3GUWA

Crystal structure of the tatd-like protein (af1765) from archaeoglobus fulgidus, northeast structural genomics consortium target gr121
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
233
Chain Sequence
YFDSHLHSEGLGFSELVKLKENGIKEVCSLAFFPVKPKYPQTMIDVFRKLTEFEPLRCEAAGVKMHPAVGIHPRCIPPDYEFVLGYLEEGEWVAFGEIGLELVTDEEIEVLKSQLELAKRMDVPCIIHTPRGNKLKATRKTLEILESLDFPADLAVIDHVNFETLDMVLETEYWIGLTVQDAARIVAEHGERFMLNSDAGYRVAEAAVKIEEAVGREEMEKVARENARKFLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein AF_1765
publication title Northeast Structural Genomics Consortium Target GR121
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
total genus 56
structure length 233
sequence length 247
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3guwA00
1JGMA 3S2JA 4F0LA 1PSCA 1GKRA 4ERGA 3QY7A 2I9UA 1EYWA 3K4WA 4B91A 3DUGA 3TN6A 1FWCC 2A3LA 4C6QA 3NEHA 4LEFA 2GWGA 4EPBC 3NQBA 3F4DA 2ZC1A 3IACA 2QPXA 1R9XA 4GY7A 4KERA 2RAGA 3ICJA 2DVUA 3SFWA 4GX8A 4NG3A 2FTYA 1EJWC 2Z25A 3QY6A 1GKQA 1E9YB 1ONWA 3UR5A 3S2LA 4IH3A 3ID7A 4IF2A 4HK5A 4B90A 3HM7A 4HK6A 4RZBA 3EGJA 2Q09A 2HBVA 1EJSC 5HMEA 1K70A 4HK7A 4L9XA 1KRMA 1W1IE 2OGJA 1RK6A 4C6PA 2R1LA 4H9YA 4GK8A 4IFRA 3HPAA 2R1NA 3GTFA 1EJXC 4B3ZA 1QXLA 2DVTA 2G3FA 4DIAA 3E74A 3LGDA 4GX9A 1UIOA 1K6WA 1NFGA 4GBDA 4IFKB 4HJWA 3ORWA 2Z27A 4XAZA 3UPMA 4C6DA 4ZSUA 2WJDA 1M7JA 4H00A 3GRIA 1P6CA 2OQLA 3DC8A 2HPIA 4KQNA 4DZHA 4CQCA 2P53A 4LAMA 2DVXA 4PCNA 1O5RA 1EJVC 1P6BA 4C60A 4QS6A 4R7WA 2PGRA 3PNUA 1NDYA 2D2GA 4EPKA 4J2MA 2GOKA 1HZYA 1NDZA 3HTWA 3UR2A 4GOAA 4KEZA 2PGFA 3D6NA 4KESA 4R88A 1EJUC 4HA0A 3TN4A 3LSCA 4GXWA 2HBXA 1FKXA 3S2MA 2IMRA 4RE0A 1P1MA 4C6EA 2O4MA 4V1YA 4KIRA 4CQBA 4DZIA 1V51A 4C6FA 3A3WA 3WZ0E 2ADAA 4LCQA 4D8LA 2ANUA 4L6DA 2VR2A 4CNTA 1ITUA 4CEXC 1I0BA 5HMDA 3IARA 1ADDA 3B0YA 2WJFA 4CNSA 2AQVA 2Q01A 1PB0A 2AMXA 2Z4GA 3EWCA 2VM8A 1RJPA 1UMLA 4PCPA 3OODA 4LCSA 1V77A 2Z7GA 4C6KA 3IGHX 1YBQA 4KF1A 4XAYA 1RA5A 4DLMA 3RN6A 2FTWA 2WM1A 1FWGC 1FWIC 2EG6A 1ITQA 5HMFA 3S2NA 1ONXA 4XD3A 4ERIA 3MVIA 4IQJA 4IFOA 1K1DA 1WXYA 2VC7A 3T1GA 4M51A 4RDYA 3RYSA 4XAFA 4H9ZA 2AQOA 1A5NC 3ITCA 4GYFA 2FFIA 2BGNE 1FWBC 3F2DA 3DCPA 2D2HA 3OU8A 3O7UA 4IG2A 3GTHA 2HPMA 2PAJA 3QGKC 4ZSTA 4IGMA 5G4HC 4J5NA 4LALA 3AU2A 4OFCA 4YIWA 3OQEA 3F2CA 3LNPA 3MDWA 4NP7A 3GU1A 2QVNA 2F6KA 2KAUC 1XWYA 1J6OA 3ISIX 2Z28A 3LS9A 3FDKA 2GZXA 3PBMA 1FWEC 2VC5A 1A4MA 3B40A 1PTAA 1YIXA 3OVGA 3K2GA 3CAKA 2BB0A 1NDWA 4TQTA 3IRSA 2VUNA 3PAOA 1DPMA 4EP8C 1UBPC 1J6PA 4C6NA 4C5YA 3CS2A 3MVTA 2E25A 3LGGA 3PNZA 4G7EB 4PBEA 1R9ZA 3LA4A 5A6TC 3MDUA 3PANA 3B0XA 3MSRA 1FKWA 3AU6A 1RAKA 1RJQA 3RHGA 4WHBA 3GTXA 3GG7A 3MPGA 3OOQA 1I0DA 4IFKA 4GY1A 2UBPC 2Z2AA 2Z29A 4BJHA 2Z00A 3LSBA 3IPWA 4UBPC 3RCMA 4QSFA 1XRTA 4WGXA 4AQLA 3GU9A 2W9MA 1KRCC 1V7AA 4CQDA 4G7EA 4XD5A 4I6KA 1A4LA 3SO7A 1FWDC 4F0SA 2ICSA 1YMYA 3MJMA 2GWNA 2QS8A 3LY0A 2FVKA 5FSDC 4C6MA 4DI9A 2EG8A 4H9TA 4QRNA 1IE7C 3C86A 4R85A 3TN3A 1YNYA 3MKVA 1J79A 4DI8A 5E5CA 5LXXA 1UIPA 2YXOA 3T8LA 4Z42C 3WMLA 4C6BA 2PUZA 4WVXA 4UB9A 2R1MA 3IJ6A 4PBFA 3GIPA 3IV8A 4NI8A 1VFLA 2OB3A 2HNHA 4F0RA 4B92A 1V79A 1WXZA 3G77A 4JOMA 1RJRA 4I6VA 1O12A 1ZZMA 4QS5A 1R9YA 2R1KA 1RK5A 4EPDC 4INFA 4BY3A 3O0FA 4QROA 3T81A 3JZEA 3NURA 2FVMA 2Z2BA 3V7PA 3GIQA 2YZ5A 3TN5A 4GC3A 2I5GA 1A5OC 4DLFA 2OODA 4LH8A 3QY8A 1A5KC 2OOFA 4H01A 2QT3A 3GUWA 3URBA 1XRFA 4KEUA 1A5LC 4C6LA 4DO7A 1FWFC 1J5SA 1E9ZB 2P50A 1POKA 3E3HA 3URAA 2UZ9A 2HQAA 1NDVA 1FWHC 3E38A 4LANA 1GKPA 2Z26A 4H9XA 1KRAC 4PE8A 4QTGA 1RA0A 1KRBC 4CNUA 4V1XA 4BKNA 4DYKA 4H9MA 3F2BA 3URNA 3FEQA 1QW7A 3K5XA 1EZ2A 3A4JA 5AKQA 4E3TA 3TNBA 3EWDA 4ERAA 1S3TC 3R0DA 3S4TA 4C6CA 3E0FA 3OJGA 2YB1A 2D2JA 1V4YA 5CH9A 4GZ7A 4MUPA 5FSEC 3WYZA 4H9UA 4CEUC 1A5MC 4C5ZA 1EJTC 4KEVA 4J35A 4LFYA 4XD4A 4P5UA 2E1WA 3URQA 3LU2A 3MTWA 3UBPC 4G2DA 1FWAC 1M65A 4EPEC 4C6IA 1EF2A 2WJEA 1YBQB 4ICMA 4DNMA 4RDZA 3UF9A 2Y1HA 2GSEA 2VHLA 3FDGA 3GU2A 2O4QA 1BF6A 4LAKA 3E0LA 1POJA 2Z24A 4C6JA 4C6OA 1PO9A 4C65A 3A3XA 3AUOA 3GTIA 3N2CA 4H9VA 3BE7A 2YB4A 1XGEA 1M68A 3F4CA 4RDVA 2XIOA 3E2VA 2CZVA 4KETA 4XAGA 2R1PA 3KM8A 4IGNA 3QGAC 4GY0A 1KCXA 4LAOA 4LCRA 1EJRC 3CJPA 4XD6A 4AC7C 1YRRA 4IG2B 4RDWA 2PLMA 2EG7A 1FWJC
chains in the Genus database with same CATH superfamily
5C71A 4GRSA 3G6MA 2HVMA 3AC0A 3BCJA 4ERGA 3CQKA 2BTMA 3B05A 3CO4A 4JY8A 4YHEA 3PZMA 1QATA 4XZ9A 4IOTA 1ZUAX 4UTWC 3NEHA 4Y96A 1R5YA 4XBJA 4D8AA 4HMCA 3G8EA 2F38A 3BLFA 1V93A 2R9RA 5TQLA 2FTYA 5DANA 3EX1A 4RE2A 1ME8A 3PPCA 1W32A 3MC5A 1U1UA 3IIXA 1PDZA 4WF7A 1CENA 1F73A 1E6SM 3BDKA 3CUXA 1FX6A 1TZ7A 3WN6A 2CNCA 1K70A 4L4OA 2QW5A 4UOQA 3OG2A 1BWLA 2WMIA 3SRKA 1W1IE 1XGZA 1XCFA 2R1LA 3BLIA 4J1OA 1HKJA 2RJHA 3IUHA 3W24A 2G3FA 4FXFA 1W1B1 1UD2A 4GI8A 1O66A 3GFYA 3CWHA 4JIPA 1V6VA 4X3ZA 3IK2A 4H8HA 4UTMA 3GRIA 1Q2RA 2RDUA 3DGBA 4RL3A 2WMHA 4ZFCA 3SDOA 1KTBA 1DBTA 3REQA 1JCJA 1XF0A 4R7WA 3W7NA 2ZYFA 1HZYA 3HTWA 3PTMA 3W1RA 3QPEA 4W7WA 4A3YA 4R88A 5T91A 1XIBA 5AHIA 4GXWA 2E5CA 4QJ3B 4WK9A 4RE0A 2R6OA 5DX7A 1JR1A 1VLWA 4YTRA 4V1YA 2EKCA 4KIRA 2VFIA 1LZOA 4L6DA 2VR2A 3M4HA 2XU2A 4US5A 