5HNTA

Crystal structure of akr1c3 complexed with cape
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
315
structure length
315
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal Structure of AKR1C3 complexed with octyl gallate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 117
structure length 315
sequence length 315
chains with identical sequence C
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5hntA00
4G5DA 2IPGA 1PWMA 2PFHA 4QX4A 3KRBA 2HE5A 3UWEA 2PDIA 1X96A 1VP5A 3WG6A 1AH4A 3FJNA 1MRQA 4WRHA 4EXBA 4DBUA 4WGHA 3LQGA 1T41A 3UGRA 4QBXA 3H7RA 2PDQA 2AGTA 5AZ1A 4I5XA 3N6QA 3T42A 2INZA 4YVXA 1YE6A 4PRRA 2I17A 1AH0A 2IPWA 4HMNA 2R9RA 1UR3M 3ERPA 2WZMA 1Q13A 2A79A 4DBSA 1FRBA 3NTYA 2P5NA 3MC5A 2QXWA 1VBJA 4NKCA 4JTQA 2F38A 4GCAA 2PDBA 3UZWA 3H4GA 2I16A 3Q67A 4PUUA 4QXIA 2PDXA 2IPJA 4RPQA 1XF0A 1A80A 4WDTA 3V36A 4JQ4A 2NVDA 3P2VA 3WBWA 3EAUA 1PZ0A 2ISFA 3UG8A 3LQLA 2IQDA 1YE4A 4YS1A 2PDKA 4LBRA 4WDXA 3RX2A 4XVEA 3GHTA 4JIHA 3WBXA 3CV6A 2FZ9A 2HV5A 5LIYX 5LIUX 3GUGA 1OG6A 4L1XA 1C9WA 1Z3NA 3VXGA 3R6IA 3WBYA 3EB3A 1LQAA 3U2CA 4Q3MA 4FA3A 4JQ1A 2BGQA 3CAVA 4LB4A 1Z89A 1PWLA 2FVLA 4MHBA 2IKHA 1IHIA 1PYFA 2PDWA 3LBOA 3ONCA 3FX4A 4PR4A 2CLPA 2IKGA 4XO7A 2PD5A 1X97A 3LENA 3O3RA 1M9HA 3S3GA 3D3FA 2HDJA 1EL3A 1S2CA 4JQ3A 2PDUA 3LEPA 3LD5A 1HW6A 2PDJA 4IJCA 4JTAA 3R7MA 1PZ1A 4FAMA 3M64A 3R8HA 3BCJA 3LZ5A 3CASA 4FALA 3UZZA 5LIWX 4HBKA 4OTKA 4LAZA 1S1PA 4LB3A 2DV0A 3RX4A 3V0UA 3M4HA 1LWIA 3Q65A 4XVDA 1ZGDA 3B3DA 3BURA 1JEZA 1MI3A 1YNPA 4FZIA 1Z9AA 5LIXX 2PDGA 3MB9A 3V0TA 4GIEA 5HA7A 5HNTA 4L1WA 1XJBA 2PDPA 2IKIA 1QRQA 1AZ1A 2PDFA 4IJRA 2IKJA 1AFSA 3UZYA 4PRTA 3QKZA 2PDYA 1Z8AA 2R24A 4XZMX 1GVEA 2VDGA 5LIKX 3BUVA 2ACRA 3EB4A 3CAQA 2NVCA 5HNUA 1EF3A 1S1RA 3GHUA 2HE8A 2PDNA 1T40A 2F2KA 4Q7BA 1J96A 3GHSA 1X98A 3RX3A 4XZLX 3DOPA 3LN3A 3ONBA 3R58A 2WZTA 5JH1A 5KETA 4GABA 1K8CA 2PZNA 3UYIA 2INEA 4DZ5A 1Q5MA 3COTA 2PDCA 2IPFA 4XAPA 4JTRA 2PEVA 4JIRA 2IS7A 2HVOA 3WCZA 1XGDA 3V0SA 1HQTA 2FZ8A 2PDLA 1RY0A 4QR6A 3V35A 1RALA 3LZ3A 3UZXA 4XZIA 2PDHA 4JTDA 1YNQA 4WDUA 3R8GA 4JQ2A 3UFYA 3R94A 1AZ2A 4XK2A 2BGSA 2ACQA 4GA8A 4H8NA 4GQGA 1R38A 2BP1A 1ZSXA 1EKOA 3GHRA 2IQ0A 1SM9A 3DN5A 4YU1A 4EXAA 4YVVA 2FZDA 4WDWA 4XZNX 3R43A 1ADSA 3O0KA 2DUZA 5C7HA 1ZQ5A 4XZHA 4IGSA 4PMJA 3H7UA 3CV7A 1MZRA 5DANA 1EXBA 3G1RA 4GQ0A 5AZ0A 3C3UA 3M0IA 4JTCA 2ACSA 4DBWA 3LUTA 3CMFA 3G5EA 4JQAA 4LAUA 1ZUAX 2DUXA 2HEJA 3N2TA 4F40A 4H7CA 4AUBA 2ALRA 2PF8A 2J8TA 3F7JA 4JIIX 1S2AA 1RY8A 4XO6A 4R9OA 4GACA 5M2FX 2C91A 3UP8A 1US0A 2ACUA 5JH2A 4ICCX 1QWKA 2FZBA 3BV7A 1IEIA 4PUWA 4YVPA 4LBSA 3LNMA 4ASTA 2PD9A 4ZFCA 4WEVX 1AH3A 2HVNA 2FGBA 2PDMA
chains in the Genus database with same CATH superfamily
1L2UA 1OFAA 3S47A 1Q2RA 1KLZA 1I9CB 2ZA3A 4LT9A 1JXKA 3TSDA 2HE5A 4H8VA 3IRSA 3SDOA 4RKAA 3KBNA 3NXLA 3TZFA 4C6NA 1G7VA 3GR8A 1IV8A 5AZ1A 1AK5A 4LTSA 4DB7A 4PA8A 4YVXA 5A3HA 4D6EA 1MXDA 1TYGA 2I1OA 1RPXA 1E73M 3OLIA 1LRTA 4MSSA 1T7LA 5LHFA 2X05A 1HNYA 2VVNA 3TK7A 5G5IA 1XLMA 1TIWA 3DAQA 2XDFA 1B3OA 4JX5A 2VEIA 1GNXA 3T9PA 4C65A 4NZJA 2IPJA 1YW1A 1EGVA 4ES4A 4FLOA 5FOOA 4MKSA 4MPQA 3W7JA 4CGTA 3RPDA 2A5HA 1TQXA 2E28A 3DFHA 3BGGA 4DELA 4C6DA 1BG9A 1CLVA 1PUDA 4A8RA 2AMGA 1R3WA 4XBJA 3IIVA 2EPLX 3NQCA 3J7HA 3FFSA 4JY8A 4LY4A 3VE7A 5M5DA 4XAZA 2FZ9A 3P93A 4EIVA 2VQTA 3BARA 3HM7A 4R9XA 4PSPA 1XQLA 3W86A 1Z3NA 4MDOA 4HA0A 3QXBA 1GW1A 5GNXA 2O4QA 5I23A 2TPSA 3CZLA 3NSNA 4L4MA 5ABGA 1XP3A 2EGZA 1KTCA 2DVTA 3VCNA 3O3RA 5CPMA 4LH8A 4RDZA 2V82A 3F03K 4LUSB 4IJCA 1ALDA 3ELFA 4CUCA 5DN1A 2V0TA 2PWDA 1GQIA 2XWEA 3IGHX 2Z1BA 3SIMA 2FJKA 5LIWX 1KRMA 4P5UA 4OTKA 1YX1A 2XPKA 3L68A 3THQA 3L2IA 1XDJA 2VZSA 3LA4A 3W00A 2W92A 4LSBA 3ES8A 4IGNA 1M7JA 4WVXA 1M5WA 3OVRA 3H2CA 1KBBA 1B3WA 2OGJA 1UWRA 1EJVC 2E09A 1ISZA 4LQ1A 2DSUA 4O17A 1OX5A 2A3EA 3W7NA 2KX9A 1V3MA 2Z0IA 4Y9PA 3JR2A 2EXOA 1UWQA 4BI5A 1BTCA 3NVTA 4NIRA 1EP1A 2WWDA 4DBEA 3RYSA 1WKYA 2F8QA 1WCGA 1IIGA 1XUUA 3R10A 2DIKA 2CPUA 1V6VA 3GVQA 3ZVIA 3WF2A 3E0FA 4HU4A 1GVEA 3DKLA 4FNPA 3L5AA 4EPDC 2FMNA 2GGGA 3LI1A 4HK5A 1DIOA 3LCIA 2Y8UA 4DNMA 1US3A 3PUEA 2O92A 4REQA 2Z4GA 3TV8A 2J25A 3TSBA 2ZCGA 1OT2A 3M07A 4EK7A 1UR9A 2VRQA 3M0LA 4KF1A 4H8HA 4S38A 4XAGA 1TZ9A 1W6TA 1S46A 4GGBA 4DEFA 3COTA 2VX4A 3VINA 3SR7A 1KLYA 1C8YA 2VGIA 5FEZA 1W9DM 3DHUA 1XG4A 3WLPA 4XBSA 3BMXA 1P0DA 4DZIA 5TIMA 2OZ8A 1IXQA 3NOYA 1F76A 1OFRA 2OQLA 4HNTA 3SB0A 2W62A 3MP3A 3B9NA 1WDDA 2VENA 4HZ8A 2GVJA 4JX6A 4JS3A 4ORMA 3R8GA 2PWGA 4DJFC 4TR9A 2YL6A 1B90A 4KFPA 1JULA 1TV8A 2VEFA 3S9IA 1UUQA 1NP2A 3UZJA 4AY7A 4NZ1A 1MEHA 3AS1A 5E09A 5DCDA 1F3EA 2QVNA 3H2AA 3MYOA 2WCAA 5A8MA 4DN1A 3EPOA 9XIMA 1TQJA 1TA3B 2VFDA 1OX6A 4S23A 4L6DA 2ON3A 3RLVA 3TTYA 3W71A 1EDGA 4XZNX 1S3TC 5AYZA 4AEOA 1S5TA 2E68A 1T8QA 3SQSA 1GJWA 4XG1A 3H2MA 2PC4A 1W9BM 4MZ1A 2G41A 2R1MA 2VXNA 3M7SA 4HU3A 4UZUA 5CGMA 2ZVRA 1AL8A 3A4XA 4V2XA 2JIWA 1ZY9A 3BAKA 3LU2A 1HL2A 1A3WA 1C8XA 3V1PA 2DUXA 4RPPA 3IWPA 3EWDA 1FH8A 3MMWA 4YTSA 4N42A 3ITVA 1S2AA 5AYYA 3EKLA 1FBAA 4ZENA 1MWOA 4D6IA 1NH6A 4Q8OA 