3N12A

Crystal stricture of chitinase in complex with zinc atoms from bacillus cereus nctu2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
NNLGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLESGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHYNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDGLSLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Chitinase A
total genus 113
structure length 332
sequence length 332
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n12A00
2V38A 2CBIA 2EPMX 1XSKA 2NT1A 4D6JA 5DMYA 5A8OA 2VZVA 3AIRA 3AS0A 3RM4A 1E6XM 4XV0A 3WDQA 4TVUA 4AMCA 4MAZA 1VEMA 2G41A 5FL1A 2J8FA 4IM4A 1I1WA 3WDJA 4PTXA 4M1RA 4AD5A 4F9JA 3WEMA 3FHQA 1RP8A 4MB1A 2DH2A 1BYCA 1UD8A 4D6GA 2WMIA 3ZR6A 2OSYA 1G01A 3B8SA 3EDKA 5D8ZA 3LMYA 2QF8A 1BYDA 1BVZA 4AZGA 1MW3A 1WZKA 5CGMA 2J25A 2VX5A 1CLVA 3N12A 3IANA 2XWEA 1JXJA 3U7VA 4CD8A 3PTQA 1FFQA 2VX6A 1MQPA 1H49A 3N18A 3L4YA 1QI2A 1XC6A 3WBAA 4Z2GA 3DC0A 2WNWA 1J9YA 1KCLA 1UD6A 3ARXA 4CD6A 2WB5A 3VGFA 1V3MA 2CIPA 1B2YA 3BAJA 4JIEA 5I5RA 1JZ3A 1UR1A 1C91A 3WDIA 3UCQA 3SCUA 1ISZA 4EE9A 4V2XA 2BHZA 3T08A 3CIVA 1TG7A 3UG5A 1C92A 1UWRA 1WDRA 1WKYA 1XHGA 2XVPA 2G3JA 4W88A 1V3JA 3L4VA 1HJQA 1R8LA 4KGLA 4PRWA 1TE1A 2EPOA 5LA2A 3CUJA 2WBGA 7A3HA 5AYIA 3J7HA 3KL5A 1FH7A 4AIUA 1KBBA 2AOSA 2DSWA 1BYBA 4WSJA 5CXPA 4HZ6A 1V3IA 1W2VA 2D0FA 3I3DA 4MDOA 2VL4A 3JUGA 3WF4A 1GJUA 5A2CA 3FW6A 3OZPA 1K6AA 5DF0A 1UUQA 4TXEA 2VCCA 1XCXA 5IFTA 4W84A 2PWFA 1I75A 4PMYA 4KRUA 4LYPA 4TOQA 3L2LA 3CTTA 1VBRA 2YL6A 5HDRA 4FF5A 3VIKA 3VD4A 1PBGA 3VILA 3WF2A 4ATDA 2WHLA 4UCFA 1GORA 1JD7A 5DT7A 1Q6DA 4CVWA 5CG0A 4AZ6A 4JL2A 3L4UA 3D5HA 3LPPA 3WH5A 2DEPA 1RD6A 2WHMA 3APGA 4W87A 2OYMA 4HP5A 4AIEA 2WKGA 1EIBA 1UR4A 2WBKA 4KH2A 4CU6A 4ZE5A 2X8RA 4EKJA 3MSGA 2UY5A 2XTKA 1LL4A 3HMCA 2VR4A 1OBAA 3BMWA 4MNJA 2VZTA 3RIKA 1GOIA 5ECUA 3VIIA 4ZENA 3VUPA 4YPJA 4KGJA 2G3NA 4C7GA 4QAWA 3DHUA 3L4XA 2G4FA 3AMDA 4BF7A 1BFNA 4HA4A 2WSKA 3NSNA 2XVNA 1KGXA 3AZTA 3WH6A 4P7LA 3OIHA 3WF0A 2GVYA 1WCGA 2VI0A 1BG4A 2ZICA 1QI0A 4P8XA 3BCFA 4J3XA 1CPUA 3TTQA 4AYSA 1XD0A 3ARSA 1BLIA 1UWTA 5JIPA 3M7SA 4GI8A 1AMYA 2YDRA 3BGAA 2EEXA 1G5AA 1H1NA 4W5ZA 1BVNP 2J7GA 1DWAM 2UWFA 3RDKA 2XFYA 1JZ7A 5A94A 4MB5A 3K8KA 3MMDA 4AD2A 2YA0A 2PWEA 3WNKA 4M29A 4B3LA 1HVXA 1KCKA 4IUGA 2C7FA 1C90A 4H41A 4HPHA 5FCZA 3L4TA 3NJ3A 4TVCA 3WUBA 1VIWA 5JUVA 4ZFMA 5CPTA 1R7OA 1SFSA 1J0YA 2XM1A 3QGVA 1E6RA 2V5DA 1UYQA 1A47A 2ZIDA 2WMJA 4RE2A 5BRPA 3PN8A 4M82A 4B15A 3B9DA 1B30A 3WDHA 3AISA 3CMJA 1HVQA 4AZBA 2A3AA 1B31A 1E1FA 3HN3A 4PMUA 4WSKA 1IT0A 1E15A 1K9TA 4P8VA 4D1JA 1WZAA 1V3LA 3SCWA 3I3EA 3PZTA 1GQKA 1DHKA 2XFRA 4W7UA 1UWQA 1XGZA 2YA1A 1OCQA 1WAWA 5IHRA 2FGLA 1BAGA 1EHAA 2BY1A 2A3BA 2VTFA 3T0DA 4NSBA 4WKAA 3RJYA 1B3WA 1PX3A 4P8UA 1MWOA 1QI3A 1V0LA 2YKKA 1MQRA 1FOBA 2ZXAA 1XH0A 2WC3A 3U5UA 5ABFA 2XUCA 1Q6EA 1KR0A 4NRRA 5A6BD 2PF0A 3WD1A 2BNJA 3AS1A 2CITA 2BVTA 1VF8A 3BSHA 4CKQA 5E09A 1BGAA 3EDJA 1QNQA 7TAAA 4N0RA 4UFIA 1G0CA 2ZX5A 4GZJA 1LJYA 1WDSA 1HJUA 4FLSA 2DSZA 3ARYA 2J77A 3GNPA 3ARPA 1GQJA 5KZ6A 3BAXA 4TTGA 5A2BA 3SUTA 1HNYA 4GI6A 4OOZA 3QOMA 1DTUA 4JHOA 2WVSA 2W5FA 3DYMA 1B0IA 3ALFA 1CXLA 3N1AA 1HP5A 4Q22A 1UR8A 2WVUA 3BMVA 3WNLA 3ZO9A 3W38A 4QP0A 1UD2A 3UESA 1NQ6A 1JL8A 4AZCB 3VD5A 1W1YA 2GK1B 2XG9A 2V3FA 4LYRA 4CCEA 3OG2A 4W89A 4PMRA 1EH9A 3OBAA 3VIFA 5A6SA 4BS0A 3GXMA 1D3CA 3AMKA 1TA3A 2X09A 2UY4A 4H2CA 3WEZA 2D22A 2YDQA 5A6MA 3CBWA 1UG6A 3SCVA 3WQWA 3AIQA 1H0IA 4D6CA 2IUZA 3PTMA 3AHZA 4PMDA 3W37A 2BHUA 2A3HA 5E6YA 4QCFA 2BY3A 1ZBKA 1OWQA 2WVVA 1I1XA 1HP4A 4MPKA 4GQRA 4Z2IA 4UQ9A 3T0BA 1H5VA 1SMAA 3MUY1 4AZ7A 3VIMA 3VNZA 1JZ8A 2E9LA 4AY1A 2BVYA 1JZ5A 3THCA 1JXKA 1ZL1A 4KWUA 3A4AA 1E3ZA 1LL7A 1IV8A 1CNVA 5AY7A 1UD4A 1UQYA 3CHEA 5EMYA 1CGUA 2VRJA 2GDVA 3MO4A 1DWFM 1OT2A 1UR2A 4HMCA 1E9LA 1NWSA 3W26A 2WKLA 2YIHA 1GOKA 3UG4A 4MNKA 2VZOA 4ZE4A 3TTOA 3MV11 1UR0A 1TFVA 5IDIA 3AIWA 4CD4A 2ZWZA 5I79A 3WL1A 4F9DA 3WMBA 3BH4A 5CGTA 3WF3A 4ATLA 5M3WA 3TOPA 3DYOA 2VR5A 4RL3A 5I2UA 5IFPA 3OA5A 4BQ5A 4WF7A 3CLWA 3CGTA 2GK1A 2Y8VA 1TCMA 5A69A 2ZXBA 2JIEA 1XSJA 2VVSA 1CGYA 4L4OA 3U57A 2IXUA 2X0HA 1ESWA 2DGAA 2W4XA 3CHCA 4R27A 4DM2A 3MANA 2WZIA 1E6SM 4XB3A 1WP6A 4J3UA 3KEHA 1UR9A 1TA3B 1C3FA 4C7FA 3W53A 2J75A 1EOKA 3RILA 1QHOA 3GXIA 3GH5A 3QHNA 5A3HA 1Q6GA 4XZWA 2CCRA 3CZJA 1QNOA 2WVVB 1NP0A 1E71M 2CBVA 3SUVA 5A6JA 3VD3A 1EQPA 1C7TA 2E8YA 1JZ4A 4PTVA 3L2MA 3GDBA 5BXTA 1J12A 1JNEA 5A95A 1WPCA 2UY2A 3U7BA 2DPEA 1OSEA 3VDHA 5D9PA 3SCQA 3K1DA 5GNYA 4W5UA 3AZRA 1ITXA 1E4MM 3KE0A 2O92A 1SMDA 3E1F1 3DYPA 5A6BA 4ACZA 2DSUA 3N17A 7CGTA 3CUIA 3FNDA 5FL0A 2AAAA 3WDPP 2YBTA 3WQ4A 2VT0A 4D1IA 1PEZA 1R7AA 5KEZA 1ISWA 1O7AA 1UZ1A 3AQUA 1M04A 1MXGA 3WNMA 1LG1A 3AIBA 5A8PA 2XGIA 1LWJA 3GBEA 2F2HA 2J74A 3NYDA 3A47A 4ZXOA 3VNYA 5EB8A 3WUFA 3PZMA 5D9NA 1H09A 3FAWA 4NF7A 1ISVA 1V3KA 1UZ4A 1PIGA 1OM0A 2WLYA 1UWIA 2W62A 3AICA 1AQHA 2EQDA 2YL9A 3ZT7A 2J47A 1XSIA 3ZT6A 3AIUA 1XRVA 2ZXDA 4P7QA 2VX7A 2Q8XA 4OUEA 3RM9A 3AOFA 2RGLA 3T0AA 3SCTA 1LWHA 3POHA 4H8VA 5LYRA 2XJ7A 