2FHBA 3WUFA 2ASHA 4J3ZA 2HS6A 2Q01A 4AEOA 3MBDA 3VOGA 4AXKA 3WO8A 4XAYA 4YMZA 3WF1A 1I1WA 1M04A 1TCDA 3KHDA 3WLHA 2VCBA 3W7GA 2WVSA 2O92A 4FOKA 5HWNA 2HROA 3MUXA 3RIKA 3GE7A 4XV0A 3I68A 5H91A 4XISA 3H22A 4KFOA 3C2RA 3G22A 2NVCA 4XG1A 4ACZB 2ZXDA 2OZ3A 3QQ0A 4UFLA 1JYNA 4LF1A 3CHVA 4DVOA 3IANA 1OC5A 4JTAA 2O56A 3W0KA 1DIEA 3KFTA 4MB5A 4M7SA 1DV7A 3O06A 3UZ5A 2QVNA 4DAFA 3PZ9A 5EBUA 4IIGA 2GDVA 1BKHA 3KS6A 3WY1A 4FSAA 3KOWA 2BB0A 3WLMA 1XLEA 1TWDA 2E7FA 4RKAA 2ZDSA 3W7MA 2D23A 3PNZA 4C7FA 2ISVA 2YW4A 4ZA0A 2XZ7A 2XM1A 3QHNA 4UUIA 1KFJA 1ZBWA 4J3XA 3F4WA 3GVGA 3GM8A 1KXVA 4IFKA 3KRUA 3EMCA 3SURA 4H83A 3NXLA 4HU4A 1XRTA 1TTQA 3UXLA 4QM1A 1B1YA 1VFHA 4A8LA 2JQXA 1HP5A 3PZNA 2NVDA 3K4DA 3ITYA 3GB6A 4FXRA 4I6KA 4JTUA 2QS8A 4DI9A 3DYOA 2DH2A 1QAPA 2WXDM 3N14A 4MNJA 1W5NA 3TXVA 2VZSA 1J01A 5LXXA 3W2JA 3VIOA 4W86A 2X0HA 5K3VA 1V6UA 1M53A 1RQBA 4FX8A 2PTDA 4DEFA 3G24A 2ZTKA 3WNMA 4NNCA 4QEEA 2EPMX 4FPSA 1F5ZA 1AL7A 2W0UA 1UH4A 4IHCA 1QI5A 4Z0SA 5C2GA 3D46A 4ZOEA 3JZEA 3OA3A 2PDFA 5DT5A 4Z2KA 4M82A 2NQZA 3TN5A 3WQWA 4PR4A 3OBKA 1QMLA 2HWGA 2BVTA 3QRHA 1HTIA 1E9ZB 4W87A 3B04A 2C19A 3IVSA 1KBKA 2DH3A 3ZT6A 3H2OA 4XK2A 4MNKA 1XBXA 1ZHAA 1AJ2A 4W8BA 2DUXA 4ZB5A 4PE8A 3G18A 2DT0A 2X40A 1WDWA 3SGGA 1V7YA 3V1PA 4U3CA 1GVFA 3EDKA 2Y63A 3C0SA 4NX5A 4ERAA 2ZX5A 4DAIA 3ZT7A 1U22A 5E9XA 1IEVA 3LTPA 1VC4A 4HQVA 1IGSA 5H8PA 2IQTA 4C5ZA 3SGUA 3W3OA 3CXOA 3DKJA 3R79A 1W1A1 3WBYA 2JE8A 1SZNA 4AZCB 3L65A 5AZ0A 4AHOA 4PGLA 2C1GA 4LBSA 4CN6A 5LA0A 2QHAA 3ZO9A 4C6JA 3CZGA 3H2FA 3V75A 2QCGA 3N2CA 2XN1A 1JCTA 3CQ0A 3ZJ6A 4LQ1A 2V69A 4RDVA 4Q7IA 2YJQA 4D1IA 2R1PA 4YTUA 3VKAA 3NIYA 4MWAE 3CHDA 2VVNA 1G7VA 2WV8A 1L6WA 3TCEA 4KFNA 1UD4A 4KGJA 2XSXA 5F7UA 2XH7A 1UR3M 1HVQA 2ZA2A 3FKKA 1FA2A 1OGSA 4O1EA 1ICSA 3AMKA 1IYXA 3PS7A 4LEFA 4EPBC 4ZO7A 2ZC1A 1TIMA 4GY7A 2Y88A 3SRDA 2GSJA 1ECEA 1Q6RA 4L7ZA 3WQPA 3C4UA 3ME3A 3STGA 3KXQA 1XCWA 1DIDA 1OB0A 1IQ8A 4IIHA 4M80A 5LGXA 2BY0A 4AZ6A 2O7SA 1JUBA 3W02A 3OLIA 3WQ8A 3BJTA 3HPAA 1THFD 4NY2A 3G3MA 5D9NA 3GXDA 3DBNA 3BJFA 4Q3MA 8RUCA 1XDLA 1NWTA 4BR1A 4DIAA 1Q85A 2QMJA 1O1ZA 1PVNA 1GG1A 3CTLA 1I4NA 4C6DA 2PDWA 3NO3A 3AZRA 4IQDA 1P6CA 1KGUA 3DN5A 3M0YA 3C2FA 2EQDA 1FRBA 3HPFA 3OZMA 4IIEA 3TKFA 1GZJA 3DHPA 1M01A 1V3HA 1GVQA 4J2MA 4AD2A 1DQXA 4KESA 7REQA 2C14A 3BW4A 3MU7A 5JUVA 3TTOA 4IMDA 7A3HA 3KRSA 1XICA 3TC7A 2ACUA 4C1NB 4YJ5A 4JTSA 3B0YA 4WZHA 4AF0B 5K4XA 2W91A 1DHKA 1IXNA 1C8XA 4GYJA 3ZJ7A 1SPQA 3U6WA 3FY1A 4L9ZA 3W7EA 3LI1A 1W6TA 1EA0A 3PTQA 3O0KA 4B9ZA 4RPQA 4DZ5A 2YXGA 1XYCA 2EG6A 2XH4A 4MUZA 4HMNA 4IFOA 2QF7A 4DJEC 2QPUA 3CL8A 1GQIA 3DOPA 3I10A 5G2IA 4YVPA 3NSXA 4ATLA 2EBNA 3LYEA 2J7CA 3JRKA 1X38A 2YGYA 3AOFA 3O7UA 1W8SA 5F2IA 3M7WA 3QGKC 1EOKA 1XP3A 2XFFA 3KP1A 1RP8A 5G1MA 3ZM8A 2VI0A 3O05A 2A79A 5HQLA 2OCZA 5GVJA 4UQBA 1P7TA 3N11A 1VZWA 4HOXA 5JVLA 2YBUA 3ZJ8A 3GNOA 1OX6A 2ISDA 3TC6A 5A2CA 4NRRA 4JD4A 1C3FA 1OIFA 3OGRA 4GINA 4XZLX 4KFPA 4F2BA 1JZ4A 2E25A 1ZAHA 2ABBA 2GJRA 4RR4A 3ZMRA 1EUNA 5ABHA 1YEYA 3LLFA 1RQHA 3WMBA 2X8RA 1IXPA 1YYAA 5BOEA 2GJNA 4GIRA 3DERA 5DN1A 4CCEA 5F2GA 2ONEA 2PDKA 3L4WA 1QO2A 2G50A 2PWFA 4RZ4A 5BCAA 5CZ0A 1UWAA 3UGVA 2F7FA 5DRIA 3O1NA 2D20A 1IZKA 4UC5A 3W1TA 2QCDA 1E0XA 2IPFA 4AQLA 1YTEA 2XVKA 3A5VA 3BLKA 4KGLA 4M6UA 2I5QA 2QR6A 3OYZA 4CQDA 5GJPA 5C54A 2G5WA 4F2TA 3SO7A 1EC9A 2WZEA 1JNDA 1UUOA 1VRDA 4NQ1A 2GWNA 1I8JA 1H7XA 4QRNA 3LD5A 4CCZA 2OEMA 3ATYA 1PZ2A 1QPOA 3PG8A 3EWXA 1XLHA 1VFLA 2ABAA 4ASTA 3G0SA 5I7GA 4XUGA 3UWZA 2BZNA 3VD4A 1QHPA 2D0HA 2PGWA 2V30A 3BOLA 3OLDA 1RK5A 1MW0A 3PSWA 3QW3A 4E6MA 4ZGYA 1TQXA 4ACYA 3TYAA 4JQ4A 3D0CA 2QAFA 1E71M 3WH8A 1RCQA 3CWOX 3B0UX 3BARA 4NJJA 2POTA 1Q45A 3PSVA 2CZ5A 3QY8A 3R0UA 3A4AA 3GDBA 1O5QA 3T40A 5LKYA 1SJAA 4KEUA 1CBGA 1SU5A 1XSKA 4NZ3A 4HNUA 2EPOA 1GQNA 1R3RA 2HQAA 4P7NA 4I5XA 1AQHA 3EX2A 4IL2A 1RVKA 1ODZA 4GCAA 1ISXA 1KRBC 4OV4A 4E4UA 1C7TA 4L9YA 3WK0A 5HQEA 4H9MA 3FYYA 4E3TA 2PTWA 1CGWA 1UBSA 2AKMA 3R0DA 3S4TA 1S5MA 5TNVA 3JUGA 3KVMA 2OPJA 1AQFA 2JF6A 1V4YA 1VBUA 4K38A 4IGSA 2KZHA 1K8ZA 3CZKA 4MZ8A 1A5MC 4JTLA 2A0NA 3DG3A 4D6DA 4W88A 3G0XA 1U5HA 2IKGA 1SFTA 3W7HA 1BXNA 3SIZA 2A3CA 3GDLA 2PFHA 4XIAA 2HRWA 1OCBA 2WW5A 3CMFA 1U83A 4IIBA 4Y9OA 4GH3A 3WLQA 4REQB 4HGXA 4R9XA 2G95A 3WIJA 1P5BA 3H4GA 2X1SA 3R0KA 4XSLA 3BAWA 3VZYA 1FTXA 1VYPX 3NEVA 2H8XA 4AU0A 3KLLA 2A3AA 3CJPA 1TPC1 2PLMA 1G9HA 1V6TA 2QYGA 4MGGA 2GDQA 3NM3A 3EPNA 3KOYA 3QR1A 1E3ZA 2QCMA 4R3UA 4XX6A 4FAMA 3QZ6A 3WDRA 3TW6A 3ITOA 1XLLA 1Z42A 2PEVA 2EPKX 1YXDA 3N34A 4DXKA 5D37A 4B90A 2J78A 2IS7A 4CQAA 5FJRA 4MF4A 2ISWA 1KLZA 2PE4A 3C52A 3BGGA 1YKWA 4DUXA 3GUGA 4LVBA 3QOKA 2CHNA 5F4XA 5I06A 2WHKA 4ZQMA 3N15A 1AK5A 3CTTA 3FXGA 5C0QA 1B2YA 3K1GA 2P8BA 3MKCA 5TF0A 3P81A 3VOIA 4EE9A 4WKHA 1R3SA 1M7JA 4PB4A 3VIPA 1ZPTA 5REQB 1G69A 4AD1A 1F3TA 1XDJA 4YWSA 3VIHA 4MDPA 5J8LA 3VOJA 4B4HA 1OFDA 3NDZA 4WSJA 3BMXA 1O7AA 4LOCA 4F0KA 4TMCA 5F2MA 4ATWA 1ECQA 3W6LA 1N2VA 2IMRA 3MUZ1 4HA1A 4G6CA 4E8GA 2TPSA 4PMOA 4QXIA 4DZIA 3QZEA 4NAEB 4LCQA 3FYOA 5E0CA 3PUOA 5A6MA 3W7DA 1OD8A 2DORA 4CNSA 4HBKA 1FXPA 5K9XA 3INPA 4U31A 1F9CA 1MSSA 