3N12A

Crystal stricture of chitinase in complex with zinc atoms from bacillus cereus nctu2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
NNLGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLESGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHYNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDGLSLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase A
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 113
structure length 332
sequence length 332
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n12A00
3BAWA 1E9LA 1NM9A 1UWIA 3L4YA 6TAAA 4OZOA 5IDIA 1BVNP 2CYGA 3QHOA 2J7FA 3PHAA 3RJXA 1XCXA 4AZ7A 3AI0A 3AIBA 3MO4A 4AEFA 1WP6A 4PMZA 2XPKA 1V6WA 3CH9A 1BYBA 3I3DA 1E5NA 3UG5A 1H2JA 2WXDM 2PB1A 1IV8A 3AMCA 4UOZA 4IUGA 4C7DA 4OBSA 2Y8KA 1KXTA 3N15A 4AWEA 4GO8A 4M56A 2G41A 4M24A 1JL8A 1GOQA 3PZMA 3WDPP 2VZTA 2OWCA 3NDZA 2CESA 3OGRA 4NRRA 4PCTA 1LJYA 3LPFA 2CETA 2VRJA 4U3CA 2WMKA 1AVAA 2CKRA 4JFUA 3AS2A 3WEMA 3RIKA 4WJXA 2W67A 1UR1A 3AICA 2WMFA 1WCGA 1W32A 1C7SA 1FP8A 3AIQA 1E0XA 1LL6A 2DPEA 1VEMA 3O2LA 1E1EA 1VENA 3WH7A 1TVPA 1CGWA 3VMPA 4ZXLA 1K9EA 3HMCA 1E0WA 3WF3A 2EXOA 4J3VA 3VNYA 4W93A 3WH6A 2WLZA 3KL0A 1LWJA 1E4IA 3GZAA 2AOSA 2B31A 1V02A 3ZM8A 4DM1A 3CZKA 4HZ7A 2WCGA 1KXQA 1QNPA 2QHAA 4AXNA 4GKLA 1EDTA 1CIUA 5LA1A 3SCPA 1W1YA 2EJ1A 3EMCA 1OCQA 2XWDA 3BCFA 4P8VA 3M7SA 4LYQA 1HVQA 5AYIA 1UWTA 3WQWA 4B3KA 2DH3A 3UR8A 2EPOA 2BHYA 5IHRA 1ZBVA 2WVTA 1CGXA 2EPKX 3AIUA 1CBGA 2W5FA 1AMYA 3BXWA 3WD0A 1W2PA 2O9OA 4ACZB 1F4HA 4GQRA 4CN1A 3ZT5A 5FL0A 3VIMA 5F7UA 2D20A 1E6QM 5E0FA 2YDRA 3SCSA 1E71M 2UY3A 1CZ1A 3WD3A 2V38A 2WBKA 1QBBA 4M82A 3MMDA 1W3LA 9CGTA 1IZJA 1VFFA 4AD4A 1MW2A 3WNPA 3N18A 1HKMA 4Z2HA 1Q6DA 3AQUA 1ZJBA 2J8GA 3GNOA 3AXIA 4J3XA 1ISVA 1D2KA 3AHZA 2YLLA 5FIPA 1RPKA 1E3XA 2BY3A 1S46A 3A4WA 3PZIA 4LXFA 2JALA 1H49A 1K9TA 4Z2LA 3VO0A 1JAEA 1VEOA 3A6OA 3MMUA 1J18A 4AIOA 1E55A 1JZ4A 2XGIA 5BWFA 1UKTA 4CVWA 4J27A 3EMZA 2WCAA 2FHFA 1HL9A 3ALFA 1Q6EA 1WDPA 1W9VA 3BLPX 5M03A 1UR0A 2VR4A 4JZ5A 3WF0A 1MW1A 5D9NA 1CGVA 2IXVA 4QP0A 4R27A 4NRSA 2G3IA 2FDMA 3WQ4A 4U2ZA 5EB8A 1KXHA 1WNOA 2Z1KA 3BSHA 1GQKA 4PTMA 3WIJA 3NYDA 2CKSA 1BFNA 1NWUA 2GK1A 1QNOA 1FH8A 5HNNA 3SCNA 1DWAM 2WVVA 4F66A 1EHNA 1OGSA 4OUEA 1VF8A 3CHEA 3HN3A 1QVBA 2X0HA 4D6JA 1R85A 1NARA 3ECQA 3M46A 5I78A 3ARPA 3WF4A 5KEZA 1UG6A 3D3AA 2D0FA 1TZ7A 5IHSA 1VFMA 2Y24A 1CECA 5D9PA 5A8QA 1KWGA 2WW5A 5GPRA 1FH7A 1AQMA 4AZCB 2WCSA 2YA1A 3W0KA 2UY4A 4WLCA 3DHUA 4BQ3A 4J3UA 3NSMA 1V3LA 3WUBA 1ISWA 2A3EA 2BS9A 3EMQA 2D0GA 1E4LA 4J3TA 1FFQA 1PX8A 4MDOA 5HBFA 3GH7A 1V0MA 4AIEA 4W89A 1J12A 4QCEA 3PZNA 1B31A 2DGAA 3F4VA 3WUEA 2F2HA 4UQCA 3MANA 4U3AA 2VX4A 1EQCA 2VVSA 2VX5A 4GZEA 2FGLA 5A2AA 4PTXA 3NJ3A 3OGVA 3L4XA 1VJZA 4YHEA 1BLIA 4UNIA 1E72M 4BCEA 2DSWA 1XC6A 4DWSD 4HOZA 5CJ5A 2WMHA 4UQAA 4DWSC 5FOOA 2C8NA 3W37A 1F4AA 1JZ3A 2WZIA 3AIEA 4C7FA 5AC5A 1MW3A 4IPNB 5A94A 2AMGA 3PZGA 1DWGM 1JI1A 3WNMA 1VJSA 4D6EA 1I75A 2XYLA 3ARQA 4MB4A 1BVZA 2OWXA 4J28A 3PZVA 5M3WA 1C3FA 1UD5A 1UD6A 1NP2A 3FNDA 1X6LA 2Q8XA 3VIHA 3SCRA 3OZOA 1JFXA 4EE9A 4TTUA 2VMFA 3VM7A 4TX8A 5CSYA 2VCCA 5CXPA 1GQJA 3TA9A 1WO2A 4F79A 1EHAA 1B3WA 3L2LA 1V3IA 3PZOA 2CBUA 1HXJA 3ARUA 2VNCA 2D3LA 1JXKA 4MTVA 3LMYA 1KCKA 1DWIM 1KQYA 2XFRA 5EBAA 2J7BA 3U7BA 4XZBA 1JF6A 4GO9A 3GBEA 4NZCA 3SEPA 3WH5A 4KRUA 2W63A 2V3FA 2CPUA 2WAGA 2WMIB 5DFAA 2WKLA 2EBNA 2F8QA 4D6FA 1CGTA 1CXKA 1M01A 1QNQA 2WZHA 4MPKA 1SMDA 2OLHA 3PN8A 3T0AA 1Q4NX 1HJWA 3ALGA 1DTUA 3UG3A 2ZUNA 3VD9A 3D5HA 2VZOA 1JZ6A 4PYSA 3QOKA 3NSXA 3L4WA 4H8UA 3K46A 3MSGA 1H4PA 1EXPA 5A6LA 2ZUTA 3AHYA 1CPUA 1Q6CA 2Y2WA 4B16A 2BXZA 1MFUA 1HL8A 5I2UA 1V0LA 2NT1A 1L0PA 3VD4A 3VGHA 1PEZA 1NWRA 1GOIA 2FHCA 1QW8A 3N11A 4EANA 1HKJA 3K1DA 4W5UA 1HX0A 2G3JA 1JDDA 4D6HA 2BHZA 5DT7A 1BGAA 1BG9A 4F8XA 1E6RA 1TE1A 2VZUA 1E56A 1QHZA 4WSKA 1OGGA 2J78A 3FY1A 2A3CA 3T2QA 2XG9A 4JL1A 3U5UA 4N42A 3CUIA 1PX3A 1DP0A 1SR0A 4PRWA 3QGVA 2UY5A 1ECEA 2WHJA 6A3HA 3ARWA 3BCDA 4QLLA 1B0IA 1K9FA 1UUQA 1UYQA 3RO8A 1X6NA 3FXYA 4CN4A 4MNJA 1TA3A 5I6SA 4PTVA 3ARZA 4JFWA 3PZ9A 3WKZA 4HMDA 3T2PA 1ZS2A 1ZBCA 2WM0A 1NH6A 2J7CA 2E9MA 3VUPA 1OD0A 4AMCA 1H1NA 3O6AA 4Q7NA 1E15A 4X0VA 4AZHA 3OZPA 2CITA 2BNJA 5CPSA 3SUTA 3CBWA 1AQHA 4AZGA 3ZJ7A 1AQ0A 1JIBA 5E09A 4ACYA 2VQTA 2VVNA 3IK2A 4P7QA 1JYVA 2FHBA 2VRQA 3W25A 3RCNA 5JBEA 2BVDA 3ZIZA 2C7FA 2VX6A 5A8OA 4JFTA 3GDBA 4JHZA 4H8HA 1FHLA 2YL6A 5AY7A 3UEQA 1FFRA 3IJ7A 1C93A 1IT0A 4MAVA 2XFYA 3PTQA 3WQ6A 5JBDA 1W9DM 1J0JA 2GJPA 2PWDA 3AIVA 4E8CA 3BAYA 3VDCA 1TVNA 4PMRA 1GOOA 2A3AA 3VMOA 3RM4A 3GNPA 2CBVA 2D23A 2YOCA 3SURA 1OD8A 1GHSA 1JFHA 1WZAA 4NF7A 2VC9A 1E5JA 4PMQA 4UFKA 5ABFA 3CUFA 2GJXA 2XSBA 4W8AA 4UQBA 2VTFA 7CGTA 3AFBA 1UA7A 4GQQA 2NT0A 2VL4A 3M07A 3IAQA 5CG0A 2OYLA 1ODZA 3WUFA 6CGTA 3BMWA 1DWFM 1EDGA 1J10A 4MNLA 3TTYA 5A6BD 4KWUA 4RE3A 3VDBA 4QFUA 1B30A 1DWHM 1GZJA 2DSVA 3K8MA 4A4AA 4P8XA 2ZWYA 1WZKA 1QI4A 1LL4A 4Z2IA 3T0BA 3AMDA 5C71A 1CENA 5BXRA 1GCYA 4KGJA 3WNLA 3AHVA 5A8PA 4PUDA 3RMEA 3WMCA 4QLKA 1EOKA 4HTYA 4PCSA 3FHAA 3HJEA 3N13A 4BQ5A 