3N12A

Crystal stricture of chitinase in complex with zinc atoms from bacillus cereus nctu2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
NNLGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLESGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHYNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDGLSLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Chitinase A
total genus 113
structure length 332
sequence length 332
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n12A00
1NOFA 2BXYA 1H0IA 3ARVA 4UQBA 3WUEA 1J01A 1JNEA 4P8UA 3OG2A 2YOCA 2A3EA 3LPFA 1A3HA 2WK2A 1JZ3A 1UKPA 4OOZA 4D6FA 3W6LA 1H41A 3BMWA 1WZMA 2WYSA 2VRJA 1MW3A 3UEQA 4L4OA 1MQQA 2A3CA 2XVPA 3CUGA 4CD5A 3WNMA 4GI9A 2OWXA 1QBAA 4RL3A 4ZENA 3OLIA 1GHSA 3BAWA 5E6YA 1FOBA 1WDRA 1DEDA 4AD1A 1UA7A 1UH4A 1VIWA 4W86A 3N1AA 3AZRA 2WZHA 3WN6A 3MKKA 3PZMA 3ARZA 1XV8A 5ABFA 1LL4A 4S3JA 1MW1A 1DWJM 4BQ5A 3MMDA 4U31A 4W87A 3IK2A 1TVNA 2E8ZA 3SCUA 3F4VA 3PTKA 4TVUA 3T2QA 1UZ4A 2VI0A 3PZTA 2WZIA 2E9BA 5BROA 1P6WA 4AW7A 1VF8A 3WL0A 5CGMA 3RCNA 4CN4A 1W32A 1L0PA 3VM5A 3L4VA 2YLLA 2WC7A 2EPNA 2WNWA 3W53A 3I3EA 4RE4A 4MJ2A 1KCLA 3OB8A 3WQ5A 3VIMA 2D0GA 4AY1A 2BXZA 2YL5A 3FXYA 1EH9A 2J79A 2V3EA 1KXHA 3RIKA 1ZBWA 4D6CA 5D9NA 3MU7A 1XGZA 5CZKA 1G1YA 3U5UA 1JZ5A 3MSDA 4QP0A 4HOZA 1QI0A 2ZUNA 3THCA 2F8QA 1LG2A 1K9EA 1Q6GA 4W7UA 2DSKA 4W8LA 4H2CA 3CBWA 3B9DA 1I75A 3SURA 4JFUA 1ZJAA 4P8XA 1JL8A 1UUQA 3GXDA 4GO8A 4UOJA 1LG1A 2OSWA 2CKSA 2PWGA 2BVYA 1W1YA 2E4TA 4XZBA 3RPMA 3VMOA 3FY1A 3ZJ6A 1J18A 2EPMX 1S46A 2G3NA 1E9LA 4BA0A 5BXTA 1V08A 2CNCA 1K9FA 3AQUA 2WVSA 3W29A 3PZ9A 2O9PA 3WF3A 1XRVA 1PIGA 1CNVA 1FP9A 3VINA 1JD9A 2DDXA 4MNMA 1CGUA 2WSKA 4KRUA 2ZUUA 2FH6A 3CLWA 1R85A 1BYAA 5I23A 1NWRA 4ACZA 2EPLX 1VFUA 1EDGA 1UWIA 3AMCA 3W25A 2WANA 2YKKA 5M17A 1JI1A 4HMDA 3WQ8A 4UFHA 3DECA 3PBGA 3L2MA 2WXDM 3S2CA 3VNYA 3IAPA 1J0JA 3ZJ7A 2Y2WA 3F5JA 5BCAA 3VGGA 2CBIA 1V03A 3KWXA 2D1ZA 2VO5A 1QNQA 3L4UA 4WKFA 1E3XA 1CXFA 3EDDA 2O9TA 1WDQA 1V3LA 2DSWA 2TAAA 2W92A 3ARPA 3N13A 4TTGA 8A3HA 2XSBA 3II1A 3GBEA 2CYGA 4MB3A 3EDEA 2ZOXA 1HKMA 2XIBA 1E43A 1KFWA 3WD2A 1TZ7A 4JCMA 3SCVA 1KQZA 3B9EA 2BY2A 1C90A 3MUY1 4AISA 3PN8A 2E3ZA 1FHDA 1QHOA 4JL1A 4BF7A 1ZU8A 3GXFA 5C70A 1IZJA 3T0BA 4B16A 5AC5A 1B9ZA 1UR2A 1WKYA 1UD5A 1UOKA 2WMFA 1JGIA 4WKAA 5IFTA 1HIZA 1B2YA 1IZKA 1Q6EA 4FLOA 4L4PA 2VQUA 3O2LA 2XVLA 3L4TA 4PMXA 2V5CA 4PTWA 5FL0A 3BGAA 4ZEPA 2VZUA 1NWSA 1KGUA 1B0IA 3PTQA 3KEHA 1KXVA 4XB3A 1LQ0A 3EBVA 1GZJA 5GNZA 1DWGM 4UFJA 1AVAA 1B1YA 2J75A 2WLZA 2IXUA 1J9YA 1QBBA 1SMDA 3VO0A 1HVQA 3GDBA 3ZO9A 1BLIA 3A4XA 2BHZA 5IHRA 1KQYA 4GINA 4CU6A 3L2LA 3NSXA 1ZL1A 3WIJA 1ZB5A 3BCDA 2ZICA 5DFAA 2DGAA 3WQWA 1UR4A 1WCGA 1JXKA 1KBKA 2QHAA 2G41A 4CGTA 3BH4A 2Z1KA 1EOMA 1EHNA 2VCBA 1OIFA 2UY2A 2ZXQA 2QMKA 2Y24A 4W88A 3OGVA 2YDRA 3GYCA 3GNRA 2V3FA 3ARWA 2QV4A 3CZEA 3FAXA 2UWFA 7TAAA 1BG4A 2HVMA 1TCMA 3WNKA 1W3KA 2VZTA 4MJ4A 4D71A 3IAQA 3WEZA 2ZX6A 5I0DA 1AQMA 2J7GA 4PUDA 1E15A 1CIUA 1X1NA 1QI2A 1GQKA 2V3GA 2VRQA 4E4PA 4AD3A 2WKGA 4AZBA 4CD6A 2UY5A 2VX4A 4TTUA 4YPJA 1J0ZA 1RP8A 1JIBA 4CD4A 1WAWA 5BXSA 2D2OA 1CXKA 2XFYA 1JZ8A 2FDMA 3AIQA 1ITCA 3W28A 3WF1A 2JIWA 4H04A 3A4AA 4UFLA 4V2XA 3ARTA 2PC8A 3G6MA 3NIYA 1R8LA 4U2YA 2WCSA 4W84A 2ZE0A 1JD7A 1CECA 1XC6A 3I3DA 4BQ3A 3CZ8A 3WL1A 5BRQA 1ISZA 3EMZA 1EQCA 2J7CA 3FHQA 3QHMA 1PZ2A 4ACYA 1NP2A 3WUBA 1FP8A 1XD0A 3BAJA 6CGTA 1C93A 2WMGA 4N42A 2YLAA 5D4YA 2O9RA 3ECQA 1UWRA 2CETA 4WLCA 2E0PA 1WZAA 3GTNA 1JF6A 4TOQA 5CGTA 2W62A 3AIUA 1X6NA 4JFWA 5IXEA 3L4XA 3VKKA 4AZHA 3WH6A 1XD1A 4AEFA 1WDSA 5I77A 5BRPA 1J0YA 2J25A 4JHOA 3WD1A 1UKTA 5CSUA 5HOSA 4AC1X 3ARQA 2UY4A 5D8ZA 4E8DA 5CJ5A 3ZSTA 3AZSA 2EBNA 4AIEA 3N15A 2E40A 3CZKA 3MO4A 1M03A 3KL3A 5E0CA 2J7FA 2XFRA 4Z2GA 2DH3A 1NOUA 2WWCA 1GQJA 2JFEX 3W27A 3WDQA 3SUTA 5A6SA 3AIVA 3VM7A 3W0KA 5CG0A 4HPGA 2BFGA 4AD4A 2W67A 1B3ZA 4Q22A 3SCSA 4PSPA 3LPOA 2Y8VA 3SCRA 3RILA 3VIPA 2ZUTA 3A47A 1W9BM 4X9YA 2WC4A 1NH6A 1M53A 3T09A 1NARA 4NF7A 5DEZA 1TUXA 2VX6A 2X1IA 2XVKA 5LA0A 1HJUA 1R87A 1OGSA 2ZUVA 3MS8A 1TVPA 3K4DA 2D23A 1C8YA 2NT0A 3GM8A 4XZWA 4D1JA 3N04A 4DWSC 4UFMA 3L4YA 2J8GA 1HJXA 5A6LA 4EE9A 2XG9A 4F9JA 1QW9A 1UR9A 2FHFA 4Z2KA 1VB9A 1OD8A 5IDIA 3RM8A 1PPIA 1C92A 4HMEA 2W4XA 1MW2A 4U3AA 3AFBA 2PI6A 1HN1A 3BLKA 3VGHA 3EMQA 5FD0A 2WWDA 1J0HA 5CPTA 1W9XA 1E4MM 2WW5A 4HU0A 1EO7A 1XH1A 2GJXB 3WH5A 1VEPA 3AISA 3VIJA 2JEQA 1JF5A 5ABGA 1HNYA 3GBDA 5A8MA 5CLWA 3VUPA 3QGVA 4F9DA 4H41A 2GJXA 2G3JA 1JI2A 4X0VA 4OJYA 1CGVA 2QMJA 2XWEA 3WQVA 2ZXAA 2ZX8A 2PBOA 3WD4A 3VU2A 1EO5A 3ARRA 3VVGA 3POHA 3KE0A 1E0XA 4UZUA 3AHXA 4GZIA 3IJ8A 5EFDA 4AZ5A 1U30A 2OSYA 3HU7A 2C7FA 4PSRA 3CHEA 4IUGA 2WBKA 4M29A 2PWEA 4PCSA 4MNLA 7CGTA 1F4AA 1VENA 4MAVA 2RGLA 2VOTA 2X0YA 3AIRA 3AROA 5KZ6A 1RD6A 4AD5A 2WVVB 1PX4A 1J10A 1HP5A 4WIWA 4B3LA 2WPGA 4XX6A 5C8BB 3CO4A 4HZ8A 3W81A 4J7RA 4PTXA 1R86A 4W8BA 5IHSA 3GXIA 4RE3A 4BCEA 3OLEA 1CLVA 1US2A 1UR8A 4DUXA 3OIHA 3VD7A 1BGAA 1OB0A 1OGGA 4CU7A 3VGDA 5JBDA 5TD4A 4FLQA 1L8NA 5DO8A 2WVTA 4JZ5A 5C71A 3WUFA 1H11A 2YA1A 