3N12A

Crystal stricture of chitinase in complex with zinc atoms from bacillus cereus nctu2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
332
structure length
332
Chain Sequence
NNLGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLESGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHYNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDGLSLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Chitinase A
total genus 113
structure length 332
sequence length 332
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n12A00
3B8SA 4XV0A 4MAZA 3GXMA 3VD9A 2VO5A 2WM0A 4FF5A 5M03A 1P6WA 3AXXA 2XVGA 4JCMA 2F61A 2Q8XA 2WC3A 2PF0A 2JEPA 5LA0A 4MDPA 1V6XA 1VFUA 2X09A 4QLJA 1AVAA 1BPLB 2ZUTA 3NSNA 5BCAA 3GBEA 3VM7A 2WMKA 4RL3A 4PRWA 1OD8A 1QI2A 4TVCA 2E40A 4AZCB 1V6YA 4JKKA 2YDQA 3ZJ6A 3EMQA 1G1YA 2J7FA 3AHXA 4PEEA 4C7GA 2EEXA 4HTYA 3OA5A 2XVKA 4YN5A 3ZJKA 1B3VA 1US2A 1OT2A 1UWUA 2GK1A 1HVQA 2VNCA 1M7XA 3UG5A 3MSDA 5IFTA 2A3EA 1BYAA 1U2YA 5ABGA 4TTGA 4X9YA 1B3ZA 4UQDA 3UEQA 4W93A 1NWSA 3SEPA 3RDKA 1XH0A 1MQRA 2WCGA 5CLWA 2VRJA 2ZOXA 5LA2A 2VRKA 4W89A 2BHUA 4XB3A 3GH4A 4HZ7A 2G3IA 3DECA 5D4YA 3POCA 4PN2A 5BRPA 1EO7A 3WF0A 2XVPA 3CZLA 2YA2A 1XSKA 2DPEA 2J8FA 4QFUA 2FHBA 5CLTA 1L0PA 1JZ5A 4UQEA 2O9RA 2JIEA 2VCBA 2MANA 4DM2A 1KCLA 2X1IA 3L2LA 4Z2KA 1V02A 1GORA 3AIRA 1W9BM 1OGSA 3F5JA 2ZX8A 4J27A 1BQCA 1G0CA 2DH3A 1E1EA 4MDOA 4P8VA 3VDAA 3VGFA 4D6FA 5HPOA 1FH7A 3WDRA 4Z2GA 2W91A 3CZJA 2VCAA 2WLZA 4BS0A 1UR8A 2IUZA 4JL2A 2FH8A 1WKYA 3W29A 1MW3A 3U57A 4QCFA 1FH8A 1GW1A 1HT6A 4U2YA 2PC8A 3J7HA 2XM2A 3WDIA 3AXHA 5FIPA 4KRTA 3DYPA 1BVNP 4TVDA 1KGUA 2DT1A 4JFUA 4HP5A 2Z1KA 1KXQA 1Q6EA 3WEOA 1XD0A 4M82A 3ZT6A 5TD4A 4WKFA 2J79A 1H41A 2WVVA 2XM1A 2WWCA 1W3KA 2V3DA 3UR8A 4EK7A 5I77A 3KE0A 4HPHA 2EXOA 5ECUA 5I5RA 5M3WA 3CUHA 3LPFA 4U3AA 3GYCA 3VGEA 3GNRA 3PZQA 2AOSA 5CQ1A 3WF4A 1VIWA 1H11A 3S2CA 3EDKA 3WNLA 1C93A 3VNYA 3VMPA 5GNYA 4H8UA 4W86A 1ZBVA 3VUPA 3SCQA 2DGAA 2WW5A 1J0IA 2CETA 4CD8A 1C7SA 1B30A 1GOIA 5DT7A 4AXNA 1W32A 2DIJA 5CZKA 2DDXA 2VQTA 1JDAA 1KQZA 1KR0A 4ZE5A 3WH8A 2VVNA 1OSEA 1VFOA 2VZVA 4TVUA 4WKAA 1HVXA 1VB9A 2O9OA 1ZBCA 3THDA 1ECEA 2W5FA 3BGAA 4H04A 3ZT7A 2J7HA 2WZHA 3DYMA 1ISVA 2D1ZA 3VNZA 1GJWA 4RE2A 1EHAA 2OWXA 2E9BA 3LMYA 1PEZA 2CHNA 3AMGA 3WF3A 4BA0A 5FL1A 1XD1A 3WMSA 1SR0A 4IUGA 2CESA 1TG7A 3KWXA 1AQ0A 5ABHA 5CSYA 2D20A 1JI1A 2OWCA 3W38A 5A8PA 3VIPA 3EDFA 3PTKA 4AD2A 4GQRA 2A3CA 1SYTA 3CTTA 2O9PA 1V3HA 1TVNA 2BXYA 3NSXA 4D6EA 1CBGA 1YHTA 4HU0A 4B15A 3WEMA 1PBGA 2YOCA 2WVSA 3N04A 1JYXA 3EDJA 4ATDA 4HOWA 4BCEA 1EDQA 2XSAA 4CCDA 5KEZA 5BXSA 3QR3A 1PZ2A 1ITCA 3WBAA 1V3KA 3WBEA 1FP8A 4W7VA 2NW0A 1EXPA 3HU7A 2J25A 3VU2A 1R87A 2JF7A 4D1IA 2YDSA 3OBAA 1TCMA 2FHFA 5DO8A 3ARZA 5A69A 1DEDA 3SUTA 1BGGA 2C7FA 1W9XA 3RCNA 5GNXA 5A6LA 1CNVA 1EDTA 4PSPA 3WUGA 3AMKA 2VZUA 1UR9A 3WH9A 2QMJA 3AIEA 4MJ2A 1WDSA 1QW9A 2W62A 3IAPA 1DHKA 4CD5A 3OLIA 5GPRA 2OSYA 2J8GA 4D71A 3L4ZA 3VGGA 7CGTA 3WF1A 2CKSA 1JG9A 4PMOA 2XFFA 2G3NA 4WK9A 4CU7A 1EGZA 2VR5A 2CHOA 2V3FA 4NRRA 2JFEX 1HJUA 5CSUA 3GBDA 1D3CA 4EE9A 1C8XA 2ZX5A 4AISA 3GDBA 2YL8A 4AWEA 1F4AA 4PMZA 1GUVA 3VDBA 1PAMA 3PZGA 4KGJA 1BYBA 4E2OA 2D0HA 5JIPA 4PMXA 3PZTA 1GQLA 2IXVA 2VURA 1WZLA 4AIEA 2GVYA 5BRQA 4M29A 3RM8A 3NUKA 1CGWA 3HJEA 5FOOA 2DH2A 2WZIA 4PCTA 4WKHA 2WBKA 2YA1A 5ABFB 1BTCA 5A8OA 1TA3A 1ZJAA 4J3XA 1JD7A 1CGTA 3THCA 4CD6A 2DSVA 4P8WA 5F7UA 4GINA 3KL5A 4HA4A 4UZUA 1XGZA 4EAMA 3AS2A 3W4RA 4JHOA 1C3FA 2Y24A 1I75A 3W6MA 1CWYA 1X6NA 2ZXQA 2WHJA 1JDCA 4ZEPA 4R5EA 1UWSA 5CJ5A 5I2UA 3CHFA 3GXDA 4S3KA 1EH9A 1HJVA 1B3WA 4C7FA 4IM4A 4U31A 2WSPA 3GH7A 4FLRA 4AD5A 1K9TA 4TOQA 1NP2A 5I24A 3VMOA 1UOKA 1JYWA 5CPQA 3VIIA 1LQ0A 1XRVA 1ZB5A 1U30A 3G6LA 1CDGA 3CUFA 2WKGA 3EDEA 3MUY1 3HN3A 3IJ9A 4Z2JA 1J12A 1H4PA 2XFYA 4R27A 1OT1A 2VR4A 4EANA 2DSZA 4U3CA 5BYWA 1J01A 1V3LA 3MU7A 5M5DA 3T08A 1F4HA 1UHVA 2PWFA 1KXHA 3AZSA 1E6RA 1LG2A 2VMFA 4P7RA 3VDHA 3N12A 3OGSA 4J7RA 1V6UA 3WNPA 4ATLA 3AIBA 1W3HA 1CTNA 4AZ7A 1JAEA 3ARSA 4LQ1A 3GM8A 1WCGA 4W8AA 3MO4A 5GQBA 3WH6A 1C90A 3WDPP 1G9HA 2J4GA 3BLKA 3TTQA 5A3HA 2OSWA 5BXPA 8CGTA 4V2XA 1CZ1A 3IANA 4PYSA 2GK1B 1BG4A 2ZXAA 3T2QA 2VQUA 4AD4A 1JXJA 2CKRA 4JFVA 1OB0A 1W9DM 3B9AA 3SCRA 2ZICA 3K46A 1EQCA 2WSKA 1FHDA 1V3MA 3AHVA 3ZM8A 1IZKA 3ARUA 1IZJA 3VD3A 4A3HA 4LGXA 3WUEA 1GOWA 5JBDA 2QLYA 3WNMA 1R8LA 2Y5EA 4XUYA 4KGLA 5E70A 4RE4A 2W61A 1CENA 4AZHA 2NT0A 3ZJ8A 1I1XA 1LL4A 2HVMA 4GZIA 3FW6A 1NOWA 2EBNA 1PPIA 3WH7A 1VRXA 4AZBA 3AIWA 4ZFMA 2VOTA 4L4OA 1K9DA 2EQDA 2CCRA 4HU8A 1UUQA 1W1PA 1O7AA 2ZUNA 1CPUA 1E3ZA 1TE1A 3WUBA 2PI6A 4MADA 4KH2A 1UR0A 1HJSA 3KZSA 2VTFA 4BQ4A 2WHMA 1JYNA 2TAAA 4KWUA 1HIZA 1JF5A 1QNQA 3CMGA 2ZUWA 4QP0A 1HXJA 1UKSA 5LYRA 1B3XA 4FLSA 3UERA 2PWGA 2YBTA 4JFWA 4DWSD 1FA2A 1UYQA 3AS1A 4DUWA 3CO4A 3PZNA 2J7DA 4YHEA 2DSWA 3AOFA 1TR1A 1US3A 2VI0A 4GO9A 4YPJA 2UY2A 1MXDA 4LYQA 1H2JA 1BVZA 1ISXA 1WZKA 2WMIB 3GNPA 1VFMA 2WVVB 2BHZA 3VD7A 2GFTA 4IPLA 4JKMA 4WIWA 4ACZA 4JFSA 1XC6A 1CLXA 3WDQA 3W6LA 5A6BD 2YKKA 5HDRA 1J11A 1ZBWA 2XIIA 3TTOA 2XTKA 3QGVA 1NH6A 