3N12A

Crystal stricture of chitinase in complex with zinc atoms from bacillus cereus nctu2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
NNLGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLESGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHYNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDGLSLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chitinase A
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
total genus 113
structure length 332
sequence length 332
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n12A00
2FGLA 2VZSA 3QOMA 1ZBVA 4LXFA 1FOBA 1W9XA 3WL0A 1UA7A 1D7FA 4U3CA 2VRJA 2E9LA 1EDGA 2VCAA 3ZT7A 2QLYA 4UFMA 5GQBA 3W6LA 1C91A 2G41A 2VZUA 4RE4A 2YA0A 1TA3B 4AIUA 1B3YA 5IFTA 3AHZA 2A3EA 2CPUA 1VFUA 3NJ3A 2PI6A 1TFVA 5D8ZA 4AD5A 1V3IA 3N17A 4GI6A 5IHRA 2WCAA 2OWCA 4AZGA 2BHZA 3WBEA 4BCEA 1WDPA 1CXIA 1E6RA 3VD3A 3AS2A 3MANA 3BSGA 4QCFA 2EXOA 2PB1A 4CUCA 5A6LA 4AW7A 3UG3A 3SIMA 1ZB5A 4JIEA 1HP5A 1H5VA 4JFTA 1E3XA 1JZ7A 4OOZA 5F7UA 1V3HA 2EJ1A 4P7OA 3F5KA 2TAAA 2Y4SA 2F61A 5JBFA 1KGUA 1QNRA 3IAQA 5M3WA 2FHFA 3W24A 3BAYA 2XUCA 3SURA 5IHSA 1DWIM 1F4AA 2E9MA 2X8RA 4PCSA 5FL0A 1E1EA 1O6IA 5FIPA 7A3HA 4GXPA 2X05A 2WC7A 1LL6A 1KXHA 3WQ8A 5AY7A 1GHRA 5D9OA 1XRVA 5BRPA 5BXRA 2XFFA 2X09A 3SCNA 4GI8A 5DT7A 5A6JA 1KBKA 2YBTA 4OJYA 2BXYA 4LX4A 5EFDA 3S6TA 2O9OA 4NF7A 4J3XA 2W92A 3BXWA 1JD7A 2WAGA 3CUHA 2QV4A 3KL5A 3CMJA 4UCFA 4JFUA 4KRUA 2BY0A 4PMRA 3GXIA 4BF7A 4J3TA 3IAPA 3FN9A 4LYRA 2VURA 1JZ6A 2WC4A 3UERA 3AMKA 1RP8A 5D8WA 1BG4A 3BMWA 4FLSA 1QI0A 3CZKA 4UNIA 5A8MA 1M7XA 3BH4A 2YOCA 4PTWA 3VIKA 3WNKA 4F79A 4CVUA 1W9UA 4HTYA 4CD7A 2CEQA 5I77A 1LWJA 4ZXOA 1MXGA 3FAWA 1C3FA 2BY2A 3CHFA 1E9LA 2UY2A 5TD4A 1I1XA 2VT0A 3SUUA 3EDDA 3EDFA 1BHGA 3RCNA 1LF1A 1BYBA 2PWEA 4DUWA 2WMKA 1O7AA 3AYSA 5M03A 3PZQA 2YLAA 2AAAA 4W88A 4XUYA 3SUVA 3AZTA 1U33A 4ACZA 1JZ2A 2Z1SA 5CXPA 5D9MA 1WDRA 1GOOA 3D3AA 5ABFB 3FAXA 1YHTA 1BAGA 4A3YA 1QNOA 5BXPA 4M29A 3FXYA 3VMPA 2CETA 3CUFA 1GNXA 2G8ZA 3VM7A 2ZUMA 1XGZA 5AYBA 3AXXA 1VAHA 2VCCA 2FDMA 4DM2A 2MANA 3AMCA 1C8YA 1LG1A 1HXJA 3OGRA 2CYGA 3GYCA 4UZUA 2EEXA 1C90A 1JFHA 2WHLA 5A2BA 1UOKA 3VD5A 3QHOA 1E5JA 1UWTA 2W63A 3AHVA 5IFPA 2QPUA 3L2LA 3ZSSA 2BFGA 3ARXA 3OG2A 4BQ5A 5I5RA 1FP9A 4ZEPA 2VCBA 3WEOA 2Q8XA 6A3HA 1UWRA 1TR1A 4C7DA 3WUEA 3WDRA 5FD0A 1J10A 2HISA 4MTVA 1KXQA 4HA3A 4UOQA 4UTFA 5CSUA 1VJZA 3RPMA 4DWSB 4JCLA 4WKFA 3NSNA 2CKSA 1BYAA 2OYLA 1W3LA 3IJ7A 3UR8A 4CU7A 1E70M 4PUDA 3CZGA 2XIBA 4AD1A 1W9DM 1A3HA 1UR2A 3AYRA 3EDJA 4C7GA 4QCEA 1ZU8A 1V6VA 4P7RA 1V3LA 4CVWA 1FHLA 1CYGA 1KCLA 3WQVA 1JF6A 1NWUA 2WMHA 3WQ4A 1OGBA 2ZUTA 3MU7A 1UH4A 2XYLA 3AI0A 2DGAA 5I6SA 2CITA 1XYZA 2VRKA 5CPQA 5C8BB 4GINA 4CN6A 3AIQA 1QNQA 1H41A 1GOIA 3WNPA 4ZFMA 1WDQA 1FH8A 3CHEA 4AZIA 2ZX6A 1K6AA 4AD0A 4BQ2A 3ZIZA 1EA9C 2JFEX 1QBBA 3PN8A 4J3VA 3ALFA 4AZ5A 2QMKA 4DUXA 4WSKA 1R7OA 2WVTA 3AZSA 3CZ8A 3VIPA 1E15A 1NWRA 5CLTA 5C71A 4PMZA 2WWCA 5EMYA 2A3CA 2OLHA 3PZTA 2DSUA 1PBGA 2VZVA 4IM4A 3WF2A 2Y8KA 4AZCA 3VO0A 3RDKA 4TVDA 4W84A 4W89A 2EQDA 1AMYA 3SCUA 3PHAA 2D1ZA 4UQCA 2UY5A 4TTGA 1W3KA 3M7SA 4D71A 1C7SA 4XX6A 3UG4A 4D6CA 4MNKA 1AQHA 4E4PA 2ZUNA 2ZWYA 1W2PA 2BHUA 1CENA 3L4XA 1NP0A 4ML4A 1MQQA 1I75A 2WC3A 4V28A 2WSPA 1XCXA 3ARPA 2XG9A 3EBVA 1E0XA 3PTMA 3VX1A 2VQTA 3ZR6A 5A6MA 3WD0A 1N82A 4LPCA 2J8GA 2VR4A 2VZOA 3WQ6A 4KMQA 3OLIA 4AZ6A 1KR1A 2ESCA 1M01A 4TUFA 1KCKA 5BXTA 3IK2A 3AISA 1UR4A 3TTYA 3ZM8A 1WZMA 3WNOA 4E8DA 2ZXAA 5ECUA 4AYSA 3EMCA 4CCDA 2XVNA 3VDAA 2W66A 1WB0A 5I2UA 3SCTA 3VGBA 1RPKA 2WW5A 5A3HA 1UR1A 4CD6A 2Z1KA 4YPJA 4MB4A 1XD0A 3K4DA 1W3JA 2XFRA 1LWHA 1FFRA 1XH1A 1LJYA 1VENA 3GDBA 3WY1A 4Z2KA 1OIMA 3GTNA 2C8NA 1ECEA 4M80A 3BMVA 3VIGA 5BWFA 4K68A 5A94A 4ZE4A 3KZSA 3VGDA 8CGTA 5LA1A 1ZS2A 2G3JA 4TX6A 1TVPA 3AIVA 2A3HA 4ATDA 1HVQA 1RH9A 2WMGA 1SYTA 4S3JA 3MMWA 3PZMA 3WNNA 1Y7VA 3RM4A 3AS1A 3OZOA 5I23A 5JIPA 3VUPA 1L8NA 2DT2A 3QHMA 2WXDM 3MKKA 3MUZ1 4MNLA 2DSVA 4PMQA 1HJSA 1FH9A 3AMDA 1TCMA 2WPGA 3FNDA 3WEMA 3QOKA 2WMIA 4OKDA 3IJ8A 5CLWA 4B15A 4ZENA 1V0NA 2XGIA 3PZOA 2PWFA 2XWDA 4PN2A 4EE9A 5EFFA 1MVYA 1QI3A 1VIWA 4HOXA 3VIIA 1C93A 4U5KA 4U5IA 2CHNA 3ZSTA 1UWSA 3DYOA 2J7CA 3MUY1 3CMGA 1JNDA 2XVGA 4MAZA 1KQYA 3WKZA 3N11A 1QHPA 4GO9A 4CCEA 3WDQA 2J62A 3B9EA 3BLPX 3MMUA 2GDVA 1EHNA 2DSKA 1CPUA 1UA3A 2XSBA 1V0LA 4HMEA 2VL4A 2J7HA 1PAMA 2XGBA 3QGVA 4M82A 1VBRA 3NIYA 1UZ4A 4HZ8A 3KEHA 3WL1A 3ZR5A 3SCPA 1H0IA 2DT1A 4A3HA 1JZ8A 3WNLA 3AIUA 5ABEA 1V03A 1XYFA 1KXVA 1UH2A 1VFOA 1HX0A 1SR0A 4F8XA 1FA2A 1MFUA 3CIVA 1LG2A 1XD1A 2WZHA 2GVYA 2W62A 3VINA 4HZ6A 3U5YA 1L0PA 1UQYA 4TVUA 5D9NA 4PMDA 1EGZA 1E40A 2ZX9A 1E6PA 1HP4A 3VIHA 4F66A 2W5FA 4PTVA 1DEDA 4D1IA 1DWAM 3CPUA 2XVPA 1WZAA 2CBVA 4CGTA 3LMYA 5GPRA 4E2OA 1E72M 2PBOA 1B1YA 3ARWA 3KWXA 3M6DA 1JYNA 1HN1A 1CGXA 3M46A 3WBAA 1ITXA 1ZL1A 2E4TA 1NOUA 4B9YA 4P8XA 5IDIA 4WK9A 2VMFA 4GZEA 2CXGA 3CZJA 1AQMA 3SUSA 4YHEA 1GW1A 3BAWA 1B3WA 2VUYA 4AMCA 1E5NA 2WVVA 1TG7A 2ZUWA 3MSDA 3N13A 1HT6A 1M03A 3A4AA 1B2YA 4ACZB 7CGTA 4QLKA 4FK9A 3VILA 5I79A 3WELA 3WD4A 3LPGA 3POCA 