3N12A

Crystal stricture of chitinase in complex with zinc atoms from bacillus cereus nctu2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
NNLGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLESGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHYNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDGLSLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase A
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 113
structure length 332
sequence length 332
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n12A00
1E40A 1W3LA 1VF8A 4UFKA 3OLGA 1BAGA 1WB0A 1GJWA 3WUFA 3MMUA 2D20A 2WBGA 2X1IA 3MUAA 3ARPA 4AXNA 1UKOA 4CCCA 4W84A 3B9EA 3BAXA 2ZXDA 2WPGA 3AXXA 5JBDA 1RH9A 4E2OA 5EBAA 3CHFA 3G6LA 2Y8KA 4M80A 1HVQA 2YDSA 3CPUA 3LPFA 3WH9A 4UFJA 1NQ6A 3L2LA 3GXIA 1JZ7A 1QPKA 1JI2A 2WWDA 3CZKA 1O6IA 4LQ1A 1HN1A 4OOUA 2J7BA 4ACZB 1JZ6A 4CVWA 5I6SA 2IXVA 2O9PA 3KE0A 4B9ZA 2QMJA 2WXDM 2F61A 2QV4A 3AZTA 3N04A 5HBFA 3ARQA 2WLYA 1J0YA 1MFUA 3NJ3A 4F9JA 2X0HA 4N0RA 1LQ0A 2DGAA 1E3XA 1ODUA 3OZOA 4KRTA 4XZBA 4BF7A 3MV11 2C0HA 1J0IA 1W1YA 3NDZA 5A6KA 1J10A 2J7DA 2NT1A 3SUTA 2NSXA 1HP5A 2GDVA 3LPPA 1EDTA 3U5YA 3MUY1 3TOPA 4ZE5A 2E9BA 1RPKA 1G0CA 2JALA 4H8HA 1PZ3A 1V0KA 4M81A 1TR1A 3ARXA 2ZOXA 1UZ4A 7TAAA 5D9PA 2JIWA 3BCFA 5JBFA 2XFRA 2D0GA 1E9LA 1L0PA 1VJSA 1WDRA 3VGEA 4EE9A 4PTXA 5AYIA 3WMBA 3U7BA 4GIAA 4PMXA 3AZRA 3BGAA 3WNKA 5DO8A 4GZEA 3WFZA 4MNKA 1HL8A 1KQYA 4KWUA 4HOZA 2Y2WA 1CEOA 1ZJBA 2OLHA 2UY4A 3GBEA 1UR9A 1ZS2A 1QHZA 2WHMA 4D72A 4QFUA 5D9MA 1LG1A 5I2UA 4PMOA 3IAQA 2FHCA 3ARTA 3AMLA 4XZWA 4JFSA 3VX0A 4DWSC 4PMYA 1BYCA 5HOSA 3GH7A 4H8UA 3WQ5A 3WUBA 1QHOA 1H4PA 3VIFA 2X8RA 3CIVA 3VKKA 1FFQA 4H8VA 5FIPA 1CXEA 2W63A 3EMZA 4PUEA 1VRXA 4MDPA 2AAAA 3MMDA 4TX8A 2CIPA 3T0BA 2WVUA 1HL9A 5BCAA 3VD7A 2V38A 3WQ4A 1EA9C 3CZLA 1OT1A 3W4RA 4F79A 2WZEA 2D1ZA 3EDFA 4M8UA 5FKYA 4HZ6A 1WAWA 2YA1A 1HX0A 3ZJ6A 2O92A 3GNOA 1HJVA 5A6SA 2CXGA 4PTVA 5AC4A 2BHYA 1V3IA 2JF6A 3N11A 1JYXA 3W6LA 1IZJA 6A3HA 1FH9A 2EEXA 4U33A 2NW0A 3SEPA 4AZ6A 2VRJA 5A6JA 3OB8A 4IISA 4A4AA 4W87A 2Q8XA 4DM2A 1QNQA 3DHUA 2TAAA 1VFFA 2DT0A 1J0ZA 2D23A 3WQWA 1GOMA 3CUJA 4AD2A 4W7UA 1Q6EA 3NDYA 1C91A 4OUEA 1SR0A 1TMQA 2FDMA 4RL3A 1E1FA 4HZ8A 4R27A 2CESA 5HPCA 1AQMA 4P8VA 4U3AA 1B3YA 1X6NA 1UOKA 3MSDA 2ZX6A 1JD7A 2BHUA 5LYRA 2YDQA 4PTWA 2WKLA 5E6ZA 2VMFA 4W8AA 1UD4A 4ATLA 1E0XA 5CGTA 4UZUA 4H41A 1E71M 4PTMA 3EYPA 1CIUA 5ABHA 1GQKA 1JZ4A 2WMHA 3ARYA 2YBUA 1LWJA 4EKJA 5DT5A 2EXOA 1DP0A 5DMYA 1CPUA 1G01A 3VTRA 1K6AA 3DECA 4QCFA 3ZT6A 2WVTA 1H1NA 4V2XA 1LL6A 4ACZA 4W86A 1UD2A 3TTYA 4S3JA 4J7RA 2G3NA 4HA4A 2J4GA 3MANA 5CPTA 2WHJA 5E0FA 3AMGA 2XSBA 3KWXA 2VZVA 4CCDA 3UERA 4OJYA 3PBGA 2CBIA 3WDHA 3AIQA 2GK1B 1UA7A 4BCEA 2YIHA 1UKSA 3SIMA 4WKAA 5BXRA 3ZOAA 2BXYA 1BG4A 3IK2A 2WSKA 4MPKA 2V3DA 1CXLA 3W29A 1UD8A 3AS0A 3II1A 4AZ5A 1GCYA 1R85A 4MJ2A 2WM0A 1TZ7A 2V3GA 3L4UA 2CHOA 2OWWA 1B2YA 4U2ZA 2G8ZA 1LG2A 2EPLX 1H49A 3CGTA 4W88A 5E09A 1C7SA 3L4VA 3FNDA 3IJ8A 2YJQA 1Q4NX 2JFEX 2J75A 5I23A 1EOMA 4TTGA 4J3XA 4AZ7A 4KGJA 4W8BA 3AMKA 4CU6A 4IPNB 4MB5A 4QDMA 3WL1A 3ZR6A 3AS1A 3ARZA 4PMZA 2ZE0A 2VT0A 3W38A 2PB1A 4Z2KA 3WD3A 5M17A 1G5AA 2ZUMA 1JYVA 3VGDA 3UG4A 3TTOA 2GUYA 3N12A 3N9KA 2VQUA 1JZ5A 1JFHA 3K8KA 3KL5A 1BGAA 4ZE4A 3GH5A 2AOSA 4HPHA 3TP4A 4FK9A 3VGHA 3A3HA 2WLZA 3ZSTA 4AD4A 3VX1A 2JIEA 1GOQA 2VNCA 5E9AA 4W93A 5DEZA 1UHVA 4FLQA 3I3BA 1H3GA 4AEEA 5I24A 2D0FA 4PYSA 1CXHA 5A2BA 1M04A 1EO7A 3WSUA 1ISWA 4HA3A 3FW6A 4W89A 3CMJA 3ZQ9A 3UESA 3PZQA 2X0YA 4S3KA 3M46A 1E6ZA 2V3FA 2W4XA 1KXVA 4GQQA 3AMDA 1OWQA 1U2YA 1V3KA 2ZUVA 4CCEA 3M6DA 2XWEA 4U31A 3PZ9A 1BYDA 3GZAA 1QW9A 4LXFA 8A3HA 1JZ3A 1OSEA 2OYKA 3QHOA 2WK2A 1E56A 2BHZA 5HDRA 2DIJA 2XGBA 3WF4A 2PBGA 4FLSA 1ESWA 4M82A 3VMOA 5GNZA 4OZOA 1C8YA 2BVTA 2WMKA 3ZMRA 3SCVA 3EDKA 4CD5A 3VOCA 2J78A 2W67A 3ZT7A 4BS0A 3WDRA 1JGIA 2XVNA 1J12A 4WJXA 3VIMA 2CETA 1UWTA 1ISXA 4QLJA 2VO5A 1AQHA 1KGWA 4B9YA 1M7XA 2GSJA 3MUZ1 1ITXA 1K9EA 4LYQA 1KGUA 1H2JA 2ZX8A 2ZX7A 1WDQA 3W28A 4B15A 4HPGA 1JYWA 1CXIA 3DHPA 6CGTA 2BNJA 3UETA 3AFBA 3GM8A 2WVVB 4PMNA 1GW1A 2B31A 4L4PA 4D6CA 4GZJA 3IAPA 1E6QM 3LPGA 4PMUA 1V0MA 1QBBA 2BFGA 4NSBA 2XM1A 2Y5EA 4GI6A 1XRVA 1V6VA 4A3YA 4JL2A 4NRRA 1CTNA 2Z1KA 4UR9A 4H2CA 3CUGA 1M01A 3ALGA 1E5NA 4D6IA 1GQIA 4D6GA 3WDIA 5A2AA 5IHSA 1E70M 3A47A 3N1AA 1J01A 4HOWA 1E4LA 3GNRA 1H41A 5ABGA 4W7WA 2E40A 3WF2A 2BY2A 4W5ZA 1KFWA 1BFNA 1W3KA 3CO4A 4DM1A 1L8NA 1NM9A 4CD7A 4H04A 1MYRA 4J27A 3ZJKA 4CUCA 2PWGA 1BYBA 1IT0A 1UKQA 1JAEA 3IJ7A 3FHAA 1UUQA 4M1RA 2PWFA 2E3ZA 4JFVA 1OD0A 3QOMA 1W9VA 1V0LA 2W66A 2CBUA 4JAWA 1CGVA 3UG5A 4BQ2A 3N18A 1M03A 1LF1A 1EO5A 3PZMA 1V03A 2Z1SA 1B3XA 2CPUA 1DTUA 3IJ9A 4HMDA 2CCRA 1UWQA 4CD8A 4MB4A 3M7SA 3SUVA 2DH3A 1KR1A 1W1PA 4HZ7A 2WB5A 3T08A 2FGLA 3AHTA 3GXDA 3POHA 2GK1A 3L4YA 1E5JA 5FD0A 4GQRA 1GHRA 1CXFA 1B30A 5EMYA 1XH0A 1B3VA 1V6UA 1U30A 3WF0A 3MV01 3CTTA 3PZUA 3VD9A 4NZCA 2GDUA 1Q6CA 2J7FA 2WMFA 2YL9A 2D3LA 1QOXA 5CZKA 4V28A 2EJ1A 1JDDA 4URIA 5C71A 2W92A 3B8SA 4U5KA 3TTQA 3SCQA 3BCDA 3VIJA 1US3A 4BZYA 2HISA 