3C61A

Crystal structure of dihydroorotate dehydrogenase from leishmania donovani
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
b'TMSLQVDLLNNTFANPFMNAAGVMCSTTEDLVAMTESASGSLVSKSCTPALREGNPTPRYRALPLGSINSMGLPNNGFDFYLAYAAEQHDYGRKPLFLSMSGLSVRENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPQVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANVNAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGPAIFERLTAELLDVMAKKGYQTLDEFRGKVRTLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Dihydroorotate dehydrogenase from Leishmania donovani.
rcsb
source organism Leishmania donovani
molecule tags Oxidoreductase
total genus 106
structure length 314
sequence length 314
chains with identical sequence B, C, D
ec nomenclature ec 1.3.99.11: Transferred entry: 1.3.5.2.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3c61A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c61A01
5LHEA 1KM1A 2DU2A 2GPTA 2VXNA 3P82A 3TSBA 5IBXC 5T26A 3TAOA 5AFDA 3W1TA 3G1YA 2A0NA 2C19A 5DY2A 3ATYA 3LCLA 5FF4A 2CFFA 1HTIA 3IVTA 3W07A 5CSRA 3EB2A 4CNOA 1ZAIA 2YZRA 3P8IA 4JYEA 4Y90A 5LNVA 1ALDA 1K7EA 3G1VA 3ABRA 3A9IA 1ME7A 3GR8A 4DEFA 4W9TA 2RKXA 3G24A 4GUJA 4FX6M 4XWUA 4XTIA 2C15A 4X9SA 4DO5A 4O57A 5K7JA 4LS0A 1JQVA 4RXFA 3GDMA 4FIRA 4GRSA 4Q32A 3KOFA 3LLDA 1FWSA 5D2XA 1FUYA 2JGQA 3QW4B 2E6DA 1L6YA 3CU2A 4DBEA 1TPWA 2NXIA 3MWAA 3G1SA 1KBIA 2RH9A 2Y61A 5I3KA 3LI1A 5AYYA 5CPLA 3TW6A 4UTHA 1BEUA 2VEPA 3MP5A 3PY2A 3IGXA 4MIMA 4MY9A 3EKZA 1AW2A 1AG1O 4NJJA 1EUAA 1LORA 1TB3A 4LT9A 4MFEA 2B7QA 3W7QA 3PWAA 5FF2A 3P67A 1F6PA 3L0NA 3MBDA 2ZFAA 3U6WA 3FA5A 1QR7A 4GUGA 4UR7A 4BR1A 3G0UA 2J24A 1K3UA 4K8HA 3KFTA 4IMFA 3DKLA 3PF3A 1LRTA 1VLIA 4Z0SA 3G3MA 2QEZA 4ADTA 3E12A 4M7SA 4MFDA 1C29A 2XN1A 2ABAA 4AH7A 4UTIA 4DF1A 3BLEA 4O15A 3STFA 4DPPA 4JTSA 5TIMA 3LCWA 1V7YA 3BG3A 1W31A 2CZDA 1OK4A 1H51A 2XFWA 4HN4A 1TV8A 4O1DA 1DQXA 1FDJA 4HPXA 2GVJA 3W2JA 5KZMA 4UFIA 3WJZA 1TYGA 3IVSA 1SSGA 3W7MA 3PG8A 4KKXA 1YADA 1S5TA 3C3NA 2QDGA 5K3VA 2O7SA 4C1LA 1FWRA 5D2YA 1AW5A 1BWKA 4I7VA 1OF8A 5K9DA 3EXTA 5F1VA 2BTMA 1UCWA 1Z44A 3B0PA 5G2IA 3QYQA 1YXCA 2A6LA 2ZQ0A 3G1DA 2Q8ZA 1GG1A 1H1YA 1G4EA 3W84A 3W2UA 3TC6A 3QZEA 3CWOX 3OVRA 5G2WA 3GX9A 1TTQA 3FYOA 3O6YX 1UJPA 1JCXA 3FOKA 2E68A 3RNDA 2QUTA 1ICQA 2TRSA 1H7XA 3GKFA 2CZ5A 3F4NA 4JDBA 3O15A 3UXDA 1W56A 2J9XA 5FF0A 1KLYA 2E5CA 4TIMA 4QSHA 1M7PA 2R91A 1DBTA 4IX2A 4WX2A 1PE1A 3STEA 3W7PA 3MYOA 1TQXA 3EEGA 5FI8A 3ANYA 4CQ9A 4LOCA 2NUXA 1QOQA 4OT7A 3RLVA 2V9DA 4DF2A 1H63A 3TROA 1H7OA 1RQHA 3QPZA 4HT3A 1TPB1 1GG0A 4O12A 2Y88A 3BVJA 4WJEA 3L66A 5DELA 3TXVA 4UFMA 4BWLA 1W8SA 1XCFA 1OX4A 2DP3A 2B7OA 4FHAA 6TIMA 2X2GA 3TUUA 3EX2A 1VH7A 4N2YA 5F2GA 1H61A 4MYXA 3THAA 3B8DA 4O0KA 3Q58A 3Q94A 1FDYA 3MBFA 4WQ6A 5H2ZA 1F73A 2Q8LA 1VZWA 5D30A 1UBSA 3TJXA 2X16A 1KFEA 2E6AA 4OHQA 4LS1A 3M7WA 5CKSA 1H7PA 6ALDA 5EBUA 2CZEA 2VEIA 4XBSA 4JDYA 1VHCA 2W79A 2BXVA 4TX9A 5HINA 3HG3A 3TKFA 1EA0A 1MXSA 4Q33A 3DBPA 2ZZ4A 3RU6A 3W7LA 3G3DA 3LHYA 3PVFA 2NUYA 5BRBA 3SR7A 1W5OA 3S5NA 5LNWA 3NG3A 4BK9A 4LY8A 3W86A 2TSYA 2DZUA 2H3BA 3CIWA 1ZALA 4NXKA 2VOMA 4XQ6A 1LTDA 3EX1A 3HGSA 1XUZA 1ADOA 2Z6IA 4JTLA 3NZ1A 1EP1A 4L4MA 3KXQA 3L67A 5BMXA 3PB0A 4N4QA 3R89A 3TDFA 2V8ZA 2PE4A 3V75A 1ZHAA 3WJWA 3W7NA 4UTTA 3LXAA 4QJ1A 4TMBA 4HNTA 2CU0A 3DFTA 5F4XA 3NQ2A 3CB8A 3FLUA 3NQ6A 3L68A 1XBXA 2QF7A 1JJKA 3RMJA 2LLEA 3TV8A 4D2JA 3NOEA 1T0OA 3P62A 4N02A 2NWSA 3NEVA 4ZQCA 3GR7A 3T78A 2QJGA 2V5BA 4O1AA 1EP3A 1B4EA 1R2SA 3A24A 1WV2A 2QCCA 4K7YA 1RQBA 5EA9A 3SW6A 5FESA 2G95A 3L21A 2CLEA 3UY7A 2J27A 3WK2A 5C54A 3LTYA 3LHVA 2HTMA 1L6WA 3FJLA 5AHNA 1M7OA 4O10A 2Y62A 1B4KA 4NUWA 5KINA 4XUGA 2ISSA 3N34A 3W6YA 2ISWA 3I6RA 4NNBA 1JUKA 3QEZA 3NPVA 1IXNA 3C52A 3KHJA 4ZL1A 1L9WA 3S5ZA 3UZ5A 3SZ8A 2VKZG 5DN1A 3M5XA 2CLHA 1ML1A 3PBVA 3FS2A 1F74A 1WXJA 3W85A 2Y7EA 3M5YA 3UWUA 1XKYA 2QCLA 2Z2UA 5AHEA 4P61A 3HO8A 4LUJA 1G4SA 2J88A 3P80A 4RXGA 3KVLA 3AO0A 3BW4A 4YCPA 5BMWA 1X8FA 2W0UA 3WK3A 3Q2DA 5EKYA 1YDVA 3STCA 5F4SA 4ORIA 1BKSA 1RZMA 3BPWA 1A50A 3HG4A 3TQ0A 4M6PA 4A3UA 3W2LA 3DFPA 4LC6A 5K9XA 4UUIA 4I7WA 2PRHA 5AB3A 2A1YA 4MJMA 3DFNA 2JKEA 3A21A 3BW2A 1KM3A 3PBYA 3HPSA 5HR6A 2DJXA 4AWUA 4B5NA 4NNAA 1AW1A 3TA6A 4QM1A 5G4EA 3GXNA 1I2NA 2ZA2A 1DJQA 1HO4A 3C8FA 3TC7A 3W2MA 4FNPA 3B06A 4ZQMA 1ZNNA 1OG0A 4AXKA 1Z41A 4MKNA 4A21A 5SWUA 3DZ1A 5CZSA 1VCVA 1TPDA 4N9BA 4ZQPA 1MEIA 4BFAA 3LLFA 4QAIA 5L9FA 4PC8A 1OJXA 5TQLA 3CWNA 1ZJIA 2JK2A 1PVNA 3NQDA 2B4GA 4IMEA 1FCBA 2NX9A 4R7JA 5BOOA 5I3GA 2VFDA 3GIYA 1KTBA 4UNKA 3YPIA 1TPFA 3WJSA 1JCNA 4TO8A 1AL8A 3W7JA 5CZTA 3AJXA 3IIZA 4UR8A 1QPOA 2QCEA 3GDRA 3QSTA 3HPZA 1I45A 5HMSA 3S5OA 3TJLA 2Q3RA 3EWBX 1MEWA 2AAMA 3G18A 3I65A 4K39A 3DGRA 3W1PA 2QJHA 1N7KA 4O50A 4CQAA 1J4EA 3QPYA 1TPH1 1VYPX 3PBWA 5A8GA 2NXGA 4IUOA 1WOBA 4UTWC 3I7QA 3M16A 3T7VA 3QM3A 1TIMA 1RQEA 2P0OA 4P2VA 2VFGA 2I14A 3B05A 4YLWA 4U28A 1AMKA 4JEQA 1JCLA 2CLIA 2V30A 3VCRA 2CLKA 2WNZA 3NQEA 1LRNA 1MZHA 4LU0A 3JS3A 3UD6A 3SI9A 3PBUA 3DI1A 1T99A 2ZRUA 5IBXA 4GE8A 4CCDA 5DBUA 2DZSA 3EXSA 1NSJA 1QFEA 1FY6A 3M6YA 3PB2A 4LVDA 4Z08A 3UNDA 4JR5A 