3GUWA

Crystal structure of the tatd-like protein (af1765) from archaeoglobus fulgidus, northeast structural genomics consortium target gr121
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
233
Chain Sequence
YFDSHLHSEGLGFSELVKLKENGIKEVCSLAFFPVKPKYPQTMIDVFRKLTEFEPLRCEAAGVKMHPAVGIHPRCIPPDYEFVLGYLEEGEWVAFGEIGLELVTDEEIEVLKSQLELAKRMDVPCIIHTPRGNKLKATRKTLEILESLDFPADLAVIDHVNFETLDMVLETEYWIGLTVQDAARIVAEHGERFMLNSDAGYRVAEAAVKIEEAVGREEMEKVARENARKFLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein AF_1765
publication title Northeast Structural Genomics Consortium Target GR121
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
total genus 56
structure length 233
sequence length 247
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3guwA00
3E74A 2WJEA 1EJWC 4J5NA 4CQBA 4EP8C 3PAOA 4XD6A 1GKQA 2PGRA 3KM8A 2R1KA 3S2JA 4LFYA 4C6QA 2UBPC 3MTWA 1EJRC 2FTWA 2R1LA 1RA5A 4WGXA 4GY1A 4KERA 4NI8A 1K70A 2PUZA 2Z29A 4C6BA 1YRRA 3MJMA 2AQVA 4DZIA 4DZHA 4GYFA 4R7WA 4RDYA 3R0DA 2F6KA 5HMEA 2HPIA 1R9ZA 2DVUA 4KEVA 3URBA 3OU8A 3FDGA 3EGJA 3FDKA 4GBDA 1EYWA 3PNUA 1A5LC 1V51A 3MPGA 4XD4A 4R85A 2EG6A 1O12A 1E9ZB 1DPMA 3NEHA 5A6TC 4GY7A 2I9UA 4C65A 4EPBC 4IFKB 1I0DA 1ZZMA 2R1NA 3EWDA 4KETA 1RJQA 3DC8A 4XAGA 3IPWA 5FSDC 4GZ7A 2KAUC 3PBMA 4P5UA 3IRSA 1FKXA 2HNHA 4B3ZA 3A3XA 3HPAA 1KRAC 3S2NA 4ICMA 1XRFA 3LNPA 2IMRA 4F0RA 5FSEC 2G3FA 4YIWA 3CJPA 2A3LA 1M65A 4J2MA 3MKVA 3AUOA 4KQNA 3O0FA 2ADAA 2Z27A 4OFCA 1YIXA 4CEXC 2Z24A 3IARA 2OGJA 3F2CA 1RJPA 1O5RA 4UB9A 3MVTA 2QT3A 1EJTC 4C6DA 1NFGA 1KRCC 4DNMA 3TN6A 4XAZA 1QXLA 3WZ0E 4HJWA 1ITQA 4C6KA 3E2VA 3GTIA 3N2CA 4J35A 2VM8A 4LANA 1PB0A 3B0XA 3GIPA 4AC7C 4HA0A 1P6CA 4QS6A 4IG2A 1UIOA 2HPMA 3PANA 1UMLA 1YBQB 3SO7A 1NDVA 2Z2AA 3F4DA 4RZBA 4EPKA 2PGFA 2EG8A 4IFRA 2ICSA 1A5OC 4DLMA 3V7PA 3OVGA 2DVXA 4H01A 3IGHX 4L6DA 4C6EA 3RHGA 2Z28A 4HK5A 4LEFA 4CNSA 3QGKC 2VUNA 3GIQA 4HK6A 3LU2A 4INFA 3JZEA 4B92A 2O4MA 2WM1A 2E25A 2GWGA 1YNYA 4I6KA 1P1MA 1ADDA 4E3TA 2EG7A 3UF9A 1KCXA 2E1WA 1UBPC 4IGMA 1POKA 4C5YA 4G7EB 3TN3A 4CNTA 3HTWA 4UBPC 4V1XA 2WJFA 2GOKA 1RAKA 2DVTA 4CQCA 4CNUA 4IQJA 1XRTA 1RA0A 3S2LA 1R9YA 3PNZA 4MUPA 2VHLA 1XGEA 1V7AA 4G2DA 3F2DA 1IE7C 2QVNA 3IACA 1ITUA 3GG7A 4DLFA 3LSBA 3URQA 4C6JA 3MDWA 1ONXA 3OJGA 4C60A 3RCMA 3TNBA 1V79A 4IFKA 3NQBA 3IJ6A 3K2GA 4QTGA 4PBFA 2Z25A 3T81A 4RDZA 1GKPA 3GTFA 4BY3A 1RK5A 1RK6A 2GWNA 4Z42C 3A4JA 4KEUA 4KF1A 4CEUC 4C6PA 2P53A 3K4WA 4LALA 4KIRA 1KRBC 3GTHA 3LY0A 4NP7A 1E9YB 3LGGA 4LAOA 4C6NA 1FWGC 1FWFC 1BF6A 2Y1HA 1FWDC 2ZC1A 4C6IA 1FWAC 4ERIA 4AQLA 1A5NC 4PBEA 1WXZA 3UR2A 1PSCA 1J5SA 1PTAA 4H9MA 1PO9A 3T8LA 3AU6A 4KESA 2UZ9A 3EWCA 2VC7A 1EJUC 1R9XA 3CAKA 2Q09A 1V4YA 3TN4A 2QPXA 2YXOA 3ICJA 3F4CA 4LAKA 5AKQA 4GC3A 3GRIA 3UBPC 3B40A 1FKWA 2Z7GA 4H9VA 1FWJC 4H9TA 1K1DA 2PLMA 3ISIX 4L9XA 4C6CA 2FVMA 1JGMA 4HK7A 1J6OA 4PCNA 4LAMA 3C86A 3O7UA 2YB4A 3ID7A 4D8LA 1M68A 3GTXA 3NURA 4IG2B 3S2MA 4DI9A 2BB0A 4C5ZA 2Q01A 3ITCA 3E0LA 1NDYA 3E38A 2W9MA 3HM7A 2OQLA 4WVXA 1RJRA 1EJXC 4ERGA 1M7JA 4B90A 1QW7A 3D6NA 4GY0A 3E0FA 4LCQA 4QROA 1UIPA 4QS5A 3T1GA 2RAGA 2WJDA 3GU2A 1NDZA 4R88A 4RDVA 2Z4GA 4DO7A 2P50A 2HQAA 3LS9A 5LXXA 1FWEC 1NDWA 5E5CA 1J6PA 4LCRA 3RN6A 3UR5A 1FWIC 1S3TC 2O4QA 4EPDC 3QY7A 3FEQA 3K5XA 3DCPA 4GOAA 2YB1A 4QRNA 4B91A 1A4MA 2BGNE 3OOQA 3WYZA 4XAYA 2OODA 1KRMA 3GU9A 5G4HC 2XIOA 1V77A 3S4TA 2GSEA 2YZ5A 2Z2BA 4IFOA 4GX9A 3TN5A 2OOFA 2FVKA 4GK8A 4LCSA 4DI8A 4DYKA 3URNA 4CQDA 1ONWA 3OODA 4H9ZA 1A5MC 1XWYA 4GX8A 4EPEC 2GZXA 3GUWA 3WMLA 4F0LA 3F2BA 4H9YA 1I0BA 4H9XA 3MVIA 1YMYA 4ERAA 4NG3A 1EF2A 3LGDA 1EJSC 2D2GA 5CH9A 4DIAA 4C6FA 5HMFA 3B0YA 3RYSA 3AU2A 4XAFA 2R1MA 4ZSTA 4C6LA 4WHBA 3QGAC 3CS2A 1K6WA 1A4LA 2PAJA 4H00A 3MDUA 1HZYA 4LH8A 4JOMA 4M51A 4F0SA 3IV8A 3QY8A 2HBXA 4XD5A 1EJVC 3LA4A 2AMXA 1EZ2A 3A3WA 3UPMA 2ANUA 1FWHC 2Z00A 4I6VA 3OQEA 1P6BA 2D2JA 4TQTA 2AQOA 1YBQA 2OB3A 2D2HA 2I5GA 4RE0A 1J79A 3BE7A 4RDWA 4XD3A 4C6MA 4BJHA 2QS8A 1POJA 1VFLA 4V1YA 2FFIA 2VR2A 2FTYA 4BKNA 2Z26A 3GU1A 4IH3A 5HMDA 3URAA 4QSFA 1WXYA 3MSRA 4IGNA 3DUGA 3G77A 4PE8A 3LSCA 4IF2A 3QY6A 2HBVA 4C6OA 1GKRA 1FWBC 1W1IE 3SFWA 4GXWA 3E3HA 2R1PA 2CZVA 1A5KC 4PCPA 3ORWA 4ZSUA 4KEZA 4H9UA 1FWCC 2VC5A 4G7EA
chains in the Genus database with same CATH superfamily
3P6LA 2QJJA 5AN7A 3PZQA 3E1F1 3WQDA 4ZA0A 2PGRA 1C8QA 2D0FA 4QNWA 3SGUA 3H54A 5BXRA 4WGXA 3GS6A 3D3FA 3VD5A 3NGFA 4XVEA 3AXHA 4CKQA 1Q6RA 4DZHA 5DCEA 1W3TA 3QW4B 1EKOA 3GNOA 3W1PA 4B3LA 1M3UA 3LBCA 3H2AA 4XBSA 4D6DA 2YBUA 1PTGA 1UA7A 3CT2A 1IXNA 1RPXA 2QYGA 2DZVA 2NWSA 3PNUA 1LG2A 1H5VA 3N3TA 5B7YA 4PMDA 4B5SA 1C7SA 3TROA 4K7VA 1ZP3A 2H3DA 1NOWA 4PUNA 4KMQA 2GL5A 2NXHA 3MMUA 1GEHA 3KL0A 3W23A 4CD5A 4L4LA 3IAPA 1FCVA 2WWCA 3EWDA 1A3HA 4XAGA 5M1TA 1UWAA 3LHTA 3N9SA 3IRSA 2HNHA 3G0SA 4LUSB 1F8IA 1XM3A 3LNPA 3AROA 4O19A 3UQNA 1EPVA 3BG3A 1V0NA 2EPOA 3AUOA 5E9XA 3QV9A 4OFCA 2OCZA 4DBDA 3Q58A 2YX0A 1O5RA 1R7OA 1EWDA 4IICA 3GW3A 4DYEA 3WF2A 3F5LA 3OZOA 3DOPA 1YDNA 4R27A 1XIFA 1AMYA 1FHVA 3B0XA 4Y96A 2WANA 3N2BA 1W2VA 3INPA 2VQTA 1Y5XA 4O1FA 3M64A 2ZTJA 4G1NA 4K68A 3QGVA 1UMLA 3SO7A 