3KTSA 3WLOA 3L0KA 1BFNA 3TNBA 1QUMA 2QR6A 1G6CA 3EWUA 3N4AA 3VOGA 2XN1A 2FJUB 1JFXA 4DJEA 3MS8A 1OCNA 2BHUA 3A22A 8CGTA 5LA0A 3HGRA 4LNCA 2OCZA 2E9BA 1Z48A 4IIFA 3A12A 4HHMA 1J0KA 2GJNA 3T4WA 4NZ3A 4ZFCA 3PJTA 2I9EA 1EJTC 4B9YA 4MVAA 1W5NA 2HVNA 4AAJA 4G5DA 3R0DA 3JS3A 5CPOA 3W37A 1UQYA 3FKKA 3R0UA 4HZMA 4QG6A 3T55A 3KVMA 3TU9A 3LQGA 4W7VA 4J2MA 4CCZA 3N17A 2QCDA 1JQXA 3FIGA 4XIMA 4EF9A 1JCMP 1XPGA 1HGWA 5F1UA 3IUDA 4QIUA 4W87A 1HGYA 4ICMA 3CT2A 4Q4MA 5J5RA 2GUBA 1XBYA 4AY8A 3BWWA 1DPMA 1YXDA 4KESA 1UR3M 3AIUA 1UD5A 3W28A 2GPTA 4N02A 3MC5A 2OJPA 3H4GA 3E0WA 1US2A 3TQ0A 1AMKA 4FNSA 3G1XA 1K9EA 4Y9NA 4P7NA 3RF9A 4AB4A 1DHKA 4ONVA 3GYEA 1E6SM 1XQKA 3UG8A 1KXTA 2YDSA 2NUYA 1EDTA 4JL2A 3SW6A 3V3WA 1UR2A 2GSEA 3TC6A 1SR9A 4GKTA 1T96A 2E6DA 4HNVA 3NXFA 1UR8A 3ZYZA 3QOKA 1QNVA 5JBEA 1NOFA 1PX8A 2LLEA 1E40A 1JI1A 1OG6A 2VX7A 3RRAA 3THDA 3MMUA 4GIRA 4AF0B 1FCUA 1ZBKA 3WBYA 1G67A 2DZPA 2VCAA 1OD8A 2NQHA 4WIWA 5EMLA 2ISSA 2BGQA 3ARPA 4WY0B 2RDXA 4O50A 4O19A 3EXSA 1LUCB 1VPXA 4MHBA 1AJ2A 1KFBA 1OJXA 1XUZA 2IKHA 4I9MA 3TN6A 5I78A 1X97A 5I03A 1GKQA 5D4YA 1NWTA 1BVZA 3QR0A 2YR1A 3UXAA 1TRDA 3R8HA 1SUXA 2QAPA 3EWWA 3VM5A 2XGIA 2YA2A 5D04C 5HINA 3OLEA 4WY0F 1S1PA 1OD0A 3IJ7A 1CXKA 3APYA 1P0BA 3DGBA 3NQMA 2QCMA 2BX7A 4IXHA 2GUUA 3RG6A 5BXTA 5LIXX 4PTDA 3OIHA 4ZQRA 4E2VA 1KCZA 2AAAA 2FKPA 3VK5A 4PMXA 4NNCA 3LTPA 1BXBA 2OZ0A 5H6HA 3H24A 7CGTA 7PTDA 3B05A 3WY1A 3GXIA 3C8NA 1UP0A 2CLFA 2QUTA 1BPLB 4OKDA 3K4WA 3EX1A 2Y85A 4GFSA 4FXJA 4I8DA 1BF6A 3WNPA 1ZJBA 4X2RA 1EBGA 2EO7A 2VL4A 1Y0EA 1EF3A 5FJTA 3DENA 1PHQA 2WM0A 3ZO9A 1TPVA 3OHMB 3B0UX 4R5EA 3GX9A 5AY7A 4DWSD 4FR1A 4WXZA 3NQAA 3L2MA 4I9JA 5A5WA 5H8PA 2VP8A 2YDAA 4GXPA 1WDSA 4Q32A 1E70M 3W74A 5EGRA 5BROA 2J7DA 3AJ7A 4Q8VA 2IPFA 1YDYA 4TTGA 2V30A 2PCEA 4C6MA 1HXJA 3CZ8A 2BV9A 3WCZA 3W75A 3DUGA 1JG9A 3EPNA 4A6GA 2Y8VA 2WCSA 1TO3A 4MADA 2H8ZA 1ME9A 2GVLA 1Z41A 3R12A 1EGZA 2J6XA 4OECA 2DEPA 1VFHA 3ABXA 4IISA 4MZ8A 1H49A 3PBUA 3PTQA 3EX2A 3H7VA 3KDOA 5HK4A 4Q8UA 1JD7A 1F5ZA 3UJFA 4DJEC 2W6RA 4J3UA 1GOIA 3MSYA 3R94A 5F7UA 3W7RA 4K3ZA 1SU5A 3GY1A 4B4HA 2EPKX 5FSEC 4YWIA 4Y8EA 2CZ5A 4DBDA 4AG0A 2P53A 2WVTA 1TB3A 3BV4A 4V33A 2EAWA 2V38A 1A49A 4L1GA 4ECLA 4IHCA 1CYGA 4B91A 3K1DA 1BRLB 1ZHAA 4N9CA 3QN3A 4PULA 2UY2A 3MT1A 5A6MA 2CLKA 3KVLA 2Q71A 3W3OA 4PC8A 2FZDA 4WDWA 1V3IA 1MW2A 3QY6A 3L0GA 5DEZA 4WX2A 1A0EA 3RHGA 2D0GA 3W0KA 3MI3A 3SADA 1XH1A 3CHCA 4GE8A 4KW2A 3SRHA 1NFGA 4QQ3A 2NV1A 2C3ZA 1XFBA 5HQLA 3S2MA 3PY2A 1AW1A 2J4GA 3VPLA 4KBXA 1KWKA 1Q6GA 4DBWA 4PODA 3R79A 5BCAA 1EZ2A 3VFCA 5HJYA 1E4IA 1N8FA 3WELA 1T99A 1XCFA 4UOQA 1JIBA 3GW0A 2PF8A 4HCHA 1NQ6A 4HHHA 1XBXA 1JZ8A 2QKFA 1U2YA 3MI6A 4WOZA 1MNZA 3DG7A 1RY8A 3CIXA 1JPHA 3UERA 4XO6A 2HMCA 2XSBA 3K8LA 2EG6A 3S5NA 1V3LA 2WLYA 4OFCA 3UP8A 3WF4A 1HP4A 3RMJA 3C0LA 2VFFA 4BS0A 4H9MA 5MF5A 3L4TA 2I5GA 3HOJA 3NGFA 5G2HA 2E4TA 2OZTA 5CC3A 1G4SA 2XIIA 4U5KA 3DBPA 5D9OA 4ASTA 4N0RA 3WJYA 3B04A 4WEVX 1XC4A 3NSXA 5DX7A 3GS6A 2ZE3A 3KOZA 4GRSA 1V6TA 4PUNA 3SUSA 5HQMA 3UWEA 1UKOA 3PTKA 4HHPA 3WQ5A 3WG6A 2RGLA 4DBUA 1UPPA 2QDEA 5CSUA 5REQA 1AJZA 3P62A 1ITCA 3ARQA 3DZ1A 4M6VA 1PZ3A 2V3FA 5G2IA 5F2GA 1CECA 2X30A 4I5XA 4NASA 4CEXC 4E4FA 3OZPA 4AZCA 4EPBC 2JK2A 3W7LA 2D23A 1HZYA 2WANA 5BXPA 4Q8PA 3OBEA 3AWOA 3R2GA 1A0DA 3UNTA 3WD0A 5D9NA 2EPMX 2J7FA 3STCA 1UMLA 3PTMA 2DT0A 1XR2A 2P5NA 4E38A 3NYDA 5M03A 1TPUA 3ANUA 1EHAA 2AL2B 2PDXA 3CUFA 1F9CA 1XRSA 1GTHA 3NQGA 5D2VA 1RVKA 3HFTA 1GOMA 3ZM8A 4Z0SA 5AC4A 1E3ZA 3FA4A 4AMCA 4AD4A 3I65A 2X09A 3RU6A 1MVYA 1XM3A 3M1ZA 3T07A 2ZWZA 4GQBA 3UWWA 5HPCA 3UBPC 2ZX6A 1R9YA 3TC7A 4AWEA 5I3JA 5CSSA 4KFOA 3RK8A 2OKTA 4QEHA 3TUUA 1WPCA 4U2ZA 3NQVA 1E72M 1JVNA 4LB4A 3W1QA 1LT7A 3QHOA 4AD0A 4J28A 3ZT6A 1PYFA 3DFNA 1U5JA 1PIFA 3S3GA 1AD4A 2HDJA 1S2CA 3L5LA 4AU0A 4MNMA 4H1ZA 3ALGA 3ZR4A 4EOUA 3WBEA 2FDMA 3JUGA 5KINA 2BOEX 1Q6CA 3QQ1A 1OK6A 4JR5A 5AN7A 3F4CA 5E0FA 2OYKA 3CASA 4FALA 3M0YA 4UTKA 7ODCA 1VYRA 2Y89A 3OW1A 2VOMA 1PZ2A 3AFBA 1EUAA 1CT5A 4QFUA 1Y5VA 4ACZA 3QGAC 4HOZA 1RAKA 2GFTA 2VFHA 3B3DA 4DPQA 1TFVA 4XD3A 3WH6A 2D2JA 1NELA 4R27A 3LSCA 1XYBA 1H11A 3GC5A 1JPMA 2QV4A 4CN1A 1AZ1A 1WAWA 4IJRA 2QVHA 3GU2A 1HTIA 4PRTA 1JCJA 3M46A 1DL3A 4KWWA 1V7AA 3KVKA 4B4FA 4CQ9A 1RQEA 4O1CA 1Z8AA 1ZP3A 1RVGA 3B8DA 3EOOA 3FHQA 4YTUA 3KOXA 2PA6A 3VNMA 1XPYA 4IP5A 4XD5A 4N7QA 4PTVA 2G3MA 2JIEA 3FVMA 1K8ZA 3U8GA 1S1RA 3M44A 1TWWA 4NNAA 3MCNA 2PDNA 2CLEA 2NSXA 4G2DA 2YL8A 3OPSA 2NQLA 3P74A 3U9IA 1XYLA 4DI8A 1J2BA 2ZKMX 1FFRA 3HG2A 2O7QA 1PPIA 1KV5A 3ATYA 2INEA 4GG9A 1Q5MA 3WDJA 4ERGA 2C18A 5D2TA 1XINA 1EJUC 2Q8ZA 4OZOA 2FZNA 3WLNA 1WKFA 4XWUA 3HJZA 4PCPA 4BKNA 2OR2A 4O4VA 1WV2A 3LY0A 2XIMA 1FP8A 4YJ5A 4HYVA 3PZNA 2V8ZA 3CIWA 3WJSA 3JZUA 3F5KA 4C1NB 2VUNA 5C6MA 2R91A 2BOGX 4CNOA 1PTDA 3C52A 4WR3A 4G1NA 5BRPA 2GK1B 3SN0A 3M5VA 5BW6A 3MSGA 3BAIA 4E0CA 4ATWA 1V8EA 3C0QA 4NY2A 5BXSA 1W1VA 1UWSA 3V5CA 1FVPA 5CBJA 1PJ9A 2YCJA 1NEYA 1W3NA 2VUYA 1QFEA 4PMVA 3IUHA 1H7PA 1YLVA 1T5AA 3B40A 1I2QA 1F73A 1DORA 4LYPA 3TTQA 2VHLA 5CC7A 3ZWTA 4E2DA 2VEPA 3GTFA 3TAKA 