1LLOA 2OSWA 4Z2GA 5A3HA 1GHSA 2J7EA 4E4PA 5A8NA 1W3HA 2WW5A 3BAJA 2VTFA 1X6LA 4Z2JA 4AD3A 3TTSA 5KEZA 1WDSA 3CUIA 1NP0A 5CLWA 1Y7VA 4CD6A 1VJZA 3VNZA 4DUVA 1UKTA 2J77A 2YLLA 5BRPA 1WZMA 5CLTA 2VI0A 3AIUA 4QP0A 1MQRA 1FFRA 5IXEA 3PZGA 2DSUA 2VR4A 1CNVA 1E72M 3PZIA 1UA3A 3WQ6A 2YDRA 2OSYA 3BSHA 4WKHA 2WMJA 1E0WA 4D1JA 3BH4A 4CU7A 4X9YA 1ITCA 2PF0A 5A1AA 4X0VA 1R7AA 4F9DA 1UH3A 5A6BD 4PCSA 2BS9A 1OGBA 1Z32X 4ZENA 5I3DA 3D3AA 1QI0A 2NT0A 4F66A 1H0GA 1OM0A 2EQDA 3W0KA 2O9OA 1J0HA 1QW8A 1C7TA 1BLIA 1D7FA 2J8FA 1QVBA 3SURA 1PBGA 1UH2A 4KGLA 3BLPX 4QCEA 1A3HA 1RP9A 3WDJA 1RD6A 5CGMA 4L4OA 3WELA 1MQPA 4NRSA 1JNEA 3SCRA 2CITA 1E4IA 1BQCA 1M53A 3BMWA 2DH2A 4UQBA 4ZFMA 2WVVA 5LA0A 1VFMA 3NIYA 3VIGA 4X0NA 2GJRA 2J74A 1MXGA 3IANA 1U33A 3RJXA 3BSGA 3VUPA 1E55A 5E6YA 1JL8A 5CQ1A 2WAGA 4A3HA 3DYOA 1IV8A 5EFFA 4JIEA 3OBAA 1V3LA 2WZHA 1NARA 5LA2A 4MTVA 2VCCA 2XVGA 4AZCB 3VGGA 5JBEA 3U5UA 2V3EA 1B9ZA 4CN4A 4D6FA 3PZNA 2CEQA 1TA3A 1DWHM 5I77A 2VOTA 3PTMA 4R5EA 4JCLA 1SFSA 3I3EA 4JZ5A 3W81A 2RGMA 2GJXA 4LGXA 5IHRA 1BF2A 3AYSA 3TA9A 5A8OA 1MFVA 3SUSA 2J79A 2ZWZA 3VVGA 3W27A 3WD4A 1R86A 2EPOA 3OGSA 1HJXA 1H5VA 1C8XA 4AWEA 2YA0A 1HKIA 2VZTA 1UWIA 3HJEA 5ABFB 2YL8A 2IUZA 3KEHA 1PX3A 4CD4A 1NWRA 5JIWA 1EHAA 4ATDA 1OT2A 4GI9A 1XD1A 2DEPA 3CZGA 3CHEA 5AYBA 2VX4A 2ZUSA 3OGVA 1K9DA 2F2HA 2VURA 2VR5A 1ZBKA 4MNLA 4CN6A 3CHDA 1CDGA 3VD3A 5A69A 1H09A 2QF8A 3CMGA 4W5UA 2A3CA 1V6WA 2E4TA 3L4XA 4N42A 5AC5A 5M03A 1ODZA 4UQCA 1VAHA 1ZBWA 3AIWA 2YOCA 4WK9A 4FLRA 1XCWA 4EK7A 1EQPA 4GINA 1PEZA 4M56A 3T2PA 3MUIA 2EO7A 2WCAA 3EMQA 2OWCA 3WNLA 1QI3A 1KBBA 4D6EA 5A6LA 3ARRA 2VZUA 2Y4SA 3ZJ7A 3RCNA 1V6XA 3VD5A 2E8ZA 5FL1A 5I78A 1TFVA 2J7GA 4JFTA 1UD6A 3VMNA 2J25A 1EDGA 3WDQA 2W61A 2YA2A 3RM9A 2XUCA 1D3CA 1MWOA 4MDOA 4MNJA 4W7VA 3MSGA 3A4WA 1TUXA 1G1YA 1UQZA 3WH6A 1SMAA 4GZIA 1OIFA 4XUYA 1JZ8A 1JZ2A 4BQ5A 4CN1A 3CUHA 5A2CA 5CPQA 3CZEA 2C7FA 3SCTA 6TAAA 2JF7A 2W5FA 1HT6A 4J3UA 1N82A 1E3ZA 4C7GA 1BVNP 3AQUA 5A8QA 4PEEA 3GBDA 4TVUA 2PWEA 1W1VA 2PC8A 5BYWA 1UR4A 3VM7A 2BY0A 4J3TA 1DWGM 4DUXA 2XHYA 2XSAA 3RO8A 5TD4A 2XWDA 1HJSA 1JG9A 4PBGA 2JEQA 2VVSA 1UR8A 1IZKA 3N13A 2XVPA 4TUFA 1JD9A 4U3CA 3T09A 3WN6A 3OLDA 1JF6A 2DPEA 1ZBVA 3M07A 3BAWA 3CHCA 3EDJA 4C7DA 1PAMA 2XG9A 2WCSA 4GXPA 5A8PA 1E6NA 1FP8A 1W9UA 3L2MA 1WP6A 1W3JA 1WPCA 3WD2A 5BXPA 2ZXBA 5A6BA 4AIEA 3EBVA 3VIKA 5IFPA 1BHGA 2XTKA 4MNMA 1J9YA 3QGVA 3VD4A 3WENA 2FH6A 4OBRA 3OZPA 3A4AA 3W6MA 1XSKA 1HKKA 3WF1A 4JKLA 1HNYA 1CGXA 2VCAA 1NOWA 3RDKA 3VGBA 2OYLA 3T2QA 5D4YA 2V5DA 2PWDA 3E1F1 3EDDA 3K1DA 3UEQA 4JKKA 3WIJA 5ABEA 2UWFA 4MAVA 1ZL1A 2WC3A 4JFUA 2VJXA 4AZCA 3VIOA 1FP9A 1W9PA 3ZM8A 1JDCA 3OA5A 5D8ZA 1Q6FA 3AS3A 1QNSA 1KR0A 3PZOA 1GJUA 1E6XM 2VZSA 1VFUA 3AHVA 2WHKA 1CZ1A 3F4VA 1MQQA 4CVUA 2ZX5A 3POCA 3O6AA 4YHEA 1OCQA 1E43A 3NUKA 4HU0A 2XIBA 4E8DA 4AIUA 5A6MA 3NSNA 4P8UA 2QLYA 1NOUA 3BAKA 2WVSA 4IPLA 3OIHA 3W25A 1WZKA 2WKGA 4PSRA 1UKPA 2VVNA 3PHAA 4J3SA 3WF3A 4ACYA 5ABFA 1ZB5A 3AIEA 5C70A 1UD5A 2C8NA 4Z2IA 4LYPA 3F5JA 2CHNA 2YLAA 4KH2A 3AS2A 2ZXQA 4Y7EA 4AEFA 1MVYA 4MB1A 1F4HA 1KXHA 2CERA 3K8MA 1EGZA 1I1XA 4AZBA 2ZUWA 1EHNA 3MMWA 4WF7A 1GQLA 4OOZA 3VIPA 2BVYA 4Z2LA 2PWHA 4MADA 3RM8A 2WMGA 3BXWA 1V3MA 3QR3A 5BXSA 3THDA 5C8BB 1C92A 1TA3B 2G41A 2X2YA 1KBKA 3ARVA 4J28A 1PIGA 1V6YA 4HU8A 1FHDA 4W8LA 3CUFA 8CGTA 3WH7A 3PTKA 2GJXB 1KB3A 5I0DA 4OBSA 3AZSA 3GNPA 1B31A 3N17A 4PMVA 3AISA 5HNNA 2ZUTA 3WMSA 2BY3A 1UH4A 1MW0A 4GPNA 1JNDA 4HMEA 1US2A 3EDEA 3SCUA 2QPUA 4D1IA 1HF6A 3FXYA 3AIBA 2UY5A 4GO8A 2DT2A 2D24A 3AIVA 3DC0A 3ZO9A 5BWFA 1B3WA 4P7RA 4TXEA 3K4DA 1E4NA 3AJ7A 1EDQA 3W37A 2G3MA 1QI5A 2VX6A 1JAKA 3L4WA 5A94A 2XGIA 2ZXAA 1VEPA 5E70A 5D9NA 1TE1A 3NSMA 3VILA 1FOBA 1HP4A 4EANA 2O9TA 5CXPA 1HXJA 3WL0A 4UTFA 1XCXA 2J8GA 1HJUA 2ZWYA 3W82A 4Q7NA 2A3BA 2YL6A 2DQXA 1R87A 3WNMA 1WDPA 1NWUA 4ATWA 2VX5A 2EPMX 1XGZA 9CGTA 1W1TA 1W2PA 1QNOA 4TTUA 2PI6A 4NF7A 1MW3A 3CLWA 3L4TA 1DWJM 1UYQA 4UQDA 4D6DA 1JI1A 1GOOA 3WD1A 1B90A 3O9NA 4PSPA 2J7CA 1FA2A 3D5HA 2VUYA 1BYAA 1QI2A 2YKKA 3ZJ8A 2DT3A 3SUWA 3KZSA 2YBTA 4LX4A 5BROA 2WSPA 4CGTA 1CGTA 3ARSA 4UOZA 2E9LA 3WQVA 1TG7A 3VDHA 3NYDA 4MAZA 2IXUA 3RPMA 1B0IA 1ECEA 4GKLA 4AZGA 2Y24A 4XV0A 5GNXA 2DSVA 5EFDA 1TCMA 1KXTA 2D3NA 4JHZA 2VX7A 3UG3A 4V27A 4QAWA 1KQZA 1E4MM 1JYNA 4PN2A 4RE4A 3LPOA 1FH8A 3BAYA 1CLVA 3MS8A 3UR8A 3ZSSA 3WY1A 1EOKA 2W91A 3I3DA 1WKYA 3NSXA 2EPNA 4UFIA 1GVYA 3W24A 4YPJA 4ZEPA 2WC4A 4J3VA 3ECQA 4U5IA 2WNWA 4UQEA 3THCA 4K68A 2HVMA 2FH8A 1VBRA 2BY1A 3K46A 3KL0A 1CBGA 5GQBA 1G9HA 1V3JA 4NI3A 1WZLA 1S46A 1YHTA 4JCMA 4UFHA 3K8LA 4P8WA 1WZAA 2V5CA 4PRWA 1G94A 4AYSA 1K9FA 1DWAM 1WO2A 3GTNA 4XB3A 1SMDA 1UWSA 4DWSD 1CGWA 4PUDA 2VZOA 4AW7A 3VIHA 1PZ2A 1C93A 3AROA 4FF5A 1Q6DA 3A6OA 4H7VA 1EQCA 3VU2A 3AXIA 1WNOA 1UD3A 1E6SM 4HMCA 3AI0A 2DIEA 2UY3A 3HU7A 3WNOA 4CKQA 1ISZA 1QNRA 1BGGA 1C90A 4HTYA 3JUGA 1AVAA 4YHGA 3CZ8A 1UG6A 5GPRA 3OLEA 3GXMA 3ZIZA 2F8QA 4AZIA 3F5KA 3WFLA 4DWSB 4JFWA 4GO9A 4HA1A 5M5DA 3BLKA 2QMKA 1H0IA 1R7OA 1CGYA 1XH1A 3NCOA 2XVKA 1HKMA 1KGXA 1PIFA 1GPFA 4IUGA 2X05A 3GDBA 4WKFA 