3RM4A 3AYRA 2X2YA 4D72A 1DWHM 2RGMA 2V3DA 1US3A 4OBRA 1CTNA 1KR1A 4TVDA 4MNJA 1E6SM 3D5HA 1LWJA 4TVCA 3ARYA 1NWTA 1IV8A 1CLXA 3AHVA 3BAIA 4H8UA 2WC3A 1FH9A 1JYVA 2J4GA 1QVBA 3ZJKA 3CZJA 5A6BA 3QR3A 1XYFA 4JKMA 3W37A 4BQ4A 4JKKA 2QPSA 4PMZA 1TA3B 3WNPA 3K46A 1CXIA 4BS0A 5BXPA 4HA3A 1CGXA 3NYDA 3UG3A 1KGXA 1FH8A 4Y7EA 3KZSA 4OUEA 3ALFA 2EQDA 1U2YA 2VNCA 2CERA 1WDPA 3K8KA 2X05A 5A6MA 4UQDA 2VUYA 1V3KA 4ZE5A 5M3WA 3L4ZA 4UTFA 1NP0A 2J7HA 1M01A 5ABEA 5HPOA 1OT2A 2G3IA 5JIWA 1O6IA 4WSKA 4AD2A 1E6NA 2AAAA 2XTKA 3WH9A 4TXEA 1JAKA 5DF0A 3WQ6A 1H0GA 2BS9A 1HXJA 1W2VA 4QAWA 1JYWA 1E4LA 4TUFA 1C8QA 2JF7A 2DIJA 1SMAA 3TOPA 3VX1A 3LPGA 1G94A 4DUWA 3TTSA 4A3HA 3CUJA 2CESA 2EXOA 4R5EA 2WBGA 3WMSA 4D6GA 3CMGA 3T2PA 4PMQA 1C91A 3VGEA 4NRRA 3W26A 1UR0A 1C3FA 3DYPA 4D6DA 4DM2A 4W8AA 4AZ7A 4IM4A 3CPUA 4HZ7A 1UKQA 2D0HA 5FIPA 1UWTA 1WZKA 3U7VA 4PMUA 3WF0A 2YDSA 3VD9A 3DYMA 2ZXBA 5EFFA 1J0KA 2AMGA 4B3KA 3FW6A 4AD0A 4HP5A 1JG9A 3WENA 1EHAA 2XHYA 2WVUA 1KXTA 2WMIB 1HJSA 2D3LA 1V02E 3N9KA 1PAMA 1JAEA 1JFHA 4KGLA 2F61A 1OGBA 1JDCA 1FFQA 2WHLA 3D3AA 4H8VA 2BNJA 2GFTA 3AIWA 1MXGA 2VVNA 4UQ9A 5A2CA 5A94A 2O9OA 2ZUMA 1UH2A 4F66A 3RJXA 1W3HA 3U5YA 1H5VA 1JNDA 1CYGA 3FHAA 1FA2A 1PZ3A 3IJ9A 5FKYA 3WBEA 3BCFA 3U7BA 4PYSA 1EA9C 4URIA 2YIHA 3CZLA 1OWQA 3PZNA 2BHYA 1MWOA 4E2OA 2GVYA 4F8XA 5D9MA 1GQIA 3LMYA 1BF2A 3AXIA 2ZIDA 4FF5A 3VD3A 1QNPA 3DC0A 1BVNP 1JDDA 2CBUA 3WNLA 2AOSA 1ESWA 3K4AA 1XYZA 1QHZA 2J7DA 2HISA 3VMPA 4ZE4A 4S3KA 3WDPP 4AYSA 4GZJA 1QNRA 3CHCA 2BVDA 3PZVA 1UH3A 4Z2IA 1C8XA 2BY1A 2PWHA 3OBAA 2YA2A 2PBGA 4UFIA 3WMCA 1W1PA 4NSBA 2OSXA 3ZOAA 1VAHA 7A3HA 1CDGA 4A4AA 1VBRA 2ZWZA 4CCDA 3M7SA 1LJYA 3QHOA 5GPRA 1V3IA 3K8LA 4M56A 4QLLA 1TG7A 3UG4A 4HOXA 2B31A 8CGTA 5I79A 3VGFA 1MQRA 3OLGA 4EK7A 4HTYA 1VEMA 3CHDA 3WD0A 4CN6A 3SUUA 2BY0A 3PZIA 3MMUA 1GJUA 2XGIA 3BAYA 1DP0A 4KWUA 4J3UA 1ODZA 3WD3A 2DT1A 2VT0A 2XPKA 2WKLA 2WHKA 3MUZ1 4ATDA 4MTVA 2XYLA 1GHRA 2GK1A 1E6RA 1WB0A 5LYRA 4JFSA 1MW0A 3J7HA 3VX0A 1E6ZA 1E6QM 2ZX5A 3OZOA 1GVYA 2OYLA 2YBTA 3HMCA 4KRTA 2DT3A 5E9AA 4MB1A 1Z32X 3MANA 3KL5A 2XM2A 1QHPA 4ZXOA 1CEOA 4W89A 2G4FA 4M1RA 5I78A 1UWQA 4D1IA 1CXHA 3WMBA 2DH2A 3T08A 3WNOA 3AHTA 1OM0A 1JZ7A 4C7GA 3DYOA 4QCEA 5HXMA 3VD4A 3I3BA 2YL8A 4J3VA 2FHCA 4ZXLA 2D0FA 3ZSSA 1GCYA 4GO9A 4N0RA 5CXPA 4MDOA 3FN9A 4WJXA 1V0KA 2F2HA 1GORA 1Q4NX 1VEOA 1B30A 1ODUA 2XFFA 4E8CA 2QLYA 4LX4A 4J3XA 3N11A 1EDTA 3AIEA 1W1VA 4M80A 4ATLA 4X0NA 5A6BD 3N17A 4HA4A 4D6IA 3AHYA 3AMLA 1OSEA 1H4PA 1HJQA 2Q8XA 3B9AA 2UY3A 4K68A 3CMJA 4JL2A 3LPPA 3QHNA 4V27A 1RH9A 5HBFA 1BQCA 3FNDA 1UWUA 4W5UA 1B3VA 1QNSA 3WELA 2A3HA 5LA2A 2CHOA 1TFVA 4JIEA 4P8WA 3VMNA 3WUGA 2D24A 1B31A 4J3TA 3E1F1 4XUYA 1GPFA 2WB5A 4AWEA 3OZPA 1W2PA 1ZBKA 1ISYA 5I3DA 5M5DA 2VRKA 1XSKA 4J3WA 1EQPA 4GPNA 4MADA 2VJXA 2CXGA 5CLTA 2WCAA 1HJWA 4LYRA 4CKQA 2XVNA 1I1XA 2ZUWA 1HKKA 2IXVA 4F79A 1MVYA 4P7LA 3F5KA 3AXHA 3AMDA 5LA1A 3B8SA 4CUCA 3HJEA 3M46A 2VR4A 4PMVA 1DHKA 5DMYA 1UZ1A 2VCCA 1C7TA 3WDIA 4W7WA 2G8ZA 4AZCA 3A6OA 4XV0A 3MSGA 4LXFA 4P7RA 2J8FA 1XSIA 1PBGA 3PHAA 5ABFB 2WVVA 1XH2A 3ZT5A 3OLDA 1V3MA 3TP4A 5FOOA 1WP6A 3ZT7A 4FMVA 2IUZA 1HT6A 9CGTA 5FL1A 1Q6DA 3OA5A 1J11A 4UQAA 2DIEA 3ZT6A 2BHUA 1V0NA 1EDQA 3PZOA 1JZ2A 3NJ3A 2XM1A 4KH2A 3WFZA 4M24A 4LYPA 2D22A 3WF2A 4JHZA 5CSYA 1GOOA 1V6YA 2WCGA 4TX6A 4GIAA 3RM9A 3MUAA 2VL4A 3NSNA 3WBAA 2YA0A 1VFMA 3ARXA 4KGJA 2NW0A 1SYTA 2CEQA 3SCPA 1QI3A 3MV01 1H3GA 1W9PA 4P7OA 2CIPA 4B15A 5A2BA 1I1WA 1OCQA 4QCFA 2CITA 3BSHA 3BC9A 1GNXA 3CUFA 3BAXA 1NWUA 3WDJA 1E0WA 4M8UA 3EYPA 5AYBA 3WNNA 4YN5A 4JKLA 1MQPA 4BQ2A 1E73M 1HKJA 2DEPA 1HX0A 2W61A 2X0HA 4QLKA 2VVSA 3WDHA 2GJRA 2EJ1A 3RJYA 1OINA 1UA3A 4CCEA 1EXPA 3F5LA 1GQLA 3CIVA 4LGXA 4HA1A 4QDMA 2PWDA 2JEPA 1D3CA 2VZOA 3L4WA 2VR5A 1KGWA 1DWIM 4HPHA 3N12A 4WKHA 3W6MA 4IPLA 3EDJA 4HOWA 3U57A 3AXXA 5ECUA 1EIBA 4PBGA 3WH7A 3SCTA 3EDFA 3VDAA 1CBGA 1E71M 3A3HA 1OD0A 5E0FA 1HF6A 1LL7A 5JBFA 2VZVA 1XCWA 4DWSA 2EO7A 2NT1A 1E5NA 3BLPX 2JF6A 2OYKA 1CGWA 3ZR6A 1CXEA 3AMGA 1PX3A 2W91A 1N82A 1F4HA 1V6VA 3ZJ8A 1KXQA 2ESCA 3UG5A 2FGZA 4B9ZA 4U2ZA 3UERA 1D2KA 1CGYA 4PMYA 2WAGA 1VJZA 4NZCA 1FH7A 1UG6A 1ZS2A 5A6JA 4EKJA 1RPKA 4UFKA 4QFUA 1UD4A 1V0MA 3BAKA 3K1DA 1E6PA 1UD3A 3AICA 4AMCA 3AS2A 2J7BA 1EGZA 1UD6A 2XJ7A 1BFNA 3WF4A 4MAZA 1VRXA 1ZBVA 1UD2A 5I6SA 1W3LA 4Q7NA 1XHGA 4V28A 5CQ1A 5A8NA 3ALGA 1TR1A 3GZAA 3ZM8A 3VIOA 4CVUA 3TTQA 1HVXA 2YJQA 1UYQA 3SEPA 5DT7A 2J47A 4FLSA 2J62A 1HP4A 1GVIA 1WO2A 1E0VA 3TA9A 2W5FA 2YBUA 4H7VA 3VDCA 2JE8A 3ARUA 1E72M 2FGLA 4WF7A 2Y5EA 4GI8A 4ATWA 1VFOA 3BXWA 4R27A 1WPCA 3O6AA 4PMDA 2DSVA 2WHMA 2QF8A 1MYRA 1XCXA 2VC9A 2GK1B 5D9OA 1ISVA 1ZBCA 1U33A 5I2UA 5HNNA 5AYIA 3RMEA 3WH8A 1AQHA 1FHLA 3GH4A 2FHBA 3UETA 4MDPA 2ZX9A 1UHVA 3K8MA 2A3AA 1CWYA 4HU8A 1PJ9A 1BPLB 4DUVA 1R7AA 3VIKA 3ZIZA 3NUKA 3IANA 5D9PA 4UQEA 4WSJA 5A8PA 4UOQA 5AY7A 4PMOA 1B3WA 2VMFA 3GNOA 3VGBA 1V6UA 5GQBA 1ECEA 1PX8A 4NI3A 2OWCA 1B90A 1QOXA 1RP9A 2VX5A 4W7VA 2ZXDA 5BYWA 4PRWA 4Z2JA 2DPEA 4IISA 2PWFA 3AYSA 1W9DM 1VBUA 1PEZA 3VIIA 3NDYA 2GUYA 3OGRA 1M7XA 3THDA 4J3SA 1H49A 