2QCCA

Crystal structure of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase, apo form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
256
structure length
247
Chain Sequence
ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'- phosphate decarboxylase (OMPdecase)
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 94
structure length 247
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qccA00
3W7KA 3QMTA 3GLCA 4FNTA 1MXSA 4PL1A 2V5LA 2ZRUA 1ZENA 3EXTA 1F05A 1A5CA 4CCCA 4LUIA 2V81A 4ZQPA 2DZWA 1OG0A 3N3MA 4TIMA 3BW2A 3D0CA 4N4PA 3W84A 2R8WA 1W37A 1NF0A 3TROA 1F76A 4HNNA 1JUKA 4O4WA 3QJAA 4LOCA 1AK5A 1YTDA 4CNOA 3U8GA 1SFJA 1VPXA 3DBPA 5I3GA 3CM4A 3DGRA 3G1YA 2ATSA 1L6WA 5DY2A 1GPWA 3TSBA 3EX2A 1FWNA 3WJZA 4RKAA 1WQ5A 5TIMA 4K38A 3L2IA 3L66A 3LTYA 4JYDA 3UQNA 4TMCA 5EY5A 3SIZA 3UPWA 3EKLA 1LOSA 3G1AA 1GVQA 1TPUA 1P5BA 5AN7A 4RLIA 1PS9A 1VLWA 1SO6A 4GUFA 4ICNA 4AF0B 4N2YA 3HGRA 2C18A 3PF3A 1VQTA 1K3UA 3GDMA 3EKZA 1KLZA 2KZHA 1T0OA 4HT3A 1WX0A 2CLLA 2PE4A 2YSWA 3C61A 3M5XA 2R91A 1G4EA 1KBIA 2PRLA 1ICPA 4K7YA 2ZRVA 2NWRA 1WBHA 1RPXA 3DHFA 1OYAA 5AOUA 1JCJA 3A22A 5HWNA 4M7SA 1IXPA 5CPMA 3UZJA 3I7SA 1SO5A 3LV6A 2VENA 5D2VA 3G1SA 3M44A 3P82A 4PL2A 4GWEA 1SW3A 1TTQA 3UXDA 3W75A 2V2DA 1J5TA 4AF0A 3NO5A 1TTIA 2OT0A 1K8XA 4OE7A 1TV5A 4AHPA 2J9ZA 1LOQA 4Y90A 3W7MA 2QJGA 4U4MA 4AHQA 1XBVA 2YYUA 4O15A 2WNQA 1H5YA 1RD5A 5C5YA 2J27A 3NQ2A 1D3GA 1QR7A 4FNSA 1F2JA 4NNAA 4KWWA 2Y89A 2QJIA 1H51A 3PUOA 3NNTA 2PCQA 4EF8A 4IX0A 3F1QA 2ISVA 3MHGA 4QM1A 3O6YX 3ZFHA 1VYSX 2FPYA 2XFWA 3ELFA 1KFJA 1LOLA 4JTFA 3G18A 3CTLA 5DCDA 5I3JA 1OFRA 3W1QA 2Y7DA 2DJXA 4PEKA 3T40A 3DFNA 3IIPA 3W23A 1WXJA 3B03A 3FJ6A 3G1DA 4DPPA 4IMCA 3CWNA 4AMAA 3BLEA 3W2NA 4IMEA 4M6QA 4AWSA 5CZTA 1TPFA 2NUYA 3W2LA 1QO5A 2V82A 1ZJIA 3ZS4A 5AYXA 4K36A 1LROA 3Q37A 4EOUA 3M41A 2CLOA 3DU0A 3EX1A 5BW6A 3S6DA 3TE9A 1LBLA 3R8RA 3TCEA 4O1CA 3ZR4A 4DO4A 1AMKA 2ZZ3A 1EP2A 3UWUA 4OV9A 2G96A 2V2CA 2B0MA 5F4XA 3W2KA 2P0OA 4NJJA 4A21A 1FWWA 1VHNA 1W56A 3TFXA 5I3FA 3IV3A 2F7FA 1XCFA 1TPH1 3BK0A 5AFDA 3L9CA 2A6NA 4ONVA 1YYAA 1GG1A 2IQTA 4GBUA 2RH9A 5F4SA 3P5ZA 3BV4A 4ORMA 1D3HA 3C4UA 4AAJA 3W1LA 2A0NA 3L5MA 5AHEA 2H6RA 4O1DA 2G95A 1D9EA 3B06A 2Z1BA 1SZEA 3HJZA 4LS0A 2JK2A 8TIMA 2E1DA 4BI5A 4PFMA 4DQWA 3L0KA 1KTBA 3FYPA 4N4QA 3FEMA 2OX1A 3TSDA 4UR7A 3MYPA 3G22A 4LY8A 1VZWA 4MLRA 4EF9A 3GNNA 4Z1AA 1T8XA 5AHNA 2NXHA 4IMGA 1Q6QA 1YPIA 3CHVA 3IGXA 4O0KA 1OK6A 4MKNA 2V8ZA 3ABQA 3M7WA 3HG4A 1EP1A 4UMCA 1NSJA 5LKYA 5C2XA 2GJLA 2OCZA 1LDCA 4QSHA 5F4WA 1GTEA 3BVJA 2WSRA 1VYRA 1WOBA 4BR1A 2NX1A 3OVPA 4UR8A 4EIVA 3PAJA 1YXDA 1FDJA 2E6AA 3P81A 3I7RA 5K2ZA 1CX9A 2Z0IA 2A85A 4MY9A 4XWUA 1OX5A 4IMFA 4JX5A 4LVAA 1ONRA 3GR7A 4NT0A 3ABOA 3W1UA 1BEUA 2E09A 5BRBA 1I2PA 4RX0A 1NEYA 4UTHA 5D2YA 3L65A 2F84A 1XC4A 2YPIA 4Y9AA 3W7JA 3TV8A 2A5HA 3G24A 1SPQA 1QPNA 5D33A 5DELA 1G67A 3QRHA 2W79A 3PG8A 4NXSA 2Z6IA 4E38A 3W1XA 4RZ4A 1DQWA 3E49A 2BSLA 5K4ZA 4LC6A 4QNEA 2A7RA 3NXFA 3IGUA 2QCCA 3PSVA 1KV8A 3SR7A 3C0JA 2ZTJA 4UMAA 1W31A 2RDTA 3KX6A 5HJLA 2ATMA 3NQGA 3CLMA 3P5YA 4Y96A 1ZFJA 3T78A 3OIXA 2YR1A 4X22A 1FX6A 4L4LA 2EHHA 3T44A 1S5TA 4YXGA 4O57A 2O7SA 5HQEA 4WOZA 1Z44A 4NX0A 1H60A 2ALDA 4A2SA 1NVMA 3HGOA 2DP3A 1VCFA 3GAYA 5HR6A 5IBXC 3O16A 1FDZA 5LHEA 2UV8G 5T26A 4N02A 1KM0A 3RU6A 3EX6A 4M6PA 3EB2A 4MJZA 2VEMA 1WOAA 1L2UA 4JIPA 3NQ6A 5FF0A 2R94A 3N73A 2Y7EA 1V5XA 1KM2A 3DKJA 1JUBA 1WV2A 2XN0A 1KTCA 4O4VA 2TMDA 4UFKA 1ADOA 3R13A 3FFSA 3S5ZA 3PULA 3LTPA 2Q8ZA 4IPIA 3JR2A 5KMYA 4DELA 5CPOA 3NQVA 4BK9A 4CLMA 1TO3A 1SO3A 2QF7A 3W1RA 3SW6A 1XBZA 5C55A 3A24A 3G0UA 3W7LA 5FEPA 3GXTA 3UZ5A 4XUGA 3CT7A 3MP3A 3F4NA 4A29A 1GTHA 2H3DA 4UTWC 1VRDA 5CG7A 5CPLA 3P67A 4G1KA 4O28A 4E2DA 3VFLA 4IUOA 4FB7A 1UBSA 3DZ1A 3IRDA 3W9ZA 1OFOA 1VR6A 1GEQA 3HGJA 4FNQA 2E5DA 2CLFA 4Y6GA 1Q6LA 3W7NA 3NPUA 5DBUA 3RFAA 2JKAA 4CQ8A 1FCVA 4R7JA 1JR1A 1SQ7A 1A53A 5BOOA 5DCBA 2J24A 4PODA 4HN4A 4PH6A 1EA0A 3B04A 5LNWA 1CW2A 2CLKA 2RHGA 3SECA 1FCBA 1PIIA 5G2IA 5D04C 1AL7A 2VFDA 1AW2A 3S42A 4S1FA 1TIMA 2CZ5A 2TSYA 3QFEA 4NQ1A 1OHLA 1W0MA 3HPXA 3N9SA 1UJPA 1W3TA 2NLIA 4O54A 4NJIA 4NZFA 5HNRA 3LXCA 3LDVA 3H55A 3TXZA 1PHQA 4NJKA 4M7TA 4CCEA 3LX9A 4UTIA 5CSRA 3T4CA 2XN1A 3O1NA 1GWJA 2CU0A 3EXRA 3O8AA 1P0NA 4K39A 3THAA 4FNRA 2RFGA 1KM4A 1F6PA 3GAKA 5FF2A 3S1XA 3WJSA 4UNKA 3KRZA 1DL3A 1SUXA 3NQEA 4JGDA 3FKKA 1XL9A 4YCOA 1OABA 3DENA 3E9AA 1TB3A 1UASA 4FNPA 3QW4B 1IXOA 4ZQCA 2J6XA 5H91A 3ZWTA 3GDRA 3KOFA 3N9RA 5GVJA 3LB0A 1VHCA 4QJ1A 3PVFA 1JQXA 3MP5A 1HO1A 1XXXA 4Z1BA 1QAPA 1K7EA 3DKLA 1ICQA 