3UY8A 1TPUA 5LNSA 2E5BA 3MI3A 4JX4A 2RHGA 2X1RA 1XI3A 2FB3A 5I3JA 1YDOA 4DO4A 1G4PA 3QSRA 1OX4B 3EWXA 3I7RA 3MHFA 1KM0A 3N2XA 5AYXA 1GOXA 1OFAA 3W22A 3FJ6A 4MZ1A 4AHOA 2FTPA 4GFSA 3GKAA 1SZEA 4UXDA 3F4WA 3WJXA 2YW4A 3CHVA 2WJZA 2A5HA 3MYPA 2F7FA 4EIVA 4E2BA 2XN0A 4S2BA 1RD5A 3LGEA 4HSNA 2D73A 1BWLA 4KFOA 3OA3A 2YDAA 3M0ZA 2WNNA 2QCFA 4GUIA 3KVJA 1XM3A 4K36A 1KFJA 4ICNA 1LLZA 3G0XA 3P74A 1IF2A 3OVQA 3TMQA 4ZQOA 4IGHA 3C4UA 1D3GA 3U2OA 5E1QA 3LERA 2RDUA 2A7PA 2GQAA 1H7WA 1VQTA 2J9YA 1WDWA 1GT8A 3A22A 5DBTA 2DZPA 2WQPA 2VFFA 3TSDA 1V5XA 5F2MA 1O5KA 4NX0A 2A21A 5D02A 5AHLA 1SR9A 1W3NA 4LRSA 1JQXA 1A53A 4H6KA 3ZS4A 3V1PA 1R47A 3O07A 4A2SA 3NM1A 5D2TA 3WFAA 5L6UA 1G69A 1YXDA 5LNUA 5FEXA 5ABTA 1R2TA 2EF9A 5I3FA 1VPXA 1YXYA 5CG7A 4UFJA 2PRLA 1JUEA 1S5WA 5GVJA 1Z48A 2FIQA 1LRQA 1L6SA 2YFOA 4LV9A 3LCHA 4XBKA 4NX5A 1TJPA 3GLCA 3W2NA 3L2IA 3DHFA 1XFBA 3LRLA 2XN2A 1ZENA 1FXPA 5D37A 3S9YA 3R8RA 1RPXA 2ZA1A 2DZWA 2DZXA 3NM3A 1SO5A 5CZ0A 4MY8A 1H5YA 1G67A 4IXXA 2ZZ5A 1IXPA 2R94A 3DHDA 4OV4A 4O8RA 3KAOA 5LGZA 4UFHA 1SUXA 5E0KA 1QPRA 1DV7A 1F05A 3P5ZA 1LP6A 4E38A 2ATMA 2QAFA 4DBDA 4TU1A 4RZ4A 1OX5A 3BV4A 1UASA 1SSDA 1SU5A 3W1UA 2R14A 4NVTA 1HG3A 1K8XA 3PUDA 2YGYA 3D0CA 1LOLA 3INPA 5KITA 3PR2A 1M6JA 3TE9A 1YTKA 1SPQA 2FPTA 4RJEA 3GK0A 4LV4A 4UCGA 5U7SA 2OT1A 2NV1A 3L5MA 5AHMA 1GTHA 1I2QA 4UMCA 1LOQA 2H6RA 3H55A 4HPJA 1YDNA 3BG5A 3NPWA 4IPIA 1D3HA 3C6CA 4DO6A 3CIXA 2Y85A 3C2OA 4QITA 1SFJA 2CLLA 4N6EA 2Z1BA 2QDHA 2RFGA 4PH6A 3VFLA 4MLJA 4JTTA 1EEPA 1G7VA 3W9ZA 3EWZA 3W1AA 2VFHA 2GJNA 4AHPA 4NZJA 4Z1AA 3TW7A 4FNTA 5DXYA 4YCOA 5U4NA 4AWTA 3F03K 1OFDA 2E6FA 3S6DA 1F76A 1O94A 3DFOA 3NO5A 2ZTJA 4EVZA 1GJPA 1FQ0A 5G5IA 1R46A 1W54A 3B0UX 3C2RA 3M44A 1FDZA 4Z1CA 3HQ1A 1KA9F 1XBZA 1SZNA 3MO7A 5D2VA 3MW7A 3QFEA 3TNOA 2ZZ2A 1X1ZA 1FX6A 2B7PA 1SO3A 3NPXA 2HS6A 3UQNA 1GZGA 3LCFA 2YX0A 2UV8G 3TSMA 2EPHA 3HPXA 3W1XA 2GJLA 5AC8A 2FB2A 4N9DA 5KMYA 3NXFA 2WSQA 3CQ0A 4K6AA 1H60A 1MEHA 1CI1A 4MJZA 4PL1A 3W1QA 3N14A 1J5TA 1R30A 3NGJA 4IX0A 2RDWA 4JNMA 4JTFA 4N4PA 1G6CA 1VHNA 1TTJA 4FIQA 3IIVA 4O1CA 3SIZA 2QCGA 2FJKA 3G22A 5D09A 1ZCOA 4RV8A 3QQ0A 3E96A 1Y0EA 5F2LA 3LB0A 3LV6A 2Q3OA 5D38A 4JYFA 2C0AA 1O4UA 4O17A 3RK8A 3ABSA 3IIXA 4K38A 3W72A 1H7NA 2I1OA 3BO9A 4I7UA 2Z6JA 4CNPA 4WY0B 3UWVA 4IOTA 3VKJA 4JXCA 5EYWA 1JULA 4IPJA 1FCVA 3S1VA 2DZTA 3W2KA 3ATZA 3SFKA 3UPBA 5C55A 3LTSA 2NV2A 1G7UA 1YYAA 3O6DA 4YXGA 4FB7A 1X1OA 1KFBA 3JRKA 2WSRA 3R12A 4X2RA 1SFLA 1DOSA 3OG3A 1G4TA 5KZDA 4LVGA 3FFSA 3W83A 1EX5A 2V81A 1PCWA 4FNUA 3HB9A 1QAPA 4OWGA 4AWSA 3W7KA 3TAKA 1TQJA 4DPQA 3S1UA 1THFD 2QUUA 2X1TA 3QMRA 3M47A 3U8GA 4CLMA 2W6RA 3TXZA 1QO5A 3BGGA 4G1KA 1Z42A 2BZNA 4JTKA 2A85A 3LBMA 3NL2A 1Q45A 2QJIA 3N9SA 3TH6A 4DQWA 1ICSA 2EGZA 2QAPA 3IIPA 4NJIA 3H53A 1P5BA 2FLIA 3NQAA 3K30A 4ZQNA 1I2RA 4UMAA 1QOPA 2GVLA 3LXBA 5H91A 3W1LA 3B4UA 3W7OA 1Q6LA 3BARA 3GNDA 2QCDA 3FKRA 3W7RA 1CW2A 4HNUA 1SW7A 3R13A 3W1RA 4DXVA 4HNNA 1S3HA 2VEKA 1GVRA 1OFBA 4PCFA 2QKFA 4RZ5A 3MMTA 4J9JA 3TFCA 2JGYA 4LVBA 3NL5A 4L4LA 3IRDA 3LCXA 4U4MA 4AF0A 1KW1A 4WOQA 3M5ZA 5D32A 3W76A 2Y63A 4QNEA 4AAJA 4UTTC 1QNVA 1VC4A 3TU9A 3GVGA 3QW3A 2A7RA 1JCJA 1ME8A 3KVKA 1OF6A 3HG2A 4O11A 2EAWA 5F1UA 3FYPA 5BNKA 3DKJA 1C8VA 2FPYA 1LBMA 4AMAA 4M6QA 3UWYA 3B0VC 1Q3NA 1VS1A 2NXHA 3M1ZA 2ZBTA 3GXTA 4RCXA 4FX7A 2A2IA 3G8EA 1W3TA 1EB3A 1B9BA 1WYIA 1KFCA 2VELA 4UTJA 2V0TA 4XKYB 2VFIA 1O5XA 3KRUA 3OIXA 3TQVA 3QH2A 3T4CA 3C2EA 1GVQA 4MVAA 4K7VA 1I8JA 4EF9A 4RR4A 2JBMA 4IMDA 1D9EA 1LYXA 4MUZA 4Z0JA 4WY0F 4ADUA 1A5AA 4N9CA 3IGSA 4O53A 2P10A 3W7HA 4FO4A 4FNQA 2YPIA 2Y6ZA 2ZA3A 2AGKA 1FWTA 1TTPA 3T40A 5C5YA 4FXRA 3B03A 2QCNA 4PODA 2FPVA 2DORA 3HJZA 5D05A 3DFSA 1LLWA 3R2GA 1JRCA 2ZCGA 1FCUA 1QWGA 2WV8A 1VJIA 3C61A 3RF9A 1QO2A 5G2HA 1FWNA 2GOUA 1SZFA 4WXYA 5K4ZA 4JTGA 1M5WA 1HO1A 4A2RA 3PUEA 4KFPA 2ISVA 3EXRA 3L65A 1XDLA 5CSSA 1EPXA 2VEMA 3QF0A 3W7GA 3N19B 1CX9A 1LROA 1WOAA 5CPNA 3DFQA 5EMUA 1L2UA 5D04C 1PV8A 3Q37A 1PS9A 3NQGA 4HSOA 2OJPA 5FF3A 4YMZA 1O60A 2ALDA 4LTSA 4S2CA 3L9CA 4NQ1A 3PSVA 1WQ5A 3W75A 3TR2A 4WOZA 4WY0A 3IV3A 2B7NA 2C13A 4ORMA 3TQKA 4WD0A 2V5LA 4RX0A 4MLRA 5DLCA 4O13A 1KBJA 1K8ZA 5A5WA 3O16A 8TIMA 3S8HA 3WK1A 1TRIA 2Y7FA 3NQMA 3P84A 3O8AA 5HULA 3PULA 1WX0A 3SSJA 3NAVA 1HL2A 4NU7A 3S1WA 3W7IA 3NPUA 4TMCA 5HWMA 5AOUA 4RLIA 5KTLA 3LOTA 1UB3A 4HNVA 4FXSA 1WAUA 4OGZA 4JTIA 4JY9A 4QIUA 1NF7A 1U83A 1EIXA 2F84A 2YYTA 2JKPA 4MYAA 1VGAA 3ZFHA 2E09A 3OHIA 4S1FA 1QPQA 4I9AA 1XBYA 3WK0A 5HUPA 5K4XA 1TV7A 3DXIA 2RDTA 5CGQA 5E93A 2TYSA 2NZLA 3LBCA 1GWJA 4FNSA 3P61A 3G0SA 3MHUA 1WA3A 1F6KA 5G1YA 1OX6A 3G1XA 3PSWA 1SW0A 4GBUA 5G4WA 2AQWA 1SO6A 1DJNA 4UIOA 3CC1A 3LHUA 1P0KA 1WBJA 4PFMA 2EHHA 3O05A 1LM1A 1X7FA 3MI2A 3NL3A 4QISA 4OU1A 3LV5A 3S1XA 3BK0A 3EX4A 1OFRA 5C2XA 5K2ZA 1XBVA 2V82A 3NQ8A 5G1TA 3UXAA 2OT0A 2CLFA 3O63A 4BF9A 1NVMA 3TCEA 1OYBA 1OFPA 3NYZA 1LBLA 2WNQA 4GWEA 1GYNA 3S0CA 3C56A 1DORA 1IXQA 4JTEA 3ELFA 2E5DA 4AVFA 3QQ1A 1U5JA 2A7NA 4JTJA 2QR6A 1XC4A 1JCMP 2PRMA 3KRZA 1F5ZA 3G1FA 3G8RA 2ZZ1A 4GJ1A 4FX8A 2C1HA 5EY5A 2Y7DA 1GEQA 1OHLA 4JX6A 4FF7A 3I68A 1K7FA 1A5BA 4XKYA 