1E3XA 7A3HA 3II1A 2BHYA 2DIEA 1GPFA 5A6KA 3AYRA 1D7FA 5D8WA 1VENA 2GJRA 2WC7A 3RO8A 2RGLA 1UA7A 4OBRA 1QPKA 3W0KA 1GQIA 4CVUA 5I0DA 1VBUA 2QF8A 3OG2A 4CN6A 4DWSC 3AZRA 3K8LA 4BQ5A 1MW0A 4F79A 3AMCA 3UR7A 3ARYA 3ARRA 3UG3A 1UWQA 4UFHA 1IT0A 5C70A 3F5KA 1IV8A 2XWEA 1CGUA 3N11A 1QNSA 3CHDA 3PTMA 4AMCA 1XH1A 3GZAA 1BSIA 5CPTA 3CZ8A 5CGMA 1G94A 3MV11 1E5JA 3AROA 3FN9A 3W26A 4GI8A 2VL4A 3WQ5A 1K9FA 2ESCA 3VPLA 2GSJA 4OBSA 1PX8A 4A3YA 4B3LA 3N18A 5E09A 1GZJA 5E6ZA 5EB8A 1E73M 3ARVA 5HPCA 3VVGA 1JZ7A 1E0XA 3CHEA 1E72M 1VBRA 3MUZ1 3DHUA 1CXFA 1Q6GA 2VX7A 1V0KA 2J7CA 4JIEA 4J3WA 3AS0A 2OYLA 4DWSB 3WENA 2WHKA 3WELA 4TX6A 2EO7A 1B9ZA 5DEZA 1V3JA 3FXYA 3VIFA 4UOQA 3N13A 4W8BA 1NQ6A 2J7EA 1ZBKA 1JXKA 3VX0A 4EKJA 1Q4NX 4MTVA 1HX0A 2EPKX 4H2CA 3SUVA 1SMAA 3SCWA 4JKLA 4AZIA 1L8NA 2ZWYA 3WEZA 3F5LA 1MFVA 2BS9A 2GDVA 3AIQA 2VRQA 2Y8VA 4ATWA 3VIJA 5E9AA 1UD4A 4NSBA 4E8DA 3MANA 1EIBA 2WKLA 4JHZA 2CBJA 1FHLA 3VOCA 4MNJA 2YBUA 2DSUA 3WQWA 1NWUA 3VD5A 1DWGM 2BFGA 3QHNA 1ZL1A 3I3DA 3AXIA 1EQPA 3BLPX 5BWFA 4Y7EA 3RM4A 3ZSTA 3W37A 1JL8A 1KGXA 1W9VA 1X1NA 1BG9A 4V28A 1E70M 1JIBA 1Y7VA 2BXZA 3BCFA 5HBFA 3VM5A 4CD4A 1E6XM 2CITA 3FAXA 4GZJA 2YL5A 1ODZA 5CXPA 4E8CA 5IHRA 2WMJA 2X0YA 1ISWA 1J9YA 1PX4A 4W88A 1GONA 1UWRA 5EFDA 3VILA 4CU8A 5ABEA 1KB3A 3B9DA 1WDRA 2XIBA 3B9EA 3T2PA 5EFFA 1QHZA 3OZPA 4AZGA 4PMVA 5AC4A 3CPUA 2BY2A 3M46A 1HKKA 1CXHA 3ECQA 2NT1A 2WMFA 4H8VA 3LPGA 3RJXA 1PIGA 1WNOA 4IISA 3EBVA 3AMDA 1H0GA 3GXFA 1PJ9A 2E9MA 2ZXBA 3VTRA 4BF7A 1HN1A 4HMDA 3A4XA 3MMUA 5CPSA 3OGRA 5JUVA 3AFBA 3BAIA 1SMDA 5GNZA 3ZT5A 2OYKA 4D1JA 4MB3A 1BF2A 4F9DA 4J28A 1E43A 4W7UA 3U7BA 1VJZA 1EO5A 2ZX9A 1LL6A 3TA9A 1E6PA 3A47A 3O2LA 5I23A 5ABFA 2EPOA 3VGDA 2PWEA 1E4IA 4D6DA 3W53A 3AHZA 2WK2A 4OZOA 1B0IA 3U5YA 1V0NA 5A95A 3WNOA 4MAVA 4CUCA 4U33A 1W91A 4UFMA 1QI3A 5M17A 4HZ8A 4PTXA 4W5UA 4AZ5A 3ARXA 2G8ZA 1I1WA 4AD3A 3TOPA 4OUEA 2UY3A 4FLOA 4UFIA 3WNNA 1PIFA 3WNKA 4M81A 3WL1A 1E9LA 3OLEA 4D6GA 1CGVA 1HL9A 4PTMA 3OLGA 2QMKA 3K4AA 3F4VA 3AJ7A 4PCSA 1JZ6A 1E4NA 4GPNA 1OCQA 3CZEA 4TUFA 2YL6A 2E0PA 3KL3A 5D8ZA 1W1TA 2WANA 2WMHA 4OIFA 5A8MA 4WSJA 2FH6A 2WPGA 3G6MA 5I6SA 4P8XA 1W3LA 3N9KA 1BFNA 2BVYA 1CXIA 1WAWA 1UKOA 1PZ3A 2J77A 2PBOA 2X2YA 4PUDA 1NM9A 1WO2A 2GDUA 1MVYA 1VFFA 4M80A 1J0HA 1UZ1A 2YJQA 3NIYA 1V6VA 2W63A 1XYZA 4URIA 5BXTA 2DT3A 2BNJA 1OIMA 1XSJA 4PMRA 3AHYA 4PMQA 3I3BA 2VJXA 2BVDA 1E6QM 1WB0A 4QCEA 5D9OA 3CH9A 1C8YA 4LX4A 3MMWA 2F8QA 3EYPA 4AZ6A 2CNCA 2D3NA 3M07A 3VIMA 3MSGA 2JE8A 3ZR6A 3LPPA 2J47A 1NP0A 3O6AA 1J0JA 3IAQA 4UFLA 1AQMA 3ARWA 3WFZA 1NOFA 1GVYA 1G5AA 1WP6A 4J3TA 4JCLA 4QDMA 1B31A 3U5UA 3OB8A 3WMBA 1C8QA 3ZO9A 1JDDA 1H0IA 1LG1A 2D0FA 4GIAA 3AHTA 3UESA 2AAAA 2VZTA 1TMQA 1V6WA 4UQ9A 4ZENA 5FD0A 2XVNA 1H09A 1QI5A 4S3JA 4HOZA 2BVTA 2PB1A 1H1NA 2A3HA 4HPGA 4FLQA 2FGZA 3NYDA 2CYGA 5HNNA 2BY3A 4AY1A 3BAJA 3BMWA 3MMDA 2XGBA 1B2YA 1UKQA 1ESWA 4DUXA 1V08A 2WZEA 1JNDA 2XWDA 3OLDA 3S6TA 1QNPA 4JZ5A 3M6DA 3BMVA 1W2VA 1KCKA 4D6CA 5EMYA 3KL0A 4P7NA 4UFJA 1KFWA 3SCNA 3UETA 1W9PA 4ACYA 3TONA 3ALFA 1NARA 4UNIA 2XUCA 3FHAA 3AQUA 2WXDM 3AZTA 1C7TA 4B16A 2NSXA 4UCFA 1WDQA 1WDPA 4J3VA 1QI0A 3TTSA 3MKKA 1W1YA 1JZ4A 1JD9A 2GJPA 3L2MA 2BY1A 2W66A 1E56A 2G41A 1ISZA 1ISYA 1MXGA 1GOQA 1UKTA 3ARTA 3WN6A 3BSGA 1HJQA 4PSRA 4K68A 5A8NA 2C8NA 1RH9A 5I78A 3ZJ7A 5JBFA 4ACZB 4BZYA 1TA3B 2ZX6A 1CXLA 1UR2A 1MQQA 4CKQA 3SURA 1HJXA 2D3LA 1V3IA 4AYSA 3CUGA 4QLLA 3ZOAA 1VEOA 3WH5A 3WD1A 1HKIA 1J0KA 3WD2A 4MPKA 3IJ8A 4JFTA 2D22A 1OD0A 5KZ6A 5A6AA 1EDGA 3VO0A 1HKJA 2J7BA 1OWQA 2ZUUA 4PMNA 3OGVA 1X6LA 1E0VA 2FGLA 1QW8A 1QNRA 2BY0A 5JBEA 4U5KA 1DWIM 1UQYA 1E6ZA 1UG6A 3N1AA 4A4AA 4CD7A 4BQ2A 2VX5A 4UR9A 3AS3A 1BAGA 2E4TA 1E55A 1M04A 3SCPA 5JIWA 4LYPA 1UR4A 4PMUA 1MFUA 2WMGA 1QBAA 3VINA 2CERA 1W9UA 4E4PA 3IJ7A 2UY4A 1QVBA 5A2AA 1J10A 3CLWA 1GCYA 1GJUA 1VEPA 2XYLA 2X0HA 1CECA 1KR1A 3PZMA 3WD0A 4P7OA 3VDCA 2J62A 4HZ6A 2DT2A 1UH2A 2JF6A 1MYRA 1QNOA 2DQXA 3SUWA 4YHGA 4Q22A 2Z1SA 2VT0A 1UWIA 1BLIA 2CIPA 1JZ8A 1YQ2A 3JUGA 3FAWA 3ZSSA 3W27A 3VKKA 2XSBA 1HNYA 1UA3A 3T0DA 2EPNA 3BAWA 5FCZA 3GTNA 1GVIA 2XJ7A 3CUIA 2EPLX 1QOXA 1MW1A 3A6OA 1KWKA 4CU6A 2ZXDA 3K8MA 3BAXA 4FK9A 5FL0A 1JFXA 4XZBA 4PMDA 1BYDA 4MB4A 4AIOA 1C92A 4HOXA 5A8QA 1DWHM 3PZIA 3AIVA 2WB5A 5DMYA 2XVLA 2AMGA 2O92A 2QHAA 5AYBA 5E6YA 3W24A 4Q7NA 3O9NA 1E4MM 1H5VA 1KBKA 1A3HA 1HP4A 3NSMA 4P8UA 1S46A 3WY1A 3BAKA 2WCSA 1QI4A 1E1FA 4HA3A 2QV4A 2V5CA 5DFAA 4U5IA 3MS8A 2WCAA 8A3HA 4C7DA 2WYSA 2OYMA 1CEOA 1JGIA 1KXTA 5DF0A 4DWSA 1QHOA 2CBUA 3PZUA 3TP4A 1KGWA 4JL1A 3PTQA 3WIJA 1HF6A 4Z2IA 2C0HA 1QHPA 9CGTA 3WQ4A 3WMCA 2E8ZA 3D3AA 4OOUA 5C71A 3PHAA 1J18A 2OLHA 5IDIA 2J78A 3AMLA 3HMCA 1JI2A 3W82A 4MB5A 1E71M 2V5DA 2QPSA 1K6AA 2E9LA 3ZMRA 5A6BA 2PBGA 3EMZA 1E40A 1NOUA 4V27A 1MQPA 6CGTA 3BH4A 1RP8A 3ALGA 1UD8A 2VZOA 4HMEA 4HMCA 1GHRA 1ZJBA 1XV8A 4H8HA 1JAKA 3SUUA 1Z32X 4AZCA 1CLVA 7TAAA 4AEFA 4TTUA 4XZWA 1PX3A 3I3EA 4F8XA 2GJXA 4N42A 1OINA 4NRSA 4PTVA 3MUAA 3K1DA 1MWOA 4W87A 2GUYA 4P7QA 5C8BB 3CMJA 3PZOA 2Y2WA 1EOKA 1B3YA 1C91A 5D9NA 2WMIA 1DP0A 1KXVA 3CUJA 2E8YA 