1WCGA 3BAIA 3QHMA 2BVDA 1V08A 4QLLA 4C7FA 2QHAA 1BG9A 2DSKA 1FH7A 1J0KA 4JHOA 5JUVA 1KCKA 3BMVA 2BV9A 1EXPA 2VRQA 1AQ0A 3AHZA 3PZVA 2XIIA 5I79A 1Q6GA 1A47A 4JL1A 3N15A 2EBNA 7A3HA 4B3LA 3QOKA 3TONA 5D9OA 2RGLA 3U7VA 3WH8A 3VDBA 2XJ7A 3FHQA 1TVNA 1I75A 3ZT5A 1E1EA 2OYMA 4FLOA 1UWRA 4WSKA 5FL0A 3QHNA 1VEOA 4UCFA 3GXFA 1GOWA 4JKMA 3VM5A 1XD0A 2A3HA 1GOIA 4UQAA 1TVPA 4GI8A 2WANA 2J47A 5FOOA 4P7NA 1HJWA 1RP8A 1V3HA 3RM4A 3W53A 3DYPA 5CJ5A 1R8LA 1UZ1A 3AYRA 3PN8A 2GJPA 3WUGA 1GNXA 3WBEA 2WMIB 5E0CA 3MKKA 4W85A 4RE3A 4AMCA 3CBWA 4D71A 4AD5A 2CBVA 3L4ZA 1E0VA 1KWGA 4AZHA 2FHFA 1GORA 1X1NA 4QLKA 1MW1A 1UR1A 1GQJA 3WBAA 1DEDA 3W26A 1QNPA 3FY1A 5KZ6A 1B3ZA 4M24A 1J18A 3DYMA 1JIBA 3G6MA 1ZU8A 2DSZA 4B3KA 5EB8A 4DUWA 1JFXA 2VC9A 1PJ9A 2CBJA 4Q22A 1HIZA 3S6TA 1W91A 2G3JA 1W2VA 1DWIM 5GNYA 5A6AA 4UFMA 3S2CA 3AHYA 3FN9A 2XPKA 1CWYA 2YL5A 1CXKA 1JXJA 1J0JA 4MB3A 4FMVA 2Y8VA 2AMGA 2G3IA 4U2YA 4MJ4A 1C8QA 4HP5A 3ARWA 2QPSA 1DHKA 1XHGA 1LL7A 1ISVA 4RE2A 4IM4A 3B9AA 1J11A 2EPKX 4D6JA 4BQ4A 4UOQA 1ZJAA 2VQTA 2UY2A 2XFFA 2J62A 1UR2A 1GOKA 3SCWA 3PZTA 2DT1A 1MW2A 3KL3A 2D2OA 5BXTA 2J7HA 3F5LA 5A8MA 4KRUA 1XC6A 1CLXA 5A95A 1B1YA 2E8YA 1OB0A 3SCNA 5LA1A 3ZR5A 5IDIA 1E73M 3ARUA 1D2KA 4TOQA 4P7QA 1GUVA 4P8XA 5DF0A 1E15A 1JXKA 1NWSA 5M3WA 3O2LA 4XX6A 1CECA 2BXZA 5DT7A 1OD8A 1KCLA 2ZX9A 4PMDA 2GFTA 1OGGA 2JEPA 4ML4A 3T0AA 5I5RA 1QHPA 1V0NA 1XH2A 1O7AA 3FAWA 1K9TA 2X09A 1NOFA 4AC1X 2E0PA 3WDPP 1W9BM 1ZBCA 3WUEA 1XYFA 4UQ9A 4P7OA 3T2OA 5IFTA 1VIWA 2WZIA 4E8CA 2XYLA 3LMYA 3B9DA 5CSUA 3CH9A 5ECUA 4J3WA 3VPLA 1KWKA 4ZXOA 2DSWA 2OSXA 4ZXLA 2ZICA 1PX8A 2FGZA 3OG2A 3GYCA 4PCTA 1UQYA 3WQ8A 4CU8A 2ZUNA 2PBOA 1CGUA 2VL4A 1LJYA 4BQ3A 4DWSA 4PMRA 1HVXA 2E9MA 2MANA 1BSIA 4UOJA 1CYGA 1HKJA 4KMQA 3VDAA 1JDAA 3UCQA 1OBAA 1VBUA 1GONA 5CG0A 3RJYA 5F7UA 2ZIDA 2XVLA 3AIRA 3VINA 1WE5A 4WSJA 1W9DM 1VENA 1XSIA 3HMCA 2G4FA 1OINA 3VIIA 1E6PA 1VFOA 2CKSA 4Z2HA 1UWUA 4WLCA 4AD0A 2FHBA 3WKZA 3U57A 4D6HA 3WNNA 3VGFA 2A3AA 1YQ2A 4LYRA 3SUUA 1V02A 2WBKA 2XM2A 3GH4A 3RIKA 5BRQA 2CNCA 3AMCA 1SYTA 4YN5A 1E6RA 2ZUUA 1DWFM 1PPIA 1NWTA 4UZSA 3WNPA 4AIOA 3AOFA 2ESCA 3AHXA 3VNYA 2WYSA 4OKDA 3WEZA 4EAMA 3MU7A 5JIPA 3T0DA 1XYZA 2W62A 4UNIA 5HPOA 2XFYA 2WWCA 2D0HA 3EMCA 1P6WA 4M29A 1XV8A 2OWXA 3RILA 1GZJA 1HJQA 1CENA 3RMEA 4F8XA 5FCZA 4AY1A 1EH9A 3SCOA 3OGRA 3APGA 4UFLA 2D22A 3MO4A 4TVCA 1MXDA 3CZJA 1QBAA 5D8WA 4TX6A 2A3EA 2WHLA 1PX4A 2CKRA 2DDXA 2WMIA 3SCPA 2VCBA 2WC7A 1OIMA 4TVDA 7CGTA 3VDCA 1UR0A 4WIWA 1KXQA 2CYGA 4AD1A 3BC9A 4HOXA 3HN3A 3A4XA 3UR7A 1I1WA 3K4AA 4OIFA 2JE8A 1V02E 3SCSA 3VO0A 1BVZA 1F4AA 1ISYA 2WCGA 3PTQA 1VB9A 3WH5A 3ALFA 1H11A 1AMYA 1FHLA 3VMPA 1JF5A 4AISA 3AXHA 1QI4A 3J7HA 1NP2A 1W32A 2GVYA 5CSYA 3WEMA 1NH6A 1LL4A 3FAXA 4PMQA 3AICA 5HXMA 5AY7A 2O9RA 1C3FA 4B16A 4P7LA 2VRKA 1LWHA 1W9XA 1XSJA 4BA0A 1EIBA 3WEOA 3WD0A 1OGSA 5DFAA 1BPLB 1GVIA 3WMCA 3OLIA 1BTCA 4LPCA 5CPSA 1VEMA
chains in the Genus database with same CATH superfamily
1NF0A 3LXAA 3RO6A 4UFKA 2BDQA 3WMLA 3WUFA 5T26A 4YU1A 3DU0A 1JCJA 2WBGA 4PGLA 4O0QA 4BJHA 4MY1A 1UKOA 4W84A 4HSNA 4O0KA 1U22A 4HNNA 3DBNA 2DVXA 2EGZA 1ONXA 2ZXDA 1NELA 5TBOA 3G1RA 4JPGA 2QDHA 3SSJA 4R88A 5JBDA 4E2OA 1WAUA 3AO0A 1AD1A 5AHEA 3LPFA 1JDFA 3C0JA 2I9UA 3WH9A 4JY9A 5F2MA 3WQDA 1KC7A 4JTLA 1TJ1A 2IKJA 1JZ7A 2Z2UA 1JI2A 2QUNA 3W73A 2Z00A 3TSBA 2J7BA 4XO7A 3PJUA 4PMJA 1JZ6A 1FCUA 2OX4A 1W1A1 2QV4A 3QKEA 1Q8JA 3W2UA 1KBLA 4WY0B 3NJ3A 4E4UA 8RUCA 1JUKA 3P6LA 4XZBA 3MYOA 4O53A 1W1YA 1RBOB 5A6KA 2J7DA 2NT1A 3SUTA 2WKJA 3E49A 1KTBA 4B3ZA 4PL1A 2JALA 4H8HA 1PZ3A 4HU3A 3EPOA 5LIUX 3UJ2A 4ERGA 1L9WA 2JIWA 4IUOA 1GZGA 4LEFA 5H1WA 1L0PA 4PZVA 1GYLA 3W7MA 3VGEA 3VNJA 4PTXA 1T8XA 1TSIA 3WMBA 1ZP3A 5LGXA 2FLIA 1RXOB 1F5ZA 1X7IA 3KHJA 2FTWA 4GG9A 4US6A 3WFZA 4MNKA 1HL8A 2ZTKA 1FVPA 1ZJBA 3EWXA 3GBEA 1N2VA 1UR9A 2ADAA 1FWCC 4AWSA 1LG1A 5I2UA 3LTSA 4WDTA 3GX9A 3VX0A 4PCFA 4Y9MA 4IFRA 3WBWA 4A6GA 2AKMA 1LRNA 3WQ5A 1W5OA 3EOUA 3VIFA 3SI9A 3VKKA 6ENLA 1UP3A 3GYEA 3DFHA 2W63A 3GFYA 1R0MA 4AYGA 4MDPA 1EJXC 4TX8A 3OTRA 4HK6A 2WVUA 3SDOA 2IKHA 1A0EA 2J6VA 3T4WA 3T78A 3TYZA 2BTMA 5BCAA 4OHQA 2QUTA 3WQ4A 4Q4KA 3CZLA 2PGRA 3EX6A 3W4RA 3SRHA 4C6IA 4HZ6A 2XSXA 4PUKA 4HU4A 5EYWA 3ZJ6A 4R53A 2HNHA 3B0YA 4GUFA 1V3IA 1A4MA 1DHPA 4N6FA 6A3HA 2G96A 2YXXA 4U33A 2CLEA 4XTIA 3SEPA 4JTFA 4AZ6A 4A4AA 4DM2A 4DJDC 3AU6A 2O56A 2DT0A 4CQDA 3UZ5A 3OO2A 1IXNA 4CQ9A 1SO4A 2JKEA 1KFJA 1Q6EA 1C91A 4L6HA 4OUEA 2R9RA 4ORMA 3EA2A 1KM2A 4RL3A 3VC5A 3A3XA 4DIAA 2I7GA 4I6KA 2CESA 2GVLA 4P8VA 5C0QA 3DHDA 1UOKA 3MSDA 5I3HA 4J1OA 4BY3A 1FXPA 1WBJA 1JPDX 1VHCA 1YPXA 4DPPA 2X1TA 1EGMA 4G7EA 4F0KA 3P61A 1J5SA 1UD4A 1KM1A 4ATLA 1E71M 3BWWA 5ABHA 3TW7A 1JZ4A 2PCEA 3USBA 5AZ1A 1LWJA 5K7JA 3O6DA 1K7FA 4ZA0A 4NAEB 3TYAA 3IARA 3ICJA 2EXOA 3QLLA 4W4QA 1US0A 1I2QA 5HULA 3VTRA 3UPBA 2FGBA 3W7LA 4LU0A 3O0KA 2WVTA 4YVVA 4YXGA 2A21A 3KVKA 2NUXA 1PDYA 4HB7A 2J4GA 2JBMA 4XBSA 3R12A 3W2LA 3UERA 2CBIA 4ROQA 4J3ZA 3UPMA 2GK1B 1UA7A 2AL1A 3TROA 3OQEA 2YIHA 1UZHA 4GH3A 1UKSA 7PTDA 1BG4A 4JNZA 3IK2A 5KZDA 2QEZA 5LNVA 1OVDA 2DZUA 