3WDQA 1UH4A 3W82A 1MXDA 3EDKA 5E6YA 3L4VA 3VTRA 1NWSA 1BYAA 1JYXA 1OWQA 3GM8A 3E1F1 4W7WA 1MFVA 4FLQA 3VIIA 4HPGA 1CDGA 1NP0A 4X9YA 1QHPA 1WZLA 4TTGA 2XVLA 2X2YA 1W3HA 4MADA 2ZUUA 1V08A 3SUWA 5M17A 2DIEA 1JDCA 1ISXA 5I24A 4TOQA 5ABGA 2G8ZA 3CZJA 3G6LA 4AEEA 2E9LA 2J4GA 5GNYA 3CUJA 3T0DA 3L4ZA 3WF2A 1E4NA 4JKLA 1E6XM 3AOFA 2ZXQA 3AISA 1R86A 4AD5A 4P7OA 3ARYA 2CBJA 4H2CA 4XX6A 3W4RA 4ZFMA 2WC3A 4PMUA 2CNCA 2QV4A 1R7OA 3WSUA 4RE4A 4WSJA 1B3YA 4BS0A 4W86A 3MUY1 1HKKA 1VFOA 5KZ6A 4HZ6A 1OINA 4HMEA 4U5IA 4GI9A 1RP9A 4ATDA 3AS1A 3F5LA 5A6MA 1IZKA 4ML4A 3WQ5A 2X8RA 2BVYA 3OLDA 4J7RA 1UZ1A 1MXGA 1FHDA 5BXSA 4OBRA 3VIKA 3DECA 1EH9A 3OGSA 4A3YA 2XFFA 1A47A 1CYGA 2ZXDA 2CERA 1GJUA 4AZBA 1UR2A 4BF7A 1BAGA 3SCUA 1GNXA 3BAXA 5D9MA 1ZB5A 1J0KA 1XRVA 1YHTA 1CTNA 1JDAA 2GJRA 1GUVA 2GVYA 3EDDA 4D6CA 3KZSA 3AMGA 3UG4A 4Q22A 2DSUA 1FP9A 4PMDA 3B9DA 2Y5EA 1OB0A 3B9EA 4AD2A 1BTCA 1YQ2A 2YLAA 1E0VA 2V5DA 2W62A 4U33A 4W88A 5HPOA 1EDQA 4P7NA 1JZ7A 3VKKA 2WHKA 1UH3A 4CCCA 5IFTA 5HOSA 4ZXOA 1V6YA 4AZ5A 5LA0A 5D4YA 2PBOA 2CXGA 1E6SM 1V3KA 3WQ8A 4B9YA 4LPCA 3CMGA 3W27A 4D6DA 3SUVA 1JF5A 3GBDA 2JIWA 5FKYA 4DWSB 4KH2A 3T09A 3FAWA 4DUVA 2X09A 1ZJAA 1VEPA 1V6XA 1B90A 4H7VA 4Z2GA 4HOWA 1C91A 3ZO9A 3DYPA 2J47A 1SFSA 3MMWA 3AXXA 2ZXBA 1OT1A 4D71A 1WDSA 2QMKA 1RH9A 1C8YA 1EO7A 2BFGA 5HPCA 1CXEA 2DT1A 2E40A 1WZMA 2GDUA 4JHOA 5BCAA 3OBAA 3VIOA 4R5EA 3W6LA 3VGBA 2CBIA 4AD1A 3UERA 1UWSA 3SUSA 1QI2A 3VPLA 1V03A 1E6ZA 2IXUA 3W38A 1CGUA 2JEPA 1M03A 5D8ZA 2XTKA 2XIIA 4GIAA 4Z2KA 1ESWA 1V6VA 4HOXA 1PZ3A 1CLVA 4TVUA 2RGLA 4PEEA 4UZUA 5CSUA 5A95A 1HJSA 4D6IA 1W9UA 4ACZA 3IJ9A 1JYWA 1WPCA 2DT3A 1UZ4A 4MDPA 4UTFA 2XVKA 1HJVA 3N9KA 1J0YA 2JIEA 4CVUA 2E8ZA 1XH0A 1DEDA 1JI2A 1EGZA 1KB3A 3ARVA 1G94A 2QF8A 2QPSA 4F9JA 4H41A 1PBGA 3IANA 1GOWA 2EQDA 5ABEA 2DEPA 5E9AA 3AHXA 2DSKA 2J74A 2ZUWA 1W91A 3ZQ9A 3SCVA 1QI3A 4FF5A 5CPTA 4W7UA 4DM2A 5I77A 1UH2A 1WB0A 3POCA 1WDRA 3AHTA 1X1NA 3NIYA 1QHOA 4JAWA 5EFDA 1US2A 1G5AA 3ARXA 1W9XA 4AYSA 5I3DA 8CGTA 1XD1A 5A1AA 3MUAA 2A3BA 1WE5A 1C8QA 3A4XA 4W87A 3FHQA 2O9PA 4UOJA 2ZX8A 4U2YA 1BHGA 8A3HA 1GVYA 1XH2A 2D0HA 4D72A 4J3SA 4Y7EA 1H5VA 4MAZA 4E8DA 4NI3A 1U30A 1XD0A 3CHFA 3T08A 2D1ZA 2YDSA 4HU0A 3ZJKA 3AZSA 1R87A 1KQZA 2WMGA 1J0IA 4KGLA 2VZVA 5GQBA 4HMCA 4GXPA 4DUXA 2FGZA 2J7EA 3ZR5A 4OKDA 3CIVA 2WSKA 3WELA 1MQPA 3N04A 1OSEA 3WNKA 5LA2A 2WYSA 3AMLA 4OIFA 2Y8VA 5EFFA 3WNNA 4OOUA 4M1RA 3CZGA 3VD3A 1PAMA 4FLRA 2EO7A 1KXVA 3AYSA 2XM2A 5FL1A 3MS8A 1RP8A 4AZCA 3UESA 3DC0A 3VM5A 2D3NA 1BSIA 2BY2A 5TD4A 4P8UA 4A3HA 1J11A 2VZSA 1PIFA 1W3KA 4TVDA 3U57A 1VBRA 2PBGA 4UFJA 1B9ZA 3RPMA 5D8WA 1KR0A 3ZR6A 3W6MA 3CPUA 1JZ5A 2ZX9A 1MW0A 1A3HA 1GPFA 2VURA 2HISA 3PTMA 4URIA 3TTOA 3AROA 1ZBWA 1RD6A 3APGA 2V3DA 2XUCA 4H04A 3K8LA 3RM8A 3EBVA 1C92A 1UKOA 3MUIA 1W1TA 2CEQA 3B9AA 2BHUA 1XCWA 5CZKA 1OBAA 2GUYA 2XHYA 4YPJA 3VILA 4PN2A 1H41A 3WH9A 1QW9A 4L4OA 5E0CA 2G4FA 4LX4A 5A69A 2ZE0A 3VOCA 3ARRA 3VIJA 1QNRA 1ISZA 1J9YA 1US3A 2BV9A 3CLWA 5IFPA 3VDHA 4GPNA 1KGXA 3WN6A 3ZMRA 4M8UA 3SCTA 4M29A 4W85A 2D24A 1UHVA 2J25A 1L8NA 3W24A 4BZYA 3OIHA 3OLGA 3ZSTA 2WLYA 4K68A 2J62A 3BMVA 2YBUA 2XVGA 3VVGA 4UQEA 2QLYA 4AC1X 2E0PA 1TG7A 1ISYA 1E73M 4LQ1A 3POHA 1M53A 3A4AA 2YA2A 3OA5A 1W9BM 2YKKA 3BAKA 3AS0A 2CHNA 5M5DA 3CGTA 3W29A 5JIWA 1MYRA 1ZBKA 3KL3A 4P7LA 5A6AA 2QMJA 1I1WA 2C0HA 4JFVA 1C90A 4HA1A 3M6DA 1VRXA 1PPIA 2CCRA 3WFZA 2G3NA 2WHMA 1H0IA 7A3HA 3CMJA 3AIRA 4KMQA 2W92A 4QDMA 3CZEA 3TOPA 2QPUA 3WMSA 1H09A 3AS3A 4MJ2A 4AZ6A 1HJUA 1JAKA 1V0KA 2BXYA 2V5CA 4UOQA 1QNSA 3ARTA 1LQ0A 5IXEA 2PWGA 4HPHA 4MB5A 4W5ZA 2D22A 5GNXA 3DYOA 4M80A 1BYDA 1MQRA 3WDJA 4GZJA 1OGBA 3CUHA 3ARSA 4ATWA 2WMIA 3KL5A 3WD1A 3AMKA 5A6KA 1UR8A 2EPMX 3AJ7A 1LLOA 4XZWA 1BPLB 1B1YA 1TUXA 2YDQA 3VIPA 4GINA 1MQQA 4BA0A 4B3LA 3WFLA 3VNZA 3ZOAA 1HJXA 4Z2JA 3ZJ6A 4PSRA 4EAMA 1JYNA 1GW1A 3MV01 1BF2A 3RJYA 2PF0A 2WHLA 1TFVA 3L4UA 1UD2A 1E4MM 3GXIA 2XSAA 2ZUSA 4PUEA 3RILA 3L4TA 1XYZA 3N17A 1KBKA 2V3GA 1NQ6A 1VB9A 4WKFA 4UFIA 4UZSA 1UOKA 3L2MA 2VOTA 4E2OA 3QOMA 5HDRA 3WBEA 3VX1A 5CPQA 4LGXA 3WY1A 2JFEX 2GSJA 5A6SA 4ATLA 2ZX7A 3CO4A 3FAXA 1KBBA 1XSIA 1H11A 2YL5A 2VT0A 1C8XA 2PC8A 4PTWA 5DF0A 3S6TA 4TXEA 1HN1A 2GK1B 3W81A 1LF1A 3CTTA 2OSWA 2WVVB 3SCOA 1LG1A 1V6UA 4QCFA 1QI5A 2ZUMA 5EMYA 4AW7A 2ZXAA 4LYRA 1W2VA 3BLKA 1CNVA 4GZIA 2NW0A 1JGIA 2OYMA 3FW6A 1XSKA 1O7AA 1GVIA 4PMOA 3VIGA 5JIPA 2WVSA 1UD8A 5LYRA 3EYPA 3SIMA 5A6JA 1ITXA 2IUZA 2VUYA 2WBGA 5CLTA 1CGYA 1ZU8A 3AXHA 2JF6A 3ZT7A 4W8BA 3IJ8A 1G0CA 1Y7VA 4AY1A 4D1JA 3F5KA 1K9DA 4CCEA 3KE0A 2V3EA 4AISA 4CUCA 1B3ZA 4HA3A 1GQLA 5I5RA 4TVCA 4CD7A 4FMVA 2OYKA 5CQ1A 1CLXA 5BYWA 4FLSA 4HZ8A 1C7TA 3TTQA 3VD7A 2AAAA 1BQCA 5A6BA 3LPOA 3DHPA 4PMXA 3OLIA 1VBUA 2PWHA 3WD4A 1KR1A 3S2CA 3N12A 3WD2A 4JKMA 2VCAA 3U7VA 3BSGA 3ZJ8A 1VAHA 3U5YA 1R7AA 1MWOA 3W26A 1JZ8A 1WKYA 5CLWA 3NSNA 5CGTA 4NSBA 1FA2A 1MVYA 1XV8A 3PZQA 5A8NA 4WK9A 1UD4A 7TAAA 1JZ2A 2XVPA 4N0RA 1UWUA 1QOXA 2GDVA 3MV11 4EK7A 4L4PA 4MB3A 3A3HA 2VR5A 1PJ9A 1JD7A 3VU2A 3LPGA 3WNOA 2J75A 4AIUA 3KEHA 2X05A 5DT5A 1CXHA 1B2YA 1HNYA 2VRKA 