1AW2A

Triosephosphate isomerase of vibrio marinus
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
255
structure length
255
Chain Sequence
RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSAIILGAQNTDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHAESDEFVAKKFAFLKENGLTPVLCIGESDAQNEAGETMAVCARQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEKSEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAEAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Triose-phosphate isomerase (TIM) of the psychrophilic bacterium Vibrio marinus. Kinetic and structural properties.
pubmed doi rcsb
source organism Moritella marina
total genus 89
structure length 255
sequence length 255
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1aw2A00
1FWSA 1XDMA 4MKNA 4AHOA 5AHFA 1KFLA 1OFRA 4X9SA 1UUMA 4NX5A 3TAOA 3W7MA 2B7OA 1QPOA 2YCEA 4O15A 2ZFAA 1PCKA 3L9CA 4QJ1A 3HGOA 3W84A 1AW1A 5D04C 3TKFA 3MW7A 3BG3A 4LUIA 4UFKA 5J5RA 3HBLA 3M1ZA 2FQIA 3QYQA 4UXDA 4O1AA 3S5OA 2C14A 3TUUA 4UTKA 2CU0A 3SJ3A 1FDYA 3P5ZA 2V2CA 3TQVA 2YYTA 2Z2UA 4LC8A 1HO1A 1L6YA 1WXJA 3STGA 1ZAIA 2VFIA 1T96A 3NQ6A 3GNDA 4M5PA 5DY3A 5F2GA 4O19A 4NNBA 4Y96A 2QJIA 4M6VA 4GFSA 3TMQA 5MHBA 1CW2A 2PC4A 5EYWA 2ZZ6A 3QC3A 4ZMGA 5LZLA 3Q2DA 4CNOA 3M5YA 5CZ0A 2ZRWA 2O7SA 3W1QA 3OVPA 3TSMA 3BVJA 3C2FA 3BLEA 3DZ1A 5AYYA 4B5NA 1AW2A 3STEA 4K38A 3G0XA 1H51A 4O16A 3ZR4A 4NX0A 1DJQA 3R5EA 1ZNNA 1JCXA 7TIMA 3G3MA 3VE7A 1KV8A 3L21A 3OHIA 3TNOA 5EMUA 2CLHA 1KFKA 5DELA 1VLWA 3O07A 3PR2A 2BTMA 3QMRA 1A53A 2NX3A 1F6PA 1TCDA 3HPXA 3P60A 3N9RA 1GYLA 4XKYA 2FIQA 3PB0A 3UWQA 1OFOA 2WKJA 3TFXA 1XL9A 4DBEA 1XBVA 1ADOA 3C56A 4GUJA 4UR7A 4DEFA 1H60A 5CZTA 3AJXA 4IMEA 1RQHA 2QCDA 3G1FA 3KRSA 2Z6IA 3B03A 3BO9A 4CLMA 5CSRA 3NQGA 1UB3A 1LLZA 2NZLA 3TU9A 1EX5A 1W5PA 2A7PA 1J5TA 1XI3A 4JX6A 1W3NA 1C8VA 2QR6A 1O94A 4LT9A 5I3IA 5HWNA 4UR8A 1WAUA 3I7SA 3QFEA 4E2BA 4PL2A 5G2IA 4XBKA 1EUNA 3SR7A 2ABBA 4LUJA 3QM3A 2QJGA 4BI7A 4EF9A 3F03K 4QQ3A 3NAVA 3S42A 2WNZA 3EWWA 3HF3A 1OX6A 3W7EA 2QUVA 3M16A 3RK8A 2OMAA 3DBPA 1K7FA 4A29A 2YW4A 3IIPA 4AHQA 3NPUA 4JXCA 1R47A 2NLIA 3BGGA 3IRDA 4MYAA 5AC8A 2QKFA 3FFSA 1UUOA 4H6KA 1CX9A 2Y85A 5K9DA 3C4UA 3UXAA 4R7JA 4UNKA 3NM1A 4K8EA 4ALDA 3IIVA 1B4EA 3PWAA 3GDLA 3W7CA 1IIGA 2QUUA 1W31A 3LTSA 1JCYA 1B57A 1AL8A 2WSYA 1XKYA 3U8GA 3WK3A 4JNMA 2DU2A 1SW3A 2ZRVA 3KFTA 1R2RA 3I65A 2E09A 2Q8ZA 2ZZ2A 3IIXA 1MXSA 5HR7A 3EX6A 3NEVA 5KSWA 4RZ4A 3HJZA 4LV9A 1N55A 4FNSA 2V8ZA 2YDAA 2R14A 3THQA 2CZFA 3CLMA 3IGUA 2JGQA 1EUAA 4KFPA 3EKLA 4MZ8A 3GB6A 3NOEA 3W1NA 1FWNA 1H7XA 1S5VA 5D03A 2TYSA 3B0VC 1EPXA 4ZL1A 1LBMA 4LVBA 1VQTA 4XWUA 1BKSA 3PBUA 2NX9A 3MHUA 1LYXA 1DQXA 5HINA 1Q6QA 3N2MA 1ME8A 4KFOA 4ZZ9A 3W73A 3TXVA 5U7SA 1PHQA 1ZAJA 1T0OA 2GQAA 4L4LA 1LZOA 2A2IA 1R30A 3LI1A 5K9XA 1GVQA 4O53A 1H7NA 3PSVA 5HUOA 4ONVA 3T40A 3L0KA 4DPPA 1A5AA 1G6CA 3EKZA 4QITA 2AQWA 4S2CA 4U4MA 3SI9A 1QPQA 4X3ZA 3RNDA 1YXDA 3H53A 1NVMA 3H54A 1JCLA 3MYOA 4JY9A 2ISSA 5CGQA 1LRNA 3ZWSA 5D30A 4H3DA 1A50A 2CFFA 4YWIA 1U5JA 1WBJA 5K7JA 3PBYA 1W0MA 3UWUA 4PH6A 3USBA 5AN7A 3PC0A 3KHJA 3S9YA 1KA9F 1NAL1 3NGJA 1KTCA 1OFEA 3CPRA 3MBDA 4YCOA 3BW4A 4IX0A 4IPJA 3S5YA 4HPJA 2NV2A 4LRTA 1H50A 1OX4A 1F2JA 1I45A 4QISA 2F7FA 2E6DA 4WUIA 4XTIA 3P62A 3B4UA 4JN6A 3W7JA 1WBHA 2C0AA 3DI0A 2DJLA 1LLWA 1GTHA 2OT1A 3NQAA 4EF8A 1TPWA 2TRSA 4ADUA 1QPNA 1G7VA 1GEQA 4PTNA 3TK7A 4IUOA 3P61A 4FF7A 2FPVA 4MY8A 3OBKA 3HG4A 3BW2A 1BWLA 1EP1A 2I1OA 1QPRA 1H62A 1V7YA 3FA5A 3NPWA 3UPBA 3PY2A 3UWYA 2J9XA 2G96A 3MP4A 2YSWA 2ZZ3A 4ZQNA 5AYZA 2DORA 2ZRXA 1H61A 1VHCA 5I3FA 1GPWA 1LDCA 4TO8A 2XN1A 1C29A 4XKYB 3H55A 4HNNA 1I2OA 2I14A 2EHHA 1ME7A 3BPWA 1T99A 2NXHA 1R2SA 5TQLA 3S1WA 3W6YA 4EWND 2QCDB 2V82A 3W1RA 3PUDA 1FWWA 1YLVA 1OG0A 2ZCGA 2CLEA 5LNRA 4LNYA 5FF0A 4LW7A 5F2IA 3N9SA 4UTIA 2V5BA 5CPLA 3W1AA 3CTLA 1VLIA 1DL3A 2C3ZA 1DJNA 1YDNA 1S5WA 1OYBA 5E0KA 3TQKA 5CPMA 3C2RA 5KMYA 3GXTA 3E49A 3R2GA 1EP3A 3O1NA 2CLLA 3I6RA 1OYCA 1RV8A 2F84A 1VHNA 4FNTA 1V5XA 2CLOA 2ZA3A 5KZMA 1GTEA 3MI3A 4DPQA 4FEZA 3QF0A 5I3GA 1JJKA 4I9AA 1SO6A 3FS2A 1RR2A 3W7LA 2CLMA 4NZJA 2FJKA 3UD6A 4K36A 3IIOA 5A8GA 4ZQRA 2WV8A 3E96A 2KZHA 3LHVA 1P0KA 4UC5A 4O54A 4JEQA 1DKWA 2WO5A 4NU7A 4UUIA 4UFMA 3NQVA 1GG1A 4RXFA 3W1TA 2CZDA 1ZENA 1LP6A 1W8SA 1RVGA 3MJYA 2E5DA 2FLIA 2YYUA 4XQ6A 2DZTA 2NWSA 2FPTA 2NX1A 2VC6A 1A5SA 3KRZA 1K03A 2DZVA 5BNKA 3VE9A 4AWUA 1AL7A 3LV6A 3QW3A 2VEIA 4C1LA 1KW1A 1AMKA 1NF7A 4IOTA 1XM3A 1OVDA 1WV2A 1H7RA 2CLIA 4G1KA 3JR2A 1GZGA 2Y7GA 3W2JA 4JTJA 2A5HA 3W76A 5IBXC 3S6DA 1Y0EA 4FNPA 4QNEA 2BLEA 3BV4A 1PL9A 4JTEA 4FIQA 4HT3A 2NUXA 1VYRA 2DZSA 1ZFJA 2W0UA 4R33A 3HGSA 3LXCA 3NL3A 2OJPA 3MHFA 3OIXA 1IXNA 2GJNA 3MYPA 3ABQA 2W6RA 1TV7A 4Y8FA 3W75A 3VNDA 1FCQA 3Q58A 4O1DA 3SGZA 1DBTA 4R53A 3NA8A 3EXRA 1THFD 3TQ0A 3DXIA 1GYNA 1YTDA 1QMLA 5L9FA 5C6MA 4NXKA 1FCVA 1EWEA 3LCWA 3W2LA 3L5MA 4Y9AA 3KVMA 2A6NA 4RCXA 4GXMA 3BARA 3MWAA 3B06A 2B7PA 2VEKA 3CEPA 4KKXA 1D3HA 2Y63A 3VCRA 4PFMA 1RZMA 5DXYA 4DF2A 1RQEA 3W1UA 1YTKA 3LRMA 4OHQA 3WK2A 2H8ZA 4O1BA 3UXDA 1OX4B 1G69A 3PM6A 3SGUA 3LV5A 2R8WA 4PCFA 