2QCCA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase, apo form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
256
structure length
247
Chain Sequence
ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'- phosphate decarboxylase (OMPdecase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 247
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qccA00
3KVLA 4A2RA 4I7UA 6ALDA 4FIRA 3E0IA 1W54A 3ANYA 4OQVA 3IEBA 4PH6A 3OVQA 2G97A 2Y7EA 5AB3A 3LHYA 3G0UA 7TIMA 2Z2UA 8TIMA 3WJXA 2RDWA 2QR6A 2ZZ7A 4LUJA 4K38A 5AHIA 1GTEA 3GXTA 3NM1A 1GVFA 4JTFA 1B3OA 4NQ1A 3HG4A 3S5YA 3MP3A 5LHEA 3IIOA 4O17A 1SU5A 1A5AA 4YLWA 5BMWA 1JUBA 2JKEA 4XQ6A 3BO9A 5DY3A 4MJZA 2TYSA 4N4QA 1P1XA 2E6DA 4LC8A 1OFBA 2OCZA 5I3GA 2FFCA 3B4UA 3IIZA 5AOUA 3W7NA 1TPH1 1OX4A 1R46A 4N4PA 4RLIA 1H50A 4Y90A 3AJXA 5U4NA 3ATZA 3ZR4A 2ZRXA 4O12A 4LT9A 3N9RA 3TSDA 2EAWA 4UUIA 3UYCA 1R30A 1FWWA 2A7RA 3LX9A 3LHUA 3NDOA 1OF8A 3LCWA 4UTJA 4JTIA 3P7YA 1NEYA 1TQJA 2QKFA 4N6FA 3W2KA 3W85A 3DFSA 1SO3A 5D37A 1TPEA 3PSWA 4JTSA 4HNUA 3MP5A 3W1PA 2ZZ3A 4O28A 1VLIA 1G4EA 2ZZ1A 1HUVA 1Q45A 4J9JA 4UFKA 3W3OA 3NA8A 2NV1A 3HGSA 3FFSA 1YXYA 1A5CA 3HOJA 1LTDA 5LZLA 3M5XA 3W2UA 1L6WA 3B04A 3LRMA 3L65A 4K8EA 3UZJA 5L9FA 1J4EA 1KTCA 3BV4A 4UFIA 3LHWA 4K7YA 4X22A 1VHCA 1V7YA 2Q8ZA 3LB0A 1K3UA 4LTSA 4RXGA 1FCQA 1OX4B 5CGQA 4XWUA 1TPDA 4K39A 1B9BA 1IIGA 1NAL1 1RR2A 3GLCA 2C16A 2A7PA 2V5LA 3M5YA 2ZDRA 3NQMA 3WK1A 3PVFA 2B7OA 3R12A 5DXXA 2A4AA 3EXRA 1HL2A 1I4NA 2F7FA 2QCEA 1I2OA 4NXKA 4JTUA 4OHQA 3DZ1A 3W2LA 3UXAA 1D9EA 2DU2A 2IQTA 3EWWA 1BKSA 2JGYA 3DAQA 3TR2A 4IX2A 2F84A 2C6QA 3R8RA 4KFPA 3NQ8A 2E1DA 2EF9A 3NQ7A 2VFFA 3N2MA 4HT3A 1QR7A 5F2GA 2WJZA 3R13A 1M5WA 1XCFA 3UWVA 3G1VA 2B7QA 1XI3A 2CZDA 3KVJA 3ZWSA 3PB2A 3QRHA 3SGZA 3PS7A 2V9DA 3R2GA 4MZYA 4WQ6A 1PVNA 1GVOA 5CZSA 3DFPA 3P82A 1I8JA 3NG3A 3FLUA 4MUZA 2QDGA 4M6QA 3H54A 1GVRA 3D0CA 1JCYA 1F6PA 4TO8A 2ISWA 3DFOA 1RQBA 3BVJA 3JS3A 3E12A 1VC4A 3G1HA 3T78A 1W37A 2GVLA 4PFMA 5AHMA 1TQXA 1TPFA 2E68A 3EKLA 4A29A 1LYXA 5IBXC 1LBMA 4E2DA 5AYYA 3S5OA 2Y70A 3NPUA 2PURA 4Q32A 3EX1A 2BLEA 4UCGA 3TE9A 1JCMP 3M5VA 3QH2A 2X16A 2YFOA 3JRKA 1TSIA 2CLKA 5K4XA 3HIJA 1EA0A 1WBHA 1G4PA 4Y96A 3TC6A 2YCEA 3NEVA 3U2OA 1TO3A 2WO5A 3T40A 3W1NA 4JY9A 2DZWA 1TPC1 1GJPA 2Y61A 3GIYA 1NFBA 3E96A 3T4CA 3HQ1A 5DBUA 4UMBA 4MY8A 5AYXA 1KFEA 1VGAA 4K6AA 4AAJA 3EX3A 3GKFA 1KV8A 2RHGA 3LCHA 3DH7A 2E6YA 1YDNA 2A6NA 3I68A 5I3KA 3MI6A 4UTIA 4OT7A 3W7HA 2AGKA 1U83A 1JVNA 1EX5A 4ADUA 3A5FA 1H7RA 3EWYA 3TK7A 4FEZA 4UTKA 3L5LA 3SZ8A 3L0GA 3CHVA 1CI1A 4Z1BA 2PRMA 5AHEA 4Z0SA 3YPIA 1TTJA 3G22A 3L5MA 4JTJA 2BSLA 2G5WA 3EWXA 3VI2A 3LM7A 1JJKA 1YPFA 4L4MA 2BTMA 3IIXA 2WSQA 1NVMA 3SJ3A 3PBUA 1SW3A 4IX0A 3PR2A 1QO5A 1EUNA 3PSVA 4BWLC 4PC8A 4LU0A 4MFEA 3TH6A 3IIPA 3RNDA 3UPWA 3HGJA 3QZEA 1FWRA 3LRKA 5C54A 3TXVA 2PC4A 2VC6A 5K3VA 5KSWA 5FF0A 2B7NA 1E51A 3UWZA 1WV2A 2WNQA 1D3GA 5LNWA 3HGOA 3W22A 4DEFA 3I7SA 3W1LA 3M44A 3O15A 2ZZ2A 3L2IA 1ICPA 4FX6M 2Q8LA 1YTEA 2ATSA 1F76A 4N2YA 1P5BA 3KRUA 4UFLA 2KZHA 1L6SA 4JYEA 4UTWA 4UR8A 3HJZA 3R89A 5G4EA 3TIMA 5FF4A 3NNTA 4NX5A 2FPTA 1EPXA 1TTPA 3TV8A 2AQWA 1QNVA 5CSRA 3ZFHA 4PCFA 1A53A 3NOEA 1AK5A 1VYPX 4AWTA 5AC6A 3P8JA 2CWNA 2NXHA 3DGRA 5EL1A 3CU2A 3OIXA 1ZENA 4O1AA 4Z1CA 2XN2A 3LXBA 1VCVA 4O4VA 1OYBA 1PHQA 4XKYA 1G7VA 3O06A 4O4WA 1Y0EA 4NJHA 2QEZA 4DO6A 3NQGA 2CZFA 3QC3A 1KM5A 3A23A 2GQ9A 3NM3A 3OHIA 1JR1A 3LTPA 3GR8A 1A5BA 4O16A 3O6CA 2WSYA 4DPQA 3QFEA 5FESA 5C55A 5F4WA 1W5OA 3TSMA 3SW6A 3LLFA 4KFNA 4UNKA 1F7BA 3G0XA 3LCFA 3W6YA 4ORMA 3FOKA 1OX6A 3EX4A 4BI6A 4ADTA 2XN1A 3TFCA 1KFKA 2A7NA 1PHWA 4QNWA 4C1LA 4BI5A 1J2WA 4JGDA 3MUXA 1YXDA 2ZZ5A 4LRSA 4KWWA 2ZZ4A 2J9XA 1EWEA 4ZQCA 5I3IA 3CM4A 3O6YX 1BWKA 2P0OA 3L67A 3RLUA 1K03A 2GJNA 3TMQA 3DU0A 1SFLA 1WOAA 4FNRA 2FB2A 1LBLA 4R34A 3NO5A 1LZOA 2X1UA 2PRLA 2FDSA 4DF1A 3UNDA 3CIWA 1A5SA 4M7SA 3OA3A 1KBJA 1XUZA 1W56A 4JDBA 3GDLA 5E0KA 3GZ3A 2OT0A 3C3NA 5D03A 5K9XA 3BK0A 3KOFA 3MBFA 2CLEA 3W83A 3UWYA 4MPQA 2QCLA 3GYEA 3LCGA 4BR1A 2G96A 1OG0A 1OYAA 2CFFA 1DL3A 3W7QA 4WXYA 3C6CA 4HPXA 1AG1O 3W2NA 4YXGA 3GXPA 3I6RA 1YYAA 1TYGA 1ME9A 3LERA 3SSJA 3WJYA 1OFEA 2ZQ0A 5DELA 5HJLA 4YL2A 2ALDA 2OX1A 3EEGA 2J88A 3MMTA 3NVTA 1EP2A 2NX9A 2NZLA 4I7WA 4UFJA 2Q3RA 2FJKA 4A3UA 4H6KA 4A22A 2ZA3A 1ZY9A 3GR7A 4JX4A 4O10A 4LW7A 4UIOA 3B06A 3THAA 4QJ1A 3ZS4A 2VFIA 3IIVA 3GDMA 4AWSA 1RQEA 3P80A 4JTTA 1K8YA 3QQ0A 4FNQA 4ICNA 2X1TA 3QYQA 4LY8A 2YW4A 3M9YA 5K7JA 1JCJA 3JR2A 4AH7A 3RLVA 1LM1A 5D30A 1N8FA 4UXDA 2A21A 4ZQOA 1GTHA 1ML1A 1BTMA 3PBYA 2YZRA 4GFSA 4EF9A 4OBTA 2WPBA 2FIQA 1W1ZA 3EKZA 4WOZA 4QSHA 5G5IA 2C1HA 3CTLA 2BXVA 3DENA 1TPVA 2Y6ZA 1OVDA 5DCBA 3KVKA 1HTIA 4M19A 1GPWA 2BX7A 3NPXA 1W3IA 3M0ZA 4MIMA 5F1VA 1SO4A 4RV8A 3INPA 4YMZA 3W7PA 1XFBA 4GJ1A 4RCXA 2HS6A 1M6JA 4QIUA 4MOZA 1YDVA 3FYOA 4IPJA 3W1RA 3M7WA 2QUUA 3L66A 4BF9A 1KFBA 3HG2A 2B7PA 1K02A 1ZFJA 2OZ0A 2TPSA 3NQDA 3STCA 5AN7A 1PCKA 2GQAA 3KVMA 5I3JA 3SIZA 1AMKA 3LXAA 3B0UX 4FO4A 3SECA 4QAIA 1F6KA 5D33A 3W87A 3CB8A 5HQEA 4NZJA 2A0NA 3UQNA 