4A35A 5BU9A 1G4TA 1TCMA 1BYDA 3CHDA 1ZJBA 4UFJA 2HWGA 3IGHX 4RPQA 4LEFA 4ZOCA 4WK9A 2ONEA 2Z1WA 1OINA 3LU2A 2YDRA 2E9BA 3CZJA 3U6WA 2ISSA 2G97A 1E0VA 1DJYA 2ZDSA 4M24A 4Q4SA 4GIEA 5C2CA 1UBPC 3LM3A 4UTWC 3QOKA 4C1NA 2WNNA 4LTSA 3KRUA 3N13A 4JQ2A 1CGXA 2O92A 2NQHA 5GQBA 4IQJA 5AYIA 2PDBA 1V7AA 4FEZA 2VT0A 1C93A 2QVNA 2QIWA 1GW9A 3VA8A 4P7LA 1YX1A 1OFBA 2ASHA 4C60A 3TNBA 5HR7A 4ZQCA 5MKGA 4L1XA 2Z25A 2H9AB 3GG1A 3RMEA 4H8HA 2GWNA 4LBSA 3CWOX 4F0MA 1PKNA 2NVCA 4GXMA 2BOGX 5IBXC 3B8UA 1E56A 2G4JA 4YTTA 3LY0A 4AMAA 1OZMA 1O66A 2XJ7A 1OYBA 3A21A 4WY0A 3WH7A 1ZNNA 3R6IA 2PP1A 1TJ2A 4PUJA 1XF0A 4MJMA 4XZMX 2VR4A 1PSCA 1PCWA 3T2QA 2X2GA 4GVIA 2ZA2A 3H8AA 4H9MA 4YTUA 2ACUA 1AQMA 1DXEA 1JCTA 4WGHA 5C55A 5C71A 7TAAA 3ICJA 3F4CA 3ZO9A 4GC3A 4D6CA 1T99A 3BAYA 4I9MA 3W00A 3W73A 1A5AA 1C9WA 3CAVA 3T42A 1K1DA 5CPQA 4FSAA 4C6CA 1E0TA 2WZEA 3HFTA 3EYPA 1OFPA 5D8WA 1JR1A 4YHEA 2E8YA 3NURA 3OZYA 1D7KA 2VDHA 1ZPTA 3ITCA 5E0KA 4KBXA 4UTIA 3LEPA 1UKSA 2W9MA 1XLKA 5L6UA 2P8CA 1SSGA 3ZOAA 1RJRA 1EHAA 3RM8A 2VEIA 3H2FA 1V6TA 4GCAA 5CGQA 1KO0A 3F03K 3ARQA 3W7HA 3XINA 3G1AA 1E6RA 2QR6A 1P0DA 2XN2A 3LPFA 5AZ1A 3R8RA 1RLDA 4HIBA 4FB7A 2BDQA 1KQZA 1TTQA 1XIHA 4HMNA 1HJVA 4JQAA 4Q8TA 1AZ2A 5HA7A 1J01A 3W24A 1O5XA 1JDAA 1GCYA 2KZHA 4O13A 4XSLA 2G50A 1DTNA 5G4HC 2PU1A 4A2SA 4HA4A 2PURA 3S4TA 5A6BD 2JKEA 5FL0A 1BEUA 5LNSA 2FVKA 2VC9A 3HQNA 1QO5A 4D6GA 1XLCA 5G2HA 5DMNA 3LRMA 4K1WA 3B03A 1NJJA 2BHZA 3NYDA 2Z7KA 1GJUA 3MY9A 4O50A 1QWGA 4J4KA 2CXEA 4NG3A 2GJRA 3NFUA 3WF4A 4MPQA 5HMFA 5HUOA 1U22A 3WQFA 1OFDA 3TMLA 3WNPA 4H00A 1GVQA 4R34A 2X7VA 1LQ2A 1OIMA 1EBHA 3L4VA 1XG4A 3IV8A 5K9DA 4GG9A 1IXPA 3EWZA 2A6LA 3UPMA 3VGGA 4W8AA 1YTKA 2OVLA 1P6BA 3OQEA 4JNMA 2IXVA 1OX5A 3OA3A 4CD6A 3TV8A 1HJXA 4NUWA 1L6YA 4MZ8A 1V03A 2VI0A 4MWAB 1ODZA 3GU1A 2D3LA 2TPSA 4MFDA 4MB3A 1TIMA 5AOUA 2VX4A 3QY6A 3C2VA 2D22A 1X1ZA 2WKGA 4D1JA 2PDQA 1NF0A 4FNPA 1NOFA 2XYLA 4UQCA 3M0LA 1QR7A 2J7BA 2CBUA 1FWCC 5G2IA 3S2CA 1HVXA 1WAWA 1WOBA 4IJCA 5F7UA 4ORIA 3S9ZA 2WHKA 4Z2JA 1CEOA 3S42A 3SQMA 4S3CA 2FJKA 2GVEA 4OQVA 1MMFA 4RX0A 2Z1XA 1NOUA 4D72A 2F7FA 1M7XA 2DT3A 3VIIA 3KFTA 4C1KA 3ARTA 5EMJA 4WUIA 1R0MA 1F6YA 4AWUA 1VB9A 4Z17A 5AECA 5D05A 1IR1A 4O0QA 3C52A 2NV2A 4L65A 4GFSA 2DDXA 5HQEA 4BHYA 3QTGA 4KWOA 3N14A 2WMHA 4PUUA 2YLAA 1B57A 2I9UA 4RJEA 1QAPA 4CU7A 1H4PA 3TLQA 1E70M 3W28A 1ME8A 2WBGA 4M6UA 4W86A 1JF5A 2C15A 3TP4A 3HPAA 2Q8XA 3R0KA 2CLKA 5LYRA 5A6SA 1F5ZA 1OCJA 4AEOA 2J7EA 4LV4A 1MRQA 4I9AA 3N1AA 4LAZA 1EP1A 3KVKA 1J10A 2DH2A 4I9TA 4F8XA 1SO6A 5HNUA 1PBGA 3M5ZA 1Z6KA 3CO4A 4UR8A 1TPDA 3W1XA 1KR0A 1NWTA 2E67A 4BF7A 4XIAA 4AC7C 2ISWA 3IJ8A 1GQKA 4QS6A 2QCFA 2BVDA 3LCWA 3PANA 1JYNA 1YEYA 2E0PA 3N4AA 5FCZA 2GQ9A 3WL1A 2YW4A 3R12A 1GQJA 2A7PA 3E2RA 1M9HA 4H41A 4RLIA 1TVNA 1V6UA 4S3FA 2WM1A 3W7OA 3USZA 1P1MA 1SFLA 4JTSA 2GK1A 3CNYA 3K8KA 1DTUA 1S2VA 4C5YA 2PPGA 4ONVA 3BW3A 3EDJA 5HNNA 1LRTA 3O2LA 3TC3A 3DFHA 3LPOA 4CU8A 2GOKA 3OBKA 3DG3A 1QHOA 4KS0A 1PX3A 1UW9A 5H2ZA 1SFSA 2P5NA 1AQ0A 3SCPA 2Y88A 1YKWA 3CAQA 3AIEA 3DX5A 2W91A 1QWKA 4MOZA 4L9ZA 4RDZA 1GKPA 1Q8JA 5CXPA 5G1TA 1FCQA 1RK6A 3KS5A 4GACA 2FFCA 2XPKA 4NZ5A 3Q65A 3C2OA 1J5TA 2CLIA 3V0SA 4BQ4A 4ACZA 5F2GA 3UPBA 5HK4A 1BF6A 4ZOBA 4AYSA 1KFJA 5ABGA 3MKCA 3VOFA 2FZNA 2NSOA 2DZWA 3AU6A 3O6YX 3W1UA 1H62A 4DHGA 4LSBA 3MANA 4W88A 3PN8A 4JIQA 8TIMA 1XQKA 5LIXX 4URIA 2KX9A 3B40A 3ZVHB 2CU0A 1AZ1A 1FWJC 3O6AA 1QI2A 3FYYA 3BJSA 4DBUA 4ZO8A 3UYCA 2A3HA 4MGGA 4JTEA 1A3XA 2F38A 1IGSA 4PCNA 2D69A 5A2BA 1GJWA 3B05A 4OOUA 3DXIA 1LOQA 3M5XA 2A1YA 3KBNA 2D2OA 4F3HA 2ZZ5A 2GUUA 2VQUA 3PB0A 1QRQA 3CYVA 2C3ZA 3VKCA 2YCIX 4QROA 3CV7A 2ISVA 1KKOA 2Y7GA 4BEUA 1W2PA 1ME9A 2DU2A 4NSBA 3HB9A 3UESA 3MWAA 3UXIA 4FLQA 2IQDA 2OODA 1TX2A 4R9XA 1V77A 1VC4A 4Y8EA 5H1WA 3THCA 1J96A 5F4SA 4PMXA 3URNA 4IMDA 3IJDA 4ATWA 3QZ6A 3WUEA 1UD2A 1B1YA 1PXGA 7TIMA 2G8ZA 3P60A 4O16A 1A80A 2G3IA 3NQ8A 3ZR4A 2ZC8A 3VZYA 3LD5A 3PZ9A 4H6QA 3B8DA 4NAEB 3I65A 3HZ3A 1OJXA 2V68A 1V3MA 3CXOA 4NYYA 3TDFA 1SR9A 3OB8A 4CQ9A 2P3ZA 2QDHA 4DJFC 1SZGA 2YKKA 1HJWA 4ZB0A 1DJGA 3WN6A 3O05A 3VDBA 2WNWA 5DCDA 1PZ2A 1KFLA 4LV9A 3QMTA 3BLDA 4RW5A 5EKYA 2G41A 1WPCA 2PF0A 3PZIA 1JYXA 1CXIA 4YVPA 3TLLA 1AG1O 5KZ6A 3BOXA 4NNCA 1V6VA 4R5EA 3M16A 4RDWA 4MWAE 4QDMA 2GUBA 2E1DA 3AOFA 1UR3M 2OPJA 4M81A 4QAIA 1EO7A 1Q2RA 2FFIA 4REQB 2AKMA 4US6A 1KBBA 3HMJG 4UCGA 2QV4A 5HNTA 1KLYA 4IGNA 2F6UA 4JBRA 4AIBA 4YLWA 2VEMA 4JIPA 4C6OA 1K77A 4XK2A 3PZGA 5KETA 1KW1A 3L21A 3NZ1A 3D5HA 5EFDA 3FA4A 4HU0A 3MI3A 4NNAA 4U5KA 4PMNA 3M07A 3RJYA 1FP8A 3B97A 3L0GA 2VFFA 1CT5A 3KM8A 3NNTA 1CTNA 1LWHA 4JL1A 3KBVA 1RA5A 1O94A 4H4IA 1FWSA 4HZMA 4M5PA 4LVDA 2PUZA 2YDQA 2O9RA 5KZDA 5AYYA 2PDFA 5GJNA 3N6QA 4X22A 2AQWA 2B4GA 1A0DA 3VYLA 2QCLA 4BEQA 1F4HA 2P8BA 2RGMA 3MI2A 4DWDA 3EMZA 1GG0A 2OYMA 3LXAA 2ZVIA 1XCWA 5C54A 1PKMA 4H7VA 3AXXA 1GOOA 1UCWA 3UG3A 4KWVA 4C65A 4H19A 1MFUA 3GW0A 1LRNA 3P7YA 3ANYA 3E96A 1KD0A 1UKOA 3FK4A 3TFXA 2IS7A 1FFQA 4AD4A 4IQEA 1KFEA 2INEA 2QUMA 3U7VA 2V82A 4LYQA 2F6XA 1TJ0A 2Y7DA 2BY1A 2J88A 2VGIA 5JVLA 1UWRA 4ICMA 3SURA 1YDOA 1UP3A 1CNVA 1VS1A 