5A6MA 4UTFA 5HOSA 1TVPA 2WHLA 3W28A 1UZ4A 2WNWA 4D72A 1EHNA 4B3KA 4GQQA 4CVWA 5FKYA 4QAWA 5A1AA 1DTUA 4KRUA 1JF6A 3RIKA 4AC1X 1RD6A 1VF8A 3A3HA 1OGBA 1WPCA 2O9TA 2J75A 4D6HA 3EDDA 3L4WA 3TTYA 5CG0A 3WDJA 2V38A 1EOMA 3POHA 1V0MA 2G4FA 2UWFA 4TXEA 1FOBA 4DUVA 3NDYA 1KBBA 2ZUVA 1JNEA 3WQ6A 4J3SA 5EBAA 1LL7A 3BAYA 2WWDA 3A4AA 1V0LA 3T09A 2XG9A 2PWHA 5BXRA 2IXUA 2W92A 3ARPA 3D5HA 4HA1A 1VEMA 4GXPA 4UOJA 2X05A 4DM1A 1CGYA 3IK2A 3ARQA 3NDZA 3SIMA 4ZE4A 5A2CA 5IFPA 1CGXA 1SFSA 3WFLA 4M24A 2CXGA 3CIVA 3MUIA 1KWGA 1M01A 1FP9A 4IPNB 2D0GA 2VX6A 3W81A 1BGAA 3E1F1 2PWDA 2D24A 1DWJM 4FMVA 1GHSA 4X0NA 4WLCA 1VJSA 1OM0A 1R7AA 2B31A 1E4LA 3WQ8A 1JZ3A 3VIOA 2GJXB 2DEPA 3LPOA 3CHCA 3OZOA 4NZCA 3K4DA 4PBGA 4WJXA 1BYCA 1WE5A 2VC9A 5AY7A 4WF7A 1R85A 2ZX7A 1U33A 1MW2A 2A3BA 4MNLA 4ZXLA 4PTWA 3VMNA 1GOMA 2WVUA 4TX8A 3VIGA 2VX4A 1UD2A 1EA9C 4Z2LA 3RJYA 3QHMA 3FHQA 1NWTA 4AW7A 1UR1A 1KQYA 5CGTA 3RMEA 1UH4A 3BSHA 1M03A 3WQVA 4CN4A 4PMYA 1XCXA 2YL9A 4QLKA 3RM9A 2X8RA 1JZ2A 4XX6A 3GXIA 2VUYA 5I3DA 3SCOA 1XYFA 4L4PA 2XGIA 3FNDA 3WDHA 1RPKA 2G3JA 3N15A 4RE3A 2G3MA 5AYIA 4AIUA 5A94A 1HP5A 2V3EA 1Q6CA 1TZ7A 1H49A 2ZE0A 2CBIA 1Q6DA 3PBGA 3VD4A 3VX1A 1E15A 3PN8A 4CGTA 3RILA 1FH9A 2JIWA 1DWAM 5LA1A 2WVTA 4UQBA 1UQZA 2RGMA 1GOKA 1HL8A 3MV01 1JFHA 3AISA 1XH2A 2Y4SA 4UQCA 3WUFA 2ZIDA 4W5ZA 2WLYA 4CCEA 1UWTA 6A3HA 1CYGA 2J7GA 2YIHA 4UFKA 1GQJA 1BHGA 1FFRA 1B90A 1W1VA 4H7VA 1V02E 1G01A 2DT0A 2YDRA 2Y8KA 4GI6A 3SCSA 1JYVA 5HXMA 3NCOA 2YLAA 1WZMA 4CN1A 1CXEA 3DYOA 3QHOA 4ML4A 2CPUA 4LPCA 3T2OA 5DT5A 3DC0A 2FHCA 2ZUSA 2D23A 2YA0A 1M53A 2XFRA 2W67A 3N17A 4N0RA 4KMQA 3K8KA 3KEHA 3L4VA 4W8LA 2ZWZA 3PZVA 2WC4A 3T0BA 2JEQA 4M1RA 5IHSA 5IXEA 2A3AA 1ZS2A 4AD0A 1XHGA 1OIFA 4M56A 1R86A 2VZSA 2HISA 1LLOA 2BV9A 3UCQA 3CBWA 3ZQ9A 1UH3A 3EMCA 1E6NA 4AD1A 1CXKA 1TFVA 4P7LA 2D2OA 4OJYA 1WZAA 3PZ9A 2OSXA 3WD4A 1A47A 3CZKA 1ZU8A 2WBGA 1LWJA 2F2HA 1Q6FA 2VCCA 5E0CA 4W84A 1D2KA 3A4WA 1DWFM 3FY1A 1OBAA 5I79A 5BROA 1CIUA 3GNOA 2CEQA 2OWWA 4LYRA 2V3GA 2YLLA 5D9MA 3L4TA 4NI3A 1HKMA 5A6SA 1ODUA 3DHPA 3T0AA 1LF1A 1N82A 1UKPA 4MB1A 1XSIA 4D6JA 3VGBA 3L4XA 4GI9A 4JAWA 3AICA 3UG4A 2ZUMA 4BQ3A 2EJ1A 1TUXA 1GQKA 4M8UA 2XPKA 1GOOA 2FDMA 2VVSA 4UQAA 3SUSA 4J3UA 1UD3A 3U7VA 1W3JA 1UD6A 3QOKA 1E6SM 2UY5A 3WSUA 2DSKA 3L4UA 3APGA 3SCTA 1GNXA 1HJWA 2E3ZA 4WSKA 4AEEA 5A6JA 1FFQA 1NWRA 4GO8A 3AYSA 4MNMA 3M7SA 3AIUA 4OOZA 1OGGA 2J74A 1B1YA 1ITXA 3WD3A 4LXFA 4CCCA 2WAGA 4F66A 1UD5A 1J0YA 1XCWA 3RPMA 1RP9A 3W25A 1E5NA 4H41A 2QPUA 4MNKA 3VGHA 3ZIZA 5E0FA 3VIKA 3BC9A 3BCDA 5A2BA 3QOMA 1VAHA 1O6IA 3AI0A 2EPMX 4B9YA 1LJYA 4OKDA 3SCVA 4U2ZA 2XHYA 2CBVA 4UZSA 3L4YA 3WL0A 4Z2HA 1QBBA 4W7WA 4D6IA 4B9ZA 4NF7A 3GH5A 1W2PA 3ZR5A 5AC5A 4UOZA 3OIHA 1H3GA 4W85A 1E0WA 4GZEA 6TAAA 1K9EA 1AQHA 1R7OA 2W4XA 4GKLA 1V03A 4X0VA 1J0ZA 3CZGA 4F9JA 3WKZA 3WF2A 5D9PA 1AMYA 1LWHA 4PUEA 3VIHA 3BXWA 4ZXOA 3CGTA 4MJ4A 3SCUA 3NJ3A 2JALA
chains in the Genus database with same CATH superfamily
4Y90A 3STPA 2VGBA 3B0UX 5H8PA 1EKOA 3MWAA 2VO5A 2P8CA 4MFEA 1ZP4A 1P6WA 2XVGA 3E02A 5D32A 1LOLA 2F61A 3EB4A 4KCTA 2G96A 2WC3A 1MEIA 4KRZA 2JEPA 4MDPA 4QDPA 1YNQA 3D3FA 2PWUA 4WUIA 2X09A 4H7ZA 1SW7A 1AVAA 1DIEA 5CKSA 3NSNA 2BMBA 2WMKA 3QSRA 1OD8A 2PP3A 3DKLA 3ZJ6A 2RAGA 1G1YA 4I5RA 3AHXA 3P62A 2EEXA 4HTYA 1B3VA 3ITOA 1K6WA 3IVTA 4GUIA 2GK1A 1HVQA 3KVKA 2CLFA 4XK2A 2GQ8A 5ABGA 2GVGA 3LCGA 3RK8A 1L6FA 4EPDC 3IJDA 4BF9A 1ZLPA 5C2GA 4WVXA 2ZOXA 5LA2A 2IW0A 3P67A 1M5WA 1RK6A 3GH4A 2H90A 4LFYA 5D4YA 3POCA 2Z6IA 3CIXA 1TMLA 2QV5A 3GHTA 3WF0A 3IGSA 3FYYA 4GA8A 5CLTA 1F05A 1M1BA 4DM2A 2I56A 3GTHA 4IJCA 5T9CE 4Z2KA 3BW3A 2Z2UA 3EA1A 2PMQA 3AIRA 2XGZA 1OGSA 3OHMB 3GVRA 1G0CA 3PP7A 3KS6A 2V5BA 1XLAA 3BJTA 4FEZA 4P8VA 1SZNA 3VDAA 4WXYA 4D6FA 3MMTA 4EWND 2ZC8A 2VCAA 4JL2A 3RXZA 1WKYA 3UXLA 3U57A 8XIAA 1W17A 2NQLA 2HVOA 4DPQA 2PC8A 5CZTA 1S2VA 3XISA 2Z1WA 4Y9MA 1UJPA 3AXKA 3COTA 4H9XA 3CAQA 3GG7A 1IGWA 1Q6EA 4M82A 3SY1A 2VWSA 2EG7A 3LXBA 4DYJA 4CQ8A 2QDGA 1H41A 3UJEA 4C91A 3I4KA 5I77A 1CX9A 4BEQA 3PM6A 4HIBA 3PTDA 3CUHA 4I9JA 2KX9A 4XTDA 3G1VA 4Y9OA 2AOSA 3N2BA 4TX9A 3B97A 5CQ1A 2ZFAA 4JX5A 3EDKA 3WNLA 3ZFHA 1C93A 3VNYA 1FWIC 3VMPA 3W2NA 2HPIA 2WW5A 1J0IA 2CETA 2JGQA 1C7SA 4JHMA 4FHAA 2VQTA 4OU1A 5LIXX 3WH8A 3H26A 4ZTXA 4A3RA 3ES8A 4GACA 1TV3A 4TV5A 1VFOA 1HVXA 4LUYA 3P0WA 3L67A 3T8QA 2W5FA 3B40A 3DYMA 3ES7A 5AN7A 4RE2A 4AX7A 3P81A 3QKZA 2VD9A 2CHNA 3WF3A 2E6FA 4LANA 3QMRA 5FEZA 4L4LA 4B5TA 1M41A 1EX5A 5CSYA 1JI1A 3A23A 1H63A 3VIPA 1ZGDA 3MSRA 3EDFA 4FI4A 5FJJA 1EJTC 4RZBA 2C0AA 3OOQA 5TBOA 4NHVA 1V3HA 1TVNA 2GGEA 3NSXA 1F6YA 4D6EA 1QASA 3ATZA 4OV4A 4G9PA 1FKXA 3WEMA 2VDGA 4AFYA 1R9XA 1QAPA 4ATDA 1EDQA 3NQCA 4CCDA 5BXSA 5KEZA 3HGJA 1ITCA 1EXPA 2BOFX 3HU7A 4NAEA 4ZOBA 4IQDA 1R87A 3VU2A 2QUTA 1LROA 3TFXA 4ES4A 3MCNA 4MG4A 1OZQA 1P0BA 3ZR4A 4Z1CA 1OVDA 3SGUA 2QJGA 4D2JA 3R8RA 4PA8A 3VFCA 4HKPA 1KM1A 3M0LA 5I3KA 1UR9A 1MSSA 3L0GA 1TWDA 4MJ2A 1UPMB 1WDSA 3T0TA 2W62A 1HUVA 3GDRA 3OLIA 3STEA 5GPRA 4MZYA 7CGTA 3WF1A 3N2MA 2CKSA 3YPIA 2XFFA 2G3NA 4WK9A 1EGZA 2VR5A 4XBSA 1HJUA 