3W2JA 4B5NA 3C8FA 4HNNA 2VFEA 3L68A 3LHVA 4HSNA 4IMDA 3C2OA 5CZTA 3QMSA 5F2IA 3CPRA 4X3ZA 3IGSA 3UWQA 4UTTA 1RV8A 2CZEA 5K9CA 3W7EA 3DKLA 3RK8A 1ZHAA 1YLVA 3M5ZA 1TTQA 4Z08A 1KM2A 1K8ZA 1KTNA 1MEHA 4PL1A 3BGJA 4XTDA 5CG7A 4NXSA 5U7SA 2R8WA 4FF7A 3MI2A 1MZHA 1THFD 4GUFA 5G1TA 2ABBA 1P4CA 2QDHA 2E6AA 5F2MA 3OG3A 2DJXA 5L6UA 4PA8A 1LROA 3PUEA 4MYAA 3P81A 3Q94A 3CEPA 1LDCA 3W07A 4CLMA 5HR7A 2X1SA 3QW4B 4KWVA 3EB2A 2CLIA 3GDKA 4K7VA 3LBMA 5A5WA 3TKFA 1LRNA 3UPBA 1RZMA 1FBAA 5KZMA 3KXQA 4Z0JA 2ZA2A 3GKAA 3N2XA 4C1KA 4FXSA 1JUKA 5HWMA 5CPLA 5CSSA 2Y63A 3NL5A 5FEZA 3S0CA 1FWTA 2EHHA 3G3MA 3DFQA 3NR0A 3W88A 3WK3A 3I65A 3L0NA 4K36A 4Y8FA 1H1ZA 3LV5A 3MYPA 4M5PA 3W1AA 1KFLA 1LRQA 4N9BA 3MI3A 3LDVA 5K2ZA 4GUGA 2JK2A 4FNUA 4HN4A 2E5BA 3G24A 2Y88A 2ZRVA 4LV4A 1L2UA 3IGUA 2FQIA 5D2TA 4Z1AA 4AHPA 4O8RA 3HMJG 1TTIA 1R2RA 1ICSA 5J5DA 2ZFAA 5C6MA 3K30A 5EA9A 5LGXA 4OGZA 4IQLA 3TW6A 4E2BA 3W1TA 3LHTA 3L9CA 1W8SA 2HTMA 1SZGA 3I7RA 3HG5A 4XBSA 2RFGA 1TRDA 1YTDA 2HS8A 5KMYA 1YPIA 1N55A 3C2EA 1UCWA 4ADSA 3W7DA 4K8HA 3TA6A 1AW1A 1I2QA 2I14A 4GUJA 2VFGA 4WXZA 1HFBA 3MBDA 1FDJA 1XC4A 5CZJA 1FQ0A 2ISVA 1PL9A 1K7FA 1QO2A 4JEQA 1TB3A 4RX0A 3MP4A 1SUXA 4MZ1A 1SW7A 4P61A 1N7KA 5KZDA 2X2GA 5DCEA 3QSTA 4OE7A 2ZZ6A 1VYSX 5G2HA 3V75A 4UNLA 1YXCA 3IVSA 4O19A 1JCNA 3LI0A 2QCDA 3Q2DA 5TQLA 1TPB1 3BARA 4XZ9A 3Q37A 3EWBX 4NVTA 4ML9A 4OV9A 4PTNA 4FB7A 4FIQA 3M43A 3BLIA 1AW5A 2C19A 2H8ZA 3TJXA 3W7RA 4IWWA 4POCA 4FXRA 2CLMA 1XBYA 4JX5A 3DHDA 4FHAA 1M7PA 1WYIA 1MXSA 3EWZA 1H51A 1Q6RA 1WDWA 1H5YA 2Z6JA 1K7XA 4RXFA 2X30A 3STFA 3M6YA 4AVFA 2V82A 5BNKA 1F2JA 2QCFA 3HF3A 1R47A 4NUWA 3GDRA 1V5XA 5HNRA 3NQ6A 1GVQA 5D2VA 5GVJA 3TX9A 2TSYA 2VEMA 5G2WA 3QMTA 2D73A 2NWRA 3STEA 5D2YA 1HO1A 3S5ZA 5LHFA 4MKNA 1WXJA 4JNMA 1VRDA 2QCGA 3MJYA 5LNUA 3MO7A 1GYNA 2QCDB 2DZXA 2BZNA 2CLFA 1X1ZA 4IXHA 4LC6A 5BOOA 2ZA1A 3W71A 1LLZA 2R91A 5DBTA 4ORIA 4M7TA 3VE9A 1KV5A 4E0CA 1ZNNA 2CZ5A 3LGEA 4M6PA 3W7GA 3S1WA 2C14A 1WA3A 4M6VA 4TMBA 4OWGA 5AHFA 1SPQA 3PUOA 3TNOA 3P5YA 1IIHA 1BEUA 1YTKA 4DBDA 4LWWA 2A2IA 3W7CA 2W79A 1UBSA 4AXKA 1FDZA 2H90A 3NQ2A 4JYFA 4DF2A 1C29A 3WK2A 1O4UA 1G7UA 3IVUA 4XBKA 1ONRA 4O14A 4CCCA 4YCPA 4N9EA 2QCCA 2O7SA 2VFDA 3B03A 1S5TA 1W3TA 1KFCA 4GUHA 3S1XA 4DO4A 1S5VA 3LV6A 3STGA 1KTBA 4KKXA 2YFNA 5DY2A 3M47A 4GNJA 3MHFA 3UY8A 2V30A 3NZ1A 2DJLA 3NGJA 3G1SA 3P5ZA 4CNOA 5FF2A 2O7QA 3BG3A 1KLYA 1QWGA 3P8IA 4IPIA 2R14A 4AB4A 3PB0A 1R2SA 1GZGA 4UFMA 3PF3A 3QQ1A 1EEPA 2WOQA 3VNDA 2FLIA 2H3BA 2WNNA 1F5ZA 1OABA 3T44A 5TBOA 3OBKA 1O5KA 3KHJA 1HG3A 3H53A 1EB3A 1JULA 4BK9A 2OJPA 2YX0A 4LS1A 1OJXA 4LVGA 1K8XA 2HSAA 5C2XA 3FJ6A 3L5AA 3IV3A 2J27A 1KM4A 4DXVA 4AMAA 3FS2A 3B05A 3LCLA 3UWUA 3U8GA 5ABTA 1MEWA 4JICA 1KFJA 2PRHA 3PC0A 3U6WA 4IMGA 1QDSA 3O1NA 2VENA 3W75A 4RZ6A 3MW7A 1NF0A 3P60A 1SQ7A 3THQA 3HPXA 2WV8A 3A5VA 3Q58A 5AYZA 4IUOA 2E5CA 3TC7A 2DP3A 3QW3A 3DFTA 5KINA 4GC4A 2FPYA 3F03K 5D02A 3ZWTA 1KBIA 2RDUA 2V5BA 4UFHA 2C13A 5EBUA 4RZ5A 1QPRA 5MHBA 1QPNA 2W0UA 4CCDA 1XXXA 1VCFA 5F4XA 1PCWA 3TROA 3GX9A 5HMSA 3E9AA 5I3FA 3T55A 4NU7A 2CW6A 1AL7A 1FXPA 3UXDA 4EWND 3W7JA 1UJPA 4TX9A 4Z1DA 4G1KA 3M1ZA 4AHOA 4LV9A 3NQVA 3GNDA 1RPXA 2QF7A 3N19B 3QPZA 3G1AA 5HR6A 2ZRWA 3KFTA 1XM3A 1KM6A 1VHNA 1KA9F 3CQ0A 5D2XA 2JKPA 4ZQNA 2FB3A 3A21A 5D05A 3ABSA 1S5WA 1DV7A 5SWUA 3VCRA 4LOCA 1ZCOA 3LHZA 2Y89A 1HO4A 3TQ0A 2YW3A 3S8HA 2YYUA 3E49A 1B4KA 2VKZG 1S3HA 3E02A 4JIQA 1LOSA 3R5EA 1OYCA 3KRSA 5A8GA 1TMHA 3TQVA 3NL6A 4MY9A 2YSWA 2CLOA 1G69A 4X9SA 5BW6A 2NLIA 4CNNA 1ICQA 1Z41A 4WY0A 3P62A 4Q33A 5EY5A 5FEPA 1GVSA 4ZL1A 2H6RA 4UMAA 4GE8A 3KX6A 5DN1A 1XDLA 1TV5A 5C5YA 2DZUA 4N6EA 1DKWA 4O52A 4LS2A 1SFJA 4O1BA 3SGUA 2A85A 3G8EA 3TCEA 1T8XA 2R94A 5DLCA 2Y62A 4HSOA 3SY5A 1F05A 4NJKA 2J9YA 2ZRYA 3W84A 4DELA 1ME7A 2DZTA 4O1CA 5LNRA 5TIMA 4ZQPA 2YYTA 1FXQA 2GOUA 3A24A 4QNEA 4O11A 4CCEA 2B0MA 5D09A 2H3DA 4MLJA 3PG9A 2E09A 4JIPA 2QCMA 3G1DA 5LKYA 3TUUA 3QEZA 3USBA 5KZEA 1TJPA 5HULA 4YWIA 3NPVA 4RR4A 5K9DA 2LLEA 4KFOA 4ONVA 3QMRA 3G8RA 4UTWC 4XTIA 1H7OA 4EVZA 1I2RA 2TMDA 3G1YA 4WY0B 3VKJA 3BLFA 4UMCA 3GAKA 4N9CA 1LRTA 4FNTA 3P67A 3O05A 1UUOA 2A5HA 4IXXA 1U5JA 3IRDA 3O6DA 1KM0A 2NV2A 2FTPA 2I9EA 1I2NA 3GK0A 1GOXA 1LBFA 1NF7A 5FF3A 3P84A 4MZ8A 4FNSA 4ZQRA 1VR6A 1VYRA 4XUGA 3TAOA 4JX6A 3CT7A 4JS3A 3QF0A 4ALDA 1A50A 3AO0A 3TAKA 2Z0IA 4ZMGA 2GUUA 3P61A 2B4GA 2Y7FA 3S42A 2VFHA 3L0KA 3TDFA 3N73A 1JQXA 1XL9A 5IBXA 4NNAA 3O16A 4WX2A 2VOMA 1RQHA 3QJAA 3NYZA 3RMJA 2NUXA 4LNYA 2JBMA 1LOLA 3W7IA 4NX0A 3SI9A 3EX6A 2GVJA 3HO8A 4OU1A 5KTLA 1T96A 3MHGA 1SO6A 1KW1A 1FCVA 2C3ZA 3W7OA 1OFAA 3M41A 1JRCA 3PULA 4Y9AA 1BWLA 1H7XA 1G4SA 1XBXA 2RH9A 5D2WA 5D32A 1XKYA 3FJLA 1GEQA 4EOUA 1P0KA 3G18A 4BFAA 3EXTA 1DHPA 1SSGA 3C2FA 2WQPA 3NQCA 1ZAJA 2WKJA 2ATMA 4GWEA 1SZFA 4NJIA 5CKSA 4NNCA 4L4LA 4X2RA 3B8DA 4ZZ9A 4HNTA 1O60A 5HINA 2Y7DA 4WJEA 3WJZA 4DBEA 3GVGA 1GG0A 4U4MA 5EMUA 4N9DA 3OVPA 4WOQA 1TIMA 4R33A 1JQVA 3A22A 3MHUA 2NXGA 3NQAA 3DFNA 3N14A 3FA5A 1R2TA 3DBPA 4DQWA 5CPMA 3TW7A 3KRZA 1L6YA 4BWLA 1TREA 1W5PA 4O15A 1O95A 4O57A 