3GUWA

Crystal structure of the tatd-like protein (af1765) from archaeoglobus fulgidus, northeast structural genomics consortium target gr121
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
233
Chain Sequence
YFDSHLHSEGLGFSELVKLKENGIKEVCSLAFFPVKPKYPQTMIDVFRKLTEFEPLRCEAAGVKMHPAVGIHPRCIPPDYEFVLGYLEEGEWVAFGEIGLELVTDEEIEVLKSQLELAKRMDVPCIIHTPRGNKLKATRKTLEILESLDFPADLAVIDHVNFETLDMVLETEYWIGLTVQDAARIVAEHGERFMLNSDAGYRVAEAAVKIEEAVGREEMEKVARENARKFLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein AF_1765
publication title Northeast Structural Genomics Consortium Target GR121
rcsb
source organism Archaeoglobus fulgidus dsm 4304
total genus 56
structure length 233
sequence length 247
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3guwA00
1FWGC 3FEQA 1J79A 4I6VA 1RA5A 2F6KA 2Z4GA 4F0RA 2PGFA 2QT3A 2VHLA 3OJGA 5FSEC 4C6PA 4GY1A 1P6BA 3A3XA 4UBPC 1QW7A 1QXLA 3WZ0E 2D2JA 1FKWA 3ITCA 3N2CA 3TN3A 3UBPC 1M65A 4C5ZA 4GZ7A 3G77A 4B3ZA 4KIRA 4C6JA 2ANUA 2D2GA 4R88A 4V1YA 4EPKA 4QTGA 1KRCC 3ISIX 4IF2A 3GTHA 2G3FA 4IH3A 2QVNA 2FVKA 4HA0A 4C65A 3FDKA 4IFRA 4QSFA 4V1XA 4RE0A 3SFWA 3LGGA 1A4MA 3NEHA 4LAMA 1KRBC 4LAOA 5A6TC 1YMYA 1EJVC 2R1MA 5AKQA 1K6WA 3MJMA 1NDVA 3IJ6A 4NP7A 4KERA 4MUPA 1UIOA 3QY6A 2PLMA 4INFA 3MDUA 3KM8A 3T1GA 3E38A 3F4DA 1GKQA 4H9VA 1A4LA 1PSCA 1YIXA 4RZBA 2AQVA 4C60A 2UZ9A 4XAYA 3WMLA 4AC7C 2FTYA 4IQJA 3GIPA 1WXZA 5HMFA 3PBMA 2WJEA 4C6CA 1ZZMA 1XWYA 2WJFA 3A3WA 3R0DA 4J35A 4QS6A 3V7PA 4HK7A 4KF1A 3ICJA 3EGJA 4UB9A 3LA4A 3QY7A 3O0FA 3URAA 2XIOA 4M51A 4DO7A 2Y1HA 4H9MA 4C6IA 1R9ZA 4LCSA 2Q01A 1RJPA 4QS5A 4R85A 3PANA 4EPEC 4LCRA 1YRRA 4IFOA 2VUNA 4GY7A 3AU6A 3ORWA 4EPBC 4RDYA 4ERIA 4E3TA 3S2NA 2Z2BA 5LXXA 3HTWA 4C6DA 2R1NA 4EPDC 1UMLA 4C6KA 5E5CA 3DCPA 2BB0A 1FWAC 1I0BA 1RAKA 3LGDA 3RHGA 3UPMA 2VC5A 4OFCA 3BE7A 4XD6A 2DVUA 1M68A 1K70A 2W9MA 4H9XA 1J6OA 2Z00A 3NQBA 1FWEC 4RDWA 4H9ZA 3GTFA 2BGNE 4CQCA 4KESA 2VC7A 1PTAA 3F2DA 4B92A 1KRMA 1NDZA 4R7WA 2HBXA 2YXOA 3OQEA 3LU2A 2QPXA 2HBVA 4LANA 4LH8A 1V51A 4KQNA 4IGMA 4L9XA 1ONXA 1XGEA 2IMRA 3LSBA 4EP8C 3IACA 3FDGA 1FWHC 4CNTA 3LNPA 2P53A 2AQOA 1JGMA 2OODA 4HK6A 4KEUA 1UIPA 1A5OC 1POKA 2GSEA 1EJSC 4CNUA 2YB4A 1FWBC 4LALA 1RK5A 2DVXA 4F0SA 3AU2A 3MVTA 1EJRC 1EYWA 2R1LA 4C6QA 3GU2A 4GY0A 4LFYA 3UF9A 4DI8A 2FFIA 2I5GA 4AQLA 2PUZA 2D2HA 2GWNA 3NURA 3AUOA 2DVTA 1W1IE 4C6FA 3URQA 4PBEA 1K1DA 4G2DA 1O12A 3B0XA 3TN4A 4C6EA 2CZVA 2OQLA 4XD4A 4RDVA 3E0LA 1WXYA 3EWDA 3F4CA 2KAUC 2Z24A 4GOAA 3IV8A 4PBFA 3MSRA 1FWJC 3CJPA 4H9YA 2Z28A 2R1PA 2YZ5A 2EG7A 3LS9A 3TN6A 5HMDA 4C6MA 2ZC1A 4TQTA 3RN6A 4DI9A 1GKRA 3OU8A 1R9YA 1E9ZB 2Z29A 4H01A 4IFKB 4KETA 3T8LA 3IARA 1V4YA 1FWCC 1NDYA 3PNUA 3S2MA 4Z42C 5G4HC 1DPMA 3B40A 4WHBA 1YNYA 3UR2A 3MDWA 2UBPC 1KRAC 1VFLA 1V77A 3GTXA 2ICSA 1UBPC 4QRNA 3GU1A 1YBQA 4IG2B 1PB0A 3HM7A 3OVGA 4GX8A 3MPGA 4B91A 2QS8A 3T81A 2E1WA 2Z26A 4PCPA 2RAGA 3DC8A 1EJUC 3IRSA 3OOQA 4BJHA 1BF6A 4GBDA 4D8LA 2EG8A 2GOKA 4C6NA 4F0LA 2FTWA 1ITQA 4CEUC 1EJWC 3LSCA 4GXWA 3HPAA 4C6OA 2P50A 4GC3A 4XD5A 5FSDC 4LEFA 2O4MA 1RJRA 4DIAA 2Z2AA 1XRTA 1A5NC 5CH9A 3S2LA 3A4JA 1ADDA 1RA0A 2Z7GA 1A5MC 3SO7A 2Z25A 3GTIA 1YBQB 3MTWA 4WVXA 2OOFA 1O5RA 3S4TA 3WYZA 1GKPA 3B0YA 2HNHA 2OB3A 3TN5A 4GK8A 4DLMA 4CQBA 1FWFC 1R9XA 4IGNA 4J2MA 3K4WA 3GUWA 3OODA 3E74A 2HQAA 4J5NA 3RYSA 1J5SA 3DUGA 1KCXA 3K2GA 1HZYA 4B90A 3D6NA 3MKVA 2WJDA 4CEXC 4XAFA 4KEZA 2AMXA 1IE7C 1XRFA 4GX9A 4DYKA 4I6KA 4PE8A 1EJXC 4IFKA 3UR5A 1A5LC 4G7EA 1I0DA 3PAOA 2O4QA 3K5XA 4YIWA 2A3LA 3GU9A 3O7UA 4KEVA 1EZ2A 4DZHA 1NFGA 2GWGA 4P5UA 4DZIA 2YB1A 4GYFA 4BY3A 3QGAC 1FKXA 3F2BA 4DNMA 4LCQA 2GZXA 4CQDA 2PGRA 3GG7A 1A5KC 3URNA 1J6PA 4XAZA 4IG2A 4HJWA 1P1MA 3EWCA 1EJTC 4H9TA 4C6LA 4NI8A 4NG3A 1ONWA 2E25A 3CAKA 3LY0A 4ICMA 3QGKC 3QY8A 4QROA 1PO9A 4JOMA 2VR2A 2FVMA 4PCNA 4WGXA 1V79A 2WM1A 3C86A 3E2VA 1V7AA 2OGJA 4G7EB 4ZSTA 4L6DA 2HPIA 4LAKA 2PAJA 2Z27A 2HPMA 1E9YB 4DLFA 3E3HA 3F2CA 1NDWA 2I9UA 3RCMA 1FWIC 3JZEA 2R1KA 3TNBA 4C6BA 4C5YA 1POJA 4ERGA 4ERAA 4RDZA 3IPWA 3E0FA 3GRIA 4HK5A 2ADAA 1RK6A 2EG6A 4XAGA 1RJQA 3GIQA 3URBA 3CS2A 3PNZA 4CNSA 2Q09A 4H9UA 3S2JA 1EF2A 5HMEA 4ZSUA 1S3TC 1FWDC 3ID7A 1M7JA 2VM8A 1P6CA 4H00A 3MVIA 4BKNA 3IGHX 4XD3A 1ITUA
chains in the Genus database with same CATH superfamily
3P61A 1W56A 3O6YX 3W1AA 2X0YA 1RA5A 1DP0A 4L4MA 3H70A 4YHEA 2WSPA 1VBRA 3O6CA 4HSNA 3UETA 5DBTA 1XLLA 1DTNA 1P6BA 3RPDA 3FAXA 5DMMA 3F5LA 2D24A 3KDOA 3UBPC 1P0EA 3A5VA 3SM0A 2ZKMX 3VNJA 2ANUA 4V1YA 5FCZA 1Q7MA 3W75A 3AS2A 1TVPA 3CUFA 2C14A 2PTYA 4XX6A 1Z6KA 4U5IA 3EBVA 3FA4A 2INZA 1EC7A 3NXLA 4UQ9A 5D2XA 4GGHA 4ZQRA 1A4MA 2ZUTA 3WEMA 1TV2A 1VBHA 3F5JA 5DY2A 4RZ6A 2BHYA 2I17A 4XZMX 2R1MA 3PULA 4EK7A 4BF5A 3LD5A 1UIOA 3IGXA 3CYJA 3WL1A 1JYNA 5LHEA 2FYMA 1S2WA 3MZ2A 1PSCA 3E12A 1GNXA 3N6JA 1B3ZA 1OADA 1F05A 4IQJA 3R12A 1R87A 4IT1A 4UTHA 4S3JA 2WJEA 3ANUA 5BMXA 4QLJA 2QCLA 3WF1A 4JXCA 2X1SA 3H7VA 5AVHA 3MHFA 3PZTA 4L1XA 3KOZA 2VR5A 1KWGA 3EGJA 4HT3A 4PMXA 2JF6A 3MUY1 4XIAA 4FR6A 4BQ2A 4AF0B 3QOMA 5FI8A 3EWYA 3KBNA 1LLZA 4DO7A 3OP2A 1WDWA 3PB0A 4MPKA 5I78A 3KBJA 4WOZA 3F4WA 2X40A 