3UCQA 1GQIA 3WUGA 5BRQA 2GFTA 2ESCA 3IAPA 4E4PA 3GNRA 1HIZA 3A47A 2O9TA 3VGGA 2ZIDA 2XIBA 2WZEA 5I0DA 2YBTA 2E3ZA 1N82A 2WMJA 1LG2A 1CEOA 1TMQA 3K8KA 1TR1A 1Q6FA 1K6AA 2ZX5A 3II1A 5A3HA 1BGGA 1KGWA 3CUGA 4PMVA 2J79A 2VX7A 1U33A 2PI6A 3GYCA 4HA4A 1HP5A 3QHNA 4WKHA 3WENA 4UFMA 5BROA 1V0NA 4U31A 3BC9A 2O9RA 4PSPA 4RE2A 1G1YA 2O92A 2DT0A 2WB5A 2YJQA 4JL2A 2XJ7A 3CZLA 1V3MA 2E4TA 2D2OA 3VX0A 3MKKA 4CD4A 1NWTA 1WAWA 4X0NA 3WDIA 1KWKA 3NDYA 1UKPA 3VGEA 4BQ2A 2XGBA 1PX4A 1GOMA 4UFHA 2WWDA 3J7HA 1JXJA 3SUUA 4ZE5A 4IISA 4WIWA 1LL7A 2RGMA 3F5JA 3EDJA 2FH8A 5DMYA 2DH2A 2JE8A 4WF7A 3EDFA 3GH4A 1XYFA 3AYRA 3GXMA 2XVNA 5HXMA 2VI0A 1CXIA 2JEQA 3RM9A 1EIBA 1FOBA 1J0ZA 3CHDA 5I23A 2DDXA 2Y4SA 2DIJA 4JKKA 3K4DA 3VD5A 2E8YA 4JFSA 4XUYA 1XHGA 3BAJA 5E70A 1QPKA 3ZSSA 1HT6A 2VJXA 4OOZA 2J77A 1CXLA 5FD0A 3B8SA 4W7VA 2E9BA 3LPPA 3THDA 4P7RA 3PTKA 4JCMA 4CU6A 2DT2A 2PWFA 3QHMA 4XB3A 1HKIA 2WC4A 5I79A 3K4AA 1JNDA 1UR4A 1GHRA 2WC7A 3RDKA 1OIMA 4IM4A 4CU7A 4CCDA 1E43A 2OWWA 3NCOA 1XSJA 4ZE4A 3VGDA 5BXPA 1GONA 4JIEA 3UR7A 4B9ZA 1TA3B 2JF7A 5C8BB 1M7XA 4HP5A 1NOWA 1J01A 2J7HA 3AZRA 1P6WA 1R8LA 2VQUA 2J7GA 1HVXA 1EO5A 4D1IA 2BY1A 3DYMA 1W3JA 2MANA 4V28A 2F61A 4P8WA 2ZICA 4W8LA 1D3CA 1O6IA 1J0HA 4QLJA 1OIFA 4RL3A 4CN6A 3WMBA 4BQ4A 2ZX6A 4QAWA 4IPLA 4PMNA 2DSZA 3WH8A 1W1PA 1JNEA 1UKSA 2X0YA 2OSYA 1E40A 3G6MA 4CD8A 3BH4A 1UQZA 2EPLX 2W66A 4KRTA 1VIWA 2BVTA 4CD5A 3N1AA 2W61A 2G3MA 2J7DA 3AZTA 2CHOA 4FLOA 4MJ4A 4F9DA 2WNWA 2FH6A 3SCWA 3VGFA 1E6NA 5BXTA 1E1FA 2ZUVA 1LWHA 1B3VA 1EA9C 1SMAA 4CKQA 5C70A 4M81A 1Z32X 4DWSA 3WDHA 4C7GA 2UY2A 4AD0A 2EEXA 3OLEA 1HJQA 2HVMA 2Z1SA 4GI6A 2XWEA 1V3JA 4YN5A 3MU7A 1CXFA 4DUWA 3VDAA 5AC4A 3WF1A 1SYTA 1PZ2A 3WEOA 5DO8A 1E3ZA 5BRPA 3KWXA 3SCQA 1Q6GA 2WANA 2W4XA 4YHGA 1V02E 4PBGA 3O9NA 5ABFB 3THCA 2GJXB 1G9HA 2ZOXA 4GI8A 1JD9A 3T2OA 4JCLA 4HU8A 1QI0A 1KGUA 2YL9A 1CWYA 2DQXA 3WBAA 1U2YA 3GH5A 1NOFA 1W9PA 2WK2A 3NUKA 1W1VA 5ECUA 5FCZA 3WDRA 1NOUA 1E6PA 4MNMA 1BYCA 4U5KA 4UFLA 2UWFA 1OT2A 3GTNA 1ZL1A 3CHCA 1HF6A 3W28A 4V2XA 1JG9A 4J3WA 3I3BA 1DHKA 1UD3A 4V27A 4UQDA 5ABHA 4OJYA 2YA0A 1XH1A 4XV0A 1UA3A 4ZENA 3WEZA 3BGAA 5JBFA 1EQPA 4S3JA 4PMYA 1GOKA 4UCFA 2WVUA 5DEZA 3WQVA 1UQYA 3TP4A 4ZEPA 1H3GA 4EKJA 4D6GA 2W91A 4AD3A 1UR9A 2A3HA 3VMNA 1EOMA 3OB8A 1E70M 1I1XA 1KFWA 5JUVA 4CGTA 2VCBA 2WSPA 4W84A 2WPGA 3BAIA 3VINA 2WKGA 3WL1A 1M04A 5D9OA 4MB1A 3UETA 5GNZA 2PWEA 3FN9A 2TAAA 1DWJM 3AIWA 4UR9A 4CD6A 2EPNA 1FH9A 4FK9A 1UWRA 1GORA 2OSXA 2NSXA 2WWCA 1ITCA 1V3HA 3I3EA 1GJWA 1VFUA 3ZT6A 2X1IA 3QR3A 3MSDA 4AZIA 1TCMA 4UQ9A 3WL0A 4LYPA 5AYBA 2ZWZA 4H8VA 4TUFA 3TTSA 4CU8A 4TX6A 1WDQA 3GXFA 1BG4A 4MNKA 3CZ8A 1PIGA 2J8FA 3TONA 3VIFA 1B3XA 1OM0A 2YIHA 3PBGA 3MUZ1 5A8MA 3PZTA 1G01A 1QBAA 1UWQA 1ODUA 1XGZA 2XM1A 1D7FA 2BY0A 1HP4A 4WKAA 3JUGA 3GXDA 5CGMA 1H0GA 2VO5A 3EDEA 3HU7A 1UKQA 3PZUA 2CIPA 5E6ZA 5A2BA 4S3KA 1KCLA 3OG2A 3W53A 4B15A 5A2CA 2YL8A
chains in the Genus database with same CATH superfamily
3BK0A 4NU7A 1NM9A 3L4YA 4XZHA 6TAAA 2ZQ0A 3T0CA 1BVNP 2J7FA 4YIWA 3RJXA 4PUUA 3IARA 5C9RA 3EWYA 3NQAA 4G1KA 1KM4A 1S3HA 3E38A 1V7AA 4L7ZA 1R3SA 3V4BA 4JTKA 2ZTKA 1IV8A 4UOZA 3MC5A 3H4WA 1VPXA 4OBSA 3SRDA 1XYMA 2Y8KA 4IMCA 1JQXA 4GO8A 1FWBC 4ML9A 2WJDA 2GSHA 1WXJA 4LANA 2G41A 1B3OA 3WDPP 4JTEA 3MYPA 1SZFA 3GY1A 4NRRA 3M0YA 1SJCA 5AOUA 4PCTA 4PRRA 3V0TA 3DFNA 1QAPA 3DHDA 3EEZA 4U3CA 2V5KA 4A22A 4AY7A 2CKRA 1YXCA 3C6CA 4IJCA 3HA1A 1S5VA 3AS2A 4GI4A 1Y5VA 4WJXA 2W67A 2WMFA 1TIMA 1W32A 1F6PA 2DPEA 2FZNA 4BKNA 3U8GA 1VENA 1F6KA 1CGWA 3HMCA 1E0WA 1X39A 2C1IA 2SFPA 4J3VA 4ZO8A 4DF2A 3F4WA 4XZNX 2PF8A 4CEUC 1NVMA 1E4IA 2CLIA 3GKFA 2QNEA 2B31A 2Y61A 3LRLA 4GUHA 1TJRA 3A22A 4Q8PA 3GVGA 3EAUA 4H9TA 4O10A 2EJ1A 1MMFA 2XWDA 1KFEA 1HVQA 3EPNA 2VFDA 5AYIA 3RYSA 2EPOA 2BHYA 1ZBVA 3PAOA 3R13A 1W8GA 4RW5A 3TQKA 1W1B1 3WD0A 1PS9A 3BXWA 4A8IA 2VC6A 2VENA 1EPXA 1EC9A 3CWNA 1PB0A 4Q4SA 5D2WA 3ZT5A 2E77A 1E6QM 5E0FA 1CZ1A 3STGA 4TMBA 1QBBA 5FF7A 1L6SA 2WZMA 3TA6A 2CU0A 1XBXA 1OK6A 3N18A 1HKMA 2VHLA 2AGTA 4OTKA 1ZJBA 4AUBA 4LVGA 3RX2A 1SUXA 3AHZA 4XUGA 3PBUA 1L2UA 3FYOA 1ME9A 1RPKA 2QDHA 2BY3A 1S46A 1IGSA 3TW7A 4BEUA 4LXFA 2VOMA 5BW6A 3H22A 1H49A 1P6BA 4Z2LA 3VO0A 1JAEA 3A6OA 2QCCA 1O5XA 4RLIA 3CB8A 4FNPA 2WCAA 1XP3A 2FHFA 1JRCA 1XLBA 1UB3A 3GXTA 4MZ1A 4AIBA 1K77A 4R27A 9RUBA 3WQ4A 1Q45A 2FDMA 3L5LA 5FF4A 1AW2A 2Z1KA 3W84A 2RDXA 3K2GA 3BSHA 4R33A 2PDKA 2ZRXA 3QFEA 3NYDA 1NWUA 1F3XA 3SCNA 2POTA 1DWAM 2XFWA 1N8WA 1I0DA 1EHNA 3B04A 4IIEA 3CHEA 4D8AA 1YDVA 4XAZA 5I78A 4IPPA 1UG6A 5IHSA 5D9PA 4GJIA 3R0DA 1HGWA 2YPIA 3THQA 1TTQA 1XX1A 2HTMA 4NAEA 3L23A 3DU0A 3NSMA 3LBCA 3S6DA 3IIVA 3EMQA 5MKGB 1A0EA 2D0GA 2W0UA 4K8HA 4RCXA 5T9BG 4G7EB 3OZYA 3B8TA 2FTWA 1XLJA 1YPFA 1ZUAX 2DGAA 3DKJA 3N73A 4LT9A 4HNUA 2VX4A 2VVSA 4BWLA 1FDJA 2XINA 1Q8JA 4PULA 1FWEC 4IMEA 3KVJA 5TNVA 3P3BA 3SN0A 3NJ3A 1QOPA 4BEQA 4K38A 1BLIA 4UNIA 5FF0A 4GUIA 2PGWA 4XAGA 4H7ZA 4GXWA 4P61A 3GG8A 5EKYA 1MO0A 2E09A 3SQSA 1GVFA 1S2TA 2WNZA 4GYJA 2WZIA 4C7FA 3IK4A 5AC5A 5A94A 3PZGA 3QFWA 1DWGM 1RBLA 4R7JA 2ZRVA 4NZ5A 2KX9A 2OWXA 