1QJWA 1VFFA 3FJLA 4GBDA 1X7IA 4KKXA 4GGHA 4DUWA 5ENLA 3TZNA 4MOZA 2DORA 4MYAA 3CPGA 3MUAA 4JTUA 1WKEA 4XX6A 3N34A 5FA5A 4K7YA 2JBMA 3W1NA 3LCFA 5CJNA 4CLMA 2J79A 3VUPA 5HUPA 3PWGA 3SCSA 4DM1A 3OO2A 4PCSA 4PYSA 4H83A 1TVPA 3B9AA 3LUTA 3CU2A 3CMFA 3TYUA 3DHDA 2HWGA 4HJWA 3APTA 1OWQA 1PIIA 3W23A 3QKEA 4A21A 5DT7A 2WVVA 5KITA 1TKKA 1KR1A 2OEKA 4LC8A 2G3JA 1B2YA 1SSGA 4J3WA 1MW0A 2JF7A 3W7EA 1VQTA 4RE4A 3C2YA 4DO7A 3B8VA 2Y4SA 2ZZ2A 4RDWA 4FNQA 2VD8A 2ACUA 2Y63A 3MMTA 1F61A 4QAWA 5E6YA 5HANA 1E1EA 5B80A 4PTXA 1VBHA 3OBKA 3VIMA 4CN6A 3N15A 5FEPA 4DJFD 3T2OA 4U28A 4L80A 3PF3A 3HPFA 4UMBA 4CNTA 2FTPA 3G0SA 1UYQA 1AVAA 2YYTA 1BAGA 4J35A 1OIMA 4RV3A 1TTJA 2O9RA 1QOQA 2W63A 1O12A 3FSTA 4AIUA 3BJTA 1SJAA 2ISDA 2ZZ4A 2WHKA 3PSWA 2PGWA 3BE7A 3UGRA 4NG3A 1DEDA 2NQZA 4KGLA 1P0KA 1VBUA 2OSWA 1C90A 4A3UA 4PTNA 1OGSA 3IAPA 3OOQA 1P1MA 1VFSA 1GJUA 2IPWA 4XZWA 3T2QA 1HF6A 4D6HA 3AUOA 1FCBA 1RBOB 3PAOA 3RLUA 1K6AA 3EPMA 4UFKA 4H9XA 4FOJA 2OFJA 2F38A 4DRSA 3O15A 1X8CA 2PAJA 3F2DA 1MXSA 1KTBA 4LWWA 3CEPA 3D46A 5C8BB 3ARXA 1HJSA 4TVDA 1SO5A 1VFUA 5CC5A 1Y8BA 4UQEA 1V3HA 3S2NA 5FJPA 2OPJA 2V6AA 2BHYA 1SJDA 1LBFA 1EIBA 3FKRA 1EJWC 5E9XA 1TPWA 4C5ZA 4GZIA 3KP0A 1ODZA 1TV4A 1YXCA 3SGGA 3WBXA 1OBAA 1R3TA 4MY1A 4HNUA 2W61A 4LRSA 1TCDA 1PB0A 5LIYX 3DESA 4LU0A 4MFEA 1KQYA 3A4WA 4YCOA 2VZVA 3N2MA 3U2CA 1AJ0A 1VFMA 5A8NA 5D32A 1OG0A 3CL6A 3E3HA 1X8FA 5CG0A 1JF6A 3GK0A 2VEKA 1Y5WA 2PD5A 3KP1A 3TYBA 3AXMA 2XWDA 3K1GA 4X2PA 4JQ3A 3O1NA 4DNHA 5EMYA 4BFAA 1I0DA 1LP6A 4O10A 2ZRZA 2IXUA 3WD1A 1PZ1A 4D9PA 1V79A 4GUJA 3SUVA 2QJJA 3IARA 1QPQA 3XINA 4PUKA 1KQZA 4MY8A 4UFMA 2G4JA 2JKPA 3QSTA 2PC8A 3WMLA 2O7SA 4PCTA 1ISXA 3O16A 6ALDA 4IXXA 3FV9A 3LXBA 5E70A 3LV6A 2VT0A 3HMCA 4Q6JA 5FJOA 1A5CA 4CNSA 2YFNA 4UWMA 4ML4A 2PDGA 3NGJA 1TMQA 2OQYA 3IS4A 3MZNA 4B2DA 1GPFA 1GGOA 1RHCA 3M0ZA 5HA7A 3KCOA 3KX6A 1KNWA 3FAXA 3TMQA 1JDDA 4HOXA 3NCOA 3A4JA 5HAOA 2FHCA 4PMDA 1XWYA 3TQPA 1UA7A 1JD9A 3RPMA 4B5NA 2L5HA 3GDBA 4AWUA 4GQQA 4Q4KA 1UR4A 1VPQA 1AUSL 1SFLA 2C1GA 1U1UA 5IFTA 2VWTA 4RE2A 3ITLA 4JIQA 1EP3A 4H9YA 1KFCA 1R3SA 1DQUA 2YYUA 3KRUA 4NJJA 4O1BA 2VQUA 8XIAA 2C1IA 3POCA 3F2BA 4MYXA 1M1BA 3S6OA 3LTSA 4JTKA 3A3XA 2TAAA 3NPUA 1H5VA 4EANA 3T6CA 3CZKA 4PZVA 3GTXA 1AA1B 2HISA 2PU1A 1WDWA 3IANA 4UUIA 1Q7QA 5E5CA 3DYOA 2FYMA 4P7OA 2VCBA 4IMDA 4H19A 2I56A 2F7FA 1OSEA 3F5LA 5BWFA 2QIIA 2UY3A 4IL0A 2PDHA 1TMHA 1CWYA 4KH2A 2NW0A 2WAGA 3FOKA 1TZZA 1DJQA 1E3XA 4DYEA 3L4XA 2AMXA 3B9EA 3U7VA 1IT0A 4UR9A 4J3ZA 2RGMA 3VM7A 4RZ6A 3A3WA 5DT5A 1MW3A 3NZPA 2YDRA 3MUY1 3TVAA 2HXUA 4O1EA 1KM0A 5DY3A 4MGGA 4JN8A 3W9ZA 3GVGA 3P60A 1UH2A 1BWVA 1ZCCA 4OV9A 2YSWA 3S1VA 3WD4A 5EMMA 4MJ4A 4LUTA 3V4BA 2XVLA 4AD1A 3SJ3A 3LHYA 3VU2A 5C7VA 2NX3A 4AX6A 5I3KA 4OU1A 4MAVA 4GFIA 2X41A 1GOKA 2NQJA 3QYSA 2XH4A 2PP3A 1ZBCA 1UH3A 3BW2A 4GOAA 1Q6DA 3SY5A 4GQ0A 3ENLA 1HFBA 3QTGA 3M0IA 1AW5A 1HO1A 1M41A 1GWJA 4F0MA 1J5SA 3KS6A 1CGTA 3NPVA 1YDVA 1HVQA 3WQ8A 1SFTA 4AYSA 1WNOA 5HOSA 2IXVA 4U2YA 1FWJC 3TP4A 2D24A 3RAOA 1H51A 3ARSA 3PP7A 4H01A 3UD6A 3O8AA 5CQ1A 2ZUTA 3EX6A 2XIBA 5E9AA 2YL5A 3VDAA 1BYCA 3WIJA 4HSOA 3CEUA 4QQUA 1IZCA 2QEZA 2E5BA 2V3EA 4F79A 1US0A 4AH7A 1GOQA 3LCHA 2X0HA 1R30A 4LALA 3PZQA 4LBSA 1WOBA 5LKYA 1SO3A 2ZRUA 3DBNA 1KM6A 5BOFA 2QDHA 4F8XA 4GNKB 1RBAA 3DFYA 3G22A 1J5TA 1OC7A 4S3JA 2ZVIA 2IPGA 5F2MA 4FSAA 3IACA 3W72A 3VKBA 1CXIA 1VP5A 2X2YA 3ABSA 2JGYA 1YIXA 1RD6A 8XIMA 4DVOA 3FGCA 2PWVA 4DF1A 2FB3A 5HPOA 3HZ3A 1J93A 3EB2A 2WZHA 3ZZ1A 4X9SA 4DO4A 4UZSA 1KCXA 1XRVA 1WBJA 1PDZA 1QOPA 2GVEA 5T8GA 4JHZA 3S5ZA 4PMUA 4UR8A 1SW0A 4MKNA 5I2UA 1ONWA 1Q13A 5D03A 3TA6A 4GK8A 1BHGA 4UMAA 1FWDC 3ABZA 3PHAA 4GNVA 4NXSA 1VBRA 4YIWA 4RE3A 4K39A 2PLKA 3BOFA 3LGDA 2DH2A 4AFYA 4Y9MA 5GJPA 3V5FA 4ZOEA 1RA0A 1OQFA 3U2EA 3GXFA 1TVLA 4KCUA 4MZYA 3G6MA 4DY1A 5I02A 3VMOA 3S9YA 1UD3A 1OX4B 3B9OA 2PSNA 3TDFA 2RDWA 4YN5A 1E4NA 4IFKB 3CV6A 5BXRA 3GC2A 1THFD 1Z6KA 4DLMA 2WPGA 2PGEA 5E1QA 4QGCA 4W86A 3FDKA 3MZ2A 2CBUA 2PURA 2XU2A 4GVIA 5CSYA 3CAVA 3UR7A 4Q8TA 2CXGA 3NZRA 3DDMA 1VFTA 3FX4A 2EBNA 3AMGA 2CLPA 4U31A 3LENA 3CGTA 1RJPA 1EIXA 1YTDA 3DI1A 3LD5A 2GJXB 5AHEA 1BQCA 1UWIA 2ZQ0A 3TONA 5DRIA 4KRTA 4FXFA 2Z1KA 2PCQA 1H63A 1LF1A 3GR7A 4US5D 4LS0A 5HMFA 3TCSA 3N6JA 1RA5A 1FWFC 4QJ4B 5C0QA 2QQ6A 2R6OA 2ZX8A 3EOEA 5CBIA 2WCGA 4PUMA 2DV0A 3RX4A 4ICNA 1L6WA 3WLIA 4UFIA 2ZUUA 1K4HA 5DMYA 3T0TA 1EB3A 1M53A 1JEZA 1NJJA 1V5XA 1VF8A 4ZEPA 1WXZA 3GTNA 2WC7A 4C7DA 4R7OA 2PF0A 5KZ6A 2QCFA 3U57A 4FOUA 4KCVA 1QRQA 2JKEA 2QAFA 1P6WA 3SBFA 2VOTA 3HQOA 3TCEA 3UZYA 3A23A 4J40A 5HMSA 1UZ1A 1FKWA 1JDEA 1JUBA 3RM9A 1IEXA 5D30A 4LVBA 5FL0A 3W76A 2HNHA 4A8IA 2XJ7A 5D2WA 2NUXA 4KIEA 1MO0A 4BQ5A 2E3ZA 1WA3A 2ACRA 3HU7A 4Z2GA 3WK3A 1GKRA 4JDYA 2NVCA 5LHEA 4IIEA 1F8IA 4E6MA 3S4TA 1LJYA 2CEQA 4CQ8A 3VGHA 4MIMA 4TMBA 1EWEA 5FF7A 3GDTA 3VOIA 3UYIA 4DZ5A 1W31A 2PLCA 3QW4B 2HJPA 4QNWA 3L12A 1XICA 4Y90A 3C2OA 1PX3A 4IOTA 1DE5A 2PEVA 3SN4A 3CM4A 1ECEA 4CQAA 1IF2A 1JGIA 5IRPA 1JYXA 3V0SA 3WNLA 3W53A 2PE4A 3MSDA 1E4MM 3L0NA 2D20A 2V5CA 4CD6A 3MHGA 3AS2A 4HYRA 2B7NA 