5HNTA

Crystal structure of akr1c3 complexed with cape
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal Structure of AKR1C3 complexed with octyl gallate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 117
structure length 315
sequence length 315
chains with identical sequence C
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5hntA00
3BV7A 1S2CA 2PDPA 1EL3A 1AH3A 3V0SA 4QXIA 1C9WA 1A80A 3R58A 1HW6A 4JQAA 3GHSA 4XAPA 2IPFA 1RY0A 4XZHA 2PDQA 3C3UA 3LZ3A 4Q3MA 2IPJA 3WCZA 3WBXA 2IQDA 2FZ8A 4Q7BA 3EAUA 3LQLA 4AUBA 2PEVA 3H7UA 2FZDA 3NTYA 3LN3A 2NVDA 1S2AA 4H7CA 4XZNX 3S3GA 3T42A 4XK2A 4YS1A 1S1RA 3P2VA 1ADSA 2PDMA 2PDLA 1YNQA 1X97A 4WEVX 2I16A 4PMJA 3LEPA 1HQTA 1YE6A 4XVEA 2HE5A 3UZZA 2R9RA 4FZIA 4DZ5A 3DN5A 2ALRA 3LENA 4YVXA 4HBKA 2FGBA 2J8TA 3R8GA 5LIXX 2FZ9A 4GQ0A 4DBWA 2DUXA 4DBUA 2F2KA 4L1WA 5AZ1A 2INEA 2IPWA 4PRRA 2WZTA 4GABA 3CAVA 3FJNA 2WZMA 2HE8A 1Q5MA 3FX4A 2R24A 3CV7A 3G1RA 5LIKX 1OG6A 4GACA 2HVOA 3CAQA 3MB9A 4GIEA 1JEZA 3Q65A 2VDGA 2DV0A 1YNPA 3UP8A 2IKGA 3ERPA 3LD5A 2PZNA 3Q67A 3O3RA 2HV5A 5KETA 3RX3A 1AFSA 1IHIA 4XO6A 4PR4A 1AH0A 4ZFCA 4JQ1A 3RX4A 2PDUA 3LQGA 1RALA 2PFHA 2ISFA 1YE4A 5AZ0A 1UR3M 3COTA 4L1XA 2BGSA 3M64A 4G5DA 3GHRA 4RPQA 3M4HA 3ONBA 4IJCA 3UFYA 3GHTA 4R9OA 2BP1A 2IPGA 1J96A 3UGRA 1Z89A 3N2TA 3D3FA 2ACRA 1LWIA 2IKIA 3GUGA 5HA7A 5LIUX 4NKCA 1R38A 2FVLA 2F38A 1FRBA 5M2FX 4PRTA 4PUWA 4OTKA 2PD9A 3V0UA 2HVNA 1QWKA 4DBSA 4YVVA 4GCAA 1SM9A 4FALA 5HNTA 1EF3A 3LUTA 4IJRA 5HNUA 1Z8AA 2A79A 1M9HA 4JTCA 1LQAA 2HEJA 2PDCA 3M0IA 4YVPA 4H8NA 1ZUAX 3LZ5A 5DANA 1MI3A 2DUZA 3UYIA 1ZQ5A 2IS7A 4I5XA 4JTQA 4IGSA 4XO7A 2IKJA 4XZMX 3UZYA 4QX4A 1X96A 1US0A 3BURA 4EXAA 1T41A 4F40A 4WDUA 4LBSA 1XF0A 4XZIA 3V35A 3CV6A 2CLPA 4XVDA 1RY8A 1S1PA 5LIYX 2PDJA 2PDNA 4HMNA 4JTAA 4JIRA 3F7JA 3CASA 1PYFA 1T40A 2PDWA 4WGHA 1EKOA 3EB3A 1QRQA 1EXBA 1ZGDA 2PDHA 3R8HA 4FAMA 2ACSA 4EXBA 1AZ1A 2AGTA 2PDKA 4WDTA 1Q13A 2PDXA 3EB4A 2PDGA 2BGQA 3R43A 2QXWA 5JH1A 4GA8A 2ACQA 3WBWA 3N6QA 1MZRA 3U2CA 3R6IA 4WDWA 2INZA 4JQ2A 2IKHA 2P5NA 4JQ4A 3UZWA 5LIWX 3G5EA 2PDBA 4JIHA 1Z9AA 5C7HA 3CMFA 3GHUA 3QKZA 4JTDA 1K8CA 2FZBA 4QR6A 3MC5A 2PDYA 3VXGA 3LNMA 1PZ1A 4WRHA 4WDXA 1AH4A 3UZXA 3V0TA 2PDFA 1PZ0A 2HDJA 4GQGA 3ONCA 2ACUA 1XJBA 5JH2A 3B3DA 1ZSXA 4LAUA 1PWLA 3BCJA 4LAZA 3WBYA 2IQ0A 1X98A 4YU1A 1XGDA 2NVCA 4JTRA 2PDIA 1VP5A 1PWMA 3R7MA 3O0KA 3H4GA 4LB3A 3RX2A 2PD5A 4PUUA 4JQ3A 3R94A 4MHBA 2C91A 4FA3A 3DOPA 3BUVA 4ICCX 4LBRA 4XZLX 1MRQA 4JIIX 2PF8A 3LBOA 3UWEA 1AZ2A 3KRBA 1IEIA 1GVEA 3WG6A 4QBXA 1VBJA 4ASTA 3UG8A 3V36A 4LB4A 1Z3NA 3H7RA 2I17A
chains in the Genus database with same CATH superfamily
4E38A 1ZNNA 4GIRA 4IG2B 1CB7B 2ANUA 3VNYA 3GXFA 4R3UA 4RDVA 4HSHA 4IUOA 3FHAA 4AH7A 3KBJA 3WK3A 1A80A 4GXPA 4HNCA 3SY1A 4ZL1A 4Z0SA 3P7YA 5K4XA 5C6MA 2Q6ZA 1TX2A 2DSZA 4LY4A 4M81A 5GNXA 1XINA 4AWSA 2C14A 1VHCA 2FZDA 4W85A 5D9OA 2ZTJA 1CENA 4EVZA 4PL1A 1RPKA 2YX0A 2GJXB 1JCNA 3WD0A 4H41A 1XIJA 3PJWA 1L6SA 4C6NA 3NSMA 3T42A 4Y8EA 4JNMA 3OOQA 4QFUA 5FL0A 1IEVA 2C19A 1TMLA 1DJXA 1U33A 1ZP4A 2H8ZA 4PBEA 3DAQA 1JDAA 1RA0A 3QR3A 3OPSA 5LGZA 2HBVA 5G2WA 3VDCA 3NSNA 4PUDA 4MWAD 2X1SA 4GH1A 2CZDA 1W5PA 1B9ZA 4UFMA 1ELSA 2AKMA 1E1FA 1OT1A 2WNQA 1QI3A 2ZRYA 4YTUA 3CJPA 4H8UA 2NUWA 3VOCA 3GBEA 3TTQA 4QEEA 2GJLA 4QSHA 2FFCA 1JUBA 3UU0A 1XSIA 4LANA 4ML9A 1L6FA 1B57A 1FXQA 1CCWB 3N4FA 3Q4DA 3C0SA 5AHIA 3B9NA 3P67A 4GACA 3SM0A 2XIJA 5D9PA 1UOKA 4U3CA 2YDQA 5U7SA 4GO9A 4J40A 2H8XA 3UCQA 1EUNA 4AY8A 3UP8A 5H8UA 3IANA 1S5MA 3EKZA 4DWSA 3A6OA 3Q67A 4DHGA 3ARPA 4N9DA 2YIHA 1TMQA 1AVAA 1REQA 4JL2A 4PR4A 4UQAA 1AH0A 1R3YA 3T0BA 5TIMA 1IT7A 3GG7A 4CCDA 1Q7QA 5C9ZA 4A05A 5D30A 5EMLA 1V6WA 2WQDA 3M64A 1UKQA 2ATSA 3L2MA 2WPBA 5CSSA 2B7PA 4ZXLA 4J3WA 3ONBA 4LYQA 4S1FA 4I7WA 2GK1A 3SSZA 1DJIA 1J96A 1MQRA 3H12A 5E6YA 3RCYA 5JQ9A 2HK0A 1JI2A 1LWIA 1V5XA 4FXSA 3NXLA 5F1UA 4JL1A 7TIMA 4Y6GA 3GRIA 2WCAA 8TIMA 4GMEA 4AEOA 4OBSA 1R3SA 3U4FA 4FK9A 3N2MA 2QCFA 3LLFA 1P6CA 1V93A 4ZEPA 5A6KA 5BRQA 3W22A 5BRBA 1U5HA 4AXKA 4D1JA 3F5JA 4NQ1A 1SMDA 2A3CA 3TSDA 1POKA 5I09A 3UVAA 1I2PA 3HG4A 1XYLA 3LZ5A 1DHKA 5DANA 3F1QA 3TNBA 5E1QA 3F4WA 4E5TA 3SN0A 3WLKX 5G5IA 3K4WA 4HIBA 3QFWA 4UFIA 1AQ0A 5HOSA 4QX4A 4DJDA 2WSPA 1XLAA 2GOKA 1JZ3A 1V3HA 1U1JA 1U83A 2ISWA 4NNBA 4KMQA 1J93A 3GLCA 3IJIA 3OZPA 1NTHA 4B90A 2FYMA 2O56A 5CEWA 1K3UA 2G3JA 3BAYA 5L9FA 4HN8A 4AQLA 2OOGA 2O0TA 3NYZA 3Q2DA 4HSNA 1D2KA 3N2CA 1UH4A 1XRTA 5CXPA 3W29A 1E0TA 2PI6A 3ZFHA 2PDWA 1KRMA 3V7PA 3SB0A 3ZR6A 1BSIA 1KFCA 4QJ4B 3C6CA 1X1NA 3VNZA 2ZX9A 1UR4A 1WB0A 4X60A 4IIFA 3MJMA 1LTDA 2E5BA 1W56A 1WXJA 4FEZA 3B0UX 1KRCC 4EPDC 2BY0A 3MP5A 3M0KA 5BZAA 4EXBA 2Z2AA 3I6TA 1KTBA 4XSLA 3VNMA 1PPIA 1Q13A 5FACA 1UH3A 1CLKA 3UWQA 5HNRA 3VAVA 4AFYA 3W7PA 1A50A 4HVXA 1JRCA 2ZBTA 3H54A 4JQ2A 4QRNA 3PNZA 2FLIA 4Q22A 1ZB5A 2HNHA 4L4PA 1BWVA 3DIPA 4GC4A 3CZ8A 3LYEA 5E09A 1ME9A 3NYDA 4JTKA 2GFTA 1KM6A 3VXGA 4A3UA 3G8RA 5DX7A 4I9JA 3OODA 3AHTA 1PZ0A 4JTJA 1QNOA 1TPC1 4GQGA 1I8JA 1U5JA 3BE7A 8XIAA 2XFFA 1ZSXA 4GVGA 4UFLA 4UR7A 3CXOA 