3B05A 4LRSA 3WJXA 3LX9A 4UTTA 3DFPA 4NNCA 4O11A 5AHLA 3M44A 3GLCA 2NXIA 3G1VA 4FX8A 2X1TA 2FB2A 1M7PA 3L66A 3IGXA 4ZVJA 2Z0IA 4AAJA 1SZNA 3C2VA 4O17A 1KTBA 3N14A 2QCCA 2VFEA 1Q45A 2VXNA 5FF3A 2ZZ1A 3LHZA 3BLFA 4UFJA 3ZFHA 3TR2A 4BI5A 1LROA 5K4ZA 2RKXA 4O52A 3TC6A 4LS1A 4LS0A 3NR0A 5I3HA 1Z48A 4BF9A 2VFDA 2Z6JA 3ABOA 1PS9A 1KM3A 2QCNA 1SR9A 2QCEA 4C1KA 1OHLA 4IJBA 4Q4KA 1EWDA 4M6PA 4AF0A 3HMJG 4UTTC 1GVSA 2Y70A 2YX0A 1I2QA 3NQEA 2OZ0A 3NVTA 2E5CA 3W3OA 1H63A 1P5BA 1VC4A 4FHAA 4MY9A 4FNQA 3EX1A 2EAWA 3G1XA 4KFNA 4NJHA 2E6YA 3IEBA 3TC7A 1OK4A 2I9EA 4GE8A 3U2OA 1MEHA 4OGZA 5D02A 5D2VA 1TTQA 1OFPA 2QCLA 4O14A 3KVJA 3RF9A 3TDFA 5LHEA 3FLUA 4JTIA 2ZQ0A 3PS7A 4AMAA 4MJMA 4GUHA 4TU1A 4N4QA 1TB3A 1I8JA 3LDVA 1TREA 5DY2A 3CT7A 1OFQA 4MZ1A 3BK0A 2G5WA 1VR6A 3WJSA 1FCUA 4QAIA 1QAPA 1YPIA 2P10A 3C6CA 3HG5A 5I3KA 3O6YX 4AWTA 2V0TA 3VFLA 3ABRA 4GC4A 3CU2A 1XCFA 1M5WA 3W9ZA 1L2UA 3G18A 3ELFA 3LCIA 1O4UA 3DI1A 3G0UA 4JTKA 1IGSA 3LI0A 3PAJA 6TIMA 1KM1A 3P81A 4E0CA 1SO4A 3B8DA 1SSGA 2WPBA 4QSHA 3W7PA 1I4NA 2G97A 4LOCA 2ZRUA 4WY0F 4H4IA 3LRLA 4LC6A 1P4CA 4BFAA 2B7NA 3QEZA 3THAA 3EX4A 3EX3A 5LHFA 3N73A 1LTDA 4K6AA 3W86A 1SO5A 2E1DA 2V9DA 2R91A 4CNNA 1Z42A 3YPIA 1W5MA 1TPUA 4YLWA 5CKSA 3C52A 3LCFA 4IPIA 3KAOA 4QNWA 2WJZA 2J6XA 3QSRA 1BWKA 1W5NA 1QOPA 2V5LA 1PV8A 1GOXA 5DCBA 3GDTA 3LB0A 1KM6A 4IMDA 3QRHA 4RJEA 3W2NA 2DJXA 3M9YA 5HWJA 2X16A 5KZEA 4MFEA 5AHEA 2CZEA 2V2HA 3GAYA 4MFDA 4NT0A 4WXYA 1X8FA 3G24A 1WX0A 2WSRA 2C18A 2X1RA 5SWUA 3W2UA 1TQXA 3GZ3A 3GVGA 2H8XA 5G2WA 5BW6A 2C15A 4ZQCA 3DENA 3UY7A 1TPC1 2J27A 2VKZG 4JTLA 2NUWA 2QCFA 1NF0A 1VYSX 1O5XA 3GAKA 3KVKA 1F6KA 3DHFA 2YGYA 1ALDA 4MUZA 3W72A 2Q8LA 3MI2A 4TX9A 2H90A 1JQXA 4JS3A 3P7YA 2GQ9A 1B4KA 2QCHA 2X1SA 3HB9A 4M7TA 1G4EA 1UASA 3W7GA 4ICNA 3GKFA 3EWZA 3LHUA 2XN2A 3SW6A 4GUIA 5G5IA 4FXRA 4NQ1A 3CB8A 4A3UA 2C6QA 3Q94A 5E93A 1I2NA 1L6WA 4RXGA 3O05A 5F4WA 1Z44A 2PE4A 1SZGA 3FKKA 4HNVA 1W5OA 4ML9A 2GVJA 2E68A 2G95A 4OU1A 3UYCA 4CQ9A 4M19A 1YDVA 4UCGA 1AK5A 3UY8A 4U28A 3O15A 1TPB1 5DBUA 5EPDA 5FEZA 1XXXA 2EPHA 4O13A 3N34A 4RZ6A 4JY8A 5E1QA 3HO8A 4JTTA 3HOJA 5A5WA 3VKJA 3DKJA 3GDKA 3NPVA 1F76A 3HG2A 4DO5A 4ADSA 3OEXA 2X1UA 2ZRZA 4BR1A 1IF2A 4LVDA 1ZJIA 3BGJA 4LVAA 1WYIA 4FNUA 1MSSA 3I68A 4O0KA 4N9CA 1O60A 4MZYA 1OFAA 2WNQA 4CCCA 3NQMA 1MEIA 3OA3A 3CM4A 3R13A 4UTUA 2QCGA 6ALDA 1Z41A 4UFIA 1KLYA 1L9WA 3HGRA 3HIJA 1VJIA 4FX7A 1GWJA 5HQEA 4I7UA 4GUFA 1WQ5A 3TW7A 1X1ZA 3WFAA 3PBVA 3C3NA 1UBSA 4ADTA 4AF0B 3JS3A 1S5TA 2H3BA 4X22A 2BWGA 1JUEA 3EWXA 1JULA 3PVFA 3LGEA 3QMTA 4Q32A 4TIMA 3NL6A 2Y61A 2YXGA 1RD5A 2GQ8A 3WJYA 3TSDA 4M6QA 3K30A 2QAPA 3FOKA 2Y62A 4I7WA 2ZYFA 3LTYA 1DV7A 4JTFA 5HULA 5C5YA 1GJPA 2C1HA 2JKPA 1I2RA 3T55A 1H1YA 2CLFA 1H5YA 3P67A 1EEPA 3OVQA 4XUGA 3DFQA 3RU6A 5T26A 3W7QA 1DORA 3D0CA 3E12A 4P2VA 4AHPA 1HL2A 2GVLA 3PUEA 4MIMA 3LHWA 4Y90A 1Q6OA 3S1XA 3A5FA 5L6UA 4YMZA 3W70A 1HTIA 4CCEA 1M7OA 2HS6A 1W3TA 4BI6A 4NJJA 5DCEA 1F74A 3C8FA 2GVGA 4S2BA 3TJXA 4UTWA 2QDGA 3A22A 1JRCA 2NXGA 1FDZA 3FKRA 1SZFA 2BZNA 4LV4A 4IQLA 2C19A 3IV3A 1MZHA 1VZWA 2C16A 1KFBA 5F4XA 1PE1A 4HHPA 1TPEA 5FI8A 3MI6A 1OYAA 2ISWA 2D73A 3QSTA 2BX7A 1X6UA 2E5BA 4WXZA 4I7VA 3LBCA 2CW6A 5HWMA 3RLUA 1UCWA 2V30A 3TA6A 3UZ5A 1ZALA 1N8FA 1PHWA 3LHTA 4NNAA 3PB2A 3F4WA 3DU0A 3LBMA 3NYZA 4QIUA 3MBFA 3DH7A 3W1LA 4DQWA 4J9JA 3W1XA 3DKLA 4FIRA 4AVFA 1F7BA 5F1VA 4E38A 2ZZ7A 4TR9A 4D2JA 1TTPA 5IBXA 5CG7A 3C2OA 3DFSA 1ICPA 1TPFA 4UTWC 2B0MA 1W56A 5D37A 4PEKA 3EXTA 3NDOA 3MMTA 3O6CA 2LLEA 3WJZA 3P80A 1YADA 2RH9A 1AG1O 1SQ7A 1LBFA 3BG5A 3OG3A 3HG3A 4UMAA 1QDSA 3EWUA 1QR7A 1HUVA 3ATZA 1LM1A 4UNLA 2PCQA 3ZWTA 3A9IA 4Z1BA 3NL5A 4OV4A 2PRLA 4N6FA 1KFEA 3M6YA 3PBWA 3R12A 3IIZA 5D05A 4IMCA 1XC4A 1G7UA 3LTPA 1DVJA 4POCA 1B3OA 3GIYA 3QPYA 3N3MA 2NWRA 4Z1DA 3QMSA 3G22A 5F2LA 4DO4A 5LNSA 5BOOA 1TIMA 1VGAA 3QPZA 3W1MA 1IXQA 1WDWA 1TQJA 2ZRYA 1ICSA 3NZ1A 5FEPA 4UFLA 3HPSA 3W2KA 5FESA 2VELA 1IXPA 1SZEA 2Y7EA 3L0NA 5EY5A 1SW0A 2JKEA 2R94A 1FWTA 2A1YA 3GDMA 3PSWA 1QO5A 4LVGA 4JGDA 1M6JA 3TJLA 1HG3A 4W9TA 3SIZA 3A23A 1NEYA 4O1CA 1EIXA 1W54A 2WQPA 3KOFA 2QCMA 4PL1A 1VRDA 1VH7A 1DOSA 3LLDA 3A21A 5GVJA 3NQ7A 5TBOA 1K8XA 5KITA 2VENA 3SSJA 3UQNA 2ZZ4A 2P0OA 4YL2A 2JKAA 4PODA 1X1OA 3NZRA 2J24A 2YFNA 3P5YA 2E6FA 1A5BA 5KINA 3S0CA 3BLIA 4FXSA 2VEMA 1W37A 2QUTA 3HQ1A 5CPNA 3TV8A 3GK0A 3KRUA 4MPQA 3TXZA 4KWVA 4WZHA 1VPXA 2ZBTA 1H7WA 3UWVA 1EB3A 1YTEA 5CSSA 5G4EA 3BG9A 1P0NA 5FEXA 5LGXA 4LTSA 3M5XA 3W85A 4IXHA 3KX6A 1OFDA 5K4XA 1K8YA 1KM0A 5H91A 3DFOA 5D09A 4O0ZA 4A2SA 4RKAA 3NL2A 1K7EA 1Q3NA 3W2MA 2VFGA 1ML1A 1R46A 4MJZA 2EGZA 3QQ1A 2QEZA 2VOMA 1JUBA 3LRKA 3TAKA 1QNVA 1TTIA 1ONRA 3IVTA 5FF7A 4RV8A 3EEGA 4N6EA 1SU5A 4LY8A 3N19B 1L6SA 1YXYA 3GR8A 4QM1A 4LWWA 4HKPA 2Z1BA 1K8ZA 1AW5A 1ICQA 2A0NA 3P74A 2BXVA 5K3VA 1ZCOA 4AWSA 4EIVA 3G8EA 4GUGA 5G4WA 3KVLA 5F4SA 3G8RA 4IX2A 5FEWA 1FCBA 2PURA 5DXXA 4HNTA 5CZJA 3C2EA 3FYOA 4N9BA 5U4NA 3MP3A 2OT0A 3HGJA 1FBAA 1A5CA 2X30A 1KM2A 1OF6A 2FB3A 2E77A 4LS2A 3W83A 1JCJA 2GUUA 4MYXA 5CZSA 3NM3A 3L65A 5K9CA 2FDSA 3KXQA 5EL1A 4OQVA 4OWGA 3F1QA 2OCZA 1I2PA 3STCA 