5A6BA 5A94A 4LCSA 2A21A 3H4XA 1RPKA 4R9OA 1E1CA 1ZFJA 1E55A 5TBOA 4ZL1A 1F2JA 4BK9A 1D3GA 1X6LA 1B3VA 4HIBA 3EWWA 3N6JA 4H7CA 5CC7A 2PP3A 4OUEA 2X1UA 1EGMA 3HFYA 3W1PA 3ZVIA 3TQVA 2H9AB 4S38A 3V4BA 3SRHA 3ERPA 2ZZ4A 2QGHA 2DZBA 4L56A 4IG2A 1BD0A 1J4EA 4AD0A 3T78A 4ZTXA 4QCFA 2PU0A 2VO5A 3IIVA 4HNLA 1MQQA 1CXIA 4FNUA 1XIGA 3FYPA 5HNRA 2DT1A 4HCHA 4WX2A 1PKYA 1Y0EA 1EC8A 3ZR5A 3N9SA 3OVGA 3IIPA 1UMYA 5JQ9A 4US6A 1GVOA 2FQIA 4MB1A 3GNXA 2V3GA 3RRXA 4EP8C 4LGXA 3R8RA 1RUSA 3UR8A 3C6CA 3ARXA 1OJXA 4WQ6A 1WKDA 3LGGA 4JDBA 5D05A 1R9ZA 3E0IA 3OZYA 1NWSA 3EBVA 1ZAIA 4UNLA 2XGIA 3FVDA 3ZVHA 2JIWA 3AWNA 2BV9A 4OV9A 4X0VA 3W2MA 1B90A 2D69A 2QJNA 4JTKA 3I7SA 4NHVA 1JFXA 2ZRZA 4JEJA 3DI0A 1A0EA 3LOTA 4WY0A 4F4RA 3PZTA 2W9MA 2E0PA 1KRCC 1OFAA 4XD5A 2PDNA 3PULA 5KZDA 4MB4A 2VTFA 1CEOA 4AY1A 3LY0A 4PTWA 3GAYA 3FCPA 4OECA 3TAOA 2YYUA 3EAUA 4OVXA 5FI8A 3TIMA 3BVJA 4NI8A 2I5IA 3MV01 3CYVA 1VFOA 3U48A 3SADA 1RJRA 4FIQA 4QDWA 3LRKA 3KTCA 5AY7A 2KX9A 3L4VA 1F8IA 3W07A 3PZUA 2OZ0A 3T81A 3SJNA 1KM4A 2J7BA 2VD9A 2FVMA 4EF9A 6TIMA 4TUFA 3OVPA 2I5GA 4GQBA 3MA8A 4S2BA 3L2LA 1FH7A 3C8FA 5K2ZA 1EP3A 1WBHA 2BVDA 3T0AA 1FWFC 4FALA 2A3BA 4WJXA 4N9BA 4GUJA 5IHRA 2E6YA 3V0TA 2NLIA 4KCTA 3MB9A 3TSDA 1XLDA 3NQ6A 5D30A 4K8EA 1J0ZA 3STCA 3G1RA 1WDPA 5CLWA 3P0XA 1LOLA 3GKAA 7ODCA 2X16A 3NYZA 3TDFA 2D22A 3CMJA 3G1AA 3IVUA 4A3UA 2EGZA 2IQDA 3FA4A 4QE1A 2QJHA 2G8ZA 3W9ZA 5BXPA 1H63A 3CUFA 2WC7A 5T9BG 3QFEA 4DJDC 2Y1HA 4Q7NA 3WSUA 3W2LA 2DSWA 1QPNA 2ZRVA 4NYYA 5FL0A 2YA1A 2B81A 2PRMA 1NQKA 3FEMA 3M9YA 3SY1A 3XINA 4GZJA 4AZIA 3E2VA 4WGHA 2OZ8A 4KETA 1LLOA 1XKJA 4HMDA 4P7LA 1OINA 2GJXB 1E4IA 1S2UA 1UJPA 3AJ7A 1FCBA 1X7IA 3G1FA 3KBJA 4YL2A 3ZWTA 2PODA 5EFFA 1JZ7A 4JY9A 2D2OA 3GXFA 5IHSA 5CG0A 4PH6A 1BGGA 3O2LA 3TSMA 2GWGA 1KXHA 2J27A 3L4YA 1J96A 3QPZA 4I7UA 4FLRA 1SO3A 2FGZA 4GIAA 3RPTA 3VFCA 3M43A 2DVUA 4EAYA 4GX8A 2YDAA 4BI7A 1ADOA 3DFYA 7TIMA 2PCEA 2OSWA 3ID7A 4Q8UA 4QISA 2J8FA 5AHEA 4XZNX 4A2RA 5I78A 1RR2A 4GBUA 5I00A 2D3LA 3CASA 4GK8A 2IKHA 2X05A 2R1NA 4Q32A 1ZSXA 4S23A 2DVTA 4LTSA 5A1AA 4HCLA 3CT7A 2FMOA 3PJXA 4HU0A 3R12A 4L65A 2IPJA 3JR2A 2DZXA 3WQFA 3GXPA 2WJDA 1OABA 3LTYA 3QKEA 4I7WA 2E40A 3W86A 2WQDA 3TK7A 5FF4A 1IEWA 5CSSA 2EPNA 1E4NA 4KRTA 4LRSA 2CBIA 1EJVC 5AN7A 3ZOAA 1AA1B 3P7YA 2DSVA 1DOSA 4W9TA 3UZWA 1BVNP 2FZ8A 1FKXA 2ZZ3A 4QE4A 4V27A 2XIMA 3CZ8A 1K9FA 4Z2JA 1WZKA 4GH1A 1E0WA 3ABQA 1XJBA 3WZ0E 4XKMA 1B3YA 2REQA 5CPNA 1BEUA 1QO5A 4ADUA 4DB7A 3EWZA 1PCKA 3M47A 4JZ5A 1XIMA 1V77A 1MW1A 5KINA 4NXSA 4DLMA 2YCJA 2IPGA 1TWSA 1DXEA 4XO7A 4NZ5A 4TIMA 3HFTA 3UNDA 3B9NA 4CD6A 2Y2WA 5A8NA 4GE8A 4MFEA 3MZNA 3N6HA 2QKFA 4L6OA 1XG3A 3H4WA 4WDXA 3P6LA 1MUCA 4HYRA 1JNEA 2Y89A 4UNIA 4DXXA 4JTFA 1ESWA 2HPMA 3NJ3A 3QMSA 1P0NA 5FCZA 3NDOA 1FOBA 4S3BA 3MI6A 1XUZA 3S5ZA 3UFYA 4KWSA 1GQJA 4IICA 1MEWA 3C2YA 5HNTA 3SB0A 1P1XA 3SCUA 3LBCA 2YPIA 2BHUA 1GW9A 1TG7A 2XIQA 4JIIX 2OU4A 3B40A 3RDKA 2EF9A 4JN6A 1CZ1A 3NAVA 5C6MA 3MQTA 3MP5A 1S46A 4XZHA 3HN3A 2HEJA 3EX3A 3IAQA 1WNOA 3W7JA 2CWXA 3GBDA 4TX6A 2CCRA 5FJJA 4DUVA 2GUBA 1MDLA 2WM0A 5IBXC 3O6CA 2ODOA 1E0VA 6CGTA 3L0NA 3WLOA 1RY0A 4UXDA 1S1PA 2J8GA 3GHSA 2BOFX 3PZIA 3FK4A 4B5NA 4LYPA 1OQFA 3T2QA 3MSRA 2BOEX 1REQB 3WD2A 2DW7A 2I56A 3QM3A 3TV8A 1VFUA 3DFQA 3DHDA 4A3QA 4JX5A 2Z00A 2TODA 4N7QA 2ZICA 1VH7A 4LB4A 4H6KA 2QGYA 4AAJA 4Q8PA 2WNWA 2G3NA 1LQ0A 4I5UA 3GVRA 1NFPA 2B7PA 1A4LA 4R53A 3L4TA 1NARA 4HTYA 4B5XA 1OFEA 2WO5A 1HG3A 4DF1A 4Z08A 5KTLA 3BLPX 4NNAA 4GYPC 4GUHA 1UIPA 5C9WA 4F3HA 4AWTA 4M19A 2BASA 5HNUA 2PUZA 2R1MA 4ENLA 1BRLB 3NQMA 1GVSA 1WXZA 3R8HA 4XBKA 3M0IA 4JGDA 1FWTA 4MYAA 3TVAA 3AIVA 1AD4A 1IHIA 2Z1WA 1XIFA 1OG0A 3UESA 3UCQA 1OK4A 5IFPA 4ECLA 4JTQA 3QLDA 5MKGA 1H1YA 3M0VA 3UWVA 3LHVA 3EA2A 3V7PA 3T0BA 4GC3A 3EZ4A 2C91A 1PIFA 2DIKA 3BZJA 2I16A 3GUWA 1SZRA 3IUIA 1A53A 1J9YA 5KMYA 3FJLA 4C6LA 4DO7A 3CAQA 3MYPA 4LS2A 4LXFA 3UCDA 2WB5A 3WNLA 2UZ9A 2WNZA 3H23A 5GPRA 4DUWA 4JNYA 1LUCA 3N3TA 2Z26A 4H9XA 2VWTA 2OSXA 4BWLA 3C61A 3QW4B 4HNNA 4WSKA 1PDYA 1ZQ5A 2RGMA 3LN3A 1I2RA 3BLEA 1XGDA 1C7SA 1TE1A 4UMCA 4V15A 2PZNA 3D5HA 2QUUA 1H1NA 3WNOA 3GXIA 2OG9A 3WYZA 4CEUC 4V33A 3M07A 2Y61A 4KEVA 4XZBA 4GVHA 4G2DA 4GJJA 3NSNA 3JS3A 3GQYA 2Y7EA 2INFA 3RJYA 3II1A 3TOYA 1FH8A 3LENA 2DT3A 3UGRA 2DSKA 4LAKA 3VNIA 3L21A 1V0KA 4KRUA 2Z24A 3VKBA 1R3VA 3L4ZA 4E3VA 4Q8OA 3VZZA 3BK0A 5EBAA 4P8VA 2WK2A 9CGTA 1XHGA 4TV5A 1JCNA 1SZFA 2JIEA 1S5VA 1Q6LA 1E51A 3PUEA 2WBKA 2VOTA 4ZOCA 3MMTA 2NSXA 3IJ9A 2BXZA 5BXSA 5FOOA 2JBMA 4O15A 1C91A 1K77A 1UR9A 4RDWA 1GZGA 4FNPA 2ACQA 3T6CA 4YVXA 2GFTA 1WV2A 3GW3A 2C6QA 3T07A 1V6XA 4S3DA 1S2TA 2DU2A 3IACA 2VZVA 2QPXA 4N6EA 4UCFA 5HDRA 5AYYA 3ICJA 3WLKX 1XCXA 1XYLA 1DWJM 3GNPA 2Z25A 1ONWA 2PD9A 4NL1A 1I2OA 3DIPA 4IH3A 4CU7A 1XIDA 1MI3A 4AHPA 2J9YA 3E0WA 3O6AA 1KC7A 3PTDA 4ZBCA 1PBGA 2CLIA 4DYJA 4GNJA 5HNNA 3VKDA 3K8KA 1R47A 2PRLA 4B5WA 1PYFA 3B06A 3QSTA 5JBFA 4O52A 1PUDA 2JGQA 4MADA 1AVAA 4GUGA 4HJWA 3WDPP 3FOKA 2ATMA 2HS8A 2R82A 1H7NA 1VYSX 3RO8A 2ESCA 4HPGA 3M0JA 2PLKA 3VOFA 2IUZA 3BLOA 2ZA3A 4FLQA 3O9NA 3TR9A 3RG6A 2WZTA 1H7RA 2P0IA 5D32A 1W3JA 4EPKA 