY 3MZNA 4UV7H 3QN3A 3D18A 2HFGL 2OSLA 3Q7JA 1H6FA 5FYJU 4LSRH 4W9IC 1YMMB 4JTSA 3QUXC 3T4WA 2NUPB 1ROWA 4OTKA 4B96A 3QEQB 9XIAA 2XXMB 3KCPA 3LK6A 4Z2JA 4U3HA 4CVXA 4UT9L 1RURH 3KVMA 3KGSA 2PCFA 5BS0E 1OEZW 5CAYB 5L4IA 1SUJA 4EBQH 2QZQA 3MV7A 3QDGD 1JI2A 3PYCA 3K4AA 3MRRB 1NOAA 2R1NA 1BVNP 2F7RA 1V03A 4NM8H 5HHPA 1NDGB 3OGOE 1FQ0A 4MCMA 1W72L 3KUMA 2HJFB 4A2EA 4GH3A 1UWSA 4XHJC 2X28A 5H94B 2OQHA 4AJ0A 4O2EA 1JV5A 5GHWH 2NY2D 2IH3A 3DX6B 3TC6A 3PZUA 4G6KH 4L1GA 3Q45A 4JFDB 4AIBA 4F58L 1PIGA 3RI5F 5HDBB 3MRMA 1N6UA 5DFWH 1E4WL 2ZSWA 4RNRB 3BSGA 4J6RL 2J72A 3ABMB 5A8OA 3MNMA 1OTUC 4KX7A 4GVHA 3QMSA 2L7JA 3OA5A 4DJEA 3I3BA 1DJNA 5EO9B 1GOQA 4EXBA 2J1KA 3UZVA 2CJSA 3OJDA 3UGEA 4HGWB 3PZVA 1I0DA 2CZEA 3HFFA 3CAWA 5BXPA 3V0DA 2BNRA 3OJVC 1CFVH 5FGBA 4MMYA 5BU9A 5ESAB 2YD6A 5A43C 1NJ9A 4IBSA 4OFPA 5D7LE 1RP8A 1DN0B 1I7ZA 3U25A 4S2SA 3QIUD 1YYMH 2VXUH 5JIWA 3HA0A 3ECQA 3KPTA 2V7NB 2NQDA 5C55A 4KI5D 3CH0A 3VGHA 3D7PA 5KETA 2VCAA 5EZPA 5DI8B 4RCXA 1OZQA 3PSWA 4AKPA 4GAYA 4NCC1 1ZPUA 4ZVJA 3B3IA 1S8DA 3E6FB 2WKGA 1PNCA 1EZSA 1VJZA 2F1BA 1U8CA 2ZUMA 3L9YA 1RJCA 2BNQD 1I1AD 4I0PD 1WEJL 2ZYIA 5LSMA 3KS0J 2X05A 2XYBA 4GI9A 1L3NA 3ANUA 3BSZH 2JCCA 3UZWA 1LILA 1OIOA 4DJDA 1CFNB 2RCSH 4XXDB 2WY3B 3LPOA 3RU8H 4XMZA 1CCWB 3IJEA 1AQKH 3PWUB 2VC7A 4X6EA 1BFNA 1V3JA 3DETD 1XIHA 2B7QA 4Z2KA 3M0YA 4LSSH 3TBVB 2CLZB 3UP8A 3JW7A 3IDUA 4XZWA 5KS9F 3F4DA 1H3UA 1R7AA 4O13A 3X3FH 4NQDB 1WBXB 1R5IA 2FCBA 4R4FL 4QHNA 3MLRL 1IBFA 1Y6MR 1UENA 4LLAA 4YIQA 3LQAH 4OLXL 4N6EA 5JMRA 2GSIB 4ES9A 1MCLA 2EHHA 2OOGA 1ZLSL 3I3DA 2R15A 4HXAL 3VIMA 3ZKQD 1CFMA 5AKVA 3AG2B 1CFSA 1FNEA 3WDHA 4LCIL 4QRSB 2XH0A 2FJGA 2WLNA