3V36A 1YQ2A 3IIZA 1DXIA 3TVAA 1U2YA 4JYEA 5IHSA 2JEPA 3BH4A 3R58A 4UIOA 4M29A 2PBGA 3WMCA 2E09A 4JTKA 1V5XA 3EOOA 1R2SA 4OUIA 3FW6A 1CDGA 4GISA 4HJWA 4LXFA 3BAJA 3WZ0E 3RFAA 2PTYA 1P0EA 5KZEA 3CZEA 4GNVA 2WHMA 5I2UA 4N9DA 3N19B 4NX5A 3QTPA 3WJZA 2HPMA 3WLTA 3G5EA 4IPIA 1Q7QA 3EMCA 3RM4A 4L6HA 3W2NA 3ZS4A 1KFKA 1FXPA 4E38A 1PVNA 1OK6A 4MYXA 1AW5A 4L6DA 3T4CA 2DP3A 4S2BA 2PZNA 4PRWA 2V3EA 3OZPA 2VXNA 3MBFA 3W7LA 1G4SA 4IHCA 4GINA 4N02A 1CXKA 3WDRA 3FJ4A 4D9PA 3QPZA 1GNXA 3GNPA 5A6LA 4F2UA 2VFEA 3IJ7A 1T5AA 3S1XA 4XV0A 3WJWA 4P8WA 4Q33A 4ZGYA 3SRKA 3WH5A 4FNSA 3H7RA 4DJED 4Y9AA 1AW1A 1DQXA 2CZ5A 4CUCA 2FZDA 2Z6IA 4RCXA 4ORMA 1K03A 5HANA 4MM1A 3W7MA 3AICA 1G67A 3W7EA 5CPNA 3BLOA 4IMEA 3QM3A 5BMXA 2OEJA 1TREA 4EWJA 5CPSA 2YYUA 3AIRA 2XIIA 4LUSA 3ZMRA 5FEZA 2WQPA 4GJJA 4BCEA 2J62A 2CEQA 1XSKA 2BY0A 2V5DA 3HG5A 2XZ9A 4V27A 2OJPA 1S1RA 3ZT5A 4Y9OA 2FQIA 3E5BA 5A8NA 4J3UA 4YVVA 4HU3A 4C7GA 3KDNA 3W38A 3CIVA 1BPLB 3TWAA 2PDKA 2QMJA 4ZMGA 4JFWA 3GLCA 2XFWA 9XIMA 1YXYA 2QXWA 1GOWA 3NIYA 1Z9AA 2BNJA 3ISIX 2Y8UA 2Y7EA 1IIHA 3N29A 1LT8A 1GYMA 2CLMA 3WD1A 1P4CA 3D3AA 1QW8A 3BSHA 2J6VA 4ILSA 1WDWA 1MNZA 1LM1A 2RFGA 8CGTA 2QULA 1NFBA 3W1QA 3EEZA 5T9CE 3L68A 1TJRA 2I9EA 1SJBA 3MYPA 5D2YA 3EX1A 4QCEA 4LCQA 4PSPA 3APYA 2WJZA 2YCLB 3MW7A 5CGMA 5TD4A 4DO7A 1TJPA 3SZ8A 4B16A 1TV5A 4RR4A 4H2CA 4EPDC 2W0UA 4TUFA 2OWCA 2YB1A 1L8PA 3MCOA 1E1FA 4XAYA 4G9PA 3GU9A 4XUYA 1NH6A 2MNRA 4GX9A 3OA5A 1JXJA 2H9AA 4MZ1A 3G6MA 1DE6A 4DI8A 4YTSA 1BAGA 5EMKA 1LCOA 4P7NA 3SFKA 3O0KA 5XIMA 5FF7A 4WOZA 3F7JA 2DQWA 3HV9A 2WLZA 3LXBA 3SEPA 4E8CA 3PBYA 3EDEA 4AEFA 5I78A 2LLEA 1V6XA 2WCGA 4W5UA 2CERA 2Y4SA 3TE9A 1M03A 3RCYA 2FDMA 3FXYA 2JF7A 4IMGA 2JGYA 4RNFA 2NQ5A 5ENLA 4GYPC 3VZXA 2GJXB 3R94A 2NW0A 1UG6A 3U48A 2RJHA 1J79A 3WJSA 3VILA 3W6YA 3MUIA 4IM4A 4DO6A 1W5MA 3OYXA 1ITCA 1Y8BA 3GXNA 2Z26A 5FJIA 3URAA 1REQB 3L4ZA 3O06A 4J40A 3AUJA 1AFSA 1HJSA 1V02A 3W81A 3NQGA 3N2TA 5C0QA 3T09A 1JZ7A 1YXDA 5AYBA 5B7ZA 1TRIA 3TAKA 1GVYA 1DXFA 1VF8A 2ZRWA 5CZKA 4E4PA 4QDWA 4AD3A 4AIOA 3NQVA 1KM5A 4MPKA 5H8MA 4EP8C 1X97A 4GQ0A 3GKAA 1K8ZA 1UOKA 3PZMA 4D6JA 4LNYA 2YDAA 1OEPA 3GTNA 3ECQA 3QH2A 1DWIM 3H70A 4M6PA 4QX4A 3QV6A 2YFNA 3VIMA 4DVOA 4AD5A 2GYIA 2J9XA 1YRRA 4H7ZA 3PFMA 3GAKA 2NUXA 2IQ0A 2ZWYA 5F2LA 3C2EA 4Q8NA 1XLHA 5H8PA 3O16A 1CB2A 1MUWA 2DVUA 5EY5A 3UW6A 2EPHA 2GFTA 1JQXA 4IPPA 3RU8X 1XFBA 3M4HA 1WV2A 4FLRA 3M6DA 3VUSA 3S47A 3IUHA 1G7VA 3DYOA 1O12A 2W63A 2VD9A 1BSIA 2Y0FA 2CLPA 2FPVA 1LLWA 3POHA 1KGXA 1QASA 2W62A 5EPDA 2CKRA 5IOBA 2HE8A 1BGAA 1SFJA 2PDMA 1XRVA 3W88A 2XH7A 2CLEA 2Z1BA 4YTRA 1Q8AA 1PZ3A 3LHUA 4AHQA 1E1CB 5I6SA 4A8IA 1RJPA 2CHRA 2X0YA 1AL7A 1DJNA 1V3LA 3MT1A 5I3GA 1ZBVA 2YXXA 2Z1VA 2P1FA 2ZE0A 3SCQA 1RCXB 1DEDA 4CNOA 1JPIA 1P6CA 2XGBA 3MCMA 3TYUA 4JYFA 3NSNA 4Z2KA 3LCHA 3L67A 3QJAA 1B3OA 4LF1A 3GNNA 1GVIA 3LCGA 1PZ1A 2QUTA 5K9XA 3GDTA 3OTRA 5I00A 2ZIDA 1LUCB 2VRQA 5DMYA 4E4FA 3V18A 2DW6A 4DLMA 4FXRA 1XLJA 4GGBA 1KM0A 5FF4A 3EXTA 1PL9A 2D20A 3VD4A 4LQ1A 1UUMA 3EMQA 2CYGA 1NWRA 3PS7A 4ADTA 4HD5A 4AWSA 2Q8LA 1NELA 4OGZA 3H4XA 4IGMA 4MNMA 2DZUA 1PKLA 1UP2A 1SSDA 5E9AA 4NZFA 1L2QA 2V2HA 3UY7A 1VCGA 3PP7A 1DBTA 4IGHA 2Y62A 1AH4A 1GJPA 3TSBA 2VHLA 1QFEA 1EC8A 5XIAA 5CZJA 4ACYA 1DWAM 4M1RA 1TE1A 1PHWA 4D6FA 1KGWA 2OWWA 4Z2LA 4QTGA 3KBJA 3TYCA 2VZVA 2XVKA 3CB3A 3W86A 1SFTA 4L1WA 3ELFA 3TTQA 2REQA 4C6PA 4PUKA 3B0PA 4Z1DA 1EOMA 1ZCCA 2BHYA 3T0AA 3BO9A 3AIWA 1J18A 3DN5A 2JEQA 4LYPA 3WLKX 2DZSA 4HA3A 3NQCA 4TTUA 3D46A 2CCRA 1XD0A 5CJ5A 4GJ1A 2Z1KA 4US5A 4OE7A 5I06A 2EKGA 3GM8A 2CPUA 3EOEA 2ZKMX 2Y5JA 3QRHA 4UNKA 4C90A 1XC4A 4AH7A 3QXBA 4YU1A 5AKQA 3WJYA 1ISWA 4AAJA 3U4AA 3PM6A 4Q8UA 3C4UA 2ZBTA 2D23A 4KFOA 3UJSA 1JF6A 3W85A 4IQLA 5BWFA 2FVMA 4MJ2A 5LKYA 2QCNA 1TR9A 1XIIA 2VFGA 1N2VA 2VRKA 3C2RA 1OIFA 5CAKA 1ITXA 5A5WA 2EJ1A 4GKLA 4OVXA 1ZALA 3ITTA 2VX5A 1RR2A 1W1B1 1PIFA 3R11A 1PCKA 3T0CA 1M7JA 4B90A 4DELA 4GY0A 3KDOA 4JIHA 3EDFA 3P82A 4YCOA 1EL3A 4CN4A 1V3KA 3LZ5A 2Z4GA 3A24A 2HQAA 3W7IA 4F2BA 5M2FX 4LBRA 4ZODA 4U31A 5M3WA 5CSUA 5BXPA 3CZGA 4UTUA 4WXYA 5BZAA 3UERA 2A3EA 5DBTA 3QV8A 1EJ7L 4GK8A 2ZCGA 4LCSA 3H6OA 2FPYA 1GGOA 3OODA 3NPUA 2FHBA 4F48A 1XWYA 1ZTVA 1FWWA 3A64A 5D04C 4JTHA 1O6IA 3GIYA 1O1ZA 1MXDA 4XVDA 3MVIA 4ERAA 3SSJA 3FCPA 1RPKA 3T44A 4M7TA 4FAMA 3CS2A 1TE6A 1VP5A 3T05A 4DAIA 1SZRA 4LVFA 1KWKA 3H4WA 1W9XA 4LUJA 3AS1A 4M19A 1XQLA 1UASA 5GJMA 1XYMA 4Q8OA 2FMNA 3N2OA 1CLXA 3NL2A 1EDTA 4ML9A 1QNQA 1XIEA 3UZZA 1L0PA 3ZVHA 5I24A 2PRMA 1Z32X 1CIUA 2DQXA 3BE7A 2XHYA 3MKKA 1OCBA 4RE3A 3L4TA 1O7AA 4E8DA 2VFIA 2HROA 2RDUA 5ABHA 4PBGA 4I7VA 3JS3A 4MAZA 3KCLA 3ANUA 2ZE3A 4FOKA 3H26A 5CJMA 3UA4A 1MQPA 2B31A 3PZVA 2HE5A 4G7EA 2WJEA 3K8MA 4HTYA 2C8NA 1W3IA 1XIBA 3NJ3A 2RHGA 4HA1A 2PWGA 2J24A 1OFRA 1R3TA 1YLVA 2UBPC 3IJIA 6REQB 5H6HA 4GY1A 1HO4A 2WC3A 1R85A 4IT1A 9CGTA 2G5WA 1IEIA 3WLHA 1S5VA 1OG0A 4UFHA 1H51A 2HPIA 4S2CA 1IEWA 4AXNA 2PU0A 3CZLA 3NZPA 4AEEA 3QZEA 4BR1A 2X1TA 2R14A 3EKGA 3BK0A 2ABAA 3NPVA 3SAZA 4H04A 4IFKB 1B54A 1C7TA 4H8NA 3EWYA 2V3FA 3IJ9A 1B3VA 3DG7A 4D2JA 3W7RA 1VBUA 4A4AA 1R5YA 3ARRA 4QE5A 1T7LA 