1H0GA 5GNYA 1R8LA 5E6ZA 1NWTA 1US2A 1WAWA 3W25A 4UFJA 2GFTA 3WFLA 5A69A 2VX7A 1PIFA 4CD4A 4AEEA 3BAJA 4KWUA 3MSGA 4R27A 2QMJA 3PZNA 2VTFA 1EXPA 1OCQA 4IISA 3G6MA 3THCA 4D6DA 5IXEA 3W81A 3WMBA 1UHVA 1V3JA 1E71M 5A8PA 2ZXQA 1WE5A 2IXVA 1NOFA 1V02E 3OGSA 4W8AA 3OLEA 2O9PA 4QAWA 4MJ4A 3SCOA 1W3HA 4MJ2A 3W0KA 1EQCA 4EKJA 5HPOA 1E3ZA 4KRTA 3I3BA 4NI3A 5GNXA 1JI2A 3WH8A 4RE2A 3VDCA 3LPOA 4S3KA 3WSUA 3AXHA 4KGLA 5DO8A 1TUXA 1PPIA 1V6YA 4U2ZA 1GQIA 1JD9A 4CCCA 2J7BA 1BVZA 3ARZA 1PZ3A 3ZJ8A 1CGVA 2DT3A 2V5DA 1Q4NX 2WK2A 4PTXA 3WH6A 3ZT5A 4D6HA 2VRQA 2F8QA 2NSXA 1E73M 2D0HA 3EDKA 1GJWA 1DHKA 5CQ1A 1CXEA 2DH3A 3U5UA 1DWHM 3AS3A 2O92A 4JL2A 1BQCA 1JXJA 4WKAA 1PX8A 1Q6GA 3L4ZA 2XHYA 1WDSA 2YIHA 3QHNA 4OIFA 4UQBA 2CKRA 4CN4A 4UOZA 1VJSA 2FGZA 1R87A 1W2VA 1MYRA 2EPMX 2WANA 4Z2LA 5FL1A 1QOXA 5JUVA 1ZJBA 1D3CA 2OSYA 4FF5A 4J3WA 3DECA 1C8XA 3RMEA 2XM2A 2YKKA 4CN1A 3OZPA 4AD2A 2FH6A 3UCQA 4NSBA 1S46A 1E55A 1OT2A 2CBJA 2BNJA 2CNCA 5DF0A 2OYKA 2YLLA 4KH2A 1F4HA 1XSKA 2UY3A 2D0GA 4W7WA 2AMGA 3VGFA 3SCRA 4GKLA 2E3ZA 1FH7A 3AMGA 3CUIA 1H4PA 1TZ7A 4PMYA 1R7AA 1HNYA 2O9TA 1JF5A 3T09A 3ZJ6A 2W91A 2EBNA 3KL0A 1NM9A 2GUYA 3CLWA 2VX6A 4MPKA 3W37A 4MADA 1HJVA 1GQLA 2BY3A 2JE8A 4X9YA 1SMDA 2J8FA 1W9BM 2C0HA 4H41A 2YA2A 3II1A 4Q22A 2DSWA 1UR9A 2A3BA 1TA3A 1CLVA 4DUVA 1UKTA 1EOKA 3WDIA 1DWGM 3WEZA 3A4WA 1TVNA 3CZEA 1JFXA 2BHYA 4D6JA 4H8VA 2XWEA 3BAIA 3AIWA 3VPLA 4M24A 3GBDA 4JCMA 1JDAA 3GH5A 2ZX7A 2V38A 4P7QA 3B9DA 4W5UA 4MDOA 3VGEA 3ZOAA 1BGGA 1PEZA 4HPGA 3AFBA 2J77A 1KXTA 4ATLA 1VFFA 2WHKA 5AYIA 4YHGA 4UOJA 4PMXA 2E8YA 5D9PA 1PJ9A 4DM1A 2CESA 1D2KA 2GJXB 2OYMA 2DT0A 1CIUA 2J78A 4MNJA 2PWGA 4GZIA 4ZE5A 4WKHA 3DYPA 2D24A 3NYDA 3WMSA 1HJXA 4P8UA 3VMOA 1IV8A 1UD6A 3CH9A 1OGSA 3VIFA 2XFYA 1GONA 3M07A 4JKMA 4PMOA 1E6SM 1PX3A 1X1NA 2D22A 1CBGA 2ZOXA 1QNSA 4WIWA 3U57A 3BCFA 5DMYA 3A6OA 3SUTA 3EMQA 4EANA 1V6WA 4H2CA 1Q6CA 4HOZA 1KBBA 3AIRA 3WF3A 3N9KA 3AIEA 4JL1A 3CO4A 2J79A 5AC5A 1OWQA 4GO8A 4UFLA 4P8VA 1UKOA 4MB3A 3N1AA 1IT0A 1YQ2A 3PTKA 4RE3A 1OGGA 1UWIA 1EO5A 4AZHA 1EIBA 5LA0A 5BRQA 2JEPA 1KWKA 1GVIA 1CDGA 3APGA 3OLGA 4Z2GA 1HVXA 2B31A 1KQZA 6CGTA 1EO7A 2JF7A 3ARYA 1NWSA 4BA0A 1KGWA 4W7UA 1J01A 2YJQA 4W87A 2WZIA 1OIFA 5DFAA 1UQZA 4L4PA 2DQXA 1BGAA 1TE1A 2ZICA 3GH7A 2YBUA 3POHA 4X0VA 5HDRA 3HMCA 1E4IA 2J47A 4WJXA 4W5ZA 4H7VA 3BAKA 4C7FA 3ARSA 1ODUA 3WH7A 2V3FA 1V08A 1E6NA 2DH2A 2PWHA 2WMJA 4U3AA 1B0IA 3AOFA 2XIIA 2ZXDA 3T0AA 3MUAA 1UWUA 4NZCA 1WCGA 4JHOA 3K1DA 1PIGA 3A3HA 5EBAA 3UG5A 1MXDA 1CXHA 2XSAA 3D5HA 2JIWA 3LPPA 1VEMA 3CUJA 3PZVA 3SCVA 3L4UA 1IZJA 1JNEA 2J7EA 3BGAA 3ZT6A 1CXKA 1MW3A 2NT0A 2V3DA 3PZGA 3GNOA 2X0HA 1V3KA 1V02A 5FCZA 1BPLB 4WSJA 4CKQA 2CCRA 1ZBKA 2GJRA 5AC4A 1XV8A 4AC1X 1E4LA 2WKLA 4B16A 1GVYA 2WVVB 4DWSC 1AVAA 1QW8A 2XM1A 3T2PA 4AIOA 4LQ1A 2AOSA 2VO5A 1FP8A 1ISWA 1C8QA 1JGIA 4D6GA 1UD5A 4TX8A 2D3NA 4TOQA 1JAKA 2EPOA 1Q6DA 3VDBA 3ZJKA 3W82A 1CEOA 2PF0A 4HA1A 3WIJA 5ABGA 3TA9A 1E4MM 5CZKA 2VR5A 2WSKA 4PEEA 4DWSD 3F4VA 5HBFA 1W32A 1EDTA 4F9JA 3A4XA 3TTSA 3VGHA 2WCGA 3O6AA 5A8QA 2OWWA 2CIPA 3ARVA 3OA5A 2VC9A 1V6XA 4GQRA 3JUGA 4U33A 4OBSA 1HKMA 3CBWA 2PWDA 1GCYA 2DSZA 2D3LA 2X2YA 1ITCA 4NRSA 3NUKA 1QI4A 1GJUA 1QW9A 3VDHA 4CU8A 3ARQA 3IJ9A 3K4AA 4XV0A 1DTUA 5A2AA 3TTOA 4D72A 4U31A 3DHPA 3VD7A 1G5AA 5LYRA 1B31A 2ZUSA 5EB8A 3T2QA 1H3GA 1IZKA 4CU6A 2WM0A 2XTKA 3MUIA 3EDEA 4JAWA 4UR9A 1ODZA 1EOMA 1R86A 1KB3A 1J12A 3ARRA 2J7DA 2J75A 3RJXA 1B9ZA 5E09A 4EK7A 1KFWA 1G1YA 1ESWA 2XVKA 3AJ7A 5DEZA 2VOTA 2WLZA 1HIZA 1GOWA 3T0DA 1H49A 4AEFA 3PTQA 1W9PA 3K8LA 3AMLA 2WHMA 4OUEA 4JFWA 5I0DA 2WVUA 3CHDA 4PMUA 3AHYA 3TOPA 3BC9A 3W4RA 4TVCA 1CNVA 4UQAA 1ISXA 3ARTA 1JZ4A 3WUBA 3VIJA 1W1VA 4ZXLA 4L4OA 2NT1A 4J27A 4PYSA 5I78A 4D1JA 2IXUA 3WF4A 1OD8A 1JXKA 3TTQA 5E9AA 1GPFA 4AXNA 3E1F1 1UD2A 1JDDA 1TMQA 1V0MA 1UZ1A 3FHAA 1BYCA 1GOQA 5C70A 2EPNA 1JI1A 5JIWA 5E0FA 1CGWA 1A47A 4KGJA 1VEPA 2ZUUA 2WMFA 2DEPA 1XCWA 4OZOA 3GNPA 3VX0A 1K9TA 3BCDA 1E43A 3GXMA 3UETA 4UFKA 1P6WA 1X6LA 2EO7A 5KEZA 4AY1A 2OSXA 2BV9A 1FHDA 4PSPA 3U7VA 1B30A 1LL7A 2YDSA 3IANA 1XSJA 3BLKA 2WBGA 3EYPA 2D23A 2QHAA 2JIEA 3AICA 4PRWA 2WKGA 2WB5A 2WYSA 3VNZA 9CGTA 1HKJA 1Q6FA 1ZBCA 1W1YA 2E0PA 3CZLA 2ZWZA 4A4AA 2CBUA 1EDQA 4QLJA 1OB0A 1NARA 3N12A 1OM0A 2EPLX 2PBGA 1CTNA 2YA1A 3CHCA 4V27A 1RP9A 5M17A 2D2OA 1QHOA 3VU2A 5CGMA 1CGUA 4B9ZA 5CGTA 1GQKA 1H2JA 3PZIA 4CD5A 4M1RA 3MO4A 3MMDA 4FLOA 3GZAA 1E6XM 1BVNP 4Z2HA 1JDCA 1CZ1A 2J4GA 4AWEA 2IUZA 1HKIA 1CWYA 2V3GA 1JIBA 2XVLA 4HOWA 4NRRA 3GXDA 3WD3A 3WD1A 1BTCA 4HZ7A 3G6LA 4OOUA 2WLYA 1E56A 3W29A 1GQJA 2G4FA 2GJPA 2GK1A 4PMVA 1E6ZA 4XZWA 2CERA 5JBEA 1ISZA 1EH9A 1CLXA 1J9YA 1MW1A 1LLOA 3O2LA 3ZO9A 4E8CA 1J0ZA 3K46A 1J18A 3AHTA 4PMNA 3RIKA 5D4YA 4BQ4A 3FW6A 3TONA 1UG6A 2J7FA 1E6QM 4MDPA 2FHCA 3VKKA 1I1WA 4N0RA 4H8UA 3UESA 1HKKA 1UR8A 1WPCA 4XZBA 4WF7A 1J0YA 3NCOA 4HU0A 4HP5A 1HJQA 5A6AA 3WDJA 4AZCB 4D6IA 2YL9A 2FHBA 5A8NA 2G3MA 3RILA 1FFQA 3TP4A 1DP0A 2VX4A 3I3DA 3L2MA 4H04A 3WF1A 5KZ6A 1ISVA 4V2XA 3VVGA 3OGVA 4JKLA 1MQPA 3B8SA 4TXEA 4P7LA 1NP2A 1GOMA 4PUEA 2YL5A 3L4VA 