1W37A 4GOAA 2DDXA 4QQ3A 1D2KA 2E3ZA 1FFQA 1Q7QA 1OFPA 2W67A 4BS0A 4B16A 4OOZA 4YCPA 2VL4A 1W5OA 4JTGA 1LBLA 2C13A 5DCDA 3CV7A 1PHWA 2ZVIA 4AHQA 1LOSA 2ZUWA 4UCGA 4PCPA 3S9IA 2YA2A 1R2SA 5I5RA 1JEZA 4NU7A 2V5LA 2PC4A 4W5ZA 5A6KA 4TO8A 3R4IA 2OO6A 4O19A 1WP6A 4FNQA 1SFLA 5EMJA 2OLHA 3V5CA 2XH0A 4EVZA 1RV8A 2CKRA 1WXYA 2V38A 4RZ5A 3WQ6A 2I1OA 2PDBA 1SVDA 3WDQA 3L4UA 1JL8A 3UWYA 3WL1A 3CMGA 2G3MA 3B8DA 5DLCA 4FB7A 2E5BA 1A5NC 1S2CA 2FFIA 3QH2A 3B9DA 1FWBC 1FBAA 4M6VA 1J2WA 2NXHA 2WMGA 4FNTA 3IIOA 1E9IA 3CUJA 3PWAA 3WQVA 5G4HC 1V8EA 4PL2A 1GOWA 4LALA 4AZ5A 1J11A 5C7VA 1RP9A 1MXGA 2EEXA 1QVBA 3ZSTA 3ISIX 3UETA 2NX9A 1Q6GA 2YCKX 4TVUA 3W7OA 1WYIA 2V5BA 4QSHA 3THUA 2CESA 1OCNA 1MXSA 4OU1A 3FHQA 4Q8TA 1RBOB 4AISA 1B9BA 3Q94A 5D2VA 3MCMA 2GJPA 1SO5A 4CCDA 1K8XA 3QLLA 2GVJA 4MMWA 2O9PA 4PMYA 3VXGA 1D8WA 1EH9A 1Z48A 1ISVA 5BZAA 3NO1A 1HUVA 4PTMA 2X0YA 3THDA 3LDVA 2H6RA 3P5ZA 1KFKA 4H8UA 3ALFA 2V81A 2XHYA 2CBVA 3PPGA 5DMNA 3RR4A 2CWNA 1ELSA 1BYAA 3T4WA 3KZSA 1XSIA 3AZSA 1F3EA 3A4XA 3HG4A 2E77A 1L8PA 2AGTA 1HJQA 1LQ2A 1FHUA 4ZO6A 4G7EA 4JBRA 1VBHA 4PMVA 3WLNA 1W3HA 3MS8A 2C15A 3O8AA 1F4HA 4C6MA 1LRTA 2NX3A 4GD0A 5XIAA 1QUMA 1R2TA 3W76A 3ZSSA 1J79A 4P7QA 2J75A 3K8LA 2XVGA 4UB9A 1GOOA 2ZX8A 3PM6A 4NUWA 5AVNA 3V35A 2JKAA 3S6DA 3ARWA 3W37A 2OGYA 3M0HA 1XUUA 5HUOA 1M5WA 2GUYA 3S2CA 1UCWA 2QCLA 1QHOA 1NH6A 2HDJA 4AWUA 2R1KA 3SQSA 3I65A 3MW7A 4AYSA 1R7AA 2XJ7A 4PYSA 2DIJA 3NURA 4H8NA 4RCXA 3FGCA 1HKIA 4IPNB 1CNVA 4IP4A 1ODUA 1KCLA 1ZS2A 4PTVA 1TR1A 2B4GA 2Z1VA 1FCUA 1VBRA 5F1VA 1GWJA 1XRFA 3C3NA 3LPOA 3UD6A 2V2DA 1YLVA 2AGKA 3VABA 1H7WA 1PL9A 1TX2A 3LXCA 1OFRA 4JL1A 5AHMA 1I9CB 2LLEA 3GHUA 3STEA 2WVVB 4M5PA 5I03A 1YNQA 1XLAA 1SSGA 3VE7A 4UIOA 1CYGA 4V1XA 4BKNA 1FH9A 1T0OA 1GYLA 5A8MA 4CNNA 4QLLA 3KBNA 4JTIA 4F2UA 1V3JA 2X2GA 1N8FA 3ZJKA 1CGTA 2OKTA 3W28A 3IJLA 3ZFHA 1BXCA 1EA9C 4C7DA 2WZHA 2PDMA 3HGJA 3OYXA 3VIFA 2Z6JA 4QAWA 4HPXA 5CCZA 3S6TA 1L0PA 1QI4A 1MXDA 2GSEA 3UZYA 1VFFA 4UMAA 3N73A 1R2RA 1PO9A 4YU1A 3AUOA 4M56A 4PUNA 2R24A 4KCVA 3WENA 4ADTA 3CAVA 4ONVA 1DORA 2PDUA 4XAGA 4GABA 3OEXA 4GXMA 3AMDA 4GY0A 2O9RA 4BQ4A 4QQUA 4NNBA 3KCLA 2RHGA 4ADSA 1YRRA 3UZXA 4UQ9A 3RAOA 2VGFA 1ZALA 2FTPA 1ISZA 4LRTA 1TSIA 2H8ZA 4H41A 2CITA 4F40A 4K8HA 3OW1A 3KX6A 2OKOA 4AD5A 1R30A 1YPIA 4U3AA 1QNVA 1B3WA 4JIHA 4LS0A 1VFTA 4YS1A 3TEVA 2DP3A 2YYTA 2BSLA 1GCYA 2BS9A 1FVPA 2ALRA 1EQCA 4L6HA 2GQ9A 4O8RA 4DPPA 4JXCA 1AD1A 1NY1A 1TMHA 4D2JA 2ZX9A 3NQ2A 4HSNA 3GWQA 3ARQA 6A3HA 1Q6DA 3O63A 3P60A 2GDUA 1KCZA 1J0YA 4UFKA 2YCEA 1PHQA 2VRKA 1L6SA 5U7SA 2EJ1A 1ZU8A 4XAPA 5ENLA 4QIUA 2J7GA 5FACA 3AHXA 1B31A 3S6OA 3W01A 4MKNA 4O11A 2Y85A 4AW7A 3A9BA 5KEZA 5C9UA 2HV5A 1QJWA 5LIUX 1OD0A 3TMLA 1ISYA 2GLKA 1BSLA 2J77A 4C1KA 4JKMA 1KBBA 2Z27A 3WLRA 1FWRA 4JR5A 3U2OA 1B57A 2ZX7A 4DF0A 3ANVA 2UY2A 4RNJA 3SSZA 3S1XA 3VUSA 4PSRA 4NZJA 2AL1A 3WQDA 4O10A 4MNMA 2OWXA 5FEPA 1R8LA 3GR4A 4R27A 5EY5A 4NJHA 1KKOA 3HBLA 1S2AA 1P1MA 3E49A 1FDJA 1C92A 3FN9A 3PZVA 3O3RA 2NV9A 3AAMA 5A2BA 5D9OA 4ZQCA 2PBOA 3CB8A 5KZ6A 2YCLA 1GVRA 2DEPA 3DENA 2XSAA 2FMNA 4P7RA 3F03K 4Q4RA 4K7VA 3GHTA 4XKYB 1Y7VA 4HHMA 4JYDA 2VRQA 4HTBA 3MO7A 5C9XA 2PDGA 2YW3A 4ERIA 5IOBA 4XVEA 3SEPA 4KS0A 3ABOA 4BQ5A 3R2GA 1HFBA 1MFUA 4M81A 4O1CA 1DJHA 4D6GA 1A5CA 4B3KA 2QV5A 3WK1A 1MFVA 4I7VA 2G37A 3W27A 4ORIA 3F2DA 3HMCA 5GNYA 2PWUA 1M03A 3DEQA 2C8NA 1MUWA 1H4PA 3ATZA 3PPFA 2WMJA 1UKQA 3BW2A 3PF3A 1JXJA 4MAZA 3CM4A 3G3DA 4X61A 5KZEA 3RNDA 3R58A 4HN4A 1Q66A 1EL3A 1UD5A 2VEPA 2XFYA 3BANA 1KKRA 4B9YA 1XWYA 2C71A 4FLOA 4GC4A 3T09A 4Q8QA 2J25A 3R25A 4DXVA 2FJUB 3RLVA 1JCMP 1AH0A 4AXNA 1EEPA 3UWWA 2VMFA 3KS5A 1UROA 1HJXA 2QLYA 2QPSA 5FESA 1MZRA 1J6PA 1Q6EA 2YZRA 3KP0A 4S3FA 4CD8A 4WJ8A 3KL0A 1LL7A 9XIAA 1HN1A 3BPWA 3UZJA 3CNYA 3EPMA 4A22A 1P0BA 4Y9PA 2W79A 4LUYA 4GY1A 3DFHA 3U8GA 4KWWA 3UCCA 3HPSA 2Y62A 5LZLA 4QCEA 4FMVA 4D6EA 2BOGX 4HKPA 1PWLA 2C7FA 3DYPA 2NQ9A 2BGQA 4JTCA 2WVTA 1VPXA 3RXZA 1OT1A 1XH1A 2XWDA 3PTKA 3B8VA 3C2OA 3PG9A 3BURA 3NQVA 2ICSA 1YMYA 3APYA 1NU5A 3PWGA 1N82A 1IEQA 3K13A 5AHNA 4H9TA 3TN3A 1YNYA 1AJ0A 5E5CA 3NG3A 3VA8A 1RBAA 1I2NA 1Q8JA 5CC5A 1LF1A 2RUSA 3GIPA 1BVZA 2FZDA 3NA8A 2VOMA 2W4XA 3WH9A 4JOMA 3HMJG 3UU0A 3SECA 3TTEA 1XFCA 1GZ1A 1D9EA 4R33A 3QVQA 3N4FA 3E1F1 4OZOA 2V5JA 4YTTA 1OBAA 3CPGA 1A5OC 3PFMA 4DLFA 3LHWA 2ZRYA 4PBGA 5FIPA 2QT3A 3URBA 3TYEA 1M7PA 3BSGA 1DXFA 1XLBA 1J12A 3AXKA 3E3HA 4MVAA 3W25A 1VJSA 2VC9A 4ACZA 5FF2A 1TUFA 1SZEA 2W92A 5DXYA 1TZZA 3T44A 3N4AA 1QNOA 2A3HA 1ZY9A 3L5AA 3K5XA 4JQ1A 3NO5A 3PBWA 1OX4B 3TXZA 3W87A 3KOZA 1JCYA 1SMDA 1TFVA 2E5DA 4LFYA 2DFAA 2RFGA 2P8CA 3OO2A 1VAHA 2E1WA 4YYFA 1TR9A 3N2OA 3UJFA 5HULA 2ZC8A 4CUCA 3GIYA 3WQGA 4LVFA 1RBLA 3HGSA 4K2SA 1X6NA 6ALDA 2G4FA 3W2UA 5HWJA 1BF6A 3E0LA 4EWND 2ZXAA 5CBIA 3Q67A 3CYJA 4G7FA 1IF2A 3WDIA 1TV8A 1XV8A 1DWGM 3RLUA 6XIMA 3AROA 2NX1A 3GVWA 3SN0A 1XLGA 3RX3A 2V2HA 1XR2A 3QGAC 3RLGA 1C90A 1GYNA 2GOUA 2VDIA 3POCA 2EAWA 3U5UA 1OYBA 3F5LA 2A4AA 5D33A 3R1ZA 1W2VA 1H0GA 3T08A 5K4ZA 1A5SA 3P82A 3RX4A 4ZXLA 1X7FA 2PP1A 4GUIA 2DQWA 1DJNA 3F4DA 4O4WA 1JZ5A 1AQ0A 4NKCA 3HO8A 