2VX7A 5F7UA 3WQ4A 2XVGA 1BSIA 1H2JA 3VTRA 1BAGA 1GOWA 4JAWA 3NSMA 1JYNA 3RDKA 4EANA 1UQYA 2JIEA 5A8OA 1B3XA 1UWSA 2DT2A 4P7QA 2E9LA 2GJPA 3SCWA 4H8HA 5HPCA 3PZQA 2WLYA 1E70M 6A3HA 1JYXA 3GXMA 4PMRA 3UCQA 1QW8A 5CPSA 1E5JA 1E6XM 4YHEA 2QPUA 1QI5A 4FK9A 5A69A 3A4WA 4PMNA 4HZ6A 4PN2A 2VZSA 2CPUA 1MFVA 3CUIA 1G5AA 1NOWA 4Z2HA 1J12A 1SR0A 3W24A 4DM1A 3AMKA 2J78A 4DWSB 4C7FA 2GDUA 4PTMA 1BHGA 5M03A 2WMKA 4IPNB 3NDZA 3W82A 1OIMA 3VNZA 1ZJBA 4OIFA 2EEXA 3WDRA 1GOQA 1MXDA 3RO8A 1QI4A 3WKZA 3T0AA 1KBBA 5I24A 1YHTA 4KMQA 2D3NA 1BTCA 4P7NA 1E4IA 5FCZA 3EDKA 1M04A 3IJ7A 2J77A 4OZOA 2WSPA 2VCAA 4TX8A 3T0DA 3SIMA 3MV11 2DSUA 3PZUA 4RE2A 2DT0A 2BVTA 4AXNA 1OBAA 1O7AA 1TMQA 4U5KA 5GNXA 3VDHA 4D6JA 5CPQA 1ISXA 5GNYA 1YQ2A 2CBVA 2CBJA 4W85A 1KR0A 3M6DA 4ZFMA 1KWKA 5E6ZA 1CZ1A 5D8WA 3PZGA 1GOKA 4OBSA 4U3CA 3SCQA 2JALA 3CZGA 5A1AA 4GI6A 3M07A 1J0IA 2V5DA 1JZ4A 1E3ZA 3AIBA 1E55A 3AJ7A 3CH9A 2BY3A 4UQCA 4AEEA 2CCRA 2OLHA 5I5RA 4PTVA 1SFSA 1CPUA 1LF1A 1E40A 1Q6FA 1KB3A 1W91A 4UR9A 3QOKA 5JUVA 3BSGA 2DSZA 1ITXA 4CN1A 3UESA 2Y8KA 2E9MA 4PUEA 1JXJA 1LL6A 2G3MA 5A2AA 2OWWA 4GQRA 3VIHA 2ZWYA 1Q6CA 1V3JA 3AS1A 4Z2LA 5EMYA 1BYDA 1W9VA 4GZEA 3CHFA 4HMCA 3EMCA 4GKLA 4AZIA 1GUVA 5DT5A 4AZ6A 1G0CA 1AMYA 2XWDA 1UR1A 1VFFA 4DWSD 4UCFA 1LLOA 3WSUA 3UR7A 2C0HA 4LYQA 1JZ6A 4MB5A 1WZLA 3TTYA 1QPKA 2GSJA 2VTFA 4GQQA 4CCCA 4D6HA 1HJVA 3AS0A 1QNOA 4MNKA 1AQ0A 1BVZA 2V38A 1IT0A 2A3BA 1UKOA 4P8VA 3SUSA 1H09A 1E56A 1K9DA 1UQZA 2Z1SA 3GNPA 4OOUA 3UR8A 2J74A 1KWGA 3AHZA 3AZTA 2XIIA 4M82A 2EPOA 2PB1A 1K9TA 2WMJA 3ARSA 1R7OA 1GJWA 3SUVA 5AC4A 2X09A 3AOFA 2DQXA 1GOMA 2W66A 2YL6A 4MB4A 3VPLA 3NCOA 3WEOA 1NM9A 4ACZB 5HDRA 1K6AA 2MANA 4WK9A 1EOKA 5A3HA 3AI0A 1JDAA 3PTMA 1TA3A 3JUGA 2XUCA 4CVWA 1A47A 3VDBA 1W1TA 3POCA 1X6LA 4BZYA 3CUHA 4CD7A 4U5IA 5JBEA 3KL0A 1ISWA 1W3JA 1E4NA 5BXRA 1BG9A 2X8RA 3FAWA 5A6KA 4UNIA 2XSAA 2CHNA 5E70A 1V02A 3TTOA 3WY1A 3ZQ9A 1C7SA 1UD8A 2BV9A 1DWAM 3N18A 3QOMA 3VIGA 1BYBA 3T2OA 4AIUA 1VJSA 2J7EA 2YDQA 2WMIA 3O9NA 3SCNA 4LQ1A 1DTUA 1UKSA 3VD5A 1BGGA 1BYCA 3VOCA 4U33A 3HN3A 2C8NA 1D7FA 3APGA 1HKIA 1FFRA 4W93A 3ZR5A 2O92A 4M81A 4QLJA 1LWHA 3VIFA 4B9YA 1Y7VA 2D20A 4JFVA 2GDVA 2W63A 1CXLA 3MMWA 1WNOA 3TONA 2WM0A 5E09A 2Y4SA 2XGBA 2WHJA 1TE1A 3DHPA 1V6WA 1OT1A 1XSJA 3W38A 1GONA 2ZUSA 4GXPA 3AS3A 2OYMA 1V6XA 4YHGA 4NRSA 3CTTA 3S6TA 5A6AA 5ABHA 1NQ6A 4PCTA 3GH5A 1H1NA 4EAMA 4FLRA 4AIOA 2YL9A 5KEZA 2EPKX 1WE5A 3WFLA 4A3YA 4W5ZA 4CU8A 5A8QA 4AZCB 3GH7A 2VURA 4OKDA 1HL9A 4JCLA 3SUWA 1XH0A 5A95A 4AZGA 6TAAA 1MFUA 3W4RA 5IFPA 3CGTA 1W9UA 5JIPA 4J28A 1DWFM 4UOZA 1PIFA 2FH8A 3VILA 1JFXA 4CD8A 3DHUA 2WZEA 4MPKA 1V3HA 2WMHA 3G6LA 3SCOA 1CENA 2PF0A 5EBAA 5EB8A 4LPCA 1HL8A 3ZMRA 1G9HA 1G01A 4C7DA 4ML4A 4PEEA 1KCKA 1V0LA 1CGTA 2CKRA 4D6EA 5BWFA 1GW1A 3OGSA 2NSXA 4UZSA 4JFTA 1B3YA 1E1EA 1E1FA 2VQTA 2E8YA 3WEMA 2ZX7A 3BMVA 1GOIA 3MUIA 4J27A
chains in the Genus database with same CATH superfamily
1H0IA 4UQBA 3QTGA 1FRBA 1JNEA 2PLCA 2ACUA 1D3HA 5DBTA 3NGJA 3BV7A 3LPFA 2WK2A 2ZZ3A 2NUWA 1JZ3A 1UKPA 3M47A 3MSYA 3VE7A 4GIRA 1K7FA 5HNTA 5KZEA 2NQ9A 2NLIA 1WZMA 3TOYA 1TV7A 4K39A 2TYSA 1FWFC 3CUGA 1LRQA 1GWJA 4GI9A 5G1YA 4RL3A 1N7KA 2EG8A 1L9WA 3SRDA 3UYIA 1W0MA 1UH4A 3I7QA 3AZRA 1DVJA 5T9CE 3T4WA 2OQHA 3C2YA 1J2BA 4JHMA 4S3BA 4BQ5A 3IK2A 4ASTA 1I60A 1TVNA 3QW4B 3SCUA 3F4VA 4GI4A 3PTKA 2C79A 3T2QA 5CAKA 2VI0A 1O12A 2E9BA 1BQGA 1P6WA 1SFTA 4AW7A 1T96A 1VF8A 5CGMA 3RCNA 1WAUA 3UCCA 2NXGA 3VM5A 3PNUA 3W23A 1WDDA 2WC7A 2EPNA 1IYXA 3L65A 1AFSA 2A4AA 3I3EA 1QR7A 4HPNA 3SR7A 4NX0A 4H7ZA 4DUOA 1XPYA 3LBCA 3UPMA 2YL5A 5BW6A 4CQDA 4RE0A 1EF3A 2V3EA 3RIKA 2WKJA 2P0OA 2OR2A 2Y62A 4EXBA 5D9NA 1G1YA 4Y90A 3MSDA 4WGHA 4A21A 2F8QA 1LG2A 4MYAA 4H9MA 3SADA 4NAFA 5IBXA 4PL1A 1AUSL 1ZJAA 1IIHA 4GO8A 3FFSA 4C90A 2QCMA 2PWGA 3I6RA 3VMOA 4RNFA 1SM9A 4HNVA 2EPMX 3BDKA 3AQUA 1CB2A 5HUOA 2WVSA 3W29A 1BKSA 3PK7A 3VDGA 1FP9A 3V0TA 2P5NA 1QPOA 1HKWA 1CGUA 2WSKA 2ZUUA 3R0UA 3URAA 1GVRA 1AD1A 4GACA 3F2DA 2RAGA 3N29A 4LAKA 4DPQA 3QMTA 1FCBA 1P7TB 1JI1A 5M17A 2XDFA 4H01A 3S1XA 4PCNA 1IWAA 2NV2A 3L2MA 4DBDA 1J4EA 5IBXC 2Y2WA 3F5JA 1WXYA 3ERPA 3TQVA 1GKRA 3ITOA 2D1ZA 5FACA 3WLPA 2F38A 4IX0A 1E3XA 3LRMA 1NFGA 4IQEA 2W92A 8A3HA 2WJDA 3SSJA 3EDEA 2ZOXA 1HKMA 3W02A 1E43A 1KFWA 1TZ7A 3ANYA 4ZMGA 4JCMA 3AUJA 1KQZA 4AEOA 1IR1A 1TTIA 1VPYA 1C90A 3MUY1 1VP5A 3PY2A 5I3GA 2PDJA 4JL1A 4N4PA 5C70A 1IZJA 2PU1A 4LVFA 1WBHA 3T0BA 4B16A 1PKMA 3SRKA 4FNTA 3PPCA 3REQB 1JGIA 4AHPA 1O5QA 3IWPA 3OQ8A 1JPDX 2ATMA 4GVGA 2G97A 1IZKA 1Q6EA 2FZMA 5KZDA 2VQUA 2E7FA 3AYVA 2FGBA 2V5CA 3U48A 1V6TA 2VZUA 5K9XA 1NWSA 1QU4A 3DAQA 4HU4A 3QY8A 3PTQA 4LEQA 3TW9A 4YLWA 1GZJA 5ABTA 1DWGM 4UFJA 2QZRA 1B1YA 2WLZA 1SUXA 3S2MA 2ADAA 2AKMA 3VO0A 4GCXA 1V7AA 3U2CA 3ZO9A 4GOAA 2ACQA 3HF3A 3M1ZA 3ABZA 1S1PA 3V3WA 3IPWA 1H62A 4NZ4A 3TCSA 2OZ3A 2ZICA 3LCHA 3PUDA 1E9IA 4H00A 3R11A 3CL7A 3N6JA 4CGTA 3BH4A 2Z1KA 3O0KA 4J2MA 4LUJA 4W88A 2YDRA 2PLJA 4QDPA 4RNHA 1ONWA 3CYVA 3NZ1A 2UWFA 1B4KA 1W3KA 2OQYA 2O7SA 4MVAA 3CQHA 2ZX6A 4MWAE 1WXJA 2WQPA 1VQTA 2XN2A 4HNCA 