3BLEA 3TFXA 4JN6A 4D2JA 1VS1A 1VCGA 1B4EA 1OFOA 1Q6OA 2DORA 3GXNA 1YDOA 1H63A 3W2MA 1SSDA 1OFQA 3GNNA 2EPHA 2JKAA 1H61A 4LUIA 4NJGA 5CZ0A 3UZ5A 2OT1A 1AL8A 1PS9A 5BRBA 5HUOA 1LORA 3C61A 1UUMA 2V2DA 3IVTA 1F74A 3RFAA 1XBZA 4NT0A 3SFKA 4JR5A 3LCIA 5AHNA 3NAVA 5EYWA 4ZQMA 3W1XA 1FY6A 3TXZA 5I3HA 1ZALA 3PWAA 5BMXA 1IF2A 3WFAA 1OFDA 4RJEA 5LNSA 5FEWA 3W7KA 1OK6A 4JTLA 2X1RA 1J5TA 2CU0A 3W1UA 2XN0A 4WY0F 3FIGA 1W5MA 3EXSA 3SR7A 1KLZA 3QSRA 2FPVA 2NX3A 3CWOX 3OVRA 2ZTKA 3DXIA 1PIIA 1C9DA 3FYPA 4IMEA 1UASA 1DVJA 4GXMA 4N02A 1DQWA 1FX6A 4A2SA 1KM3A 4HIBA 4JDYA 1RVGA 3PAJA 4PEKA 4W9TA 3S1VA 4LVDA 5FI8A 3TQKA 1X6UA 4O13A 1FCBA 3O07A 4LS0A 4IMFA 1Z42A 1IXNA 1QMLA 3PG8A 5AHLA 5DCDA 5HWNA 3N3MA 1OFPA 3DI0A 3G1XA 2Z6IA 3DKJA 1Z48A 4R53A 2UV8G 5F4SA 1Q6QA 5E93A 4O50A 5F2LA 4TMCA 2J24A 2C18A 2W6RA 5DXYA 4K37A 2OMAA 1TRIA 3NPWA 3BG9A 3C2RA 1SW0A 1PV8A 4JXCA 3CLMA 4Y6GA 4YCOA 4UTTC 1FWSA 3B0PA 2YGYA 2QJIA 3LI1A 2ZBTA 3HPSA 1GT8A 1FUYA 3QPYA 2BWGA 4NNBA 4JTKA 3C0JA 3PM6A 4AEOA 2J6XA 3PUDA 1T99A 2TRSA 3A9IA 1AW2A 5CPOA 2E5DA 3PBVA 2AAMA 4UTLA 3TSBA 5EKYA 1ADOA 1TPWA 3BW2A 3EWUA 4O53A 1VPXA 1WQ5A 3W76A 4O0KA 3W7LA 4MJMA 4CQ9A 4JY8A 2PE4A 1LOQA 4LVAA 3LCXA 4FX7A 4WUIA 3O63A 4CQ8A 4DO5A 1H7PA 4FNPA 2HMCA 2EKCA 1FCUA 1VZWA 5G1YA 3LTSA 3LTYA 3NZRA 3T7VA 2NXIA 4AWUA 3N34A 4NZFA 1B57A 3S1UA 3NXFA 3VE7A 2Y7GA 1O5XA 3NQEA 4QITA 3W72A 2P10A 6TIMA 1W0MA 3S9YA 4RZ4A 3ABOA 2XFWA 3KAOA 3NL2A 4A21A 1DORA 4R7JA 3TJLA 1X8FA 1QAPA 1GWJA 3PY2A 4WD0A 1QPQA 2V2HA 3GB6A 2ABAA 4PL2A 5E1QA 3S6DA 1H60A 4UTMA 1M7OA 4MYXA 4TR9A 5G2IA 2GQ8A 5H91A 4EF8A 3NQFA 3C56A 2Q3OA 4LVBA 1VH7A 1EUAA 2WNZA 3W9ZA 3F4WA 1C8VA 1XUUA 1LP6A 4DF0A 1T0OA 3L21A 1W5QA 2VEPA 4NJJA 4H4IA 1MEIA 3LRLA 1CW2A 3BG5A 4HNVA 4MVAA 2GPTA 1NSJA 1ZJIA 5KITA 1WOBA 4FX8A 1TCDA 2DZVA 4CQAA 2J9ZA 1GG1A 1TJRA 1KM1A 2V0TA 2QJGA 1OK4A 2V2CA 2NUWA 1MSSA 4GRSA 1W3NA 4EIVA 3W7MA 2ZCGA 1TPUA 4I7VA 4RK8A 4WZHA 5G4WA 1Q6LA 3BW4A 2GJLA 3I7QA 3OEXA 4I9AA 1H62A 4CNPA 2Z1BA 1YADA 4H3DA 2ISSA 4O1DA 3G0SA 4QM1A 1QOQA 4E38A 3TMLA 4QISA 2I1OA 4S1FA 3PBWA 4PODA 1D3HA 3LOTA 1H7NA 5H2ZA 3W1QA 1I2PA 3W74A 2QAFA 3BGGA 1L9WA 5AC7A 4O0ZA 5IM51 3ATYA 5J5RA 1ZAIA 2VEKA 4RKAA 3WJWA 3WJSA 3C4UA 1IXPA 1FDYA 1SZEA 3W1MA 1O94A 1ALDA 4JYDA 2E77A 3M16A 2WSRA 1EWDA 2QUVA 1DOSA 4O54A 4UR7A 3BW3A 2A1YA 2RDTA 2Y85A 1WBJA 5D04C 1EIXA 2NUYA 2NWSA 3ABQA 5K4ZA 1G67A 1PE1A 2CLHA 1X1OA 2H8XA 1WX0A 1LCOA 2EGZA 1K7EA 1H7WA 1OHLA 2JGQA 3F1QA 2GVGA 3CWNA 3UD6A 4TU1A 3WK0A 4Q4KA 4AF0A 1Z44A 4S2BA 3TU9A 1CX9A 4MFDA 4BI7A 4O18A 2CLLA 3MWAA 1SR9A 3LLDA 3W23A 1IGSA 3RF9A 1OX5A 2V8ZA 1JUEA 3HGRA 1P0NA 3ELFA 1LLWA 1QCWA 4XKYB 3B0VC 1IXOA 3HB9A 1RD5A 2A6LA 4MLRA 1EP3A 1F73A 3VFLA 1GYLA 1DBTA 4MY1A 3G3DA 1Q3NA 3LBCA 4TIMA 1H1YA 1G6CA 1XDMA 4DPPA 1X7FA 4P2VA 3GDTA 3G1FA 1JCXA 4S2CA 5FEXA 5LGZA 3P74A 4JTEA 2YXGA 3CC1A 1QFEA 5F1UA 1XBVA 3LXCA 3W70A 1UB3A 4HKPA 2QAPA 2DZPA 4U28A 1QOPA 5FF7A 2PCQA 1OFRA 1JRBA 1DJQA 1TV7A 2ZTJA 3C52A 4IGHA 2YDAA 3RU6A 1JCLA 3V1PA 4UTUA 1VQTA 4AF0B 2VELA 1TV8A 5D38A 2V81A 3UWWA 3MYOA 5LNVA 3W86A 1W31A 3N9SA 1ME8A 3HBLA 1QPOA 2DZSA 3CIXA 5CPNA 1OF6A 3UY7A 5EPDA 3W73A 1VJIA 2RKXA 1SO5A 2P1FA 4LRTA 3HPZA 4LVFA 3FKRA 3F4NA 2QUTA 1VLWA 1DQXA 1FWNA 3DI1A 1IXQA 3CEUA 2ZYFA 4IJBA 4IOTA 1G4TA 5HWJA 3S5NA 4HHPA 4GBUA 1MO0A 1W5NA 2VXNA 3ABRA 2ZRZA 5AC8A 5HUPA 1GQNA 2QJHA 1DJNA 2YR1A 3IGXA 4ZVJA 1WAUA 3FKKA 3DHFA 2YPIA 2C0AA 4HPJA 2G95A 1ZAHA 3H55A 4JTGA 4JD4A 1SZNA 3HG3A 2C15A 2E6FA 2ZRUA 4AHQA 4UTHA 1I45A 2NX1A 3QM3A 3GAYA 2QCHA 4OV4A 3C2VA 5T26A 4QQ3A 3FEMA 3BPWA 3O8AA 5AFDA 2QCNA 2VEIA 1EP1A 4JTHA 3NL3A 4GUIA 4UC5A 4IMCA 5LSMA 3EX2A
chains in the Genus database with same CATH superfamily
4PTWA 3MCMA 2O4MA 2J79A 1X6NA 3OVQA 3UG3A 3G0UA 7TIMA 3GDBA 1EJUC 5I77A 2WCGA 3H4GA 5D8WA 1GTEA 2ZXAA 3GXTA 1OWQA 1N2VA 4JTFA 3OLGA 5EB8A 4S3JA 3MP3A 5CC6A 4O17A 1GK8A 5KEZA 5C7HA 5BMWA 5CGMA 4Q22A 1FWAC 2JKEA 4Q7NA 3OA5A 1XCXA 4E2VA 1J0JA 1JDDA 4QGCA 4LC8A 3RJYA 1TWDA 4ERGA 2XGBA 3IIZA 5EU9A 2PDPA 4FOKA 3UCCA 2ZRXA 3N9RA 3NWRA 3TSDA 7REQA 2OODA 3LLXA 3AS2A 3R1ZA 1OF8A 1RHCA 3LCWA 3CUGA 3GFXA 4JTIA 3P7YA 1NEYA 4HJWA 1TQJA 2UY3A 1AQFA 3DYPA 1DJGA 5D37A 3ABXA 1Q6EA 1AVAA 4QX4A 2V5KA 2HVNA 2ZZ3A 3LA4A 1VLIA 3ARUA 2ZZ1A 3BQ6A 3LNPA 5AYBA 4UFKA 4HTYA 5FJJA 2NV1A 3HGSA 4WF7A 2PWGA 3N25A 3WH6A 3FFSA 3HTWA 1A5CA 3HOJA 2GQ3A 1L6GA 3WLRA 2BP1A 1L6WA 4P8XA 3GXIA 1QI3A 4L1GA 4X2PA 5L9FA 2VD9A 3BV4A 4K7YA 1A47A 4X22A 2W62A 2Q8ZA 5JIPA 3UR8A 1OD8A 1FCQA 9XIAA 3UZZA 3TYBA 1B9BA 3BSMA 3S1GA 2CIPA 2X0YA 2DUZA 5DEZA 2ZDRA 4E6MA 3NQMA 3RCNA 2H9AB 3PVFA 3RO6A 1ZBKA 2Y5EA 4B2DA 1OEPA 4EP8C 4IQJA 4LUSB 1XH2A 3FN9A 4OHQA 4I8YA 4U5IA 5XINA 4IGSA 4DJED 2IQTA 4LAZA 4KH2A 1BKSA 3TR2A 3NTYA 2DIKA 4EAYA 2C6QA 1KWKA 4W4QA 3N2MA 1DWJM 2WJZA 3R13A 3FCPA 2B7QA 3VC5A 1XI3A 2CZDA 4XX6A 3QRHA 3SGZA 3PS7A 4HMCA 3OHMB 4WQ6A 1PVNA 5A6SA 1GVOA 2P5NA 3BSGA 3P82A 2CXEA 3NG3A 3FLUA 3QV9A 1F4AA 1CXKA 4M6QA 3H54A 4TO8A 3CZJA 2CEQA 2ISWA 3DFOA 1RQBA 4AX7A 4DWSC 1HJXA 2OKOA 3VNJA 2DV0A 4IMAA 