3C61A

Crystal structure of dihydroorotate dehydrogenase from leishmania donovani
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
314
structure length
314
Chain Sequence
TMSLQVDLLNNTFANPFMNAAGVMCSTTEDLVAMTESASGSLVSKSCTPALREGNPTPRYRALPLGSINSMGLPNNGFDFYLAYAAEQHDYGRKPLFLSMSGLSVRENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPQVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANVNAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGPAIFERLTAELLDVMAKKGYQTLDEFRGKVRTLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
publication title Dihydroorotate dehydrogenase from Leishmania donovani.
rcsb
source organism Leishmania donovani
total genus 106
structure length 314
sequence length 314
chains with identical sequence B, C, D
ec nomenclature ec 1.3.99.11: Transferred entry: 1.3.5.2.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3c61A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c61A01
2E09A 3UY8A 2ABAA 4YCPA 2ZYFA 2AGKA 4Y6GA 4BI6A 1Q6RA 1W5NA 1GPWA 3FYPA 1VRDA 2Y85A 4K37A 4GFSA 4O1CA 2H8XA 4E38A 3VFLA 4JEQA 2RFGA 5DXXA 1AW5A 3MJYA 2P10A 1H50A 4O1DA 4O54A 3WJSA 1Q45A 2HSAA 3N9RA 4AWSA 3O06A 4O16A 4Y90A 1LBFA 3FIGA 4DPQA 1V5XA 4QM1A 4MOZA 4LU0A 1EP2A 4HSOA 1YTKA 3KHJA 5EKYA 4BF9A 2QR6A 3D0CA 5MHBA 5LNWA 3IIPA 2YFOA 5EBUA 1KTBA 4LV9A 3BV4A 5K9CA 2F84A 2NUYA 1BWKA 4R7JA 4IMCA 1M5WA 4J9JA 3W22A 4CNNA 2C18A 2R14A 5KZDA 5J5RA 4QISA 3EX6A 2YW4A 1OK4A 2G96A 4Q32A 5LKYA 4PODA 3THAA 2A1YA 2PRMA 5D2XA 1D9EA 3L9CA 5DBUA 2B0MA 1TYGA 3W71A 1DV7A 5BRBA 2VXNA 2X1RA 5HR7A 3QW4B 4TX9A 2TYSA 3GB6A 1UASA 4NX5A 3IGSA 4RCXA 1H5YA 2A0NA 4O57A 4A21A 3SGUA 3FKKA 1EA0A 3PM6A 5I3JA 2WO5A 3CLMA 1VJIA 2QCNA 3CWOX 1TTQA 3PSVA 2HS6A 3EX1A 3M5XA 3TX9A 2DZPA 4FIQA 3TC7A 1W3IA 2JGQA 4YWIA 3HMJG 5DLCA 1ZAIA 3O16A 2B4GA 3G8RA 1HO4A 4LUJA 1NF0A 1KFLA 2ATMA 3W7OA 4LVFA 3NPXA 3GAYA 1AL8A 2NXHA 2H8ZA 3QQ0A 4JX4A 3TROA 3M7WA 1PHQA 3L21A 1OFOA 3H53A 4LTSA 3G1XA 3EEGA 3UY7A 3JR2A 5G4EA 2EKCA 1KM5A 3GK0A 3I68A 1QPNA 1VCVA 3OVRA 1KV8A 4EOUA 2OZ0A 3W72A 1THFD 4XQ6A 4AHPA 1HO1A 2O7SA 3TMLA 3UWZA 3GXPA 1W56A 3P8JA 5EY5A 3LBMA 2PCQA 1BEUA 3MI3A 3MP3A 4ZQPA 1GJPA 3UWWA 3OG3A 3F4WA 3W88A 1K03A 3S5NA 2ZFAA 1A5SA 1A5AA 5LNVA 4MIMA 3DAQA 3PB0A 4Z0JA 5AHLA 3STFA 1M6JA 1LBLA 2J9XA 1FWRA 1KFBA 3L2IA 3T44A 3AO0A 3KVKA 1W5MA 4MFDA 1LRQA 4DF1A 2X1UA 2V0TA 3GZ3A 2C0AA 1VLIA 2ALDA 3LB0A 2DZSA 3NQEA 3PUOA 2V81A 3BLEA 2WSQA 3PVFA 4TU1A 4O15A 1OF6A 1WOAA 2QEZA 5FEPA 3BW3A 5T26A 5AN7A 1K8YA 3W6YA 4TMBA 5IBXC 1H7OA 1S5TA 5F1VA 5E1QA 4NNCA 3PBWA 1MEWA 3HGSA 3MUXA 2OX1A 2C1HA 3LCFA 1QMLA 4O18A 1KM6A 2NXGA 3M43A 1ICSA 1SW3A 3EWXA 5H91A 4KKXA 5D30A 2CW6A 3HJZA 1H62A 2Z1BA 3NO5A 2I9EA 2PRHA 1I45A 3G3DA 4AB4A 2J9YA 3PF3A 1GTEA 1AMKA 2A2IA 4P61A 4O50A 2J9ZA 2H3DA 4NXSA 4RZ5A 2ATSA 1JQXA 4WOQA 1LOQA 3HF3A 2ZRYA 1DHPA 5D02A 2I1OA 1H1ZA 2C6QA 1GVSA 4OV4A 1FCQA 1YXDA 3C8FA 2FQIA 4WY0A 4HNTA 3GYEA 2V2CA 2NZLA 4BFAA 1EX5A 2PURA 2RH9A 5F2IA 2QKFA 3VI2A 3PUDA 3LHTA 3SI9A 2D73A 1G4SA 4ML9A 4IMGA 5EA9A 3TH6A 3USBA 1R46A 1U83A 3ANYA 4E0CA 4E2BA 3I7SA 5U7SA 3N3MA 5G2IA 2RDUA 1N55A 3CIXA 4ZQCA 1O60A 1LROA 3LHUA 3LRLA 1W0MA 3NQ7A 1QCWA 2XFWA 1WOBA 2H3BA 2TSYA 2QUTA 5FI8A 3W7EA 3B03A 5BNKA 3GDMA 2Q8LA 5G2WA 2JK2A 3YPIA 3C2FA 1TPH1 3F03K 1GOXA 3TJLA 4N4QA 1T0OA 5BMXA 2VFHA 4NXKA 3W1LA 4TO8A 3IEBA 3W1MA 2FPYA 1A5CA 2CZDA 2B7OA 1ME7A 2A7PA 2QUUA 1R2RA 1K7XA 1SO3A 1A5BA 1RZMA 2CFFA 4GRSA 4ORMA 3UWVA 2Q3OA 3LTSA 3I6RA 2J24A 4FNQA 3TW7A 1MSSA 1J5TA 1AG1O 4AF0A 3U2OA 2E5CA 4AWUA 4N02A 2FB3A 1GWJA 1EEPA 4LVGA 5E93A 1FWWA 3NNTA 2FB2A 4IGHA 4BI7A 3RK8A 3IIVA 4UCGA 1F05A 3H54A 4UMAA 3BO9A 2V82A 3C2EA 1UCWA 4LW7A 3UYCA 1PCKA 3TSMA 4HNUA 4MZ8A 3CC1A 4M7SA 1D3HA 1B57A 3OHIA 5HULA 3TCEA 1L6SA 1OF8A 1TPB1 3CEUA 4UIOA 4EVZA 3STEA 4A22A 4Z1CA 1W3TA 3AJXA 3O63A 1IIHA 5CPNA 1SR9A 2ZQ0A 4O14A 1GYLA 4JY8A 3KRZA 5C54A 1LOLA 4FNPA 4OBTA 2DORA 5G2HA 3RMJA 3S0CA 3VE9A 2AAMA 2FPTA 1YXYA 1WYIA 3M6YA 4AWTA 3A24A 5HNRA 5CZ0A 1FWNA 3MYPA 4EIVA 3NQCA 3UD6A 4H6KA 3C0JA 3NL6A 2WOQA 1R2TA 1TPWA 3R89A 4GUIA 4LVBA 2FDSA 1TV8A 2V5LA 1XCFA 1XDMA 2AQWA 1JCJA 3ABQA 3WFAA 4NT0A 1FQ0A 1ZJIA 4WXZA 1O5XA 3RLUA 3N19B 2ZRVA 1H63A 4UTUA 1W37A 1OABA 1GEQA 4ORIA 3EWWA 3GR7A 5K3VA 2ZZ4A 3SZ8A 2V8ZA 2A7RA 3EWYA 2OMAA 2GVJA 3I65A 2WNNA 3LDVA 4NUWA 4U28A 2QCDA 3DFPA 1JCYA 1OG0A 1F5ZA 4JN6A 3TQKA 2PC4A 1OK6A 4JTEA 4K39A 2E5DA 3MHUA 3W1QA 1LP6A 2E6DA 1EWDA 4RKAA 1IXOA 3DZ1A 4ALDA 3W1XA 3TSBA 1VPXA 3DKLA 3BK0A 3L67A 4HN4A 4RZ6A 2ZZ2A 3QYQA 1DVJA 3EX2A 1ZFJA 4LOCA 2CU0A 4KWWA 3HIJA 3W86A 1QO2A 1QPQA 4GUHA 4CLMA 1KFEA 1B4KA 3ZFHA 1XUUA 3QMRA 3BG5A 3BGJA 4KFOA 4WJEA 3W83A 5CSSA 4NJGA 3S6DA 7TIMA 2WJZA 2NUWA 3ZWTA 3GKAA 5CGQA 3N14A 2KZHA 2IQTA 2VFDA 3W7DA 3P67A 1F76A 2ISWA 5F2MA 1TQJA 5LGXA 3ABOA 3L5LA 3SIZA 4C1KA 1TTPA 2QJHA 3GIYA 4UTLA 4UR8A 2ZRZA 4AVFA 3S8HA 4QQ3A 3ZR4A 4FO4A 3LGEA 5CKSA 2WV8A 2YYUA 4ONVA 1LM1A 3M47A 3QZEA 4JD4A 5FEWA 3LCWA 2Y89A 4XUGA 4N9CA 1CX9A 3EWUA 1W31A 1EP1A 1PV8A 4MY8A 4DPPA 4JTFA 3NQVA 3GLCA 3OBKA 4MFEA 3NZRA 1GT8A 4MVAA 3C56A 4FEZA 1A53A 3W7KA 4N2YA 5KTLA 3GXTA 