4C60A 1A5SA 4E4PA 1DIOA 3S9YA 3FYOA 2WKGA 4AZBA 4CD6A 4JTHA 3HBLA 4TTUA 5I3HA 4GH1A 2PDLA 3ITXA 3GIPA 3N2TA 4JOMA 5BXSA 5AHLA 1JZ8A 1A5AA 5HNRA 3AIQA 8XIAA 1OYBA 1ITCA 1O4UA 1P48A 3W28A 3WF1A 3C0QA 3C8NA 4H04A 4R34A 4V2XA 3D47A 4HA0A 4U2YA 4M3PA 1A5KC 3PPHA 3P3BA 3HTWA 3M0KA 3IRSA 3V0UA 2Y7GA 1XC6A 3U3HA 1ISZA 2J8TA 5AHNA 3EMZA 1KM4A 1OX4A 3QHMA 1PZ2A 1XYMA 1FP8A 3E74A 3W2MA 1XXXA 1C93A 3V35A 2VEIA 4O54A 2VHLA 3GWQA 3UVAA 2YYUA 3UWEA 1WZAA 1K8ZA 1JF6A 1NDWA 1TMHA 2Z1BA 4TOQA 3WLLA 5CGTA 1XIHA 3MP4A 1TTJA 2NX3A 1NVMA 1XD1A 3MCNA 3GKFA 5BRPA 2VOMA 4JHOA 5HOSA 2DUAA 1X1OA 1B54A 3CPRA 3B0YA 3NG3A 2UY4A 3F4DA 4RKAA 4DI9A 4GFIA 2NQLA 4ZB5A 4KWVA 3CQKA 5D8ZA 3SN4A 1OFPA 1XF0A 3OP2A 2E40A 3PB0A 1R2RA 3BLLA 3KL3A 4UTIA 3EB2A 4TMCA 4LU0A 1NOUA 3LOTA 3GW3A 5A6SA 1NDYA 4Q8QA 1VBGA 2NV1A 1XLKA 2YGYA 5CG0A 4HPGA 1AH3A 2BFGA 2W67A 3H2AA 3ZVIA 3STFA 4N9EA 3SCSA 3LPOA 4X61A 4K1GA 3RILA 4A3UA 4X9YA 1W9BM 3W76A 1UW9A 1M53A 3TQ0A 3OPSA 2E28A 3QY6A 4XZ9A 3S6OA 1UP2A 2PDMA 4KEUA 2INFA 1OGSA 3K4DA 5D04C 5I3IA 3M7WA 2NT0A 4PCPA 4DWSC 3DU0A 3L4YA 4WQ6A 3VKBA 4Z2KA 3MZNA 4RZ5A 3EOLA 1OD8A 5IDIA 3RM8A 1C92A 1HZYA 3AFBA 4PFHA 2PI6A 3VGHA 5FD0A 4EPDC 2OT0A 5BOFA 2Y7EA 2HSAA 2OKTA 1YTEA 5CPTA 1E4MM 2Q3OA 1GQNA 2WW5A 1M7JA 3UNDA 1XH1A 1D9EA 1VEPA 3AISA 3TYCA 3ID7A 1JF5A 5HJLA 1A5NC 3GBDA 2Q8ZA 4Q8WA 3GDKA 2QCNA 1AJ2A 3WLRA 2VD8A 4GXMA 1D7KA 5I06A 3VUPA 2VXNA 1A5LC 5CGQA 2GWNA 2PWVA 3MI6A 4H41A 3TR9A 4OFCA 4GVIA 2GJXA 2OX4A 4X0VA 4JICA 1OF8A 2EG7A 1JCJA 2B7PA 2PBOA 3WD4A 3VU2A 4KEZA 1DJXA 3POHA 3KE0A 1E0XA 3LU2A 3AHXA 5KITA 3GTFA 4NILA 2Z2BA 4PSRA 4IUGA 1T5AA 4M29A 4ZQMA 3T81A 4PCSA 1RK5A 1F4AA 1VENA 3NQVA 1JEZA 4N9BA 2VOTA 3MTWA 4CEXC 3HOJA 4AD5A 1A53A 3UR5A 2HCVA 3DFSA 5C8BB 3MJYA 1N2VA 3W81A 4J7RA 1BXCA 1FY6A 1R86A 3MWAA 5D02A 5B7YA 4BCEA 1I2PA 5HNUA 2ZZ6A 3JW7A 2YXGA 3VD7A 3LNMA 3W1AA 4Z1AA 1EA0A 4FLQA 3YPIA 3TNOA 2CXEA 2WVTA 5C71A 3WUFA 1W31A 2V3DA 1US3A 1VPXA 2FTWA 4LEFA 1EGVA 1TQXA 1FHVA 3D5HA 1SFJA 4BFAA 4KKXA 1MUCA 1PHWA 2DFAA 3TYZA 1UUMA 1XKYA 5EKYA 4HK5A 1NWTA 1TIMA 2NZLA 3TJLA 3LTPA 3UYCA 2VEKA 3BSMA 1FH9A 4FXSA 2VD9A 3SY8A 3CZJA 5A6BA 3QR3A 4Z1CA 3PB2A 4BQ4A 1TA3B 4PMZA 4DELA 3K46A 2QUNA 2DZSA 4HA3A 5JXQA 1ECQA 3NYDA 4Y7EA 1FH8A 3S42A 4Z0JA 1XFBA 2JBMA 3KZSA 7ODCA 3ALFA 4JD4A 4GFSA 2X05A 3W2KA 4JTGA 4WD0A 3N14A 2VUYA 3L4ZA 1NP0A 3R12A 5G1TA 3G5EA 1M01A 4QBXA 4CNOA 2QAPA 1OT2A 3I6EA 2G3IA 2A0NA 1E6NA 1G4TA 3LGGA 1PZ0A 1W2VA 3H24A 3LCLA 2PWUA 3IJLA 1C8QA 2JF7A 3DG6A 1UIOA 1JUKA 4DXKA 4O15A 1MRQA 3M5YA 3WLKX 2XH4A 3TLQA 1XQKA 3CUJA 3AAMA 4BWLA 1TE6A 4D6GA 4QTGA 2E6DA 3C2RA 1YKWA 3NWRA 4LY4A 3GG1A 1M68A 1MEHA 3DI1A 4C6QA 4DM2A 4O52A 3UGRA 1WKEA 1RALA 3PTDA 3IGXA 1XKJA 4IM4A 4HZ7A 1BWLA 3DKJA 4M1BA 1UWTA 1WZKA 4PMUA 1JRCA 3W84A 3CIWA 3IVSA 5TQLA 4UMBA 2Z0IA 2YDSA 3NL6A 3INPA 1JPHA 3LGDA 5AYZA 1DJHA 3S5NA 3L67A 3A64A 3FW6A 4AD0A 4HP5A 4LAUA 3QKEA 1YDVA 1DV7A 4F0SA 1X8CA 4WDTA 3H2FA 3RPTA 1V02E 1H50A 2W6RA 3UXAA 1JFHA 4KGLA 5CPMA 1TR9A 2F61A 5C5YA 1OGBA 2C16A 2ON3A 1FFQA 2X0SA 3WLOA 1JR1A 4H8VA 2GFTA 2QGYA 2VVNA 1SZEA 3I10A 4L4MA 5A2CA 1XCFA 1L6FA 2V6AA 2SFPA 1W3IA 3UWUA 1W3HA 1H5VA 1PZ1A 1JNDA 1CYGA 1FA2A 5GJPA 3VC6A 1PZ3A 4Q8PA 4S39A 3B8TA 1M41A 2GQ3A 3WBEA 5GVJA 3U7BA 2XSXA 3HA1A 3TMQA 4KCWA 1EJVC 3ABXA 3PZNA 2BHYA 1M7OA 3QR1A 3N9SA 5D9MA 3K1GA 2XISA 1X7FA 1F05A 1RCOB 3DC0A 3P5YA 2CBUA 2IKHA 3G1YA 4YWSA 1XYZA 2BP1A 2DJXA 3WDPP 1RLCL 4GZJA 3GVGA 3SY1A 3PZVA 1UH3A 1FBAA 4X9SA 4Z2IA 1C8XA 7REQA 4C5ZA 5F4XA 2JGQA 3BLDA 2IPJA 2ICSA 1KTCA 7A3HA 1CDGA 3W7QA 5FAJA 3OA3A 4V33A 1Q4WA 4RNIA 3FJLA 1V3IA 3ONCA 4US5D 4NG3A 3K8LA 4M56A 3UG4A 5HMFA 2ZKMX 2DZVA 3VGFA 3GYEA 1VYRA 3HPFA 1VEMA 3WJZA 3FJNA 3W1PA 2ZZ7A 1WKFA 4CN6A 3P2VA 1CCWB 3EEGA 1GJUA 4HCDA 1XGDA 2VR2A 1J5SA 3B0VC 3CQ0A 4KWUA 2RKXA 1ODZA 1BF6A 3EX3A 4YMZA 5H8PA 2QVNA 3CS2A 5K3VA 3TA6A 3CQIA 2XYLA 1GHRA 4MTVA 1Y0EA 1WB0A 3QMRA 4LUYA 1MW0A 1MSSA 4E2VA 3IV3A 4L56A 4TQTA 3QJAA 5E9AA 4MB1A 5DXYA 3MANA 2G4JA 3QLDA 3W75A 4AUBA 4PMJA 3GFYA 2G4FA 4I90A 4DRSA 4A8IA 5A6TC 4O14A 3TWBA 1LT7A 3T08A 4B4FA 4NJGA 1HKVA 2XIQA 2YCLA 4C7GA 4QCEA 3I3BA 4J3VA 2O4QA 4ZXLA 8RUCA 2H9AB 5CXPA 4GX9A 1V0KA 3PPFA 4K2SA 4IFKB 2XFFA 5C6MA 4UR8A 2QLYA 4MJZA 4OGZA 5EPDA 1W1VA 4DJEC 5D2VA 4D6IA 3AHYA 4AVNA 1HJQA 2Q8XA 3B9AA 3KTCA 4GD0A 4G7EB 3RMJA 2PLMA 3LPPA 3W1TA 4V27A 3ITLA 4C6OA 3W2JA 5HBFA 1W6TA 2CHOA 3CPGA 2GSHA 2Z25A 4G1KA 2D24A 1B31A 3E1F1 4XSMA 3EWXA 4HIBA 1GPFA 3UQNA 2QQ6A 3ZLHA 4L64A 2VRKA 4HSHA 2QVHA 4PUKA 1OCBA 4GX8A 4HNLA 2VJXA 1Y8BA 4A2SA 2FMNA 4IX2A 4CKQA 5C9UA 2PDHA 1XG4A 4ERGA 4I9TA 2RHGA 4F79A 3W1RA 3F5KA 2R24A 3AMDA 5LA1A 4CUCA 4XAGA 1R0MA 1LP6A 1C8VA 3HJEA 2B0MA 1XLDA 4PMVA 1UZ1A 4W7WA 4KQNA 3A6OA 3PJXA 4F0LA 2H3DA 3FGCA 3KVLA 1QCWA 3OVRA 1XSIA 3ATYA 1PBGA 2J88A 2OZ0A 4I7UA 2PP3A 2IKJA 4Q8NA 3TP4A 3G3MA 5HR7A 4FMVA 3BJFA 2IUZA 3R7MA 1J11A 3FCPA 3QYQA 2DIEA 4GCAA 2CWXA 2ACSA 1PE1A 1OY0A 3OZMA 1V0NA 1BXBA 4JEJA 4V15A 4TMBA 2PTWA 3MUXA 1S5TA 4LYPA 1XISA 2UZ9A 3TKFA 4MHBA 2D22A 3WF2A 1AA1B 1ZJIA 1V6YA 3EGJA 3O63A 