4K1GA 3A22A 4LS0A 4ROPA 1O4UA 2I14A 1NQKA 1XLLA 3GDBA 1YKWA 2GDQA 3EXSA 1YE4A 3DXIA 1X96A 1XINA 5JIPA 1AL7A 4WJEA 3UGVA 3WQOA 3TSDA 3UNTA 1GQLA 3MO7A 5FF3A 3QV6A 2V2HA 3OTRA 1OZMA 2GVYA 3RM8A 1M7PA 2JGYA 2ZADA 5FOOA 4N6EA 2DH2A 2WZIA 5G1YA 2WBKA 2YFOA 1ZJAA 2QCFA 3C2RA 4RE0A 4UZUA 2HBXA 3GVWA 4L9XA 3ABSA 3W4RA 1I75A 3GNDA 3N34A 2WHJA 1JDCA 4ZEPA 2AKZA 3IUHA 4FZIA 5I2UA 2JKAA 2R14A 2ODOA 4PODA 3NO5A 4YIWA 1EH9A 2FMOA 2ABBA 3BLOA 4UWMA 1H51A 5I24A 1ME7A 2FVMA 3VMOA 4EVZA 5CPQA 3E2VA 3SRKA 1XRVA 3MDWA 4B5XA 2PU1A 1YPFA 4UC5A 3HN3A 4GUJA 4LH8A 2QJIA 5I3FA 4Z2JA 3CC1A 1OJXA 4ML9A 1XRSA 4R27A 3M6YA 1OT1A 5TAOA 3S42A 3MBFA 3K13A 3TYCA 4JBRA 2GZXA 3A5FA 3ITYA 1F4HA 2PWFA 4R3UA 4QDWA 1TE6A 5GVJA 2VGGA 4BWLC 1FX6A 2PLCA 2VGFA 3HIJA 1JAEA 4WHBA 3ARSA 2A7RA 1LBMA 4LQ1A 3QW4B 2ZRVA 4DX3A 4WX2A 1WCGA 5GQBA 1S5VA 3W72A 3PK7A 4H9UA 3BLKA 2J4GA 1XBVA 4JY8A 3IANA 4PYSA 5FF0A 3P0XA 3C0JA 4A2SA 1KNWA 3WLJA 3H4XA 4RZ4A 5AZ0A 4H7CA 3T2QA 3EPNA 5T26A 4AD4A 3EOUA 4ERAA 3QY6A 3GW3A 4JFVA 1OB0A 1W9DM 1QPRA 1DIOA 3C5QA 3HB9A 2HPMA 4GVHA 1JULA 3B9AA 3MC5A 3VA8A 2VHLA 1I4NA 3U9IA 4YVXA 4TMCA 5HWMA 1BKSA 4LUIA 3W9ZA 4DLFA 3DBPA 4LYKA 4M6UA 2ACSA 3ARUA 4LGXA 4XUYA 4AY8A 3ATYA 3L23A 3TV8A 1PCWA 1LL4A 1NOWA 3T44A 2EBNA 3W71A 1JGMA 2O4QA 4DLMA 4EOUA 2INEA 3VDGA 1F3EA 3VZYA 4LAMA 1WDWA 1U22A 1E3ZA 3GR4A 2PI6A 2IKIA 1RQBA 2OX1A 4J2MA 4PTNA 1HJSA 2XFWA 4BQ4A 2ZE3A 1JYNA 1EC7A 1HIZA 1Z3NA 1QNQA 3GHSA 5LYRA 1TREA 4XZLX 1EP1A 3WYZA 3RFAA 5EMUA 1TCDA 3UERA 3D46A 1EGMA 3CO4A 1XBXA 4Z17A 4N9DA 3RPDA 2QAPA 1A0DA 3GVQA 3FXGA 4GOAA 1H2JA 1ISXA 2IQ0A 3W1TA 4JNZA 4IQJA 3V5OA 2GFTA 4JKMA 4JFSA 5CJNA 5DY3A 1CLXA 4H6RA 5FF4A 1MEHA 1WA3A 3IACA 1T41A 5A6BD 4OE7A 3LNPA 1IWAA 2OXNA 4GVGA 5EBUA 3CAKA 1ZBWA 1EFZA 4UB9A 1QOPA 2XTKA 3FDKA 3QGVA 5E9XA 2XDFA 1F6PA 4CEXC 3HFYA 3EWBX 2PEVA 4DZAA 3LCWA 3H55A 3AYRA 2OQYA 1TV4A 2RGLA 4PUKA 2V6AA 2V81A 4E2BA 1AJ2A 3N6QA 5HMFA 4CVUA 1A0CA 1IT7A 4IIDA 3I65A 3H12A 4BQ5A 4F79A 4LU0A 4C5ZA 3UR7A 3ARYA 1KFCA 3UG3A 4UFHA 3NNTA 2QF7A 2QJJA 2HWGA 5C70A 2W3ZA 3NZGA 3MDUA 2XWEA 2NXGA 2XZ9A 3DX5A 4AMCA 3L68A 4YNGA 3VOJA 2Y7DA 1OABA 3MT1A 3P5ZA 2VL4A 1L6GA 3WQ5A 2ESCA 1KTBA 2J8TA 2NX9A 4B3LA 5E09A 1GZJA 5MKGB 3KVMA 3S5OA 4KF1A 2ICSA 4KCVA 2PDWA 5EB8A 5HPCA 1E0XA 4QROA 1CXFA 4KEZA 4C5YA 1V0KA 2EPHA 3TN3A 2QGYA 1L9WA 4JIEA 3WENA 1VCGA 4O28A 3AYVA 3VIFA 3WBWA 4DRSA 1A50A 5AB3A 4IFKA 3VX0A 2QIWA 3QQ1A 3BO9A 1HX0A 2QKFA 4REQA 4CNUA 3LB0A 1RD5A 4FIRA 4JQAA 3NG3A 3AIQA 2VRQA 3V1PA 1TV5A 1XFCA 4NZ3A 5E9AA 1I6NA 2QGHA 4E8DA 3MANA 1EIBA 3BV7A 1KO0A 1FHLA 5K3VA 4GIYA 3GE7A 1Z44A 1TTQA 3BLFA 2RDUA 4RV3A 5CZSA 3MHGA 5BWFA 3BLPX 4IMDA 3OU8A 3EWUA 1JL8A 1W9VA 4A29A 1VR6A 3GYEA 1VFHA 2BXZA 5BW6A 3T8LA 1JQVA 4CD4A 4QS6A 1E6XM 4GZJA 1DJHA 2VEFA 2WMJA 1ISWA 4W88A 3VILA 1KB3A 4C6JA 4C6MA 4DYEA 1WDRA 1XLFA 5PTDA 4B3ZA 1OX5A 2XIBA 3T2PA 4B5SA 1QHZA 3CPUA 2PDPA 2X2GA 3TNOA 1CXHA 3ECQA 3S6DA 2WMFA 2V63A 1A53A 1GKPA 3O05A 4IX0A 4JTTA 4Z08A 2ONEA 3GXFA 1PJ9A 2ZXBA 4HMDA 3A4XA 5CPSA 3OGRA 1MDLA 4US6A 4ICMA 1QATA 2ZZ1A 3LHUA 3F2CA 2FJUB 1SR9A 4R9OA 1YTKA 3QLDA 3SSJA 4JY9A 1W1IE 3D0CA 4IT1A 1LUCB 4LC8A 1E4IA 1K1DA 1XX1A 1I2PA 3T9PA 4IIBA 4LEQA 4D6DA 2BWGA 3W53A 1PCKA 2WK2A 4OZOA 1VC4A 4FNQA 1B0IA 3I6RA 2XSXA 3WNOA 4CUCA 1WXZA 3DFQA 4DAFA 3EKLA 2DUZA 3DZ1A 4HZ8A 1XKJA 1TPDA 4NZFA 4AD3A 1V79A 1W1B1 3TOPA 4OUEA 2UY3A 4FNPA 3OQEA 1PIFA 4M81A 3WL1A 1TTIA 4D6GA 4DO4A 3OLGA 2ZZ5A 4UXDA 3AJ7A 4PCSA 1GT8A 3CZEA 1KBLA 5D8ZA 1CB7B 4JX4A 4Q8NA 1SQ7A 4H01A 2FYMA 4G1NA 4P8XA 1R3WA 3ABQA 3WMLA 1TWIA 2TODA 2X2YA 4MJZA 3HPSA 2F7FA 1VFFA 1G4EA 4M80A 3UZXA 7PTDA 3JRKA 3N14A 5ECVA 2DT3A 4QQUA 4J4KA 3UWUA 3C0SA 2BVDA 1E6QM 2C14A 3CH9A 1KRBC 2PP1A 5K2ZA 1C8YA 2JE8A 3LPPA 2C18A 4FOKA 4PRRA 3FFSA 1SO3A 2Y0FA 3IAQA 1SZRA 1NOFA 4QR6A 3UXIA 1ZALA 4O0QA 4JOMA 1PHWA 3KXQA 2EG6A 4ZO9A 4GIAA 3IGUA 4E2VA 3AHTA 2XIOA 4KWOA 2VZTA 3KRZA 1EC8A 2E6AA 1F9CA 1U5HA 4XTIA 4B2DD 4HNVA 1P6CA 3GC5A 3GXPA 5HUPA 3BMWA 4XBJA 3WLTA 1UKQA 5I07A 4DUXA 1V08A 2WZEA 2E5CA 1EJWC 1OYAA 3S6TA 4Q6JA 4JZ5A 1JUKA 1H1YA 5E0KA 3R94A 3BMVA 3MI3A 1W2VA 1DL3A 1PWMA 4P7NA 3TN6A 3EWCA 3SCNA 4FALA 3QSTA 1B4KA 4DZHA 4XD6A 1S5NA 4B16A 3S9IA 4R34A 3A9IA 5IBXA 5JXQA 4J3VA 1S3HA 3WLSA 1W1YA 2GUUA 3TYAA 1AQFA 1TPFA 2RH9A 3GD6A 1IWBA 3BQ5A 3UU0A 2BY1A 3EKGA 5G2WA 1GOQA 4ZQRA 3RO6A 3WN6A 2ZDSA 1HJQA 1UBPC 4PUMA 1RH9A 3LNMA 4KEVA 4AHOA 2PU0A 2FIQA 1TA3B 3RLVA 2ZRYA 1GTHA 2J66A 4IUOA 2GSEA 2ZX6A 4J2PA 3PS7A 5LXXA 5LNVA 2QCLA 4FNUA 3ZOAA 1VEOA 2VYOA 4XAPA 2E77A 1L8PA 3BARA 1OD0A 5KZ6A 3G1DA 5A6AA 1EDGA 1HKJA 1OWQA 2ZUUA 4KESA 3OGVA 4UMAA 4WD0A 3PJXA 1EB3A 4H19A 3DERA 4K2SA 2CLIA 5HUOA 1QW8A 3ABZA 3Q94A 1E6ZA 3SADA 3LBOA 4CD7A 1Q63A 2IPJA 4JTJA 4UR9A 2CU0A 2V69A 5LNUA 3TN5A 1M04A 3SCPA 4LYPA 3MJYA 2QS8A 3IJ7A 2UY4A 1AH3A 5A2AA 2Y85A 4B5WA 1VYRA 5D33A 1CECA 2EHHA 1A80A 2J62A 1UH2A 4RDVA 4YHGA 2FB2A 2ISWA 2NUXA 4Q22A 4POCA 1OX4B 2AQOA 2DY3A 1YQ2A 3JUGA 4HB7A 1VPXA 3ZSSA 3W27A 2FTPA 3ZLGA 1UUOA 1TJPA 2ZDRA 3B05A 2EPNA 3BAWA 2ZRXA 3DC8A 3P3BA 3R0DA 3W7HA 2WOQA 1QOXA 