1H7XA 3NXFA 3MW7A 4LRTA 3TE9A 2YXGA 2QJGA 4WUIA 4IQLA 4LVDA 3IIXA 4PC8A 2ZTJA 3ABRA 3GXNA 2WNZA 1H60A 1Z48A 2OT0A 1VH7A 3E49A 4S2BA 5L6UA 3H55A 3BPWA 1RQEA 2B7QA 4CNOA 3BGGA 3N34A 1YDVA 4BWLC 1KM0A 2CZ5A 1T99A 4N6EA 3W85A 1OFQA 2EGZA 3IVSA 1BWLA 3V1PA 3QH2A 2HMCA 3W7PA 3GX9A 4JR5A 4U4MA 3QM3A 2JGYA 4UNLA 4GC4A 1I2PA 3NYZA 3LV5A 3O1NA 4XKYA 1SFLA 2H6RA 2A6NA 4HPXA 3N73A 4MLJA 3G1DA 3W1PA 3SECA 3EX3A 4PL2A 2YPIA 5D38A 4HNNA 4QNEA 4M6QA 3LHYA 2DZTA 4O1AA 4DF2A 2QDGA 1IGSA 1VCFA 3L0NA 3P62A 3G3MA 4JNMA 4O0KA 4JYFA 1OFDA 2DZVA 5KZEA 2OT1A 1ZAHA 5AYXA 1QFEA 3G1YA 5BOOA 2JKPA 3DENA 3S5YA 3M5ZA 1YLVA 3PR2A 3FYOA 3TAOA 2J27A 4R53A 3Q2DA 3W7NA 2GQ8A 4ZQOA 4K7VA 1LRNA 3C2VA 3DXIA 4MUZA 5FEXA 5FF2A 1F74A 1Q6LA 1IXNA 3BLFA 1F6PA 2NWSA 1P0KA 1KBIA 2JKEA 2H90A 4ZZ9A 3TAKA 1OX4A 2NLIA 3B05A 4POCA 4BI5A 3TXZA 5FF0A 4NNAA 4MYAA 4HPJA 3MHFA 4JYDA 2Z6IA 4QAIA 2P0OA 3E02A 1JUEA 3W3OA 1WDWA 4LT9A 4IOTA 1FDZA 4IPJA 3WJXA 3MHGA 4JX5A 5FF3A 3OA3A 2J6XA 5IM51 1VS1A 3W7QA 4GNJA 1ZAJA 3O8AA 3U6WA 3LI0A 2LLEA 3DGRA 5HUOA 3KXQA 3WK0A 4CCDA 2VFEA 1DOSA 3P74A 3Q37A 2YYTA 2FTPA 4M7TA 3EWBX 1JVNA 3LCHA 2GQ9A 3O6CA 2C14A 5D33A 3W1NA 1TJRA 5SWUA 1FDYA 1KW1A 3LCLA 4R33A 4NJIA 3BLIA 1SO6A 4JDYA 3SSJA 1ONRA 2WKJA 3QPZA 5D2YA 3NQFA 1XBZA 4O28A 4AMAA 3W75A 4K8HA 3ELFA 5CZJA 3MO7A 1JUBA 3BARA 1LYXA 3NQAA 2R8WA 3QJAA 2Y62A 1FCVA 1FWTA 3OVPA 4DO4A 1LCOA 1SFJA 3GNNA 4O53A 4MJMA 5CSRA 5IBXA 4MLRA 2Q8ZA 2FFCA 2GVGA 1KM3A 4UMCA 4L4LA 3LV6A 4MJZA 2EPHA 4JTGA 1OHLA 2ZZ1A 4N4PA 4JTKA 4O10A 2YGYA 4O12A 1TO3A 4HKPA 3UPWA 4UTMA 5CG7A 3TSDA 3F1QA 3NL2A 1I2RA 4LC8A 5KITA 2QJIA 3E12A 2QDHA 3UNDA 1XKYA 3W7IA 3TMQA 2Q3RA 4LS2A 1AK5A 5K9XA 2BTMA 4CNPA 3EXTA 3M44A 5BMWA 1GYNA 2WNQA 5AC7A 5D2VA 2VOMA 3DFTA 2NV1A 3DFOA 1XBYA 4RZ4A 3NGJA 3DFNA 4UTKA 1ICPA 3W2LA 2G5WA 1KV5A 4QIUA 3HG3A 2JBMA 3NL3A 5ABTA 3K30A 2YW3A 3TA6A 2VFGA 4JTIA 3F4NA 3P81A 4JTUA 1IXPA 1JRBA 1ICQA 2A21A 1FBAA 3WK1A 5AHNA 1P0NA 4NVTA 1MEIA 5F4XA 3S1UA 1BKSA 3FOKA 1GTHA 3KOFA 3M16A 1YXCA 3W7RA 4LS1A 3P80A 1HG3A 3W1UA 1X7FA 3I7RA 1LBMA 3B4UA 3GAKA 1R47A 5K7JA 2C3ZA 4DBEA 5I3HA 1WBJA 1EUNA 4GXMA 3MI6A 4K6AA 4ZQNA 1QAPA 3QQ1A 1H7RA 4MZ1A 4YL2A 1OYCA 1PHWA 2RDTA 4PTNA 5LZLA 5HWMA 2NV2A 3CU2A 5AC8A 3PG9A 3TR2A 2ZZ7A 4B5NA 5D37A 3W87A 5FF7A 4QNWA 3W7JA 3O15A 1JRCA 4UTHA 1DQXA 2VENA 3BG9A 1KFJA 3NQ6A 1TMHA 2BX7A 3BG3A 2G97A 3TDFA 4O11A 4NZFA 1XUZA 3T4CA 1LLZA 1O94A 2UV8G 1SO4A 3NAVA 3P5YA 3KVMA 1SZNA 3NDOA 3JS3A 2VEKA 4A2RA 3ZWSA 3LRKA 5BW6A 1SSDA 2PRLA 3LOTA 3MI2A 4HSNA 1E51A 1RV8A 2V9DA 3T55A 5D09A 3EXRA 1QNVA 3BW4A 5KSWA 1NF7A 2W6RA 4Q4KA 3TKFA 2ZTKA 4CCCA 1A50A 1HUVA 2CLMA 1OYAA 1W54A 5AYZA 3G8EA 4WD0A 1WXJA 3PBYA 1UB3A 5HWNA 1KLZA 3L66A 3QC3A 1WQ5A 3C4UA 3UXDA 5DCEA 4IMFA 4UTTC 4IMDA 2I14A 4AEOA 3G18A 4X3ZA 2E6YA 4O19A 3C52A 1TPUA 3FJLA 3W7GA 3PBUA 5G5IA 2CLLA 3W2NA 5AYYA 3GVGA 4ADUA 4CQ9A 3HBLA 3DHFA 4IXHA 4NU7A 5CZTA 5KZMA 4BK9A 1WBHA 5EPDA 4UMBA 4WQ6A 4Q33A 3G22A 3ZS4A 3TNOA 4DBDA 2YZRA 5K9DA 3WK2A 3IRDA 1FCBA 4ZMGA 1I4NA 1W1ZA 3UZJA 1AL7A 3FEMA 2C16A 4CCEA 1ZY9A 4K8EA 3L68A 4WY0B 3TC6A 1QDSA 3QRHA 3ATZA 4NNBA 1ZHAA 2FLIA 1TV5A 2Y7EA 2XN0A 1JULA 1TQXA 5F1UA 5HQEA 3LCGA 3EWZA 5AHEA 1SZGA 1TRIA 1K7EA 1VYSX 3ATYA 3W76A 5LHFA 4KFNA 3C2RA 2Y6ZA 3HGOA 3TFCA 5C5YA 4FX7A 4LC6A 1RR2A 1OFAA 2GQAA 1OVDA 3NPUA 4AHOA 4RJEA 4MYXA 1HTIA 1UUMA 1P4CA 5AHFA 2FJKA 1M7PA 1TPDA 3PC0A 4G1KA 3HOJA 4O4VA 3P82A 1SQ7A 1EB3A 1DJQA 2V2HA 3N9SA 2YR1A 4JTLA 3G1VA 4M19A 5FESA 4UFIA 4XTDA 3G1FA 4WZHA 1MO0A 2NX1A 4DEFA 1CW2A 3FKRA 1KFKA 1QO5A 3UPBA 3W07A 1FCUA 3LLFA 1VR6A 1LTDA 1YYAA 4FXSA 2Y7GA 5TQLA 2P1FA 4PFMA 4RX0A 5LNUA 2XN2A 3M41A 2E6FA 1IF2A 3R5EA 3IVUA 3RLVA 3C61A 3R12A 5D2TA 1QPRA 4MPQA 1N8FA 3IGUA 1X1OA 3T7VA 1RD5A 3HG2A 4AF0B 3SJ3A 2E68A 4OWGA 3UXAA 1G7UA 2GOUA 4Z1DA 3NA8A 2CLHA 1NFBA 2GUUA 3LLDA 1R30A 4OHQA 3E0IA 3UWYA 1WX0A 1KBJA 1O95A 5EMUA 4UFKA 2CZEA 3STCA 3WJZA 4IJBA 4GUJA 4RXGA 3W2MA 1DBTA 5DELA 3SY5A 5HR6A 1PE1A 3L65A 2RHGA 1X1ZA 1TPFA 2J88A 1TPC1 3IIZA 5HINA 2ZCGA 4K36A 1K8ZA 4JS3A 2VKZG 1EIXA 3QFEA 1Q6QA 3OIXA 1O5KA 3TJXA 3G1HA 1VHCA 3W1TA 4UUIA 2QCMA 1F73A 3DFSA 3RF9A 4IX0A 3A5FA 1TV7A 5G4WA 3OEXA 1IIGA 4JYEA 2W0UA 1TTIA 1C9DA 2JKAA 2QUVA 1PL9A 3MP5A 4UTIA 2TMDA 3MWAA 4XBSA 1GG0A 1PIIA 3EB2A 4UTWC 1MEHA 4ADTA 1FX6A 3P84A 2X30A 1T96A 3FS2A 3ABSA 4FNRA 4LS0A 3VCRA 5F2LA 4OE7A 4BR1A 3W7HA 1MZHA 2TPSA 4KFPA 1AW2A 3A5VA 2Z2UA 1W5PA 5HMSA 5C6MA 1R2SA 3LHVA 3W7MA 3TQ0A 2RKXA 4XZ9A 3B0UX 2DJLA 4AH7A 1LORA 4BWLA 4HIBA 1VYPX 3DI1A 1TB3A 1U5JA 2ZA3A 2QCDB 3W73A 3TUUA 3OVQA 1TPEA 3S5ZA 4DELA 2ZA1A 1K02A 3S1XA 1B3OA 1YTEA 3FJ6A 5DY3A 1GQNA 5HJLA 5DBTA 2E77A 3W70A 3KVLA 4NJHA 5LNSA 4LY8A 2OCZA 1DORA 3W7CA 4N6FA 4X22A 1YTDA 3S1WA 1VZWA 2CWNA 2ZZ3A 4OV9A 1PS9A 3PS7A 2ZA2A 4Z1AA 5F4SA 6TIMA 1KTCA 2CLKA 3NL5A 3G0XA 1C29A 2ZRWA 4IMEA 1ZENA 1HL2A 3HG5A 2RDWA 2ISSA 3CT7A 2C19A 1EPXA 4FNUA 3R2GA 2YCEA 3W2JA 1YPFA 2Y7FA 3IV3A 3QPYA 1FWSA 4A29A 5DCDA 5AOUA 3NZ1A 1TPVA 2GJLA 3KVJA 3I7QA 5U4NA 5GVJA 3WK3A 3IGXA 1WA3A 1TREA 4FIRA 1JCLA 2X1TA 2B7NA 4Z1BA 3L0KA 1DKWA 3PY2A 1K3UA 4XTIA 4UR7A 1OFPA 4FHAA 1OJXA 