3CEUA 2A6NA 1B57A 2C18A 3G1HA 3LRKA 1KTNA 3L0KA 1O95A 1KLZA 1LCOA 3LM7A 4UTKA 3NQFA 2V2CA 4Y6GA 5J5DA 2PC4A 4TR9A 3H54A 3PS7A 3M5VA 1VYSX 3BLIA 1NEYA 5C6MA 3KRSA 1HFBA 1RVGA 5AHFA 2OX1A 3WJYA 2WSYA 4BI7A 2J6XA 4JIPA 3LDVA 4A22A 1TTIA 1NF0A 1ZY9A 2CLOA 2YW3A 4GNJA 4AHQA 3O1NA 4GXMA 3TMLA 3EWYA 5CZJA 3M43A 2QCDB 3HG5A 5AHIA 3EWUA 1GVSA 5EL1A 4JS3A 4OQVA 4CNNA 4OE7A 4IXHA 4MPQA 1EUNA 4LVAA 4LUIA 3LRMA 2NX1A 1H7RA 4AF0B 3GAKA 1LZOA 1KFKA 3NZRA 3CTLA 3NQ7A 3USBA 5DXXA 5HWJA 1LBFA 3G1AA 5HQEA 1EP2A 1KM4A 2C14A 4HHPA 3VE7A 1PCKA 2Y70A 2CLMA 3HBLA 4O16A 3OEXA 3MP3A 1N8FA 4ONVA 4BI6A 3ZR4A 2HMCA 3HGOA 4MZYA 2DZVA 1DKWA 4PTNA 4HKPA 5HJLA 5EPDA 3SGUA 4Y8FA 3NQCA 2X1SA 3FIGA 1VR6A 1OVDA 1TREA 5FEPA 4IWWA 3VE9A 1UUOA 3TK7A 1MSSA 4EF8A 1ZFJA 4MY1A 3FEMA 4ZQRA 4NJGA 1KV8A 3UWZA 3THQA 4LW7A 3PG9A 1Q6QA 4EOUA 4FNRA 1NFBA 4Y9AA 1QDSA 3P60A 4BI5A 2TPSA 5DCEA 2R8WA 5FF7A 4O54A 4ZMGA 3GNNA 2QCHA 5HR7A 3W88A 1GPWA 2C3ZA 2J9ZA 4AB4A 4UTLA 1R2RA 1QCWA 3W1MA 1OK6A 1SZGA 1W37A 4KFNA 2DJLA 5F2IA 3PC0A 3NA8A 1P0NA 3L5AA 1TCDA 4WXZA 3DH7A 1AL7A 1UUMA 1I2OA 2ZZ6A 1KFLA 2Y89A 3LI0A 3QJAA 3PM6A 4KWVA 4K37A 4UTUA 4M19A 4LVFA 5MHBA 4K8EA 2G5WA 3T55A 4O52A 3ZWSA 2YFNA 1C9DA 1J2WA 1XXXA 1JUBA 1NAL1 3E9AA 1JR1A 3VNDA 1TJRA 1KM5A 1GYLA 4Q4KA 4JX5A 4UFKA 3LHWA 3ABOA 3VI2A 2IQTA 3GYEA 3M41A 3GDKA 2YCEA 2HS8A 1YLVA 4O4VA 3NDOA 2E6YA 3GAYA 5D2WA 3JR2A 1SW3A 1VLWA 1DHPA 5AYZA 3SGZA 3OVPA 3DU0A 4WUIA 3TIMA 3QC3A 3BW3A 2Z0IA 4Y96A 1QMLA 1OYCA 3L0GA 3NVTA 1A5CA 1TRDA 1XUUA 3W70A 3HMJG 4CCCA 1TPVA 2ZYFA 1KTCA 2WPBA 2NWRA 4WZHA 4NJHA 3LHZA 3GDTA 1DL3A 2YR1A 3UYCA 5HWNA 4XTDA 2ZRZA 4O1BA 3GDLA 4Z1DA 1MO0A 2OZ0A 4RKAA 2H8ZA 3HIJA 1EWDA 4R53A 5BW6A 3W87A 1P1XA 1W5NA 4BWLC 2JKAA 5D03A 4R34A 3MHGA 3SY5A 5J5RA 1F7BA 3UPWA 3E0IA 3IEBA 3C2VA 4C1KA 2CW6A 4NXSA 3O6CA 2NUWA 1W0MA 4PA8A 5CPMA 3HF3A 2WOQA 2TMDA 2E1DA 4ALDA 2WO5A 3S5YA 1OYAA 2NX3A 4JICA 4MZ8A 3T44A 3CT7A 5KSWA 2V2HA 1ICPA 5FEZA 1VRDA 2ZRXA 1TPC1 5F4WA 1TSIA 3W1NA 7TIMA 1ONRA 3E49A 1YPFA 1GTEA 4DF0A 3UZJA 1H62A 4CCEA 5LGXA 2GQ8A 3W7DA 1I4NA 3UWWA 4LC8A 4FEZA 3TX9A 3W3OA 3SJ3A 5HNRA 1X6UA 1W5PA 5FEWA 1F2JA 3P8JA 2G97A 4X3ZA 4IMGA 2ZZ3A 2ZRVA 3CPRA 1I2PA 4N9EA 3S42A 5TBOA 3MI6A 2ATSA 4RK8A 5KZEA 1PHQA 4JIQA 4UFLA 4OBTA 4M6VA 1HUVA 1YPIA 3C2FA 3N2MA 2P1FA 4XZ9A 3HGJA 2X1UA 5IM51 3TFXA 3MP4A 4EWND 2BWGA 2V2DA 1RR2A 4UMBA 2O7QA 3DENA 4LS2A 4X22A 3LTPA 1H50A 1JCYA 3QMSA 3NNTA 4N6FA 2ABBA 1PIIA 3FKKA 5I3HA 5HUOA 3W71A 2HSAA 2PCQA 1OFEA 1QPNA 2OCZA 2A4AA 4IQLA 3NQVA 3UWQA 4JYDA 3HOJA 1FCQA 2QCMA 2B0MA 1TV5A 3GXPA 5LZLA 4LNYA 3NR0A 4LRTA 1N55A 4IJBA 2G96A 2WKJA 1AK5A 4NT0A 4OV9A 2VENA 1LDCA 4Z1BA 5D33A 3CM4A 3P7YA 2GVGA 2CZFA 3B04A 3P81A 4UTWA 3P5YA 5LNRA 1FXQA 2I9EA 1ZAHA 4POCA 3GZ3A 1ME9A 3MJYA 4O0ZA 1A5SA 1SQ7A 2BX7A 4PEKA 2FDSA 1KM2A 1T96A 2C16A 4JTUA 3RFAA 4QQ3A 2ZRWA 1FBAA 3N9RA 4JD4A 2E77A 1GQNA 2ZDRA 2FQIA 3W7CA 3SECA 4H4IA 1PL9A 2GQ9A 2ZZ7A 3BGJA 4JY8A 3R5EA 1JVNA 2C6QA 3STGA 1RV8A 3DI0A 4QNWA 2KZHA 3E02A 3LHTA 1JRBA 4UC5A 1TO3A 3W74A 1XDMA 4GUFA 1B3OA 3KX6A 3QRHA 3MUXA 1YTDA 2H8XA 3W73A 4E2DA 2OMAA 1YTEA 3EX6A 1IIHA 3IIOA 4R33A 4H3DA 4YWIA 2Y7GA 3CLMA 3BLFA 2BSLA 2X30A 4UTMA 1E51A 3OBKA 3PAJA 1OFOA 4ML9A 1TPEA 3LX9A 4RZ6A 1KM6A 2QUVA 2ZRYA 5K9CA 1Q6OA 1W1ZA 4GC4A 3CEPA 4ZZ9A 4CQ8A 1VCGA 1IIGA 4PL2A 4LWWA 1GVFA 4JTHA 3NL6A 1K7XA 3LCGA 1GVOA 2YXGA 3LXCA 5AN7A 5LSMA 4MOZA 1IGSA 3ZWTA 3A5FA 2H3DA 4UNLA 3RLUA 4O18A 1K8YA 3O06A 2CWNA 3A23A 5AC7A 4JN6A 4AEOA 5DY3A 5DCDA 3F1QA 4KWWA 4E0CA 3ABQA 3BG9A 2H90A 3LCIA 5I3IA 3W7EA 1PHWA 1P4CA 1TMHA 4NJKA 1SO4A 3EX3A 1FWWA 3KVMA 3EKLA 2VC6A 1BTMA 1DQWA 1KV5A 3I7SA 3GB6A 2VFEA 1WBHA 1IXOA 1W5MA 4NZFA 1EWEA 1ZAJA 4M7TA 3DAQA 5LKYA 3N3MA 1Q6RA 5CPOA 4JGDA 1OFQA 2EKCA 4M5PA 1K02A 3QMTA 1VYRA 4IMCA 4NNCA 3A5VA 4O28A 2YYUA 3PUOA 1S5VA 1LOSA 4HIBA 1K03A 3C0JA 3N73A 1W5QA 1VCFA 4ZVJA 3IGUA 4O14A 1H1ZA 2NLIA 1W3IA 3W23A 3HGRA 4GUHA 4A29A 1XL9A 4O4WA 1T8XA 2YSWA 2GUUA 3IVUA 3EWWA 3M9YA 1OABA 4DELA 5LHFA 4O19A 4ADSA 5DCBA 2PURA 2ZTKA 1DVJA 2BLEA 3L5LA 2FFCA 5AC6A 4YL2A
chains in the Genus database with same CATH superfamily
5LHEA 1E71M 1KM1A 2DEPA 2GPTA 2VXNA 2Z26A 4TV6A 1V0NA 2VZTA 4DZAA 2PWGA 4WRHA 3F5JA 2G8ZA 4HCLA 3ATYA 3LM3A 1MUWA 4GKTA 3GQYA 4C6LA 3IVTA 3EB2A 1GOKA 4CNOA 3BCFA 1ZAIA 2YZRA 4HZ6A 5ABFB 3WDHA 2XWEA 3ABRA 2QT3A 2RKXA 4W9TA 4GUJA 3WKZA 4XWUA 4X9SA 4LS0A 1JQVA 3SN0A 1Q5MA 4MGGA 5D2XA 2JGQA 3KOXA 2E6DA 1P0BA 1JFHA 1L6YA 4LSBA 4DBEA 1DHKA 4UCFA 2D2GA 4Z17A 5CPLA 3W37A 4PTVA 1BEUA 4MY9A 3IGXA 1AG1O 2ONEA 2TAAA 3UYIA 4F0SA 3PWAA 2P88A 4YTRA 5FF2A 3D3AA 2ZFAA 5HBFA 2ANUA 3TJ4A 4BR1A 3G0UA 1LL7A 1JDEA 4K8HA 3PF3A 4MADA 3AMDA 1XYZA 3SN1A 3E12A 1D3CA 2HK1A 4HNOA 1XD0A 1C29A 2XN1A 5I6SA 1I9CB 4O15A 6XIAA 4DPPA 3WYZA 1A5NC 3GXIA 1JNEA 4LF2A 4XAFA 3BCDA 1W31A 1YHTA 4P8UA 4UNIA 3GO2A 1H51A 2XFWA 4DB7A 2I5GA 4HN4A 1AQ0A 2PWVA 1GHRA 3IRSA 3M4HA 1G01A 2DUXA 3H2CA 4YVVA 2HWGA 4UFIA 3WJZA 1MNZA 3IVSA 3W7MA 3PG8A 3QHNA 4KKXA 3HU7A 3AS2A 2PGRA 5I23A 1AW5A 1BWKA 4RZBA 4FOKA 4RE2A 4IIDA 3WD4A 1W9PA 1K9FA 2VX7A 1GG1A 3W2UA 1HL8A 3FYOA 3O6YX 4LY4A 