2HNEA 5DCBA 1YDOA 3ZLGA 1ZNNA 4ROPA 3DDMA 4U10A 1Y8BA 5CZSA 3QY6A 4S3JA 2ZZ1A 3S2LA 2BGSA 1UH3A 2WWDA 3H8AA 4PEEA 4GNKB 3WEMA 4GVGA 4LX4A 1C9WA 5DCEA 1UKTA 1KNWA 3GDTA 2R14A 1KFLA 4H9YA 5LNWA 4D9PA 1WZMA 1HXJA 4JTHA 3UJEA 2QULA 1VGAA 5LA1A 2WMFA 1UR1A 1XLJA 4Q4MA 5FF0A 3VILA 1OVDA 3NQCA 3OVQA 2QMKA 3CQHA 3H2NA 5BU6A 3JW7A 4Y2WA 1ENUA 4M6PA 4HB7A 1UASA 2MANA 1NOUA 3R11A 3D47A 4DJFD 2DZSA 3KWSA 2W27A 1NF0A 3UG8A 1P6BA 1EB3A 3LCHA 2OEKA 4LUTA 3PNUA 3Q37A 3TFCA 4KKXA 3NFUA 5EL1A 2GOKA 3IIZA 4Y8EA 1E6ZA 1QPKA 3W7LA 3LHZA 4IGHA 1WPCA 1FFRA 4HA0A 3N9RA 3HQOA 1BFNA 2HE5A 4N0RA 1XD1A 2YL8A 4JYEA 3U5YA 5AYIA 2NWRA 3TLLA 1J93A 3GNNA 2EKGA 2ZE3A 1B4EA 1XLMA 3F7JA 4E2OA 2XVNA 2INEA 3LX9A 1R86A 2RJGA 1TRIA 3KVLA 2XFWA 4LYRA 6ENLA 2XDFA 2PTXA 4I9MA 2CLMA 2WCSA 4AZCA 1HKKA 1KO0A 2WM1A 4GIEA 3CHEA 4B2DD 2B0MA 3CBWA 1K4GA 3EWBX 2XINA 3VX1A 4LV9A 1ZP3A 4E8DA 3H21A 1ALDA 1UUQA 4PMUA 4LVDA 5SWUA 1JZ2A 3CPRA 2QZRA 3I4KA 5CGMA 2BGNE 3EKZA 5I3DA 2D2HA 5ABFB 1KFEA 4M0XA 2BFGA 3WELA 5CBJA 3LXBA 5GQBA 1JYXA 3A12A 4MJ2A 3M6DA 1XRSA 4N2YA 2FH6A 3EKLA 3G1HA 3MT1A 3F2CA 2Z1BA 4LB3A 3LNPA 1W9UA 8TIMA 1RD5A 1KM5A 3T9PA 5CGQA 2EPLX 1L6GA 3NWRA 1UWTA 5D9MA 1HJSA 2YFNA 1V0NA 4CKQA 1KM6A 4GXPA 1G0CA 4TMBA 2A7NA 3CHFA 5AFDA 5JIWA 1W3NA 4FX6M 3NOEA 3MP3A 4M24A 5AB3A 3KWXA 1X1OA 3IJ8A 1GHRA 3HZ3A 4JFWA 3W6MA 1TJ0A 4LC8A 3SCTA 1PKNA 1S5NA 5HR7A 3PANA 2YBVA 1O95A 4YHGA 3SCSA 2Y4SA 1W5QA 4S3CA 4CD7A 5M17A 4GKLA 2UV8G 3P2VA 1ZLPA 3PB0A 1Q8AA 3RCMA 3U7VA 1RH9A 4JFVA 1PZ3A 4AFYA 1AMYA 3VAVA 3L66A 1YHTA 3SUSA 1XYFA 1E6NA 3LCFA 4O0QA 3UG5A 2PD5A 3EX6A 4RUBA 3DXIA 3U9IA 2E8YA 2CLLA 1FDZA 4UTJA 5BYWA 4Z0JA 4MIMA 1YDYA 3ARSA 4C1NA 4AF0A 4WKAA 1V79A 1QNRA 2L5HA 3VD3A 4IPPA 3KDNA 2PTYA 2GVYA 3P5YA 3FA5A 1U2YA 4LUJA 2VP8A 1R9YA 1A3XA 1BG4A 4I9TA 3TR2A 4UTKA 2YDQA 3F4NA 2QV4A 4ZOBA 3TJLA 3RX2A 4ATDA 1XXXA 3ZYZA 3TU9A 2ZXBA 1D8CA 1DWAM 3ITXA 4A8IA 4NVTA 3DG7A 3LEPA 3NL3A 2OQHA 1DJXA 1IGWA 2EHHA 3M0ZA 4WRHA 1UC5A 5RUBA 4TX8A 3L0GA 3NNTA 3N6QA 1I60A 2P50A 3VCNA 3K46A 3WH6A 3GXTA 2PF8A 3KHJA 3VOHA 1IEIA 3MKKA 4CNUA 4PUWA 3WJZA 2D0FA 1QW7A 3VDGA 1GEQA 3TNBA 4R34A 3OTRA 2EJAA 1LRNA 4ZE5A 3OHIA 3MYOA 4Y9MA 3PBYA 1EJTC 1M41A 4XD4A 4UOJA 4GO9A 1MEHA 1CB7B 2XYLA 4PB5A 4LV4A 1K9DA 4L61A 3DYMA 5LYRA 1LDCA 1J0HA 4PUDA 1POJA 4PA8A 4NZ1A 3KOXA 1HKMA 1C9DA 2YB4A 1CIUA 1EX5A 4NYUA 1VEMA 1JAEA 1E5NA 2NUYA 1KXQA 1KCXA 4LAOA 2RGLA 4LCRA 1NOFA 1XD0A 3FHAA 1PJ9A 5BU9A 2P3ZA 3B3DA 3SW6A 2BXVA 3CZLA 3A3HA 1CXLA 5XIMA 1E1EA 1VR6A 4MDOA 4PCFA 5I24A 2XPKA 3M7SA 3DHUA 4IJBA 4D6FA 1UZDA 2P1FA 1NFBA 3DUGA 4C6QA 1FWCC 2A3LA 4NZCA 3A64A 4Z2HA 3UEQA 3NQFA 1H61A 4QITA 3FJNA 1OFBA 2E8ZA 5DELA 3KL5A 1HIZA 3VOCA 4MLRA 3W84A 3MWCA 1TWZA 5A5WA 2I7GA 3UR5A 2O55A 2P0OA 3K8MA 4HK5A 3N25A 1ONRA 3SSJA 2BY1A 1XI3A 4L9XA 2Y5EA 3AS3A 3N9KA 1ZJBA 3CUIA 4QNWA 2PC8A 3MUIA 5DQPA 4RE4A 3GAKA 3BG5A 2CKSA 4GGHA 3W29A 1KQZA 1EP2A 4IP7A 2NSOA 4YTQA 1UIOA 2WNNA 1NSJA 4J3WA 3M5VA 3W1UA 3QC3A 3S9YA 1QU4A 2CBJA 1HL8A 3W22A 4JNMA 3GVVA 4RLIA 1CCWB 1W8GA 1KM3A 2P53A 1WOAA 3I3EA 4OGZA 3C5QA 3WKZA 1QPRA 1HKVA 5EMYA 3DKLA 2JK2A 2FZBA 2WNQA 3L68A 3P74A 4GQGA 1YDVA 3S1GA 3NR0A 3M46A 1DKWA 4C6EA 3HU7A 4CQBA 1NELA 5BROA 1DWFM 2P5NA 2V67A 3OIXA 2HXTA 4DN1A 1C8QA 4TVDA 1ADDA 4JTJA 3LQGA 2UY5A 4HMEA 1ICQA 1RJPA 4WR3A 2G41A 2WPGA 1VYRA 1CGXA 1KV5A 1DP0A 3TLQA 3RCNA 3ECQA 4U5KA 1YTDA 1MW2A 1ZBVA 3M0LA 3W71A 4PFMA 3GDMA 2F8QA 1B3OA 5AYXA 3B8TA 1DEDA 1Z44A 1H60A 1ICPA 3EOEA 5EMUA 4AC1X 4YPJA 2V5KA 4JCMA 5C5YA 3PFRA 4REQA 4S3GA 4J28A 1OGBA 4WSHA 5L9FA 3QQ1A 3W00A 2QJIA 3ABZA 2CLPA 2WC3A 5JXQA 3GTHA 3ABRA 5AYZA 4RW5A 1JYVA 4XTIA 3A23A 7ENLA 3GYCA 1R46A 1H41A 3T0DA 2PCQA 2BX7A 2F6KA 4JQ3A 4L5ZA 1S3HA 4GUFA 1OT2A 2V8ZA 4NI3A 2VZOA 3WLJA 1TV2A 1TELA 3FDKA 3V16A 3CU2A 5BW6A 4XUYA 4UWMA 3H2AA 3LPFA 1I2QA 1IEXA 3R10A 2I17A 4JHMA 4TTUA 3IRSA 4OWGA 3G1SA 1SFJA 1IXQA 4GQRA 1E73M 2WSYA 4JYFA 4LPCA 1B30A 3VMNA 3WD1A 2ALDA 1SO6A 3G1YA 3MDUA 1TMLA 4DJFC 1EDQA 1JI2A 1UUMA 3RHGA 4B15A 3GTXA 3MPGA 4TVCA 2PB1A 1CB2A 4C90A 2Z29A 2OT1A 2NLYA 5FA5A 3FVMA 1F3WA 3I7RA 1OF6A 4IPLA 5REQA 2RDWA 3NZ1A 1J18A 3XIMA 3W7PA 1RLDA 3UA4A 2WSKA 5CSUA 4O1BA 5CXPA 2J7EA 5FEXA 4UR7A 3CV2A 5HAOA 4F0SA 3W2KA 3PC0A 4PEKA 3DBPA 4GIYA 5FSDC 3VMOA 3R5EA 3HQ1A 1MRQA 5JH1A 5GJMA 5H1WA 4R85A 1Q6FA 3WD4A 4JNZA 1K6AA 1Y5XA 3BGJA 4NAEA 1JPMA 2VCAA 4IX0A 1KD0A 3BICA 3IV8A 4Q4SA 4Z1DA 2WHMA 2SFPA 3B0PA 2VX7A 4KT2A 4UR8A 3VVGA 3WNPA 2J79A 4HYVA 1JPHA 4I9AA 4TR9A 1C8YA 1GVIA 5BOFA 2TSYA 2XIIA 3T0TA 3H7UA 2VT0A 3CAWA 1E72M 4KWVA 3LNMA 4WXZA 5KETA 3N2MA 5AECA 1RCXB 1DJIA 4V2XA 1SJDA 4MSSA 5E1QA 1BQGA 3PUGA 3WJWA 2OLSA 1P0KA 1CDGA 1A5KC 3ITTA 1UZ1A 4F0HA 4Z1YA 4S2CA 1H09A 1JI1A 2H9AA 3GW0A 4GYPA 1VBJA 4AIOA 1U1HA 2NW0A 1KQYA 2QUVA 1LWIA 1AZ2A 1UPPA 4HCDA 1OX5A 4DYKA 2PDPA 3A4JA 2NQHA 4AUBA 1TUXA 1O1HA 4S1FA 1S3TC 2J6XA 1E4MM 3OJGA 3AS0A 3V0SA 4UQAA 1GW1A 3L12A 3SUTA 4UTTA 1R3WA 3LU2A 1R38A 2DY3A 3GC5A 1M65A 2BY3A 1ISWA 1OZQA 2FFCA 1YBQB 3UF9A 2J4GA 4XTDA 4JDYA 4G1NA 2GGEA 1Z41A 1WCGA 3VMPA 4LAZA 2ACRA 5IRPA 4EACA 4OE7A 4E2BA 4WUIA 4DNHA 2HK0A 