4UMBA 1IR2A 1FWGC 3P3BA 1B2YA 4DUVA 3FAXA 4AZHA 1P7TB 3INPA 3EX1A 2MANA 4O0QA 3FEQA 3IAPA 3BARA 1KFWA 2A0NA 1K02A 3DEQA 2ZADA 4GYPA 5M5DA 1YQ2A 2E1WA 3EBVA 4DYKA 4HJWA 1J0KA 1N7KA 1O66A 5I3DA 5SWUA 4MKSA 2WQPA 5HK4A 2ZX5A 2Y61A 1KM4A 2J7EA 4FX7A 2E6FA 4L61A 4ACZB 3NQBA 4KT2A 2NV1A 4M29A 4UBPC 4HD5A 1RVGA 3TZNA 2XH7A 3RF9A 1Z3NA 5A6LA 2WNNA 1QHZA 2QMKA 1R3WA 2J8FA 3VCNA 3PTMA 4DQWA 5A6JA 3WF4A 4BFAA 5AHNA 2VHLA 4US5D 1VIZA 1RLDA 4JQAA 3GHSA 2JKAA 2IPFA 4JCMA 9CGTA 3E2QA 1RY0A 1P0DA 1EQCA 3K5XA 3PZNA 3ZM8A 1C8XA 2C0HA 1W9BM 5CBIA 4MADA 2NUXA 4I8DA 4DAIA 4N6EA 3EGJA 4MB3A 3JU2A 4A3HA 2PP3A 2QUTA 2JEPA 2VWTA 2XDFA 5I78A 1SJAA 4INFA 2E09A 3UXKA 4AVFA 1YPXA 3MSGA 1BXNA 5I7GA 4CQDA 4L6DA 4PCPA 1XLDA 1H0IA 2IQTA 2WMJA 1EDGA 1I2OA 4GVHA 2ZUMA 3GR4A 4M56A 3KRZA 4GH3A 1EFZA 7ODCA 2Z1SA 1J5SA 3ZWTA 4ZB5A 3SZ8A 1OHLA 4U10A 1BG9A 4PULA 4MVAA 5BWFA 4Q32A 4ZSUA 4DLFA 3LGEA 2C7FA 5EU9A 2BSLA 3TIMA 1U22A 3GVWA 4DBUA 5AZ1A 3GNXA 1VF8A 4PRRA 1PHWA 3SGGA 1F05A 3AYSA 1W17A 2A7NA 2A3HA 4KEVA 1SUXA 3CAQA 4Q4OA 4U4MA 5T9CE 5G4WA 1VIWA 2ZOXA 3TCEA 1Q85A 3F5LA 3E02A 1EO7A 3WMSA 1KRBC 3W1PA 1GOQA 3A23A 3HPFA 4S2BA 4FR6A 4NYUA 1FUYA 2YSWA 3RX3A 4QE5A 1OBAA 2QT3A 1SW7A 1SZRA 1J12A 1DWFM 1GVYA 3R25A 3W26A 2D2JA 4RNFA 3W7GA 4I8YA 4CCCA 1VJZA 1T99A 4D9PA 3HU7A 5LNVA 1F61A 3KOZA 1XBXA 3AUOA 2I14A 3SRHA 3TQPA 3GHRA 1XV8A 1M6JA 4H6RA 1PBGA 3NIYA 1SJCA 3P0XA 4NSBA 1IIGA 3GHTA 3MMTA 4IX0A 4C65A 3KLKA 3U7VA 1FX6A 2BLEA 3UGRA 2DT2A 4H9TA 5MKGB 1XQKA 4LVAA 4NKCA 5FCZA 3KBMA 5A6TC 1TTQA 2GGJA 4B3ZA 3TJLA 1H63A 2Z28A 2OEKA 5I77A 3PB0A 4P8VA 4NG3A 1PCKA 4ZA0A 2NQZA 3KE0A 2CBVA 4IJRA 1UH2A 4Z2GA 3WJYA 2GQ9A 3SADA 3URQA 4ADUA 4JOMA 2VZUA 4OBTA 4LYKA 2WJEA 3EDFA 2Z1XA 4H8NA 4DWDA 4M6PA 1JF6A 1TREA 4H8VA 1OT2A 1NWRA 1LWJA 4JTFA 2VGIA 3UYIA 1BYDA 1R2SA 4O4VA 3T4CA 1LG1A 1WXYA 2IS7A 4JTQA 1JDFA 4KESA 2WOQA 5LNUA 3U8GA 3WDRA 1XG4A 2ESCA 3VABA 3NO3A 3UY7A 2VFFA 2IXUA 3WLSA 2Z7KA 1G6CA 3RRXA 1FDZA 3CUGA 3H2MA 3QV7A 1M53A 1MUCA 3MTWA 1W3NA 1TSIA 4PUEA 4WKAA 4NXSA 3CASA 4C7GA 3LSCA 1IXQA 3DESA 1E51A 4Y9MA 1YW1A 3N2OA 3UETA 1VBHA 4MJMA 2HROA 3I7QA 4FNSA 4LFYA 4QJ1A 4DJFC 1K8YA 3F2CA 4AMCA 3BCDA 4HU0A 3GXDA 3BG3A 2ACSA 2NSXA 4ZSTA 4C6OA 3I4KA 4ZQRA 1JCJA 2ZUVA 3T44A 5T8GA 5IHRA 2GVJA 4O1BA 1CNVA 3HA1A 1S2UA 3ELFA 4JAWA 3UWYA 2VOMA 3SFKA 4F79A 2A4AA 1DWGM 4ECLA 1VEPA 3MHGA 2OYKA 1SFLA 2PDBA 3BWWA 3MC5A 2BY3A 3H2CA 1M3UA 2OB3A 5DMYA 1PZ1A 1BKSA 1QO2A 2AL1A 3HJZA 1DXEA 3SY5A 3IGUA 3LHUA 3LSBA 4O57A 2DUAA 3UPBA 3ZOAA 2W79A 4UFJA 3C2EA 2C16A 2A85A 4CD5A 1DQUA 3DHUA 3GH5A 4X0VA 4QLLA 1P1MA 1EWDA 2HJPA 1M7XA 1KM1A 1G01A 2F84A 3OA3A 3QSTA 4KWVA 4HKPA 4JX5A 2LLEA 1D7KA 1ME7A 1IT8A 4ZMGA 3WBYA 3ZT6A 1SPQA 4DYEA 1X98A 1Y5XA 4YU1A 4ZZ9A 1E9YB 2ZRXA 1UR8A 2OSWA 3QZEA 1GEHA 3A5VA 3CWHA 3H4GA 3I6RA 1JQVA 3T8LA 4M6VA 5E70A 1EZ2A 3IVSA 1NFPA 3WEMA 4Y96A 3AI0A 1ODZA 1B3ZA 3VDBA 2WBGA 1JAKA 3K30A 4XZWA 3CL7A 4A3YA 3WNNA 3UWEA 1O6IA 1V0MA 1IWAA 1YTKA 4BQ3A 1WCGA 1MO0A 2XIMA 3IJ8A 5JXQA 3KOYA 3TXZA 2I17A 3O07A 1PZ2A 1GVSA 4IPIA 5LYRA 3UG3A 1F7BA 3WMBA 1OC6A 1B54A 1K77A 3VIMA 4ZXOA 5A2BA 4MZ8A 2GQ3A 4GZJA 3T07A 1GOMA 5FJIA 3DI1A 3SQLA 1PIFA 1SYTA 4A2RA 1RBOB 3C8NA 1UWRA 1JQXA 1MMFA 3PZTA 1X7IA 3Q37A 4P7QA 3SCNA 3CB3A 3BLEA 3GC4A 1EX5A 1V02E 2VEIA 3K13A 4FO4A 4XZNX 2EPLX 1J79A 1MW0A 1O1HA 3WLQA 4WJEA 1E15A 1P1XA 2V67A 1Z44A 3S3GA 5BXTA 3KCLA 3EDEA 4M7TA 4MB4A 1QI2A 4GO8A 1Q2RA 3PPGA 4DLMA 5A95A 1UWSA 3TC7A 2ISSA 4B16A 1OB0A 3NXFA 2FVKA 3W73A 3B8DA 4HK7A 2VNCA 3FNDA 4W9TA 1YE6A 1QPRA 3M5XA 4MNLA 3H53A 1PSCA 2YGYA 4ORMA 2ALRA 1FWRA 3NPWA 1BG4A 4IFRA 1DIKA 2FGBA 5EB8A 3U9IA 1R5YA 1GOKA 4Q8MA 4KRUA 2G0WA 4GQ0A 3W4RA 2XG9A 4QCEA 4AZGA 3M0JA 2PTZA 4AZ7A 2OMAA 1E6RA 5KZDA 3FX4A 4AZBA 1ZLPA 1CIUA 4L5ZA 1TV4A 7A3HA 1LCOA 3FSTA 5DF0A 3BMWA 4GZ7A 4LAKA 4DELA 1MSSA 3W7LA 4MWAA 3ERPA 1F8MA 2OEMA 3NQDA 3CUZA 4W4QA 3DKLA 3EPNA 1WKDA 3NNTA 3VD4A 3KDNA 2G4FA 4OOZA 3ZVHA 3N25A 1JRBA 3V16A 2VT0A 2R1MA 3M7WA 1LZOA 1O68A 1RAKA 4HA4A 4Y7EA 1SJDA 2ISFA 1UBSA 2PF0A 3ZWSA 3AAMA 4DIAA 1V7AA 3DYMA 3LY0A 2FDMA 4DWSB 1DYSA 1UD3A 1G0CA 1I2QA 3QV6A 4GCXA 2GGHA 2ZWZA 4O52A 4NX0A 4LALA 3WQGA 1KBKA 2EGZA 2ZVIA 3ARQA 3S1GA 4QS6A 1YDNA 3WL0A 2IKIA 1LUCA 4JICA 1NAL1 4QQ3A 3GW3A 3GY1A 4UNLA 1B5TA 4P5UA 1A5BA 4UNKA 2DH3A 3IACA 2GK1B 2O7SA 1MRAA 2FTWA 3WQ6A 2VD8A 2WAGA 1RBAA 4MKNA 1IR1A 1FWAC 3FKKA 2VZTA 3E2SA 1CXEA 4O11A 1JCTA 3AO0A 1JPMA 4W7WA 4AG0A 1TJ1A 1VR6A 3WUBA 3UCDA 3IJ6A 1UC5A 3EX3A 3KOWA 1YNYA 1EO5A 1E6XM 5E0CA 3ABSA 1E4NA 4ORIA 2ZICA 3B4UA 4P7RA 3ZMRA 1WKEA 4PMXA 2PWDA 3CO8A 4LQ1A 5BMXA 1UWUA 1OYCA 2A2IA 1QCWA 3ZJ6A 4UMAA 4H7ZA 3HG3A 3VNLA 3SCUA 3AALA 1SU5A 1X96A 1N8WA 3KLLA 3UXIA 1MUMA 3CS2A 4QG8A 2Y8UA 3BH4A 4KBXA 4F40A 3QGKC 1WQ5A 3THUA 1H7WA 3SSJA 4H6KA 1LG2A 5HUPA 3WNMA 4K39A 5BNKA 4XVDA 3TE9A 4KCWA 3R8RA 3ARUA 2Y62A 1SMAA 1NP2A 4PMUA 1Z6KA 3A13A 3DFPA 3MO4A 3JVAA 2W6RA 2VC6A 1OFBA 2HK1A 2UY4A 3S5NA 1V6VA 3L66A 4FOUA 5LNSA 4GI6A 4LXFA 4S39A 3ZT5A 5I2UA 4FR1A 2TODA 3DUGA 5CPTA 1ITXA 1QRQA 1BTMA 4KCVA 4YPJA 