2FH8A 4ADSA 1E0UA 4Q4QA 4C91A 2QZRA 3QQ1A 3QHMA 3CHEA 1TB3A 4J2MA 4YN5A 2WK2A 1IHIA 1IWPA 5SWUA 4Z2HA 3LHWA 1YIXA 3L4UA 3VIOA 2PRLA 3GVVA 3WQVA 1YDVA 4X9YA 4ZQMA 1HF6A 1NFGA 1KRCC 5CLWA 3W7CA 3FN9A 3E2VA 1RZMA 5K7JA 3IIOA 1XLMA 4A3QA 3H55A 4REQA 5ECVA 2ACSA 1SW7A 4WXZA 5JMUA 1VCFA 1UC5A 1J4EA 1E72M 1H41A 3W53A 3NQAA 3HG2A 2YIHA 4JHOA 4Q6XA 3OYZA 1DWFM 3EPOA 3OLIA 4JTCA 4WSJA 3KLLA 2OT1A 4RPPA 5D2VA 2Z28A 3F5KA 3QGKC 1Q85A 5DXXA 2J7DA 2E25A 4DM2A 4I6KA 4UOZA 1B9BA 1UWUA 4AFYA 4JDYA 1EOKA 1XV8A 3VKDA 5A6AA 5LA0A 3UCCA 1G1YA 3KXQA 4UZUA 4H1ZA 1S2WA 3C2FA 1I45A 4LS0A 4JYDA 5ABFB 2G3NA 3WENA 1JRBA 2HMCA 3KLKA 4ZO9A 1XLLA 2X05A 3WFLA 2VCAA 4WJEA 1E51A 1UKPA 4OBRA 1E9LA 3I6TA 1IYXA 4LPCA 5BYWA 1JUKA 3GG7A 3WLSA 1WNOA 3N12A 4R7JA 1GOKA 3LCIA 2W27A 1BQGA 3IJ6A 3QLLA 4QIUA 1IZJA 1TPVA 4PBFA 1XIGA 4NXKA 3W1TA 1J0IA 1XFCA 3UR7A 4W8BA 3QC3A 5BWAA 3I7RA 1EH9A 1GTHA 7REQA 4QG6A 3N9KA 3DENA 1QNRA 3MJYA 5GPRA 1CGTA 1ICSA 1FWGC 3NDZA 1QNPA 3EX2A 2ZQ0A 4X61A 2BODX 3IIXA 3RPDA 4LEQA 1HL9A 3P93A 2E9MA 1TRDA 2UZ9A 2FH6A 1CXEA 3WY1A 1V4YA 2WVTA 2NQLA 3WD4A 4JX5A 2G95A 2HSAA 2XWDA 4I5UA 1S39A 6XIMA 3ITLA 2C18A 3QOMA 1OHLA 3VNJA 4CCDA 1H1ZA 1E6PA 4U33A 4YYFA 3ABQA 4F0KA 3KS6A 4KPLA 2VFDA 3AJ7A 3KRZA 2PDPA 4S38A 2VENA 1OD0A 3SUTA 2VEFA 4ROPA 3OPSA 4RZ4A 2OQLA 3KZPA 3SQSA 3QR1A 3CQKA 3OG3A 1JDCA 2ZDRA 4PUMA 5BCAA 1K6AA 4QG9A 1VJIA 3N25A 4PMZA 5DO8A 1GVEA 4NKCA 3GDMA 1DYSA 1XPYA 3OHMB 3SCTA 1S3TC 3T7VA 4NU7A 1UPPA 4KRTA 4A3UA 1VPQA 2JGQA 4C1NB 3ABSA 1ZCOA 3DC0A 3M0XA 2YZ5A 3KX6A 4B5XA 3QSRA 1QOPA 3GR8A 3BDKA 4B5NA 4E2OA 4F40A 4H9ZA 2QJHA 4PMQA 3B8TA 2WC4A 3AXIA 4UTLA 2QCGA 4RXGA 1GVFA 2WMIB 4JKMA 1EQCA 1BYBA 3CPRA 1ME7A 3LGDA 4N9CA 5MKGB 4KKXA 1KTNA 4M8UA 1FTXA 2QDDA 3EOSA 3T2OA 1ECEA 3FGCA 2ISFA 3UCQA 4UTMA 3LDVA 4Y9NA 4BS0A 2VKZG 1CPUA 3LBMA 3AMCA 4L1GA 3NWRA 3GYCA 3S3GA 3Q37A 1VH7A 4HT3A 4A3RA 2H90A 4WY0B 4MLJA 5AC7A 1L6WA 3VPLA 3HQPA 1AVAA 3FJ6A 4L4PA 2PD5A 1F3XA 3G18A 4K3ZA 1X1OA 1GTEA 4PMVA 2PGEA 1ZP4A 1EB3A 4DF2A 1POJA 4V1YA 2FGLA 3MMDA 1CLVA 3SECA 4QSFA 3UJRA 5A6MA 2PTWA 4O0ZA 4Y8FA 4PYSA 3TJIA 1GKRA 2WNQA 1I1XA 3ITYA 3S5YA 1F7BA 2DJLA 4K8HA 3E3HA 4XZNX 1CGVA 3CMJA 3WLOA 2WZTA 4KCVA 3VCNA 1GYNA 1WKYA 1MQQA 4LS1A 4MAVA 1BXCA 2TRSA 3V75A 4F66A 2BLEA 1GKQA 1QNVA 2PDYA 2OO6A 4GQQA 3OEXA 1IWBA 3WK0A 5J5RA 2PWEA 3E0VA 3JZUA 3OZMA 3ZT7A 4OIFA 1Q2SA 4BFAA 4Z0SA 1WZKA 1GOQA 3UD6A 4S3GA 2Y6ZA 2GJNA 1OVDA 3M7SA 3URBA 2JK2A 4Z2GA 1YTDA 5HOSA 3DI1A 1H61A 4JCLA 1QU4A 3MPGA 1CGYA 1S5MA 5A95A 5E1QA 3S5OA 1G4PA 2G96A 1KFWA 3N11A 3S0CA 2DZBA 3ZT6A 3DFOA 4O28A 2GGEA 4EPBC 3TW9A 2YCKX 4A21A 3AMGA 4GHRA 1UYQA 4D6IA 4GZ7A 4P5UA 1RH9A 1LDCA 4XISA 1KM3A 1ZGDA 3WG6A 2ZZ6A 4RL3A 1M65A 3PAJA 1GQLA 4O1BA 2F9RA 4KQNA 4QJ3B 5CKSA 2IPWA 3KOWA 3UZXA 4GWEA 4RK8A 2GJXA 1T8QA 1ZBWA 1P0KA 1QXLA 3LERA 4CNPA 5F4WA 2ZZ7A 3NG3A 3I3BA 3GIPA 4D1IA 5DEZA 3M0MA 4WDXA 1KBKA 5FAJA 4DUXA 4DWSA 5HULA 2JKAA 5XINA 1XYCA 3GQYA 4GUHA 3GY1A 4RZBA 1XH1A 4Q8MA 4LY4A 4IGSA 2J78A 3WO8A 1A5OC 5MF5A 1H3GA 3OVGA 1W9UA 1MYRA 3R2GA 3TIMA 1TWIA 4RV3A 3GIQA 2J9YA 3IVSA 1BWLA 3DIPA 1OABA 3CL8A 3I3DA 1GEQA 3RLUA 1U1HA 5G4EA 2EG7A 1WKFA 2E1WA 2OYKA 1WDSA 3VCCA 3UNDA 3RG6A 4BI6A 3TN3A 5FJUA 3WJXA 3JW7A 4J3VA 3W2UA 3C56A 2EPKX 3VNIA 4HCDA 3SGZA 4CQCA 3NPWA 4HCHA 1PPIA 3L9CA 3UVAA 4YXGA 3F2DA 2PI6A 2OEMA 2XSXA 1S2UA 5BU6A 2QCEA 1SM9A 1V79A 3S5ZA 2ZFAA 3GVQA 1FP9A 2PDGA 1NIUA 3LTPA 3L2MA 5DRIA 1WBHA 5K3VA 3N6JA 1T6MA 2CETA 1GPFA 4HP5A 1JD9A 1UH3A 5J04A 3MP4A 1DQWA 1ZJIA 2C7FA 3I68A 4EOUA 3U9IA 3N34A 4BF5A 2B0MA 2QIIA 5AC5A 1E9YB 3UP8A 1XDJA 3VM5A 4M6VA 4XIMA 1FOBA 1Y5WA 3BICA 5DF0A 3TA9A 3K1GA 3PPGA 3SADA 4HPJA 2WW5A 3EWCA 1XYZA 2PP3A 3WF3A 3UT0A 2POZA 4W85A 3C0SA 3TX9A 2NQ9A 3K4AA 2GVJA 3PUOA 2V8ZA 4HN4A 1LUCA 4PB3A 3NQ6A 3LN3A 1F3EA 1R30A 1H1NA 3DHFA 1UZHA 3O7UA 1UWSA 2RGLA 2PDNA 4D8LA 4HOXA 3BV4A 3ARPA 2FGBA 3C3UA 4AWTA 4M6QA 2NLYA 2XN0A 2X7WA 3E0LA 1ADSA 1KFBA 4P7QA 4OT7A 2C71A 3QEZA 2ZWZA 3L5MA 3HM7A 4AVOA 1EA9C 3D6NA 4HU8A 4PZVA 5EL1A 2YGYA 2OZTA 3AS3A 4LRTA 2G3JA 2E6FA 3SUSA 1E6QM 3MSDA 1W3JA 1FWIC 4PEEA 3W7DA 4N6FA 4O15A 1T8XA 2VVNA 3QY7A 2GK1B 3FEQA 2JFEX 4IP4A 5C2GA 4LUTB 4Z2IA 4QRNA 1UZDA 3L65A 2WAGA 3TR2A 4AISA 4ZB5A 4NNBA 3OVPA 2VUYA 1K7EA 2Y61A 1E4NA 5DQPA 3SIMA 2ALDA 2J7GA 1XSIA 2YOCA 1RXOB 2QUUA 3S83A 3ABOA 4XWUA 4GMEA 3W7GA 4FI4A 5EYWA 1BWVA 4K1GA 4WR3A 2E40A 4ZXOA 2OKOA 4C6FA 3NXFA 1UH2A 1JZ3A 3RYSA 5FJPA 1T0OA 2XIQA 1A47A 4WHBA 3CPUA 1Q65A 1E6NA 4QJ5B 3FX4A 4V2XA 1THFD 3ZXWA 4M80A 3QY8A 3EX4A 1CI1A 5FA5A 3LENA 1MUCA 2GQ8A 1WDDA 1EZ2A 4ACZB 4ZFMA 3KWXA 4KWUA 1M1BA 3HV8A 3VXGA 3ES8A 4DN1A 1RUSA 3VDGA 1WCGA 5BOOA 3B9OA 3K30A 5BOFA 3J7HA 3HQOA 4C6MA 4BJHA 2GGIA 3CASA 3T07A 3GBDA 1XRSA 4AG0A 3LX9A 4EK7A 2CHNA 2VR2A 4HGXA 3LRKA 4IH3A 1ZS2A 3RXZA 2P10A 4PE8A 4IF2A 2V67A 2ZTKA 1TWZA 3TOYA 1FHDA 3DKLA 2JF6A 1FWBC 3W7PA 2X42A 3CAWA 3I4KA 5LNUA 1FBAA 3MHGA 4PA8A 3KCJA 1QNOA 3DU0A 1L9WA 3G22A 5F2IA 1Z48A 4IIGA 4H8VA 1X98A 3E74A 5A2AA 2PDUA 5E6YA 3W2MA 2WSRA 3RCNA 4GGHA 4HYWA 2ZYFA 3SW6A 1KQYA 1UR9A 4E8GA 1TQJA 1W1YA 1VRDA 3CWNA 3LLXA 