5HNTA

Crystal structure of akr1c3 complexed with cape
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal Structure of AKR1C3 complexed with octyl gallate
rcsb
source organism Homo sapiens
total genus 117
structure length 315
sequence length 315
chains with identical sequence C
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5hntA00
3M0IA 4JQAA 4PUUA 3UZWA 2FVLA 4PR4A 3R43A 4G5DA 3O0KA 4XO6A 2HEJA 5HA7A 2IPWA 1ADSA 3D3FA 4MHBA 2INEA 2QXWA 4Q3MA 2A79A 3QKZA 3V35A 3C3UA 3EB4A 1AH4A 4GQGA 2FZDA 1Z3NA 5KETA 2PDBA 3LZ3A 3V0SA 1AZ2A 5LIUX 2PDIA 3GUGA 2PDKA 2PDMA 3MC5A 1VP5A 4H7CA 2PF8A 4DBUA 3ONCA 1PZ0A 1A80A 4XVDA 2IKJA 2ISFA 3RX3A 3WCZA 2HVOA 3FJNA 2PDUA 4L1XA 2WZTA 1FRBA 5LIXX 1K8CA 3R8GA 1XJBA 3COTA 2IPJA 4I5XA 1QWKA 3EAUA 2PDQA 3UGRA 3H7RA 5M2FX 4WEVX 3M4HA 3GHTA 3T42A 4GABA 3R94A 4L1WA 3U2CA 3R7MA 2NVDA 3H4GA 2HE8A 3V36A 1IHIA 5AZ1A 2PDGA 4JQ1A 5JH1A 1MI3A 1OG6A 2J8TA 1LWIA 1J96A 4LAZA 1XF0A 4WRHA 4JQ3A 2PDFA 4Q7BA 4FA3A 4JTRA 4ASTA 3DN5A 2PD9A 4YS1A 1AH3A 4JTQA 4YU1A 1Z9AA 4JIIX 2DV0A 3G1RA 4JQ4A 4GCAA 4WDXA 4GQ0A 1GVEA 2IKIA 3H7UA 4JTCA 3N2TA 4FAMA 1IEIA 3V0TA 1S1PA 4WGHA 4HMNA 2PDNA 1S2CA 2IQ0A 2R9RA 2DUZA 4PRTA 1T40A 3LD5A 1M9HA 1ZGDA 1Z8AA 1UR3M 4JIHA 3CAVA 4IGSA 3LQLA 2BGSA 2F38A 3R58A 4XZIA 2NVCA 4GACA 4XAPA 2ACSA 1PYFA 5JH2A 2ALRA 3VXGA 4PUWA 4YVPA 4YVXA 1EL3A 4XZNX 3GHSA 3BCJA 2WZMA 1Z89A 1C9WA 2PDLA 1SM9A 2FZ8A 1YNPA 4DBWA 4JTDA 1VBJA 2PDXA 2ACQA 5HNTA 4LB4A 1AH0A 1X98A 2BGQA 4QBXA 2PDYA 3LENA 3M64A 3BV7A 2CLPA 2FZ9A 3R8HA 4GIEA 3BURA 4GA8A 4FZIA 1LQAA 4XO7A 3UFYA 1PWMA 4WDTA 4JQ2A 2IQDA 2HV5A 1US0A 1Q13A 1ZQ5A 3R6IA 1RY0A 4EXBA 4LBSA 3UWEA 2VDGA 3GHUA 3RX4A 2PDHA 2F2KA 3V0UA 1X96A 2C91A 2PD5A 4F40A 4WDWA 1YE6A 3NTYA 1AFSA 2IS7A 4XZHA 2AGTA 1ZUAX 4PMJA 2I16A 4FALA 1EF3A 1QRQA 3BUVA 3P2VA 1RY8A 3UZZA 2ACUA 4JTAA 4ICCX 3DOPA 4RPQA 3UZYA 4AUBA 3UZXA 1EKOA 3CV6A 4QR6A 3CMFA 2PFHA 1EXBA 3ERPA 3CV7A 4HBKA 3UG8A 2ACRA 3G5EA 2DUXA 4QXIA 3LBOA 2HE5A 1ZSXA 2PDPA 3LNMA 3WBXA 4XK2A 3LUTA 3Q65A 1T41A 5C7HA 2FZBA 2IKGA 1YE4A 2R24A 1HQTA 1R38A 1X97A 4EXAA 4XZMX 3RX2A 2PDWA 4NKCA 1XGDA 2HVNA 3LZ5A 3CASA 3ONBA 3Q67A 1YNQA 4JIRA 3WBYA 3O3RA 3EB3A 2PZNA 3F7JA 3LN3A 3WG6A 3GHRA 5LIYX 3KRBA 1MZRA 3WBWA 2IPGA 3S3GA 3UYIA 4LAUA 3B3DA 5DANA 3MB9A 4IJRA 4YVVA 5HNUA 1PWLA 2IKHA 1PZ1A 4H8NA 4ZFCA 1S2AA 2FGBA 1S1RA 1AZ1A 5LIWX 1Q5MA 3CAQA 4DBSA 2P5NA 4LBRA 3FX4A 3N6QA 4R9OA 2IPFA 2PDCA 2PDJA 1MRQA 4XVEA 5AZ0A 4IJCA 4LB3A 4DZ5A 4WDUA 4OTKA 2HDJA 3LEPA 2BP1A 3LQGA 2I17A 2PEVA 5LIKX 3UP8A 4PRRA 4QX4A 1JEZA 4XZLX 1RALA 2INZA 1HW6A
chains in the Genus database with same CATH superfamily
3W82A 4HZ6A 4C65A 3VCCA 3UZWA 1E6QM 1EC9A 4MB1A 1XD0A 3B05A 3W7CA 1YBQA 5FA5A 5ABGA 1H60A 1GQNA 4G5DA 4H8HA 3HA1A 1BVWA 4GBDA 1Q66A 3GY1A 3ABZA 3A12A 2QULA 2ZX7A 3GW0A 4HYRA 1QJWA 1UP2A 3CUGA 2WMIB 2AKMA 2FZDA 3K5XA 2PDBA 1ZAJA 1SZGA 3P7YA 3V5OA 5A6BD 1SO5A 2YL6A 4IIEA 3GX9A 2Y24A 4GYPA 1AZ2A 3ONCA 3VDAA 3S1XA 4XAFA 4HPNA 3HPAA 1O94A 4S3KA 1CXKA 3PBMA 2TODA 2VRJA 1A5AA 5LIXX 3UJSA 1M6JA 1QNOA 1VHNA 5IHSA 3A4JA 1UKQA 3UGVA 5A8GA 2B81A 3IUIA 3TW9A 4DUVA 1PIIA 3EKLA 3STFA 3H7RA 2VGIA 3M4HA 4N0RA 3PJUA 1S5TA 3WDHA 4DELA 4GABA 3W84A 4PCSA 1BSLA 1CXHA 3LRKA 4NZFA 2SFPA 4L5ZA 1T8XA 3GC2A 3C86A 2G5WA 4GYFA 2B31A 3TYEA 3N9RA 2FFIA 2X0HA 1DJHA 2CLLA 3W9ZA 4JNYA 5DO8A 1E9YB 3FN9A 3ITYA 3TNOA 1QNVA 1X8CA 3ZWTA 3URAA 1UZHA 3M0LA 1UWAA 4ERIA 3SECA 4JQ3A 4LVBA 2PDFA 1TIMA 5HMFA 5LNSA 1PTGA 1QW8A 2GQ3A 3T0TA 3EX4A 4ZO8A 3T09A 3NZQA 4MJ2A 4YTUA 4PULA 4LS0A 3E6EA 2Y7DA 1XG4A 5K4XA 1XRFA 2Z6JA 4WCJA 3GBDA 4DM1A 1A5KC 4JFTA 1WV2A 4UR9A 4P7NA 4NX0A 4YCPA 1PJ9A 3TIMA 4A6GA 1WX0A 4YTTA 3CTLA 4ZL1A 2QUNA 4NYUA 2DUZA 2PTXA 1IQ8A 2V3GA 2VOMA 3CWOX 3E5BA 4DWSB 2J7HA 8XIMA 5EYWA 3WLRA 2GGGA 4QROA 1A53A 3W87A 1ZJAA 1SO3A 2QCMA 4LX4A 4RX0A 3M7SA 4L64A 3W3OA 1JQVA 3VCNA 3M5VA 2DP3A 2VFGA 2W63A 2KZHA 3VK5A 3SCWA 2ISWA 4TVCA 4B3KA 1VGAA 3MP5A 3B8WA 1EL3A 4Q4MA 4P61A 4XX6A 1KM6A 4I9AA 3BANA 1FP9A 3P5ZA 1SM9A 4EPKA 1GYNA 4FEZA 4HHMA 3F2DA 2E3ZA 3A47A 4TX6A 1DWIM 5HK4A 1LL6A 1UH3A 5I6SA 3EZ4A 3LLFA 4O54A 3CS2A 3CLMA 4MG4A 3T07A 4MZ8A 4GVIA 2W0UA 4R7OA 5L6UA 1MSSA 5G4EA 1OVDA 1SZNA 2AL2B 2OO6A 2DZUA 5FCZA 2QUMA 3GLCA 1NOUA 2E8YA 1DQWA 4YTSA 4RUBA 3LI0A 3NZPA 4M24A 4YL2A 1TJ1A 3UFYA 1SSGA 3TYZA 2ZZ1A 4Z0JA 4MAVA 2FMNA 3FV9A 4B90A 2O4QA 1OT1A 1CENA 3CO4A 4US6A 1DXFA 3VIIA 4ILSA 2MNRA 1RD5A 2VD8A 2ZUNA 4JAWA 4GUHA 2QJIA 4Z1CA 3BLFA 1JAKA 1Q6RA 3UXAA 3TOYA 1QPOA 1ZP4A 3VD3A 1Q6QA 4IICA 4PMJA 1MUCA 5F1UA 3TK7A 4L4OA 1HL9A 3BSGA 1DIDA 3SY8A 1OFPA 2EPOA 5CZJA 2ZE3A 4R33A 4IG2B 2JGQA 1B3OA 1EZ2A 2FKPA 4IMEA 3TZNA 1LUCB 2FHBA 4Z2IA 2RGLA 4B15A 5LXEA 2ZKMX 3TSMA 3LBOA 1HKMA 5D33A 4CD5A 3NQ6A 1W1TA 3BG9A 1UD5A 2PMQA 3VMNA 4M3PA 2QDDA 5DCDA 2CLIA 1VEMA 2ZICA 3GFXA 4QE5A 1NIUA 2PP0A 1P7TA 1Q4NX 3KBWA 4U28A 4YNGA 1AW2A 3MMWA 4EOUA 1JNEA 1XRVA 3EOOA 1TV3A 3GXMA 3EB3A 2OWWA 3WG6A 1FWJC 3MO4A 4ORMA 3G3MA 4NL1A 2DDXA 2YIHA 5AYZA 3LTYA 3THCA 2DZBA 4NY2A 3IJQA 1C92A 4UTFA 1UMYA 4DO7A 1AG1O 