3VOHA 3GHUA 4PFMA 1EOKA 1P7TB 2VEFA 1QT1A 2F2KA 1JCMP 2OO6A 4HA0A 1LWIA 3CZLA 2PC8A 2QDDA 3M5VA 3UXKA 2IXUA 2X16A 4IP5A 3JRKA 5K4XA 1PYFA 4W84A 1G4PA 3TC6A 1BF2A 2YCEA 4OUIA 1TO3A 1KQZA 4IZGA 2XGZA 4EE9A 2Y61A 3VYLA 1ISZA 1TWZA 3E96A 3T4CA 4PCTA 4UMBA 5AYXA 1KFEA 4L5ZA 1AH4A 4AAJA 4JN7A 3EX3A 3JZEA 3GKFA 1GGOA 5BRPA 3LCHA 1Q6GA 3DH7A 4M82A 5I0DA 3WQVA 1JYWA 5I3KA 5IDZA 4V1YA 1K70A 4FR1A 1PZ3A 4BQ5A 1JVNA 1DJWA 4AXNA 3EWYA 3TK7A 1XSIA 4KPLA 3WF1A 4UTKA 2UBPC 4HOWA 1VFTA 1KR1A 4Z1BA 1NP0A 2G37A 1ITQA 1O68A 1V02A 3LM7A 1JJKA 5CAHA 2WSQA 1VIZA 2QLYA 3PBUA 4DX3A 1SW3A 1X38A 2J8GA 3DERA 3LK6A 5T8GA 3TH6A 3RNDA 3V3WA 4EXQA 1VIWA 1FWRA 2XZ9A 3QV6A 5JIWA 1KFWA 3TXVA 1ZJHA 1ZS2A 4IF2A 2FJUB 5FF0A 2JALA 3K4AA 5LNWA 3T4WA 2OXNA 2ZZ2A 1ICPA 3VABA 3VILA 4FOJA 4M51A 3VIHA 4F0RA 1L6SA 4M8UA 2XWDA 3HMCA 4NX5A 3U4FA 2J25A 4AX6A 5IFTA 4PCFA 3AHXA 3NOEA 2XIJA 1W9DM 1VFUA 4GIAA 2CWNA 2XH7A 3CQJA 3CU2A 1W32A 3AC0A 2I5GA 1KC7A 3TC3A 1YDYA 2XINA 1VCVA 4PE8A 2GWGA 1OYBA 3H70A 4GI4A 2NQJA 1Q7MA 5LIXX 3NQGA 3KTCA 1FHLA 2OGJA 1KM5A 3A23A 2ACQA 2V5DA 3H2OA 3WNPA 2GQ9A 4GZEA 3S6TA 2ZE0A 1FTXA 1H49A 4TX8A 3QFEA 4C7GA 5FESA 1C93A 1PEZA 1W5OA 1BKHA 4UNKA 3LCFA 2XGIA 3F4DA 4LB3A 4BI6A 3E3HA 2GK1B 3TFCA 3U7VA 2GJRA 3MUXA 2QUNA 1YXDA 4LRSA 2ZDSA 4LBSA 5EMJA 3H2MA 5I3IA 4JOMA 2P0OA 1K03A 2HZGA 3EWDA 3MWCA 2V63A 4AU0A 4R34A 1H41A 3DYMA 3WN6A 3MO4A 2V69A 4DF1A 1EQCA 1A5SA 4G7FA 4YWSA 1ZSXA 1XUZA 1W56A 1A3WA 1VF8A 4J3SA 5E0KA 2OT0A 2PWHA 3MUZ1 1XLLA 3FAWA 4PFHA 1UD6A 4BR1A 1OYAA 1QI0A 1V02E 2IKGA 4WXYA 2BY3A 2CLPA 5EMLA 3W2NA 4YXGA 3I6RA 1ME9A 3LERA 1DWIM 1OFEA 3IJ7A 3GZAA 3PZIA 5DELA 1UWRA 2Z1WA 2VP8A 2AQVA 4MADA 4NSBA 3WNNA 3WQ4A 3VGDA 3EEGA 6A3HA 3MMTA 4H01A 2V6AA 4UFJA 2FJKA 4GY7A 3TOYA 4JX4A 4Q3MA 2FZMA 2D69A 2YBTA 3ZS4A 2VFIA 1RQEA 2OZ8A 3EWCA 4JTTA 2YBVA 5C2CA 3BAXA 2XH4A 3D47A 3JR2A 4AH7A 1N8FA 2A21A 3ARVA 4QE1A 3UP8A 1ML1A 3ZT5A 2YZRA 3AUOA 4FAMA 2FZBA 1W1ZA 3AAMA 4QSHA 4WR3A 5FOOA 3RDKA 1TX0A 1D8CA 1OVDA 3S2NA 2BX7A 3WDHA 4KCVA 1VEOA 1EGMA 4MIMA 2G4JA 1SO4A 1ISVA 3P93A 4GYKA 4RV8A 2VCCA 4GJ1A 2HS6A 3VD4A 1LG2A 2IUZA 3QOMA 2WMJA 4A6GA 3WSUA 4DZ5A 2TPSA 4XIAA 3OOQA 3FEQA 3KVMA 4KGLA 2GFTA 3B0UX 1FP8A 4QE5A 1ZZMA 3KWXA 4QAIA 1F6KA 3KTSA 2DT2A 1EQPA 3CB8A 4B5WA 3MUCA 3W2JA 3HZ3A 3C8FA 3L4WA 1KB3A 1SJCA 1UR3M 2JIEA 3LHVA 1R86A 4ZXOA 3D46A 4IMDA 1CGVA 3C2OA 2A3CA 4QP0A 3QMSA 5F2IA 3IGSA 1UQZA 1NWRA 2X41A 3UWQA 2FZ8A 3HQNA 3SCTA 1UR2A 3GR4A 1YLVA 2WMFA 1V79A 3UJEA 4B4FA 3MV01 3CWHA 3TTQA 3W0KA 1WUEA 4JHOA 5A8NA 3BGJA 1GONA 5CG7A 3GRIA 4F3HA 4G7EA 1Z69A 4FF7A 4UQAA 3MI2A 1MZHA 4MF4A 3LU2A 1RCOB 3WMSA 4IGMA 3SCSA 4PA8A 1YPXA 3PUEA 1R85A 1M03A 5ECVA 4CLMA 2CHNA 2X1SA 3QW4B 4K7VA 2VX5A 3TKFA 2V67A 3K8KA 3TEVA 4RV3A 3TJIA 1GZJA 3NEHA 4O0QA 3PNZA 2Y63A 4ACZA 4C91A 3BLDA 3OG2A 4L1WA 2RJHA 5M5DA 3L0NA 4K36A 2WHJA 1H1ZA 1MQPA 2OELA 1TJ0A 5A2AA 2G3MA 3MI3A 3OYXA 4GUGA 4HN4A 4F48A 2E5BA 1OB0A 3ITVA 4J7RA 1QNQA 1L2UA 1MW2A 1XFCA 3W27A 2O9RA 3T9PA 1XLGA 1U30A 1Z7AA 2FQIA 3UGRA 4AHPA 1ICSA 1RP8A 5C6MA 3SGGA 2QV5A 4O1EA 3N1AA 2J47A 3TW6A 3WF3A 3AIQA 3LHTA 3L9CA 2BVDA 2BXYA 2XVPA 1BXNA 3ITLA 1QNOA 4XBSA 3GC2A 1YPIA 4GO8A 1N55A 3C2EA 2DEPA 3FVMA 3QY7A 3T2OA 1AW1A 2WWDA 1HFBA 4L6DA 3CUFA 5CZJA 5E0CA 1W1A1 5FJPA 2VNCA 3TQPA 1HJUA 1EDGA 2ISVA 2EPMX 4KERA 1KD0A 3XINA 2YDQA 3CV1A 4RX0A 1PZ2A 4P61A 1SW7A 2XPKA 3RILA 2YKKA 3QSTA 3RGTA 3L4VA 5G2HA 1M7JA 1YXCA 2X42A 3H26A 2ACUA 4WHBA 3BARA 4XZ9A 3UG5A 4ML9A 2ZUMA 3BLIA 2C19A 5A2BA 2XJ7A 4POCA 4JX5A 2HNHA 1S2UA 3DHDA 4FHAA 1ITXA 1WYIA 3GBEA 1MXSA 5A6BA 4UBPC 1QWKA 2E67A 2ZX9A 4FPSA 4ERAA 4DYKA 2WCAA 2WZEA 3BH4A 4MUPA 3ARXA 2V82A 1XLBA 3HF3A 3B9OA 1V5XA 1V6WA 4GVHA 4IP4A 1F4HA 2EKGA 1J12A 1HO1A 4AD2A 3IUIA 3LD5A 5HNTA 1UHVA 2QCDB 2BZNA 2CLFA 2PDFA 3R8GA 2OU4A 4C6CA 2WPGA 2R91A 5DBTA 4XZIA 4A3HA 3UU0A 4H9TA 3LGEA 4M6PA 3W7GA 3S1WA 4KBXA 2INEA 2YLLA 3XISA 4OWGA 3QV8A 1EJRC 4D6DA 2A3BA 4LEQA 1TV2A 2VGBA 2A2IA 1UBSA 3UBPC 3NQ2A 4JYFA 4C90A 4DF2A 1C29A 1K9DA 2O4QA 4IFKA 1B5TA 2PP3A 1UKSA 1H1NA 2XYLA 4L64A 1V0LA 4YCPA 2VFDA 1W3TA 3WMCA 1KFCA 4GUHA 2YFNA 3M47A 2BY2A 2V30A 3NZ1A 4M80A 3F2CA 3VKBA 1B30A 3PB0A 3PF3A 1B2YA 1Q7QA 3BLPX 1GQLA 3VNDA 2EXOA 4DAFA 1F5ZA 2VURA 3GO2A 3OBKA 5TBOA 2GL5A 3OYZA 3P3BA 4YYCA 5FD0A 1XG4A 4IPPA 1OJXA 3L5AA 3IV3A 4W7WA 1KM4A 2XVLA 2EPLX 5DRCA 3B05A 3TP4A 5HQLA 2YA0A 5E9XA 1E1CB 2BXZA 2IQDA 5ABTA 5FAGA 3JVAA 4JICA 3PC0A 5C8BB 1QDSA 3MW7A 3P60A 3THQA 3HPXA 5AYZA 1QTWA 5HDRA 3TC7A 3DFTA 1JI1A 4PMYA 3M07A 2W4XA 2Z7GA 2V5BA 4AVOA 4GMEA 2C13A 4GIYA 5I02A 1BYDA 3ID7A 1PX4A 4RZ5A 1QPNA 4WGXA 3DG7A 2W0UA 1XXXA 2X7VA 3R43A 5HMSA 2WC4A 3T55A 2CW6A 1AL7A 3ZR5A 1NY1A 9RUBA 4IG2B 2CITA 4J40A 1R9ZA 2PTZA 2QF7A 3N19B 4H6QA 2ZXQA 3VKCA 4NZ4A 2D0FA 2VTFA 5LA2A 5LYRA 3AYSA 4EAMA 2ZRWA 3KFTA 2YCLB 5D2XA 1KA9F 2JKPA 3VD7A 4YPJA 3RUBL 4B5VA 5A6KA 3ABSA 3CMFA 3CL7A 3VCRA 4LOCA 1ZCOA 1NARA 3PTQA 3RITA 3AISA 4BQ4A 3PFRA 3S8HA 3E49A 2OZTA 3H12A 2VKZG 1S3HA 4JIQA 2FZNA 4C65A 1PIGA 4LCQA 2CLOA 4X9SA 3WLIA 3GYCA 5BW6A 5KZ6A 