4H9XA 1QPRA 3T8QA 1PIIA 4UNLA 1TZ7A 2V3GA 4UTMA 2VP8A 2CHOA 2GQ8A 1B2YA 1H49A 1IWPA 3CGTA 3EOSA 5E09A 3H4XA 1C7SA 4C6JA 3N29A 2JFEX 2J75A 1EBHA 4TTGA 2Y5JA 3HQ1A 4PRTA 4MY8A 4CU6A 4A3QA 3MJMA 4ZQCA 2IKGA 3ARZA 3PANA 3GQYA 2ZE0A 3COTA 2PB1A 4DYEA 2GUYA 1DQWA 3A9BA 3N9KA 4WSHA 4X22A 3UG8A 5CZTA 1BGAA 1FCBA 1S2UA 1GJPA 2YW4A 5F4SA 4HPHA 3LMZA 4HJFA 3M47A 3VGHA 2CU0A 3A3HA 3ZSTA 4AD4A 2PDYA 2JIEA 3KOFA 3C56A 4R3UA 3IPWA 5AHNA 4PYSA 1CXHA 4O1BA 5A2BA 5JH1A 4YL2A 1R46A 1E0TA 5FJUA 4Q8OA 2X0YA 4S3KA 2W4XA 1KXVA 4HNLA 4IFKA 4ZGYA 3GNDA 3QBUA 3ABRA 2OQLA 3QY6A 1VCVA 1BYDA 2AL2A 5LXXA 1QW9A 1LM1A 3WLKX 4LXFA 2QCGA 3LV6A 1O12A 2IKIA 2OYKA 4S3DA 1E56A 5HDRA 1MRAA 2XGBA 3BANA 3EOOA 2E67A 2A7RA 1TV4A 4OZOA 3E2RA 1IEIA 1KFEA 4GKTA 3ABOA 3S2MA 5L9FA 4OUIA 1S2VA 2BZNA 3KCOA 2J78A 1L6FA 3VCRA 3WDRA 1FX6A 1JGIA 2HXUA 2O55A 3VIMA 4QLJA 1RHCA 3ME3A 4YTRA 3M5ZA 4M7SA 1AQHA 1CI1A 1ADDA 3MUZ1 1K9EA 2YCJA 3V5OA 4ICMA 2BNJA 3UETA 4EPDC 3AFBA 7REQA 2CLPA 1XLIA 2C1GA 1GW1A 4D6CA 4GZJA 3IAPA 4NJJA 1E6QM 4Q3MA 5I02A 4UC5A 4NSBA 1GWJA 3DG7A 1XRVA 4A3YA 4GACA 4PCPA 2I14A 1M01A 1SFTA 4KWWA 1OZQA 3WDIA 1SQ7A 5IHSA 1E70M 3N1AA 3MUXA 4HOWA 1MXSA 1E4LA 3GY1A 2AKZA 2NUYA 4ZR8A 3WF2A 4O13A 5DX7A 4W5ZA 1KFWA 2HVOA 2D2GA 1W3KA 4N9EA 3G0UA 1CLKA 1L8NA 1TRIA 3QY7A 5L6UA 3ZJKA 2RDTA 3WCZA 1UKQA 1NFBA 1JRBA 3KTXA 3LCXA 2RDWA 3RHGA 3WJYA 3LCLA 2ZRWA 3N18A 3PZMA 1V5XA 1P7TB 2QIIA 2CCRA 1XLLA 4CD8A 2HTMA 3M7SA 1FWNA 1LYXA 1LBFA 4LUTA 1KR1A 3BOXA 2Q02A 1O5XA 3TXZA 2PLKA 3GXDA 3POHA 3L4YA 1TPB1 4L9XA 3LU2A 2RDUA 4IF2A 3UJSA 3UWZA 1U30A 3FSUA 3PZUA 4NZCA 1Q6CA 2ZDSA 4HQVA 1YX1A 1RD5A 1KFBA 4I9TA 4IPJA 2H90A 2W92A 3SN1A 1J2WA 3B8SA 3TTQA 3HM7A 3GDRA 3L0GA 4BZYA 2HISA 1A5KC 4QEHA 1DE5A 4EP8C 5A3HA 4O15A 4OQVA 3BAJA 3TTSA 5KEZA 3VDGA 2TMDA 1Y7VA 5FF7A 3MT1A 3W84A 1VJZA 3N25A 3OVQA 3T42A 4AF0B 4DJEA 3DFSA 1R38A 1VPXA 1XRTA 3V0TA 3CK5A 1Q65A 1KKOA 2OEJA 3KP0A 4JTQA 5IXEA 2DSUA 1CNVA 1E72M 1SZEA 1D8WA 2CXEA 4ZZ9A 4IMFA 2YDRA 1UPPA 5BMXA 1CX9A 4WKHA 1E0WA 5EU9A 1ZHAA 4D1JA 2X16A 1TVLA 2CLIA 5MF5A 4TX9A 4IIGA 1PYMA 4KERA 2IPFA 4F9DA 2P50A 3R2GA 9RUBA 5D2TA 4I5RA 5IOBA 5CGQA 1F3WA 4EVZA 5I3DA 2EQDA 2O9OA 1J0HA 2VFHA 2NXIA 1B9BA 1QVBA 3SURA 4KGLA 1BRLA 3FV9A 1I4NA 1RP9A 3WDJA 3S9IA 1DBTA 3FJNA 1I6NA 1SZFA 4RDVA 4YTQA 1BQCA 3P5YA 3BDKA 4UQBA 2PP3A 3TR2A 1VHNA 4ZFMA 2WVVA 1OC7A 3GHTA 4XD4A 3VIGA 1PKNA 4ZQNA 1F8IA 2J74A 3CQJA 3VZZA 1VBJA 1QTWA 1U33A 2C0AA 1E55A 1S5NA 2JGYA 3S83A 3TCSA 4NZ5A 2Y7DA 4C6MA 3HTWA 3QFEA 2GDQA 3OBAA 1XFCA 2WZHA 4FB7A 4MTVA 5T9CE 2QJIA 2VCCA 2V3EA 1B9ZA 2XH7A 3W7NA 2H9AA 4BKNA 1PYFA 2PTXA 4GK8A 5HJYA 3H53A 4R5EA 3I3EA 3B4UA 1O1ZA 4PFMA 3REQB 1OY0A 1RQHA 2WZMA 5IHRA 1F2JA 3F4CA 2HRWA 1NAL1 3UJFA 3PF3A 3W27A 3G1HA 3GKAA 2EPOA 1H5VA 1C8XA 3CLMA 4PH6A 3S1UA 4DBSA 3HJEA 3AWOA 3I10A 1PX3A 4C91A 3PG9A 3QH2A 4MZ1A 1OT2A 3LGGA 2XN1A 3BO9A 1TUFA 4MY9A 2DEPA 2QUUA 2YX0A 3E5PA 1DXEA 3OGVA 2VR5A 3GUWA 4MNLA 1A5CA 1CDGA 3VD3A 3ITGA 5A69A 1H09A 4GY1A 4KKXA 5AKQA 1UASA 4H9YA 3OYXA 5M03A 1XDJA 1VAHA 1RJQA 3AIWA 1V8EA 3TV8A 1PEZA 3MI2A 1FKXA 3T2PA 3MUIA 2EO7A 3WNLA 4FNPA 2DVTA 3PAJA 5G1YA 4UUIA 3G1YA 4IMDA 3VNIA 3C8FA 3N73A 2CLKA 2BODX 2GVJA 3CV2A 2VZUA 5G5IA 3V75A 1V6XA 3GTHA 3BG3A 4XZLX 4XD6A 5FL1A 2F2KA 1TFVA 4JFTA 1UD6A 2ZTJA 4MFEA 2JK2A 4UTWA 1QDSA 5AC7A 5C9ZA 2PLCA 3NZQA 5DY2A 1MWOA 4MDOA 1AH3A 3VABA 1Q6LA 3APTA 2C79A 2ANUA 3DUGA 4G8TA 3CIXA 3A4WA 3CUZA 1UQZA 3WH6A 4WXZA 3N2CA 2DZPA 4IIHA 2Y63A 3GDKA 4J3UA 1N82A 4LAOA 5A8QA 3G1XA 2G50A 3HPSA 3W7GA 1SJAA 4H6EA 1J4EA 3UBPC 4MKSA 1GVEA 4J3TA 2Q8LA 1I2NA 1Q63A 3MHGA 4LVGA 3V7PA 3G22A 3CUXA 3RO8A 1UC4A 4RCXA 3T8LA 1JG9A 1Q5MA 2OU4A 3BGJA 3KUMA 4U3CA 3SQMA 5I06A 4OV9A 1AODA 2DPEA 4GBDA 1ZBVA 3BAWA 4C7DA 3TA6A 3LUTA 4N4QA 1EWEA 3H55A 1WPCA 3WD2A 4ADUA 1W0MA 2WPBA 3EBVA 2BB0A 3VOJA 3INPA 2TRSA 1G6CA 2FH6A 2G37A 1F07A 3OZPA 1HZYA 1XSKA 1HKKA 4UIOA 1HNYA 3I65A 3PP7A 3U48A 3DFYA 4XUGA 4PE8A 1TX2A 1Q2RA 4MPQA 1YXCA 1YW1A 3O06A 2PRHA 3E1F1 5FEXA 2DFAA 3K1DA 3O8AA 2QGYA 4KBXA 3WIJA 2WQPA 2UWFA 3RN6A 3SSZA 1AQFA 3FGCB 5M1TA 1KR0A 1XQLA 2VFDA 5I3KA 3AHVA 2O0TA 2ZVRA 3F4VA 1SSDA 1ITUA 2Y6ZA 1D8CA 4E8DA 5A6MA 5FSEC 1GW9A 5DANA 4LV9A 4P8UA 2QLYA 4XAGA 3LDVA 2MUCA 2BWGA 2G4JA 4YVPA 3W25A 1HKWA 3IUIA 4N2YA 2WKGA 3ZLGA 3FA5A 1OK4A 4PSRA 1UKPA 2VVNA 3M6YA 3PHAA 4JTEA 5ABFA 3UZZA 3ENLA 4L61A 4KFPA 1E1CA 3H2CA 3MHUA 3UD6A 1W8GA 3PSWA 1F05A 3CYJA 4TQTA 1H62A 4Y7EA 4I7UA 1ZZMA 1RV8A 2YFOA 3HJZA 2P3ZA 4LS0A 4AX7A 1KXHA 3RLUA 1POJA 1EGZA 2FJKA 3MMWA 5DQPA 4LV4A 3VIPA 1DJIA 3E38A 2RDXA 1VLWA 1KBIA 2QNEA 1VKFA 3DENA 1QASA 2PLMA 2WMGA 3BXWA 1V3MA 5BXSA 1R47A 3E6EA 1C92A 1PL9A 3KP1A 2VYOA 1H50A 4J28A 1PIGA 2NSOA 1KNWA 4W8LA 5CPLA 3WH7A 1NFPA 2ZQ0A 3PTKA 1KB3A 4GI4A 1ICSA 1IHIA 3N17A 5HNNA 2ZUTA 2FZDA 5DCBA 1TKKA 3HURA 5CPNA 1YYAA 4LCQA 4ZO6A 2QPUA 4S3BA 3EWUA 1HF6A 2G3FA 2DJLA 5EA9A 3AIBA 2UY5A 4GO8A 4K39A 4H9VA 1YXYA 3PUDA 3ZO9A 4Z1DA 2DQWA 3W37A 1JUEA 3EGJA 1GOXA 2VX6A 3L21A 1EZWA 3ABZA 3N4FA 2DUXA 2ZXAA 5E70A 1QATA 1S1RA 3XINA 5D9NA 3N6QA 1TE1A 3NSMA 