4BCEA 1O4UA 3S47A 4Y9NA 4AX6A 2DSZA 3O63A 3EDKA 4GO8A 2WC3A 4WVXA 3UWVA 3TXZA 1B3VA 1GJPA 1S2AA 1T5AA 3UXKA 3NQBA 4Z0SA 3GQYA 5LIWX 4PFHA 1CT5A 3O6DA 4O1CA 2JGYA 3CAQA 1L9WA 4DBSA 1VR6A 3DHUA 3TN4A 3QZAA 3G1AA 4FOJA 3KOZA 3LGDA 4HNNA 2VCAA 2VCCA 4IJCA 1QPQA 3KWXA 5CJ5A 1BWVA 1YIXA 4J9JA 2XH2A 4NJIA 4LYRA 3UP8A 4AISA 4LBUA 3UJRA 2P53A 1RR2A 1YTKA 4WJXA 4JTLA 2ZUSA 3O2LA 1HJSA 1VFMA 2GSJA 4R5EA 4LAOA 4ZOBA 1F3WA 3WF3A 3R79A 2OQLA 1IXOA 3G8EA 4MFDA 4PTWA 1ADSA 4ZSUA 1TTIA 4H19A 3LHYA 2G97A 2A79A 3V35A 4RDWA 3HZ3A 3RJYA 4TXEA 3HJZA 2RH9A 4HMEA 3CWHA 1FY6A 1A5OC 1E9LA 4R7JA 2IUZA 1BG9A 2BOGX 1S5VA 3VMOA 2NUWA 4C90A 1EJ7L 4QG6A 4QFUA 3KOWA 2HZGA 2OT0A 3A21A 3CUJA 4NIRA 5C9WA 2ZIDA 4R85A 4AWTA 2PDUA 1QXLA 4H9ZA 1AQFA 1YADA 1E0XA 3PJTA 3VC6A 3N73A 5A2AA 2RJGA 2VURA 3SZ8A 3TQ0A 2W9MA 3CQHA 2TYSA 1TO3A 4CQDA 5I00A 1AJ0A 2FDMA 2XZ7A 5HINA 1UBPC 4RCXA 2C19A 5GNZA 2AKZA 4F0MA 3R13A 4LYQA 5TBOA 2WCSA 3IJDA 3OLGA 3PC0A 3VUPA 1TTQA 1J12A 3QXBA 1P0DA 4NZCA 4FXSA 3NEVA 4DYJA 2CBVA 3ITOA 3M5YA 1QOPA 5E0CA 5BRBA 2E5BA 3VNYA 2WZEA 3G8RA 1EEXA 4POCA 3LCIA 3B8SA 2YW3A 3DECA 5D38A 3VNKA 4JTUA 1XC4A 2WBKA 2ZX5A 3WQFA 1ISWA 3SUUA 2A7NA 3VDCA 3W23A 2VUNA 3FA4A 1CLXA 3OU8A 4IFOA 3VAVA 4W87A 4W8AA 3SUSA 1G5AA 1H41A 4HIBA 4HOWA 3C2OA 1J0KA 2VELA 4EAMA 3RCYA 3BLDA 5CPQA 5G5IA 5ABEA 4E4FA 5I09A 5I07A 2FDSA 4WOQA 4FAMA 2X8RA 1H0IA 3APTA 3TFCA 2RDTA 1F76A 1D8CA 3JW7A 1ME9A 4JFWA 4JTKA 1T40A 5LZLA 1MXDA 4X0VA 3E0VA 1SPQA 4ACYA 4PTDA 3RJXA 4WK9A 2D1ZA 2WKJA 3LOTA 4W84A 2WKLA 3CAVA 3HFYA 2ZCGA 4LYKA 4Q4PA 1G4EA 1W0MA 3L2MA 1FWBC 4ERGA 3L2LA 5DELA 5A1AA 4D72A 1RZMA 3PWIA 4N9EA 1UWSA 5A8MA 2ALRA 3BLPX 6XIMA 4M6QA 4XZNX 3TV8A 4AZCB 1HVXA 3ECQA 3VOJA 4IMDA 3O06A 4HTBA 1VHCA 1NWRA 2JEPA 2FZ8A 3RGTA 2XJ7A 2RDUA 1VBJA 2GPTA 4UXDA 2P1FA 3GDTA 2V5KA 3KS6A 2W61A 1AW1A 1WZKA 2HSAA 2Z27A 1MQRA 1X1NA 4I9TA 1X98A 4QBXA 5FJOA 1CTNA 3T8LA 2FZ9A 3A4WA 3R8HA 4GIEA 4KERA 4Z2GA 5HR7A 1UKOA 3MSDA 1VAHA 3EPMA 3FAWA 3PPHA 3GC4A 4QISA 3WLJA 2G3JA 2NX9A 2RHGA 4A3UA 4ZQRA 3AS2A 4Y90A 3UVIA 3WMSA 3SY5A 1Q13A 4ML9A 4HN8A 1V6YA 3VE9A 3CIWA 5JXQA 4IL2A 3W7HA 4UNIA 4EE9A 4F40A 2W4XA 4KETA 3T1GA 1AL8A 1EQCA 3OA5A 4GHRA 3NTYA 5JUVA 1GTHA 3KTSA 3THDA 4QG9A 5K3VA 1IZKA 4ICCX 1JDAA 1ELSA 3CV6A 5JIPA 2OKOA 2ZBTA 3B8TA 3UERA 4X60A 3ERPA 4L6DA 1J79A 4WHBA 4HBKA 4MAZA 2Q71A 1YQ2A 3A22A 3DG6A 3G6LA 3LNMA 3S1UA 1GW1A 3KTCA 4AHQA 3OLEA 1U1HA 4DJFC 1Q6EA 3FYOA 3ID7A 2XDFA 3AXIA 2Y5JA 2R91A 3LM3A 3FA5A 2XVLA 2BBFA 3FEMA 5I3FA 5AHLA 1BF2A 2OU4A 3ANVA 5DMMA 3SUWA 2HJPA 2X40A 3HQNA 1UPMB 5J8LA 1DL3A 3F7JA 1E6ZA 2WSPA 3CYVA 5BOEA 4RNJA 3KRBA 2XGZA 4HA0A 1OYBA 2QDHA 2XFFA 2IPGA 3UR2A 2ADAA 3ZM8A 5I2UA 5L9FA 3IV8A 2YBUA 1Q6OA 4DUOA 4HD5A 5KMYA 5LNUA 3E74A 7CGTA 5HNUA 1PWLA 2DVUA 4W89A 2V2CA 2ZUVA 3ITXA 5E9AA 3GVQA 4QNEA 3SDOA 2X05A 1X38A 4TX9A 1E1FA 1EJSC 4B5SA 4XBKA 4K3ZA 4Q8QA 3A3XA 2J47A 1SZFA 2XIQA 3C2VA 1KKOA 3WBAA 3TE9A 1XRSA 5D9MA 4OHQA 2D2GA 2HRWA 1TJ0A 5M3WA 5DMLA 1ML1A 2XIIA 5HUPA 4GYJA 1UWQA 3H26A 1JCJA 3E0FA 4C6CA 3NWRA 4V27A 3WQEA 4N9CA 1QTWA 3RCNA 1B0IA 1R47A 2O55A 2OEKA 4E6MA 3CQKA 5AY7A 1XYMA 1J0ZA 2QLYA 3NGJA 4UIOA 4TQTA 3D6NA 3TTQA 3KAOA 1PPIA 2WQDA 4FF7A 3VOCA 4B5VA 4Q32A 1LCOA 1XFBA 3M0YA 3PTDA 3W25A 4XSLA 2WJZA 3EXSA 4JHOA 2D2OA 4MPKA 3WLMA 3N25A 1AW5A 4CQAA 1E73M 3AIBA 1K4HA 4C7DA 1P0BA 5IOBA 4F8XA 4GIYA 1RVKA 4P2VA 4AWSA 4TTUA 3H2AA 2WNNA 2PDMA 1AJZA 4H7CA 5CCZA 5E09A 4DBUA 1TWDA 3NO3A 5CZTA 3C2RA 3UG4A 3K4DA 1JPHA 4ICMA 4L4MA 3RLUA 3KWSA 1P1XA 4A3HA 2YBVA 3WNPA 3CMJA 2YKKA 4MUZA 4QEEA 2Y8UA 6A3HA 2PU1A 3COTA 2IPJA 4S3EA 5HWMA 3QEZA 1F05A 4V15A 1XPGA 3GS6A 4C6MA 1MNZA 1Q2SA 3IGUA 4R27A 4WEVX 3WSUA 1DWGM 5E70A 1JJKA 4FHAA 1GG0A 2PU0A 3GTNA 1ECEA 1YTEA 4RXFA 2XM1A 4F0KA 1VPYA 2YL8A 2DZPA 1P6WA 4CCEA 4QLKA 1LT8A 5CC5A 4CU8A 1GTEA 3VIJA 4EPEC 1RBAA 5E93A 1T96A 3CV1A 3SQMA 3T8QA 2WVUA 5AVHA 1LBLA 4S3GA 3F2BA 2J7GA 3VKBA 3B9DA 4AB4A 1PUDA 4Q7BA 4FA3A 3EOEA 1XIIA 2DJXA 4O50A 2FLIA 1XUUA 3IJ8A 4RDYA 3PZGA 2VVSA 3CUFA 4A3QA 3GZAA 1JDCA 3PN8A 3VKJA 1DJZA 4NRSA 4O13A 1V02E 4UB9A 4QLLA 2OYKA 1R7OA 2ZUTA 2D0GA 1W5MA 1HT6A 3CL7A 3WFLA 3NAVA 4PTXA 3TN6A 1O7AA 1BTCA 1H4PA 2PB1A 3SN4A 4E4PA 2Z2BA 4OIFA 3VTRA 1P48A 2ZXBA 4W4QA 2VEFA 1OWQA 8RUCA 1W2PA 4JIHA 4HK7A 1IR1A 3MS8A 4P8XA 4MKVA 1XGZA 5DBUA 1VFSA 3W07A 4HNOA 1H7RA 3VIOA 5D9PA 4QDPA 2FB3A 3VYLA 2JEQA 1XX1A 1C3FA 2P3ZA 3R12A 3ZO9A 1ZAIA 3S5SA 3CJPA 2VL4A 3UWYA 3LHVA 5BXTA 1BGGA 1XCWA 5HNTA 1FOBA 3CT7A 2W3ZA 1AH0A 2AAAA 1E56A 1BGAA 1DJWA 1NFGA 4C1NA 2GVGA 5DLCA 3KVMA 3VZXA 4QCFA 1DJYA 1XG3A 1UH2A 1FDJA 1MWOA 1X6UA 4XO7A 2HS6A 1E1CA 1SZEA 2G41A 4RE3A 4BA0A 3HOJA 1QU4A 4PUMA 3NGFA 3ATZA 3W76A 3SY1A 2V63A 3VFCA 1E4NA 1CGVA 1RY0A 2PAJA 4IPIA 5CAHA 2VDGA 1IWPA 2NW0A 3DYPA 1LBFA 2F2KA 4N7QA 4MKNA 3OP2A 4A3RA 1P6BA 4JL2A 1OX4B 4JYDA 3MT1A 3ISIX 3WQPA 1JYNA 2Y7EA 1WXYA 2XVKA 3P2VA 4YPJA 3AIEA 1CYGA 3OLDA 2EJ1A 3LBMA 3DFYA 1H1YA 4IXXA 3GG7A 3VOHA 3WK1A 1ALDA 4XKYB 1EXBA 2J7DA 3BOXA 2XVPA 1A4LA 1B5TA 1UR1A 2ZZ4A 4ZR8A 3VZZA 4GINA 2HE5A 3WBXA 