2D22A 1H60A 1UA3A 4R3UA 3WELA 5LXXA 4C6DA 1UMLA 4WSKA 5GNZA 3VK5A 2VDIA 4B3KA 3KRSA 1EF3A 1A0CA 1WKFA 1SVDA 1TQXA 4DJDD 1EB3A 2EKGA 5HWNA 3TAOA 1OT2A 1X97A 3GYCA 3W27A 1UHVA 2I9EA 3GAYA 2J47A 4AXKA 1JD7A 3T40A 4QGCA 1B90A 3PK7A 2E5DA 3WF3A 3W74A 4A21A 3W25A 3LU2A 3MO7A 3QH2A 3QPZA 2Y61A 1TPUA 4HIBA 3H2FA 3LLDA 1BXBA 3FV9A 1GHSA 1QDSA 3GTNA 4M5PA 4RE4A 1O6IA 4NF7A 4EP8C 5LA1A 4B3LA 5C9RA 1B3WA 1QW8A 4HK6A 4I3GA 3FVMA 1W9XA 3THUA 3UXKA 1O1HA 4UQCA 1CB7B 3CUHA 2QMKA 3DFOA 3C2FA 1MEWA 3PFMA 2VZSA 2J8FA 4QCEA 1V03A 1Q2SA 1KTNA 3S5YA 1HJWA 3OLEA 4NI3A 3DYMA 1W3KA 3URQA 4IP4A 1GVIA 2QULA 4K37A 3SGGA 1B57A 2OZTA 3E0LA 4PBGA 1PZ3A 1EUNA 1XIHA 1FWJC 3RPMA 4R34A 5A8QA 2YZ5A 3W23A 2WQDA 3FY1A 4GISA 2F7FA 5MKGA 1ESWA 4QDPA 2DSUA 3T8QA 2ZZ2A 2DW7A 4KETA 3PB2A 5FACA 3NPXA 5IHSA 2YCIX 3KOYA 5CJNA 5EFDA 5G1TA 1W1TA 5G4HC 5HNRA 4XVEA 4IX0A 3UJSA 1ISWA 3EXRA 5F4WA 1ITXA 3W28A 1B3VA 2X41A 1VPQA 5GNYA 1DL3A 4W87A 3O05A 1JGIA 1YBQA 1VBGA 3T2PA 3ARRA 2VGGA 4ENLA 1TRIA 3MPGA 3USZA 1UWIA 1TR9A 4DYEA 5CXPA 3M43A 3TK7A 3N9KA 2WLYA 3VKKA 3W87A 1GOXA 5C6MA 2OX1A 1CNVA 1VPYA 1RXOB 2FZBA 2WMIB 4FK9A 1QI4A 3XINA 1XRTA 3T4CA 3MUAA 1SR9A 1K7FA 4MYXA 1ZALA 1Q6DA 3SO7A 1LOLA 1QJWA 2X0HA 3GH7A 1ZBWA 3GNPA 2GJLA 3WYZA 4X60A 2ZUMA 2INEA 1NOUA 4PSPA 2X05A 4CQBA 2NV2A 4J2MA 1Q63A 4Q4PA 3K2GA 3TV8A 4ECLA 1X6UA 1N82A 4H83A 1HF6A 4LJ3A 1XRFA 1NM9A 1MEHA 4GVGA 2BP1A 4DY1A 1VKFA 1UZDA 3UR5A 1WUEA 1S5NA 4YIWA 4R7OA 4S2BA 3BAJA 2GGHA 2XWEA 4FO4A 3S1WA 1JYWA 1FWWA 3FGCB 2XZ7A 4X9YA 4OIFA 4CQDA 1FBAA 3VD4A 4ATDA 3ES8A 3HGOA 3M5YA 5HR7A 4TVDA 1BHGA 1PKNA 3LHTA 2VX4A 3W29A 2W66A 6REQB 3BMXA 2BWGA 1XGDA 3UCQA 2WHMA 1BXCA 3UJ2A 3BOXA 3VCRA 2GK1A 3BJTA 1DJHA 1EPXA 1TTIA 5BXRA 5FJTA 3TNBA 4C6BA 4RLIA 1YADA 2ZFAA 1ZJBA 3DECA 3APYA 4O4WA 2BOGX 1RK6A 1SJCA 4GUIA 2VX6A 3M4HA 4BI5A 1KFKA 1T6MA 1P6CA 1CTNA 3L4TA 3U3HA 3IGHX 3ALFA 4J4KA 2J74A 1SSGA 4RPQA 2PC8A 1TPEA 3CL7A 3WJSA 1R5YA 3ZFHA 2OEJA 2DORA 3MCMA 1V3IA 3ZJ6A 2VFFA 3TEVA 5AC5A 1UP2A 2O56A 3W7KA 2DW6A 3GC5A 4LUYA 5K2ZA 5LNVA 3WZ0E 4V33A 4EANA 3ITCA 4LVDA 5XIMA 3TN3A 6XIMA 3H53A 4HJFA 3AXMA 5E0FA 3D0CA 2YDAA 2NUWA 4B3ZA 1WCGA 2XIMA 4UQDA 3MC5A 4I9TA 3R43A 5T26A 4I5RA 3M7WA 3VOIA 1GVRA 2QPSA 2ZOXA 5D2YA 3REQA 3NEHA 5K3VA 4D6FA 2ZYFA 3STGA 1HG3A 5C8BB 1AODA 4PMDA 1DQXA 2PRMA 4KCTA 1LWJA 4NUWA 5A6BA 1HFBA 1YIXA 5C9UA 4AIUA 2VGIA 3LXAA 4LSBA 4PTNA 1YDOA 3W7PA 1W37A 3WLNA 4PR4A 1GVYA 3OBEA 4M29A 3RAOA 1YXYA 1DJGA 4KF1A 4C7GA 3I68A 1F6KA 1XP3A 2CITA 1KB3A 4PRRA 5BW6A 1RVKA 1ALDA 1YW1A 3BAXA 5I3KA 4JZ5A 3URAA 3SN4A 2G3IA 3NCOA 2DZSA 2YIHA 1TPH1 4K68A 3S1GA 3LV5A 4F4RA 1QFEA 2ZICA 2I16A 3WK0A 2HVOA 4XZNX 3H6OA 3EKGA 2WCSA 3PUDA 3LN3A 3OZYA 2J8TA 4O50A 2CZFA 4ML9A 3CB8A 3UPMA 4GJ1A 4ZQCA 3ARQA 1RQHA 4OKDA 1E55A 5D8WA 1RLDA 1RBLA 3ARSA 4YXGA 4TMCA 4NAEB 4YVVA 1E6PA 2Z00A 2H9AA 3GTFA 2TYSA 6PTDA 2V9DA 2OR2A 4QAWA 1MFVA 3TMQA 3OA5A 2XH2A 3KL3A 3CYVA 1SW3A 2X16A 3QRHA 3SFKA 1H7NA 2B7NA 3ZS4A 2F8QA 3S9YA 4XZ9A 5KZMA 2GJXA 2NQ5A 4UFJA 2J75A 1QW9A 1GW1A 1S1RA 1Z8AA 5EMYA 1N2VA 1F4AA 4WJXA 2UY2A 3AIVA 3VINA 3GR4A 2OSWA 3L65A 4E4PA 1L9WA 4FZIA 5A6MA 1KTBA 1JPIA 3JW7A 1VF8A 4N4PA 1C91A 3M47A 1BF2A 4LFYA 3DESA 3OBAA 4XG1A 3RPTA 4DJDC 1HJXA 2WKLA 1EGMA 4JKLA 2WNZA 3E0WA 4JQAA 3RU8X 3S47A 3N18A 4LAZA 3QXBA 3W1XA 4RDVA 3OVPA 3I3EA 2NXGA 1WP6A 4GOAA 3CJPA 3ITOA 3U2CA 2V8ZA 3T2OA 3Q94A 3HPFA 3SJ3A 1XRSA 5DBUA 4FLRA 1GKRA 3TH6A 3ARVA 2O7SA 1FWCC 1F9CA 2VDHA 4A8LA 1OYAA 3AROA 2XVKA 4GINA 3QW3A 2I56A 3UR2A 1I2RA 3HZ3A 4MJ4A 2BTMA 4IMCA 2FH8A 3L5AA 1FX6A 2ZDRA 1JRBA 4OBRA 1E6XM 2VVNA 2RAGA 4M0XA 4MWAA 1S38A 3TTSA 4C90A 1BWLA 4IIFA 3D3FA 3C61A 1EJWC 3KHJA 3ZR6A 4OZOA 4CCCA 3NO1A 2FHBA 5AHFA 1A5MC 2JGQA 4QISA 2CLEA 2WVUA 3OLGA 4DXKA 3QZEA 3V1HA 1F3EA 3M0IA 4L9ZA 4CNPA 2OB3A 1W1PA 3BVJA 3TN5A 4B5TA 1XH2A 4B5SA 5A8NA 2VGFA 1YE6A 4E6MA 4ICCX 3B8WA 3B06A 2TPSA 2PRHA 5EMLA 1VIZA 1OF6A 3NZ1A 3A64A 4HYVA 3WFAA 3MKCA 1UWTA 3VMOA 1TX0A 1ZJAA 2GUYA 3QV7A 2I5IA 1MFUA 1LDCA 1WZAA 1FTXA 3NZGA 4DZIA 2C13A 1XSKA 2YDQA 1Q5MA 1ZL1A 5M3WA 4XIMA 4UTFA 5BWFA 4HJWA 3GXIA 4A2SA 4WXZA 1TJRA 3BAKA 2E8ZA 2QCHA 5A8GA 4ZQNA 3BW4A 3W7JA 2O9TA 3PVFA 3OIHA 3PTKA 4QAIA 1IZCA 4WGXA 2OGJA 1G4TA 2V6AA 2ZX5A 4LAKA 1GTHA 5D37A 3F2CA 2GQ3A 2CXGA 4NQ1A 3UG3A 5JUVA 4DJFA 1E71M 4HHLA 1KNWA 4AZCB 1W1B1 2DDXA 4D6JA 3TWBA 2ADAA 2BY3A 4FNSA 1K9DA 3WLSA 3BG3A 2ZTKA 1F3WA 4FX7A 4JIHA 3RRAA 3S2JA 4O19A 1HKKA 3WQOA 3ARYA 4ZGYA 4H00A 1J9YA 2VT0A 3B4UA 4XQ6A 4LS2A 4HQVA 1UCWA 3BK0A 4KCWA 2WNNA 4PCSA 4F0RA 2ZRXA 3FHAA 4CU8A 3B0PA 1RQEA 1LOQA 4I9JA 2OSXA 4GVFA 4UNIA 1QW7A 4AEOA 5HA7A 2B31A 4EAMA 3LBOA 4NJHA 3IANA 5FL0A 1AZ1A 1IIGA 1TA3A 4G6CA 1JYXA 4GZ7A 4RL3A 4MJ2A 3GNOA 3N4FA 4C6JA 4MB3A 1KFCA 1C8VA 3NQCA 4FSAA 4WXYA 2VDGA 1BD0A 1R3SA 2QDHA 2YL5A 1XDMA 4LAMA 3PBGA 4K8GA 1LQAA 3HN3A 4DO4A 4ZMGA 2TMDA 3TW6A 5AKQA 1K6WA 4HVXA 2QGHA 3MKKA 4DAFA 4IPPA 4AMAA 3IJ6A 1K8XA 2NQZA 2PLMA 1P4CA 3MDUA 1S5MA 3W1NA 1W5QA 2ISSA 1F8MA 4FLSA 3F4DA 4H9VA 4P7LA 1FDZA 2EHHA 4HYWA 1TCMA 4HKPA 1WXZA 3PBMA 1C9DA 4BI6A 5CZSA 4JNZA 3WLOA 3IEBA 1SSDA 1XLFA 4QITA 