3FOKA 4R7WA 1GONA 2TRSA 4QG8A 2F8QA 3GKFA 3P2VA 4S3GA 4Z2GA 1NP2A 4TIMA 4PUWA 3LN3A 3P3BA 1DBTA 4WX2A 2QLYA 1FWHC 3QTPA 3STEA 3W7PA 3MYOA 4ZO9A 2WNWA 2ZADA 4CQ9A 3AMCA 3QLLA 4LOCA 2NUXA 4Q22A 3NEHA 4JQ4A 1H63A 5GJMA 1EEXA 3TYAA 1TPB1 3BVJA 3RR4A 1W8SA 1XIHA 2FZMA 2X2GA 3TUUA 3AIEA 3SUSA 5CG0A 4MF4A 5H1WA 5F2GA 1H61A 2OLHA 3Q58A 1FDYA 1K1DA 5H2ZA 4N42A 4HMEA 1VZWA 1UBSA 1KCZA 5FJUA 2AKMA 2E6AA 3QKZA 4ZXOA 3BUVA 3ITYA 3M7WA 3ENLA 1H7PA 4M1BA 1UIPA 2YBVA 4YHGA 4LXFA 2CBJA 1VHCA 1E0XA 4CEUC 1J0JA 5HINA 2GOKA 3HG3A 4CU7A 1U5VA 3M64A 2WHJA 4A3QA 3OW1A 2ZZ4A 3ZO9A 3WQFA 5IFTA 1RHCA 4HU0A 3PVFA 2NUYA 2VDGA 3AIUA 5BRBA 3SR7A 1L0PA 4AD0A 2I56A 3S5NA 3CTTA 1JXJA 3BAKA 2EPLX 4NXKA 4ATWA 4XQ6A 1LTDA 4MPKA 3FJ4A 4B15A 3L67A 1H11A 2PE4A 4AIEA 1NDVA 3UXKA 1IEIA 1HJQA 2XM2A 5F4XA 3RCYA 2CNCA 1SJAA 2EQDA 3EDEA 3FX4A 3UW6A 1P43A 2XIJA 1YNPA 3M0VA 3CS2A 4E4FA 3FDKA 3NEVA 2CLPA 2J8TA 4ZQCA 3PWIA 2HNHA 4O1AA 1EP3A 2GJXA 3GVRA 1F3EA 1WV2A 2QCCA 4A35A 1Y8BA 3GHTA 3NGFA 3NURA 1UPMB 2G95A 5A6TC 1TWSA 1J0ZA 5HANA 5BXSA 2Y62A 1SJBA 4DJDD 4NUWA 2W66A 2QS8A 4WSKA 2ISSA 3N34A 3W6YA 1XQLA 1CGTA 1JUKA 2QGYA 5HMDA 5A69A 1HF6A 1P0EA 1IXNA 3C52A 4PCSA 2JEQA 2E9MA 3S5ZA 3UZ5A 1XS2A 2CLHA 4U2YA 3FS2A 1WXJA 4XV0A 4DZIA 4MAZA 4URIA 3HO8A 1G4SA 3P80A 4RXGA 3KVLA 4YCPA 5BMWA 1X8FA 2E0PA 3CZGA 3WK3A 1YDVA 3AS0A 3CQIA 3VINA 2XGBA 1EF2A 4RW5A 1A50A 3EEZA 3WIJA 3HG4A 3TQ0A 1DJIA 1GKQA 4AFYA 4LC6A 3NO1A 4FPSA 4Y9OA 1E72M 1KXHA 2ESCA 1KM3A 3V35A 3HPSA 4AZIA 1K6WA 2Z2AA 4YVPA 4Q8VA 2F6UA 2WLYA 1I2NA 4EXQA 3ANUA 4F0MA 3N4EA 3TC7A 1GHSA 2FMNA 3UCDA 5SWUA 5HNUA 2J13A 3LD5A 1EJRC 3VD3A 4FA3A 4XO6A 1E0WA 3A4WA 5L9FA 1OJXA 2EG8A 4JPGA 4GIYA 3WQPA 1EO5A 3TZNA 2NVCA 3KWSA 1YX1A 3TTOA 4IT1A 1VPQA 1WP6A 1JPMA 3WJSA 1IGWA 2V67A 4FLOA 2IPWA 2VZSA 4KCWA 3LG3A 3AJXA 2PSNA 4AZBA 3CPUA 4O8AA 2VRQA 5GNZA 3B40A 5HMSA 4J3SA 3I65A 2QJHA 1N7KA 4PB5A 4D6GA 4UQ9A 3DHUA 4MJ4A 4ERIA 1TPH1 2XINA 1W1PA 3Q4DA 3VGHA 2EJAA 2FHCA 1TVPA 1ZLPA 3I7QA 4HZ8A 2VRJA 3QM3A 3CL7A 4ZO6A 2OWCA 4DJDA 1RQEA 2Y24A 4U28A 1XLBA 4GA8A 1X98A 2OWWA 1AMKA 3QLDA 1AD4A 2V30A 1MW1A 3VCRA 2ZUSA 3EPMA 3U2EA 1Z89A 3SI9A 4DX3A 2ZRUA 1A49A 2PTDA 2Y5EA 5DBUA 2WC7A 4GO9A 4R88A 4JTRA 3DFHA 4BY3A 3IV8A 2WMJA 2D0FA 3FAXA 4A8IA 2RHGA 3E3HA 2NVDA 4C6FA 8A3HA 4D71A 2FB3A 5I3JA 2CKRA 1UR8A 1RBLA 3VM7A 5CAHA 5D9OA 2WMIB 3MHFA 1CT5A 4E4UA 4GX8A 3VUPA 2Z4GA 5AYXA 1CB7B 1CWYA 1XSKA 2FTPA 3DYMA 2OVLA 1W1YA 3XISA 4HZMA 4KCUA 5T91A 2QJJA 2R1MA 4H9ZA 2XN0A 7REQB 4X2PA 1A4MA 4A8RA 2WNNA 2QCFA 1XM3A 1KFJA 3O7UA 3BZJA 1UZDA 2Z25A 4G9PA 4ZO8A 3RRAA 1PX8A 3P74A 3OVQA 3D6NA 3URAA 4BHYA 4ZQOA 4GLEA 5E1QA 4IF2A 2GQAA 2PDJA 2V3DA 4DLMA 1JD7A 2ZX8A 3OG2A 4I6VA 1B3ZA 2GUYA 3OYZA 4QR6A 1QWKA 1DJHA 4LRSA 1JQXA 3S3GA 4H6KA 3ZS4A 3V1PA 4ECLA 3WFAA 4MJ2A 1YXDA 2PLCA 5FEXA 5ABTA 2P53A 3EOUA 4TTGA 1YXYA 5CG7A 4UFJA 1QI0A 3WLJA 3WH6A 2XWDA 1S5WA 5EMLA 2FIQA 1L6SA 2GSHA 4XBKA 1MFUA 5T8GA 4E2VA 3LRLA 2XN2A 1Q6DA 3WL0A 3DUGA 3T8LA 3MZNA 5GPRA 4LCSA 1X1NA 2DZWA 2DZXA 3RX2A 3TN6A 1XRFA 1SO5A 4Q7IA 4R9OA 2ZZ5A 2R94A 3FN9A 2XVNA 3KAOA 5LGZA 4H6EA 3WLTA 1XPYA 1LP6A 3GG8A 3KL3A 4GQGA 4DBDA 3QV7A 4TU1A 3WMLA 4GH1A 3PZTA 1UUQA 1AH4A 1UASA 1NDYA 5DQPA 2PWEA 3W1UA 1IEQA 1P1MA 5HOSA 3NYDA 2ZUVA 3GHSA 4W88A 2GQ3A 3WD0A 2FTWA 4RDVA 2FPTA 4HK7A 3GK0A 4MWAB 3EA3A 2NV9A 4LV4A 3U48A 3IJ7A 2OT1A 4GI6A 3L5MA 5AHMA 5KETA 3RITA 1KKRA 4MHBA 2JF6A 2D2OA 3GRIA 2G3FA 1LOQA 3HQNA 2CEQA 4TX6A 3T2OA 4IPIA 1X38A 1XR2A 3WD3A 3RUBL 4B3ZA 4W4QA 4HVXA 4WF7A 4N6EA 2P50A 4S38A 3FSUA 2Z1BA 4PH6A 3VO0A 1C7TA 3VFLA 1EDGA 5CJ5A 2CXGA 2IPJA 4KPLA 4YVXA 1VFHA 4AHPA 2P8BA 2DVUA 3TW7A 4FNTA 1FWCC 4U2ZA 5DXYA 1AODA 5C9WA 4DO7A 3F03K 1OFDA 4JTAA 2E6FA 1XDJA 3NO5A 4GZJA 2CHOA 1DWGM 4EVZA 2BOEX 1FQ0A 5FD0A 3A6OA 1PKYA 4S39A 2XVGA 3TNBA 1XBZA 1Q4WA 1SZNA 5D2VA 5I06A 2RJGA 2ZZ2A 1X1ZA 1FX6A 2B7PA 2HROA 4S3EA 5CBJA 3ARUA 3DBNA 3LCFA 2YX0A 4CD4A 3PPFA 4LYPA 5CC3A 5AVHA 2D0HA 3W1XA 1K4HA 1QK0A 3DC0A 4DM2A 5TNVA 3WD1A 3UJFA 5DX7A 1E6QM 3CQ0A 4J2PA 1CI1A 2XSXA 1RP8A 3H23A 1YW1A 2XZ7A 3SGGA 3UP8A 3BSGA 2RDWA 4N4PA 2DIKA 4KRTA 3TTSA 4FIQA 3IIVA 1EC7A 2HEJA 4HK5A 4O1CA 5M2FX 2RUSA 3QQ0A 2X7WA 3AIWA 2V3FA 3MDUA 3ES8A 4HTBA 4JYFA 2C0AA 3IIXA 3VDAA 2W91A 4YTTA 1FHUA 5EMMA 5JU6A 3SURA 1BRLB 1AZ1A 4JXCA 4J3XA 1FCVA 4MMWA 4CUCA 3W2KA 3AIVA 4XKMA 1IT7A 2V3EA 1B30A 1YYAA 3O6DA 4YXGA 4GISA 4FB7A 1HKJA 2WSRA 1K9TA 3H4WA 1OGGA 1SFLA 3FXYA 4PYSA 3F2BA 2QDEA 4AVOA 2YA0A 3OB8A 2VX4A 4LVGA 4OOUA 3W83A 1EX5A 4FNUA 3GNXA 4TVUA 3S1UA 3VD4A 2PP3A 2X1TA 4BJHA 4F66A 3JVAA 4CLMA 5A8QA 4B5TA 3WENA 2Q6ZA 2XFRA 2BZNA 3VNMA 3L23A 2W62A 3CUGA 1JNDA 3TH6A 5B7ZA 3VK5A 1ICSA 2EGZA 5IOBA 3IIPA 1P5BA 3TA9A 2XISA 3NQAA 3K30A 4ZQNA 3VNYA 3QGVA 1QOPA 3LXBA 2G3NA 2AL2B 1Q6LA 1HGYA 5HQMA 3FKRA 1CW2A 1SW7A 4K2SA 4PBEA 1BGAA 1BGGA 2JGYA 2WMKA 4L4LA 4BQ4A 3LCXA 4U4MA 5D9MA 3T9PA 3UA3A 1N2VA 4XD6A 4LAUA 2VD8A 4H9YA 1VC4A 4A3YA 4PUNA 3FDGA 1GOOA 2NT1A 2EAWA 5F1UA 3S1GA 3VXGA 1C8VA 5I02A 3B0VC 1Q3NA 1JPIA 2RGLA 3K5XA 2ZBTA 3W01A 1VEMA 1BVNP 3E5BA 1WYIA 1UQYA 2VC9A 4IIBA 2V0TA 4XKYB 4XX6A 1XV8A 2IQDA 3TQVA 2VP8A 