4U4MA 3B9OA 3ELFA 4FPSA 4G1NA 2VL4A 2HROA 3NSNA 3QSRA 2YA0A 1F8IA 3GVQA 5HANA 4Z1YA 5K4XA 6ENLA 2QEZA 1N55A 4ERIA 4EAYA 2CEQA 1H3GA 4B15A 5DANA 5A2BA 2R1NA 2YB4A 1OX6A 1V4YA 4O1EA 4PGLA 1LYXA 2CITA 3BSHA 3BAXA 1NWUA 5CZJA 1R3WA 4DYEA 2YBVA 5H6HA 2VM8A 4JX4A 2DEPA 2X0HA 4R53A 1XPGA 2ZADA 4LBSA 3W7MA 1OINA 3C5QA 4Q32A 1EXPA 1GQLA 4RZ4A 1B5TA 2GSEA 2A2IA 4WY0F 2HV5A 2PWDA 3B06A 1D3CA 2VZOA 1R3RA 4QROA 1H7XA 3REQA 3A24A 4GUFA 1U83A 1TJRA 4O8RA 2FPTA 4IPLA 2E6YA 4HOWA 3U57A 3AXXA 1MI3A 1DHPA 3PFRA 2OGJA 3EDFA 1E71M 3PJWA 3ZR4A 4EACA 1OD0A 3GQYA 1LL7A 3W7JA 3GIQA 4L1XA 3DHDA 4DZ5A 5JH1A 2WOQA 2YCEA 3MVTA 5FF2A 4IPIA 1CXEA 2W91A 4L7ZA 1AJZA 5B80A 4E4UA 2I5QA 2FGZA 4B9ZA 1PDZA 3RU8X 4PMYA 1VJZA 4NZCA 5A6JA 2YR1A 4QX4A 1PCKA 1UD4A 3K1DA 3H55A 3TXZA 4UTMA 2OOFA 2NWRA 3P93A 4AMCA 1HO1A 4FB7A 1UD6A 2GUBA 3GC2A 4B2DA 2XJ7A 3LM3A 3WF4A 3KTXA 1MEIA 3P80A 3HPZA 3QVQA 1UD2A 1XHGA 3LSCA 4MGGA 5A8NA 5KTLA 3NO1A 2VC5A 2XH7A 3BL3A 3UPBA 4CVUA 3BMXA 1HVXA 1UYQA 4DJDA 3RUBL 4E4FA 2J47A 4FLSA 2J62A 1HP4A 2YB1A 4HVXA 2NXHA 3TA9A 3IUDA 2JE8A 1E72M 4ZODA 2FGLA 2QW5A 2Y5EA 2ZC1A 4ATWA 4N02A 5CAHA 1VFOA 5AHEA 3BXWA 4LY8A 2ZRWA 2WHMA 3TNBA 1PB0A 3VC5A 3P60A 5D9OA 2PEVA 1U33A 4O8AA 3MZ2A 5C7HA 3HPAA 5AYIA 1AQHA 1FHLA 2HBVA 1UHVA 2A3AA 2GGGA 3B0UX 5E93A 3H2MA 3IANA 3VOJA 5D9PA 4UQEA 5A8PA 4DO5A 1SZFA 4WR3A 1VZWA 3GNOA 3C2FA 1V6UA 1PL9A 1DORA 2W79A 1PX8A 4IMAA 4NI3A 1HGWA 2TRSA 1ZAHA 5HQLA 2DPEA 4FXRA 1FWRA 3KW3A 4MPQA 3VIIA 3NDYA 1KRAC 1TJ1A 4A3QA 3OGRA 5AC8A 1H49A 2VX7A 1ZRQA 5F7UA 2XVGA 3GFXA 1BSIA 1H2JA 3VNKA 1BAGA 4JAWA 4H3DA 1XIIA 4JYDA 3CT2A 3P14A 2V68A 3KVMA 4S3EA 3TAOA 3W85A 5FF7A 2E9LA 3IJDA 1FWCC 5DY2A 3PZQA 1UZHA 1JQXA 5AB3A 4B5VA 3C2VA 2QUTA 2JQXA 2CLFA 2R8WA 4DBUA 1YPFA 3L0GA 2PODA 3GHSA 1ZPTA 2Y8UA 4PRTA 4HB7A 4HZ6A 2REQB 3CUIA 1QWKA 4C7FA 1WOAA 4KFPA 3DIPA 4IPNB 3GW0A 3NDZA 1OIMA 3MYPA 1ZJBA 4KFNA 2EEXA 1GOQA 3SM0A 3CV6A 3RO8A 1QI4A 5T26A 3T0AA 1EZWA 2D3NA 2ZFAA 5AZ0A 3CM4A 2YW4A 5CBBA 5FCZA 3IJ7A 3PZUA 4RE2A 2DT0A 2CZEA 3CQJA 1JCXA 5BU9A 5U4NA 4XTIA 2DP3A 4BEQA 1TMQA 4NT0A 2PDNA 4LBUA 5CPQA 1NDVA 2VC7A 2OKOA 1OC6A 3KOWA 4GJIA 4ICNA 4A35A 3H6OA 3LX9A 1KR0A 1JPIA 2HS8A 1TVLA 2DZXA 1KWKA 4FSAA 5E6ZA 6TIMA 1UMLA 1EUNA 1VR6A 4H9XA 5DCBA 4FNUA 2XFWA 1XICA 3SCQA 5A1AA 1TO3A 3KHJA 2FB2A 5I3KA 1RZMA 4GNJA 1E3ZA 4A8LA 4IXXA 2B4GA 2X1UA 4QGCA 3WBWA 5C9WA 1OK6A 1KB3A 4JN7A 4QJ5B 1RPXA 3QOKA 5JUVA 3BSGA 1Q3NA 2DSZA 4V1YA 1DE6A 4CN1A 4P2VA 2QUVA 4IIDA 3N2MA 3GR8A 2G3MA 2ZCGA 1AODA 5MHBA 4KCVA 3VIHA 1RJQA 4A6GA 4WVXA 4E8GA 5EMYA 1WA3A 1O68A 4HMCA 3DG3A 4AZIA 3TJIA 4EPBC 5AFDA 2XWDA 3Q65A 1XLBA 4MKNA 1UR1A 5REQB 3ZYZA 1RLDA 4GUIA 4AXKA 4EPKA 1JZ6A 4ZOCA 3TC3A 1ZGDA 3N34A 4H2HA 1TMLA 2GSJA 3DKLA 4DXXA 1QNOA 2NUXA 3IJQA 5DBUA 2A3BA 1BRLB 3CAVA 1K9DA 5CKSA 1FWHC 3G3DA 4XUGA 3UR8A 2H6RA 5HJXA 2I9EA 3AHZA 3AZTA 3P8IA 4M82A 3W71A 1K9TA 1LOSA 5DN1A 5AC4A 4S2BA 2W66A 1J6OA 4DIAA 4JQ3A 4ZTXA 1GKQA 4S3CA 2PDUA 5A3HA 2C0AA 4Q6XA 3G1XA 2Z26A 5D03A 3QYSA 3RO6A 4R88A 1QOQA 1W1TA 1P0NA 4GMEA 3CUHA 1DJGA 4BZYA 4O4VA 3KL0A 4O1DA 1W3JA 2UBPC 2VWTA 4WDWA 4NQ1A 4NZFA 1BG9A 2X8RA 3CXOA 1EC8A 1NU5A 2VFDA 4UNIA 1XLJA 4Y9PA 4IFOA 1XLLA 1BD0A 2CHNA 5E70A 3TTOA 3WY1A 3U9IA 5GJNA 4F0HA 5LZLA 2BV9A 2FZNA 3HQOA 3T2OA 3QRHA 4JNMA 2AL2A 5CJNA 1XX1A 1D8WA 3W70A 2C8NA 2DZBA 4L5ZA 1YE6A 1BSLA 1R6WA 1EB3A 3WBYA 3ZR5A 4QLJA 3LHUA 3GC5A 4JFVA 3MMWA 3LTSA 4JYEA 3LB0A 1FVPA 2Y4SA 2RH9A 4H4IA 4LVGA 1RSCA 2WHJA 1TE1A 4UMCA 4A8RA 1GONA 5U7SA 1V6XA 3T0TA 5ABHA 1NQ6A 1UCWA 1W5QA 3GLCA 5AC6A 3GH5A 4QJ1A 4EAMA 4AIOA 2EPKX 1P0BA 3M5XA 1WE5A 4WGXA 5FA5A 4DPPA 1HL9A 4JCLA 5KSWA 3LEPA 4IQDA 4B5UA 3S83A 2XH2A 4NAEA 3W4RA 3NTYA 1A5CA 3UT0A 3QXBA 4NKCA 1YX1A 1XLGA 4ZQOA 4PR4A 1EL3A 3GAKA 2NVAA 3MDUA 3G6LA 1VCGA 4D2JA 3S46A 3TXVA 3BZGA 4CNPA 1GG1A 5EB8A 4LPCA 4CEUC 3TYEA 4C7DA 1KCKA 1V0LA 5DMMA 2CKRA 1KCXA 4S2CA 1TPVA 1B3YA 4MWAA 1E1FA 2VQTA 3NZGA 2QJGA 4HPXA 4IP5A 3T4CA 2ZX7A 5EMKA 3GR7A 1J01A 3JU2A 3S2NA 2YOCA 5GJMA 3NQEA 4J35A 4BF9A 1NTHA 3G1VA 4GY7A 4LH8A 4WXYA 1UMYA 4D6FA 4OOZA 3ABSA 1H41A 3MBFA 3EOUA 2WYSA 4ADSA 4N4QA 1A0EA 3VK5A 1RA0A 2XVPA 4CD5A 3WNMA 4FZIA 4RUBA 1KV5A 1SJBA 2PDGA 3TFCA 4NZ1A 2QDGA 2XIJA 4IGMA 4GQGA 3BW2A 3P8JA 4HMNA 4NJJA 1V51A 1DEDA 1VIWA 3KAOA 2WZHA 1NFBA 5C55A 3CNYA 3WN6A 3ARZA 3E38A 1SW7A 1QASA 1RBOB 5EGRA 3URQA 3OHIA 3FXGA 2GL5A 2GVLA 1DWJM 1LCOA 3MMDA 4U31A 3ORWA 4W87A 4JTUA 5LNUA 1FWGC 1H7PA 4OECA 1UZ4A 1G6CA 3B40A 2WZIA 3PBWA 1IWBA 2Y5SA 5BROA 4Q33A 4ZO7A 4CN4A 2XZ7A 5TIMA 1JCMP 4Z42C 2YLLA 3UR2A 1EWEA 1C9DA 2PTXA 3PAOA 4S1FA 4RR4A 2Y0FA 4RE4A 2BLEA 1SZRA 1KCLA 1LZOA 2GJLA 3NPWA 1Z44A 3WQ5A 5FEZA 2QV5A 2D0GA 1VHCA 3CMFA 4AY1A 2BXZA 4DZIA 2GDQA 4GIEA 4HPJA 1XGZA 1GJPA 1KW1A 2ZTKA 3U5UA 5CCZA 1JZ5A 2J27A 3GHUA 4CCZA 3N4EA 3THCA 4KIRA 4H2CA 3F1QA 2QJHA 4ROPA 3V1PA 4P8XA 1JL8A 1AL7A 1MDRA 1OJXA 2CKSA 3E0FA 4ES4A 1A50A 1LORA 2BVYA 4XZBA 3ZJ6A 3COTA 1J18A 3W7NA 4AYGA 2G3NA 3SQLA 1W1IE 3PZ9A 2O9PA 2P3ZA 3DFNA 1CNVA 3APYA 3HGRA 4DVOA 5E5CA 3GG0A 3MWCA 4OTKA 4GYFA 4MNMA 2FKPA 2FH6A 1BYAA 