2UWFA 1NY1A 2VRKA 2PDHA 4PMRA 3R8HA 3WBAA 1ONWA 1JR1A 2PGEA 4GINA 1UG6A 1AZ1A 2AGTA 2YA0A 1X7FA 1K7XA 2FH8A 3B9EA 2HPMA 2PDXA 2PDGA 4H3DA 1L8NA 4CVWA 3S47A 5LGXA 1K8XA 1MZRA 3U2CA 5B80A 4L65A 4MGGA 3TOYA 5LIWX 1TYGA 3W87A 1DWIM 2ZX6A 4ICMA 1FOBA 4BF5A 3MA8A 3CK5A 2X16A 4HOWA 2VYOA 3GHUA 3QKZA 3WLPA 2CESA 1UR1A 3DHDA 4UZSA 3GUWA 3M0VA 3KRUA 4CD7A 2BVWA 1T8XA 2YDAA 2P8BA 2D22A 2BXVA 1AJ0A 3ARZA 3H4XA 1YMYA 4DXVA 4UTKA 3GYCA 5D32A 3MYOA 4F2UA 2HTMA 3AIQA 2F6XA 1ONRA 5XIAA 4PTWA 1W9PA 1E6QM 1KKOA 4KPLA 1JD7A 1KQZA 3IWPA 3ITYA 3VKJA 1OGBA 3TW7A 1OD0A 4F2TA 3G22A 3UW6A 1LJYA 3OIHA 4CKQA 3L4YA 2ISDA 2FHFA 3OQ8A 3GNPA 3LS9A 3OZMA 2CHNA 5RUBA 1EBGA 2D2HA 4S3JA 4RX0A 2E6AA 2VR5A 4KRTA 1RCOB 3TTEA 3WQDA 3IIXA 1VFUA 3PM6A 3L5LA 2J7GA 3WENA 1W5OA 1FTXA 3VNIA 2L5HA 4W5ZA 3NURA 4AHOA 3CUHA 2QGYA 4EX4A 3TYZA 3EOOA 4LU0A 3WQ5A 3VIKA 3RJYA 3W1XA 2BWGA 3KWXA 3EMZA 4RXFA 3RM4A 4ROQA 1MQQA 3BK0A 3O9NA 1VBGA 4GY7A 1GYNA 2VTFA 4QSFA 2J8GA 3HPZA 1R9YA 4QTGA 4ERIA 3WLJA 1OFDA 3EAUA 4S3DA 2BV9A 4AUBA 2GDUA 3M0ZA 2XIOA 3AISA 1VFLA 3CWOX 2WB5A 4AIEA 3MSYA 4H7CA 1RK6A 2WZEA 4V1YA 2PTDA 3NQ7A 3GNRA 3GXTA 3ARWA 2VEFA 4Y90A 3N4AA 3P2VA 4J3TA 4RL3A 3W9ZA 1XQLA 5GVJA 4CCZA 3U48A 4GBDA 1TV8A 3GXMA 4FNUA 4US5A 2ZWYA 3ORWA 2V8ZA 1BPLB 3VTRA 3TA9A 3MUXA 4K8EA 1OCQA 3S0CA 1JIBA 1F6PA 5FJTA 4N9CA 5AYZA 2EQDA 2NXHA 1F8IA 1BGGA 2Y7GA 1FWFC 3FIGA 3XISA 4MJ2A 2J8TA 2V5LA 3W07A 3W74A 3RNDA 2R6OA 4A3RA 3W0KA 4B91A 3WUFA 1VEOA 1HP5A 4PH6A 4RXGA 3WQ8A 1QPQA 1EPVA 4CNTA 1YXYA 1H1YA 4JTGA 3VC6A 2WZMA 4WF7A 1Q5MA 2R24A 1RZMA 3TH6A 4LUYA 4GIEA 3Q65A 3B0XA 4HPHA 1YNPA 3I3BA 3ZT7A 4UTTC 1CB2A 3H2EA 2CEQA 2WLYA 2BOGX 4NAFA 4UTLA 1W9UA 3OGRA 2Z27A 3USZA 4U31A 3RITA 1IGSA 1TVPA 3DX5A 4MPKA 3SI9A 1HO4A 5I3HA 3BAWA 2YDRA 3NO5A 3M47A 3NQ2A 1C92A 2Q3RA 4V33A 2Q8ZA 3HQOA 3UWWA 1ICQA 1GPWA 1BD0A 1KCLA 4B5UA 2EG6A 3PBVA 2VX7A 4Z42C 1RCXB 4O8AA 2CYGA 2QPXA 3D3FA 3BSHA 4NZ5A 1P6WA 1A5LC 2CLLA 2V6AA 1ZENA 3SGZA 4AEEA 4H9VA 1ZAJA 1R2RA 3UG4A 4OTKA 5FJJA 3IGXA 4B3LA 1JDDA 3CEUA 2IMRA 3ITOA 5C9RA 1RJQA 5FJPA 2Z1BA 1LQ0A 2EKCA 2OLAA 3MP3A 2CNCA 2ZZ2A 3OYZA 2WSYA 4GIYA 2X42A 4H83A 2RDTA 4HMCA 3FJ6A 3A4JA 4GYJA 3ARTA 2DUZA 3E2RA 4WHBA 3N14A 3SCWA 2CLKA 5DMMA 2C15A 2DZTA 3V1PA 2W27A 3I10A 4ADTA 3ES8A 3CPUA 2J7HA 4QP0A 1UB3A 1TTIA 3FVDA 3WQ4A 3TDFA 4LS1A 1T5AA 4HCLA 1R85A 1LLZA 1SGJA 1FFRA 1GUVA 1EYWA 3HGSA 3KHDA 5G1YA 2YBVA 3DGBA 3IVUA 4WXYA 4XG1A 3QMRA 3WNPA 5FJUA 6CGTA 1WUEA 4ZTXA 3QLDA 3K1DA 1PYFA 3KP1A 2BS9A 1NU5A 1GKQA 3UR8A 3N9RA 5T9BG 3KX6A 2Y7DA 2JALA 4N9BA 1OK6A 3SY8A 1KW1A 3B97A 3W6MA 4N6FA 4YXGA 4QEHA 4KIEA 3NM3A 5IFPA 1E6ZA 1ZBCA 5E0FA 4ZB2A 2W92A 3S1WA 2GWNA 2VC5A 1GQNA 2XN0A 1TV5A 2VFIA 4JEQA 5HNNA 1M7OA 2O9RA 3KP0A 3R2GA 3TYAA 3MDUA 2TRSA 2INZA 3S5ZA 3M6DA 4URIA 2I1OA 2G3FA 3G5EA 3T09A 2ISVA 2F6KA 5D8WA 3L21A 2VCCA 1HN1A 4NNCA 1V3LA 5EPDA 1L0PA 4LRTA 3D0CA 4Z2LA 3EDDA 1WDPA 4QAIA 3LNMA 3C5QA 4RE0A 3GX9A 3QW4B 3EOEA 4PYSA 5LHEA 2VFEA 4OZOA 1H3GA 3MW7A 4QIUA 1VEMA 2E68A 4DJEC 4QQUA 4TV5A 2DVUA 1NF7A 1JDEA 1KR1A 1XPGA 3AWNA 1HL9A 3OVQA 3ZLHA 1KFEA 3W1QA 4C6KA 3NQCA 3LRMA 2NVCA 2DVXA 3WL1A 1VP5A 4I6VA 1R47A 4HA3A 1O60A 3RX2A 3PFMA 3WDJA 2QR6A 1XXXA 3R94A 1T96A 2DJXA 1ITUA 4ILSA 3STFA 3BJFA 1DPMA 1HJQA 2WC4A 3EEGA 1CGXA 3N9KA 2V81A 2NZLA 2PMQA 1ICSA 1S5VA 3S9IA 1XG3A 5LA1A 2ADAA 1E56A 3W2KA 3LOTA 2PSNA 4X2RA 1A4LA 4MAZA 3L2IA 2XN2A 1QMLA 1EJVC 6XIMA 4A8RA 2FQIA 1PKLA 1TKKA 4IQJA 3BANA 3GXPA 1J0IA 1B3YA 4UFHA 3VZXA 1C9WA 5A3HA 1A0DA 3LM7A 4OUIA 4K8HA 2E5CA 4Q3MA 1VLIA 5CAHA 2DQWA 1QK0A 3A3HA 4JY9A 4H00A 1QOQA 3HFYA 2J62A 4HHPA 1Q6EA 1UMYA 4HOZA 1I4NA 2GVEA 1P48A 2W63A 3DFQA 1S1RA 1ADSA 5E6ZA 5HINA 1XYBA 3GVRA 3MKKA 1W8SA 2V5JA 4AB4A 1G94A 3MV01 2CLEA 2FPVA 3W25A 2GUYA 4LAMA 2FTYA 4HCDA 3G6LA 3NPUA 2FGLA 2G41A 1MXDA 2BG5A 4CUCA 3QR0A 4D6EA 1PO9A 3WMLA 1FXPA 4A3QA 3DN5A 4N7QA 2KX9A 4J3ZA 3MZ2A 4C5ZA 4J27A 1QI0A 4PUJA 4J4KA 3H21A 5BROA 3LTSA 4O15A 2IPWA 4W88A 4AW7A 3FJNA 3IIZA 4KCUA 3AJ7A 2O9OA 4BJHA 4DEFA 3T40A 3TN6A 9XIMA 3LRKA 1EX1A 2XVGA 2QDGA 2P8CA 2PODA 1WBJA 3LD5A 1K6WA 3TTYA 2HXTA 3AS1A 4EPKA 1AFSA 2WLZA 2YW4A 5CSRA 1MEWA 1GEQA 2HVMA 4EACA 3GTNA 3NR0A 3WK1A 3ZYZA 3WN6A 4RZ5A 1TX0A 1XIFA 1A5MC 2HISA 4RPQA 5HWJA 4C6BA 4DUWA 3W1AA 4AWEA 2VM8A 1DTNA 5AHEA 1R0MA 5PTDA 2QZRA 2X41A 3TQ0A 3UF9A 1DEDA 4HZ8A 1TWWA 4D6JA 1WUFA 3UCCA 3VGDA 3GUGA 4M8UA 1FVPA 3M44A 2VURA 4GJJA 3DG7A 2WO5A 4UMCA 4PMZA 1VYSX 3QVQA 3LM3A 2NXGA 4CNSA 2QVNA 5C5YA 2DT0A 1DVJA 3OHMB 4KFNA 4W93A 3N1AA 3MU7A 2VGFA 4B5SA 1LUCB 3O0FA 4GBUA 3URBA 3O2LA 3AUJA 4KKXA 4M0XA 2JKEA 1JZ2A 4L1GA 3VDHA 3M0IA 4UOJA 2JE8A 1W91A 5J5RA 1E71M 1EPXA 2YXGA 1V79A 1FCUA 2VMFA 3UT0A 4D6GA 3EWXA 3R10A 3PUEA 1TJ2A 3AC0A 2CWXA 4PMQA 3FFSA 1ZQ5A 5D4YA 2Z2UA 5IDIA 3CBWA 3GC5A 1MUWA 3NL2A 4IGSA 4XO7A 8XIMA 3UZYA 3CMJA 5TQLA 4L64A 1H4PA 4LT9A 3AROA 2P0OA 3DFYA 3R5EA 4OVXA 4QLJA 5A8GA 1HKMA 1UZDA 4XZBA 3GDTA 1KNWA 1FBAA 1AG1O 1H1ZA 1HJUA 5A6BD 5IBXA 4DAFA 2XVKA 3D6NA 4KFOA 3OYXA 4Y9PA 4BWLC 3ABXA 3W7MA 1GJWA 2VZVA 4ERGA 4WSJA 1FKWA 