3QH2A 4LQ1A 3ZR5A 4YHEA 4DBUA 1I8JA 2XVLA 4GIEA 5BCAA 5C9UA 4JNYA 3IGSA 3IK2A 4FO4A 2YPIA 2PLJA 1K4GA 4CNSA 1DWIM 3AISA 3T2QA 1EHAA 2QCNA 4PODA 5D05A 2O56A 3DFSA 1JRCA 1BQGA 3AZRA 1J79A 4BS0A 1M9HA 4CNTA 1FWNA 2GOUA 2IXVA 4QHRA 2OLAA 5EFDA 3S2MA 4A2RA 1PKNA 5CSSA 3CGTA 3QF0A 4CQCA 1XINA 1CX9A 3N4AA 4LAZA 1CBGA 3DFQA 4LBUA 3LMZA 2TODA 4IZGA 5LIWX 4U33A 1PV8A 1PS9A 4YMZA 1XF0A 3N29A 4WGXA 3GTIA 3W75A 4K1WA 4MNKA 4WY0A 3A3XA 2C13A 4ORMA 4V28A 3TQKA 2VRKA 2V5LA 3FY1A 1BHGA 4WEVX 4O13A 2YB1A 1B1YA 4RUBA 1TZZA 1E5NA 3BJTA 2PWUA 2GGGA 3S8HA 1NFPA 1ZRQA 3TZFA 4J3TA 3SSJA 4TMCA 5HWMA 4RLIA 5C0QA 2DH2A 5KTLA 4QJ3B 1A47A 4FXSA 3IPWA 4JTIA 1EIXA 2F84A 4G56A 3HM7A 4GX9A 4MYAA 3VZYA 1B0IA 5IDIA 2ICSA 3UR7A 5BXRA 4I9AA 1XBYA 1U5HA 3UU0A 4H2CA 3ERPA 2VGFA 3CHCA 4ZOAA 5DMNA 1XD1A 1PYFA 2TYSA 2NZLA 2E9LA 2CWXA 1FFRA 3P61A 3G0SA 1WA3A 5AC4A 5LIYX 3PSWA 1ESWA 1E40A 3K4AA 1EIBA 1DJNA 3DOPA 4TVDA 3CC1A 4DJDC 3IARA 2IPFA 1P0KA 4PFMA 3GYCA 2EHHA 3MMUA 3S1XA 4OU1A 3LV5A 3AYSA 3VD5A 2OT0A 5BU6A 3V1HA 3W26A 3O63A 3SUTA 4HHMA 4BF9A 3RN6A 3BAIA 1PZ3A 2OOGA 3O0KA 1OFPA 4ACZB 3NSMA 1C90A 4H1ZA 1P7TB 2ZUMA 4QS5A 1J01A 4OTKA 1GYNA 2QHAA 3C56A 3H4XA 5E0FA 1XLMA 4HPNA 2A7NA 2QR6A 5BZAA 2PRMA 3FXGA 4IH3A 4F4RA 2ZE3A 4HCDA 2VZUA 2CYGA 4Z2IA 4DWSD 3SSZA 2C1HA 5EY5A 1KCXA 4OOZA 2HK0A 4IP7A 1K7FA 4JQAA 3LRKA 4RE3A 1O95A 1KLZA 4AW7A 3LM7A 3WNMA 4LUTB 4PR4A 1J11A 3O9NA 3ARSA 2V2CA 1LJYA 4Y6GA 5J5DA 3PZVA 4KWSA 3H54A 3M5VA 1VYSX 8CGTA 5C6MA 3SCQA 2Z2BA 4KMQA 3WJYA 3GNOA 2WSYA 4FLRA 2OGYA 4QEHA 4BI7A 4IP5A 3QY6A 3LDVA 1TTIA 1NF0A 3QGKC 1ZTVA 3KCJA 3O1NA 4GXMA 1Q8JA 1VB9A 1K6AA 2QCDB 5AHIA 1VBUA 3EWUA 3KHDA 2QVNA 2J6VA 4OQVA 3KP1A 2WZEA 3SJNA 3BANA 1AJ2A 1EUNA 1XIBA 2GSEA 4LVAA 4LUIA 1H7RA 3VPLA 1GUVA 5CC7A 4AZ6A 1LZOA 1KFKA 3NQ7A 1QW8A 5HWJA 1KM4A 2C14A 1DJYA 3PP7A 2ZUUA 4PCTA 3AWNA 4XD4A 2HMCA 3HGOA 2PDGA 3R11A 2DZVA 1DKWA 5EPDA 2WKGA 3SGUA 4KERA 2QW5A 4Y8FA 3NQCA 2AGTA 3W02A 4H9UA 4IWWA 3TK7A 1E3XA 3M0YA 1QBAA 4MY1A 2FZNA 3N9KA 3V3WA 1RJQA 1RJPA 5H8MA 1QUMA 3UWZA 1ZZMA 3EB4A 4LW7A 4UOQA 3KCOA 3VKKA 1NFBA 4KRZA 1QDSA 3VIJA 3TOYA 4R27A 3WQ6A 1GQLA 1MNSA 2G3IA 5FF7A 2XIMA 1XIJA 4ZOEA 2HXUA 2YBUA 4QQUA 4UTLA 2D0GA 4B92A 1QCWA 5FIPA 1W37A 5F2IA 3GE7A 1P0NA 1QATA 2QZRA 1GEHA 1HKVA 1TCDA 4CD7A 1KXQA 3DH7A 2PTYA 4GY7A 1PAMA 3LI0A 3XIMA 4UTUA 3PM6A 2DGAA 1A5KC 4LVFA 4M19A 1NY1A 4PB4A 4DWSA 2G5WA 3T55A 2AKZA 3ZWSA 1A3HA 3HFYA 1B31A 5TAOA 1FRBA 1NDWA 1NAL1 3E9AA 1JR1A 2GGHA 3VNDA 1TJRA 1KM5A 2YCLA 1QOXA 6XIMA 2F38A 1JZ6A 3AS1A 2YCEA 1OIMA 3AHYA 3WFLA 1UOKA 4L61A 1E1CA 1PIGA 3QR0A 1SW3A 2WB5A 1VLWA 3OGVA 4KH2A 5AYZA 3H12A 1M1BA 4WUIA 2UY2A 4A8LA 3QC3A 3L0GA 1OYCA 1TRDA 1UP2A 1DQUA 2XSAA 3GXFA 4CCCA 1IEXA 1S2TA 1TPVA 1AH0A 2YCJA 4ASTA 1U33A 3GWQA 4RE4A 3GDTA 1PB0A 4XTDA 1MW3A 1VRXA 2ZRZA 2WMFA 3ICJA 3CHFA 4PMUA 1GPFA 5ABFA 4GGHA 5A6KA 3UZWA 2RJHA 1EWDA 3G1RA 3HIJA 4Z2HA 1W3HA 3QZAA 2DVTA 4R34A 1J6OA 2GSJA 4NRRA 3SCVA 3UPWA 3C2VA 3GZAA 2CW6A 3WBWA 5JXQA 1DE6A 1UMLA 3QZ6A 2E1DA 4XZIA 4JHZA 4JICA 4OBSA 3CNYA 1EYEA 4W5UA 1US3A 1RD6A 3PWGA 5KSWA 4XVEA 5AYIA 1E55A 5T9CE 3UG3A 1P6CA 1YQ2A 4GY0A 3GIQA 3ZLGA 1UZHA 4GYKA 4GIRA 5H8UA 3BCJA 3UWWA 1A80A 4FEZA 3CH0A 3SJ3A 1W5PA 3USZA 3L4ZA 3FAWA 1F2JA 5F7UA 5CC5A 3UG8A 5LXXA 1DYSA 2C71A 2ZRVA 4KESA 1I2PA 2FZ8A 3H26A 1RAKA 1E0VA 5TBOA 3CUZA 2ATSA 2PDFA 3MUY1 4JIQA 4OBTA 4V33A 4XVDA 3CO8A 4DJFD 4GVGA 4AWEA 4LF1A 4DNMA 1F6YA 2I5IA 1R5YA 3R0KA 5IM51 2V2DA 3GFXA 4LS2A 3KLKA 4UTFA 1X6NA 3FKKA 5HUOA 2PCQA 4MWAE 1OFEA 1O68A 2EBNA 2FZDA 4JYDA 2DH3A 1KGUA 2B0MA 1TV5A 4IJRA 3NR0A 1ISYA 3URBA 3BAJA 4CEXC 3VDBA 1J5SA 2WKJA 1C92A 4I5XA 4NT0A 4OV9A 2VENA 2GVGA 1TX2A 1AVAA 3FA3A 4POCA 1V4YA 3F4DA 2WBGA 2QJMA 1ME9A 3AAMA 3LSCA 2J77A 2G4FA 1C8QA 4KW2A 3T07A 3W29A 1WXZA 5EMYA 2W4XA 1CYGA 4H4IA 3ARQA 4MNJA 1JDCA 1RV8A 5I2UA 3V4BA 4WKFA 1TO3A 3V18A 3EDJA 4IGSA 4GUFA 4AD2A 1B3OA 3QRHA 1YTDA 3MUXA 2BOFX 3GVQA 5I03A 3PTKA 3G2GA 4M80A 1UZ4A 1UMYA 1ADSA 3POCA 5KZ6A 4UTMA 1E51A 3IACA 1OFOA 4V1YA 4L56A 3WQDA 1JFXA 4C6KA 1HW6A 1T7LA 2QUVA 1LUCA 2ZRYA 4M6UA 2J7FA 4BEUA 5K9CA 3BAWA 3APYA 3WDPP 3IWPA 2WQDA 1IIGA 2YXOA 4MSSA 4PL2A 4V15A 4JTHA 4O1EA 1VFOA 1GVOA 3VKAA 3E5PA 2V68A 3RLUA 4H9TA 1ISWA 3O06A 4HN8A 4QE5A 4AIOA 3UFYA 3GUWA 3WY1A 1VFFA 3F1QA 3W7EA 1HKMA 1PHWA 2DT0A 3KVMA 1FWWA 1XYMA 1V03A 3MKCA 1ZJBA 3I7SA 3GB6A 1DEDA 4DZ5A 1FH8A 3WLQA 4ZODA 1OT2A 2YL9A 1J96A 3UERA 1GGOA 5CPOA 4QE4A 3QMTA 4JCMA 1VYRA 4NNCA 3A5VA 4HU4A 1TV2A 3PUOA 3IK4A 2BXYA 3N73A 4ZVJA 2DT2A 3PZNA 5FJPA 2NLIA 4Q8OA 6ENLA 2PODA 2FFIA 3HGRA 3ALFA 5I79A 1XL9A 5BU9A 2YSWA 4AZ7A 2GUUA 3RJYA 1QK2A 3M9YA 4DELA 3U0HA 4NZ5A 4ADSA 2ZTKA 1SVDA 3VOIA 4YS1A 1W3LA 3H2AA 2FFCA 1DPMA 1H09A 2HISA 2VGIA 3L4TA 3SQSA 2V3GA 4M1RA 2DU2A 1W9UA 2C1IA 2RGMA 2IXUA 1ONWA 1V08A 3P82A 3AHTA 2PDKA 1EFZA 5AFDA 3W1TA 3G1YA 4UWMA 3IS4A 2G50A 3EYPA 5DY2A 3CMJA 3OVGA 3W4RA 1BQCA 4H19A 2CFFA 1DIDA 4F9JA 4XSMA 4H7VA 1ALDA 3G1VA 1ME7A 3VNIA 3G24A 3L4YA 4FX6M 2BVTA 1ZB5A 6PTDA 4M82A 5K7JA 4RXFA 1UJQA 4GRSA 3LLDA 2OG9A 1UWRA 3CU2A 3CV7A 3H7UA 3MWAA 1POJA 5EFFA 2Y61A 5I3KA 1CXIA 5FJJA 