3MYOA 2MANA 1F3TA 5JBDA 1KM5A 2GVJA 2VNCA 3SRDA 2BODX 4DPQA 4JDBA 2YR1A 1L6GA 4NAFA 5EMKA 5G1MA 1Q8AA 3VOGA 1XFBA 4MGGA 1G4PA 1A3XA 1Q3NA 1QBAA 1JZ3A 4GY7A 3JZUA 3FSUA 2XSBA 3O15A 2INFA 2DFAA 3BPWA 3RRXA 2P3ZA 3PTQA 4N42A 2ESCA 4C6KA 5E5CA 3CTTA 2VCBA 4Q8QA 1LT8A 3CAVA 3AHXA 3KWSA 4BWLA 1C92A 3W02A 3L68A 3BSMA 4CU7A 4PRWA 3TAKA 3UPBA 2RJHA 4NXKA 4E2VA 3GG0A 2GGIA 3B4YA 4JICA 2FPTA 2VC7A 5C7HA 2J6XA 4JHMA 3EX4A 3P82A 1KRMA 1Q6OA 1A49A 4RW5A 3DG7A 4Q8UA 3WLKX 5IDZA 3BSHA 1TG7A 4KQNA 2Q02A 4A8NA 2E6YA 5BU6A 4E8DA 4G1NA 3LSBA 4AVFA 4DUWA 2ZRZA 4ZO7A 2P53A 1LWHA 4IPLA 2HXTA 4FAMA 1C7TA 1RH9A 2E9LA 1EX1A 1UIPA 4AZGA 2ZVIA 1KFEA 1AK5A 4UC5A 3WDPP 2WC4A 5TBOA 3R89A 5C5YA 1GPWA 4QEEA 5DXXA 3TW7A 4DVOA 4L6OA 2CBUA 1BYAA 1XDLA 4DBWA 3G1SA 2D2HA 1T5AA 1I2QA 3NURA 3RNDA 4EXQA 4HU3A 3S9IA 1U1JA 5BOEA 3HFTA 1XQKA 3W24A 3HQOA 1WXYA 1UB3A 3BW3A 2XFWA 2V0TA 4CN6A 5A8OA 5HMDA 3PWGA 3VDHA 4K38A 4LQ1A 3QHNA 1E9ZB 2HV5A 3RK8A 2EAWA 2YCJA 1HO1A 1IXNA 3R13A 3GFXA 1AQMA 3A4WA 1TUXA 4ZZ9A 2E8YA 3W7MA 1GQKA 1BWKA 3VNZA 1TZ7A 2J4GA 3CEPA 4LGXA 4YMZA 1UOKA 2GDVA 2JFEX 1FWSA 1L6FA 2GVGA 1V6YA 4WCJA 4JDYA 3KX6A 4FPSA 3AIUA 5HANA 1D2KA 4IJRA 4DZ5A 4IOTA 3S5OA 1PKMA 1DVJA 1KCKA 3OOQA 2XVNA 4C1KA 1XF0A 3IUDA 4JTDA 1VC4A 2XN0A 3O06A 1HL8A 2Z1SA 2P50A 1OC5A 1IIHA 4GH1A 4DIAA 1NOWA 2PDFA 3SGUA 4TO8A 5CH9A 2ZUSA 3TTEA 2IKIA 2NX3A 1UD3A 1YBQB 2J79A 2Z0IA 3UXDA 2E0PA 2OU4A 2TODA 4J3XA 3W53A 4M7SA 4AWSA 4L4LA 4P8WA 4GK8A 4AB4A 1K8CA 3POCA 3EX2A 4I8DA 3DH7A 1FCQA 1XLEA 4B90A 4O1FA 3H12A 3R94A 1OIFA 1GOQA 4IMAA 1U5VA 2WJDA 1FDYA 3WH9A 3GDRA 4XAFA 4KEZA 4PFMA 5HK4A 4H2CA 1C7SA 3NGFA 4WY0A 3N17A 3W88A 2A3EA 1IF2A 4KW2A 2QUMA 4DWDA 5D03A 1XKJA 4H6EA 4QE1A 3ATYA 5CZJA 5F2IA 4LCQA 3QTGA 1K7XA 4JTEA 4IG2A 4H9TA 3ZT7A 4W7UA 1XH0A 3STFA 3TYBA 1UH4A 2VR2A 2Y5EA 3N2BA 2PS2A 3CIXA 1JDAA 1JDDA 5I03A 3M5VA 2CLKA 2VZVA 5EMJA 3EYPA 1FWIC 5CGTA 1L6WA 1POJA 1A47A 2FB2A 3E0FA 3PTMA 4GMEA 5DO8A 4YN5A 1L0PA 3W71A 2CHNA 3RCNA 1XXXA 4W89A 2FHCA 3HF3A 1S3TC 5H8UA 2MNRA 3QW4B 4LY4A 3TFCA 4XD3A 3GDTA 1TZ9A 2RDUA 3W0KA 1MDLA 1OIMA 7A3HA 2Q3RA 2WKGA 3CH0A 3H22A 3LCWA 4P7NA 3UPWA 3VXGA 1KCZA 3OJGA 1TTQA 1ZBCA 1P5BA 3B9DA 1DWJM 1XCFA 4AHQA 1U22A 1YPXA 2D2JA 3OHIA 3S8HA 3IK4A 3DZ1A 3NQAA 1JDFA 2W67A 2VFDA 4AWEA 2OWCA 5LIKX 4R33A 1CPUA 2GSJA 2QF7A 2O9OA 4IFRA 5J5RA 1O5XA 2PE4A 3P60A 1KM1A 1Q85A 1SZFA 3KW3A 3BLOA 2FZDA 3WUEA 1TPB1 3DFHA 2XVGA 2WANA 3BMWA 2DV0A 1EJVC 3EXSA 2PWDA 2G41A 1R38A 4AC1X 3KEHA 2NW0A 3VGDA 2VZUA 3EX6A 3HQ1A 4JTRA 4GRSA 1FP9A 3DG6A 3DBNA 5IRPA 1ZUAX 5EA9A 4S3FA 3GBEA 3CGTA 5JIPA 3T0TA 2G8ZA 1XHGA 1XG3A 3CQ0A 3APTA 3W7QA 3EXTA 2E1DA 4QS6A 4QG8A 2HS6A 3EDDA 3HV9A 3MMTA 3EPOA 3VX0A 1JNEA 2REQA 1UD6A 3CV2A 4O28A 3I6EA 1IEQA 3VUPA 3NL3A 2Q6ZA 4Y7EA 3VNYA 1KM4A 3W2LA 3L67A 3MWAA 3ZVHB 2E9BA 2WYSA 1G01A 4L65A 1FHVA 3PZ9A 3ORWA 2BY1A 1GJWA 2AQWA 5IBXC 3HURA 1KQYA 4O14A 1F6YA 2E6DA 3RIKA 3MMDA 3KHDA 2DUZA 5I06A 2YYTA 1ME7A 1FWAC 3PZNA 2Q8XA 4MZ1A 4DF0A 3R2GA 3LGDA 3RHGA 5LIXX 1R3QA 3BUVA 4ADTA 3W7DA 2BMBA 1M7PA 1KLZA 1K70A 3FJNA 2OYKA 1DWAM 3K30A 4MAVA 3MMWA 2Y5SA 3NQ6A 4WF7A 5CBJA 3WNOA 4KWUA 3LQGA 5HWJA 5CC3A 4GE8A 4DM1A 4KBXA 3UG5A 3U5UA 3GX9A 5CJMA 4Y9AA 1HKMA 4Z08A 2EPKX 1QPRA 2OKOA 4UMBA 4LAUA 3M0XA 4WOQA 4JHZA 4LRTA 1RCXB 3KOWA 4GZIA 4UQAA 3RILA 2H9AB 5HNTA 3HA1A 1FWBC 2HWGA 1KM2A 3EWBX 4HPHA 3AIBA 1O1ZA 2BXVA 4OOZA 3UVAA 3S46A 4AY1A 4AQLA 2ZWZA 4X9SA 3VZYA 5FESA 4N6EA 2GJXB 3CHEA 4F3HA 2ZX9A 1DHKA 1BG4A 2QJGA 4AUBA 2PU0A 4DBEA 2XIBA 1P7TA 3VKBA 5HQEA 4BK9A 1A5AA 1HX0A 1OX4A 1Z9AA 3CB3A 1TCDA 1SJAA 1RALA 3LERA 4J2PA 3QPYA 3MSDA 3BQ6A 7TAAA 2PDJA 4TQTA 1LT7A 3GS6A 2WQPA 3L4UA 2XGIA 3JU2A 1NDYA 3L12A 1FFRA 1DPMA 3KDNA 3SSJA 1YHTA 3CEUA 2ZRYA 1ME9A 1XGZA 3WQVA 2JK2A 1U1HA 4M81A 2VD8A 3ZZ1A 2WWDA 2J7DA 3H24A 4NNAA 3OVGA 3LLFA 2X7WA 1ZHAA 3U4AA 4GUGA 3ECQA 2YW4A 4HNLA 3O9NA 3NGJA 2VC6A 1H1NA 3CMJA 1E1EA 7ENLA 3BANA 4IJCA 2YLLA 2O4MA 4W8BA 4AZHA 3A47A 3WJWA 4FX8A 4LV4A 1BKHA 1A5NC 2V3GA 1JCLA 2CNCA 3NVTA 4IP7A 5T9CE 3GXMA 1JCTA 2QCNA 2XN2A 3DXIA 4L1WA 3KWXA 2BFGA 4B5WA 4HU8A 3PBVA 4Q4MA 1J12A 4MWAB 5AHEA 2E9MA 3OODA 4J5NA 1O7AA 2OWXA 4CLMA 3BWWA 3N11A 1GWJA 3RM8A 2DH2A 3SCNA 3N14A 4D71A 4GI8A 4YTUA 1KBIA 1CX9A 4C91A 3ATZA 4IFKA 2BASA 3VD9A 4IQLA 4U3AA 4WJ8A 4U3CA 1C93A 2GFTA 4XO6A 4CNOA 1ONRA 8CGTA 1JXJA 1GVSA 3DHDA 1EZ2A 1D8CA 5DY3A 3SSZA 1FWRA 3MV11 5AYBA 2XH7A 4MJMA 4X3ZA 3QLLA 1PZ0A 1J2WA 1I4NA 4TTUA 1EJTC 3OZPA 1CXEA 3WLTA 1US3A 4ZOBA 3G0UA 5MHBA 1ONWA 1XPGA 4WLCA 3TWAA 1OBAA 4UFLA 1XFCA 4HYRA 4W9TA 4ZSTA 3QGVA 3NA8A 4P8VA 2Y7FA 2ISVA 1TELA 1PDZA 4M8UA 4JGDA 1CBGA 3TOPA 4JTLA 3G8EA 1ZENA 4JTUA 1UWSA 2GQ9A 1FP8A 2Q8LA 2PDGA 3GVWA 3M9YA 4OHQA 4UCGA 3R25A 3VIPA 4AAJA 4UFHA 4XZWA 4TX8A 3I6TA 4A35A 3CIWA 2H3DA 4GUHA 4MMWA 2DIKA 2VRQA 3B8VA 1MZHA 3PNZA 1H41A 1VJSA 4H9UA 3BAWA 4AD2A 1J11A 5H8PA 1FWDC 2VM8A 4MLRA 1EIBA 4L6HA 5E9XA 2VWSA 5D9OA 4PSRA 2A7RA 2A1YA 3S6DA 1XINA 4U31A 1YKWA 1EKOA 3QSTA 2V5CA 3TR9A 1Z48A 3KL5A 4Z1AA 1B9ZA 3KVKA 3DAQA 4MVAA 3PPCA 3A3XA 3E0VA 4IMDA 1PPIA 3KCLA 2OSYA 1WB0A 1UUOA 2PFHA 2VFHA 4JD4A 