1TPH1 2YR1A 1XBYA 3DFNA 3LOTA 3SZ8A 1H7OA 5LKYA 4IMFA 1SFJA 3WK1A 2HMCA 5AC6A 3GKAA 5LSMA 3NG3A 3EWYA 2YW3A 4FB7A 1VCVA 1VCGA 2H6RA 4M7SA 4YXGA 3WJWA 1LBLA 2XFWA 4Z08A 4X2RA 1LCOA 5KTLA 3T78A 3I7RA 4Z1AA 1PIIA 3MO7A 3LXBA 1LOLA 1F5ZA 3SFKA 4GNJA 1G4PA 2CLKA 1IIHA 3UPWA 1J2WA 1RQBA 3RLVA 1G4TA 4N4PA 2ZTKA 3G1HA 2AAMA 2QJHA 4EVZA 2PRMA 2HSAA 3O16A 2DZXA 1XUZA 3E02A 1KM5A 4Z0JA 3FIGA 3UNDA 3E0IA 4MLRA 5C2XA 3P8IA 5C54A 3GX9A 4K7VA 1KTNA 4UIOA 4OV9A 1LORA 2RDWA 1GVFA 3ABSA 1XUUA 2A6LA 4JIQA 5C55A 1W3IA 2J88A 2ZA2A 4TMBA 4Y6GA 2GPTA 5AOUA 1SPQA 3W71A 1O95A 1UJPA 4O50A 5G1YA 3TMLA 3ZS4A 3A5VA 2JGYA 2YFOA 2XN0A 3TX9A 3CIXA 1GT8A 4WX2A 3LCGA 4BWLA 1JQVA 3NQ2A 5LNVA 1K02A 4JX4A 4CCDA 3P82A 4A2RA 3CHVA 2UV8G 2EF9A 4JTGA 4IWWA 4KWWA 5EA9A 4AH7A 1TYGA 3P8JA 3W7HA 1KV5A 3W23A 3W7OA 1XBXA 3TFCA 1R2TA 5HJLA 4N9DA 4ZQOA 3STFA 2J9YA 3GR7A 3PG9A 5D2WA 2HTMA 5AHMA 4WJEA 4YCPA 4IMGA 1F73A 3B0PA 1KFCA 5D32A 4JD4A 4WY0A 4Z0SA 1CI1A 1PCWA 5IM51 1D3GA 5H2ZA 4JDBA 1GG0A 3S1UA 3TCEA 4UTMA 3CEUA 3I7QA 4K7YA 3MHGA 2QF7A 5I3JA 2H3DA 1LOSA 3O06A 3RMJA 4TMCA 4PC8A 3V1PA 3W87A 3LCLA 2ISVA 4N02A 3TE9A 1FWRA 1XFBA 1W1ZA 2ZA1A 3FYPA 4BWLC 2EKCA 4OT7A 3C0JA 2Y89A 3TIMA 1KFJA 2DZPA 4HN4A 1F05A 4IXXA 4E2DA 3S1VA 5ABTA 1FQ0A 4R34A 4UMBA 1U83A 4ZQPA 1SW7A 4JTHA 4UTHA 3EXSA 1TV5A 1OABA 2JK2A 4DF1A 4HSNA 5AB3A 3A24A 3ANYA 2Y7DA 1NFBA 1KBJA 2V2DA 4LVFA 5LGZA 4OE7A 3S5ZA 5D2XA 2JBMA 4O4VA 4DXVA 4JIPA 3T4CA 3LCHA 3B0UX 2X2GA 4Q33A 4AEOA 5HR6A 4S1FA 3L5AA 3M47A 2ATSA 4HIBA 5HMSA 5EBUA 4O8RA 3W7NA 5HNRA 2WOQA 2QAFA 4FNRA 5AHNA 3IVSA 4O28A 1VS1A 4XTDA 5BMWA 3NXFA 4P61A 3PF3A 2ALDA 4WOZA 1QFEA 1WA3A 2RDTA 4AB4A 4OBTA 1EP2A 3O6DA 3GYEA 2NUYA 2RDUA 4NXSA 3DGRA 3IGSA 3P84A 2RHGA 4JYEA 5AYXA 3TROA 4BK9A 1J4EA 1H1ZA 3FJLA 2A7NA 4DO6A 2CWNA 1QCWA 2ZTJA 5LNWA 4Z1CA 2Y6ZA 3S5NA 4CNPA 2AGKA 4K37A 4NVTA 8TIMA 4N2YA 1JR1A 3EWBX 2TSYA 5D33A 1QOQA 4RX0A 1LRQA 1X7FA 3W7IA 1KBIA 3L68A 4GRSA 3M5VA 4N9EA 1C9DA 4GWEA 4JR5A 5EKYA 1BEUA 3WK0A 1TPVA 4JYDA 4L4MA 1SFLA 3W74A 3M5ZA 3CC1A 3PULA 4O18A 5DBTA 1XDLA 3BW3A 3M7WA 3DFTA 4A21A 3EB2A 3LCXA 2V81A 1ME9A 1TV8A 3LXAA 5CPOA 5F2MA 1SUXA 5G1TA 4JX5A 2YPIA 2FPYA 2Y88A 4CQAA 4GBUA 3T7VA 5AC7A 3CWOX 3G1DA 1W5QA 1EA0A 1OK6A 3UWZA 4RZ5A 1GVOA 1O5KA 2A85A 5KZDA 5LNUA 2CZ5A 3QJAA 3OVRA 4NJKA 5BRBA 3EX2A 1FXPA 3PUOA 3VI2A 2J9ZA 4MVAA 4DBDA 3L67A 3G3DA 4JTSA 1OFBA 1TRDA 1JCMP 2YZRA 3Q37A 5J5DA 2GJLA 3GXPA 1OJXA 4MOZA 1TSIA 4MY1A 3NQDA 5FF4A 2DZWA 1DQWA 1LRTA 3O63A 1B9BA 1MO0A 3M41A 3F4NA 2WSQA 4UTLA 1FXQA 2ATMA 1WOBA 3L5LA 1QWGA 3LLFA 1HFBA 2Y7FA 4O4WA 3W7KA 4RLIA 3NNTA 3DAQA 4HPXA 3W22A 3CWNA 2Q3OA 4PA8A 4XBSA 3U6WA 1P1XA 2IQTA 2A7RA 3M43A 4K8HA 3UWWA 1WOAA 1YDOA 1FDJA 3L2IA 3G1YA 4O12A 2PRHA 3S8HA 1DHPA 2DP3A 1T8XA 1S3HA 4XZ9A 3E9AA 1TJPA 1VCFA 2RFGA 3R8RA 3NQCA 5G2HA 4IGHA 3FEMA 5DCDA 1K7XA 4EOUA 3NPXA 1Q6LA 4UMCA 2E6AA 4WD0A 4JTUA 2B4GA 1JCNA 3HPZA 3LM7A 3QW4B 3QZEA 5HUPA 4HNUA 3SY5A 4GJ1A 2A4AA 4NJIA 5DLCA 1D9EA 2WNNA 4WY0B 4UFHA 1TJRA 1JRBA 4WOQA 4ZQMA 5D2YA 1YPFA 2HS8A 1YXCA 3M0ZA 2VFHA 5TIMA 3LERA 3NQ8A 4DF0A 2ZDRA 5D2TA 2VFFA 3NO5A 1JVNA 5DN1A 1QO2A 2BSLA 1TMHA 4NJGA 3TW6A 4FX6M 2ZZ5A 3W07A 1SO3A 1TTJA 3G0SA 3N2XA 2FFCA 4LU0A 2NV1A 3AO0A 1XBZA 3L0GA 3W7DA 1RPXA 1Q6RA 1LOQA 1TPDA 3GDRA 4UTJA 3B04A 3TSBA 1FY6A 2FTPA 4JICA 3QH2A 5BMXA 5FF2A 1GVRA 3R89A 2ABAA 5D38A 1TO3A 2O7QA 1G4SA 1MEWA 4ORIA 1E51A 3W1PA 3NQFA 3DHDA 2GOUA 4RK8A 5AHIA 3CIWA 1KLZA 4HSOA 2C13A 5F1UA 3G1AA 1PVNA 1TRIA 3ATYA 3CQ0A 3W7RA 1FUYA 4ORMA 4NZFA 4K39A 4WQ6A 3T44A 1N7KA 3UZJA 2A21A 3G1SA 3GXNA 1ZY9A 1OX5A 4FO4A 3MP5A 1HO4A 2DZUA 1SSDA 3C61A 4DELA 4O57A 1GQNA 1IXOA 4O10A 1BTMA 3MUXA 1K3UA 1NSJA 1FX6A 2P1FA 1H7PA 3IVUA 3TH6A 4JYFA 3LHYA 1JUKA 3GNNA 2B7QA 2TPSA 3W88A 4AXKA 3FJ6A 4NUWA 2OX1A 3QQ0A 1G67A 1ZAHA 2QDHA 4MLJA 3O8AA 3RFAA 1ZHAA 3PG8A 3INPA 3V75A 3JRKA 1OF8A 4RR4A 1YYAA 2Q3RA 5AFDA 2W79A 4JDYA 4CQ8A 4A22A 3SECA 5K2ZA 1KM4A 1VYPX 2VEPA 2TMDA
chains in the Genus database with same CATH superfamily
4MKNA 1RLCL 2PDQA 1S38A 1OFRA 3W7MA 2B7OA 2YCEA 1PCKA 2Y8KA 1A49A 2VGFA 3I6EA 5D04C 3LUTA 3BG3A 2V38A 3PTDA 5J5RA 1V3LA 3M1ZA 1Q85A 4UXDA 2C14A 4IFRA 3WUEA 2CU0A 3SJ3A 2PDIA 1UH4A 5HPCA 2XH2A 2V2CA 2XFFA 2Z2UA 1KRAC 2DW6A 1HO1A 2BV9A 3OQEA 1WXJA 2YDQA 4YTRA 1XLKA 1XYBA 3H23A 1ONEA 3KOWA 3REQA 1VFTA 4W7WA 1R0MA 4O19A 4DJED 1P43A 2D1ZA 4MWAE 3ZJ6A 5MHBA 6XIAA 4DI8A 5CGTA 3ZOAA 4C91A 4ZO9A 1KRCC 2XM1A 4CNOA 1UG6A 4MB1A 2ZRWA 3B8IA 2UBPC 3KBWA 1MW1A 1Y65A 5AYYA 4FLRA 4XB3A 4K38A 1R85A 1S46A 1W3KA 1W1A1 2J79A 3CQJA 3OLDA 3ZR4A 1XR2A 3CUFA 4Q8UA 4PYSA 2JEQA 4M82A 3ZJKA 2GVEA 3L21A 1X1NA 3CYJA 3TNOA 5EMUA 1EJ7L 5EBAA 4BZYA 5DELA 1VLWA 2WWCA 4C7GA 1U2YA 2NVAA 3K46A 4EK7A 2CITA 1HXJA 1BVZA 3N9RA 4GI4A 3PB0A 3FJ4A 4UQDA 3TFXA 1XL9A 4F4RA 3C56A 3N12A 4GUJA 5CZTA 4H9YA 4IMEA 1RQHA 2QCDA 3GC5A 1SR0A 3KRSA 3BO9A 3N9KA 4CQCA 4WVXA 2CKSA 1LLZA 2GGHA 2QV4A 2YA1A 1QNRA 1BRLB 4JX6A 1C8VA 3WNNA 2NQ9A 1GNXA 1J10A 5G2IA 2BOFX 2QJGA 4EANA 2WZTA 1Q63A 3IK2A 4GOAA 1AVAA 4BI7A 3W7EA 3URQA 3KCLA 1WE5A 2ALRA 3DBPA 3EWDA 3VNJA 4A29A 2YW4A 