3G6MA 1DWIM 4D6EA 1W9VA 1K9FA 3N11A 3MSDA 1LL6A 4BQ3A 1GW1A 4J3VA 1E73M 2CERA 3CUFA 4ZXLA 4UQCA 5BRQA 1JFHA 2WXDM 3CPUA 4JFTA 2O9TA 2WSPA 3W27A 1E5JA 5EFDA 2Z1KA 4UQBA 3K4AA 4OZOA 2JEQA 4WIWA 3NSMA 2EXOA 1JI1A 3GNRA 1GHSA 2ZE0A 4AISA 4D72A 3I3BA 1DWJM 1UH3A 4WK9A 4URIA 1BGGA 4AD1A 1UHVA 2JF6A 4JKMA 4X0VA 1OGSA 2FHFA 1HJWA 2WM0A 1GOOA 3OGRA 1ODUA 2J8GA 1JNDA 5IXEA 3VU2A 3AHXA 2TAAA 2YL5A 4P7RA 4L4PA 3PZOA 3M07A 4V28A 3GXFA 3WIJA 5M5DA 1JD9A 1CENA 3VIPA 1VFUA 1H4PA 5DEZA 1KFWA 1WZLA 4C7DA 4Z2JA 5JIWA 2O9RA 1C8YA 3O9NA 2V5CA 3GTNA 3NIYA 3BLKA 3UR8A 4RE3A 1GVIA 4JFUA 1CLXA 1K9EA 2XSBA 3CZGA 4JFWA 3NUKA 5HOSA 3BAIA 3ZT5A 3BC9A 3IJ9A 1EDTA 3ARZA 1LQ0A 1NARA 4HTYA 3CZLA 1U30A 4PN2A 3W6MA 3VMPA 3NDZA 4D6HA 3WQ6A 1EDGA 4JKLA 2WCGA 1GOQA 2CYGA 3WD0A 3SCRA 3RMEA 2ZUUA 3VX1A 4XUYA 3VDCA 4OIFA 2ZUVA 2DT0A 4JZ5A 1DP0A 3ZQ9A 2W91A 1TVNA 3VGDA 2OSWA 3MKKA 2Y24A 4N42A 4QLJA 3KL0A 4YHEA 2ZX9A 3WMSA 1SR0A 4F8XA 2W63A 1N82A 3AIEA 4IISA 1RP9A 5C8BB 1R86A 2CETA 1HL8A 4DUWA 3W6LA 2VRQA 4DUXA 2A3EA 3OLGA 3FAXA 4MTVA 1JF6A 5AYBA 3VTRA 3VIHA 1PX4A 1JYVA 1KXVA 5ABHA 4QCEA 4OBSA 4Z2HA 1DWGM 1KQZA 1W9DM 3AIVA 2FGZA 2OLHA 1HJSA 2E3ZA 3SEPA 1GONA 4AW7A 4B9ZA 3ARQA 1F4AA 4PTMA 5CQ1A 1J01A 5D8WA 2ESCA 2DH3A 4AIOA 1C7SA 3TA9A 1V0KA 5DT5A 3CUGA 3RO8A 8A3HA 2F61A 1QHPA 3IAQA 3PZGA 2D1ZA 1PZ3A 1C8XA 3OGVA 3K4DA 2QPUA 2Y4SA 1H11A 3FHAA 1UKTA 3F5LA 1Q4NX 2E9BA 4F66A 2DIEA 3MV01 4FLOA 3OB8A 2JE8A 2QPSA 1SYTA 3VPLA 2W66A 1RH9A 4GKLA 3AXXA 3DHPA 4UQAA 4E2OA 1US3A 5I77A 1W9BM 1L0PA 2E8ZA 2FHBA 3L4ZA 2VC9A 2WANA 1NM9A 1HT6A 3POCA 2X1IA 4CU7A 1E3XA 1MXDA 1KGUA 1D2KA 1CXFA 4E8DA 3PZIA 3EYPA 1EOMA 2EBNA 4X0NA 2OYLA 2WC4A 1JIBA 4XZBA 4U3CA 3CH9A 4W8BA 1OGGA 3AYRA 3N9KA 1QBAA 2C8NA 2D0HA 3IJ7A 1Q6FA 3GZAA 1ODZA 2WCAA 3VIJA 3WNNA 1PJ9A 4LGXA 2VRKA 1KB3A 1HL9A 3AHTA 2ZX8A 4PBGA 4TVDA 4P7OA 1R85A 1CWYA 1GNXA 1TZ7A 3ECQA 5FD0A 2WHKA 4CCDA 5BXPA 3ALGA 4HPGA 5JBEA 3F4VA 1M7XA 1FHLA 5FKYA 3WD2A 3II1A 1W2PA 2D3LA 2WMGA 3W0KA 3W24A 1GCYA 1RPKA 1ZS2A 3K8MA 2BFGA 4CD7A 2X05A 4GO9A 4LX4A 2A3CA 4HOZA 1W9XA 2BY0A 3VMOA 3BXWA 2VMFA 1LG2A 2XPKA 1CGTA 2XHYA 2XSAA 4WKHA 3WN6A 4PCTA 1VENA 4QFUA 3AI0A 4DM1A 3AFBA 2WYSA 4H04A 4H8UA 1HF6A 1X1NA 1VEOA 3T2OA 1JAKA 1H2JA 3AS2A 1TUXA 5M17A 5AC5A 1FH8A 3ARVA 1KWGA 4PYSA 1HX0A 4NRSA 3T2PA 1MVYA 2D0GA 3UETA 1E1EA 2OSXA 2GFTA 3WH7A 1NP2A 1PIFA 4QLLA 1NWTA 2MANA 3WNOA 4RE4A 1CEOA 6CGTA 3MMWA 3ZJ6A 1B3XA 2FDMA 3QR3A 4CN1A 3ZSTA 3RPMA 4H8HA 3VD7A 1W3HA 3VM7A 2WK2A 4M24A 1UA7A 5BCAA 1A3HA 1E70M 1OINA 3O6AA 5GQBA 3WF1A 1CDGA 3NDYA 4AZHA 4UOZA 5HNNA 4UFHA 5BROA 5DFAA 4CD5A 3TTSA 4A3YA 3ARRA 3MMUA 2QLYA 1E55A 2OWCA 3FN9A 5E6ZA 4FK9A 3AXHA 1E4LA 3WD3A 2VOTA 5CSUA 3OZOA 1E6ZA 2ZWYA 2F8QA 3CZKA 4D71A 2NT0A 1W9UA 1O6IA 1JDDA 2BS9A 2WMIB 3GXDA 3GNOA 2XIBA 3VDBA 1NOUA 1MFUA 2D24A 2YOCA 1E40A 2O9OA 2WZEA 1EGZA 4U2ZA 3MUZ1 4CN4A 4HA3A 3VDAA 4B3KA 2CBUA 3OGSA 4FLRA 3N13A 1W32A 2OYKA 3HJEA 1XD1A 1UKSA 2QMKA 2BY2A 3MS8A 5DO8A 4J7RA 1UKQA 3PZQA 2B31A 4UTFA 1HJVA 2DDXA 4CCCA 4CU8A 2VQUA 2PI6A 3BCDA 5TD4A 1QNSA 2CKSA 1QPKA 3VVGA 4DWSD 2YLLA 4UOQA 4CN6A 2PWDA 2DT3A 3MU7A 4DWSA 4HU0A 1GJWA 1EO7A 2XVLA 2UY3A 1ZJAA 1JZ2A 2YBUA 3W4RA 2J7HA 1UKPA 2XIIA 4HOWA 3SCSA 4CUCA 1ZBWA 4D6DA 4XX6A 2GUYA 3A6OA 3SURA 2WLZA 4CGTA 3TTYA 1E6PA 1UD5A 1WNOA 4PMOA 4A3HA 1MW0A 5BXRA 3VINA 1V6UA 5CZKA 2PC8A 2GDUA 4W8LA 4AEEA 4QDMA 2CHNA 6A3HA 1UWSA 5E0CA 3QHMA 2BXZA 4J3TA 1J0HA 1WDQA 1V0NA 3VX0A 1BQCA 1E5NA 4HMEA 1WZMA 4OKDA 5ABGA 3PZVA 5I3DA 2XFFA 3WENA 2ZXQA 1ZBCA 1FH9A 3AMGA 5I23A 3AXIA 4OOUA 1FA2A 2DSVA 2C0HA 4TX6A 2JIWA 3LPGA 5CLTA 2VCBA 3FXYA 1HKIA 1V02A 2VZSA 4WKFA 3WEOA 3ZR5A 4AD0A 1XYZA 2VUYA 1WDPA 1B90A 2VURA 4GZEA 5I78A 1OIFA 1JYNA 2E0PA 4MNMA 3CUHA 4WLCA 2CNCA 4DWSB 4PSRA 4PSPA 3PZNA 4AZIA 1OD0A 4Z2KA 1V08A 3TONA 1JZ6A 4P7NA 4S3JA 3KL3A 1EA9C 1MW2A 4W93A 2HVMA 1BTCA 5BWFA 3SUUA 3EDEA 4TX8A 4GI9A 2G3IA 4U33A 4X9YA 1B1YA 1WO2A 4NZCA 1DWHM 1BG9A 1W3LA 2WCSA 1KXTA 1NWRA 1X6NA 1GOWA 1FP9A 2WWDA 1LLOA 5HBFA 2VJXA 3CHFA 4W85A 1KGWA 2G3MA 2YDSA 5F7UA 1PX8A 2FHCA 5E70A 4LYQA 3A4XA 2YA2A 2WC7A 2J7BA 3CZ8A 1UH4A 4LPCA 4R5EA 2WVTA 3BSGA 3ZJ8A 1J11A 4ML4A 3W82A 1JDAA 2FH8A 1KXQA 2CXGA 2XYLA 2VO5A 1US2A 3OLIA 5EBAA 1UD3A 4BCEA 2J7EA 3HU7A 4JFVA 1JYXA 3NSXA 3W28A 4PUDA 5CPSA 4AZ5A 1GOMA 1FFRA 2XVKA 3ARUA 2WMFA 1GPFA 2VCAA 1BYAA 3PBGA 4HU8A 4AC1X 1K9DA 5EFFA 1OIMA 1XCWA 1ECEA 3O2LA 1G1YA 1KR1A 3D3AA 3F5JA 5A6LA 2AMGA 3M6DA 2WZHA 1HN1A 1CTNA 3SCOA 5BXSA 1JYWA 1QI4A 1V02E 1W3KA 4KMQA 1W1PA 4GIAA 1MQQA 2DT1A 4MB3A 3M46A 1C93A 1NH6A 2FH6A 1BF2A 1VFMA 5FOOA 1E6NA 4B9YA 4MAVA 5GNZA 1BHGA 2Y8KA 1CZ1A 1G9HA 5CPQA 1IZKA 1QW8A 1W1VA 1E0WA 4IPLA 3SIMA 1HKKA 1X6LA 2DT2A 3GH7A 4AD4A 2GSJA 1UWUA 5ABFB 1CBGA 4HMDA 2BVDA 4YHGA 1W91A 3GYCA 4GQQA 3WELA 1H3GA 2CBJA 3LPFA 2O9PA 4E4PA 5GNXA 5LA0A 1E4NA 4JKKA 4BQ2A 1QBBA 1QHZA 1CXHA 1QNPA 2X0YA 5I6SA 1V3HA 1Y7VA 3BAWA 5E0FA 4UZUA 1H41A 2EPLX 2XM2A 1E56A 1VFFA 2ZUNA 4UOJA 3AROA 1M53A 2W61A 4ACZB 4MDPA 4DUVA 4TTUA 5C71A 2QMJA 2D3NA 1E4IA 2ZUMA 3CO4A 1GUVA 1TR1A 2J62A 2RGMA 2CHOA 