3WLHA 1KBJA 3TDFA 3IVUA 4D6HA 4R88A 4Y96A 2PU1A 1XSIA 2DT3A 3V0TA 4Y9PA 2EBNA 5I79A 1QVBA 3WIJA 1J5TA 4GQQA 1PKLA 2FVKA 2WCAA 3SW6A 4C65A 4Q22A 3K46A 4ORIA 1XI3A 3OHMB 3ARUA 2W0UA 4E0CA 5DN1A 3APGA 1XICA 3ME3A 2YCLA 1YMYA 4HOXA 4YYFA 4B4FA 1XLGA 3TYUA 4F9JA 4J9JA 3QY6A 1GOIA 5CPMA 3UYIA 3KM8A 5BWAA 3NDZA 1Q4WA 3AAMA 2O7QA 1CCWB 1YTKA 2WBGA 3RGTA 1XYLA 4I7UA 1MVYA 5HMFA 1TWDA 3I6RA 8TIMA 4O57A 4RNJA 2ZZ6A 4S1FA 3MANA 4NZCA 1JZ8A 3MI2A 3FVDA 4J7RA 2WZEA 4OBSA 1E6NA 2D3LA 1CIUA 2BSLA 3LCHA 1E4NA 3DKLA 3U4FA 4NX5A 2Q01A 1M53A 3P74A 1D9EA 1JRCA 4GLEA 2XINA 1AL7A 3W7OA 3AU6A 1WX0A 5HAOA 1Q6QA 3IV3A 5I7GA 3XISA 1FCBA 1E3XA 5BOFA 5I23A 5EYWA 2YXGA 2BB0A 4AY8A 4YVPA 3BGGA 4GQBA 1KXHA 1E0TA 5KZEA 1DIDA 1DQWA 5HUPA 2JALA 1OC7A 1VCFA 4Z2IA 4PUDA 4XD6A 1W0MA 3N3MA 3EOLA 2R9RA 4NAFB 2RKXA 4RDWA 4PC8A 1EZWA 3FEMA 2R82A 5HDRA 2WXDM 1S39A 4J3SA 4I8YA 1WOBA 3NQ7A 1VLIA 1HKVA 4BHYA 2QPXA 5FD0A 2JIEA 3K13A 2OTDA 5EBAA 5AVNA 3UGRA 5AYIA 4ZB0A 3LTYA 1W9PA 4WD0A 3W7NA 3W84A 1D3CA 3ONBA 1KKRA 3DGBA 2CLLA 3KOXA 2Y70A 1F76A 5K4XA 2GSEA 2V2CA 3SN0A 4UTIA 1EYEA 2VX7A 1JCNA 1GYNA 4AEEA 1HQTA 5BNKA 1KR0A 1YXDA 2ZXBA 2FZMA 4ACZA 1QOXA 4RZ5A 4WQ6A 3YPIA 1QTWA 3DFNA 2Y24A 3GBDA 4JIEA 1YLVA 5AOUA 1O68A 2V81A 1AMYA 3GNRA 1O12A 4JKKA 4AZ7A 3O6AA 3QC0A 3W85A 3VC5A 3N34A 1SU5A 1V0KA 3UWEA 3H2EA 2NX1A 2WSYA 5D30A 3LRMA 1OC6A 1XL9A 1UWUA 1KR1A 1GHRA 2LLEA 3DDMA 1B31A 1NWTA 1SO4A 2WMKA 2PGWA 2WVSA 2QJJA 1GONA 1P48A 3VOFA 4A3HA 5FIPA 1V4YA 2PPGA 1XIGA 4Z42C 2NVCA 1OINA 1VRDA 4YU1A 1X7FA 1JFHA 3C8NA 3WFLA 1US2A 1HVXA 3WQ5A 4QRNA 3T7VA 2ZUUA 1QR7A 4GIEA 4WY0F 3U9IA 2EF9A 3LMZA 2WHLA 4C7DA 3EA3A 2YZRA 3MUIA 4D8LA 1GQNA 3AHTA 2FH6A 4CQAA 1YX1A 1QNVA 3MCNA 2YCEA 4K8EA 1JFXA 3MU7A 4IL0A 4GXMA 4PL2A 3LV6A 1OCQA 3SECA 3WUFA 3V3WA 3KBSA 1V02A 3EMCA 3GTIA 1XIFA 5E1QA 4UTLA 1EP2A 3TC3A 5SWUA 1UYQA 1FWFC 2C1HA 2XZ9A 1V93A 4NZFA 1L8NA 2YLAA 5TF0A 1UOZA 2V5KA 1V6UA 3VKAA 2A21A 4JQ2A 3NL6A 1ENUA 2G3NA 4Q7NA 2V3EA 4DWSD 1L2UA 2GQ8A 1G4SA 2ZXDA 4PTDA 1PHWA 4K7YA 4ZO8A 2GWGA 1HN1A 1CECA 4TVUA 1AW5A 5CJ5A 3GG7A 3ZLFA 5IXEA 4Z2HA 1V6VA 4C6LA 3R0UA 2PLCA 2PB1A 1K7EA 4PL1A 4E38A 3SQSA 3UD6A 1W1YA 4XTDA 3UERA 4PTWA 3CL6A 4WY0B 3TXZA 5H1WA 3VIIA 1OZMA 1F4HA 3FKKA 4Z2GA 2NWRA 3OG2A 3NL2A 3TQ0A 4L56A 4LUSA 4LYRA 3EMZA 2XFYA 1Z44A 3A22A 3GRIA 4WGHA 3SRHA 2EG6A 1V6XA 4HPXA 4ZE4A 4NHVA 2QCFA 4NZ4A 3VABA 2BHZA 3IJ7A 5DX7A 3MVIA 3NO3A 1VHCA 2WOQA 3QMSA 4Q4QA 4C1NB 4MFEA 5I3IA 3VFLA 4I6VA 2A3HA 3RXZA 3UWVA 1AQHA 4LVFA 4NT0A 4GY1A 2XDFA 3TTYA 3ABSA 4JTKA 1G7VA 1E0XA 4DUVA 2J88A 4CU6A 4FA3A 2EPLX 4G9PA 3W1RA 2G96A 2FQIA 1GYLA 3WQCA 1CGVA 1R7OA 1OD8A 4V1XA 5I77A 3H7UA 3LGGA 5G1YA 3VDBA 3FJLA 3C6CA 4W86A 3GXPA 2HMCA 4KERA 1MNZA 1TMHA 3FAWA 1XBXA 1EHNA 4BCEA 1PX8A 1A4LA 1HT6A 4QE5A 4RZBA 4UTWA 2CPUA 1WZMA 1Y8BA 3E1F1 3WMSA 4UTMA 1DWHM 1E0VA 3HGSA 4C1LA 4HHHA 1XJBA 1TV7A 2QXWA 3Q58A 4AVOA 1IEWA 3W70A 3V7PA 2PEVA 5CPSA 2YBVA 4EWJA 1AW2A 3AHZA 2VEIA 1A3HA 4ZFCA 3LZ3A 3WBWA 3SUSA 3C2EA 2XIOA 3SRFA 2Y1HA 3PJXA 3UU0A 3M44A 2NT1A 5A6AA 2J13A 4V28A 5A6JA 3WY1A 5A8MA 4D1JA 1Z69A 4GFSA 4BEUA 2FJUB 1PBGA 3N12A 1E43A 4O10A 2I5QA 2NQJA 1Q65A 2XGZA 4GWEA 4AHPA 2FZNA 3ZXWA 4A3RA 5LA2A 3L2IA 4CVUA 4UQBA 1TWWA 2DVUA 1R7AA 4LVAA 1SYTA 1JZ5A 3RFAA 2W79A 1H1YA 1ADSA 1JZ2A 4H9ZA 3TE9A 4XISA 2BVDA 2NVDA 1XIEA 1JDCA 2ATMA 4B4HA 1UASA 2BVWA 2YXOA 1HL2A 2PDQA 2VGBA 2W5FA 4L80A 4HTYA 2PDBA 1M7OA 5F2MA 2GOUA 4KH2A 4EF9A 9XIMA 2I1OA 4US5A 2E68A 3FNDA 4G56A 2ZX7A 2OCZA 1I2OA 4G1KA 3PBWA 1E6RA 3LNPA 4W8AA 2OT1A 3VMNA 1T7LA 7REQA 4H6KA 1EOMA 2GPTA 1PDYA 1ZJIA 4ZL1A 1NFBA 4NYUA 4DI8A 5C2GA 4E8CA 3VNLA 3VA8A 5A69A 1W1IE 1A80A 2QLYA 1XSJA 4P8UA 5G4EA 4G2DA 4J3UA 4QM1A 4NJKA 4XD4A 1R2RA 1WDPA 2PDKA 5KITA 1H61A 3TIMA 4PBFA 2QCCA 4GI9A 1IWPA 4MNJA 4HD5A 3GXNA 8RUCA 2J9ZA 4F2BA 2Y4SA 5HPOA 3W37A 1KV8A 3A4XA 2H8ZA 5M03A 1U30A 4DXVA 3WQWA 4E2OA 4PN2A 3W7EA 4AVNA 1MUWA 1WBHA 2F6XA 4IZGA 3TXVA 1D8WA 2PTZA 3W7GA 1UW9A 3MSGA 1P7TB 3TSDA 3WENA 4GKTA 3IIOA 3EOUA 3BARA 5U7SA 4P61A 2FJKA 3BJFA 3UY8A 1W8GA 1EXPA 3BLFA 4J1OA 3E5BA 3N9RA 4XBKA 3UFYA 6TIMA 3AYTA 1BF6A 3VIHA 3W01A 3R4IA 1IXPA 2GOKA 4LWWA 4EACA 5C70A 2YSWA 5B80A 1VJIA 4GXWA 2HROA 3H2OA 3EWUA 4PRTA 4W5ZA 1HKIA 4DO6A 1F61A 4AD5A 4UNLA 1KBLA 3H4WA 1VEMA 3MTWA 1MNSA 3C5QA 3VMPA 2B7QA 1SR0A 1UROA 4KWSA 3ABRA 1M3UA 1GKPA 5C71A 4E3VA 4IXHA 3VIGA 2E7FA 4DLMA 4PYSA 4HA1A 1OF8A 1C8YA 2QUNA 3THCA 1HZYA 3DHPA 5FEWA 2V2DA 3SCWA 4JTFA 1Z89A 4S39A 2NQHA 4XZBA 4G7EA 3LYEA 4TV6A 2NLIA 2WHJA 5C7VA 2A3LA 4PTXA 4ZA0A 3L23A 3NPVA 3GZAA 5HUOA 3S9ZA 4PMNA 1NFGA 2HISA 5AHMA 2WWCA 4M1RA 1W91A 4GO8A 1IEVA 2GZXA 5AYXA 4JIRA 3SCRA 5ABTA 4JCLA 5CBBA 4XAZA 3AZTA 1ISXA 4DJED 4ICMA 1V0MA 2JEQA 3AUJA 3QGKC 3QY8A 1HGYA 1PO9A 4JOMA 5IDIA 1V79A 2AAMA 3W1UA 4AZ5A 3BAYA 3FSTA 1WPCA 1TJ2A 2DZVA 4M7TA 4Q8NA 2CERA 1OG0A 2I9UA 3A13A 5FJOA 5IHRA 3T08A 5DT5A 4ERAA 2ATSA 1QU4A 5TD4A 1EDTA 3LQLA 2EXOA 3LZ5A 3RLUA 4CQ8A 4DWSC 5FF2A 3VGHA 1XISA 4HP5A 4MKSA 2J66A 3CWOX 3FLUA 1VPXA 3C2OA 1U1UA 4PMUA 3N9SA 1ITUA 5JH1A 4AD3A 4JN6A 3G8RA 2A0NA 3DFYA 1DJWA 3CIVA 4DUOA 