4NRSA 4F0KA 3BAWA 5T9BG 4HPNA 1TVLA 1XRVA 2J25A 3IRDA 3EOEA 4MYAA 3AUJA 5A3HA 2QKFA 3FFSA 3WEZA 1Q6DA 1UUOA 4H6KA 1CX9A 2Y85A 1E3XA 1C7TA 3RPDA 2YBUA 3VK5A 3MV01 4M29A 4HD5A 3RUBL 3VM7A 3SCTA 2ZWZA 3IIVA 1B4EA 3PWAA 2GL5A 3GDLA 3W7CA 1GW9A 1W31A 2FHBA 2XWDA 5CCZA 4P8XA 4Q4RA 4JNMA 6TAAA 2QJNA 1FWFC 2PD9A 2E3ZA 1MXSA 4UR9A 3MSYA 4GY7A 5KSWA 4RZ4A 3CUJA 1QOXA 3CMGA 1N55A 1LF1A 4FNSA 1EL3A 2PDHA 2ZUTA 1HKVA 3CLMA 2PC8A 2JGQA 1EUAA 3DYPA 3EKLA 4MZ8A 5HJYA 5D9PA 3EA3A 4Z2JA 1H7XA 2VWSA 4NF7A 5D03A 3B0VC 1T6MA 5CAHA 1BKSA 2NX9A 1SMDA 1BFNA 3MHUA 4N0RA 1ME8A 3BDKA 2W4XA 1RK5A 4RDWA 4GZ7A 1ZAJA 3QR1A 1JYWA 3AALA 1GOQA 1LZOA 2A2IA 5K9XA 2VR5A 4OBRA 2WBKA 2OR2A 1XLJA 5TD4A 1A5AA 4QITA 3QGVA 1QPQA 3TEVA 3O6AA 3TCSA 1YXDA 1NVMA 3H54A 5JH2A 3MYOA 2J7DA 3RPTA 3AUOA 4B3KA 1A50A 3T81A 4YWIA 4GK8A 1U5JA 2ACUA 2XGIA 1PZ2A 4RZBA 4HNLA 2F8QA 1BG9A 3THDA 3NGJA 1OFEA 3T1GA 3QZAA 8RUCA 3V0TA 4XV0A 2H9AB 4HA4A 4HPJA 4D6HA 2CHOA 2OZ8A 1H50A 1VKFA 4UZUA 4XTIA 3I10A 1M03A 1WBHA 2C0AA 4KRTA 1A4LA 2DJLA 1LJYA 2PFHA 4EF8A 4MPKA 2TRSA 4XIMA 2PP0A 3TK7A 4PTNA 5BXPA 3ALFA 4IUOA 4KGJA 3SY1A 3P61A 2QVHA 2W63A 3HG4A 1BWLA 1QPRA 2I9UA 1H62A 3FA5A 3UPBA 4DBWA 1EZ2A 3MP4A 3IGHX 4NYYA 1XLBA 2WVSA 3GFZA 3CHDA 1AH4A 5AECA 4HZ7A 1G01A 1GPWA 2FDMA 4TO8A 2XN1A 5HQLA 3JUGA 3WL1A 3B8TA 3XIMA 1VBUA 2L5HA 4HNNA 1I2OA 3LSBA 4CNUA 3LZ3A 2V82A 3VNLA 2OYMA 1FWWA 3S2CA 2ZCGA 1YIXA 4IPNB 2YB4A 5LNRA 4X63A 1N8IA 3KEHA 1G1YA 4PULA 4JNZA 1VLIA 3WQOA 3FGCB 3R8HA 5M5DA 5E0KA 3TQKA 3C2RA 2GSHA 3SRHA 4L80A 2WM0A 1O5RA 3MUCA 3R79A 3GY1A 2BHYA 3VDBA 2CLOA 2WVTA 5KETA 3WDJA 3MI3A 1CENA 4DZIA 4CVUA 4ZOAA 4HZ8A 4DPQA 1ZJHA 3QF0A 1REQA 2OQYA 4I9AA 1K9TA 4K36A 3TN5A 3WY1A 3BSMA 1QNPA 1UR9A 5FJOA 1P0KA 2ZE3A 3H24A 4E8DA 4R7WA 3K4DA 4UUIA 3KWSA 4UFMA 4E2VA 1JXJA 2PWEA 3W1TA 3OPSA 3UGRA 2PS2A 1FP8A 1E71M 1P48A 1ZENA 4GI6A 4PUDA 5HPOA 4J5NA 3CUZA 4OJYA 4E4PA 4J3TA 1TELA 3ITCA 3EMZA 4ZB0A 2X0SA 2WWDA 1DJXA 3VNZA 1JEZA 2DZTA 4AG0A 1YNYA 3ES8A 2VX5A 2NX1A 1Q7MA 3WD2A 1K03A 4DXKA 2CESA 1AL7A 1VB9A 1KW1A 1OVDA 1R9ZA 1WV2A 1H7RA 5M1TA 2Y7GA 1YW1A 3W76A 4M8UA 1Y0EA 4EX4A 1RBAA 4QNEA 2BLEA 5JUVA 3WUBA 1TV2A 4FIQA 2PBOA 2DZSA 5C7HA 4BQ3A 1ZFJA 3L4VA 3M0XA 1ZS2A 3NL3A 2OJPA 3OIXA 1IXNA 2DW7A 5CLWA 3AIQA 3W75A 3SGZA 1W2VA 3M46A 1CIUA 4WCJA 2HDJA 5BOEA 2EJ1A 1W1VA 5J04A 5FJPA 3LCWA 3W2LA 3L5MA 4Y9AA 3H4GA 2A6NA 3PZ9A 3FW6A 3PPFA 3MWAA 5A1AA 2QS8A 3WDRA 4GHRA 1D3HA 2Y63A 3RM4A 4YVVA 2J47A 4GZEA 3TP4A 1ONXA 1CPUA 1YTKA 3LRMA 4OHQA 1OX4B 1G69A 1ZU8A 2P3EA 3SGUA 1PUDA 3K8LA 3WH9A 1R3QA 4PCFA 3B05A 3RLGA 1EIBA 4UTTA 1T41A 1UYQA 3SM0A 3M44A 1Q65A 2VEGA 3G1VA 1Q4NX 3T09A 4C1NA 3HV9A 1XSKA 4HMNA 3AIEA 3IGXA 3QQWA 1UC4A 2Z2BA 1BPLB 1KTBA 3AROA 2O92A 5FF3A 1HZYA 4B3LA 5K4ZA 2KX9A 4UQAA 5E70A 3TC6A 1HIZA 2ZXQA 1RXOB 4B5TA 4GINA 2BY2A 1Z48A 2VFDA 1WKEA 3W27A 3GUGA 4C1KA 3VOHA 2RAGA 1JDCA 3TOYA 1AJ0A 3M0YA 1EWDA 4M6PA 2RUSA 2J8TA 2ZUVA 4PE8A 3V5CA 4DRSA 1GVSA 2Y70A 2B81A 1XV8A 1I2QA 5C70A 4H1ZA 5CEWA 2E5CA 3M0KA 3MKCA 4Z2KA 4FHAA 3W26A 4KFNA 3N1AA 4GXPA 2VVNA 1JXKA 3U2OA 1MEHA 4OGZA 2QCLA 2PDLA 4DO7A 3RF9A 3TDFA 2DVUA 3FLUA 3IRSA 4AMAA 4TU1A 2P5NA 3UJ2A 3LDVA 5DY2A 1E4NA 1US3A 3BK0A 4MZ1A 1V0KA 3WJSA 1FCUA 4QAIA 3FEQA 4HPGA 3T0AA 3WF4A 3NCOA 4PMZA 2V0TA 4GC4A 4YTQA 4WDUA 1XCFA 1C7SA 1UP3A 1GEHA 3LCIA 4B91A 3BJFA 1H3GA 3LI0A 6TIMA 1E1FA 2OFJA 3L7RA 3VDAA 4UTFA 1SSGA 2WPBA 3EDEA 3B9OA 4HHMA 4W84A 1I4NA 4WY0F 3S46A 4H4IA 1JZ3A 4LC6A 3T8LA 3EX4A 3PZIA 4P8WA 4XSMA 3ZT7A 3ZYZA 1SO5A 2HZGA 2E1DA 4Y9PA 4CNNA 1Z42A 4JL1A 3KZPA 3S3GA 1TPUA 4OECA 3WLSA 4GQQA 2WJZA 2J6XA 3ZSTA 4J2MA 1W5NA 1RP9A 1ZZMA 3PANA 5DCBA 1HKJA 1KFWA 4D72A 1KM6A 4IMDA 4GVIA 3VZYA 5HWJA 5KZEA 3CUXA 3H2EA 4WXYA 4NT0A 1VJZA 4AXNA 2C18A 2QUMA 3AMDA 2NV9A 3GVGA 2H8XA 2BG5A 5H8PA 5DMMA 3KW3A 2J27A 1G5AA 5C0QA 1O5XA 1XIFA 2YGYA 3DHFA 5CSUA 2INEA 1RBLA 2H90A 4TX9A 1JQXA 1WKDA 2NQLA 1V03A 4JS3A 1H2JA 4ZR8A 5CBIA 1B4KA 2QCHA 3HB9A 4M7TA 3LQLA 3UR5A 2XN2A 4GUIA 3ZLGA 3Q94A 5E93A 4ZCWA 4NI8A 3O05A 2QPXA 4JTAA 2GK1B 2PE4A 4MB5A 1R86A 4ML9A 2GVJA 4OU1A 4PUWA 4QHRA 4CQ9A 1H11A 1RP8A 2WC4A 2GJXB 1AK5A 4LBSA 1TPB1 4O13A 4LBRA 5E1QA 4JIIX 1CZ1A 3DG6A 5A5WA 2BVTA 4D1IA 2O9TA 1C90A 2WK2A 2I56A 3U57A 1ECEA 1E0WA 3V7PA 1A0CA 4D6EA 4XX6A 4B4FA 4L6HA 4N42A 3H4WA 2POZA 4QJ5B 1WYIA 3WD1A 3NWRA 4C6EA 1MSSA 3AHZA 4NI3A 4HJWA 2AQVA 4N9CA 1O60A 1IEIA 3ONBA 1TKKA 1OFAA 4CCCA 4LCQA 4LUTA 4US5A 5BWAA 2VRQA 3GVRA 3OA3A 3CM4A 4FALA 6ALDA 4UFIA 3HGRA 2J7EA 3HIJA 3XINA 3LK6A 3PK7A 9RUBA 5HQEA 4I7UA 4DUOA 3BLPX 2X1IA 4ERIA 5M03A 5EGRA 4X22A 3RU8X 3WLQA 5A6KA 3N3TA 3UR2A 4NHVA 3ZJ7A 3LGEA 1E40A 5ABFA 1FKXA 5I6SA 1DJHA 2Y61A 3U4AA 3V36A 3WJYA 3ARPA 3N4EA 1XQLA 1O1ZA 3FOKA 2F9RA 4I7WA 4J27A 1HKKA 5HULA 3OBAA 2C1HA 5E09A 1OT2A 1W8GA 2OGJA 1JF5A 1K9DA 4TOQA 1R9XA 3P67A 3DYMA 3OVQA 1BTCA 1ADSA 3D0CA 3CUHA 2PDXA 4P2VA 2BVDA 4MIMA 3RCYA 4Y90A 5I0DA 3CV1A 1Q6OA 3A5FA 5L6UA 3V5OA 2J75A 2W27A 3ZXWA 3RX2A 3PTKA 3I4KA 3P14A 4NJJA 4GQGA 3TN6A 1UD5A 3NQBA 4UTWA 2QDGA 2FZ9A 1E6NA 1KGXA 1MZRA 3EYPA 2C19A 1MZHA 3S9IA 1VZWA 3NSXA 1KFBA 5F4XA 