5D9OA 1Z32X 4ZEPA 1KWKA 4J27A 3WL0A 4JCLA 4BZYA 4M81A 4AZCA 1YHTA 4UNIA 3AMCA 3QOKA 3GM8A 1YQ2A 2PB1A 4DWSC 1HKMA 1VFOA 3SCNA 4PMXA 4MNLA 1EO5A 3WH8A 1TVPA 1JG9A 4U2YA 3B9AA 3BAYA 3WBEA 2VNCA 1HIZA 5D4YA 1EXPA 3WQVA 1VJZA 1VAHA 4BQ4A 3VD9A 4GXPA 1UKOA 3GH4A 3MUIA 1HJXA 2X2YA 1TMQA 4A4AA 1UOKA 1FP8A 2ZX7A 2CPUA 4GINA 3VGGA 4OBRA 3IK2A 4CVUA 2WHJA 4OJYA 4PMNA 3BAKA 3EMQA 3WFLA 3CHDA 2E4TA 4AXNA 3SUWA 5JBFA 2GJRA 4FLQA 3GBDA 4S3KA 1LF1A 2ZUTA 1ZB5A 1OB0A 2VQTA 3CZEA 4M80A 4UQDA 2IXVA 2EJ1A 4NI3A 1ITCA 4UR9A 1MW1A 3K8LA 2VX4A 5A8MA 1CXKA 3KZSA 1J0IA 5A6AA 1KBKA 2J7DA 6TAAA 5A8QA 5AC4A 2JF7A 4LQ1A 3RJXA 2ZUWA 1JAEA 5A1AA 3VMNA 4HZ7A 5E9AA 1CXEA 3PHAA 2CESA 5M03A 2QV4A 3CMGA 1UQZA 1CGXA 4UFKA 3WQ8A 1U2YA 3AHYA 2JEPA 1CYGA 2YJQA 1JDCA 4GPNA 2ZUSA 4AD3A 2JALA 1V6WA 4Q7NA 1B9ZA 1VRXA 4W7VA 2CKRA 3QHOA 1XYFA 2EO7A 1V6YA 3G6LA 3LPOA 4UFLA 2ZOXA 5I24A 2J4GA 2WMHA 1V03A 1W3JA 2V3GA 3WSUA 3F5KA 2BV9A 3KWXA 3N04A 4M56A 1E0VA 1E6QM 4PMVA 5D9MA 1CGWA 1P6WA 1KXHA 4U5KA 1AQMA 3AJ7A 3K46A 1H0GA 1HKJA 1S46A 2WPGA 3W25A 2YLAA 3W81A 1E43A 4J3SA 2EPKX 3AHVA 3TP4A 2V3EA 4JL1A 4E8CA 4EANA 1QW9A 1V0MA 3AMLA 5CSYA 3S6TA 3WH9A 2BXYA 3VM5A 1IZJA 2Y5EA 3EBVA 1V6XA 5FIPA 3EMZA 3ZM8A 1QVBA 4HA1A 1JFXA 3ZJ7A 4Z2LA 2WMKA 1JF5A 1VB9A 4B16A 4ACYA 1VBUA 4GO8A 2Z1SA 3T09A 3WD4A 1J10A 2XVGA 4U3AA 4EK7A 3EDDA 1GQLA 3VGEA 1MFVA 2PBGA 5HPOA 1PAMA 1DEDA 3SCPA 1EQCA 3WKZA 3SUSA 1W9PA 4QLKA 3VGBA 3FY1A 5CLWA 2WW5A 1EDQA 1G94A 2PBOA 2D20A 1CECA 4BA0A 1QI5A 2GJPA 1M03A 4W7WA 1CIUA 1ZBVA 3WMCA 4MJ2A 4PMZA 1CGVA 1E72M 3WUEA 4K68A 3RM8A 1ZJBA 3RCNA 5LA1A 1B3VA 2QHAA 1D7FA 1AQ0A 2XWDA 2J78A 4TUFA 2W92A 4UFJA 1Q6CA 4GZIA 1MYRA 3VKKA 1E0XA 1PPIA 2YL8A 4U31A 1NWUA 2GJXB 3OLDA 4JFSA 4UZSA 4YN5A 2PWGA 3AZSA 3N15A 2OWWA 3DECA 1GVYA 4J28A 4IPNB 1VJSA 4Y7EA 3ZSSA 1F4HA 2J79A 3EMCA 4V27A 4EAMA 3ZOAA 1OT1A 4WJXA 4P8WA 3MUAA 2HISA 8CGTA 5JBDA 1WE5A 2JFEX 1B3YA 1PZ2A 3AYSA 3S2CA 1KQYA 1BSIA 5A6KA 4AWEA 1BPLB 4JAWA 3UEQA 2V3DA 1XH2A 2DQXA 4H7VA 4MB4A 4MADA 4FMVA 1WB0A 2D2OA 1ISXA 3A3HA 1B3ZA 2DSKA 3UERA 2VZUA 3WNPA 2ZX6A 2W67A 4U5IA 3ZIZA 4J3WA 4PEEA 4M8UA 5C70A 3VIGA 4PMQA 9CGTA 3EDFA 1JGIA 1J18A 4HZ8A 4D6IA 1EHNA 1QOXA 1AVAA 3WDRA 1ZU8A 4W8AA 3VOCA 5HXMA 5A8NA 2PWHA 1J0KA 1C8QA 1NOWA 1V6VA 3IJ8A 3VO0A 4AEFA 2BHYA 3UG3A 3A4WA 4UQEA 2OWXA 2VVNA 2E40A 1GHRA 2DIJA 4JHZA 2WAGA 3WFZA 5CJ5A 1QNRA 2XGBA 1JI2A 2E9MA 1U33A 4ATWA 4JCMA 1OGBA 1J0ZA 3ARTA 2J7CA 3BLPX 5HPCA 1M01A 2GJXA 3U5YA 3UR7A 1HXJA 3L4WA 2Y2WA 4PCSA 3ZMRA 4F79A 2D23A 1FHDA 5GPRA 1ISYA 3B9EA 3WUGA 5BYWA 5A2AA 3WY1A 4LXFA 4MJ4A 4KRTA 1GQIA 5IHSA 1NOFA 3IAPA 2WWCA 1L8NA 3T2QA 3W29A 2G8ZA 2CEQA 1CXIA 1OD8A 1UA3A 1R87A 4D6FA 4PUEA 1GZJA 3WQ5A 1J0JA 4PTWA 3AS3A 4W86A 1XV8A 3ARWA 1VEPA 3PZ9A 2NW0A 3VGHA 1W1TA 1XH1A 3NCOA 4UFMA 3VIOA 3PTKA 3PZUA 3ZJKA 2EPNA 3OLEA 5ABEA 4HOXA 2J7FA 1UH2A 2NSXA 3THDA 5I0DA
chains in the Genus database with same CATH superfamily
3V75A 5DMLA 1DJXA 2WKJA 2NT1A 1EGVA 3TKFA 5D2VA 1L6FA 5DMYA 3FX4A 2VZVA 3AS0A 1QFEA 5B7YA 4LBRA 4R9OA 4AMCA 2G41A 2CLMA 4EPBC 2J8FA 3LTPA 1GZ1A 3WQDA 3V5OA 3TQ0A 2X2GA 1XXXA 5KZMA 3FHQA 3EWWA 4HNVA 4RDZA 2WMIA 3ZR6A 1G01A 5F4XA 1BYDA 1PKNA 1WZKA 9XIMA 1MEHA 3N12A 3HGSA 2XWEA 3U7VA 3GHUA 1OG6A 2NV1A 3NM1A 3W7PA 4YMZA 2VDHA 4IXXA 5DANA 1FWCC 3DFSA 1XYAA 3HG2A 2VX6A 2JGQA 2ZDRA 3RPDA 1PVNA 5IOBA 4Z2GA 3D46A 3DC0A 1UD6A 4CEXC 2HK0A 1B3OA 2WB5A 2CZVA 3S0CA 2GGEA 3O16A 3A4JA 2QDHA 4DJEA 1K8ZA 1UR1A 3UCQA 3SCUA 3FJLA 4EE9A 2BHZA 3T08A 1XJBA 1L2QA 3O1NA 1TG7A 4UTWC 1WDRA 1WKYA 2XVPA 2G3JA 4MWAA 1QW7A 4PRWA 3YPIA 1W0MA 3BCJA 3Q65A 3LU2A 3SN1A 3ZLGA 1QU4A 3KL5A 3GXNA 1Q6LA 2YW3A 5F4WA 4GX8A 4MDOA 3WF4A 4G7FA 3OP2A 5DF0A 2VCCA 3L5LA 3WO8A 5D2TA 3QPZA 2PZ0A 4TOQA 4H9ZA 1ZZMA 3VD4A 1PBGA 3VILA 4ATDA 4LS1A 5GJMA 1GORA 5DT7A 4XAYA 3INPA 4JL2A 4NILA 3L4UA 3LGDA 3D5HA 2WHMA 4NZ4A 4Z1YA 3APGA 1EZ2A 4W87A 3N9RA 2OYMA 4HP5A 4RR4A 4E4FA 4FNRA 4I9MA 5KSWA 2X8RA 5D09A 1LL4A 3HMCA 1OBAA 4EWJA 3BMWA 5C2GA 1IXNA 2FFCA 1U22A 2HWGA 1I6NA 3NQCA 4ZENA 1JCYA 4CQAA 4YPJA 4HHLA 1XG4A 4KGJA 2FPYA 3A24A 3L4XA 1IZCA 2G4FA 3T6CA 4BF7A 2J6VA 4HA4A 3RITA 1SFJA 2ISSA 3VC6A 3WF0A 2GVYA 3CTLA 2ZICA 4LC6A 1DQUA 1Y0EA 4N9CA 3BCFA 1JDFA 5FSDC 1LM1A 3PPFA 3EA1A 4AYSA 1W1ZA 3T0TA 1VFHA 3MCNA 3M7SA 3CC1A 4GI8A 3UNTA 3UPBA 5I3FA 1YADA 4YVXA 1TPB1 3CIWA 3SO7A 4NX0A 2E6FA 3QRHA 1M1BA 3RDKA 3U2OA 1DJYA 2XFYA 1SW0A 4QR6A 1YPXA 2YW4A 4XZHA 3EX4A 3G1AA 2XISA 2PWEA 2PWVA 3NYZA 5F4SA 4B3LA 1KCKA 4IUGA 2C7FA 1C90A 3WUBA 5JUVA 1R7OA 3QGVA 4WY0F 4PUMA 2ZIDA 1RPXA 5BRPA 3PN8A 4Z0SA 3GG8A 1TMHA 2A3AA 1P0EA 4OGZA 2W0UA 4LAZA 4GQBA 2R1KA 1IT0A 4G1NA 1ECQA 1WZAA 1XFBA 2QCCA 4GYJA 2VDGA 1XLJA 4DUOA 3PZTA 1DXFA 4XKMA 3WFAA 4CCZA 1UWQA 1XGZA 2FGLA 1BAGA 2KZHA 2Z1XA 4P8UA 1MWOA 2YKKA 4O8AA 5DMNA 1FOBA 4RDVA 4LBUA 3AU2A 2G95A 1K4GA 4NG3A 1WBJA 1PIIA 4Q8OA 1F3EA 1L6YA 4XO7A 2PTDA 2BNJA 5AHEA 3AS1A 4JXCA 1TO3A 2IS7A 1M6JA 1BGAA 4Q4KA 4QNEA 4N0RA 3EXRA 1G0CA 2ZX5A 1WDSA 4XIAA 1HJUA 5LNWA 2OO6A 2ZZ3A 3ARPA 4WUIA 4U10A 4TTGA 4MKNA 2VGGA 5A2BA 3SUTA 