1SZRA 3GG1A 3TW6A 4UTHA 1A3WA 4MIMA 3EKZA 4QBXA 4NJJA 1LORA 1D8WA 4LT9A 2B7QA 5M5DA 1QI2A 3L0NA 4IQDA 3MBDA 2XJ7A 3TYZA 3B9AA 3WUEA 2Y8UA 4DZHA 3TTQA 3BMVA 1K3UA 4ZCWA 1Q6FA 3KFTA 4R3UA 4IMFA 1LRTA 3G3MA 2ZX5A 1OWQA 4ADTA 4M7SA 4MFDA 1Q6EA 4AH7A 4DF1A 3BLEA 1WO2A 4JEJA 4JTSA 3DESA 2CZDA 1OK4A 2PWFA 1E9ZB 1TJ2A 2GGJA 4HPXA 2O0TA 2GVJA 1V51A 4HOXA 3FHAA 1PKLA 3GTXA 1WAWA 2DUAA 5K3VA 1FWRA 1RBOB 5K9DA 3UPMA 3EXTA 2BTMA 3P6LA 1AUSL 2YB4A 4FZIA 1H1YA 3TC6A 1OT1A 3QZEA 3CWOX 3GX9A 2IKJA 3JU2A 1UJPA 3TWBA 3TCSA 1Q13A 4DYJA 2VYOA 4NG3A 3URQA 4US5D 5C9XA 1W56A 4B5SA 1FP9A 2J9XA 1MQQA 1KLYA 4QSHA 2R91A 1UA3A 3MZ2A 1TQXA 1PJ9A 1ODUA 2ZC1A 5FAJA 5DFAA 3GTHA 4BCEA 1XGEA 1ZU8A 4OT7A 4RNJA 3RLVA 2QVHA 4DF2A 3TROA 3WNPA 3QPZA 2PGEA 4JIEA 5CLTA 3WD2A 5DELA 4UFMA 2WMIA 4J2MA 1OCBA 6TIMA 2PA6A 4QFUA 1BYCA 1VF8A 1REQB 1PXGA 2POZA 3THAA 1CNVA 3B8DA 3Q94A 4Y9PA 3MBFA 4WQ6A 1F73A 2BMBA 3CWHA 3FSTA 2X16A 5CGTA 1XG3A 4ACYA 2XSBA 4TXEA 4OHQA 3QBUA 1EQPA 5CKSA 7REQA 1R7OA 4HU3A 1QRQA 4GGBA 1UC5A 2HJPA 4ATLA 1B5TA 2W79A 4TX9A 2Q02A 3OOQA 1MXSA 2WYSA 3D3FA 1VFMA 2DQXA 2YLLA 3CYJA 2Q01A 3SRDA 5LNWA 3NG3A 4BK9A 4LY8A 2J25A 1S2VA 2H3BA 3CIWA 3T4WA 2ZXDA 4AIUA 3W6MA 2VOMA 2DSVA 3EX1A 1IZCA 1ADOA 2Z6IA 3LUTA 4L4MA 2I5QA 4D1JA 1VFSA 1BF6A 3GH5A 3PB0A 2VWSA 4N4QA 3R89A 3TDFA 4Z2LA 4CD6A 4HYVA 1UR1A 2EJ1A 4TMBA 4HNTA 4M0XA 3DFTA 4DWSC 4J3VA 3GXMA 3FLUA 4MB5A 4PMXA 1MW2A 1UKPA 5IXEA 2QF7A 3KS6A 3TV8A 1T0OA 2FTYA 3ZJ8A 1TR9A 2NWSA 4WGHA 3VOFA 4Q3MA 5D8WA 3GR7A 3DG7A 1VJSA 2VCCA 4KBXA 2CXEA 1A5OC 3ZM8A 2W5FA 3MO4A 3MPGA 3N2OA 4QJ4B 4GY1A 1UC4A 2A79A 3W28A 3UETA 4B3LA 1TWWA 4US5A 3LHVA 1L6WA 5KINA 4XUGA 2XGZA 1TUXA 4AU0A 2ISWA 3I6RA 1P6BA 3T8QA 3QEZA 3NPVA 4KEUA 3RO8A 3KHJA 1W8GA 5CSUA 1LT7A 2NQ9A 4ZXLA 1AJ0A 3ONCA 1ML1A 4HOZA 5A2AA 4PUUA 3IGHX 5AHEA 1W1VA 3IUDA 4LUJA 2DV0A 2J88A 4DRSA 3BW4A 1JF6A 2W0UA 2BNJA 5EKYA 3STCA 5F4SA 4ORIA 2YCIX 2PDBA 1UR0A 1RZMA 4LPCA 3BPWA 4PN2A 4BQ3A 4M6PA 3W2LA 1JL8A 4HA1A 5FA5A 2HVMA 5K9XA 2PBGA 4PRWA 4MJMA 3DFNA 1LWHA 2JKEA 2WVTA 4H6QA 4F40A 3A21A 5BWAA 1EXBA 3VIMA 5HR6A 3A47A 1VIWA 4B5NA 4NNAA 1AW1A 4IIGA 4QM1A 3S4TA 3BSHA 1H1NA 3VMPA 5IHRA 1SM9A 1OY0A 1HO4A 1S2WA 3B06A 1WUFA 4AZCB 3WELA 3MQTA 5CAKA 3U57A 4PUMA 1NOFA 3FA4A 3ISIX 1VCVA 1MEIA 4QAIA 3DCPA 3REQA 4PC8A 4JKLA 5TQLA 3PHAA 1ZJIA 2PTZA 2QGHA 1UH4A 3AXKA 3GXDA 2GFTA 2B4GA 3MU7A 2FHFA 1FCBA 1FWAC 3F2DA 4R7JA 5BOOA 2VFDA 3NUKA 3RAOA 4UNKA 1TPFA 4QLKA 4GINA 1JCNA 3FYYA 4PMDA 4FF5A 1AJZA 1XKJA 3W7JA 4IHCA 1QPOA 1Q2RA 3GDRA 3HPZA 1XRVA 2PZNA 3CUHA 3QPYA 4UQEA 3PBWA 1TELA 4IUOA 1WOBA 4PEEA 1HVQA 1OCNA 1GVEA 1TIMA 4IGMA 4WIWA 3B05A 1BRLA 4YLWA 2Y8VA 2WK2A 5XINA 1ZL1A 4JEQA 5DT7A 2CLIA 2WNZA 1LRNA 1S2CA 2ZVIA 2J7DA 3JS3A 3UD6A 3AU6A 3AU2A 1M41A 3PBUA 4IQJA 2R1NA 4KIEA 3ORWA 3K1DA 2DSUA 2DZSA 3EXSA 3FK4A 3WEOA 1NSJA 3PB2A 3AXIA 2WZMA 3LPFA 1V7AA 1QU4A 5FAGA 2UWFA 2ZICA 3UNDA 5CPSA 3UY8A 4C6NA 1J12A 3CLWA 1V77A 1YDYA 2VJXA 1ISXA 1BXNA 3D46A 1UD3A 2CIPA 2X1RA 4XZLX 4L6HA 2QV4A 2CBUA 3WLSA 4CD5A 2D23A 1G4PA 1OX4B 4J7RA 1EOMA 1M68A 4BQ5A 3QVQA 1FFQA 2E67A 1B9ZA 1SZEA 2FVLA 3GKAA 4F0KA 4B2DD 4W89A 3UG4A 2WJZA 1LQ0A 4EIVA 3W6LA 4LBRA 2O4QA 1RD5A 3P93A 2YDAA 2GWGA 2FVKA 4GUIA 1E1FA 3KVJA 3QOKA 3LMYA 2CKSA 4ICNA 3S6OA 4H2HA 3KBWA 1KXTA 1FHVA 4DJFC 4XD5A 3FGCB 3DYPA 5BXPA 3N1AA 2XH4A 4HOWA 1FOBA 4AX6A 4AZ5A 3U2OA 3WNOA 1JI2A 5HMFA 1H7WA 1VQTA 1UKTA 2WQPA 3ZVHB 1OINA 1ITQA 1YKWA 4NX0A 4H83A 3QFWA 4AY7A 1SR9A 4CQDA 3C3UA 2D2JA 2HVNA 2WVVB 3AMLA 3FW6A 1L6GA 5L6UA 1V02E 1G69A 5FCZA 1TUFA 3ZSTA 5I3FA 3F4CA 2PRLA 1JUEA 3WH7A 3GD6A 1K9DA 1Z48A 1LRQA 2YFOA 3LCHA 1OCQA 4NX5A 1D8CA 1TJPA 3KL0A 3AICA 3L2IA 1E6ZA 1ZENA 2WXDM 1FXPA 1U2YA 2HBXA 5D37A 4GMEA 3WFZA 3AUOA 2ZA1A 3NM3A 5CZ0A 1EJWC 4IXXA 4L9XA 1IXPA 4GK8A 4ZSTA 2YL8A 1DV7A 3P5ZA 4E38A 2ZKMX 3IJDA 2WCGA 3ZYZA 1YPXA 2OYMA 2ATMA 2QAFA 3PAOA 3WH5A 2BY0A 2Z00A 1SFSA 3GSMA 1U22A 1XLKA 3S83A 1W2PA 2ZVRA 1OX5A 2HE5A 3HQOA 4GQBA 1EJVC 1PO9A 3N4FA 4NAFB 3BTNA 5AC5A 3DYOA 1K8XA 3PUDA 2PF0A 3CYVA 3RHGA 1M6JA 3PPGA 3TE9A 4RJEA 1SPQA 1DWFM 4JHMA 2G3MA 2XYLA 5CC6A 2NV1A 1GTHA 1XPGA 4UMCA 2F6XA 3EDDA 2H6RA 5D8ZA 2VTFA 2GL5A 1Q6GA 3BG5A 3W00A 1MUCA 4C5YA 3C6CA 5EMKA 4QXIA 4QITA 4X9YA 1SFJA 1UWQA 4EANA 4MLJA 5I07A 1XLDA 3IUHA 1W32A 2XDFA 1EEPA 1E9IA 1G7VA 2Y5SA 3W9ZA 3W1AA 4RDYA 2VFHA 2GJNA 3MKKA 2NSOA 4NZJA 4Y7EA 1Y5VA 5AY7A 3PZQA 1I1WA 3S6DA 1F76A 2GJRA 3LQGA 1R46A 1OG6A 1W9DM 1UH3A 6TAAA 4REQB 3M44A 4K3ZA 4Z1CA 3VKDA 1KCLA 3CAQA 2F9RA 1PSCA 1C9WA 3UXIA 2OSXA 3MWCA 5LIUX 3OQEA 4JL1A 2HS6A 1GZGA 5M3WA 4DBWA 2YLAA 1ITXA 5GQBA 1GKRA 9RUBA 2EXOA 1UKOA 2QPUA 3QR1A 1NWRA 4S3AA 2FB2A 2F61A 2WSQA 1H60A 5I78A 3N14A 1XLGA 4BEQA 3EPNA 1GORA 1KWGA 5DMYA 2E9BA 3H2EA 4JTFA 3VIHA 4JAWA 1YNQA 2QCGA 2FHBA 2OQLA 3KDOA 2C8NA 2Z1SA 3C86A 3CZJA 3PK7A 1XSIA 2Q3OA 4B91A 4MB3A 4W7UA 4K38A 5FKYA 2I1OA 4CNPA 4WY0B 3F2CA 3WEMA 4IPJA 3AHZA 1CDGA 4GIAA 4WJ8A 3LTSA 1Y7VA 4ACZA 2ACQA 1P7TA 5I5RA 1KFBA 5BOEA 1JZ8A 4XAGA 2PI6A 1HL9A 1DOSA 2OKTA 1G4TA 5KZDA 4L1GA 5HPCA 1XIIA 3GIPA 3STPA 2YCKX 5REQB 2INZA 2BGSA 1ONEA 3TAKA 4ZO7A 1TQJA 4DPQA 