2H6RA 4JEJA 4Z2JA 1ZCOA 4B9ZA 3L65A 3V5FA 3ZSTA 1C90A 3G1YA 1QBBA 1NEYA 5IM51 1CYGA 1UWAA 2DZSA 3GBDA 1E3XA 3WNLA 5FA5A 3KHJA 5AVHA 5AC7A 4O12A 4C90A 3BW3A 5BMWA 1Q45A 2PDKA 2QLYA 4LVGA 4TVDA 2OWCA 3U5UA 1G69A 3DH7A 1MYRA 3N3MA 4MM1A 4AIBA 1YDVA 3LCHA 3G77A 3FLUA 5D05A 5HXMA 4C6MA 4LF2A 1Z9AA 3LDVA 2EF9A 1OCBA 4O19A 2GGEA 4JX4A 3EWDA 4GOAA 3SCPA 1RA5A 1QNSA 1TB3A 2RFGA 4ZE5A 1VPQA 2ZDRA 3PAOA 4FOJA 3CH0A 4AD2A 4F0MA 4I5UA 1FCVA 3LHYA 3FV9A 3B8WA 4WOQA 4WY0A 4OBRA 4AC7C 5C55A 1XJBA 5JH2A 1ECQA 1NQ6A 3QLLA 4ZB0A 2Y8KA 2PE4A 1V03A 5HWMA 3AHXA 3CH9A 4H9YA 4FNTA 2VD9A 1ITQA 1O5XA 3TYBA 4AF0A 1XISA 3GS6A 2ZQ0A 1HL8A 3GC2A 4AY7A 1XGDA 2DZBA 3S6TA 3KL5A 1BXBA 1QNRA 1L6GA 5IXEA 1QW8A 3ZLGA 1L2QA 3VZZA 1H09A 1K70A 2Y5JA 3FXGA 1TZ9A 5AFDA 3GSMA 4K3ZA 1QWGA 1NDWA 1XUZA 3E2VA 4IL0A 1HGWA 1W1PA 3ALGA 3O1NA 3N17A 1IEIA 1MQPA 5I6SA 1HJSA 4GUIA 2QJGA 2YB1A 1S3HA 3S1UA 3VGHA 3HV8A 3GFYA 4ASTA 2GVGA 3M0HA 4R9XA 1XBZA 5DQPA 3H7RA 1GWJA 4EPEC 2Y85A 3NQFA 1F4AA 1PKYA 4PCFA 5DRIA 4E2OA 4QROA 3RLGA 3W1MA 3VNDA 3T0TA 1RLCL 4GIAA 2XM2A 1JNEA 3V1HA 1JNDA 1IQ8A 1SVDA 5HJYA 3AIRA 3DZ1A 3QN3A 3DFHA 4Z2HA 1CGTA 4OOUA 3LQLA 1UWIA 2WC7A 4PMNA 1TPH1 5I3KA 2FMNA 1HKJA 2C1GA 4C6QA 4HZMA 1SO6A 4KETA 4M5PA 3CHCA 2JEQA 3N19B 1BQCA 5D2YA 3WF1A 1EBHA 1E6PA 4NJJA 4RZBA 1YNQA 4NNAA 2J7CA 2PGWA 3NDYA 3QQWA 2NQHA 1YXCA 3QXBA 4JFUA 3QGVA 4KCTA 1ME8A 1Z48A 4C6LA 3MVIA 4US6A 4XVEA 2WHJA 3ARXA 2R9RA 5CC5A 2OX4A 5I03A 2X05A 4NHVA 1KLYA 4L4MA 2HXUA 1JCXA 1I9CB 4YVXA 4KERA 3R12A 2VC9A 5LHFA 1QNVA 3G1VA 1PB0A 1AQMA 1I0BA 2POZA 2DUXA 3GDLA 5A8NA 4DXKA 4BEQA 1XYZA 4IJBA 4U28A 1HJWA 1K9TA 1XRFA 5LSMA 5AN7A 2JGQA 2PPGA 3DCPA 1LOLA 4TV6A 1N55A 3BLKA 3VA8A 2OKOA 4KGLA 2P10A 2PWGA 2DV0A 3TJXA 5REQA 2DIJA 3F4DA 3LCWA 3G1HA 2X0SA 1FA2A 5KETA 2W4XA 5KZ6A 1UD5A 2ZC8A 1RQBA 4BQ2A 5CGTA 4Y9AA 4ZFCA 3VD7A 1CW2A 3BSMA 5DXYA 3W53A 4LPCA 6TAAA 4ONVA 4K1GA 5DT7A 3POHA 1QNPA 3HJEA 4AIOA 2F61A 2AAMA 4NAFB 8A3HA 4IJCA 4LCRA 3AHYA 1KBBA 3E12A 2OCZA 2IPGA 3NSXA 3NDOA 5DBUA 1Z89A 4TUFA 4PMOA 2ACRA 2YJQA 4M1BA 4BY3A 4D6HA 1MXSA 1NH6A 1Y5WA 2Z6IA 4O50A 3TJIA 1FP9A 2CWNA 3R0KA 1ZBKA 4IMDA 1VAHA 2PD9A 1P0KA 3CZJA 2GGIA 3NPVA 4EAMA 1POJA 4BCEA 3KEHA 3I7RA 4GCAA 1KCZA 3WSUA 1TVNA 3GG8A 3LHWA 4XWUA 3GD6A 3O16A 4F48A 2A79A 1PX3A 3W1NA 3M07A 2J74A 4B9YA 3GG1A 3T1GA 3VOIA 1KQYA 3TONA 1UUMA 2PRMA 4MY8A 5F2GA 1HL2A 3ME3A 3WX7A 2OZTA 2WWDA 2HZGA 1VLWA 4JKLA 3VILA 2J79A 4I5XA 1V7YA 1TIMA 4F0LA 3L4XA 1RBLA 5G4HC 3Q45A 4TOQA 4BI6A 2OGYA 4WY0F 5F2IA 4J28A 2QUNA 4HU3A 2AL2A 3DFOA 1FWHC 1JXKA 1QBAA 1F4HA 4CN1A 5D2WA 3H55A 1G4TA 4X3ZA 5CZKA 3FYYA 3BGGA 3BAKA 2HQAA 5BWAA 1JZ6A 4WKFA 1NSJA 1SJBA 2RDXA 5CBJA 4RNJA 4O1FA 1FWCC 3DDMA 4HK6A 3P81A 4N0RA 1DIDA 3CAWA 2C79A 3GNNA 3QY6A 2VVNA 1ZPTA 3CHVA 2NW0A 4AWUA 3ABZA 3TWBA 3HN3A 1GW1A 1SR0A 5G2HA 3KL3A 2D69A 1Z7AA 3PZMA 3LERA 4YWIA 3SUTA 1BXCA 1TWIA 4FLOA 2GDQA 4NY2A 3TK7A 2J27A 4GXWA 1GK8A 4S38A 4HT3A 2HCVA 1OX4A 5CJ5A 2CU0A 3GVVA 1AL8A 2E9LA 2PTYA 2AQVA 4G1NA 4IPLA 5KEZA 1MW2A 4NASA 1IZKA 4AZCB 4GFSA 4G2DA 1JJKA 5CPOA 1GVIA 2YDSA 4QR6A 1M5WA 3CHDA 1E40A 5C70A 3WQVA 1J18A 1KXVA 2REQA 4GISA 4U5IA 4CNPA 4PL2A 1Q6RA 4UQDA 6PTDA 2OELA 4QAWA 5MF5A 1NQKA 1W31A 5HQEA 2R91A 2PU0A 3RDKA 4A8NA 5ABHA 1QW9A 4Z1YA 3PJUA 3CUFA 3GFZA 4LUTB 3URAA 3MUAA 4JNYA 1Z41A 1EOKA 4W86A 3E0WA 3G8EA 1LOSA 2E8YA 4KEUA 1I60A 3U2ZA 3MWAA 5AYIA 1XC4A 4MG4A 4IIBA 1PWMA 1Q63A 1UZ4A 3GU1A 3HM7A 3W1RA 3BQ6A 4FF5A 1C8QA 1JGIA 1WZAA 4X9SA 3VMOA 3AMGA 2WVVA 4ICCX 1OCJA 1ISXA 3W72A 3HB9A 1D9EA 3S5SA 3DU0A 2YCEA 1GVEA 3H70A 4EOUA 2F6UA 3GE7A 4FB7A 1W5MA 1BHGA 1MNSA 3M43A 2GWGA 3NZQA 1Q4NX 5AHLA 1TRDA 4XBKA 3MCNA 2PLJA 2NWSA 3SUUA 3MWCA 3V75A 1FWNA 3QGAC 1H50A 4UOQA 3MANA 2QJNA 3SRKA 4C6PA 4O14A 4UZUA 3QZAA 1UZHA 3WCZA 3AIWA 3TA6A 1VC4A 4D72A 5I79A 2CBIA 1D7FA 3M5ZA 3K8MA 4HGXA 5U4NA 3FA4A 2NVDA 2VWSA 3RFAA 4J3VA 3H22A 5DRCA 5BXPA 3NZRA 4C1NA 1TIWA 2DSUA 3F4CA 4JN7A 1IZCA 1I2NA 3W7CA 3GW0A 3TTSA 6XIAA 3IIPA 3TAOA 1VPXA 4YCPA 3CQIA 2HRWA 3HQNA 3GZ3A 4JIPA 1O12A 1J0ZA 1QK2A 1ICPA 3T6CA 5H1WA 3GFXA 3TU9A 4B5NA 1HGYA 3I68A 1FWBC 4DZ5A 1WPCA 4BEUA 1OCNA 1OGGA 3ITVA 4BK9A 1L6YA 5C71A 1CX9A 2VL4A 2PWVA 2YA1A 3FEMA 1TR1A 3VGGA 1V3KA 4GZIA 4DBWA 4OT7A 3ITXA 5AVNA 3BLIA 4FSAA 4U5KA 4F9DA 1UMLA 1TUXA 4MLJA 5KINA 5FOOA 2ZUSA 1TR9A 1GOOA 3B0VC 2WJDA 3CV7A 3CZGA 2VUNA 3VIOA 2HVOA 2QAPA 3WLTA 1J8VA 3NVDA 1UROA 3GAYA 1K9DA 1UP2A 4LC6A 5D03A 1GOIA 3RPMA 3KW3A 3O6DA 3O3RA 3WLOA 1IHIA 3HURA 3W7IA 4XAYA 3FSUA 3RU6A 3RX4A 3EWWA 5DT5A 2PBGA 4AZIA 2CKSA 2P3ZA 3O6YX 1HT6A 1LT8A 4QGCA 2BOFX 5AHFA 1B9BA 3DYPA 5G1MA 2XZ9A 2WVUA 4CN6A 4NZ1A 1F3TA 2HSAA 1B31A 2ON3A 2VQUA 4IQEA 5IOBA 1V6TA 2QJMA 4CQ9A 1U5VA 2UY3A 2VFDA 4O0ZA 1ONEA 4HHLA 3WDPP 3UYCA 4BR1A 5CG0A 2FHCA 3OBAA 4C1LA 3TYDA 1XC6A 2X1IA 3N2TA 4Q4PA 4PGLA 3N2XA 3URNA 2HWGA 2XWDA 3MCMA 5EBUA 3IGSA 1GQJA 3BPWA 4BI5A 4M24A 2ZE0A 2FVLA 1NOFA 3IARA 3N15A 2OPJA 2VR2A 1P0BA 3UG5A 5LNWA 6ALDA 4RNIA 4GY0A 1LRNA 2XSBA 3IJDA 4WCJA 3WK0A 5DCDA 4ZQMA 1SW3A 3IRSA 2DT3A 3GIQA 2OYMA 