4GI6A 4OOZA 2I17A 2P10A 4AG0A 4JHOA 1FWWA 2R6OA 2WVSA 3FYOA 3I7QA 4NZ3A 1VLWA 3N1AA 4HCHA 1RQBA 4A3RA 1UR8A 4F48A 3WNLA 5AYXA 1DE5A 3S9YA 4QP0A 5LXEA 1S5WA 3UESA 3B8DA 1PHWA 4RLIA 4B2DD 3BLIA 2PP1A 4CCEA 4Q3MA 3OG2A 3E2VA 3RPTA 1LLZA 3P61A 1QTWA 1KM4A 1KV8A 4PMRA 3OBAA 5DRIA 4M6QA 1TYGA 3N9SA 3N34A 4UTHA 3IVUA 4LUTA 3UP8A 3VA8A 4DBDA 1PTAA 4G7EA 3H26A 1UUOA 4H2CA 4MWAE 4Q8WA 2G5WA 2YDQA 4UTWA 3WQWA 3AIQA 1H0IA 1XG3A 2QGYA 4D6CA 4DJDD 1HQTA 3C5QA 3I7SA 2BY3A 4KETA 3TW9A 4GQRA 2DZTA 1SMAA 3GU1A 3W75A 2E5DA 1Q7QA 3GFYA 3VIMA 1TPDA 4DZIA 1ZL1A 2NZLA 1ZHAA 2GDVA 1G4PA 3RFAA 3S2MA 3W26A 4CNPA 1WOBA 2NX9A 2RKXA 4LWWA 1NDVA 2NV2A 4PODA 2ZWZA 1R2TA 3BOFA 3IUIA 3WL1A 4DBWA 2A5HA 4QJ3B 3WK0A 5LIKX 4LCSA 4NP7A 4ATLA 4NU7A 5I2UA 4AQLA 2NUYA 4WF7A 3AUJA 3LEPA 3TQPA 4GHRA 1TCMA 3LA4A 1F7BA 2ZXBA 2DZBA 1CGYA 4LC8A 5C2XA 3M47A 4L4OA 3R1ZA 3OO2A 2W4XA 3DBPA 3WLLA 3DN5A 3DFOA 4LUTB 5CBJA 4KERA 1E6SM 3W76A 1L6WA 4DJFD 1TA3B 5DY3A 1C3FA 4F2TA 3W53A 1EOKA 3QTGA 1TJ0A 5HWNA 2QDGA 2NVAA 3GH5A 2R82A 1Q6GA 1AH3A 4PFHA 4L4MA 3AWOA 2FTYA 4XZWA 3RMJA 2Z0IA 4ENLA 5FAGA 2WVVB 4UB9A 1E71M 4ZTXA 3V1PA 3SUVA 4FXSA 3UWZA 1C7TA 1JPIA 4ZA0A 5BXTA 1US0A 1WPCA 4B90A 3IIXA 3U7BA 1VS1A 3QFEA 1OSEA 4HK7A 4WJ8A 3BTNA 3SCQA 5FEPA 2RJHA 1DTNA 3FSUA 3OIXA 2O92A 2VGIA 3DYPA 1GTHA 5A6BA 1LOSA 4ACZA 2DSUA 3N17A 1T99A 3FNDA 3W7JA 2F7FA 3BV4A 3WDPP 3KCLA 1XIHA 5JH1A 1EJXC 1ONXA 3QR0A 1KFBA 4O17A 4IIEA 3F4CA 1VYRA 1O7AA 2G96A 4RNIA 4NAEA 1R30A 3AIBA 2XGIA 5I02A 3G77A 3W2NA 1AD4A 4MUPA 5D9NA 3EWZA 1V3KA 1UZ4A 1YBQB 4GUJA 1UWIA 2W62A 1AQHA 2D2HA 3ZT7A 2FLIA 3B05A 1VPYA 4M7SA 1IWPA 3P93A 3AIUA 4IF2A 2ZXDA 3TAOA 1OFBA 1VBGA 3PVFA 3I6TA 3TSDA 3N4FA 3AOFA 2BP1A 3GVRA 4AX7A 2A0NA 2QKFA 1BXCA 5EGRA 2UZ9A 5IBXA 4H8VA 2Z1VA 3W2MA 3NR0A 1K9FA 3LTYA 4GQGA 2DORA 3TAKA 1CX9A 4JDYA 3W7RA 4E0CA 1IEVA 4GK8A 4BQ3A 4AH7A 3L7RA 2XN1A 1GW1A 3QM3A 2VYOA 3Q37A 5CZ0A 2AL2A 4UQCA 3BUVA 3GTIA 4BWLC 2OFJA 5EMUA 4WY0A 2O9TA 4UQBA 3JRKA 4OZOA 4C1NB 3HTWA 3TYEA 2QUMA 4R7OA 4BK9A 1AH4A 3GNRA 4IP5A 5T9CE 2AGKA 1KBLA 1U1JA 3QC3A 4G8TA 2C14A 1WV2A 5F2MA 2V67A 4WK9A 1EXBA 4URIA 4DXKA 5FF4A 2FJKA 1X1OA 2W79A 4NXSA 3DFQA 4NAEB 1FCVA 4LTSA 3N2BA 4EP8C 1HJWA 3DGRA 1GOOA 3R89A 1G67A 2PU0A 2XZ7A 2YL5A 5HUPA 1BWLA 1DIKA 2REQB 1KD0A 1YBQA 3GXFA 4MHBA 3S1UA 3VK5A 2ZZ7A 3KOFA 1CENA 4PB3A 4US6A 4WOZA 5T26A 1H4PA 3M5YA 4LF2A 5DEZA 4Z2JA 5HK4A 3HQ1A 5FA5A 3C2YA 3NIYA 1KFKA 4RE3A 4RW5A 4YTUA 2DQWA 4W4QA 2XSBA 3RLUA 4QG8A 3BC9A 1A3XA 3QW3A 4HSHA 3KZPA 2Z1WA 1O1HA 2QCDB 3ARZA 3IK4A 1E9ZB 2J9YA 3CEPA 3CZLA 3FSTA 3K30A 3IRSA 4PN2A 3CH0A 3VMPA 5DX7A 3LV5A 3L68A 2WCGA 1GOQA 1P1XA 2AL2B 3ITVA 3WBWA 3WD0A 2ZUUA 1F5ZA 3SSJA 2ZUVA 1G7UA 4UR7A 4Z1CA 3MKKA 4QLJA 5D04C 1SR0A 2POTA 1ZUAX 5ECVA 1CI1A 4NJKA 1HL8A 3HBLA 4TR9A 2DJLA 2PDPA 3T7VA 2VWSA 1MEIA 3OLGA 2ZZ5A 3W9ZA 3AJXA 3OBEA 1JF6A 3MPGA 1F8MA 1PKLA 3PULA 3WLKX 2B7OA 1KXVA 2J6XA 3OZYA 3PPHA 4IPPA 4OBSA 1FWRA 7REQA 3KS5A 1DJHA 1R9XA 5LXXA 3NL2A 3QZAA 5I06A 2PWUA 1WKFA 2FMNA 3ARQA 1EPVA 5BOEA 1YMYA 1XLDA 1MZHA 5D8WA 1RXOB 1O1ZA 3CL6A 4V1XA 4JQ1A 1V0KA 3RO8A 8A3HA 5C7HA 2BBFA 2YCEA 1RCOB 4MSSA 2QCHA 1SZNA 1SZEA 5HATA 1I2PA 3HGOA 4LS2A 3XIMA 1S2WA 2E9BA 4F66A 1EJ7L 1FUYA 3S1WA 3OB8A 3W83A 4FOJA 2QPSA 1W5OA 2W66A 3AXXA 4E2OA 4EPDC 3ZLFA 3WLRA 2WANA 1NM9A 4RNFA 3KWSA 2PD9A 1GVSA 1KGUA 1XLBA 4IIDA 1GYNA 3OBKA 4IHCA 4HVXA 5AECA 4GH3A 2C19A 4IFOA 1J8VA 1QBAA 5D2YA 4M51A 4WR3A 4AY8A 4RDYA 2WSRA 3VIJA 4PE8A 1YE6A 4LGXA 2FZ9A 5BU6A 2QJGA 1TZ7A 4B5XA 2ONEA 3ECQA 4UWMA 1P43A 1IEXA 4ZOAA 4EXQA 5JBEA 1HKWA 1KLYA 1B54A 3U8GA 4I7VA 5FKYA 3WD2A 4IIBA 4KWWA 3SQSA 1W2PA 3PP7A 3O3RA 2D3LA 1SSGA 1W8SA 4GYKA 4DO4A 5HANA 2RDTA 1FWIC 4UTJA 2BFGA 3LCWA 3ORWA 1GQNA 3KVLA 4TV5A 3GR8A 2A3CA 1YPIA 1U83A 1XUUA 2BY0A 3VMOA 2P8CA 1CGTA 3P5YA 2ABAA 3UXKA 1RHCA 4PCTA 4QFUA 4GG9A 4KEUA 2NVDA 4C6NA 3S9ZA 3AFBA 3B0PA 3CAQA 1D7KA 2R91A 1HF6A 4ICNA 1XFCA 3R2GA 4WGXA 1UBSA 2PDXA 3FVMA 3ARVA 3RF9A 1KWGA 3NWRA 3BLDA 2B7PA 1BVWA 2QJJA 2OSXA 2GFTA 1B9BA 1XBYA 2H8XA 4IQDA 3GYEA 1NWTA 4NNAA 3VC5A 2YDAA 1ZFJA 3LCHA 1B3XA 3P81A 3WJSA 5AYZA 2PDFA 1TJ2A 2XIJA 4H8HA 1W3HA 1YIXA 4LBSA 1UA7A 1ONWA 1A3HA 3P5ZA 2GJNA 1OINA 3PNUA 1UBPC 3O6AA 1CDGA 1WUEA 5C5YA 1DHPA 1YE4A 2ZRUA 1PTDA 4GABA 1IXPA 3LNPA 3AXHA 1E4LA 2ZRYA 3WLSA 5DMMA 5CSUA 4FNSA 4DBSA 1E6ZA 3BW3A 3CZKA 3VNKA 1W9UA 2O4MA 1JDDA 1R46A 2BS9A 4QISA 2WMIB 4AHPA 2PTXA 3GNOA 2XIBA 1MEWA 1LZOA 3C8NA 1Z3NA 2PDKA 3NZQA 3H55A 1OYAA 3MUZ1 1AZ2A 3O8AA 4HA3A 3H4GA 3OGSA 4Y6GA 3GKAA 3HJEA 1UKSA 2QMKA 2BY2A 3GWQA 1AH0A 1UKQA 4L64A 1Q6QA 3PZQA 5CZTA 5DLCA 4UTFA 3EOOA 2OPJA 1MUWA 3TYUA 4CU8A 3UPMA 3DKLA 4DAFA 3MI6A 1CCWB 3BCDA 4DWSD 4QAIA 4QROA 3K5XA 3MU7A 1GVRA 5I3GA 2YB4A 4QJ5B 1XYMA 1ZJAA 4BI7A 1WDWA 2YBUA 4IMEA 1M65A 1CB7B 4NZFA 5CPOA 2E1DA 3NPXA 3T9PA 4D6DA 4IZGA 4FNQA 4XX6A 4L56A 3MI2A 4LALA 4CGTA 4L5ZA 1UD5A 4JN8A 3A22A 4A3HA 1SQ7A 4AEEA 1SJBA 2ZKMX 4QDMA 4DF1A 6A3HA 1EEXA 3L5AA 4CNTA 5E0CA 3QHMA 2BXZA 2INZA 4H6RA 4LVBA 1WDQA 1V0NA 3VX0A 1BQCA 1E5NA 4ADTA 2GGJA 4HMEA 4DQWA 4O52A 5ABGA 