2Q02A 2RJGA 3E6EA 1PE1A 4HHPA 3VC5A 3VOGA 1E1CA 2ISWA 2XG9A 2E9BA 4PUUA 1X6UA 2CKRA 5HWMA 1GQLA 3T0BA 3WBAA 2V30A 4MWAA 4IFKA 3WLOA 3IJDA 3WEOA 4QS5A 3HZ3A 4AISA 3SN1A 2HNHA 3DH7A 3W1LA 3W1XA 3T05A 4FIRA 5ABEA 1F7BA 3I3EA 2OZ3A 4E38A 4MJ4A 1Z3NA 3T08A 3N15A 2VZTA 3D46A 2BY3A 4D2JA 1TTPA 3PTQA 4DLFA 1R3YA 5IBXA 4F0SA 3AHTA 1QNOA 3WD3A 3W29A 3VX0A 5I2UA 2WVVB 2V3DA 5IFPA 3MMTA 3O6CA 2NQ5A 3WJZA 3GU1A 3GSMA 1SQ7A 3BG5A 4O8AA 1I0DA 1AODA 1QDSA 1QR7A 3S1GA 2PCQA 3ID7A 2GJRA 4OV4A 4OKDA 2D2GA 2PRLA 4H9MA 4N6FA 3M6YA 1GKQA 4Q4QA 4G9PA 4QR6A 2JIEA 4IMCA 2W9MA 4DJDC 8XIAA 2FH8A 4E8GA 2PCEA 3GZAA 3N3MA 2NWRA 4AZ5A 4DBUA 4ERAA 4PMOA 4D6CA 4I3GA 2IQ0A 3T0CA 3CMFA 2V3EA 1TIMA 1QHOA 3BH4A 4XKMA 3W1MA 1TQJA 2ZRYA 4ATWA 1RPKA 3W2KA 1ISZA 2ZOXA 4J3UA 2C8NA 2XVPA 5T9CE 1US0A 1SZEA 2HPMA 1A0EA 4DAFA 3ENLA 2JKEA 2R94A 2YIHA 4AD1A 1S5MA 4RW5A 3STPA 4IQDA 4W9TA 1NEYA 3NIYA 5BCAA 1W54A 2P76A 4AMCA 2WQPA 1I9CB 4DZ5A 4L6OA 1VRDA 3TN3A 1VH7A 5CH9A 3M64A 5TBOA 3K8MA 3LNPA 3DFHA 3UF9A 4RE0A 2OLHA 1UR4A 2C1GA 2JKAA 3DOPA 3BTNA 1X1OA 3NZRA 2BHUA 4B90A 1QW9A 3MKKA 3S0CA 4KESA 4G56A 2G4JA 3FA4A 1OZMA 3UWEA 4YHEA 3KL0A 1PWMA 1JYXA 5C8BB 2D0HA 2V69A 4MPQA 4KWVA 3NGFA 1Z32X 3HQNA 3ITYA 3CV6A 3VD4A 1YTEA 5G4EA 3BG9A 4V15A 5I5RA 4ZB5A 4IXHA 5K4XA 5H91A 3BMXA 5D09A 4O0ZA 4A2SA 3NL2A 4F2TA 4PFHA 3W2MA 1TX2A 1V7AA 4G8TA 4MJZA 4W89A 4FF5A 2VURA 3S2MA 1QNVA 1TJ2A 3VZZA 1KCKA 1B3WA 2YL9A 4LY8A 1L6SA 4JN7A 3T0TA 2VCCA 2VZUA 1O7AA 4LWWA 2BDQA 3OP2A 2NSOA 1Q6GA 1K8ZA 4QSFA 2A0NA 3P74A 1U5HA 4I5XA 3QV9A 3WNOA 1ZCOA 3N11A 5F4SA 4C6NA 2DPEA 1M04A 3WH8A 5FEWA 5DXXA 1TR9A 2OX4A 4HNTA 4PBFA 3C2EA 3FYOA 4FOUA 2QV5A 3MP3A 4IL2A 2X30A 2GUUA 4PMJA 5K9CA 3KXQA 4D6JA 4GO8A 5HK4A 3GXIA 1TPH1 3SN0A 2WVUA 3LOTA 3WK1A 5AC6A 4C7DA 3NYDA 3LPPA 4J3SA 1Q5MA 1XF0A 3EWYA 2PSNA 2YW3A 1UPPA 4FB7A 2KAUC 4JFVA 7CGTA 1LBLA 1ZPTA 4X2RA 3TTEA 1LCOA 5KTLA 3I7RA 1S2UA 2D69A 3POHA 2I16A 3MO7A 2WC3A 4OOUA 3LXBA 4Z2HA 3RM8A 1F5ZA 1UROA 4GNJA 4ZE4A 1V6VA 2HSAA 2WMJA 3O16A 2OTDA 1NDZA 1KM5A 1V02E 3W4RA 2AGTA 1A47A 1JAKA 3OZPA 5C2XA 3AYVA 2UWFA 2CHNA 3CJPA 4AWEA 3PFRA 4W85A 5JBDA 3VD9A 1TJ1A 3MY9A 4LAKA 4OV9A 3ABSA 4JIQA 1W3IA 2ZA2A 4Y6GA 1J0IA 5AOUA 1SPQA 3W71A 1O95A 4KWUA 5ABGA 4M1BA 4UCFA 3PTMA 2XN0A 4BWLA 3LCGA 2BS9A 5ABHA 4Q4MA 3CHVA 2UV8G 3F4CA 2EF9A 4AH7A 1P0EA 3I4EA 1R2TA 4N9DA 1TVPA 3PG9A 2Y8VA 4WJEA 1CB7B 4P7NA 3B0PA 1C92A 5D32A 4JD4A 1E9ZB 1CI1A 2YBTA 2XU2A 4A8RA 5FAGA 5FAJA 1GG0A 1OINA 2JALA 4K7YA 1QBBA 1LOSA 4NRRA 2I17A 2W61A 3W87A 1ZBKA 3TE9A 1FWRA 1XFBA 2ZX9A 5ECVA 3ERPA 1E9YB 2Y89A 3V0SA 2POTA 3IJ9A 4JTQA 4BF5A 2BXYA 1SW7A 1F61A 4UTHA 4PUKA 5A6AA 3M0VA 1TV5A 4CN1A 4DF1A 3G1RA 1G94A 3VOIA 4WIWA 1KBJA 1YNPA 4ZO6A 3PWIA 2DT3A 3S5ZA 4JCLA 2E7FA 2IPGA 2WZMA 3CQIA 3LCHA 2FHFA 4Q33A 4AEOA 4S1FA 4CQDA 4GVGA 1TZZA 2ATSA 5HMSA 5EBUA 1P0BA 5HNRA 2QAFA 3WLPA 2P8CA 1VS1A 5BMWA 3NXFA 4PB3A 9XIAA 3CK5A 5BU6A 5B7YA 1WA3A 2RDTA 3O6DA 1J11A 3DGRA 2CPUA 4JYEA 5AYXA 3TROA 4BK9A 1H1ZA 3QLDA 4QLLA 1AQHA 1OD8A 1QCWA 4YU1A 2VQUA 5HA7A 4FOKA 5LNWA 3NVDA 4WJ8A 3DDMA 4AC1X 2AQOA 3S5NA 1QI5A 2YA0A 2PZ0A 4NVTA 8TIMA 1FH9A 3LEPA 3LGDA 5D33A 1QOQA 4E3TA 3BMWA 4FPSA 3ZJ8A 1V6XA 3W7IA 3IJ7A 4N9EA 2WZIA 4JR5A 4KRUA 1BGGA 3LENA 3EOLA 3OLGA 4DJFD 3PULA 1XDLA 4DN1A 1E6SM 4IPPA 3CB3A 5KZ6A 5EFDA 1ME9A 5KEZA 4JX5A 2VL4A 3G1DA 4ZTXA 3W28A 2FZDA 4RZ5A 1GVOA 1IT8A 5DRCA 3AIUA 3EX2A 5A6MA 1FXPA 3R8GA 3WEMA 2X7VA 3B0YA 1XG4A 1X8CA 2G3NA 1OFBA 4DWSB 2VGIA 1GKRA 2YZRA 4MOZA 1TSIA 4CNSA 3GH7A 4XG1A 2XUCA 1LRTA 4S3CA 1T40A 3F4NA 3EBVA 3MUZ1 3ZO9A 4AYSA 1B9ZA 1MW0A 2ATMA 1DE6A 2E40A 3VCCA 1E9LA 4Y9OA 3N6JA 3U4FA 4DIAA 3W7KA 4RLIA 1RA0A 3L2LA 1QUMA 4TV6A 3U6WA 1X6LA 5FJIA 2IQTA 1M68A 1YDOA 1CLXA 4P7QA 1FDJA 2CBIA 3AS3A 3FV9A 3L2IA 3G1YA 4O12A 2PRHA 4GX9A 4HTYA 1UZHA 1XH1A 2DP3A 2GGJA 2W62A 5HMFA 3LNMA 4IP5A 1S3HA 4XZ9A 3R8RA 4IGHA 3WQ8A 1FHVA 2GDQA 2OLAA 2G4FA 2E6AA 4FR1A 2B4GA 1JCNA 1OC5A 3HPZA 1FWGC 3N04A 3QW4B 1FP9A 4IQEA 5HUPA 1DE5A 2A4AA 1TV3A 3J7HA 2PLCA 4M0XA 5A8PA 4NY2A 1KQYA 1BRLA 5TIMA 3M0ZA 2F2HA 3HPFA 2XFRA 1JVNA 2YLAA 1NJJA 2BP1A 3OGSA 3TA9A 1TMHA 1KR1A 4NJGA 4FX6M 3RR4A 3DHUA 3G0SA 3HPAA 3M4HA 1CDGA 4GIAA 3GDBA 5JVLA 4HU8A 3AO0A 3L0GA 1BF2A 3WCZA 1RPXA 1Q6RA 3OGRA 1QTWA 4UTJA 4PTWA 4JICA 3VD5A 5BMXA 1U5VA 1GVRA 2BGNE 1NDVA 3SDOA 3CH0A 1G4SA 1RVKA 1MEWA 2IKIA 1A5KC 2CC0A 1EYWA 3NQFA 4TVDA 2PAJA 4IGMA 1AD4A 4GZJA 2C13A 3BUVA 4GIRA 1QJWA 3G1AA 1XGEA 1TRIA 1EC9A 4WQ6A 5I24A 2XVLA 1ZY9A 3GU9A 1HO4A 4DELA 4ZE5A 4O10A 3MUXA 1K3UA 4R5EA 1H7PA 3IVUA 4FSAA 1IZKA 1QHZA 4RPPA 5CPTA 3ZVHA 4PMXA 1JUKA 1JCTA 1U1JA 1QXLA 2OX1A 2NVCA 5MF5A 1B3YA 4MLJA 3ZLFA 1ZHAA 3SIMA 3ARVA 1A5OC 3JRKA 4RR4A 3PNZA 1Z6KA 4WLCA 5DO8A 1VD6A 2AAAA 3SCRA 4A22A 3SECA 3JW7A 1VBRA 4NZ1A 1WDDA 1SZRA 2V67A 3GC2A 5E0FA 1E4MM 1XX1A 1FWSA 3FNDA 5AHFA 3U5YA 3WDIA 1QPOA 4NAFB 1JPDX 1MQRA 3QC0A 3WKZA 3W84A 4EWJA 1UKPA 2IXUA 3HBLA 2B31A 3QYQA 3QPEA 3BMVA 1HJXA 4UTKA 7REQB 1F07A 1Q7ZA 2ZWYA 3FHAA 3MVTA 2INFA 2AL2B 4LC8A 1ZB5A 1XRFA 2VNCA 2VFIA 1QW7A 1ONWA 1T96A 2H9AA 3VKDA 4A8IA 3GNDA 4M5PA 5DY3A 3RILA 