1NJJA 4GQ0A 4UTFA 4Y9AA 1POKA 1S2CA 4C6PA 2ZWYA 3W82A 4FNSA 2A3BA 1OYBA 1Z7AA 2QKFA 3I4EA 3C3UA 3GDLA 4DXXA 1OZMA 4ZCWA 1F6KA 5EL1A 2VX5A 1S3TC 2EPMX 4NZ1A 5EMJA 4DI9A 6REQA 5FJRA 4O57A 1DJWA 4FHAA 2ZCGA 1K8YA 5C7VA 4JTCA 1Y65A 5KTLA 3WD1A 4LT9A 2A7PA 1XLGA 1XLMA 2DT3A 3KZSA 1EPVA 2YBTA 3W2KA 1DE6A 1YNYA 5IRPA 3MSRA 3FYPA 4MUPA 1RVKA 2GJLA 4UOZA 4X2PA 3NYDA 4MAZA 1EB3A 4X60A 2IXUA 3RPMA 1ECEA 4H9UA 1L8PA 2Y24A 4JTJA 3EOLA 3R10A 1WBHA 2FKPA 1RBLA 4L64A 3F4NA 2D3NA 4V27A 1KQZA 3K1GA 1YADA 1JYNA 4PN2A 3DFQA 1F3XA 5E1QA 3UR8A 3ZSSA 2Y1HA 2W91A 4C65A 3GNNA 3I3DA 1WKYA 3PB0A 1EC9A 5LNWA 3W88A 2TYSA 4KF1A 3NFUA 4YWSA 4Y96A 4K68A 5PTDA 1XJBA 2PURA 2VWSA 1IEQA 2PFHA 4NNCA 1V3JA 1WZLA 3IS4A 3V1PA 3MDWA 4PRWA 1X38A 2YZ5A 1UWAA 2IPJA 1WO2A 4JD4A 4NAFB 1CGWA 4M6PA 3MCOA 5HR6A 1C8VA 1C93A 3AROA 2Z0IA 4LYKA 4UTTA 4H7VA 1A5NC 7XIMA 3AXIA 4RW5A 3OJGA 4HMCA 3OIXA 3R0UA 3HU7A 3WNOA 4CKQA 1BGGA 1C90A 1RJRA 4DO4A 2Q3RA 3QR1A 3GTIA 1UG6A 5GPRA 3OLEA 3HMJG 3JVAA 4ECLA 1NTHA 3WFLA 5TQLA 4JFWA 3CWNA 3NQBA 3R25A 3KDNA 3DFPA 1R7OA 3C0SA 3LCHA 1CGYA 1FTXA 2XVKA 1HKMA 2F6KA 1RVGA 2HBVA 4JQAA 4O8AA 1WCGA 3BAIA 4C6DA 4QLLA 4C7FA 3TAOA 4JYFA 5U4NA 1TPEA 3S2NA 1FH7A 1SO6A 4JHOA 3F2CA 4H01A 1QRQA 3BMVA 2BOEX 4DJDD 2VRQA 1XIIA 1LZOA 3ZVHB 5I79A 4JL1A 2EBNA 3E9AA 1RSCA 4JICA 7A3HA 2RGLA 4GMEA 3U7VA 3WH8A 1I75A 1E1EA 3NOEA 4FLOA 1QJWA 1EKOA 5DBUA 4KCTA 4KFOA 1YKWA 3QFWA 3CB3A 4UCFA 1O66A 2WJDA 2VENA 1H7XA 3QQWA 4PL2A 1WXYA 4INFA 1GOIA 5G4WA 4IIEA 3IJLA 2B7NA 4P7NA 1HJWA 3WLHA 3RM4A 3W53A 1K4HA 3GG0A 4Q4QA 5C9WA 3C2VA 4UR8A 9XIAA 3WUGA 4O1AA 1XP3A 3IUDA 5E0CA 4J40A 5T8GA 1FWGC 1BVWA 3TVAA 4W85A 5DMLA 4AMCA 4D71A 1L2UA 4AD5A 4V33A 4K6AA 1E0VA 3MYPA 5A5WA 3VCNA 1KWGA 1X1NA 5KETA 4KWSA 1DJGA 1QNPA 5KZ6A 1B3ZA 3HV9A 2QCFA 1JIBA 1Q66A 1TJ0A 3RLHA 4YMZA 1ZU8A 4QQUA 2QGHA 3STPA 4A05A 2CBJA 1OCJA 4Q22A 3I68A 4Q6XA 3RPTA 5GVJA 2V0TA 4Y8EA 1DWIM 5A6AA 2FYMA 2E1WA 4RKAA 1CWYA 2YL5A 3GO2A 3E2VA 4WY0A 2WJFA 4FMVA 1WKDA 3B3DA 1UB3A 4HVXA 3OU8A 2AMGA 2G3IA 2VD8A 4U2YA 4J5NA 3ARWA 4A35A 1IXPA 2QPSA 3KTSA 4IM4A 3SY5A 5DN1A 2VQTA 4WY0F 1BTMA 1UJQA 4R9XA 3C0LA 2I5QA 1KKRA 1GOKA 4H2HA 3SCWA 3TH6A 3V35A 3U6WA 1HO4A 1M65A 3KL3A 5CPOA 5BXTA 2E6FA 4IH3A 4L6OA 5A95A 3GVRA 1OB0A 3ORWA 3SCNA 1LBLA 2GVGA 1YIXA 3ZR5A 2OKTA 4H7CA 3H8AA 4KEMA 1GUVA 2OODA 4P8XA 4CQ8A 4UXDA 3VZYA 3FEMA 4XX6A 2BXZA 1OD8A 2R24A 3T0AA 2RUSA 3QGAC 1O7AA 1EJSC 2ZZ7A 1R3RA 3FAWA 4NNBA 4AC1X 4EPKA 2E0PA 4OU1A 5AZ0A 3WDPP 5FEWA 1W9BM 6XIAA 1OYAA 2EJAA 3BUVA 1DORA 2PDWA 4E8CA 2GSHA 3TYBA 3PJXA 3LMYA 3B9DA 5CSUA 4LCRA 3IRSA 3VPLA 1KWKA 4CEUC 3VNDA 2ZICA 1LCOA 3OG2A 5XIMA 2QULA 3TZNA 3C52A 3WQ8A 1XUUA 4HNCA 2NV1A 3P60A 4DWSA 4PMRA 4O10A 3QEZA 4FP1A 1OBAA 1VFLA 3RJYA 5F7UA 3H12A 4ZODA 3AIRA 3SY8A 1X6UA 2DZTA 4IJCA 4NHVA 1WE5A 1W9DM 3BPWA 2G4FA 3VIIA 4A29A 4Z2HA 2VGIA 4WLCA 2FHBA 3WKZA 4D6HA 3VGFA 4GNKB 4LYRA 1V02A 2PSNA 5E5CA 1EJWC 2CNCA 2PU1A 4ZO9A 3QTPA 4YN5A 1E6RA 2ACUA 2ZUUA 1AMKA 1DWFM 2V9DA 4ONVA 4Q8WA 2DZXA 3AOFA 1O60A 3P82A 3MU7A 5CG7A 4H3DA 4FA3A 3LK6A 4MWAE 3FFSA 4UNIA 3RGTA 5AYYA 2BBFA 3TZFA 4L4LA 3S47A 1OFEA 4IP4A 2OWXA 3FCPA 3RILA 1A5SA 1DXIA 2NVAA 4GFIA 4LRTA 4AY1A 3VFCA 3SCOA 3BJSA 3APGA 3M0LA 3W86A 2D22A 4MYXA 5AHIA 1PKMA 1PX4A 1YPFA 4ENLA 2PTYA 2XN2A 1S5TA 1KTCA 2FZMA 1OIMA 4TVDA 3VDCA 1KXQA 2FJUB 2C15A 2V82A 5AC8A 3HN3A 3M16A 1LUCA 1KM3A 1R3SA 3HG2A 4GYPC 3UWEA 5FJJA 4JTKA 3R0KA 5I03A 3BLEA 3BLIA 3LHUA 3ALFA 1TV2A 5FI8A 4RPPA 1H11A 2FDSA 2ICSA 3TYEA 1S2AA 1JRCA 1BSLA 2Y7GA 2YCKX 3AJXA 3MVTA 3W7IA 2TSYA 1UROA 1T96A 4DZIA 3WEMA 1NH6A 2QUVA 1LL4A 3T05A 3FAXA 2Q8ZA 3AICA 5DBTA 2YR1A 4DI8A 2O9RA 4WOQA 2GL5A 3G3MA 4MF4A 5FA5A 1RCQA 1ZRQA 4GD0A 1XSJA 4BA0A 1LQAA 3V4BA 1UIOA 2TPSA 1U5JA 5IBXA 1BPLB 2ZZ1A 3PJTA 4M6UA 4LPCA 1E40A 1VF8A 3LCGA 3BOFA 1BAGA 1GJWA 2J9ZA 2BOFX 4F0SA 3WBYA 1TQJA 3ARPA 4UTWC 5D30A 3W7RA 3B9EA 4G7EB 3DXIA 3DGBA 1EIXA 3S3GA 3LEPA 2IQ0A 4ASTA 4V1XA 1PSCA 1RH9A 3NXFA 2Y8KA 2ZDRA 1FCVA 1HVQA 4UFJA 3GTXA 1TIWA 1FWRA 3WK3A 1O6IA 2QCNA 5CZSA 4CVWA 2INEA 3FVMA 1R3VA 3AZTA 4R7WA 3ARQA 1J0YA 1PWLA 3HF3A 1MFUA 4OTKA 5H6HA 5HUPA 3CU2A 4N0RA 5MKGA 1NFGA 4I6VA 3H7VA 4OWGA 1E3XA 4N9BA 4TR9A 3OZOA 4NT0A 3RK8A 4D8AA 2GGHA 3RX2A 1NVMA 3TN6A 4C6LA 3T81A 3TSMA 3LM7A 5FEZA 1HKVA 5H8PA 2NSXA 3H2MA 1Q8AA 3WQPA 4R9OA 1RPKA 3EB3A 4KCVA 3RX3A 1TJ2A 3KRUA 1QT1A 4M81A 4L4MA 2AQWA 3ARXA 1UZ4A 7TAAA 4WXYA 3TU9A 1QXLA 2HK0A 2DP3A 1WDRA 5LKYA 4JQ4A 1XDMA 3NAVA 2H8ZA 2HK1A 4DNHA 3QF0A 4GVHA 4RNJA 4HOZA 2Y2WA 2J88A 4MWAC 2OLHA 2UY4A 1ZS2A 4JTDA 1DVJA 3ITLA 3CAVA 4HHPA 1C9DA 5HMDA 5D9MA 2YCLA 3F03K 2FHCA 4XZWA 4L65A 3BGGA 1R2TA 1YTEA 4PMYA 4WD0A 4B92A 3WUBA 1QHOA 4ORIA 3UYIA 3S8HA 1WXZA 4GBUA 3QXBA 3QRHA 1XLFA 2OT0A 1MSSA 3MMDA 4J35A 1MO0A 4IFKB 3T0BA 3KLLA 2AL2B 3UXAA 1HL9A 3GC4A 1UC5A 2V38A 2YSWA 2C91A 1NDWA 3BK0A 1ZFJA 2C1HA 1B57A 3EDFA 4M8UA 4ZQMA 1WAWA 4UMAA 1HX0A 3HFYA 4HMNA 1FDJA 3W6LA 2EEXA 2NW0A 5E0KA 4I5UA 2X0SA 1VFFA 1UR3M 2D23A 1GOMA 4FF7A 7REQB 3CUJA 1TZ9A 4W7UA 5CPMA 3EOEA 1RY8A 1EYEA 3H54A 3FK4A 3W7CA 4HZ8A 1MEWA 