3N2BA 3KLLA 3BOLA 3V5CA 3TROA 4NNBA 3GVQA 1X6LA 1FWNA 1PHQA 2Q8XA 3H7RA 4EE9A 1G67A 4YNGA 3I7RA 4O53A 1WO2A 4F79A 3TN6A 1QPRA 1HXJA 3ARUA 2D3LA 1OX6A 2ZRUA 3LMYA 1ALDA 1DWIM 1XS2A 2YR1A 4ZQRA 3IJDA 5EBAA 4QX4A 2OXNA 4GYKA 2V3FA 2CPUA 2PPGA 2O7QA 3V3WA 4XAFA 2QJNA 4GVGA 2EBNA 4LOCA 1CGTA 2P1FA 1QNQA 1UOZA 2WZHA 1S1PA 3W7PA 4YS1A 1A5OC 2OLHA 1YRRA 3IACA 2FMNA 2GJLA 5DRCA 4GISA 2DUXA 2VZOA 4GYPA 1M1BA 1SZRA 1ZCOA 1GK8A 2JBMA 4H8UA 2WM1A 1EXPA 4I7UA 2ZUTA 4RKAA 1Q6CA 5C6MA 1MFUA 3GSMA 3MYOA 3VD4A 4GYFA 4YTRA 2FHCA 1QW8A 4WOZA 1FDZA 1HX0A 1FY6A 4GY0A 1JDDA 3OG3A 4RDZA 3TW9A 4D6HA 2P3ZA 1OFDA 4E38A 2NZLA 3JR2A 5CAKA 4L65A 4B4FA 1BG9A 4EAYA 5AVNA 5F1UA 1QHZA 3CYJA 4Y6GA 3O0KA 4REQB 2F84A 1FKXA 1DPMA 2A3CA 3T2QA 4LC6A 3BG5A 3PP7A 3U2ZA 1DP0A 1DJXA 1SR0A 1AJ2A 3QGVA 3UY7A 1FKWA 3CAKA 3P74A 2ZZ5A 3QQWA 1XLEA 4QLLA 4O1CA 1UUQA 3RO8A 3FXYA 3MSYA 4MNJA 2I5QA 3WO8A 3PVFA 4HMDA 3T2PA 5BZAA 4IX0A 1YE6A 3IS4A 3S46A 1RBOB 5AHNA 2E9MA 3VUPA 5EA9A 3MHFA 5D30A 4F0SA 1OD0A 2YFOA 3A5FA 1IGWA 2PTXA 5D03A 5C54A 3MKVA 4KWVA 3FA4A 4AZGA 1AQ0A 3GDKA 3G1VA 4AH7A 3N2CA 1JIBA 3IK2A 4P7QA 3STEA 2ACRA 4YWIA 2KZHA 5DRIA 1LLWA 2AQOA 4IH3A 4IHCA 3W1XA 3ABZA 1HL2A 4HNLA 2C7FA 3W1TA 1PXGA 2YL6A 1TSIA 2INZA 1C93A 2DZAA 4FF7A 2YGYA 4OFCA 1J0JA 2GJPA 2PWDA 1OY0A 4M19A 1TVNA 4PMRA 2A3AA 2GQ9A 1GOXA 1T0OA 1RAKA 3SURA 4EPKA 1OD8A 1GHSA 4XZMX 1R30A 1JFHA 1WZAA 4NF7A 4DWDA 3QW3A 3WLSA 3FV9A 2HNHA 2X42A 3CUFA 2NUWA 2JKPA 2GJXA 4K8EA 1M5WA 3RF9A 7CGTA 3O0FA 3EGJA 2FIQA 1VHNA 2VL4A 4I9AA 3R58A 4DB7A 5FEZA 3BURA 3HF3A 4D8LA 5CG0A 5ECVA 3LU2A 2QDDA 1EP2A 3M5VA 3QMTA 6CGTA 2DQWA 1ZP4A 1DWFM 1DJIA 1ZALA 3C2OA 2VKZG 5A6BD 4KWUA 4V1YA 1IHIA 1Q4WA 3VDBA 1DWHM 4JX4A 3T0BA 5C71A 3TYAA 1CENA 3P7YA 1GCYA 4KGJA 4YWSA 1XI3A 1D8WA 3RMEA 2H90A 4XKMA 4IIGA 4I9MA 3UZ5A 3WK2A 1EOKA 1YYAA 3ATZA 4HTYA 1VP5A 3W86A 5E6YA 3VTRA 1FWSA 3PJWA 3V18A 4ZOEA 1OWQA 4EACA 1GW9A 4K39A 3G77A 1MFVA 4MWAA 3TXZA 1DVJA 4HPGA 1U5JA 1NP0A 3MWAA 2R82A 1JGMA 1QHPA 4IIFA 4CQAA 1ADOA 3SQLA 4FNTA 1V08A 4FNQA 5DLCA 1XYLA 3G0XA 4MY9A 2Z2BA 1JDCA 3BG3A 4O4VA 2P0OA 2Z2AA 1YDYA 1Q7QA 5ABGA 3CZJA 5JQ9A 2E9LA 3GDTA 5GNYA 3IUIA 1DJZA 1GYMA 2PZNA 3UZWA 4DUOA 3Q37A 4IIDA 4UIOA 4AD5A 3O8AA 2CBJA 3BJSA 4XX6A 3GVRA 5BU9A 4S3EA 3TJIA 4F2UA 2YBVA 3TWBA 1R3QA 1B3YA 1VRDA 4BS0A 3IPWA 3MUY1 4AG0A 4JQ4A 4XBJA 3BVJA 3LTYA 2QCLA 4FXRA 1VFOA 5CJNA 2DZPA 4HZ6A 4M3PA 1EF3A 4MLRA 4E5TA 1EIXA 3RHGA 4U5IA 3VNLA 2TODA 1M6JA 3RUBL 1VFTA 2DORA 4JYEA 1VPQA 3NNTA 1IZKA 4JN6A 2BVYA 4R34A 1DIKA 3MZ2A 1FHDA 5BXSA 3NM3A 3MJMA 3H7VA 3VIKA 3DECA 1EH9A 3OGSA 2XFFA 1XW8A 2ZXDA 1OABA 3WJWA 1BAGA 1EGMA 3QZAA 3THUA 1GNXA 4KS0A 4TQTA 3UYCA 2HPMA 4FALA 1FXQA 4X2PA 3T07A 4XD6A 3UG4A 3OW1A 3UPWA 4Q22A 2DSUA 1FP9A 1WKEA 4IPIA 4PMDA 2Y5EA 4HB7A 1GQNA 1IE7C 5KITA 2JKEA 2PDQA 1UPPA 4ES4A 2GYIA 2HEJA 4JYDA 3EWWA 1EDQA 3RMJA 3VKKA 1C9WA 1F9CA 1YPIA 3CH0A 1V6YA 3S5ZA 5D4YA 1Q8AA 3G1SA 2NQJA 3W7RA 1OFAA 4R53A 1PTAA 3VNJA 2OO6A 1V6XA 5H8PA 2A79A 2PWUA 4H7VA 3RCYA 4Z2GA 1C91A 1S2UA 5FA5A 3TLLA 1P4CA 3IVUA 5D04C 1FBAA 4S2BA 1ZCCA 1WDSA 1RH9A 1W5PA 1EO7A 5FJPA 1WZMA 3H26A 1ADSA 1EZWA 3ISIX 4FOUA 1W31A 1NF0A 4HSNA 1OQFA 1V03A 1UPMB 1M03A 2XIIA 1ESWA 3LI0A 4HOXA 5FI8A 1EPVA 4NZFA 3LSCA 4UZUA 5JMUA 4Y9MA 4MJMA 4Q32A 1HJSA 4Z42C 3TTEA 1MRAA 1UZ4A 3TE9A 1TPC1 3SGUA 4HA0A 4I6KA 4ROPA 1V8EA 1J0YA 4L56A 2QPXA 4MF4A 2E6FA 4WXZA 8TIMA 1G94A 4QE5A 2QF8A 4F9JA 3VC5A 4ADSA 5D02A 1GOWA 2B7NA 1KCXA 5ABEA 2QT3A 5E9AA 3FEMA 2DSKA 5CBBA 2ZZ2A 1QI3A 4FF5A 2PDJA 5I3HA 3OVPA 3POCA 4PUNA 1JULA 5EFDA 3UA3A 5EMMA 1RCQA 1US2A 1W9XA 1L6FA 3CT7A 4GMEA 2DP3A 2OX4A 2Q3RA 4GYPC 4IGSA 8CGTA 2BBFA 4PUJA 4ZR8A 2A3BA 2FGBA 1TZ9A 4BI7A 5C2CA 2P50A 3L5AA 2ACSA 4U2YA 1Q85A 2FTYA 4J3SA 2EG7A 1KTCA 4MAZA 2HV5A 4S3DA 4Z0JA 6XIMA 1U30A 1XLMA 3LM7A 1FWIC 2HE5A 1CT5A 4DX3A 2Z1XA 1R87A 3BMXA 4ZODA 2VGGA 2VZVA 1VR6A 2QCHA 1HKWA 4GXPA 4EF9A 4DUXA 5I00A 2FGZA 4JN7A 1WAUA 1KLYA 1MQPA 2PCEA 3N04A 5LA2A 2WYSA 3AMLA 5EFFA 4UBPC 2OZ3A 4M1RA 2E6YA 3LCFA 1PCKA 2EO7A 1W56A 1AZ2A 3AYSA 5FL1A 1K1DA 1LROA 1RP8A 3VM5A 1EBHA 1BSIA 3GIQA 3QYQA 4A3HA 3NZGA 1J11A 2WV8A 2BWGA 4UFJA 3FFSA 2E5DA 4PGLA 4R88A 5D8WA 1K4HA 2ZX9A 2OZ0A 1EX1A 2VURA 2XZ7A 1WBJA 3ZR4A 3AROA 2V3DA 5JXQA 3CS2A 1Z48A 4HZMA 1XCWA 4I5RA 5G2IA 4GQBA 2XHYA 3VILA 3WK3A 4G9PA 2PDLA 5HMFA 4LX4A 4IQLA 2AL1A 4U4MA 1QNRA 2BV9A 4WOQA 1AODA 2YCKX 2WJZA 4H9ZA 4DBWA 1UW9A 2FVMA 3F7JA 1KGXA 1UC5A 3N2XA 4Q4MA 5XINA 1I6NA 5I3KA 3KX6A 2OU4A 1WA3A 1M7OA 2HWGA 2C15A 4AHOA 3W83A 1YTKA 4XD4A 1TQXA 1NELA 4ORIA 4DXXA 4IF2A 3QTGA 1X8CA 3BLIA 2E0PA 2FKPA 5HMEA 2RJGA 4ZBCA 1E73M 1RLCL 3LY0A 2YA2A 4GUFA 2C18A 3LM3A 4LTSA 3BAKA 5M5DA 3WLJA 1MYRA 4YCOA 1ZNNA 3IWPA 1L2QA 4JIRA 2OMAA 1VRXA 5ABTA 2LLEA 2G3NA 2QCNA 3G3DA 5M1TA 1PUDA 3E74A 4HBKA 3CZEA 2DVTA 2HXUA 1IXNA 3TOPA 2HXTA 4LF2A 1H09A 4MJ2A 4AZ6A 3GVWA 2VFGA 1RA5A 4G56A 2BXYA 2V5CA 5IXEA 1WV2A 2PWGA 2E1WA 4MB5A 4HPHA 4W5ZA 1LYXA 3DYOA 4LJ3A 3C2EA 3LMZA 1UMYA 4M80A 3N4FA 1VH7A 4YXGA 3CUHA 2WMIA 3G1YA 3BE7A 1POKA 1UJPA 3AMKA 2Z29A 2QGHA 3T0TA 