3SB0A 3VD5A 1W6TA 1I2PA 4HOZA 3IUHA 3ITVA 1I6NA 1Z32X 2QDDA 3NWRA 3ZMRA 4XB3A 3FK4A 1W3NA 4X2PA 5K7JA 2E4TA 4MF4A 3PZGA 4NKCA 2YOCA 3POHA 1V6WA 2QVNA 2V68A 5C55A 3FDKA 2G50A 3GC4A 1VLWA 5CSYA 4S38A 4G5DA 5A6TC 3T0CA 3FX4A 2VP8A 4HSOA 4HGXA 4J3WA 2V67A 2OQHA 4HCHA 3T1GA 1MDRA 4GI4A 4CGTA 2RFGA 1JF6A 3GIPA 3IJQA 3BCJA 3O2LA 1ZZMA 4LV9A 3WUGA 4WKFA 4UNKA 2WJFA 2XSAA 4ZXOA 1XR2A 4MB5A 1XLIA 2DZTA 3PPFA 3NR0A 4RV8A 2IXUA 1H62A 2B7PA 3WNPA 3LNMA 1W31A 2GJPA 1XX1A 2E5CA 3WF4A 4BF9A 4CD5A 5ABEA 3HIJA 5IOBA 3R0KA 2Y0FA 3B05A 1V3JA 3PANA 3CASA 3Q65A 2J7BA 3F03K 5H8MA 3TJXA 4A4AA 1G7UA 2V38A 3W2NA 3FN9A 1O5QA 2OWWA 1JZ4A 4F0KA 4Q6JA 4NZ1A 5GQBA 1GK8A 4RV3A 3VGFA 2ZRVA 4PULA 2QJMA 2WHKA 3K1DA 1LM1A 3G1XA 3PPHA 2BXZA 2A79A 1Q6GA 4A2RA 2JKPA 3W2UA 4HBKA 4L7ZA 3PZVA 4S2CA 4J3VA 5EPDA 1ZAIA 3MQTA 4R7WA 2R94A 3U6WA 4O8RA 1TO3A 2DT2A 3QJAA 4ASTA 3QQWA 2FKPA 1V51A 2V69A 4QJ5B 1E6QM 1W1ZA 3TCEA 5HULA 1A5UA 1RLCL 3TJLA 2A4AA 4CNUA 4ALDA 2NX9A 1G94A 4H6QA 3W7RA 4PMOA 2DVXA 2VEMA 3AU2A 3U8GA 2A85A 5C0QA 2R1LA 3GG1A 3OO2A 4C6QA 4LOCA 4GZEA 2FDSA 3BDKA 4WIWA 4L9YA 1N55A 3WK3A 2PUZA 2GGGA 1F6PA 3GC2A 4IJBA 1UH3A 3E6EA 5F4SA 3VGBA 1YYAA 3WNLA 3QMRA 4YL2A 4ZOCA 1S5VA 1FH7A 5D09A 5G5IA 1BGGA 4HU0A 2RGLA 4BI7A 2W4XA 3TN6A 1Q2RA 1PTGA 2AL1A 1EC9A 3A23A 5AC8A 4ACZB 3OU8A 3EWWA 4XSLA 3PN8A 4CN4A 2Y8VA 3KUMA 2DSKA 1EPVA 4ATLA 1ELSA 1QK2A 3EA1A 3H2CA 4PZVA 3NDYA 4LC6A 3L7RA 1EXBA 7PTDA 3UJRA 3A5FA 3B8SA 4MM1A 1PV8A 4GJJA 5DLCA 3MBFA 5I3FA 3DHFA 3KP1A 3G1HA 1QNPA 1WDQA 3C2YA 1GQLA 5E93A 2OT0A 4HNCA 1IT8A 1UP3A 3KLKA 4Q4OA 1J96A 1HVQA 1UR9A 3LSCA 4OWGA 4EX4A 1LP6A 3DI1A 4REQB 3ZIZA 4GXPA 3W7CA 3DERA 1MWOA 4YPJA 3V1PA 4W88A 4UTTC 3A4JA 1HL9A 2Z25A 3QV9A 1XLDA 2XIJA 3BGAA 3CZKA 3U2OA 4W8LA 3P81A 4E2DA 1EFZA 3S5NA 1RVGA 4RK8A 3RDKA 3SCTA 4Z0SA 1KGWA 3AMKA 4GYPC 4UR8A 3GH4A 4IICA 3WD1A 4RCXA 1XG4A 1LUCB 2X2GA 3W2JA 1PUDA 1EJXC 3SRKA 1CW2A 4ZQPA 2OO6A 3K5XA 3P3BA 2PF8A 4JTGA 3O7UA 3E2QA 4O1BA 2Y8KA 3V36A 1QI0A 3BLEA 4LXFA 2ZADA 3GK0A 2RHGA 5DRCA 2Y62A 4NVTA 1VQTA 3QGAC 1FKXA 2QCDA 1CT5A 1TX2A 2WO5A 1TWZA 1F8IA 3KFTA 4NZ3A 1EBHA 3W83A 2V63A 4HNTA 2YGYA 4BR1A 2NT0A 4IP5A 4N9BA 4QROA 2KZHA 1MEIA 1ISVA 3G1AA 4AD1A 2ZA1A 1WZKA 2O92A 4KCUA 3L9CA 4L6DA 5H2ZA 2HSAA 1ME8A 2HPMA 4AIEA 4Z1DA 4GYPA 4UTUA 4K36A 3PUOA 4QJ3B 4E5TA 1MUMA 4C5YA 3KBMA 1DIEA 4RDZA 4MDPA 1FWTA 1OVDA 4LU0A 2YW3A 1QI3A 4N4QA 1CDGA 4LNCA 3CS2A 1JCXA 1TWSA 3NQFA 4B2DD 3B9EA 4ZO9A 5GNXA 3O16A 4GUFA 1VB9A 3ID7A 2FMOA 5HATA 1AVAA 1V7YA 1FHLA 3W1MA 5KZDA 4BKNA 2NVAA 2ZWYA 1AUSL 4QJ4B 1J79A 1TV4A 4HPNA 3A9IA 3OA3A 2WLZA 3M5XA 4DJEC 1NP2A 4LUSB 5FSEC 3L0NA 1LRTA 1JUBA 3AIWA 3CAWA 4DAIA 1VCVA 2PGEA 1Y0EA 4M24A 3PM6A 1XW8A 4TUFA 5GVJA 4HZ6A 3K4AA 1M7XA 4OJYA 3PPGA 3I7SA 3ITYA 4ILSA 3IIZA 3ISIX 2OVLA 5ECVA 3TC6A 3ARZA 4MNKA 5D4YA 3H8AA 3RMJA 4HA0A 3WBXA 1AH4A 3CV1A 5CSUA 1RBAA 2FMNA 1QK0A 4IGSA 4LYKA 2CLMA 3L4VA 3TLLA 4UOQA 2DUAA 2Y5JA 3L4YA 5ABGA 5I2UA 3ZJKA 2EEXA 2XFRA 1K9FA 5K9CA 1R0MA 3SBFA 3CZGA 2CEQA 4E8GA 3SY1A 2C16A 4HMEA 5DCEA 2OZ3A 3C2VA 3TOYA 1NJJA 3NSMA 3LOTA 2NQ9A 4W4QA 2QKFA 1JQXA 4AEFA 2XGBA 1E9LA 2VEKA 1J2BA 3NQ2A 2PBOA 4GNVA 4C6CA 1JPMA 1ML1A 4XUGA 2WMHA 3DBPA 3B97A 3WD4A 2ASHA 3RJXA 2ZCGA 2H90A 3UJEA 3C8FA 3EA2A 1H4PA 4H9MA 1OK4A 3TR2A 1TSIA 2WW5A 2G95A 2QW5A 3W2KA 4OQVA 1TB3A 4XKYB 2DEPA 4MFDA 3MY9A 1VCGA 1CLVA 1IQ8A 2X2YA 3STCA 1KO0A 2Z2BA 1T0OA 3KZSA 4ROQA 1QMLA 4J3TA 3KVMA 1SZEA 1OZQA 4IQEA 4U33A 4Z2LA 1CGTA 2E40A 4UXDA 3OLDA 2ZQ0A 5D05A 5DANA 2NUYA 3UXAA 4H04A 2QIWA 4PMRA 1SUXA 1ODUA 3ZM8A 3PS7A 3NDOA 3VM5A 1ZBKA 1DORA 2PBGA 5I0DA 1MRQA 2HBVA 4IIHA 1BTMA 5PTDA 4IGMA 1KBBA 4L9XA 1K6AA 1Y5VA 5HWMA 3WNKA 2IMRA 2GQAA 1QNRA 1CLKA 3LTPA 2XVLA 2VFIA 1HGWA 1XLCA 4OU1A 3GIYA 1PL9A 3RG6A 1EJSC 2V30A 3VYLA 1Z42A 1VFSA 3KL0A 3DG3A 4Y9NA 1NARA 4P7QA 3RU6A 4FIRA 2G3JA 1LLOA 3UNTA 4AF0A 3LUTA 1RCOB 1EYWA 1REQB 2E09A 1H1ZA 1JG9A 4ZOEA 3UF9A 4M80A 2OELA 2PCEA 3WSUA 3ZLGA 2VQTA 2WC3A 5FEPA 4V27A 3AUOA 3GM8A 2ZA2A 1WUFA 1PE1A 3WNMA 1EDQA 1LZOA 2WZMA 3M0KA 4H4IA 2VI0A 4A22A 3BG5A 3EWDA 2QQ6A 2DT1A 2Z24A 4H9YA 7REQB 2PLJA 1VGAA 2EO7A 5D8ZA 1EA9C 4HPGA 1DIOA 4M56A 4HN8A 4D6IA 2OZ8A 3EKZA 1NAL1 2CLFA 2R91A 1TTPA 3LPPA 2DT0A 1P6WA 4Z17A 4NYYA 3HOJA 3HJEA 4PUUA 1QHOA 3N2TA 3TTOA 3WEZA 4PH6A 3E2SA 3WCZA 2PWFA 4NNCA 1SO6A 4R7JA 1EL3A 1YE4A 5HJYA 5EBUA 3EDEA 3OTRA 3FYYA 3LRLA 1ODZA 4S3BA 1YNQA 2G97A 3VE7A 3U0HA 2YFOA 3AXXA 4DB7A 1XRVA 1WZLA 4FNQA 3S6OA 3NNTA 3RM9A 1JEZA 5LNUA 1E1CB 1WDRA 4PEEA 1VBUA 1O94A 1XD1A 3E5PA 2EG8A 2PDMA 3NM3A 4GBDA 4IWWA 3V5OA 2QCMA 5CZ0A 3CUXA 1GGOA 1ZJHA 1QASA 3HPAA 5FSDC 3TQVA 3HQPA 3SIZA 3UXIA 1YNPA 2IQ0A 3S2LA 2J7FA 1R3YA 1E56A 3EB4A 3OPSA 3N2MA 2PWUA 2HEJA 5HQLA 3IWPA 3G1DA 4QCFA 3DIPA 2Y63A 1JJKA 1QI2A 4JNYA 3DU0A 1GJUA 3RF9A 3QR1A 1YPFA 3MZNA 3DUGA 4GFIA 3RLVA 1W2PA 1V08A 4ACYA 1UKSA 5CAHA 2PI6A 1SGJA 4D6DA 1V0NA 1YDVA 5LA0A 1M9HA 1VZWA 1W32A 3ITGA 3T2QA 1XYCA 3GU9A 4PFHA 4NIRA 4O0KA 3G1VA 1DJNA 1VYPX 1R8LA 1XIBA 3CL8A 1HJQA 5FA5A 1V3MA 3F2BA 3I4KA 1UKTA 5LGXA 3GSMA 1UR3M 1G9HA 1UQYA 1SPQA 3KTCA 1J6PA 1S5TA 4YTRA 3EWCA 