3RPDA 1NWRA 4ACZA 1KFCA 1EDGA 3UA3A 3AMCA 5C2XA 2WANA 2PRMA 3OVPA 1DJIA 3AALA 1TB3A 3LHVA 4UFHA 3DECA 3TDFA 1F9CA 2BB0A 3UD6A 3M0XA 3S2CA 4S3GA 1F74A 3BG5A 3KP0A 1DYSA 1J0JA 5LNWA 5I7GA 2ZBTA 4KS0A 1H7NA 4WKFA 3EDDA 4WY0A 2G0WA 3C52A 1WDQA 4XAZA 2TAAA 3W1XA 4BY3A 3N13A 1E1CB 2EG6A 1OVDA 4MB3A 3QEZA 2XIBA 2TMDA 1EP2A 3B9EA 3CO8A 3GTXA 2CZVA 2E3ZA 1FHDA 2FMOA 3KLKA 1SW3A 4IHCA 3NQBA 1ZU8A 3IEBA 2R1MA 1UR2A 1R5YA 1UD5A 1XRTA 3HGOA 4JDYA 4QEHA 5F1UA 1Y5VA 4XZNX 2HXTA 2B7NA 2KZHA 3DEQA 3O2LA 1FWIC 4ORIA 1S3TC 4PMXA 2OQLA 3KRBA 4W9TA 4QR6A 3ITTA 4IP4A 1RJPA 1B0IA 2IKGA 3UBPC 2WNNA 3C2OA 3KEHA 1QOPA 1AH4A 4QS5A 2F84A 1H51A 1UC4A 1AVAA 4ZQRA 2J75A 4TO8A 2ZYFA 3RX4A 1QBBA 2F6KA 1HVQA 3TV8A 3GU2A 3A4XA 4JGDA 5K4ZA 4JTLA 3QQWA 3NSXA 5J04A 3WIJA 1ZB5A 3BCDA 3GUGA 4E5TA 1KBKA 2QHAA 3CV7A 4GK8A 3E0IA 4X2PA 4WHBA 1VKFA 2FFCA 1OIFA 3QFWA 2R1LA 4HYRA 3ARWA 1OFQA 4IH3A 4DJFC 1HO4A 1BG4A 2HVMA 3C3UA 1GVFA 3WNKA 3DX5A 4MJ4A 2QKFA 4S3FA 4O18A 2PDXA 4NZ3A 7ENLA 3GG8A 1I9CB 4AH7A 3R6IA 2AL2B 4I5XA 5H8UA 4ZTYA 2V3GA 3NO3A 1DQWA 5D33A 2NQHA 1LWIA 4BEUA 1RP8A 2GJNA 2OEKA 4Y9NA 1JIBA 4CD4A 1ML1A 1WAWA 1K77A 3CAWA 3N4AA 3MBDA 1MUWA 3RAOA 4RV3A 1C29A 1LTDA 4M7TA 3UZXA 1SO4A 3NZPA 3ARTA 3JZUA 2IQTA 3LS9A 2G5WA 3WLTA 2YYTA 1CT5A 1ZNNA 2WSRA 2X16A 4ZQPA 1UP0A 1JD7A 2QDHA 1CECA 3WL1A 4Q7IA 3I65A 2J7CA 1XBZA 1I0DA 5K9CA 2C18A 3MCOA 2Z00A 3BAJA 6CGTA 3LRLA 1OCJA 2FQIA 4TV6A 2ABAA 1GK8A 3NURA 2PDKA 3R8RA 5D4YA 4WLCA 1X1ZA 3GTNA 3NPXA 2GQAA 2IKIA 2OZ8A 4JFWA 3BCJA 5F2LA 4AEFA 1WDSA 4LUTB 2P0IA 4LS1A 4MZYA 1H1YA 3ARQA 1KTBA 4DJDC 5CJ5A 4UTTC 3ZSTA 2BOEX 3N15A 1FWBC 1S5WA 5E0CA 1XIMA 4EOUA 2XFRA 1HL2A 4A2RA 2WWCA 1GQJA 3EKZA 3S3GA 1XIFA 4Q8TA 3W27A 3TYBA 3WDQA 3PF3A 3W0KA 1XIEA 3GNXA 1J8VA 4AHQA 1ZQ5A 2Y88A 2TPSA 3O0FA 4LYKA 4PSPA 2P8BA 2Y8VA 3BPWA 4Y8FA 2ZUTA 1OG6A 2OEMA 2Z6IA 1NH6A 2Y6ZA 4DWDA 3W3OA 3CL8A 2X1IA 2C13A 1HJUA 4Z08A 1R87A 2Y70A 2JGYA 2ZUVA 4K6AA 4Z0SA 4KBXA 1C8YA 3GM8A 3N04A 1Z89A 3CU2A 2BOGX 5EMMA 5A6LA 2J9XA 4C6CA 2EGZA 4F9JA 4J9JA 2XINA 1PPIA 2OZTA 4HMEA 5LGXA 4EF9A 3AUOA 1PXGA 1F5ZA 1Z6KA 3CB3A 2Q09A 3HO8A 3W7GA 1J0HA 2GUUA 4C1NB 3GIYA 4AMAA 4XZLX 3KHDA 1EO7A 2GJXB 1R2SA 2DY3A 4ZVJA 2JEQA 4L6DA 5EA9A 4PUNA 5ABGA 4L9YA 4GVFA 3UY8A 1KRCC 1KO0A 2BODX 4LNYA 5CLWA 4Q4QA 4MJMA 4FO4A 3B8UA 3QGVA 4F9DA 3W01A 3KCLA 4F48A 2G3JA 4GGHA 2XWEA 3E2VA 3CUXA 3ARRA 5DX7A 4PC8A 4UZUA 3CL6A 4GZIA 2V82A 3IJ8A 4H6QA 4AWTA 5CZ0A 1U30A 2R82A 2WBKA 1AW1A 2PWEA 4MNLA 7CGTA 4D8AA 5L9FA 4YVXA 3URBA 5KZ6A 3BLIA 1RD6A 4I6VA 1HP5A 4JIQA 4WIWA 2WPGA 4XD6A 1O60A 3NM1A 4F0KA 3PG9A 4PTXA 2KX9A 4NNAA 2D2JA 3OLEA 1YDOA 2OELA 1CLVA 1OFAA 3B4YA 3OIHA 1OB0A 3FA5A 3DN5A 5JBDA 3P81A 5TD4A 3SI9A 1L8NA 2QS8A 1ONEA 3L9CA 4PZVA 2NSOA 4GJJA 2PFHA 1H11A 4O1AA 2ALDA 2X2YA 4ZOAA 2RGMA 2DUZA 3IUIA 3SSZA 3BTNA 4MNJA 1LWJA 1QO5A 3O15A 2IS7A 1XJBA 4BI6A 1U1JA 1IV8A 2PP0A 4FXFA 3UW6A 1CLXA 5JMUA 3LLXA 2I14A 4NYUA 1Z3NA 3QV6A 3VFLA 1XRSA 4JKKA 3QY7A 1CGXA 1XL9A 3UG3A 1KGXA 3OZYA 3LNPA 3GTHA 3MP3A 2WV8A 1MUMA 2EQDA 1U2YA 1WDPA 4UQDA 4O12A 2Z6JA 4ZE5A 1QFEA 3M5VA 3N2XA 4DNMA 3CH0A 3FEQA 4Q4MA 3P7YA 4IT1A 3S9IA 5CC7A 1BTMA 3UFYA 5HPOA 3EA3A 1JCYA 3WH9A 3K4WA 3ZXWA 1H0GA 1O5RA 3DCPA 5G4EA 4DBEA 4H9UA 2E5CA 1Q6OA 2B7OA 3CC1A 4I6KA 1H61A 3VX1A 3LPGA 3OODA 1TPB1 4K3ZA 4R5EA 3V5OA 2WNZA 3W86A 1Q7MA 3CMGA 4CQ9A 1IEIA 1ICPA 1U1HA 3WQGA 3T2PA 4TU1A 2VKZG 1A5BA 3VGEA 4NRRA 3LHTA 1UR0A 3W88A 1ZAJA 1C3FA 5CBIA 2HE8A 4D6DA 4GJ1A 1GKPA 3KOZA 4AZ7A 4MKSA 3CPUA 5DCDA 3U7VA 3VD9A 3RR1A 3LCWA 5EFFA 4B3KA 3SIZA 2BOFX 2Z1WA 3LBOA 2WSQA 1JG9A 4N7QA 1KKOA 1U5HA 2WMIB 4IP7A 3JZEA 1OX4B 1H7OA 4R7OA 1JAEA 5FF4A 1EBHA 4MY8A 4I5UA 3OYXA 3W1NA 3HQNA 2GOKA 4G8TA 1JDCA 4XSLA 1JCLA 3KS6A 2FLIA 4UQ9A 4H19A 3BZJA 4XVDA 4KF1A 5A94A 4NXKA 1UH2A 5AVNA 4F66A 3RJXA 3MI3A 1XIDA 1TWDA 5FKYA 4URIA 2TODA 1V77A 1YPIA 2GVYA 4F8XA 1LOLA 1GQIA 1LOQA 3AXIA 1FWTA 1XINA 3HM7A 4FF5A 1E1CA 1BVNP 4D8LA 3PANA 1JDDA 3GNDA 1OX5A 2W9MA 3K4AA 2J7DA 2HISA 4ZE4A 2HTMA 1QNRA 1WV2A 5LSMA 1F3EA 2YA2A 2PBGA 3QQ0A 1AZ1A 1B4EA 2IPFA 3EWBX 4PUJA 1JQVA 3LI0A 4YTRA 3E5PA 4MMWA 4YYCA 4JTSA 3PG8A 1TG7A 3WQPA 2Z28A 2PTDA 1SZGA 3TC7A 1I2NA 3OJGA 1GVOA 3TROA 3OLGA 3B8VA 3TJ4A 1HG3A 1DL3A 1X7IA 3IARA 3UJRA 3E0LA 3MI2A 1DIDA 2BY0A 3PZIA 4OHQA 3NQAA 2X40A 3EPOA 3NQ6A 2VT0A 3A5FA 3W6YA 2EAWA 3UZ5A 2ZA3A 2WKLA 1RUSA 1AL8A 4L9XA 2GK1A 1E6RA 4ICMA 4JFSA 4DZHA 2XN0A 3LCFA 3FJ6A 3OHMB 1E6ZA 4CQAA 4OBTA 3KL5A 1PWMA 3GR4A 2XM2A 3L2IA 2GYIA 3PNZA 4W89A 3VKDA 4LS0A 1TTQA 1UWQA 4D1IA 1CXHA 4GYJA 1JZ7A 3O05A 1R3YA 1SW0A 1T99A 5KINA 2ZZ4A 4JQAA 1TRIA 1LQ2A 3FS2A 1SFLA 1JVNA 3DYOA 3WYZA 5HXMA 3STGA 3ABOA 2YL8A 4H9VA 4BR1A 4M6UA 2WZMA 2FHCA 1QATA 1GCYA 4N0RA 2ZRYA 1A80A 4WJXA 5JH2A 1I0BA 1IXQA 1XLMA 1ZP3A 3VKJA 4J3XA 5H8MA 5XINA 3N11A 5BWAA 1OFOA 4ATLA 1ZTVA 2UY3A 4BKNA 4XBSA 3KXQA 2GQ8A 1UWUA 3NOYA 3SQMA 1E0TA 2QJNA 3S1UA 4JIEA 1OABA 3H22A 3WUGA 3GAYA 2H8XA 4J3TA 3H7UA 3KP1A 3N2OA 3TC6A 2A7NA 4C1LA 1R47A 4ONVA 1XS2A 5LIWX 1W2PA 4NNBA 1GEHA 3ITCA 3UCDA 2V2DA 4GPNA 1R3QA 4FR6A 2YW3A 1PKNA 