1ISZA 3VMPA 4NSBA 4R3UA 1ITCA 3UG5A 2B7QA 1TV8A 4J7RA 1R38A 2F84A 2PDWA 5FEWA 4HA4A 3GXNA 1TRDA 2WAGA 1YNQA 1JCLA 4JIRA 3AHXA 3S5YA 1BTMA 1SR9A 1PX4A 3SIMA 2WZHA 3W1LA 2VVNA 2PLCA 1F6PA 1JL8A 3N19B 3C56A 2DFAA 3R0UA 3W72A 1DTUA 5D37A 3QZEA 5DANA 1VIWA 3D46A 4KQNA 3N15A 3PBWA 2WW5A 3NXLA 4DF1A 1GOWA 3TTOA 4QEHA 1K77A 1TV7A 4H01A 3BJSA 1IE7C 4LBRA 3KBNA 3EXTA 1KFEA 2CZDA 4DO4A 4QHRA 3CAKA 3A3WA 3UWZA 1KLYA 1POKA 2F9RA 3N29A 4UQCA 2AMXA 2HDJA 4XUGA 1VPQA 1VCVA 4GVHA 4I8DA 4A8IA 4A2RA 1OC6A 2V5CA 4Z2LA 3ARZA 4PBEA 2PGFA 1MEHA 5BROA 2V5LA 2C14A 2J75A 1W32A 1IIGA 1A3WA 5HAOA 2BSLA 4YIWA 2E9MA 2CLFA 3EA1A 4JFVA 4GI9A 4TIMA 4ACZB 4HVXA 4XAZA 1IF2A 1NF0A 3SQSA 2TRSA 5H6HA 5I06A 3ZS4A 2E28A 1TJRA 6TIMA 3P14A 3UNTA 2DZAA 3VI2A 3BARA 1Z7AA 1SW3A 4LAMA 3MC5A 3WYZA 1KB3A 5DMNA 3NCOA 2PF8A 4G6CA 3P6LA 5H2ZA 4B5WA 3WDJA 1HJXA 2HK0A 4IQEA 5F7UA 1K02A 3VM5A 3B8DA 1E3XA 1W1ZA 1JDDA 2GGEA 4NJGA 2QUTA 3UESA 1EXPA 2QEZA 5A6LA 1Q63A 1XLHA 3UR7A 3CXOA 1JR1A 4FPSA 3VGBA 2OSYA 4AY8A 1W37A 3BAIA 1PX8A 3G77A 1XIGA 3IIOA 1G0CA 4BWLA 2WYSA 3FSUA 5IDIA 1Y5VA 3H54A 3BQ6A 3NOYA 3LGGA 2D24A 1FWCC 2NV2A 4KEMA 2DU2A 2H9AA 1IHIA 2EG6A 4N4QA 1ZHAA 2PDGA 4C7FA 4WY0F 4FXRA 1UC5A 3LI1A 2BY2A 4JZ5A 3SBFA 4ORIA 1XH1A 1J96A 4IPNB 3QSTA 1RP8A 4KH2A 3CZGA 3WUGA 4MYAA 1V0KA 1KFJA 2WLZA 1W3TA 2CBUA 4GZIA 3W37A 9RUBA 1VD6A 1SQ7A 1M68A 5AB3A 4EANA 3KCLA 3KUMA 3MJMA 4HZ7A 4D1JA 4RDZA 5IM51 3URNA 2OTDA 2CZEA 2VDIA 4UBPC 1JFHA 3EWWA 2ZRYA 3QY8A 1QHPA 3B9EA 4LTSA 5E0FA 2UZ9A 4XZ9A 1IEIA 4RJEA 1A5NC 3ZJ8A 1JCTA 2IQ0A 3GNXA 2F6KA 1WPCA 3SRFA 3PZ9A 3HPXA 4E2VA 1TZ9A 4S39A 5DFAA 1FWIC 3GD6A 3SCOA 5EPDA 1UR3M 3GH7A 5CSRA 3CHFA 4AZ6A 3FVMA 3T4WA 2EAWA 2BGSA 4H9UA 4DQWA 4HPGA 1S2VA 1JRBA 4JTHA 2VFEA 1TPB1 2NSXA 1TJ2A 2YLLA 4EKJA 1PYFA 1W2VA 1UP3A 4YYCA 4IP5A 4I7UA 5BOOA 4YVXA 3CBWA 3H2EA 4K36A 4NHVA 4QM1A 1L6FA 1GORA 4LOCA 4ZENA 1KXQA 1B30A 2JF7A 1OFDA 4M56A 3BCDA 2VWTA 3SRDA 3NL2A 1R86A 4FB7A 1IXPA 3GTFA 2VFHA 3RMEA 2REQA 3LLDA 1YRRA 3C6CA 4AC1X 1J2BA 5EMUA 3C2FA 3E2QA 1BYAA 3IVTA 4B9ZA 5LGXA 3UXDA 1B3XA 2OYLA 1VENA 2PWVA 3H24A 3QTPA 4CN4A 4P7RA 4GYPC 5D9NA 1L6GA 3GU1A 2E09A 2PLKA 1WP6A 4ZXOA 4KS0A 2OG9A 3PY2A 1UOKA 3GDKA 4UFHA 1PS9A 3SCVA 2D73A 2RAGA 2XSBA 5DCBA 3GHUA 1DQUA 1P0NA 5HPCA 1IT0A 1HNYA 4LCQA 2X2GA 4D8AA 1KV5A 1SJAA 3AMLA 1RY8A 5HJXA 4AYGA 1VS1A 4RPQA 2GLKA 3MCOA 3OZYA 1E3ZA 4K2SA 3W2UA 2Y1HA 1TQJA 1MEIA 3UR5A 4JDBA 3ARTA 3W71A 1G7VA 3MYPA 2G95A 2WLYA 4UTTA 3GVGA 2PDPA 1LL7A 1NSJA 1EP2A 2V82A 3NG3A 2YOCA 3DX5A 4KWWA 1QW7A 3J7HA 2JQXA 4EF8A 3JU2A 1YE4A 3UZ5A 4HZ8A 4LS2A 1X97A 3WDRA 4L65A 4U33A 1E40A 4EIVA 1L6WA 3E96A 2V30A 4AMAA 5CGTA 4D9PA 1FH9A 3TVAA 1W3NA 5KZ6A 3G1SA 1JZ8A 3WQGA 1DWHM 2NXHA 3RUBL 2GDVA 1EBHA 1GOMA 5F2LA 4GLEA 3W1PA 3B3DA 4KWVA 1MMFA 3GYCA 3TQKA 3F4DA 1W9DM 3FXGA 4JNZA 3MUAA 1K8YA 1GKQA 3M5ZA 1Q5MA 5AKQA 5HULA 4QCEA 4UMBA 2NXIA 3PZIA 3N6QA 5E6YA 3BXWA 2PDJA 3M7WA 1C8XA 3RR1A 3UY8A 4BQ5A 3IJLA 2PTDA 4IPLA 2Y0FA 1FFQA 3TYBA 5FF7A 3NQ7A 2Z7GA 2RDWA 3STCA 3WFZA 1FWNA 4YHGA 2V68A 3UZJA 2C0AA 4PRRA 3R0KA 4MY1A 3IIPA 4S3FA 1REQB 4M51A 4G8TA 4TR9A 2UWFA 3EMQA 4HSNA 1D3HA 1T7LA 3VGEA 1J5SA 2QCLA 3TYUA 1TPH1 2WK2A 1ADDA 2A85A 1MQPA 4QIUA 5I0DA 3N2OA 3IUDA 3U7BA 3PPCA 3WJWA 3S1WA 4LAKA 2PLMA 3RU8X 3PSVA 4IX2A 1G6CA 2XYLA 3EWCA 1YXDA 1P5BA 4KFNA 4ZTXA 3VOIA 4CNNA 4US5A 3AZRA 4JN6A 3CIVA 4W7WA 3N4EA 5D30A 2NQ5A 4GKTA 2WMHA 1Z32X 3C8NA 1GQLA 1V08A 4JX5A 2EKGA 3ZLFA 4S2CA 4AZHA 2O9OA 3RK8A 1RHCA 2ZVRA 3OIHA 5I3HA 2BS9A 1NEYA 2P10A 3BZGA 2YPIA 1E4IA 5C9ZA 3W29A 1E43A 3N2CA 1R3QA 1GUVA 2C0HA 1OCQA 4L56A 3P8JA 3W7IA 2WKGA 3MWAA 2VR4A 1R9ZA 2RJHA 1MFVA 5CG7A 4DF0A 2EQDA 4AW7A 2YA1A 1V3MA 3WQWA 4HNUA 4HZMA 1JI1A 2OLHA 1GCYA 2OZTA 3CPGA 2X1IA 3T40A 1EO7A 3WH8A 1HX0A 1GZGA 1MYRA 3VUSA 1H62A 1J93A 5A2CA 1TUXA 3HV8A 4G1NA 5D04C 1MFUA 1RH9A 1XGEA 2QCDA 2YBTA 4EAYA 4DI9A 2NV1A 5JH1A 1OG6A 1B3YA 4XBJA 3M0VA 2G8ZA 1LROA 1S3TC 2WPGA 1M7JA 8CGTA 4IFKB 3DN5A 4FO4A 4P5UA 1Z9AA 4DN1A 3I6RA 1NDWA 4NX5A 5EMYA 4AEOA 5AHNA 4RE4A 3Q58A 4E2BA 4WDXA 1XPYA 2E40A 2WMJA 1KBIA 1WE5A 4BQ4A 3LGEA 3FYPA 1ZBWA 1UWUA 1FA2A 3L23A 1S2WA 2ZOXA 4LWWA 3L9CA 4CKQA 3LM7A 1PKLA 1LQ0A 3RR4A 4KPLA 2WC4A 3MKKA 2JKAA 4MADA 4J3XA 5IBXA 3QOMA 3EWBX 4XIAA 2W66A 4PB5A 4AY1A 2HCVA 1EF2A 1BQCA 3VO0A 3KHDA 4PL1A 4AU0A 3IIXA 5F4XA 1EEPA 4BHYA 3RRXA 4J3VA 1ITXA 1DXEA 3LPGA 4M82A 3S42A 4PB3A 1HFBA 4DO5A 3PM6A 1HP5A 1DJXA 1K03A 2QUUA 1C9WA 1DJQA 3FLUA 4LVDA 4GBUA 4JN7A 2J7EA 4GFSA 4HN4A 1UR8A 1GKRA 2VD9A 3GNOA 1V93A 1DXIA 3QYSA 1KM2A 1ZTVA 1LWJA 1JZ4A 1AA1B 1QPNA 4HB7A 1LRNA 2CC0A 2XUCA 2CETA 3PFMA 1EUAA 3BURA 2XFRA 3CEPA 3NXFA 3GXTA 3N6JA 4GJIA 1PO9A 4DJFD 4C6PA 3WK3A 3AUOA 3KRUA 4I5UA 1JAEA 9XIAA 2O0TA 3GIPA 3FGCA 1FCUA 4B5TA 2QCDB 3RN6A 2FYMA 1KM5A 3TZFA 4U5IA 1MXSA 1Z44A 1OEPA 1EPVA 1YE6A 1V3JA 3MJYA 4C1KA 1AFSA 2I7GA 4IGMA 2ODOA 3PZTA 1H61A 2DZSA 4JTAA 4AUBA 5AC6A 1WKDA 4DYEA 3B0XA 1EJUC 1EKOA 4HK6A 4WUIA 4KGLA 3OQ8A 2Y4SA 4OOUA 3O07A 1EGMA 4K39A 3L5LA 2DUXA 3ABRA 1UCWA 2GVEA 3IRSA 3WD0A 1I60A 3ELFA 