3H24A 3BVJA 4B4HA 3LOTA 4GKTA 1A5UA 3W22A 2J13A 4UR9A 4NI8A 1FUYA 3POCA 4RNJA 4PMOA 1JI1A 3E2QA 4DZIA 4AIUA 8XIAA 3LZ3A 3EOLA 1IXQA 4IMAA 4UR7A 5HMEA 4UTWA 3TWBA 3WD2A 1LBMA 2QUNA 4U4MA 4MDPA 3O3RA 4AHPA 3GAYA 3W7KA 3WNLA 5I23A 5HXMA 2VEPA 5GJPA 4HMDA 4A3YA 4R7OA 1ISYA 1X6UA 2W6RA 3GBEA 4LX4A 3CLWA 3VINA 4IJRA 3KWSA 5G5IA 1DIDA 2YL5A 3SRDA 1QHPA 3NL6A 3GVWA 2OU4A 3LB0A 3NSXA 3H21A 5I0DA 2P0IA 3W25A 2G3FA 3HPXA 1JNEA 3PWAA 4GYJA 5IBXA 3PZNA 4O8RA 3SCWA 3O0FA 4PFMA 4IX0A 3VIFA 5E0CA 1JCJA 3GE7A 4WSHA 3P5ZA 3ALFA 4TX9A 1XG3A 2A7RA 1CYGA 2JALA 1M04A 4C6DA 4KCUA 1EWEA 1QI4A 1KCKA 2VELA 1F73A 4QE4A 4ZE5A 3W6LA 3TA6A 3N2CA 1JYWA 2ACRA 4LANA 4LWWA 1LOSA 3MZ2A 2A7NA 1UIOA 4IG2A 4UZSA 3E9AA 2WVVB 4O14A 3MSGA 2PC4A 1EGZA 4NRRA 5LGXA 2TAAA 3W26A 4NXSA 2ICSA 4M1BA 4YJ5A 4QG8A 4DUWA 4MFEA 1EFZA 3IV3A 4OBSA 2C1GA 3NA8A 3FYPA 2I1OA 1VFHA 1JZ6A 3V0TA 3RR4A 1WYIA 2XM1A 5H91A 3U57A 4PMUA 2JIWA 1TZ9A 4AY8A 2HXTA 3AHYA 4RW3A 5F4XA 1ICQA 4FZIA 1GOMA 3AXKA 4XAPA 4FP1A 1EYEA 5GVJA 2X1SA 1WZAA 3W6MA 3P2VA 3BQ6A 3CQIA 3KCOA 3WSUA 2QJNA 2IW0A 2WJFA 3O6DA 3MUAA 3HGRA 1GHSA 1IT8A 3WMSA 4IJBA 1KNWA 4CD4A 1ITUA 3ZIZA 3URQA 3JRKA 1UUOA 3RCMA 4YTQA 2CWNA 1F74A 4IFKA 2QKFA 3T81A 1JG9A 1H50A 3AZRA 2E6DA 2Y8KA 2CZDA 3I7SA 2AGTA 3LG3A 3BAIA 4KEUA 3RM9A 5CBBA 4CEUC 3R79A 3WBEA 1KR1A 1J0ZA 3G1VA 3AS2A 1GHRA 5I3IA 3FA5A 4LAOA 2GSHA 1FWFC 4L4OA 3CMGA 1F61A 1FWDC 2AOSA 2OX4A 1XISA 2GVGA 4H2HA 4MIMA 1KV8A 1JAKA 2V5KA 1ZBCA 5LNWA 4B5VA 4JEQA 1X8FA 1XYBA 1R9XA 3CL7A 4W93A 2NSXA 3G1SA 3BJTA 3VE7A 2Y63A 1Q5MA 3WQ8A 4WCJA 3HGJA 3PJUA 2Z2UA 2PDLA 4HZ7A 2X1UA 3VDHA 1LLOA 4RNIA 1LT7A 2XUCA 1SO3A 5AHMA 4HPGA 4O1CA 4PN2A 1YADA 4PRRA 2BOEX 5CSYA 2H6RA 3HGOA 4ZCWA 3UXDA 4JTTA 3GTXA 2Y5EA 2QQ6A 3WIJA 2R82A 1A53A 2AL2A 3G6LA 1YDYA 4PR4A 1TG7A 1H7WA 3NZRA 2Y89A 5I3KA 3LXCA 4Q22A 3NYZA 4ERGA 5JBDA 4HCLA 4S3DA 1QOXA 3E0FA 4JHZA 4G5DA 2D3NA 4IPNB 4J9JA 2RDTA 2WCAA 4DF0A 4EANA 1C90A 3GU2A 2FGZA 4RDVA 3GK0A 5ABFA 2HNEA 2Q02A 3QSTA 5HWMA 3CPGA 5E5CA 2G4FA 1XGZA 1O95A 1HN1A 1LBFA 2O4QA 2BG5A 4O17A 4FF5A 4HB7A 1UR1A 4GH1A 1XS2A 3V5OA 1PAMA 4GI6A 4LW7A 3WYZA 4M82A 1TV4A 1KRMA 4GLEA 1G9HA 2XIOA 1JYVA 1P5BA 4HPNA 1KKRA 3TN5A 3EXRA 4I7WA 1B3WA 2NQJA 1EUNA 3E2SA 1UB3A 3WELA 1YPXA 4LU0A 3FXGA 2GZXA 3BOFA 1KBJA 1Z8AA 4LNCA 3EWUA 3VOJA 1EF2A 8XIMA 3WEOA 1ZBKA 3TYBA 4DXXA 4NAFA 5E09A 2A3BA 3UWVA 4WQ6A 1WXJA 2PAJA 4MWAC 3MQTA 4DBEA 4CN1A 3IWPA 1HZYA 1MSSA 3DERA 4XD5A 5EMYA 1KV5A 2FJUB 5HQMA 3GDRA 3W7QA 2ZXQA 3GHUA 1HVQA 3M0HA 3RLGA 2QDGA 4PTNA 3STCA 1W91A 1AJ0A 5D09A 4RE0A 2BP1A 2I5GA 4LB4A 3D47A 2GJLA 1H0GA 4ZTYA 3U5UA 2NX9A 2R8WA 3NUKA 2FTYA 1I1WA 3PTDA 5C5YA 3AALA 2MUCA 1YPFA 4O57A 5DCBA 5LNVA 1TCDA 1BRLB 2QMKA 4DBWA 3BG5A 3CUJA 2OQHA 5HBFA 4B15A 3DYPA 1BF2A 2ATMA 1FH9A 4P7RA 1ZLPA 2J47A 3WH9A 3XIMA 4H9UA 2ZRZA 1EGVA 3UFYA 4F9DA 2CBVA 5G1YA 4QCFA 4A8NA 3PBWA 1CGWA 2W67A 1W3KA 3OLGA 4O4VA 1ZAJA 5DMMA 2QW5A 4CCZA 5BROA 3GXPA 1NQKA 2HS8A 4HPHA 3TTEA 5CC5A 3WNKA 4TV5A 1LZOA 4A8RA 3AYVA 4UNLA 5HWJA 3IRDA 2VDGA 4WEVX 3II1A 1IEXA 3FDGA 5LXEA 1CW2A 4NZ3A 4AW7A 5EGRA 3UA3A 2DIJA 2WMIA 3QZAA 4DJDC 4XD4A 4R85A 5IDZA 4MG4A 4MWAD 1I0DA 3GH5A 2E6YA 1BWKA 4OKDA 1F6PA 1G4EA 5C6MA 1VBRA 3BCDA 1X6NA 1KRAC 4NJHA 1TJ1A 4AY1A 5TF0A 1W3LA 6TIMA 3QR0A 3WD0A 2QPSA 1CB7B 1MZRA 1NF7A 3P74A 5CBIA 1RBLA 2QCDA 1OC5A 3DGRA 1IR2A 3PZOA 3MUXA 3EX6A 2YA0A 1DHPA 3L2LA 5FF2A 5A8OA 2WQDA 2IKJA 1GZ1A 4YWSA 1RSCA 4FR6A 5LSMA 1LRQA 1UUQA 3UG5A 4JNZA 1L6SA 3FIGA 4DUOA 1XUUA 5CPOA 2Z2AA 5LHFA 2ATSA 1QPNA 5E0FA 2DZPA 4GD0A 4BI5A 3W72A 2ZRVA 2PWFA 5CAHA 3HO8A 1S5NA 1L6FA 1VBGA 1UHVA 3U0HA 1XUZA 4Q7NA 4YWIA 1SVDA 4D8ZA 4MNKA 3BGJA 1UR8A 2Y85A 1WB0A 2VTFA 4UFLA 2XGZA 2GWGA 3VIGA 4JFVA 1G0CA 3WQGA 2GPTA 2VVSA 4AHOA 3B8WA 2ZUTA 1AJZA 1EDQA 1BHGA 4I9JA 1DE5A 3TXVA 3M0KA 2Z1SA 3VKBA 2PDHA 1K8XA 4DJDD 1RAKA 4O0KA 2V30A 2BXYA 3KTCA 1TQXA 1KXHA 1VGAA 4XZWA 3LSBA 2NX1A 5HPOA 3GUGA 4NI3A 3M44A 2PWHA 4Z42C 3IGSA 3BL3A 2D73A 3ABZA 1TPEA 3AC0A 1NM9A 1TWSA 3EA2A 4QM1A 1JCLA 2J4GA 2PS2A 4LVGA 4MDOA 4S3EA 1EUAA 4ERIA 3G1DA 3NQEA 4AQLA 2C16A 3C8FA 5I3DA 1A5NC 1MVYA 1TELA 3G1FA 4PUDA 3TOPA 3DG6A 1DOSA 1JPHA 4GRSA 1O60A 3UEQA 5DRCA 1D3GA 4DJFA 2ZX9A 2QPXA 3WH6A 2VWTA 4FX6M 2ZRYA 4JIEA 1JZ5A 4K6AA 2QNEA 2CW6A 1K4HA 3W82A 4RE4A 2J7HA 1TMHA 4GIYA 2X09A 1TWDA 1XC6A 5AFDA 4PEKA 2QCCA 4BI7A 2VGBA 1ZUAX 4I7UA 2WWDA 2ZZ2A 3MMWA 4KRUA 3W4RA 4TIMA 4DF1A 2NT1A 5D2XA 3WLPA 3EEGA 3B06A 3BAXA 3WNMA 5EMLA 5HUPA 3V16A 2ZVRA 3RR1A 5FESA 4IP5A 4JTLA 1B30A 1GWJA 4B9ZA 1J6PA 5DANA 1A5CA 3AHTA 4ROQA 1FH7A 1JZ8A 2PTDA 1JPKA 4LBUA 4POCA 2ZUUA 4GZIA 4ZQRA 2VX7A 4JNYA 1B0IA 3WNOA 1BVNP 3KZSA 3B8SA 4D6HA 1A5MC 3IUDA 3EOUA 4FNRA 1IQ8A 4GQBA 3WLJA 3B0YA 1ADOA 4ZSTA 5CLTA 1I6NA 3C0JA 1MW1A 3ZVIA 3CMFA 3VTRA 2REQB 2YBTA 3KHJA 3KVLA 1EF3A 3DAQA 3GKFA 3WNNA 4GE8A 3NPXA 1VRXA 3A4XA 3BW4A 4FA3A 5DY3A 3KW3A 2X8RA 1EXPA 2NT0A 3M0VA 3F1QA 4LT9A 1H63A 1YBQA 4N2YA 4DQWA 2VO5A 5MHBA 5A69A 1EEXA 4TTGA 2CFFA 1G7UA 4WY0F 1DWGM 3WK2A 1TPWA 3MSRA 2VR5A 2I5IA 3G77A 2ABBA 3UZWA 4J3ZA 3AO0A 4GZJA 2WSPA 3S1VA 3SFWA 2HDJA 3E49A 3ALGA 1XYAA 