3WG6A 2QJIA 2VHLA 4M6VA 4C65A 3UESA 2HQAA 4YTSA 3TMQA 1CW2A 2JIWA 2ZZ6A 1W1B1 3DCPA 3C5QA 2G0WA 3H12A 1E6XM 3W1QA 4IPLA 5CAKA 1YKWA 3C2FA 3V18A 3BLEA 3ITVA 1OM0A 2A79A 4E4UA 2PWGA 2WKGA 1H51A 4O16A 1BYDA 2ANUA 2IW0A 4YPJA 1ZNNA 1JCXA 3G3MA 4DAIA 1KV8A 3OHIA 4PUEA 1XLLA 4KIRA 3NTYA 2OELA 2BTMA 1A53A 1XKJA 2NX3A 2PODA 4KGLA 5EU9A 3VKAA 1F6PA 3P60A 3WQWA 1CLKA 3I3BA 2FIQA 3UWQA 2DSZA 1UA7A 4AZ7A 2PP3A 2WKJA 5I00A 4XZNX 2E28A 4UR7A 1F4AA 4GY0A 4QEHA 3K1GA 5JXQA 3UCQA 1EDQA 4ML4A 3NSMA 2WAGA 1EX5A 1J5TA 4XAGA 4JKMA 3UT0A 2QR6A 5EFFA 2WC7A 3FGCA 4UR8A 1WAUA 3QFEA 4PL2A 4LY4A 4XBKA 5E5CA 4LUJA 2DV0A 3QM3A 1PSCA 5LA0A 4EF9A 1V79A 4QQ3A 3HF3A 2CEQA 3WN6A 3RK8A 2BOEX 3VDGA 1K7FA 4H8VA 4I8DA 4AHQA 4DYJA 3MB9A 1P6BA 1ZLPA 1R47A 1XYFA 2ONEA 3HQOA 1MXDA 2ZVRA 5CJ5A 3WF3A 3PBMA 1LL7A 3C4UA 5IDZA 3N2BA 4R7JA 4UNKA 3NM1A 4XUYA 4ALDA 4QBXA 3AIWA 2HK1A 2OODA 1IIGA 4J35A 1YE6A 2PLJA 4QDPA 5BXSA 4MM1A 1AL8A 5D8ZA 3JU2A 2XWEA 1XKYA 2HJPA 4F9DA 2ZVIA 1SW3A 3AMCA 3KWXA 1XJBA 4YWSA 3KFTA 3I65A 1XHGA 3PUGA 2ZZ2A 3E0FA 2PDFA 3NEVA 2VX4A 1ZBVA 2V8ZA 1Y5XA 1QI3A 2YDAA 3NEHA 3THQA 4DUWA 2FYMA 1KXQA 1PJ9A 2Z4GA 3GBEA 3BL3A 4CU8A 4H2HA 4X60A 4ZL1A 3P0XA 4LVBA 5E6ZA 2XH7A 2J7GA 1VIWA 5CZKA 2X42A 5HINA 1RAKA 1UH3A 4WGHA 2WCSA 2ZXAA 4C5YA 4MDOA 1HX0A 3ALGA 1T0OA 4L4LA 4B2DD 3SAZA 1GVQA 1FHUA 5HXMA 3UR7A 5HUOA 3L0KA 4DPPA 3GFYA 1G6CA 3EKZA 3W82A 5PTDA 4BQ2A 2V5DA 1E6ZA 1KRMA 3KS6A 5FACA 1JCLA 4JY9A 2D2OA 1MFVA 4H3DA 2CFFA 2XH0A 1VFUA 3CZJA 5K7JA 3ZMRA 1FTXA 3UWUA 1CLVA 4PH6A 4RNJA 4L9ZA 1KA9F 3K4WA 1EGMA 1NAL1 2VM8A 1KTCA 1X38A 4YCOA 3BW4A 4IX0A 4IPJA 3ZVIA 1VJSA 1OGSA 2ICSA 1OX4A 1OB0A 4QISA 2XIQA 3WD0A 1J93A 3F5KA 3DI0A 3JVAA 4XSLA 1F3WA 1H41A 3NQAA 3P3BA 4XZHA 2EPMX 2IKGA 3E3HA 1VAHA 1DWAM 3VD3A 3WO8A 1G7VA 4RE2A 4MY8A 3OBKA 2OLSA 3BW2A 2I1OA 1FFRA 5GPRA 4EAYA 4KIEA 5HOSA 2J9XA 2G96A 4ZQNA 5AYZA 1CGXA 5H1WA 5A6SA 1RSCA 1DJZA 1VHCA 1VBHA 2YDSA 5IDIA 5I3FA 1NY1A 3AHXA 1C29A 2DQXA 4XKYB 3N2TA 2DDXA 4QJ4B 1WXZA 1IT7A 2EHHA 1T99A 5TQLA 3S1WA 3WH6A 2YLLA 3CH9A 4PTMA 2VTFA 3BSHA 1TG7A 4KW2A 3W1RA 2X40A 1YLVA 3WLNA 3RG6A 4KH2A 1HNYA 3OLEA 2PDJA 3SO7A 1ZSXA 4UTIA 1W9VA 1XSJA 1UKTA 6CGTA 5CPLA 2PWVA 3HURA 3MSDA 3PAOA 3QV8A 3T2PA 1HL8A 2C3ZA 3AZSA 1DJNA 1YDNA 5M2FX 4I9TA 4M24A 1J0JA 2QPSA 3E49A 3FDGA 3USZA 1EP3A 3O1NA 2D0FA 1VEPA 1OYCA 1VHNA 2ZA3A 3VKCA 1IZCA 4GA8A 1R38A 1J9YA 2E0PA 4EXBA 2CLMA 4HVXA 2IKJA 1ISWA 3OG2A 4HA0A 2KZHA 1UR2A 4B92A 3O0FA 3L23A 4NU7A 2WO5A 3GR4A 4IM4A 1GG1A 4RXFA 1JDDA 2CZDA 4XVDA 3VFCA 2HVMA 3APTA 4H6EA 4J3XA 2YYUA 5C2CA 2WQDA 3UCCA 1V02A 2FPTA 3W00A 1NIUA 3FX4A 3VYLA 1A5SA 3KRZA 5AVNA 3VE9A 3BSGA 3LV6A 3QW3A 2VEIA 4C1LA 3SQSA 2VEFA 4IOTA 4V27A 2GFTA 3KTCA 4G1KA 5FL0A 3W24A 3W53A 1RJQA 4BF7A 5IOBA 1N8WA 3C86A 1KR0A 4HT3A 1CGWA 3HGSA 1SYTA 4G1NA 4K3ZA 1J01A 4D6DA 3GTHA 3UVIA 3RAOA 2GJNA 3QGAC 4IIDA 3TR9A 5E9AA 1EEXA 4Y8FA 2PDUA 3VNDA 3G6MA 1V4YA 4R53A 3EXRA 1OCNA 2VCBA 3GH5A 1MDRA 4S3GA 1FKWA 1XW8A 1FWJC 2IPFA 1YTDA 3FA3A 5C6MA 4NXKA 1J0YA 1ITQA 2IPJA 3EWCA 3S2JA 1GZJA 1NOUA 3KVMA 4W5UA 2Z27A 1SM9A 4GXMA 1CXIA 2B7PA 2VEKA 2VVSA 4KKXA 1TMQA 5G1MA 8A3HA 3AOFA 3WMBA 5A6BA 3FSUA 2GJXA 3CZGA 1KNWA 4PGLA 3EB4A 4O1BA 4L9YA 2OOFA 3PM6A 3LV5A 3IARA 9XIMA 4LRSA 1ITXA 1JZ7A 5CLTA 2C79A 2X09A 3R1ZA 1XLEA 4O11A 2QYGA 2PGEA 3IAQA 4FX8A 3HFTA 2X1TA 4PMUA 4LF1A 1DWGM 4XO6A 5CSYA 3UVAA 4ZO8A 1UKQA 2E8ZA 2VFEA 2VXNA 4KRZA 3LHZA 5GJPA 3ZFHA 1J0HA 3LA4A 4O52A 3GW3A 4YIWA 4LS0A 4JN8A 5I3HA 3ABOA 2QCNA 1KM3A 1VBJA 4Q4KA 3A4AA 3K4AA 1GJUA 1NDYA 3HMJG 3SRDA 4UTTC 4V33A 2NQHA 3H2MA 1H63A 1P5BA 3UCDA 3B9EA 3T2QA 4NJHA 3S6OA 1XINA 2PWFA 3CUIA 1GW1A 3R6IA 2CWXA 4KMQA 4HCHA 1OFPA 3H2NA 3KVJA 4JTCA 4JTIA 2ZQ0A 3MKVA 4GFIA 1AH0A 4RL3A 2XINA 3GG0A 1WUEA 1OFQA 2GSJA 1XLFA 1VR6A 1OG6A 1QAPA 3ZSSA 1TZ7A 2QW5A 2O56A 5E6YA 1MQPA 2FKPA 4NASA 1M5WA 2F6XA 3G77A 2YA2A 3F2BA 3G18A 4RNFA 2QUNA 1HKWA 1JI1A 2PZNA 3VDHA 1A3HA 3VNYA 4JTKA 4HYRA 3ZR5A 1KM1A 1JZ4A 5FOOA 1G9HA 3UBPC 1DIKA 1S2AA 1CTNA 1K77A 3AIRA 3GBDA 4ACZA 1GHSA 1TV4A 5I78A 3AYSA 3LRLA 1P4CA 5GNXA 4BFAA 2B7NA 2XIJA 3THAA 1RALA 1NP2A 3VKKA 2ACQA 3TYBA 5JH1A 4K6AA 2DEPA 4A3HA 2J7CA 5CPQA 2Q01A 2PF8A 3C52A 1AQ0A 1XIMA 4F40A 1PYMA 4QNWA 3QSRA 1BWKA 1BXNA 1N2VA 3WZ0E 1GOXA 2V3FA 4JHOA 2EG8A 3XISA 3LB0A 2R1LA 1QI2A 4X9YA 2PI6A 2YDRA 3CLWA 1QNQA 2XZ7A 2BB0A 4H9XA 4MFEA 3W37A 3B9NA 3UNTA 1TQXA 3GZ3A 4Z2IA 4BS0A 3H7RA 5BW6A 1FHLA 2C91A 3V0UA 4ZQCA 1UP2A 3O9NA 4C6OA 3KRBA 4JTLA 2VKZG 2NUWA 1WDSA 1VYSX 3RCMA 5BRPA 4MUZA 3W72A 4PBGA 2Q8LA 4AYGA 2R6OA 1MRAA 4D6IA 1XIEA 2GQ9A 2X1SA 1V6YA 4ICNA 3GKFA 4GY1A 4LGXA 3SW6A 4GYKA 1BGAA 1UPMB 1PDYA 4XO7A 1L6WA 2XVKA 1LUCB 5F4WA 3VIPA 3NZGA 4LH8A 2EPNA 3FKKA 4HNVA 1M01A 3UYCA 2OGYA 1P1MA 4M19A 1YDVA 1IWAA 3UY8A 1JDFA 2ZUNA 3QR0A 3THUA 3O15A 1B1YA 1UD6A 3KOZA 5EPDA 5FEZA 2WHJA 2WNWA 5LA1A 4HOXA 1JYNA 1LQ0A 3PJWA 3MANA 3GDKA 3Q65A 1F76A 3ARWA 1KXVA 4J3VA 3OEXA 4H9UA 4LVDA 1VPYA 3UJRA 5JBEA 4RDZA 4FNUA 3SRKA 1K6AA 4UOQA 3I68A 1YHTA 4MZYA 1EC8A 3UG3A 1OCBA 2WNQA 1PZ1A 1XYAA 3QN3A 4WSKA 3R13A 4QG8A 4UTUA 2QCGA 4W8BA 1PB0A 2WMIA 1CCWB 