3EBVA 4N6FA 5CEWA 1T41A 3VD4A 2FB2A 5CC7A 3SFWA 4ZXLA 1FKWA 3M0XA 1OZMA 2WV8A 4C6EA 2INFA 2QQ6A 4IZGA 1Z42A 4TTGA 4LC6A 4QSFA 5A6SA 1XDLA 2VZOA 4I3GA 4UFKA 1SO6A 3W7GA 1TE1A 3T44A 3EXRA 2PP1A 1KCZA 2CWXA 2CESA 1DQXA 1FWDC 3H2OA 4GZ7A 3MB9A 4UCFA 1AK5A 4LF2A 4TX8A 4YVVA 3QQWA 1MDLA 4E5TA 4H8NA 4K37A 3GR8A 3KZSA 1AMYA 2YXXA 3TJXA 3W7NA 3TCSA 3SB0A 1U30A 4CN6A 3I4EA 3HO8A 1UW9A 2YXOA 3G2GA 2ON3A 2PDCA 1PB0A 3ARSA 2L5HA 4ZQCA 3NYDA 4CNOA 5EMJA 2CHRA 4BF7A 3OHIA 1JF6A 1GVSA 3WQVA 4H83A 1XLLA 1WUFA 4X2RA 1MUMA 3DKLA 1M5WA 4E2DA 1DJIA 3QMSA 2HWGA 4Z2KA 3O9NA 2GJXA 4ERAA 4JYEA 1NWUA 2YFOA 4YWIA 3W7JA 1A49A 2V8ZA 1SFLA 1CLVA 3U5UA 4DM2A 3FGCB 3QFWA 3SEPA 2HEJA 3QV7A 2YCIX 1TB3A 1GNXA 1FH8A 1FTXA 4ZE5A 4ATWA 3NSXA 4X3ZA 3SGUA 2A3EA 4JTGA 1W9UA 3BGAA 1HJVA 1A3HA 4ZE4A 1E4LA 2CEQA 2BVWA 3MANA 3APYA 1X6LA 3P74A 1XBVA 5KEZA 3HQ1A 3LG3A 4KW2A 4AQLA 4H9MA 3WK0A 5FL1A 1TPFA 4EACA 4U2YA 1QASA 3W7LA 2FGLA 1QBAA 2ISFA 3RX3A 4HNVA 4GGHA 3WMLA 3TA6A 5CBJA 1WZAA 3GBEA 1I0DA 2OGYA 3GFYA 2CU0A 4FF5A 1TUFA 4D8ZA 4V2XA 2WNWA 4V1XA 2XWEA 1HL8A 3UJ2A 2PP3A 4YWSA 4GNKB 3LCGA 3W4RA 2QDGA 1CDGA 3U0HA 1RUSA 3VCRA 1GJWA 1QWKA 3EAUA 3AC0A 4QG8A 1E9IA 1S5NA 1UD4A 4PYSA 1OFEA 3N17A 3QR0A 2Z24A 1B90A 1UD3A 5K9CA 1X1ZA 5C54A 2PE4A 1F5ZA 1JVNA 4TVUA 4MNMA 1RXOB 5JQ9A 4CVUA 1I2RA 3R25A 1S5MA 4M8UA 2HROA 3MDUA 3EDJA 3N6HA 3ZMRA 1UUQA 1W5OA 2PGWA 5DT7A 2JIWA 2XTKA 3GXPA 4XISA 2P3EA 4W7UA 2H3BA 1MI3A 3PJWA 5G1YA 4WRHA 3GDRA 1LF1A 5FKYA 1QNSA 3WLNA 4NZ4A 1TMHA 3AS3A 3G1VA 4LUSB 4OKDA 1HL2A 4BFAA 1OFOA 4KWSA 3BC9A 2PRMA 2DV0A 1XLIA 2OOFA 4PUJA 4NZ3A 5KZEA 1T99A 3VOFA 1K4GA 3LTSA 3QFEA 1R30A 2GDQA 1CGXA 5CXPA 3VOGA 1IXQA 1XFCA 1GYLA 1ECQA 4Q4QA 3WLTA 4UMCA 1V02A 3A13A 3MO7A 2HQAA 4C6NA 5I7GA 3FS2A 1U2YA 1FCQA 4WIWA 1OK6A 2YGYA 3W6MA 3BMVA 1RJRA 1V0MA 1VYSX 4GQBA 4GC4A 4ZOEA 3L4WA 4KBXA 3N4AA 4LUTA 1LWHA 3JVAA 1UG6A 4UTJA 2NT0A 3MKVA 1M7PA 1LJYA 2DJLA 4O4VA 3N18A 3BLIA 3FKRA 2BWGA 5AOUA 1IXNA 5D4YA 1OZQA 4KGJA 1TELA 2PCEA 3TROA 3RF9A 1HKWA 3PBUA 1A5MC 2QUVA 2YXGA 5HANA 4JR5A 1F4AA 3EA3A 3W85A 1U1UA 8TIMA 1E55A 5I3IA 4G56A 1HUVA 3LENA 1KRBC 1JGMA 4I6KA 4J35A 1TTPA 3ANUA 4PSPA 1KTNA 4MB3A 3LNPA 3E02A 2E77A 1CX9A 3AMDA 4XAYA 4XB3A 2VYOA 1AD4A 4H1ZA 3S1VA 3TEVA 1UYQA 3CHDA 2Y63A 3A4XA 1JZ2A 1OC7A 3OVGA 3SCSA 4H6QA 1C7TA 3FYYA 2FPYA 3KLLA 2JALA 1X96A 1HN1A 1UMLA 4A21A 1OHLA 2C3ZA 2Y70A 1QPRA 4WGXA 1QATA 1MW0A 1Y8BA 1ICPA 3UWUA 3P93A 1E9ZB 3ZT5A 3LPOA 1VBUA 3T9PA 5H8MA 1FQ0A 4I7VA 3TYCA 1TWSA 5CPNA 2WCGA 1UC4A 4GX9A 4E2OA 3H23A 4MIMA 3B0PA 4EK7A 4LCSA 1ZLPA 2CPUA 1YKWA 3F5KA 3ONBA 1UKSA 4JGDA 2VEKA 1TZZA 2YCJA 3SM0A 4TMCA 4LUTB 3QYQA 4LAUA 3BJFA 3UYIA 5IRPA 3WQOA 1R87A 3PK7A 5DEZA 4HPXA 5M03A 2EBNA 1GOKA 3BCFA 5CGMA 3QQ0A 2X41A 4RLIA 2GZXA 1TVLA 8XIAA 5D2TA 4XD5A 4I90A 1I2PA 2DQXA 3VC5A 3QR3A 2E9LA 3RFAA 1BKSA 4UQEA 3TOPA 1KFBA 2WQPA 5BU6A 3UPWA 4UC5A 5K9DA 4H6RA 3GZ3A 3BAJA 1KGUA 3D3AA 2OB3A 3E38A 3H2NA 4C6FA 2I17A 3BVJA 3DFPA 3DESA 2NUXA 4UTLA 3IEBA 3R0DA 3LMZA 4BI6A 3VABA 4ZEPA 3AU6A 3QH2A 4ADTA 1RPXA 1WXZA 1QK0A 4FS9A 3MMDA 5HNNA 4QJ5B 2PODA 1XYFA 1J10A 2NWRA 3R43A 3L21A 3IK4A 3O05A 1NP2A 1JFXA 1D3GA 1O1HA 4QQ3A 1TX0A 2IPWA 4U3CA 4YXGA 1VRDA 3WNNA 2OZ8A 4C6JA 2QXWA 5C5YA 3C3UA 4DRSA 4DEFA 1G4TA 3L68A 3TH6A 1PKMA 4PCTA 4JYFA 5KITA 3IS4A 1XDMA 2VT0A 2Y6ZA 2DZVA 3TNBA 5HJLA 5LIUX 3S5ZA 2Z2UA 3GAYA 4BEUA 4LUIA 3G1FA 3LTPA 4B5XA 1DIKA 1SW0A 3R11A 4IP4A 1OIFA 4B5NA 3WCZA 4W8LA 1NWSA 3EWUA 1AJ2A 2VENA 5EL1A 3B0YA 4UUIA 5J5RA 4AF0A 1KO0A 1HJUA 2GUBA 1KFLA 1MXGA 3QPYA 3IVSA 4A8NA 3I65A 1JPMA 3E0LA 3B9AA 3P80A 1VZWA 3WNMA 4Z1DA 3NA8A 2ZC8A 1XCFA 4IXHA 1PEZA 4QJ4B 2Z1WA 2A3CA 3QHNA 2VC6A 5LKYA 2Z1BA 3AMGA 1GEQA 1Q65A 4Y2WA 1H50A 2RUSA 1BRLA 2VC7A 3BTNA 4D6HA 1PHQA 1LOQA 1IGSA 4UQ9A 1Q3NA 1HGWA 2UY3A 5LNRA 3UCDA 1OX6A 3ZJKA 2PC4A 4LQ1A 3QY7A 5HJYA 4C1LA 3T81A 2G3IA 4CD4A 1NJJA 4IISA 3NQVA 3GDBA 1XH0A 5A8PA 4JTRA 2QS8A 3UJEA 5D02A 2PD9A 4YS1A 4QAWA 3WF4A 3CUZA 5K2ZA 4JIIX 4O18A 2WWCA 1ZJHA 3G1RA 1CPUA 1YDNA 4IX0A 1M1BA 2E9BA 1O5KA 4DWSD 2QJMA 3UA4A 4BZYA 4CD7A 3AXHA 3DHFA 3N2TA 3P5YA 1HP4A 4GD0A 4MUPA 3MSYA 3HURA 3S6OA 2VZVA 3NNTA 3TJIA 4NJKA 2QCHA 1JCXA 5LYRA 1ONEA 5LHFA 4GNJA 2HXUA 4M81A 3U2OA 2GVJA 3OG2A 3ZYZA 3HQPA 2TAAA 2VX6A 3AI0A 4MGGA 3LQLA 3H2MA 4UFIA 4QGCA 1T0OA 3PP7A 3MVIA 4B3ZA 2C16A 3VXGA 1E6NA 3ANYA 4LV4A 2QV5A 1P4CA 4YVPA 3VD9A 3ZIZA 1W5NA 2V0TA 4HMDA 2YCLA 3GG8A 2VO5A 1P43A 4MY8A 1V6TA 2ZDRA 3HBLA 1W8GA 3WQ5A 3L4VA 1YNYA 1YPIA 4WD0A 3IJ7A 1F9CA 3U4FA 2J78A 4HCHA 3KL5A 4P8WA 4MZ1A 3EMZA 2VR5A 3O16A 1X39A 3ZVHA 4E3VA 2BGQA 2KX9A 4ZB2A 3KCOA 3A9BA 3M64A 3DHDA 3M0KA 2YDRA 3SN1A 1FWSA 1UD2A 4GA8A 3S0CA 3LBCA 5CC6A 4URIA 5F2IA 2VZSA 5LA2A 4UOJA 3CAWA 4XBSA 5BNKA 4CNTA 3CQIA 4WKFA 2POTA 4P8VA 3FXYA 3QMRA 3WL0A 2ZFAA 1E6RA 2HV5A 2I56A 4MB4A 2V2DA 4YHEA 3NQEA 1A0CA 4UFLA 1H3GA 3K2GA 5CSSA 1POJA 3V0UA 3YPIA 1G4SA 1J9YA 3REQA 3RAOA 3NZRA 3FKKA 2AGTA 4FALA 4TVDA 1KBLA 2NZLA 3EKGA 4JTFA 1M7OA 1FHDA 3NIYA 4NAEA 3PZVA 4BWLC 3C0QA 1BD0A 2A5HA 1N8IA 2RFGA 1TIWA 