3PAOA 3WENA 1TX0A 1ZBCA 5I3HA 4DNHA 4GC3A 3S6DA 4XD6A 2KX9A 2JIWA 2VCBA 3FXYA 1Q3NA 5LZLA 3O15A 1HO1A 1V02A 2VZSA 1EJUC 3ZR5A 1F6YA 1MRAA 2CWNA 1A5OC 2X30A 1M41A 2Y7GA 4XWUA 3E2SA 3SIZA 4NXKA 5I78A 4E2VA 3W84A 4PULA 3GIYA 3BSMA 2CNCA 3PBWA 3OA3A 2RDWA 4PSPA 3PZNA 1F3WA 3QN3A 1V08A 2HPIA 1JZ6A 3MSRA 1H7XA 3SQMA 1NJJA 2PDNA 3EDEA 4TX8A 1I2RA 2OCZA 1B1YA 3B97A 1WO2A 2QCEA 4TMCA 3LHVA 2ISFA 5I09A 2X41A 2WCSA 5LSMA 3NO5A 4RX0A 2WWDA 5DBUA 1PWMA 5HBFA 3CHFA 2G3MA 3S5SA 5E70A 3CPGA 1UMYA 3QQ1A 4O1DA 3STFA 1UH4A 3NQDA 1V4YA 3KW3A 6XIAA 2VC5A 2HCVA 3C0QA 3F2DA 3CLMA 4QS5A 3AXKA 2F6KA 3R8RA 2BDQA 5FJRA 4X61A 4GZ7A 4IPJA 4CQDA 5H91A 1PV8A 1SO3A 4EVZA 3LQGA 1XX1A 3MC5A 3V3WA 1D8CA 1BYAA 3QTPA 2PDJA 5ENLA 1K9DA 1OIMA 2XSXA 3C3NA 3WQGA 3O2LA 2FMOA 1G1YA 1K77A 3MUCA 3M6DA 3SCOA 2NX3A 4YS1A 1TV4A 1Q85A 2VEKA 1V02E 1W3KA 4Z17A 3M46A 1C93A 1IWAA 2A21A 5FOOA 5FEZA 1S1PA 3EKZA 2YZRA 4DNMA 3R10A 2ALRA 3L2IA 1QAPA 5K3VA 3M7WA 1VPXA 1G9HA 5CPQA 1IZKA 1QW8A 1W1VA 1E0WA 1TSIA 2BVDA 2FDSA 3GFZA 4ORIA 3GDLA 3TR2A 2XN2A 3KRUA 4GQQA 1DYSA 1ITQA 4UTTC 2Y6ZA 1F61A 3NFUA 2O9PA 2CLIA 3IJDA 4JKKA 2YCJA 1QBBA 2F38A 1G4EA 3W22A 5I6SA 1REQB 3GG7A 2QGHA 3UJFA 1C8VA 5HMEA 4UZUA 3UGRA 4JR5A 4HK5A 1VFFA 3GVWA 2TPSA 1XLMA 3BOXA 2W61A 1L6SA 5C71A 4FNUA 2QMJA 4PCFA 2D3NA 3W01A 4S3BA 4HQVA 2GGGA 1GUVA 1K03A 4Q4MA 1ZGDA 3VKJA 1K70A 1JQVA 1OF8A 3DHFA 5LNUA 1Q7MA 1EYWA 2AKZA 1HW6A 4LUIA 4XVDA 3SCNA 1UJQA 2HMCA 4PMJA 3M0ZA 4IGMA 1X39A 3GSMA 1N8FA 4O50A 5HMSA 2VNCA 1HIZA 4BQ4A 2Y62A 4GXPA 1UKOA 3P0WA 2X2YA 3W7HA 3UF9A 2PPGA 1DL3A 1FP8A 2ZX7A 2ZQ0A 4Y90A 2WHJA 4PMNA 4GUHA 3SRKA 4AXNA 4WQ6A 2GJRA 3BW4A 5H1WA 4FLQA 4HTBA 3GBDA 5E1QA 1DPMA 4ICCX 2CFFA 1MNZA 4L4LA 4O4VA 1LF1A 1OCJA 4M80A 1R3VA 4UQDA 2PDYA 3EB3A 1RJPA 4UMCA 1ITCA 4RZ6A 1MW1A 4JQ3A 2OEMA 1RLDA 3MWAA 1OFPA 1H7OA 1KBKA 2QVNA 1F6KA 1RK6A 2JF7A 5F2IA 4GVIA 3UZWA 2IPWA 4GGHA 3RXZA 3LHYA 3VMNA 4UTMA 3BZJA 5E9AA 3SECA 4HK6A 3QV6A 3WJYA 1MUMA 3WQ8A 1FX6A 1U2YA 5I07A 1FCBA 1CYGA 1U1UA 3EOLA 2YFOA 2HK1A 1V93A 2ZUSA 4M6UA 1TRDA 2JALA 2QAFA 3W1TA 1V6WA 3HIJA 1B9ZA 4K7VA 3BL3A 1VRXA 3D3FA 3OQ8A 1PZ1A 4W7VA 2VFFA 1XKYA 1V6YA 2PCQA 2VUNA 3G6LA 4CEUC 3GRIA 4XD3A 2ZOXA 5K2ZA 3B0XA 1V03A 2V3GA 2VFDA 3WSUA 1XS2A 5H8PA 3N04A 3LZ5A 1E0VA 3HM7A 4GISA 4GYFA 4AXKA 1CGWA 4JOMA 1KXHA 4I6KA 4LVFA 4H6QA 3H70A 1EJWC 3B0YA 1AQMA 1S5VA 1XYBA 1J2BA 1YX1A 1H0GA 3SRHA 3W25A 2YLAA 1NU5A 3ONBA 1HGYA 4UIOA 3TP4A 1KFEA 4JL1A 4EANA 2HXTA 3AMLA 5CSYA 1JCMP 2BXYA 4FSAA 3VM5A 1IZJA 3G18A 1FHUA 2Y5EA 3H2FA 1UIPA 1QVBA 3EPNA 4NNBA 2TMDA 2WMKA 1JF5A 1TR9A 1VB9A 2XN0A 1J10A 3S4TA 2XVGA 4D9PA 3VGEA 4KEVA 1DEDA 4KKXA 3PS7A 4AF0A 2WW5A 2QCNA 1EDQA 2NXHA 2PBOA 1R9ZA 1M03A 1H7PA 4M3PA 4MJ2A 1YLVA 1E72M 3WUEA 3GNDA 1KV5A 1ZJBA 5LA1A 2PRMA 3F2BA 1D7FA 3R7MA 3P74A 1AQ0A 3KXQA 4UFJA 1WKEA 3W86A 1Q65A 3MHUA 5I3JA 3GTHA 1E0XA 1PPIA 3PWIA 1SFTA 2JKPA 3OLDA 4JFSA 4UZSA 1Q45A 3AZSA 1GVYA 4Y7EA 4V27A 4EAMA 3PUDA 1OT1A 4WJXA 4IMGA 2YSWA 1RJRA 3MUAA 4C1NA 2IQTA 1SU5A 4NL1A 5JBDA 2I5IA 1WE5A 4JDBA 3KUMA 2P3ZA 3I6EA 1GEQA 1SJAA 2DQXA 3LBCA 3HG5A 1XIGA 3O05A 1ISXA 3A3HA 1B3ZA 1TQJA 4L9YA 3PWAA 2VZUA 2QEZA 3E0LA 2ZX6A 5A5WA 1DE6A 3TLQA 1GG0A 1T5AA 4PMQA 9CGTA 3EDFA 3PFRA 4HZ8A 4ZOBA 2RUSA 4JNYA 1EHNA 3PBMA 3RX4A 4W8AA 3C2VA 2UV8G 3TN5A 4AEFA 4KFNA 5TF0A 3F4WA 3A4WA 2CW6A 2OWXA 4A35A 4R33A 1EWDA 2QT3A 4GNVA 1QRQA 1QNRA 1R6WA 2E9MA 3L0GA 4ATWA 3FJ4A 4XBSA 3AUOA 4WX2A 4JTSA 5HPCA 1M01A 1FWFC 3UR7A 2ZE3A 1HXJA 3L4WA 3WYZA 2Y2WA 2VM8A 4K3ZA 2CLFA 1PKMA 3GU2A 5BYWA 5A2AA 3U3HA 1KKOA 4LXFA 4KRTA 1NOFA 1W31A 3G0XA 2GGIA 3IAPA 2WWCA 4IH3A 2G37A 2PZNA 3T2QA 2FJUB 1R87A 3W2LA 3CAVA 1E9YB 4H6EA 3R94A 2FPTA 3H54A 3PNZA 1AJ2A 1HG3A 3ARWA 3DUGA 2OTDA 3PTDA 3VGHA 1W1TA 1PL9A 5TBOA 3PTKA 4JBRA 5FF2A 4IG2B 4Z1BA 2QF7A 2YXXA 2W3ZA 5KTLA 3THDA 3B06A 5I0DA 3CQKA 3E12A 3URNA 2ANUA 3U6WA 2CBIA 2EPMX 4FR6A 1G7VA 1XSKA 4BEUA 1AG1O 2F6UA 5A8OA 2BODX 3QY6A 1AL7A 3H2EA 3WDQA 4TVUA 5FL1A 4IM4A 3WDJA 4PTXA 4AD5A 4S2BA 1JDEA 3WEMA 3CEUA 4MB1A 3DIPA 2DH2A 1ENUA 2PA6A 2OSYA 5HR6A 5D8ZA 3RGTA 1IT7A 3DXIA 3THAA 5CGMA 1PB0A 2J25A 2VX5A 1JVNA 4C6QA 2P3EA 3W2UA 4A29A 3IANA 1JXJA 1EJTC 4JTRA 2Q09A 3SZ8A 2QUUA 3CYJA 3PTQA 3NQMA 5BRBA 2ZVIA 2V5BA 2DIKA 1QI2A 3V36A 3GC4A 2OZ0A 1KW1A 3ARXA 5TNVA 3VGFA 2CIPA 3FOKA 1VYPX 4ZODA 1Y5WA 4A3QA 5XINA 4JIEA 3IGXA 1C91A 1IEIA 3LV6A 2QDDA 4HNNA 1ISZA 4AY7A 2WO5A 3SY5A 3UG5A 1C92A 1NF7A 4W88A 3L4VA 3ISIX 2V0TA 3BMXA 4KCTA 1TE1A 2EPOA 5LA2A 3CUJA 1ZCCA 3VOFA 4LVDA 2FVKA 2AOSA 4WSJA 4TQTA 4HZ6A 3RX3A 3TZFA 2A1YA 1PHQA 3CPRA 3FW6A 1K6AA 1EF3A 4GC4A 3FJNA 5IFTA 1VZWA 3C2OA 1I75A 4GY1A 5CPNA 4KRUA 4LCRA 1XKJA 3L2LA 3CTTA 2YL6A 5HDRA 2WHLA 3DC8A 4RJEA 4CVWA 4NUWA 4QRNA 4JYFA 3H7UA 4QE4A 3LPPA 3WH5A 1OFOA 3EXTA 2PLCA 4ZR8A 3MO7A 4YWIA 3HFYA 4GJJA 1CW2A 1EIBA 1UR4A 1GKRA 2WBKA 4YTQA 3RAOA 3T4WA 3R12A 3LY0A 4EKJA 1VP5A 3W1PA 3S1GA 3XISA 2VZTA 1TWIA 1GOIA 4GKTA 2QVHA 1Q8JA 3IJLA 1ONRA 2V6AA 1TPEA 4HHMA 2HE8A 2ZTKA 1VJIA 4ERAA 4GOAA 3W1XA 3W1QA 3KOWA 2G3NA 3UFYA 4C7GA 4QAWA 1Q13A 2PDMA 2QUVA 1GVFA 