3RFAA 3G1SA 3HB9A 3A21A 1IXQA 3LHZA 3Q58A 4LV4A 3L0GA 4JTSA 3TU9A 4EF8A 2A7NA 3NPVA 5AFDA 2QCLA 5D03A 5CPLA 4TR9A 4RXFA 4JXCA 1VQTA 2R94A 2TRSA 3PB2A 2BLEA 4UTJA 1KTNA 3QSRA 1TSIA 3SFKA 1P1XA 4UFLA 1I2NA 3A9IA 4CQ8A 1L2UA 4GBUA 4PH6A 4DO6A 1F2JA 1H7PA 3GDTA 5LHEA 4OQVA 3UWUA 5EYWA 1J2WA 2YX0A 1S5WA 3PWAA 4X2RA 1H7WA 2Y70A 4I9AA 2BWGA 1OFRA 3R13A 3HG4A 1TTJA 1XFBA 3O6DA 5C55A 1X6UA 3LXCA 5F4WA 1SZEA 4ICNA 4S2CA 3DU0A 3Q94A 5CPOA 4QITA 1YDOA 3E96A 1JJKA 3MBFA 3LTPA 1ADOA 4XBKA 1I2QA 1PVNA 4XKYB 4N9BA 2X1SA 3C3NA 4AXKA 2CLEA 4UFJA 4JTTA 3SW6A 1OX5A 5G1TA 2C15A 2QCHA 1ZALA 3P5ZA 4TIMA 4GUFA 4OGZA 4P2VA 3GDKA 1M7OA 3MP4A 4O52A 4WXYA 3NQ2A 3SGZA 4IX2A 1J4EA 2NX9A 1H51A 2VFFA 3PULA 5LGZA 3BW2A 4QSHA 4ZQMA 1Y0EA 1JCMP 3GDLA 1ALDA 3M0ZA 4MZYA 4DO5A 1YDNA 4O8RA 1FUYA 2ISVA 1NAL1 4LWWA 4A2SA 4RLIA 5J5DA 1XBXA 2QAFA 2WSRA 1RQBA 3GDRA 1GZGA 3TV8A 2ZDRA 5C2XA 3CEPA 2NUXA 5D2WA 2DP3A 3VNDA 3VKJA 3QMSA 3TK7A 3V75A 2DZUA 1LLWA 4AHQA 1OX4B 1QPOA 4N9DA 3IVTA 4NJJA 3LCXA 4M6VA 2GVLA 3PG8A 1F6KA 4GUGA 5CZSA 4ZQRA 2V2DA 3INPA 1KFCA 5L9FA 2Y88A 3IIOA 1G67A 4JY9A 2W79A 1B9BA 3L5AA 4X9SA 4IUOA 1RPXA 2FIQA 4O17A 3WJWA 3QSTA 3HPSA 5AB3A 3KX6A 4UC5A 3LCIA 2Y63A 3T78A 4E2DA 1WAUA 3CWNA 4JDBA 1DJNA 4NZJA 1TRDA 3DBPA 1SU5A 5FF4A 4Z08A 5FEZA 2HS8A 2WSYA 4Y9AA 3HPZA 4EF9A 3NM1A 4MY9A 5TIMA 1WV2A 4IXXA 4JGDA 1XM3A 3G24A 4FX8A 5DCBA 5G1YA 4KWVA 5K2ZA 2B7PA 4Z0SA 4NJKA 1T8XA 3P61A 1G6CA 3NPWA 5A8GA 2X2GA 4FB7A 3CHVA 2QCFA 4UFHA 3KAOA 1LDCA 2VELA 4K38A 4FNSA 2X16A 1EWEA 3NQMA 1GVRA 1VGAA 3TXVA 3RU6A 3WJYA 8TIMA 4JICA 2Z6JA 1VLWA 4LNYA 3QF0A 1PCWA 4I7UA 4I7VA 2CZFA 1I8JA 3FFSA 3HGRA 3JRKA 4FNTA 1OYBA 1SSGA 3N2MA 1MXSA 1Q3NA 2E5BA 3NG3A 2VFIA 3NOEA 1GVQA 3PAJA 3GR8A 2O7QA 2ZRUA 1KM2A 3EX4A 4OT7A 4UTTA 4NX0A 1FY6A 2Y7DA 4PL1A 4PEKA 5LNRA 2V30A 3C2OA 3CB8A 4PCFA 1SZFA 1VYRA 5KMYA 2CLFA 3W84A 1JR1A 3G0UA 1XXXA 3KFTA 1G4PA 1JCNA 1QOQA 1LOSA 4HHPA 4C1LA 2XN1A 2ABBA 1Q6OA 2E1DA 3NM3A 1Z42A 3W9ZA 1SW7A 1EP3A 1G69A 4DF0A 3O07A 2QCCA 3A23A 4UFMA 3EKZA 1FDJA 2A6LA 2NWRA 2QAPA 3TFXA 3STGA 3O05A 1FXQA 1VCGA 4ZL1A 2WQPA 4JTHA 1ZCOA 1N7KA 3LX9A 1DL3A 3S42A 4YLWA 5F2GA 1EUAA 3HGJA 1LZOA 3B0PA 3CTLA 3G1AA 4TMCA 1FXPA 1XI3A 1YPIA 3CIWA 3UZ5A 3MMTA 2YFNA 4FXRA 1GG1A 4YCOA 3S5OA 3L5MA 2E6AA 5AC6A 2R91A 3P7YA 4Y96A 2DU2A 3W7LA 4AAJA 2DZWA 3NQGA 2CLIA 2OJPA 4LUIA 4D2JA 1JCXA 1TJPA 3KRSA 1CI1A 5DN1A 4WY0F 1BTMA 4S1FA 1XC4A 2BXVA 1W5OA 3A22A 2QCGA 1QOPA 3B04A 4WX2A 3E9AA 2VEMA 1XBVA 4N9EA 5I3FA 1SW0A 5D05A 2F7FA 4ZVJA 1TIMA 2BZNA 5K4XA 3BVJA 3TW6A 4RR4A 3GKFA 3NEVA 1QWGA 3UQNA 1ME8A 4H4IA 4O4WA 2A5HA 3CM4A 1JQVA 4JIQA 2NX3A 2YDAA 4FF7A 3CPRA 3NR0A 1W8SA 2WPBA 1NVMA 4OU1A 4JIPA 3PUEA 2BSLA 3HPXA 5D32A 1UJPA 3W2UA 4GWEA 1H7NA 3VE7A 5H2ZA 5HWJA 4M5PA 5DY2A 1W3NA 3MYOA 3MBDA 3GNDA 2DJXA 5CPMA 4EWND 3KRUA 4Y8FA 4NQ1A 5I3GA 2PE4A 2DZXA 1QR7A 1K8XA 1W5QA 4A3UA 3NQ8A 3R8RA 1SPQA 1OFBA 3DH7A 3M5YA 5DXYA 4YXGA 5AHIA 1ML1A 2Z0IA 4W9TA 2QF7A 1I2OA 1SO5A 4M6PA 4QJ1A 5E0KA 3S1VA 4XWUA 3W1AA 3W1RA 4O1BA 5I3IA 3S9YA 3LBCA 3DI0A 4O0ZA 4UNKA 5K4ZA 3T40A 1NSJA 1OX6A 1XL9A 2ZZ6A 5HUPA 4JX6A 1L9WA 3LERA 1P5BA 3DHDA 4DXVA 1G4EA 4DQWA 2G95A 4I7WA 3LM7A 5D04C 1H61A 1O4UA 2QCEA 3TIMA 4JTJA 4GE8A 3P8IA 3U8GA 3LRMA 1AW1A 1D3GA 1G7VA 2C13A 3N2XA 3EKLA 3THQA 1KM4A 1LRTA 1YADA 4LRSA 4UTWA 3QMTA 2CLOA 1ME9A 2Y61A 1UBSA 4YMZA 3FLUA 1L6WA 1L6YA 1SUXA 2GPTA 4L4MA 4WOZA 5I3KA 3FA5A 1KLYA 3B0VC 2VC6A 3SR7A 1DQWA 4UXDA 3RNDA 3TQVA 1K7FA 2A85A 5A5WA 4PA8A 3EXSA 4HT3A 5KINA 3C6CA 3DKJA 1NEYA 2GJNA 2V5BA 4MKNA 1RQHA 4HNVA 1RVGA 3LHWA 2EHHA 2VEPA 3LXAA 6ALDA 4IPIA 4RV8A 4K7YA 3HO8A 3UWQA 1TCDA 1B4EA 3B06A 3QW3A 4O13A 3LXBA 1JUKA 3HQ1A 3LTYA 1S5VA 1VHNA 1X8FA 3NVTA 4H3DA 2HTMA 1HFBA 4FX6M 3M9YA 4RK8A 5TBOA 2VEIA 2EF9A 3M1ZA 4LVAA 3CQ0A 3PSWA 1C8VA 3O6YX 5AHMA 1KA9F 3W2KA 2ZZ5A 4CQAA 3B8DA 1S3HA 4ADSA 1F7BA 3NQDA 2ZBTA 2FPVA 1ZNNA 2EAWA 1G4TA 1GVFA 1OFEA 2A4AA 4MY1A 4IWWA 1UUOA 3W23A 2YSWA 5EL1A 1KM1A 1V7YA 3G0SA 3P60A 1Z41A 3PBVA 3QEZA 1GVOA 3DFQA 1VC4A 1Z44A 5LSMA 3W74A 1XDLA 3LI1A 2NXIA 4GJ1A 3M5VA 2ZRXA 1H1YA 4R34A
chains in the Genus database with same CATH superfamily
2ZE3A 4W93A 3UY8A 4YCPA 3DG3A 4BJHA 3S46A 1IHIA 2DIJA 2XVLA 1TJ0A 2Y85A 2E7FA 4JEQA 4XZNX 1GGOA 1AW5A 5DRIA 2P10A 1ADSA 4O1DA 3WJSA 2VCAA 1LBFA 3FIGA 4HCLA 1V5XA 3KS5A 1FHUA 5EKYA 2YCLA 5MHBA 1KQYA 2WM0A 3ARXA 3IIPA 2OEKA 1KGUA 3KP1A 1HVXA 1J18A 4LV9A 1GOWA 4WSHA 1EO5A 3QZ6A 1OD0A 2ZXQA 1V0LA 1BWKA 3W22A 3GYCA 2C18A 1M01A 2I5QA 2R14A 4JTQA 4QISA 4H6RA 3EX6A 2DZAA 4Q32A 2PTZA 5E5CA 4X63A 3CQIA 2A1YA 4A3HA 2E25A 2HZGA 3L9CA 4DAIA 4XO6A 1C92A 4IQEA 2VXNA 2Y1HA 5HR7A 3EB3A 1M04A 5T9CE 2O9TA 3IGSA 1JNDA 2YA1A 4CKQA 3A3WA 4A21A 2PGWA 1TELA 4MNJA 3DESA 3KWSA 3PZOA 7REQA 3ZT7A 5EMMA 1OGSA 5TF0A 2VUYA 3M5XA 4IISA 1UR1A 3UEQA 1RA0A 3SUTA 3IJDA 1ZAIA 4UR9A 3G8RA 1P6CA 1NF0A 2EJ1A 1KFLA 2ATMA 4PGLA 2VX6A 1CPUA 3WLQA 1F3TA 3NPXA 3VGGA 1AL8A 2NXHA 3QQ0A 3QXBA 4JX4A 3M7WA 4UWMA 4LTSA 4DWDA 3RLHA 3PHAA 3ZYZA 2OELA 1JEZA 1QT1A 4EOUA 3ABXA 3ITYA 1THFD 5I06A 1R85A 3P8JA 3MVIA 3KZSA 1AODA 3CHCA 3HFTA 5EY5A 3LBMA 1BEUA 1G94A 