1VBGA 4PMDA 3TQVA 4PMXA 4IFRA 4GCXA 1BQGA 3PWAA 1HVQA 1PZ3A 3T0DA 2JF6A 4KCWA 4F3HA 4OZOA 2BOFX 3HGOA 4GY7A 5DMYA 2ZRXA 4WXZA 2BODX 1R3YA 4NJHA 2VHLA 1KC7A 5CQ1A 2GUUA 1TPVA 1EGVA 5G1TA 2GFTA 4JY9A 4A8LA 4H8VA 2DPEA 4IIFA 1J0JA 2FZNA 4AD5A 1YLVA 3FW6A 1EO5A 3ARVA 1VQTA 4IMFA 5I78A 3WH7A 3WD4A 1G67A 5BXSA 2GVLA 4MLJA 1NH6A 1JCYA 3ZT7A 1TRIA 2PWEA 2Z1SA 4A35A 1W17A 2YYTA 4CCDA 1UKTA 3AIVA 3LU2A 2QDEA 4LU0A 2IKHA 2Y8KA 2PSNA 2OLSA 3GK0A 3F4WA 2ONEA 3WX7A 4EVZA 3PR2A 2NLYA 3KOFA 4GUGA 5U7SA 4XTDA 1JI2A 1JUBA 1H09A 1RBOB 4JNMA 1W3JA 2DH3A 4R9OA 1U1JA 4HU4A 2BASA 1XIEA 1NAL1 4AG0A 4LB3A 4UQBA 1EOMA 4OTKA 1H5YA 4F48A 1QHOA 2W62A 3LQGA 4Y7EA 4XD4A 3W86A 4WKHA 1NELA 4CEUC 3PSWA 1OIMA 1VCFA 5BZAA 2ZQ0A 4WKAA 2ASHA 2D22A 4BI7A 1FWFC 5G2WA 4R53A 2FVLA 5JMUA 2X7WA 5ENLA 1WZMA 5HA7A 3BGGA 3EX3A 1WAWA 4AZ5A 1J6PA 1S38A 1TCMA 3REQB 3BSHA 3RIKA 1VJSA 3F5JA 4MWAA 2UV8G 1QI0A 3CT2A 5JBDA 3NO1A 3LZ3A 2ZXQA 3VD7A 1EDGA 1RA5A 4NAEB 1XCXA 1YBQB 3HG5A 5HWNA 1O12A 1ZBCA 3U9IA 4JPGA 4C6OA 4Y9PA 3L5AA 4ZQNA 5EY5A 4TMBA 3CH0A 4O1FA 1J01A 1XR2A 5T91A 4PMUA 3W7OA 4B3LA 1GVOA 3DAQA 1E5JA 2DQWA 5C9RA 3BOLA 4BK9A 3M9YA 5JIWA 2I14A 3O6YX 3OVQA 5FJTA 3NL3A 4RNFA 4E8DA 4OWGA 2GJLA 2OT1A 3G1XA 2BHYA 3ZJ6A 4Z42C 3AJXA 3QGKC 3XISA 3XINA 2VTFA 4AWEA 3DEQA 4HT3A 4RZ4A 1SZRA 2WSYA 2P88A 4GUIA 4E4UA 3W28A 4DJEA 3U2CA 2ZXDA 4LVAA 4OFCA 3BGJA 1TFVA 4Q8TA 2FQIA 5M1TA 5FJRA 2Y2WA 3CZJA 1C8VA 4UTTC 3K4AA 4D8LA 5FJIA 2Q8XA 3CZKA 3IGSA 1PCKA 4BQ2A 2PWFA 3MSGA 3TJ4A 4ROPA 1F4HA 4JQ1A 1KD0A 2OEJA 1VB9A 1WKEA 5GQBA 4ZTYA 2YA2A 3GYEA 3PG9A 4IIBA 4PA8A 2WANA 3TQPA 1DBTA 3VDGA 3AROA 2BB0A 3BMXA 5E0KA 2WJEA 3SUTA 2PWUA 1F3TA 4FI4A 1FHLA 2Z6IA 4GJJA 5HBFA 2ISDA 2BFGA 3F4VA 1NY1A 4YU1A 3PZQA 1TPWA 4K8HA 1FBAA 4EP8C 3K30A 1E70M 3N12A 1R9YA 4O28A 3U48A 3CK5A 5GVJA 1WDRA 1O5QA 2CLKA 5FI8A 4JTCA 2VMFA 5IDZA 3IGXA 3PVFA 1TVNA 2ISSA 4ML4A 4AHOA 4WGHA 1WKFA 1K3UA 3G1YA 4ZZ9A 1LG1A 3LV6A 4JTEA 2YDSA 4QJ3B 3ZWSA 1Q6CA 4MPQA 3HGRA 3S8HA 4KCUA 4MLRA 2OGJA 1ME8A 3T0AA 1JDEA 1W56A 2V81A 1C90A 9XIMA 4DX3A 1ICQA 1GEHA 4JKKA 3R58A 1S46A 2NVCA 4XZIA 1J0IA 1KNWA 4KRTA 3CU2A 1QNQA 2ACSA 4AH7A 1XP3A 2V38A 4PUWA 3TWBA 2OODA 4IJBA 3CZLA 4CCZA 5B7YA 1CLKA 4LRTA 1O1ZA 2ZRUA 1QW9A 1XRTA 2F8QA 4HSHA 4PMRA 3V16A 2VNCA 3SN0A 1XSJA 2PWHA 1W3HA 4PL2A 1NDZA 1OBAA 1YNPA 4MJMA 3UJFA 1W1B1 3LERA 3WUBA 2YFNA 3TN5A 4WY0A 1GVQA 2W92A 5T9CE 4G7EA 3OBEA 1XC6A 1KXHA 1RP9A 5C8BB 4J3UA 2X0YA 4WQ6A 4E8CA 3L4UA 5FSEC 4Z1AA 1YDOA 3N2MA 2NT1A 1PWMA 3R4IA 4XD6A 2QAPA 4H9VA 4JQ2A 3KEHA 3ES7A 3MV01 1R3VA 4Q8WA 1U22A 4UTKA 2C1GA 1QUMA 3TLQA 3WL1A 3I68A 1US0A 1MNSA 2NV9A 2UY5A 3UWEA 2HPMA 5FACA 4ZO6A 3O1NA 5DT5A 3OJGA 1TCDA 2QMJA 4ZO7A 3WLPA 5FF0A 2F2HA 4WDWA 4ZFMA 3U8GA 5EBUA 1TMQA 2CITA 1TPUA 1B54A 4ATDA 3RNDA 4EWJA 4H6KA 1K7XA 3T0BA 2EF9A 1V3HA 3BAKA 1ZSXA 3B9NA 1I2NA 4UWMA 3LUTA 4HA3A 4AZGA 1OF6A 1Y0EA 3HB9A 5HOSA 1BVNP 1TZ7A 2ABBA 2FZBA 3C0JA 3GM8A 4FXJA 1QWGA 1CGUA 1CEOA 5DY2A 4LT9A 2QR6A 3C0LA 1XLGA 2HVNA 3MI2A 1W3IA 3W1XA 5BRQA 3VGGA 3MA8A 1W91A 3ORWA 3NEHA 3W0KA 4BS0A 3LDVA 2PZNA 4GGBA 3GHRA 5AHFA 3HMJG 3V5CA 3AXXA 1Y7VA 1PYMA 1Q6LA 1QO5A 1I2QA 5IFPA 4GYKA 3S3GA 3EKZA 1UPPA 3W2LA 3KVKA 2YLAA 1OABA 4ZQMA 3G0XA 1GOOA 1P7TB 2Q02A 1G01A 1OSEA 3OOQA 1UWIA 4OBSA 2V9DA 3G3DA 1JPKA 3EDDA 4ZQOA 1DEDA 1GZ1A 3PUEA 4DB7A 1EHAA 5IBXC 2BY3A 3DENA 1ICSA 4WY0B 2BMBA 4DVOA 1DE6A 1YEYA 1KR1A 2W5FA 2V2HA 1VJZA 4Z1YA 2DZTA 1H7PA 1XUZA 5I3DA 3TKFA 2ZX8A 4GISA 4CUCA 2BP1A 3PZOA 4UFJA 1NP0A 3STPA 5AC4A 1CIUA 2J8FA 5LHEA 3O15A 5LA0A 1NTHA 2G3FA 4ZB5A 1IT8A 4H9TA 4JQAA 1L6SA 4B2DD 1JD9A 3PTKA 3B97A 2E25A 1XIBA 3MU7A 5FEZA 4S3CA 3OBAA 1FCBA 4XSMA 1H7NA 2GDUA 2V5BA 2W67A 1E5NA 1K9DA 5CJNA 2MANA 3N1AA 3ARWA 3EB4A 3OVPA 4NZ5A 3GIQA 2Z4GA 3JS3A 1AL7A 1Z3NA 2I1OA 1GWJA 2PA6A 2A3BA 3CQ0A 3V0SA 2CIPA 4NF7A 4LJ3A 2YJQA 3DYMA 3VVGA 2E6AA 1VFHA 1BHGA 1RK6A 1QI2A 3L66A 5DY3A 1I2OA 2CLOA 2C15A 4LY4A 2J77A 1KXVA 5B80A 3SGZA 3MHGA 4TOQA 3WENA 1Q8AA 1RA0A 2ZYFA 2XN0A 3NDOA 3L65A 4ZOCA 1N8FA 2VCBA 4RV8A 4CEXC 3ARXA 4AZ7A 1ONRA 1PKYA 3BLKA 1JDFA 1UZ4A 3UGRA 7PTDA 3SGGA 1H5VA 1ZJBA 4E0CA 1R7AA 4AX7A 1CB7B 3EMCA 1X7FA 4MY9A 3B40A 3R94A 2BV9A 2HBXA 3WKZA 4S2BA 3H4GA 1XD1A 4WJEA 3PTMA 9CGTA 3NQ8A 3MP4A 4O19A 5HMEA 1JCMP 1A4MA 4RW5A 4F66A 3VIGA 1R85A 4QE1A 3TW7A 5B7ZA 3MUCA 5A95A 4MZYA 4BJHA 1U5VA 3WEMA 3FIGA 2D20A 4IGHA 2JK2A 3V5FA 3VIHA 3N3TA 1QDSA 3U3HA 2XSXA 3TUUA 3K8MA 4J2MA 2V69A 1KR0A 3OGRA 5LA1A 2A0NA 4DZHA 1TA3A 3B04A 4GWEA 3WMBA 2E5DA 2YW4A 3WLLA 3WJSA 1VIZA 4WOZA 1V0LA 4FR1A 3TU9A 4A3YA 2WM0A 4KFPA 3UQNA 1KRAC 2IW0A 3T55A 1GJUA 3QQ1A 2NQHA 2F6XA 1M9HA 4NU7A 3GNNA 2AMGA 3W26A 2NQLA 3JZEA 2XH0A 1XIJA 2X1SA 3BZJA 4WX2A 3KBSA 1TX2A 2WJDA 2XM2A 1IR2A 4UQAA 1KM0A 5T8GA 4DO6A 3AAMA 1MQQA 1CECA 3E2SA 1PXGA 4FX6M 4OU1A 1DVJA 3I4KA 1WOAA 5EMKA 1JYWA 1GQJA 1S5WA 3AUJA 6PTDA 3OW1A 1XISA 3EEZA 3OGSA 3JZUA 2H3DA 5FF3A 2EO7A 1KM1A 2PCQA 4R88A 5GJPA 2WHKA 3AYSA 4GZJA 2IXUA 2OYMA 1BVZA 1HG3A 1Q85A 1QNPA 3BAWA 3FJLA 4IMAA 4UCGA 3AS1A 5DQPA 1V5XA 3TONA 2DGAA 