2XVNA 3AZTA 1XLLA 3P80A 4ML9A 1R3YA 4YYCA 3VCNA 1QI0A 4P8XA 3HJZA 1POJA 3MMTA 4YTRA 1WA3A 3ARSA 1P0KA 1UWTA 1QDSA 7TIMA 3A12A 1YTDA 3ZFHA 1RD5A 2RHGA 2V5LA 2J7GA 3R8GA 1DWAM 2UWFA 3QPYA 1P4CA 1JZ7A 5A94A 4DYKA 3K8KA 4NQ1A 1HTIA 4S23A 2WM1A 2NXGA 3BICA 4UTTA 4GJIA 1XR2A 1VBJA 4PL1A 7ENLA 4F2BA 4ZFMA 1XPYA 2OEKA 1J0YA 3UWUA 1FKWA 1E6RA 1AJ0A 1A47A 3C2EA 2WMJA 2ADAA 3NVTA 4B15A 1DOSA 3M0JA 3AISA 3CMJA 2DZAA 4I5RA 1V77A 1VCVA 4ZO7A 3F1QA 4GFIA 2OGYA 1TB3A 3SCWA 4I9AA 3I3EA 3KRZA 1GQKA 4O8RA 2YA1A 5K7JA 5IHRA 2VELA 3NQ7A 1IT8A 3HO8A 2BY1A 2A3BA 3T0DA 4WKAA 3VKAA 3RJYA 1PX3A 1EZWA 1QI3A 2ZTJA 5DRCA 3A5FA 3KBJA 4YTSA 1FY6A 1Q6EA 1NEYA 4DZ5A 3LN3A 2HVNA 3WD1A 3HMJG 2I57A 3IV3A 4X2PA 2BVTA 3QSRA 2VEMA 4XKYB 3RRXA 2XIOA 1Q8AA 2IPGA 4C6MA 2BWGA 3EX2A 4C6FA 3W1AA 3W7GA 3PPCA 5CEWA 3ARYA 5FI8A 1XIBA 4KW2A 1GQJA 3WJWA 3BAXA 1OY0A 3NM3A 3ITLA 2PDBA 3QOMA 1DTUA 2DU2A 4EAYA 2EAWA 1R2SA 1AW5A 4QDPA 2W5FA 4C6BA 1TTPA 3ALFA 1CXLA 2OEJA 1TV3A 4GI4A 1YTEA 3BANA 4C6IA 4Q22A 3BMVA 2GZXA 3W38A 1UD2A 1DQXA 3M0IA 5HJYA 3N25A 4DJED 5HMFA 2GYIA 3KM8A 3CNYA 4LYRA 1OZMA 4J9JA 3QV9A 3STCA 1ADSA 1KM1A 3TUUA 3NQBA 1FDJA 4BS0A 1TWDA 1O5XA 1QPQA 3B40A 1D3CA 2VHLA 1KRBC 6REQA 3LSBA 4ORMA 1TA3A 2X09A 3WEZA 5AHNA 3H12A 5A6MA 1UG6A 1R47A 2OQYA 1LOLA 2IUZA 3PTMA 1RVKA 2L5HA 1TPH1 2P88A 1ZBKA 2WVVA 3SJNA 1HP4A 1GEHA 4UQ9A 4GBDA 2EG7A 3PUOA 3TCSA 3MUY1 4AZ7A 3M5ZA 5T9BG 2E9LA 2RJGA 2PP3A 1JZ5A 3THCA 1DIDA 1CB2A 3WQPA 3A4AA 3VKBA 2XFWA 1IV8A 3SADA 5AY7A 3EWCA 2Y7EA 1UD4A 4H9TA 3KBMA 1CGUA 2XH2A 2OLSA 2VRJA 1ZSXA 4FNTA 4U4MA 1FCUA 2OLAA 1QATA 2E6AA 4O1EA 2PU1A 1NWSA 2GGHA 4GACA 4MNKA 5EKYA 5G2HA 4HN4A 3TYDA 1JULA 3AIWA 4JIQA 3MJMA 3P82A 4N9EA 2PSNA 3BH4A 2Z2UA 4FIQA 2VWTA 3K4WA 3ZXWA 2VR5A 4RL3A 5IFPA 3OA5A 1XDMA 3CLWA 3CGTA 4IIGA 3VYLA 1E9IA 4GNJA 1F07A 1Q7ZA 2VVSA 4ROPA 3FKKA 3U57A 4E8GA 4S2CA 2IKJA 4DM2A 5KMYA 4XZLX 2OKTA 2WZIA 1WP6A 4J3UA 2DJXA 3KEHA 1UR9A 5CC5A 5EMJA 4C7FA 3RILA 3QHNA 4N7QA 1HL2A 2YCLB 2QDEA 2GL5A 3O06A 3LUTA 3S2LA 3CQJA 4Y9MA 5A6JA 4YNGA 4PTVA 1BEUA 4X22A 7PTDA 3L2MA 1DJZA 3ES7A 4EIVA 2UY2A 4C6EA 1BRLB 1P6BA 3CAKA 5D9PA 4ZO6A 1KBIA 5GNYA 2O0TA 3AZRA 2HNHA 1E4MM 2BG5A 3E1F1 1EPXA 7CGTA 3CUIA 5FL0A 4O16A 4C5ZA 2WPBA 3U9IA 2VT0A 4MZ1A 3H2CA 2BB0A 3LNMA 2XZ9A 1M04A 3B04A 3SJ3A 1LG1A 2PDHA 1J5TA 1OF6A 2J74A 2V63A 2Y89A 1EL3A 2J9XA 3ABSA 1H63A 5EB8A 4N6EA 4H8NA 3FAWA 3KVKA 1PIGA 1OM0A 2CU0A 3DU0A 4DPPA 5FEWA 4RV3A 4LB3A 4OE7A 3KVMA 4IIHA 3VOIA 3G0SA 3MY9A 1XRVA 2VX7A 4JTDA 1XIEA 2Q8XA 3P67A 3RM9A 2Q3RA 3T0AA 3LXBA 1LWHA 1ZY9A 3GIQA 3CV7A 3POHA 2XJ7A 3G6MA 1DWIM 3B4UA 3HQNA 1SM9A 2B7QA 3LCFA 4H9MA 3HGJA 1LTDA 4I7UA 4JEJA 5BRQA 4LSBA 4C6LA 2WXDM 4QBXA 1W37A 4JFTA 5EFDA 3K4AA 4FS9A 4WCJA 2JEQA 3C0SA 1FWSA 2EXOA 3QF0A 5FJIA 2J24A 3PB2A 1GHSA 4AISA 3I3BA 1DWJM 1UH3A 2HNEA 1OADA 3ICJA 1GK8A 3PAJA 5M1TA 1RBLA 1BGGA 4DZAA 4IOTA 2JF6A 4GWEA 1LRTA 1OGSA 3TZNA 2Z27A 2WM0A 1JNDA 3RYSA 2R14A 3B8UA 3ABXA 2ASHA 4L4PA 3M07A 1FVPA 5HWMA 1A4MA 1VFUA 2ZCGA 2VDIA 4C7DA 1C8YA 1POKA 1YNPA 2QZRA 3MVTA 3GTNA 3SRFA 3BLKA 3C61A 3WLIA 3UR8A 3P6LA 4Q4QA 2WZMA 1CLXA 1RSCA 1K9EA 3NL3A 3ZT5A 1Z8AA 3DFPA 1LQ0A 1TKKA 1C9WA 5EBUA 1NARA 3Q2DA 3IJQA 1A53A 4C60A 5LGXA 3WQ6A 4UUIA 1JPDX 4M0XA 2Z29A 1RBAA 4LRTA 3LG3A 3SCRA 2Z28A 1SR9A 3VX1A 1WDDA 3ZQ9A 2DT0A 1TVNA 4Y9NA 3H2AA 1UZHA 3KL0A 4YHEA 3TYZA 1SZGA 5D38A 2EGZA 2QJNA 1QJWA 5C8BB 1PS9A 3IWPA 4HNCA 3S5NA 2ZADA 2EKGA 3W6YA 2V5KA 5L9FA 3LYEA 4MTVA 3VTRA 3NOEA 3VIHA 1NQKA 4JD4A 1PDZA 2ZC1A 3VNLA 1NDWA 5ABHA 4QCEA 1DWGM 2C16A 1I8JA 3RCYA 3AIVA 2BOFX 1HJSA 1UW9A 2FKPA 5DXYA 4OBTA 4AW7A 4B9ZA 4LT9A 4C91A 3BPWA 5CQ1A 3GR4A 5HA7A 1J01A 3WQOA 1UP3A 1W3IA 4NZ5A 1FWGC 4AIOA 2I56A 3S46A 5DT5A 3CUGA 3ES8A 4E2DA 2F61A 1QHPA 3PR2A 1QUMA 4AX6A 4RXGA 3PZGA 1C8XA 3S5OA 3KTXA 2ATMA 3OGVA 3QY7A 2QPUA 1IE7C 2Y4SA 3FHAA 2ICSA 3I7RA 1UKTA 3PSVA 4E3TA 3P0XA 3F5LA 4M5PA 5JU6A 1XISA 1Q4NX 1F8IA 3LI0A 4FLOA 1TE6A 5K9CA 1X8CA 2YR1A 2JE8A 4FAMA 1M5WA 1RH9A 4GKLA 4RE0A 1US3A 1W9BM 1Q5MA 2E8ZA 1XYLA 1ADDA 2DUAA 1T41A 4L6OA 4GYPA 1XGDA 3POCA 3APTA 5CJMA 3IJIA 3KTCA 1D2KA 1CXFA 3PZIA 3EYPA 1EOMA 1TRIA 4XZBA 4E38A 2R1NA 4W8BA 4ICMA 3AYRA 5CSRA 3LHTA 1JJKA 1P48A 2PGRA 1ODZA 1RJQA 1R3QA 3SSZA 1S5NA 2ZX8A 3VDGA 2BZNA 4IJBA 3FLUA 4QE5A 1GNXA 3S83A 1A49A 1NDZA 5BXPA 3GKFA 5REQB 4HPGA 3B0VC 1KCZA 1M7XA 3FA3A 3DESA 4CLMA 3IARA 5EPDA 4BR1A 4DBUA 4LAOA 2INEA 3TFXA 3W0KA 4GX9A 3QW4B 3GVQA 3M0MA 2XIMA 4Q6XA 4F0KA 3KHDA 1GCYA 2GVGA 2GSEA 1RPKA 3SBFA 3GTXA 3K8MA 4KS0A 1DIOA 4CD7A 2X05A 4LX4A 1XIDA 4FB7A 2DVXA 3P3BA 3S3GA 2X1RA 2OVLA 3BXWA 1LWIA 4AWTA 3WQEA 4E4UA 3PB0A 4PTNA 1TWZA 4WKHA 3E96A 3WN6A 2G50A 1VPQA 3DG3A 2BTMA 3NL6A 1VEOA 4DELA 1H2JA 2VD8A 1TUXA 3DBNA 1Z44A 1YNQA 3T2PA 3NG3A 2VEPA 3G2GA 4TV6A 3GUWA 3GIPA 2F9RA 3WNOA 3TMLA 4O10A 3MMWA 2FDMA 3QR3A 3UXLA 2A4AA 3T81A 3OQEA 4IG2A 3RPMA 2OZ3A 3C86A 3PJTA 1OYCA 3VM7A 2WK2A 2J27A 1E70M 3KBNA 1FWHC 4AZHA 4UOZA 1QWGA 1XLKA 4WOQA 1TTJA 5HNNA 1X7FA 4IMDA 5BROA 4CD5A 3TTSA 4QGCA 3ARRA 4WDTA 1E55A 4O12A 3FN9A 3QPEA 5E6ZA 3TW6A 5BWAA 