3IS4A 2ZCGA 4P8UA 4ZQPA 2NX9A 4RDZA 4YIWA 5H8PA 4HTBA 1TA3A 2YLLA 1KCXA 2V9DA 1VFTA 3B9OA 4YTQA 3JS3A 3USBA 3CUIA 3HGOA 3G24A 6REQA 2Q01A 2E40A 3GM8A 4MNMA 4AZ6A 3TYEA 1MI3A 3BLPX 4HU4A 1F07A 4HP5A 2ZTKA 1GYLA 4H2CA 5IFTA 3ZSSA 2PWUA 3LLDA 2PA6A 5FEXA 1EP1A 3P84A 1XD0A 4TX9A 4HMEA 1MDRA 5FEZA 3QOMA 1KRAC 1C8VA 2I9UA 2W0UA 4U33A 2YFNA 4XZIA 4TO8A 3MJYA 4JKMA 4DZIA 3RUBL 3VNKA 3WQFA 3M9YA 4Q4SA 5LIYX 1WO2A 3W38A 2WSKA 2BTMA 1CGYA 1EYEA 2VEPA 3IUIA 2CLOA 4JTAA 2INFA 1N2VA 4U2YA 4RE4A 1E5JA 1QI4A 3TXVA 1R6WA 2IUZA 2O9PA 4FIQA 4RKAA 2Z1WA 4IPNB 2E77A 1G4PA 2OQYA 5GQBA 3VE7A 3NQAA 2DZWA 3W71A 2W5FA 1EJRC 5D2VA 3W6LA 3BC9A 3AHZA 2OG9A 2RHGA 3D46A 4Z1CA 3WMCA 3ZS4A 3TR2A 1HKVA 1DJGA 4F0HA 2ALDA 3EB4A 1AQHA 5ABFB 1R7AA 2R94A 3OGSA 3F2DA 4MKVA 3K8LA 1QUMA 5A6BA 2CITA 5I3GA 4FF7A 4JIHA 1WDRA 3QY7A 3C0QA 5F2LA 4ZGYA 3EX2A 3XINA 4H6QA 4NT0A 4B15A 4XKYB 3LV6A 4WDXA 5BCAA 1W2PA 2OSXA 4EIVA 4XQ6A 1JCYA 2E6DA 2OYLA 7CGTA 2TMDA 4YL2A 4A4AA 3FY1A 3IIVA 1VJIA 4X63A 3KBWA 4DPQA 1UKPA 3U5YA 3R79A 3W7HA 3BCJA 1OJXA 1VCFA 4XAFA 3PTDA 2AQWA 4Q33A 1Q2SA 2Z1KA 5A94A 1Q6QA 2PCQA 3C2RA 5DFAA 4MDOA 3PB2A 2W3ZA 1CPUA 2JQXA 4ZCWA 1EIXA 1S38A 4F66A 3U0HA 3QV9A 3GZAA 1SFSA 2A1YA 5AC5A 1R3TA 1K1DA 4AF0B 3L0KA 3EKGA 1JYXA 2BMBA 4RE3A 3RMEA 1AZ2A 3KRBA 1XD1A 1XYMA 1UJPA 2QAFA 5I06A 2R1LA 4AVNA 1OGSA 2WYSA 4J7RA 4XBSA 4NAEA 4GK8A 3S6OA 1UA3A 1QO5A 3WJWA 2QCCA 4OKDA 1C8YA 1RQHA 2PP1A 4DI9A 4J3UA 1QASA 1GZJA 1LROA 4CQAA 1EJ7L 4G7FA 1OK4A 2R1PA 3WFLA 3MY9A 3C3UA 3LZ3A 4Q8OA 4X2PA 3WBXA 4QS5A 3N04A 5CLTA 3PPFA 3QEZA 2EPOA 4LYPA 1ZJHA 1R30A 3FJLA 3HPSA 3MDWA 5CJNA 2QCNA 4JN8A 1BWKA 2WM1A 3JW7A 3O15A 4KQNA 3KFTA 2XISA 3MZNA 3AMDA 3U3HA 3IV3A 3WFZA 4WVXA 2XUCA 4XUYA 4UTMA 1C7SA 3E9AA 5C0QA 1D3GA 3ZZ1A 2ASHA 3STCA 3LEPA 4HPXA 1M04A 2YXOA 3VO0A 3CL6A 1FQ0A 1YLVA 3KUMA 2QCDA 2HE5A 2I5GA 4YYCA 1G1YA 4GI4A 3H24A 3WH7A 4ES4A 4J9JA 5I07A 4QG9A 3PS7A 2H9AA 3GIYA 3PZVA 3BW4A 2G3NA 1J0HA 4BZYA 4X22A 1T7LA 5GJMA 1L9WA 3MS8A 4B4HA 1GOWA 4Q6XA 1D3CA 4QHRA 3W7KA 2DIEA 3M5VA 2X7VA 4GI9A 3U2EA 1O5RA 3B8SA 2VZSA 4GABA 3CAVA 3IJQA 3K8KA 1VRDA 1UR2A 3LPFA 4M3PA 3QHOA 3LBCA 4HOXA 2NLYA 3SGUA 4H9UA 4Q7IA 1JL8A 1JEZA 4LUIA 3N4EA 1J0JA 2RGLA 5FKYA 3OO2A 4IHCA 3UPMA 1YADA 3KVMA 1GGOA 3BICA 3WIJA 2OWXA 1XDLA 3CLMA 3IPWA 3HPXA 2YXXA 5DEZA 2CLMA 4XB3A 2ZZ6A 3W01A 3PZIA 2VX6A 5CC3A 2YL8A 1KXHA 1WDSA 4GE8A 4WQ6A 1WKYA 3UWVA 2GJXA 3MI2A 4EE9A 1LQ2A 4Z17A 1DBTA 2Z0IA 1DWJM 1EC8A 5REQB 4DJFA 5F4WA 5D9NA 2FH6A 3ABRA 4DJED 1B3WA 3QOKA 1YTDA 2WMKA 5EMYA 2FPTA 2Z29A 4LH8A 1EC9A 3VDGA 1DIEA 3SN1A 4LUJA 4MPQA 5BXRA 5FL1A 1R9XA 3N2BA 3AU2A 5HANA 5I0DA 3KOXA 2WC3A 1K03A 4MDPA 4Y2WA 1XLKA 4V28A 4MOZA 5M2FX 4PUWA 1AODA 4IP5A 3N18A 3FHQA 3OG2A 4FP1A 4I9MA 3BAJA 5HDRA 4MFEA 4DBSA 3S8HA 2A21A 1L8PA 2WSRA 4TMCA 4FALA 3LUTA 3GDMA 3W23A 4IGMA 2J78A 2Y7FA 3S2JA 5JU6A 2HEJA 1TRIA 2C71A 3BW2A 3AXKA 3NEVA 3WD1A 4UNIA 4PODA 3WH5A 1XBVA 4M80A 3TR9A 1EGZA 3VKAA 4REQA 4DF1A 1X6LA 4YCOA 3DFSA 3WUGA 2E1DA 3AMLA 3C61A 3SUSA 3M1ZA 1VYRA 4G8TA 3VD3A 1FWDC 2WXDM 5TD4A 3VU2A 1US0A 4NL1A 4PN2A 2PUZA 4GGHA 2PU1A 3OLIA 4MMWA 3NZGA 3EMCA 1LORA 3SW6A 5A1AA 3LBMA 1LM1A 1WAUA 3NDZA 2OKTA 3PWIA 4PMDA 5FF7A 1ADOA 3G0UA 4ZODA 4PEKA 3U57A 1W54A 2C3ZA 2VX5A 4WJXA 3W7DA 3F7JA 1EF2A 1C29A 3A4AA 3T9PA 5D02A 1XR2A 2WJFA 3OW1A 3EXRA 2J9ZA 4WLCA 2AL2B 4HN4A 4I5RA 1XS2A 5J8LA 5CGMA 4QE4A 1IGWA 1UKOA 5IHSA 4HA0A 1DWAM 3RM8A 4QDMA 2VELA 3RLUA 1F76A 1FHVA 4LX4A 4UIOA 1SZGA 4NZJA 5CBBA 3QM3A 4RCXA 5CPMA 3LCIA 4F2BA 2J66A 1P0EA 5J5DA 4AD0A 2Y5EA 2XGIA 3WYZA 1VENA 3ARSA 3N6QA 3D47A 3WUEA 5EBAA 4XZ9A 2QV5A 3TW9A 4GUFA 1Q66A 3WY1A 1TPFA 3GIPA 1PVNA 1V3IA 4J35A 4JTDA 1UHVA 1E1EA 4XD5A 2CZFA 5XIMA 1DHPA 1OX4B 3YPIA 1NWSA 2XVPA 4BI7A 3V0TA 4DF0A 1VFMA 3CIVA 2AMXA 1XCWA 4F9JA 1HNYA 5D37A 1W3KA 3N3TA 4YTTA 2QCHA 2IXVA 1WDQA 3P93A 4MB1A 1A0EA 3CIXA 4A6GA 2REQB 3AIUA 1G9HA 3MUCA 3W76A 1E43A 1TTPA 5FJOA 3BZJA 4JTIA 3FDGA 2BY1A 3CNYA 3KWSA 4XUGA 3CQHA 4S3CA 4LB3A 3QSRA 4ACYA 2VENA 1DL3A 4JQ3A 3PJXA 3AXHA 1EWEA 2FTPA 3C2YA 1JF5A 1LP6A 1HP4A 1TMHA 1M41A 5D8ZA 3LBOA 4JR5A 1BRLA 1GHRA 2J7BA 1VYPX 2OT1A 2HPIA 1JCMP 4QBXA 5CAKA 4DO6A 1WE5A 3GWQA 4QNWA 1A5KC 4DZAA 1XYFA 1EQPA 1LOQA 2V2DA 2QUMA 2W91A 4E4PA 2WVVB 4GXMA 3V3WA 1YTEA 1OSEA 3V0SA 2A5HA 4R53A 3GH7A 3OVPA 4HTYA 3M0XA 2PDQA 4ATLA 1ODUA 1JFHA 3VVGA 2A6NA 4Q7BA 4GGBA 2JIEA 2NT0A 2PEVA 1HKWA 1W1VA 1GT8A 1M03A 3S2CA 3DHPA 4OE7A 1JPIA 1AW2A 4K2SA 3NGJA 2A3BA 1Z32X 3L4TA 1CTNA 3OZYA 1CXIA 2VO5A 4HPGA 3RR4A 4ZO9A 1Q8AA 2NQ9A 1EH9A 2V0TA 1JYNA 4GPNA 5F4XA 4XAGA 5D04C 3GDRA 4GHRA 2P0IA 3ICJA 4S3AA 3P0WA 2BODX 4FLRA 2VOTA 4C1NB 2AAAA 2J9YA 1PIIA 1QU4A 1OY0A 4RPPA 2DORA 2Y24A 4H19A 3VOJA 4L4OA 3M7SA 1T0OA 3LENA 4ACZA 2OT0A 3ZLFA 2QKFA 4MIMA 4DXXA 3STEA 1FKXA 3TQVA 4XIMA 1X8FA 2OZ0A 2WZTA 5IDZA 1BEUA 1S5TA 4K7VA 4GFIA 1OG6A 4IXHA 3VIIA 2QIWA 4W5UA 2ZYFA 3OVRA 1R8LA 3T55A 3N11A 2R1KA 3PVFA 1D8WA 4NZ3A 1OFPA 3AIEA 4Q4MA 2CZEA 1DIOA 3NL6A 4N2YA 4GNVA 4YYFA 4L56A 2V3FA 3A64A 1VCGA 3MBFA 4XV0A 4OIFA 4YTRA 4C6JA 