3LZ3A 1XH2A 2QUUA 3G77A 2XN0A 4G7FA 1I2PA 4HSHA 1RJRA 4WDUA 1UW9A 4JEJA 2H8XA 3M0HA 4B3KA 2P8CA 3REQA 1N2VA 1EX5A 4HCLA 4AZIA 2POZA 4JFVA 5LNSA 3WFZA 4ZSTA 3CQIA 2DH3A 1QPKA 1HKVA 4XIAA 1XHGA 2G0WA 3PJUA 1JZ4A 2FGLA 5B7ZA 2FB2A 1Q85A 1U1JA 4JFTA 3GHRA 1LOSA 3VI2A 1O66A 4N6FA 5F2IA 2HCVA 1A0CA 1A5BA 4MUZA 2BB0A 3P8IA 5ABFA 3K30A 4JX4A 3BSMA 3P61A 1O94A 1C9DA 1KBKA 3W2JA 2O4MA 3ZR6A 3AROA 4URIA 1QU4A 1KRBC 4UR7A 4Z1AA 3UPWA 1H41A 1JPIA 1S5NA 5IM51 3WLTA 2BY0A 2CERA 4JBRA 3WMSA 2FGZA 5A8OA 5BRBA 4GXWA 3GBEA 1VH7A 2PPGA 1IGWA 2BZNA 3F1QA 3QBUA 4LUYA 4DF0A 1PHWA 1L6GA 1TE1A 2HPMA 2GGIA 2IW0A 5KZMA 2HEJA 2HK0A 4GC3A 4Z0JA 1M65A 3FW6A 5TAOA 5HJXA 4FO4A 4F2TA 3PPCA 1BLIA 5E0KA 4LYKA 2OLHA 2ZUWA 3MV01 3PFMA 4A3HA 4LAOA 1WUFA 4IQJA 1Q45A 2V5KA 2VFEA 3PB2A 1PCWA 4IPLA 3VNKA 1LDCA 2QJIA 2G3NA 1JQVA 1XFCA 4S3DA 2X1SA 1WQ5A 2Q01A 3D0CA 2E9MA 1VJIA 3EKGA 4AC1X 1S2TA 1XLAA 2P3ZA 1CGUA 3PWAA 3EMCA 4O18A 4S1FA 1GZ1A 3S5OA 2NUWA 3VIPA 1GQJA 1TWSA 2I9UA 5F1VA 3CPUA 4LUSA 2C16A 4NRRA 4NP7A 1BGAA 1I8JA 1AH3A 5D02A 2FGBA 2QW5A 3GM8A 3IIZA 5FL1A 2BTMA 1MSSA 1A5AA 4MY9A 2XYLA 1T8XA 3LMYA 3TJIA 1KBIA 1UG6A 1C92A 3KL0A 1RBLA 1KKOA 3QR3A 3I4KA 4NZ5A 2YXXA 2X0SA 4BA0A 2AGTA 1XH0A 4JFUA 2X1TA 4GXMA 3BOLA 4JTSA 3T05A 3QZ6A 2ZX7A 4M81A 4JEQA 1E0UA 3G1VA 3I3DA 2Z2UA 3G1YA 1JPKA 2ZWYA 4NAEA 3PUOA 1JR1A 2NVAA 4X9YA 3CXOA 2NZLA 3EWBX 3UEQA 3BAJA 3PBGA 3QZEA 4RE0A 4C60A 3HTWA 2J8GA 4BJHA 2PDBA 4YTQA 3WEZA 4DAFA 3W7OA 4IPNB 3BTNA 3T40A 4K8EA 4DXKA 3KHDA 5BU6A 4FK9A 4REQB 4DWSA 3NEVA 3P2VA 1YBQA 5C2CA 5ECUA 3N3MA 3FNDA 2D2GA 2UZ9A 2J9YA 3W2KA 4C6EA 4RNIA 3RU8X 2OYMA 5A95A 2XZ9A 1TWDA 5LYRA 1E6NA 1BWLA 3F2CA 4GCXA 1DQWA 3AZRA 4FXRA 4JDBA 1Q8JA 2E67A 4OBTA 1TR1A 1PIGA 3LM3A 3B8TA 3U4FA 5FKYA 2FVLA 2WKGA 4AHQA 4PEEA 4YL2A 3WQEA 2CC0A 5K7JA 1VRDA 1FWCC 1F3XA 2PDUA 3PPHA 3ORWA 3TTSA 2PP1A 3HG5A 3L5MA 2RJGA 4OIFA 3O06A 3DU0A 3TYDA 1KV8A 1A3HA 1FUYA 3PVFA 5KEZA 1KC7A 2G8ZA 4IPPA 2YBTA 4AISA 3VIKA 4L56A 4HBKA 2BXYA 1LTDA 4FPSA 1I1WA 4LB3A 4ZTXA 3V0UA 1PKYA 2JALA 1BD0A 1B54A 4UTJA 3URBA 3QYQA 2MUCA 4GX9A 1YADA 4PBGA 4S39A 1GEQA 1AL7A 4QDWA 3W81A 3CIVA 2R82A 3MCMA 2PDPA 5ABTA 2Q3OA 4AWTA 2JEPA 3LV5A 4UFHA 3W87A 4MLRA 3IK4A 3UY8A 5IDZA 2OT1A 3CYVA 4B5WA 4FX7A 4QITA 3N13A 2V2CA 1B3VA 4ZZ9A 2UWFA 3D6NA 1I0BA 5TBOA 1RLCL 2V2DA 1R46A 3PS7A 4ZBCA 2QJNA 3RJXA 2WV8A 1XYMA 1N8IA 3WNMA 1KFJA 1XCXA 4E8GA 1SFSA 2PS2A 2AQWA 3GHUA 3E2SA 1Q2SA 3DOPA 3H2NA 1L2QA 4KRUA 4ACYA 4GZJA 3EOSA 3VFLA 2PGRA 5FEWA 2WJFA 3VNLA 4O57A 3HPSA 2JEQA 1LROA 4NQ1A 1AQMA 4XAPA 2B7PA 3TNOA 2QGHA 3VGEA 2OSYA 1EBHA 4NL1A 3RLGA 2DSVA 2V68A 4CD8A 4IT1A 4LANA 2YLAA 3MO7A 4JN7A 2VC9A 2F61A 1SVDA 2J66A 4IG2B 3T0CA 4IMEA 1A3XA 1SZEA 4L61A 4AZ6A 5A6SA 5JU6A 1U83A 1V4YA 2QCHA 1V02A 2W9MA 2XGZA 4CNNA 1ME7A 4H8NA 2NX1A 3BLLA 3NG3A 3RJYA 1XIGA 3AXHA 4NT0A 4MNLA 4GQGA 4HA4A 3GWQA 3QMSA 3N4FA 4GYFA 4U3AA 2A7PA 1P7TB 4PGLA 3UWVA 3BLEA 1WZMA 5JQ9A 2ZA1A 1IZJA 8TIMA 1BVNP 1BEUA 1M7PA 1ENUA 3NPWA 2ZXBA 3QHMA 2H90A 2VVSA 4S3AA 4YVVA 4YYCA 1F6PA 2G3IA 1SW7A 5A1AA 3IEBA 3I3EA 3IRDA 1QHPA 2FPTA 1V6WA 1XLJA 4O14A 3UG4A 4XD6A 1NU5A 5BMXA 1Z32X 1DQXA 2GGJA 4ZQMA 2CLMA 3W2UA 3IIPA 3N3TA 4G1KA 1QATA 4RZ5A 1EXBA 2WNWA 5AYXA 5H1WA 2J75A 4YHGA 5I3FA 1S2VA 3ABQA 4UTFA 4OJYA 2YL9A 4LNYA 1FA2A 4JQAA 3W1LA 1V93A 2WM1A 2TODA 2DPEA 3T8LA 1DJYA 3M5XA 1EOKA 4F0LA 1PL9A 2WHLA 2VDHA 2X0YA 3LCGA 4S3CA 2J8TA 3I6RA 4NJGA 4AIBA 4ERAA 3OZYA 3EDDA 1ZJAA 2NX9A 2ZFAA 2A2IA 1WZAA 3FLUA 4K37A 7ENLA 2JQXA 2PLMA 2R14A 3T8QA 5GPRA 1OEPA 1XLHA 4WY0A 4DWSC 3FCPA 2J77A 5TF0A 4CEUC 4R3UA 4QS6A 4W85A 3G2GA 1LM1A 1IEIA 3DC0A 4PUWA 4I8YA 3C2EA 4GBUA 2ZZ3A 5HNRA 2GOKA 4XTIA 4IP7A 3ABRA 2Q3RA 1LCOA 3CAWA 4Z2IA 3VKAA 3PPGA 4C6KA 3UJSA 4AMAA 1OFPA 3H26A 4MDPA 4GWEA 4MAZA 3ZLHA 1XV8A 1HL9A 2YZ5A 3A5VA 3MY9A 5MKGA 2D3NA 3WL1A 4ZCWA 1JCXA 1QPOA 3HB9A 3CWOX 4OV4A 4E8CA 4MWAD 3O0FA 4XUGA 3TN4A 1T41A 5J04A 4AZBA 3BK0A 4BQ4A 3N6QA 4GKLA 2WSPA 1V0MA 4O13A 4L65A 4JN6A 1ZCOA 5I3DA 4NSBA 2I14A 1Q66A 2XFFA 1QHZA 4DUOA 4DBSA 2CWXA 4KEMA 5L9FA 4GCAA 3E38A 1NWUA 4PUUA 3E2VA 2Z1XA 3T78A 5CAHA 3EX3A 3IAQA 3CS2A 4HPNA 1RH9A 3NWRA 3HURA 1OC6A 3NFUA 3CUGA 2IQDA 4NJIA 2EF9A 5T26A 3URNA 1FWNA 3OEXA 4ZSUA 4WQ6A 3NO5A 1X1ZA 2FDSA 3L4ZA 3BLFA 3WLJA 3NM1A 4ZVJA 1XIHA 3RILA 1GCYA 4FNUA 3HPZA 1MDLA 1A4LA 2VO5A 1JRCA 1C9WA 1X39A 3NL6A 3XIMA 5AHLA 3EB3A 2OXNA 5HR7A 1JZ2A 5A69A 5EY5A 2VFIA 4PMYA 2WQDA 1A5MC 2Q09A 2V5BA 4PR4A 4AW7A 2ZYFA 4GI4A 4UC5A 2XIOA 3UYCA 3ZJKA 1ZFJA 3LCWA 4AZ5A 5FSDC 1O5XA 3M64A 2ZE0A 3QRHA 1Z7AA 4A3YA 4HJFA 3BCJA 4S3GA 5A6LA 4KQNA 2XSXA 3VNDA 1ZAHA 4LVFA 1H7OA 3BAYA 3H55A 1W8SA 3WD3A 2F6XA 4U33A 7TIMA 4TX6A 5IOBA 5C54A 2VC6A 3WLRA 1MEWA 1UIPA 4JTIA 1MI3A 2H9AB 3NQ6A 3K4DA 4PUDA 3S5SA 3AHXA 1FXQA 3T2PA 5H2ZA 4J9JA 2IKIA 1Q63A 2P0OA 1NM9A 4K1GA 1LBMA 4KWOA 1CNVA 1LRQA 2HK1A 4WD0A 4GQRA 3FY1A 4O8AA 3BJFA 1Q6QA 3P82A 1D3CA 3AIEA 1TJPA 2VI0A 1ONRA 3BQ5A 1QXLA 3CL8A 5I77A 3ITYA 3B0XA 3QV7A 2WBKA 3OGSA 5BOEA 4GO9A 2HE8A 1FQ0A 3L2LA 2VD9A 1S2WA 3RX3A 4Q8MA 5LXXA 1MFUA 4R7JA 