4HA4A 1XHGA 2NW0A 3WENA 3AIBA 1GORA 4BZYA 2ZIDA 4AIEA 4JFSA 3WQ5A 2O9RA 1EQPA 1H11A 2VZTA 2BS9A 3ARUA 2XJ7A 4WLCA 2V5CA 1B90A 4D6FA 5HOSA 4AZ7A 1MW2A 3VMNA 3VTRA 2VI0A 1C7TA 3NSMA 4QP0A 5A6BA 4HMCA 3KL3A 1J0IA 4QLLA 5BYWA 1MQRA 4W85A 5A95A 2D20A 3WNMA 5CJ5A 1SFSA 4UQDA 1G0CA 1QI2A 2DPEA 2YDRA 5CPSA 5A6BD 4GIAA 4W8LA 1OBAA 3VNYA 1B3ZA 3WDHA 3DYMA 2EPKX 1J0HA 1QPKA 1WZLA 1U2YA 3AZRA 2J74A 3DHUA 3N04A 2VVSA 3UEQA 3MV01 1R85A 2WCSA 1JZ5A 2G3IA 3ALGA 2FH8A 3L4TA 4JZ5A 3SCWA 1UKQA 2YL8A 3BSHA 4FLRA 4W7VA 2WHJA 1CXFA 3F5JA 1WNOA 4JKKA 3K8MA 5E6YA 2VNCA 2BVDA 1KWGA 4P8WA 6TAAA 1UD4A 3HU7A 1G9HA 3EMZA 4UFHA 1JZ3A 1PX4A 2WMIB 3WQWA 1J0JA 5I24A 2DDXA 3MS8A 5DT5A 2QF8A 3I3EA 4W86A 4GQQA 4MB5A 3PBGA 1BYDA 3RM9A 4MB1A 3WDPP 4UZSA 1GUVA 4U2YA 3W26A 2C7FA 3U7BA 4M56A 4AISA 3HN3A 3VOCA 1VF8A 4MAVA 2Y5EA 4QDMA 1DWJM 1XSIA 1H09A 4GPNA 1QNPA 3ECQA 2W61A 2WVSA 4CD8A 2WWDA 2OWXA 1DWFM 5HPCA 1JL8A 1G01A 4PBGA 1UYQA 1LL4A 2X0YA 1W9VA 2VQUA 1G94A 4LGXA 2Y2WA 1WO2A 1ISYA 2W67A 1AQ0A 1H1NA 3NDYA 3WH9A 1X6NA 3NSXA 3AROA 4FMVA 5FOOA 4JHZA 4OBRA 5CPTA 3RM8A 3RO8A 2VX5A 1JG9A 1EHAA 2X1IA 5E70A 2JF6A 3A47A 1V0KA 1SMAA 1MWOA 3QR3A 2ZUVA 2ZE0A 4IPNB 1U30A 2UWFA 1JYXA 1GHSA 5HNNA 2BXZA 2OSWA 3SUWA 4URIA 1CGTA 2YL6A 1NQ6A 2ZXBA 3OBAA 3WMCA 1B3XA 2CHOA 2PC8A 3WUFA 5ABFA 1QBAA 2XPKA 1UUQA 3OLDA 1B3VA 1M04A 5ABHA 1K9EA 5I3DA 1BFNA 2JALA 5GNZA 5A8OA 1CGYA 4QFUA 4HPHA 1MW0A 1HF6A 1VBUA 5FKYA 4BQ3A 5BROA 3FHQA 3B9AA 1BG9A 4AZBA 4Z2IA 5E0CA 2BVYA 1J0KA 3DC0A 2Y8VA 2VJXA 4LYQA 1HL8A 4D6EA 3T2OA 3FY1A 1UWQA 2V3EA 4UQEA 5JBDA 3VGGA 3ZMRA 4M81A 3W27A 3N15A 1KGXA 3SCSA 2E8ZA 1K9DA 3WF0A 4J3SA 5A6SA 3SCQA 4PSRA 3WUGA 3O9NA 4DWSA 5CG0A 2D0FA 2BY1A 3NDZA 3L4WA 4J3UA 1MFVA 3SEPA 3WFZA 4N42A 1J11A 2JEQA 1HL9A 2RGMA 2ZX8A 1JYVA 1LQ0A 1ZBWA 5A1AA 3GH4A 1M53A 2WBKA 2GJXA 3AS0A 3WN6A 3GM8A 1W91A 4W8BA 4M8UA 1UR0A 3CTTA 3W6MA 3GNRA 1ZJAA 1CECA 2UY4A 2W4XA 3OB8A 1V3MA 1E4NA 2HVMA 4J28A 3T08A 5A2CA 1QHZA 2RGLA 1OD0A 3BAXA 4HU8A 3THDA 4RL3A 3GXFA 4Y7EA 1WKYA 3CUGA 1VFMA 3VD9A 3OIHA 1HJWA 7TAAA 2ZX5A 3F5LA 4J7RA 8A3HA 3LPFA 3VD4A 2F2HA 1CXLA 1WZKA 4UFIA 3N18A 3K8KA 1GOKA 1V6UA 4F9DA 3S2CA 4PTMA 2YDQA 5BCAA 1E1FA 4XB3A 5A6KA 1XH2A 4GZJA 2QPSA 3KE0A 1KR0A 3W38A 3GBEA 2VVNA 4UQ9A 1OINA 4ATWA 2J7GA 1JAEA 1UD3A 3J7HA 4EAMA 1VRXA 4Q7NA 4BS0A 4IUGA 5LA2A 2CBIA 2GK1B 4X0NA 3UR7A 1K9FA 3W53A 2BVTA 4TTUA 1JYWA 3ZQ9A 1UH3A 2DIEA 4B3KA 1E0VA 1W1TA 4H8HA 1OSEA 2E40A 2A3AA 3L4YA 5M5DA 4W93A 4YN5A 5HXMA 3WD2A 1NH6A 1VEOA 4MNMA 1HJUA 3AQUA 3VM5A 2WZEA 1QI5A 2J25A 4IPLA 2G3NA 3RJYA 4AD4A 3HJEA 4FLQA 1Z32X 4Z2JA 1BF2A 1WP6A 5BXSA 1XH0A 2E9BA 1VB9A 2DIJA 3AHXA 1C92A 4PCTA 3PZ9A 1PZ2A 1GZJA 1E0WA 3AXIA 3VIMA 2GSJA 3W28A 1UKSA 4ACYA 1NOWA 1XC6A 4HMDA 1Q6EA 1RD6A 1UKPA 1US3A 2WNWA 3T0BA 2Y24A 3WH5A 1BSIA 1OT1A 5CSYA 1UD8A 4LYPA 1QVBA 4GI9A 4B3LA 3MV11 2GDUA 3ZJ7A 1W1PA 4R5EA 4JFVA 3PZUA 3CGTA 3VIOA 1BLIA 4P7NA 4AD3A
chains in the Genus database with same CATH superfamily
3HF3A 3XISA 3KCOA 4G7EB 5GQBA 1C91A 3U2EA 2YA0A 1Q6QA 4AIUA 1TKKA 4GY7A 3L5MA 1VFUA 3OJGA 1JPMA 2OJPA 1V3IA 2WCAA 4Q8QA 2OWCA 1DJXA 4ZZ9A 2BHZA 1K8YA 5I02A 1IE7C 3BW2A 5DN1A 3TSBA 2PB1A 3A23A 4AG0A 4H9ZA 5PTDA 2A7NA 3DFPA 5MKGB 2EJ1A 1P0BA 4N9CA 4GYPC 3F5KA 3RF9A 2TAAA 1TSIA 4MPQA 4PRRA 5JBFA 1KGUA 1ME7A 4PUUA 3T07A 6XIAA 4RW5A 4YYCA 2FHFA 2DZSA 3W24A 3BAYA 5IBXA 5K9DA 4GYPA 2E9MA 1TTIA 2X0SA 1E1EA 2QIIA 1K4HA 1ZENA 7A3HA 2WC7A 4OQVA 4LAMA 1LQAA 1RQBA 3NPUA 1GHRA 2XFFA 2X09A 3SCNA 5DT7A 3C0LA 2OXNA 2YBTA 3C0SA 1XI3A 3ATYA 4LX4A 4LEFA 4M51A 2O9OA 2NQLA 2C71A 2W92A 3BXWA 1JD7A 2WAGA 3I10A 4KBXA 2FJUB 4L4MA 2QV4A 1IXQA 3KL5A 3QM3A 1R0MA 4ZSUA 4B92A 4PMRA 4R33A 4J3TA 3S8HA 4LYRA 2NQ9A 1A5SA 4GH3A 3L9CA 2DIKA 2WC4A 1RCQA 4JQ4A 1TRDA 1BEUA 1KCXA 3U4AA 1M7XA 2Z2BA 5XIMA 3UJSA 2ZA2A 1CW2A 1YNYA 3QY8A 5BW6A 4HTYA 1PUDA 1TMHA 1OFQA 3M0ZA 3FAWA 4DF2A 1E9LA 3SQLA 3MTWA 3CAKA 3EDDA 4WR3A 2PAJA 3LCGA 4PTNA 4V1YA 1LF1A 4C6JA 3SI9A 3AYSA 5M03A 1X7IA 2YLAA 4UUIA 3W7RA 3OVRA 4X9SA 4ACZA 4QHRA 1JZ2A 2Z1SA 1WDRA 2DZBA 4CLMA 3VXGA 5AVNA 3TQKA 3S3GA 1YDNA 1XRSA 3FXYA 2W79A 1GNXA 2ZUMA 5AYBA 2FDMA 4F0LA 3TZNA 4H6EA 1LG1A 3RR4A 1HXJA 2CYGA 2I57A 5I00A 1QAPA 2R82A 3E5BA 3TLQA 2HNHA 1M68A 2YCKX 5A2BA 1R2TA 4ZO8A 3VD5A 4C6PA 1E5JA 1UWTA 5LXEA 1J4EA 1P7TB 3M5YA 1XIMA 3ZSSA 3ARXA 5I5RA 1FP9A 4ZEPA 3DC8A 5DY3A 2XH4A 1TR1A 3M5ZA 4C7DA 3JW7A 2NZLA 5FD0A 3M0JA 4HA3A 4UOQA 5HA7A 5CSUA 3RPMA 2Q8ZA 3ELFA 4MYXA 2NV9A 1K1DA 4DLFA 1ZP3A 1QNVA 1BYAA 2A4AA 2ABAA 2CKSA 2GWGA 4WHBA 4E2DA 3SGUA 1EJRC 4NJHA 5G5IA 4C7GA 3ES8A 4QCEA 3WK1A 3ISIX 1V3LA 5IM51 1Q6RA 3GG7A 1CYGA 1KCLA 4GUJA 2FTYA 2CZVA 2WMHA 3B9NA 2OLAA 3MU7A 4RW3A 4EPBC 3FA5A 1QT1A 2OB3A 2CITA 1XYZA 1RQHA 2VRKA 1VJIA 1VZWA 2AQWA 3AIQA 1ZZMA 1H41A 3GFZA 4ZL1A 4XZIA 3GUWA 3ZVHA 4DPPA 4Q4QA 3N2CA 4BQ2A 2R9RA 4I7UA 5C2XA 2D73A 4DF1A 2QMKA 4DF0A 4WSKA 1R7OA 1DKWA 2A7RA 3CZ8A 5CAKA 3PFMA 4XKYA 4PMZA 1Q8JA 3QY6A 3LTPA 4N6EA 4H4IA 4MKVA 3PZTA 3P62A 3W22A 1JGMA 3RDKA 1MEIA 1M9HA 1HFBA 4JBRA 1T5AA 4UQCA 3FXGA 2UY5A 1JPHA 1S2WA 5CGQA 4D6CA 