6PTDA 1BPLB 2YDQA 1TUXA 1MQQA 3LYEA 1AH0A 3VNZA 1ZGDA 4MWAD 4EAMA 3MV01 4L5ZA 3VK5A 4QITA 4MWAC 1TFVA 1ZQ5A 1UD2A 4IX2A 3AC0A 2ZUSA 2OX1A 2XSAA 2PLKA 3HURA 3PG8A 1XYZA 3W1RA 4JIPA 4WKFA 3SAZA 2OEKA 4LW7A 4UZSA 4LNCA 3L2MA 5D05A 2VD9A 4QAIA 2Z1WA 4HK5A 5CPQA 1E0UA 3HQNA 4LGXA 3N6HA 4C1KA 2PURA 3LRKA 4ATLA 2ZX7A 1AL8A 3T4CA 3E49A 2A3LA 2Z2UA 4IT1A 4KIEA 3BANA 1F2JA 1TTJA 3HFTA 2HBVA 3GC5A 1HN1A 1LF1A 5GVJA 1IWAA 4LNYA 4AW7A 1BRLA 3GR4A 3W22A 4O16A 3BLKA 1JCTA 4CQ8A 5DN1A 4RZBA 5M2FX 4EOUA 3VIGA 1ENUA 2WVSA 3SIMA 4J4KA 2ISFA 2Y70A 3ABXA 2WBGA 4O15A 2X0SA 2CZDA 4NAEB 3I6EA 4PTDA 1LP6A 4W8BA 3IJ8A 3K1GA 4LCSA 1QWGA 3F5KA 4GCAA 3IIPA 2V5JA 3FS2A 2P8CA 3H55A 4MKSA 2V3EA 4AISA 2WKJA 1PVNA 3LGEA 4BFAA 4CUCA 2XU2A 3WBWA 3N6JA 4TVCA 4FS9A 3W72A 3UVAA 1W5NA 2OYKA 5CQ1A 5D2VA 1TWSA 2J13A 1C7TA 2AAAA 4CNNA 3E9AA 5TBOA 1EJXC 4L6HA 4WCJA 4BJHA 3OLIA 4ILSA 3P61A 1EX5A 3YPIA 3UZZA 3UZXA 3M44A 4JKMA 3V7PA 3BSGA 3KP1A 1U5HA 1MWOA 1JZ8A 1WKYA 4RPQA 5CGTA 3B9NA 1MVYA 1H61A 4TR9A 2XVPA 2PP0A 1UWUA 3GU2A 2OB3A 1I2NA 3MV11 1M68A 3A3HA 3TN5A 3WQGA 2ISSA 1PJ9A 1K7XA 3FJLA 3LPGA 4PE8A 4AIUA 3KEHA 3R8GA 2X05A 4LS1A 1B5TA 3QPEA 4UTLA 3UCQA 3S2JA 3WUGA 5BRQA 2GFTA 1ZPTA 2NWSA 3IAPA 3R1ZA 3B8VA 3GWQA 3FKKA 2VFHA 2XIBA 3T44A 2WZEA 2GSEA 3XINA 2ON3A 1YTDA 5C9ZA 1TR1A 2KAUC 5CAHA 1MEHA 2Z6JA 2VM8A 1PDZA 3AUJA 2QF7A 2W3ZA 2R14A 1GT8A 3GYCA 2ZKMX 3HG2A 3UWZA 3QKZA 1HP5A 1W6TA 4WKHA 4ICMA 5BROA 3W2KA 4U31A 1K4GA 1QOQA 4PSPA 4D8ZA 2V67A 3TYBA 3E2RA 2YJQA 4JL2A 4C6EA 3CZLA 2E4TA 2D2OA 3VX0A 1ELSA 4J9JA 3R7MA 1AJ0A 4JXCA 1GTHA 3WDIA 4JTSA 1KRAC 3LNMA 3NDYA 1UKPA 1GOMA 1JXJA 4WIWA 3PBWA 4DF1A 3AJXA 1D3GA 1J96A 1KV8A 3HFYA 3GH4A 3KOXA 4KETA 4QJ3B 5HUPA 3RM9A 5I23A 5DQPA 3UFYA 4JKKA 3GW3A 3V36A 4XUYA 6ALDA 1XL9A 3RPTA 1HT6A 2QKFA 5FD0A 2OOFA 3LPPA 1DIEA 2FJKA 4JCMA 2DT2A 1FDYA 2HVNA 4MSSA 3HMJG 3QHMA 2D69A 3DDMA 5I09A 1G4TA 3LZ5A 1TO3A 1TX2A 5HATA 4DPQA 3RDKA 2CZFA 4CU7A 1E43A 2DIKA 2YDAA 3NCOA 4L9ZA 1XSJA 2O0TA 1AW5A 2G95A 1YMYA 4MPQA 2PDXA 4JIEA 3UR7A 2OKTA 1NTHA 4J40A 1M7XA 4US6A 3SY5A 3E0WA 4XVEA 2NQ9A 4EWJA 2VQUA 4H4IA 1HVXA 3RLVA 3ONBA 1EYWA 1J6OA 4F0KA 1EUAA 1B54A 1O5KA 3LLXA 3QY7A 1W3JA 3VKCA 4DJFA 4GC4A 4W8LA 4UTUA 4QLJA 3ZWTA 1OIFA 4RL3A 4CN6A 3WMBA 3CASA 3KWSA 3SRKA 1JNEA 2DW7A 2W66A 5T9CE 5TIMA 4KRTA 1VIWA 4HNOA 3S3GA 4CD5A 3N1AA 4DYEA 3LTSA 1KFJA 3CAVA 4EIVA 4QM1A 4F9DA 3INPA 3SCWA 4NNAA 1AL7A 1E1FA 3B8UA 3SW6A 4RV8A 1LWHA 3EOLA 1A5MC 2FDSA 2PMQA 1EA9C 5C70A 2CLFA 3H70A 4C7GA 3R89A 5HNRA 1XYCA 1HJQA 2HVMA 3BWWA 2Z25A 3STCA 1O68A 3VDAA 4FSAA 1K7EA 1SYTA 1XRTA 3TCEA 5BRPA 1Q6GA 2W4XA 1V02E 4QQUA 3THCA 2GJXB 4UR8A 1X96A 3GNXA 4C60A 1E1CA 2YL9A 1U2YA 1NOFA 3NUKA 5ECUA 1NOUA 5HWMA 1BYCA 5CJMA 4UFLA 2UWFA 1OT2A 2PDGA 3URNA 4X2RA 1JG9A 3TIMA 4O8RA 3MZNA 1XLLA 4S3BA 1F8IA 3ITLA 5EMUA 5PTDA 4OJYA 1FWCC 4NT0A 3L12A 4AVFA 4KEMA 4ZENA 3BGAA 4JX5A 1EQPA 4S3JA 3S6OA 2WVUA 3WQVA 2QCFA 3UXDA 3A5VA 1H3GA 4EKJA 2W91A 4G5DA 1UR9A 1TV8A 2V68A 3AWOA 1KFWA 4CGTA 2MNRA 4MWAB 3HQ1A 2WPGA 3U48A 3VINA 5HJYA 2WKGA 5D2YA 2NVAA 2PUZA 2NXHA 4HTBA 4MVAA 4JDYA 2PWEA 5MHBA 4UTTC 2QIIA 4UR9A 3G8RA 2EPNA 1M7JA 4LC8A 4C6LA 1A5LC 1UWRA 3LS9A 2VP8A 3FJ4A 1TPVA 3TR2A 3QR3A 4AZIA 1TCMA 1PKNA 3HBLA 4PL1A 2OR2A 4LYPA 2IQ0A 2B7QA 1YW1A 3TV8A 1JPHA 4TUFA 5LNVA 1WDQA 3VYLA 2FPTA 1RJRA 1VBJA 4MNKA 1TRDA 2HNEA 3PANA 2ZZ6A 1I4NA 3NFUA 1GYLA 2GPTA 5A8MA 1QWKA 1QBAA 2BOFX 3P0XA 3IUDA 3PSVA 3VKBA 3NL6A 3HTWA 4L9XA 5C9UA 3C52A 1L6YA 1RCOB 2BY0A 5CGMA 3JUGA 1H0GA 2VO5A 3E2QA 1H7WA 4H9VA 4S3KA 4O50A 1HGYA 5A2CA 2YL8A 3BAWA 4QISA 3WQFA 1S2AA 4LV9A 2CYGA 4B5UA 3PHAA 1X1ZA 3UZYA 4GWEA 1YNPA 3RXZA 2XH0A 1RPXA 2ISDA 4NNCA 1WP6A 4PMZA 4HVXA 3I3DA 3N9RA 1E5NA 3DFOA 4L61A 2CFFA 2X30A 4H83A 3AMCA 4LS0A 4IUGA 2ANUA 4BR1A 2WPBA 4C7DA 1OX4A 5C2XA 1H7RA 4O18A 3C8FA 3UGRA 5HA7A 1NFPA 4M24A 1JL8A 1ZTVA 4K3ZA 3NDZA 2CESA 4HCDA 1UROA 2PU0A 1GVOA 3LPFA 2CETA 3LGDA 2WMKA 1PYMA 1AVAA 3GNNA 4QXIA 5E5CA 3AAMA 4HPJA 3BLFA 1UR1A 3CWOX 2P3EA 3V75A 4RXFA 2YCLA 1FP8A 4LVFA 3ABQA 3C3NA 4H9XA 4O1FA 2DY3A 1K9EA 2QVHA 2EXOA 4NP7A 4NG3A 2WLZA 5FAJA 4GJ1A 1TPDA 4DLFA 3ZM8A 4HZ7A 2QHAA 2X1UA 4GKLA 4JS3A 4RDWA 3SCPA 1W1YA 3QF0A 4P8VA 4B90A 1G69A 1DJYA 3PBMA 1UWTA 3HB9A 2AL2A 1I45A 2DH3A 4DBUA 1CBGA 5FJIA 1EFZA 2W5FA 1AMYA 3VA8A 2O9OA 4WVXA 4RX0A 1E71M 2UY3A 1QXLA 2WBKA 2FTPA 4M82A 3MMDA 9CGTA 3W1AA 1W5MA 3LXBA 1Z9AA 2ZA1A 3AQUA 2J8GA 3N2TA 1ISVA 2XZ9A 3PTDA 4AAJA 4PFMA 1VFSA 1FWAC 1XLIA 2YLLA 3Q45A 2H8XA 4DYJA 2VC5A 5FIPA 2XN2A 3KBSA 1XIEA 3CQKA 3VOIA 1ZHAA 4WSHA 3M9YA 3PZIA 3W71A 3TXVA 5C7HA 4V33A 3LHZA 4B2DA 4DLMA 1VEOA 3MMUA 2V2HA 1JZ4A 4OGZA 3HG4A 3EMZA 3STFA 5TAOA 2OQHA 5D33A 3ICJA 3VNIA 1WDPA 3BLPX 8XIAA 1UR0A 4JZ5A 5AFDA 2IPGA 4LUIA 1CGVA 2IXVA 4NILA 1NAL1 2G3IA 5EB8A 3GUGA 2YFNA 1IEIA 3GXPA 4TV5A 3O63A 1GQKA 1GTEA 5CPNA 3WIJA 2CKSA 1K7FA 1KM5A 1BFNA 1P7TA 3S4TA 1FH8A 4UWMA 4F66A 1OGSA 1P0EA 4LY4A 3H4XA 3GIPA 1QVBA 2VR2A 3H8AA 4D6JA 5EY5A 1R85A 1NARA 2D0FA 1VFMA 2Y7GA 2Y24A 3VI2A 5GPRA 1KTNA 3QZEA 3S5NA 2WCSA 3NURA 2OFJA 2UY4A 4WLCA 4LVDA 