4E38A 1M9HA 3LCWA 1LT8A 3ABSA 2FB2A 1TTIA 5F4SA 3BJSA 1YE4A 4Z2LA 5CG7A 4AX7A 1JCLA 2Q02A 5TIMA 3MY9A 2PDJA 3HG5A 5CZKA 3SUVA 1BAGA 1V6YA 5ABGA 4X63A 3QY7A 2GVLA 1E70M 5L6UA 3ARRA 1WDRA 1QI2A 3WFLA 3P14A 3GY1A 4H2HA 2X42A 4JFUA 4NZFA 3NZPA 4QLJA 3LMZA 1GVYA 3TCSA 4K36A 1EJWC 5M5DA 3IK4A 4IMAA 2H90A 2VDHA 3NSMA 4GVFA 3UYIA 4RW3A 1A49A 4P8UA 1HGYA 2AMGA 2YCIX 3GG1A 4I8YA 4ZB0A 4AD4A 4C6PA 1W3KA 2PDHA 2NT0A 4ALDA 1R87A 1XX1A 3LCGA 4DWSD 4A2SA 2C0AA 2Z1XA 3JU2A 2VC6A 5I3KA 1F8MA 4LYQA 4U28A 3AIQA 2GVEA 3VPLA 4WDTA 4YCOA 3GBEA 2VDGA 1DTUA 3UG3A 1HT6A 1K7EA 4HZ6A 2PF0A 1K8CA 5FD0A 3H26A 4DM1A 2F2KA 1VEOA 2BWGA 5E0FA 5EGRA 3MP4A 4AWEA 5D04C 5H8UA 4DWSB 3V3WA 3TA6A 3MHGA 2A85A 4QDMA 3S2MA 4FOUA 2TAAA 4JQ2A 3K1DA 4DJDD 4YNGA 1GT8A 2AAAA 1QWKA 1W1ZA 4ZODA 3BAJA 3CWNA 3W83A 4A3RA 2E6FA 5BMXA 1TWIA 2A7PA 4D1JA 2V0TA 4L1WA 3K30A 1IWBA 3G0UA 1NEYA 4LU0A 1LOQA 1K9TA 5EMMA 2D1ZA 2P88A 4DO4A 2ZDRA 4EX4A 2FHCA 3DI1A 1F6KA 2VC7A 3T1GA 3H7VA 2PDCA 2VEIA 4N9DA 1KBJA 2W63A 4XAFA 3UVAA 4ZO9A 5K7JA 1TX0A 2GJXA 5HJLA 4EKJA 1JRBA 1CXFA 3DZ1A 5A8QA 2PRHA 4IQLA 3QFWA 3WL0A 4DRSA 3WJXA 2BDQA 3NL5A 1P6WA 5AOUA 2X1RA 3O15A 2G3IA 1QT1A 3AU2A 4YIWA 1YTKA 3LBMA 1IWPA 4DBUA 2GL5A 5BWFA 3E0VA 3RCYA 4PMZA 4FZIA 1H0IA 1W5MA 3NPWA 4R7JA 1VRXA 4J7RA 1TWWA 1VF8A 3CAKA 3H2MA 3CEUA 4KW2A 3TX9A 3NCOA 1KBIA 3ANYA 4DO6A 3WLSA 2WLYA 3OG3A 2V3EA 4O0KA 3DFSA 1UWRA 2Z6IA 1UWUA 3AISA 4G7EB 1SUXA 1ITCA 3QV6A 4IPIA 1F61A 5CJMA 1Y5WA 2A5HA 1VEPA 2VFEA 3TJIA 2YFOA 3UP8A 4FHAA 1NF7A 2X30A 2UBPC 4S3KA 3FAWA 3ES7A 4BJHA 4GG9A 4FS9A 3W1AA 4EXAA 3BAXA 3PP7A 4GACA 3PJWA 2XTKA 4Z1BA 2XGZA 3T2OA 1WKFA 4ES4A 4W85A 1OK6A 4GA8A 3TWBA 2PDLA 1PIGA 4MG4A 1KLYA 3WJYA 1G4TA 3AXXA 3MUAA 4F79A 4RX0A 3SGZA 2ZADA 2EG8A 2QEZA 4JX4A 3V0UA 3QGVA 2UWFA 4U2ZA 4DI8A 3DAQA 1JDAA 1XDMA 1TPH1 5CLTA 4Z42C 1R0MA 1GORA 1PE1A 1M3UA 3VC5A 3A6OA 2HNHA 3TSBA 3YPIA 1J2BA 5BRQA 4B92A 4GQQA 2ZOXA 3WMSA 1H7OA 3G77A 4GI4A 4HZ8A 2A1YA 5DO8A 1TPEA 1BGAA 2FVLA 1ZGDA 3ONCA 5HBFA 1B3ZA 4N4PA 4E4FA 3FJ4A 4AZGA 1LORA 3EWYA 3WQCA 4Z17A 3B97A 1W31A 4JTDA 4ZO8A 2HXUA 3O6DA 2HSAA 1WB0A 2NXGA 3EA1A 4PB3A 1UB3A 1UR4A 1W0MA 4J3SA 3RR1A 1Z9AA 3USZA 1A5LC 4LYKA 4LW7A 1RVGA 2XM2A 4W5UA 1NDVA 4JCLA 4OTKA 5LA2A 1KRAC 1OIMA 4QTGA 1RA0A 3M0KA 3DFTA 1EFZA 3TQPA 3JVAA 5CJNA 2VXNA 3APGA 4KIEA 4QNEA 4ZFMA 4O1DA 4UQEA 3OBAA 2C0HA 4D8ZA 1G4PA 4MUPA 1HO4A 2OSYA 1B0IA 5LIXX 4JS3A 1OFOA 1ZL1A 1FWSA 1AW2A 4J35A 3LM3A 1J8VA 3URQA 4F9DA 1FCVA 1DIKA 1XRVA 4W7VA 5IXEA 1AQMA 1ZRQA 3RU6A 4C6IA 3KL3A 3N29A 4C7GA 4ICMA 4DNMA 2E6DA 3RRAA 3TJ4A 2VR4A 4UFJA 3GU2A 4X9SA 1IT8A 3GD6A 4C6OA 1SSDA 4C65A 1EWDA 3EXSA 3V5OA 3EDEA 2CERA 2VZUA 4H9VA 1VB9A 1REQA 1FHLA 2OYKA 1K3UA 3H53A 3B4YA 2BG5A 4GZEA 3GLCA 4ZENA 3SUUA 5PTDA 4UR9A 3MCOA 1VIWA 3A22A 5CZTA 5HPOA 5I6SA 4TX9A 3S2JA 5AYBA 1V3KA 3IJIA 4X2RA 1KR0A 4AWSA 2BLEA 2A6LA 2CIPA 4CNPA 3OHMB 3IWPA 1R9XA 1HNYA 3CZJA 3SFWA 1VJZA 3EOOA 4P7OA 1JQVA 3VNDA 1BRLA 1BLIA 5FKYA 4IF2A 3PZQA 3ELFA 4IIFA 3W4RA 4XO6A 2VKZG 3WBEA 1EX1A 3OPSA 1X39A 2RDTA 1JFHA 2D0GA 3B8WA 3ARVA 3THAA 4Q6JA 1TVNA 3MJYA 1SW0A 1PTDA 1VJIA 2Y0FA 3S1VA 2MNRA 3LGDA 1FDYA 4GX9A 4K3ZA 4BEQA 2YDRA 1ADSA 5FJTA 3AFBA 3SIMA 1LQAA 3KRBA 3GDKA 3PB2A 4KCUA 4WKFA 2OQLA 3TE9A 1JIBA 2HPIA 4KQNA 1GPFA 2NUXA 3PBUA 2GVGA 3B9EA 3BL3A 4PCNA 3BQ5A 1A0CA 3AIBA 1I2PA 2VQUA 2H3BA 1NDYA 1L8NA 3BW3A 2X0SA 3N04A 3UR2A 2NXIA 1JG9A 5HA7A 1ONEA 3W2NA 1E1FA 5G1YA 1WQ5A 2DGAA 2ZBTA 3WQ4A 4L4MA 4PFHA 5I07A 3EMZA 3FIGA 3VYLA 1SO4A 1I0BA 2Y8UA 3CEPA 1DWIM 3H2EA 2Z4GA 4M1BA 1Q6OA 4N6FA 1QI3A 1QPQA 1ZENA 1WDSA 3F5KA 1TKKA 5MHBA 4C6KA 3IGHX 2PU1A 1PIIA 2QDEA 2FTWA 3RN6A 6REQB 3FKRA 3LPGA 4BI5A 4IQJA 4YWIA 3QV8A 3FX4A 3RO6A 3TUUA 3QYSA 2PDXA 2CC0A 5JMUA 4MZ1A 2AQOA 3FS2A 3OA5A 1S38A 3GSMA 3CT2A 3CIWA 3TTQA 1W5PA 3OU8A 1WAWA 5AZ1A 2OELA 1W3LA 3ZLHA 4IGMA 4KMQA 5HANA 1GOIA 3EA3A 1W9PA 2YBTA 2YL5A 4IMEA 4RNIA 3UPWA 3VM5A 3M6YA 2WPBA 3C2VA 5GJNA 4RNHA 4LVAA 4CQ9A 3GR8A 1XC6A 5D4YA 5IM51 2ZE0A 1XC4A 2Q71A 3LPPA 5H2ZA 5T9CE 5CEWA 4NAFB 4FR1A 2VENA 4IL0A 1X97A 3EX4A 3MSDA 3RMJA 5CPOA 1PTAA 3NXFA 3K2GA 4HU3A 4PL1A 1NDWA 4DWSC 3NGJA 1IIHA 3ARYA 3V18A 3KVKA 1CLKA 3PAOA 4HOZA 1EIBA 3VIJA 4HHPA 1LM1A 4KEMA 1JUKA 4FXSA 1G4EA 3HB9A 2YKKA 1JYWA 3E5BA 1GQLA 4XSMA 2QIIA 3BOFA 5LIWX 4M1RA 1WBJA 1OADA 4WHBA 3FXYA 4Z2GA 1I0DA 1Z7AA 3AXHA 5C7HA 1J0JA 2FH8A 4QSFA 2IPWA 4AMAA 2CEQA 1DWHM 3GZAA 1US0A 2F61A 1KXTA 1TPFA 1BPLB 3WEZA 1JPIA 1AJZA 4H6EA 3U2EA 3N19B 4GFSA 4JIQA 1SJBA 2FVKA 2FPVA 3P93A 4HVXA 3ONBA 3H55A 3C86A 1WXJA 2VFDA 4JTTA 1GUVA 3T8LA 4WCJA 1OSEA 1BYCA 1TPB1 4C6BA 1A3HA 4WVXA 2JEPA 2DQXA 3UY7A 4QGCA 3Q58A 3NTYA 5E70A 4CN1A 3UXDA 1BG9A 5CAKA 3VIKA 3QMTA 4LBRA 2CETA 4I6VA 3S47A 3L2IA 1ZZMA 4G1KA 4ROQA 1U33A 4XBSA 1RCOB 1OHLA 4EANA 4HZMA 1KM1A 3OZPA 4KWUA 2WWCA 4K1WA 1I75A 3RFAA 3TFXA 1S5TA 1SW7A 1WZLA 4S3EA 4DPQA 2PBGA 3HV9A 4HSHA 2GYIA 3GG0A 4YLWA 3DFPA 3S8HA 5M03A 2OZTA 3VE9A 1JD9A 4UFMA 2QNEA 2PWGA 2AL2B 3V1HA 2VYOA 1EC7A 1KGXA 3F2BA 3UJSA 4A4AA 1US3A 2VGGA 3EWDA 4PRWA 4Y9NA 2Y24A 2B31A 1MYRA 1FQ0A 1ZCCA 1G6CA 4PMRA 5CH9A 3VUPA 3VGHA 