4QS6A 1DJYA 1GKQA 4Z1AA 4R27A 1QMLA 3HQNA 4YVXA 4L56A 1EJ7L 3MI3A 1B3YA 1UP0A 1X6NA 1XS2A 3TYUA 4IGHA 4PA8A 1XKJA 1EF3A 1Q45A 4NNAA 3TXVA 2YDQA 2GQAA 5E6ZA 3IVTA 1VGAA 1TYGA 4W8AA 1HO1A 1ZAIA 1E0XA 4UZUA 4H41A 1ZJIA 4PTMA 2PS2A 3UWVA 2PGWA 3KWSA 3LHWA 5HANA 2OR2A 4QNWA 3L0KA 1L6SA 5LSMA 4U28A 4Q8PA 2E6DA 4F3HA 4W86A 1UD2A 4AC7C 4J7RA 2HWGA 5AHMA 4R34A 3R6IA 1KM4A 2XSBA 3EXTA 3KWXA 1Y5VA 4JYDA 4RDWA 4AF0A 4CCDA 4LUTB 1I8JA 1NU5A 3PBGA 2OG9A 3WDHA 1O5QA 4FX7A 1CB2A 4BCEA 2X1SA 1TE6A 4WKAA 1OQFA 2BXYA 3PUGA 1ITQA 3U8GA 3W29A 4AZ5A 3G0SA 3EKZA 1XUZA 1R85A 2WM0A 2X7WA 3VE9A 1DQXA 5TF0A 4U2ZA 4O0ZA 1LG2A 2HZGA 2OX1A 2QCMA 3PPFA 3FNDA 4KEVA 2YJQA 3ZYZA 4ZTYA 3W7KA 3RF9A 3TQPA 3WL1A 1XYCA 3M1ZA 2HV5A 3UJRA 2VT0A 3SAZA 4LUJA 2QT3A 4JTTA 5LHFA 4Z2KA 1DJQA 1DYSA 3UZJA 4GY7A 2VQUA 3HG5A 3B8IA 4ZE4A 1EYWA 3GH5A 3NGJA 1P1XA 2O7QA 4Q4PA 4IMGA 3TP4A 4FK9A 1Z41A 2DJXA 1GOQA 1FKWA 4W93A 4LWWA 1UHVA 4QXIA 2QVHA 4FLQA 1H3GA 4A21A 1EO7A 1T99A 1U1JA 3WSUA 1ISWA 2XFWA 4HA3A 3FW6A 3LQLA 1H7NA 1FWAC 2P5NA 1E6ZA 2V3FA 3MP4A 4YJ5A 2PDGA 1OWQA 1U2YA 2ZUVA 4CCEA 3M6DA 2XWEA 3Q45A 4U31A 2GOKA 4J2MA 3ZS4A 8A3HA 1JZ3A 3ATYA 4RX0A 4XIMA 3QHOA 2WK2A 4M7TA 4HYRA 2E77A 2DIJA 3WF4A 5CJMA 5HJXA 2PBGA 1ESWA 4FLSA 2A0NA 1GVSA 3WLJA 4RR4A 4WDUA 1XC4A 3EDKA 1IZCA 3HPXA 1YNQA 3ZT7A 4G56A 2AMXA 2IS7A 5GJNA 4NZFA 1DTNA 4GC3A 1J12A 1SFLA 1TV8A 2CETA 1BRLB 1SM9A 1ISXA 1TIMA 3ID7A 2WQDA 2GYIA 1KGUA 3UP8A 4HPGA 2Y70A 1JYWA 3DHPA 4M5PA 2WVVB 3VNKA 3LPGA 4UBPC 2Y62A 4JN6A 4XAYA 2BFGA 2XM1A 4GI6A 3QYSA 4UR9A 3CUGA 3URNA 3ALGA 1LP6A 1E5NA 3GSMA 4D6GA 3SECA 5A2AA 1IXOA 3TC6A 3A47A 1S5MA 1JPIA 3CT7A 3KCJA 3FOKA 4GHRA 1A5LC 1H41A 4W7WA 1JCXA 3QW4B 2OT1A 4XZHA 4L1XA 3T6CA 2HEJA 1VBHA 2H9AB 4CD7A 2PTWA 4POCA 4H04A 1MYRA 4HSOA 3CO8A 1K8CA 4CUCA 3V5FA 3UWWA 1BYBA 3UY8A 1M6JA 4AHQA 1JAEA 3LRKA 1W37A 1UUQA 4PTNA 3S5NA 2E3ZA 3OZYA 1OD0A 2VHLA 5D2XA 3PS7A 4GVFA 3ITCA 4EF8A 2W66A 4JAWA 1CGVA 4BQ2A 4H9MA 1LF1A 1EO5A 1M68A 4C60A 2VC6A 2CPUA 4HMDA 3VK5A 4MB4A 4JTUA 1VC4A 3V0SA 4MGGA 3R13A 2B4GA 5LIYX 3ES7A 2WB5A 3T08A 3U4FA 1YBQB 3LTPA 4IZGA 4LAKA 1E5JA 2P76A 3GXTA 1VS1A 2ASHA 1DJZA 3TKFA 4ZL1A 3UGVA 3KRSA 3EX1A 4FPSA 4KCUA 2HE8A 4FX6M 5LGZA 2J7FA 1TV3A 4QBXA 3GUGA 3MP5A 3U0HA 1SW3A 2D3LA 3CL8A 1QOXA 3W70A 4V28A 3PTDA 2EJ1A 2QW5A 1ZALA 1JDDA 1XX1A 1D3GA 3NZRA 4URIA 5C71A 4XZIA 2VOMA 2B0MA 3B0VC 2Y5SA 3VIJA 1US3A 2C6QA 3TDFA 1LLOA 2GUUA 4XAZA 2XH2A 2RAGA 3KBMA 1W3HA 4ES4A 2R6OA 5AB3A 5KZMA 1X6LA 2ALRA 1H51A 3DC8A 4AD3A 1WDSA 5CLWA 2Z7GA 4S2BA 4KEUA 2XH4A 1PE1A 3VNZA 4C6BA 2ZADA 1U5VA 3CL6A 3TYDA 2QCDB 4FIRA 2F6UA 2P1FA 1JVNA 2VI0A 4FNQA 5CBIA 3AIUA 3SBFA 4G1NA 4UB9A 3GB6A 4H83A 1UA3A 1TMHA 1RCOB 3KBJA 2OSYA 1ML1A 3QC0A 2WMJA 3M9YA 4O28A 2EG7A 5H8MA 4X9YA 2PF0A 1QPNA 1R7AA 5BU6A 2YCIX 1UH3A 4O16A 4PCSA 2BS9A 1OGBA 2POTA 4E38A 1Q7QA 1QI0A 2NT0A 4AY7A 1H0GA 4IHCA 1QW8A 1C7TA 3SW6A 4IICA 1D7FA 1OFAA 1PBGA 2V2CA 5J8LA 1UH2A 3NG3A 4M51A 1XQKA 5CGMA 3WELA 3TQ0A 4US5D 3MUCA 4NRSA 3P8JA 2INFA 1JNEA 3SCRA 1CW2A 3ANVA 2C19A 1E4IA 1YLVA 1M53A 3BMWA 1EF2A 1IGWA 7ENLA 4YNGA 3LZ3A 3S5OA 2ZA2A 1VFMA 3EA3A 5FAJA 1IT8A 3THAA 4X0NA 1MXGA 3IANA 3RJXA 3BSGA 3KFTA 1OG6A 3VUPA 1GVQA 5E6YA 1EC7A 5CQ1A 4IP5A 2WAGA 4C6EA 3GFXA 3VNLA 3SIZA 4Q4RA 4AX6A 1Y5XA 4C6OA 5LA2A 4D6FA 4Q8TA 1TQXA 4HGXA 3ITXA 1WDDA 3D47A 1VQTA 3PTMA 4LBUA 5HK4A 4D2JA 3KBNA 2Z29A 3CMFA 1BF2A 3WQFA 2FZ8A 4MJZA 4MZ8A 3SUSA 2J79A 3VVGA 3NVDA 4DBEA 3WD4A 1BKSA 3SM0A 1HJXA 4F0LA 1KCZA 3FYYA 2VZTA 4PB4A 5ABFB 4DJFC 4CD4A 1NWRA 1N7KA 1EHAA 3D6NA 3CL7A 3DX5A 4RXFA 1U5HA 3CZGA 4UTIA 2YYUA 4IP7A 5AYBA 2RKXA 1K9DA 4PEKA 3W72A 2CC0A 3CHDA 3KBWA 3FDKA 4W5UA 3NO1A 4IL2A 1V6WA 4DNMA 2WZTA 4E5TA 3D0CA 5C7HA 3L4XA 5HMEA 4QJ1A 4YLWA 2OO6A 4LS1A 3PBUA 1QU4A 4FLRA 4DXVA 3PY2A 2VEMA 2WOQA 4EK7A 2ISFA 2X1UA 4LUIA 4GUIA 1LOSA 3EMQA 3GXPA 2J9YA 3M0KA 1UBSA 1QI3A 1SJDA 3SN0A 3EX3A 4LFYA 1KBBA 1SPQA 1QNVA 4M6QA 1LQ2A 4LSBA 3WLMA 5ENLA 3NZGA 3RCNA 3VD5A 2E8ZA 5I78A 2J7GA 3VMNA 3P84A 3QYQA 3T9PA 2J25A 1XIFA 4KWVA 3P7YA 2OGYA 2XUCA 4W7VA 3H23A 3MSGA 2DZBA 4WZHA 3AALA 3CM4A 4Y9PA 1OIFA 1PHWA 1JZ8A 1HUVA 1JZ2A 2REQA 4YS1A 1JUBA 5CPQA 3CZEA 3SCTA 3UNDA 1QOPA 3BSMA 3NA8A 4HN4A 2W5FA 1E3ZA 3AQUA 4ZFCA 5CZ0A 3UWQA 2PDKA 3VUSA 2ZRVA 2FQIA 3G1DA 3QV6A 4PEEA 3B97A 1FY6A 1DL3A 4BWLC 4ADTA 4FS9A 1EFZA 3EPMA 4QROA 5BYWA 1GVFA 4QE5A 6REQB 2BY0A 4K7YA 2G97A 2W79A 1M3UA 1A5MC 5C5YA 3H2EA 3KAOA 4PBGA 1Y5WA 4PUNA 3OEXA 1RK5A 3FJ4A 3T09A 1JD9A 2C3ZA 1JF6A 3M07A 4H9ZA 4XZMX 3LI1A 1PCKA 4NAFA 2XG9A 2E1DA 1Q6OA 1W9UA 3UF9A 1WP6A 5CBBA 4QE1A 3E2SA 3CQHA 4FOKA 3CAWA 4HIBA 1O4UA 3VD4A 4XWUA 3WENA 2V68A 4OBRA 3GAYA 1CGXA 3VGBA 3LGDA 3CV1A 2OYLA 2ZZ5A 3AWNA 1TPWA 2DU2A 3EDDA 3DESA 4B90A 3NNTA 5ABEA 2C16A 1XYAA 4MAVA 2WC3A 4AZCA 4JFUA 2VJXA 1FP9A 3ZM8A 5FEPA 2QF7A 1BWLA 3W76A 3PZOA 1YTDA 5JU6A 3KOZA 3QQ0A 4CVUA 1VR6A 3EKLA 4YHEA 1OCQA 1YDNA 3TOYA 1P0KA 2XIBA 2TODA 4XIAA 3TJLA 3U9IA 4IPLA 3OIHA 2OXNA 1XINA 4Y8FA 4J3SA 5KINA 1EP3A 1ZB5A 2ZRUA 4HD5A 3PNUA 5REQA 2C8NA 2QZRA 4E2VA 3LCFA 4KH2A 3N6HA 1F4HA 4ZMGA 