1ZBCA 1RVKA 3AMGA 2QUUA 3H2OA 1VKFA 1XYBA 4BKNA 2D69A 2W6RA 3COTA 3WEZA 1Z42A 4LUTA 4OIFA 1HT6A 3NL2A 1Q45A 2QJIA 2J4GA 4IL0A 4DQWA 2X8RA 3AXMA 2Y1HA 5JBFA 4NZ1A 5BRQA 3L4XA 4UMAA 2D3LA 3VGFA 5DF0A 2VQTA 3ITVA 3TTYA 1K77A 4PGLA 2OQYA 2QCDA 3GNDA 5HA7A 3W7RA 4HNUA 4PSPA 3W1RA 3VCCA 4HNNA 2VEKA 1OFBA 4ERAA 4RZ5A 3WO8A 2WCSA 3MMTA 1T6MA 3DECA 3IRDA 3QV8A 2G0WA 3FNDA 2W63A 3OO2A 5MF5A 1G0CA 4DN1A 4QJ5B 5D32A 1LQAA 4AAJA 3IJLA 1CGUA 3TU9A 3GVGA 1VP5A 4M24A 4H8UA 1JCJA 1ME8A 4H8NA 3EKGA 1XIMA 3HG2A 3FYPA 2FPYA 4ZTXA 1NTHA 3BLKA 1VS1A 1E4LA 3H24A 3M1ZA 3M7SA 4PMYA 2A2IA 4JKMA 4LH8A 1B9BA 1OZQA 3C2EA 5ENLA 4MVAA 4AY8A 3PZMA 2EPNA 4PTXA 3U9IA 4EF9A 4RR4A 2NLYA 4MB1A 4ADUA 3RMEA 1KRMA 2ACUA 3W7HA 2GDVA 2AGKA 1SFTA 1TTPA 3T40A 3U4AA 5C5YA 2J7EA 3B03A 5CGMA 2PMQA 4RDWA 4DXKA 2INEA 2P8CA 3ZSSA 1QO2A 2HRWA 5G2HA 1SZFA 4WKAA 4WXYA 5K4ZA 4JTGA 2Y0FA 1H2JA 1HO1A 3EXRA 3L65A 3VM5A 1JZ7A 3GH7A 1V6YA 2EG7A 1LROA 3W81A 3CAKA 3N11A 1GZJA 1VBRA 4KIRA 3BLDA 1IWAA 3NQGA 3OZOA 5FF3A 2ALDA 1H5VA 1X6LA 4LTSA 2X0HA 4AEEA 4H41A 4NQ1A 2EEXA 3PSVA 1WQ5A 2OLSA 4WOZA 3IV3A 1ELSA 1OC5A 1XLEA 4RX0A 1S5NA 3PNZA 1K8ZA 3GC4A 1WUEA 5H6HA 3OGSA 1OD8A 3P84A 5JH2A 4LEQA 2HV5A 1HL2A 3NPUA 4QDPA 1FWGC 5AOUA 4WHBA 1XLCA 3TVAA 4HNVA 4NL1A 4OGZA 1SJDA 1U83A 2VZOA 4GBDA 3BXWA 4C6MA 3WLHA 2C91A 1VGAA 2J78A 3TOPA 2OZ3A 3OHIA 4M3PA 4Q4QA 5HUPA 2RDTA 3MDWA 2VR5A 2VR2A 4HMNA 5E93A 3ID7A 2IUZA 4FNSA 5EB8A 1JZ4A 3G1XA 3KL5A 1JAKA 1VBGA 4UIOA 3BLOA 3SCRA 3M0IA 1C93A 1LM1A 1X7FA 7ENLA 3BK0A 3R1ZA 1NIUA 3NQ8A 5G1TA 1S1RA 1T40A 4PUDA 1Q7QA 3THDA 1RLDA 1GCYA 1Y5WA 4D8AA 1VENA 4Y9MA 1TX0A 4ZR8A 2ZIDA 1OYBA 3BZGA 4HD5A 3RYSA 4EACA 2PWHA 2YL6A 3NVDA 4W87A 4AVFA 1U5JA 1JCMP 3RILA 4US6A 1V02A 3KRZA 1F5ZA 1NARA 5J04A 5XIMA 4ZENA 2ZZ1A 4FX8A 5I3DA 2Y7DA 4UB9A 3O3RA 3S2LA 3WDRA 5HMEA 4JX6A 1XISA 3I68A 1VBJA 2VUYA 3N25A 2HXTA 1UZ1A 4ZOCA 3I3EA 1DJGA 5A2CA 2PDXA 2NVAA 1CPUA 4Z42C 1JYWA 4D6JA 4HJWA 3Q45A 4XAYA 2PC4A 1U30A 3PS7A 3II1A 3BLIA 4HNLA 1NEYA 2OWXA 2XIBA 1RVGA 5AHFA 3KWXA 4RW3A 2BVDA 2Z1KA 3UVAA 2J6XA 1QNSA 1M7XA 5D9NA 4A22A 4FALA 3EWYA 3AHVA 3M43A 3HG5A 2W67A 1GVSA 1A5LC 4RPPA 4CNNA 4OE7A 4YJ5A 2XGIA 1DTUA 3L4WA 3A9BA 2O9TA 3EMQA 1KD0A 3GNRA 4TVCA 2BY1A 3GAKA 3MSDA 1XX1A 2P76A 3USBA 5DXXA 3DGBA 1LBFA 1EP2A 1MQRA 1JPDX 2WBKA 1M65A 2ZXQA 4NIRA 2Y70A 3HBLA 9CGTA 1OADA 1K8CA 2W9MA 2L5HA 1D2KA 3QYSA 3E2RA 4PMNA 1O6IA 4GI4A 3IJ9A 4HKPA 3WSUA 3B8SA 4EX4A 5FSEC 1ZS2A 5CBBA 5FEPA 2CZVA 5ECUA 3FEMA 3R7MA 4ZQRA 4NJGA 1ZGDA 2G4JA 1WDRA 3T0TA 3N2BA 2VX5A 4FNRA 3RR1A 3P60A 1UBPC 4L1WA 2ON3A 2EG6A 1S39A 3VOJA 3EMCA 2PP0A 4O54A 3GNNA 2QCHA 4B5UA 1I0DA 3W88A 1M03A 4OKDA 2J9ZA 4AB4A 4GJJA 2Z7GA 4QDWA 4BF5A 5A3HA 3NA8A 1W9BM 4I9MA 1W9VA 2FZBA 2XUCA 4KF1A 3WF3A 1UKQA 2ZZ6A 1VIZA 4LAMA 1CECA 1E0UA 1M53A 2YFNA 1C9DA 1J2WA 3LENA 1XXXA 4GVIA 4LGXA 3SRKA 3VNJA 1JUBA 1AH3A 2E3ZA 8XIAA 4MM1A 2OO0A 1HKIA 4Q4KA 4IJCA 4JX5A 3LHWA 3BAYA 3GYEA 3M41A 2HCVA 1FHLA 1GZ1A 3CQKA 2E6YA 3SY8A 2GK1B 3GAYA 5D2WA 4PZVA 4PUEA 5JBEA 1Q7ZA 2FGZA 4Y96A 1IHIA 1LUCB 4MKVA 1A5CA 4PTWA 1FTXA 3W70A 4P5UA 3S9IA 3HMJG 1V3IA 1F8MA 2WPBA 3TEVA 3AROA 4FMVA 1BVZA 2VT0A 3CIVA 3UYCA 5HWNA 2PFHA 3UGVA 4B90A 3JZEA 4M51A 5HAOA 1E1EA 4BWLC 1TCMA 3MCNA 3MHGA 4M29A 3MC5A 3GC5A 2OOFA 1F7BA 3E0IA 2PF8A 4C1KA 3VNKA 3RGTA 1W0MA 2R1PA 3HF3A 4HNCA 2WOQA 2TMDA 3IJ6A 1OYAA 4C7FA 4MZ8A 1ZJAA 4HP5A 3V36A 3SB0A 5FEZA 1VRDA 2ZRXA 1TPC1 4UQCA 1TSIA 3W1NA 1ONRA 3NXLA 3KBSA 3DERA 1GTEA 1HKKA 4WKHA 3UWEA 4F2TA 2ZX6A 3OLEA 1EJUC 3U4FA 5HNRA 1BYBA 2SFPA 3PJTA 2FYMA 3P8JA 2G97A 1FKXA 3CPRA 2PTXA 4C60A 3S42A 1FP8A 4L4PA 5G4HC 4D8LA 4KWOA 3KUMA 3WMCA 1HUVA 1BLIA 2WANA 1GK8A 2X1IA 7A3HA 1B3VA 4ICCX 2QPXA 3WQWA 3MP4A 2BWGA 2ZX9A 4R7OA 2O7QA 3DENA 7CGTA 3ABZA 3QMSA 4QS6A 1IYXA 4N6FA 2GVEA 4ES4A 2ABBA 4IQLA 2VL4A 3UWQA 2YA2A 1FCQA 4LNYA 2UY3A 4JNZA 1HJSA 3CO4A 3OLDA 1I60A 3NCOA 4ERGA 3UBPC 3V5OA 3M0MA 3HMCA 5PTDA 5D33A 3NQBA 4C65A 1U1UA 4W7VA 2OTDA 1BYDA 3GBEA 3P5YA 2CESA 3RPMA 2P5NA 3GZ3A 3PTDA 1F61A 3BICA 4O0ZA 1A5SA 1BG9A 1SQ7A 4TX8A 1VPYA 2BX7A 3OU8A 3VCNA 4JIIX 1NOUA 1T96A 4TTUA 2QQ6A 3MS8A 3AMKA 4P7RA 4JTUA 5FJTA 4U5KA 4P8VA 1HVXA 1RCQA 1X39A 2E77A 2DY3A 9XIMA 4AY1A 1GQNA 3TYEA 3OA5A 3SECA 3AYRA 2J66A 1VEPA 2UBPC 3R8HA 2ZZ7A 5M17A 3BGJA 4JY8A 2C6QA 3H6OA 3DI0A 2KZHA 3LHTA 1JRBA 2WJFA 3CUJA 3D5HA 3C0LA 3W74A 1REQA 1XDMA 3MSGA 2OMAA 1YTEA 4IG2A 1IIHA 2Y7GA 3R0UA 4PMZA 1S46A 3MY9A 3S2JA 1PDZA 4BF7A 2BB0A 4DM1A 4GPNA 1KM6A 1KRAC 4LNCA 5CCZA 1Z3NA 4A8NA 2J47A 1GNXA 1W1ZA 1IQ8A 4PUKA 4K1GA 1TFVA 3BOLA 3H7RA 4OFCA 4DIAA 1TE6A 4LWWA 3NL6A 3LCGA 2YXGA 3LXCA 3GDBA 4MOZA 1IGSA 3ZWTA 5GJPA 5A6MA 2H3DA 2CWNA 3MTWA 1NQKA 4JN6A 2WMHA 4E0CA 2DT1A 3LCIA 4JIHA 3MCOA 1P4CA 3EAUA 4WJXA 1XH2A 1DQWA 2C7FA 4NZFA 5E09A 4M7TA 3DAQA 1B2YA 1LL4A 1OFQA 2EKCA 1LT8A 4M5PA 2IKHA 4O28A 1V6WA 1LOSA 2GVYA 1K03A 4F2UA 3KBMA 1XWYA 3HZ3A 2YZ5A 4UBPC 2HBVA 1T8XA 4ZA0A 3IVUA 3EWWA 2V5JA 5LHFA 3JZUA 3VNLA 1GOQA 2PURA 2VI0A 4WDXA 1QI4A 2BLEA 1KRBC 5AC6A 1XCWA 4W8AA 4YL2A 1F07A 1HJVA 3B9OA 3O6AA 3NSXA 5FJIA 5IBXC 3TAOA 9XIAA 3WH9A 4AX7A 3WH8A 2XHYA 1XH0A 