4LV4A 3PSVA 3S83A 4RXGA 3VDBA 1KGWA 5KETA 4FF7A 2REQB 3BZGA 3U5UA 2F6KA 1VS1A 4LVDA 2HVMA 4TQTA 2OOFA 5F4XA 6TIMA 1VJSA 3PB0A 4Q7NA 4A8LA 3QPZA 3WD2A 2QHAA 4DJFA 4AHOA 4NZCA 1OCJA 1E0TA 4HPJA 1QNRA 3AHZA 1VBGA 4DZAA 2ATSA 1DWFM 5DCEA 1BKHA 3LPFA 3P5YA 2W27A 4ZOCA 3NA8A 4HMCA 1P5BA 2FVKA 1EJSC 1TIMA 1E6XM 1EFZA 1R2TA 1TRIA 1QMLA 4GUIA 3N12A 3DX5A 4GMEA 4NX5A 4W7UA 5REQB 1TJ1A 4K7VA 3W22A 2A3CA 1SZFA 4YYFA 3LPOA 3MUXA 1N8WA 1OINA 1ESWA 5K4XA 1M01A 4AZCB 1ZSXA 1QI5A 4Z17A 1E43A 4LF1A 3WK0A 2QGYA 1MEIA 1EH9A 1SM9A 3GIPA 1Q6OA 1W5MA 3EYPA 3KTXA 2ZDRA 5CGQA 3LK6A 4A05A 4CCCA 3W26A 3EXRA 1QNQA 4X0NA 2PUZA 4B90A 3GVRA 2AL2A 5DO8A 1MZRA 3CUIA 3OZMA 3RR4A 5DANA 1XD0A 3YPIA 3QFWA 3L23A 3D5HA 5K9XA 1HO4A 3M5YA 1DIKA 2EKCA 3VVGA 1TTQA 4O28A 4Q6XA 1VGAA 1JZ3A 1JI2A 4K2SA 3TYEA 3E5BA 3M7WA 4F40A 1WZLA 2FPVA 3TFCA 5CC6A 1UKSA 2PRMA 3GW3A 3DHFA 4HU8A 3ZSTA 2ZUNA 3KVJA 1XIJA 5K3VA 4UQCA 3N9RA 4AQLA 1V6XA 3QF0A 2ICSA 3THAA 2QMJA 4Q4OA 3S2LA 3SN1A 4I3GA 5AC6A 4ATDA 2GL5A 2QULA 1O1ZA 2J7CA 4MJMA 5PTDA 4C6LA 1QR7A 3CMJA 1XG3A 2EPOA 3UF9A 1KR0A 4ZOAA 3TW6A 3TTEA 1JAKA 3B8WA 2C8NA 3R4IA 5I3IA 3XISA 1GK8A 3EDKA 1WX0A 3NM3A 1P0EA 2J6VA 4LC6A 1QNPA 4EXQA 5FF4A 2HROA 3E9AA 4GUGA 2Z2AA 3KRBA 4ATLA 4GUHA 2CZVA 3SCRA 2QPXA 4EXBA 1UKQA 2UY5A 5T9CE 4PL1A 5U4NA 4MLJA 3W7CA 1XBVA 4YMZA 4JOMA 4ZO6A 4ACZB 4HA1A 1NARA 2BFGA 5I5RA 3T42A 2Y70A 1J10A 1O5QA 1FDYA 4G8TA 3K2GA 1PBGA 1KGXA 1OABA 5D8ZA 1V0KA 3BXWA 2OU4A 1EA9C 2I17A 1NY1A 3ZT5A 4F0HA 5C9XA 3BZJA 1LL4A 4A29A 1V7YA 5C70A 1EDQA 4XKYA 1YTEA 2GOUA 3ZWSA 1FWIC 3UZWA 1CB2A 3WF3A 4IFRA 4PBEA 1S39A 1FWGC 1XF0A 1R86A 3AO0A 1TPEA 4M6UA 1KCLA 4N6EA 4QE5A 4LOCA 4TX9A 3UR8A 3R11A 3ANVA 5AECA 1WUEA 3P5ZA 1RPKA 2XGBA 1JJKA 3BMWA 1CEOA 3LQLA 3IJQA 3TR2A 1E56A 4LBRA 4K36A 1OGGA 1GHSA 3GHTA 1H4PA 1FHDA 1CXEA 3A64A 4MB5A 1XXXA 2YX0A 1TPDA 4WKFA 2PMQA 2Z24A 3LHUA 1CXHA 3JZEA 7REQA 3R6IA 5A6BD 1LQAA 3QVQA 1AODA 3VIOA 3IJ9A 2DIJA 4H2HA 1LWHA 3SRKA 3B0YA 6XIMA 1FWAC 1SZRA 4UOZA 2EG8A 2BG5A 4O1AA 2ZOXA 3EDEA 3EWCA 4P8XA 5E6ZA 2GGEA 1G1YA 2PDWA 1W0MA 3LBOA 1R3QA 4LF2A 4W7WA 3CHDA 3W83A 3G18A 4WCJA 1EL3A 3WLLA 2X2GA 4XQ6A 1SO6A 4JTFA 1H60A 1BXCA 1AQHA 4P61A 2Q6ZA 1H09A 1XRFA 2H6RA 3AXXA 3R7MA 1LQ2A 4AZGA 2WPBA 1DJGA 4QAIA 3LZ5A 4A8NA 2QYGA 1UD4A 4YHEA 4LAZA 4QSFA 2J7HA 3SFWA 3H4WA 2V81A 4WK9A 3A4AA 4WUIA 3AHTA 3QV9A 4GI8A 2SFPA 4UTWC 1UB3A 2Y7FA 1KM1A 1YNPA 1VHCA 2Z6JA 1KKRA 3GB6A 3GD6A 1TMLA 1XIIA 2YBVA 4OWGA 4XZ9A 3NUKA 4HPXA 2QDGA 1GHRA 1Q6FA 4PCFA 3VZYA 5F4SA 3N29A 1XKYA 1E5JA 2WC4A 1XCWA 3N11A 4D6JA 3GDKA 3MANA 1KXVA 1QK0A 2PDYA 1BKSA 1SR0A 1J0IA 4XZMX 4NI8A 2BDQA 1JDCA 9CGTA 4AHPA 1ITQA 3QMTA 1G5AA 3P6LA 1IEQA 3P7YA 4KEZA 3PPFA 4Q7BA 2QUVA 1JZ7A 2V69A 3H53A 2NXGA 4D72A 1KBLA 3BL3A 3PFRA 1PKMA 1ZLPA 1KFLA 2CBVA 6TAAA 4L4PA 3BLIA 1XD1A 1IE7C 2V9DA 3RR1A 1H7WA 3PZTA 3OB8A 3G8EA 2PWFA 2PDCA 3TYAA 4M1BA 3PK7A 3FJ6A 3EZ4A 4JTRA 5D9PA 5T9BG 3A3HA 5D09A 2VZUA 5I6SA 2QJMA 1PXGA 2CHNA 5AC5A 8RUCA 2V5DA 3WNOA 1OB0A 4EX4A 1R47A 1XGEA 3SCTA 3N2XA 4NZFA 5I24A 4JTDA 1FWBC 3UFYA 2E6AA 5D38A 3G1HA 2YPIA 5CSRA 3V1HA 3K8KA 4X61A 3KBVA 2Y5EA 3QPYA 5DQPA 1IR2A 4MTVA 4HB7A 2IUZA 3E0IA 3IJDA 4GA8A 3FXYA 3BLDA 1R7OA 3HPXA 3STGA 1BYBA 3CUXA 2G97A 3P67A 6REQA 4Y8FA 1F2JA 3KRSA 4UQBA 3W70A 3HGOA 3LLXA 4FP1A 3LHZA 3RMEA 4IH3A 1VEMA 4GY0A 1UBSA 4YU1A 5AKQA 2R8WA 5I7GA 3GO2A 3GNOA 5I0DA 1E55A 3UJEA 3K5XA 4JCLA 1IWBA 4JYEA 2XZ7A 4UXDA 1MZHA 2ODOA 1E9ZB 2J13A 3M0VA 1W3JA 3RM8A 5EBAA 2GQAA 2C71A 4D6FA 4Z1DA 4NVTA 3OA5A 3TC3A 3C86A 2J7EA 2ZX5A 2FHFA 1K9FA 5H8UA 5C55A 3CUHA 1WZKA 3T0DA 3G5EA 2E0PA 1HJUA 1R2RA 4JY9A 3N2TA 3PBWA 3RNDA 3A9BA 4B5XA 1GVQA 2J27A 2CYGA 3F7JA 4UBPC 3NURA 6XIAA 2D22A 3SRDA 2C6QA 3PAJA 1FH7A 2Y61A 2Q02A 1W9UA 3NQ2A 1TVNA 1J2WA 2YA0A 4XB3A 1KM5A 2C91A 1OY0A 4IGHA 4P7LA 4CNUA 3QV6A 2J7GA 5CZ0A 1QWKA 4X0VA 1RR2A 2FZBA 3ARYA 1HVXA 4YVPA 4HU0A 3I6EA 3OODA 4K8HA 3LI0A 2Z6IA 4GJJA 3C61A 2YDQA 3BLPX 1M7XA 2ZA2A 4GO8A 3VCCA 1K02A 3DHPA 2QCGA 4US5A 3EEGA 1PAMA 4LS1A 4GVFA 2QS8A 4OBSA 4LV9A 2ZICA 3QJAA 2OWWA 1E6RA 1FWHC 2OB3A 3KL5A 3KW3A 2PDIA 5C5YA 1QHOA 4L6HA 2DSWA 5D05A 5CEWA 1B0IA 1WXJA 1S38A 3TYZA 3VYLA 1EO5A 2DT1A 1D3HA 4HQVA 3TOPA 1J8VA 5D37A 2G4FA 4WHBA 4EPKA 2Y24A 1GG0A 3E02A 1XLEA 2Y6ZA 3MWAA 3MYPA 1EC8A 2AKZA 3GH7A 1UWUA 4LFYA 2PRHA 4Y9OA 5HBFA 1GKPA 3LHWA 3VO0A 2IQTA 6ENLA 5HULA 4UTLA 2OODA 3ITTA 3BOXA 3UG3A 5A6TC 2D3LA 2ESCA 1H7NA 4V15A 3CWHA 3HO8A 4ADTA 1HL8A 1QI3A 3BGAA 5EKYA 4RL3A 2VTFA 3GXPA 3NL3A 2GQ9A 2VGGA 4OUIA 4H04A 3VGGA 4O52A 4HPHA 2WVUA 3T44A 4QM1A 3O6YX 3N2CA 2CHRA 2V3GA 4ZQPA 3EDFA 2O0TA 2E8YA 4EWJA 2HNEA 3UWUA 3STPA 1R9ZA 3VILA 4Q4PA 4WXYA 1LG2A 3STEA 3V75A 3ZOAA 2CETA 3JRKA 1B1YA 3UCCA 4H7VA 3NR0A 1X6LA 1MUMA 4PUEA 2ISVA 4V1XA 3TXZA 1X1OA 2GLKA 2BVDA 3BCDA 1J0ZA 2FH6A 4BQ2A 4DX3A 4ZA0A 1L8PA 2PDJA 4FR6A 2C15A 1XYFA 1W1A1 1VYSX 3IK2A 3ARTA 2MNRA 3UXIA 4WZHA 1X38A 1O5RA 1ZP4A 4UFLA 3VTRA 1EX1A 4Y6GA 3KBSA 2BVTA 2WWCA 3CZGA 3FYYA 1VHNA 4AD2A 4A35A 3PG9A 1BSLA 3N2OA 3QMRA 2FTWA 1DXIA 2VWSA 3DIPA 4IFOA 2A7RA 3UWYA 