3LYEA 4O57A 5EMMA 2ANUA 4M5PA 2WVVA 3W1QA 3ZZ1A 1L8NA 4L4PA 1RAKA 2FHCA 2OX4A 5C0QA 5I3KA 4PB4A 4KF1A 1CI1A 4YTRA 3V18A 4N2YA 2Z1VA 4HU3A 4K8GA 3O6CA 2FIQA 3CWNA 3E2RA 3CHCA 2ZTKA 3CQJA 3E1F1 4WZHA 4JD4A 4KEVA 3RXZA 2EPLX 3GH4A 4HNCA 3L0KA 3BUVA 3LHWA 3AHTA 2C13A 2X1RA 3Q2DA 2HNHA 4O1AA 4ADSA 2GOKA 3NDZA 1F6KA 3WLIA 3IAPA 5TIMA 2GUYA 2BXVA 2ZRZA 4RK8A 4DPPA 3OGVA 2ZZ6A 2DZXA 1PDZA 3CPRA 1ONXA 3KE0A 3THAA 3DFNA 4TUFA 4XK2A 1YXCA 3I3EA 3SSJA 3FNDA 4P7LA 3PBGA 1MDRA 1C8QA 1ZNNA 4IQLA 4UR8A 2D3NA 5CZKA 2EJAA 1QK2A 3W22A 4EXAA 3E12A 3CNYA 1JUEA 4RZBA 2GQAA 1UUMA 3WUFA 4U4MA 2DEPA 1I1WA 1BAGA 1EOKA 2FZMA 1HKIA 5D2XA 4LUJA 3QY6A 3QC0A 1LOSA 1W5QA 1WNOA 2Q3RA 5HMSA 3T2OA 5CPTA 4K1WA 4W9TA 1HKVA 2PF0A 1MW2A 2HS8A 2YR1A 1DHPA 3T78A 4DNHA 1IWAA 3B8IA 2OLAA 2J13A 4HNLA 1VEPA 2UBPC 3W70A 1FWEC 1E0TA 4Y9OA 4B4HA 1RCOB 2E67A 2VKZG 5AC7A 3KOYA 3VX0A 1JNDA 1K1DA 1MW3A 4DHGA 3S46A 4N42A 4Q4SA 3ZT6A 2H90A 4JHMA 2OVLA 2G3MA 3IWPA 1S1RA 2V5JA 3AICA 1X7IA 4NNBA 1IEVA 3UCQA 2VI0A 1M04A 5K7JA 4AVOA 2WO5A 2PRLA 3FX4A 3S1GA 2NX3A 4IM4A 2Y85A 5PTDA 3WY1A 1A50A 1V51A 1V77A 1DV7A 1QAPA 4K68A 3DDMA 3VNJA 1JG9A 3NVTA 3EX1A 2R1KA 4NRRA 5LIKX 1PIFA 4QX4A 3G22A 3UCCA 3SRHA 4A2SA 2NQJA 1VKFA 4LF1A 1RQBA 2P8BA 4IH3A 2AOSA 1XQLA 1CXIA 2WSRA 4PUKA 3MUXA 2G4JA 3HG3A 1FKXA 1R5YA 3AIRA 4PMOA 3BO9A 2D69A 4IUGA 3W7KA 4FP1A 4F0RA 4QE4A 1XYCA 4MM1A 3WF0A 3QV9A 1KLZA 3LRMA 4NILA 1UIPA 1EFZA 4Z17A 3WN6A 1JULA 2VR2A 6REQA 3LCHA 1JD7A 2PDKA 2XPKA 4S1FA 3SADA 1VP5A 1KFWA 4D6GA 5AC8A 3NFUA 1U5JA 3W83A 3TC7A 3RLHA 3KL0A 1YYAA 3HG2A 1THFD 2FFCA 3AYTA 4QAIA 5LXXA 3CZ8A 3PNZA 2BY1A 3DC0A 1L2UA 1GPFA 4MKSA 2OO0A 1IV8A 1XIMA 3ABXA 2WZTA 1TTJA 3T2PA 2VC5A 2BOEX 4JCMA 1EJVC 5CLTA 1BXNA 2BLEA 4A29A 3R8GA 2QT3A 3LXBA 1E0WA 2CZ5A 4GO9A 5JBEA 2C79A 1TVPA 2FVKA 2EPMX 2OZ3A 1SW7A 4O11A 3NR0A 1EWEA 4JN8A 2X1TA 3WQ6A 3KRZA 5C6MA 3V7PA 3S4TA 3CHVA 2CBIA 4BF9A 3T42A 3OEXA 3L7RA 1SJBA 3NSNA 1CW2A 5FF2A 1GVIA 3WLOA 2QJHA 3UWWA 5LGZA 2ZWYA 3UWQA 4C60A 1YX1A 5HDRA 3NO5A 4JCLA 4O10A 2X1UA 1W1IE 2YL5A 1EJRC 2J8TA 4LFYA 2QHAA 3UW6A 4GY0A 4LAZA 3PWGA 1XF0A 2MUCA 3VILA 3KOXA 3CM4A 2Q3OA 1XSIA 4JY8A 4B4FA 2E1WA 3TTSA 3GG0A 4PUNA 3UXLA 1BSIA 2WMFA 3G1DA 1QVBA 1YTDA 4J2PA 5F4WA 1WB0A 3WFAA 4DWSA 1EP3A 2PRHA 1MEWA 1BXCA 4CNPA 4FX7A 3AZSA 2I57A 3SO7A 4GQ0A 2QVHA 2A2IA 3H7UA 2WXDM 3NOEA 3V0TA 1K70A 2WCAA 4QLJA 4HMNA 2XGIA 1F6YA 1HO4A 1S2CA 4CU6A 1XW8A 4DUWA 3RRAA 1KW1A 4DJDA 1UIOA 5A5WA 1BXBA 4U5KA 3Q94A 2ZDSA 4DWDA 4Q4RA 4GUJA 5M5DA 3E2VA 2CNCA 3UEQA 1QCWA 1W9VA 4LXFA 4PEKA 1JZ7A 3BPWA 4RZ6A 4QNWA 1I75A 4GACA 3IK2A 4UZUA 4B92A 4QDMA 4HYWA 6REQB 2OJPA 4UMAA 3AIUA 1F8IA 1OG0A 1X8FA 3CPUA 4GXPA 1G69A 1KFCA 2WZMA 1V7AA 2AL2A 5HUOA 1RPKA 3ATYA 1XBYA 2NQZA 4PZVA 1GW9A 5CG0A 2PGEA 3GNRA 1SYTA 1XHGA 3TJLA 5A94A 2ACQA 3KBJA 1GVYA 3M41A 1DORA 4LB4A 3AMCA 4H4IA 3CGTA 3R5EA 4XUYA 3VIPA 2CCRA 3CUIA 1OCNA 4NI3A 3P81A 1VFLA 2E6DA 2Z1KA 1W3KA 3GDLA 3IGHX 5BWAA 4ROQA 2NWSA 3W74A 1QI5A 2OELA 5G2HA 1OFRA 1GHRA 1FP8A 3ALGA 3QOKA 2ICSA 4DZIA 2CHOA 2CKRA 3K1DA 1RLDA 5G1MA 4ZOAA 4PMVA 2GQ8A 3N34A 1ZS2A 3LA4A 4C1NB 4IG2A 1ZBKA 3GDMA 3RX4A 3SCUA 1KV8A 1J0YA 1LUCA 4ZO9A 1XH2A 1E1CB 3AHYA 3QGAC 5C55A 3RO6A 2AGKA 1PTDA 3TWAA 1SUXA 4ZQPA 2IS7A 2J27A 1SJCA 1UB3A 4MB5A 1KKRA 2XGBA 1QRQA 4AZBA 1CBGA 2ZUMA 3UZZA 4Y9MA 5I77A 3DOPA 3QVQA 1LDCA 3WNLA 2YB1A 3VNIA 1QT1A 3NPXA 3HJEA 3CMFA 1A0DA 3CUHA 1IYXA 2E4TA 3CV7A 1H7XA 1JZ5A 3V1HA 5A6BA 2ACRA 4J5NA 2WMKA 1BYCA 3BL3A 1Q45A 1SFJA 2EPNA 5EKYA 2XN1A 3Q65A 4AXNA 1Q7MA 4JBRA 3NPUA 4G7FA 4UNKA 2DSKA 1WUEA 1EDQA 1HQTA 3GB6A 4NZ1A 3VX1A 5I5RA 3K46A 4Q8OA 1PX3A 5K4ZA 2XU2A 3RHGA 4W5UA 1OT2A 3AO0A 1EDTA 1HKJA 1FFRA 2XINA 1XL9A 2I5GA 4Y8FA 3T05A 1SMAA 4XG1A 5CGQA 5GJMA 3TFXA 3RLVA 1Y5XA 4IT1A 5DF0A 4HTYA 1GK8A 3M47A 4UTIA 2I5IA 1ZRQA 4G9PA 1TV2A 4MVAA 4Q7IA 2P5NA 2WB5A 2XH7A 3PTQA 4I8YA 4O15A 2Y5SA 4X22A 1ZY9A 4PUEA 2QMKA 4N9DA 3IPWA 3H55A 3T0CA 4DY1A 2OQHA 2HNEA 3MBFA 4UOQA 3LMYA 4KEUA 2PTZA 2BHUA 3S2JA 1UR4A 2J6XA 3A24A 5E9XA 1VYPX 3BSMA 1BLIA 3LXCA 2DT2A 3ZOAA 3EOUA 4GKLA 3O7UA 4PTMA 1I1XA 3IARA 2CW6A 1Q6FA 2XIMA 2Z0IA 1TE6A 1ZPTA 3CMGA 2I5QA 4RXGA 5D09A 4D2JA 3SJNA 2FGZA 2EGZA 1ZFJA 2EG7A 2XIBA 3KW3A 4AIUA 2PWGA 3WDPP 1JXJA 3QKZA 4GQGA 3AXKA 1JPDX 3AALA 1BFNA 3IIVA 4L7ZA 3AOFA 3ENLA 4GC3A 2H6RA 4GI8A 2ZXAA 1OY0A 4LRSA 4CD8A 2O92A 5JU6A 2YX0A 4GJ1A 2JE8A 1UD6A 2Y62A 2CZFA 3W6LA 4HOZA 2Y7FA 4MYXA 2GQ9A 4TV5A 4C6BA 1L6YA 1FDZA 1W1PA 2YCKX 2CBJA 1QNRA 4L80A 1K6AA 2VRKA 5E5CA 3PUDA 1GQIA 5FD0A 4BKNA 1F7BA 1KTBA 5I24A 1SJDA 1FXPA 1J0HA 3LHUA 4QSHA 1W3LA 1XLMA 1GPWA 2WNQA 1B9BA 2X2YA 2YDQA 4FK9A 3P61A 3S6TA 3ICJA 3ZLGA 4JOMA 3EGJA 3DGRA 2NVDA 1VF8A 3MCMA 5I23A 2QCFA 1PBGA 1T8QA 3HGSA 3NQGA 4E8GA 2O7SA 1V3IA 3WK2A 3LS9A 5FAJA 1RSCA 1JRCA 3FVDA 4ATLA 1TWZA 4WSKA 1DHKA 3BH4A 1ISVA 2WPBA 2X0SA 3QJAA 1E71M 4FXFA 4H7ZA 2B7OA 1NARA 3NYZA 2H9AB 2WJFA 1VFFA 1AH3A 1N2VA 1ZU8A 3C0SA 5HQMA 6TAAA 3M6YA 3OYXA 4GCAA 2Q8LA 3GRIA 5TAOA 4H8UA 3RM9A 3W38A 1FWTA 3QC3A 2GJRA 2IKIA 2QGHA 4J1OA 4X2PA 2F61A 