3PN8A 1EO5A 2VQTA 1QNSA 3LCXA 4IUGA 2FGBA 1SR0A 4AMCA 4P8WA 1QK2A 4RXGA 4LY4A 2YL6A 1SMAA 3WH5A 1SM9A 3EOSA 3GR7A 2HMCA 1KA9F 1BVWA 2ON3A 1EEXA 4U5IA 5TD4A 4XZMX 4MNLA 1US2A 3A3XA 1O60A 4AX6A 4ZE4A 3KZPA 1OEPA 3E5PA 1T7LA 3ITLA 3BO9A 1QBAA 4IGNA 1A3WA 4PZVA 5LNVA 3P8JA 1OYCA 3C2EA 3NUKA 4O50A 2VVSA 3WLLA 3S5OA 1OC6A 1Z32X 1EJRC 2OX4A 2FYMA 3GKFA 5CPSA 3FSTA 3G6LA 4KH2A 3C56A 4QG9A 4JIEA 4QG8A 3GH5A 3V36A 2FB3A 2CZDA 2VEFA 5IFTA 5FJPA 1C29A 4DBSA 4O18A 1UHVA 3NQBA 4DHGA 2XN2A 3R6IA 4NILA 4D72A 3EB2A 2ACSA 1OG6A 4PODA 3PHAA 4Y9AA 3HQNA 3EGJA 2Q09A 2WSQA 3OB8A 2R94A 3W85A 5K9DA 2QDHA 5GNXA 4HK7A 2PWHA 1O68A 2R91A 1V3LA 1CLXA 1A5UA 3W70A 4QLKA 4IFRA 3S1WA 4LUTB 1LCOA 3LXAA 4O0ZA 5AC4A 1TB3A 3M1ZA 1QXLA 4O17A 3VCRA 5FF3A 2MUCA 3ARUA 1Q7ZA 4H4IA 4P8XA 3TMQA 9RUBA 4K1GA 5HINA 3WCZA 1RZMA 4CU8A 3DC8A 3AMLA 3IUDA 2QUMA 4ZQRA 4DZHA 3WX7A 3BMVA 4G8TA 1F05A 4OOUA 2WKLA 4LAMA 3AMGA 4LUSB 1NQ6A 2WVVA 4HHHA 4CQ8A 2DUAA 3OP2A 4Q4QA 2NQJA 1AFSA 1TA3B 4N42A 3D6NA 2F6UA 1Y5VA 3QV7A 4UFHA 3CH9A 3LMYA 2WANA 3A3WA 1IZJA 1T99A 2ANUA 1ITUA 3HV8A 1HW6A 2OO0A 1W3TA 2HISA 2GK1B 3BUVA 5C2XA 3UXKA 4Q4OA 1GVEA 2JKPA 4IT1A 1W9DM 3L23A 2Z7GA 4GFIA 3COTA 3L9CA 1FWGC 1JPDX 4AVNA 5HMFA 3E2QA 2HTMA 3NVTA 2PLJA 2P76A 2PDYA 4BCEA 3NQGA 4JKKA 3GNDA 4EOUA 5IDZA 1D3HA 4A8NA 3T0CA 4H9ZA 2PI6A 5FAJA 1IR1A 4ML9A 2V2CA 4Y90A 3KBSA 4BF7A 4EK7A 3RGTA 2OTDA 3G1DA 1G01A 4FR6A 1PX3A 1V0LA 1A50A 1MNSA 1H5YA 1KV8A 3I6TA 3DC0A 2AKZA 4UFIA 4X60A 4PCSA 3HGRA 4HZ7A 4NP7A 3NVDA 3QQWA 3FJ6A 3WDJA 4MWAD 3O6YX 1F74A 3RILA 5HATA 5T8GA 3H12A 2GZXA 1V3IA 3EYPA 1A4MA 1YXYA 5LIKX 3U2ZA 2Y7DA 2ZZ5A 3LLDA 4BEUA 3BAYA 2VUNA 1CPUA 3SCQA 4GCXA 3MI2A 2BP1A 1XKYA 4JEQA 1IIGA 3NGFA 1E6RA 2WMKA 4MWAB 1T41A 1UWSA 4DYEA 1GK8A 2BXYA 3TYDA 3L4XA 1BYBA 1RAKA 4AEEA 1UG6A 1E0UA 3GZ3A 4A8RA 3MI3A 1TTPA 5F1UA 2YOCA 5LNRA 4WGXA 1LROA 1TQJA 3L7RA 4GPNA 5DMMA 2F84A 5I3IA 1XIIA 3SCNA 3GU9A 2XSBA 1RLCL 9XIMA 2YR1A 1XLIA 3FLUA 3H70A 4TU1A 1EUAA 4M8UA 1PWMA 2YXXA 4A35A 4CNOA 1X6UA 2ZUMA 3WD3A 3SCRA 1IE7C 3GNRA 3W7IA 3WMLA 3C0JA 4YTSA 3BV4A 2HVOA 5TAOA 3MHUA 1O12A 3WUGA 1PTGA 4JN7A 5EU9A 2WMIB 2J7HA 3I6RA 1K4HA 1AODA 1XG4A 4XKYA 1W56A 1KTCA 4QG6A 1M6JA 3Q45A 1FUYA 1MVYA 2VFFA 1WAUA 5LXEA 1BWKA 4Y7EA 5DMYA 3KBVA 1G5AA 4LH8A 1FP9A 3ZR4A 4QJ4B 1F6YA 4E4PA 3B4UA 4US5D 1J5SA 4OBRA 3N2TA 1MNZA 3REQB 5K9CA 1LTDA 4XIMA 2UY3A 1PX4A 1C93A 3M44A 1YDNA 2TMDA 3ZR6A 1I1XA 3W6YA 4ZVJA 4OQVA 2FPTA 5FF7A 3CO8A 1B4KA 5I2UA 1IR2A 1LRQA 3FEQA 3POHA 2VR5A 1F07A 1VHNA 3LCIA 2NV2A 5HWMA 3IRDA 1SFSA 3OLGA 4J3UA 1S5WA 2QJGA 4UTWA 2NQLA 4HA4A 1A5AA 4FK9A 1Z89A 5EYWA 1MZHA 3APTA 3WUEA 4IXHA 2DZPA 4RZ6A 1JZ6A 4ZTYA 2FDMA 3TROA 2ZKMX 2NT1A 2WJEA 1OC7A 5C2CA 3TC3A 1IT7A 4AZHA 4IUOA 4G5DA 1GNXA 1LL4A 4DZAA 1TPVA 2QCEA 3QMRA 3W38A 3GTIA 3L5MA 4N4QA 1GOKA 1ZJAA 4FOJA 3G1VA 4Q8NA 3VCCA 1X98A 3C3UA 4P2VA 1GOXA 1ITXA 3QR3A 4RE3A 3AIRA 2EG7A 2VNCA 1FWJC 2HZGA 3MHFA 4BA0A 5AC8A 1PKLA 4F0LA 1W2PA 2I9UA 2J62A 1GHSA 3K4WA 3WF4A 3TN6A 3GHRA 3SM0A 2ZZ7A 1LG1A 3BCFA 4URIA 1BWVA 1VCVA 3R13A 1KR1A 6TAAA 3TZNA 3SI9A 4NG3A 2Z1SA 3DESA 4FNRA 2YSWA 1G1YA 1UKOA 1VFMA 5LNSA 4CD4A 3H6OA 4QJ5B 2ZRUA 1TRDA 3TTSA 2UY4A 2HBVA 1LT7A 3ES8A 4IMFA 4LWWA 3W81A 4U33A 5BRBA 1F76A 5BWAA 1DTNA 1KWGA 2V68A 1JUEA 2WLZA 3WQOA 1PPIA 1EPVA 4E5TA 1EJXC 4B3ZA 5JIPA 4H2CA 4FA3A 2XVLA 4IFKB 4N9EA 3EB3A 2EPHA 1T5AA 3OZOA 1DE6A 2WHJA 4TOQA 3M41A 1QNPA 3H2CA 4B5SA 4H00A 5A2AA 3GO2A 4Q6XA 4DQWA 2E6AA 4C60A 5B7YA 3LV5A 2Y7GA 3W73A 1D7FA 3P62A 4JFSA 1QASA 3W88A 4UOZA 5U4NA 1TV5A 1HL9A 2HBXA 3QHOA 3MMWA 1T6MA 3CK5A 1V51A 1HO1A 1QDSA 1TE6A 1OX4A 3G2GA 3B8UA 3CB3A 2DZUA 3HURA 2WJFA 4J3VA 1HVXA 4EIVA 3T2PA 3NZGA 3BSHA 3BG9A 2C3ZA 1JAKA 1CT5A 1QBBA 3W23A 2F2HA 2YDSA 1NP0A 1PXGA 1E4LA 1OYAA 1PV8A 2PDIA 1A0DA 1R85A 4LJ3A 1QK0A 3KW3A 3AYRA 4GISA 4PUKA 4XD3A 4I8DA 3NZQA 1WKYA 1E43A 4IJRA 4WOQA 1DHPA 4D6CA 1J10A 1E56A 3QN3A 1OM0A 2E9MA 2Y7FA 1AG1O 2DJXA 4AVFA 1CGVA 4OHQA 1JGIA 3T55A 3ITCA 1LBMA 1VCGA 4FF7A 2CLOA 4C1LA 1CGUA 3VGFA 1IT0A 1Z8AA 3VNYA 2Z7KA 2ZQ0A 2J9ZA 1G67A 5M1TA 5JBEA 4ZB2A 3OQEA 3CQJA 2W5FA 3AYTA 3WQEA 3QV9A 3DX5A 3LTSA 4BQ2A 4HN8A 4OT7A 3GC4A 2QIWA 2KAUC 1R3YA 2HCVA 1J6OA 2Q3RA 4HPJA 3HA1A 3AALA 2ZXQA 2VJXA 2WYSA 3PBMA 3VFLA 3WBAA 2NUWA 1QRQA 4NXKA 1R6WA 1HP4A 1YIXA 2V5DA 3M5YA 5AC6A 1JZ3A 3N2XA 1UR8A 2R8WA 4MYXA 1SJCA 4XZWA 2ZUNA 4ILSA 5A6TC 3SY8A 2DT2A 1ZTVA 3IVTA 1W1TA 3MBFA 3SCPA 3IAPA 1ZBKA 1UA7A 4GVIA 4D6JA 1FXQA 1W1YA 3PPHA 3UW6A 3K4AA 4UBPC 3BWWA 3MANA 3L5LA 3W7RA 4ZCWA 4P61A 1L9WA 3KAOA 1E0TA 5LHFA 3WDHA 4FF5A 1V7AA 2CLEA 5HR6A 4D71A 1EQPA 1ZJIA 3LHUA 1E40A 3TYZA 3ZQ9A 3H7RA 2XH2A 2VX4A 1XQKA 5I23A 4Z2IA 2PS2A 1NAL1 1P0DA 4AEFA 1KW1A 4PBFA 3LQLA 3VZXA 3WMCA 1D7KA 4RJEA 4DJFA 3CUHA 2I14A 5I02A 1LBFA 1PCWA 2OR2A 8XIAA 4QS5A 3BV7A 2ZUUA 2VD8A 1NWRA 1MEIA 1E15A 4OBTA 3DHFA 1DQUA 2OEJA 2W61A 2GGHA 3ANUA 3UY8A 2XVPA 3GIQA 3OIHA 3AS1A 3SCVA 3TQ0A 2B7QA 2FLIA 3FA3A 2OODA 2OOFA 1LWJA 1TJPA 1VFSA 1RSCA 4RNFA 1EXPA 3AQUA 1HJVA 1NM9A 1MO0A 4MWAC 1POKA 4ZXOA 4IPJA 5ABFA 4D6HA 3ZXWA 5LHEA 4B2DA 2XFRA 3BOXA 2WJZA 1CX9A 