1JRBA 3ANYA 2GUUA 1Q3NA 4WX2A 1PV8A 4HPXA 4QNWA 4ZQMA 3IVUA 4XKYA 1EIXA 1GZGA 1L6SA 2A2IA 4I9AA 4UTMA 2DU2A 3RF9A 3NEVA 2PRHA 3LHYA 1DOSA 1JUEA 3MI6A 2AAMA 2ISSA 4P2VA 1Y0EA 4O0ZA 1IIGA 5E93A 2E6FA 5LSMA 1GOXA 3MHFA 3PSWA 4TR9A 1L6YA 2E5CA 4GXMA 2QDGA 4NUWA 1PL9A 4O12A 1K7XA 4OT7A 4WUIA 2OMAA 4K8EA 2Y70A 3W7HA 3CB8A 4HSOA 1KLYA 1W1ZA 1PCKA 3GNDA 1CI1A 3MP4A 3QH2A 3HMJG 4XTDA 4MUZA 1AL8A 2ZQ0A 4HNTA 3FJLA 5ABTA 1LBFA 3PM6A 4LVDA 3G8RA 4JYFA 3E0IA 3G0XA 3LCHA 2JGYA 3EWZA 3MO7A 1FWTA 5HULA 2Y6ZA 2HMCA 3BLIA 4ZQRA 4H6KA 4FIRA 4DEFA 1QOQA 4BWLA 3KVKA 5G1TA 1OF8A 4IXHA 3W1AA 3W70A 4FXSA 4QIUA 1KFLA 1DORA 2DJLA 3IEBA 3PR2A 1GG0A 1H7RA 2Y61A 4CNPA 3EXSA 1W5MA 4TO8A 1XBXA 1LP6A 3ABSA 2ZRXA 3FIGA 4JTSA 3WJWA 1JQVA 2CLEA 1C9DA 4XQ6A 4JTIA 3PBWA 1BWKA 2V0TA 2WNNA 4PCFA 4JTTA 5KSWA 4AWTA 3PS7A 1ZY9A 4O1AA 2C3ZA 5F2IA 1BTMA 4UMBA 3C8FA 4OGZA 2FFCA 2HSAA 1X1OA 2QCFA 4RXGA 3LXAA 2QCEA 5I3HA 4JR5A 4FF7A 2ZA2A 2CZEA 5HUOA 4D2JA 3MYOA 1B57A 4L4MA 1MEWA 4ALDA 3GVGA 2DZSA 4N9EA 5CZJA 3O63A 1VCVA 1P1XA 5FI8A 3M43A 3QQ0A 3QYQA 4FX7A 3P74A 1FBAA 2Y63A 2C16A 5D32A 1KM3A 3IIOA 1R46A 4AWUA 3QPZA 4LW7A 1ZNNA 3GDLA 4MYAA 1R2TA 4Z0SA 1OVDA 3C56A 3TQKA 3W7QA 1ZAIA 3CC1A 2BXVA 3O6CA 2NX3A 2HS6A 3BG5A 3TQ0A 4UTKA 3W71A 3IIXA 4AXKA 5EKYA 4YMZA 3ABRA 3W07A 1NAL1 1DVJA 3LHUA 3NOEA 4LU0A 1FCQA 1YXYA 2C19A 1JCNA 4E2BA 4HSNA 4UTTC 2VFHA 3P80A 2ZDRA 2GVGA 1NFBA 1TPEA 2JKPA 2ZZ7A 1FY6A 3NG3A 2B4GA 5F1UA 3LI1A 3NQ7A 1OK4A 2B7QA 1O5KA 5DBTA 5BMXA 5KITA 2Y7FA 4UFLA 3KVLA 4CCDA 1H7XA 5KZDA 2GOUA 1LBMA 1YPFA 1UCWA 2FLIA 4Q32A 4AEOA 3W7DA 2J88A 5F1VA 4UFMA 5D30A 1GQNA 2B7PA 1YDVA 2XN2A 3TKFA 4WY0B 1LLZA 3W88A 4BI7A 2D73A 1YDOA 3P8IA 3DAQA 4WY0F 2QCHA 3TAKA 1R30A 1H7PA 3LRMA 3I7QA 1WBJA 3EWWA 4AHOA 2ZA1A 2TPSA 5A5WA 4UTJA 3V75A 1A5BA 3INPA 3QSRA 3W1MA 2VC6A 3DFTA 4H3DA 1JCYA 3OEXA 1JULA 2X2GA 5CZ0A 1Z48A 4GC4A 4GNJA 5DN1A 5G4WA 3HQ1A 2WV8A 3PBVA 1TCDA 4JTJA 4N9CA 4WD0A 1X7FA 4FXRA 4LVBA 1T96A 1QNVA 4PC8A 2G5WA 1WDWA 1ME7A 3V1PA 1I45A 2NUXA 5D38A 1FWSA 3UPBA 2A4AA 3QC3A 4ZL1A 3PY2A 2Q3OA 2V2HA 4WY0A 2VFFA 2C15A 1DJQA 2C13A 2DORA 4I7VA 3S9YA 2YDAA 3W2JA 1YTKA 5F2GA 3NQFA 5G4EA 5G1YA 3CIWA 4ADSA 2QKFA 3W1TA 3W87A 2OT1A 4MFDA 4OQVA 3R5EA 3GB6A 3NAVA 3WJXA 3IIVA 2FB2A 3LM7A 3QM3A 1PHWA 1TREA 4NXKA 4HKPA 3BG9A 5E1QA 4LV9A 3C6CA 3L67A 3W7PA 3C3NA 4LC8A 5AYYA 2FIQA 1EX5A 2NXIA 2WO5A 3E12A 1I2QA 1RQEA 2EGZA 3R89A 1F73A 2A6LA 5FEXA 2NXGA 3YPIA 2WOQA 4LUJA 1KW1A 1QPOA 3NQ8A 1OF6A 4JTLA 1LCOA 2X30A 1G4SA 4NNBA 3TU9A 4C1KA 3TXVA 4QITA 4GE8A 5AC7A 3TFCA 2WPBA 3UWVA 5E0KA 4NVTA 3E96A 5AC6A 1LM1A 1H61A 2VXNA 3NL3A 1KA9F 4LVFA 3TR2A 4MOZA 1QDSA 1QOPA 3AJXA 4S2CA 3PC0A 5FF4A 1YTEA 4K8HA 1N7KA 1KM1A 1VGAA 3FA5A 4GUGA 4C1LA 4DBEA 3IVTA 2E77A 1W5NA 4RV8A 1I4NA 1KM5A 4Z08A 3WK0A 3BGGA 4N6EA 3G3DA 4Y8FA 2QJHA 1MSSA 2ZZ1A 3MWAA 3UXAA 5IM51 1F74A 3DFQA 2OZ0A 1MEIA 1ZCOA 2YFOA 2B7OA 3PUDA 1EUNA 2GVJA 4POCA 4FX8A 4WXYA 4GUIA 1LZOA 5LNSA 3TK7A 2HS8A 3QPYA 4M5PA 5D03A 1LLWA 3PG9A 1H50A 1OFPA 4LWWA 1RR2A 2EKCA 3NM1A 3R12A 2QUUA 3WJYA 1SFLA 3MI3A 1VC4A 2NZLA 1TPDA 2LLEA 3VE9A 1FXPA 5F2LA 5CGQA 3L5LA 2WKJA 3MMTA 5D09A 2YW3A 4O18A 1S5VA 4LTSA 4IGHA 1O5XA 4O50A 1FUYA 1SZGA 4IXXA 1M6JA 1TJRA 2QCNA 1QCWA 2YZRA 3GZ3A 1J4EA 1M7PA 5G5IA 4X2RA 3I6RA 4JY8A 1M5WA 3DH7A 3QMSA 1SSDA 3TAOA 1IGSA 2FQIA 2VFIA 1HFBA 1K8ZA 4UFIA 1W5OA 1G4TA 3P61A 3QMRA 3G1HA 3G1XA 5K4XA 3W76A 3S1WA 2H8ZA 3TC6A 3NQMA 4K37A 3B0UX 1OFDA 1A5SA 3T55A 1FCUA 4OV4A 3TJLA 3W83A 3CEUA 1GT8A 3TNOA 2GJNA 2ZRYA 5L9FA 2Y88A 1EEPA 4IOTA 3QQ1A 3STFA 4U28A 2EPHA 3O06A 1UB3A 2VEKA 3VI2A 3W74A 1ICSA 4EVZA 1DQXA 4AVFA 1K8YA 2I1OA 2YCEA 4X9SA 3GKAA 1HTIA 5J5DA 4O11A 3PWAA 1N8FA 1L9WA 4RJEA 4OHQA 1IXQA 1O95A 3DI1A 3NL2A 6TIMA 3LCIA 3LCWA 1G69A 5K3VA 2ABBA 3BARA 3WK3A 5FEWA 3LLDA 4ZQOA 4S2BA 4LRTA 3NPVA 5LGZA 3MW7A 1MEHA 2W6RA 1AG1O 6ALDA 1G4PA 4O8RA 5KZMA 4KWVA 1IF2A 4I7WA 3CQ0A 3O07A 3TMLA 3EEGA 4MYXA 1LRTA 5TBOA 3CIXA 3LI0A 4AH7A 1TSIA 3GR8A 4YLWA 3QW3A 5I3KA 2Y85A 4Q4KA 1TPVA 3LRLA 5LNVA 3LBCA 4QISA 4KFNA 3SGZA 3W2UA 1V7YA 4EWND 4HHPA 4JY9A 1Q6RA 2ISWA 2VEIA 5C54A 3LCXA 3QSTA 3STCA 5D37A 3RNDA 3USBA 3Q58A 1QPQA 4NU7A 1FXQA 5D05A 1ZALA 1PE1A 1YXCA 3STEA 3I65A 1SR9A 3ZWSA 1OFQA 3LERA 1W3IA 4IQLA 4E0CA 3NQCA 3SJ3A 4WQ6A 4O10A 4JDBA 3W72A 4A2RA 1YADA 1C8VA 5DXXA 3MHUA 1H1ZA 5CZSA 3W7CA 3M47A 1SW7A 3RK8A 4O14A 3SGUA 1XM3A 4MY1A 3FYOA 4UUIA 2JBMA 3S1UA 4IPJA 1KBJA 3EWYA 5LGXA 2E6DA 4PTNA 3B0PA 1TTPA 3E02A 2QCLA 3TDFA 3TIMA 1I2RA 3H53A 4CQAA 1QO2A 3PB2A 5MHBA 1HO4A 4KFOA 3LHZA 3LRKA 4ZZ9A 2ZZ4A 3A9IA 