2C79A 3KRSA 2V8ZA 3DHUA 5CSRA 1V3LA 2BOGX 3WUBA 1KTBA 2A3EA 3LRMA 3NQ2A 4RZ5A 3T40A 2BS9A 1R9YA 4PEKA 4J3TA 1E4LA 3VOJA 3W1LA 1PX8A 4HHHA 2TYSA 5HBFA 4KW2A 1V0MA 5EGRA 1S5TA 3GHRA 2VDGA 4QCEA 3TOYA 4DJFD 3B3DA 4PODA 3L0GA 3F4VA 4KPLA 4L1XA 5CPOA 4DJFC 1EQCA 2ZVIA 3SO7A 1U5VA 4GBDA 4B5VA 2VX5A 2I16A 2XSXA 4O14A 2FGLA 5DMMA 1BWLA 2V30A 2VYOA 1YX1A 3NOEA 3MUXA 4HKPA 2OODA 3OGVA 3L4XA 2G5WA 1L8PA 4IZGA 5FAGA 5B7ZA 1EWEA 4BCEA 4LEFA 3IVTA 5JH2A 3OHMB 4NZJA 3C0JA 3N25A 3EOOA 2P0IA 1ZRQA 4O0KA 4UQAA 5CJ5A 1B57A 1D9EA 3R12A 4HHMA 4Q33A 3W37A 3ANUA 4Q8UA 3UW6A 4IPNB 2NSOA 5HQEA 3M5YA 1I75A 2XISA 1RCXB 4MB4A 1M41A 4GABA 1BVZA 3KS5A 3R6IA 1LRNA 5LNWA 3PZVA 1UD5A 1TE6A 1UD6A 2ZZ1A 1XFBA 3B4UA 4A8RA 3SCRA 5KZMA 2DZTA 1JFXA 2VMFA 3N34A 4XKYA 4TX8A 2VCCA 5CXPA 1GQJA 4NJKA 1YIXA 3BW3A 5CC3A 1B3WA 3TNOA 1V3IA 1PSCA 2ZRZA 2CZ5A 1PZ0A 4O1DA 1KCKA 2XN1A 4GO9A 4NZCA 3SEPA 5LGXA 4I3GA 3KBNA 4H9UA 5BU6A 2WMIB 2WKLA 2F8QA 1E0TA 3G8EA 4RR4A 1CXKA 1M01A 3GFYA 1VBGA 1T6MA 3T0AA 5LIWX 3NXFA 2ONEA 1Q4NX 3UG3A 2V6AA 3D5HA 4C6MA 5IDZA 2UV8G 2QCEA 5I3IA 3D6NA 4JICA 4AVOA 1I8JA 5DY2A 4MUPA 4QDPA 4E2BA 1L6GA 4M51A 3K46A 2EAWA 5A6LA 1K6WA 1LOLA 3OP2A 4A29A 2Y2WA 2BXVA 4B16A 1HL8A 4FNUA 4UTIA 3UT0A 2PTDA 3QC3A 1GOIA 2HPIA 4W5UA 1P6CA 1BQGA 2G3JA 4F40A 1W3IA 1XLHA 3V16A 4F8XA 1E6RA 3AU2A 4DVOA 4UB9A 3HPZA 1E56A 4WSKA 1OGGA 2Z27A 4Q6XA 1H63A 3XIMA 1PTGA 3IJQA 4XBSA 3UA4A 5HULA 3O16A 3MWCA 4JL1A 3U5UA 1YE4A 1R9XA 3CUIA 3DGBA 1TUFA 2UY5A 6A3HA 1LLZA 2G97A 2CWNA 1UYQA 1IEXA 1Q5MA 1TA3A 1G4EA 3A64A 1XLGA 3WKZA 3DN5A 1ZS2A 1R38A 2WM0A 1T8XA 3I7SA 2QJHA 1OYCA 3O6AA 4Q7NA 1S38A 4X0VA 3OZPA 2BNJA 1H7PA 1NSJA 3SUTA 4MMWA 3ZJ7A 4GACA 4M6PA 2DUZA 1D3HA 3USBA 3LNPA 2VQTA 2DVUA 4YVXA 5LHFA 3RU6A 2VRQA 3RCNA 4E4UA 1P0DA 1E9IA 2PD5A 4LH8A 5A8OA 4JIQA 4L4LA 5AY7A 4DXVA 1W37A 1TWDA 3AU6A 2BG5A 1ML1A 1BSLA 3WQ6A 4RZ4A 3EPMA 2HROA 4I9TA 1VBHA 3P5ZA 3ZFHA 2PP3A 2D23A 2YOCA 1CB2A 4MYAA 2VC9A 3M64A 3PSWA 1E5JA 4HCLA 2QJGA 2PTWA 5AHLA 3QW4B 3HGOA 2VTFA 5FESA 3F4DA 5DY3A 1A5UA 1A5BA 1I60A 1IT7A 1ONXA 2YXOA 3M0JA 3M07A 3IAQA 2P5NA 2OYLA 3SB0A 3SY8A 3RFAA 3HIJA 3BMWA 3LCLA 3NG3A 4ZOBA 1EDGA 1J10A 4MNLA 2QZRA 4ALDA 4ZGYA 4QFUA 4LWWA 2DSVA 3MB9A 1LL4A 2GDQA 3AMDA 2PLCA 2A7RA 5BXRA 4PB5A 1NDYA 5EMLA 4LBUA 4IGMA 4O0ZA 4Y9OA 4PCSA 4LUSA 4LVBA 2C1GA 1DBTA 3N13A 4XWUA 3WDQA 1YDNA 4US5A 1MXDA 3EDKA 3L4VA 3LHTA 2PE4A 2WOQA 2PP1A 1WQ5A 3E1F1 4Z0SA 4O13A 1ME8A 4HHPA 2F7FA 4O52A 3VIIA 1CDGA 2DZWA 4WZHA 1WZLA 2XVLA 2X2YA 1W3HA 4FO4A 3SUWA 1OEPA 1VGAA 3WK1A 3MHGA 2Y8UA 3KDNA 1ISXA 5I24A 1OC6A 3HO8A 5DELA 2J6VA 3FA5A 2PAJA 1QRQA 4KEUA 3QV9A 4B2DD 1YXYA 4IFOA 3S5YA 1M65A 3CUJA 3T0DA 3VFCA 3B8DA 3R10A 4HIBA 3S5OA 5CEWA 3AOFA 2ZXQA 1R86A 3CEUA 4XAPA 4OQVA 4NY2A 3IGUA 2WC3A 3S83A 4LAOA 3TSDA 3L0NA 4KKXA 4ENLA 1F74A 1R7OA 4WSJA 4E3VA 4JN8A 1C8VA 3C2RA 1RA0A 4YJ5A 4B91A 3T6CA 1OINA 3OU8A 3UPBA 1EGVA 3RGTA 1KKOA 4MG4A 3PPFA 2Y89A 4L4MA 3UG8A 4WR3A 3PWAA 1CW2A 1UJQA 3MP5A 3OODA 5A6MA 2X8RA 1MXGA 1K8ZA 2OZTA 2Y1HA 1OCJA 3P8JA 3C56A 1A47A 4LRTA 1CYGA 1SO4A 3B0VC 1GJUA 2QCGA 2VXNA 5D9MA 3KS6A 2GVGA 1XRVA 3MCNA 4ZSUA 1U83A 2GJRA 4IMAA 3KZSA 5TF0A 3LX9A 4HPNA 4IQJA 2X2GA 3EOSA 1A5CA 3SADA 3UXLA 3ZVHA 1KFCA 4AD2A 1SFTA 3W1UA 3SRFA 1NEYA 3W7CA 2NXGA 3TN3A 4W88A 4H2HA 1UH3A 5IFTA 2QDGA 3U6WA 3FSUA 4AZ5A 2GGGA 3N2MA 3VZZA 3O3RA 2CXGA 3WJZA 1E6SM 2XN0A 3EX6A 3O06A 3W27A 3SUVA 4MYXA 4EXQA 3GBDA 2JIWA 3D47A 4E0CA 4PCNA 3T09A 2FQIA 4DUVA 3FLUA 3H53A 1TKKA 2X09A 1ZJAA 4O57A 1VEPA 4WUIA 2JKAA 3S47A 4O8AA 2J47A 5LKYA 1SFSA 3MMWA 1TIWA 1R9ZA 2QUVA 1R46A 2VFEA 4H6QA 3QQ1A 2BFGA 5HPCA 2FVKA 4MJZA 4FOJA 2E40A 1DQUA 2FB3A 1E1CB 4M6VA 3LCXA 3VIOA 4R5EA 3W6LA 3BQ6A 3P93A 1UWSA 2Z1BA 4QE4A 3SECA 1QI2A 2GQAA 1JPIA 2G50A 2F38A 1CGUA 1FCBA 3OVQA 4YVPA 2C19A 4Z2KA 4XD3A 3S5SA 1QK0A 3GZ3A 4FR6A 2J9YA 3EWXA 3BPWA 2RGLA 5G2WA 1W9UA 2WNQA 4ACZA 3LV5A 1WPCA 4AWSA 2GVJA 2BGSA 3E0IA 3K4WA 1E51A 4FI4A 3N9KA 4CVUA 1XH0A 3L9CA 4S3FA 1M9HA 4KCTA 4M6UA 1EGZA 1LUCA 1KB3A 1THFD 1GJPA 4FX7A 2QPSA 4H41A 1S2VA 2BDQA 3R5EA 4WDXA 2Q02A 2J74A 2ZUWA 1KKRA 5CPTA 3BL3A 1W1A1 4W7UA 3VKDA 4DM2A 3AHTA 1G5AA 1KRBC 1WOBA 1LWIA 2GZXA 3OVGA 1XD1A 1QDSA 1WE5A 1P0NA 1TYGA 2HS6A 4JQAA 4M7TA 2PLJA 2ZC8A 1BHGA 1XH2A 1XRSA 3BZGA 3UU0A 3GDMA 4PR4A 2QV5A 4MZ8A 4NI3A 4NJHA 3WBYA 1W5OA 1TR9A 2D1ZA 4K36A 5LZLA 1MZHA 4Y9AA 4GZ7A 1L6WA 1RBAA 2WMGA 3NL3A 4AVNA 4UC5A 3TAKA 2PDBA 3BG9A 2WSKA 3JW7A 5KZDA 4N4PA 3I65A 4QBXA 1OSEA 3NZPA 3WNKA 1X38A 2X1SA 2V0TA 1OC7A 4OOUA 3OVRA 1NF7A 2WSQA 2Z1VA 4UMBA 3VD3A 1XRFA 1VHCA 2XM2A 2I56A 4DN1A 3GS6A 4AZCA 3UESA 2CW6A 3DC0A 5HNUA 3WLIA 4P8UA 1S2CA 5GJNA 5LSMA 1W3KA 3U57A 4LUTA 3M47A 8RUCA 1KR0A 3PUDA 3ZR6A 2I9EA 2B0MA 5HUOA 2GGIA 1PTDA 1A3HA 1F6YA 2HISA 3PTMA 4E2DA 1K8YA 1OX4B 1KBLA 4GVHA 4H04A 3SZ8A 3ZVIA 1IQ8A 3K8LA 1JCXA 1LOQA 5AKQA 1DXFA 3B9AA 1KNWA 1TREA 4ASTA 5J8LA 2R1PA 3HOJA 1OBAA 3PWIA 2GUYA 4YPJA 3W7MA 4PN2A 2E25A 1RVGA 3LGGA 3VOCA 3ARRA 2HE8A 1ISZA 1DTNA 3QLLA 4QSHA 4UTJA 3DFTA 5DX7A 1BF6A 3WN6A 4M8UA 4C6BA 5D2XA 4QHRA 2D24A 2YCLB 4XIMA 