3NDYA 3Q4DA 1KLYA 1L9WA 5I3DA 3UA4A 3GFXA 5IRPA 3WFAA 1X1ZA 5C9XA 1ADDA 4Y9NA 3C3NA 1IEWA 4AF0B 2H3BA 3TTSA 3E74A 1KGUA 3R0KA 3URBA 3MV11 2YXGA 3AXHA 3TSDA 4B5XA 1H49A 1B2YA 1DV7A 3SURA 1OQFA 5FSDC 2YBVA 4C6CA 1I2RA 3QBUA 3VO0A 3QV6A 3PZGA 2TODA 4D6GA 5GNZA 3PJTA 4EXQA 4JKKA 1EEPA 3AMKA 3DFQA 3W7QA 5T26A 3EB3A 1DORA 5D9OA 3E12A 1OGGA 1TE1A 3LHWA 3OA5A 4KEVA 4DBSA 3C0QA 4PCTA 3W81A 1W3TA 4BI6A 1F74A 1Y8BA 2P0IA 4L7ZA 4LAUA 3C8FA 4AZIA 5I07A 1J96A 3G2GA 4PBEA 5I77A 1DQUA 3DEQA 2BZNA 3ITGA 1TPEA 3T9PA 4S3DA 1GQJA 1OYAA 2E67A 4LX4A 5LA2A 1AJZA 1XIBA 3EEZA 1IR1A 1I75A 2E5BA 3HV8A 4HCDA 5A6JA 1UCWA 1TVNA 4NNAA 3GQYA 3VVGA 3DU0A 2Y4SA 3CHCA 2HVOA 3MBFA 2AL1A 3TONA 3DKLA 1IGWA 6A3HA 4D9PA 4NAEB 4WSJA 1MW2A 5F1VA 2X41A 3VTRA 1BD0A 3WF2A 2PDMA 4WKFA 1HGYA 5CG7A 3L4UA 4BA0A 1ICPA 1TPFA 4UTWC 3N25A 4C7FA 2B0MA 1F8IA 3EXTA 2XIOA 4WRHA 2XIBA 2F6KA 1YADA 2WLYA 1AG1O 3B8SA 1LBFA 3EWUA 5LXXA 1CT5A 2VC7A 3MQTA 1LM1A 4MWAC 3ZWTA 1CXLA 3BAIA 4ACYA 3BAJA 4PMRA 5FJTA 3TJ4A 3R12A 1W1YA 4IP4A 5I06A 1NOWA 3IUDA 4XISA 3VABA 2VGGA 1YDYA 3HJEA 4POCA 5AYBA 3CTTA 1B3OA 3NURA 4Z1DA 3WIJA 2HEJA 4DJDD 3G22A 4DO4A 5BOOA 1VGAA 1H0IA 5FEPA 3MC5A 5FESA 4TTUA 5I03A 3BLDA 2Y7EA 2J62A 1K9EA 3ARSA 2A1YA 3GDMA 4XAZA 7ENLA 4LVGA 4GQRA 4Q8VA 1M6JA 4A8NA 1BWVA 3KOFA 1DOSA 4L56A 3K2GA 1K8XA 4MNLA 4C6LA 2BMBA 1D8WA 4PCSA 2J24A 1TE6A 1SJDA 3UZWA 2XYLA 3SCOA 1A5LC 3BLIA 5C9RA 1WZAA 4FXSA 2Z1XA 2VEMA 4HYVA 6XIMA 2QUTA 1V77A 4L6DA 1YQ2A 2GGGA 2OB3A 1R6WA 3MA8A 4PCPA 4WZHA 3LM3A 2ZBTA 3UWVA 2DSUA 5CSSA 3N13A 5FEXA 4KERA 1KM0A 4DX3A 2XM2A 3T0DA 3VIIA 1K7EA 1RUSA 1KC7A 2VFGA 1ML1A 1V6UA 2VR4A 4G6CA 3BJTA 1EX1A 3QQ1A 2VOMA 1JUBA 3LRKA 2QNEA 1GVEA 2PWDA 3IVTA 1JD9A 3L4TA 4N6EA 3NXLA 4ICMA 4GH3A 1D2KA 3N19B 2FMNA 4C6BA 3ARRA 1WXYA 1Q6CA 4H7VA 2Z1BA 1NELA 1ICQA 1OC6A 2YOCA 4DYKA 1HVXA 3PFMA 3G8EA 1ZJAA 2QMJA 1R3VA 1FCBA 2W67A 1EFZA 2ZADA 3MSGA 1RCXB 5CZJA 4N9BA 5U4NA 2OT0A 1FBAA 1A5CA 2GWGA 1KM2A 2I5GA 3B8VA 4MYXA 5CZSA 6REQB 3L65A 2FDSA 4OQVA 4OWGA 3PPCA 1LL6A 1SJCA 2QJMA 2VP8A 1I2PA 3GUWA 3DFNA 1Q6FA 1UW9A 3AICA 3SZ8A 5AZ1A 1EHAA 4G7EB 3TYEA 1L6GA 5J8LA 1W9BM 5LSMA 2PBGA 1VCGA 2H6RA 4M7SA 2FHCA 4XZBA 3WF0A 2ASHA 3F2CA 3WJWA 2W92A 4Z08A 3CL7A 3WSUA 3VGBA 5GQBA 1G4PA 1YX1A 2CLKA 4AZCB 1EJTC 1QI4A 3RLVA 4N4PA 2ZTKA 5DANA 2AAMA 4EVZA 4DWSA 4IFOA 5LXEA 1Q2RA 5HNTA 4ZSUA 3CASA 4FMVA 5A8MA 5DT5A 1E15A 1V0MA 5HAOA 3TWBA 3FIGA 3E0IA 1NFGA 4Q8TA 3IPWA 4QX4A 3EPMA 3P8IA 5C54A 2ON3A 3CZKA 4K7VA 3T2OA 3CQHA 1OWQA 1LORA 1CGVA 2OO6A 3GTFA 4AY8A 3MUY1 5G1YA 2Q09A 3TMLA 1K70A 3ZS4A 2AKZA 4ECLA 2Z29A 3A5VA 3FXYA 1D8CA 1JQVA 5LNVA 1IWPA 3F7JA 4ZSTA 3UEQA 4IWWA 1V51A 2J13A 3L2MA 1DYSA 3W7HA 3W23A 4JAWA 3W7OA 3TFCA 4H7CA 3O7UA 1OIFA 1U22A 5AHMA 4B15A 1KFCA 2GVYA 4Z0SA 1P6WA 3PZUA 5H2ZA 3EAUA 4LNCA 3TCEA 3I7QA 3VGFA 3MHGA 5I3JA 2H3DA 1F3TA 3O06A 2WHKA 4H9VA 2ZKMX 2ISVA 4N02A 4GJJA 3ZLHA 2XTKA 4BWLC 4OT7A 3C0JA 2Y1HA 3IWPA 3RYSA 3WLIA 2PTYA 1FWDC 4E2DA 3VD7A 5ABTA 1U83A 4ZQPA 4B5VA 3N29A 4FOJA 4JTHA 3KTSA 1E3ZA 3BWWA 3UPMA 2OU4A 3SEPA 3VIKA 4B16A 2J66A 4OTKA 5CXPA 1MXGA 3ANYA 2Y7DA 3CPGA 4MTVA 4AU0A 5LGZA 1WAWA 2JBMA 4EPDC 4O4VA 4DXVA 4JIPA 2DT0A 4C6KA 3T4CA 8XIMA 5LIXX 1GVYA 2X2GA 2ZIDA 1PTDA 4O8RA 3QLLA 3W02A 2Y0FA 4O28A 4XTDA 5CJMA 2HBVA 3II1A 3UXLA 2FVLA 3QVQA 4B9YA 1GJWA 3GXDA 2EG6A 2NUYA 3H2CA 3ARXA 4XD5A 1ZTVA 3S2NA 3P84A 3SQMA 3CXOA 2CWNA 2ZTJA 4A8LA 4Z1CA 4HA3A 1GPFA 4K37A 3U7VA 4OVXA 4ZFCA 2TSYA 4LCRA 2J7HA 4BQ4A 4BCEA 3KZSA 1EF2A 1X7FA 5C9UA 3C0LA 3M5VA 4GWEA 3GE7A 2DUXA 1MW3A 2Z1SA 4P7RA 1W3HA 3W74A 4O18A 1R7AA 4NAFA 4B5SA 5DBTA 2PDYA 4RV3A 3BW3A 1NFPA 3NO3A 1CBGA 2BXZA 2O4MA 1MWOA 3B8WA 3LCXA 1WDRA 3GG8A 4LAZA 1XIJA 4M56A 1SUXA 4A3RA 3POCA 1NARA 4J28A 7REQA 2Y88A 4GBUA 5AC7A 2HE5A 2QULA 1OK6A 3UWZA 4YHGA 3F5JA 2AL2A 2J74A 5LNUA 2CZ5A 1GOMA 3QJAA 3OVRA 3VC6A 3VI2A 1ODZA 4MVAA 1UMYA 3G3DA 4JTSA 1JCMP 1ZBWA 3PZNA 3BCFA 2GJLA 3CT2A 2DSWA 5FA5A 3SUTA 4IJRA 1DQWA 2WSQA 3RRAA 4LBUA 4UTLA 1BYCA 4DM1A 1W1IE 3F4DA 1QWGA 3LLFA 4P7LA 3EDJA 3IK4A 1HFBA 1SFTA 2PTXA 1E72M 4HGXA 3NO1A 4JHZA 4WR3A 4DI9A 3CYVA 3LGGA 2Z1KA 1WKYA 3DAQA 4HPXA 2Q3OA 4PA8A 2VWTA 2A7RA 5HMDA 4PTVA 3UWWA 3GG1A 2O55A 4CD6A 1JFXA 4V28A 3S8HA 1E4IA 2G8ZA 1AH3A 2XIIA 3E9AA 1VCFA 2RFGA 3AZRA 2Z2AA 3NQCA 1MI3A 3CPUA 5G2HA 5DCDA 3BAXA 3IJ6A 1Q6LA 4UMCA 4WD0A 4JTUA 2VC9A 3WUFA 3SB0A 4NL1A 3MMDA 3QZEA 2VT0A 3SY5A 1EQCA 1D9EA 4JQ1A 4U33A 3H8AA 4REQB 4UFHA 4WOQA 4G7FA 3R0UA 3GTIA 5E0CA 1YPFA 3GXMA 5TF0A 2NQJA 3WX7A 1IE7C 2VFFA 4ZOEA 2CNCA 4PMNA 4L61A 1D7KA 1HKMA 1QO2A 2O0TA 1JPHA 3FHQA 3KBVA 3U0HA 2AMXA 2BSLA 1LLOA 2ZZ5A 1TX0A 3N2XA 2FFCA 4GGHA 4UOJA 3KHDA 1EYEA 4ES4A 3MMWA 1TPDA 2J7BA 4IZGA 2VD9A 5D9NA 3Q67A 1ZJBA 4D6FA 3OW1A 4PRWA 3QH2A 2ACSA 4IGNA 3N18A 2NQZA 4AZBA 4LANA 5FL1A 3W1PA 1PX3A 1AUSL 1HN1A 4KS0A 4RK8A 3WNLA 4ZGYA 3CIWA 4HSOA 3KL3A 5F1UA 2WLZA 1PVNA 4W7VA 4NZFA 4K39A 2WMKA 4U2YA 1OX5A 4FO4A 3MP5A 5M3WA 1S1RA 3SUVA 3C61A 1KRBC 4IF2A 1GQNA 3AIBA 4JIEA 1NSJA 1FX6A 4EXAA 2P1FA 4RDVA 3SCPA 3GNNA 3KBJA 4LALA 2O9RA 2TPSA 2FZBA 3FJ6A 4NUWA 5HNUA 1G67A 1H5VA 2ADAA 