6ENLA 3MP3A 1GJPA 3F4WA 3W88A 1K03A 1E1EA 2ZFAA 1PPIA 1EIBA 2DH2A 4MKSA 2XIOA 1M6JA 1DHKA 5GJNA 3KBVA 1CGXA 3L2IA 2HBVA 1W5MA 3IANA 1LRQA 2X1UA 2V0TA 3PWIA 2C0AA 3LB0A 2DZSA 2IKGA 3BMVA 2V81A 4O15A 4R7OA 4KW2A 1X98A 3TYZA 3BW3A 3UNTA 5A95A 1EZ2A 2A3LA 5T26A 2ZDSA 2XVGA 1UZHA 4W7WA 2YL8A 3N12A 4QE4A 2I57A 4TMBA 3PBWA 3RUBL 1HJXA 1MEWA 4WEVX 1C90A 3UJSA 2C1HA 4FSAA 3GRIA 3V18A 1N8WA 3M43A 3FCPA 3VDBA 4GGBA 5D30A 3GG8A 4AZ5A 2D0HA 3BE7A 4Q8OA 1XICA 2A3EA 1V0KA 4GY1A 2CW6A 3HJZA 5BXPA 2PRHA 2PSNA 4D1IA 4UQAA 5CC6A 1ISWA 2J9YA 3PF3A 2H9AA 4LB4A 4NXSA 2ATSA 2DFAA 1JQXA 4MWAC 4WOQA 4GVFA 2XSXA 2XIJA 1E9LA 1Y5VA 4C7GA 1FCQA 1KXHA 4S3JA 2E3ZA 1FH8A 3ZR5A 1H0GA 2FQIA 9CGTA 4GXWA 2NZLA 4BFAA 2PURA 1ITQA 3LHTA 4ML9A 4L65A 3OBAA 1R46A 1U83A 4XB3A 4E0CA 3N3MA 5CGTA 4E8DA 1D2KA 2O9PA 3CIXA 4ZQCA 1CYGA 1J79A 2WMFA 3LHUA 2NSXA 1XLCA 4B3KA 1W0MA 4GZJA 4BQ4A 2OOGA 4G7FA 5AECA 4AIBA 3GNRA 4HPGA 1QCWA 2XFWA 4HMDA 4LQ1A 2TSYA 2VTFA 2QUTA 3E0VA 3C0QA 3WSUA 5FI8A 3ZXWA 4PE8A 1NFPA 2VFHA 3COTA 2XFRA 4A3QA 4TOQA 4YPJA 3C0LA 3V0UA 1L8NA 2Z2AA 1RJQA 2OFJA 1EJ7L 2W5FA 4FZIA 1ME7A 2QUUA 1R2RA 1SO3A 2DT0A 3N9KA 3H4GA 2RAGA 4GRSA 4ORMA 3VIMA 3UWVA 1XR2A 1AQMA 4L9ZA 1J5TA 1AG1O 4D6FA 2J47A 1D8CA 1FWEC 3GVVA 4AY8A 1GWJA 1B9ZA 1FWWA 2WANA 3NNTA 7CGTA 5JBDA 4C91A 3OGSA 2NQHA 3D5HA 3QY8A 4ACYA 2PPGA 3FA4A 2R9RA 1LQ0A 3L4XA 3VXGA 4LW7A 3O6AA 3TSMA 2OX4A 4HNUA 3CC1A 4M7SA 5HULA 3TCEA 1L6SA 1OF8A 3FHAA 4G1NA 1X6LA 3CEUA 3AXXA 5CBBA 1GW1A 3STEA 3TVAA 5I2UA 2WHJA 4Z1CA 3F4VA 4Q4PA 4C6EA 1PYFA 3O63A 1LUCA 1R6WA 1GYLA 1DWIM 4QLKA 5C54A 2HK1A 1LOLA 4FNPA 4CEXC 3UW6A 2WW5A 5CSYA 2VR5A 5G2HA 3VDAA 5EBAA 4D1JA 3WH5A 1A5KC 1YXYA 3W81A 4AWTA 5A6KA 1FWNA 3NQCA 4ZR8A 1JDDA 1NP0A 4H6KA 4JIHA 1W6TA 3QGKC 4FMVA 2D24A 1R2TA 4GABA 3R89A 5DQPA 1XCFA 1IQ8A 3VOHA 3WFAA 1R3RA 5I24A 1XP3A 4WXZA 3RLUA 3CL7A 2D2HA 3QR3A 4UTUA 1W37A 3GHTA 4A3RA 1EQCA 2DIKA 4H8VA 4MSSA 2A7RA 3EWYA 3WQPA 1DXEA 1FWDC 1UH4A 2GVJA 3SCNA 4Z17A 1R3YA 4JN6A 3TQKA 1D3CA 4JTEA 3VDCA 3MHUA 2MANA 1EWDA 1OT2A 3KOWA 4B4FA 4RKAA 1UOKA 4AZ6A 5I09A 3MANA 4HN4A 3AYVA 5REQB 3OLGA 4AZIA 2WM1A 3QYQA 2FYMA 4PMNA 3AYTA 4IL0A 1QPQA 3WKZA 3DDMA 3CWHA 3RITA 1TA3B 5DRCA 3KBMA 4AMCA 4Q7IA 4LCRA 4KFOA 7TIMA 3H2OA 3GKAA 1DWHM 1TQJA 2OZ3A 3L5LA 4NZCA 4C1KA 2QJHA 4Q4SA 4UTLA 2ZRZA 4AVFA 2I56A 3ZR4A 4QJ3B 3LGEA 4LF1A 2YYUA 4MDOA 3E3HA 4W5ZA 3BUVA 2QUNA 3EWUA 5AYIA 4JTFA 3OBKA 2UBPC 4MVAA 3WNKA 3C56A 1A53A 4DBUA 3TLLA 4ZE4A 4J3XA 5KTLA 1L0PA 5CZKA 3NXFA 3MW7A 4WVXA 4TUFA 1FKXA 3VM7A 4NRRA 4WUIA 2PODA 3CZKA 5T9BG 3ARTA 2ZTJA 1I0DA 3ZJKA 2WNZA 3B9DA 4N42A 2CWXA 1E6QM 5L6UA 1R3QA 2FTWA 4LH8A 1IZJA 3H55A 5C0QA 2B7QA 1I1XA 4X0NA 2P3ZA 3RHGA 3W85A 4XV0A 2EGZA 1K77A 3V1PA 2HMCA 2WQDA 4B15A 3GX9A 4PMXA 2YCJA 1GK8A 5A6AA 2GSHA 1LJYA 4E4UA 4CU6A 1QNPA 3NYZA 3EA1A 3LV5A 2OGJA 5HQMA 4HPXA 3N04A 4U5KA 4MLJA 3W1PA 3AHVA 1H1NA 1QNRA 2DT3A 3EX3A 1US3A 1YBQB 2EKGA 4QNEA 3SADA 1UZ4A 4UQDA 2QDGA 3P62A 4QJ4B 3LS9A 4JYFA 4M56A 5BOOA 4AFYA 5TNVA 1A3WA 1YLVA 2EQDA 4GQRA 4M80A 1EF2A 2J27A 4QE5A 2GQ8A 4WLCA 4MUZA 1UBPC 2PDWA 1AMYA 1Q6LA 2WLZA 3DHPA 4TVUA 1V6WA 3KW3A 3AIUA 4FI4A 1JYVA 3B05A 3V1HA 1JCTA 1BVZA 3TXZA 5FF0A 4I90A 3U5YA 1AH0A 4QAIA 2P0OA 2YLAA 9XIAA 4UQEA 4C6FA 2EEXA 1FDZA 2D3LA 3IJ6A 5AC4A 2J6XA 5FCZA 2QUMA 1ZAJA 2PDKA 4QGCA 5HUOA 3UXKA 4KPLA 3WK0A 2E8YA 2ZUTA 2VFEA 4GVIA 3GU1A 4M7TA 2FTPA 1U5VA 1XGDA 3SQSA 1JVNA 3AJ7A 2C14A 2HEJA 1TJRA 3SCTA 1FDYA 1O1HA 1X38A 3SY1A 5DEZA 1BSLA 1EPVA 5C9UA 3UG3A 4MB3A 4NG3A 3CHDA 4AZCB 1ONRA 5D2YA 3H7UA 4AMAA 1LL6A 4HU3A 1JUBA 2WZTA 1G5AA 3WLHA 3QJAA 3M0VA 3WNNA 3OVPA 2XH7A 4LYQA 1QNQA 3H70A 1J93A 4PUKA 3GD6A 2VI0A 2Q8ZA 2FFCA 4IIDA 3JZUA 4L4LA 3LV6A 4JTKA 3M0XA 3NL2A 3K5XA 3E12A 3UNDA 5HNTA 3LG3A 3VZXA 5BWFA 1XQKA 3RYSA 2BTMA 3EAUA 2PDNA 5BMWA 3ES8A 4FLRA 5DMLA 2DH3A 4JL2A 2VOMA 2NV1A 2CESA 1V6UA 4PSRA 2G4JA 4MWAA 1EYEA 4UTKA 4H9TA 3MDUA 2WJEA 2OQHA 5I79A 3RMEA 1KV5A 5E6YA 5C70A 4E6MA 4CCZA 1IT0A 4JTIA 5CAKA 1TZZA 1ICQA 1DJYA 1P0NA 4NVTA 2DPEA 4IGNA 3DYPA 5FIPA 1QXLA 1RH9A 3FSUA 3HM7A 4LS1A 1X7FA 4ZCWA 1QHOA 1XSIA 1R47A 3ARZA 2C3ZA 4DBEA 5I3HA 4RW5A 1WBJA 3MZ2A 1EUNA 3QQ1A 3KOYA 3P0XA 4MZ1A 5T91A 1PHWA 2ZX5A 3W26A 3TYBA 2IS7A 3CU2A 5AC8A 3RX2A 1E55A 2F61A 1AQ0A 5D37A 4Q3MA 1W9PA 3W7JA 3UJ2A 5EFFA 2VENA 3BG9A 1KFJA 2BX7A 3IS4A 2G97A 3WLTA 1XUZA 3TTYA 4NIRA 4DUVA 1C8QA 4YS1A 1LLZA 1W1B1 3I4KA 2INZA 3VFCA 1SZNA 3LRKA 3WQ8A 3NDZA 4HSNA 4G2DA 2V9DA 3EXRA 3UCDA 2WK2A 3E2RA 1NF7A 1HUVA 1H2JA 3O0KA 4WD0A 1NOUA 1BQGA 5HWNA 3OLDA 4N0RA 1JZ8A 3L66A 3LLXA 3C4UA 5DCEA 4BQ5A 5I02A 3WDJA 4IMDA 2I14A 3G18A 3OYZA 4X3ZA 2IQDA 3FJLA 1CZ1A 3GTFA 5JH1A 2BHYA 4W8BA 3DHFA 4IXHA 1ITUA 1A4LA 3R7MA 3WBAA 4UMBA 4UNIA 3ZS4A 4RE2A 4Y8EA 3ZLFA 4L5ZA 1D7FA 1W1ZA 3UZJA 7ODCA 3L68A 4RW3A 3EMZA 3D47A 1Z3NA 4NNBA 3H2FA 1PWMA 2XN0A 1JULA 5F1UA 5AHEA 1SZGA 1TRIA 1K7EA 4YTUA 1RY8A 3C2RA 4LYKA 4LFYA 3TFCA 1V93A 3NPUA 4WGXA 4AHOA 4W87A 1DWGM 3EBVA 1UUMA 1M7PA 4G1KA 4LCQA 3HOJA 1EB3A 2V2HA 5HNNA 4DO7A 3MB9A 1NM9A 3IPWA 4XTDA 3E0FA 3G1FA 4WZHA 1MO0A 2NX1A 4L1WA 4DEFA 1L6FA 1E1CB 4FXSA 5TQLA 4L9XA 3RLVA 