3OBEA 1XFCA 2O4QA 4FXRA 2BGSA 4EP8C 2BGNE 1FHUA 1JDCA 2OO6A 3OQEA 3FCPA 4HU8A 4IFKA 3NQGA 3NG3A 3HG5A 3TSBA 3VIJA 1LBLA 2JIWA 3T0DA 3CL8A 2VUYA 2VRQA 3QV8A 1ZALA 2G97A 4JTEA 4O54A 3GNDA 1NF0A 1YPIA 5HA7A 3W02A 4LC8A 3E5BA 5EKYA 2F38A 1FRBA 5HMDA 3RRAA 2Q8LA 3QTPA 1NWUA 1RJPA 4PTDA 2HVNA 1GYMA 3SJNA 1UOZA 1SZFA 1WNOA 4NI8A 5HNTA 5LXXA 1EF3A 5HNUA 2V3DA 3EWZA 1ZJIA 4NJHA 4PB4A 1M9HA 3BO9A 4NF7A 2ZZ4A 4EF9A 5M03A 1KTNA 3THQA 5C2CA 1PV8A 4HNOA 3VMNA 1WBHA 4CCEA 2QHAA 2Z2BA 5C2XA 1GW9A 4AISA 3E1F1 2XFYA 2YL6A 1H62A 3KCOA 1J2BA 4O1CA 5BOOA 5HUOA 2DZUA 3STGA 3W70A 4ZTYA 3IAQA 1TA3B 1B4KA 3E49A 5CC7A 4V15A 1T41A 1CXFA 3KTCA 4WDUA 1XF0A 4XD4A 1PTAA 1A53A 4NJIA 3TC6A 1KWKA 4GWEA 1H7OA 4WSKA 3AIBA 1H51A 1R2TA 3MCOA 3CV6A 2VJXA 2WVTA 2P3EA 3GB6A 2XFRA 3UQNA 3L68A 3QPZA 2PDNA 4HMNA 2GYIA 3FYPA 4LNCA 2PRLA 1PKNA 5ECUA 4HK5A 3WD3A 1G7UA 1ISVA 3MYPA 3M41A 4NP7A 5MKGA 4CU8A 3PUGA 2RJHA 4IM4A 3W85A 3BG5A 3WJXA 4LV4A 2ICSA 3A9IA 2A3EA 1CECA 2OFJA 5F7UA 2RH9A 3W75A 3WQCA 3AU6A 4ZBCA 3C52A 1AW1A 4F0KA 4WJ8A 1VD6A 1U1HA 4PSRA 2NV2A 4YMZA 4IP7A 3R6IA 4QE1A 3B4YA 5KSWA 1TFVA 3UJSA 3JRKA 3DXIA 1CZ1A 2FKPA 2JK2A 1XPYA 2V30A 1UPPA 2NVAA 3ITLA 2FZBA 4P61A 4D6DA 3KTXA 2VC7A 3RGTA 4POCA 1ZY9A 3THDA 3B03A 5HR6A 3ONCA 2D0GA 3SCQA 2DSWA 3DFTA 1A0CA 2ZRVA 4HHHA 3VUPA 1BYAA 2O9TA 3OA5A 4MY9A 3LHTA 1MEHA 5DO8A 3KS6A 1ZZMA 4KRZA 4EK7A 3C2VA 3R0UA 2A3LA 3L4VA 3WLNA 3B8TA 4KWWA 3RAOA 3W83A 3E0LA 3EYPA 1OWQA 3ZO9A 1U2YA 1KV5A 3VD9A 4FLQA 2V5CA 4PSPA 4B5XA 3AHVA 3G1AA 1XSJA 1W9XA 3BAIA 4KGJA 1W9VA 5A2CA 3UERA 4UTTA 4EXQA 4OV9A 4Z0JA 4GKTA 4C6DA 2DP3A 3VK5A 3LG3A 4ZO6A 2P53A 4LB4A 2E5DA 4LTSA 4IP4A 2PDPA 1X8CA 1WYIA 4HB7A 2NQ5A 1KFLA 4V27A 4XIAA 4QXIA 3NQMA 5B7ZA 3E5PA 4WXZA 4XZHA 5DLCA 5FF3A 4NAEB 3W1LA 3W2NA 3H7UA 3P74A 4KW2A 2YYTA 3E0IA 1W3HA 1REQB 3NOEA 3PFRA 2VEKA 1VJSA 3DHFA 5FI8A 5CGQA 1DV7A 2DFAA 4PA8A 1FWEC 1CBGA 1EHNA 5HPOA 3B04A 3T2OA 5FAJA 3LXAA 3BGJA 4AVOA 4LVDA 3TV8A 2ZKMX 3BMVA 4C6EA 1Q6DA 3N6HA 4CNOA 3VYLA 3I3DA 1HQTA 2WZHA 4I7VA 4D2JA 3FOKA 4IISA 2B31A 5TNVA 1SFJA 3AIVA 3WF2A 4JFWA 1GJPA 3HBLA 1QFEA 2Y88A 1H7RA 3UR7A 3HQPA 1TWZA 1RP9A 3GAKA 3UWUA 3VIGA 4A8LA 1YHTA 2RAGA 4D6IA 3TMQA 3L0GA 5LIXX 9XIAA 1XICA 1YDOA 2F2KA 4FX8A 5FAGA 2INEA 2QCDB 4E2BA 1QATA 2WK2A 3LXBA 5JBFA 5C54A 1S5NA 4WGXA 4U3AA 1Z69A 1FWIC 2DZXA 1XBYA 1WAWA 1J9YA 1LRTA 4R33A 1I6NA 4TQTA 2VVSA 3MKVA 5DMLA 3PWGA 4FMVA 2IKGA 4GLEA 5FEWA 1C9DA 4CD4A 2NWRA 1E4MM 1M65A 2FDSA 2Q02A 2CXEA 4V1XA 5CPNA 1MVYA 4FNPA 3BOLA 2D24A 2HNEA 1FWWA 7PTDA 2PDUA 5K2ZA 3PBYA 3PR2A 1QJWA 3AS2A 2B7OA 1BYCA 3LI0A 1BAGA 4EF8A 5HJLA 3MUY1 1H7NA 3KVJA 1RCQA 1N82A 3M0YA 1R86A 4NILA 2DIKA 3E3HA 2QQ6A 3R11A 1XH1A 5FD0A 3OTRA 3C0JA 2QJHA 3LHZA 3DENA 3BAXA 1KGWA 3G1SA 2VRJA 4HPJA 1L6WA 1W1TA 2UY2A 3L2LA 3TUUA 1QPOA 3PPCA 3ARVA 4NX5A 2YOCA 2UV8G 4JFSA 2PC4A 3H2FA 3V0UA 1NOWA 2WM0A 2IW0A 2DZAA 3NGFA 1XM3A 3CAKA 2Q8XA 3M0LA 4S2CA 1QWKA 3T0AA 4KEMA 4S3BA 1SSDA 1B30A 3N29A 3BMXA 1HF6A 1IXNA 1W1A1 2WKGA 4PBGA 4GUGA 4DJEA 1U30A 2GDVA 2PDCA 3RN6A 1DTUA 1OABA 2VEGA 4RV8A 2D73A 3JUGA 1EJXC 3TEVA 2Z24A 1TPB1 1Y5VA 2VFGA 1GHSA 3QBUA 2E8ZA 1H1NA 5E0KA 1JG9A 4NI3A 2ZUUA 4HNLA 2IKJA 3UWZA 1S46A 2YYUA 4EXAA 4JYDA 5EMUA 4PTMA 2WWCA 4UXDA 4PTVA 3V35A 1XYCA 3RLHA 4K7YA 4REQB 2QVHA 1S1PA 4Q8PA 4R5EA 3QC0A 1V6UA 5AYYA 2NQLA 4ZOCA 4YNGA 3L9CA 4LVBA 4JIRA 1NDVA 5A8PA 1A3XA 3PHAA 2R82A 3K2GA 1EJSC 1GTHA 4BQ5A 1UQZA 1FHDA 4MWAE 4JY8A 2WHLA 1TPUA 2Z26A 3NPXA 4DNHA 3LXCA 1CT5A 2AMGA 5KMYA 4L6OA 1ZGDA 3O6AA 5KZEA 3VGEA 4JDYA 3KDOA 3PK7A 1E1CA 2E6YA 4A29A 3AXMA 4R88A 4LUSA 4H9MA 3FGCA 1CXKA 3VOFA 5JH1A 1RVKA 2ACQA 3THCA 2GJNA 4ENLA 3DC8A 1GVFA 1DJYA 1UC4A 1XH0A 1OZQA 4MF4A 3TN4A 3WLHA 1M7JA 3N73A 1JZ7A 3MUZ1 4WIWA 3R4IA 1XLBA 3CUXA 4L4LA 2TSYA 2E67A 3BL3A 1BF6A 2PDFA 2Y4SA 1DWHM 2C8NA 1VB9A 2CERA 3OP2A 1EEXA 3W1TA 2YB4A 3CEPA 3OEXA 5K9XA 3KL0A 5E5CA 2XM1A 4D71A 2QYGA 1ZP3A 1XDJA 5GPRA 1PJ9A 3CPRA 4WX2A 3C0LA 3GYEA 3AZTA 1NM9A 4CVUA 1XH2A 4QLKA 4JTRA 3QYSA 1BTCA 2VGGA 3CQ0A 2Z1VA 3VIHA 1CGWA 4ERAA 1DJHA 4X9YA 2FB3A 2XGZA 3VC5A 4FA3A 4CGTA 1MRQA 4L9ZA 1XRVA 4JIIX 2AGKA 3W1UA 1TVLA 3EWYA 3W24A 3I7SA 4Z2KA 5CG7A 1E9ZB 1A47A 1US3A 3CYJA 1KXTA 3WG6A 2J24A 4X61A 1E5NA 5I5RA 2FHBA 4HSOA 4IF2A 3HMCA 4O1DA 4IIEA 3CQKA 1C91A 3G0SA 3BV7A 5C9XA 5EY5A 2TAAA 3JZEA 1BSLA 5FSEC 1BRLB 3MP4A 2CLHA 5KITA 4XAPA 3S6DA 2X1UA 4L9XA 3WD2A 4TTUA 2I57A 1KR0A 1AJZA 2XN1A 2J25A 5CKSA 2WJZA 2CBUA 4E3TA 4IX2A 2EXOA 3UBPC 1S2AA 5BXSA 5K3VA 5M17A 1TTJA 1QVBA 3L12A 4CQBA 1QHOA 3AYVA 1YYAA 5HULA 4XD3A 1E4IA 2J4GA 2J6XA 1NWTA 3WKZA 3GVGA 3UPWA 4PFHA 1X97A 1Q4WA 1YEYA 1UUOA 3S2NA 2XVNA 1YKWA 3MKCA 5F1VA 3TC3A 3EWUA 2PC8A 1V6YA 3HF3A 1LF1A 3W82A 2G8ZA 2TYSA 4HZ7A 1Q8JA 3CYVA 3VOHA 2WANA 3A22A 1YDYA 2GVLA 1DJNA 2ZVRA 4UR9A 4LCSA 1E9LA 2J9XA 3NCOA 3MUIA 4TX8A 3U2OA 4CU6A 2C13A 4JZ5A 1FDJA 4NVTA 1QPKA 4M6UA 4M7SA 3EB2A 3S42A 1GCYA 4H4IA 1DE6A 2SFPA 3T8QA 3WLMA 4DM2A 5JMUA 2RDUA 2GUBA 2YCLA 4JTUA 4AHPA 5D38A 3ALFA 5J04A 1TG7A 4O28A 1OIFA 2AQOA 1HUVA 2G96A 2UZ9A 4MJ4A 