2WHKA 2WKGA 4WY0A 4Q33A 1F07A 4NKCA 4ZFCA 3KZPA 4UMAA 4D6GA 4Q8VA 3UXIA 1GYMA 5DN1A 1XG3A 1XDLA 3SJNA 1TR1A 4XD4A 5DMYA 4YN5A 4HTBA 3TCEA 1CEOA 1Z8AA 4QG9A 1EPVA 3WBYA 3EOSA 3VINA 5FJRA 3VC6A 2JE8A 1M3UA 1R0MA 2ZRYA 1EC7A 1HP5A 3N4EA 1A0EA 3IWPA 1SFSA 3WBWA 2CESA 3BUVA 1DWAM 4JPGA 4ZQPA 4QNEA 1QBBA 4CCEA 2B0MA 3PG9A 2XM2A 2E09A 4JIPA 1V6TA 3GFZA 3TUUA 3U4AA 3QEZA 5HULA 1QXLA 5K9DA 1BQGA 4Q8NA 4R88A 3AICA 1JAKA 4F2BA 1DTNA 3RLHA 3I4KA 3T2PA 4B5TA 1PWMA 1OT1A 1I2RA 3VKJA 5DFAA 4LGXA 3GAKA 1Y65A 4Q8TA 3E5BA 4FNTA 3EPNA 3O2LA 1XP3A 4AD3A 3PZQA 3O6DA 3H4WA 4HP5A 4Z17A 4UR9A 1XIBA 2NV2A 2FTPA 4PZVA 2BGNE 1I2NA 1GOXA 5CSUA 3MUAA 4EXAA 4MZ8A 3ITXA 4R85A 1VR6A 1WZLA 4XUGA 4JX6A 4H7CA 4L9YA 4GACA 4ALDA 1ONEA 1PSCA 3ALFA 2B4GA 1J6OA 1PWLA 2GLKA 2ODOA 2Y7FA 2VFHA 1R9XA 3O16A 6REQB 1RQHA 1EOMA 3CHDA 4DBWA 2NUXA 4LNYA 2WXDM 4ICCX 3EX6A 4AZBA 1Y5VA 3WLTA 3MHGA 1KW1A 4DI8A 1FCVA 3H6OA 3T8QA 3IUHA 6PTDA 3ZJ7A 3V35A 3PULA 5BU6A 1BWLA 2RDXA 4WJXA 3CNYA 2C7FA 4JFVA 1B0IA 3EBVA 2RH9A 4F2TA 1KRBC 5D32A 3WQPA 4EOUA 3RM4A 5FCZA 4D72A 4PRWA 1GEHA 2WLYA 4DWSB 1M41A 3ISIX 3C2FA 2WQPA 3NQCA 4U3AA 4DVOA 5CKSA 4NNCA 2IQ0A 3AIWA 5HINA 5J04A 3WJZA 3B9AA 2VGGA 3PAOA 1NM9A 2VR2A 2VDHA 4R33A 1JQVA 3A22A 2IKHA 2NXGA 4JTAA 3SUUA 1R2TA 4K68A 3WDQA 4E2OA 2I7GA 1ADDA 4GY0A 3BJFA 3BZGA 1Q6CA 1H2JA 1L6YA 1W5PA 3A9BA 4O57A 1N82A 1JD9A 4D2JA 5HOSA 4WDTA 3T2QA 1E0TA 1NIUA 5JQ9A 4IFOA 4MWAA 3CUHA 1I60A 2DORA 1H63A 3W2MA 3CXOA 1UQYA 1V6YA 1IZKA 2XIMA 4NJGA 5J8LA 5CGTA 5CZ0A 4QSFA 3UZ5A 1U1UA 4REQB 1NDYA 5HNNA 1LORA 3VXGA 4A3YA 3C61A 1B3XA 1F74A 5CXPA 1QASA 1J0IA 3NAVA 4ZQMA 1EGVA 4KCUA 2V5JA 2YZ5A 4ZA0A 3S3GA 1ZALA 3PWAA 3MJMA 3SUWA 2ACSA 1VAHA 1M65A 4G1NA 5LNSA 4F66A 3AHYA 3AMKA 5FEWA 2IPJA 3I10A 4HOXA 3MSDA 3ZT7A 4JTLA 2VDGA 4PB4A 2CU0A 2FVLA 2PDHA 3H7VA 3CT2A 2XN0A 4WY0F 3GTIA 2AMGA 3FIGA 4XAFA 2VQUA 4IPLA 4TVCA 3EXSA 5IHSA 1NDWA 1KLZA 2PD9A 1W1VA 4U31A 3OVRA 3DXIA 1PIIA 3TCSA 4IMEA 3DN5A 1DVJA 4GXMA 1CB2A 4N02A 1DQWA 3WDPP 4QG8A 2BBFA 1XC6A 3PAJA 1FWGC 2VEGA 2PP0A 2HDJA 5FI8A 4DNMA 1FCBA 1XF0A 3AIUA 1YIXA 1CT5A 3NXLA 4FR6A 4RL3A 1GNXA 4YNGA 1Z42A 2VL4A 1QMLA 3KOWA 3N3MA 1GUVA 1Z48A 4R53A 5F4SA 1KCLA 3NO3A 4HK6A 2W6RA 4HU3A 3TWAA 4K37A 1BSIA 3KDOA 4GNKB 3BG9A 4J2MA 4E4UA 4OUEA 3WD3A 4UTTC 3LI1A 4ASTA 4DM2A 1WKDA 3E2QA 3EEZA 4NZ3A 3PM6A 1RA5A 1JZ8A 4F0MA 1TR9A 3URNA 1ONWA 1PTDA 2ACRA 1QK2A 3TSBA 5EKYA 1TPWA 1UWUA 1KGWA 4O53A 1WQ5A 1KXVA 4C1NA 5B7ZA 1MFVA 4JY8A 2BGSA 1LOQA 4AZIA 2FMOA 4MB3A 3AIRA 2NQ9A 1QK0A 2VHLA 2ZUNA 1QHOA 5G1YA 4FA3A 3LTYA 1XWYA 3NZRA 1ENUA 1PAMA 3N18A 4NZFA 1JFXA 2GGHA 2Y7GA 1O5XA 2O9PA 5A2CA 1R7OA 1W0MA 1PDYA 3VUPA 4LUTA 4L65A 4MWAE 2PWEA 3FV9A 1VEMA 1H0IA 3TJLA 4XKMA 2V3DA 3NDYA 3BLKA 3AROA 1QPQA 3U3HA 2HK1A 2ABAA 4J28A 3N6JA 1CGWA 4UTMA 5F7UA 2AMXA 5G2IA 1V3KA 4EF8A 2FTWA 3NQFA 2Q01A 2QULA 1NOFA 1XISA 2WNZA 1BHGA 1XUUA 2HCVA 2PPGA 4DF0A 1V3MA 3L21A 3L23A 4H4IA 1MEIA 3LRLA 4HNVA 2GPTA 1NSJA 4C6JA 1JNDA 5KITA 2PS2A 1X1NA 1XD0A 1Y7VA 4GYPA 3SRKA 1TJRA 5H8UA 1KM1A 2VX4A 3RM8A 2QJGA 3BICA 2PLKA 1R9YA 1JZ5A 4U5KA 3E0WA 4GQGA 1WZKA 3LMYA 3BW4A 2VR5A 3BJTA 1E0VA 4Z1YA 2NLYA 1M01A 3URBA 3OODA 4D6JA 4WLCA 2ISSA 3GNXA 1FHVA 2I1OA 3L4YA 4XZNX 5JBDA 3ZM8A 1YRRA 3W1QA 3FK4A 2QAFA 3LNMA 1L9WA 1EJ7L 1DJZA 4GIEA 1Q65A 3BAJA 4LAMA 4FI4A 3TZFA 3W1MA 1ZGDA 4JYDA 4Q4SA 1EWDA 4U33A 3VNZA 1Q63A 3FHQA 1E55A 2A3AA 3PFMA 1WBJA 1XIEA 5D04C 2NUYA 2R82A 5I7GA 5K4ZA 1G67A 3LSCA 1PE1A 1X1OA 4HJFA 1NOWA 2XVKA 1JF5A 2X0SA 1LCOA 3CPGA 3EKGA 1OHLA 3GU1A 4LUYA 1GW1A 3CWNA 1ESWA 1BG4A 4Q4KA 4AF0A 1Z44A 1JPMA 4S2BA 4C6KA 3TU9A 3TR9A 4O18A 2CLLA 2R1MA 1JYVA 2GGJA 3MWAA 1SR9A 1W1TA 3LLDA 3SCPA 4YJ5A 3SCUA 1JCTA 1FWBC 2C71A 1UOZA 3ELFA 1IXOA 5DMLA 3I4EA 4MLRA 3TJ4A 2FHFA 1TVNA 1IR1A 3AI0A 1F73A 1KBKA 1DXEA 4LYPA 1A3XA 4MY1A 3LBCA 3W01A 1G6CA 1XDMA 4DPPA 1X7FA 4P2VA 5E9AA 2J4GA 4N7QA 3GDTA 4HZ8A 3IJ9A 5D9PA 1UROA 3TYEA 5FEXA 3CC1A 1C3FA 1QFEA 3VIFA 1OBAA 4U28A 2ZX6A 1QW8A 3BLOA 4CVWA 3GIQA 2PSNA 3V1PA 1VQTA 3QOKA 2OLAA 1TV8A 1YBQB 3MYOA 5LNVA 3HBLA 3F2DA 1JDEA 3CIXA 4BEUA 3GVQA 3H21A 2D1ZA 2RKXA 5D9NA 3HPZA 3N29A 1UJQA 4W93A 1VLWA 1DQXA 3N6HA 4YHGA 2FGLA 2L5HA 1JZ3A 1K77A 1AJZA 3AFBA 1QNPA 3I6EA 2QJNA 2FFIA 5I23A 3ABRA 1W3JA 4HZ6A 1IT8A 3N12A 1AZ2A 1CZ1A 1OC7A 3MU7A 2D0HA 2YPIA 2PMQA 4JD4A 3N6QA 3PANA 4M56A 3EOUA 4YTSA 3LPFA 2C15A 2ZRUA 4NYYA 4UTHA 4US5A 1I45A 4XZHA 3QM3A 1XIIA 4JQ4A 3FEMA 3BPWA 5AFDA 2VEIA 4JFUA 3PZVA 2PWDA 4BQ2A 4B4HA 3N2CA 1QW9A 4UC5A 5LSMA 2ZUTA 6ALDA 2C91A 3MPGA 3TW9A 4PCNA 3ANYA 2G0WA 2G97A 4DZAA 5CC5A 5AB3A 1XQKA 1E1FA 2Z2UA 4NRSA 2ZZ7A 4ZTYA 1VFHA 1GVFA 3CLWA 1B3OA 1RK6A 1S38A 1CBGA 3MKKA 4YLWA 3STPA 4H1ZA 5EFFA 4C6IA 2NVDA 2QIIA 2E9MA 3BO9A 3V0UA 4Y7EA 2EJ1A 4MJZA 4N4QA 3E0VA 2GJPA 2E6DA 2VOTA 3GU9A 3SQLA 4MSSA 3VO0A 2OCZA 3U2EA 1A80A 3BANA 1TPH1 4PUDA 4N4PA 4GYJA 1FH7A 1H50A 4ROPA 1S2WA 5U4NA 3ATZA 3AZSA 1C90A 4O12A 3UYCA 4MM1A 2QGYA 3OGVA 1FWWA 3GTFA 3LHUA 3NDOA 2XWEA 1K9TA 2QGHA 1QHPA 3VGEA 4UTJA 2H9AA 5CBJA 2EG7A 1R3YA 1D2KA 3RN6A 2X40A 