4CQ9A 1FWRA 1K03A 2H8XA 4IMDA 5FEZA 2YW4A 1B3OA 5AC8A 3W7GA 1PCWA 3RMJA 1UUOA 3C2FA 1OFBA 2YGYA 3SSJA 2QAPA 4PA8A 2AGKA 2YXGA 1WAUA 2J9XA 5HMSA 1GYLA 4MJMA 2C1HA 3GDKA 4NJHA 3KXQA 4N6FA 2NV2A 4UCGA 4HIBA 2GQAA 3G1FA 4R33A 3DFPA 3L68A 1J2WA 4DF1A 3B8DA 2R14A 5DLCA 1JRCA 1EP3A 1X1ZA 3W86A 2ZRZA 2HTMA 3S5YA 4GJ1A 3W6YA 4UXDA 4WXZA 1TJPA 3MJYA 3W2MA 5LZLA 3W7IA 2QDHA 2H90A 5CSSA 1EPXA 5J5RA 2QCGA 3KVMA 2W0UA 2FJKA 1ME9A 4IX2A 4DO6A 3OVQA 2Z2UA 3S1VA 1QPRA 4Q33A 4UIOA 1N55A 4MPQA 2PURA 2CLIA 2V5BA 5DXYA 5AHFA 4LT9A 2VELA 5HR7A 3HIJA 1XI3A 3W7OA 4UTUA 4RR4A 1TMHA 1QWGA 1QMLA 1ZAHA 2GVLA 3LBMA 3WK1A 2A1YA 1F6KA 3CEPA 1EWEA 3CWOX 5IBXA 1B4EA 4LNYA 2E5BA 2ZZ6A 5I3IA 3I68A 2DZVA 4GUJA 3LHWA 4W9TA 3M5YA 3LV5A 2X16A 5U4NA 1BKSA 1Q6OA 4MY8A 1B9BA 2EAWA 3DI0A 3HPSA 1RV8A 4LVGA 2BLEA 4JN6A 1RZMA 1XFBA 4R34A 3QF0A 5D2WA 1KFEA 1Z42A 4O52A 4BF9A 3NL6A 2QUVA 2BWGA 3KHJA 2E6YA 4DF2A 3TSMA 3N19B 3UNDA 2BX7A 1JVNA 1JCMP 2I9EA 3LCGA 1TRIA 4JX6A 1I2OA 2QCMA 4MZYA 5CKSA 4RXFA 4MVAA 3NGJA 4UTWA 4NX5A 5U7SA 1TPC1 2I14A 1OJXA 3KAOA 1MO0A 3HGSA 4KFPA 1SSGA 4FIQA 2E68A 3TUUA 5HWMA 2ZYFA 3Q94A 7TIMA 1VLIA 3THQA 2Y62A 3BPWA 1TTJA 3HB9A 4GFSA 4M19A 5CPNA 2GPTA 4JTKA 4TX9A 1XKYA 1LTDA 4Z0JA 5TQLA 2ZZ2A 3C2RA 3W85A 2A21A 3M5ZA 3KRUA 2X1TA 3LOTA 3HOJA 3NZRA 4N9BA 4ZQNA 3HPZA 3QEZA 2YYTA 1F7BA 1C29A 4JTHA 1ZAJA 4OU1A 3FOKA 3DXIA 3SFKA 3NR0A 4WZHA 3GXPA 2CLHA 1JJKA 1U5JA 3BW4A 1G7VA 2X1SA 3MI2A 2QEZA 4JYEA 4WOQA 1X8FA 5AB3A 5C6MA 1RVGA 1TYGA 5FESA 1K02A 5K9CA 1F5ZA 3G0SA 1I2NA 1TPB1 3LCLA 3S5OA 2C6QA 3S0CA 3PB0A 1H63A 2QUTA 5KINA 3W3OA 4NNCA 3U6WA 1AW5A 3L0GA 4FNUA 3SI9A 2CFFA 3MUXA 4UFHA 1B4KA 4P61A 3MBDA 5KZEA 1H62A 3UWWA 3P84A 1LYXA 2QAFA 4MZ8A 1KFCA 3UY7A 1KFBA 1OYBA 3GX9A 2NV1A 3C2VA 1I8JA 1KM6A 4TU1A 3NDOA 3VKJA 4BFAA 1O4UA 2TRSA 1OYCA 4KKXA 4ZMGA 5K7JA 4O53A 2DZUA 3W7EA 3FS2A 3NPWA 3TH6A 1W8SA 3TW6A 3NQAA 4JX4A 3N2MA 3TX9A 2VKZG 1SW0A 2Q3RA 3P62A 3G3MA 3HBLA 2VOMA 4XZ9A 3PUEA 3EX4A 1HL2A 2FDSA 2A7NA 1XDMA 3NA8A 3F03K 2NWSA 4YL2A 5A8GA 2NX9A 2ZA3A 1JCLA 3B05A 1Q45A 3N2XA 2C0AA 2FB3A 3NPXA 3G1VA 1GYNA 3Q2DA 2WNZA 4FEZA 3M6YA 2VFEA 5AHLA 1IIHA 3K30A 3LGEA 4MIMA 5EL1A 2P1FA 2C14A 2YX0A 4JIQA 2EF9A 4JD4A 5EYWA 3VE7A 3BGJA 1QFEA 1KTNA 3L0NA 1ME8A 3M16A 1EUAA 1TQJA 3M5VA 3W73A 3NL5A 4MFEA 1M7OA 1H7WA 2BZNA 5EBUA 2CW6A 4JTEA 3BO9A 3L21A 1S5WA 5LHFA 1RQHA 1GJPA 4UNLA 2PC4A 3H54A 1H7NA 3A5FA 2JKEA 1TQXA 1EB3A 4R53A 1E51A 5FF7A 3O05A 1NF7A 5K9XA 1UUMA 3L5AA 3WK2A 5D2XA 3IVSA 3FKRA 4OWGA 5EMUA 2CZFA 1OFAA 3MBFA 3ATYA 3EWUA 1XUZA 2ZBTA 3CPRA 3GXNA 3WFAA 2FTPA 3LCFA 3M1ZA 2DZXA 1W5PA 4JS3A 3T7VA 2ZRWA 2ZFAA 4JTUA 3PBUA 4XBSA 2GQ8A 1GVOA 4ZVJA 3KFTA 3P8JA 5AHIA 1SO4A 4XBKA 3STGA 2NUWA 5SWUA 1ML1A 2DZTA 5F2MA 4O17A 3OA3A 4BI6A 1FDYA 4GUHA 4JNMA 5G2WA 1G6CA 1A5AA 5EA9A 2WSYA 3B0VC 2ZZ5A 3UWZA 3NZ1A 1TV7A 1U83A 4GRSA 4UTLA 3DHDA 2J9YA 3IGSA 1O94A 4LV4A 5BMWA 1DV7A 1XDLA 3BLFA 3P7YA 3C2EA 3VCRA 1BWLA 1THFD 3LXBA 3N34A 5L6UA 5BNKA 1YLVA 3BW3A 3G8EA 4X3ZA 3W22A 1P4CA 1AW1A 3EWXA 1LRQA 2RKXA 3OG3A 4Z1DA 3NQDA 2Y7GA 4BWLC 1W3NA 5FF3A 3HG5A 4JDYA 4WJEA 3A23A 3LHVA 4YWIA 3NM3A 1WA3A 2JGQA 1OX6A 1TV8A 1RQBA 2P10A 3QZEA 3GIYA 4HNUA 4MLJA 1R47A 4Z1CA 1P0KA 5DCEA 2RDUA 3GDTA 4UTTA 4ML9A 3IIZA 1SZNA 4LS2A 3W1PA 2FPTA 3U2OA 4DF0A 2TYSA 2CWNA 2VEPA 2DZPA 1YDNA 5LNUA 4K7VA 4RK8A 1OFEA 1G7UA 4FHAA 4UFJA 3GK0A 1VCGA 4K6AA 3A21A 4ADUA 3RLUA 1SZFA 3S5NA 4AB4A 3CU2A 2O7QA 2YFNA 4A3UA 1DBTA 1HUVA 4M6VA 2X1UA 4O1BA 4QAIA 4DPQA 2VFGA 1JCXA 3VNDA 4OBTA 1FQ0A 1S3HA 3TW7A 2GQ9A 4I7UA 3UD6A 3RLVA 3M0ZA 4NJGA 2ZCGA 2QR6A 4DBDA 2WJZA 1LRNA 3EWBX 1OX4B 3LTSA 3KVJA 3R2GA 5LNRA 2V9DA 3FLUA 5AHMA 4QQ3A 3HO8A 1X6UA 3HG2A 5D2TA 4H4IA 3DFSA 3P60A 2WSQA 1ZHAA 5HINA 2G97A 3AO0A 3LLFA 1A50A 4FO4A 3ATZA 2CLMA 1IXNA 1K7FA 2WQPA 3GYEA 4J9JA 3KRSA 4YCPA 4FX6M 4CNNA 2X1RA 5D02A 2RDWA 3UWQA 2QCDB 4RZ5A 4B5NA 1T99A 3NVTA 1W5QA 3NYZA 4TMBA 1HG3A 2OJPA 2ZTKA 2A7PA 4HNVA 2V30A 3C2OA 2Q8LA 3TQVA 3TMQA 1GVFA 3DFOA 4IWWA 3TC7A 3LHTA 4NZJA 1R2SA 3M9YA 1OX4A 3JS3A 5K9DA 1O60A 4LS1A 3O6DA 3UYCA 4A22A 3TJXA 1ALDA 1VYPX 1GVSA 4ADTA 4UC5A 3EX3A 5G2HA 5H2ZA 3F4WA 2FPVA 3A5VA 3TA6A 3UWYA 1MZHA 1Z41A 1VJIA 2QCDA 3HF3A 4MZ1A 4RZ6A 2AQWA 1KV5A 4JXCA 4ORIA 4O16A 1TRDA 1VS1A 4JEQA 3JRKA 2BTMA 3N14A 3O15A 3OHIA 3UY8A 4JTGA 4DXVA 5KTLA 5AYZA 4XKYB 1TPWA 3W1NA 2H3BA 5EPDA 1W54A 1XUUA 1VH7A 3SZ8A 3W7RA 1PVNA 2ABAA 1SU5A 1LORA 3GKFA 5DY3A 1DKWA 1GVRA 2Z6JA 5HUPA 1H1YA 3C52A 4N9DA 4IJBA 1WYIA 3OBKA 5HWJA 4HPJA 1DHPA 4O13A 3PBYA 1DJNA 2CZDA 2PRMA 3SY5A 3OVRA 3B4UA 3S8HA 1XBYA 4DO5A 1R2RA 4JICA 1EWDA 1H7OA 4O19A 3HG3A 1KFKA 2B7NA 4RCXA 4XTIA 3BG3A 4LRSA