3C2EA 2ABAA 3HMJG 5EU9A 3I7QA 5CBBA 2CLMA 4RDYA 3K8MA 2W0UA 2YBVA 3BAXA 1JFXA 4XZBA 2WV8A 1I2QA 4XD4A 1K77A 4O1DA 1TPH1 5A8QA 3PZIA 5C0QA 3KHJA 2QZRA 2WB5A 3V0UA 5DMYA 2QHAA 3NOYA 3PPCA 3O9NA 1E4MM 4MMWA 3LCFA 4LW7A 1DJWA 1RBOB 2AGTA 4ZVJA 1FCUA 1NU5A 2B81A 4P8UA 1S46A 3OEXA 3WY1A 2WCSA 1QI4A 4I90A 2GYIA 2QV4A 5DFAA 4U5IA 3GDLA 3MS8A 3KRBA 2WNNA 4J5NA 3DH7A 3UD6A 1JGIA 1A4MA 1QHOA 2IS7A 4A8IA 3PZUA 3TP4A 3RN6A 3HGOA 3D6NA 2YB4A 1FCVA 3G0UA 4H2HA 3WMCA 3CV6A 3TEVA 1DJXA 3MCOA 1FDJA 1Y5WA 5REQB 4B5NA 3PHAA 5L9FA 3TZNA 3QJAA 1QR7A 1GEHA 4RZ5A 4QG9A 3EB2A 1W3TA 3CQIA 4MF4A 4Z0SA 3E38A 1E71M 2QPSA 1K6AA 1J96A 2PBGA 3BW4A 1YBQA 1MQPA 1BXBA 4B5UA 1VJIA 3E0VA 4O15A 3UCDA 1ZJBA 1S2CA 1CLVA 7TAAA 1DBTA 2E7FA 3ELFA 3I3EA 2GJXA 5D02A 5H8UA 3I6EA 3VC5A 2DJXA 2OMAA 4RKAA 2OEMA 4IIGA 4A05A 2PDFA 1YADA 3CMJA 4IP7A 3PPHA 2WMIA 1DP0A 1KXVA 3IV8A 4M3PA 2Q8LA 2E8YA 4UTFA 3OBKA 4BR1A 4H00A 3PWIA 5RUBA 3RX2A 2P76A 4X60A 5FKYA 1Q2SA 1RQHA 3R0KA 3BCJA 4XZHA 1L2QA 1VF8A 1POJA 1WPCA 2J75A 5LGXA 1SZFA 2RHGA 3H2FA 3TTYA 1IR2A 5CG0A 1V7AA 3WDJA 3OVQA 3POHA 4PB4A 3W73A 4YTTA 2CZVA 1FXQA 3LCXA 3L21A 1PDYA 2Z26A 3FEQA 3I6TA 1DJIA 3DIPA 4QEHA 5HK4A 3VABA 2EAWA 2RJGA 3L7RA 1V0LA 1VFLA 2IXUA 3DG7A 4UOJA 4XSLA 4DM1A 2PTYA 4ZE4A 5A2CA 5C55A 5IFPA 3RLUA 2P88A 1DXEA 2ISDA 4EPBC 3MW7A 4HYWA 3EX4A 2D0GA 2D24A 1KM4A 1XCFA 4FMVA 3U2OA 3W7GA 3E5BA 1W5OA 5I3HA 4BWLA 1OFOA 4FA3A 4JTHA 4WLCA 1OM0A 3H23A 3VIOA 4AWUA 3LPOA 3CHCA 4NZCA 2VC9A 5A8GA 5C9RA 3PNUA 1R85A 5LIUX 2ZX7A 1U33A 1MW2A 2RJHA 4WDXA 3VMNA 4CNOA 5BOEA 5CSRA 2VX4A 1QU4A 3KUMA 3RJYA 3QHMA 4GC3A 4AW7A 3GKAA 1UR1A 1KQYA 5CGTA 1UH4A 4NT0A 4IL2A 4RNJA 4PMYA 5HJYA 3ONCA 3RM9A 1IXQA 4E3VA 4M7TA 5BNKA 1XPYA 5IDZA 3M4HA 3MTWA 1JDFA 1Q5MA 2REQA 4A8RA 1AFSA 4RE3A 1J2WA 1HP5A 2V3EA 4NVTA 1JUBA 4S38A 3VKJA 2ZTKA 2ZZ7A 1TMHA 3PBGA 2ZTJA 2Y1HA 3N73A 5HNTA 5C9WA 2DORA 1G69A 1FTXA 3UYIA 1UQZA 2RGMA 3M0XA 4MY8A 4UTHA 3UR2A 3PBYA 2X40A 1QOQA 1S3TC 3SN4A 1XDJA 3MV01 3G18A 2Z1BA 4UQCA 3R13A 2YFNA 4AAJA 4IPIA 6A3HA 4UFKA 2OTDA 1GQJA 5IOBA 4JX6A 2V0TA 1XG3A 4H7VA 3I4EA 1G01A 2DT0A 3M0MA 3HM7A 4KS0A 2GQ9A 3OO2A 4OHQA 5C7VA 1J8VA 1Z42A 5E1QA 3G1RA 3IJ6A 3KZPA 1K8XA 1MO0A 2ZUSA 4ROQA 4MM1A 3P7YA 1HO4A 3GX9A 2ZZ3A 4L6HA 5H6HA 2W67A 2C91A 1VP5A 3N17A 3KEHA 3L4VA 1V5XA 2ZWZA 1SSGA 4M1RA 5IXEA 5FJRA 4KBXA 5HQEA 1PKLA 4M56A 4C6OA 2VZSA 1MNSA 3KBSA 2BV9A 3WK1A 3UCQA 3ZQ9A 1UH3A 4QRNA 4NYUA 3EMCA 3JZUA 1E6NA 3FS2A 1TFVA 3UJFA 2AKMA 5I3IA 3WD4A 2OSXA 3NL3A 1UUMA 4HJWA 4ZL1A 3MP5A 2WBGA 5D2WA 4PULA 3T6CA 3AUJA 3ITVA 4DJFD 4I7WA 4JYDA 2PGRA 1ZQ5A 3TJXA 1U1UA 3BE7A 4LYRA 3LQGA 5D9MA 3L4TA 4GX8A 3DEQA 5HWJA 2GQAA 2FZ8A 2I1OA 2I7GA 1UKPA 4MB1A 1XSIA 3TAOA 4D6JA 3V0SA 4GI9A 1YMYA 5HULA 1T7LA 3IEBA 4N9CA 4BQ3A 1TUXA 2V5JA 4M8UA 2XPKA 3STCA 1KM5A 3MKVA 1OYCA 4J3UA 1TPB1 1E6SM 1C9WA 1UR3M 2DSKA 3L4UA 2JKEA 3BICA 3FGCA 3RITA 1L2UA 1HJWA 3T4CA 1EF2A 2Q02A 3VOFA 2YB1A 3AIUA 3FK4A 1K7XA 1V51A 3NQMA 4QGCA 3WD3A 1WXJA 4AEOA 4UCGA 1UD5A 1J0YA 4FB7A 3R79A 3GWQA 2QPUA 3VGHA 3ZIZA 1OCJA 4L6DA 2ZA1A 4WRHA 3LXAA 5A2BA 4JTQA 1VAHA 3AI0A 4QG6A 2EPMX 1XLEA 3AXMA 3F7JA 1ALDA 3SRDA 3KHDA 2CBVA 3S6OA 3L4YA 2ATMA 5AC5A 4UOZA 3UWZA 5BRBA 3OIHA 3NTYA 4RV8A 5AHEA 3MQTA 4ZGYA 1R7OA 4E2DA 3W7MA 3STFA 1V03A 1UP0A 3U2CA 4F9JA 3WKZA 3WF2A 4G7EB 4IPJA 3C86A 2NV9A 3DAQA 3NJ3A 1KFJA 2PDYA 4XV0A 4R7JA 4F2TA 3GXMA 4FS9A 3FA4A 2WM0A 2QJMA 4PCPA 3IVSA 4LUTA 4DF0A 3DG3A 4D8ZA 3B8DA 1X6UA 1Q45A 4L1XA 2BLEA 2REQB 3SW6A 4L1WA 5LA0A 1V6XA 3DUGA 1VFUA 4FP1A 2PRMA 3ITTA 4ADUA 2ZUTA 3R8GA 1TRDA 1Q6LA 2Y7GA 3VM7A 4RL3A 2YCIX 3NQDA 3T42A 2E40A 4JKKA 3SGZA 3NQBA 3FSTA 4YN5A 1EA0A 2OT1A 1UWUA 4ZSUA 1GOXA 3UG5A 3APTA 4BY3A 3MSDA 3HQOA 5IFTA 2A3EA 2V2CA 1PZ0A 1U2YA 4JDBA 4TTGA 1B3ZA 4UQDA 3UEQA 4W93A 5DXXA 3SEPA 3FIGA 3N4AA 3WLRA 5CLWA 1SFTA 3B0VC 1QXLA 3B0XA 3TNBA 3ORWA 1S1RA 4HSHA 3DECA 3N19B 5DRIA 4C6QA 5BRPA 4DWDA 2YA2A 1XSKA 2FHBA 2FZBA 1JZ5A 4LV9A 2JIEA 2VCBA 4J9JA 2MANA 2PDKA 1DORA 1XRFA 4GYPC 5I03A 1V02A 2YW4A 3QZEA 1GYMA 3F5JA 1BKHA 1V6TA 1EYEA 4J27A 4LF2A 5HJLA 3TIMA 1SZEA 2QT3A 1E1EA 4XAYA 2PUZA 2G3FA 1Q13A 3VGFA 3TW7A 5HPOA 1OEPA 1FH7A 3WDRA 1Q66A 5CC5A 4XG1A 3A13A 2PFHA 4IJRA 1HQTA 4BS0A 3E96A 4N2YA 4HCLA 3W29A 4QCFA 2G97A 3SQSA 2Z4GA 3LS9A 3P74A 3AXHA 5FIPA 3DYPA 4TVDA 3W1MA 1SFLA 4US5A 4KQNA 2DT1A 2CZ5A 2OQLA 4JFUA 4HP5A 4I9AA 1KXQA 3B8TA 4YLWA 3ZT6A 3B9NA 1LRTA 1TWZA 1D9EA 2Q71A 4O50A 2V3DA 3NAVA 4EK7A 2WZMA 1TZ9A 3BK0A 4O14A 4QSFA 4HPHA 5M3WA 2VGIA 3LPFA 4NU7A 4U3AA 3G0XA 1P0DA 1RHCA 1O5RA 3GYCA 4Y2WA 9XIMA 3VGEA 3PZQA 4EP8C 3A4JA 1VIWA 2UV8G 2ZA3A 2EGZA 4QS5A 3KDOA 1H11A 3EXTA 3S2CA 3CV2A 3TYBA 3V16A 1PYMA 5GNYA 4W86A 3VUPA 1SJBA 1B30A 1F76A 4IOTA 4HPXA 5DT7A 4AXNA 1W32A 2DIJA 3KDNA 1FDYA 3MB9A 1KQZA 3M0IA 1KR0A 2XH4A 1R46A 4D8AA 1VQTA 7ODCA 5H2ZA 4DXKA 1DQXA 2VZVA 3VCCA 1VB9A 4JTGA 1YEYA 2O9OA 4GCAA 4DBWA 1ZBCA 2Z27A 4DXXA 3N3TA 1EJRC 4H04A 2XZ7A 2J7HA 1ISVA 2XISA 2D1ZA 1GJWA 2I5QA 2PPGA 1EHAA 4S3FA 4ZCWA 3C4UA 1SPQA 1PEZA 1Y5XA 3N29A 4PTDA 3RX4A 8XIMA 3LUTA 2CESA 4S39A 3G1AA 3KWXA 