4MNKA 3TLLA 3B97A 1W2PA 2BHUA 3DZ1A 4FXRA 4H19A 4BFAA 3UWZA 1NP0A 3LS9A 1PTDA 2HVNA 1UPPA 3ONCA 2WSPA 2YDAA 1OF8A 3NURA 4GIRA 2PGRA 2VEFA 3PTMA 2I56A 2DZXA 4YCPA 2VQTA 3ZR6A 3NQ6A 1N82A 3ZR4A 4IFRA 5DY2A 1YPFA 1ZCCA 3NAVA 3OLIA 4CNNA 1KR1A 1M01A 3F2BA 1J6OA 3HMJG 1WZMA 3MI3A 2VFHA 2DUZA 1V5XA 3QXBA 3H26A 5ECUA 4Q8OA 1EA0A 1WB0A 4CNTA 4IPIA 3TJ4A 3RX2A 5H8MA 1LOLA 3LN3A 1VH7A 2VD9A 2ZRWA 4LS0A 4WDXA 2Z1KA 1X38A 3V4BA 4YPJA 3NOYA 2XFRA 4GX9A 1KCZA 4JTQA 4XD5A 3WY1A 3E49A 1LBFA 1OIMA 4QJ5B 4K68A 2ZE3A 4ZE4A 2R1PA 3VOGA 1TVPA 4IXXA 1AW2A 4ATDA 1NVMA 4H1ZA 3VFCA 1S1RA 3TYEA 1H60A 1YW1A 2OT1A 3WQOA 1SYTA 4B2DA 3MMWA 4FOKA 4O0KA 3AS1A 2ZA3A 3OZOA 3W2UA 3BOLA 4PR4A 8XIMA 5BWAA 4XTDA 4PMQA 1HJSA 3SRHA 1JDFA 2WPGA 2WMIA 2FB3A 4B2DD 2I9UA 1POKA 1V0NA 2XGIA 3HIJA 2YB1A 4QE1A 4C5YA 2XWDA 4XIMA 5EFFA 3W9ZA 3WLMA 2BVWA 5REQA 4HOXA 3PY2A 4U5KA 1I6NA 3SADA 2J9XA 4C1NA 3SRKA 3U2CA 2UV8G 1GW9A 4AH7A 3SAZA 3LRMA 3P61A 3MUY1 2AL1A 5EMJA 3N11A 1KBIA 2Y88A 1QHPA 4JTCA 5LNRA 1QJWA 2GDVA 2DSKA 2XN1A 4HMEA 2TPSA 2XGBA 5AHIA 3UPMA 4UMCA 2I5GA 4RZ5A 1VBRA 1RJQA 3TWAA 4HZ8A 2QGYA 4H8NA 5CAHA 2DT1A 3AIUA 1V03A 3CO8A 1XJBA 4F40A 3B0YA 1HX0A 1SR0A 1OZMA 4YXGA 1OEPA 1AZ1A 2H6RA 2DJXA 1TPC1 3DOPA 2HWGA 1SZFA 2W62A 3G1VA 4HZ6A 3E38A 4TVUA 4IWWA 2QCGA 3NL2A 4FOUA 4IP5A 2ZX9A 1E6PA 3R11A 3VIHA 1PE1A 4S23A 2YXOA 3RU8X 1D9EA 1B3OA 1DWAM 3CPUA 2PS2A 4Q7IA 1WZAA 5GPRA 1H51A 4TQTA 1E72M 4QTGA 3KRBA 3NYZA 1HN1A 1CGXA 3A9IA 5CPOA 1GEQA 2OEJA 2Z1BA 4HK5A 2KZHA 3ITGA 1NOUA 3OVQA 2IKJA 3DENA 4P8XA 3C3NA 5IDIA 1MRQA 1F61A 3LLDA 3SUSA 3CZJA 3WLOA 2QQ6A 4ES4A 1UW9A 3ITLA 5C2GA 5CBJA 3A4AA 2YZ5A 3EXRA 4GGBA 2BTMA 4BI6A 3FDGA 5I79A 3TN5A 3HOJA 1RD5A 1YPXA 4S3AA 3VC5A 3NEHA 1NWTA 3TFXA 5A69A 1R47A 1LT8A 4H83A 3WJSA 4CD4A 1C9WA 1K77A 3E9AA 1ENUA 4KWUA 2Z0IA 2P1FA 3WCZA 3PZNA 4EACA 4Z1DA 2VTFA 1EXPA 3OA3A 1OCQA 3W81A 3O1NA 1UHVA 4CQ9A 4JTRA 3OQ8A 1YXYA 1WE5A 1NOFA 1F5ZA 4C6MA 5T9BG 4W8AA 1XIEA 2O9PA 4QG8A 3SCOA 3O07A 1PCWA 2VGGA 4MJ2A 3T55A 2F9RA 5KZEA 5HPOA 3MT1A 1DJIA 1LT7A 3PUGA 1UROA 4UWMA 1NTHA 1QUMA 1K8CA 3WSUA 3M5VA 2QDDA 3TW7A 1GQIA 3KVLA 4CCCA 3ARZA 4PBEA 3ZJ8A 3LGEA 1OCNA 4D6HA 2VRQA 1G4EA 2PU1A 2D0HA 1GJWA 3WJZA 4XD6A 1FDYA 2ZTJA 4QIUA 3N9SA 1DWHM 2V5JA 3AS3A 3K5XA 1OC5A 1HGYA 2DVTA 4WKAA 4LBSA 1WDSA 3TX9A 5HAOA 3WQCA 5I3JA 3QHNA 2RJHA 5HK4A 2FGZA 2OU4A 1R87A 2X1RA 1W2VA 4CCZA 1N8WA 1MYRA 1RBAA 2EPMX 4EAYA 4Z2LA 5FL1A 4FPSA 3LB0A 2PDMA 1DBTA 2BMBA 1JCLA 1ZJBA 1D3CA 3R94A 2OSYA 4FF5A 4FALA 3LNPA 4DWDA 2PTXA 1AMKA 1C8XA 3RMEA 2NWRA 3OBKA 4TMBA 5MF5A 1Y5WA 1F2JA 3CM4A 3F4DA 1YLVA 4GBUA 3AO0A 1F4HA 2XH7A 4RUBA 2UY3A 1Z6KA 4W7WA 2AMGA 4GKLA 2E3ZA 1FH7A 3AMGA 3RRAA 4JN6A 4K37A 1JJKA 1YXCA 3G5EA 1JF5A 2W91A 1AODA 2ADAA 2EBNA 3R4IA 3PUEA 1ZHAA 2GUYA 2VX6A 3NQEA 3PAJA 4NNCA 1OY0A 3GY1A 4WDWA 4GKTA 2V5BA 3OOQA 1VHCA 1J93A 1S1PA 2BOEX 4GISA 4Q22A 5EU9A 2DSWA 4YIWA 4AIBA 4NAEA 3WDIA 1DWGM 2I17A 2FZNA 4KS0A 2PDNA 2ISFA 4O52A 3BK0A 5CKSA 4D6JA 2BHYA 3STPA 3VPLA 1LROA 3GH5A 2ZX7A 5EBUA 2QJNA 2FDSA 1BGGA 3AFBA 3T4CA 1G4PA 1YBQB 1VFFA 2WHKA 1N55A 3MUXA 1VBJA 3TEVA 4IOTA 5TNVA 1S2UA 5J5DA 1FCUA 1I2RA 1D2KA 2OYMA 1RQEA 3N6JA 1MDRA 3O6DA 3GAKA 2PWGA 4O19A 4WKHA 5G1MA 3DYPA 3WMSA 4LUTB 1IV8A 1UD6A 4ZOBA 3P0XA 3GIPA 1EBHA 3VIFA 4HNUA 2XFYA 1GONA 5D02A 4RE0A 1X1NA 1CBGA 4WIWA 3I7QA 1WYIA 1XG3A 3EWZA 3A6OA 3W07A 5C55A 4O0QA 3M0HA 4EANA 3LXBA 4DJFC 3F03K 1OFDA 1KBBA 3AIRA 5CC3A 3CL8A 4LBUA 2J79A 3H22A 1OWQA 5DBTA 1UKOA 3EPMA 4MB3A 2GOKA 1YQ2A 4JYFA 3LHTA 4DZAA 2O4MA 1EO5A 2HK1A 1KO0A 1KWKA 3L0NA 4Z2GA 4L6DA 2B31A 1DJZA 3C0QA 4YVXA 6CGTA 3GFYA 1NWSA 1OFAA 3JZEA 3COTA 3T42A 4W7UA 1EXBA 1VPYA 3Q65A 4W87A 3TC3A 4L6HA 5DFAA 5I3IA 4GUIA 3C2EA 1BGAA 5FJRA 1BD0A 3POHA 1BVWA 4JTTA 4O8AA 1EC9A 5CZSA 2J47A 4H7VA 2C14A 4IMAA 3DDMA 3KDOA 1L6FA 2NV2A 3WH7A 2MNRA 1WUFA 1XLCA 2PWHA 4QQUA 4ZB5A 3SRDA 2XIIA 4FI4A 3WX7A 3T44A 2RJGA 1G6CA 5AN7A 1VYPX 4AQLA 2TSYA 4IMGA 1PIGA 5C9ZA 3A3WA 1TO3A 4DBUA 2PD5A 3V7PA 2QXWA 3D5HA 3UBPC 3TV8A 3CLMA 3L4UA 2PTDA 4NZ4A 3DFTA 1JNEA 3LGDA 3TAOA 4Y9OA 1V02A 1BPLB 4CKQA 3WLTA 2CCRA 3FVMA 2GJRA 1OK4A 1E4LA 4B16A 1MUCA 1T7LA 3APYA 2XM1A 2R14A 3V0TA 3OZYA 1XFBA 2E77A 1XYMA 1XP3A 2PTWA 4CEXC 1ISWA 3FGCA 3OYZA 2ATSA 1UD5A 1B57A 4DUOA 1Q6DA 2PWUA 4QG6A 4DQWA 1CEOA 4P2VA 4M7SA 2J66A 2P5NA 4XAPA 4MUPA 3TA9A 1E4MM 2WSKA 2V82A 1RHCA 5HBFA 3VGHA 2WCGA 4FX8A 2OWWA 2VC9A 3U8GA 4IQDA 2DSZA 3HBLA 3DKJA 3GK0A 2D3LA 5DCBA 2VFEA 2GLKA 3HG3A 4QEHA 1WXYA 3NPVA 1QI4A 3TYUA 2W27A 1XC4A 3VDGA 1IEIA 1GJUA 3H24A 4J1OA 4GNJA 3MKVA 3R12A 3W70A 3IJ9A 1DTUA 1M1BA 3DHPA 1G5AA 3MZ2A 2Z2UA 4C5ZA 4HYRA 1X96A 2WM0A 3MO7A 2JGYA 3WLNA 2VXNA 1O68A 4BJHA 1ODZA 2Q71A 4QEEA 3KRSA 3EWXA 1BWLA 5CEWA 3BLEA 1B9ZA 4EK7A 4B5NA 3RLHA 1G1YA 1A3XA 1XRFA 4UMBA 3RXZA 1VBHA 2Y7DA 2QVHA 2Z24A 3T0DA 3HA1A 3E12A 1ONXA 3Q4DA 4R9OA 3QPYA 3W87A 3UR2A 2WHMA 4OUEA 2CHRA 5KSWA 3LXCA 1YTDA 4PC8A 2PRLA 3AHYA 3W85A 3EB4A 3BC9A 1AFSA 4TVCA 4Y8EA 1ISXA 3ARTA 4J5NA 1KV5A 3MVIA 3IV8A 2PCQA 3HFTA 2G0WA 3WUBA 2NX9A 3H55A 3T1GA 3NQCA 3VIJA 2R24A 1W1VA 