chains in the Genus database with same CATH superfamily
3WMLA 2GLKA 4QG9A 1FWCC 3R11A 4PL1A 1ZENA 2V81A 1OB0A 1OG0A 3BW2A 1FFRA 4JFUA 3W84A 4LBRA 3OW1A 1OWQA 1BF6A 3H7VA 1VBUA 1JUKA 3UR7A 1V08A 1AK5A 3OB8A 3QOKA 3U8GA 1UR9A 1VPXA 1IHIA 1S39A 1EKOA 2CYGA 3NZQA 3DBPA 3DGRA 2ATSA 5DY2A 3TSBA 3EWCA 2PTYA 3G6LA 3A4XA 2BMBA 3LNPA 1WQ5A 3JZUA 2GYIA 4QJ5B 3L2IA 1V0NA 4J7RA 3LD5A 5LA2A 2NT1A 3UPWA 3WF4A 4FXFA 2PZ0A 1LUCB 4TX8A 4YTSA 1TPUA 1P5BA 1KO0A 1HKIA 1J18A 1PS9A 4GUFA 7ODCA 3LS9A 4LJ3A 4XAPA 4IP7A 1VQTA 2PA6A 3H26A 2CHOA 3EKZA 1PZ3A 4R7OA 2GOKA 3VGFA 4D72A 3M5XA 4EK7A 5HNUA 4GCAA 1WKEA 3T2QA 1ICPA 1VPYA 5EMYA 4B91A 2EG6A 2ZRVA 4IIFA 2NQZA 1WBHA 5DRCA 1EEXA 3BE7A 1G5AA 1RPXA 2VWSA 3ZT5A 5AOUA 5FSEC 3L4TA 1X8CA 4M7SA 1IXPA 5CPMA 1MFUA 3SRHA 5D2VA 1TTQA 3W75A 2V2DA 1J5TA 1O6IA 1T41A 1TV5A 1LOQA 2YDRA 4Y90A 1PKMA 4U4MA 4QE1A 4O15A 4DY1A 1ECEA 3PPFA 1RD5A 3ARZA 2GVEA 4GINA 1QR7A 3V5OA 1F2JA 3WD2A 3AIVA 4FAMA 2A3BA 3VCNA 2PCQA 1T5AA 3B8WA 2HK0A 4EF8A 3F1QA 4QM1A 5A2CA 4V27A 1KC7A 5A8QA 2YB1A 2ZUWA 5GNXA 3G1RA 1OFRA 1DWAM 3W1QA 2Y7DA 3T40A 1W2VA 3ZJ7A 4V15A 5CAKA 4GI8A 4AMAA 3E74A 4AWSA 2G3JA 5CZTA 3VABA 1QO5A 2V82A 3QTGA 4F40A 4P8WA 5TF0A 3Q37A 2P3EA 2CLOA 1C91A 5BW6A 5I02A 1E70M 2V69A 3ZR4A 1A4MA 1AJ2A 3WD0A 3PPCA 1ZU8A 4OV9A 2V2CA 2B0MA 3N04A 4AFYA 1VHNA 2VL4A 1W56A 2XGZA 2EPKX 5AY7A 3IV3A 3FGCA 3BK0A 3WF3A 2WJDA 2NW0A 1W9UA 1G0CA 4MMWA 4PB3A 2HWGA 3BC9A 4ONVA 1YYAA 4GBUA 4DB7A 1NDWA 5F4SA 3P5ZA 3PP7A 3VDGA 1K4GA 1RCXB 4AUBA 4ATWA 3SRDA 2WC4A 5XIMA 3CQIA 3IJ6A 3DYMA 4MAZA 2H6RA 4O1DA 5I06A 5I03A 3E38A 3RG6A 3S46A 2JK2A 3FAWA 3K8LA 2BVWA 5LIXX 4GYPC 3GNRA 3L0KA 3E2RA 5I24A 4U10A 3OZOA 1ZPTA 1NTHA 3MYPA 4LY8A 1JFHA 3GNNA 2Z1SA 4CN1A 3TONA 1F6YA 3PWIA 4MTVA 4MKNA 4LYPA 2V8ZA 3ABQA 3HG4A 4L56A 1EP1A 5LKYA 3MMDA 2OCZA 4YVPA 2WSRA 1RA0A 3OVPA 1TIWA 4D6EA 3O0KA 1FDJA 4A3RA 4BF7A 4OZOA 4KPLA 4MY9A 4J3SA 4QJ4B 1OX5A 4IMFA 4JX5A 3VGHA 3GR7A 4NT0A 4Q7BA 3ABOA 3N29A 1BEUA 2OWXA 3GC4A 1NM9A 4KRUA 4RX0A 1NEYA 5FCZA 2PDYA 1D8CA 2PDQA 2F84A 1XC4A 4FP1A 4Q3MA 3Q4DA 4DBWA 3TV8A 5CLWA 1QPNA 1WUFA 5DELA 3URBA 4F9JA 2QF8A 3PG8A 5CC6A 2NQJA 4IUGA 3W1XA 4RZ4A 2ACRA 4G56A 5IDIA 2AL2A 1AA1B 3E49A 4GY1A 3VGGA 5T8GA 4QNEA 4RDZA 3NXFA 4JPGA 2PDWA 3PSVA 1KV8A 2BHUA 3SR7A 5TNVA 2HDJA 1XIBA 3GHTA 3CLMA 3P5YA 4Y96A 3QHOA 2VEFA 4S39A 3U5UA 2QS8A 3THUA 4MDOA 4X22A 4L4LA 3PTMA 4YXGA 3UR2A 1E6SM 5HQEA 4WOZA 3K2GA 1DIDA 2VGIA 4HU3A 3HGOA 1A80A 4QP0A 1AQHA 1F07A 4W88A 1R3TA 1ITUA 4QR6A 2E1WA 1OEPA 2WMFA 5CC7A 4N02A 3RU6A 4H01A 2I56A 3W0KA 3EB2A 3RU8X 4WKFA 4DJDA 1A5NC 3NQ6A 1ONWA 3FA4A 2GDQA 2Y7EA 2OGJA 1JUBA 1KTCA 2XH7A 3CZ8A 2OO6A 1J0JA 3CL6A 4YTQA 1ADOA 4B5TA 5M5DA 3E0FA 1S38A 1SMDA 4IPIA 4DELA 4MWAA 5HATA 5A6BD 2ZADA 3NEHA 4PFHA 4CLMA 2QPSA 4B3ZA 2XVLA 1YPXA 1UKOA 1MXGA 1XBZA 1PTAA 3A24A 5C55A 5FEPA 3QZAA 3UZ5A 4JTQA 4XUGA 1UZ1A 1KRAC 3HPAA 4A29A 1GTHA 3WDIA 1WB0A 4NL1A 2R1KA 4O28A 2ACSA 1TWDA 3VFLA 4IUOA 3WNKA 1OFOA 1VR6A 2E5DA 3MUAA 3RFAA 2OQYA 4A3HA 4CQ8A 1IEVA 1PYFA 5HAOA 1UIPA 5DCBA 3AROA 2ONEA 1EF2A 2XWDA 3SCNA 4HN4A 4R5EA 1FCBA 1PIIA 3S2CA 2CZ5A 3QFEA 4NQ1A 1W0MA 3WN6A 3VIGA 1W3TA 1GQLA 2NLIA 4IIBA 3LDVA 2GDVA 2PD5A 3WLIA 2ZUUA 3LX9A 5CSRA 1MWOA 5HXMA 3T4CA 3CHDA 3WLPA 4GI6A 1XPGA 2XN1A 4PSRA 3O8AA 2PZNA 4K39A 4S3JA 5FF2A 4JAWA 3MU7A 1DL3A 1SUXA 3NQEA 4JGDA 3AUOA 1BHGA 2DZBA 1TV3A 1ITQA 2PDCA 2WPGA 5H91A 3GDRA 5FAGA 1E4MM 2IKJA 4D6IA 1HO1A 3F5KA 1K7EA 3T09A 1E6ZA 4FXJA 4MADA 1JRBA 1VEOA 3P14A 1TWIA 3ABXA 4XKYA 1EIXA 2VYOA 3GQYA 4JFSA 2GWNA 1BGGA 3NEVA 4D6GA 2PRHA 3LHYA 3VD5A 3VA8A 1MUMA 1XISA 3CV2A 1NU5A 5LSMA 2REQB 4JTAA 1K7XA 2BV9A 1DEDA 3QBUA 4K8EA 4INFA 2PD9A 4HSOA 1W1ZA 3ZOAA 2ZC8A 1BQCA 2V67A 2I7GA 1S5MA 2ADAA 3G8RA 4JYFA 3E0IA 3G0XA 3EWZA 3VKKA 4FMVA 2Y6ZA 3BLIA 4H6KA 3M64A 3SADA 1QOQA 3KVKA 2GSEA 1PWLA 4C7GA 3W70A 3R25A 1KFLA 3K8KA 2Y61A 3EXSA 1JD7A 3WL0A 4NZ5A 3KTSA 1WDDA 1LP6A 3ABSA 5A95A 3TYBA 6CGTA 4H8UA 4M6UA 4JTSA 3RCNA 3WJWA 3GH4A 2FVKA 3PBWA 3S2JA 4H9VA 2O9RA 2XJ7A 5KSWA 3PS7A 5CC5A 2D2OA 3RX4A 3AXKA 2OWWA 1BTMA 4UMBA 2FFCA 1Q85A 3BJFA 5JQ9A 2QCEA 2ZXBA 3ITLA 1DXIA 3UVIA 3WLQA 2NSXA 1LUCA 2XIBA 2E3ZA 1B57A 1MEWA 4I90A 1XG4A 4XD3A 5BU9A 4E6MA 3LNMA 3CQHA 1PKYA 1VCVA 1HP5A 1FKXA 4B16A 1FBAA 1KM3A 3IIOA 2DSWA 5HANA 1ZNNA 3SN4A 4MYAA 4ZFCA 3D5HA 4EPDC 2BXVA 3LPPA 2NX3A 1KQZA 1GNXA 4NI3A 3FA3A 3DFYA 5EKYA 3ABRA 3W07A 2V5DA 1T8QA 1KRCC 3LHUA 4LU0A 3I10A 5JIWA 2XTKA 1XQLA 3A12A 3SRFA 3COTA 4DNHA 1UROA 5EFDA 2JKPA 