2HTMA 1AQ0A 4MPQA 5ABHA 5A8PA 4H83A 3W1QA 2HZGA 1H7WA 3PTKA 3HGRA 2Z2BA 1FWNA 1AD4A 2O9PA 2P50A 4C6IA 2BXYA 5HWNA 4GIRA 3C3NA 1PTAA 4HU0A 4K7VA 3LTSA 3GK0A 2PDLA 2WVSA 1JYXA 3EDJA 1VHCA 3PC0A 5MF5A 4HOWA 1EXBA 4K8EA 2VFIA 3QR3A 2NUWA 5FSEC 3TQKA 3WBAA 2AAMA 1FP8A 2NW0A 1RLCL 1TPEA 3IIZA 2JF7A 3OBAA 4O1BA 2VEMA 2FHFA 3ARZA 4Q4KA 2NUYA 1LLZA 1XL9A 4GNVA 4F2UA 3GU1A 3RCNA 3GFZA 2Q8ZA 5A6LA 1EDTA 3P61A 1GPWA 3WUGA 1WOAA 3B4YA 1OQFA 4LAZA 2H3BA 3G8EA 5EMJA 5DX7A 3VNMA 4KCUA 2YCLA 4CD5A 1F8IA 1VFSA 2J8GA 3L4ZA 2BG5A 5HINA 3DESA 4ZOAA 3QM3A 4GH1A 2PDJA 3LZ3A 4KW2A 1UWAA 4XBKA 2VC7A 3NVDA 2E1DA 4RW3A 2O4MA 3R6IA 4AISA 3AC0A 1EIXA 4A8LA 1P48A 2YL8A 4AWEA 1GUVA 3PZGA 4LBRA 2F6XA 2E6YA 2G5WA 3PZTA 2R82A 3CT2A 4EPKA 1XLCA 1ZTVA 2DZBA 3MBDA 1HGYA 2VURA 4L65A 3UWYA 4N9EA 5BRQA 5CPLA 4NX5A 4KFOA 2A2IA 1QPOA 5LNRA 3S5YA 5ABFB 1BTCA 1TA3A 1A5MC 1OC5A 4J3XA 4P8WA 3GNXA 3MHFA 4XD5A 2J9XA 3WCZA 4HHLA 3UXDA 3BW2A 2IPGA 1XGZA 4EAMA 3W87A 1FWSA 3WQFA 3W2MA 1UPPA 2O56A 2FB3A 2ZXQA 4GQGA 3S8HA 1HZYA 4GD0A 4O12A 1R3VA 1UWSA 1QTWA 5CJ5A 3CHFA 3G0SA 3DFTA 5JVLA 2CLLA 1B3WA 4C7FA 3ANVA 4N4PA 4IM4A 2OELA 4FLRA 1KLYA 1SO5A 1UOKA 3V5FA 4MSSA 1U30A 1YTEA 4B91A 3QR1A 4L9ZA 3TZFA 3ISIX 3SY5A 1IR1A 2XFYA 5D03A 1XC4A 3ZZ1A 1VRDA 5BYWA 1J01A 3Q65A 3MU7A 6REQB 2XIQA 2Z25A 3T08A 3UZ5A 1UHVA 2BVWA 2Z29A 1X7IA 1LG2A 4Q7IA 2VMFA 4F3HA 3PG9A 2PLJA 1CI1A 2V5KA 2R9RA 3WNPA 4ATLA 3AIBA 1OC7A 5LIYX 5F2IA 1DE6A 4A6GA 2GGIA 4W8AA 3MO4A 1TX2A 1RA5A 1G9HA 3TTQA 4E0CA 2OSWA 8CGTA 1O68A 1CZ1A 3E0LA 1BG4A 4N7QA 2ZXAA 3W84A 1PTDA 3C52A 4DAIA 4P2VA 2CKRA 1EYWA 3O6DA 4KETA 2ZICA 5HMEA 2DZUA 3T78A 2QEZA 4L4MA 5B7ZA 3G2GA 3A9BA 4HU4A 4FIQA 1TB3A 4WEVX 1BQGA 4LV4A 3ITCA 3OP2A 3M5ZA 1VBGA 2W61A 2NT0A 3ZJ8A 1KM3A 5CZ0A 4C90A 3PB0A 3UBPC 1PE1A 4ZOEA 4IP5A 3BLDA 2A7PA 4AZBA 3HF3A 4ZFMA 2VOTA 4DZIA 1O5QA 4NXKA 5FESA 3E2RA 1OG0A 2VM8A 3P84A 3PAJA 2ZUNA 4XO6A 2GSHA 3MI6A 2XIJA 4MADA 1UR0A 3KZSA 2VTFA 2WHMA 1YLVA 4H1ZA 4WXZA 4KWUA 4R85A 1BWLA 4Y6GA 2Q01A 1RJQA 2YBTA 3PZNA 1MDRA 3OA3A 1R38A 1RALA 2VI0A 3GHRA 4GO9A 2UY2A 1MXDA 1TJ2A 1NDZA 1BVZA 3F2DA 3DHFA 1WZKA 4Y9AA 2WMIB 2Y88A 3GNPA 4M6PA 1QK2A 5AHNA 2H6RA 3VD7A 1TKKA 4ACZA 3NYZA 3VE9A 1XC6A 3W6LA 1SVDA 4M19A 1QUMA 1R47A 2YKKA 2XIIA 3O6CA 4YTSA 3TTOA 3MYOA 4QJ1A 4HNTA 3EX6A 1E3XA 3II1A 1P0EA 2BHYA 3EPOA 2DIEA 1D7FA 2WC7A 3G1HA 2HE5A 2C1HA 1UA7A 4FNSA 2QCHA 1UROA 1QPKA 4MUPA 3C2VA 5I0DA 2QF8A 3OG2A 1T0OA 4DZ5A 4DWSC 1KFKA 3K8LA 1MW0A 2G37A 4S3DA 3AJXA 2VR2A 3CASA 2WJFA 1IT0A 4V1XA 4GQBA 3GFYA 1CGUA 3N11A 1PYFA 2DFAA 3THUA 1ICQA 3Q67A 3PTMA 1XH1A 3H7UA 4BI6A 3GZAA 1BSIA 3CZ8A 3GDMA 2PGFA 3JR2A 2PTZA 3NXLA 3W26A 1SW0A 1K9FA 4WOZA 4OBSA 1PX8A 1PSCA 1XFBA 5E6ZA 1E73M 1OFDA 2NQHA 3PULA 1VBRA 2ACRA 3CHEA 2XN0A 1Q6GA 3NQAA 1YE6A 3T4WA 3K30A 1HL2A 3WQCA 4I5XA 4J3WA 5K4ZA 4PUJA 2OLSA 4K3ZA 5AYXA 4TX6A 1KV8A 4WDTA 2DVUA 4UOQA 4W8BA 3TUUA 1BXCA 2J7EA 4IMAA 1JXKA 4EKJA 1Q4NX 3TMLA 3TVAA 3LCIA 2EPKX 4H2CA 1SMAA 3GXTA 4TQTA 2Q3OA 4AZIA 1L8NA 2QCDB 3LA4A 5CC7A 3F5LA 4QITA 4XSMA 4FX6M 1I60A 4CNTA 3BANA 4BFAA 3N9SA 2VEPA 2Y8VA 4ATWA 3UW6A 4NSBA 3L0NA 3WLIA 3W7IA 2BGNE 3GU9A 3REQB 4PUUA 2X7WA 2P5NA 2YBUA 3LERA 3C61A 4XKYB 2BFGA 4O8AA 3I3DA 1UASA 3Q45A 2AQWA 1W1A1 3MCMA 3R0UA 5ENLA 3ZSTA 1KGXA 2GQ3A 3WO8A 3ZLHA 3JW7A 4V28A 3REQA 3N6HA 3SGGA 1M3UA 5HBFA 2DP3A 4DNMA 3FAXA 1J9YA 1P1MA 1PX4A 4DO7A 5F2MA 5CEWA 2PE4A 2AL1A 3QF0A 3QR0A 4CQCA 4CU8A 2PRLA 1ZENA 4DI9A 3GIYA 3THQA 3CTLA 4QNEA 4AZGA 3MY9A 3M16A 5AC7A 3M46A 3FKKA 4NP7A 4NYYA 4ZQOA 3UF9A 1YDVA 1K4GA 3MUXA 3EBVA 3AMDA 2ACQA 3NO3A 1VCFA 2E9MA 4BF7A 3IK4A 2FJKA 4QNWA 3KBNA 1NDVA 3AFBA 2Y89A 5GNZA 3ZT5A 3BJFA 2OYKA 4MB3A 4J28A 4AY7A 4HHMA 3LLXA 3HOJA 3NEVA 5CPOA 1RR2A 1LL6A 2C79A 5FAGA 3A47A 3O2LA 3C8FA 5ABFA 1AK5A 2EPOA 3INPA 1NDYA 2CFFA 1JPKA 1EZ2A 2OCZA 2XINA 3AHZA 4PL1A 1O60A 4BI5A 3U5YA 3DFSA 3BOFA 4FOUA 1QI3A 1IEWA 2VENA 3W7KA 4W5UA 4AZ5A 5EMKA 4NJIA 1IGSA 4HA0A 1A5CA 2TPSA 4QJ3B 1RVKA 1TPWA 1H7XA 3IWPA 4HNOA 3B0PA 3R1ZA 1F07A 4PTMA 2QMKA 3K4AA 1XWYA 3LY0A 1ONXA 2OEJA 3IPWA 1OCQA 3TE9A 2YL6A 4UTTC 2E0PA 3KL3A 2WANA 4OIFA 5A8MA 4WSJA 1J79A 2FH6A 2BZNA 3LGEA 5I6SA 3S2MA 1Q6QA 1T5AA 4M0XA 4EPEC 1R3SA 1W3LA 3VI2A 3A5VA 5FJOA 1U83A 3N9KA 1WAWA 3NZPA 1UKOA 2GVLA 2I9UA 1ADOA 4AVOA 1WO2A 2VWTA 2GDUA 4DF1A 2Y6ZA 1NEYA 1EJ7L 4S3BA 3NIYA 1V6VA 2W63A 3M5VA 5BXTA 2BNJA 1B3OA 1XSJA 2FVLA 3AHYA 4K38A 4HPNA 2VJXA 3F4NA 1WB0A 4QCEA 5GJNA 2A85A 2NSOA 3RHGA 4DY1A 3CO8A 2XN2A 4LX4A 4ICCX 2F8QA 4AZ6A 1JPIA 3KLLA 4HSOA 1J0JA 1VGAA 3TWAA 1AQMA 1GVYA 4QDMA 2I57A 3IJQA 1B31A 3M47A 3U5UA 3OB8A 2Z7KA 3ZO9A 5HQMA 1H0IA 1LG1A 3HG5A 3UESA 2AAAA 2PRHA 3MI2A 4ZENA 5FD0A 1F5ZA 4Q8WA 1H1NA 4HPGA 3C0LA 1VIZA 4GFSA 3NQGA 3N9RA 4O1CA 4KWSA 2BY3A 1XLIA 2PZNA 2NV1A 2XGBA 1OF8A 2QUNA 3HO8A 5AYZA 3ITGA 2A21A 4GBDA 1GJPA 2FQIA 3OLDA 3AWNA 2OZ0A 2QCDA 3M6DA 3VNKA 4ALDA 3UNDA 1WUEA 3JS3A 4UFJA 3CPRA 3IV3A 1KFWA 2YPIA 4AIBA 4AB4A 4UNIA 3WLLA 2XUCA 1WXYA 3C0QA 2NVCA 3S4TA 3AZTA 1C7TA 2NSXA 1R9YA 3QC0A 4DF2A 2B0MA 2GJLA 4QXIA 1JD9A 3TOYA 3L5AA 3L2MA 2W66A 