3V5OA 4XVDA 1WO2A 4N4PA 1JNDA 5H91A 1D7FA 3PBYA 5IDIA 1TTIA 3W4RA 4F66A 1G4PA 3W85A 5HNTA 1XI3A 4P2VA 3LCXA 1UC4A 4J1OA 1XIFA 4RR4A 3NQEA 4GYPC 1VENA 1W37A 1MYRA 1D8CA 4J3XA 3QKZA 4FLQA 1NP0A 2WKLA 3CQ0A 3DFPA 2YFOA 1RP9A 2AAMA 1CGVA 4JPGA 4ADUA 1NF0A 1QPRA 3JVAA 1GVYA 2HXTA 2VEGA 4OHQA 3MHFA 5DXYA 5C9ZA 2XVKA 1VEOA 4I7WA 2C79A 4IIHA 1OGBA 1OK4A 1XBZA 3A5FA 4GY7A 1QTWA 1YDOA 2ZUSA 4Y7EA 1EQPA 1ME8A 2YBUA 3SGUA 3ONBA 3UVIA 3B0PA 4LGXA 1FH9A 3UR5A 1B3ZA 4GABA 3SCVA 4L4LA 1HKJA 3MJYA 3BAWA 1SGJA 1OT1A 3WF1A 3ZFHA 2A6NA 2R1LA 4AD5A 2W67A 1V51A 1CDGA 1ZENA 5FEXA 1E6QM 4KIRA 4W5ZA 5AYBA 4J4KA 1XGDA 2J74A 4ZE5A 4DM2A 4JTHA 1IR1A 1RY0A 3OHIA 1XDMA 3ALFA 3EMQA 4C6BA 4OOZA 1J01A 2DZBA 4NYUA 3IGXA 4O1DA 2DQXA 3QTPA 3AI0A 3WLKX 3RDKA 3QY8A 4C6IA 4EAMA 4W5UA 5AYIA 4AC7C 2DDXA 2OSXA 1FHLA 4GVGA 2UBPC 2DW7A 4JYDA 4FX6M 3FGCB 3CQJA 2QDDA 1CGYA 5K9CA 1UR1A 1CTNA 1DHPA 1YKWA 1DIEA 1XISA 3EX4A 2GQ3A 4L9YA 5EA9A 3SECA 1UUOA 3QV8A 3AS3A 3GRIA 2V3DA 4RXFA 3KBWA 1MRAA 3UJ2A 5BMWA 3EWXA 3NSMA 2OYLA 1ICQA 3WO8A 3IPWA 4R53A 3NZGA 4Y2WA 3WYZA 3W07A 3AALA 4IGSA 4OT7A 1WOAA 2AQVA 2WNZA 3VZZA 4Q33A 2VRJA 3MJMA 1UD2A 3ZS4A 4JTCA 4FXSA 4INFA 4F2BA 3O2LA 2ZC1A 4LCRA 4EPEC 3E0VA 4O0KA 3L65A 4PEKA 3SSZA 3WK1A 3LLFA 2B7QA 4IFKA 3N19B 1J12A 4E2OA 4K1WA 3LPGA 3T08A 2ZXAA 3ITXA 2J9XA 3KBMA 4M0XA 3FHAA 3C6CA 5KZDA 3I7QA 4O0QA 4DO6A 4UQ9A 1QBAA 3S1UA 1R85A 3MU7A 5JH2A 4ZB2A 3T81A 2J78A 3IV3A 4KMQA 3DFTA 5L6UA 3BV7A 2VZOA 2PTWA 1WYIA 3AJXA 5U7SA 4AXKA 3KWXA 1EA0A 3RLHA 1RK5A 3MTWA 3R1ZA 1EQCA 3GNPA 4M51A 3RFAA 1UZHA 4B3ZA 3U6WA 1F7BA 1EF2A 1ZALA 4GY1A 4N9EA 4E8DA 1PWMA 2D1ZA 2XISA 2XM1A 4N4QA 1JYVA 3H2OA 3VZXA 1BTMA 1LZOA 4RW3A 1IIHA 4ILSA 5G1YA 4M24A 4IQDA 1B4EA 2ZXQA 4MB4A 3DKJA 4U10A 3KRZA 2NSOA 3FS2A 3H70A 2Z2BA 1QAPA 4HN4A 1QCWA 4W9TA 4EWND 3H54A 1YE6A 4FNTA 4J3TA 1TWZA 3TWBA 1TPC1 2R9RA 2PWEA 5HWJA 3UU0A 1DKWA 2WNQA 2DVUA 1ZPTA 1BQGA 1H7RA 4JTGA 2TMDA 4WKAA 5HATA 2DIEA 4JNZA 3UNDA 1RZMA 3DEQA 1Z69A 4KT2A 1FWRA 1TREA 3RCMA 4RK8A 4RNFA 2RFGA 3G3MA 3BVJA 1Y65A 4O0ZA 4WDTA 4A4AA 5FF2A 1MFVA 1KRCC 3N14A 4JQ4A 4OQVA 4O54A 2C0HA 3WQ6A 1K4GA 1QW7A 1W1B1 2DT3A 4B5UA 2W91A 1I75A 3CT7A 2I57A 5KTLA 2C14A 4GH1A 3OU8A 4JIHA 3CQKA 3H22A 3LNPA 3KZPA 5FCZA 1U1HA 3S1GA 1KW1A 1TV3A 4ZB0A 3AIVA 1ISVA 4L1XA 4PMOA 4GIYA 5G1MA 3FDGA 4FS9A 3BANA 4HSNA 4CQBA 5CGTA 1K1DA 3GQYA 1ODUA 2RDUA 3CPRA 3PZOA 4MUPA 1HT6A 4V28A 1E1CB 4F9JA 2X40A 2ZZ5A 2NXIA 3A9IA 3UETA 1UIOA 4YWSA 2VEMA 5BYWA 3E0LA 2B7OA 1VAHA 1E0XA 4G7EA 2VNCA 2OLAA 1HW6A 4G9PA 3LBCA 3BSGA 2OT0A 1RJQA 4B5SA 2FMOA 5C9UA 3WLQA 5LXEA 3PWIA 3KFTA 3MPGA 1F6KA 3REQB 2D0FA 4YCPA 2CW6A 2BVYA 3IJ6A 2A3HA 1FHUA 2XFYA 1GORA 4RUBA 3QW3A 2J8FA 4PBFA 5HMEA 5EFFA 4RZ4A 5FI8A 2VELA 1PVNA 3MBFA 4Y96A 4WKHA 1ADDA 1LWIA 1POJA 2V2HA 1TUXA 2YCLB 1Q6LA 4HVXA 3DFQA 5ABFB 3KTCA 4R88A 3V0TA 3G0XA 3VD5A 3SJNA 1DTUA 1W1ZA 3I7SA 3WH8A 1OF6A 3GFYA 3ZR5A 2XHYA 4S3KA 5BU9A 3VKKA 4PMRA 3LG3A 3MP5A 1ZJIA 2ZUMA 4C6QA 4IIDA 2R24A 3VOCA 1FX6A 3HG3A 3M6YA 4C6CA 5LIKX 1ZBVA 4ZOBA 3WQPA 3CWNA 1PX4A 3P80A 1W91A 3IVUA 2P3EA 3TMLA 3WZ0E 1WDPA 3SRFA 3GNNA 2QF7A 1Q65A 4LXFA 2EEXA 4I5UA 1OCBA 4HP5A 3NNTA 1P4CA 4M8UA 4Q4SA 4TXEA 2XVGA 4H4IA 2WZTA 1I60A 3BLKA 3RGTA 2DT2A 2CKRA 2VJXA 3U48A 2EJAA 5HR6A 3OTRA 2AGKA 3AWNA 1ZJHA 2R1NA 2WXDM 1QW9A 3W73A 2IS7A 2PLJA 4XSLA 3BICA 4LYRA 1KA9F 4UTHA 3GNXA 1B9ZA 3BCFA 2BY3A 2QF8A 1JF5A 3AMCA 2GWNA 3WQ4A 4Q4QA 1RALA 2JF6A 2FIQA 4IX2A 4QE4A 4H6KA 4H6EA 1PCKA 2POTA 1J0JA 1QNSA 1YNQA 4MWAA 2WB5A 3OBAA 1JZ6A 2P10A 1QI4A 4JQ2A 2OZ3A 3W7DA 3CC1A 3W7IA 3UW6A 4DXXA 5EPDA 3QHNA 3W27A 4CQCA 5M1TA 1QPNA 4IF2A 1UOKA 4LYQA 3PJXA 3DG3A 4GLEA 3QGKC 2BS9A 1CGWA 1R38A 3AU2A 2BP1A 4M56A 5I00A 2QUMA 3ZVHA 1Z44A 4JZ5A 4LAKA 1UOZA 2BY2A 3FJ4A 4IX0A 4NAEB 2O56A 3MQTA 2A21A 4FOKA 4DQWA 5HMDA 1B31A 5CJ5A 4BEUA 2AL1A 4QRNA 1C93A 3LLDA 4LEQA 2OOGA 3PNUA 4UFJA 3AAMA 3UXKA 1FKXA 3HFYA 4H2CA 4Z2LA 1OFEA 1H7XA 4GJIA 2WJDA 4IP4A 4FI4A 2WHMA 4DWSB 2CZFA 5IHSA 3IGUA 3Q45A 2EQDA 3ISIX 1YBQB 1VKFA 2NT1A 3HBLA 4IGMA 1DJXA 4PTWA 4LAUA 3W1XA 3U3HA 5LSMA 1N82A 1F6YA 4RV8A 4JXCA 4O4WA 1OM0A 1ZRQA 4MB1A 3EDJA 3DH7A 3WN6A 1ZTVA 4KRZA 3VMPA 3W1AA 4M82A 3G0UA 1XLKA 1JCTA 3R25A 3VABA 1S5MA 3WKZA 3TQVA 2XH2A 3VDCA 3TXVA 3BDKA 3TKFA 4AWSA 4CD7A 4ZTYA 3CTLA 4GC4A 3S8HA 4J3SA 3M0KA 3TR9A 4GI9A 4PCNA 3GU9A 1QNOA 4HK7A 1B9BA 1HKKA 2P0IA 3TWAA 2E1WA 3NQ8A 5XIMA 1TCMA 1UP3A 4I6VA 4HZ6A 1XGZA 1X96A 4IIGA 3EOUA 4HMEA 1AH4A 1F8MA 2W66A 3DERA 3EGJA 3W38A 3BPWA 4BWLA 1HG3A 4E3TA 2G3FA 2WNNA 2PDQA 4Z42C 3AHVA 3TTOA 2X42A 3LERA 3MKCA 5EU9A 5DMMA 2FVMA 4M7SA 1HJVA 4MMWA 3MUCA 4Q7IA 1REQB 2QZRA 3EWYA 1HJWA 1AH0A 4FEZA 1IEVA 2OVLA 2YKKA 2QLYA 4J3VA 1VBJA 1W3IA 5KSWA 3FN9A 2I16A 4O11A 4C91A 4IJBA 5FACA 4Q8NA 4IUGA 4HMDA 3VIIA 3CUZA 1EJ7L 3C0JA 3FEQA 3K46A 1XDLA 3W6YA 1UP2A 3NZQA 2RAGA 1C29A 2DY3A 5CG7A 3VX0A 4BF9A 3Q2DA 4C1KA 4ML9A 1GTEA 3OIXA 3GG1A 2OO0A 4Q3MA 1XIDA 3GU1A 2CZDA 2C19A 3G1SA 4FA3A 4JQ1A 3DFSA 1K9TA 3VDGA 1SPQA 3WEMA 1KXQA 5CPNA 1CPUA 2DFAA 3IVTA 3H21A 4K6AA 3ONCA 1UH4A 3OLGA 