1V6TA 2ZZ7A 3NG3A 1E0TA 1OK4A 2B7QA 2DIJA 4Y2WA 3KLLA 1HVXA 5KZDA 1QT1A 3WBEA 1UCWA 5JXQA 4ZXLA 4H6QA 4CQCA 2J88A 5F1VA 1AD4A 5B7YA 4LSBA 4GJJA 2XN2A 4AD3A 1LLZA 2D73A 5CBBA 4RDWA 4YTTA 4GBDA 3MSGA 1YKWA 3ITGA 1IQ8A 1EHAA 1R30A 4QTGA 2YOCA 3I7QA 3EWWA 2ZDSA 1J0HA 2TPSA 5A5WA 2ZUMA 1WCGA 3V75A 3QSRA 1FH7A 4EXBA 3OEXA 3SCRA 4AIOA 3H4XA 2DT0A 5DN1A 4OOUA 4QE5A 3CZEA 3TYZA 1KQYA 4KF1A 4IGSA 2V3EA 4WD0A 3ZLGA 4D6FA 3BUVA 3ZJ6A 2VCBA 2Z1KA 1E4LA 3ZT6A 2G5WA 5A6LA 2OFJA 3WLJA 1I45A 1UP2A 4YYFA 4IGMA 4P7NA 3B9NA 3QC3A 4ZL1A 4C6OA 5M3WA 2C15A 1W32A 1WAWA 1UKSA 2QW5A 3CWHA 4I7VA 2G37A 8RUCA 3W2JA 1Q66A 2CETA 3WDPP 1RD6A 5CG0A 1M7JA 3W87A 2I9UA 2OT1A 4MFDA 1E1CA 1XD0A 4JNZA 1QU4A 3C6CA 5C9WA 1F3EA 4F48A 2NXIA 1V4YA 1V6UA 1MW2A 2AAAA 2O56A 3R89A 4F2BA 2GZXA 1ITXA 5FEXA 3WQ6A 2G4FA 3YPIA 4HNLA 3VGDA 1ZZMA 1LL7A 4M3PA 1R3WA 1GOQA 2X30A 4Q7IA 4HOWA 4QITA 3VC6A 1YNYA 4IJCA 5E0KA 3IK4A 1H61A 1KA9F 1KXQA 4LYQA 3CV6A 2QGHA 2Z25A 4L80A 5FF4A 1YTEA 1SM9A 3L2LA 1BSIA 2CNCA 2VCAA 1E9ZB 4DLMA 1VGAA 1GVIA 4H8VA 4NAEA 2DVUA 4Z08A 2D0FA 3WK0A 2YLLA 2FGZA 2NQLA 4N6EA 4IIEA 1PO9A 2J13A 3E0WA 1MSSA 2ZZ1A 3BLOA 1ZP3A 4MB4A 3WFLA 2RGMA 2GVJA 4POCA 3IGHX 4FX8A 1JDCA 2UWFA 5LNSA 5CGMA 4M5PA 1N82A 1LLWA 3U7VA 1H50A 2JF7A 5AVHA 1OZMA 3SQLA 5GPRA 4W85A 2QUUA 3VOIA 3WJYA 3RR4A 4MM1A 1TPDA 2WKJA 3HFTA 3MMTA 5D09A 1PBGA 4LTSA 1O5XA 3WZ0E 4HA0A 1J6OA 2YL8A 5D9NA 3RN6A 1PX3A 4HBKA 1GW1A 2OLAA 4JEJA 1XHGA 3ITXA 4ERAA 4D9PA 4H19A 1W5OA 3P61A 3WDQA 3G1XA 5K4XA 1M65A 3CUXA 3NQMA 3OO2A 4AC1X 1CGYA 1FCUA 2Q8XA 3DOPA 3TJLA 2PDNA 2BXYA 2ZRYA 4H7CA 1EEPA 4IHCA 1H09A 1OT2A 2HCVA 4ZODA 2W63A 1BVZA 2EPHA 3O06A 4EVZA 1NOUA 3KZSA 2I1OA 2X41A 2O55A 3CL8A 3BJTA 3R58A 3E0LA 5DMLA 4C1NA 1E40A 5DMMA 3U5YA 3AYSA 1HKWA 3I3DA 3MDUA 2EPMX 1DQUA 2TODA 2ABBA 4FLOA 1QVBA 1K4HA 3FCPA 3NPVA 4LX4A 2PP3A 4YPJA 4Z1YA 5MF5A 1G4PA 1RLCL 3AICA 3CV7A 1LF1A 1V0KA 3CQ0A 3O07A 1PIGA 4E4UA 3TMLA 3EEGA 5I5RA 4G1NA 3PPGA 3K1DA 5LA0A 2IUZA 1U2YA 5LNVA 1JZ5A 4QISA 1V7YA 1K9DA 4PTXA 2YL5A 1M01A 1G94A 3QZ6A 1Q6RA 2ISWA 3LCXA 3IARA 3NO1A 3B8VA 3RNDA 4BZYA 3MQTA 4IPLA 4C6CA 4HU8A 3Q58A 4NU7A 2PWFA 3OQEA 4NY2A 5D05A 1SJAA 1SR9A 1QWKA 1IWPA 2G4JA 4IQLA 1D8WA 3VKAA 4HMDA 1FKWA 4DBUA 4O10A 5DXXA 5CZSA 4CQBA 3M47A 1HJSA 4FS9A 1UIOA 3SGUA 3DECA 4PRWA 2ASHA 3WLKX 3V35A 2WZEA 3AUJA 5M03A 2WJEA 2E6DA 3GVRA 1TTPA 3E02A 1Y5XA 1W91A 1W1YA 1LWHA 5C9ZA 4KFOA 3MVIA 3LHZA 4KEUA 1XLLA 4KRZA 4CD8A 1K03A 2PDBA 2YW4A 2I5QA 1B3OA 1O7AA 2E7FA 1JDAA 2G3MA 2QAPA 4QLLA 1XLHA 4PA8A 5GJPA 2YXGA 1TFVA 5HMSA 5A6JA 1GYLA 1V3MA 1UA3A 4IPNB 4NJHA 3EKGA 4HJFA 1NWTA 1E1FA 1Y8BA 1R8LA 4HIBA 3CUJA 3L68A 1J2WA 1UWSA 1Q6GA 2R14A 2VT0A 5JU6A 1DXFA 5FJJA 2ZE3A 1QNSA 1V0MA 4L61A 3MZ2A 1X1ZA 3W86A 1DE6A 2HTMA 2HK1A 2ZRZA 3W6YA 3W2MA 3BAWA 3FNDA 2HBVA 2H90A 5LXXA 3KOYA 2J7DA 5CSSA 1EPXA 3KS6A 5J5RA 3KVMA 4C6BA 2ON3A 3OVQA 1QPRA 4MPQA 2PURA 5KZ6A 2V5BA 3RPDA 5E6YA 5AHFA 1E9IA 1CB2A 2VELA 1Q7MA 1LL4A 4A8LA 4GVHA 1XI3A 3W7OA 4UTUA 5C9XA 3AU2A 2AKZA 1ZAHA 5EMMA 1E43A 5CBJA 2A1YA 3CEPA 2O0TA 1W17A 2R24A 4J2MA 4LNYA 5IBXA 2ZZ6A 4W9TA 1HL9A 2MNRA 4CD5A 4OIFA 1GZJA 3UFYA 4R9XA 1TV4A 4L65A 9XIMA 2VGFA 1FFQA 1BYAA 4C6DA 5T9CE 3DI0A 3HPSA 1PYMA 4JN6A 3EDEA 3AZSA 1XLKA 2Z7GA 3LPFA 1OC6A 3WIJA 3VK5A 4CU7A 3BLDA 1KFEA 4H9YA 5AKQA 1ZBVA 1VIZA 1R38A 3KHJA 2E6YA 4DF2A 1XYAA 3TSMA 3UNDA 4LCSA 2BX7A 3LCGA 4IQEA 3CS2A 2R82A 3BXWA 1VENA 4AZCB 4GPNA 4MVAA 3WF1A 3KAOA 2ZKMX 3FEQA 2WWDA 3VOFA 2ZYFA 4XV0A 3Q94A 3PBGA 1VLIA 4EE9A 3CYVA 4GFSA 4Z0JA 3SY8A 3C2RA 3E3HA 4DLFA 3EMZA 5CLTA 2DQXA 2X1TA 3LOTA 1EFZA 3NZRA 2YYTA 3PZNA 1ZAJA 3PN8A 4OU1A 4IT1A 4WZHA 4ASTA 3GXPA 1E5JA 2CLHA 1U5JA 3OYZA 1YHTA 1OIFA 2C8NA 1QBBA 1RVGA 5FESA 1K02A 1JPHA 1EL3A 2X7WA 4UB9A 3BCDA 1TPB1 2C6QA 4ZEPA 1JZ3A 4Q8PA 4HA4A 3PB0A 3TOPA 2PSNA 3WLTA 3V4BA 3AMDA 2V68A 4W84A 4QDMA 1JXJA 5KZEA 2QPUA 1H62A 1RCQA 1KFCA 1UMLA 3AMGA 1OYBA 5I6SA 1PUDA 3VKJA 3TR9A 4CEXC 3A64A 3VKCA 4KKXA 1RY8A 5EB8A 3FXYA 1BTCA 3FS2A 2VX6A 2C7FA 3QR3A 4GI9A 1O66A 1MUCA 2VKZG 1SW0A 1QW7A 1XLJA 4L9YA 3EX4A 1KXVA 2FDSA 1XW8A 4HPHA 2ZA3A 1JCLA 3MCOA 2X40A 1Q45A 2C0AA 3G1VA 1KCXA 2WNZA 3CIVA 4FEZA 3BV7A 3T0DA 4MKSA 4MDPA 3CZGA 4J3ZA 1IIHA 3UGVA 3K30A 3ZLFA 4JIQA 3VE7A 3VINA 3WLNA 1A47A 3M16A 1V3KA 1TQJA 3M5VA 3W73A 2EEXA 3MUIA 1H7WA 1QRQA 3T1GA 3BO9A 2J75A 1S5WA 1F8IA 3URQA 2XM2A 3B8IA 3N4EA 4Q7NA 3IS4A 4PUNA 3A5FA 2JKEA 1TQXA 3ARVA 1EB3A 3WQ4A 5E0FA 1CWYA 3WSUA 3O05A 5K9XA 1UUMA 3WK2A 1HKVA 1R3QA 1JF5A 3SBFA 3IVSA 2QULA 2CZFA 3NUKA 1XUZA 2XIQA 3WFAA 1QOXA 2FTPA 1UD6A 3AC0A 1I1WA 