4D6JA 5A2AA 5D2TA 3SRDA 4P7QA 1ELSA 4AF0B 4LAKA 3CZGA 4OWGA 4KEUA 1KXVA 2GOUA 1YE4A 3ZLGA 3IAQA 3UWYA 2R1LA 2XH0A 3KOZA 1KBJA 1O95A 5EMUA 1DWFM 3EEZA 4NI8A 2Z2BA 3WJZA 4GUJA 4B2DA 3W2MA 2FH8A 3SY5A 4WGHA 1R3SA 1X1ZA 2GGHA 3FDKA 2ZCGA 4K36A 2X7WA 3QFEA 4DNHA 3ALFA 4S3FA 1ZQ5A 3OIXA 3TJXA 3G1HA 3MKKA 3W1TA 3K4WA 4UUIA 1FH7A 5MKGB 2W63A 3WD3A 1R9YA 2PDLA 3DFSA 2VDGA 4ZOBA 4IX0A 3ABZA 2NLYA 3N2CA 3T9PA 5G4WA 3S2JA 4IQDA 1VPQA 2FZ9A 4DYEA 4PB5A 2BFGA 2GYIA 4BF7A 1XIBA 3ZM8A 3VPLA 1E6SM 1GG0A 1OCJA 1V6TA 3R0DA 4IZGA 2J8FA 2XU2A 3P84A 1T7LA 3VCRA 1V3LA 3ABSA 2QVNA 4TQTA 4OE7A 3KCJA 2ZX8A 1AW2A 1CLXA 1EBHA 4XZ9A 1YIXA 1BPLB 2HNHA 4AH7A 2XH2A 2WMGA 3RCYA 1ADDA 1V6VA 1FHVA 1F07A 4I5RA 5MF5A 4L1XA 3WLLA 4XUYA 3TWAA 3DN5A 5C9WA 4A8IA 4GX8A 4JHMA 4KCTA 1B3OA 3N29A 3FJ6A 5CPTA 5DY3A 1GQNA 2XZ9A 3OJGA 2PP3A 3AIWA 4H8UA 1DORA 1W9XA 4QE1A 1S2CA 1EC7A 2CWNA 3ARUA 1S39A 4Q6XA 4GY0A 4Z1AA 4XZHA 1A0DA 4JCMA 3G0XA 1C29A 1V51A 1ZENA 1EJWC 3VC6A 1Y65A 8RUCA 4C7DA 3ZVHB 2YB4A 2RDWA 5G4HC 4AD1A 3CT7A 1EPXA 2EG8A 3VGHA 3R2GA 5HBFA 4EE9A 1V03A 4CN4A 3FY1A 3BJFA 2HV5A 3I7QA 4PBEA 3WK3A 4EACA 1AH4A 3LMZA 2PF0A 4P8XA 4IHCA 1TREA 4KEMA 4Z1BA 3PY2A 3T0TA 4UR7A 4HPHA 2OQLA 1F8MA 1WDDA 1CGUA 1R3WA 1GJUA 2XIQA 3BOLA 4A8RA 3BCDA 5AFDA 1JYWA 5HA7A 5E6ZA 2R94A 3CAQA 2BLEA 4UTJA 4WKAA 1TSIA 4UFLA 1GPFA 1L2UA 4GBUA 4PH6A 4G7EB 2PZ0A 3N17A 5LHEA 4V33A 4XK2A 1KRBC 2V69A 2WYSA 1J2WA 3N4AA 3PZQA 3RPDA 3UERA 1S5WA 1U30A 2Y70A 4I9AA 2BWGA 3SQLA 3W4RA 4PMOA 3HG4A 2HVMA 1XFBA 4PMDA 5C55A 1RBLA 4MJ2A 4D72A 1UMLA 3SO7A 3PZVA 2G3NA 3Q94A 2Z1XA 5CPOA 1YDOA 5A6MA 5ABFB 2IKHA 3MBFA 3LTPA 1ADOA 2VDIA 4M51A 1I2QA 4XKYB 1MRQA 4JQAA 3AYSA 3VOJA 4EXBA 5A8NA 2Y5JA 3CUGA 2AMXA 2ZC8A 2GUBA 3P5ZA 4TIMA 4GUFA 4P2VA 5CC7A 1M7OA 2VD8A 4WXYA 3SGZA 4IX2A 4WDTA 2G3IA 3GC4A 5KETA 1TG7A 4PCSA 3MSYA 1XLGA 2G0WA 1KGWA 1Y0EA 3N2TA 3GDLA 6TAAA 3M0ZA 3PPFA 4WDUA 3OHMB 4M1RA 2NQ9A 3GDRA 3WLMA 3D46A 1GZGA 4ZB5A 2UWFA 3GXMA 2ALRA 3VIKA 3SN4A 2HBXA 1E9IA 4GFIA 4X0VA 4H83A 4I5UA 4X61A 2DP3A 3TWBA 3VNDA 1L6GA 3QMSA 3TK7A 3CBWA 1LLWA 4PRRA 3A12A 3B0YA 3CH0A 4NJJA 1XIHA 3QVQA 4M6VA 4IUGA 4CD4A 1F6KA 1KFCA 5DMNA 1NU5A 1QASA 3IIOA 4FP1A 3WUGA 1XCXA 3MUY1 4QAWA 3FN9A 4X9SA 1E1FA 1MYRA 4IUOA 1DIDA 1GONA 3TJ4A 1RPXA 3BV7A 4KERA 1WUEA 3ITXA 3WJWA 3HPSA 1V77A 4LY4A 1UKSA 3FJ4A 2F9RA 3SM0A 2QT3A 1DJNA 3TYDA 4W8LA 1TRDA 1CBGA 5FF4A 5AC5A 3NJ3A 1KXTA 3LSCA 2PZNA 2P5NA 2XM2A 3BL3A 4WDWA 3AOFA 3NM1A 1B0IA 5LA2A 1UPPA 4GMEA 5DCBA 3RM9A 4NJKA 5HAOA 1EQPA 3P61A 4OZOA 1MI3A 1G6CA 3NPWA 1AZ1A 1AA1B 2X2GA 3F5JA 3WMBA 3KL5A 2VELA 2D69A 4FNSA 2Z00A 2X16A 1EWEA 5LIUX 1GVRA 2W91A 8TIMA 2Z6JA 3NZGA 3THUA 4ZXLA 1E4LA 3HGRA 3JRKA 1OYBA 1SSGA 4BA0A 3W25A 3RXZA 2P0IA 3NOEA 2REQB 4OT7A 1S2AA 1E6XM 4PEKA 5LNRA 3OQ8A 1HKMA 5KMYA 5E9AA 3IAPA 4U3AA 3MCMA 3VTRA 1G4PA 2XN1A 2D22A 2IXUA 1Q6OA 2E1DA 3W9ZA 2G41A 1JPMA 3H2MA 4DJDC 3B3DA 1ITXA 2QCCA 3MSDA 2GJPA 4AIEA 4U2YA 1CIUA 8CGTA 1IWBA 3VIOA 4F9DA 3H23A 4X9YA 3SUWA 5IXEA 1XSJA 2G50A 4YLWA 3R10A 1EUAA 3B0PA 3CTLA 3V7PA 1YPIA 4DUWA 1DYSA 2HQAA 4FXRA 4MWAD 1GG1A 3MKCA 1HKJA 2J4GA 1IE7C 4UOZA 3P7YA 4JIIX 1US2A 1K1DA 3W7LA 3QV8A 4RDWA 4OFCA 1SJAA 2DZWA 1TJPA 1CI1A 4QRNA 3CV1A 3FV9A 4S3AA 1BTMA 2FHBA 2PWEA 4XAGA 2QCGA 1QOPA 3E9AA 2VEMA 1CTNA 2BZNA 3BVJA 3TW6A 4PCNA 1QWGA 1TA3A 1ME8A 3T2PA 2YBVA 1H41A 2YDAA 4H04A 1AD1A 4AY7A 3L7RA 5IHSA 4OU1A 1J2BA 4F4RA 4JIPA 3PUEA 2BSLA 1UZDA 5A6SA 2OYKA 1WUFA 3VE7A 3IRSA 1VIWA 3PZ9A 5H2ZA 2WC4A 1X39A 3M0MA 1WKFA 4KMQA 2WCGA 3MYOA 2DSUA 2PFHA 2VGIA 3GNDA 3WF1A 4ROQA 1LQ2A 4Y8FA 3R6IA 1MW3A 3VKDA 3K8KA 3TA9A 3W53A 3UVIA 1VBJA 4KT2A 1EKOA 3R8RA 3VGDA 3DH7A 1CWYA 1R0MA 2YBTA 3GH4A 1ML1A 5DFAA 4W9TA 2CBVA 2R1MA 3TQPA 3S1VA 4M6PA 3ARSA 1V3KA 3NTYA 3TZFA 3W1RA 4M0XA 3FGCA 3S9YA 3DI0A 3CMFA 4PTMA 3M0LA 3ZT5A 5K4ZA 1NSJA 3EKGA 4JX6A 1P5BA 3WO8A 4K68A 4DQWA 4ZGYA 5HMFA 1HZYA 4GXPA 2PLKA 2TODA 1O4UA 1SYTA 4GE8A 3P8IA 3ONBA 1IZCA 3QHOA 2QMJA 1G7VA 4FXJA 2WVSA 3V16A 1KO0A 3K4AA 3THQA 1KM4A 1QI0A 1LRTA 4H9VA 2CLOA 2OWXA 3AIRA 1UBSA 1JDCA 2BBFA 1L6YA 4LUYA 1BFNA 1QBBA 2YL5A 2VC6A 3UG8A 1IR1A 3GFXA 4Q8UA 4PA8A 1FH9A 2PLCA 1A0CA 1JI1A 2GJNA 2V5BA 4FS9A 4Q22A 1RVGA 1N8IA 1YBQA 3B8TA 3BOFA 3LXAA 1YHTA 1OC7A 5AY7A 3HO8A 4LYPA 3H2EA 1J0JA 2GVEA 1B4EA 1WDQA 4BY3A 4GH3A 4HCHA 3LTYA 2DVUA 1HFBA 2IPJA 3M9YA 5DANA 1YEYA 2EF9A 3L2MA 3GG7A 1SMDA 3M1ZA 5JH2A 1C8VA 4H7VA 5AHMA 4J27A 2ANUA 4CQAA 2ZBTA 2FPVA 1XX1A 4MY1A 1OFEA 2A4AA 5EL1A 1DIEA 1V7YA 2R6OA 3G0SA 1Z41A 3P60A 3GU9A 3H24A 4PRTA 3QEZA 4P7OA 1GVOA 3Q65A 4WHBA 4AU0A 5LSMA 4Q7BA 1ZP4A 2R1NA 2NXIA 2XSBA 2E40A 1XIMA 1ECEA 2HCVA 3A9BA 1DTNA 1W5NA 3JU2A 4Q8MA 3LQGA 1VRDA 4Y7EA 4K37A 4O1CA 1QOXA 2H8XA 3KUMA 1E5JA 2X41A 5DF0A 4JQ2A 1BYAA 5DXXA 1GVEA 4B2DD 1OIMA 4AWEA 4AZCA 2ACUA 2J79A 1Q45A 3N9RA 1OINA 1MNZA 2ZICA 1RAKA 4DPQA 1EJVC 4MOZA 1EP2A 4HSOA 1YTKA 1VAHA 3IUIA 3UT0A 4Z2IA 1OSEA 5EBUA 4PUUA 4F79A 2V3DA 3CO4A 2WHMA 5J04A 3BLLA 2F84A 3PJXA 3WNMA 1BQCA 2WVTA 1E9YB 1MMFA 1WDSA 4QBXA 3R1ZA 4HPNA 4CNNA 3N25A 1S5MA 3WD1A 1POKA 2YW4A 1OK4A 3WQ6A 3KLLA 3T2OA 4PODA 4DXKA 2PRMA 5D2XA 4ERIA 4INFA 