2G3NA 1TMLA 3ARQA 4QQUA 4MFEA 2Z1XA 2PDNA 3EWDA 1ISXA 5BMXA 3LD5A 1SMDA 2AQWA 1KWGA 1ZGDA 1J2WA 5RUBA 2POZA 4AZCA 3H12A 3IANA 3KL3A 4US5D 3ZSSA 3AMKA 1D2KA 4BEQA 2F6UA 5CBIA 1Z41A 5XIAA 3DG3A 5HQLA 4H00A 4IOTA 3FDGA 5JH2A 4IL0A 3BW4A 5D9OA 1GHSA 5EU9A 2O9PA 2XG9A 1XKYA 3MI3A 5BW6A 2Y5EA 1KQZA 3OZMA 1DP0A 4XV0A 4NNAA 5ECUA 2TSYA 3ES8A 5C9UA 3THQA 3GTHA 1Z6KA 2J4GA 4RE2A 1YDYA 3CIXA 3WO8A 3STGA 2Z2AA 5ECVA 3R8RA 1E6SM 5EB8A 4I9MA 3W00A 4MWAC 3A4AA 2O9RA 3F1QA 4QS6A 2CLPA 3QKEA 4HSOA 3EWXA 4FZIA 4GI6A 4OOZA 4FIRA 1LL4A 1VLWA 4KEZA 3EOLA 1JCNA 2REQB 5EA9A 3W1TA 3PAOA 2J7BA 4QJ1A 3GTXA 2PUZA 5K9XA 3WDQA 5ABHA 3CLWA 2QZRA 3MUZ1 4L9XA 1Q6GA 1K8ZA 2XSAA 3U7VA 4LS1A 3PUOA 3NPWA 1LQ2A 3CUXA 2G37A 4P8UA 2Q09A 5A2BA 4AFYA 2PS2A 3G1HA 1CNVA 1IGWA 1A5CA 4L9YA 3M46A 3U57A 1UR2A 3CYJA 3N2XA 4QRNA 1ZUAX 1EF3A 3CZEA 1KXTA 1FDYA 2DSVA 4MWAE 1UQYA 2GVYA 4DJEC 1PZ2A 4QR6A 1FCVA 4FLOA 4ES4A 3ZVIA 1M65A 1EA0A 1XI3A 5MKGA 4UOZA 3IUHA 4J3TA 2BTMA 1O68A 3ZLHA 3QBUA 2VP8A 1XLKA 2CFFA 1SFTA 5C7HA 3SW6A 1A5SA 1HJWA 1DPMA 1F73A 2H8ZA 1B3ZA 1XBZA 4ALDA 2YZRA 2C1HA 4UZSA 3EWYA 3CHEA 3GTIA 3ABOA 3H22A 2X16A 1ZAHA 3OYZA 2VX5A 5HQEA 4OV9A 5DCEA 3EWZA 1M01A 3MP3A 1AVAA 4X63A 2OSXA 2VWSA 4S3AA 2V5DA 3GR7A 1G7UA 4JICA 4REQA 2R1PA 2EPKX 2ZA1A 3CC1A 2QYGA 3DFSA 4JX4A 7XIMA 4GVFA 3DZ1A 4UNLA 2TMDA 2Y7GA 1H11A 1AZ1A 2XZ9A 4D6CA 1PKNA 3KZPA 3MW7A 2R8WA 4H2CA 3I3BA 1RJQA 3W73A 2CKSA 4HCDA 3UPBA 1XYBA 2V3DA 3KDNA 3VPLA 5IHRA 3WH6A 3MPGA 4PSRA 2QCCA 4FNQA 5TQLA 1B9ZA 1Y5WA 3WD2A 3UF9A 4DZ5A 5MHBA 4ENLA 1KFKA 3F4CA 4DZAA 3I7SA 3U2ZA 2WNZA 3VA8A 2BVTA 4O4WA 4W8BA 5CLWA 3MKCA 4B2DA 3Q45A 1JEZA 3HPFA 3TC3A 1RCXB 1VBRA 4KRUA 3KCJA 3D5HA 4D6DA 3ITCA 5D8WA 4O8AA 1UKPA 4L1GA 4GOAA 4KWUA 3O0KA 5T26A 5KZMA 1C29A 3M0JA 3D3FA 2O4MA 1BKHA 1EIXA 1JYVA 1HGYA 3C52A 3DFOA 2VJXA 2HISA 1NOFA 4J3SA 3ARUA 1H1NA 4S38A 1FH7A 1Q7ZA 2E5CA 3NQMA 2CLHA 3HGJA 5FAGA 2HVMA 3GUGA 4ZSTA 1TQXA 4WXYA 2A3AA 3RO8A 3V1PA 3LLXA 1JYXA 1RLCL 4FSAA 2H8XA 3VE7A 1UJQA 3OHMB 3ITLA 2HVOA 4DNMA 1PCWA 3AJ7A 4EPBC 5MKGB 2W6RA 2FMOA 2GSEA 1OGGA 3DIPA 1TREA 4O0QA 3K8LA 3MWCA 2BVDA 1FRBA 3QF0A 2QCEA 2YYUA 3NVDA 2PBOA 2ZWZA 1OF8A 3B03A 3DU0A 5AYBA 1KRCC 3IAQA 3GR4A 4CVWA 2OEMA 4AD4A 4M1BA 2X42A 2WVTA 2J62A 5JBFA 2FH8A 2PDQA 5ABFA 1M41A 3STEA 3SCRA 2YDAA 1FUYA 5CSYA 1QI3A 3ARRA 1E51A 4O17A 3I7QA 5A69A 3W7PA 4MDOA 3UU0A 2B7PA 3QV8A 5FL0A 5D2WA 4REQB 3ITGA 4W5ZA 3FY1A 1XLFA 3W01A 2ZRWA 4IGNA 4N9BA 4RNIA 1AQ0A 2QIIA 3LK6A 3SCTA 1LWIA 4CNUA 2JBMA 5FOOA 5KSWA 2WZIA 4O1BA 5HATA 1A47A 1V6XA 1R0MA 4D71A 5C2XA 2DSWA 2V3EA 1M3UA 4F0LA 4M29A 1XINA 1WDDA 4MSSA 1J11A 1J5TA 3BW2A 2IXVA 3W2KA 3GG1A 2XIOA 2XHYA 1W6TA 5BCAA 2V6AA 3QHMA 4PH6A 1KGXA 1ZCCA 1HF6A 1QBBA 1AD1A 2G50A 3SCNA 3CTTA 3P60A 1QI4A 3VNZA 3ARYA 4PRTA 5G2IA 3HG4A 3PULA 2DW7A 1ME7A 5GPRA 1EWDA 3DBPA 1F2JA 4C6DA 4IHCA 1O95A 4Q8VA 1UR0A 4X9SA 3PFRA 3TP4A 4HNTA 1FVPA 5HMDA 4M0XA 4E38A 4KIEA 4U3AA 3VKKA 2F38A 4KRZA 1B1YA 2Q8ZA 4OQVA 2BXZA 4AWUA 3P67A 3TR9A 1W5PA 3A3HA 3KXQA 4ZMGA 1CZ1A 4ZGYA 3OZOA 3A5VA 1E0UA 4LCRA 3GHSA 3BJTA 1LLWA 3BCJA 3GIYA 3S5OA 3ZR6A 4EXQA 4RPPA 3BMWA 5BOFA 3E49A 4MNLA 1XSKA 2X09A 3SQLA 1VH7A 5A6TC 1QO2A 1G9HA 5CZ0A 1JIBA 4QDWA 1PVNA 3LPPA 2QF7A 4G1KA 3GVWA 4F2UA 2A6NA 1OCJA 1LP6A 2FTPA 5BXPA 4A22A 3A64A 3PB2A 4CQ9A 6XIAA 5DX7A 1LG2A 4PCPA 5ABFB 1LQAA 4J3ZA 3BLOA 2OQYA 1XICA 3GW3A 2NQ9A 5F2GA 3A6OA 3MBDA 1OX4A 1OD8A 3LCFA 4WDTA 3UT0A 1XLCA 5FSDC 1OX5A 3P8IA 5I79A 3NM3A 1EA9C 4FOKA 3RM8A 1ZQ5A 3FCPA 5CJMA 4C6LA 3NJ3A 2Z28A 3VIFA 1P6CA 2OR2A 4LNCA 4N02A 2JFEX 3VZYA 2VGBA 4XKYA 3KX6A 3P82A 3VIMA 2QW5A 3TMLA 4IIHA 5AHIA 1VYRA 2AQVA 2AL1A 1UUOA 2E0PA 1LLZA 3H7VA 4K7YA 4ONVA 4NASA 1SSDA 2YZ5A 2ACUA 4G2DA 4LC8A 4LH8A 5TF0A 3I3DA 1F07A 2PFHA 5EBAA 4V1YA 2NX1A 3WLQA 3Q37A 2RDXA 4EF9A 3PS7A 1VFTA 2VEPA 3NQFA 2J9ZA 1M03A 4F0HA 2BHZA 4M6PA 4IWWA 2YCEA 3UR8A 2FH6A 5C71A 3RDKA 3ZFHA 3GXIA 4YTQA 1HZYA 2DIJA 4AXKA 2VEGA 3LHZA 2NSOA 3G0UA 3KTXA 3WJZA 3UD6A 3RX2A 1UZ1A 2WHMA 3LZ5A 2VEMA 4HHHA 3N3MA 4OBTA 2OMAA 4S23A 1TR1A 2J66A 3OLIA 3VM7A 1IZJA 1I4NA 3L0GA 3DERA 3RPDA 1MZRA 1KRMA 2XFYA 3ME3A 2EG8A 1UD8A 3TTEA 1WBJA 4MF4A 3UETA 2CZVA 3MDWA 4IJRA 3S83A 4NYYA 1SU5A 2A1YA 2Y89A 2JIEA 3P3BA 3BG5A 4XTIA 1FX6A 4FLRA 2BVYA 3MUY1 2DORA 1PHWA 3GH5A 4B9YA 1K6WA 2OSWA 2DY3A 4HA1A 2ZX6A 1SO4A 3P0WA 3C4UA 2ZADA 4MJ4A 4PEEA 2VDHA 3W88A 4XVEA 5AZ0A 1H51A 1B57A 5A8NA 4FR6A 3A23A 4OGZA 4FLSA 3CH9A 2GK1A 3PNUA 4ACZA 2PEVA 5A6KA 2QNEA 3MHUA 5AFDA 4DF2A 2UY4A 2QJGA 3USBA 3PBYA 3NDYA 2J7CA 4M6VA 1UA3A 2W79A 4Q4KA 1KA9F 4PR4A 4AZIA 3VKDA 2ZUWA 2XFWA 4Y8EA 2J79A 4D6FA 2A4AA 1QR7A 4RV3A 2INEA 1TPEA 3FHAA 3W2NA 2J88A 1AH4A 1DIOA 3NQ2A 5DBTA 2GJXB 2WSQA 5KETA 1AODA 2C7FA 4ZCWA 3T2QA 1UHVA 2EHHA 2ZA2A 2ZVIA 3RM4A 4WSJA 3THUA 3K4WA 4KCTA 3EPNA 5LNVA 3TYDA 2A21A 1PDYA 4AD2A 2Z25A 4XVDA 1LBMA 3KP1A 3FJNA 2JKPA 3KLKA 4GXMA 2OWXA 4NXKA 4DAFA 2DUAA 3G18A 1I9CB 1PL9A 8A3HA 2J74A 4UTUA 1TPC1 3ZR4A 2YSWA 1OGBA 3LB0A 1XJBA 1Q2RA 3PHAA 4OT7A 1EYEA 2QPXA 3AYRA 4Q33A 1TV5A 5C9XA 3UG3A 4QTGA 