1P7TB 1XX1A 5C70A 1VBGA 2ZFAA 1JI2A 1KCKA 3KCOA 4FOKA 1TWWA 2PP1A 4JTUA 2ZIDA 3BLKA 1GVOA 3DYPA 4Y9NA 5AHIA 2IKGA 3TWAA 4XBKA 3STGA 1XPYA 2DZTA 4Q8MA 5F2MA 4IIHA 3RO6A 3WQGA 4BI6A 1FDYA 5B80A 1G6CA 7PTDA 1EC9A 4M51A 4EWJA 3ITYA 4KEVA 4UTLA 5DT5A 4ZFMA 5EMJA 4G9PA 2J9YA 1AUSL 1O94A 4I6VA 4DXXA 1CLKA 5BMWA 2FHCA 1FWFC 4GIYA 1V3HA 1THFD 5L6UA 3SN1A 3NXLA 4CEUC 3W22A 3EWXA 3OG3A 4HU4A 3NQDA 4F2TA 5HMEA 5D9MA 7ENLA 3HG5A 4S23A 4B2DA 1EDTA 3LHVA 4AZ6A 2CBIA 3DUGA 3H2EA 5BXTA 2XFYA 2VWTA 1OX6A 1TV8A 2Y8VA 4HNUA 2D3LA 4MLJA 1R47A 1JEZA 2R1PA 1ADSA 2RDUA 3GDTA 1KWGA 4I6KA 3IIZA 1SZNA 3U2OA 4PMQA 1V8EA 4REQB 4IP4A 3UZXA 2D3NA 2CWNA 4K7VA 1JI1A 1G7UA 4UFJA 4K6AA 2NQ9A 1FWAC 4I9JA 3AHXA 2YFNA 4A05A 1IWBA 3OZYA 4RV3A 1JCXA 3GXIA 5C71A 2GQ9A 3NVDA 3TP4A 1BXNA 2ZCGA 4DBDA 4HP5A 2WJZA 3H2AA 4JCLA 4S3FA 3AIRA 5LNRA 2V9DA 1R3RA 5D2TA 3CO8A 4H4IA 1ZHAA 2G97A 3AO0A 1YBQA 4FO4A 4RL3A 2YCKX 1K7FA 3GYEA 3M0JA 3BWWA 5D02A 4BA0A 2EO7A 4B5NA 1T99A 4QX4A 1GOMA 2DW7A 4GXPA 2D69A 3NVTA 4TMBA 1E73M 2HZGA 2ZTKA 3IANA 3URAA 2WZMA 2V30A 1V6YA 2Q8LA 2WB5A 4NI8A 2GL5A 4L7ZA 1GVFA 3DFOA 3POHA 3LHTA 4DAIA 3KWSA 2PGWA 5E0CA 3WQPA 2W5FA 3RRAA 1O60A 4LS1A 2WHLA 3O6DA 1E72M 1AQFA 1Y65A 4A22A 1ALDA 1JZ8A 3OJGA 5D9OA 2PUZA 4ADTA 3EX3A 2FPVA 1MZHA 2HPIA 3UYIA 1EBHA 4F0RA 4Q8NA 2AQWA 3CB3A 2V3GA 3SDOA 1VS1A 4FR1A 2VD9A 7CGTA 3CYJA 2BTMA 3O15A 3CZJA 2XZ9A 4IZGA 2DV0A 4OVXA 2ZXDA 2BVYA 1PVNA 3W7RA 4JFVA 2OYLA 5DY3A 3MO4A 1GVRA 2GK1B 5HUPA 1FHLA 2W62A 1H1YA 4N9DA 5CSUA 2OYMA 1WYIA 3SUUA 3UR8A 1DJNA 3GH5A 4FLRA 3B4UA 1XBYA 3NSNA 4S3CA 2IQDA 1R2RA 4HOZA 1H7OA 3N2CA 3VDAA 1BAGA 3GHUA 4V1XA 5DO8A 1CXFA 1ZSXA 3S2LA 4I9MA 3AMLA 2V5LA 2G3NA 1F05A 1A5CA 3ZR5A 1VBRA 2DZWA 4TIMA 3D0CA 4PRRA 4DWSB 3EOUA 3S4TA 1CXLA 4HNNA 2HXTA 4UOZA 2D2JA 1YTDA 2QYGA 4CNOA 4TV5A 3PANA 1HVQA 3L2MA 1UP3A 1UWTA 5I3GA 3CM4A 3AYVA 4DX3A 1L6WA 1GPWA 5EFFA 3BICA 1E0VA 3EX2A 2PGEA 1PAMA 1WXZA 3WJZA 4O1FA 3FHAA 1SZRA 2E28A 4K38A 1QI5A 4LALA 2EPOA 3LTYA 3BOFA 4JYDA 3UQNA 5JBDA 4LANA 2ZWZA 3EKLA 4PCNA 3S2NA 1AVAA 2PGFA 2WM0A 3KHDA 1XSKA 2QJNA 4ICNA 4AF0B 1F9CA 3HGRA 2C18A 4GQRA 3GDMA 4AZ7A 1KLZA 2KZHA 3R0UA 3N2TA 4GH1A 1BKHA 1WX0A 2CLLA 1ZJBA 2YSWA 3C61A 4IFKB 1G1YA 5REQA 1KBIA 4QCFA 4K7YA 3EB3A 3R43A 3W02A 3VMPA 4H9XA 3GO2A 3I7SA 1SO5A 1TJ0A 3M44A 3UXDA 2DIKA 1TTIA 3VYLA 1YNQA 1QNOA 2PAJA 1R5YA 3MSYA 3VMOA 3OODA 3GZAA 4ACZA 2YYUA 2FTYA 3OLEA 1W9PA 5C5YA 2DPEA 3FAXA 1XLCA 3N1AA 5H1WA 3T2OA 2ALRA 3CQJA 5A2BA 3NNTA 1MQQA 1AD1A 3ITTA 1JYWA 3MHGA 1R7OA 3O6YX 1VYSX 3ELFA 3UF9A 1LOLA 4JTFA 2C0HA 3GS6A 4OBSA 5I3JA 4PEKA 3I6TA 3IIPA 3W23A 4GACA 2G3FA 3B9DA 4DPPA 3CWNA 3BLEA 4M82A 3W2NA 2PTDA 1W3HA 4D1JA 2J7FA 1TPFA 2J7HA 2NUYA 4MJ4A 4P7QA 1ZJIA 4H8HA 1W9VA 1VJSA 5AYXA 1LROA 4Z2LA 2A3HA 3LMYA 3EX1A 4QLKA 2DUAA 4AZIA 3H2FA 2R1MA 1ZJAA 2PU1A 2QJJA 3UZYA 1P0DA 1UD8A 4DJFC 2WBKA 1Q6DA 1K9TA 1QNPA 3TFXA 4LBSA 1FWEC 5FJPA 4DBSA 4H7VA 4DUOA 5CAHA 2VJXA 3OU8A 1QW8A 4V28A 4WDXA 2A6NA 2QMJA 3EZ4A 5D4YA 4R9OA 2RH9A 4U31A 3C4UA 1HXJA 4AAJA 2VM8A 3W1LA 1RCOB 3L5MA 5JBFA 2ZUNA 3CXOA 1MW0A 1KR0A 4R85A 3QGVA 2Z1BA 5E09A 1EJ7L 2HXUA 1JYVA 1SZEA 4LS0A 1NY1A 8TIMA 3N4AA 4DQWA 1Q7ZA 1KTBA 4WKAA 1DJXA 3U57A 3FEMA 3AHTA 4BS0A 2OX1A 3RRXA 3TSDA 4UR7A 1VFTA 1T8XA 1L8NA 3SQMA 2NXHA 2QT3A 3CHVA 5ABEA 4CU8A 3IV8A 3WELA 5BU6A 1GTEA 3BVJA 2I5GA 5A3HA 4LYRA 4LEFA 1C8YA 3GTHA 4BR1A 1Q2SA 1W1A1 3P81A 5K2ZA 2Z0IA 4AD0A 1CBGA 2ZVRA 1CIUA 3QPEA 4HB7A 3F5LA 1RAKA 2HBXA 5BRBA 4GLEA 1CGVA 3CAKA 1EJXC 3L65A 3PK7A 1I0BA 1Q5MA 1UR0A 3HQOA 4QAWA 4J28A 3W7JA 1P43A 3AIUA 2A5HA 2BVDA 1ZP4A 2FHFA 4HGXA 3GNXA 3XISA 1G67A 1TZZA 3IJQA 3TLLA 4E38A 2MUCA 3VAVA 4EKJA 4CUCA 4B4HA 4LC6A 4NRSA 3HTWA 3IGUA 4Z2JA 3C0JA 1W31A 2RDTA 5GNYA 4ZOCA 1QBAA 4LH8A 4IPPA 1EDQA 5F7UA 3CAWA 3KL3A 3EAUA 3OIXA 2PLMA 5E9AA 3O6AA 3T44A 4V1YA 2OB3A 4O57A 4QDPA 4LUYA 3H2MA 2ISDA 4A2SA 4DRSA 1E3XA 2DP3A 4E8CA 3J7HA 1FDZA 5LHEA 2PI6A 1KM0A 1V3LA 4M1BA 4MJZA 4KH2A 3P3BA 2EJAA 1L2UA 2J7CA 1BVNP 4ZOBA 5FF0A 3GRIA 3WD1A 5C9UA 1R3SA 1V5XA 2XN0A 3BLPX 2DT1A 4G7EA 4LPCA 3R13A 3FFSA 4RZBA 4JIEA 1J11A 4AMCA 1P0EA 5CZKA 4BK9A 2DEPA 1FWGC 1DHKA 4IMAA 4UBPC 3E0VA 4AIBA 3PPHA 3UGRA 3F4NA 3VVGA 1HJXA 2OPJA 4E2DA 3QC0A 3W9ZA 2W4XA 5I23A 1DWIM 1PIFA 3EBVA 1GEQA 3HGJA 2OELA 1Q6LA 4QG8A 3NPUA 5DBUA 3RR1A 3EWDA 4XKMA 1I9CB 3PJXA 3WBXA 2JKAA 4QDWA 4I8DA 1XSIA 3CNYA 1XRTA 4K3ZA 1GGOA 1IEIA 4PH6A 1XD1A 3L23A 1EA0A 2CLKA 3SECA 1JZ2A 1AL7A 3WEMA 2VFDA 3T42A 2TSYA 1ZL1A 4Q8QA 2WLYA 4GH3A 1OINA 1GPFA 4NJIA 3QXBA 4DJDD 4NP7A 3PBMA 4E2VA 5HNRA 4QLJA 1SR0A 4J2PA 