1L8NA 2QIWA 3W24A 3B06A 2CLOA 1ITQA 1WX0A 3OLGA 1XG3A 2WLYA 1W3NA 3RCMA 4OV4A 3F4NA 4R3UA 3CQ0A 3ITVA 4A8LA 1EP1A 4MY1A 4LQ1A 3TFCA 3POHA 1M53A 1W9BM 1EBGA 2YKKA 3GFZA 4JTQA 1G7UA 2CHNA 1P0KA 4QEEA 5JIWA 3KL3A 2PRHA 2YB1A 3M0KA 4P7LA 5AHEA 5A6AA 4JFVA 1C90A 4HA1A 3M6DA 1HFBA 1PPIA 2CCRA 3WFZA 3WQDA 3W7EA 2AL2B 3RU8X 1IYXA 3L67A 2UZ9A 2W92A 5K3VA 4GUJA 3M0ZA 1R2RA 2J88A 3WMSA 3AS3A 3CYVA 3VCCA 4PCPA 3UNTA 1OC5A 3SN4A 1WXZA 3JVAA 5GNXA 3UY8A 1SVDA 3W6YA 4CNOA 3VUSA 1OGBA 3ARSA 1XCFA 4AWTA 4US5D 3C5QA 1A49A 4D9PA 1ZENA 2XH4A 1ZAJA 2GJNA 4XZWA 5I03A 1B1YA 1F3TA 4BA0A 1TMHA 4GRSA 4B3LA 3ZOAA 4Z2JA 2FFCA 3ZJ6A 4FXJA 4NASA 1JYNA 2E6DA 3UNDA 2VEGA 4CNUA 3RJYA 2PF0A 3L4UA 3LD5A 5CSSA 3GXIA 4PUEA 1V77A 1ONWA 2BASA 4OHQA 5K9XA 2X1TA 2PTYA 1VPYA 2ZADA 3AUOA 1RHCA 5HDRA 3PBVA 4Q4QA 3VX1A 4Q8NA 2YZRA 4JTTA 3WY1A 1XQLA 3M1ZA 2GSJA 5A6SA 4M0XA 4N9DA 3CO4A 3FAXA 3LUTA 4H6EA 4IICA 3ZXWA 2J24A 3PJUA 2PC8A 4R9OA 4BF5A 4TXEA 1P7TB 3U2CA 3W81A 1YLVA 2X16A 4K7VA 5EMJA 4O1BA 2ZUMA 4JTGA 4O1AA 2ZXAA 4QQ3A 4Z08A 4GZIA 2NW0A 3FW6A 1O7AA 4XK2A 2CWXA 2P10A 1UD8A 5LYRA 1ITXA 3OOQA 4BI6A 4ADTA 5CLTA 1AG1O 1BWVA 5AECA 3AXHA 1Q6QA 4H19A 2ACQA 2EKGA 2GOUA 1K9DA 4GIRA 1A5KC 3KE0A 3BW4A 3HPFA 5CBIA 1VFLA 3DKLA 4HA3A 4FIQA 2PC4A 3E0VA 4LFYA 5I5RA 4Q4KA 3T78A 3EKGA 5G4HC 1OFOA 1Z3NA 3NL2A 2PDPA 1BKHA 3H4GA 3TTQA 3VD7A 1BQCA 3DFHA 1H51A 5A6BA 3NEVA 3PM6A 4H7CA 3LPOA 2QCDA 5J5RA 2A85A 1VBUA 4GNJA 2PWHA 3WD4A 3N12A 3WD2A 3MP3A 3ZJ8A 4MHBA 2GL5A 2V69A 5CPLA 1LBMA 4DZ5A 3GRIA 4ONVA 3U5YA 3W1MA 1R7AA 3E2VA 3W26A 3OTRA 1XV8A 4H8NA 4YYCA 4BF9A 4IMDA 2CLEA 3UJEA 4N0RA 2JK2A 4WJ8A 3TZNA 3H2NA 1QOXA 3W1QA 4L4PA 1YNQA 3RN6A 3HJZA 1GZGA 2IS7A 1JD7A 2A21A 3WNOA 3GG0A 4GA8A 3S1WA 4KWOA 1HNYA 3GDRA 3B8IA 3N29A 5G4EA 2WQDA 5MF5A 3A9BA 1VFHA 3DZ1A 4JTCA 2O9TA 3ONCA 4OU1A 3ITOA 2OG9A 5I0DA 3ITGA 5E93A 1EUNA 3WLTA 1SSGA 3ATYA 4GJJA 2E3ZA 1N82A 1C29A 4XKYB 1TMQA 3K8KA 4MY8A 1K6AA 3RG6A 3SRHA 1O12A 2Z26A 1BGGA 3A24A 4ZMGA 1KGWA 3GK0A 1RY8A 3FX4A 3ABOA 5AZ0A 2VX7A 4G2DA 1O5QA 2R24A 4HA4A 1TPEA 2IKIA 1TPWA 2E67A 3QR0A 3NQ7A 3WENA 3GHTA 1V0NA 5CKSA 4RE2A 4A3RA 1G1YA 1LT8A 1YKWA 3VABA 2YZ5A 2WB5A 5LIXX 4PUMA 2XJ7A 1V3MA 3ENLA 3A12A 2G4JA 3MKKA 1XFCA 4LB4A 3IGSA 1NWTA 1OYAA 4X0NA 2XIOA 3UWEA 2RDTA 4BQ2A 3DBNA 2XGBA 3V0UA 1PX4A 1R2TA 4UFHA 1Q7ZA 3J7HA 1GG0A 3URQA 4Z1CA 2NXIA 2FH8A 4RV3A 3G5EA 2XVNA 1VLWA 2PRLA 5HXMA 2VI0A 1ZAHA 3CHDA 3K4DA 5E0KA 2C14A 2W27A 2PDHA 1XHGA 5E70A 2DU2A 3ZSSA 2VJXA 3CL8A 2EG6A 5DCDA 5D38A 4L80A 2J77A 1CXLA 2DZBA 2E9BA 3GVVA 3TH6A 1J79A 1LRTA 3L5MA 5LGZA 1RUSA 1V5XA 3S1VA 3LQLA 4ZQCA 1HKIA 2WC4A 2JGYA 1X6UA 2V5BA 5DCEA 1E9ZB 1EXBA 4IM4A 4CCDA 1I2QA 1PO9A 2NVCA 4ZE4A 3IGXA 3VGDA 1GONA 1TA3B 3KLKA 4MM1A 4B3ZA 4HP5A 1NOWA 4O4WA 2HCVA 1OF6A 1TV7A 2C91A 1R8LA 2PDWA 3KVLA 2WJEA 3LBOA 1AD1A 2F9RA 1XXXA 4HNCA 5CZJA 4BK9A 5F2IA 4KCUA 2MANA 4V28A 4H9MA 4ZQPA 3UVIA 1D3CA 1O6IA 3TKFA 4IXXA 1REQA 2ZX6A 5REQA 1UP3A 1KV5A 5T8GA 1UKSA 2X0YA 3G6MA 3CV2A 1TV3A 1FWRA 4CLMA 1JRBA 1F73A 2W61A 1H5YA 2G3MA 4FLOA 1EEXA 3CXOA 4G8TA 5D09A 3W7DA 3Q65A 1E6NA 5BXTA 4YCPA 5T26A 2GUUA 1P5BA 6REQA 4M81A 3OQEA 3U0HA 2EEXA 3OLEA 3THAA 4GI6A 4YN5A 2D2HA 4MLJA 1DL3A 3VE7A 4XO7A 1E3ZA 2WANA 4NJIA 4YHGA 3O9NA 3CQIA 1G9HA 4GI8A 3OPSA 1TRIA 4JCLA 1QI0A 3W70A 4FNRA 4O28A 5A6TC 3IGHX 1TWIA 1CWYA 3SIZA 2VD8A 2WK2A 3KOYA 3WDRA 1U22A 3WLLA 1E6PA 5DXXA 3SGGA 1NDVA 3FVDA 1ZL1A 3CHCA 4QROA 3I6TA 4V2XA 3I3BA 1W17A 4FA3A 3WQEA 4DBEA 1DHKA 3S9IA 1UD3A 1K3UA 5ABHA 1A5NC 3WYZA 2W9MA 3GLCA 3SR7A 3WEZA 5E1QA 4C6QA 4L1GA 1KFKA 1GOKA 3N14A 3OYXA 4LUSB 5DEZA 4ICCX 4ZEPA 3R0KA 4FXFA 4E3TA 1ADDA 3APYA 5K9CA 4AD3A 3BICA 3PG9A 1E70M 2B7OA 4OVXA 3Q94A 2ZBTA 2VEMA 1PWMA 2VCBA 4W84A 3BAIA 2OKOA 3F2DA 3CAWA 3T8LA 1JUEA 3IEBA 3EA2A 3UETA 4RNIA 3LDVA 2TAAA 4R85A 1T96A 1XUZA 4W4QA 4FK9A 2FFIA 1SJDA 2OSXA 4N02A 2WWCA 3WJYA 1GJWA 1A0CA 3P5YA 2PDFA 3LG3A 1ZSXA 3EWDA 4UQ9A 2X7VA 3RITA 3WL0A 1W1IE 1P43A 4NUWA 2ZWZA 3TTSA 3P82A 1H62A 1BG4A 3E6EA 1B3XA 3EKLA 1OM0A 3G18A 3P84A 2YIHA 3FEQA 1TWZA 1LZOA 1UZHA 2HJPA 3C0LA 3RNDA 4QG6A 3PZTA 4FZIA 4L6OA 4Q4RA 4WKAA 3E0LA 5DANA 3EDEA 4R9XA 3HU7A 1RZMA 5E6ZA 5A2BA 4NXKA 3DG6A 3ITXA 1E9LA 4A35A 3KXQA 4C6JA 5AYYA 5G5IA 4U28A 1UWIA 2I5IA 3BOFA 5IDIA 3S1UA 1EYEA 1RJPA 4LBRA 4AZ7A 3FDGA 3AI0A 1XDLA 4AEFA 1V6WA 1BYBA 1VYPX 3UG5A 1H2JA 2WXDM 2PB1A 3P67A 1AZ1A 4YTUA 1XLDA 4HN4A 5G1YA 1SZGA 1KXTA 3TJXA 3NQDA 1WXYA 1HO4A 4KIRA 3ZVHB 1AD4A 2ZVRA 2YYTA 3PZMA 2IPFA 2VZTA 2OWCA 3KHDA 3OGRA 1Z42A 4DO7A 4HJWA 3QBUA 1TJ1A 3G1RA 3CU2A 4A21A 2NQ5A 4JFUA 3QLDA 3QR1A 4FOKA 3QY8A 1EJTC 1RR2A 1WCGA 2ZA2A 1X97A 1C7SA 1KFLA 1RSCA 5H6HA 1E1EA 1TVPA 3VNDA 3VMPA 4IQEA 3UWUA 3WF3A 5KMYA 4NX0A 2FLIA 2FVLA 4B5XA 4K37A 3UWVA 3H21A 4DO4A 3NEHA 3WH6A 3PJXA 4Y8FA 4KT2A 1V02A 4DM1A 5LXXA 2P88A 3QC0A 4C6PA 3H2EA 2WCGA 4XD5A 4NYUA 5G2HA 3KW3A 4NI8A 1MXSA 3W7OA 1EDTA 1CIUA 2QQ6A 2VFFA 2DZVA 5LA1A 1G4PA 3EMCA 3BCFA 3R2GA 1KRCC 3MDWA 3WQWA 4Y2WA 3TCSA 3UR8A 4ZTYA 2WVTA 1B4EA 4RW3A 1QJWA 2ABAA 1LQ2A 4ACZB 3EB4A 1GVRA 2H9AA 1VKFA 2QS8A 3BTNA 