3AC0A 4AD0A 1KFBA 1VJZA 5AFDA 2ABBA 3H2AA 4RXFA 3VCNA 4DRSA 1IZJA 4G7EB 4LY8A 3P8JA 3NQDA 4NNBA 4DLFA 3RUBL 3CMGA 1EGZA 4LVGA 3IRDA 1NDWA 3BW2A 2ZX8A 3M0VA 3THDA 1JZ6A 5BXPA 1GQIA 3OG3A 4XO7A 4QDMA 1WXJA 4WDUA 1OGGA 4A05A 3WKZA 2WVVA 1GOOA 2FZ9A 4POCA 2E77A 4QHRA 1EHAA 4ZSUA 4LYPA 3VI2A 1OEPA 1RV8A 3D46A 3TNOA 3G6MA 1H11A 4I90A 4TMBA 5DMLA 2XJ7A 5HXMA 3LLXA 4WEVX 1RSCA 2P8BA 2EPOA 2F6KA 2HNEA 1QAPA 5DFAA 1B4KA 2I7GA 2NXIA 1DHPA 2DZXA 2DJLA 3MP3A 2JIWA 2P1FA 1QPKA 1NFPA 3ERPA 1M65A 1Q6CA 2P76A 2PMQA 3VNDA 1E6SM 2BNJA 5CPNA 1TMLA 4RKAA 4QX4A 3P14A 1J0IA 1MO0A 1AMKA 1H3GA 4RNFA 3KVLA 2DY3A 2YL6A 4AHOA 1B1YA 3C56A 1QNOA 4FNRA 3SCSA 2B0MA 4EXAA 1ZNNA 3PZQA 1X98A 3LXBA 3B9OA 4PGLA 4YJ5A 5E0KA 3UWZA 1KRBC 2NSXA 1HJUA 4GCXA 4LX4A 3OGRA 2VKZG 3VTRA 2CFFA 3CQJA 1HKWA 3WH6A 4TR9A 3NZQA 3UCDA 3OVQA 3Q67A 4DO5A 2WZIA 1IV8A 3WMLA 3MI3A 4UFKA 2FTYA 3WDRA 1L8PA 3BURA 1FCVA 1K4HA 2PWHA 3TX9A 4ZEPA 2PLKA 1FWNA 3N1AA 4HTBA 1J10A 3CZLA 4UB9A 5BROA 2VZTA 1JIBA 4Q7IA 4IXXA 3BO9A 1IXQA 1SQ7A 1T8XA 3U2EA 2DZBA 1YDNA 1BKSA 1Q6FA 4XKMA 5CEWA 2Z6IA 4EPEC 5ABFB 2VUNA 4FLOA 4I7VA 3VX1A 3G18A 3T07A 4KRZA 3FJ4A 3S2NA 2YDSA 3O8AA 4HOWA 1ICSA 3W4RA 1XIMA 1LTDA 1KXTA 5F2LA 2TAAA 3Q45A 2XFFA 2QNEA 1RAKA 4DJDA 3NAVA 1B4EA 2W3ZA 3L0KA 3BCDA 1TIMA 2CXEA 3WBEA 4B5XA 1NELA 3VKDA 1YEYA 3UZ5A 1S3HA 1UZ1A 1W5PA 4CQCA 3IIPA 5BU9A 2VVSA 1E1FA 3CC1A 1R6WA 4XUYA 4O52A 4B5NA 4HA4A 3UG4A 1UR2A 2QV4A 1E0WA 1G5AA 3WMBA 4UFMA 3M1ZA 2PCQA 3BLDA 4UIOA 2HJPA 3TSMA 3KCOA 4IMGA 4JTHA 1SFLA 4LBUA 3M5ZA 4LALA 4PUNA 4K39A 2G3MA 3NOEA 3P5YA 4JTTA 3LHYA 4HB7A 2ONEA 1JCYA 3QKZA 1WOAA 2Y88A 2PZNA 3L4WA 1XV8A 2ACRA 2P10A 1RQBA 4EF8A 2I5GA 3GR7A 1X1OA 3RMEA 2GWNA 3SCOA 4Q8MA 5BOOA 2WSRA 1MXDA 3L4ZA 2FIQA 3TN4A 5AY7A 3TYEA 1LORA 3F4CA 3G0SA 3FYPA 3WBAA 3IV8A 2XM2A 5C9XA 3SY5A 2C15A 4KFPA 4LUTB 3ZO9A 4B9ZA 5K9XA 1LRNA 1SO3A 2VD9A 4KT2A 2QPUA 4QSHA 4B5VA 5A1AA 1YNYA 3U48A 1LL4A 2WPBA 4AU0A 3A12A 4GBUA 5LSMA 4O0ZA 1BVNP 3USBA 2PP1A 3N4EA 1HP4A 5HJLA 5FEXA 5D38A 5JBFA 3L2LA 3WMCA 1WE5A 5JVLA 4Q8PA 4IX2A 2C1GA 3O0KA 1JUEA 1CYGA 4UQEA 4H8VA 1B3OA 4C6OA 5A8PA 2ZBTA 1JPKA 3LEPA 1H49A 4OVXA 2Z2AA 3GVRA 4IGHA 1W5OA 3ZR4A 3T09A 2I14A 1RA0A 1RP8A 5F1VA 3VILA 2WPGA 3AYRA 3WJZA 1O5RA 1QRQA 4FOUA 5E0CA 2R8WA 3TCSA 1F74A 1Q6RA 4I9AA 3ZSTA 1VYSX 4RJEA 4UTJA 2VJXA 2A3CA 4LC8A 3GUWA 1BSLA 1P0BA 3LDVA 2WZTA 3WDIA 4D9PA 3WLRA 2IQTA 1DV7A 4PTMA 3ABXA 4JYFA 3L21A 2GSHA 3WLIA 1XM3A 1XIIA 4KMQA 3FJ6A 5D32A 3V35A 4MADA 5D2TA 4P5UA 5J8LA 2DZUA 3AZRA 1A50A 4UWMA 6XIAA 5D9PA 3URNA 3EDFA 3DX5A 1SO5A 4KRUA 3CM4A 2YYUA 1Z3NA 3GXFA 3CH9A 4NG3A 3ZT5A 3W72A 4LPCA 4YVXA 4Q3MA 4QLLA 3W82A 5FOOA 3AMLA 2ZZ5A 1G67A 2WM1A 4OUEA 2OJPA 1F7BA 1JULA 3ZWTA 3E3HA 5AC6A 3SZ8A 2Y8UA 4F2UA 2D20A 1KGUA 1RPKA 2QCDB 4BF7A 3KS6A 1OFOA 3O07A 3NG3A 3LM7A 3QC3A 4YCOA 1JVNA 1QUMA 4P2VA 4GA8A 1DE5A 1SFTA 3GIQA 4CNSA 4NU7A 4ZTYA 2HXUA 5HMEA 3GVGA 1OSEA 1UUQA 2GGEA 3DEQA 4GZJA 3IJLA 5TQLA 3N4AA 1OFQA 1FWGC 1IEXA 1OCBA 2Z4GA 1DIKA 4W7VA 5F1UA 3GVQA 1YDYA 2JGYA 3INPA 4C6PA 3T55A 3WK2A 4UR9A 3D5HA 3DFPA 3G2GA 2GYIA 2O9PA 4FB7A 3C3NA 3LCGA 2OYMA 1BEUA 1U5HA 1WO2A 3VNMA 1CENA 4IH3A 1AQFA 2FVLA 4RE0A 1OM0A 3WLLA 2P8CA 6ENLA 1PCKA 1DXIA 5LKYA 1Q8JA 1FFQA 3HMCA 1J01A 3RCYA 5CG0A 4AZIA 2V5JA 1R85A 1GQJA 3PZUA 4NILA 4DBDA 7XIMA 3N25A 2GLKA 2XVPA 3AO0A 2A7NA 3WFZA 1GVEA 3T0AA 2CETA 4KWVA 5A6BD 5T8GA 4KGLA 1P0NA 4NASA 3QLDA 8XIMA 3IAPA 4J35A 3BZGA 4ZB5A 2BXYA 4IL2A 1W3LA 1WA3A 2DU2A 3NQEA 3UZXA 3SUUA 1TJ0A 4LCRA 5I07A 2VEPA 2DIEA 4RDYA 3GKAA 4F40A 2BVYA 3PUEA 2A3AA 4LF2A 1BYDA 2C7FA 4D72A 4F0HA 3VGGA 3PP7A 3THAA 1E51A 4XSMA 1CWYA 2V5DA 2Q71A 4M1BA 3UWYA 1I9CB 5MKGB 4Z0JA 1DBTA 3SURA 4Z1CA 5FJJA 3I7RA 1KA9F 1J6OA 1OCJA 4R9OA 4P7OA 3KTXA 1BVWA 1V8EA 3IJ8A 3JVAA 3GFYA 1WAWA 3F2DA 1GG0A 1XC4A 1HJVA 4EAYA 3TW9A 3E02A 3MHUA 2HBXA 3R79A 3LPFA 1QHZA 4B15A 1N8WA 3CT2A 3VOHA 1J0ZA 5CC7A 1IT7A 1KTCA 3ITTA 4ZQMA 1XGEA 1OHLA 4X22A 1UBSA 1ADOA 1LCOA 1UZ4A 1A5OC 5I5RA 3QF0A 1ECEA 1R3WA 2O55A 1TIWA 5AC4A 1TV8A 1W9DM 4I9MA 4JY8A 4NL1A 2VFGA 1JXKA 4F0SA 2XH4A 3L0GA 1XYBA 3MVTA 2YA0A 4Y9OA 3NPWA 2OEMA 4Y90A 1OJXA 1J8VA 1LG2A 4FI4A 3GB6A 1DKWA 3OEXA 2RUSA 5CKSA 4PUMA 2BHUA 4K2SA 2VOTA 4C6EA 1TZZA 4ZODA 3TZFA 3HFYA 4I5XA 1MUCA 3GG8A 4D1IA 1CGWA 5KTLA 2DQWA 2CWXA 5HNUA 1J93A 1HTIA 3G1YA 4S3AA 4W93A 3HG3A 4S3CA 1LBMA 3FYOA 1FRBA 1S1PA 1NEYA 3KLLA 3CUJA 1TE1A 2CLPA 1W8SA 1Y5XA 4MHBA 2OOGA 1DJYA 4BEQA 4G8TA 4U2ZA 3GAKA 3WD2A 4JFUA 3P67A 1CXHA 3CHFA 4FALA 4AFYA 3L5MA 1CXIA 1D7KA 1LQ0A 1KRAC 2QUTA 2VWTA 1K8ZA 1PEZA 4F79A 5C2CA 1XKYA 2J9XA 3MB9A 5CLTA 2ICSA 3FW6A 3CUIA 4EVZA 4A3UA 1PB0A 4GX8A 2PP3A 3CQHA 2CCRA 3HPXA 2FGLA 2C1IA 4FS9A 1IHIA 1C8QA 5M5DA 4MNMA 1E4LA 3LHWA 3LG3A 4V2XA 4JFTA 4MWAD 2PA6A 4CEUC 4OBTA 3G0XA 1XDJA 1QHPA 3CMFA 2GK1B 3VPLA 4IM4A 3R1ZA 5ABHA 1XBVA 5DMNA 1F73A 3B0VC 1RZMA 3TJ4A 3QEZA 4FNUA 3S4TA 3A6OA 3LXCA 4KPLA 3EEZA 4JL2A 3VIJA 3RO6A 3RYSA 3EDKA 3B9NA 5TIMA 3N73A 3TYDA 2X30A 2X09A 3HG2A 1K4GA 3AHVA 3ARTA 1QOPA 3ANVA 4M6PA 1LRQA 5D9NA 3AWOA 4JAWA 3MKVA 4Y9MA 4CEXC 2AMXA 1MZRA 2YDRA 3LK6A 2A2IA 5CGMA 