4HU4A 2JKEA 3RN6A 2VENA 4LANA 4H6QA 3TQPA 3TTQA 5E9AA 3E1F1 2XN2A 1IEQA 4A2RA 4ZA0A 3W7CA 3R10A 2EPNA 4HN4A 3CMFA 4US5A 2XSXA 1AQFA 4IQLA 4N4PA 1QTWA 3BLLA 2X1SA 3VX0A 2H9AA 2VC7A 3GXMA 3CU2A 4UFKA 1XLHA 1DOSA 2G5WA 2ZDRA 2BV9A 4QM1A 5CPMA 3BOXA 3TCSA 5HWMA 1JCYA 3MZNA 1XSJA 2PDIA 4HKPA 4DXXA 2WBGA 1P5BA 3LHVA 2D23A 4JTDA 2JIEA 3UG8A 1AA1B 2WKGA 4JPGA 1KKRA 3N4FA 3IJ6A 3T0TA 2VDIA 2NWSA 1R3RA 3B0UX 1A4MA 1U1UA 3N12A 3M41A 1OM0A 1DQXA 3GRIA 5K3VA 1RP9A 2QJJA 1M7JA 1CGUA 4B9ZA 5TAOA 1H2JA 1AJ2A 4CD5A 4O10A 4EXAA 1Z9AA 1LQ2A 1LCOA 1B4KA 1A0CA 1I0DA 4Z2HA 5LKYA 3WLPA 1JDCA 1XLMA 2A2IA 4IIBA 4NRRA 3IIVA 4CNUA 3KBSA 3WD1A 4UBPC 3V3WA 4JNYA 1ZGDA 1KFJA 2DP3A 1ISZA 3TXZA 1EH9A 3SN1A 1K7EA 4S3BA 3IVUA 4JTSA 2C91A 3AHTA 4PMNA 4BQ4A 1DJYA 3BTNA 2HXUA 1OYCA 1UG6A 5T91A 1E6QM 3QZ6A 4XKYB 3VKKA 3VE9A 4MY1A 4JQ1A 3CQHA 2E6FA 2PP3A 4XZBA 3M0LA 1YDOA 3LI1A 3GO2A 5H2ZA 4KF1A 4V33A 5A8NA 3HQOA 3INPA 1RPXA 1SFJA 1DP0A 1TPH1 4H04A 2J9ZA 4KEMA 3LHWA 3PF3A 4V2XA 1M65A 5H8UA 4JKLA 1Y5XA 3SSZA 1NP2A 1GOMA 4PUEA 2YXXA 3WENA 4K3ZA 4AIEA 2PRHA 3G1DA 8RUCA 3MYOA 5LGZA 1ADSA 1WX0A 1MI3A 4WCJA 4NT0A 1A53A 3GTIA 6XIMA 5FJUA 2V5CA 4XUGA 1VKFA 3C4UA 2FIQA 5FJIA 3V36A 3CHVA 2EHHA 5HQEA 3GTFA 4NYUA 2ZZ3A 3DEQA 1ZPTA 2D20A 5CJ5A 4YWIA 1SFSA 4I90A 4UC5A 4UQDA 2QDGA 2DPEA 2YDRA 5CPSA 4GIAA 1Q63A 4M3PA 2FTPA 3OU8A 1PXGA 4KEZA 5AHFA 1B3ZA 3VNKA 2NVDA 3APTA 1WZLA 2A85A 2J74A 3DHUA 3N04A 2IKHA 2WSRA 3ALGA 4JIIX 3H2EA 3L4TA 3SCWA 3BSHA 5FSDC 3W84A 2ZADA 4JKKA 2VNCA 2RDUA 1MZRA 1ADDA 5AHEA 2PDQA 1QR7A 2PDHA 3NQGA 1JZ3A 1WAUA 3CS2A 2WMIB 1YTKA 4HJFA 5I24A 4WQ6A 2QF8A 3I3EA 1QPQA 4W86A 1BYDA 3WDPP 3A64A 1WXZA 3R0KA 4C1NB 1H50A 1HZYA 5D2YA 2FZMA 3FEQA 4U2YA 4HNVA 3GS6A 4C6LA 2Z7GA 4PCNA 3GNXA 3HN3A 4MAVA 1VF8A 3UJ2A 3WBXA 3G22A 2RDWA 2J8TA 2WVSA 3IS4A 4H01A 4CD8A 3B0XA 2EG6A 5HPCA 1JL8A 1X39A 1G01A 3KS6A 1UYQA 1XBYA 1QW7A 1LL4A 1PVNA 3TXVA 1KV8A 1W9VA 1F6YA 1QATA 1H1NA 2QAPA 1FXPA 1KLYA 2NXGA 1X6NA 3EXSA 3IIOA 3WH9A 3RMJA 3A5FA 5AHNA 2DQWA 1JG9A 2Z00A 2GSHA 2JF6A 5JU6A 1IXNA 3OIXA 3PAOA 4XAZA 4L1XA 3TKFA 2A3LA 3VNDA 2E6DA 2B7QA 3SUWA 3WMCA 3OBAA 3NXLA 2C19A 1MDLA 1B3XA 4E0CA 3WUFA 1GJPA 1P0KA 3G24A 2XPKA 1UUQA 1K9EA 5I3DA 4NYYA 1F9CA 1CGYA 4QFUA 4HPHA 1MW0A 1HF6A 3ABQA 1VBUA 2QUUA 1LYXA 3QY7A 1JQXA 4OBTA 1GQNA 4QDWA 3GHSA 2X7VA 5E9XA 3R43A 2PWVA 2GQ9A 1J0KA 4NASA 3SZ8A 3V16A 3GG0A 2QKFA 1M41A 3FY1A 1W5QA 2HSAA 2OGJA 3DGRA 3GQYA 3SCSA 1BSLA 3M43A 1K9DA 1I60A 1UJQA 3O9NA 4DWSA 3EA3A 2DU2A 3GSMA 3TAKA 2D0FA 3MCNA 3NDZA 2C18A 5JQ9A 1EF3A 3SEPA 1K8ZA 2JEQA 3H4WA 1SO3A 2O4QA 1FWJC 1JYVA 1LQ0A 1ZFJA 1ZBWA 2A79A 3QZEA 3SR7A 3GH4A 3OG3A 2QULA 3KRZA 4ZO7A 1UR0A 2Q01A 1IR2A 1TJ0A 1RLCL 1GYMA 3GLCA 1OABA 1FKXA 2UY4A 2W4XA 3OB8A 1V3MA 2CZDA 1E4NA 4EOUA 3RK8A 4QBXA 1T8XA 3LCIA 4Y2WA 1BXCA 4RL3A 4AY8A 4H9MA 1WKYA 1VFMA 4MUZA 3OIHA 1OYAA 3QGAC 1Q66A 4J7RA 3GVWA 4O1AA 3VKDA 1CXLA 3UZJA 3M4HA 4GOAA 3K8KA 1V6UA 2GYIA 3F4NA 4PTMA 2YDQA 4XB3A 3IUHA 4R7OA 4B5VA 1EIXA 4HN8A 4LSBA 1FBAA 5M2FX 1TMLA 4MFEA 2V69A 1PO9A 3NZ1A 2VVNA 4FXFA 1TV2A 3E96A 3W73A 1UD3A 3J7HA 4RNFA 4HA0A 3KM8A 4IUGA 5LA2A 2CBIA 4IP7A 4ZO9A 3B8WA 3O7UA 3A4JA 4X0NA 3WLKX 3SN0A 3UR7A 3W53A 4O50A 3JVAA 1JYWA 1JVNA 3V18A 5KITA 1I4NA 3XINA 2PSNA 1W1TA 2E40A 4KCWA 3TFCA 2VC6A 1ZALA 3E0LA 1K70A 2A3AA 3TSDA 1KW1A 1TJRA 4YN5A 3ZYZA 1NH6A 4GJJA 4MNMA 1IT7A 1YIXA 3G8EA 2G3FA 1QI5A 4IPLA 4FLQA 3CQ0A 2EG8A 1UC4A 4FXSA 1BF2A 2QJMA 3LZ5A 5BXSA 1DQWA 2FKPA 3V5OA 3AHXA 1C92A 1MZHA 4FOJA 3NPWA 3SY1A 3AXIA 4J3ZA 4UMAA 1PYFA 1UKSA 1XC6A 1VC4A 1WQ5A 2GDQA 1SGJA 1EJTC 1UKPA 1UP2A 1F3XA 3N14A 1OT1A 2HEJA 3S5NA 2DUXA 4LYPA 4DZIA 1T8QA 3MV11 3ZJ7A 1KM1A 4GVHA 3V5CA 3FLUA 4P7NA 4AD3A 5DQPA 1VRDA 3P60A 2VZSA 1ZTVA 4LXFA 4DPQA 2P0OA 3WL0A 1YPIA 1UA7A 1D7FA 2E9LA 2X40A 2QLYA 4UXDA 2POTA 2VEPA 2CLMA 3W6LA 2G41A 4RE4A 5L9FA 3MHFA 2I7GA 3W7IA 2HTMA 2A3EA 1IWAA 1RJPA 4NAEB 3KLKA 3NJ3A 4PUNA 2ZFAA 4AD5A 3N17A 4GI6A 5IHRA 3A13A 1XWYA 4BCEA 3G0SA 3P0WA 1RVKA 4H7CA 4C91A 1FCVA 3MANA 3BSGA 4GYFA 4QCFA 4HB7A 4PE8A 3TC6A 4KCTA 4JEJA 3EX6A 4OOZA 1V3HA 1JEZA 1GVQA 4UR8A 3NVDA 2Y4SA 4XAFA 3QKZA 2Z29A 2PURA 1QNRA 3IAQA 5TQLA 3W7MA 5LXXA 5DMMA 1ZAIA 5LGXA 3MDUA 1PKYA 4ERAA 1A5MC 2QT3A 5FL0A 3LA4A 3VOIA 5FIPA 2ZZ2A 4GG9A 3BQ6A 1LL6A 3BPWA 1KXHA 5AY7A 2C16A 2IQ0A 1Q5MA 5BRPA 3RX3A 5BXRA 2YPIA 4LVAA 5EFDA 3TW9A 3LDVA 2V67A 4OTKA 4JFUA 3DG3A 2BY0A 3UYIA 4BF7A 4GMEA 3FN9A 4M19A 4LRSA 5D8WA 1RP8A 1QOQA 4FLSA 4IL2A 3CZKA 3QSRA 2BX7A 4UNIA 3NZRA 1NIUA 3BH4A 3ITXA 1R2RA 4OHQA 3TDFA 4CVUA 1LWJA 3HO8A 4ZXOA 1MXGA 1YRRA 1BQGA 3CAVA 2VT0A 2VYOA 4JGDA 5U7SA 3S2NA 3SUUA 1FWRA 4QSFA 3DHFA 3EDFA 1BHGA 2NXIA 3KBVA 1BYBA 4DUWA 3W74A 1O7AA 4R9XA 5TIMA 3S2MA 3SUVA 3STGA 4L9YA 2PMQA 3B3DA 2HBXA 5ABFB 2I5IA 1YHTA 3MPGA 1QNOA 5BXPA 4M29A 5GJMA 3C56A 3VM7A 2G8ZA 4LB4A 3QV6A 2FJKA 4DO4A 3HV9A 2OFJA 1S39A 2NUYA 3PTDA 1C90A 6REQA 3E74A 2FYMA 1X6UA 4CNSA 2GQ3A 5C0QA 2B7PA 5E93A 4ZSTA 1TCDA 3AHVA 5IFPA 1J96A 1RAKA 3OG2A 4JTUA 3CV6A 4KWOA 2Q8XA 4C60A 4WGXA 7REQB 4AAJA 2HISA 1SJCA 3WJYA 4RK8A 1XLLA 1VJZA 