5F2LA 3VIMA 2D20A 1KM2A 2Q71A 3U2OA 5DBUA 4TV6A 2XGZA 3WD3A 2Q8ZA 1LUCB 1EJVC 1VFFA 4AD4A 2FJUB 3WNPA 2VEKA 3TYCA 4Z2HA 3ZLHA 1OFBA 4J3XA 1SGJA 2Z4GA 1HG3A 2BVWA 4B5NA 2FMOA 3DI0A 4B4HA 4PZVA 2OEMA 2ZRYA 1JUKA 4E4FA 1F8MA 1OADA 3H12A 3A4WA 2QUMA 4JQ3A 2JALA 2BZNA 1TJ2A 3I4EA 3MVTA 4XSLA 1K9TA 4IJRA 2POZA 1J18A 5FACA 1E55A 2R1NA 2XGIA 1UKTA 2BSLA 2QDEA 4J27A 2BODX 4DI8A 2YYUA 1HL9A 1TQJA 4ZOCA 5M03A 3WF0A 1I0BA 1MW1A 3FKRA 4JTAA 2VWTA 3BCJA 4U2ZA 2PWVA 3LXAA 1ZAIA 3DESA 1KXHA 1WNOA 3CT2A 1QUMA 2GK1A 1QNOA 2NV1A 3IV8A 1OFQA 3PJTA 3M16A 5BOEA 1N7KA 2INEA 3QJAA 2DZUA 1S3TC 2E28A 3HN3A 3TVAA 2X0HA 3COTA 3ECQA 4YU1A 3ARPA 2V9DA 3LLFA 4S38A 4GQGA 1CECA 4HYWA 5A8QA 1AW1A 2WW5A 4JYFA 1F05A 1FH7A 1AQMA 3FDKA 3S0CA 4WY0F 4AZCB 2YA1A 3W0KA 2PGFA 4YTQA 1FHVA 3MBFA 3CC1A 3KP0A 1ISWA 4UTHA 4LUTB 1LQAA 4LU0A 4B5TA 5EMKA 1J12A 1XC4A 3DFQA 3MI2A 1W3TA 1B31A 3B0UX 2F2HA 4UQCA 3MANA 4KFPA 4U3AA 3ZS4A 3N19B 3URBA 3OHIA 3C8NA 1YEYA 4GZEA 3B97A 3SM0A 2PDUA 4ZQOA 4DAFA 2ISVA 3UXIA 1XWYA 1VJZA 3MMTA 1KM6A 4GHRA 4XZ9A 1E72M 3TMQA 1DJHA 1XGEA 2P53A 4NZ4A 2QR6A 4EXAA 4HOZA 4DF0A 5FJTA 2WMHA 1ICQA 3R79A 1IWBA 3W00A 3LHYA 1XIGA 2C8NA 4HK6A 3B8WA 1F4AA 2B81A 1JZ3A 3EX3A 1IIGA 1MW3A 4GGHA 1A5AA 2AMGA 1SJAA 5BMXA 1KW1A 1RK5A 1XISA 3NTYA 5I3FA 3HQPA 4YVVA 1JI1A 3WNMA 1VJSA 4D6EA 3ARQA 3M0XA 3DEQA 4GCXA 3MJYA 4J28A 3W9ZA 5M3WA 1C3FA 3QGKC 5KTLA 1EC8A 1NP2A 3WMLA 2WO5A 3GD6A 1OCBA 2XIJA 3KFTA 3OZOA 4GX8A 4TTUA 2E7FA 3QXBA 4DEFA 3VM7A 4J2PA 3NPVA 3TA9A 7TIMA 3WBXA 3GO2A 1F7BA 3B03A 4JTFA 1YXDA 2TRSA 3V35A 3PZOA 3LI1A 1H7NA 3EPOA 4NIRA 1ECQA 2Z28A 1PV8A 2XFRA 4RNFA 1JF6A 4C6DA 5C2GA 4DBSA 4C5ZA 1TTPA 4KRUA 3HGRA 2HDJA 1PYFA 1TPUA 3EZ4A 2BGQA 3DFPA 5DFAA 1QT1A 4D6FA 4WY0A 2F2KA 4LEQA 1VJIA 3KOZA 3RLHA 3QH2A 5J04A 4IWWA 2A7NA 2B4GA 2NQZA 5HWJA 4BHYA 1SMDA 1WDDA 4MZYA 3P2VA 4AC7C 3VD9A 3MCMA 4IL0A 2FPVA 1A80A 1FWGC 3NSXA 3QOKA 4S23A 1Q2RA 3G1DA 3SFWA 4IQDA 3NZQA 1GWJA 4BI5A 2L5HA 4HMNA 1ZY9A 3W01A 3AXKA 3UJFA 3QY6A 2BXZA 2IMRA 5I2UA 1V0LA 2NT1A 1L0PA 3CEPA 1PEZA 4NVTA 1NWRA 3LB0A 3N11A 1HKJA 1ZFJA 4YTTA 1JQVA 2BHZA 1FVPA 1Q2SA 1P48A 1BGAA 5C9WA 3B05A 2BMBA 4DJDD 4M5PA 2GUBA 4S39A 4ZL1A 3FY1A 2XG9A 4DJDC 1PX3A 4PRWA 1ECEA 2WHJA 5HINA 4PL2A 3U9IA 3FA3A 1MUWA 4JNMA 3GC2A 1K9FA 4DNMA 2ATMA 5HWNA 4A3QA 4PTVA 3BDKA 4NXSA 1KLZA 4JFWA 3PZ9A 2BB0A 4FXSA 4JOMA 4D2JA 4FP1A 1ZBCA 4CQ9A 1NH6A 2J7CA 3NAVA 3KOWA 3SSZA 3ANYA 4HU4A 3DAQA 1H1NA 3GG1A 4RDYA 4AZHA 3I68A 1PCWA 2PS2A 4INFA 5CPSA 2X41A 1AQHA 3WQPA 2RHGA 4CQCA 3D46A 4J1OA 3QPZA 4RJEA 5E09A 1R3YA 4ACYA 2VVNA 3LOTA 1X1OA 3LN3A 2I5GA 1JYVA 3W25A 3G1XA 2FZDA 3GTXA 5JBEA 3DHFA 1RQEA 1F3EA 3M5ZA 4Y90A 3TFXA 2VX6A 1DJNA 2Z00A 3GDBA 2QCDB 4JHZA 1FHLA 3UEQA 2HQAA 3IUHA 3IJ7A 4FX6M 5KSWA 2IQDA 2EPHA 2QJJA 4XO6A 3DG7A 3BJTA 4Z1DA 1FUYA 1V51A 5JBDA 3NWRA 1W9DM 1XPYA 3P62A 4PB4A 3WLPA 3AIVA 4Q7IA 4KBXA 4RNJA 3L2IA 2PCQA 2QAPA 2Y7FA 3OBEA 3UD6A 3A9IA 3RM4A 1DOSA 2NX9A 3GNPA 3P0WA 4Z17A 1FXPA 3WLKX 4DAIA 3N4EA 3OBKA 1J8VA 1LM1A 1VLIA 4NYYA 5ABFA 3NZRA 4W8AA 5AVHA 2PEVA 3AFBA 1UA7A 4GQQA 4PRTA 2NT0A 4UTTA 4OUIA 4XBKA 1QTWA 2H3DA 3CUXA 1HTIA 5H2ZA 3NGJA 1ODZA 1CCWB 1O1ZA 2ZDRA 1WKFA 5AHMA 3CMFA 2EJAA 2C1HA 4RE0A 3UZJA 2H6RA 3WFAA 1B30A 1GZJA 3VZYA 4A4AA 1I2PA 4P8XA 3TYUA 3NPXA 1QI4A 5A5WA 4S2CA 1PZ1A 1B9BA 4PUDA 5A8PA 4IUOA 1PL9A 3WMCA 4QLKA 5ENLA 1OG0A 4DO6A 3HJEA 3KM8A 3GW0A 4TX9A 3W82A 3W7JA 2D73A 4LVAA 1JYXA 3GM8A 6ENLA 1OVDA 4W7WA 2RH9A 4XSMA 3HM7A 4FLQA 5H91A 2C71A 4WHBA 4KEZA 3MO7A 4X9YA 2ZCGA 4TTGA 1S39A 2YCEA 1TMLA 5DMNA 4ZVJA 4MADA 2ZUUA 5M17A 4JDBA 2DIEA 3LEPA 4AF0A 3E0FA 3BV7A 4C6IA 4TOQA 4AEEA 1P0BA 3G6LA 1T40A 2PDCA 4F0HA 5KZEA 1E4NA 4JKLA 3LV6A 4C5YA 4IFKA 4P7OA 3ARYA 5C5YA 1GKQA 4H2CA 1Q65A 3GB6A 3W4RA 1F76A 4ZFMA 1DXIA 4PMUA 3RR1A 3MI6A 4Q8VA 4W86A 4DI9A 4HHLA 4V1XA 3LCIA 1DYSA 2B7PA 4GI9A 3LTPA 3E2SA 3F5LA 1W8SA 3ZWSA 4ML4A 3WQ5A 1R3VA 3N3MA 3OLDA 3EXTA 3KBMA 2NWRA 3TQVA 2NLYA 4WDTA 5C55A 3W7NA 3FCPA 1UR2A 4AZBA 1J93A 3SCUA 5HNTA 3TQPA 2QGYA 3E12A 3L65A 3G1AA 1J0KA 1YHTA 1JDAA 3EDDA 1WUFA 2P76A 4KFNA 3SSJA 4KQNA 1REQB 5AYZA 3CIXA 1D7KA 3GR8A 3FVMA 1XIMA 5REQB 3RK8A 3B9DA 4YL2A 2WNNA 1OB0A 3T05A 1A0DA 1ZJIA 1PIIA 1YQ2A 2OLSA 1E0VA 2YSWA 3WQOA 4U33A 1ZLPA 4L6DA 4NAFA 4P7NA 1JZ7A 2WHKA 4N4QA 4LBSA 4CCCA 2VEIA 5AC7A 4JTUA 3SQMA 5HOSA 3LHUA 3JRKA 3OA3A 1KRMA 3DC8A 2PBOA 2ZRWA 1V3KA 4B9YA 4LPCA 5DXYA 6REQB 1JF5A 2C6QA 4ZTXA 5I3GA 1B90A 5K4ZA 4XAYA 3G2GA 3KVMA 1NQKA 1EJRC 2Y5JA 2IPWA 1Q6RA 4O54A 2QMKA 4JGDA 1C8YA 1NIUA 1CXEA 2YX0A 2DT1A 2WSYA 2GDUA 5BCAA 1JPMA 3BLOA 3UJ2A 2PGRA 4CQBA 4AHQA 2CBIA 1DKWA 3SUSA 1H1ZA 2AQWA 3VPLA 3NR0A 2FZBA 1DHPA 1E6ZA 1US0A 2PDYA 4QE1A 3W38A 3QSTA 2NX1A 5D8ZA 2XTKA 3ITYA 1V6VA 1GEQA 1PZ3A 3EB3A 3VC6A 5A95A 1AQFA 3IJ9A 3QQ0A 4QS6A 2DT3A 4XG1A 4MDPA 1UASA 4UTFA 4B5WA 1CLKA 1HJVA 2JIEA 2R94A 3NPUA 7PTDA 1FWTA 5JVLA 1DEDA 1JI2A 3KCOA 3K30A 1XDMA 3H2AA 1Z69A 4HYRA 5I02A 4UNKA 2A6LA 5HR6A 3IANA 3DBPA 4RXGA 2DEPA 1V6TA 3AHXA 3W76A 1W91A 1KM3A 3WLQA 1UH2A 2I9UA 3ERPA 3NGFA 3NIYA 3FIGA 1QHOA 1AJZA 4LCRA 4LRSA