1EGZA 3O8AA 1CXKA 3V75A 1PAMA 2EKGA 5D4YA 4I6VA 3IJ8A 4LYKA 2IKHA 2EBNA 1YYAA 3WBXA 4DJEA 4C60A 2W79A 2QHAA 2VZVA 2O4QA 2HWGA 1UC5A 2VEPA 2TMDA 3GNRA 3WD4A 1D7FA 3APGA 2SFPA 3GHRA 4I90A 4AHOA 6PTDA 4X9SA 1UUMA 1S2WA 4O15A 1GOKA 2ZFAA 3E0LA 3BJSA 3L9CA 5BZAA 4QJ1A 3L12A 3VNMA 3TKFA 5EMYA 1RLDA 4WDTA 4HHLA 4O1AA 1UR1A 2HVNA 4L1WA 4JKLA 3UJFA 1FDYA 4GABA 1TWIA 3P5ZA 1Z7AA 1DPMA 4OFCA 3BE7A 1TWZA 4NIRA 5F2GA 4NNBA 4Y96A 4YN5A 4GFSA 3VUSA 1JI2A 3TYUA 5EYWA 3S6TA 4N7QA 1PKNA 2X0HA 4HN8A 3CL6A 3QC3A 3VUPA 1Z69A 3Q2DA 4KCWA 5CZ0A 2O7SA 4FK9A 3OVPA 4TVUA 3TSMA 3DZ1A 1P7TB 4B5WA 3STEA 2REQA 3G0XA 3G5EA 2R1KA 4RPQA 2GZXA 3EA1A 1ODUA 3OOQA 4NX0A 4C6IA 4B3ZA 4GCXA 3VE7A 3WDPP 5BYWA 3SY8A 1C93A 3T4WA 3R43A 4EAMA 5C7VA 3O07A 4GACA 1YMYA 3VGHA 2P53A 4GX8A 1GYLA 4XKYA 3TVAA 1XIIA 4C6PA 1FH8A 2XVGA 1OFOA 1PZ3A 3W25A 4AIOA 4DBEA 5FSEC 1XBVA 1ADOA 2F6UA 1MVYA 3AC0A 4MKSA 4DEFA 4IT1A 3AJXA 4Y2WA 4Z2GA 2V5CA 3B03A 3OIHA 4CLMA 3UZXA 3TU9A 5EMMA 1W5PA 2A7PA 3FVDA 2ACRA 1KCLA 2PB1A 4QLJA 3ITXA 3R7MA 1O94A 5I3IA 5HWNA 3I7SA 1Y5VA 4WJXA 4DZHA 1VEOA 3SR7A 2ABBA 3OZYA 1V3KA 4ZODA 3ORWA 1EBHA 3WQDA 4PUJA 2YCIX 1S5NA 3VGDA 2WNZA 2QUVA 1R7OA 4U3AA 2OMAA 1V6TA 4L65A 4JTRA 3M0IA 4GYFA 3CWHA 2CIPA 3NPUA 4JXCA 2NLIA 3BGGA 2HXUA 3AS2A 4EE9A 1PKLA 4IP7A 1AA1B 4UOZA 1NP0A 4ZO7A 5K9DA 1JGIA 4PMYA 4Q22A 1BYAA 3D3FA 3UXAA 2BFGA 3WMCA 5B80A 3D6NA 1FH7A 2GGIA 5IFTA 4IIEA 2XGZA 4IUGA 5H8UA 3AI0A 3QXBA 3AS1A 1JCYA 3VOJA 1B57A 4Q3MA 4I6KA 1XYMA 4QDWA 3GC4A 5I02A 3U8GA 4J2PA 1AMYA 5A8QA 2DU2A 3FYYA 3AXIA 1R2RA 3IIXA 3H22A 3EX6A 1EHNA 1A3XA 3HJZA 3M0LA 1UQYA 1F6YA 4DYEA 5FIPA 1Q4WA 3SBFA 4QGCA 3UXKA 3WMLA 3W1NA 1S5VA 2TYSA 4H00A 4H01A 1F8MA 4GO9A 4XWUA 1A5UA 2D3NA 1XS2A 1LYXA 1ECQA 1RCOB 3ZM8A 4ZZ9A 3W73A 1U1UA 3VNKA 1PHQA 1RJRA 2CBJA 1DJIA 4O53A 1WB0A 4ONVA 4PRTA 1KBKA 1L8NA 2AQWA 4S2CA 4U4MA 3SI9A 4Z1YA 4H2CA 4X3ZA 2VCAA 4URIA 2OO0A 3VIOA 3L4XA 4TXEA 4FS9A 2ZDSA 5GNYA 4EP8C 1NQKA 3FDKA 3HQPA 2VOTA 5AKQA 3CGTA 1XLAA 1WBJA 2OYLA 3WYZA 1W0MA 3USBA 3PC0A 1VFOA 3KHJA 4JNYA 2Y5EA 3JZUA 4DM2A 3S9YA 4O0QA 2D0GA 2YB1A 3TYZA 4IGSA 4PTDA 4HA1A 3UP8A 1F2JA 3GM8A 1ISVA 1I45A 2GUYA 3N6QA 3RHGA 2E6DA 2YL5A 3P62A 1DHKA 5DT7A 1OCQA 3B4UA 4JN6A 3W7JA 1J5SA 2R24A 1A5NC 1LLWA 1GTHA 1CXFA 4ADUA 2GDVA 1M9HA 2ZX6A 1BXBA 1GEQA 3EPOA 4Y9MA 4FF7A 2V68A 4MAVA 2BVWA 1X7IA 1K8CA 1S1PA 3BOLA 1NH6A 3NPWA 3UU0A 3UWYA 1ZP3A 3ANUA 3BC9A 2YSWA 2ZZ3A 1XGDA 4AEFA 2DORA 2ZRXA 2ZE0A 1OSEA 2NLYA 4ROPA 1LDCA 1BXCA 1E4LA 1V0NA 3AFBA 3QOMA 5BOFA 3H55A 2GQ3A 4U5KA 1ME7A 3B3DA 4HSHA 3W6YA 4J7RA 1TA3B 4GISA 1W9XA 4NZ4A 3SUSA 2Q71A 1FFQA 3H2FA 4JHMA 5FF0A 3HM7A 4LW7A 2Q6ZA 2OKOA 2VRJA 1V93A 2V5BA 3VIGA 3O3RA 5FJRA 1PTAA 5CC6A 1DIOA 3W1AA 4PUNA 2VRKA 3K1DA 1DIEA 1MQQA 3RIKA 1OYBA 1EZWA 5CPMA 5KMYA 3RO6A 3MUAA 1W3JA 2OG9A 1O5QA 3W0KA 3MO4A 2C7FA 3O2LA 1RV8A 2F84A 4H6RA 4Q8WA 4XZLX 4WF7A 4GCAA 5KZMA 2OXNA 2QIWA 3AMGA 4YNGA 1FWIC 4FEZA 3E38A 3CZLA 1JJKA 2P3ZA 1SO6A 3V35A 7ODCA 4NZJA 2NW0A 2FJKA 3UD6A 3FSTA 2CYGA 1JZ8A 1QU4A 4ZQRA 3E96A 3LHVA 4UC5A 4O54A 1EGVA 4CKQA 4YVPA 3N4FA 1DKWA 2I7GA 3NQVA 2R1PA 1GHRA 4M1RA 2FH6A 3MJYA 2DFAA 2J8GA 5ECUA 2FLIA 2Q8XA 2NWSA 3ME3A 3DYOA 4I9MA 4J40A 2VO5A 1ZP4A 3GHTA 2DZVA 1IEXA 2QMKA 4AWUA 1NDWA 1UWIA 1C8YA 2W3ZA 2WJDA 1NF7A 2CLPA 4W86A 1DTNA 4R9XA 4GMEA 2CLIA 3AMLA 1GZGA 3W2JA 5A2AA 3IAPA 4RNHA 3S6DA 1ZGDA 3LS9A 4FNPA 4IICA 2G3FA 3BV4A 1PL9A 4JTEA 1V6WA 2NUXA 1V0LA 2W0UA 4R33A 4HTBA 3LXCA 3TYAA 3TLLA 3VIJA 3MYPA 2EQDA 1CEOA 2W6RA 3ABQA 4US6A 4O1DA 4W8AA 4V2XA 1DBTA 4QS6A 3NA8A 2JF7A 4LFYA 3DXIA 4H9TA 4Z17A 1GYNA 2VDGA 4UQ9A 1Q6EA 4XD3A 5EMLA 1FCVA 5I7GA 4U5IA 3CAVA 2PU0A 3P93A 3WBWA 4K8GA 2GSEA 1LUCA 2OSWA 4F9JA 3B06A 1B31A 4I5UA 5F7UA 3RR1A 1CYGA 4J1OA 2WJEA 4BKNA 3QKZA 5DXYA 4GXWA 4TX6A 3CV7A 3FVMA 3W1UA 2PDGA 3WK2A 2H8ZA 1XPGA 1XIHA 3WJXA 1V3IA 2A3AA 3LX9A 3DFPA 4FR6A 4NNCA 3QHNA 4Q6JA 1FA2A 3GLCA 3QR3A 2FB2A 3R11A 2Z0IA 4AAJA 1SZNA 3C2VA 4O17A 3PN8A 4LQ1A 3N14A 4GYPA 2QCCA 1WZMA 3ECQA 4ZOCA 1QI0A 1TUXA 1HGWA 5IHSA 4U31A 4I8YA 3OTRA 3TR2A 4BI5A 1LROA 1Z9AA 3PZTA 4LS1A 3AJ7A 4ZFMA 4TUFA 3DGBA 4BF9A 1TWWA 2Z6JA 4F79A 1MUMA 1SR9A 2QCEA 4UNIA 5FCZA 1SGJA 4IJBA 2X2YA 4F2UA 4PUMA 5DFAA 4AF0A 3M0MA 3L4ZA 1OIMA 3NQEA 2OZ0A 3NVTA 4AC7C 1LG2A 1UD4A 1UWQA 2RGLA 3AXKA 4S3BA 1HJWA 4MY9A 1TUFA 1HQTA 2QGHA 4CN6A 3B0XA 1OK4A 2VZSA 5D2VA 4BHYA 3CHEA 5LHEA 3PZVA 3BICA 3PS7A 3LPOA 1EKOA 1I8JA 4JL2A 1TREA 3UYIA 2DGAA 3WFLA 4GNVA 2G5WA 4GG9A 1H1NA 1NU5A 3E0VA 5I3KA 3VFLA 3ABRA 3CU2A 3PJUA 1ISYA 4Q8MA 3UZYA 3ES7A 3SADA 1L2UA 1GCYA 2D2HA 1IEQA 1QBAA 5A8NA 3VXGA 4D71A 4NZ3A 3DI1A 3SN4A 1AQMA 1IGSA 3ARTA 3PAJA 1XLGA 1C91A 1SVDA 4E0CA 1UWUA 1SO4A 3C3UA 3KUMA 1UKSA 4P7OA 3FJNA 4LOCA 2ZRUA 3RMEA 2V3GA 1JFHA 2YL8A 4J3WA 1RBOB 3WQ4A 1RCQA 1W9PA 4QP0A 3EX3A 4A6GA 2ZX8A 3N73A 1BSLA 2C1IA 2BY1A 2HXTA 1IV8A 4K1WA 1JZ5A 3GVWA 3YPIA 3QTPA 1UIOA 4YLWA 2D3LA 5CKSA 4CVWA 3RJYA 4IPIA 3KAOA 4NAEA 4EPBC 1VFSA 3A6OA 1QOPA 1PV8A 4YYCA 3AISA 4U3CA 1KKRA 3GDTA 3S47A 4FXJA 1RH9A 3UXIA 3A3XA 3UERA 3F4VA 4L5ZA 5MKGB 3W2NA 3M9YA 2X16A 2CZEA 2V2HA 3GAYA 4MFDA