2XIBA 2IQ0A 3EZ4A 4LYRA 2NQZA 4WR3A 2J13A 3QW4B 2TYSA 3UF9A 3THDA 1UASA 1H5YA 2A0NA 3TJIA 3TLQA 4O57A 1WKDA 3QN3A 3SGUA 2QJNA 1EA0A 4HU8A 1XYAA 3PM6A 2XDFA 2YA2A 3BDKA 1VJIA 3PSVA 3CWOX 3UA4A 3WNOA 2P8CA 3K8MA 1LLOA 3TC7A 2B81A 5JU6A 4YWIA 2VOTA 5DLCA 4CD5A 3C2YA 4HP5A 1LT8A 4LUJA 1KRCC 2ODOA 3W7OA 4F3HA 4V2XA 2OEJA 3VIGA 4GD0A 4PUEA 1BAGA 2OKOA 3KCLA 2ZADA 3EEGA 3MUIA 5G4EA 1KM5A 2VURA 4C5YA 1KV8A 2ICSA 3W72A 4KBXA 1RJPA 4AHPA 4PMVA 2O7SA 1JNEA 4OUEA 4GYPC 3FW6A 3PZMA 3MZNA 4MAZA 3MI3A 4ZQPA 2CZVA 3UWWA 2O9RA 4S23A 1DXFA 1XLJA 3PB0A 1OCNA 1VBHA 3FVMA 1DPMA 1K4HA 2J9XA 1FWRA 2G3JA 8XIMA 1PZ1A 3T44A 4V1YA 3AO0A 3EB4A 3KVKA 4MFDA 1LF1A 2HE5A 5IFPA 3I10A 2BODX 3ARVA 2UZ9A 3PVFA 3HPAA 4TU1A 1AVAA 3UXLA 1OF6A 2NVAA 2QEZA 3DX5A 2ZX6A 3AS2A 3THCA 4DZ5A 2JF7A 4B3ZA 1FFRA 4ASTA 3RILA 5IBXC 5F1VA 4A3YA 3NSXA 5I03A 4GACA 2ZWYA 3HGSA 1ZB5A 3LCFA 1BF2A 1KM6A 5XIAA 2NW0A 1ICSA 1FP9A 4H9UA 5M1TA 1XYCA 4M81A 5H91A 4KKXA 1TE6A 1VFLA 1A5UA 3BSHA 3T09A 3ISIX 5A8OA 1AMKA 2A2IA 4P61A 2DY3A 3REQA 5FA5A 2H3DA 4LXFA 4JQ3A 2PD5A 3CGTA 2C79A 3MSGA 3R0UA 2ZRYA 4EP8C 1DHPA 3QZAA 1KR0A 2QNEA 2BY2A 2YL9A 3O3RA 4OV4A 4DNMA 2IW0A 2C91A 3GYEA 2V2CA 1V4YA 1P48A 4L1GA 1EX5A 2MNRA 1W1PA 3PUDA 4JQ1A 4CD6A 3CTTA 3CL8A 3TH6A 1M41A 3ANYA 4JFSA 2OSXA 3KLKA 1RPKA 2RDUA 2QYGA 4J3VA 1O60A 5CJNA 3H21A 1WDPA 4HYRA 3L4VA 4P5UA 3NQ7A 1NOWA 4I9JA 2H3BA 1KD0A 3W7EA 4HA4A 5BNKA 4AX7A 3UP8A 5JIPA 5G2WA 2IPGA 3G77A 3YPIA 4KH2A 3QTPA 1SGJA 3F03K 1GOXA 2QQ6A 1BHGA 4A05A 4REQB 2A3AA 4IM4A 5EMJA 1PDZA 5BMXA 4IL2A 1QHPA 1LWHA 3W1LA 2ACSA 2YDSA 3WEZA 3EDKA 1E1CA 3XINA 3W1MA 3G1RA 1WZLA 3UGVA 4HOXA 4LBUA 2CFFA 2WAGA 3LTSA 1XDJA 3I6RA 1VBUA 2J24A 2HE8A 3N6QA 4BS0A 2PWFA 4HK5A 1ENUA 4AF0A 2XINA 2E5CA 4AWUA 4LVGA 1EEPA 1P6WA 4ACZA 2FB2A 4IGHA 3RK8A 3F4CA 3ZSTA 3OZPA 1F05A 3H54A 5BYWA 4UMAA 4JN7A 3BO9A 1PAMA 2V82A 3C2EA 4A6GA 2D0FA 3L4WA 1SFTA 1RLDA 2J66A 1IWPA 2ZX7A 4A22A 3FSTA 4I9TA 3ZSSA 2PGRA 4P8UA 3WCZA 5BCAA 3QLLA 2ADAA 4O14A 3DYMA 3GTHA 3LK6A 3VNZA 3WH9A 3KRZA 5MKGA 1E70M 2BY3A 4OBTA 3W01A 3S0CA 3VE9A 3S2CA 4CU8A 3GC5A 3VOGA 1BRLB 1E5NA 4ROPA 1J6OA 3A24A 4DIAA 3GTIA 5HNRA 4EIVA 3MYPA 4C60A 3UD6A 3C0JA 3NL6A 5CLTA 2WOQA 3W6LA 1PUDA 2VQTA 3ZR6A 3T4WA 6CGTA 4XBJA 2FDSA 2V5LA 4LSBA 2IUZA 2O56A 1JCJA 4HK7A 2IPFA 2DVXA 3UGRA 1Q8AA 1EC9A 3SN1A 1FQ0A 1O5XA 1EX1A 4C6IA 1OABA 2GLKA 4ORIA 4QFUA 1WDRA 3GR7A 4J4KA 3GM8A 3TOPA 1HIZA 4F2BA 3ZO9A 7A3HA 1Q7ZA 4NHVA 3I65A 2WNNA 4L7ZA 1YKWA 3WUEA 3DFPA 2AQVA 1OG0A 4AVOA 1F5ZA 5BXTA 5C7HA 2PC4A 4LB3A 3U4AA 2PDHA 3V0TA 4MB4A 2E5DA 3E38A 5IFTA 1QI4A 3CO8A 3W1XA 4Z2LA 3DKLA 2VHLA 3L67A 3AUJA 2IMRA 1DVJA 1GQLA 4Z2KA 5PTDA 1XYFA 2CU0A 4KWWA 3HIJA 4XSLA 2R1KA 4CLMA 2GOKA 4GIAA 4CGTA 2GDUA 4MJ4A 3TNBA 4B9ZA 2JALA 4I9MA 1Q7QA 1QI5A 4NJGA 3S6DA 2WJZA 2NUWA 3A4JA 3ZVHA 4GNVA 1VF8A 3W7DA 3P67A 1UD3A 2ISWA 2PDQA 3WQ4A 1KGXA 1M7JA 2WB5A 5FKYA 3UZZA 1UD4A 3B9NA 4QQ3A 3A4WA 3U7VA 3S9ZA 1FWGC 4MB5A 4IIGA 1D7KA 3N3TA 4QDMA 4XISA 3VYLA 4HTYA 3QZEA 3ANVA 2QPXA 4XUGA 4N9CA 4MY8A 1W9BM 3NQVA 2BY1A 3H4XA 4JTAA 5CCZA 3NZRA 1GT8A 4GZIA 3VCCA 3WNLA 4DB7A 2PU1A 3DGBA 2GK1B 1GKRA 3ZJ8A 5LXXA 3GXTA 1VFMA 1H7XA 3NSNA 4MPKA 1F3XA 2PDGA 1H60A 3G5EA 1Z48A 2OT0A 3LYEA 2PDCA 2RGMA 1VH7A 2NSOA 2YCIX 1DJHA 1RQEA 2OLAA 3N34A 2ISDA 1YDVA 4BWLC 1K8CA 2V38A 1BYBA 1VKFA 4JAWA 2CCRA 1QRQA 2DEPA 5AZ1A 1T99A 1RP8A 3EA3A 3IVSA 2WBKA 2XIMA 2QGHA 3QH2A 1PKNA 2OYLA 3OYXA 4C6DA 3QM3A 2JGYA 5ABFA 3S4TA 1BWVA 3VAVA 4XKYA 1CGWA 1TZ9A 1SFLA 4Q8VA 4B5VA 3MA8A 1FVPA 3H6OA 3RRAA 3SECA 1AD4A 2VC5A 3R43A 3TEVA 4H41A 3CPGA 3ITLA 3I4EA 4M6QA 2OO0A 3EDEA 3LHYA 3RLGA 4DF2A 1NIUA 3G3MA 3IJ7A 4JNMA 1OFDA 2X2YA 3RM4A 2OT1A 1MUCA 2PWGA 3G1YA 4XAZA 1B5TA 2JKPA 3MCNA 3M5ZA 4I6VA 1TVNA 4AYGA 3PR2A 3QGVA 3TAOA 3KBJA 3VKKA 4CD8A 5D8ZA 3DXIA 3C2VA 3UWEA 5FEXA 3SUVA 1F74A 2DIEA 1F6PA 1P0KA 1KBIA 2H90A 3WDPP 1ISXA 1GVIA 3DBNA 1B3YA 4GJJA 1GJWA 4D6IA 3CPUA 1BXNA 4JIRA 2UY2A 4MYAA 1OB0A 1WDWA 1V3HA 4LT9A 4Z42C 1JYXA 2QJJA 3WJXA 3B9AA 1MDRA 3MHGA 3LSBA 4OBSA 1VS1A 5JUVA 2JF6A 4HZ8A 3U6WA 3R94A 3LI0A 2LLEA 4GYPA 4HYWA 4CCDA 1JZ5A 3P74A 2YYTA 4AW7A 3EWBX 3LCHA 2GQ9A 3O6CA 1NWTA 5D33A 1KW1A 3CMGA 4S3CA 3HA1A 3T0CA 1SO6A 1TFVA 2WKJA 3VIHA 1M3UA 2F2HA 1XBZA 3ZT6A 2F2KA 3KDOA 4EKJA 3XISA 4JPGA 1A80A 3MO7A 3BARA 1XRTA 2R8WA 4JZ5A 3E2SA 2Y62A 3XIMA 1CXLA 1FCVA 4E5TA 3G2GA 1FWTA 1LCOA 3GNNA 4H00A 4KWOA 4Q4OA 3A3XA 3M4HA 3RGTA 4QS5A 3G6MA 4WSJA 3O0FA 5IBXA 4MM1A 2VZOA 1X97A 2GVGA 3VINA 1KQZA 4WJXA 1XLIA 4UMCA 4MJZA 1TX2A 2GSEA 4JTGA 3BJTA 2DDXA 4O10A 2YGYA 4IFKB 4O12A 3P14A 3F1QA 4IPLA 1I2RA 2YDRA 5FJRA 4RNFA 5C9ZA 2AKZA 2REQA 1XKYA 3W7IA 4S3EA 2Q3RA 3TMQA 1RP9A 1AK5A 4ZE5A 1XPGA 3ECQA 3M44A 2NVCA 5D2VA 2HXUA 1NDWA 1XBYA 1E3ZA 1WCGA 3GVRA 3FVDA 1ICPA 3W2LA 3RRXA 2QMKA 5T8GA 3QOKA 3NYDA 4M82A 2CHNA 2JBMA 2ZWZA 4XZWA 3QFWA 3TYEA 1LL7A 4PUWA 3GZAA 3TA6A 2VFGA 3F4NA 4ENLA 3J7HA 3OP2A 1JRBA 2RUSA 2A21A 1FBAA 3WK1A 5AHNA 1MEIA 5F4XA 2B31A 2GQ3A 2WWCA 1YXCA 3M16A 1HG3A 3W1UA 1X6NA 4PB4A 4YYFA 2RJHA 1VFUA 2F38A 3DYOA 4XAPA 2Q71A 4E2VA 1XIIA 3B4UA 2FZMA 3S3GA 5K7JA 3BAIA 1XSKA 4GXMA 5CBJA 