3DFSA 3SCWA 3IJ6A 4HNUA 3MP5A 1EJSC 4LEFA 4GA8A 4HN8A 4G9PA 4LUSA 3ZXWA 1Q45A 2GSJA 2WMKA 3W3OA 1UD5A 3NA8A 3ARRA 1E5NA 1G94A 1YXYA 4EWJA 3WFZA 3W2UA 2CBIA 4H41A 3B04A 3LRMA 3L65A 1W1PA 3N15A 3UZJA 1UBPC 2ONEA 4LJ3A 1KTCA 1NWUA 2D24A 3LB0A 3NYDA 4B5UA 4IHCA 2QMJA 1GKRA 4AZ7A 4K39A 3SDOA 2ZX7A 1NAL1 4GX8A 3VNKA 2A7PA 2V5LA 1W91A 3C8NA 1J0ZA 5BXSA 4QDPA 1LWHA 1RBLA 4M1BA 2ZWYA 6CGTA 2VZTA 4KEMA 3WIJA 2UWFA 1HL2A 3RX4A 4NXKA 4JTUA 3GNOA 3H22A 3DZ1A 1YHTA 3MDUA 2DT1A 1P7TA 1D9EA 2DU2A 3MCOA 1UKQA 3GXDA 2F84A 3DG3A 3R8RA 4KFPA 3MB9A 3KWSA 3NQ7A 1U22A 4DI9A 4HT3A 3URAA 1XCFA 5LA1A 4XAZA 3UWVA 2WB5A 3EPMA 1P6WA 2Y8VA 3SN1A 3G1VA 3IJDA 4K3ZA 2GVEA 3ZWSA 2V9DA 4GZIA 3WLKX 1SM9A 9CGTA 3ME3A 3SURA 5I03A 1GJWA 4FF5A 2QDGA 3T08A 3M64A 4BZYA 1BSLA 3D0CA 2PB1A 1D7FA 1W6TA 1AZ1A 5CG0A 1EX1A 3JS3A 3E12A 3G1HA 3A6OA 5LIYX 3GXFA 2PTDA 2AKZA 4LYQA 2GVLA 2E68A 3ZYZA 4DJDD 3WDIA 4C6PA 2BDQA 1LYXA 1S1RA 1LBMA 3OIHA 1Q66A 3W82A 2Y70A 3VDBA 1MW1A 2PURA 3IJ8A 4F4RA 1V0NA 3K46A 4TOQA 5EMYA 5C7VA 1IHIA 4I5UA 4XO6A 2IKIA 4KGJA 2CLKA 3EA1A 4Y96A 1JGIA 4JL1A 1IV8A 1AH0A 4L6HA 2HQAA 5C9RA 4FK9A 4D9PA 1W1IE 4J27A 1KV8A 4CD4A 2E6YA 1XQLA 5LXEA 4IJCA 4EPBC 4KIEA 1YDNA 3I68A 1ZJBA 1EEXA 3WZ0E 4EPEC 2PDLA 3W7HA 4ZB2A 1HJVA 3SZ8A 1XLCA 3L0GA 3BAYA 1W8GA 3ABZA 5AHEA 2YCJA 3G22A 4JTJA 2G5WA 4JFWA 2GYIA 2E8ZA 3SJ3A 2NT1A 2F6KA 5A6MA 4IX0A 1KCXA 1QO5A 1Z3NA 3PSVA 1X7IA 4BWLC 1H0GA 4PC8A 4LU0A 4MFEA 3IIPA 3UPWA 2CZVA 3HGJA 3WF4A 3QR3A 2FVKA 2IPGA 1E51A 4KWUA 1D3GA 1J93A 3HGOA 3I7SA 4W86A 3O15A 4DWSD 4E8CA 4FX6M 1YTEA 3VGGA 3WNOA 4AISA 5HAOA 3EDFA 3W6MA 4CNUA 3HJZA 3R89A 5G4EA 2EPKX 3MSYA 4DJFA 3NNTA 2GK1A 1NH6A 4IPNB 1C92A 5BZAA 4JAWA 2AQWA 3WD2A 1VFSA 4KF1A 1UP0A 1EDTA 3VCNA 1R5YA 4AD0A 1VYPX 2C1GA 5AC6A 2VUYA 3DGRA 4Z42C 1X6LA 2VGIA 3EYPA 3B0YA 1ZENA 4O1AA 2XN2A 3VFCA 3KOXA 4N0RA 3LXBA 4JTRA 3UT0A 5I2UA 1VRXA 3BJSA 4HA3A 1PHQA 2OFJA 3L2LA 3QC3A 3PPGA 3SEPA 3TYDA 1E6XM 1S2VA 2OVLA 3GR8A 4B90A 3ANUA 4O1FA 4O16A 3BCFA 5F4WA 1SMAA 2WZMA 3LLFA 4KFNA 3W6YA 4ORMA 3FOKA 1ITUA 4ADTA 2A7NA 3BZJA 4QNWA 4PMXA 1J2WA 1YW1A 2VDIA 4JGDA 4W7VA 4NZ1A 1EWEA 4GQRA 2DSZA 3CL6A 3WEOA 3L67A 3PN8A 5FL0A 1SFLA 1LBLA 2PGRA 1XIDA 1LZOA 1K6WA 4AUBA 3OA3A 3PZNA 1A5OC 1KBJA 1OZQA 3GD6A 4WEVX 2WLZA 5D03A 4KIRA 4MPQA 3GW3A 3LPGA 2OG9A 1DL3A 4RE4A 3GTNA 5TNVA 2J8TA 1BPLB 3H8AA 3U2ZA 2WAGA 4YL2A 5CH9A 3Q67A 1OQFA 1EP2A 4A3UA 3IK4A 3KEHA 1CLVA 3GR7A 4XO7A 4O10A 4LW7A 3RJXA 4XZBA 3THAA 4AWSA 3P80A 1K8YA 4Y9OA 4A8RA 2X1TA 3KOYA 5CQ1A 2WVTA 5K7JA 3CUZA 4OFCA 5D30A 4DNHA 4UXDA 1XIMA 4JNYA 4M29A 1WB0A 4QJ4B 4BHYA 3PBYA 4OBRA 2D23A 4EF9A 4OBTA 3WQCA 3EKZA 4WOZA 3N4FA 5TAOA 3DENA 1Z9AA 5DCBA 1HTIA 4M19A 3CV7A 3C5QA 3NPXA 4PBGA 3M0JA 4HVXA 3NO1A 3INPA 4YMZA 4QIUA 2WKLA 1EHAA 4IPJA 1EJXC 3H4XA 1NFGA 3L66A 4RW3A 1IEIA 4GCAA 3I6TA 1K02A 1EBGA 2OZ0A 1M68A 1PCKA 3L4XA 5B80A 1FWFC 5I3JA 3SIZA 2E0PA 3LXAA 5CZKA 4B5SA 4FO4A 1BG9A 5HK4A 3R7MA 3SECA 4CU6A 3QYSA 2ISDA 1LT8A 1P0DA 1AMYA 4DJEC 1XS2A 1AA1B 4DYEA 1UD2A 1ONXA 2F61A 5CZTA 3ITCA 1KGXA 3ZZ1A 1XRVA 3BMVA 4CNSA 2ESCA 2CZEA 3W7EA 2R6OA 3EOLA 4FLSA 1TTQA 4XAGA 1W9XA 3CASA 4ACYA 3AXMA 5ABFB 4PUJA 1SJAA 2Z1VA 3JU2A 3AYVA 5U7SA 3UYIA 2BHZA 3T0CA 5JBEA 2R8WA 5C9WA 2TAAA 5FL1A 2PGWA 2E6AA 5LIUX 3ITTA 1IWBA 2DJXA 5L6UA 1WDSA 4MYAA 3P81A 3Q94A 3BMWA 3CEPA 4FOUA 3E2RA 4Q4OA 4IM4A 3SUTA 1UIPA 3LBMA 5A5WA 1FWCC 3WQDA 1LRNA 2QW5A 2WK2A 3UPBA 1KQYA 5KZMA 1UZHA 4IT1A 3GKAA 2ZUSA 2FVMA 5CPLA 3NL5A 5FEZA 1XLDA 2VR4A 3S0CA 1FWTA 1RSCA 2GUYA 3G3MA 5BXPA 3O3RA 3NR0A 1SJDA 3T09A 4Y8FA 4V15A 3MYPA 2HEJA 3W1AA 1KRAC 2JFEX 5FJIA 3OB8A 2JK2A 4FNUA 2WHMA 3DFYA 2VT0A 3AWNA 2ZRVA 2Q8XA 1WKFA 3IGUA 5H6HA 3R6IA 4GVIA 4KEVA 1L8PA 1E1EA 1TTIA 3APGA 3B0XA 1R2RA 1PPIA 4BKNA 3CPUA 3W00A 5LGXA 1XLIA 1PIFA 4OGZA 4IQLA 3L7RA 4E2BA 4S3GA 3RLGA 4QLJA 1XPYA 2HTMA 3GC5A 1EF3A 3HG5A 1F6YA 2HS8A 5KMYA 2CBUA 3CS2A 5DANA 3W7DA 5KETA 4K8HA 3O6AA 1XV8A 1I2QA 2I14A 3WUEA 5CC7A 5I6SA 3SRDA 1J0HA 5DMNA 1QNSA 1DIOA 1PL9A 1TB3A 1IEQA 3CMJA 1SUXA 4MZ1A 5DCEA 4AG0A 2QT3A 4H9UA 2OX4A 1F61A 4KQNA 4Y9MA 3V75A 3KP1A 3VIKA 3IVSA 3WH8A 3G2GA 2WJEA 2QCDA 3O9NA 7ODCA 1TPB1 3VCCA 2QPXA 3IV8A 3Q37A 4L9ZA 4RNFA 3QPEA 3ZQ9A 4OV9A 4PTNA 4FB7A 4FIQA 3WLHA 4I9JA 3M43A 1FKXA 4RPQA 1MUWA 3W7RA 8CGTA 4J3XA 1DJIA 3FGCB 1TVLA 4H2CA 1Q6RA 1WDWA 2PI6A 4TX6A 3RX2A 1OIMA 3WL1A 4AYSA 2QCFA 1V6UA 1OIFA 1BYAA 2BB0A 5D2VA 4CQBA 5DT7A 3THUA 3ONBA 1J01A 2TSYA 3IARA 2VEMA 5G2WA 1R3RA 2Z2BA 2D73A 2CERA 3STEA 1QW7A 2X05A 1CDGA 2QCGA 3MVTA 3U5YA 2G41A 3ORWA 4S3CA 2DT3A 4IXHA 4LYRA 2ZA1A 2Y4SA 1LLZA 2ZXBA 4TUFA 3OLDA 4ORIA 1V0MA 4GH1A 4D6CA 4JTQA 1KV5A 4PUMA 2J7FA 2C14A 3BGAA 3L4TA 3PZ9A 4M6VA 4TMBA 1SPQA 3P5YA 1BEUA 1V3JA 1V93A 4LWWA 3W7CA 2W79A 1CGTA 1UWSA 1FDZA 2H90A 3S2LA 4IL0A 1E1CA 5CBBA 3NZGA 3RPMA 1ONRA 4P5UA 4ZXLA 1A3HA 4IICA 1PX3A 2QCCA 2O7SA 1JXJA 3B03A 3GUWA 4DO4A 1S5VA 3STGA 3WNMA 4KKXA 4HNCA 3U5UA 4GNJA 4QCFA 2DJLA 1J5SA 3NGJA 5FF2A 3PWGA 3BG3A 3P8IA 4UQDA 1GZGA 2HXUA 2J7DA 3TONA 4ZSUA 4IIGA 1PZ1A 2HVOA 4LFYA 1DWHM 