4NY2A 4Q4SA 1EHNA 1X1ZA 4OOZA 3C61A 4Z2LA 5F1VA 1XWYA 2PWHA 4HZMA 3NQDA 4WOZA 2QYGA 3THDA 3M5XA 3UGRA 4Y6GA 4DO5A 2X2YA 2GGIA 2C1IA 4HU8A 3CUFA 8CGTA 1ONEA 4X61A 3AZSA 3GNPA 1B31A 3AISA 5E93A 1R3YA 3BW2A 2BY3A 1MDRA 5HWJA 3D3FA 3M0MA 3LHZA 2V2HA 3O6YX 5HNTA 3R7MA 4Z17A 6PTDA 1US2A 4QAIA 3C3NA 5G1TA 5EGRA 2GPTA 3FXYA 4FALA 2QJMA 1W17A 2DT2A 2X30A 4GVIA 2FPYA 5BWFA 1B3WA 4P7RA 1EDQA 3P2VA 3QW3A 4ADSA 2ABBA 3P8IA 5A94A 4ILSA 1P43A 1R3TA 2E5DA 4JY8A 4NUWA 3LQGA 1FOBA 4EANA 3QTGA 1FXQA 1UIPA 2O9TA 5CXPA 3WL0A 1PWMA 4Q8VA 1FWFC 3PSVA 3DI0A 3TAKA 3N2OA 2D69A 4ATWA 1DJNA 1W2PA 3WLTA 4NF7A 3P81A 2OTDA 2PZNA 1UYQA 3CPGA 4UQDA 1JI1A 1GOOA 4BEUA 1B90A 4PSPA 4MKNA 3CHVA 1FDZA 4A3RA 3GG1A 4LX4A 4F0HA 3ARSA 4DQWA 2VXNA 5K9CA 3I6EA 4Z0SA 1WUEA 4AY8A 3W1NA 4GKLA 4Q8MA 3B8DA 2Y61A 3MJYA 1CCWB 3JZEA 3MBDA 3RLGA 4H7ZA 4AU0A 2PU0A 1FWHC 4RLIA 5SWUA 2XIQA 4QAWA 1E4MM 2YCEA 2XISA 4DLMA 4RE4A 3LPOA 1FH8A 3BAYA 3WY1A 3CQIA 4MFDA 3AU2A 1GVYA 4DWDA 1PVNA 4U5IA 1RZMA 3THCA 3SGGA 1UUOA 2NWSA 1VBRA 3GU1A 5JH2A 2BY1A 3OHIA 3K46A 2QV5A 2PRMA 2NV2A 5GQBA 2VDHA 5HMSA 1G9HA 1OFDA 4ALDA 4MWAD 1S46A 1YHTA 1VJIA 3EWWA 4JCMA 6ALDA 4S23A 4GXWA 2V5CA 2VFEA 2XINA 3W6YA 5LNSA 3W74A 1K9FA 3E12A 1DWAM 2OLSA 4V15A 2QJGA 4TIMA 3TJ4A 3W71A 4IOTA 3HFTA 1MNSA 4AW7A 3A5FA 2ISWA 3S5YA 3S5ZA 1X97A 3A6OA 5I3GA 1R3QA 3VU2A 5DELA 1WNOA 3N9SA 1Y8BA 4M6VA 1ISZA 3R79A 3QZ6A 4EAYA 4HTYA 1IQ8A 4REQB 3E74A 4YHGA 3TYCA 1JJKA 3PPGA 3WFAA 1KD0A 5DRIA 4JIRA 4AZIA 4U4MA 3STCA 4DWSB 1R2RA 3VZXA 1XBVA 4HA1A 2QMKA 1R2SA 5J04A 1PIFA 2Z1XA 1B4KA 2BGQA 2OZTA 5LNUA 3UNTA 2DW6A 8XIAA 1V08A 4GY0A 3ITTA 4ROPA 2DSKA 5G4EA 3N4AA 1J0KA 3H22A 3GG7A 1BF6A 4ZOEA 3WX7A 1ZP4A 3ZR4A 3W1MA 2KX9A 1Z48A 4GNVA 2VGGA 4ZVJA 1A47A 3BCJA 3N15A 4B5WA 3P67A 3UJEA 4B3LA 3TONA 5D9OA 3LS9A 3W7HA 4QG8A 3VDBA 2XJ7A 5C54A 2OYMA 1DOSA 3NQFA 1B5TA 4EPBC 1W5PA 5F4WA 1HW6A 4JKMA 1XD0A 3I7SA 5K9XA 2IQTA 2FB2A 4QITA 1E9YB 4C6KA 2PPGA 4DBDA 3KBVA 3DFOA 2RH9A 5F2IA 2A2IA 3WBEA 4XSLA 4MZYA 4HCDA 4ZBCA 2VELA 2ZBTA 1ADSA 3PFRA 1LBMA 3A4JA 3L4ZA 5H2ZA 2P3EA 1EJTC 3K4WA 4AZHA 1Z69A 4LB3A 1MW1A 5EMMA 1OFPA 3GU2A 3WBAA 1FWJC 1LUCB 3A13A 1XPGA 3W87A 1FWDC 4R7JA 3TNOA 3R8GA 2BASA 4O1CA 2DSZA 1ADOA 4B3KA 4WCJA 3U4AA 2ZZ4A 2Q09A 3RMJA 1N8IA 3E0FA 3HG3A 1W3IA 1XLHA 3S2CA 2Q3OA 3VXGA 3FN9A 3SY1A 3JS3A 3R89A 1W31A 1AG1O 1BWVA 1XISA 4GQGA 2GQ9A 2BXVA 3EEZA 5G2HA 1DHKA 1XHGA 1LL7A 1ISVA 1L6YA 1M5WA 3TW9A 1W1B1 3L5MA 3FA4A 9XIMA 3LZ5A 3PZTA 1V7YA 4NL1A 1XF0A 2D2OA 1AD4A 1S39A 1Q6RA 2W0UA 5G4HC 4AMAA 4DBWA 1X98A 5LA1A 4MSSA 5IDIA 1E73M 3ARUA 1M7JA 3M5VA 4P7QA 2VM8A 3VCCA 1VBGA 5M3WA 5DT7A 2R14A 2ZX9A 4PMDA 5KSWA 4ML4A 5I5RA 1XH2A 1K9TA 2X09A 1NOFA 4K36A 3QLDA 3S42A 4UQ9A 3UXIA 3IJ6A 1VIWA 1WDWA 5MKGB 4IXHA 3CH9A 5ECUA 4L1WA 1OHLA 2I1OA 3TK7A 3TC7A 1PX8A 1UPMB 4PCTA 1UQYA 1J8VA 2ZUNA 2PBOA 2VL4A 4BQ3A 1GEHA 1K77A 1TPFA 2MANA 3MP3A 4E0CA 2FFCA 3TTEA 4JQ3A 3EWBX 4KMQA 3M5YA 1JDAA 1KW1A 1GONA 2ZIDA 4AWUA 2R1PA 1XSIA 2HBXA 2YB4A 2NX9A 2CKSA 4AD0A 4I7WA 4G6CA 3EWZA 3WNNA 3Q2DA 2YZRA 1O94A 2A3AA 3SUUA 4F48A 3GH4A 2ON3A 2X1RA 2YFNA 2DV0A 5CC5A 3S2JA 3LY0A 2YCLB 2JGQA 1NWTA 3ATZA 4S3GA 2PDPA 3CJPA 3AHXA 5JIPA 3WEZA 1Z89A 5JVLA 3EXRA 2FFIA 2OOFA 1XYZA 3O07A 5AECA 4DF0A 1ZUAX 3K2GA 5HPOA 2D0HA 3G1SA 1ME7A 1P6WA 4M29A 2A7NA 3W1LA 3LA4A 4DJDA 1AW1A 1CENA 2QJHA 3PWAA 1KM6A 1RAKA 3OGRA 1A49A 5HATA 3NQ8A 1OABA 4UFLA 4TVCA 1MXDA 1JPKA 3CZJA 5I07A 2WHLA 2CKRA 2E68A 2ZFAA 4NI8A 3SCPA 3SGZA 7CGTA 1UR0A 1ZCCA 4C5YA 3UY7A 1FQ0A 1XLCA 1B3OA 1SO5A 2WNNA 3TE9A 3UR7A 3K4AA 4FO4A 5LZLA 2OELA 3GTFA 4O50A 5FJPA 4OIFA 3W1AA 4QQ3A 2OFJA 5CC6A 2X7VA 1YPIA 2PWVA 3EZ4A 1VB9A 3N19B 3WLNA 3WH5A 3VOGA 5DCDA 4IPPA 2FPTA 3VMPA 1QI4A 1IWAA 1Q7ZA 2EPHA 1NP2A 2DVUA 3H21A 5CSYA 5HWNA 4PMQA 5HXMA 5AY7A 4UTLA 3M0HA 2P53A 3QMRA 3TCEA 5CJNA 2VRKA 1LWHA 1EIBA 3L9CA 3WEOA 4U10A 3QV9A 2OGJA 4FR6A 5DFAA 1RY0A 3PUOA 3OLIA 4CCZA 1BTCA 4RE0A 2A5HA 1VEMA 1FWBC 1W3LA 3GFZA 5BU9A 1AZ1A 3OLGA 1LT8A 3MMUA 4I9MA 3NOYA 3E3HA 1J93A 4C1KA 1D3HA 3VKAA 1V7AA 2WV8A 2X1IA 5CCZA 3GC5A 4RPQA 4H8NA 1WX0A 1KO0A 3ZVIA 1GYNA 3BAXA 5D03A 1S38A 2WPGA 4QGCA 1AH4A 2NXGA 3AXXA 5K4ZA 1JCLA 2QAPA 1RR2A 4C1NA 3G6LA 3JU2A 2FVKA 4M80A 3XISA 3AYTA 3CPUA 3MVIA 4QSFA 1JDEA 1TREA 1NQ6A 2R8WA 1H63A 5HNUA 3L2LA 3GXIA 4KS0A 2ODOA 4LUSA 1QPKA 2NQLA 2WWDA 3CZKA 4LQ1A 3CNYA 3ES8A 3S9ZA 4KRZA 3H4GA 3A23A 3FS2A 3RNDA 3KE0A 4B9ZA 2QMJA 2WXDM 5AFDA 2QAFA 4DX3A 1SJBA 3N04A 3FDGA 3NURA 3LCWA 3S46A 4F9JA 1OX4A 4JR5A 4IQLA 4J4KA 2DGAA 1OCNA 4KRTA 1JCTA 2E25A 3MV11 3RRAA 2C0HA 1J0IA 1F74A 3SZ8A 1WOAA 4GVGA 1E9IA 1F76A 4C90A 3LPPA 4I9JA 1EDTA 3U5YA 3MUY1 3IIOA 1IF2A 4Q33A 2V8ZA 4LY8A 4HNOA 4JTIA 2E9BA 3GHSA 1G0CA 2B81A 1DV7A 1RPXA 3EX2A 1EJRC 5D9PA 3BCFA 2XFRA 3F2BA 2D0GA 4DO7A 1E9LA 4WJEA 4A3UA 3U7BA 6TIMA 3AZRA 1KFKA 3V0UA 3BGAA 3WNKA 1ICQA 4KWUA 1DQUA 4HPNA 4PFHA 1QHZA 2WHMA 4M0XA 4PMOA 1A5AA 2RJHA 2CZDA 3ARTA 3AMLA 4JFSA 2OZ8A 4EIVA 3T0CA 4GLEA 1JR1A 4GIRA 4IG2B 1RK6A 1H4PA 1PB0A 3CIVA 4Z1CA 1FFQA 4DRSA 3U3HA 1VRXA 4JHMA 5CAHA 2RHGA 2AAAA 2Z2AA 5LXEA 