1EX5A 1OFEA 4NY2A 4O1CA 3GTIA 1KM6A 1GEQA 2ZUWA 5FESA 1MDLA 2IXVA 1YE4A 1OZMA 1XBVA 5BU6A 1Q2SA 5F4WA 3DG7A 4N2YA 5DMYA 1PWLA 1RXOB 4XV0A 1OEPA 3DENA 4AHOA 5F1VA 1XYBA 5AHIA 4DAIA 2NVDA 4AU0A 1RV8A 2BGSA 2VC6A 4JBRA 3E02A 3ZT5A 3OLDA 1PVNA 3Q2DA 1NJJA 1UUOA 1SJDA 3F4WA 5FL1A 1A5OC 4F2TA 3LERA 2ISSA 4HYVA 1S5MA 3TN6A 2CZ5A 3UVIA 4GYKA 3PUGA 3ZT6A 1SO3A 2BHUA 1QUMA 3NJ3A 4JYFA 2XM1A 3DFYA 4KH2A 1FWSA 1F6YA 2A79A 1GOOA 2WCGA 1KTNA 1NY1A 1AD4A 4TX6A 1F76A 4O0KA 1KA9F 5PTDA 3WBAA 1EEPA 4YTTA 1UPPA 3QTPA 1PO9A 1DXEA 4H8NA 4NP7A 5D30A 5CC3A 4PODA 1QI3A 3MV01 3BE7A 2CIPA 3QV9A 4XIAA 5C9ZA 3M0HA 3RGTA 3OEXA 4FNPA 3O16A 4UWMA 2ALRA 1FWAC 4L65A 1I6NA 3G22A 1E0WA 4M8UA 2R1KA 1YDYA 2GGEA 4JKLA 4BQ2A 1KFBA 1E73M 3OQEA 4LW7A 4WOZA 5BRBA 4QLKA 5E1QA 5TBOA 8TIMA 2VVSA 1UWAA 1A3XA 1E51A 1KKRA 1K6WA 2UV8G 4CCEA 3F5LA 2FZ9A 1G7VA 3CIVA 2JEPA 4IG2A 3TR2A 1KGWA 3S2LA 1DWIM 4XTDA 4NIRA 4RCXA 3G18A 2QNEA 4C6EA 2ISVA 4PBGA 4DB7A 3EAUA 3ICJA 1CBGA 1U22A 2IMRA 1PTAA 1W54A 5E0FA 3SJNA 1HF6A 5JBFA 5J8LA 3TN3A 3W1QA 1TV8A 3BURA 3H4GA 2NT1A 2O0TA 3W73A 1CGWA 1N82A 4N9DA 1V6VA 3ZJ8A 3CK5A 1KXQA 2ESCA 4MIMA 4MUZA 3ZZ1A 3UERA 4QAIA 3FOKA 4LWWA 1U1UA 1D2KA 3QZ6A 5LHEA 4JQ2A 4RDWA 1PIIA 2QCFA 4MY9A 1FWJC 1RPKA 4UFKA 5FEPA 2RJHA 1E6PA 1UD3A 3AICA 3AS2A 1CB7B 1EGZA 3HV9A 3WJXA 1BFNA 1NF7A 3DFTA 2X1TA 1QWGA 1ZBVA 4XQ6A 1TPH1 5FJOA 4X63A 3GZAA 3ZM8A 5DT7A 1KM0A 1VIZA 3MA8A 1E0VA 2R14A 3VDCA 3M9YA 1X6UA 4WF7A 1LLZA 1YXDA 2QULA 1OHLA 4R27A 4Q8VA 1WPCA 1ENUA 4I3GA 4JR5A 1PYFA 1DIEA 2QF8A 4B5TA 1XCXA 2E6AA 4QG6A 2HRWA 4AIBA 1Q7ZA 5LNSA 1S38A 1T0OA 4NZJA 4J1OA 4H6RA 3K8MA 1CWYA 1PJ9A 1BPLB 1K8CA 1PKLA 4DN1A 3VIKA 3ZIZA 3NUKA 4WSJA 2WM1A 4KW2A 5AY7A 2X2GA 3S5OA 2DV0A 2YCKX 2NWSA 2VMFA 4YCOA 1YNPA 3M16A 3R79A 1ECEA 5TAOA 1B90A 1RP9A 1Q8JA 2PC4A 4KIEA 5BYWA 4PRWA 1VCFA 4AG0A 4RW3A 3UNTA 2GUYA 3ABQA 2E09A 4XKYA 4PE8A 2ZRUA 3P5ZA 3VTRA 3W7LA 4QE1A 3KVKA 1THFD 1UQYA 2JIEA 4HK6A 1UWSA 4GUJA 5LIKX 4P7QA 1Z7AA 1GYNA 3SCWA 2VGGA 5HPCA 1E70M 6A3HA 4XWUA 3N6HA 1E0UA 3KDOA 2J9ZA 4N6FA 1QW8A 1XUZA 4RV8A 3KVJA 2HDJA 5CPSA 1E5JA 1E6XM 3G0XA 4AWUA 4IMEA 4TIMA 4PMNA 4PN2A 3P74A 4UTHA 2CPUA 3NZQA 5HK4A 1G5AA 1NOWA 3PVFA 4GRSA 1J12A 1RQBA 4DM1A 3H53A 4C6PA 1R3VA 1OC7A 1JRBA 4JTKA 1Q13A 3VNZA 1RCXB 3HG3A 3WDRA 3WKZA 1KM2A 2ZA1A 3HMJG 3BOFA 1M04A 4OZOA 3P6LA 2E68A 4MWAC 1OBAA 3HFYA 3MB9A 5G2HA 1FDZA 3S8HA 4RDVA 5GNXA 3IIXA 3VDHA 4D6JA 6XIMA 3KUMA 1ADSA 1ISXA 5GNYA 5LIUX 2DORA 3MQTA 3QMSA 1A4MA 4YJ5A 3EX2A 1RQHA 3AWOA 3GD6A 5TF0A 4ZFMA 3LXBA 1QMLA 3EWYA 3RX2A 5DLCA 3B8WA 2Y85A 1GOKA 1IT7A 4GI6A 4GIYA 1G67A 3TIMA 3QW3A 5FSDC 3TQKA 3EXRA 4QSHA 5H91A 4UTUA 4UQCA 1O5XA 2BY3A 4KWSA 2CCRA 5I5RA 4DO7A 3MUCA 1SU5A 1SFSA 3CEUA 1LF1A 1Q6FA 1JJKA 1X38A 3WLQA 3UESA 4O16A 1M9HA 2Y8KA 3MDWA 3STPA 2E9MA 4KERA 1LL6A 1OG0A 1TPEA 4LRSA 4GQRA 3FEMA 1IEQA 5FJJA 1K3UA 4Z2LA 3EWUA 3Q67A 3EMCA 3SAZA 4BI7A 4NUWA 1XDJA 1AMYA 4DWSD 1LLOA 3WSUA 3UR7A 4GYPA 2C0HA 4LYQA 4MB5A 1BEUA 2VGBA 4WJ8A 2VTFA 3ZLFA 1R46A 4IUOA 3V75A 4LS2A 4QHRA 4M0XA 3M0LA 4KCUA 3GNPA 2QXWA 4ZSTA 5LXXA 4ERAA 4PB3A 4OOUA 3H7RA 1KWGA 2FDSA 2XIIA 2HK1A 2EPOA 4FR1A 3XIMA 2WMJA 1J93A 3VABA 3AOFA 2DQXA 1GOMA 4MB4A 3NCOA 3WEOA 3TN5A 4FHAA 5HDRA 3EB3A 4H83A 2MANA 3VOGA 1G4SA 2C1IA 1GG0A 3AI0A 4PA8A 1HUVA 3O1NA 4C6IA 1JDAA 4IPJA 3MKCA 2XUCA 1XM3A 3A22A 3UA4A 4MWAB 1A47A 3VDBA 3I4EA 1TSIA 4WCJA 4PULA 3E5BA 3KTSA 5FAGA 4CD7A 5JBEA 4DF2A 1MXSA 4A8NA 3TFXA 1E4NA 3BWWA 1QK2A 2YXXA 4R9XA 1FDJA 4C6JA 3FYPA 3LGEA 4E6MA 3ZQ9A 4AX7A 1UD8A 2FTYA 1OFBA 3B04A 3QSTA 5G4HC 1VJSA 3L0KA 4KT2A 4LQ1A 1DTUA 1W8SA 3NAVA 1XC4A 3UWYA 1DE5A 1D7FA 2HVNA 4LCQA 1HKIA 4W93A 2O92A 1QO2A 3PUEA 1LWHA 4R33A 3EX1A 1GZ1A 1Y7VA 3W74A 1WNOA 2HE5A 1IIGA 1MMFA 2RDXA 1U5JA 4LAMA 1V6WA 1OT1A 1XSJA 5I00A 1M65A 3W38A 2ZUSA 4LV4A 2QYGA 2OYMA 4YHGA 1MZRA 2PRLA 3CTTA 3SN1A 2GGJA 5KEZA 3KM8A 4W5ZA 2V5BA 3QF0A 3DFPA 5F2IA 2VURA 3QBUA 3SUWA 1W1ZA 3FSUA 1IR2A 1DPMA 2E5BA 3A9BA 3DERA 1LBLA 2J13A 5LKYA 3LV6A 2F9RA 5C7VA 4LAZA 3S2JA 1W9UA 2JKAA 2Q02A 4J28A 3PAJA 1XLAA 3B97A 5E9XA 5C0QA 3VILA 3M6YA 1Y5WA 5EU9A 3M0IA 1OFRA 4UIOA 2WMHA 3SCOA 3N3TA 4TX9A 4FNQA 4GC4A 4ZA0A 1XGEA 3R94A 3VNLA 3OOQA 2PF0A 4JTEA 5EBAA 4Z1BA 4JPGA 3ZMRA 3UY7A 4ML4A 4PEEA 5LNVA 4Z17A 2YDAA 1NQKA 1GW1A 3OGSA 4UZSA 3WX7A 1PS9A 3HPSA 1Z9AA 2PD9A 4ZR8A 2PDYA 3MUIA 3DXIA 3HPXA 4J27A 4CQCA 1NOFA 2BXYA 3WUEA 4P8UA 3L21A 3AO0A 5ECVA 4PBEA 2I57A 1UP3A 3B03A 3GXNA 1PHQA 2JKPA 3GNNA 4QE5A 4JTCA 1ADDA 4PUMA 1REQB 1EF2A 2RDTA 4JQ4A 3BMWA 2BSLA 4FS9A 2P8CA 3HGSA 4FIQA 3UEQA 4L4OA 2B7QA 2A3CA 1Q7QA 2CLIA 4JXCA 1K70A 1FWNA 1ZCOA 2YX0A 2OWXA 3BJSA 1QBAA 4A05A 4ZENA 3BAWA 1IHIA 1WDRA 3UXLA 3IV8A 4UTLA 1UA7A 3ZWTA 3N1AA 3VKCA 1QAPA 3ANVA 5ABFA 2L5HA 3EKLA 4G7FA 1LL4A 3R13A 4J3ZA 3C4UA 1X97A 2POZA 2G95A 3KS5A 1MNZA 5HATA 4WDUA 1SVDA 4TVUA 3VFCA 2Y7FA 3PZTA 2PTYA 1TUFA 3WL0A 1KFKA 3BG3A 3GZ3A 1SSGA 3W7EA 1L0PA 2P76A 1TQJA 4A22A 1YXYA 1J79A 5HR6A 2WNWA 2PDBA 3W53A 1VFLA 2IW0A 1AZ2A 3T78A 4JEQA 4JS3A 3SJ3A 3FXYA 1EH9A 2J79A 2D73A 1KM5A 3W7IA 1ZBWA 5CJMA 