4PUJA 4QEHA 2EXOA 3R89A 4EXQA 4J40A 7REQB 2DPEA 3UVIA 3W7KA 3E0FA 2WC4A 1V5XA 2GQAA 1A5BA 5EFDA 1B54A 2RH9A 5FSEC 4H9UA 5HOSA 3G5EA 4OBSA 5HUPA 2P10A 5D38A 3LHTA 4WDUA 2Y70A 1K02A 2VHLA 1VPYA 3EEGA 4OUIA 4AY8A 2VGBA 1QW8A 3QF0A 4B3LA 3L0KA 5D2YA 2VGIA 1N8IA 2H3DA 4W84A 4B4FA 3QOMA 5J5RA 3AXMA 3AHYA 5DY2A 1UD6A 2QJMA 1XLKA 2XIOA 2QUTA 4MB3A 2Q8LA 4H19A 3T42A 2FGLA 3NPXA 3R8GA 3PY2A 3FNDA 2PP0A 3EOLA 4Q8VA 3EOUA 2OJPA 4QBXA 1RHCA 1WO2A 4BFAA 3CIVA 5CSRA 5EA9A 3U4FA 4XWUA 1XIJA 1H2JA 1AMKA 1GKRA 5ABEA 4IXXA 3GTNA 5E6ZA 5FAGA 4A3HA 1UOZA 1E6XM 1XYZA 3TP4A 1Z69A 4HNOA 1BF2A 1TV4A 3VKCA 1P7TB 3UWEA 2XIJA 1JULA 2VELA 5A8GA 1JCXA 4POCA 4H8VA 4HT3A 4RZBA 1H3GA 4NF7A 5HMEA 1R7OA 2OYLA 1YE6A 2VEMA 1KRMA 1XS2A 1RK6A 1Q4NX 2DSUA 2ZIDA 3LB0A 4I9JA 2VFHA 4WY0F 1K6WA 1NFGA 1A80A 4GBDA 3UPMA 2CHRA 1K9EA 4DJEA 4O53A 1VP5A 3E96A 3VGBA 3KCJA 4L64A 2QCDB 1WOBA 3FFSA 5CC6A 3Q4DA 1WUFA 1KWKA 3LRMA 4MPQA 2ZWZA 1E9LA 4UTFA 3ENLA 4AD3A 4X9YA 1B9ZA 4DM2A 1ME9A 5DRCA 3UQNA 4Y6GA 3WLPA 3UA3A 1NDZA 4HYWA 4S39A 1QFEA 4KEZA 1EXBA 2PGFA 3VNJA 1EF3A 3GS6A 2J7DA 3LV6A 2PURA 1GTEA 3WH7A 2O9TA 4MAVA 1V03A 1XW8A 2CZEA 4KRZA 5CBBA 5A69A 3AIUA 3L67A 2ZX6A 3B8SA 5HMDA 2CPUA 2HE8A 4NX0A 4WEVX 1S2VA 4CU6A 3SCOA 4XVDA 1EGVA 1MMFA 2WSRA 2G3JA 3LZ5A 1J0KA 2X09A 2OYMA 3RITA 3WLIA 3OGVA 4KF1A 1RA5A 4O8AA 3A9IA 4O14A 4HA3A 1I6NA 1ONXA 2C1HA 4PUEA 4CVWA 3VDAA 1U5VA 3VC6A 4M51A 4MJMA 1DJYA 5AVHA 1EYEA 1W9BM 1L6YA 4M29A 2QDDA 2OMAA 1T40A 1VENA 3W74A 1GJWA 3I4EA 1VCFA 4L1XA 4CGTA 4ICCX 3CLWA 1QI0A 2V82A 1WX0A 2ZUTA 5CJ5A 4DF2A 1EDTA 2YLLA 4EXBA 5M2FX 1G94A 4IP5A 3NOYA 3DGRA 4F8XA 5CSYA 4HNCA 4GGBA 4HPHA 3JZUA 3I3BA 1VKFA 2POZA 2Z28A 3NQ8A 2JGYA 1UKSA 3RPDA 4M3PA 2PLCA 3WQ5A 2ZA1A 1QW9A 4JQAA 1LL6A 2F6XA 4TQTA 1QOPA 4PUUA 1CI1A 1JVNA 4QDPA 3W72A 1UBPC 1BTMA 4EF8A 1WUEA 2NVAA 1IWAA 1VLIA 4C5YA 2CYGA 3MVTA 3VNLA 4DBDA 4O16A 3P3BA 4F48A 2CU0A 5BMWA 3VD9A 4H3DA 3LA4A 4C91A 1NTHA 2GGGA 3M0MA 3EPOA 6PTDA 1W9XA 1FKWA 3AU6A 2J47A 3C0LA 5A8PA 1NVMA 2XISA 4U2YA 5F2LA 2IXUA 4UTLA 5BXTA 3QTGA 3BSMA 1JZ8A 4Q22A 5D2XA 5DMLA 4HPNA 1HQTA 5D03A 3WG6A 3W53A 1OF8A 4FX7A 2ISFA 2VCCA 4NZ4A 1G4SA 3N18A 3BGAA 1MRAA 5G2HA 3QJAA 3MJMA 3B0VC 4AZ7A 1EKOA 5CPQA 1UWIA 5AC5A 3NDYA 3P61A 4JIRA 1NIUA 5F4WA 1TIWA 1XFBA 1JPKA 3U7BA 3TZFA 2XG9A 3BLLA 1UWQA 3GXNA 3IS4A 3CUZA 5E93A 1T8XA 1LG2A 1QCWA 3NQ7A 3S83A 4HJFA 1JDCA 4H7VA 1EWEA 3EDDA 4JICA 1TV7A 3KBWA 3PK7A 2X1TA 3E2RA 1K7FA 1OWQA 4YVVA 1FHDA 1PS9A 4XQ6A 1PEZA 3QC0A 1ZAJA 1CXEA 2WVUA 3FAXA 3LZ3A 4Q8WA 1AL8A 1TMQA 4F9JA 4W8LA 4PTNA 3TJXA 2E09A 3CGTA 4Q4KA 3E38A 4U4MA 1ML1A 4J27A 3SN4A 3SQLA 3EMQA 5A6BD 5A3HA 3Q65A 2QCCA 1EP1A 5A6SA 3CC1A 4A05A 4MFDA 2XZ9A 5LNUA 2C18A 1EZ2A 5AKQA 4MY9A 4PULA 3QEZA 1N7KA 2D2JA 8A3HA 1R3QA 2VZTA 1F6PA 5B7ZA 2E28A 2Z0IA 4ORMA 4W8AA 3AYVA 5MF5A 3M5ZA 3RLHA 4FEZA 4DUOA 3Q2DA 1FWAC 2GSHA 1ZBCA 2Z2UA 2XIBA 5DBTA 4RDZA 5JU6A 4D6IA 4PMJA 3GYEA 4LBUA 1W1PA 1X8FA 4JN8A 3FDGA 1E1CB 4CN4A 3AUJA 3I6EA 2I57A 2WAGA 1D3CA 4B5UA 4O1AA 4CLMA 1X1NA 3VTRA 3PUDA 1I45A 3BE7A 3SR7A 2C1IA 2BBFA 1ME7A 3NZRA 4O12A 2D24A 4LUIA 7XIMA 2CZVA 4V28A 1MQRA 4I3GA 1P43A 1TJ1A 1XBYA 3BG3A 4AC7C 1ZCOA 4IG2B 1E6PA 2EO7A 4PMNA 3DH7A 2XUCA 4UZUA 4ML4A 2Y6ZA 4J9JA 4JTRA 3SY5A 4E2DA 3ABXA 5KZMA 5BNKA 3S5NA 1UP0A 3VIGA 4KERA 3VINA 2RAGA 4UTTC 2C79A 3CV1A 3ITVA 1GG0A 1WKEA 3ARZA 4YN5A 3KUMA 1KFWA 4RV3A 3EKGA 3WK2A 3LGEA 4GHRA 1RD6A 1EJSC 3O16A 4TV6A 1A47A 3A13A 5EB8A 2FDSA 5AC7A 4MM1A 4K37A 3IJ7A 2WHLA 4AH7A 1W91A 4PMQA 1FY6A 3RF9A 3VKJA 3RPMA 1V02A 3WFZA 3ZVHB 4K6AA 1EBHA 4KPLA 1HGWA 5DEZA 2E1DA 4BQ3A 3BAKA 2V6AA 1VD6A 2J24A 1EZWA 2O0TA 1E3XA 2CLFA 2WBGA 1J0IA 4Z1AA 5KITA 3GDRA 2CHOA 3L2MA 5BRPA 5D2WA 1CXKA 5G1TA 2FZNA 1KTNA 4WY0B 1ZB5A 4CQCA 1LJYA 4PRTA 2DVXA 5D02A 2WOQA 2PGRA 4R7OA 1JQXA 2PTZA 2XGBA 4E8CA 3PZGA 2V3DA 3FSUA 3HF3A 4JX6A 1CTNA 1Q5MA 5G4WA 4F0MA 4IQEA 1VS1A 3OQ8A 3BH4A 5E0KA 2Q8XA 1YNPA 2W66A 4CNTA 1CWYA 3XISA 2E68A 1DJGA 5ECUA 6XIAA 4YXGA 1PB0A 3U0HA 2QUNA 5AHFA 5DFAA 3GG8A 3NL6A 1H11A 4ZEPA 5CPTA 5I3HA 1W9VA 3AHTA 1JXKA 1YBQA 4GWEA 1DIOA 3UT0A 3M16A 3MVIA 3F1QA 3J7HA 1SZGA 3KE0A 1LWHA 2QQ6A 1UR2A 3AYSA 2JEQA 2OWWA 3T05A 1DJQA 2QCNA 4DBEA 4A29A 2VUYA 2J6VA 2IKIA 3EDJA 2J88A 2FHFA 1XBVA 3W7CA 2CLKA 2X7VA 4GYFA 2WCAA 3VIMA 1BQCA 1UYQA 1G7UA 2G0WA 3KLKA 5HJYA 4J5NA 3H24A 1X96A 4KWOA 4OFCA 3NQDA 5B80A 4GI9A 1PZ1A 2BODX 1XIEA 2A2IA 4J4KA 4JPGA 3PZOA 4BI6A 3UNTA 4WXYA 3S5SA 4MJZA 1UKPA 1EHAA 2NWSA 4IWWA 3AI0A 5JBDA 5EMLA 2DV0A 1KFCA 5EMKA 1FWWA 3VKKA 4MY1A 4NASA 1DPMA 4QP0A 4Z1CA 3THCA 2JKEA 3WUBA 3CS2A 4UQCA 2AOSA 2ZTJA 5J5DA 1QHZA 3QR0A 1K7XA 2VFGA 1P48A 2IQ0A 3UJRA 2FPYA 2WKJA 3LLXA 3OOQA 1JJKA 4O4VA 3N3MA 3D3AA 1JDFA 4LSBA 1W3IA 1VHCA 3N17A 1S1RA 4MY8A 5I09A 2V9DA 3S42A 3UPBA 2PWDA 1OFQA 3TAKA 1UZ4A 3CV6A 3ZZ1A 3VD5A 1K8YA 3EEZA 4DWSA 3LRLA 4J3TA 1NJJA 2GQ3A 2BMBA 3VIIA 4XB3A 3MKVA 1UOKA 4EWJA 1Q65A 1S39A 3VDHA 2OLAA 1CGYA 3IJ6A 1C8VA 2PGEA 1J5TA 2O9OA 1DE5A 4F0RA 4UQDA 5GNZA 4QFUA 4QJ1A 3CZEA 3E02A 1PYMA 4EPDC 5BXRA 3SZ8A 3VDCA 1UP3A 4FO4A 1KB3A 2BHYA 4DJDA 1QTWA 2A6NA 2E9LA 2DJLA 2Z2BA