4BWLA 5GNYA 1HIZA 4YN5A 1OEPA 4HNNA 4IXXA 1XKYA 3MVTA 5K9DA 3A24A 2J77A 3PC0A 1PZ3A 3DG3A 4M82A 1THFD 3IGHX 4QM1A 4Y9OA 4GJ1A 3S2LA 5A6SA 1B3OA 3IEBA 2ATMA 3UXDA 3LMZA 4ATWA 2AKZA 3CB8A 4AXNA 5CZ0A 3PSWA 2F7FA 3GR7A 5H91A 1MWOA 3UXLA 1ISZA 1I2RA 2BP1A 3UJFA 3TP4A 3DI0A 5L6UA 1Q3NA 3FA3A 1IXOA 5T91A 2VQTA 1OVDA 1DXIA 3K46A 2BHZA 1KGXA 3VX1A 5FF0A 1O5KA 2EAWA 4UR8A 4IFKB 1CGUA 1GVOA 4NZ4A 3PBWA 4RLIA 1Q6CA 1FY6A 2PTWA 1XYAA 3A5FA 3KBVA 3B05A 4G1KA 3VKKA 6ENLA 4JBRA 1A5NC 1ONXA 2D20A 3QY8A 4G56A 2VP8A 3NVTA 3UR5A 1D3HA 3DYOA 2GQAA 2V38A 4UOZA 3EKLA 4MY1A 3AYTA 2DJLA 1UKTA 3RO8A 3ABOA 1GONA 3IJ7A 5DCBA 4UTUA 2NSOA 4PFMA 1FHLA 2A6LA 1TJRA 1VQTA 1ISYA 4MNKA 4D1IA 1W3TA 3A9BA 3IUDA 1AMYA 1W6TA 2CC0A 1JPDX 2WMIA 3WNOA 4C7FA 3ATYA 2I56A 2KZHA 1QR7A 3IK4A 2YL9A 1OADA 3BURA 3PBGA 4GJIA 4I9AA 4DZHA 4P7LA 2C1HA 2PZ0A 5ENLA 2ZX8A 3TX9A 4MTVA 1RY8A 3LPPA 4PUMA 2CETA 4DWSC 3BOFA 3CZLA 2OQHA 2WMFA 3UNTA 2G4JA 3F4NA 3WQPA 4DRSA 4ROPA 4TXEA 2ZRZA 1HO1A 1DOSA 1BGAA 3GTXA 1EUAA 3FA5A 1UIPA 4NJGA 1ZTVA 1BLIA 2EO7A 2P88A 1S2VA 4ZQNA 3NL5A 4RK8A 2YCIX 4B3KA 3SJ3A 3UJRA 1V02A 4AD4A 3REQA 4HNUA 4CNNA 1XLCA 1JZ4A 1E73M 3PZOA 1EC7A 1DJWA 3EZ4A 2Z6JA 1T8QA 1K7FA 2XH4A 1YXDA 2OXNA 2QXWA 1QDSA 2JKPA 2PWHA 3BDKA 3C3NA 4AX7A 4JYEA 4JQ4A 4DYJA 5JIPA 5D09A 2P50A 1P6BA 1Y8BA 3PG9A 4GC3A 1GVRA 3RIKA 1IV8A 5ECVA 1OQFA 2XGBA 1K8CA 2QUVA 3K4DA 4UQBA 1QW7A 3GK0A 4XBJA 2G5WA 1RV8A 4WRHA 3WH8A 2C1IA 3DECA 3W3OA 3L4UA 2HDJA 4GY1A 2Z4GA 2ACUA 4PUKA 3SURA 1PTDA 1RJRA 3KVKA 3OVGA 1TZZA 4CQ8A 3RJXA 2D2GA 3QPYA 4S3GA 2Y7EA 3FW6A 2IQ0A 4CQCA 4HYRA 3GH4A 3EEZA 2WNZA 1ML1A 4JIQA 2PDIA 1H61A 4RUBA 1UPMB 3L0NA 4DJDC 4OUEA 4CNUA 5A5WA 4GYFA 2EEXA 3L67A 4MHBA 3VGFA 3T78A 5AOUA 1E6NA 5C8BB 1ESWA 4YJ5A 1R7OA 4CEUC 5H8MA 3G1FA 3UA4A 1JI1A 1WZKA 1J2WA 3NA8A 3V36A 4QITA 4NU7A 1NDYA 3NWRA 1ZRQA 2NLIA 1NDZA 1Q6OA 3VPLA 5BOFA 4TVCA 3HGRA 4H7VA 4B5WA 1XW8A 1NOUA 5FF2A 5IRPA 3A4WA 3OJGA 1HFBA 2XHYA 3B0PA 2Y63A 4ADSA 4Q7NA 3DBNA 1TQXA 1BWLA 4J3SA 2Y1HA 4LS0A 4MWAB 4GG9A 3TNOA 5D33A 1HJVA 3P5YA 1LDCA 1MEIA 4HYWA 3ZVHB 1U1UA 3P8JA 2Y70A 4Q8NA 1W9DM 4HJFA 3WD4A 2BFGA 2VFHA 1RPXA 1F3XA 3RCMA 1FFQA 1SO3A 3PN8A 4NJKA 2A7PA 4ZE4A 1V08A 4DX3A 2A3AA 4PE8A 1ISWA 1LBMA 2GOUA 2XH0A 1IEWA 3G18A 2XH2A 3CHFA 3RYSA 2WBKA 3H4WA 2VDHA 2FB2A 2OZ8A 4LF1A 3SFWA 4AX6A 1E0VA 2CHRA 5CZJA 3NZ1A 4JD4A 3CHEA 4XTDA 2QCGA 4H1ZA 1HG3A 1C93A 2OOFA 4B5VA 3ITCA 2ZXQA 3H2NA 3QHNA 3HPAA 1UIOA 5CZTA 4AD5A 3CO4A 4UUIA 3LLXA 5I02A 4GYPC 4C1KA 3SBFA 2OX1A 5EYWA 2WVSA 3BVJA 4UTJA 4JX6A 3ZJ7A 4KWSA 3G1RA 4J3XA 2GVYA 1PE1A 3SCRA 4AY1A 4HNTA 2B7QA 2ZA2A 2BB0A 1TJ0A 1B4EA 1TV3A 4J2MA 1VS1A 2V5DA 1EJWC 4MFDA 2HV5A 4RW3A 1E3ZA 2G3IA 1JPHA 4XO6A 1OFQA 1FH9A 4UTWA 1ZS2A 2QF7A 3DERA 4ATDA 1Q65A 4ZOEA 1R9ZA 2BVTA 5AZ0A 1UR3M 2PAJA 2VDIA 4MB5A 5EMJA 3W00A 4FXFA 2XIIA 2OSYA 4G5DA 1VFOA 3ZJ8A 5AHMA 2QULA 3QPEA 3UFYA 1GKRA 1F6YA 1OFRA 4IQLA 1H41A 3NUKA 1T6MA 4D8AA 5DCEA 3QYQA 3A3WA 2ONEA 3TFCA 1HKIA 1NFGA 2X0YA 3UJEA 3CIWA 1CWYA 4E3VA 4OHQA 2OVLA 3AFBA 3G2GA 3QZ6A 4LCQA 4P2VA 3WH9A 3BCFA 3KM8A 5TAOA 2X30A 3G0XA 1PYMA 4IUGA 5JBEA 2BHUA 1GPFA 4UWMA 5E9XA 4LEFA 1EGVA 4S3FA 3VE9A 4O17A 3ANUA 1V77A 3SCTA 3VD5A 4A22A 1MW3A 2J6VA 2XINA 4AAJA 4FX6M 3TTOA 3FYOA 1H7XA 5TF0A 2CFFA 2NUYA 3M46A 5LXEA 2X40A 3FAWA 3MSRA 1VBUA 3ATZA 3C56A 4UB9A 1ZUAX 4LW7A 1LLWA 1ZU8A 4L80A 2E9BA 3KZPA 2QEZA 1OFOA 5A8QA 4OQVA 2WHKA 1ZBVA 1Q6FA 2H3DA 1PHQA 3EDJA 2ZUWA 3DG6A 1I1WA 5D9MA 5BU6A 4Q8VA 3XIMA 4GI8A 2NX1A 1YBQA 3C2FA 1J6OA 5I3JA 4UTIA 5LZLA 1KGUA 2ZX7A 2YA2A 2G50A 3LV5A 3WQWA 4JXCA 4Q4KA 1K8ZA 1KBJA 3RK8A 3GDKA 2WMHA 2CLPA 1E72M 4JGDA 3R13A 3HOJA 2GQ8A 1XLMA 2PDJA 4Z1AA 1W1IE 2WHMA 2XSXA 1W1ZA 3W7JA 4AD3A 3B0YA 4B2DD 4I6KA 4UTHA 3CZKA 1TUFA 3GTIA 5AKQA 3AMCA 3K1GA 4IMFA 5M1TA 1S2TA 2DW6A 4L9YA 2XVLA 1Q6LA 3H2OA 2RUSA 1VHNA 1TPDA 2VI0A 1MZHA 1W5NA 2J75A 4XD6A 3VKCA 3S5OA 4FAMA 4NZFA 2PWEA 4J1OA 2XWEA 1V0KA 5AY7A 1OX6A 1PTGA 1CXHA 3PULA 1K7EA 2CHOA 3EX6A 4NRSA 5BRPA 2WW5A 3R0DA 1XKJA 3GKFA 2BOEX 1ZFJA 1RHCA 4ZO7A 4IPJA 1IXPA 2ZZ5A 3S5YA 3W2JA 2DVTA 3GVQA 3ABQA 1PKMA 1E1CB 5M3WA 4FI4A 4A8IA 1E0WA 1JVNA 1LWHA 4LUSB 1XLJA 4V2XA 3FGCB 2CXGA 3S1XA 3P14A 2QDEA 1AH4A 1GKPA 2GLKA 1UQYA 2Q09A 4Q4QA 3RO6A 4R7WA 4E0CA 1XGZA 1KM0A 2GSEA 4N4PA 1E70M 3KCJA 4MSSA 1XIGA 2XJ7A 4ML4A 2CIPA 1PCWA 1VPYA 3F5KA 4L7ZA 2PLCA 3EA3A 4LYRA 1VRXA 4GUJA 2NV9A 2EG8A 2VR4A 8RUCA 4IH3A 3NEHA 1PUDA 2B7NA 3HV9A 1IEXA 1KB3A 3EA1A 2JF7A 1BVWA 2FZNA 4CN4A 2F9RA 4PB5A 4K36A 3O0KA 3OGVA 4DJFD 3VI2A 3S9YA 1AUSL 3A12A 3N12A 1XWYA 2EHHA 3DOPA 1LL6A 3B06A 3BUVA 1F5ZA 4B5TA 5CSUA 3APYA 4F3HA 2XTKA 4P7OA 2CBJA 3ISIX 4Y9NA 3B8VA 4OV4A 3KBNA 1LL7A 2BVYA 1XGEA 1XIEA 4LNYA 1MNZA 3TOPA 3UXAA 4XISA 4E2DA 4W8AA 3TN5A 1XDMA 1IEQA 2P76A 1UUQA 3FJ4A 5AYXA 4HCHA 4W8LA 3W84A 5KZMA 1LL4A 1PXGA 2EG7A 2DZVA 3LGDA 1HW6A 3TN3A 1ZBWA 5AC4A 2XIBA 3GDBA 1Q7ZA 2CKRA 1I0DA 4JDBA 1XFBA 2VZOA 4F0SA 5ABEA 1CI1A 1V3MA 3OZOA 1TPEA 3NTYA 4HNVA 1O1ZA 1TPVA 1ZCCA 4KS0A 3N13A 3NQ8A 4WZHA 4TIMA 4AIUA 1TCDA 4IIHA 3O05A 3NL3A 