3LXCA 3H55A 2WHMA 3AISA 3TXZA 1PHQA 4NJKA 4M7TA 3MC5A 2A79A 3DCPA 4CCEA 2ZX9A 4UTIA 2OU4A 3VM5A 3IJLA 3O1NA 4NG3A 5HMDA 1P0NA 2IPJA 3SSZA 4HQVA 3THAA 4FNRA 1WKDA 4MWAD 1F6PA 2X2YA 1QK0A 2IXUA 3FKKA 4WSKA 2ICSA 1OABA 4G8TA 4KRTA 3UXIA 1UASA 3MTWA 4GOAA 1EJTC 2WKLA 2J6XA 1TZ7A 3KOFA 4UCFA 4ERIA 5GVJA 4QJ1A 1ODUA 1GJWA 3PZIA 1JQXA 3MP5A 5DFAA 2FYMA 1GQIA 1ICQA 3WBAA 3APYA 3QVQA 4C6MA 1M41A 2GUUA 1OIMA 1PV8A 4ZQMA 2F8QA 1UWUA 1L6SA 1GZGA 3IAQA 3NZPA 2DU2A 3RF9A 3ES8A 1TCMA 3AS2A 4W7VA 1OC7A 2I17A 4DXKA 3B0YA 1H4PA 1CT5A 3VNZA 3DG3A 2E5CA 1GOWA 4GXMA 1PL9A 2WBGA 3AI0A 3GWQA 4OT7A 1IEXA 4ZO8A 2Y70A 1E6PA 3W7HA 1KLYA 1PCKA 3QH2A 1CI1A 3MP4A 5TD4A 1E3ZA 5FL0A 4MUZA 1AL8A 5AZ1A 5H6HA 3QLLA 2OOFA 3ZYZA 3LCHA 2JGYA 3MO7A 3WQDA 3T6CA 4Q22A 1FWTA 5HULA 2XVNA 1UH4A 2WW5A 4DWSA 1AZ2A 2I16A 3KBMA 7TAAA 4L9ZA 4BWLA 1OF8A 2VX5A 3W1AA 1FWHC 4QIUA 2DJLA 1GG0A 2CXGA 1S46A 1E15A 1DTUA 3W26A 4XIAA 1W3LA 3FIGA 3TJ4A 1T6MA 3L4ZA 1JQVA 1TMQA 2CLEA 3SURA 3GVWA 2WNNA 3UETA 2UBPC 3H4GA 1DWJM 2VQUA 5B7ZA 1ZY9A 2C3ZA 3GSMA 1WP6A 4QG6A 2XM1A 4B5WA 3NO3A 5FD0A 1QHPA 2P53A 3L4WA 2QV4A 2CZEA 1M1BA 5HUOA 4D2JA 2WZIA 3BQ6A 3MYOA 4L4MA 4Y9PA 3TVAA 3MZNA 2DZSA 3TN3A 3GR4A 4LW7A 4W8AA 4XVEA 3GDLA 1OVDA 3C56A 4AZGA 3TQKA 1CLVA 4IFKA 1OCBA 2HS6A 3PHAA 3TOYA 1E6NA 4B5XA 3W71A 3AIQA 5J04A 5JH1A 3W81A 3AIWA 3ZLHA 1DVJA 4QCEA 4A8IA 4KWOA 1FCQA 1QASA 2DSVA 4UTTC 1KGWA 2VFHA 2QNEA 3AFBA 3P80A 4KETA 2GVGA 4OBRA 1B3XA 4QS5A 3QTPA 2PS2A 1FY6A 2B4GA 5F1UA 2GWGA 3AHZA 5KITA 4L64A 3NOYA 4X2PA 1BRLA 1W1IE 4CCDA 1LBMA 4DJED 1YPFA 3K4WA 1C90A 2VC7A 3H70A 4WGHA 1MZRA 4Q32A 3WQFA 4BEQA 1U22A 3UVAA 1YQ2A 4BHYA 4K1GA 4P8UA 3E2SA 3W88A 4H8NA 3P8IA 4XSLA 4DYEA 3DAQA 1UWRA 3WFZA 3LRMA 1NOFA 4WRHA 1WBJA 4AHOA 2ZA1A 4Q4SA 1XJBA 4UTJA 3EOOA 3INPA 3W1MA 3WQ8A 3DFTA 3BDKA 3TTYA 3DEQA 3LG3A 4ZE5A 1JULA 1A5MC 3GNOA 2VP8A 1NQKA 2WV8A 3PBVA 1PZ0A 4WDWA 4NAFA 1TCDA 4JTJA 4N9CA 1X7FA 2VR4A 4X0VA 3GBDA 1JDEA 1QNVA 3TYEA 1WDWA 1ME7A 3QKEA 2VO5A 1FWSA 2A4AA 2Q3OA 2V2HA 2XPKA 4WY0A 2VFFA 2XUCA 2A3CA 2DORA 3S9YA 4HJWA 4WVXA 1YTKA 3C86A 3EDFA 1H1NA 3T8QA 4D1IA 3NAVA 3WJXA 1OZQA 1I1XA 4PMRA 1Z8AA 4NXKA 5CPQA 4DUXA 3BG9A 1HT6A 3QV6A 4ZB0A 3L67A 3W7PA 1WKYA 3UPMA 1EX5A 3R8HA 1I2QA 1F73A 4H9MA 2A6LA 3ZZ1A 3R7MA 4IQDA 4LUJA 2AOSA 4Q6XA 3NQ8A 2ZVIA 3BZGA 4PR4A 1QK2A 4C1KA 4HMEA 4L4PA 3ANVA 5AC7A 4GZEA 2X09A 4ILSA 1DPMA 4NVTA 3E96A 1S2UA 3TQPA 5AC6A 2VXNA 2WVVB 3H24A 1VFLA 3TR2A 6TAAA 4MHBA 3DX5A 5AZ0A 1EIBA 1NFGA 3NCOA 3ONCA 4K8HA 4HU0A 3GYCA 2O9PA 1N7KA 4GUGA 3FA5A 1QNQA 2E77A 3ZM8A 4UR9A 1KM5A 2O92A 3N3TA 1J2BA 1UKQA 3BGGA 2ZXAA 3G3DA 2QJHA 1NDYA 1UQZA 1BF2A 3WQVA 2NVCA 3OPSA 1ZCOA 4BQ4A 4ZR8A 3PUDA 4KMQA 4GUIA 3N2BA 1LZOA 3TK7A 5D03A 4IICA 3PG9A 4L1GA 2EKCA 3NM1A 3SM0A 2QZRA 3MI3A 2LLEA 4JOMA 1OG6A 1EX1A 1GVEA 1VIWA 5DMNA 4LAKA 1MYRA 4O50A 1FUYA 4IXXA 4B5VA 1M6JA 1C8XA 4H6EA 1J4EA 1S2CA 1M7PA 2DFAA 3WY1A 1ENUA 3I6RA 3KL0A 5HNNA 1FRBA 1BVWA 3DH7A 3WQWA 5AYBA 1IGSA 4KWUA 2FQIA 1K8ZA 3K13A 3K8MA 4JNYA 2D2HA 3TN4A 4K37A 1AMYA 4OV4A 4GNKB 3PJWA 2XVPA 2Y88A 2E8YA 3EA1A 2VVNA 2OLHA 3QQ1A 4XZNX 2CITA 4U28A 1UB3A 2ZE0A 1TVNA 3W74A 1JNDA 1K8YA 4JTDA 4IGNA 1XLMA 3MCNA 5A6SA 1FVPA 3TJIA 1KXHA 3PWAA 1L9WA 1IXQA 1O95A 3NL2A 2W92A 6TIMA 1UR2A 1XIHA 3OOQA 1UPPA 3BARA 3WK3A 1MNZA 1EJSC 1MEHA 2W6RA 1RHCA 4O8RA 1IF2A 4I7WA 2J79A 3W01A 2VI0A 1LRTA 1FWIC 1E5NA 1EC8A 1ZLPA 2YJQA 4WSJA 3VOJA 1B3WA 5A2AA 3W2UA 2B31A 4EWND 1JDFA 2CXEA 3N4FA 2VEIA 3VNIA 4A8NA 5BXSA 2EG8A 2WHKA 1QPQA 3JZEA 3VIIA 4QEEA 1X96A 3T0AA 3DHUA 5H8MA 1NIUA 1YXCA 3CUIA 3ZWSA 4XAGA 1J10A 1W3IA 1BG4A 2WVSA 2P8CA 1E6RA 2V3FA 1NELA 2OLSA 1P0BA 1A3HA 1C9WA 1U33A 3OGRA 1YADA 1C8VA 4YS1A 1H1ZA 4KCTA 1D3CA 4O14A 3PZ9A 3S1UA 5E9XA 3DG6A 4IPJA 5LGXA 5CQ1A 2F6XA 3WMCA 2QCLA 4JKKA 4AC7C 3QY7A 3PUGA 4DI9A 4UQBA 4U2ZA 3IWPA 1QO2A 1EH9A 3ARSA 2CHNA 3VIOA 4LAUA 3A9IA 4CQ9A 1US0A 1FWRA 3B8UA 1IEQA 3AOFA 4LAOA 3W7GA 1REQB 3RMJA 4EXAA 3G5EA 2YGYA 3SCUA 3VNMA 2WC3A 3U48A 1BYDA 3MKKA 4MJMA 2C1HA 4A6GA 4WEVX 3OGVA 1XICA 1I6NA 2NVAA 3B0XA 4R33A 3LGDA 4J40A 4P7RA 1Q2RA 5DLCA 3PTDA 4GQBA 1EP3A 2B81A 2UY5A 4RPPA 4UXDA 3ONBA 4TVCA 2GJXA 3A4WA 3W7IA 2QDHA 3HV8A 4GK8A 1C92A 1ME9A 4IX2A 1DJZA 3C5QA 4Q33A 4UIOA 1N55A 3ARPA 3GG7A 2CLIA 2P50A 4LT9A 3FVMA 5HR7A 1XIGA 3W37A 1UC5A 3M4HA 5ABFA 3MA8A 4RR4A 4YN5A 4HCLA 4ICMA 5ABHA 3LBMA 3FDKA 4KGJA 8XIAA 7A3HA 3DN5A 1B4EA 2E5BA 1UD4A 3ZVHB 2ZUVA 4GUJA 1JGMA 3U7BA 3F2DA 1WDSA 5U4NA 1X1NA 4MY8A 1Q13A 3UXKA 2XH4A 1H3GA 1U5HA 2JEPA 3L4VA 4LVGA 3MV11 4HTBA 5MKGA 1RZMA 4F0KA 3B4YA 3QF0A 4DM1A 