4AU0A 3EBVA 1KB3A 1JDEA 4GH3A 3ARZA 1HTIA 1R3YA 2OR2A 3MUCA 2OX1A 3A4AA 1RCQA 1VD6A 4R3UA 2DJXA 2ZOXA 3TQPA 3PHAA 5HR6A 3THDA 3BMXA 2WOQA 4OTKA 3RK8A 3S2JA 3P0WA 2ZA3A 3MTWA 4Q8QA 2DT2A 2FTWA 3ZJ7A 4LUTA 1VPXA 3CC1A 4MY9A 4JTJA 3KL5A 3WBYA 4GIRA 1SMAA 3T78A 1O68A 4R7WA 2PDXA 4FF7A 3RX3A 4AZIA 4JKKA 4F0HA 5DN1A 2WVUA 2Y2WA 3OU8A 2TSYA 3S1GA 4NZ1A 2XH2A 5IXEA 3QN3A 3SJNA 1EP3A 3B8VA 1OX4B 1V51A 2C91A 3SY5A 1JZ4A 3WDQA 4W5ZA 3U2EA 4HN8A 3VFCA 4UNIA 2E5CA 1LL4A 3BMWA 2RDWA 1US2A 4IIBA 1W5PA 5BRQA 3VOHA 1FHUA 5GNXA 1BKSA 3M46A 3DFYA 2X0HA 4OU1A 4QLKA 5LIWX 2ZZ3A 3TU9A 3S2NA 3KE0A 5FEPA 1VLIA 3C2YA 2NUYA 5I02A 5CGTA 2X0SA 4MB1A 4HMCA 5CQ1A 1ZRQA 4CLMA 5TNVA 3KHDA 3CV1A 2V2DA 3HPZA 2WYSA 2OGJA 3F2CA 4GCXA 4P8VA 3VD3A 1GVOA 4H3DA 4PH6A 1D8CA 1OCQA 3HQ1A 1ZL1A 3C8NA 1OFEA 1AH0A 3GTIA 3IEBA 2AMGA 4Z1CA 5LIYX 4UXDA 5HJLA 4JY8A 1ICPA 1LLZA 3TJ4A 4HA0A 4WDUA 1LBLA 1ALDA 4ZO7A 3R1ZA 1E4IA 1RBAA 3VNLA 2BHUA 2QEZA 3TJXA 3F4DA 2BXVA 4LAUA 4Z1BA 3AIBA 5FKYA 5DBUA 4MHBA 1XYFA 4GJIA 1SU5A 4NJIA 3RLVA 2XISA 4D71A 1V02E 2E5DA 3BPWA 2O0TA 4HHLA 5I7GA 4CNSA 3A3HA 3GHSA 4HK6A 4YYCA 3JZEA 3PF3A 3VIJA 3B4UA 1TSIA 3T2PA 2BX7A 2PGWA 2AL1A 2XVNA 2WVSA 3PTMA 1LQAA 4NT0A 2W66A 2NXGA 1KFCA 1BVWA 2RUSA 3ARWA 4DM1A 2J9ZA 4BA0A 1W32A 4G7EB 2CLOA 4JTFA 3REQB 1OG6A 1SZNA 3BCFA 3RITA 1PYMA 1RD6A 4V1XA 3RILA 2GVLA 3P80A 3SCRA 3PULA 3GDLA 5AYZA 3Q94A 1XRTA 1DIKA 3PNZA 1EZWA 1JUEA 2PP0A 3LNMA 4JX4A 1LYXA 3I6RA 4NZCA 1SR0A 2ZRUA 3E02A 2FYMA 3GNRA 2EF9A 1ZJHA 5C7VA 5D2WA 4AZ7A 1TFVA 2VZOA 3AS0A 1FWNA 1VIZA 3PG9A 4HU4A 1RALA 1S2AA 1TPB1 4ZQNA 1AA1B 3KOXA 4JTGA 1MXSA 5FEWA 3K4WA 1MEIA 1E55A 3WK1A 3UJFA 4A2RA 2JE8A 1GVRA 4G6CA 1V6YA 3GVRA 1R3QA 4PUEA 2ZC1A 5T26A 2WM0A 4TV6A 2WSKA 3CU2A 4E2VA 4KWSA 3UGRA 3MB9A 2OYLA 4IIHA 5A8PA 2FVLA 2OZ0A 4FHAA 4H7CA 3QW3A 3LTYA 1EJUC 2X2YA 1NARA 4TMBA 2IKHA 4WKAA 3T4WA 1TMLA 4OOZA 3TONA 1W54A 1KM2A 2XSAA 2YXOA 1FCBA 3WDJA 5JH2A 1K02A 1VCVA 4J2PA 3MA8A 4S1FA 4JIIX 5D9OA 2WVVA 4WF7A 4PTDA 1FY6A 5RUBA 2CXGA 3H12A 3B3DA 3RGTA 2WB5A 2YXGA 1E5NA 1XBVA 4GUFA 2WSQA 4CU6A 4GYPA 4K39A 3T0TA 3CTTA 1J6OA 3M0ZA 1ZFJA 3WQOA 4O1DA 3AIQA 1XLAA 3OVRA 2QJGA 3IK2A 1AQHA 1Y7VA 2DUAA 4C5ZA 1FDZA 5D4YA 4WKFA 2WZMA 1FH8A 3TSDA 4O12A 5U4NA 5D38A 5BXSA 1UA3A 1VYRA 3MMTA 3AI0A 5GNYA 3LS9A 5LXXA 4ECLA 1BQCA 1GW1A 3ONBA 5HINA 3BCJA 3NDYA 4N7QA 2DT1A 2X16A 3DCPA 1Z42A 2ZX7A 3MUZ1 3SCSA 4BK9A 1S5WA 1JUBA 1OC6A 2ZXBA 4IFOA 3LCFA 2V38A 4WLCA 3IUIA 4CQDA 2QGHA 3TFCA 3AWOA 3QVQA 2PB1A 3GUWA 4O8AA 3DFTA 5D2TA 3U4FA 3OO2A 1W9VA 3LLFA 5FACA 1H60A 2OWXA 5BMWA 3W29A 1C91A 4NZ4A 4DJEC 2WLYA 4KT2A 4JQ4A 4PTWA 4AZ5A 4EKJA 4XAFA 1KCZA 2R1MA 5IDIA 4XZ9A 3A22A 1HIZA 4AX7A 3QV7A 1WDRA 3CUHA 1HX0A 7REQB 3EDDA 1W1TA 2GQAA 3I4EA 3NL3A 1YHTA 1C3FA 3B9EA 1XDLA 4GNKB 1F8MA 1UD3A 4QBXA 3VVGA 1OFAA 1MDLA 3RNDA 4FK9A 2Y8VA 3SI9A 1VPYA 4H6EA 1I2PA 1G5AA 3PJWA 1Q6LA 1TR1A 4Z1AA 5CPTA 1HKKA 4DNHA 4QHRA 4BKNA 2H8XA 3SN0A 3A13A 4IZGA 3GXTA 4I5RA 2ZA1A 1F3WA 3DUGA 2BY3A 4HNNA 1YYAA 2TODA 2QAFA 3S6DA 2DSWA 2R6OA 4NL1A 5M5DA 1UR0A 3L12A 4KRZA 5LZLA 2YL8A 2OXNA 1GK8A 1HNYA 3WL0A 4MKNA 5FJOA 1QPQA 3NZGA 2ACQA 1JVNA 3QKZA 1RBOB 4LYRA 1MEWA 3PBGA 1EJWC 4E4UA 1XLGA 3PAOA 1GYLA 4XD6A 5FI8A 3S46A 3I6EA 1NFPA 4LFYA 1LORA 4EIVA 3MWCA 1Z89A 4L7ZA 4L9YA 2Z29A 2HTMA 4C6BA 4QISA 3R7MA 3GSMA 4IP7A 4ATDA 2H3BA 1OZQA 4UTTC 5HAOA 1DWJM 3WF1A 4IPJA 3WD3A 3O63A 2YA1A 4IXXA 3LLDA 4RNHA 4QLLA 3HMCA 3C3NA 4V15A 4N42A 1FFRA 2VYOA 4NZJA 4PB4A 4P61A 3NEHA 3PG8A 3TUUA 4YCPA 4H83A 1V0KA 1ZZMA 3DC8A 5EA9A 1XR2A 1ZQ5A 1ISZA 3MC5A 5FSDC 4WRHA 3H7VA 1TKKA 4CVUA 3S8HA 3H2EA 2DSKA 2F84A 1PV8A 3MBDA 4GYKA 1O4UA 2J77A 5HQLA 3CJPA 4DO5A 3M7WA 4AD2A 3BGAA 3SUVA 4H6RA 3C6CA 2XFYA 2O9PA 4PULA 2PTZA 3QYQA 1VYSX 3FGCB 4PMJA 4TO8A 3SRFA 1EJTC 3FV9A 3WCZA 4UFIA 3GXIA 4IXHA 1ITQA 4JFSA 2EQDA 4C6KA 4NRSA 2XIJA 2EGZA 3RAOA 5B80A 3VX1A 3PVFA 2FZ9A 3GG0A 1VEPA 2RDXA 3CL6A 5KZMA 4BQ5A 2QUVA 3G3DA 2QLYA 3T55A 1BRLA 2PWVA 1MQRA 5HJYA 4NYUA 4E6MA 1EX5A 3CLMA 2I56A 1I60A 2R94A 2PBOA 1S46A 1EHNA 3I10A 3IGUA 3SIZA 2A21A 4LC8A 4B9YA 2OLAA 3RHGA 5DMLA 4E3VA 1HFBA 3KP0A 5D9PA 4KCTA 5D9NA 2DZTA 1VFOA 3TMQA 1BG9A 4LB3A 1V3IA 1L2UA 5T9BG 2A85A 3XISA 1XCFA 2JQXA 2B81A 4PSRA 3DFPA 5HATA 1BD0A 2V5JA 3FLUA 3V1PA 3TYEA 1M7PA 4HSNA 5FOOA 4GBUA 1XLIA 4TX8A 1RA0A 4AYGA 4J3SA 4PB5A 1GT8A 2XM2A 1XGEA 3IIVA 3PUGA 5LA2A 4R9OA 2FZMA 3STFA 3SJ3A 3WLQA 1TO3A 4GO8A 3NQBA 4DXVA 1BTCA 1WX0A 3K8LA 3BARA 4PRTA 1AK5A 1JCNA 2X30A 5CC3A 1GG1A 3A47A 4KF1A 2OZ8A 3NAVA 3P84A 4YMZA 4LALA 3KP1A 1X7FA 1I2OA 3KTXA 2PFHA 5GNZA 1UD5A 3KOYA 4C6NA 2E7FA 1RHCA 3CH0A 3R8GA 3BSGA 1AH3A 4GZEA 1QK0A 4G7FA 3UR2A 4LF2A 5BRBA 1J9YA 4XKMA 4Q7BA 2I57A 1HL8A 3PWGA 2V63A 5EFFA 4K7YA 2HVOA 3CAKA 1AL8A 5CG7A 3TTOA 4F9JA 1DORA 4CCCA 3OHIA 4FIRA 2E28A 3UBPC 3W1NA 3LGEA 2ZZ4A 4H9VA 3W01A 1J11A 4ICCX 1JRCA 2D24A 1ZAHA 2J27A 1EBGA 7PTDA 4LAMA 1MW3A 4FALA 3FS2A 4DWSB 1IT0A 4DI9A 2BB0A 3W75A 2VOMA 4NY2A 4GNJA 3U2OA 1N8IA 1XIMA 1XL9A 3NDOA 3LHVA 1WUFA 5G1MA 1PUDA 1PJ9A 2WJDA 1BXNA 1NDZA 4PODA 2PDJA 3WDPP 3CWHA 1HP5A 1BXBA 4LCRA 3GZ3A 3RN6A 3UR5A 