1JPDX 5LZLA 1M9HA 1JUKA 3D3FA 4IG2A 1XLDA 5E93A 4CD5A 5H8MA 2GZXA 1KD0A 3C3NA 1TJ2A 1AMYA 3PULA 4JKLA 2V5LA 3B8UA 2GJLA 4E4PA 4U5IA 3F5JA 5DCBA 4OOUA 3IV8A 1GUVA 4UQDA 1DIDA 4PH6A 3VD9A 3UA3A 3HV8A 3SAZA 4O12A 3OQEA 2ZADA 1P7TA 5XINA 5GVJA 1XLIA 1ZGDA 3TX9A 3W7KA 1RD5A 1F3TA 4AZHA 4UQAA 3PC0A 4MWAC 3OQ8A 3CL7A 3CTTA 1R3VA 4L9XA 4M1RA 3NQ7A 4PN2A 3QFEA 4FIQA 3SUWA 2PDFA 3C2VA 2IKJA 1G4TA 3BSHA 1FDZA 2CLIA 4MPKA 1UROA 4HCDA 3KEHA 2YA1A 4JIPA 2Z27A 2EKGA 3TJ4A 3UWQA 1AQFA 2WZEA 3W29A 5M17A 1IYXA 4BI7A 4NAFA 5LNUA 1NDZA 1H1YA 4HNLA 3GIYA 5LNVA 2F2HA 4TTUA 3HF3A 3NEHA 3UPBA 1DWJM 3P3BA 4PUJA 3GHSA 4JYFA 4RNHA 3NO1A 1JCLA 3FYOA 2A7NA 1B5TA 2QJHA 4B5TA 5BZAA 2WMGA 2BLEA 2VR5A 4TMCA 3K13A 1FOBA 5CZTA 5AVHA 4FLRA 4RLIA 1LBLA 4Z1YA 1QVBA 3U2ZA 3TJLA 4X3ZA 1LRNA 2OKOA 3EA3A 4W88A 5TNVA 2QMKA 2FZ8A 3EA2A 3WBAA 1SMAA 1C7SA 1GVFA 1H50A 3NQDA 7A3HA 4E5TA 2VR4A 1W5PA 2PTZA 3VC5A 3MW7A 1B30A 1DJHA 3L4VA 5MKGB 3CB3A 1TPB1 4RDVA 3M6DA 5I09A 1H0IA 1I1XA 2XVNA 4TU1A 3WQVA 2BGSA 2QT3A 1RLDA 4UB9A 3I4EA 3URAA 2X1UA 1M03A 1PTAA 1EC7A 1NQKA 1VIZA 1P0NA 5AHIA 2WJZA 2D2OA 3EEZA 3VKJA 2WJEA 3DC8A 3IVSA 4P7QA 1F07A 1MDRA 1DJIA 1ADOA 4GI6A 1OIFA 4A3RA 4M80A 4D2JA 4PMNA 4Q4RA 3AU6A 2VX5A 4BWLC 2YJQA 1L6SA 4IM4A 4PMJA 3FEMA 3CV7A 4WSJA 1DWIM 2YGYA 4PSRA 1RK6A 4ADSA 1VD6A 3WLSA 2CNCA 4HNCA 3KZSA 2CLLA 1U33A 5AB3A 3HJEA 4CNPA 5EMUA 1J0YA 3ZMRA 1X6NA 3GYCA 1XLBA 1R3YA 1U5VA 2OQHA 3N2BA 1J6OA 1GONA 1EYEA 4IQEA 5A6BA 5JIPA 3K4AA 1C8VA 1OZMA 2BODX 3NYZA 4R9OA 1XYAA 2FH8A 3TSMA 3TW9A 5M2FX 1FWEC 2WMIA 4ZO9A 3NDOA 2MANA 2XIQA 1GVOA 1V0NA 2V5JA 1J4EA 3SCWA 1HJXA 1XW8A 1C7TA 5GNZA 1FCQA 2E6FA 4LJ3A 2OEJA 1VCVA 1O7AA 1XX1A 3LPPA 2WSYA 3GFXA 4R7WA 1VLIA 1MQPA 1G01A 3UCQA 1FDJA 4GHRA 3W84A 1W1YA 5CPSA 3AQUA 3TLQA 3A24A 2HQAA 4BF5A 1M68A 4QG9A 2ZZ7A 4JHMA 5IXEA 1XC6A 3WX7A 3VD3A 4C90A 1MRQA 2NQ9A 2Y2WA 1KM4A 4PTMA 4C1LA 2QCEA 2V67A 4HK6A 1OFOA 3O6DA 2INZA 3T7VA 2H9AA 2JKAA 4GYJA 5T91A 3WFAA 4ZQNA 4LUIA 2HBVA 1TUFA 1JAEA 1AD1A 4AIEA 3CB8A 1VR6A 5HNNA 2Q8LA 1K70A 3WMCA 3ERPA 4RJEA 3P81A 2A79A 1QI0A 1DWAM 1OYCA 4DLFA 4AVFA 2R94A 3OLDA 3GXMA 1TWIA 3THUA 2JFEX 5IBXA 3WQFA 1NOWA 2PBOA 4D8LA 1R8LA 1V6YA 3GXDA 1K6WA 4RZBA 3H4XA 2QNEA 4QJ3B 3S1WA 4I9AA 3SCNA 4WF7A 2PDKA 3OG2A 2DZAA 2G95A 4PMZA 2REQA 4IWWA 1UZ4A 2IMRA 4R33A 3GUGA 4NXKA 5HDRA 1O68A 4DJDD 3T0BA 1VRXA 3TQKA 3WQCA 3MDWA 1Z89A 3WUGA 1VCGA 1LLZA 1ITXA 1IHIA 2WQPA 4HA3A 4W89A 3UESA 2BXVA 4W8LA 2OEMA 3HN3A 4QHRA 3RO8A 1W3TA 3QC0A 5HQEA 1X6UA 1IQ8A 5JBDA 4KPLA 3A47A 3P0WA 2I5IA 1EYWA 2HPIA 3R5EA 2DSZA 1YMYA 4AYGA 4I9TA 4M7TA 1HX0A 4F2UA 4JCMA 1J18A 3UZZA 2D2HA 4B3LA 1OFBA 3ZJ8A 1OVDA 3WF0A 2NLIA 3HA1A 3ARWA 3G1DA 3C56A 1A5OC 3OG3A 4RW5A 3M4HA 3VKCA 1F4AA 4P8WA 1YPIA 1W32A 1Q4NX 4QTGA 5BNKA 2VMFA 4L1WA 1WKDA 2GJPA 1VB9A 3LOTA 4I6KA 4Z2HA 3SCQA 2EG7A 4K68A 4FLSA 1CXFA 2YZRA 4ALDA 1UUMA 1UBPC 3KAOA 2AOSA 2PRLA 4IMFA 1A5KC 3VGDA 4HIBA 3FK4A 4PFHA 4EVZA 2YB4A 3L4UA 2VDGA 4BK9A 3GFZA 3RN6A 3AYVA 5FESA 3CAQA 1F4HA 1EO7A 2Z00A 2PTXA 3WSUA 4O8RA 4LX4A 5C71A 1NF7A 4ZQCA 4IMGA 3GDMA 5K4ZA 3TFXA 3R58A 5F2LA 2Z7KA 3M41A 4X22A 1XKJA 4KFNA 4DYKA 4OGZA 2NLYA 2XG9A 3UY7A 4H6QA 1RXOB 5XIAA 1T6MA 5CXPA 4L9ZA 3LHVA 4L4OA 1VIWA 1GPWA 3ECQA 2GGHA 4F0SA 1L8NA 2GYIA 1R87A 2J24A 1XYCA 2WSRA 1JCYA 1VJZA 4YTTA 4PB3A 2GDVA 3WH9A 1OADA 2YW4A 1P1XA 1V02E 4DUXA 1XLGA 5AHNA 2WHJA 2X1IA 1E15A 4GIAA 5BRQA 3USBA 2QV5A 3RCYA 3V18A 5K9DA 5AHMA 2BHZA 1E9IA 3LXCA 1ISWA 2ZX9A 5I79A 2E40A 4JGDA 4IUOA 3GLCA 3WLMA 2OLSA 1XRTA 2RKXA 2FPYA 3W82A 2DZWA 2CIPA 3DGRA 1QO2A 1HN1A 2WZIA 1MUWA 3WJXA 2YOCA 4UNKA 1MQQA 2QPUA 3WQWA 1NSJA 1CB7B 3ARZA 3LRMA 3R43A 1QASA 1ADSA 4XKYB 1I2OA 1ZQ5A 1R0MA 5J8LA 2E6YA 3KCJA 2GDUA 1DOSA 3H7UA 1SO4A 3LTYA 4EKJA 3G1RA 3ARRA 3BW3A 4CVUA 1IXPA 1N7KA 2Y0FA 2OTDA 2HBXA 3MKKA 5HWNA 4A2RA 3ZQ9A 2FFIA 1XLCA 1ELSA 2DP3A 1H62A 1XLFA 3NDZA 3OGRA 2CLHA 4GJ1A 4M6QA 3N18A 4FF5A 3GC4A 4BR1A 3RUBL 2Y5JA 1B3YA 3I7RA 1ZS2A 4WGXA 5HWMA 5CPQA 3TOYA 4HNNA 3E96A 3KDNA 4H9UA 5IBXC 7REQB 3SUUA 3OYXA 2CFFA 3UPMA 2CCRA 4PFMA 4MJ2A 2WO5A 1D8WA 4F0KA 2C0AA 2Z1WA 1W3LA 1U30A 1MUCA 2GQ8A 3OP2A 1OCQA 1JFHA 1SW3A 4C7GA 3ICJA 3M9YA 2CLOA 2W79A 3QSRA 5EMKA 2ZZ6A 5E0CA 4O1FA 5IFPA 2W0UA 3M0MA 4CU6A 4ZQOA 2DQWA 3EBVA 2YCEA 3UXLA 1LOLA 1JYNA 2F84A 3N6HA 4CN4A 1D3GA 4L7ZA 3OYZA 3E5PA 4WRHA 3E6EA 4W8AA 2PTDA 1NFBA 2ZTJA 3H7RA 4AVNA 1KM3A 4DWDA 3NAVA 1LOQA 2ZUVA 2WSKA 3DYPA 3AMLA 3N73A 3VD4A 1PKLA 4KCTA 2CKSA 1TA3A 4HNOA 5CKSA 3MWCA 2EHHA 1NFPA 4IZGA 4NKCA 3R89A 3SCUA 4JTQA 2X7VA 3E1F1 2KAUC 5DXXA 1GYMA 2WMFA 2QCCA 2J9ZA 4MF4A 3V7PA 1KXHA 2V63A 2YW3A 4HHLA 1M7OA 1JRBA 4XTDA 1CLKA 3GNRA 2VM8A 4NZ4A 4NILA 4V1YA 3FVDA 3ID7A 1LLOA 1R7AA 4QDMA 1UWAA 2E1DA 1CLXA 3W1RA 1A5NC 1SJCA 1FHVA 3RX2A 2VRKA 2Y8KA 2FLIA 4UCFA 1E4LA 4JIEA 3IJ8A 4TO8A 4DZHA 4H6RA 1DXEA 4XAFA 3PG8A 5AOUA 1NDWA 2DZXA 3Q4DA 5A2AA 3S1XA 3JW7A 2ZXDA 4QCEA 2DVXA 2XN2A 4WJ8A 3GG8A 3MP4A 1Q6RA 5LGZA 1K8XA 1UPMB 4BI6A 3I6TA 3CLWA 3VAVA 1EGMA 1ZAIA 3WJZA 4Z08A 3S42A 2CXEA 3KL3A 2OO6A 4CU7A 1N55A 4XD4A 3F4WA 