4QP0A 1KRMA 4HOZA 1QI0A 4P61A 5MF5A 2ZUNA 3G2GA 1D8CA 5K2ZA 3Q94A 1K9EA 1Q6GA 4W7UA 2DSKA 4W8LA 1Z8AA 3B9DA 3F2BA 1I75A 1GGOA 3NQDA 4LB4A 1FCVA 4UOJA 1LG1A 4Y9AA 1XIJA 2OX1A 2EKGA 3W87A 1W1YA 2E4TA 3RPMA 3DFQA 3FY1A 1E9LA 4B2DD 1X98A 4BA0A 4H6KA 5BXTA 4UTWC 4DX3A 2O4MA 1K9FA 5MKGB 3LA4A 3G1DA 5AYYA 3WF3A 1XRVA 4DQWA 3T0CA 1A5UA 3LRKA 3UG8A 2JKEA 3CLWA 2I5IA 5I23A 1EEXA 3GVVA 5HJYA 1UWIA 1TWIA 3W25A 5FSEC 1Q6QA 2HPIA 4RX0A 4O28A 1F7BA 4RZ6A 4TR9A 3WQ8A 3MCMA 2Z4GA 4PUWA 5C2GA 3TCEA 2WXDM 2Y63A 3VNYA 3B05A 2QJJA 3ZJ7A 1ZFJA 3W1LA 3PWGA 3L4UA 3SGZA 2DW6A 1V7YA 3FVMA 2O9TA 4UTKA 1AH0A 1V3LA 2XSBA 3GBEA 4QE4A 1OF6A 3WD2A 3UU0A 1QPQA 2BGQA 2BY2A 3TMLA 3QPEA 4Q7BA 4AISA 3LN3A 1ME9A 4BF7A 3H4WA 4R7WA 3GXFA 1B9ZA 1UOKA 2WMFA 1O95A 3VZXA 5IFTA 1HIZA 1B2YA 2FPVA 4S38A 3PWAA 4FLOA 2C71A 2QDDA 3K30A 3C0LA 3C61A 5LXEA 4RPQA 3W7KA 2XVLA 5FL0A 3U4FA 1FWWA 3BGAA 4ZEPA 3O6YX 2RUSA 2ZTJA 1MNSA 2Q6ZA 4QM1A 2ZZ5A 4DJED 3ENLA 1KXVA 1B57A 4XB3A 1LQ0A 3EBVA 1TZZA 5GNZA 1TJ2A 3BLOA 4O0QA 5EMJA 4J2PA 3NGFA 4W4QA 3EA2A 4UUIA 2IXUA 4AAJA 1OYCA 1SMDA 3GDBA 2F2KA 4MFEA 3ZVHB 3N9RA 5D05A 4GLEA 1FCQA 2PDPA 1XYLA 2ZZ1A 1KQYA 3L2LA 2OXNA 1XP3A 3HQPA 3E6EA 2ZE3A 4H7CA 3M0YA 1UR4A 1WCGA 3ZLGA 1JXKA 3G1RA 2HNHA 2WZTA 3C2EA 4Y9OA 4HNUA 3ITVA 2VCBA 2X1RA 2ZXQA 3P0XA 2Y24A 4Q8MA 3OGVA 2HZGA 3GYCA 1EZ2A 2V3FA 4LAOA 4O53A 3CZEA 7TAAA 1TCMA 2ANUA 4LVBA 1TPUA 3U8GA 3UZJA 1FUYA 3WQFA 4LBRA 4XK2A 2R1PA 5I0DA 1AQMA 4PUDA 1M6JA 1E15A 3UF9A 4ZB0A 4UB9A 4AD3A 2G37A 4DLFA 1I2QA 2GVJA 2UY5A 2VX4A 5HQEA 4IL0A 3LBMA 1LRTA 5FF0A 1SJCA 3T1GA 3N6QA 2XGZA 1ICQA 1CXKA 2OODA 2FDMA 3M0ZA 4NU7A 1YPXA 3URNA 3A4AA 3G6MA 3NIYA 4GH3A 1R8LA 1XW8A 1ZSXA 4W84A 2ZE0A 2Q01A 3I3DA 4BQ3A 3CZ8A 5BRQA 4IMDA 4QSFA 4NHVA 3FHQA 5KMYA 4ACYA 1NP2A 4M6QA 1GZGA 1JCNA 2DZAA 2YLAA 2O9RA 1UWRA 2E0PA 2HWGA 2QJMA 4L9ZA 2W62A 4ECLA 3U2OA 3AIUA 1X6NA 4B92A 1Q8AA 4AZHA 3WH6A 4MM1A 1ITQA 2OCZA 4RDZA 5I77A 1J0YA 2J25A 3USZA 5CSUA 1UKTA 4D8ZA 2VDIA 3BOLA 3VOHA 3IIZA 3AZSA 4AIEA 3CZKA 2YZRA 1M03A 1TWWA 4OUIA 3VXGA 3WK0A 3A13A 5IM51 2DH3A 4YYFA 1IEXA 1GYLA 4AVFA 2OO0A 1G69A 3E2SA 3SUTA 3Q58A 3USBA 4Q22A 3BW4A 3VIPA 3WBXA 9XIAA 3FJ4A 2AGTA 2BASA 2DIKA 1NARA 3QPZA 4NF7A 1TUXA 3UXIA 3RCYA 2XVKA 5G2WA 3WG6A 5LA0A 3BGJA 2CW6A 2V5KA 4HCLA 3M43A 3F2CA 1XUUA 2D23A 4XZWA 1VS1A 3OG3A 3QLLA 4U10A 2J8GA 1HJXA 2XG9A 1IGSA 1VB9A 4Z1DA 3WLHA 3GXTA 1JULA 3QGKC 3ITYA 3EMQA 1L2QA 3JVAA 1KBJA 1ONXA 1TRDA 4WX2A 4IWWA 3BQ6A 4AB4A 3W72A 2A1YA 3F03K 4DAFA 2FB3A 2CLHA 4FNRA 2PF8A 4HU0A 4B5WA 5HUPA 3PBYA 3VIJA 2ZVIA 1V8EA 2X42A 2I5GA 5M2FX 1TZ9A 1GPWA 4YVVA 5A8MA 3A5VA 1K7XA 1QK0A 3MYOA 1YBQA 4IFKA 4GNKB 2HS6A 5I03A 2Q3RA 4OJYA 1CGVA 2QMJA 3CTLA 2ZXAA 4LANA 1POKA 3FKKA 3VVGA 3V18A 3W7OA 3WMLA 3UZYA 3QN3A 3H26A 3NQFA 1TV3A 5D2WA 2OSYA 3HU7A 1Q6LA 3CHEA 1REQA 2VFHA 1VJIA 1VD6A 2RGLA 1UZDA 2A3LA 3AIRA 2OFJA 1PV8A 2WVVB 1J10A 2GWGA 4B3LA 3GVRA 2VDGA 1DJYA 3XINA 5I3FA 3CO4A 3LTYA 4HZ8A 6XIAA 1DJNA 2PGWA 4RE3A 1QXLA 3EX6A 1UR8A 1BGAA 4IICA 2QUMA 2BMBA 4CNUA 3OW1A 4ZO8A 4JZ5A 4LB3A 3LENA 3AYRA 3SECA 4D72A 1DWHM 1XFCA 2EHHA 1KR1A 3QPYA 4IJBA 3U2EA 3OVQA 3OBEA 3HZ3A 3GDRA 4REQA 3TTEA 2WC3A 1JPMA 3IJIA 2R9RA 4OQVA 1XYFA 1UPMB 5F2GA 4JKMA 3W37A 3WNPA 3VUSA 3WQDA 1CXIA 3C0JA 4R9OA 5BXPA 2PZNA 4ZQCA 4B90A 4OUEA 2CERA 3K8KA 5A6MA 3T42A 3IRDA 2Y7DA 2J7HA 3V36A 3SY5A 4DF1A 5ABEA 4ZL1A 2BBFA 3ANUA 1ONRA 3KFTA 3WJSA 1O6IA 4WSKA 4X2RA 4KWOA 2XTKA 4ZCWA 2BS9A 4XISA 4QAWA 2Z2AA 2NQ5A 1E4LA 3O3RA 4M19A 3WQEA 4B5XA 4O10A 1SMAA 3TOPA 1G94A 4DUWA 2CLEA 2XU2A 2CESA 1ZLPA 1O1ZA 4RXGA 3LMZA 2NUYA 3KWSA 3Q45A 4G2DA 4LUTA 4W8AA 3BUVA 3PPGA 3JRKA 4F0RA 1KNWA 1UKQA 4ADTA 7TIMA 2D0HA 5FIPA 4XZIA 3WF0A 4BF5A 3RHGA 3M41A 4G7EA 2V30A 2ZXBA 5DXXA 1J0KA 3T55A 3VNJA 3THUA 4IQJA 3WENA 1EHAA 3K5XA 1KRBC 5BOOA 1XR2A 2D3LA 4RPPA 5T8GA 5AVHA 4XAFA 3VNIA 4HQVA 4LC8A 4GQ0A 2FTPA 4LF1A 1TPWA 1MXGA 2ACRA 1LBFA 1YIXA 1L6SA 3R0KA 1RY0A 3W7DA 3BARA 2ZUMA 7XIMA 3OVGA 2OJPA 3U5YA 3C0SA 4R3UA 3FHAA 3IJ9A 5BOEA 4UTJA 3BCFA 3R58A 4PYSA 1EA9C 1RVGA 3TSBA 2YIHA 1OWQA 2CZDA 4MKVA 3RX3A 1F3XA 1XDLA 5DELA 2QR6A 3SDOA 1BF2A 3VD3A 1F73A 4WUIA 2AOSA 1ESWA 1O94A 4FA3A 3HV8A 3ZS4A 1A49A 5C9RA 4AYSA 1IF2A 3H21A 2VEGA 3PS7A 2BVDA 5DMLA 4Q6JA 2GLKA 2BY1A 3C8FA 3KBMA 3L68A 3ZVHA 2OLSA 3RR4A 4E2BA 3DESA 2HMCA 4NL1A 3VCCA 3GG7A 1ICSA 3WLMA 2PD5A 2RJGA 3NQ7A 4HBKA 1R9YA 1VAHA 3B9NA 4A4AA 1YYAA 2ZWZA 4RLIA 3M7SA 1LJYA 1EX1A 1S5NA 5GPRA 2BX7A 4HOXA 2B31A 4Q8OA 3B8IA 5I79A 3IVUA 2YXOA 1MQRA 4O1FA 4EK7A 6REQA 4O4WA 4HSOA 4CQBA 4JY8A 3WD0A 4AY7A 3O06A 4GYPC 3SUUA 2NLYA 2XGIA 4O11A 1XLHA 4K7VA 3WQCA 4QDWA 3WZ0E 4J3UA 2DT1A 4NAFB 2W3ZA 5DCEA 3VCRA 2BXVA 3MUZ1 3NO5A 3W1UA 1QTWA 4XKMA 2DVUA 4C1KA 2P10A 3J7HA 4IMCA 3VX0A 3CWOX 3U2ZA 2ZX5A 1RBAA 3OZOA 4NJHA 1GVYA 2OYLA 1BXNA 4EIVA 3HMCA 3RLGA 2DVXA 1Z32X 2IQDA 2C6QA 2J9YA 3DBNA 4S3AA 2XIMA 4L61A 4M1RA 5I78A 4PRRA 1QDSA 3WO8A 3HURA 3KCOA 4XAPA 2DH2A 1RR2A 3TU9A 4K7YA 2HK0A 1OM0A 3VI2A 4O17A 4QNEA 4ZFCA 3ZSSA 3VCNA 2PCEA 4IGHA 4GGBA 1Q66A 3FN9A 5FEXA 2QPXA 2C19A 3JR2A 4LX4A