5E6ZA 1P7TA 1NAL1 1XLFA 2ZX5A 3NEVA 2ZICA 3LHZA 3KL3A 4NHVA 5C70A 2BVWA 2ZXDA 3RDKA 2NV1A 4DO4A 2Z2BA 2P0OA 5DT5A 4DYKA 1XW8A 3STEA 1YE6A 5ABEA 3DYMA 1XINA 1W3HA 3ITXA 3MV01 1CXLA 3PUDA 5PTDA 1WZLA 3WMLA 4X0NA 4EF9A 3TSMA 1I0BA 4U3AA 2EBNA 2XSBA 1W0MA 2A3CA 3NM1A 1DJHA 3BANA 3AU2A 4PC8A 1HKIA 1OGGA 2XH0A 3EX3A 2PDWA 4JOMA 1ISXA 2YW3A 3G1YA 2EPLX 1ECQA 5K9CA 3CQJA 1OT2A 3EKZA 5CZSA 3LA4A 4ADUA 1LG1A 1Q7MA 1CZ1A 4X63A 1TA3A 4U28A 4ZFCA 4XZIA 4OBTA 2YCEA 3RO6A 3VAVA 1US0A 2J66A 1SZEA 1NSJA 3H23A 4XD3A 4ZENA 2NV9A 3AYSA 1TYGA 3W74A 3TC6A 1XJBA 5HMDA 6ALDA 4UQEA 4BWLC 3R5EA 5KSWA 1OF6A 1W1IE 2NQZA 1WBJA 2I5QA 1TPH1 3E0IA 1X96A 5I77A 3QYSA 2FHFA 2UY2A 1B90A 3EWWA 4GI4A 2VC6A 4EXBA 3R43A 3WBXA 4JTDA 3TQVA 3ABRA 4RKAA 2A3AA 5FF3A 3PTQA 4Q4KA 2DIKA 2PDIA 2VURA 4ASTA 1WE5A 1P6WA 2R1KA 4ZBCA 4C6QA 1UP0A 5FF0A 3AYTA 3TZNA 1XHGA 3CK5A 1XDMA 3G0XA 3GR4A 4FNTA 3P3BA 1PKYA 2DT0A 3SQLA 1WA3A 2BTMA 3EPNA 2XINA 2HV5A 2D0HA 4QFUA 1EIBA 3GFXA 4AZCA 4M56A 3V1HA 3STGA 3R0DA 2F6KA 3PK7A 2DUXA 3FDKA 1ONRA 3CB8A 4LRSA 4HSHA 2ZX6A 3EWXA 4TXEA 4FXFA 3WDHA 3E12A 4IIFA 4X2PA 1JI2A 5A6TC 5AC6A 4WJXA 4IQDA 3KTSA 5A6JA 3SRHA 4KETA 3PPCA 2O7QA 3CQHA 3PBMA 1B5TA 1HP4A 2J75A 3A3XA 1QPKA 4S23A 2FZBA 4Y7EA 2DUZA 1H09A 1QT1A 1PDZA 5FSEC 3ES7A 3P67A 2A3LA 2GOUA 4MKVA 3GO2A 2CIPA 2A0NA 1U83A 3APGA 3O9NA 4UUIA 1V08A 1Q66A 2PLKA 1SMDA 1XLEA 2VCBA 5C2XA 1BKHA 3KUMA 2VM8A 3ZLHA 5I5RA 2OQYA 1D3CA 1H7NA 1IZCA 3OBEA 4DEFA 2DZAA 4XZLX 4HOZA 4EAMA 2QF7A 3BLLA 1DHKA 3BSMA 4G1KA 1TUFA 3TYDA 2QDEA 3YPIA 3BGGA 4UQ9A 3VNDA 1LJYA 1AD1A 3FJNA 3VGBA 1RVKA 3W3OA 1DL3A 2VUNA 3BLPX 4GPNA 3DH7A 3N18A 4GUGA 8A3HA 5AB3A 4HBKA 3HBLA 3COTA 4LOCA 4UBPC 3F4NA 1XIDA 2C19A 3WFAA 1LWIA 2GGHA 2I16A 1QDSA 2DH3A 4UFKA 3VU2A 3ONCA 2INZA 1W9BM 3S2LA 1OX4A 1IE7C 3CV2A 3IACA 3ARSA 4JTIA 1H7XA 4Q8WA 3OJGA 2FZ8A 3FVDA 1E1EA 2IKIA 3UETA 1VZWA 2CZFA 4ZQPA 1PIIA 2RH9A 3UZJA 4BY3A 1YE4A 1RK5A 3TZFA 4K36A 1T40A 2A79A 3HG3A 1YTEA 2ZXAA 5I79A 3N3MA 1UC4A 4O1AA 5EBUA 3ITGA 4PCTA 3HPSA 4QXIA 4Q4RA 1FWAC 3C61A 2WCSA 1M53A 5AHNA 4WX2A 5F2MA 3FYOA 5D02A 1J5SA 5FAGA 3ME3A 3T8LA 4ZOAA 1E6ZA 1FA2A 4MB4A 3M6YA 4UC5A 4JS3A 3KRBA 3TN4A 4IUGA 3RX4A 1QNSA 3S9YA 1JCXA 2OSWA 3FEMA 2WBKA 3VMPA 4W8LA 3DHDA 5CZ0A 1JD7A 2Z7GA 4UOQA 1JFXA 2ALRA 3KBWA 3M9YA 2GVYA 1T41A 2OG9A 4YHGA 1JFHA 3NO5A 4I3GA 1WKEA 4IG2B 3UXKA 2EJAA 1EIXA 4OUEA 2BS9A 2X41A 2J74A 3NTYA 2CKSA 3B04A 1MW2A 4MKSA 2C79A 3D0CA 4QS5A 3REQA 4R88A 3FKRA 3MU7A 2P50A 2GSJA 1KXTA 2E5BA 2GLKA 3QF0A 5A1AA 1VBJA 3CZ8A 1BSLA 1DVJA 4RZ5A 2V2CA 3W71A 3P8IA 3MO7A 1W31A 2BGNE 3WEMA 3BMVA 3LCXA 3PBVA 5K4XA 2XWEA 1MEHA 1NU5A 1S2TA 1V0MA 5CPMA 3F4VA 3EWBX 3CHVA 2Z6JA 4GABA 4LYKA 2DZXA 2WKLA 3IVUA 4FIQA 3R13A 2EXOA 3F2BA 1YMYA 1UD4A 3NOEA 3HOJA 3TCEA 2DEPA 2ZRXA 4HHHA 5K4ZA 2BWGA 4KH2A 3MDUA 3KVMA 1H7OA 5KINA 4NILA 1HKWA 2CBJA 1EJVC 2I14A 4FLSA 4L61A 2GQ3A 1SZFA 2GDQA 1OFOA 1IF2A 2AQOA 1OD8A 2OSYA 1OQFA 3PBUA 2D2HA 3U7BA 1WDQA 9XIAA 1B2YA 1F76A 3THQA 1VFLA 4E2DA 2CLFA 1P1XA 3DFSA 3JUGA 3QQ0A 1X38A 1W1VA 1HG3A 3W02A 3L0NA 3W0KA 1OGSA 3NXLA 3W1AA 4GXWA 2YJQA 1Q13A 3FJLA 4MZYA 3CHCA 3R0UA 3BQ5A 4ZTXA 4K2SA 1F05A 1RLCL 5LNRA 1CLKA 2DW7A 5A3HA 4A05A 1EC9A 4CQBA 2AL2B 2Q3RA 1F07A 5T8GA 4M3PA 1ZU8A 1FQ0A 3VABA 6TAAA 4N4QA 3GB6A 3APTA 3S9IA 1E15A 1S2CA 1OGBA 2YCJA 1E43A 3LM7A 1XIJA 3Q67A 5JBEA 5AHFA 2Y70A 1TV3A 4WOQA 2A6NA 4IIEA 2B7QA 1AD4A 3CTLA 3EGJA 3VD9A 1BTMA 1JCMP 3OIHA 1MZHA 1QO2A 1R38A 2BVTA 2A5HA 4JQ1A 1DJXA 4HNVA 3B4YA 4MMWA 5AC4A 2HJPA 3ARUA 3C5QA 3SN1A 3IJQA 3T9PA 4M0XA 4G8TA 1OX6A 3W76A 1SJCA 2HK1A 4AY7A 1XRFA 2IMRA 4F0RA 3W07A 3A12A 4YIWA 1DJZA 2L5HA 3SY1A 5HJXA 2PLCA 4NAFB 3BAWA 1JL8A 4NASA 5AZ0A 1B31A 4DNMA 1G94A 3TW7A 4XAZA 5ABTA 3G8RA 4X60A 4HNOA 4J35A 2P3EA 1ML1A 3NQFA 3VGDA 1WAUA 3WQWA 5C9ZA 4JR5A 3ATZA 5EB8A 5JIPA 3W87A 4UTJA 3QFEA 3ITOA 3CIWA 1J0KA 3K1DA 3QBUA 3AFBA 4XG1A 1QMLA 2PODA 4U5IA 1R46A 1S38A 1UPMB 1GOIA 1NP2A 2C0AA 2Q3OA 4JX6A 4UTKA 1YNYA 3VM7A 2JKPA 2F61A 2ZUNA 3M5VA 4UMBA 1HKVA 1KCXA 4OV4A 2OT0A 3TW6A 3BZJA 4B5WA 3TAOA 4AC1X 3SN4A 3BTNA 3L5LA 3HTWA 1J8VA 5CEWA 1I8JA 1RVGA 3A5VA 3NL5A 4IIDA 4ATLA 1UKTA 1W3NA 1KTCA 1KXVA 2RJGA 5A94A 2PTXA 5C7HA 1R9YA 2B7PA 4ZE4A 4ENLA 1K9EA 4DLFA 1M7OA 3WQ6A 3V35A 3ZLFA 3UPWA 1LROA 4DJFD 3L23A 4QDPA 3DFNA 3ERPA 1J2WA 4UTHA 2C1IA 3H2NA 3AJXA 2OOGA 3EPMA 4PGLA 3W1RA 3VGEA 2F8QA 3T6CA 3GXMA 4E5TA 3PSVA 1XICA 4TOQA 3ATYA 1H7PA 5A8QA 4C6IA 3VK5A 4PBEA 3DDMA 1WXZA 1IV8A 3SCVA 2VZUA 4ZZ9A 4X2RA 1H7RA 3FSUA 1XP3A 3GZAA 1PTAA 4CGTA 5DT7A 2WC7A 3WLNA 3DGBA 4YL2A 2YDSA 3FAXA 4KCWA 4AVNA 5REQA 2XIBA 4NIRA 2QCDB 1AUSL 3CM4A 4X9SA 2UV8G 3W70A 2J79A 3P81A 4JY9A 3SCUA 4QITA 4H9TA 3SDOA 4JCMA 4O54A 3SGGA 3AHVA 3A6OA 3K4DA 1Q6DA 2W4XA 3C86A 1BYAA 1VENA 3ID7A 2Y24A 4WJ8A 4XQ6A 1M68A 2VDIA 2IUZA 3MCNA 3WH8A 3EXSA 3WLIA 1A49A 2Q6ZA 4JL2A 2BY2A 5FEXA 1W5QA 1QHZA 4C7FA 1TX0A 4WVXA 1RY0A 1QW7A 3BURA 4HTBA 2W92A 4K38A 3HJEA 1LF1A 2DSZA 4B5UA 4F79A 3KRSA 1E9IA 4PUWA 1PHQA 3H2OA 3N4FA 3AXMA 3SSZA 1TTJA 1C8XA 1D7FA 1U1JA 5IFTA 1QI3A 1R47A 1OFQA 2W61A 1F4AA 4PTXA 4HOWA 3CBWA 3ZWTA 