5U4NA 4I6KA 7CGTA 5I3DA 1MQRA 1TPDA 4NRSA 4RXGA 4LT9A 3I3DA 4KEVA 4MZYA 2H8XA 2UY5A 3W38A 2PD9A 4TX9A 1K3UA 1WAUA 3AJXA 2DGAA 2J62A 4Q8TA 1TWIA 1ZQ5A 2EQDA 3AS1A 3W00A 5RUBA 1FA2A 3CAQA 2IQDA 3A24A 3MI6A 2PWEA 5B7YA 1H2JA 4ZENA 3REQB 3MUCA 4D8ZA 3BLLA 3WEOA 3C86A 4TVCA 3HPSA 1UZHA 2BX7A 4DF1A 3VIFA 2J24A 4X0VA 1J0KA 4HCDA 4ERGA 3LTSA 2G37A 2D73A 3IPWA 4DJFD 3QVQA 2B81A 5HOSA 2DPEA 5H6HA 2WCGA 1THFD 3MCOA 4HK5A 2HZGA 4XK2A 5G2HA 4XAGA 1ZPTA 1MQQA 1QATA 4JNMA 2A6NA 3PZMA 2QF8A 4FXJA 4GPNA 1MI3A 4RE2A 5KEZA 1QT1A 1EA0A 1QO2A 4KEMA 1FVPA 3F4VA 3UVIA 3FEQA 4F8XA 4YNGA 2Q8ZA 2YA1A 1XUZA 8XIAA 3M64A 2F2KA 2CLOA 2YA2A 1S2UA 3STEA 2DSWA 1EC8A 4RE3A 2CZEA 1A0DA 4K3ZA 3F7JA 2WVVB 4S3DA 3KP0A 3R5EA 3S5ZA 1IEIA 1K02A 4FMVA 3TVAA 1TR1A 5B7ZA 3BXWA 2AAAA 1QWKA 4RX0A 3R8HA 1OYBA 2P5NA 1AD1A 1EO5A 5IBXA 1NQKA 4IISA 1OFRA 1ZP4A 1W9UA 1LYXA 3RR1A 4CCEA 3M6DA 4WK9A 2D23A 4GGBA 3UWWA 5CPQA 3MJMA 3MP5A 3GW0A 2F2HA 2CZ5A 3N3TA 1GEHA 1OT1A 1NF0A 1NVMA 4PUWA 3S1XA 3W1PA 3MO4A 3P8IA 1JL8A 5D04C 3K4DA 4LBRA 7ODCA 4L4PA 4DELA 1XBZA 1UR8A 3OIXA 1Q4NX 2OXNA 4HK7A 3TUUA 1X7IA 4LNYA 1DJXA 1EUAA 3ICJA 4PEKA 5LZLA 3QY7A 4QJ1A 3UEQA 1AL8A 1X96A 1X1ZA 3COTA 1XLBA 4M19A 3EB3A 4C6IA 5I00A 1FDJA 5E6ZA 1JQVA 1TV5A 3UP8A 1E4MM 2VXNA 1ICQA 4CD4A 3HGJA 4QQ3A 2BLEA 4KS0A 2R1NA 1KWKA 2G0WA 2HK1A 1SMDA 3DCPA 5E70A 1KFLA 3QV8A 3AQUA 1WYIA 3NQGA 1TPWA 5CQ1A 3AISA 3P80A 2C8NA 3RITA 4H8HA 2YCKX 3NQBA 1FWEC 3QYSA 1WNOA 4CUCA 2QJHA 9XIAA 4Q6XA 3AIRA 1ZS2A 1CGYA 2Y2WA 4IHCA 3W3OA 4ZFMA 3OQEA 1GOKA 1RD5A 3DYOA 1OGSA 3T42A 1FQ0A 5AHIA 3CZEA 4I7WA 3FDGA 1PVNA 4AW7A 1TPFA 1YQ2A 5E6YA 3N6HA 1AD4A 2ZC8A 4J3ZA 2OODA 4KEUA 1BYBA 1KBKA 1G6CA 1XYMA 2WMJA 1I1WA 1LF1A 2PDPA 4E4FA 4QQUA 5CLWA 2WBKA 2IXVA 3GE7A 3W7HA 1EQCA 1EJRC 3ZLHA 1XLMA 3AOFA 2J7CA 1UMYA 9CGTA 1XPYA 1OX6A 1PTDA 5LIWX 1HUVA 3ZVHA 2OX4A 3GHTA 1BPLB 1OABA 5LNRA 3UW6A 2DVTA 2RDTA 1T96A 3DKJA 4FOJA 4QXIA 1VIWA 1MSSA 2ZVRA 4CD6A 2DSVA 3MW7A 4FNPA 1GEQA 3L2MA 5BCAA 3NO5A 1VFTA 1AZ2A 3GQYA 5GJMA 3EDJA 2R1PA 3VC6A 3GXTA 2AGTA 4PTVA 1G0CA 3QV6A 1AJ0A 4JTCA 3TA6A 2X1IA 1R9YA 1W2VA 3JRKA 4PA8A 2OEKA 3DHUA 3PNUA 1SFJA 2HVNA 1PS9A 4J27A 3FCPA 1HNYA 1LWIA 1ZFJA 1O60A 1VFLA 1ICPA 1VFUA 1ECQA 1CXFA 3A4AA 3PBUA 1A3WA 4HMDA 4B91A 1ZTVA 4GIYA 3M0ZA 2CW6A 1MW3A 4NJJA 2UY4A 3JR2A 2EJAA 2H6RA 3W6LA 4MIMA 4GG9A 4MDOA 5DCBA 1QNQA 2C3ZA 4Y8FA 2ZXAA 4HNUA 2EGZA 4MOZA 4LEFA 1RJRA 4BQ3A 1OD0A 4KFOA 3NSNA 2Z7GA 2HRWA 4JQ4A 2HK0A 2ACUA 4WVXA 1KM0A 1HXJA 3M0MA 5D2WA 4CD7A 5IFPA 3RX2A 1US0A 2D2OA 2QR6A 3I7QA 2QJIA 5AHLA 3M46A 4NJGA 1EQPA 3SGZA 1ZGDA 3QQ1A 1G69A 4FOKA 3BZJA 3EAUA 4IGNA 3K4WA 6A3HA 1J5SA 4DQWA 1UJPA 3W6MA 3UZZA 1E40A 2XISA 4FLQA 3S0CA 1AQ0A 2GJNA 4BQ5A 4CNNA 1R2SA 5BRBA 4ZE5A 5DEZA 1GW9A 1I75A 3IJ9A 3R6IA 1TTJA 2O4QA 2GDQA 3LMYA 3ZYZA 2Z1KA 3ES7A 3DGRA 2QZRA 1C3FA 3MV01 1MXGA 2PDXA 4MWAC 1CXKA 1JPDX 1H51A 1TA3B 4OE7A 2X42A 3AJ7A 3W22A 4UOJA 1V0LA 3WLJA 3H4GA 1H5VA 2PTWA 2QAFA 3GDLA 3GO2A 4RPPA 3G3MA 1VH7A 1NP0A 2ZDSA 4QLKA 2D0GA 3W7IA 2BBFA 3P93A 4IMFA 2ZZ4A 1V7AA 3B3DA 4YTTA 3UA3A 2PAJA 1XD0A 2Z27A 3WD3A 4RNHA 3UT0A 3C0JA 1ZSXA 1OFDA 3KS5A 1Q66A 3ABOA 3LCFA 1XLHA 1UPPA 4UUIA 4O53A 4WRHA 4LB3A 2WC7A 1LOSA 2PDNA 3H54A 2WNWA 3ARWA 4F2TA 3A21A 2VUYA 2Q09A 1Z7AA 3L4XA 1O4UA 1YXCA 2HCVA 1NWRA 1L6SA 3WQPA 4W5UA 1UJQA 1NWSA 1GVFA 3QSRA 4ADSA 5HQMA 3P7YA 1B54A 4XWUA 1VEPA 4ML4A 1SJDA 3N2OA 1Q6EA 1WKDA 1X39A 3VDGA 2R14A 3PAJA 1FKWA 1UD4A 1P43A 3O1NA 2EJ1A 2DZPA 4Y8EA 4RW3A 1K9EA 3MUXA 2PTDA 4DX3A 5AYZA 1KRCC 2BZNA 4QE4A 1D7FA 2C0HA 1PKYA 3GTHA 2G3FA 3VU2A 4GH3A 4DJFC 2NQLA 4O54A 3M07A 4EIVA 4QSFA 3EZ4A 3W07A 3GDBA 5KMYA 3DI0A 5IFTA 3TQPA 4H7CA 1SZGA 1W3HA 1NTHA 3CTLA 1JAEA 2OG9A 1DEDA 1GZGA 1NDVA 3P6LA 3HJZA 3VKCA 3UYCA 1JCMP 2YJQA 1XH1A 3UR7A 2RJGA 1GJPA 2XU2A 1GORA 1N8FA 4PMJA 3CV6A 3GY1A 5LNSA 1UD5A 1KQZA 1RUSA 1ITCA 4FF7A 1VAHA 3SADA 1XLJA 1WDSA 2IW0A 1GVQA 3A3WA 3R8GA 4XTIA 1BG9A 5DCDA 3SDOA 5GPRA 1F5ZA 3LGEA 4M82A 5BXTA 4LW7A 4BZYA 4MB4A 3GR8A 1RJPA 3IVSA 4WX2A 4R85A 3T0BA 3WQEA 2ZX6A 1BRLA 3SCQA 3NPUA 4GIRA 1PX3A 3HTWA 1TUFA 3CUZA 1TMQA 4MJZA 3TROA 1WBJA 5C9WA 2PDLA 3WDJA 3BE7A 1Y7VA 3V5FA 3WDQA 3UXLA 1SW7A 4JIPA 3KOFA 4KESA 3UGVA 1C29A 1DE6A 3QTPA 3LCLA 4O1AA 3SAZA 2PODA 2BG5A 4U28A 3VCCA 4JX4A 3A3HA 4LANA 3KBWA 4NZJA 4JTJA 1NH6A 3CV7A 4R53A 4PMQA 3I65A 5AHNA 4NJIA 4MB1A 5AZ1A 3HBLA 4TX6A 5BZAA 1POKA 4A6GA 3S42A 2C0AA 3PC0A 3QN3A 4ZO6A 3PJTA 3PY2A 2YB4A 4Q8WA 4V15A 3VZZA 4AY7A 1RK5A 1R3RA 1VR6A 2DZWA 3DFSA 4ADUA 1A5CA 4ROPA 2P3EA 2YBTA 4BWLC 4OT7A 3SCPA 3H21A 1P0KA 3VNKA 4S23A 4CVWA 3IIXA 3T44A 1NIUA 2ZUWA 3QMTA 1RY8A 4AX6A 4LYQA 1AA1B 4LVBA 1FOBA 4IPJA 5EMUA 3M41A 2Z1XA 3FIGA 1BXNA 4Z1BA 3BLPX 2Z28A 3LS9A 3LENA 1GUVA 2ZC1A 3RN6A 4C6MA 1F2JA 2BVTA 3MMUA 4IUOA 1PAMA 4IQDA 1DTUA 3UQNA 3PG9A 4R9XA 5AB3A 4S3EA 4H19A 4JL1A 3UJFA 4JEQA 1FUYA 2JE8A 2ZZ3A 1B5TA 2UBPC 4CKQA 2BS9A 4NX0A 1V77A 3C52A 4UMCA 4W85A 1UBPC 2QIIA 5J5DA 1F07A 3EB2A 4IPNB 4IG2B 2PC4A 3HM7A 4MKVA 3PF3A 1XLKA 4XZIA 2Z26A 1IWBA 3DC8A 3SY8A 2VO5A 3IRSA 2QCGA 4HZ7A 3T9PA 1H7PA 1UG6A 1UD2A 4ATWA 5I3HA 3NJ3A 