1QVBA 3T44A 4Y9NA 1O5KA 4XG1A 3VOFA 4LAUA 4IG2A 1JULA 1O1ZA 4LS1A 4LVGA 4LUTB 1K8XA 4Q6XA 4J3TA 7XIMA 1ZUAX 3FS2A 1XINA 2GWNA 4L1XA 2YCLA 1KFJA 2POTA 3O1NA 2VENA 3W75A 4RZ6A 3MY9A 1NF0A 1DXFA 1SQ7A 3T05A 2HE5A 2E5CA 1HJSA 1WXZA 3APTA 4CQDA 2WWCA 3SIMA 3KLKA 5KINA 3I3EA 4CD5A 4X0NA 2RDUA 2Z2AA 3WF2A 3VNIA 1TJ2A 4GXWA 1QPRA 5FJOA 4CCDA 3FJNA 3G6LA 1E0WA 5I3FA 3W81A 3UXDA 3MTWA 4G1KA 4LV9A 3ES7A 1RLCL 4H04A 1QPKA 2WJFA 3QPZA 3WQOA 5HR6A 3I3BA 5A94A 2FB3A 3WLPA 4OVXA 4CU7A 1S5WA 1DV7A 1VBJA 4TTUA 5SWUA 3BAKA 3LHZA 3S5SA 1HO4A 4GABA 4LBRA 4U2YA 3TQ0A 3C0QA 3N2OA 2YB4A 3LEPA 1LOSA 4MMWA 3R5EA 1G01A 4CN1A 1V03A 4JHZA 2PDCA 2YSWA 1G69A 1US0A 3BOXA 1R3WA 4FLOA 5AC4A 1ICQA 5FEPA 4RE2A 4ZL1A 2H6RA 4IIDA 1J9YA 2PGFA 2WHLA 2QQ6A 4O52A 3SGUA 1T8XA 2R94A 2ZVIA 4JFSA 3RU8X 1OCQA 3UVIA 3SY5A 3E2SA 1F05A 3W84A 3RCYA 2DZTA 5LNRA 1HGYA 4AZHA 4HK5A 2YYTA 1FXQA 2GOUA 3A24A 4JZ5A 4JQAA 2PZNA 4MLJA 4OJYA 2BNJA 1A5LC 2QCMA 3LENA 4MB5A 4YWIA 4RR4A 2LLEA 3N9KA 4KFOA 2PDXA 6REQA 3IJQA 3LY0A 4CD6A 2RUSA 2NSOA 3G1RA 3QMRA 4UTWC 2QPUA 3NURA 3ZSTA 1WE5A 1H7OA 3V5OA 4HYRA 4CD7A 4UMCA 3P67A 1UUOA 4IXXA 3AS3A 1U5JA 3VDCA 4LALA 1PYMA 5EGRA 4US6A 1XW8A 2I9EA 3TN6A 4QTGA 3GK0A 1Q4WA 2FZDA 2O0TA 5C71A 5A6BD 4ZQRA 2OYKA 1VYRA 3KCJA 4Q7IA 4MPKA 3DEQA 2OSYA 2VUNA 3CT7A 4DWSA 4JS3A 3QVQA 3QF0A 1A50A 3AO0A 3FXGA 4AZGA 3LPPA 2GUUA 2W67A 3RAOA 3TDFA 5MKGB 3ZLHA 1JQXA 1XL9A 3W28A 3AOFA 2YCKX 4O8AA 2P8CA 2QXWA 1QNRA 3BLLA 3AXHA 2DVTA 3SI9A 3NQBA 3HO8A 1EF2A 4OU1A 5KTLA 4K8GA 2IW0A 3KUMA 2C3ZA 5D9OA 3M41A 1V0KA 1JRCA 3QXBA 4Y9AA 5T91A 1JF6A 4HSHA 4C6QA 2P0IA 1XKYA 3A64A 4UOJA 3OP2A 2G3JA 4BFAA 3H7UA 4P7QA 1P0EA 2DUXA 4H00A 1E4IA 4M81A 2YOCA 3VX0A 3B8DA 4REQA 4HNTA 1O60A 5CJMA 1WAWA 2P53A 3IJIA 3CHCA 1O12A 2FH8A 2YL6A 3P6LA 4NZ5A 5AC5A 2ADAA 4JKLA 4AW7A 1T6MA 2E1WA 1QJWA 3N14A 3FA5A 5BYWA 1CECA 3DBPA 5CPMA 2BY0A 3MZ2A 3TFXA 1VS1A 2P3EA 4DZIA 1JG9A 4NY2A 4YU1A 4GKLA 4OBSA 3DX5A 4NIRA 3GXNA 1YDOA 3IS4A 5IOBA 1E4MM 1OFQA 3B8SA 3UXLA 1H61A 4LANA 4LUIA 4HPHA 1AL8A 2DSUA 2PDIA 3GH5A 4QS5A 1CB7B 1PS9A 1JD7A 1UUMA 4A8IA 4DUOA 1M53A 5ABGA 4C60A 1XBZA 4NT0A 4JR5A 3WMBA 5G4HC 4HB7A 3TXZA 1DHKA 2HJPA 1H4PA 5BMXA 1R7AA 1IF2A 4MGGA 2VO5A 1ZU8A 1GZ1A 3PJTA 1J5TA 3BSHA 3AMDA 3WENA 4H8UA 4Z2JA 1C8QA 4NYUA 1W5MA 3SR7A 3QSRA 4LNCA 2YXOA 4ICMA 2ZTKA 1RA0A 1UWQA 1C9DA 3FYPA 3VMPA 1MXGA 1S46A 5H8MA 1FX6A 2DY3A 4A2SA 1KM3A 1RVGA 5FJTA 2Q09A 4PEKA 4E8DA 2GVYA 1X6UA 2J13A 3O07A 7PTDA 2POZA 1IXNA 2V38A 3PG8A 5AHLA 5DCDA 3KL0A 1XIJA 3DI0A 3G1XA 3WQEA 3DKJA 4E8GA 1HKIA 2Z28A 3RX3A 3KZSA 4TMCA 1KO0A 1W9VA 1PV8A 1TJ1A 3PTKA 1O5QA 3CLMA 4H9YA 1JPIA 3V0TA 1XRFA 1FWSA 3ZO9A 2DPEA 3HFTA 3QPYA 1GT8A 3GXMA 4CN6A 3PPCA 2HPIA 4BJHA 2J6XA 2TRSA 2VRKA 3PBVA 1EHNA 4UTLA 4KRZA 4YS1A 3EWUA 4CEXC 1VPXA 4PBFA 1L0PA 4GBDA 3W7LA 4EACA 4YVXA 1P1MA 4PUEA 4PN2A 4S3AA 4WUIA 4DO5A 2YXXA 4YTUA 3KCLA 2PBOA 3NFUA 3DECA 2DFAA 1YEYA 3NDZA 1CLXA 1WXYA 5E5CA 1Q2SA 1JYNA 2NXIA 2CPUA 2QHAA 3VE7A 3KBMA 4QITA 1YX1A 3UG4A 4HYVA 1QI4A 1HKJA 3URQA 1UZ4A 3ABOA 2XFWA 5IHRA 3KAOA 2ISFA 2O9OA 4ZCWA 4XD3A 1A5NC 1VP5A 3PY2A 1A0CA 4WD0A 3GB6A 2FHBA 4PL2A 2OR2A 3S6DA 1U5VA 2I5IA 3BE7A 5H91A 3WKZA 1BLIA 1AQMA 3CUXA 3WNLA 3C56A 2PF0A 2Q3OA 4FSAA 5HMDA 1VH7A 1HZYA 3F4WA 4AD4A 1GHSA 4PMNA 1LP6A 1W5QA 2VEPA 2XTKA 4MVAA 3R94A 4FX8A 1TCDA 1P43A 4KWOA 1X39A 1NJJA 2YCIX 2V0TA 2O92A 1S3TC 2V2CA 2VZOA 1WZAA 4Z2GA 1QHZA 4EIVA 1W2PA 4XD5A 4I7VA 4RK8A 2VI0A 4WZHA 5G4WA 1UKTA 3I7QA 1PDZA 2VM8A 1V51A 4CNPA 3UZYA 2Z1BA 1YADA 3QGVA 2F2HA 4QM1A 3SN0A 5HJXA 4S1FA 3LSBA 2F8QA 2XFRA 4ZENA 3ATYA 5J5RA 1XRSA 2VEKA 4RKAA 3O0KA 3C4UA 2NQZA 2PEVA 4QEHA 1FDYA 4UWMA 1SZEA 4TV6A 3E38A 4K1WA 1ALDA 2DZAA 4MTVA 2E77A 3LUTA 4N42A 3FJ4A 1QATA 4O54A 2WCSA 3BW3A 2O9TA 4LYKA 3VIPA 2Y85A 3VVGA 2JIWA 1BXBA 1RJQA 3ABQA 3BC9A 4OOZA 3PPHA 1WX0A 3E0FA 3A4JA 4KETA 2BGQA 1ODZA 3AWOA 4IQEA 2GVGA 4BCEA 3K8MA 4MNKA 3SCRA 2FDMA 3GNPA 3P14A 4BI7A 2CKSA 1AUSL 1YBQA 4CN4A 4MDPA 1IGSA 2AAAA 4H7ZA 3RF9A 1JUEA 3HGRA 5AZ0A 1HVQA 1UD3A 2EQDA 2VD8A 3E2VA 5AVNA 1LLWA 2AKMA 1RD5A 2J66A 1EP3A 3ERPA 4MWAD 2QYGA 3P0WA 5TD4A 2YLAA 1DBTA 1Q3NA 2OTDA 5A1AA 4S38A 3ITYA 1JCXA 1MFUA 4JTEA 2WM0A 5F1UA 3UWEA 3LXCA 3RRAA 4J1OA 2J62A 4L80A 3TLLA 2DZPA 8A3HA 4DAIA 2PCQA 4JEJA 2J7BA 4C6FA 1UKPA 3GG8A 4RPPA 3CO8A 3RU6A 1JCLA 1EKOA 1UPMB 3NSNA 3FXYA 3V36A 2VELA 5D38A 1B90A 1E72M 3EMZA 5M17A 4LAKA 4J3UA 5HPOA 1ME8A 5TF0A 2AOSA 5M03A 1UH3A 5EPDA 3OGSA 1CXHA 4S3EA 3VMNA 2GSHA 2ANUA 1SO5A 2P1FA 5AKQA 1C91A 3TTYA 1F3TA 3VUSA 2QUTA 2VMFA 1K9EA 4F0SA 1FWNA 2WJDA 1E70M 1H3GA 4IJBA 5HPCA 1XLHA 2VVNA 4QDMA 4ZEPA 1YE4A 4HHPA 4RDWA 1JFHA 2NVCA 2VXNA 5AC8A 1GQNA 1GOQA 1DJNA 3IGXA 4Q8OA 4ZVJA 1PX8A 3DHFA 2C0AA 3TVAA 3VAVA 4LCRA 1HP4A 3OJGA 1SZNA 3UJRA 5HJYA 1I9CB 5PTDA 1IZCA 4INFA 1GPFA 4OV4A 5LIWX 2DW6A 5T26A 4QQ3A 3IANA 3VNYA 2QCNA 1EP1A 1XGEA 3WX7A 4JTHA 3NL3A 4YIWA 2QVNA 4AEFA 3KVLA 4M1RA 3VU2A 1CCWB 4PR4A 5C9XA 5CCZA 1W54A 1K9FA 8TIMA 2QR6A 5AHIA 4AYGA 3NM1A 3WBEA 1J10A 4I3GA 3HG4A 3S5YA 5LHEA 3IIOA 1SU5A 3CHEA 