3QY8A 1A5KC 3G1XA 3BURA 3REQA 1EJVC 2GUBA 3RR1A 3H2NA 5DCBA 3EX1A 3PFMA 4S3CA 2P1FA 3EA2A 4UCGA 1NFBA 3VDBA 1K3UA 2O9OA 3PSWA 1GT8A 4U2ZA 6ENLA 1JUEA 4WVXA 1XLEA 4O1CA 2OYKA 5AN7A 1U5HA 1XD1A 3ZWTA 5DO8A 4MOZA 3IGSA 3A23A 4H7ZA 4CCCA 1S2AA 4JPGA 4AVOA 1Q6OA 5TD4A 1QNSA 2CKSA 2YLLA 3OOQA 4UOQA 4CN6A 2DT3A 4DWSA 4HU0A 4KIRA 5HWJA 1GJWA 1EO7A 2Z6JA 4YJ5A 1WOAA 1NAL1 1OHLA 4JNZA 1JZ2A 5LNRA 3FK4A 3E9AA 2XIIA 4HOWA 1GTEA 1ZBWA 2CLLA 3GXTA 2GUYA 4ERGA 3C4UA 4NHVA 1X1ZA 3TTYA 4PMOA 1MW0A 1O5RA 4IMCA 5BXRA 5CZKA 2PC8A 1Z48A 1TPUA 2CHNA 3JR2A 5CZJA 2FTPA 3BE7A 3REQB 2PUZA 3TEVA 3W7KA 1W3TA 4J3TA 1J0HA 1ZJHA 1WZMA 4OKDA 5I3DA 1FH9A 4N6FA 4QHRA 4RK8A 1FA2A 4IWWA 2QJMA 1Z6KA 1EBGA 2BVWA 1R9YA 2GOUA 1IIHA 2GOKA 5T8GA 3ITYA 5XIAA 4WKFA 1TZZA 3KBWA 2VUYA 1B90A 3LM7A 4DLMA 4HCDA 2VURA 4GZEA 1OIFA 5AHMA 4MNMA 4Q8TA 4WLCA 1G4TA 4DO5A 4PSRA 4DWSB 3PPGA 2WQPA 4Q7BA 4Z2KA 4JTFA 3TONA 4L9XA 4S3JA 1XDJA 2C3ZA 1EA9C 4W93A 2E5CA 2CLOA 4PUJA 1A5UA 3DFYA 4GI9A 2TODA 4U33A 4DRSA 3GS6A 2INFA 3N2MA 2QUNA 1DWHM 4H1ZA 3UY8A 3A64A 1OX4A 1XLIA 4HD5A 2XH7A 4L1WA 3TE9A 1EWEA 1GOWA 3BDKA 1DORA 2VJXA 5C2CA 3GC2A 2WJZA 4UTKA 5K9DA 5AZ0A 3CZ8A 4R5EA 2V82A 3H2MA 1OC6A 3VABA 1JDAA 2FH8A 2AL1A 2CXGA 2WJDA 1QO2A 2J7EA 3N3TA 4FOUA 4IX0A 5AKQA 3W00A 3IPWA 3OU8A 2NWSA 5CPSA 3RRAA 3CB3A 4M6VA 4AZ5A 1GOMA 2WMFA 1GPFA 1ZAJA 2VCAA 4IL0A 1VFLA 1Z7AA 3PBGA 3LHZA 4JGDA 4Y8FA 5F1VA 3L23A 1XCWA 4JTLA 3GO2A 1E51A 3TN3A 1ZP3A 3U0HA 1JYWA 3HG3A 4GIAA 3SY8A 4RPQA 4MB3A 2NQJA 1NH6A 1BF2A 5C9RA 1JUKA 3G1VA 1E6NA 4US5A 1UROA 2Y8KA 5RUBA 4G9PA 4C6KA 1CZ1A 4XAGA 3KOZA 2VEGA 4AD4A 3NL5A 1VBHA 1GW9A 2BOGX 3G22A 3DERA 1W91A 3WELA 1H3GA 3F7JA 1UB3A 4R7JA 5DN1A 5GNXA 1XLFA 1VR6A 1E4NA 4BQ2A 3BK0A 1QHZA 1OVDA 4JN6A 1FXPA 1QNPA 4FZIA 4YLWA 5F2GA 1BSLA 3QR1A 3UR2A 4TU1A 5G1YA 5EL1A 2PEVA 4ILSA 4LOCA 4JIHA 4UOJA 3STPA 1DV7A 2QJHA 2J8TA 1XF0A 4TTUA 3GY1A 3CXOA 3ZLHA 3GUGA 1E4IA 1W1A1 2ZUMA 4O15A 4KT2A 2FYMA 3SW6A 2IKGA 1Z32X 4ZEPA 3LERA 4BZYA 2JQXA 1EEPA 2WNNA 3W72A 3ZS4A 1IHIA 2PB1A 4DWSC 1HKMA 4K1GA 3N6QA 1Y8BA 3WH8A 3H22A 4XAZA 3DI0A 4XAFA 4JIPA 1E0UA 1XLGA 3LMZA 4FX8A 3UNDA 1EXPA 1I45A 4WXYA 3DH7A 5CAKA 4XBKA 3GH4A 3GAYA 3W7DA 1I9CB 4A4AA 3F03K 2B0MA 2CPUA 4GINA 3L66A 4OBRA 3IK2A 4R85A 2R9RA 5FACA 1MDLA 4O1FA 1OFAA 4TMBA 1B4EA 4IFKA 5K4ZA 3LLXA 3CUZA 1ZB5A 1OB0A 1NSJA 4J4KA 3CZEA 3V0SA 1VIZA 3RO6A 3VZZA 4O53A 2QCGA 4LUSA 2BOEX 2YZ5A 3UXAA 3TA6A 3DDMA 6TAAA 3F4NA 3URBA 4EF8A 1K7XA 4LQ1A 4ZOCA 2ZUWA 2DP3A 3LXCA 5A1AA 4HZ7A 4MZ8A 5CH9A 4ES4A 1CXEA 4RNJA 4PL2A 3ME3A 4AF0B 4UFKA 2OKOA 2WOQA 3AHYA 3DFNA 1U5VA 2YJQA 2QS8A 2OQLA 4RXFA 3EPMA 3OTRA 4Q7NA 4YCOA 2OODA 4A8IA 4MUZA 4JTIA 4HSOA 1SJDA 2CKRA 3GB6A 3FXGA 3UCDA 2EO7A 4JTJA 4UFLA 3G3MA 3AU6A 1DJNA 1W3JA 3UY7A 4HHPA 3F5KA 3PBUA 3STEA 1XIJA 4GE8A 1UASA 3APYA 3R0KA 3UQNA 2Q71A 1YXDA 4PMVA 4LAUA 1BRLA 4O0ZA 2PLMA 4MYAA 1OK6A 4LVAA 3K46A 1HKJA 2TYSA 4H3DA 3W81A 1E43A 4IMAA 1LP6A 3TROA 1QW9A 4LUSB 3S6TA 4X63A 4S3FA 3EBVA 3ZM8A 3QV7A 2ODOA 3TSMA 2OU4A 2E1WA 5G2IA 2GJLA 3W2JA 3NQEA 4GO8A 3T09A 4U3AA 1XQKA 4EK7A 1MFVA 2PBGA 2VFGA 3GDKA 3WKZA 3SUSA 2YX0A 1W9PA 4QLKA 4R34A 5CLWA 3H4WA 2OMAA 5E5CA 2CWXA 1G94A 3VCRA 2TRSA 2GJPA 1CIUA 1ZBVA 1LOQA 3MTWA 3CK5A 1CGVA 3RM8A 1QPNA 1JCJA 1K4HA 3M0VA 2ON3A 3EWUA 7ODCA 4MYXA 2A6LA 4JEQA 2HZGA 1XCFA 2QAPA 2XWDA 3KP0A 2ACQA 4GZIA 1MYRA 3VKKA 2YL8A 2PRLA 3UJEA 1NWUA 3O6DA 4DJEC 1AJZA 4J28A 4IPNB 3DCPA 3ZSSA 1ALDA 3STGA 1IIGA 2Q3OA 3PBYA 4P8WA 3K13A 8CGTA 3GQYA 1SSDA 3EXSA 3CL8A 2JFEX 1PZ2A 1B3YA 3RUBL 1Q2SA 4GQ0A 1BSIA 4CQ8A 4AWEA 1ELSA 1DQWA 1OX5A 1GKQA 3UYIA 1AD1A 4KFPA 5CJNA 4R7WA 3SRDA 3PM6A 2NUWA 4DJDC 2WJEA 3WNPA 2W67A 4U5IA 1KFLA 4KRZA 4M8UA 4GMEA 4Q8MA 2I1OA 3FJ6A 1EF2A 4LRSA 1WXYA 3TC7A 1QOXA 4BF5A 4YU1A 3WDRA 3NA8A 2PWHA 5BMWA 5JQ9A 3R43A 3Q94A 2R1LA 3NXFA 5BNKA 4IIFA 4MY1A 5D32A 4UQEA 1J4EA 2VVNA 1GHRA 5E0KA 2DIJA 2V2CA 4UNKA 2ZRVA 2Y7DA 2XGBA 3TNBA 4MFEA 3H21A 4JCMA 1EC9A 4AHQA 2J13A 5F2LA 4GXMA 2J7CA 4ALDA 4W9TA 4IQEA 3BLPX 4B2DA 3SY1A 3TQKA 3DGBA 2XU2A 2OJPA 4PCSA 3ZMRA 1FHDA 5GPRA 3JU2A 4XZMX 1VQTA 2QXWA 3B4YA 3WY1A 1FTXA 1B5TA 1GQIA 3DX5A 3A5VA 3P60A 5G4EA 1CXIA 1OD8A 1RK5A 1UA3A 1FBAA 3C0JA 4IICA 4LEFA 1EP1A 1X96A 4O54A 4PTWA 3VCCA 1XW8A 3QLDA 3WCZA 4MKSA 3C8FA 1F76A 3W7EA 4UTIA 5HNUA 1NELA 3PZ9A 2CZEA 3CYVA 6PTDA 3NCOA 3VIOA 1G4SA 2ZBTA 3PZUA 2EPNA 3R4IA 1VYSX 3OLEA 2J7FA 2P8BA 3R5EA 2NVCA 5HUOA 3TLLA 3LDVA 3BG9A 1YRRA 5LHEA 1J5SA 4FI4A 2V38A 4FXRA 2A7RA 3CASA 4RPPA 2GDQA 4D6JA 3C0LA 1QMLA 1K8CA 3UJ2A 4XV0A 4H9VA 1VEMA 4X2RA 1Y5VA 5T91A 4D8AA 4DI9A 1V5XA 4F9JA 1DVJA 4FALA 3T0CA 3W1RA 3VNDA 1BYCA 3HPSA 3ZR4A 4QSFA 3LX9A 1U5JA 3VOGA 1EC8A 3EDKA 3N19B 3QEZA 4Q4SA 3A9IA 1F3TA 1BVZA 1MDRA 4P5UA 4AZGA 1MW3A 2FZMA 4LNCA 1CLVA 3L9CA 4Y8EA 1KM5A 4JQ4A 2E6DA 3M41A 4CNUA 4K38A 5FJPA 1XI3A 1Z42A 1H49A 3EWBX 3N18A 3D47A 3L4YA 2QIWA 3OHIA 2DUZA 1XC6A 3LM3A 4JX5A 2QQ6A 2WNWA 1J9YA 5CC7A 4ZQMA 3LHUA 1TPVA 3BAJA 5G5IA 3LQLA 1A4LA 4O1AA 4MM1A 4Q32A 4FPSA 1SO5A 4Y96A 2A7PA 1RBOB 4PFMA 1R0MA 4REQB 2BGQA 3T44A 1V3JA 3FDKA 