5AVNA 4G7FA 2OZ0A 3FIGA 3WK1A 2CIPA 1MNZA 3VD7A 2XU2A 1XLEA 2FB3A 4IGSA 1XIGA 3RUBL 3C0QA 5CAKA 4F79A 2WZEA 2D1ZA 1T0OA 5FKYA 4JEQA 2YA1A 2Z1WA 3GNOA 5A6SA 4LANA 4PTVA 2BHYA 2JF6A 4QTGA 3N11A 5LIWX 2NX1A 2YW3A 4DJFD 4W87A 3R43A 1QNQA 3RAOA 3DHUA 1NF7A 5EMUA 1GT8A 2TAAA 4GIEA 2OZ3A 3WQWA 4D8LA 1VCFA 4DZ5A 4HPJA 1Q4WA 4I7VA 4CQCA 3NDYA 4C6FA 1SR0A 2FMOA 3BG9A 1TMQA 2FDMA 4B2DD 1I9CB 3SR7A 2OCZA 1YBQA 4MLRA 5HPCA 3QY8A 1IR1A 1TX0A 1ZLPA 2ZX6A 3SJNA 1P0NA 2BHUA 5LYRA 1DIOA 5EMKA 3B8TA 4PTWA 3M0IA 1YDYA 2IQDA 2VMFA 3B03A 3IGXA 2CWXA 3MDUA 5CGTA 1IIGA 2Y88A 1GQKA 3R58A 3QQ1A 1XIBA 2YBUA 5DT5A 3CAKA 3W75A 4MLJA 5U7SA 5DMYA 1CPUA 3EWCA 2Q71A 5F2GA 1K1DA 1W5QA 4B5SA 1K6AA 3G1VA 1A5UA 2QCLA 5E9XA 4QCFA 3ZT6A 3PC0A 3CIWA 4V2XA 1H1NA 1LL6A 4HSHA 3KVJA 4ACZA 3W02A 3L5LA 3GKFA 4S3JA 4GNJA 1A5BA 2G3NA 4HA4A 2PE4A 2OB3A 3MANA 2WHJA 3I7RA 3AMGA 4BF9A 4L9YA 1TPVA 4N6EA 2VZVA 4GCAA 3HQPA 4OJYA 2Z26A 1ZAJA 2QCDA 4FNRA 3L67A 4LOCA 4NILA 1H7OA 3N3TA 4KETA 4Z0JA 3ZOAA 4IX0A 1K8ZA 2WSKA 4MPKA 4AH7A 3UZXA 1CXLA 3AS0A 3II1A 1YNPA 4MJ2A 1XBXA 1BXCA 2PDQA 4MIMA 2G8ZA 2EPLX 3NQ2A 4W88A 5K3VA 5AHLA 3L4VA 2V5LA 1Q4NX 3BURA 3C86A 4HNUA 2BVWA 4J2PA 4QE4A 5I23A 4S38A 1EOMA 3SRDA 2HDJA 1YDOA 4TV6A 3RR4A 3DCPA 4W8BA 4N7QA 1QWKA 4QDMA 3WYZA 4NIRA 3AS1A 1G4PA 1VLIA 2GUBA 3RU8X 3RXZA 1DIEA 3DN5A 1JZ5A 1JFHA 3KL5A 3N9RA 5C9RA 2AOSA 3H2NA 3WK0A 2CWNA 2WLZA 3A5VA 1E9ZB 3VX1A 5E9AA 5DEZA 2JQXA 4Z42C 4AVNA 4IT1A 4AHOA 3CMJA 2CZVA 1DJHA 1RCXB 1SJCA 3TIMA 4LALA 4GQQA 4NVTA 2ZE3A 5HINA 1R9ZA 4IQEA 4ZB0A 3PM6A 4QM1A 1BD0A 1H5YA 1MZHA 4RXGA 4GUJA 2BHZA 3W83A 3VMOA 5GNZA 4O54A 3BICA 4YWIA 2ABAA 3K5XA 3SCVA 4CD5A 3OP2A 2W67A 3JW7A 1H1YA 2PGFA 4BS0A 3O15A 3NPXA 3PR2A 3NTYA 1KGWA 4B9YA 2ATMA 1ITXA 1N8WA 4LYQA 2ZVIA 2PC4A 3DG6A 1OFRA 3S1XA 2V67A 4B5NA 1H2JA 4F2UA 1CXIA 6CGTA 4WVXA 4RZBA 1JCMP 4AUBA 1XYMA 1VIZA 2B31A 4L4PA 3PVFA 1QPQA 3ZLHA 3AUJA 4Q6JA 4PMUA 1V0MA 1QBBA 1AZ2A 1Z42A 4FOUA 2HPIA 3LGEA 1T41A 4I5XA 1CTNA 2Z1KA 3PPCA 4JDBA 2BX7A 4H2CA 2OO0A 2LLEA 5CH9A 1J01A 5HQEA 1NY1A 4Q8NA 1TCDA 3CPRA 3HGOA 3KBSA 3CO4A 4DM1A 1NM9A 2GJNA 3GD6A 3NZPA 4J27A 2OEKA 3GR7A 1GVRA 4UMBA 1IT0A 3IJ7A 4JTSA 1KRBC 3DFNA 4M1RA 2ISDA 2PWFA 3IJQA 4K1GA 3H70A 5DLCA 5CSRA 4OT7A 2CBUA 3DDMA 3MKCA 3R8RA 2JKAA 1JQXA 2CLHA 3VKBA 1B3XA 2PA6A 1P0EA 3IJ9A 4GISA 3TW6A 4IX2A 3SJ3A 2DH3A 2G0WA 5J5DA 3CTLA 1W1PA 4HZ7A 2OJPA 2XDFA 4F2BA 4LW7A 2NLYA 3QPYA 1XW8A 5FD0A 4QJ3B 1GHRA 5G2WA 5EMYA 1XH0A 4J9JA 4C5ZA 3WF0A 4W9TA 4XD3A 3W1XA 3H2AA 1V4YA 3CTTA 3VD9A 2L5HA 3MCMA 3SQSA 4A8LA 2WMFA 4UTJA 2YL9A 4IPIA 3DERA 4GCXA 1P1MA 2V5KA 1I0BA 4CNTA 4DAIA 4ZQPA 3BLOA 4IL0A 2DY3A 3L0NA 2OSWA 3GR4A 4E4PA 1KFCA 2VTFA 1H1ZA 4LS2A 2DW7A 3CUIA 4EOUA 2PDHA 5CEWA 2O4MA 4CD6A 1BXBA 3GR8A 4K8EA 2J77A 1DIKA 2YLLA 3TN4A 3IVUA 1JGMA 5HWMA 3IACA 5BRPA 1GVOA 2WJZA 5CLTA 3TNBA 4QP0A 1MQRA 3P0WA 1FFRA 4LF2A 2E28A 3ZLFA 4GRSA 3DOPA 1XIEA 2REQB 4Q7BA 3W2NA 3I6RA 3PZIA 1M7OA 1VYRA 1VYPX 4LCSA 3WQ6A 1THFD 3CQKA 2CLOA 4R85A 4XVDA 3Q58A 3L7RA 1W5NA 3C4UA 4RDZA 2I5GA 3GS6A 4JN7A 4DPQA 3VYLA 1WXJA 3BH4A 2PDLA 4CU7A 1XPYA 4HA0A 4IWWA 1ITCA 1ZENA 3L66A 3CYVA 3H2FA 5A6BD 4GXMA 1EL3A 4O4VA 1FWEC 3D3AA 3NQVA 4YTSA 5C55A 3MW7A 1OM0A 1JQVA 1BLIA 2J8FA 1OYCA 5DXXA 2FVLA 3KCLA 3G1AA 2Z4GA 2Z25A 3BLPX 2Z1VA 4QCEA 1A3HA 3A12A 4IJRA 3RYSA 4OV4A 1HGYA 1MQPA 2DZWA 2W6RA 2HS6A 1S3HA 2DH2A 3TQKA 1KLZA 1OFQA 5F1UA 4JIHA 1Q13A 4OGZA 3VKDA 4BFAA 5BW6A 3TFXA 3SB0A 1JL8A 2GGGA 3JR2A 1GZ1A 3S9YA 1AA1B 1V93A 4GGBA 3DYOA 1IV8A 5EFFA 4NJGA 4JIEA 2BG5A 3TFCA 1V3LA 1NARA 4AZCB 4UNKA 3U5UA 4FNTA 5JBEA 4CN4A 3M0ZA 4MG4A 1KRAC 3PZNA 2CEQA 4GABA 1K70A 5D05A 3CH0A 5I77A 4FXFA 2NUWA 4RNFA 4K2SA 4JZ5A 1IYXA 2PEVA 3W81A 2RGMA 1ONRA 4JTGA 1L6WA 3F4DA 4RW3A 2A79A 2FIQA 4WX2A 1MEHA 1Z8AA 3QGKC 5I7GA 2E5CA 4LB4A 1R86A 4NXSA 4LC6A 3GDTA 4BI7A 1RA0A 2YA0A 1HKIA 2PDUA 4UR7A 4XAFA 1UWIA 1NSJA 2YL8A 3KEHA 4Y90A 1ZJHA 5JIWA 5REQB 3MHFA 4WGHA 1V6TA 4ATDA 2HSAA 4GI9A 4QNEA 1PZ0A 1XD1A 2AGKA 4L1GA 5B7YA 1AUSL 4HCLA 4DF1A 1EJUC 1LWIA 3NR0A 3CHEA 2VX4A 2ZUSA 1ZTVA 2QXWA 2VURA 2J9XA 1ZBKA 4CN6A 4EF9A 3GNXA 3CMGA 4IIBA 3RCYA 3ABSA 2A3CA 5MHBA 2E4TA 3G8RA 4N42A 5AC5A 3SGUA 1ODZA 4KFNA 5JQ9A 2CHRA 3FJLA 4KT2A 2X41A 4WK9A 4G2DA 1PKYA 3LSBA 4H6RA 2D2JA 2ZRXA 3L2IA 3RRXA 1PS9A 3KDOA 3RFAA 5A6LA 2Y4SA 3KX6A 3DKLA 4KW2A 4X63A 3NL5A 4GYFA 3SO7A 2W61A 1OX5A 1H7PA 3RM9A 2O4QA 1D3CA 4MHBA 5FF4A 1TUXA 2CZ5A 1SMAA 4GZIA 4XUYA 4BF5A 3F4WA 4S2CA 4BQ5A 1DKWA 1VP5A 4CN1A 3CUHA 3FKRA 5A2CA 1T5AA 4JGDA 2C7FA 6TAAA 2JF7A 3OVRA 4KWOA 1HT6A 5FJOA 1BVNP 2PDCA 4JX6A 4G5DA 4L6DA 3GBDA 3WLQA 4AHPA 3NO3A 1UR4A 3GVVA 5IM51 3B0UX 3HGJA 3H6OA 2G5WA 1F61A 1DWGM 4DJEC 2XHYA 2XSAA 4CNPA 4EXBA 1L6GA 1G4TA 3NPVA 5TD4A 2XWDA 3LOTA 5C9UA 1HJSA 3MQTA 3GIPA 1JPMA 2QJNA 4C1LA 3IV8A 1IZKA 1Q85A 3N13A 2P8CA 4TUFA 1M1BA 3CHCA 2HNEA 4Q7IA 5BRBA 2INZA 4L7ZA 1PAMA 4GXPA 5A8PA 3E0VA 4KEZA 1GTHA 2ZXBA 3V3WA 1X7FA 3WK2A 1ICPA 3VIKA 5IFPA 1KV8A 4NKCA 4TMBA 4MNMA 1J9YA 4UTHA 3TSDA 3A4AA 3GW0A 1ZCOA 3WF1A 4JKLA 2UZ9A 2VCAA 3RDKA 4REQA 3GHRA 3T2QA 4S39A