4HSNA 3BW4A 4JCLA 3VKAA 3NQDA 3R25A 3NSNA 2QCNA 4ONVA 4CU7A 1E70M 5FEZA 2OEMA 2Y7GA 2O7QA 3AWOA 1W9DM 1A3HA 1UR2A 5C9UA 3HGOA 1OADA 4GRSA 1DYSA 1IT8A 2WPBA 4JS3A 4XBKA 1PZ0A 3RG6A 1FHLA 3UWWA 4M6UA 1R3YA 3WQVA 3P80A 2PDBA 3CJPA 1F6KA 1UH4A 2XYLA 1BTMA 1UMYA 4D8AA 2HPIA 1VPXA 3OYXA 5EKYA 5CPQA 1XIJA 3TNOA 4GINA 3BVJA 4JIPA 1GOIA 3WNPA 9XIMA 4ZFMA 1K7FA 1FH8A 5AOUA 3CHEA 3B4UA 5EGRA 2R8WA 3ALFA 4AZ5A 1JCMP 2P88A 1QDSA 1XICA 3VIPA 5C71A 1A0EA 4WEVX 1L6GA 4QDPA 2VZVA 3TR9A 4PL1A 1GVOA 3KX6A 3SCUA 1DJNA 3PHAA 5DXXA 1W3KA 3M7SA 1FWWA 1AQHA 4R53A 4LUYA 2ZUNA 1CENA 3L4XA 1I75A 4ICCX 5F1VA 2AQVA 2V63A 3IWPA 3V0UA 1XCXA 3ARPA 3EAUA 1XG4A 1LTDA 1E0XA 2A0NA 3VX1A 2PD9A 2QJIA 5A6MA 3WD0A 3UYCA 4ADSA 2VR4A 4NJIA 4NXKA 3WQ6A 4KMQA 1IQ8A 1D8CA 3EWCA 2ICSA 1EGMA 3CT7A 3LHUA 3LQLA 3TTYA 3ZM8A 5B7YA 2YBVA 2OQYA 3HB9A 4LC8A 1J2WA 3W7HA 4O18A 4FEZA 4CCDA 2WZTA 1NEYA 1KFLA 4TO8A 1Z42A 3VGBA 4CD6A 4PMJA 3MWCA 1XD0A 1RK6A 4EPEC 1C29A 3PVFA 1VENA 3GDBA 4J2PA 1S5WA 2J9YA 3BMVA 3CAWA 5BWFA 3T6CA 4HPNA 3KZSA 3L12A 4TX6A 2A3HA 3RLGA 5G4HC 1EP1A 2AKZA 2WMGA 3N6HA 3PZMA 5EMKA 3WNNA 4QJ1A 2V6AA 3TWBA 3Q2DA 4R7JA 5JIPA 3MI6A 1FHVA 2C3ZA 2V0TA 1NU5A 2WXDM 2Y1HA 4MNLA 3W1LA 3N4AA 2DSVA 5J5RA 3MJYA 3G1FA 1TCMA 8XIAA 1S3TC 4C90A 2ZKMX 1LOQA 4HCHA 4JTEA 3IJ8A 5CLWA 1K4GA 1ME9A 2B7OA 4ENLA 4IZGA 4NZ1A 3XIMA 1EF2A 3K30A 1QI3A 1VIWA 3TN3A 3UXLA 1C93A 1IIGA 5DXYA 2P53A 2Q3OA 3B8DA 2FLIA 3G0XA 1IGSA 3ZSTA 1UWSA 2HBVA 3EKZA 1LLWA 4C6IA 4R88A 1QPNA 1XYAA 2XVGA 3BUVA 5LNWA 1PKMA 3WKZA 4MKSA 2X16A 4CCEA 3W7JA 3WDQA 2YX0A 2J62A 5AHMA 2H8XA 1R9ZA 5F4XA 3M0VA 3BV7A 4ROQA 7PTDA 2J7HA 3ONBA 2PP1A 3BDKA 3KEHA 1R5YA 3SCPA 2Y85A 3WNLA 5I7GA 4GCXA 1XYFA 4M1BA 1U83A 1KXVA 4FP1A 3RAOA 3B40A 3KXQA 4F8XA 3QW4B 4LY4A 4B90A 2G4JA 2WZHA 1FCBA 3GW3A 3U5YA 1VYRA 5DRIA 4HBKA 3UA3A 2H90A 1WDWA 1E51A 2CBVA 1EJUC 4LCQA 1I2PA 4MLRA 1P48A 3VCRA 5G1YA 5GVJA 3TQVA 2PBOA 3WO8A 1W54A 1ZLPA 3OODA 3KLLA 5T8GA 2EF9A 2E4TA 4X2RA 4JDYA 4K7YA 4JX6A 3LENA 2WO5A 4GZEA 4AF0A 2GVJA 2X2GA 1SJAA 1GW1A 3TYBA 4S2CA 2P8BA 1OC7A 1E5NA 5K9CA 2WVVA 2ZUWA 3N13A 4LW7A 5GJPA 4ORIA 4QX4A 4GVGA 1M6JA 5E5CA 3VILA 1PHWA 3WELA 3WD4A 3UCCA 4WY0F 1GYNA 4ZOEA 1XBZA 1H0GA 3NM1A 4NI8A 1WAWA 2GFTA 3WFLA 2VX7A 1FWDC 4AEEA 1QWGA 3MSGA 1YX1A 3UVIA 4GFSA 3BLOA 3CQJA 1LM1A 4S3FA 3GDMA 4IISA 2ZC1A 3G6MA 3THCA 4D6DA 5IXEA 2QCDA 4RJEA 4Q7BA 1EFZA 3CPRA 1LZOA 2ISWA 4HIBA 1PCKA 4LC6A 4P61A 3ZLFA 4Z1BA 1RXOB 5LNSA 4ERGA 4OFCA 1VPQA 4KCUA 5LNVA 4EKJA 4KRTA 2NX1A 1IEXA 6ENLA 3W2JA 3UD6A 3S46A 2Z2AA 3VDCA 3NL6A 4LB3A 5AHLA 5EA9A 1TUXA 3LLFA 1V6YA 4U2ZA 4DAFA 3F7JA 1JD9A 5A6TC 1N2VA 3W6YA 1JRBA 2DT3A 2V5DA 4YU1A 1Q6LA 3WK3A 4XZMX 3WH6A 2F8QA 1KM2A 3AALA 5LIUX 1DHKA 5CQ1A 4C1KA 2DH3A 1KM4A 4JQ3A 3B4YA 3P82A 3ZS4A 2CC0A 1UZDA 4JL2A 3H21A 1JXJA 4MY9A 3L5AA 5AZ0A 3RR1A 3L4ZA 2PDLA 4QISA 2QGHA 2ZZ1A 3VKJA 1U1JA 1MUMA 2DZTA 3FA3A 4IQEA 4OIFA 4H9UA 3CPGA 4EXBA 1ZUAX 4MZ8A 3CK5A 4EPKA 1QOXA 4J3WA 5LHFA 4ZGYA 4DJDA 6ALDA 3LTYA 3FKKA 1UCWA 4Q32A 1G4TA 3C61A 3CWNA 4FNQA 5K2ZA 2FH6A 3GAYA 3IIXA 3IARA 4NSBA 1O4UA 5M1TA 3RCYA 2DORA 1OT2A 5E0KA 4MMWA 4GX8A 1XLAA 1J8VA 4DJDD 2YLLA 4O57A 3BANA 1ML1A 3EGJA 3GZ3A 1XSKA 3ID7A 3UGRA 5HNTA 2D0GA 3VGFA 3SCRA 1REQA 4RZ6A 2ASHA 3RCMA 1R7AA 1HNYA 4GYKA 3GKFA 2DW6A 3LBOA 4LF2A 3ME3A 4MADA 3LHZA 3GVRA 2PODA 2YB4A 1GQLA 1ALDA 2JE8A 1Q45A 3O0KA 5HULA 1VD6A 2Z6IA 2J8FA 3AXMA 3ZZ1A 1YNQA 2ZYFA 2YA2A 1UR9A 4RZ4A 4IMDA 1TA3A 1UKTA 3FV9A 3W2NA 3SDOA 4C6DA 3WEZA 1Q7QA 1TVNA 4NZ5A 4HGXA 3BAIA 2O56A 3AIWA 4M24A 4JCMA 3B8TA 1O94A 4REQA 3SIZA 2FZ8A 4ATLA 1A5OC 1ELSA 2GGEA 4YHGA 2E8YA 4O1CA 2PDPA 4H9YA 2CESA 1J2BA 4F2TA 4E2VA 2V30A 3A22A 3BLFA 4L65A 1HJXA 4P8UA 3VMOA 2INFA 4XZLX 1P1MA 3SGGA 1UC5A 4PMOA 1F07A 3G1RA 4JKMA 1PX3A 2ZRUA 3VA8A 4FIQA 2GGJA 4XK2A 2CLKA 1KFEA 1Q6CA 3F2CA 4JL1A 1PB0A 3MVTA 4M5PA 3N1AA 3W3OA 1IT0A 5D38A 3L21A 4HNOA 2ISDA 3PTKA 3UPWA 4RE3A 5ABTA 2CLIA 1PS9A 3HQPA 1CDGA 3APGA 5CSSA 5FJTA 3QH2A 1VCFA 1O5RA 4BEUA 4DO5A 3PG8A 3URQA 1ZJHA 1YNPA 3IRSA 2C1HA 1KGWA 2DQXA 1TE1A 2YBUA 2XIOA 3P5ZA 5HDRA 1FHUA 3UZYA 3BAKA 4C7FA 3ARSA 2P0IA 3G2GA 3UNDA 4TU1A 1ODUA 4WSHA 3QV8A 5HQLA 3EB3A 4U3AA 4JIHA 4MGGA 4NX0A 3OVGA 1W3TA 1UWUA 4NZCA 5BOEA 3LUTA 3K1DA 4BWLC 1OZQA 3UG5A 4LUSA 3NFUA 3UZXA 4J40A 5KINA 4Y9AA 3QMSA 5CC7A 3LPPA 1VEMA 3NL5A 3PZVA 9RUBA 5I3FA 1KNWA 4FO4A 4F0MA 3UPBA 3UWQA 2ON3A 2NT0A 3PZGA 2FFIA 2TYSA 1WXJA 4GYJA 3GNOA 4K38A 5D2VA 2X0HA 4A3QA 5FCZA 4WSJA 4YJ5A 2E5DA 5AC4A 1W1IE 2UBPC 5DRCA 2WKLA 1EBGA 3L67A 1FRBA 4A3RA 4Q8MA 1QO5A 1QW8A 3AC0A 2VO5A 1FP8A 4HPXA 1JGIA 5EYWA 4DNHA 1JAKA 5JMUA 2GQAA 3ZVIA 4ZQPA 1R30A 2QVNA 1XM3A 5EL1A 3KVKA 3CXOA 2GSEA 4HA1A 4ICMA 1Z41A 3GX9A 1OVDA 2VR5A 3HM7A 4PEEA 2Z28A 3OVPA 4RX0A 4E3TA 3O6AA 3DFQA 5FEXA 1V6XA 3JUGA 3VAVA 3CBWA 1GCYA 3D47A 2RDTA 3VI2A 3BLDA 3PNUA 2WKJA 1DIKA 1KLZA 1ITCA 4NRSA 3NUKA 3OZMA 1MSSA 3BMXA 3QSTA 3NEVA 4NJKA 3ARQA 1AD1A 2F6UA 4XV0A 3TTOA 3SQSA 4UCGA 2ZTKA 2HXTA 4LEQA 1E1CB 2JQXA 3H7VA 3MWAA 3T2QA 3ABXA 3U9IA 1IZKA 2XTKA 3MUIA 3ITCA 4HSOA 4IPPA 1K7XA 3CUXA 4UR9A 