3RITA 4DYKA 2D3LA 3TMQA 5M2FX 1ITQA 3OPSA 4LSBA 1WDSA 5TD4A 1XLBA 3GXDA 3F5LA 3MTWA 4UTWA 4I7WA 3SUVA 1XLJA 2A6LA 2DSUA 4XAGA 1TG7A 1QHZA 2I9UA 3SURA 5CPMA 2E7FA 3V36A 2ALDA 2VZUA 1GKPA 4FNRA 3N9SA 3EOSA 2NLIA 1TPDA 4LGXA 4O0KA 4IF2A 1RQEA 2V67A 1E6XM 4OUEA 4GX8A 3C2YA 3B8VA 3QHOA 4R7WA 3URBA 5HPOA 1WO2A 4HGXA 3WNOA 4ASTA 5ABTA 4Q7NA 5CPSA 3VGDA 5H8UA 4NJJA 1EPXA 3PZNA 2VOTA 4Q22A 4AAJA 4HJWA 1JF5A 3NURA 4DIAA 4WF7A 2GK1B 3QLDA 3QSRA 2DH2A 1OYAA 1EC8A 2ZZ7A 1HO1A 2R6OA 1DYSA 2VC9A 3MYOA 3AU2A 2BDQA 2VX4A 1W9PA 3G6MA 1HKKA 4M19A 4R9XA 3LCXA 2WSKA 2BX7A 1NM9A 2DIKA 3WZ0E 4IGSA 3EX6A 3WD1A 4AD0A 5FJUA 2GOUA 4LYPA 1CXLA 3GUWA 3PBVA 2A3HA 1W31A 5CPOA 4XAPA 2ZTJA 4HOXA 2CLEA 3HF3A 1VRXA 3VU2A 3E0WA 2ZZ3A 5DXYA 1PE1A 2E1DA 2ZRVA 3IVUA 2XN2A 1F3XA 1K8XA 2VRQA 3PPGA 1Z89A 2GJPA 1VCGA 4EX4A 3MZNA 2E68A 5XINA 3BK0A 2YL9A 2VFDA 2PDXA 1H0GA 3GC5A 4CQCA 1ZP3A 3DFTA 1X6NA 1UA7A 2C8NA 4GIAA 1EX1A 3WF2A 4CU7A 4Z08A 1N8WA 3W81A 1TV4A 4Q6JA 4FNSA 4YCOA 1XLAA 4A8RA 3MY9A 2GGJA 1FWGC 2PDYA 1YHTA 2I9EA 4V33A 2GYIA 2WBGA 4WJ8A 1JXKA 5IXEA 1TYGA 3XIMA 3BLEA 1XS2A 1CCWB 2R94A 3DG7A 4P7OA 3W1AA 3R10A 5M17A 2X30A 3EA2A 1D7FA 3UYCA 1V3KA 1W9XA 1N7KA 2IQDA 2Z26A 2J9XA 3VFLA 1ENUA 1XQKA 1OM0A 4PE8A 1R2TA 5GNXA 4EXBA 1D7KA 4HU8A 4H9YA 3IV3A 4KCVA 1M53A 2O56A 4Q8PA 2PDHA 1IWBA 1EJWC 1TJPA 3BV4A 4F9JA 3AISA 3VDBA 3FFSA 4Y96A 1NQKA 5CC3A 1C91A 1K9TA 1I8JA 4AY7A 4ZODA 4JTSA 1DWFM 3S2NA 4Y6GA 3PANA 3W7QA 5T9BG 2AQOA 3WQDA 3U4AA 1RQHA 2B0MA 3AWNA 3FAXA 5DXXA 5C2CA 3DC8A 3W1MA 4GY1A 3MI6A 3KDOA 2PZ0A 5DRIA 1E15A 2AAMA 1ODUA 3B06A 1TWWA 1EX5A 1O66A 4K8EA 4JFUA 4OUIA 2CHNA 1P0KA 4I6VA 3H2CA 1F3EA 2IKGA 3QR1A 5CSUA 4YMZA 1UZDA 2D2JA 4RL3A 4Z2JA 4NKCA 1MUWA 1XGDA 2GWGA 1NF7A 4QITA 3POHA 5FJJA 3IIZA 4DWSC 4HJFA 3NUKA 3DHPA 4JEQA 4X61A 1C9DA 1OK4A 1TR9A 4J27A 3M44A 4UR7A 4ZFCA 1JQXA 3OB8A 5D32A 3WQ8A 4J28A 3N13A 1XYLA 4K7VA 1G94A 4DJDC 1IEQA 1D8WA 3VDHA 5G4WA 3F2CA 1V79A 1XIHA 4C6IA 1DWJM 2QCGA 3K1GA 3L4XA 4DLFA 1REQA 1LRTA 3LXAA 3TA9A 1GOIA 3WD3A 3SAZA 1RV8A 3M0MA 2XVNA 3EDEA 1O5RA 1K7FA 2C18A 3BICA 1JUKA 5F2MA 1UJPA 5A3HA 3BDKA 4D1IA 4ECLA 5CH9A 3IRDA 1RK5A 4PUUA 5XIMA 5EFDA 4DBEA 4OJYA 5AYYA 1OADA 7A3HA 2Y8VA 3F03K 2CYGA 3N4FA 3I6TA 4S3JA 3TDFA 3NL5A 3KBVA 2XISA 2QF8A 3TCEA 4MHBA 4FX8A 1B2YA 3GNPA 4GQQA 1OFAA 3BWWA 5JVLA 4BQ3A 1D9EA 1YMYA 3BE7A 4C6QA 3HFTA 1F74A 3AZTA 1U83A 3U6WA 5C70A 1H2JA 2TPSA 1V6UA 4JIQA 2PDIA 3TAOA 3U5YA 3A5FA 1DIEA 1A5LC 1GGOA 3GNDA 4W86A 5H91A 4LVGA 1E72M 2RGMA 4JXCA 5A6AA 3KFTA 3WQCA 1VJIA 1GVFA 4BR1A 1K8CA 3T7VA 2G96A 1LLOA 4MDPA 4BY3A 5A6MA 1B3WA 2ZC1A 4NAFA 3PB0A 1XBXA 2WOQA 5TNVA 2QGYA 2XWDA 1DTNA 1J6OA 1AQMA 1XM3A 5I02A 4NZJA 4NNCA 4NXSA 1GYMA 3GHTA 3E0IA 4ICNA 3ZXWA 2WM1A 3E9AA 3L4YA 4KESA 4AF0B 1EGZA 3CB8A 5GNYA 3R2GA 3VGFA 5FEPA 4Q8MA 1EBGA 1H7WA 1UROA 4IFKA 1LZOA 1KTCA 2BG5A 2DZWA 3NZGA 4LNYA 1KWKA 3I7RA 5E6ZA 2WHJA 4ZB0A 2LLEA 1G4PA 4RR4A 1LTDA 2ABAA 1Y65A 4GQRA 5CKSA 1HXJA 5SWUA 3F4NA 3UNDA 4AEEA 3L67A 3QLLA 2WHLA 2ATMA 1BRLB 4LW7A 1WCGA 2E6YA 3HQOA 4AVNA 2PI6A 1P0EA 4JS3A 5BMWA 4JTQA 2PURA 4C91A 4FOUA 2OPJA 3DFHA 4K6AA 2OKTA 4GMEA 5CBBA 1C8YA 3TW6A 2CERA 1NFBA 2HTMA 4UFMA 1V0NA 5D2YA 2DW6A 1S1PA 5G4HC 1ZL1A 4U10A 1RBLA 1UBSA 4MWAD 5FF4A 4GPNA 2WVSA 3M5XA 3VINA 3L4ZA 1K9FA 3NZ1A 2P76A 1Z8AA 2B7NA 4L61A 5F4SA 3AYVA 1GQKA 4X0NA 4D6IA 1MW1A 1BF6A 1XYAA 2CXGA 2F7FA 1XDJA 3OO2A 1F8MA 3E5PA 3II1A 1L0PA 4HQVA 3HMCA 1A0EA 4U2ZA 5BYWA 4HHPA 1VC4A 4RE0A 4LALA 3GWQA 2PC8A 3TN3A 2PDLA 3BQ5A 3T08A 2PLJA 3R89A 4L6OA 4JTDA 2DVTA 3W1RA 3LSBA 5EFFA 4CLMA 1HJQA 4PMYA 1ZJIA 4AC7C 5BU9A 4F2BA 4NAFB 4DJED 1YXYA 1R6WA 2YCLB 4MNJA 4NUWA 4RKAA 1ONWA 1QOQA 3PZUA 2VQUA 1U5HA 4MTVA 1NQ6A 4PODA 1OCBA 2DIEA 1AUSL 2P50A 2DT1A 1P1MA 5A8OA 4L9ZA 4AEFA 3OA3A 1W1VA 5AHEA 3SRKA 3IJ9A 3TYAA 4N4PA 3MVTA 3ZVHB 1LYXA 3WELA 2DT0A 3OQEA 4KMQA 1OB0A 5I3GA 3LRLA 4PRWA 4O8RA 4LBSA 3TXVA 1C7SA 1XLEA 3VKAA 3EB2A 1RJPA 1WXJA 3M07A 3S9YA 3RYSA 2PD5A 5C2GA 2ATSA 5IFTA 2BXYA 4XD3A 3NPVA 1VPXA 4LEFA 2P8CA 2I16A 1WZLA 3DCPA 3WEZA 1EJXC 1WA3A 3GFZA 4IMGA 3UZXA 4DPQA 4KIRA 2R1MA 3AXMA 4PMNA 1GONA 4JIPA 3VGHA 4JTJA 3POCA 3UXIA 3IJ6A 1LRQA 1NDYA 3C8FA 1GOQA 4QXIA 1V6WA 4IMCA 2FTYA 5KINA 3GAKA 1ITUA 1KBBA 4IQJA 2EPHA 3SIZA 4GFIA 4HHLA 2PPGA 4JIEA 2R24A 4UTHA 4MMWA 4XZMX 4W7VA 3INPA 1KCKA 4H2HA 1FWWA 3C3NA 1TSIA 3WF1A 1NVMA 2Q01A 4GH3A 3T4CA 3CV2A 3TAKA 4O16A 3LN3A 1PSCA 1H1ZA 2CLMA 3WBWA 5BXRA 3EX2A 1DJGA 2FPTA 2ZA3A 2ZE0A 1WOBA 1XKJA 3ABSA 1SFSA 2QPSA 3QMTA 2W27A 3WH5A 3N14A 3CO8A 3DFQA 1PZ1A 1FHUA 3DI0A 1BYDA 2JKEA 4ADUA 3HU7A 3SFKA 4AVFA 2E8ZA 4PMQA 4ZA0A 1ZALA 3W2JA 1DKWA 2EEXA 3AQUA 4YN5A 1JZ3A 3FOKA 3GO2A 2HXTA 2OX1A 3LSCA 2PTYA 3SJ3A 2QKFA 3EPOA 3DH7A 1IIHA 3VKCA 1OFBA 4RDVA 4AMCA 3VD5A 4GK8A 2O9TA 3OG3A 3B9OA 1R46A 3W2MA 4AIEA 1YDVA 4MOZA 3W02A 4HPHA 4XZLX 4CQBA 4DXVA 1GT8A 2INZA 1O6IA 3BG3A 2VGGA 3M0IA 3GU9A 3V75A 1DJNA 3N04A 1H7OA 2XIJA 3D47A 3DYOA 3KVJA 5BRPA 4PBFA 3DKJA 3DXIA 4YYFA 4DBDA 1J18A 3OVRA 1WKYA 2J25A 2A7RA 3KHJA 7ODCA 3M6DA 3TSDA 4PFMA 5I03A