1ZP3A 2X1RA 5AECA 4Y2WA 1E72M 4GC3A 3VOCA 2C91A 4LS1A 3NFUA 4JN8A 4MY1A 5FJUA 4JX6A 1KM3A 4H7VA 1E3ZA 3Q37A 4ORMA 4KFNA 3B0YA 5CPOA 3IIVA 3SI9A 3S1UA 5DELA 5EL1A 3ENLA 1E0UA 3UCCA 2W63A 3E74A 3H2MA 3WH7A 2BOEX 3OZOA 2O0TA 3EOEA 4QNWA 1EP3A 3QZ6A 4OECA 3TU9A 4PE8A 2V5BA 1IZKA 3G3DA 3SR7A 4ONVA 1DQUA 3QFWA 4QNEA 1VD6A 4DZHA 1ZAHA 2TRSA 3N19B 5FJRA 3NYZA 1J4EA 3EX3A 4L61A 3LHVA 4O1DA 2HVMA 1SZRA 3T4WA 5LIUX 4O1CA 2CKSA 2E6AA 4E2BA 4UR7A 5E09A 3CAKA 3BC9A 3FS2A 1VFFA 2OQYA 2PF0A 1KXVA 1O66A 3WH5A 2PWVA 1KCLA 4KRTA 1KXQA 2Q3OA 5BYWA 5LXEA 4HN4A 4N9CA 3WQFA 1W54A 4HA3A 3JZEA 3AWNA 1G4EA 2YFNA 2VQUA 3F1QA 3NZRA 2C19A 5CAKA 3VDAA 4JQ3A 2EKCA 1H7OA 2PDHA 2G5WA 4BFAA 2UWFA 3B0UX 2VRJA 3URBA 3W1TA 1T99A 1HIZA 4HNVA 3SJNA 3NEVA 3A9BA 2JF7A 4L4OA 4AZ6A 1IR1A 1M7JA 2OKTA 3EPMA 1JZ7A 1DWGM 1GG1A 1YTEA 1KFWA 1VS1A 2REQB 5FF3A 3AHYA 4MWAE 3CQIA 3PJUA 2PGFA 2VHLA 1E9IA 1GPFA 1T8QA 1OGBA 3QZAA 4TOQA 1QXLA 1X1NA 4LEQA 3N2CA 1Q7ZA 4MKNA 2VRKA 2HE8A 3TC7A 3WN6A 4KIRA 4EPKA 4PODA 3G22A 3HG5A 4IF2A 3VIOA 3TLQA 2WK2A 2ZUVA 3PHAA 3WQGA 4JYEA 4S3KA 3SFWA 4Z2JA 5A6KA 1OG6A 3QBUA 3ALGA 1JAKA 1SM9A 1JCJA 2OPJA 2BGQA 4NP7A 5MF5A 3HPZA 1M6JA 3FA5A 3E38A 1LQ2A 1GKQA 3S6TA 3ABZA 4AIBA 4XAYA 4NRRA 1QOQA 3LRKA 3CHCA 2QHAA 1ZCOA 3O3RA 1AJ2A 3CZ8A 3TYCA 3G6LA 1EO7A 3ANYA 1U83A 4W84A 3MUZ1 2QDEA 5A2AA 1IWAA 4DBSA 1AH3A 3VUSA 1BSIA 3WG6A 4C1NA 2CLIA 4KWWA 3PBYA 3KXQA 3NTYA 5K4ZA 1IGWA 4GNKB 1BVZA 1DXEA 3SQMA 1N7KA 1JI2A 1FY6A 5D02A 3RLGA 3MWCA 3VE9A 1H50A 4QS5A 1YRRA 4IFOA 3N2XA 4QG6A 4HCLA 3VO0A 5HMSA 3KRZA 3BV7A 1KGXA 1OX4B 2FTPA 3F5KA 3NQMA 3B8DA 5CC5A 3GXDA 2NV1A 2Z1WA 1VRXA 3ITXA 1I45A 2WZHA 2VEFA 3CPRA 3G5EA 3MSYA 4MY9A 2W9MA 5IM51 2CBJA 5TNVA 5I24A 4O8AA 4A29A 2DP3A 3LPOA 2BGNE 4AISA 4HNNA 1WKYA 3W76A 5FF4A 2E5BA 3ZOAA 2Y6ZA 5CG7A 5T9BG 1MW1A 3GH5A 5FF7A 5HR6A 3GW3A 4IIBA 1D3HA 1PYMA 1PIGA 1E70M 1DJQA 1M04A 1BFNA 1H7XA 3C0SA 3N29A 3II1A 1ONXA 1RHCA 5BXSA 1NY1A 2Z6JA 1H0GA 1JGMA 5BMWA 3IUIA 4XV0A 1ZY9A 3PJWA 4JEJA 1A5SA 4RZ4A 3EWZA 5CSSA 4PB5A 1U2YA 4YYCA 1HP5A 2E6FA 1IT0A 1W1VA 3TONA 4GHRA 3JS3A 3AIEA 1TYGA 3V75A 4GVHA 1E4IA 3FOKA 1B9BA 4GYKA 3WLPA 3IVTA 4PBEA 4L1GA 1OFEA 2D3NA 4N02A 2CZVA 4FEZA 3U2ZA 1ZB5A 3QR3A 1GOWA 2QDGA 3ZWSA 5KZ6A 1UR1A 2D0HA 1OFBA 4NSBA 2KX9A 1GTEA 2EG7A 3TZNA 1CEOA 1M5WA 2WSKA 1JYVA 2ZRWA 4H01A 4IFKB 3T8LA 1XLAA 2IPJA 4Q32A 1VENA 2AOSA 4E4UA 2NSOA 3DFQA 5HPCA 1S46A 5JH2A 4A8IA 4WDTA 4DYJA 1WQ5A 3W1QA 4US6A 3MT1A 1EWDA 3RX4A 3GU1A 3ZVIA 4IUGA 1UC4A 3I4EA 3HU7A 3UZWA 2QS8A 4KIEA 3V5CA 1I1XA 3T81A 4PCPA 1W1A1 3LPGA 2FTWA 2JEPA 3WNNA 2GVLA 3VOJA 5DT7A 1CB2A 2ZTJA 5EU9A 2YKKA 3JUGA 3ABQA 1RP9A 1I60A 4JQ1A 1GVOA 3R8RA 4HMNA 1N8IA 3B8UA 5F2GA 1Q13A 1VBJA 2CZDA 2HNHA 3SUVA 1DJZA 1SMAA 4JIQA 5CGQA 1OB0A 4CCDA 3SCVA 2XM1A 3IGSA 2AMGA 1UR4A 3D6NA 3EKLA 2SFPA 4P7RA 3GHUA 3M6YA 1MXSA 3VIKA 1HJSA 2C71A 1D3GA 1CZ1A 4DWSA 5FL1A 2WV8A 4HPJA 3GDMA 1I0DA 1W5MA 1B2YA 2IPWA 3AYVA 4AMCA 3VGEA 2IKJA 1E5NA 3OVRA 4Q4KA 2YB1A 4BY3A 2OLHA 4GIAA 2EPNA 3T6CA 3CXOA 3WLQA 2YX0A 1X8CA 3QFEA 4YWIA 1UD8A 2E25A 2VELA 3M0YA 3R7MA 1QPQA 2POTA 2FVMA 1OQFA 2HPIA 2YCLB 1AG1O 3PR2A 1PWMA 3G1FA 3DOPA 3O6DA 1GT8A 3KRUA 2JKEA 2HDJA 2WVTA 3FHQA 3SQLA 3CO8A 5C2XA 2DUXA 1OFAA 4GQ0A 2BY2A 1UP0A 4O13A 3H23A 2D69A 4GI6A 3ZQ9A 2XIIA 3RJYA 1X38A 4AWTA 3KCJA 2E3ZA 1E6ZA 3VZXA 1EF2A 4FHAA 3IJIA 3CBWA 1V5XA 4M3PA 4PUKA 4PMVA 2YPIA 4AX7A 2VYOA 3THQA 3BSGA 3WD0A 1Q45A 4Q8VA 1XBYA 1DJIA 2VZOA 1PZ1A 3ZT6A 3NYDA 3EMQA 4GNJA 1UWRA 3S3GA 2X1TA 1TPVA 4C5ZA 3G1RA 2RGMA 4HSHA 4U2YA 2WKJA 2CYGA 1V6TA 4MPQA 2H3BA 3WL0A 3GZ3A 4J40A 1YPIA 1NSJA 3BTNA 2W61A 3S83A 3RX3A 3CK5A 5XINA 1TJPA 1W3IA 5K9DA 1SZNA 3LCIA 5G2IA 1I8JA 1S2CA 4WSJA 2PDWA 1L2QA 4ZTXA 2QUUA 4DEFA 4NXSA 3ZSSA 5ENLA 5HNNA 1VEOA 3OYXA 1EOKA 3FFSA 1RPXA 2ISDA 3GNNA 3C4UA 1QBBA 2VR4A 1ZBVA 4C60A 3P62A 1B3XA 1FCUA 1CXLA 3WJXA 1KW1A 2CESA 2XN1A 3KZPA 5D33A 3G24A 1VP5A 5JIWA 2BOFX 1KC7A 3D3AA 3GVVA 3GFZA 4F66A 4O15A 1R9ZA 4LCSA 1FH8A 3HGRA 4DBUA 3IGUA 4X63A 4JN7A 3B8IA 4F0MA 2HTMA 2WJZA 3QHOA 5L6UA 1Y65A 2W92A 3W26A 1GZ1A 4ERIA 1JNDA 4DPPA 4E3TA 4XBSA 3AXIA 4EPDC 1I0BA 4B9YA 4FP1A 1A0EA 2J9YA 2V82A 5FJPA 4L64A 4HNOA 1M68A 4H9XA 3MBDA 3T0DA 4UOZA 3LI0A 3SIMA 2J25A 2XIQA 1LBFA 3SCUA 2A7PA 1NDZA 1BRLB 1VFOA 5A2BA 4HHPA 2J27A 3L66A 4Q4SA 3CNYA 5G4WA 3SUWA 5I09A 2PSNA 2PTXA 3PSWA 1OWQA 4US5D 3IACA 1FWHC 1O5KA 2PRLA 4PCTA 1TE6A 2PP0A 4AIOA 1Y5WA 3HV8A 4EWND 1R47A 4O17A 4D6GA 4KCVA 4H7ZA 1EWEA 4QFUA 4WSHA 3E9AA 3IS4A 1NWUA 1X6NA 1QWGA 1W17A 3WQ6A 3WF0A 2TSYA 1KM6A 2RH9A 5KSWA 3E0IA 2J77A 1RR2A 3KTSA 3UY7A 2IS7A 4LUIA 4QIUA 1P0DA 1SFSA 4K7VA 3GNXA 4JTSA 3NOYA 1K1DA 3QOKA 3B0XA 3NZPA 1OK6A 2FDMA 1IXOA 3H2NA 4YLWA 2NXHA 3CT7A 3UZYA 3MSRA 4UTTA 4WR3A 5LHFA 3PZIA 4AD4A 3L5LA 1AJZA 1RD6A 2FPYA 4CCZA 4DI9A 1TFVA 1NF7A 3AIQA 1K9TA 3W2MA 1ONEA 5REQA 4M6UA 1PJ9A 5AZ0A 4YCPA 4MAZA 3LHUA 4XBJA 3BICA 4WHBA 1ZCCA 1W9BM 1RY0A 1J18A 3LB0A 4PUJA 1PZ2A 2VL4A 1GYMA 4ES4A 3GTXA 4JFVA 2PDIA 4ZB2A 1IYXA 3R58A 1IGSA 4N6FA 3WO8A 4O0QA 3QYQA 1TPC1 3MJYA 3LI1A 3OLIA 4O18A 4QR6A 5JXQA 4L5ZA 1XYAA 2OFJA 1GOMA