2E67A 4YL2A 4NP7A 4PTNA 1FKWA 5LZLA 5H8UA 3BJSA 1MDLA 3TR2A 3W87A 2X40A 4QNWA 3BAKA 1JRCA 1MUWA 1TMHA 1HKKA 2VC9A 3TDFA 2MUCA 4WK9A 1FWJC 3AXHA 3NAVA 1NWSA 3P5YA 3M6DA 3JS3A 2VEKA 3B8WA 1P0DA 1W2VA 1UQYA 2PRLA 2QZRA 1Z6KA 1E51A 1L2QA 3PBGA 5KSWA 3ITCA 2QJMA 3JVAA 2HPMA 4QLJA 5I3DA 2ZTKA 4CCCA 1S3TC 4GZEA 3EOLA 3G8EA 1TV4A 1WXJA 1TWSA 3PBYA 6XIMA 1UB3A 4RDZA 3WUFA 3QC3A 1DWAM 1WQ5A 3UXDA 4IMFA 3SBFA 1F4AA 1XH0A 1NDVA 5A6BA 2EPMX 5G5IA 2CLLA 5AYYA 3GVGA 4ADUA 1FWBC 1EGZA 4GQBA 3MMDA 1PX8A 4WQ6A 4Q33A 3V5CA 4L64A 2WMIB 4GINA 2ZUSA 2YZRA 3WK2A 1A0EA 3IRDA 1FCBA 4ZMGA 1AL7A 3FEMA 4PUMA 4CCEA 1B31A 3QRHA 3ATZA 1H49A 1T6MA 4C5ZA 1E0UA 5ENLA 3T0BA 2Z1VA 3N11A 3IJ8A 2X09A 3LCGA 3EWZA 3GFYA 4GISA 3W76A 1ZZMA 2Z7GA 3WQFA 4W89A 3W29A 5C5YA 1NH6A 3WEMA 5A6JA 1Q6GA 2HJPA 4CEUC 2XVNA 1OVDA 4RJEA 4MYXA 1HTIA 1TPDA 3PC0A 1XLBA 2J7GA 3P82A 3UYIA 3EOSA 1O68A 1RD6A 4JTLA 3E2VA 3G1VA 4HJWA 1E0WA 2YIHA 3FKRA 1QO5A 3UPBA 3W07A 4KWSA 4UQBA 4DJDD 1Y5XA 2XN2A 2E6FA 1IF2A 4QEEA 2NV9A 3C61A 4J28A 3R12A 4JEJA 1CCWB 4MPQA 4F2TA 2O9OA 3T7VA 3PPHA 1E73M 1NJJA 4R3UA 4L6OA 2GGJA 3LGDA 4CVWA 1VEMA 3UXAA 3NA8A 1E43A 3MMWA 1OGGA 4HU0A 2CLHA 1NFBA 3LLDA 2WNWA 1E0VA 1R30A 2Y2WA 4B91A 2NQLA 2CZEA 2BG5A 3U7BA 4RXGA 3AIQA 4FR1A 3QBUA 3NVDA 1RY0A 2Y8VA 1XV8A 1M68A 2OEMA 3GH7A 1O5KA 2OGYA 2F6XA 1LWJA 4HCDA 4AZBA 2V5DA 2P88A 2L5HA 1S1PA 1SMAA 3A5FA 1TV7A 3NO1A 2EO7A 1WZAA 3LU2A 1C9DA 2DW7A 4GI4A 4PSPA 9RUBA 3AMDA 4UTWC 3EB2A 1MEHA 3S2NA 3FS2A 3ARRA 4HHLA 3UA3A 3EA2A 4CU7A 2GGEA 4ZO6A 1XLMA 4MF4A 4KFPA 4LALA 3W28A 1W5PA 5C6MA 1R2SA 3WQWA 3LHVA 4S3KA 3GXIA 2RKXA 1JGMA 3OQEA 1J0ZA 1UP2A 2XWDA 4BWLA 4P8WA 1J0IA 1TB3A 4AD4A 2ZA3A 2QCDB 5IHRA 3OVQA 3SCPA 4C7FA 2ZA1A 3PFRA 5EFDA 3S1XA 1QHZA 3RX3A 1YTEA 3EGJA 2YCKX 3V5OA 5HJLA 2E77A 1T41A 3DEQA 4NJHA 5LNSA 4LY8A 1I9CB 5C71A 4N6FA 4H8HA 4PZVA 1X96A 3S1WA 3PS7A 4AC7C 2W61A 3VX1A 4JCLA 2ZUWA 1KTCA 5I0DA 3NL5A 1SJBA 1LL4A 2PDUA 3SY8A 3SB0A 4LUTB 1K9TA 2HPIA 1HL2A 3HG5A 4ZO8A 1QK0A 3N13A 3U4FA 2C19A 4L80A 4BCEA 2V67A 2YCEA 1IT8A 2J7HA 1RUSA 1W3KA 4D6EA 1DJWA 1YPFA 3IV3A 1FWSA 3N1AA 3PBMA 5DCDA 2GJLA 5U4NA 4YTSA 1TUFA 2CLPA 2X1TA 2B7NA 1UD8A 5LIYX 1VFFA 1K3UA 1B3VA 4HHMA 3E5BA 4FHAA 2AL2B 4J1OA 3M0YA 3HB9A 3A21A 2KX9A 5HOSA 3LHZA 1R7OA 5A6LA 3AMLA 4IFOA 3L0GA 4JTSA 3TU9A 4DWSC 3AI0A 3LUTA 4B4HA 1VQTA 1WP6A 4B3LA 4GVHA 2XISA 3FAXA 3PB2A 5B7YA 3SRKA 1P1XA 1I2NA 4CQ8A 2QDDA 4DO6A 1F2JA 1H7PA 4OQVA 5EYWA 3DERA 5AVNA 2VDHA 4FLSA 4X2RA 1H7WA 1QNSA 1XGEA 3B97A 3R13A 3GW0A 5CC5A 1JL8A 5M3WA 1X6UA 3I3DA 3LXCA 4US5A 5F4WA 1SZEA 3BH4A 4S2CA 2QW5A 3CHEA 1O7AA 3SGGA 3PPGA 4N9BA 2CLEA 4UFJA 4LANA 1RCXB 2V3EA 1OX5A 3SW6A 4ATLA 3VIPA 4OGZA 1JD9A 3NQ2A 5JQ9A 3AAMA 1UZ1A 2VFFA 3BW2A 2XTKA 5KZ6A 4ZQMA 3N4FA 4PTDA 1YDNA 5FAJA 4A2SA 4RLIA 5J5DA 2WSRA 4GI9A 4D71A 3A6OA 5C2XA 1KWGA 4DVOA 3VIFA 1Q2RA 2CITA 1A47A 3A47A 2DZUA 4AHQA 4MB1A 4GQGA 4B92A 1SFSA 4PFHA 5CZSA 3ZJ7A 1KCZA 1G67A 1IV8A 1B9BA 1CLKA 5H6HA 4REQA 5FAGA 2PGEA 4IIEA 2FIQA 4O17A 3QSTA 3L4UA 5AB3A 2Y63A 2PWDA 4E2DA 1Z9AA 1WAUA 4JDBA 3VD9A 1SU5A 1SVDA 1YNQA 5FJUA 3URNA 3CK5A 1IGWA 2WSYA 1EL3A 4JIEA 3HPZA 1J10A 4H2CA 4MY9A 1J12A 1Q6DA 3OO2A 3QC0A 5TIMA 3G24A 3AYRA 1XIGA 5G1YA 2B7PA 4Z0SA 1TJ1A 2WMKA 3SQMA 4AZ7A 1EEXA 1GKPA 4FB7A 1EHNA 1LDCA 1MQQA 2J7FA 4LUSB 4ML4A 2EPLX 3RU6A 4X60A 3LENA 1VLWA 4ZB0A 2P76A 3QF0A 1S5NA 3PZIA 1HXJA 1PCWA 4EAMA 4I7VA 2CZFA 4NZ3A 3N2MA 3AXIA 1MXSA 1Q3NA 2VFIA 4EPEC 2ZRUA 3UXIA 1KM2A 1BRLA 2CERA 1FY6A 4PL1A 4XVEA 3NURA 3C2OA 1W3JA 2O4MA 3CB8A 2OSYA 1JYNA 4IF2A 3ES7A 1CT5A 1VEPA 4EXQA 3KFTA 3UZWA 1B3ZA 1JCNA 1QOQA 4YTQA 4ZENA 1VP5A 4G56A 4L4OA 2ABBA 2PI6A 3WQDA 4YN5A 1Z42A 3V4BA 4DF0A 3O07A 1RVKA 3TFXA 3GWQA 1FXQA 1VCGA 2WQPA 5HMDA 3WBWA 1DL3A 1KCKA 4ATDA 3S42A 1KFWA 1HT6A 1LZOA 3HGJA 3GUWA 3WLRA 3PNZA 1XI3A 4NAEB 2YFNA 3DCPA 2Y5EA 2ZX9A 4ZEPA 4YCOA 3S5OA 2R91A 1AZ2A 4KRUA 1XYLA 2AAAA 3V5FA 3H2NA 4FK9A 4AAJA 1J11A 3NQGA 4URIA 4K1WA 5JIWA 3Q4DA 2ZVIA 1K9FA 4ZSUA 3PTMA 5DN1A 3E1F1 2PF8A 5BU6A 1C9WA 1XC4A 1W5OA 1BXCA 4ZSTA 4AXNA 3WFLA 3ARWA 4HNOA 1XBVA 2F7FA 4EANA 3HV9A 4DBWA 3CZJA 4RR4A 3GKFA 3NEVA 3MU7A 2W3ZA 3UQNA 3CM4A 4JIQA 1M65A 1Q66A 3TTQA 1OADA 1FWFC 3HPXA 1REQB 1QTWA 2I5IA 4Z1YA 1GOKA 1H7NA 2OKTA 4M5PA 1BF6A 1CXEA 3W27A 3MQTA 3TC3A 3V3WA 2DJXA 1E3XA 1H4PA 4C6KA 1JD7A 4EWND 4QG8A 4KRTA 2PE4A 3HQPA 1QR7A 2X0HA 4A3UA 1YW1A 5GNYA 5BRPA 1EDQA 1ZRQA 4C6MA 5BOFA 1W1YA 1V79A 3PZUA 5AHIA 2CHOA 4EPBC 2POZA 2QF7A 1E71M 3W1AA 2GK1A 2ZUNA 1VJZA 3RPMA 3LBCA 2C1GA 4QLLA 4O0ZA 3ERPA 3OIHA 4PYSA 1VENA 2ZZ6A 4F0MA 2CIPA 3DHDA 2ZIDA 1G4EA 2WJFA 1BG4A 2G95A 4I7WA 4QS6A 2WCSA 3H2AA 3VUPA 2BVYA 4QDPA 5C2GA 3F2BA 2C13A 3CT2A 3N2XA 3EKLA 4B5UA 1YADA 2WSPA 4LRSA 4UTWA 1V6XA 4YMZA 3EDDA 1GOIA 2CEQA 1OIFA 1L6WA 1E9ZB 1T5AA 2GPTA 4D8LA 4L4MA 4GBDA 4WOZA 5TAOA 4OJYA 3FNDA 3SR7A 3RNDA 3TQVA 4O1FA 4WIWA 4IICA 1GUVA 3P0WA 4WCJA 1EOMA 2FVMA 1NEYA 1V8EA 2PBGA 2HXTA 4IQJA 4MKNA 2VO5A 1RCQA 1KB3A 4HD5A 1RQHA 3LHWA 2EHHA 3F7JA 3W37A 1Q13A 4K7YA 4AY1A 4GX9A 1TCDA 4XG1A 1EJUC 3QW3A 4O13A 3UR2A 1JUKA 4JKKA 1EGMA 3NVTA 4LX4A 5TBOA 2E9BA 3PSWA 3SN0A 