3K5XA 3VOIA 3N15A 4GOAA 2PRHA 3AZTA 1A4MA 3OOQA 3BJFA 3G2GA 1V3JA 2IQTA 2A2IA 4PCSA 3LPPA 3DKJA 4K8EA 2H8ZA 2OOFA 1RCOB 3OVQA 4MNLA 4UMCA 1UZ1A 4XO7A 4HSOA 1TZZA 1T96A 1XBZA 1GONA 2OEKA 2BOFX 3UG4A 5CC6A 1MRAA 3VUPA 4XZHA 2R91A 2FHCA 2CC0A 5AHEA 3LMYA 1EJSC 4IMCA 5CH9A 4MB5A 1A5BA 4TU1A 3FHQA 2NWRA 1JNDA 4I90A 1RD5A 1MI3A 1VLWA 4CVWA 1OYCA 2IXUA 3NR0A 1W56A 3CO8A 3NVDA 4YPJA 2HBXA 1PIGA 1DJIA 1R3RA 1YXCA 3G1RA 3GD6A 2AMXA 2J7CA 3E0WA 5LIUX 3DZ1A 3PC0A 3CGTA 1FXQA 2HXUA 2VMFA 2ANUA 5D9MA 1X7IA 3UWQA 5IHRA 4TQTA 3LBOA 7CGTA 3TTSA 4AZHA 3CUZA 3IS4A 1K9TA 1E5JA 3MO4A 2QS8A 4U3CA 2OFJA 3VKAA 3E5PA 4L56A 3CIXA 3VGFA 5EU9A 4GI9A 3LRLA 5T91A 3VGHA 1QATA 1OB0A 3LSCA 5D03A 1XSJA 4MJZA 4ICNA 3ZFHA 2R1PA 1J2BA 1VEMA 3W7JA 1TIWA 3ORWA 4JTQA 4ZSUA 2IKGA 4DY1A 1R86A 1JULA 1Q6CA 3BOLA 1EP2A 1UD6A 5I09A 2Q71A 1PX4A 3N2XA 3WQ5A 2EHHA 4LUIA 1DV7A 2R1LA 7A3HA 3G24A 5D8ZA 4P8XA 5DX7A 4FX7A 1K70A 3S5NA 4K37A 4XZBA 4JTRA 3T0BA 5BNKA 1W9PA 3L66A 3GC5A 1TPC1 2XH4A 2BGSA 3QHNA 3MHFA 4Y2WA 5L9FA 4AF0B 1EYWA 2HVMA 4ZQOA 1TPFA 3U2CA 5A8GA 3W1MA 4B2DA 3IGXA 1BG4A 1NP0A 3N17A 2OO0A 5JU6A 3B9DA 4PTVA 4IISA 1FWTA 2FLIA 2R1NA 5KITA 4J7RA 5E93A 4JXCA 2WNZA 1QJWA 1FKXA 3HJZA 3L2IA 4NJJA 5DXYA 4A6GA 4Q4OA 4QQUA 5CSRA 3JR2A 1WOAA 3TC7A 1X39A 1P48A 1EX1A 2Z24A 4UWMA 1MUMA 1GPWA 2J8GA 3TN6A 2X40A 2PD9A 3VIKA 3DESA 5LGZA 1V3HA 3OQ8A 2B7NA 4FOUA 3B0UX 3L7RA 3OBAA 2PEVA 3M0IA 4B4FA 2D1ZA 2VNCA 4D8AA 2BVYA 1N8WA 1VIWA 1YBQB 1BFNA 6ENLA 3RIKA 3TEVA 2PGFA 4IFRA 4RE2A 3WLLA 3UG8A 4IWWA 5D33A 4KGJA 3IJLA 1UR2A 1TPUA 1NTHA 5CBJA 1M41A 2UY4A 4JN7A 4N9EA 2XZ7A 1V0LA 4WKHA 3P62A 4INFA 3RLHA 4PFHA 3UCDA 2V3DA 2NXIA 2EKCA 3UWUA 4E3TA 1R8LA 4IL0A 1PDYA 3M0YA 1KXQA 1ZB5A 3FY1A 5DELA 4TVCA 4ES4A 1KBIA 3N04A 3V3WA 4R33A 1KC7A 3V5CA 4XTDA 4WZHA 3RMJA 2SFPA 3NQMA 2ZUVA 2XVGA 1UD8A 1XGDA 2Z0IA 1LOLA 3LQLA 1J0JA 2XGIA 1GZJA 4DPPA 2QHAA 4MLRA 3S6TA 1HW6A 1UJPA 3AHXA 2XFFA 1OC7A 4YS1A 1MWOA 1ODUA 5JQ9A 1W17A 4GI8A 4A8LA 1PWLA 1A5SA 1DQUA 3VOGA 1K8CA 2V9DA 2I17A 3SUWA 1PX8A 3ZSSA 4UCFA 4LUYA 4EWND 5TIMA 3RUBL 3EB3A 3EA1A 2WHJA 4PL1A 2WPBA 3B9AA 2WPGA 2WXDM 2V3GA 5EMMA 1HJUA 1Z3NA 4WD0A 1SJDA 3H2MA 2J8FA 4MWAA 1K7FA 2Q09A 1DWHM 1GVSA 3L4YA 3CUXA 2W3ZA 1W8SA 2J6XA 1KM6A 4HKPA 3G1HA 2VP8A 2EEXA 1FKWA 1EXBA 1FHLA 5A2CA 1TVPA 1KM1A 3A4WA 1DIOA 3GDKA 3TQKA 2OELA 4AXKA 1HT6A 4FPSA 4HK7A 3DHPA 2ZADA 2TMDA 4ALDA 3UYIA 1MFVA 8RUCA 2VFHA 3GVGA 3H7UA 2VGFA 4FXSA 2OLHA 5CC7A 3WBWA 2XG9A 1VHNA 3GH4A 2YZRA 3ZJ6A 1EJXC 3BUVA 4NJGA 2W5FA 2C6QA 1UIPA 1WP6A 4N4PA 4ZOEA 3LI1A 1P43A 2P88A 3OGSA 2WMKA 1VKFA 2YBVA 2ZUSA 4YVXA 5K2ZA 4F2TA 2NLIA 4W7WA 5AHLA 3WUGA 2O56A 1SW3A 4V28A 5H8UA 3VMNA 4B91A 4ZL1A 5FD0A 4AD1A 2CNCA 5JIWA 3H4GA 2PCQA 3CZKA 1V7YA 4E2BA 4CD8A 3P61A 4QJ1A 4BQ3A 3N9RA 1SYTA 1F9CA 4C1LA 3QC0A 1WO2A 2X1RA 1HUVA 1C8YA 3GFZA 3LMZA 5FL1A 1TZ7A 3HPFA 4H9YA 3UWWA 4H9XA 3WMBA 4Q3MA 5AHIA 3ZWSA 2HEJA 2J25A 2FTPA 3A9IA 1OM0A 5A6KA 1KTBA 3CUGA 5J5DA 4ZR8A 4DJDA 1FDJA 1Q4WA 4FS9A 4A3HA 1K6WA 3EDKA 3RU6A 1LTDA 2XVPA 3T0DA 2GUYA 3TJLA 5F1VA 3SM0A 4HHMA 3GYEA 1UMYA 4JN8A 1VAHA 3S5SA 5A6BA 4RXFA 4GXPA 3WFZA 4XUGA 1VHCA 4W84A 1WZMA 4AX6A 1D3HA 5FJJA 4I6VA 4WDTA 2PE4A 4W89A 2I7GA 5TQLA 3VNKA 3EB2A 2PWDA 1L6GA 3USBA 3GXFA 3MUY1 1K9DA 4NQ1A 3SCOA 4WDWA 3O1NA 2IPJA 4ML4A 4QEEA 3U8GA 4C7DA 1AQFA 3UU0A 1R6WA 2HBVA 1UQZA 4FOJA 2GDVA 1KM4A 4U2YA 1C29A 1PWMA 1XI3A 4F4RA 1R2TA 1V93A 3MV11 4OV9A 4QEHA 1A5KC 3A23A 1DKWA 4AMCA 1K3UA 4R53A 4S3KA 1H2JA 2DV0A 4Q32A 4J5NA 2V0TA 1ZY9A 1HL2A 1GOXA 1DJWA 3V5FA 4P2VA 5C9UA 5A8MA 2ZUMA 3O15A 1C8VA 4J3XA 1RP9A 5D30A 1VFTA 5M03A 3MJMA 3MYOA 1YNPA 3NVTA 3MI6A 3IVTA 4U2ZA 1O1HA 4RDYA 1Z69A 4H6KA 4QSHA 4FR1A 1S3HA 3OIXA 4KEVA 2NVDA 3PZUA 2CLHA 3K46A 1TTPA 1A5LC 2VWSA 5CCZA 3KVJA 4HVXA 1QPRA 1DPMA 1W1PA 1Q6GA 3P0XA 1B4EA 2PMQA 5HDRA 1W5NA 4I5XA 1RJQA 4H8UA 1Q6EA 3K13A 2VEKA 3IPWA 2EPNA 2KAUC 2UY3A 3L4XA 3DBNA 3SR7A 2WKJA 4MADA 3W84A 1W8GA 4XBJA 1MDRA 1X6LA 1J12A 1XCXA 1VR6A 3STPA 2ADAA 2YL6A 3BG9A 4CEXC 2XDFA 3GNDA 3IARA 3LYEA 3UWEA 2PC8A 1S5TA 1W37A 2WMFA 2QT3A 2EO7A 5C9WA 4XB3A 2B7OA 4HHPA 4AZGA 4XKYB 1RQEA 3PFRA 1L8NA 3ANVA 3QMSA 1CECA 2DSVA 1ZAIA 3SB0A 3KEHA 4PTMA 3OGVA 4DB7A 3PJTA 4QR6A 3LV5A 2W79A 1ELSA 1B3ZA 3CYJA 3THUA 3BLKA 4TVDA 1H11A 1KCLA 2G3MA 1FRBA 4J3WA 1A50A 3V7PA 1V8EA 4H01A 3W2JA 3ZR6A 3VNYA 3WUFA 3GHRA 4DPQA 4C6EA 5ECUA 1J0YA 2DSUA 3IAQA 1HXJA 4GO9A 4B92A 3DFQA 1XXXA 4XBKA 3I7QA 3R4IA 4PL2A 3WX7A 3N73A 1XD1A 1OSEA 5AYXA 1W1A1 1VYPX 4BZYA 1JAEA 4ZXLA 4KW2A 1GQIA 2UY5A 1NY1A 1JXKA 4P8UA 4EACA 4X0VA 4JKLA 4FX8A 1R7AA 3HU7A 5HWNA 1AW2A 4AIEA 1BYCA 4CNTA 3BC9A 4Q4PA 4GVGA 3MS8A 1AODA 3T8QA 3R10A 4CQAA 2F2KA 4PMYA 2V5BA 3T08A 6PTDA 1F2JA 3ARVA 2C1HA 4JDBA 3SBFA 3WBAA 3RO8A 5BOEA 5D32A 2O7SA 1AMKA 4G2DA 2WSYA 3GWQA 3NZQA 3FNDA 3QPYA 1E73M 3BXWA 1Z41A 3ZZ1A 3R8HA 1XBYA 4NAEA 4O18A 3G3MA 3K2GA 2O9TA 3VNZA 3GTFA 4HYVA 1P0BA 2ZZ1A 1I9CB 3AQUA 5EMUA 1VEOA 3H53A 3Q45A 2E3ZA 4GQGA 4W7UA 1BVZA 4UQAA 3PPFA 4KIRA 3GTHA 3Q2DA 4EE9A 4NP7A 3TH6A 3T40A 3QQWA 5DFAA 2ZX8A 2QF8A 1YNQA 4UQDA 2CLLA 1HQTA 1E71M 2YFOA 3NCOA 5M17A