1A5AA 1EC9A 3GU2A 1JUBA 2UY5A 4FZIA 1XIHA 4XQ6A 4IIFA 3SQMA 3K2GA 5DY3A 2PAJA 4D6HA 2HRWA 4Q8QA 1EZWA 5I3GA 1MXDA 1LL7A 3B4UA 1JDFA 5AOUA 4D1JA 3MMWA 4XV0A 3TOPA 1UKOA 1R46A 4RLIA 4Y90A 1BVZA 1UYQA 3RCMA 1CENA 3BCJA 2EAWA 1R30A 3LX9A 1V7AA 3LQGA 5DQPA 1S2TA 2QKFA 3W2KA 3W85A 1SO3A 3K5XA 3WFLA 1TPEA 4JTSA 1MI3A 4P8VA 1A5UA 1G4EA 1HUVA 4J9JA 1EXPA 1E0UA 2EG6A 1TZZA 2NQHA 3WLQA 1SMDA 4K8EA 1TZ9A 2Q71A 2UZ9A 4IIEA 3WEMA 4H2HA 4UFIA 3LHWA 3S2MA 1VHCA 1ZTVA 1V7YA 1K3UA 4RXGA 2X1IA 1OX4B 3QHOA 5CGQA 4DXKA 4HNOA 3IAPA 4XWUA 2CCRA 1NELA 1UR8A 1J0YA 1IIGA 3AMLA 1RR2A 1GHRA 4XSLA 2C16A 5G1MA 1WO2A 3A3HA 4LX4A 1GVIA 3GVVA 1XH0A 3HPFA 3W29A 3GUGA 1B31A 3FY1A 2B7OA 3R12A 3REQB 3ZJKA 5DXXA 4NILA 3EXRA 3W25A 2F7FA 2QCEA 1I2OA 2PF8A 3RRXA 2WANA 3UXAA 1XIGA 1A4LA 3V7PA 3PJUA 3EWWA 2JGYA 3V1HA 1IYXA 3SO7A 1ZBWA 2I17A 2VFFA 4B3KA 5H1WA 5F2GA 4XAYA 3DC8A 4X60A 1LG1A 2XIBA 5JUVA 1LQ2A 4PYSA 1FHDA 1W17A 3KVJA 3PB2A 3CQKA 4NAEB 4MB4A 3T42A 1CIUA 4K1GA 2J78A 2PDJA 3CBWA 3DFPA 3A4WA 4MUZA 4QS6A 3DESA 1GVRA 1JCYA 1F6PA 5M2FX 1C8YA 3KTXA 3F7JA 1UH2A 2A3HA 3O0FA 1XHGA 3D6NA 3QY6A 4PMZA 5AHMA 1NWTA 4A29A 5DO8A 5IBXC 4L9XA 5AYYA 1H11A 3NPUA 3K8LA 2OYMA 4Q32A 5DMMA 3WH9A 3EX1A 2BLEA 4UCGA 4CGTA 3AQUA 1R87A 1F8IA 3ZSSA 3BV7A 3DUGA 3QH2A 4DBSA 3KBSA 5FAJA 1TSIA 2FZ9A 4RUBA 4GH3A 3NEVA 1KNWA 3U2OA 2DVXA 2DZWA 1TPC1 1GJPA 1TE6A 4KT2A 4B15A 1NFBA 3HQ1A 1HF6A 1XSJA 5M3WA 4HCDA 4MY8A 2A3EA 2PBGA 3W6LA 2Y8KA 2D22A 3AALA 4V1XA 3CGTA 3UR2A 2A6NA 1J0KA 1VFFA 3S47A 3B9DA 3MI6A 4C5ZA 2VC7A 4OT7A 3HU7A 2AGKA 4NP7A 4FXJA 3CTTA 3VM7A 3A5FA 2XVGA 3HV8A 5A8MA 4FEZA 4W87A 1H09A 3CHVA 3SCNA 1CI1A 4GO9A 2PRMA 1PKYA 3YPIA 3L5MA 2BSLA 2ZOXA 3EWXA 1YPFA 2BTMA 3IIXA 1NVMA 3S9IA 1UH4A 2P88A 1T41A 4F9JA 3OLEA 1RBAA 4G56A 5C9UA 4LCSA 4A8NA 3UJSA 5C54A 4US5D 2PC4A 2VC6A 3QZ6A 5K3VA 5KSWA 3RHGA 2E9BA 1LF1A 1YKWA 5CLTA 3W22A 4DEFA 1P0BA 4EX4A 1JZ4A 3M44A 3GG1A 4FP1A 2HK0A 3ANVA 2Q8LA 1F76A 3KRUA 4UFLA 2KZHA 2REQB 4JYEA 1B3VA 4GYFA 5T9CE 1B1YA 1HL9A 3UCDA 1XD1A 1EPXA 1TTPA 2ZX5A 3KCOA 5IDIA 3TV8A 2O56A 4HU4A 1QNVA 3B8VA 1YQ2A 1B54A 2OQLA 3K1DA 3VZZA 3ZFHA 1KXQA 4D6FA 3AMCA 4AWTA 6XIAA 3P8JA 2MNRA 3KS5A 1HJWA 2HVMA 5EL1A 2Z00A 3W38A 1HKKA 1O66A 1FVPA 3PJWA 1RK5A 1ZBCA 4O4VA 4UZSA 3VMOA 4XKYA 3O06A 4O4WA 1IWAA 4NJHA 1ZCCA 2WW5A 4DO6A 2CZFA 5DRIA 3NZPA 3DG6A 4IP7A 3NM3A 1WP6A 3BAIA 5HXMA 3TSMA 3SW6A 3CV6A 3G0XA 2E4TA 1ZRQA 1OX6A 3EX4A 4GINA 1W2VA 2XN1A 4Y9PA 1GOKA 1DWGM 1XIFA 4C1LA 4BI5A 1JL8A 5GPRA 2ZZ5A 2ZZ4A 3G5EA 3KHDA 4NAFB 1PKLA 4ZQCA 3QHNA 1BF6A 3CM4A 1BWKA 4UTFA 1PB0A 3RLUA 3DDMA 3PNUA 3TMQA 1I0DA 1WOAA 4FNRA 2FB2A 3NO5A 3VIJA 2WSKA 3UZXA 1JZ7A 2FDSA 4M7SA 1LUCB 2IPWA 4HBKA 3LM3A 2BV9A 3EGJA 1WUFA 4JDBA 3GDLA 4FXFA 2AGTA 3GZ3A 3C3NA 2VQTA 4GG9A 3GG0A 1O6IA 3KOFA 3MBFA 3FSUA 2QCLA 4P7LA 3LCGA 2G96A 1OG0A 3A3WA 3ZVHB 4PCPA 1I0BA 2PGEA 4X63A 4HPXA 1AG1O 3GXPA 1MQQA 4L61A 1YYAA 3SSJA 3DHPA 2ZQ0A 5GQBA 1B3ZA 1G0CA 1FHUA 5GJMA 2Y8UA 1E3ZA 5EFDA 2ALDA 5A8OA 3SCQA 3NVTA 2DW7A 2Q3RA 1B3YA 3CYJA 4H6KA 4A22A 2ZA3A 1ZY9A 3NZQA 3TZNA 3RMEA 4UIOA 3B06A 3VNLA 4D6EA 4QJ1A 1B9ZA 4AY8A 3IIVA 2PU0A 4WCJA 4QXIA 3QQ0A 3VKKA 1XLFA 3GBDA 2YW4A 3M9YA 1JCJA 1JIBA 3RLVA 4NL1A 4DO7A 3ZJ8A 1CYGA 1GTHA 4XD6A 1XYFA 1BTMA 4W88A 4GFSA 2WPBA 3E5PA 3EA3A 4HMEA 5G5IA 2C1HA 3QQWA 2BXVA 3KVKA 1GPWA 4FS9A 3M0ZA 5F1VA 3M0YA 4MG4A 3W7PA 4JCMA 1XFBA 2PDNA 4HMDA 5HQMA 2JQXA 1YDVA 3FYOA 5ABFA 1R38A 3W1RA 2QUUA 4BF9A 3HG2A 1QRQA 4IL2A 3LG3A 2B7PA 1C9WA 1ZFJA 3WD1A 4Q8WA 1AMKA 4QLKA 3P2VA 3W87A 3LGGA 1DJYA 4NZJA 4PMRA 2A0NA 3UQNA 4PUKA 1ISYA 2WMIB 2VFEA 3EPOA 1K8CA 4HSNA 3ALGA 1TUXA 1E5JA 2P3ZA 4PMDA 4ZB0A 1E4NA 4X3ZA 4BA0A 1DE5A 1VBHA 4UTTA 4GNVA 1TZ7A 5K9CA 3HN3A 2PTYA 3DKLA 3RK8A 1ZHAA 4Z08A 3ZR6A 4DZHA 4CNTA 1KTNA 1MEHA 1Q13A 4M3PA 4XTDA 4C6MA 1QOXA 4NXSA 4KMQA 3BOLA 1UUQA 1THFD 4GUFA 2YIHA 2UY4A 5F2MA 1TCMA 1XGZA 1YNQA 1V3LA 1K1DA 1VEPA 1FWDC 4DJDC 3W07A 3GM8A 2GOKA 1FH8A 4KWVA 1WDQA 3ZOAA 3VD3A 4RE3A 3VIGA 1RZMA 4H8NA 2CHRA 3KS6A 1KKRA 2BOGX 1FBAA 5CEWA 1UP2A 1Q5MA 1YNYA 4CQCA 4MNMA 4FXSA 1PTGA 4S23A 2D3NA 2A3LA 3IAQA 5HWMA 1CGXA 1VBRA 4DJFD 2EHHA 3UETA 1GVYA 3DFQA 3DBNA 4X0VA 3W88A 3WK3A 3R0KA 5EBAA 3T8LA 4M5PA 3LV5A 5CJ5A 3GC4A 2HROA 4IUGA 4Q7BA 3VA8A 3G24A 4PMJA 2Y88A 3VD5A 2RGLA 4QDWA 4JBRA 4I6VA 3IJLA 4G5DA 1UR0A 1RUSA 2ZUWA 4O8RA 4L6OA 3EOEA 2XM1A 3MUY1 3K30A 2WVVB 1J96A 1RVKA 4B91A 4PMOA 1U1HA 1SZGA 3I7RA 4CCZA 1MMFA 5ENLA 3NVDA 4R3UA 3SUSA 3FGCA 1UC4A 1YTDA 4LSBA 4ADSA 4EANA 3TA6A 3WQFA 3QGKC 2VFGA 1FDJA 3HFYA 1U1JA 1US2A 1FQ0A 1REQB 1BAGA 1D8WA 4BQ3A 1IT7A 1WPCA 4M0XA 2YL5A 3Q4DA 3T0AA 3MP4A 4UQ9A 3TYUA 5KZDA 1N7KA 2ALRA 1G1YA 4OE7A 4A05A 1DPMA 1VYSX 3RPDA 2P76A 4UNLA 3SQSA 1XGDA 4I90A 1EYWA 4Q8MA 3LI0A 1XICA 1RH9A 1AODA 3T07A 3CZKA 3VOGA 4GX9A 4I6KA 2HWGA 3B8TA 1BQCA 3HQPA 3WO8A 4UQCA 3EWBX 4NVTA 2EPOA 2G8ZA 2HXTA 5E6ZA 4IWWA 2CLMA 1NFPA 5HNUA 3SY1A 1M7PA 1OG6A 4AVNA 1H51A 1OM0A 3V18A 1H5YA 3CQHA 3JUGA 3GTXA 2QMKA 2E9LA 4R7OA 4RXFA 2G3NA 2VC9A 1UIOA 2X30A 1NOUA 3T0BA 1F2JA 3VDGA 2WC7A 4NUWA