3E2SA 2OOGA 4HHHA 3W01A 1KB3A 1J12A 2Y5JA 1TV8A 2J7DA 1SJBA 1J79A 2WQPA 1JDEA 4PB3A 3D0CA 5DEZA 1I0BA 4HNTA 2Z26A 4Z0SA 3GTXA 1RV8A 1CB2A 4GVFA 3K8LA 4L80A 5I0DA 4GY0A 1QK2A 1U5VA 4PMUA 3S5YA 3TOPA 4FR6A 3C3UA 1CNVA 4DAIA 1W1ZA 1TTJA 3H4GA 3NZGA 4L64A 5CCZA 4ZXLA 4J27A 4HZMA 4QS6A 3E0VA 3IGXA 5DLCA 3G3MA 3IJQA 4AWUA 3S5SA 3UXIA 3WF4A 3MSRA 3EX2A 3OP2A 1O5KA 3E3HA 3GDTA 1GPFA 4AXNA 2GVGA 4JQ2A 1JDDA 3AU2A 4R85A 4AVFA 1V0MA 1UZ1A 1XLGA 1BYCA 3LMZA 1L2QA 1GOQA 5I3GA 4BR1A 3U3HA 4GBDA 3GC4A 2DUAA 5CC6A 2IW0A 1IHIA 3BE7A 4KGJA 1VEPA 4JTGA 1EPVA 1QXLA 4KEUA 1XCWA 4GQGA 1LDCA 1P6WA 3E2QA 1Q85A 2P50A 4ZOAA 2OSXA 1FHDA 4GH1A 1XR2A 1B30A 5HJLA 1MEWA 2YDSA 4XSMA 1DJGA 2VM8A 3W1QA 2W9MA 2H3DA 3BLKA 3RPTA 1QASA 4O53A 4DBSA 2GUUA 3VNZA 2WB5A 2WYSA 4I9JA 3PC0A 5HANA 1HKJA 4B5UA 3VC6A 1W1YA 2ZWZA 4A4AA 1EDQA 1F7BA 5HUPA 4LCSA 3THAA 2EPLX 1MRAA 4D8LA 2PBGA 1CTNA 2V2HA 3CHCA 4XZNX 4ZODA 3GKAA 3UJEA 2V9DA 3VU2A 5CGMA 4C6BA 1DL3A 5CGTA 2AL2B 4MKNA 4Y9PA 5U4NA 4FLOA 3GZAA 3P84A 1C9DA 1JPKA 4QR6A 3DIPA 4GXWA 4N7QA 1BVNP 5CZTA 2Z1VA 1GYLA 4OECA 2H3BA 1OCBA 3NQMA 3W1UA 5IBXC 1JIBA 5JH2A 4HOWA 5KTLA 3WD3A 1BTCA 3G6LA 3PBYA 3B05A 3W29A 2G4FA 2A6NA 2XIQA 2GK1A 1E6ZA 4LVBA 3N2OA 4JY9A 4FR1A 2HZGA 5JBEA 4B5SA 1US0A 4IFKA 5EPDA 1NFPA 1MW1A 2B4GA 3O2LA 4CQAA 4E8CA 4QITA 4BEQA 1OJXA 1J18A 1ONRA 1XIGA 1AH3A 2QNEA 4S39A 1WOAA 4DI9A 3PPCA 3I7SA 1N8IA 2XISA 4N0RA 1VS1A 3BW3A 3LLXA 1EJVC 3PULA 3UZWA 1HJQA 3A24A 5A6AA 1XYLA 2FHBA 3PNZA 3VKBA 1XQKA 2DZUA 4LFYA 3RILA 1MXSA 1S5NA 2E6YA 3GXNA 1JCXA 4BK9A 1R3WA 4S2BA 4FF7A 4TXEA 1L6YA 2CLOA 4K8EA 2VUNA 2YL5A 1XHGA 1PDZA 4ZQMA 4BZYA 1H61A 3WQ5A 2O9RA 3UWUA 2HRWA 1Z7AA 3PWGA 3ORWA 2BS9A 4BI5A 2OO0A 3C6CA 4XWUA 5FACA 4D6FA 1QK0A 4TV5A 2F7FA 1MW2A 1YMYA 4PCFA 4QP0A 3NSMA 5A6BA 3KL3A 3UT0A 1YDVA 1MQRA 2QCCA 4W85A 5A95A 1ZP4A 2PDKA 5I3KA 3NNTA 5A6BD 5C54A 4W8LA 4Y96A 4XO7A 4Q4SA 1U2YA 2BGQA 3CQKA 3AZRA 3IIPA 5AB3A 3GIQA 3RGTA 4IUOA 3TZFA 1W5OA 4JD4A 3FSUA 1UKQA 5HMEA 3MB9A 3W02A 4JYDA 1DJWA 1Z48A 4AXKA 4IGNA 2Q09A 4BI7A 1NJJA 1LRQA 3K8MA 5CJNA 5MKGA 2ZCGA 4M7TA 2FB2A 2NQ5A 4PB5A 1R3VA 6TAAA 3RUBL 1G9HA 1ZNNA 4DO6A 3KOFA 1PDYA 3WQWA 2P3ZA 1RK5A 2OX1A 2DDXA 1OX5A 3B8VA 1KTNA 4IL0A 3LYEA 2Z7KA 1XRTA 2FZDA 3LD5A 4UZSA 2GOUA 1GUVA 2VD8A 4M56A 4DJEA 2E7FA 2Y5EA 4NUWA 1XSIA 1H09A 4GLEA 3N2XA 1B54A 1EEPA 1VCVA 2W61A 5HNRA 1ADOA 4MYAA 2WWDA 3CL6A 2ISVA 3T81A 4S3GA 3SO7A 1DWFM 4DJED 5D09A 9XIAA 4PBGA 1XLBA 1A5LC 2PP0A 2VQUA 1G94A 4HSHA 4LGXA 2Z6JA 1BXBA 2PE4A 2BODX 1GVSA 1AQ0A 3TNBA 4HNCA 3EEGA 3S5ZA 3AROA 4FMVA 5FOOA 4OBRA 2A21A 3W00A 3VZZA 1QRQA 2VWSA 4I5UA 5LNUA 3A47A 2VKZG 3KZPA 3QR3A 4IPNB 1ZAJA 1GHSA 3E2RA 1EJXC 2OSWA 1HO1A 1EJ7L 3E0WA 4I9MA 1NQ6A 2ZXBA 1SUXA 4N9DA 4WY0B 1VIZA 4GXMA 4TIMA 4JX5A 5EMUA 4WXZA 2G50A 2VDHA 2ZRVA 3WLHA 2YSWA 4EWND 1M04A 4E6MA 5HWJA 2JALA 5HWNA 4DIAA 3GC2A 1DHPA 1XXXA 3FVDA 3S42A 5GNZA 5A8OA 1Q2SA 3TC7A 1UJPA 4BQ3A 3FHQA 1PWMA 1R2SA 3TQ0A 1U1HA 1BG9A 3E0FA 4MWAA 4AF0B 3R13A 4X2PA 5E0CA 1RCXB 4ZOCA 1JUEA 1HL8A 3T2OA 3PJWA 1P7TA 3W7OA 3LM7A 2V3EA 3CB8A 1AK5A 4MWAD 1SW7A 1M5WA 1F76A 2PLJA 2YW3A 2E8ZA 3E2VA 1XFCA 4JN7A 2FVLA 2ACSA 3WUGA 3GG1A 3MY9A 3T0CA 2C1IA 2BY1A 1TR9A 3LNMA 1MFVA 3NG3A 5A5WA 1J11A 2RGMA 2ZX8A 3M0MA 1EUNA 1IXOA 1EGVA 1M53A 4OE7A 2WBKA 3GFXA 2J6XA 3AS0A 2Y7FA 1W91A 4AEOA 5F4WA 3DXIA 3EX4A 2QCDB 3W6MA 3WK0A 4A8NA 1ZJAA 1CECA 5CBBA 3VCNA 1GTHA 4J28A 1SO6A 3QEZA 3EX3A 1OD0A 4G1KA 4C6CA 3WLJA 4AX7A 3GXFA 1W17A 4Y7EA 5HMFA 2ZC8A 1TIWA 3VD9A 1SZGA 1JCJA 1HJWA 3GVVA 1H62A 3FS2A 3MCMA 4K8GA 3F5LA 3VD4A 1WZKA 3N18A 1GOKA 4F9DA 1R46A 3S2CA 1V7YA 3MDWA 4PUJA 1E1FA 5A6KA 3EWWA 3IRDA 3PK7A 2QPSA 3W38A 4U28A 5C5YA 4UQ9A 2WZMA 1OINA 4ATWA 1O60A 3B06A 4BS0A 4HTBA 3V1HA 4Q8UA 5D2WA 4AMAA 1K9FA 3L2IA 3G1HA 3WK2A 4J2MA 4N9EA 3QPZA 3ZQ9A 1UH3A 4IHCA 2BASA 1B9BA 1TTPA 2REQB 1LUCB 1T40A 3L4YA 2I16A 2E6AA 3WD2A 5XINA 3W7EA 4AUBA 4HPJA 4C6OA 3VM5A 3KRUA 2J25A 2WJEA 4DHGA 1XH0A 1UP0A 2DIJA 4XO6A 1TPVA 4Y8FA 3H2CA 1HUVA 2E1DA 4HMDA 5L6UA 1AG1O 4K6AA 4F0KA 4RKAA 4F2UA 3GNNA 1US3A 2A7PA 2WNWA 3T0BA 1ZQ5A 1BSIA 3VABA 3WYZA 2B0MA 5CSYA 4IQJA 4NIRA 1SZRA 1E9IA 1GPWA 1PKLA 2YCLA 3BO9A 4B3LA 3WQDA 2FPVA 4S3CA 4DBDA 2CLLA 4YVVA 3CGTA 4JNMA 1PTAA 1F3EA 3QKEA 4IXHA 3EPOA 4FNPA 1ZBVA 4U4MA 3VYLA 1FOBA 1DJQA 4HMNA 2OT0A 2OEKA 1JUBA 4INFA 4LVGA 3VFLA 3RYSA 4U3CA 1AZ2A 3SB0A 5AYZA 1EDGA 4QXIA 3ZT7A 3QPEA 4UFMA 2VZUA 3KCLA 3H6OA 1TA3B 1CI1A 3AHZA 3W7KA 2CPUA 5BU9A 4ZBCA 3NO3A 4XVDA 4H7ZA 4LF1A 4AZGA 5HJYA 3WBEA 1Q8AA 1OQFA 4REQB 1E6RA 3VD3A 3AS2A 1FQ0A 4W9TA 4CUCA 3UG3A 5D37A 3SIMA 1ZB5A 4GD0A 4JIEA 1TZZA 3N29A 1W56A 3ATZA 1AW1A 1JZ7A 4O16A 2FVKA 4CEUC 1P0EA 3H53A 5I07A 2BGNE 1A0DA 3BURA 5EY5A 2OODA 1A4LA 2C79A 3C2YA 3SURA 5IHSA 4Q8TA 1DWIM 4O1BA 1F4AA 2X8RA 4PCSA 1TQJA 2XU2A 5LIWX 7ODCA 3WBWA 2AKMA 3P2VA 3KHJA 1FUYA 3WLIA 3WQ8A 1UPMB 4DEFA 3SFKA 2W0UA 5BMXA 4GI8A 1R3TA 5BOFA 3S6TA 3CNYA 1A49A 4J3XA 4ILSA 3CMJA 3EX1A 3MP3A 4UCFA 1ZY9A 4QJ4B 4IX0A 3IAPA 3GW0A 3PPHA 2YCIX 2ZA1A 2NUXA 4GY1A 4M6VA 3PG9A 3AMKA 3BMWA 1QI0A 5FI8A 4LVFA 5ENLA 