2FIQA 1HJQA 3HZ3A 1R8LA 4KGLA 5A8GA 1N8WA 4OWGA 3HQOA 4EXBA 2P5NA 3LBMA 7A3HA 3TVAA 1KBBA 1LUCA 1J93A 4GJ1A 2DSWA 1AQFA 3EWXA 1BYBA 1TREA 1V3IA 1W2VA 2D0FA 1ITUA 1WUFA 1LBFA 1ZENA 2HRWA 3JUGA 5A2CA 1TPC1 1UUQA 1XCXA 3M43A 2DZXA 4UTLA 1M7JA 4W84A 1UZDA 3ZVHA 5MKGB 1VBRA 4FF5A 4PUNA 3EAUA 5FAJA 1XBXA 2I9EA 3VIKA 3CV6A 2E5BA 2B81A 4A8NA 3WZ0E 4N02A 1Q6DA 2B4GA 5CG0A 1JRCA 2YXGA 4GLEA 1QPRA 3V16A 1SGJA 5GJNA 3ABOA 1VFTA 1VFSA 2DEPA 3GAKA 4A2RA 1O4UA 1YYAA 4AIEA 1KM0A 2WKGA 4KH2A 4CU6A 2YXOA 4ZE5A 3IIOA 2D2GA 5C55A 3MSGA 2UY5A 4JS3A 2VR4A 5HQMA 3CAWA 4MNJA 3RIKA 3G3DA 3VIIA 4YTTA 3IEBA 4Q6JA 2J88A 3VUPA 4L80A 4J2MA 3E5BA 1UP0A 4I3GA 3AMDA 3MZNA 1H7WA 3NSNA 3WH6A 3HURA 1KNWA 1SFLA 3BLFA 1QCWA 4ZO8A 3UZJA 3R6IA 3QQ0A 4LY8A 3MHFA 3TTQA 1XD0A 3TN4A 5K9XA 5JIPA 4X60A 3EWYA 4O4WA 5CC3A 2EEXA 2I7GA 4FP1A 3QKEA 1H1NA 4HBKA 4W5ZA 1JPKA 2PTZA 4KFOA 1A5BA 4MG4A 5D37A 4G5DA 1RAKA 4K8EA 3CV1A 3ZVHB 3JS3A 5D2WA 3MMDA 1EA0A 3OODA 2F6XA 1PUDA 4M29A 2BSLA 4OT7A 2PS2A 4HPHA 3L4TA 4DYJA 3TR9A 1PO9A 1SO6A 2FZDA 3SAZA 5HULA 2V5JA 2XM1A 3HV9A 5AC8A 2V5DA 1UYQA 3WK3A 4RE2A 4M82A 5CPLA 3B9DA 2X7VA 1B31A 4PMUA 3SDOA 4AMAA 3PG9A 3PC0A 2ZA3A 3TJ4A 4P8VA 5CKSA 4D1JA 4ZGYA 2J66A 2LLEA 1V3LA 3KX6A 2XFRA 4J35A 4W7UA 1YXYA 1JCNA 3RLHA 1GG1A 1HKVA 1EHAA 4LV4A 2VTFA 1NFGA 3IUHA 2YB1A 4L7ZA 1JPMA 4LNYA 5BOFA 1A0CA 1XH0A 4WD0A 1P5BA 3M0LA 3U5UA 3UYCA 2XUCA 1KR0A 3WG6A 1RLCL 5A6BD 4JX4A 4KF1A 4C6CA 1YW1A 4F0HA 3HPXA 2CITA 4JYEA 1XBVA 4PB4A 4PC8A 4KEMA 3BSHA 1QNQA 1YXCA 4MIMA 3CQHA 3SB0A 4UFIA 1XIMA 1LJYA 2DSZA 1GPWA 4B4HA 4V33A 1AW1A 2J77A 4N2YA 3MCMA 2ACSA 3L0KA 1XLCA 1W5PA 2D2JA 5KZ6A 1TCDA 4M6PA 4Z0JA 2NLIA 3DYMA 1VHNA 3GG0A 5JVLA 2O55A 3SFWA 2HV5A 1W1B1 2WVUA 2E25A 3E0VA 4PCNA 3Q58A 1NQ6A 4UXDA 2DFAA 3W7QA 4GGBA 4AZCB 1W1YA 2V3FA 2V30A 4MLRA 1OEPA 4JTUA 5A6SA 1MXSA 1EX1A 1A5LC 3T8QA 1DXIA 3AMKA 1UP2A 1ZAHA 1FRBA 2UY4A 2AKMA 2D22A 4XZNX 4CQCA 3SCVA 1YKWA 3AHZA 2YCLA 4DJFC 3URAA 3C3UA 3FYYA 4PMDA 3W37A 2JGYA 4QCFA 4MPKA 4Z2IA 1H5VA 2HXUA 3GC5A 1DXEA 5HAOA 1L2UA 4ZL1A 5I3KA 3HOJA 1E3ZA 4G6CA 9XIAA 1LL7A 3NQVA 4XTDA 1UQYA 3CHEA 1OT2A 1BKSA 4MFDA 3EOUA 3W1NA 5TIMA 2AAMA 3UG4A 2I14A 2VZOA 2YYUA 4ZE4A 4R9XA 1TFVA 4HYVA 5IDIA 3W23A 4CD4A 3R25A 5I79A 1S2CA 2C79A 2PCEA 4F9DA 1A50A 4QQUA 2PC4A 3TOPA 3M0XA 3LLDA 2V69A 4NASA 4AHOA 1S5TA 3S2NA 3QFWA 1IXOA 2GK1A 2Y8VA 5A69A 3UVIA 5ABTA 2NQ9A 1F73A 2DZUA 4GIEA 2WV8A 4L61A 3P2VA 2X0HA 1P7TB 1ESWA 3HFTA 4KCWA 4R27A 3MANA 3NAVA 4XB3A 1YEYA 1VCFA 3BLLA 3K2GA 3L5MA 3I10A 2W6RA 3FIGA 5A3HA 5C54A 1ZTVA 5G1MA 3HV8A 2CCRA 3CZJA 3O63A 2C6QA 3OHMB 2RH9A 2Z24A 1QNOA 1NP0A 3LZ3A 2CBVA 3B9NA 3VD3A 2MNRA 1EX5A 2E8YA 4A6GA 1JZ4A 1M68A 1J12A 3ABRA 3N2OA 3VXGA 2ZC8A 3G1HA 1DJGA 4HKPA 2DPEA 4Q8QA 4H83A 3K1DA 3JW7A 1ITXA 1TX2A 2HS6A 3KE0A 2Q01A 1EBHA 3R0UA 5KINA 3NQGA 4RZ4A 5CGQA 2AAAA 4Q8NA 3WLOA 1Z41A 4N4QA 4D1IA 1PEZA 1R7AA 4FOKA 4EXAA 5KEZA 5I03A 1WQ5A 4UMAA 4Z1AA 1O66A 3WNMA 5A8PA 2GSHA 2F2HA 5D33A 3VNYA 3WUFA 3PZMA 1XRSA 1H09A 1ISVA 2BGSA 3T4CA 3WLTA 4S1FA 2YL9A 3UU0A 4BI5A 1IF2A 1GVOA 2J47A 3T42A 1XSIA 3GD6A 3ZT6A 3QZ6A 4NY2A 1ME8A 4OUEA 1XIIA 3SCTA 3FEQA 3NPVA 4D6EA 1W9VA 3SGZA 4B5UA 3N11A 1P0DA 5AB3A 1LL6A 4ROQA 1FWNA 3W88A 4F4RA 2GQAA 4C6PA 3PUGA 1X97A 4ZXLA 3ZVIA 4S3EA 1JFHA 3GNXA 3CPUA 3W27A 2Z1KA 3ITOA 3G1RA 1KA9F 4RCXA 4WIWA 3NSMA 1ICSA 1OQFA 1TPFA 5J5DA 1BTMA 3BO9A 5CBIA 3T05A 2FB3A 4K8GA 6ALDA 2ZE0A 2AMXA 1LRQA 5E93A 4KPLA 5AHIA 4AD1A 1ZPTA 3TXVA 1UHVA 2XH4A 6TIMA 1LQAA 3T78A 4JKMA 4X0VA 4AYGA 1GOXA 1PYMA 2FHFA 3OGRA 1ODUA 2J8GA 1OCNA 3VU2A 4LH8A 4QJ1A 4O19A 2TAAA 3PZOA 4V28A 4CNSA 1RZMA 3WIJA 4IT1A 5M5DA 1JD9A 3VIPA 1A5AA 3WQFA 3F4DA 4XO6A 5JIWA 1FWEC 4XD5A 1OYBA 1JQXA 5HR7A 1GVIA 3NZPA 3CZGA 3MDWA 3NUKA 3BAIA 4UMBA 5C0QA 3IJ9A 1EDTA 2E68A 4N9BA 1PCKA 4DF2A 3W6MA 4D6HA 1AUSL 4JKLA 2CYGA 3VNJA 1OC5A 4RW3A 2SFPA 3P14A 4OECA 3K1GA 3RMEA 1FWDC 3UZ5A 4XUYA 3M1ZA 4OIFA 1DP0A 3NZ1A 3VGDA 3I6RA 2V2HA 2OSWA 4E5TA 2VC6A 4DLFA 4N42A 1QK0A 2ZX9A 3TDFA 2W63A 1GYMA 3E2RA 5FJOA 3AIEA 1H50A 1RP9A 5H8UA 1R86A 1F2JA 3KAOA 2P53A 4XZ9A 2VRQA 1IYXA 2A3EA 1UR3M 3FAXA 4JTKA 2CZ5A 4I6VA 3PWGA 2NLYA 1PX4A 3GVGA 4I8DA 2QW5A 4ZB0A 4LS0A 1KQZA 2FGZA 2G97A 1Z9AA 4PTDA 3SEPA 3TV8A 3M5VA 1QPOA 3FKRA 4KQNA 2OOFA 5REQA 1V51A 2D69A 2HSAA 2VOMA 4AWUA 3TA9A 2BLEA 1L8PA 1V6TA 2YCKX 4FHAA 3WBYA 2NSOA 1WXJA 2GWGA 4XBJA 1H11A 4QITA 3W87A 1THFD 5MF5A 3ANYA 5LIWX 3MV01 3W7LA 4Z08A 3ZYZA 2FQIA 5LIYX 2KAUC 2PURA 3DHPA 4UQAA 5IM51 5I77A 3N73A 2FHBA 1MSSA 2VC9A 1HT6A 3B8TA 2X1IA 5FF0A 4LU0A 3KCJA 4E8DA 4DPQA 3Q45A 3B3DA 1X38A 4IXHA 4S38A 1VLIA 4XTIA 4M1BA 2OYLA 1JIBA 4U3CA 3CH9A 4D8ZA 2C1HA 2Q02A 2HDJA 1QK2A 2C8NA 3IJ7A 1WX0A 1Q6FA 5U7SA 3WNNA 1XYCA 4ZSTA 1ZQ5A 1KB3A 1TQXA 3FYPA 4LFYA 2Q8LA 2PRHA 3AHTA 4TVDA 2OG9A 5XIMA 2R24A 4CCDA 4PUUA 1BWKA 4GH1A 1RVGA 1JCLA 4HN8A 3MP3A 4WZHA 1FWBC 1YDVA 2WMGA 3CO8A 3GHTA 3BGGA 1ZS2A 4AUBA 3E0IA 4GO9A 3O0FA 4XSLA 3AYTA 2H3DA 3VOJA 3HA1A 4HOZA 3CU2A 1ME7A 3B8VA 3CWHA 4GVGA 2VMFA 4OV9A 1LG2A 2XPKA 3BARA 4QG6A 2XHYA 3E74A 3G5EA 4I7WA 2WYSA