1L6FA 4TIMA 2Z29A 4LPCA 3UT0A 4YLWA 2Y62A 2ZRWA 3BG3A 1SFJA 3NQBA 5AFDA 1NWSA 1KRAC 2INFA 3VNYA 4HZ7A 1A5UA 3O07A 3QQWA 4P8UA 1ZNNA 5CZJA 4U4MA 3S2JA 2NWRA 3P8JA 3ZXWA 6REQB 3CK5A 1TX0A 1FFQA 1CXLA 1W2PA 2ABBA 4POCA 4D8ZA 3QR1A 2QCDB 3P0XA 2JGQA 4TUFA 2WMHA 3BURA 2A3LA 1E9YB 1GT8A 4F3HA 4P8VA 4CQDA 5CH9A 1K7XA 5CJMA 2VFGA 3SUTA 4FMVA 1XJBA 3WH7A 4N9DA 3T09A 4FHAA 2BGNE 2X16A 3W7QA 2Q8XA 5HUOA 1W9PA 5CAKA 2PTYA 4RNJA 4QLLA 1ECQA 1F3WA 1PSCA 3MBDA 4FB7A 3WDRA 3II1A 2A3BA 5G4EA 1DE6A 4DPPA 2WKJA 4S2CA 5KZEA 3NPXA 5I06A 1P6BA 1YTKA 1V03A 1KWGA 4MFDA 3GIQA 1KGUA 1YYAA 1TJRA 2WLZA 4D6DA 3GBDA 3DFOA 4JKKA 2YCKX 4NF7A 1MQRA 3P14A 1S3HA 2YXOA 4W4QA 5D9MA 5J5DA 1Y5XA 1K8CA 3G3DA 4XV0A 5CPLA 4KWUA 3L21A 3KOYA 1YXYA 1UKTA 2A6LA 4AF0A 2P50A 3DI0A 1GEHA 2CU0A 3QLLA 3KLKA 5FD0A 3OGVA 3L4WA 2C1HA 2DU2A 2HVOA 4UTMA 1H1ZA 3AHYA 4V27A 1O1HA 4D1JA 1LUCA 1A5SA 2GJRA 1IWPA 4QEEA 2YIHA 1S2UA 1I45A 3G6LA 1EXPA 4BEQA 3E74A 3UQNA 4A22A 1ZZMA 2AKMA 1LT8A 3ZJ6A 4IICA 4OUEA 4OE7A 1D2KA 5FJRA 5CZKA 3WL0A 1A53A 2PB1A 3ZSSA 4I7UA 4ZXLA 3CYJA 1K3UA 5G4WA 4PE8A 2OX4A 2ZDSA 3AYSA 2DW6A 4UTUA 3W2NA 1WDRA 3N4EA 1V08A 1U5HA 3NOEA 2P76A 4NJKA 3LB0A 3SI9A 5CZSA 3VNIA 2GWGA 1ITUA 1H2JA 4RDYA 1IZKA 3GXTA 1LQ0A 1W56A 4QE1A 1AG1O 4JD4A 4ROQA 4C7FA 4GVHA 1D7KA 1O5KA 3O0KA 3NO3A 3TYCA 2XSAA 1WXYA 1KFEA 3QM3A 3TROA 3UA4A 3BGJA 4XZHA 5TQLA 3URQA 2VCCA 5ECVA 4LVAA 4H7ZA 3GG7A 3MO4A 1EZWA 5TD4A 3MUIA 1DWHM 2NXHA 2WW5A 3C3UA 3KOWA 1NAL1 5AVNA 4ENLA 2W4XA 4A2SA 1IGSA 3WNNA 1ZUAX 4KS0A 3QEZA 4OVXA 3UZ5A 3BQ6A 4IL2A 4GINA 4ZL1A 4QG8A 1E0WA 3EMZA 2GVYA 3OVGA 2NV2A 4MNJA 3M0JA 1W2VA 4PRWA 4H41A 4XZBA 2HS6A 4GACA 3W1MA 2YCIX 3FA5A 4M6PA 1OYBA 2QCLA 4IMAA 3VX1A 3H2EA 3LBMA 1FY6A 5A94A 3AIRA 1TE6A 4YXGA 4ICCX 4Q8WA 3KWSA 3EXTA 1FCVA 2YXGA 2CBJA 4WOQA 3RPTA 3LNMA 3H12A 2VX6A 1GVSA 4NNBA 4EF8A 4M19A 4KEVA 2XH7A 5LNWA 2PDMA 5K2ZA 3S5YA 1TV5A 5DLCA 2EPNA 3S46A 1I6NA 3W6LA 5IHRA 3WH5A 3AOFA 3W25A 3I3BA 1ONXA 3HG4A 2Z7GA 3CAKA 4RCXA 1SQ7A 1KTNA 3W2LA 3HMJG 3M16A 4MB3A 5A8GA 3KHJA 4B16A 3BMVA 3FJNA 3AIQA 2FTYA 3PNZA 4QS5A 1OYAA 2OELA 4WGHA 4IIBA 4LW7A 1VFLA 2R1KA 1A50A 1P48A 5HJLA 2NQ5A 3CBWA 3STFA 5GJMA 1GYNA 4WSHA 3P84A 2WSQA 3MUZ1 4IQLA 1R6WA 1CI1A 3WNKA 3M5ZA 3W88A 1BRLA 4EE9A 5A6KA 3PZGA 2B0MA 4H3DA 4TOQA 2CWNA 2ADAA 3WEOA 3NTYA 4L6OA 1DJZA 2XFRA 2QXWA 4WJEA 3CO8A 5DMLA 1QBBA 3E2QA 3Q67A 4ORIA 3VNZA 4JKMA 2FFCA 3LX9A 4RPQA 1I2RA 3D3AA 5JBFA 1FWTA 2P88A 1ICPA 2OGYA 2I5QA 2ZIDA 3V36A 1DJNA 4KWVA 3WLHA 3DG6A 2J47A 1PZ0A 2CITA 3VNJA 4OBRA 1JDAA 4F9DA 2JE8A 3NDYA 4UOJA 2VC7A 2Z25A 3MV11 2XH0A 1XS2A 4QCFA 4XVEA 1Z42A 3AMKA 3AXKA 2ZTKA 4ZB5A 4WJXA 4A3QA 3EKZA 1UD6A 4LRTA 4J2PA 2PI6A 5LIUX 3MKVA 2FZMA 1JUEA 3VXGA 3WK2A 1SYTA 4BQ3A 4QJ1A 1K77A 1G7UA 4H8UA 2WC3A 4WSKA 3UG5A 1O6IA 1UKPA 8A3HA 4JFWA 1MXGA 3IJLA 4DJED 1W1IE 4S3EA 3UJRA 1BXNA 3KXQA 4PB5A 4ZO7A 3C2FA 5JIWA 1Q7ZA 3QOMA 1GVIA 2G37A 4J5NA 3IJIA 4AY1A 1L6YA 1TSIA 2O9PA 3EA1A 3S0CA 1W3KA 4UTWA 1S5VA 1FP9A 3KS5A 4YNGA 1RCQA 4YPJA 1P6CA 1R3RA 2GVGA 4KETA 2D0HA 4LVGA 1QK2A 1ZBWA 3H2FA 3HQNA 2J7BA 4JHOA 5A2CA 3MA8A 2GDQA 4KCWA 4Z2JA 3NL5A 5G2WA 3AXIA 3HQPA 5CLTA 3W7HA 4US6A 3MB9A 5BOOA 2ZC8A 1H3GA 5JXQA 3GZAA 2HTMA 3NZ1A 1E5NA 5EBUA 1PE1A 3BJSA 1L0PA 1FXPA 3GVVA 4ZMGA 1NDYA 5DFAA 3LRLA 3AYRA 2BASA 3OA3A 5CLWA 3BW4A 1UASA 1UCWA 3RO6A 2DSKA 4ZFMA 3ARUA 2D73A 4D1IA 3BUVA 1K03A 1SZNA 2CESA 3CHVA 4D71A 4NJHA 4QJ5B 1EHNA 3RM4A 1XIBA 2F2KA 1X98A 3CMGA 3PTDA 3WQDA 2HRWA 2Z1VA 4L5ZA 5JH1A 1WB0A 3QY7A 1RUSA 2NV9A 1PEZA 3MDUA 3OZOA 1C91A 2VZTA 3PN8A 4GNJA 3AICA 2QUNA 1AQ0A 3F4NA 3AZTA 1UZDA 1GQLA 1HUVA 5AC8A 4UCGA 3ZT7A 1M04A 4AD3A 2KZHA 1HQTA 2WVSA 3WENA 2TRSA 2PDLA 4TVCA 5CBBA 4QP0A 4Q8QA 3M0XA 1GJPA 3LCLA 3V35A 2RHGA 1XL9A 4TV6A 3UZXA 1JGMA 2FQIA 4K38A 4CCDA 4S2BA 2Y5SA 4MKVA 1EPVA 4AEFA 4HOWA 4PL2A 4BCEA 3HPAA 1Q7MA 1F05A 3SQMA 3B0VC 2ZRYA 4QISA 3PUDA 2XIJA 1AZ2A 2ACQA 1UR0A 4DHGA 1TTPA 3EWZA 2VGFA 1MW1A 3IIOA 1SMDA 3WQOA 3QC3A 1DBTA 5B7YA 2WYSA 1KFWA 1MMFA 3APGA 1FWSA 5GNYA 5C9RA 3W7PA 4WLCA 3TH6A 1KM2A 1QWGA 1JL8A 4DF2A 3MSRA 1QT1A 3JU2A 3IIXA 3L66A 5FJIA 3W1TA 4EXAA 4CD4A 4RX0A 2OWCA 4KWSA 3RIKA 2DUZA 3L7RA 1KB3A 4EACA 4LAMA 4J7RA 3VKDA 3U4AA 3B06A 1UHVA 2OX1A 3AS0A 4ROPA 5EFDA 1ZAJA 5BWAA 1GQKA 4NYYA 2Y7EA 1G4EA 4Z2KA 4UTTA 3AZSA 2RH9A 3CNYA 3KE0A 3IUIA 3TE9A 1OC5A 3NJ3A 1GVRA 1CBGA 4H7CA 4AUBA 2F6UA 3BO9A 4HD5A 4TVUA 3SZ8A 4JFSA 1H0GA 1OZQA 4E2BA 1XSKA 1GW9A 3PJWA 3RRXA 1O95A 1DYSA 3GXNA 1V6UA 3W02A 1C3FA 4TX8A 1R5YA 3AMDA 2BVWA 2FHBA 4QSHA 1XYZA 2XFWA 3I10A 4JNYA 1E1CA 3U2OA 4NHVA 3ITOA 3WMBA 4G7EB 2ZBTA 3ES7A 1K7EA 3SM0A 3RXZA 4JTLA 4C1NA 1UMYA 4YTRA 1BWKA 3FSUA 3GNDA 5HXMA 3VCRA 2G50A 4O16A 3VIFA 5I3GA 2DGAA 2GK1A 2WBGA 3A6OA 4W84A 1X1NA 5AHFA 4DAIA 4QX4A 3CV1A 3L67A 4HPGA 3MVIA 3NVDA 3USZA 1G94A 5C9WA 3RCNA 5GQBA 3DECA 1KCKA 3Q94A 1PV8A 4ZXOA 4JNMA 1WP6A 4DIAA 1NIUA 3O63A 2PWHA 2O55A 2J62A 1OFDA 5LA2A 3D47A 3WDHA 1GG1A 1RSCA 2YCLA 1VLWA 3R13A 4IMCA 4LCQA 4QNEA 3BC9A 3WUBA 4PRRA 1CX9A 3OJGA 5FAGA 2A4AA 3R0KA 4HMNA 6A3HA 1DJWA 1IT7A