4H3DA 2QJHA 2W9MA 2Y5JA 4OTKA 5CBJA 3GSMA 2VELA 3H22A 3SDOA 5C2CA 2C8NA 1F7BA 1XIMA 3V35A 4H6KA 4BZYA 5JBFA 4GE8A 2BSLA 1CXLA 1UR2A 4B4FA 1MQQA 2HXUA 3E49A 1EP3A 3SURA 1HJXA 2D3LA 5FF2A 4AYSA 4QLLA 1TUFA 3GY1A 3WD1A 1FVPA 3KBWA 1FHVA 3W00A 3H54A 4I7UA 4ASTA 1PB0A 3VO0A 5CCZA 3NQ8A 1QDSA 1JR1A 3LSCA 4UIOA 2FGLA 1EPVA 1ENUA 2QYGA 1BAGA 3PFRA 1A5UA 4FNRA 4L7ZA 3N2OA 7ENLA 4PMUA 1MFUA 3VINA 2TMDA 2CERA 4R33A 4LAUA 4QE5A 1QVBA 4C6CA 3K4WA 1GCYA 1XQKA 3CLWA 3C2OA 3T40A 2E09A 3UVAA 1W3IA 2HV5A 1QO2A 4HZ6A 1MYRA 2DQXA 3SUWA 3W01A 4K37A 3NL5A 2Z1SA 2VT0A 4JQ4A 1G67A 3I7SA 1JCLA 1JZ8A 3VKKA 2XSBA 1UA3A 2IMRA 3M1ZA 5F1VA 3VKDA 1GVIA 3VNLA 3CUIA 3HV8A 2F9RA 3GW0A 2E28A 4YVPA 4AWSA 2R1PA 3PB2A 3W74A 2OKOA 4AVNA 5HATA 2DZWA 1XIHA 4AIOA 2GOUA 4HNNA 4HOXA 7REQB 3AIVA 4I3GA 1YX1A 5A6TC 4E5TA 3W24A 1H1ZA 1E9YB 5F4XA 1A3HA 1XIJA 3W7EA 3HZ3A 1QWGA 1KRAC 3DBNA 3D47A 1DE5A 4HA3A 4OGZA 3CH0A 8A3HA 4C7DA 3U48A 1CEOA 1P6BA 5DF0A 3QVQA 4DWSA 3QGAC 5T8GA 1KGWA 5HNRA 3WIJA 1HF6A 3UT0A 5HNUA 5LKYA 3GS6A 9CGTA 1ZCOA 1G6CA 1OX6A 4Q4QA 3CM4A 1J18A 5DRCA 3UYCA 2J78A 3RPTA 4DBEA 4DELA 4MB5A 4H4IA 1GYNA 1FWRA 2V5DA 4R9XA 2NX1A 1N8IA 5A6BA 4RX0A 6CGTA 4G5DA 1R5YA 3BH4A 1EBHA 2GGHA 2VZOA 4JS3A 2ZBTA 2V8ZA 4HMCA 4ZTYA 1GHRA 4XO7A 4M51A 1V93A 1JAKA 2INZA 3G8RA 4Y96A 1VS1A 2J6VA 5SWUA 1K70A 3BQ6A 5KITA 1AODA 1SGJA 4F8XA 4N42A 3TFCA 2QUUA 4PTVA 1MWOA 4R7WA 4P7QA 3L5MA 2VXNA 3TQVA 1RAKA 2Y2WA 1EOKA 3OVRA 5D9NA 3QQWA 5A6MA 2ASHA 3SN1A 3BZGA 1PWLA 1KM0A 4GK8A 2FZ9A 1EHNA 4GQ0A 3W76A 1S2TA 2C3ZA 4QISA 4CVWA 3BG3A 4Q8UA 4IX2A 4GISA 5A1AA 1DTUA 3RIKA 3C8NA 3LM3A 3KVJA 3A3HA 5CGQA 4DEFA 3KTCA 3PJWA 5D30A 3VYLA 4PFHA 4GLEA 1EOMA 2P1FA 5FSDC 1A3WA 2G4FA 2UWFA 3NDOA 4GUFA 3BWWA 3N3MA 4L64A 4YCOA 2GVEA 5E5CA 2E25A 3NDYA 4CQAA 5I3JA 1JNEA 2E67A 4UTMA 4Q4OA 3TR9A 3A4AA 3MYPA 1AW1A 3KOFA 3M0ZA 2PWHA 2XG9A 3B9OA 2W92A 2ZRUA 1VEMA 1NIUA 3RU8X 5DBUA 1CGYA 3GU2A 1RVGA 3SIMA 4LY4A 1SFSA 3EWWA 3WFLA 4NKCA 4M24A 4DYKA 2YR1A 4LUJA 1FP9A 4P61A 3RLGA 3EGJA 3W81A 1BGAA 4C6KA 4G1KA 2PWDA 4DUOA 4KIEA 2PDQA 2HJPA 1YTDA 1OX4A 1E4LA 2QCCA 1MNZA 3B03A 1E9ZB 3OZOA 3CUZA 3K4DA 4WJXA 3TW6A 5AY7A 4XQ6A 1OC6A 4ZXLA 1QJWA 1TPVA 2HK0A 2DIKA 1TV7A 2PDNA 1F6KA 1HTIA 2HNHA 1W5QA 3BSHA 3RMEA 3WQVA 5LNSA 1EJSC 1BD0A 3PWGA 2VEGA 1YIXA 3QTPA 3BZJA 2WJEA 5F1UA 3ZS4A 1XISA 3WDHA 3E9AA 1AL8A 3WQEA 2G3JA 3RRXA 5KMYA 3N15A 4N02A 2G3MA 4IWWA 5I7GA 4AIUA 1U5JA 1KFBA 4JNYA 5A94A 1H49A 4HTBA 3VD4A 3VX1A 1SO6A 2GLKA 4FXSA 1PZ1A 3LX9A 1RY0A 2R24A 4DJDD 5HA7A 5LA1A 1G7UA 1GOKA 3W02A 3WZ0E 1BEUA 3NA8A 2Y4SA 4GNKB 3WUFA 2ZIDA 4W5ZA 2WLYA 3WBXA 2D2HA 1CLKA 3C3UA 1XJBA 1CYGA 2J7GA 4CQBA 4N4QA 4IG2B 4HCHA 1FFRA 1GZGA 1V02E 1LOQA 2GUBA 2CHRA 2YDRA 2Y8KA 4GI6A 4IIFA 5TF0A 1JYVA 4NZJA 5I02A 2QULA 1WZMA 3THAA 4HMNA 2OGYA 4IZGA 5G1MA 3DYOA 3QHOA 1EWEA 5DT5A 2YGYA 1MUWA 2FHCA 3UR5A 4CCZA 1PKYA 2ON3A 2D23A 3P93A 4EXQA 1M53A 1N8WA 1KC7A 2ZVIA 4N0RA 4PEKA 4W8LA 1UW9A 2JEQA 1I45A 1D3GA 2LLEA 5IHSA 3CQKA 5FJPA 4GI4A 3LV5A 3DFHA 2I16A 5KTLA 3NGJA 4AD1A 1CXKA 1MZRA 4P7LA 2D2OA 4OJYA 5G1TA 1XIFA 4GABA 3CZKA 1KM2A 1ZJHA 3QFEA 1DXFA 2VCCA 1NF7A 3GDTA 2F38A 4W84A 1F2JA 1O12A 3R12A 5BU6A 3IVUA 3QMSA 5HMDA 2GJNA 2V3GA 1FWTA 4NI3A 3WK0A 3ENLA 4C6PA 4GKTA 4C1LA 2QAFA 1MI3A 1N82A 1IXPA 4IL0A 1MZHA 1H7OA 1DJYA 4REQB 1LQ2A 1PVNA 1EF3A 3GDKA 1GQKA 3T7VA 4X22A 1PO9A 4X2PA 3SUSA 4RXGA 3U7VA 1UD6A 4EXBA 5EYWA 4J3ZA 3W83A 4WJ8A 5G4HC 3F4DA 1W3NA 2E3ZA 3O6YX 4PCFA 3UGRA 4KERA 5A6JA 1FFQA 1NWRA 4GO8A 5LNWA 4J40A 1OGGA 1DPMA 1ITXA 2P0IA 2ANUA 2QCMA 2WAGA 1XM3A 3M44A 5DANA 3N2CA 4BJHA 1RP9A 4MNKA 4NZ1A 3WLNA 5E0FA 3NL6A 5EPDA 1BRLA 4GVIA 1EP2A 3M64A 2H9AB 3S47A 4G7EA 4GXWA 1LJYA 3SCVA 1IEIA 2ZCGA 1S39A 4HQVA 4UZSA 4XZNX 1AZ1A 2TSYA 2W6RA 2V9DA 4H6EA 3ZR5A 4UMCA 5J04A 3CL6A 1O5KA 1LDCA 1AQHA 1HO1A 1LOSA 4GKLA 4X0VA 2Z24A 3CZGA 4H9YA 1P4CA 3SSZA 5LHEA 2QJNA 4MJ4A 1J4EA 4JN8A 3EKZA 3GR8A 1RBLA 2W27A 3R7MA 1WV2A 4FF5A 3R10A 2NWSA 3OYXA 4JCMA 3KVLA 5KINA 3PBUA 3WK2A 3PSVA 1VPQA 4W9TA 4RPPA 3E0FA 4GCXA 5M1TA 2IPWA 3W2LA 3FOKA 1SJAA 1G4PA 1BPLB 2CC0A 3DKJA 3CT7A 5BCAA 1KV5A 2QR6A 4H9VA 4ZQNA 1BXNA 4YYCA 3QKEA 4TVCA 3SQLA 4AZCB 1V6YA 4LAOA 1K8ZA 2YDQA 3H53A 4PEEA 4C7GA 4JNMA 3WLKX 1FWAC 1AMKA 3ZJKA 3OW1A 4YTRA 1US2A 4GWEA 4LCQA 3WBYA 2O55A 3FYPA 2G0WA 2VNCA 4N9BA 4ZQMA 3U4AA 4MKNA 2DJLA 3EOSA 1P5BA 4X9YA 3TROA 3TA6A 1KBIA 3RDKA 1XH0A 1MQRA 2NWRA 4I6KA 3BLEA 2BHUA 1UCWA 2VFEA 4XB3A 4QG8A 5DY2A 2QNEA 1EO7A 4ZA0A 2OEKA 5BZAA 1UJQA 3UPMA 3IRDA 4WSHA 2DPEA 3KTSA 2J8FA 1Y8BA 1L0PA 3P2VA 3FGCB 3PUEA 1XP3A 2O9RA 3I10A 2B7NA 2QXWA 1EZWA 3R5EA 1HFBA 4F40A 4DO5A 2YSWA 1O5XA 3LD5A 3QV8A 2ZX8A 4WY0F 1BQCA 4DI8A 3SN0A 4MDOA 1H7NA 2PDHA 3TC6A 2AQVA 4Z2GA 4LC6A 2W91A 3CZJA 4HZMA 1RA0A 3BURA 3S1VA 1ZP3A 3BG9A 4FXJA 4ZB0A 1YDNA 3B4UA 1FH8A 2BOGX 4NILA 1HT6A 1W5NA 4U2YA 3J7HA 1FBAA 4HBKA 2XM2A 4IJBA 4KRTA 3UZJA 4GZ7A 1KGUA 6PTDA 2PTWA 4G56A 4YTQA 1M7JA 4MLJA 4M5PA 5TD4A 3DFNA 2WVVA 2XM1A 2WWCA 4O8RA 1I2RA 3GFXA 2QQ6A 1LYXA 2V68A 1D8WA 3KE0A 2EXOA 5ECUA 5I5RA 2OQHA 1T96A 1GVSA 1E9IA 1CT5A 