2C19A 4CU8A 3AZTA 3LCLA 3RG6A 3HV8A 4HTYA 3KS5A 1HTIA 4QLLA 3LNMA 3ZLFA 3W07A 1PEZA 4GQ0A 3P8IA 3VC6A 3WQ8A 1Q8AA 4Y90A 1H4PA 3T08A 3T81A 1K7EA 1J9YA 3A9IA 3GR8A 1EHNA 1TWDA 4XTIA 1W1A1 2C15A 3QGAC 4DO5A 4KS0A 4JCLA 3GDMA 4FIRA 4IFKB 4Q32A 3KOFA 1FWSA 6REQA 1FUYA 1RK6A 3XINA 3BH4A 1TPWA 1LG2A 3G1SA 1KBIA 3LI1A 7TAAA 5I00A 2WM0A 4MNMA 1JYVA 2VEPA 1AW2A 1EUAA 4DY1A 4QCFA 3ZJ7A 4MFEA 4AZCA 3W7QA 4QSFA 3ECQA 4S3BA 3WLIA 1F6PA 3U6WA 5DEZA 1QR7A 3DFYA 4TQTA 4HCHA 3H4GA 2BHZA 1WZAA 5C2CA 4Z0SA 3CMFA 2ABAA 3ITTA 4NKCA 3FEQA 1LQ2A 5DRCA 2IMRA 3MSRA 3SIMA 3TN5A 3PJUA 3LSBA 4IICA 4V1XA 3LCWA 4MG4A 2YDRA 3TLQA 3ITXA 3NJ3A 1V6XA 4L5ZA 3CZ8A 1A5UA 1QBBA 1TV8A 4O1DA 1L8PA 4HK6A 1AQMA 3SADA 1FDJA 5KZMA 3GS6A 1TYGA 5I77A 5TD4A 4LUYA 1YADA 3M0XA 3V0TA 1S5TA 2ZUWA 4ZE4A 3UZYA 3C3NA 1UOZA 2O7SA 3LZ3A 4C1LA 1O1ZA 1OF8A 4R5EA 5M03A 1UCWA 3B0PA 5G2IA 3HJEA 1YXCA 2A6LA 2ZQ0A 2WPGA 3G1DA 1G4EA 3OVRA 5G2WA 3MANA 4CVWA 1JCXA 2XM1A 2E68A 1XICA 1IR2A 2QUTA 1ICQA 3B8UA 3TN4A 1H7XA 1WDDA 3E0VA 4EPDC 4EPKA 4JDBA 3F4NA 2OELA 4AZHA 5GNXA 3UVIA 1AQHA 5FF0A 4Q6XA 2E5CA 1AD1A 3SRFA 4YNGA 4Z1YA 3N04A 5FI8A 4BQ2A 3ANYA 3WMBA 1WDQA 1KC7A 1QOQA 4A6GA 3E2SA 1H7OA 4R9XA 3VX0A 1H41A 4HT3A 3S6TA 2XVPA 3VNZA 1V3KA 3REQB 2Y88A 4WJEA 4D6EA 3TXVA 2AAAA 1XCFA 1OX4A 4GXPA 4GZEA 2B7OA 1HP4A 3S9ZA 3EX2A 4W8BA 4O0KA 5IFPA 2CETA 3GG7A 2Q8LA 3W53A 1RBAA 3PUGA 1KFEA 2IS7A 4W7WA 1SMAA 3LY0A 6ALDA 1A0DA 5EBUA 2CZEA 1JYXA 4KGJA 4XBSA 5JMUA 4JDYA 4QRNA 3MVIA 2VC5A 2BXVA 3B4YA 4OBRA 3TKFA 1F3TA 2BGNE 1WZMA 1BTCA 2Z1WA 2AL1A 2BBFA 3FGCA 3LHYA 1V3JA 1W5OA 4P7LA 4GO8A 2BGQA 1I0BA 2OXNA 2DZUA 1KGWA 2PEVA 3ZVHA 2QUMA 1NWTA 3CB3A 3CHEA 1IR1A 3HGSA 4NAEB 4JTLA 5DMLA 3MMDA 5BMXA 3NDYA 2V8ZA 1HJXA 3W7NA 4QJ1A 2WVVA 1EF3A 3IJIA 4YYFA 4IIEA 3KDNA 3NQ2A 3CB8A 5E6ZA 3VDGA 5J8LA 3WBXA 2ZXAA 2YXXA 3L68A 3IJ8A 1JJKA 3RMJA 2LLEA 3K1GA 5AYBA 3N3TA 3NOEA 4N02A 4JTDA 4BA0A 3T78A 1EYWA 2V5BA 3GC2A 1OSEA 2FVMA 4K7YA 1RQBA 4C6JA 4YTSA 3R6IA 5EA9A 5FESA 4GI9A 3UY7A 3NOYA 3LTYA 3FJLA 5AHNA 4NRSA 4O10A 1B4KA 4PMOA 4HPGA 2HQAA 2NSXA 2GGIA 1QNQA 5IRPA 1AQFA 4ZL1A 1L9WA 1V6VA 5DN1A 3M5XA 4NAFA 1H3GA 1K70A 1PUDA 4L4OA 1Y5XA 5A8MA 2QCLA 4PULA 2Z2UA 1J93A 1R87A 4HBKA 5FJOA 5AVNA 2VQUA 1JPKA 4L6OA 4PB3A 3CZLA 3Q2DA 3WLPA 3WLMA 4FR6A 5AECA 4C6CA 1BKSA 4OVXA 4HA4A 4A3UA 3DFPA 4I7WA 2PRHA 5AB3A 2A1YA 4TUFA 4AG0A 3BW2A 1NJJA 3V5CA 2DJXA 1QNOA 1JD9A 4AWUA 3TA6A 5G4EA 3GXNA 1EA9C 2ZA2A 1BSIA 3VOCA 1DJQA 1WE5A 3C8FA 4C7DA 3U5UA 2GGEA 4C91A 3QV6A 4N0RA 3ARXA 1Z41A 4CN4A 4REQA 5DMMA 1EPVA 1QJWA 4WDWA 4ZQPA 4CGTA 4BFAA 1L6FA 3B97A 4ZFMA 1NFGA 4YN5A 3OLGA 1M7JA 3R58A 2JK2A 1PVNA 4IMEA 4Q4RA 2WHLA 2NX9A 3GIYA 2PD9A 1GW9A 1PX4A 4MTVA 4C6BA 4UR8A 4Q7BA 2QCEA 3MCMA 2ASHA 3ARVA 4QROA 5CJNA 4XD3A 3QTGA 3S5OA 3EDKA 3N2TA 2Q3RA 1MEWA 2AAMA 4K39A 3DGRA 3W1PA 4MDPA 3BLLA 4O50A 3WBYA 1J4EA 1RY8A 4P7OA 4UQDA 2VGBA 2DZAA 1UA7A 4ZOBA 5A8GA 4KEVA 2Z27A 1C8XA 8RUCA 3T7VA 1TR1A 3A12A 1GOMA 3ARRA 3MSYA 3KCLA 2VFGA 2WSKA 1JCLA 5FSDC 1W2VA 1E9LA 2X05A 1Q6CA 2CLKA 4LU0A 1EC9A 1YE6A 1HP5A 3MB9A 3DI1A 1T99A 3L2LA 3BMWA 4GE8A 1E6SM 1QFEA 4LVDA 4DYKA 1UWIA 1ADDA 4Z08A 2WLZA 3WDQA 1TPUA 5LNSA 1XIDA 2E5BA 3MI3A 1BSLA 5REQA 4RV3A 5LIXX 1Z8AA 3RCNA 3VIFA 4L1XA 4DO4A 3QSRA 2O55A 1JCTA 1DJXA 3N2XA 3BJSA 1GOXA 1OFAA 4Q8NA 4I5UA 4HU8A 1O7AA 4P7QA 5G1MA 2HZGA 2XZ9A 1DIEA 4X60A 3HURA 3CHVA 1FWEC 5FJRA 4XZBA 3MYPA 2F7FA 2Q71A 4S2BA 1DIOA 3LGEA 2D73A 4H7ZA 1BWLA 4HSNA 5JIWA 4CCZA 2F6KA 1L2QA 1GYMA 3WLNA 3QY8A 3KBJA 3JUGA 1MQPA 4K36A 3GU2A 4AYSA 2NQZA 3G0XA 4F0HA 1IF2A 3RU8X 4AISA 4IGHA 3C4UA 1MZRA 1Q66A 2YOCA 3LERA 2A7PA 3UJ2A 1GKPA 2J9YA 1WDWA 3A22A 2GZXA 4IPPA 3TSDA 2DT3A 5A8NA 5F2MA 2WZTA 4JFTA 2W27A 5D02A 5AHLA 3G77A 1UD8A 1PZ0A 3SCNA 1A53A 1R47A 2E40A 3O07A 4A2SA 1RLCL 3NM1A 1F4AA 1PZ2A 4EPBC 1UWSA 1VPXA 1HZYA 5GVJA 3DX5A 3GLCA 3W2NA 3DHFA 1XFBA 3W24A 2KAUC 4AQLA 1MRQA 3S9YA 3R8RA 3LZ5A 1RPXA 1G67A 3VKBA 4OV4A 5E70A 4O8RA 1TKKA 4UFHA 4FSAA 4EP8C 3OZYA 1QW7A 5A2BA 3EMZA 1ZP3A 4RZ4A 2J79A 3CQHA 2VUNA 4NVTA 4S23A 1HG3A 3GNPA 3D0CA 3INPA 3CK5A 3J7HA 1YTKA 4B9YA 4UCGA 5U7SA 1M01A 2ZOXA 4AUBA 1I2QA 3H55A 1UD4A 4UZSA 2WHMA 1JI1A 1H0IA 4DO6A 4EAYA 3CIXA 1CIUA 3EB3A 2CLLA 3I3BA 2QDHA 2RFGA 2ISDA 4PRTA 2VEGA 4XIMA 3EWZA 3LLXA 4ROPA 3KW3A 4Z1AA 5FACA 4J3UA 4E2OA 1O94A 3DFOA 4OUEA 3ZR6A 2ZTJA 1GJPA 4FK9A 4GACA 2D2HA 2FH8A 1NDZA 3SCWA 3M6DA 3SQMA 3S2CA 1KA9F 4XSLA 3MO7A 1SO3A 3NPXA 3PFMA 3UQNA 1WNOA 3TSMA 5M1TA 5A6JA 2EPHA 3WZ0E 2VX6A 4WK9A 2GJLA 3BLPX 4QTGA 3UGRA 4N9DA 5H8PA 5KMYA 3NXFA 3F5KA 4JIRA 1X7IA 2VVNA 2QMKA 3ZZ1A 1J5TA 1B3XA 3L12A 1ZSXA 1E9YB 2HDJA 5C71A 2W92A 4PTMA 3WQEA 1FWDC 1XSJA 3V0UA 2DPEA 3SIZA 2FJKA 5D09A 1ZCOA 4W5ZA 4RV8A 1DWAM 4O0QA 1Y0EA 5F2LA 3LV6A 5D38A 4O17A 3RK8A 2PDHA 4AYGA 4Z2JA 3BO9A 4I7UA 3H70A 4NYYA 1A0CA 3UWVA 4IOTA 5EYWA 4F9DA 3S1VA 2DZTA 3ATZA 3SFKA 2DSZA 3A4XA 2NV2A 3L7RA 1G7UA 2W3ZA 4PUJA 3S5SA 5ABHA 1X1OA 3JRKA 3NIYA 3H21A 2GDUA 1MRAA 4X2RA 4KCTA 4DHGA 2ZXBA 3FFSA 3HB9A 3VIIA 4E8DA 2D1ZA 2EO7A 2RAGA 1JDDA 3KTSA 1THFD 5GJNA 2WWCA 1RA0A 1TV4A 2WW5A 3OODA 3M47A 3U8GA 3KRBA 4DJED 2XVK