4YS1A 4BHYA 4UQEA 4GVFA 4RJEA 2X2YA 3LCLA 2PDLA 2PDMA 1S39A 4XSMA 5AB3A 3DC0A 2I16A 3MQTA 4MNJA 5JIWA 2ZZ1A 4MZ1A 5DXXA 1MW1A 4QJ5B 3MO7A 4PBFA 1IZJA 1NJJA 5LKYA 5FJRA 4NZCA 4IT1A 2B4GA 2FFIA 4ZVJA 3WF3A 1G4SA 3W6YA 3VINA 3NZPA 1PAMA 4N42A 4LJ3A 4H9XA 4WK9A 3R8GA 3Q58A 1MFUA 1SSGA 1TO3A 1RR2A 3EOLA 1IWPA 2W67A 1UWQA 4Z2IA 1MFVA 3P6LA 2DU2A 2D3NA 2C6QA 2YPIA 3ZR5A 5FSDC 2V5BA 3W37A 3QKEA 5F2MA 4W84A 2ODOA 3KRSA 5A2AA 1KM2A 4OJYA 4Y8FA 2X7WA 3MB9A 5EFDA 2R8WA 2UY5A 4LSBA 2WSQA 4OGZA 1PIGA 2VDGA 3FN9A 2PB1A 2XU2A 4RNHA 5KTLA 2DDXA 1W2VA 3BTNA 4DI8A 4F4RA 4BKNA 4JNZA 1O95A 4CD8A 2PZNA 4N9EA 1J4EA 3OU8A 3EPMA 4KWOA 4PZVA 2QGHA 4B4FA 3NQEA 1AMKA 3RXZA 3VNJA 3VFLA 2UBPC 3LTPA 4LS2A 1WV2A 3LX9A 3IJ9A 4EAYA 1GQLA 1RALA 2YCLB 4E8CA 4CEXC 1OF6A 2V3EA 1DJZA 3FVMA 1UWTA 3CZEA 5AYBA 4H04A 3T2PA 1XI3A 2R1NA 4D8ZA 2BX7A 3TFXA 3UZJA 4AZ5A 1JZ5A 2V63A 1V0LA 1JUKA 2QJIA 1P0NA 4YLWA 4KEZA 4GVIA 3P61A 1X1OA 2V82A 3A21A 4FPSA 3QFEA 4E6MA 1BFNA 4Z1DA 7TAAA 3QF0A 4JPGA 3TROA 3SRDA 3BG9A 1FWJC 1BVZA 1SO5A 3HFTA 3IK2A 1HJXA 1B90A 2ZXAA 4TTGA 3P8IA 1V6XA 1MXGA 4PRTA 1OG0A 1WP6A 1W3JA 2PGFA 4DVOA 3PPHA 1NELA 3EDKA 3EWCA 2DW7A 1SM9A 5FIPA 4RR4A 5AECA 4Q8UA 2E9MA 1Z8AA 2OGJA 2DY3A 3NO1A 3AMKA 3AS0A 1FCBA 3B8IA 3T0CA 4JTCA 1TV2A 1I45A 2ZC1A 2CLIA 3N9SA 4ZFMA 3TW6A 4H01A 3AZSA 3GU9A 2JFEX 3FKRA 2BBFA 4FNQA 2ZUNA 1GZ1A 3JR2A 1AD1A 2QDDA 2Z25A 3HQ1A 1EA9C 5JUVA 3G1DA 4N4QA 4FS9A 4RV3A 3U6WA 3FXYA 4GNJA 1H2JA 4MJZA 4E8GA 4GQRA 1KFJA 3KOFA 3QJAA 3LCFA 2PTXA 3BV4A 1J6PA 5A69A 3DKJA 2OU4A 5AC8A 4MWAC 3T4WA 3H2AA 4PCNA 3RPTA 2FJUB 3W88A 2WMIB 1GTEA 4GUHA 3PWAA 1FWSA 1ZHAA 1R87A 1T40A 4I90A 1KKRA 3TYCA 1A5CA 1UASA 5EMMA 5D2TA 1FCQA 4HHMA 1OC7A 3ARYA 3LB0A 3W27A 3OLGA 3RCNA 1JD9A 4NYYA 4YTSA 2VXNA 1J10A 4S3KA 5F4SA 1VZWA 2GUUA 1G5AA 4K68A 2DZPA 2GPTA 5ABGA 5A8OA 1UD8A 2OR2A 5A6AA 1LBFA 3PG8A 4ICNA 4RDWA 2IKHA 3UZWA 3V4BA 4TX6A 3CPGA 2PWFA 3E96A 3QC3A 2Y8VA 3VFCA 3REQB 4DUOA 4C6FA 4IICA 4A2SA 4HPNA 3QMSA 1JGMA 2X2GA 3BJTA 1DQXA 4XAZA 2YCJA 4JTLA 4C91A 3PTQA 3PUDA 3QQ1A 3UGVA 4R7OA 1DKWA 1ZJAA 2CZVA 1QI5A 3CT7A 2E7FA 4IMCA 1A49A 1VCVA 3RHGA 1O4UA 4PRWA 2BDQA 4K1WA 4EKJA 3M6YA 3VX0A 1KBLA 4D6FA 1M01A 4FXJA 1V8EA 2RKXA 2W61A 1AJ2A 4GZEA 3R7MA 1WZMA 1GQKA 2W62A 1N8IA 4PUUA 4K38A 5HR7A 4ALDA 2XSAA 1PDYA 3R1ZA 3LHVA 2WMGA 2QF8A 1EP3A 4IZGA 3DGRA 5HMEA 2WKJA 3KVLA 3V5CA 3PNUA 1JFXA 4IGHA 2EPNA 1WZLA 1UR9A 5FF4A 1R3QA 3UVIA 2VX4A 3HO8A 1KM3A 2ZUTA 2YL5A 1EL3A 4QJ3B 4O0KA 1HX0A 5BYWA 3PZ9A 6A3HA 4C5YA 4AZCA 1FH8A 4LBUA 3L23A 1W32A 5EMKA 4O53A 2O7QA 4FHAA 4DBEA 4LGXA 2ZRWA 1TWDA 4W89A 5EFFA 2QS8A 3S46A 2WZIA 4OECA 2TPSA 4K6AA 4KWUA 7REQA 4PCSA 3RLVA 5FEPA 1LT7A 4LUTA 1HZYA 4XK2A 5CPLA 1BYBA 4M19A 3J7HA 4C6IA 5E9AA 1YX1A 7XIMA 1LRQA 2RJGA 1WX0A 1DP0A 3C2OA 4Q8TA 2HS6A 1K9EA 1XIHA 5TBOA 4E8DA 5GJNA 3KZSA 4P8WA 3A4XA 2QCEA 3UZZA 2WNWA 1JULA 4O1AA 2JF6A 3G1XA 2V3GA 3IVTA 1VBRA 4KH2A 4EWJA 3CUJA 5JBDA 2P1FA 3D5HA 4JKKA 1XIMA 3EOUA 2HE8A 5EGRA 4P8XA 1V3JA 4JTHA 1VFFA 4M1RA 5AC6A 3E0FA 3KBSA 4I7UA 5H6HA 2V2CA 2I5QA 1TZ7A 4DUXA 5I00A 1YRRA 3WQOA 2YZ5A 3UJ2A 3SN4A 7ENLA 3MHUA 1W5QA 2WCGA 4BF9A 1KC7A 3H23A 3WLLA 1M68A 3PUOA 1PL9A 2H90A 3AQUA 3F03K 3LQGA 2ZDSA 3LCGA 1Y0EA 3LGGA 2X1RA 1TV7A 3TJ4A 1OM0A 3RR1A 2QCMA 3COTA 4L1XA 1PX4A 1X6NA 4X0NA 1NP0A 3AICA 5G1TA 1J01A 1F3WA 3H26A 3B9DA 1B1YA 3M4HA 3D3AA 1EXPA 1TE1A 3CV2A 5HMFA 4HA1A 4EPBC 3MMWA 1QOXA 3WDQA 1VFHA 5DY3A 2D0HA 1EJUC 1UYQA 1A5SA 3O8AA 4PMYA 3SO7A 3WF0A 3I3EA 3WZ0E 4QNEA 1UD2A 2X09A 4IQDA 4KF1A 1OYAA 3TSMA 3W7OA 1M1BA 2D23A 4QDWA 1S5WA 2VGBA 4IL2A 3QMTA 1EA0A 1RUSA 4PMVA 3WDIA 1WDWA 1XIBA 3AJXA 2X0HA 3FDKA 5LA0A 1XP3A 3THAA 2OWWA 3M0MA 3MMDA 3LA4A 4G7EA 3TLLA 1YPFA 1KV8A 4BS0A 5K7JA 1DJQA 5CJMA 1B3XA 3BLOA 4IOTA 3B9AA 4R27A 5I23A 2ZRUA 2HBXA 3QRHA 1HXJA 4Q4RA 1RQEA 2OTDA 4XZMX 4JFVA 1RXOB 4WY0B 1KM5A 3EMQA 3BLDA 1AD4A 1XLIA 3MPGA 4LBSA 4DO5A 1C7TA 3TZFA 1CEOA 3S4TA 2QJJA 5E93A 2QMJA 5B7YA 3RPDA 4LV9A 1TCMA 4G6CA 3VZYA 5C7VA 2BXYA 3PANA 1GORA 3UR2A 1Y65A 1EGMA 2EBNA 3DFNA 2O55A 4BF7A 3E38A 3PP7A 1YBQB 1OYBA 1NFBA 4Q8QA 1SQ7A 2YZRA 2Y5SA 1US2A 4M51A 3LCXA 3HGJA 2QCLA 1N8FA 1OF8A 1EHAA 4FNRA 2YLAA 3W81A 3VOGA 3DBPA 4TU1A 3W28A 4WKHA 2PLKA 1EB3A 4W87A 4J5NA 2QW5A 3EPOA 1EEPA 2EPMX 3HG2A 3TQKA 3WLIA 3UD6A 3WBWA 3WFAA 3VIPA 2OLHA 4LEQA 2YR1A 4MUPA 4BQ4A 1JYVA 1KTCA 4DBDA 3UZ5A 4UQ9A 1TQJA 3GTFA 1W3IA 3CU2A 4KIRA 4ZOAA 2OJPA 4IFOA 5I24A 4L6HA 4B2DA 3ARRA 3KS5A 2VKZG 2PDYA 1CLVA 1E0UA 1RP8A 2B81A 5I3FA 1B0IA 3TWAA 1I75A 4NUWA 4F8XA 2I5IA 4DO4A 3VIFA 3AXIA 3B3DA 1ADDA 3O63A 1KWGA 3II1A 4DY1A 3P60A 3F2BA 2GL5A 2V2HA 3ZQ9A 1E55A 3HZ3A 3WO8A 3CT2A 2VCAA 3AXXA 3QHMA 4TMBA 1JYWA 3TYUA 2BHYA 4JYFA 2V5KA 1TPWA 5GNZA 3WELA 5A6MA 2YBTA 5K9CA 4QG6A 1DORA 3BGAA 4IG2A 3SDOA 4LBRA 3ES7A 4AC1X 4PTNA 5CPQA 4JN6A 4UCFA 1H60A 4GRSA 4JHZA 4MAVA 5CSYA 2QPSA 3SIZA 4E2VA 3QR1A 1FDYA 1OIMA 4DB7A 4GYKA 2ZXBA 5ABFA 4AHQA 1UJQA 1AW5A 5I3IA 1P43A 3KAOA 1KFBA 1WKFA 3POCA 3OHIA 2RDWA 3PBMA 2VCBA 1F9CA 3OLDA 3PY2A 1ZL1A 1PEZA 4TR9A 1HVXA 4K37A