5EMLA 1AJ0A 1OYBA 1TSIA 4HCDA 1IXOA 1W31A 4ZMGA 3HPZA 4X9SA 4F0LA 2QVHA 4WGXA 3PSWA 2FZNA 4CD8A 2BDQA 1PL9A 1GOIA 4JIHA 2V2DA 3GUWA 2X30A 1JDAA 1F74A 1GK8A 3NR0A 1BRLB 3W7QA 4AXKA 2VVNA 1YW1A 1GG0A 1K8YA 4GGBA 1EEXA 1GVOA 4TVUA 5DCEA 1XRTA 2YCLB 3I68A 2DUXA 1ADDA 3LLFA 3THDA 1ECEA 5LIKX 3ZT7A 3S9YA 4GY7A 4YVVA 1RCOB 2WZHA 2ZKMX 1SW3A 2HSAA 3VNZA 3SQMA 4JIRA 2E9BA 1ZUAX 3AMGA 4C6NA 1W1ZA 4BA0A 1XYMA 3WMSA 4IUGA 4NJHA 1TG7A 2OWCA 2QIIA 3CV1A 3CPGA 4GQRA 3QY7A 2VP8A 3AO0A 3LXCA 3SJNA 2DVXA 3CTTA 1V77A 2XH7A 1H62A 3KS5A 1CBGA 3USZA 4B15A 4AU0A 1PBGA 3N04A 4AQLA 5B80A 4O11A 2OO6A 2XSAA 3U2EA 3CNYA 3AALA 3WBEA 4B5VA 4W7VA 2J25A 4D1IA 2YDSA 1XIEA 1EUNA 2BTMA 1TCMA 1Z41A 2R91A 3RCMA 1DEDA 1Q7ZA 4F0SA 1BGGA 3H4GA 3DN5A 3N2XA 3ZVHA 5GNXA 4DVOA 4PB3A 4PSPA 3H70A 3AMKA 2GGJA 3LCHA 1IZCA 1WKFA 1EWDA 4O57A 1F8MA 4UTJA 2IQDA 4WZHA 3W1NA 2VKZG 2NQJA 1OFRA 2QMJA 1XYBA 5I3GA 5D04C 1QW9A 1DHKA 4C6DA 5M2FX 1IHIA 4D71A 1DJZA 4YTUA 2DZAA 3PBWA 4DN1A 1AW2A 4PRTA 3Q2DA 3GIQA 4CU7A 2CHOA 2V3FA 3LTPA 4NRRA 3PG8A 1S5WA 2JFEX 3OVPA 3CYVA 1H5YA 5CSUA 1M7OA 1D8CA 3S5SA 5KZEA 2ZX5A 2RDTA 2X42A 3QBUA 4MY9A 4PMZA 3VDBA 4PR4A 3OVGA 1BYBA 4KGJA 4E2OA 3VKCA 2IKHA 1EPXA 4DBDA 1RUSA 2IXVA 1I0BA 3PAOA 4K6AA 3PY2A 3G3MA 1WZLA 2I5GA 4LVBA 3LEPA 3KOXA 4M29A 1OK4A 4BEUA 1XQLA 4PCTA 2OZTA 3SFKA 1KFEA 3HG2A 3NPWA 6ALDA 2YA1A 1JVNA 2C19A 3EZ4A 5A8OA 1CGTA 4CD6A 5F7UA 3KL5A 4HA4A 4CNPA 3LZ5A 3R4IA 3MVTA 3BUVA 4MKVA 1UC4A 3AS2A 1RPXA 4B90A 4LTSA 1XICA 3W6MA 1CWYA 2ZQ0A 4L5ZA 1X6NA 2J27A 4K8GA 5ABTA 3U0HA 4ZB2A 3EAUA 4R5EA 4UBPC 4S3KA 1HJVA 1OF6A 4U31A 3GH7A 1FHUA 1K9TA 4TOQA 1NP2A 3GKFA 2OG9A 4WGHA 2HBVA 3VIIA 1VD6A 1ZB5A 3CUFA 2WKGA 3EDEA 2Q3RA 4JEJA 4YJ5A 1TX0A 3R11A 1H4PA 1NJJA 4KFNA 3MJMA 3QN3A 2C71A 4U3CA 3W22A 1KKRA 1US0A 1MEWA 2YZ5A 1V3LA 3FA3A 3AU6A 2PDIA 3CWOX 5H91A 1DHPA 3AZSA 1E6RA 4P7RA 4JQ2A 3VDHA 3OGSA 3EB3A 4RDWA 4AZ7A 5DLCA 3TLLA 1VBJA 4UTKA 3GM8A 4TIMA 4IGHA 3R2GA 4EAYA 2C1GA 2Z7GA 2RFGA 3RU6A 3TLQA 2C13A 3VKBA 2VQUA 3V3WA 3O7UA 1R3QA 3SCRA 2DW7A 5CAHA 4HNLA 4LJ3A 3GRIA 3KOYA 4F48A 1S1PA 3S0CA 1K3UA 4Q3MA 1W5MA 2WSKA 1FHDA 1V3MA 2AMXA 3AHVA 3ZM8A 1IZKA 3VD3A 5JBDA 2VFDA 3WNMA 1R8LA 4QX4A 4XKYA 1U1HA 4KGLA 5E70A 2DZPA 2WO5A 1CENA 1DV7A 2WQPA 2HVMA 2X1UA 3FW6A 3SRFA 4HD5A 1PPIA 3NQ7A 2OT0A 3WH7A 1YXDA 2HXTA 3IRSA 2OO0A 2PDCA 3AIWA 2PDMA 3SY8A 3HG3A 1K9DA 2EQDA 4P5UA 2CCRA 4PUNA 1LZOA 1TPC1 1DIKA 1TELA 1UUQA 3UJ2A 1A5BA 1O7AA 4GFIA 3M0VA 1CPUA 3FDGA 6ENLA 1ME8A 4Q8PA 1FUYA 3ITLA 2B7QA 4MWAD 1GG1A 1F3XA 1LCOA 4H9TA 3NZRA 1LRQA 5AHIA 1WBHA 1DTNA 3UFYA 4L61A 4XISA 2XU2A 3CMGA 2GPTA 4QP0A 1HXJA 1UKSA 5AHFA 5AECA 1B3XA 4UTLA 2FVKA 4FLSA 4ZOCA 4S23A 4DB7A 3UCCA 4DWSD 1FA2A 2DZSA 3AS1A 1Q3NA 1KRCC 4JN7A 2J7DA 3BPWA 5FJUA 4A3UA 3S3GA 3BSMA 4AG0A 2DSWA 3AOFA 1US3A 4Y8EA 3Q4DA 4DNHA 3P80A 1FXPA 2FLIA 2Y7FA 4W4QA 2PC4A 2WVVB 2BHZA 1B5TA 5LSMA 3DDMA 2AL2A 4IPLA 4ZSTA 3WDQA 3FLUA 3RX3A 1A5SA 3SJ3A 3OYZA 1GYLA 2CLHA 4IPPA 4Z1BA 3FX4A 4KT2A 3PUDA 3FA5A 7A3HA 1GPFA 5A6KA 5D8WA 2GJRA 4XD3A 3RO8A 1UIOA 3GG8A 4OBRA 2QDDA 3B06A 1GQIA 4C6BA 1VBUA 1UZDA 4CN6A 3MA8A 3AZRA 2H8ZA 1MRQA 4K36A 3KBMA 3H6OA 3ARRA 2ALDA 4CQDA 4O52A 1R3RA 4PBEA 3G24A 3NOEA 4Q4PA 3F5KA 1IV8A 5LHFA 3E2QA 3M41A 2P53A 1KA9F 2WSYA 3L9CA 1VLWA 3K1GA 1F73A 2V30A 5CPTA 3MZNA 3OQ8A 1SO4A 4RR4A 3JZEA 3MV11 1E5JA 3AROA 3VXGA 4IXXA 4GI8A 3ZLFA 2BGQA 1RXOB 2E6DA 3VPLA 1Z69A 4JR5A 1VH7A 1QFEA 3N18A 4NI8A 2SFPA 2I17A 3ARVA 1OCNA 4JIPA 4LS2A 2BBFA 1E72M 2VX7A 1OFPA 3AU2A 3NQ2A 3L66A 3NPVA 4Q8TA 1GQNA 3TYZA 4TV6A 1CW2A 2OYLA 1XIIA 3QXBA 2WHKA 3WELA 4NNBA 2YXXA 4DHGA 1XYAA 1Y5VA 3BDKA 1V3JA 3N13A 2OPJA 1NQ6A 1ZBKA 1BWVA 4PUWA 1DOSA 4MTVA 3SUVA 1TTPA 5CBIA 2C1IA 1O94A 4E4UA 4IMFA 4E8GA 4NNAA 2ZWYA 3WEZA 3TKFA 3XINA 1XLBA 4BKNA 3LENA 4YCPA 2DV0A 1MFVA 3W7RA 4LUSB 1THFD 3VIJA 3DGRA 1QK0A 3BV4A 2BXVA 1UD4A 4FNTA 2QUVA 5HR6A 1A5NC 3WJSA 3VOCA 2DSUA 1ML1A 3VC6A 1NWUA 2FPTA 3LN3A 3GNNA 1ZL1A 2GWGA 4L9YA 5J5DA 2UZ9A 3M0HA 4A3QA 1X1NA 4DJED 4LY8A 1BG9A 4US5D 1JIBA 1Y7VA 1H60A 4MZ8A 2ACUA 1IIHA 2PDXA 3BCFA 4LCRA 4PGLA 5F2LA 2EF9A 2CITA 2YL5A 1ODZA 5CXPA 2X0YA 3N6JA 2IPFA 5EFDA 3B9DA 4HK5A 2FKPA 2HDJA 5AC4A 1FWCC 4ZZ9A 3GIPA 3HV9A 3LPGA 3T81A 5E93A 1WNOA 1AH4A 3W2UA 4IISA 5U7SA 5JH2A 3R8HA 4DJDA 1IT8A 3VTRA 2BB0A 3EOLA 3GAYA 3MMUA 3EWDA 3BAIA 1SMDA 4D1JA 3ICJA 4GJIA 1BF2A 5C9UA 4ADSA 1C8VA 2PODA 5FAJA 1VJZA 1EGVA 4OBTA 2Z1XA 1EO5A 1UP2A 1E6PA 4XIMA 5KZMA 2POTA 3ZWSA 3SM0A 1TJ1A 3IIOA 4F0RA 1LM1A 3VGDA 2PWEA 1JPDX 2ATSA 2W79A 1L6YA 4AH7A 2J9ZA 3NO1A 2VUNA 1Z89A 4PH6A 4M6VA 1V0NA 4EF8A 1A5KC 1AW5A 4MAVA 4U33A 3QPEA 1W91A 2JK2A 4ERGA 1ZAHA 3CLMA 4PTXA 8RUCA 3ARXA 2G8ZA 3HPXA 2OODA 3LMZA 3L2IA 9RUBA 3HJZA 2H3DA 1WUFA 5J5RA 4N6FA 1E9LA 5EKYA 3OLEA 1CGVA 4WQ6A 1HL9A 3HQ1A 1AA1B 1PV8A 4LVDA 1JZ6A 1E4NA 4TUFA 3EEGA 3ABXA 5LZLA 2WMHA 1JCYA 1GKQA 3L65A 4E4FA 4L56A 2WPGA 1XR2A 3G6MA 3B3DA 3VKAA 3SB0A 3URBA 1WDDA 5DMMA 1FWBC 1BFNA 2BVYA 1CXIA 4RK8A 1PZ3A 2PBOA 4PUDA 1OHLA 2NLYA 2YJQA 1TWWA 1XYZA 4URIA 4M6QA 2WJDA 4FAMA 1OIMA 4Z1AA 4PMRA 4V15A 5F2GA