2YOCA 2A5HA 4PTWA 3WNKA 2B81A 4F79A 1W9UA 3NQ2A 5I77A 3ZWSA 3PBMA 4FNRA 3CHFA 2PGWA 2UY2A 5TD4A 5H91A 4IGSA 4L61A 4MJZA 1OFEA 2CXEA 3IUDA 3RCNA 4NAFB 2WMKA 4Z17A 3PZQA 1OC6A 2AAAA 2HROA 1TWZA 5D9MA 1GOOA 3D3AA 4Q8WA 1LWIA 4OVXA 3FAXA 2J27A 2HS8A 3CUFA 1VLIA 4DM2A 2JBMA 4YWSA 1FWNA 2MANA 4IG2A 3AMCA 3OGRA 1Z8AA 4UZUA 2EEXA 5EMMA 2WHLA 5C9RA 1K02A 3MSYA 3PS7A 1SPQA 1UOKA 3N2TA 4ZFCA 3QHOA 2W63A 3L2LA 5D2TA 2BFGA 1TPB1 4BQ5A 1Z44A 3WEOA 5K9XA 1UWRA 3NXFA 2QUNA 3BJFA 2WJFA 4Q4MA 4MTVA 1KXQA 5G4EA 4WKFA 2VWTA 1W3LA 3M64A 3JZUA 2PCEA 2GGHA 3I7RA 2G96A 3CZGA 3WMLA 4DYJA 3AYRA 1KM3A 3QW3A 2Y70A 3CL7A 1ZU8A 4GIEA 4P7RA 5KZMA 4CVWA 1FXQA 4POCA 4JQAA 4DBEA 1JF6A 2QZRA 3HTWA 1NWUA 3F2DA 3URNA 4MM1A 2CLPA 3FEMA 1AD4A 1XIDA 2ZZ4A 1TZ9A 3UA4A 3I6RA 4YCOA 1WDQA 4QNEA 4MSSA 3SJNA 3KVMA 4C1LA 4NG3A 3HPXA 2DZAA 1IYXA 3CB3A 1QBBA 4J3VA 1H5YA 3LCFA 4DUXA 1ONWA 3G1SA 2WVTA 4GUFA 2D2GA 1VFHA 1NWRA 4DX3A 4JTAA 2VFDA 1A5BA 1P0DA 2FFCA 2A3CA 5BOOA 2DSUA 1PBGA 2Y8KA 4NNBA 3VO0A 2ACUA 4TVDA 4W84A 2EQDA 3R7MA 2IPGA 2ZBTA 4NU7A 1UUOA 1VFLA 2D1ZA 3GD6A 4MJMA 4NILA 4TTGA 1YXDA 4D71A 1C7SA 4XX6A 1RLDA 3UG4A 4E4PA 1ZCOA 2ZWYA 3CQIA 2QAFA 3MC5A 2RH9A 4US6A 3G77A 1P1XA 3Q94A 1MQQA 1RA0A 2WC3A 4LY8A 1BXNA 3HFYA 4G9PA 3O05A 3QJAA 1TJ2A 3PUOA 1XX1A 1TPEA 1DIOA 4K39A 2NXHA 4AZ6A 2FMNA 5T9CE 2VFGA 4TUFA 1KCKA 5BXTA 3AISA 2VEGA 1UR4A 2QS8A 1YYAA 1L8PA 4G5DA 3WNOA 4I8YA 1SSDA 3H7UA 3QMTA 4E8DA 1O95A 1EWDA 3EMCA 1Q3NA 2XVNA 3VDAA 1W5PA 3SCTA 2PTZA 4QE4A 1BWVA 2WW5A 1AL8A 3SQMA 5A3HA 1UR1A 5D04C 2OO6A 3K4DA 4MF4A 3UFYA 3PBVA 1W3JA 2PPGA 1LWHA 2GZXA 1XH1A 1TQXA 1LJYA 4Z2KA 1JPDX 4JICA 3GTNA 2C8NA 3KWSA 5A94A 1NDYA 4ZQNA 8CGTA 5LA1A 1ZS2A 2G3JA 2HMCA 4QNWA 1F05A 1TJPA 1HVQA 2WJZA 3DESA 3WLQA 1Y7VA 3S1UA 3VUPA 1R3QA 1KFCA 1L8NA 2DT2A 1EYEA 1SFLA 4LUTA 3E0IA 3MUZ1 1XPGA 5C9WA 1TWSA 2OTDA 3SY5A 4OKDA 1H7XA 4B15A 4ZENA 1IXPA 2PWFA 4PN2A 4EE9A 4RNHA 2PDWA 4PUKA 3VIIA 3QC0A 3CH0A 4UTTA 4U5IA 6TIMA 5HQMA 4YTTA 3DYOA 2J7CA 4YTSA 1JNDA 3S4TA 4MAZA 1KQYA 2C1GA 4WJ8A 2R1LA 4GO9A 4H9VA 2FPYA 4MOZA 3LHYA 3DFHA 2GUBA 1CPUA 1UA3A 2YW4A 2XSBA 1V0LA 2VL4A 1PAMA 1EPXA 2PF8A 2ZRYA 3QGVA 1YE6A 4M82A 4GFIA 3NIYA 3R2GA 1G7VA 4ML9A 5HR7A 3WL1A 3ZR5A 1H0IA 3BJSA 4PB4A 5ABEA 1WOBA 3MP5A 3I6TA 2DFAA 4PFMA 2EGZA 4CQBA 3NGFA 1EC7A 1SZEA 1Z3NA 2IPWA 2YCJA 3CIVA 1LG2A 4ZMGA 2H8ZA 1UQYA 5D9NA 4UNKA 1EWEA 1EGZA 4UTIA 1E40A 2WNQA 4M6QA 3RNDA 4PTVA 1HKVA 1DEDA 2EPHA 1H63A 2OKTA 4NZ3A 2AGKA 3RO6A 1S5TA 4GNKB 3G18A 1X97A 4XKMA 5AYYA 1OFOA 2B7NA 1B1YA 3KWXA 1JYNA 3PR2A 3M46A 4JY8A 3NZPA 3DKLA 2D2JA 1ZL1A 2PA6A 3WQEA 3GDKA 2ABBA 4B9YA 4L1GA 1FDJA 4WK9A 2VMFA 3REQA 3QV9A 3NVTA 1AQMA 3L66A 4YHEA 2CZFA 1AJZA 1LLZA 3C2RA 1I9CB 1VLWA 3BAWA 1B3WA 1NELA 2V68A 2CWXA 1TG7A 3MSDA 1HT6A 5GJNA 3CAQA 1B2YA 5FAGA 2V2DA 4ACZB 7CGTA 1KRAC 1KBLA 2GPTA 4FK9A 3NGJA 3CUZA 3LM3A 1OYBA 1QO2A 4QROA 2BB0A 1XDLA 3POCA 4US5D 3VZYA 3WLRA 4GI4A 1R8LA 1GG1A 5E6ZA 4UFJA 2J88A 4IGHA 2CZ5A 3EKLA 3A12A 3BAJA 3W76A 3IPWA 4R27A 3KVJA 2SFPA 1RR2A 3ERPA 4JTKA 1M3UA 3MUCA 1QU4A 3WMBA 4GVIA 3LV6A 1Y0EA 3S1VA 2ZXQA 3HG4A 3C86A 2PDJA 5AC6A 2IXVA 4GQBA 1V02E 3N34A 3TYCA 4XBSA 3BSMA 4HT3A 3SECA 3AUOA 4QAWA 5I3HA 4MJ4A 3Q58A 2PDFA 5HUOA 1W3HA 2J6VA 3TH6A 2AMXA 4QE5A 1W1A1 2DV0A 1E3ZA 1D3GA 1E0TA 3I3BA 2P76A 5GNXA 4RV3A 1P6CA 1TVLA 4XSLA 3WH8A 4RE2A 4G6CA 3LPOA 3H2OA 5DO8A 1PPIA 3NQAA 1CGVA 5FF4A 1Q4NX 4PTXA 3KUMA 1OFPA 3ZT5A 1VQTA 1S5VA 1GVRA 4GK8A 2Z25A 3EDKA 4MY8A 1MEHA 1HL2A 4RV8A 3ZVHB 2NVAA 1BQCA 1H1YA 1PX8A 1Q6GA 1CLKA 2OQLA 4UOZA 1VJSA 3H2FA 2XN0A 1TPDA 4JDBA 2HVOA 2XM2A 1AW5A 2RKXA 2VEMA 1UWAA 2QJHA 3DI1A 2YKKA 4CN1A 4AVOA 5CPLA 4RDYA 5BZAA 1L9WA 4DBWA 4KWSA 2CBJA 4GGHA 2BNJA 3QFEA 3GB6A 1FKWA 1RSCA 1TWIA 1P6BA 4EVZA 3ZLGA 1VFSA 3W2MA 4GA8A 3GU2A 4LS2A 3CUIA 3DFNA 4X60A 4RR4A 3CASA 1SJDA 1XBVA 1XPYA 5BNKA 1KC7A 3IGUA 2O9TA 1H7PA 4MZYA 3ZJ6A 3T09A 3DN5A 2Y89A 4GWEA 3ENLA 4AYGA 3KL0A 1TV4A 1F3TA 3CLWA 1WV2A 4MPKA 3VUSA 4A6GA 4F3HA 1EEXA 3QR1A 1HJVA 4A29A 4J4KA 2BY3A 4MWAB 2PZNA 1RY0A 3ICJA 3RHGA 1W9BM 2OZTA 2PUZA 1Q6OA 3G0UA 1CLVA 4DUVA 5I09A 1EOKA 1MMFA 4CQCA 1SW3A 4D9PA 5RUBA 2QCLA 3W23A 2ANUA 1UMLA 1EP2A 4GE8A 1EB3A 5FA5A 1UASA 3GBDA 1JDAA 1ICQA 2FZ9A 3AWNA 2V38A 2HE8A 3B9DA 4P7QA 4W5UA 4MDOA 4M6PA 3O3RA 4NZJA 3ZOAA 2RUSA 1PEZA 2J77A 1KXTA 3F4CA 5AYIA 4ADTA 4DELA 3O15A 2BGSA 4DM1A 5CSRA 4RXGA 4O15A 2GJNA 4PFHA 4GZIA 4ZE5A 1UOZA 1NFGA 3P67A 4QGCA 2Z4GA 3QQWA 1DXIA 2OZ8A 3CH9A 3BJTA 3NQ8A 2EAWA 3UXAA 3SW6A 3N73A 3M07A 3UY8A 3PWIA 3B03A 2D22A 3U57A 2IKGA 1HQTA 3BCFA 1SO4A 1IIHA 3EMQA 1Z69A 5REQB 1GG0A 3FCPA 4HOZA 3WF3A 1IWPA 5AC5A 4GO8A 4UFLA 3U4FA 2Q6ZA 4PEKA 4X63A 4B4HA 4PUMA 3WBYA 5LIXX 1K03A 2X7WA 1UWIA 4AZHA 3KBNA 3U2ZA 5BRQA 1GVIA 1XKJA 4IMCA 3BZGA 3CYJA 1OG0A 3QF0A 4KRZA 2Z1WA 3H70A 3JS3A 5CJMA 4FNSA 2YJQA 2RAGA 1OIFA 3NO5A 2JKAA 1UQZA 4HVXA 1J5SA 2ZICA 4LWWA 1XDJA 5BRBA 4C6EA 4PRTA 4WJXA 4OT7A 3QLLA 1JUKA 4GUHA 2YGYA 2V3FA 1V08A 1GZGA 2WMJA 3HV8A 4V15A 3AOFA 3T0AA 1W5NA 3T9PA 3HPSA 4Y9NA 3E6EA 4ZVJA 4Q8NA 4JHOA 3OQEA 3O63A 1BRLA 2P10A 4G2DA