2Z1SA 3QQWA 3B8DA 1S3HA 1U1UA 2BNJA 1F7BA 1TJ2A 3NQDA 1HGYA 1UH2A 1ZNNA 1G4TA 2ON3A 1UUOA 3UJFA 2I16A 5B80A 1U33A 2XJ7A 1Q7MA 2FVKA 2C0HA 1HJSA 4PBGA 3CQHA 1XDLA 3ARYA 4QCEA 3TTSA 2ABAA 2ZYFA 3WDRA 4BI6A 5FJPA 3AS3A 1GPWA 1YX1A 2FZBA 3BGAA 4GFSA 2C8NA 3VFLA 2UY5A 1ISZA 2RFGA 2C7FA 5FL1A 1T8QA 3OLEA 2CC0A 1H50A 3TP4A 1FOBA 4TX6A 2JIWA 4DWSA 3R4IA 1XFCA 3AWNA 4BF9A 3D0CA 4Q8WA 3WD2A 3KCOA 4UBPC 1BSIA 5LNWA 2YFOA 2HDJA 4OUIA 4DRSA 1O12A 5K9CA 2XPKA 4YTRA 3URQA 2NUYA 1DWJM 2PEVA 3E0LA 3MC5A 3BXWA 3WDIA 4R7JA 4IMCA 5C9XA 1M53A 2XGBA 3CV6A 4ICMA 2G96A 1XRSA 5LKYA 2FDMA 1D9EA 5I5RA 2XGZA 4C6JA 3VZYA 2B0MA 1TYGA 2BV9A 2WKGA 3RAOA 3ZQ9A 4TX9A 1VPYA 4J40A 1AH3A 3LM3A 3WLJA 4RCXA 1E4IA 1K9EA 1W1VA 1ZBCA 2O55A 5I3JA 2WO5A 2V5JA 2QCNA 3L2LA 1EGVA 2DQWA 3EYPA 2HS6A 3EX1A 4FXFA 3TX9A 2DZPA 4FIQA 4YU1A 3OLIA 2XZ7A 3TTOA 4F0RA 3SJNA 2B4GA 4NL1A 1HO4A 3AXKA 3IJIA 2Z4GA 3T07A 3WQ5A 2OQYA 5E09A 2OTDA 4LBSA 4Z2HA 3G1XA 4Q4RA 5EB8A 3UY7A 3JR2A 3F2CA 4XIMA 3L23A 4AZHA 2EKCA 4Y9OA 5ABGA 2OZ0A 4JKLA 1ZCCA 2PP0A 4XQ6A 3TMLA 3T08A 3UWZA 3GXPA 1W56A 3PNUA 4KF1A 1U2YA 3S5NA 1A5SA 2WHLA 3AU2A 4MIMA 3STFA 4DJEC 4R27A 3VNYA 5JMUA 2ALDA 2OO6A 3NQEA 3WQGA 3PUOA 2WSQA 1D8WA 5DX7A 4HOWA 3MUZ1 1FTXA 4HZ7A 4AUBA 3W6YA 3WIJA 5IOBA 1S5TA 5E1QA 1ZUAX 4NNCA 3MUXA 4TV5A 4PRWA 3C86A 4Q6JA 2OX1A 4DBSA 1QMLA 4O18A 5A8PA 2VGFA 6REQA 3S2LA 3LBOA 1R3TA 1U1HA 3EWXA 3W6MA 1KBLA 1MFUA 2G37A 3HQOA 2E9MA 1PTAA 2PTWA 1S46A 2J8GA 1H62A 2Z1BA 3NO5A 2XYLA 4NZ1A 2J78A 4AB4A 2V63A 3KS6A 3N18A 3UZXA 1GTEA 1T40A 2J9ZA 4RZ5A 4XD6A 3O2LA 4PMZA 1LOQA 4PTXA 3HF3A 4BEUA 2ZXDA 2WMIA 5D02A 2O4QA 1H1ZA 2C6QA 4BZYA 4F2UA 1YXDA 1ECQA 5BXRA 4I6KA 4HNTA 4GIRA 5D9PA 4QP0A 2RH9A 5F2IA 3VI2A 2D73A 1G4SA 4IMGA 5EA9A 3B8UA 3USBA 2GDQA 3WF0A 4E2BA 4IPPA 3I7SA 5U7SA 3QLDA 1LROA 3KTCA 1VJSA 2D2GA 3LRLA 4MNMA 1UWSA 3GDMA 4OIFA 1A5LC 2JK2A 1TPH1 1TCMA 4KETA 3T8LA 2E1WA 1FP8A 4IT1A 2I7GA 1RBOB 2E4TA 4N4QA 4CQBA 1T0OA 4F0KA 4QR6A 4WRHA 4TO8A 1OC5A 4K8GA 1UHVA 3RR1A 2CZDA 3S9IA 2B7OA 2WLYA 3CIVA 4P7RA 1O66A 1A5BA 1KBBA 2Q3OA 2J74A 2W67A 4RZBA 5CAHA 2VZSA 1GZ1A 3LEPA 1KRMA 2FB3A 5E93A 3KP0A 4GIEA 3KWXA 2AQOA 3AALA 4DXXA 1L8PA 3WLKX 4GQQA 4CQDA 2F6UA 5FJJA 1UP0A 1UCWA 3II1A 1F4HA 1PCKA 3SCQA 3DG7A 4MZ8A 3E5PA 1PB0A 4IPNB 1R3VA 2HK0A 3N2BA 5CLWA 4UIOA 4EVZA 4CUCA 3K13A 3N15A 2I5GA 1W3TA 3AJXA 4U31A 4WF7A 1IIHA 4RE4A 5CPNA 1B30A 2ZQ0A 1CXFA 1SR0A 4NYUA 1DEDA 1M7XA 3R11A 4RNIA 2OOFA 3PP7A 3I6TA 4KWUA 4LAMA 3RMJA 3PTQA 2J6VA 2E8ZA 2AAMA 2PS2A 2ZUMA 5HATA 1UJQA 3M6YA 2X1IA 4TVDA 6A3HA 4D8AA 3SRHA 1FWHC 1Q8JA 1PDYA 4ZO9A 1QNOA 3UETA 1E4NA 1PEZA 4LVBA 1TV8A 4PUJA 1BGAA 4J5NA 3BAXA 4NT0A 3VOIA 3JUGA 1OC6A 3KL3A 4S3BA 5AKQA 2ZRVA 4DUXA 4IIBA 2ISFA 1GEQA 4IP7A 5K3VA 2ZZ4A 1UWRA 1DP0A 2Y4SA 2ASHA 1HGWA 4S39A 1E0TA 3M07A 2EG7A 3LDVA 4NUWA 2QGYA 2QCDA 1JCYA 3H26A 4IMAA 1QUMA 5HDRA 1KNWA 4BQ2A 1W9DM 1KWKA 3BWWA 4US6A 1IXOA 3DZ1A 1H3GA 1UD6A 4ALDA 2A3BA 1VPXA 3EDFA 3BK0A 1Q2SA 1US0A 4ATWA 4RZ6A 4YHEA 1UKTA 3IJQA 2FJUB 3EX2A 4LOCA 2HROA 3W86A 1QO2A 1EA9C 3LPFA 3AHZA 1KFEA 1B4KA 3UVAA 4WSKA 1XUUA 1HF6A 3QMRA 3BG5A 4P7LA 4WJEA 5CSSA 4FLOA 3ZWTA 1K4GA 3AUOA 3K1GA 2OZ8A 3N14A 2Z26A 2IQTA 2VFDA 4C6LA 1ZJAA 1F76A 2GL5A 5F2MA 2VP8A 3CUXA 3V0SA 1CECA 3GHUA 3GIYA 3EPNA 2PWHA 4UR8A 2DUZA 4Y9PA 1MVYA 4FO4A 2YDQA 2IKIA 2WV8A 2YXXA 4ONVA 4JD4A 5FEWA 4ZO7A 3KBSA 2Y89A 4F8XA 1GKQA 1PZ0A 1EP1A 3GLCA 1IYXA 4MFEA 1DE5A 1K6WA 1NWRA 1E40A 3KM8A 4C6OA 3ITOA 3AICA 3W7KA 3S2MA 1FWIC 3V36A 5M2FX 3ALGA 4E8CA 2BVDA 4XZLX 3HZ3A 4NASA 2QJGA 9XIMA 5A8QA 3BSMA 4IQLA 4LVDA 4PC8A 5C7VA 3ABRA 3GXNA 1A3HA 3ONCA 3KTXA 1G9HA 4JTCA 1XLEA 1OCBA 3E49A 4MUPA 4S2BA 3ITGA 1V3IA 4R88A 3BPWA 3FX4A 1XC6A 4CNOA 3WF3A 4GC3A 2V3GA 3I3BA 2QVHA 2FGZA 2RGLA 2CZ5A 3KBWA 4N6EA 1YMYA 1OFQA 1BWLA 2JQXA 3ZOAA 3UCQA 4JR5A 1CXHA 4AEFA 1R5YA 1EJRC 4M29A 4U4MA 1XRFA 1PKLA 5E9XA 2INFA 3OZMA 3O1NA 2G3FA 4PTVA 5AVHA 1SJCA 2H6RA 4XD3A 3V35A 4J3WA 3N73A 4H1ZA 2WVUA 4DY1A 4S38A 2PDFA 3B8SA 4PL2A 5I6SA 3MSRA 5D38A 2DZTA 3SUSA 1IGSA 3TCSA 3PWGA 2HNEA 1C7SA 3VKCA 1WZMA 5KZEA 1ZAHA 5AYXA 2X42A 1QFEA 1P7TB 3OZYA 1DJGA 3DENA 4FA3A 1VIZA 1BLIA 1UR9A 1UP3A 4Q4QA 2J8TA 3FYOA 4XVDA 4R53A 3B8VA 3Q2DA 3W7NA 1WO2A 4R7WA 1IXNA 1HJQA 3HJEA 3BLFA 5A2BA 1WKYA 4MGGA 1FFQA 1XINA 2FTYA 2JKEA 4ZZ9A 3TAKA 1W3LA 4IP5A 3VD3A 4V1XA 5A6TC 3WBYA 1JIBA 3UJRA 4POCA 4BI5A 3Q45A 4LCSA 2CXGA 4HTBA 4HZ6A 2QIIA 3K46A 3MHFA 7TAAA 3E02A 1JUEA 5LA0A 2AL1A 3W3OA 1DIKA 4MAVA 5JVLA 3VGEA 2Z27A 1Q4NX 1XG3A 2XG9A 3CQKA 3GXFA 3TYAA 5I7GA 3OA3A 5IM51 4DZAA 3W7QA 4GNJA 1A5MC 3O8AA 4JBRA 3DGRA 1XIEA 3KXQA 4F48A 4KGJA 1B54A 1FWAC 3WLPA 4NSBA 1AFSA 1DOSA 3Q37A 3U3HA 2HVOA 1UKPA 3W1NA 3LCLA 4R33A 4HNLA 3BLIA 1TMLA 2VD9A 2Z29A 2POTA 4DJEA 4AISA 1OY0A 3AIEA 2J62A 4K8HA 4W86A 2VEFA 4H2HA 1LYXA 3U2ZA 4GG9A 4D6CA 4AG0A 4Q4MA 3PUGA 2QHAA 4O53A 4MJMA 5GNZA 3AU6A 1U1JA 4LUSA 3IV8A 4MLRA 4JNZA 1XYZA 1RALA 1OBAA 3EWDA 2G4FA 4JL1A 4DWSD 2E0PA 2HVNA 3VO0A 8A3HA 2D2JA 1TO3A 3UPWA 5CG7A 3OPSA 3M46A 5KITA 1NP2A 2QJIA 3RPTA 1F8IA 2JIEA 3S6OA 4UB9A 1BVNP 1TWIA 5K9XA 4CNPA 3EXTA 1PSCA 3FHQA 2WNQA 3DFOA 4ZOAA