3MANA 5D2WA 1Z42A 4O52A 4HOXA 3ZMRA 3NL6A 1QUMA 4IG2B 6REQA 3VXGA 3NYDA 1AJZA 3SRKA 1JZ4A 3BANA 3ORWA 3N19B 1UYQA 1KB3A 1R9ZA 1I2OA 2QCMA 2IKIA 4RXFA 3NGJA 4UTWA 4NX5A 5U7SA 2I14A 1LQ2A 1OJXA 3AIBA 4LFYA 4KFPA 4FIQA 3TUUA 3W53A 5HWMA 4Q4QA 4PB4A 1OGSA 7TIMA 3BPWA 1TTJA 2XH2A 5CPNA 2GPTA 1XKYA 3W85A 4DJDC 4ATDA 3M5ZA 1UZ4A 4PMZA 2BOGX 1JGIA 4D8AA 3THDA 4UQAA 2Q71A 4ZQNA 2VX7A 3QEZA 4BJHA 3CO4A 5BXPA 3KW3A 5EGRA 3SFKA 4OUIA 4MWAC 3HU7A 1G7VA 3MI2A 2YA2A 4JYEA 5AB3A 1B2YA 5K9CA 1F5ZA 3WMBA 2DVTA 2FH6A 1QI2A 3G0SA 4PBGA 3L7RA 3DG7A 3LCLA 1BYBA 1CXEA 1QPKA 4JTCA 4M0XA 4PULA 4PUJA 4NNCA 3SI9A 2V63A 2CFFA 3MUXA 2FTWA 3VZXA 2F2HA 4DUWA 4GIEA 3MBDA 4CD4A 1C93A 1NWSA 3GW0A 1W9XA 3UY7A 2G0WA 1HZYA 2NV1A 4PUWA 4ZBCA 4BFAA 2BHYA 2TRSA 4HK6A 3WYZA 2PMQA 1B3VA 3ZSSA 1L0PA 2JIEA 4H9UA 1FH9A 5K7JA 4GA8A 3RLGA 2R1NA 2FZ9A 3CHCA 2DSZA 4AISA 5XINA 1F8MA 3VUSA 1W8SA 3NQAA 4W87A 1BD0A 2VHLA 2VOMA 3NA8A 1HL2A 2XHYA 1XDMA 1ZQ5A 3F03K 4YL2A 3OG2A 4BY3A 3M0IA 1A49A 3M6YA 4AX6A 1I60A 1R3YA 1RK5A 3LGEA 2C14A 2YX0A 5C7VA 4UQEA 2EF9A 4JD4A 4XISA 3L12A 4FA3A 3RO8A 1EUAA 1PX4A 4F2UA 3ID7A 1M7OA 2WMIB 1YRRA 2XSXA 2CW6A 3WQCA 3MPGA 3FVDA 1HGWA 2PDJA 3W6LA 3C3UA 4UZUA 3OLIA 4R53A 5CPTA 3BCJA 1YE6A 2XU2A 4Z2GA 3REQB 2EPNA 2YLAA 5D9PA 4OWGA 1E6XM 1CXIA 1OFAA 3SCVA 3EWUA 3VMNA 3GXNA 3LCFA 3VKBA 5AC5A 1FP9A 2VCCA 2ZRWA 3A4AA 3MS8A 2VVSA 3PTKA 4XBSA 2PWHA 2GQ8A 1FHDA 2PPGA 3KFTA 4E2OA 4F0MA 1SO4A 2ZXQA 1F3XA 2DY3A 4JTRA 3EPOA 2R6OA 3OA3A 2VQTA 3VU2A 3VOCA 1JZ6A 3RGTA 1TV7A 1U83A 1E6QM 2Y8UA 3CBWA 4LV4A 4DWDA 1X39A 4K1WA 3VCRA 1BWLA 3LXBA 1YLVA 2PLCA 3SCTA 4C7DA 3CLWA 2RKXA 3W82A 1PZ1A 4XO6A 3GBEA 3F5JA 5LIKX 4JDYA 2XDFA 5ENLA 2DVXA 3GE7A 1OT1A 1M9HA 2JGQA 5BRPA 1UR8A 3QZEA 4LAMA 3IJ9A 1P0KA 4C91A 4ML9A 3VGBA 5BROA 3S9ZA 4YYCA 3KCJA 3W29A 4B15A 1UP0A 1M03A 1YDNA 2A3LA 5LNUA 3EMQA 4URIA 3WLSA 3ECQA 2YCLB 1HL8A 1TX0A 1TA3A 3GK0A 5FIPA 4XZMX 1P1MA 4ADUA 2VZVA 1SZFA 3S5NA 5HOSA 3CU2A 2XSBA 1HUVA 4M6VA 3S83A 2X1UA 4LY4A 3WQEA 4HMCA 1CENA 2VZTA 1GONA 2VZUA 4A8RA 3VNDA 5CJ5A 1A5UA 2GSJA 4AD5A 4I7UA 3RLVA 4NJGA 3HMCA 2H9AA 1ADDA 3U0HA 3LTSA 2AGTA 1B0IA 3RXZA 1GOKA 4JIRA 3UJEA 4MB1A 3P60A 1PDYA 3WDRA 1B31A 3SJNA 5A94A 3LLFA 1A50A 2PP0A 3VC5A 3VILA 4YU1A 2CLMA 1IXNA 1BXBA 4FX6M 4Q4RA 3ISIX 2X1RA 2A3AA 2Y2WA 1UJQA 4RZ5A 3FJ4A 3ENLA 3U3HA 4B2DD 1KKRA 4ZE4A 1B90A 4LUTB 1W5QA 2E9MA 2HE5A 3NYZA 5JUVA 1NP0A 2A7PA 4HNVA 3D6NA 3C2OA 3H2OA 3TQVA 3TMQA 4NZJA 3EDJA 2BGQA 1OX4A 3JS3A 3N13A 3CH9A 1RP8A 1KBKA 2Y8KA 2UY4A 4XAYA 3GXMA 3UYCA 5A6MA 1V6WA 3LSBA 1VYPX 2WMKA 1P6CA 1W2PA 1Z41A 1YIXA 1F3TA 1VJIA 2QCDA 1C3FA 3HF3A 4JXCA 1ZB5A 2Q02A 4AZHA 1OY0A 4JEQA 4P8XA 3OHIA 4GX8A 3UESA 1CXKA 1IR2A 1TPWA 2H3BA 6ENLA 7REQA 1W54A 1VH7A 4GJIA 2WSKA 3VFCA 1R0MA 3C52A 1TVLA 3FK4A 8A3HA 5AYIA 5HWJA 4O13A 4JHZA 2XFRA 3GIQA 2OWCA 3CT2A 3W25A 4X60A 3S8HA 4DO5A 3CHFA 4JICA 1EWDA 1FWBC 2C1GA 5C2GA 2WMHA 3DHPA 2J74A 1KGUA 3W7KA 4FF5A 5A8MA 4FR6A 4FNTA 4AY7A 2XIMA 2ZRUA 3GXDA 3EXTA 4CCCA 2Y5SA 3N3MA 1W1B1 2A3EA 2PDHA 2R8WA 1VB9A 3TROA 1F76A 4O4WA 1VP5A 3QJAA 1PTGA 3B9EA 1IR1A 5HMFA 3DERA 4YVVA 4KCWA 4AVOA 4AU0A 3AYRA 3IJ7A 5A6KA 4RKAA 3MSRA 1XF0A 3KBVA 2BB0A 5TIMA 1CDGA 2PDXA 3L66A 4ES4A 3RHGA 2WC7A 2PBGA 3KOZA 1R9XA 3SIZA 4GIAA 1DIOA 1SYTA 3S2MA 5EBAA 5DT7A 1LOSA 5AN7A 2HVOA 2Z24A 1SO6A 3WLRA 3SCSA 1OM0A 3C0SA 1MI3A 1K3UA 1QJWA 3ABZA 4HT3A 4DJEA 4M29A 3BAXA 2PRLA 3MB9A 3AXMA 3TC3A 5HJYA 2NWRA 3E2QA 5J8LA 4Z2KA 1OQFA 1OYAA 3OIHA 1JCJA 3NDZA 2W3ZA 5HWNA 4G6CA 3WEOA 3LV6A 5CBIA 1B9ZA 4KCVA 4GWEA 3S6OA 1XH0A 3ZVHA 3NO5A 1OSEA 5CCZA 4AHPA 1DJWA 3GM8A 4F0HA 3F4VA 1NFPA 1TVPA 3JW7A 4IF2A 1C7TA 4AHQA 3C0QA 8CGTA 5D8WA 2J27A 3NQ2A 3ZJ8A 1O5RA 4KWWA 1TJ1A 4XD4A 4PE8A 4JQ4A 5JVLA 2IW0A 3PUOA 2X0SA 4IX0A 2ISVA 1VBHA 3WH8A 1KFJA 3G18A 1H49A 5DCDA 1PZ2A 3TW9A 4XZIA 3SB0A 1RSCA 4PYSA 6XIAA 4LF2A 1WXJA 3B03A 4IIDA 1XR2A 3FGCB 4XG1A 1AH3A 4IMCA 2QPXA 4IMEA 4K68A 4M6QA 5FJTA 1V6VA 1T7LA 3W2LA 4RE2A 4PRTA 4K36A 5IFTA 2WXDM 4EOUA 5C9RA 1GEHA 3DU0A 3UCDA 2PC8A 3S6DA 1YMYA 3M0XA 3EYPA 2ZICA 5DQPA 4O1CA 4DO4A 2POTA 1DWHM 1AMKA 3UWUA 4FZIA 3GFYA 3GNPA 1LG2A 1O68A 2P0OA 4NJJA 4LYKA 5I3FA 3CUHA 4J3WA 3B9OA 1XFCA 3UG5A 1FA2A 1NJJA 1XCFA 3T05A 3AWOA 4TVDA 2AQVA 1UBPC 4PTDA 4UNIA 3L9CA 3CTTA 2IQTA 3CK5A 1ONEA 2JALA 2E8ZA 2CBJA 2Z2AA 3CAQA 1UKTA 3CPGA 2A0NA 5H8UA 4M24A 3DDMA 2E67A 3RUBL 2WMGA 3IJDA 4AZBA 1Z9AA 4ZENA 4CGTA 3LY0A 4PZVA 2ACQA 1H0GA 2G95A 1D9EA 1LLOA 3E5PA 1Y5VA 3HJZA 1VFOA 3N6HA 1O1ZA 4BI5A 2VGGA 3FYPA 2VMFA 1EA9C 4N4QA 2JFEX 4B5UA 4H41A 3G22A 1K9FA 3IACA 1E4IA 3V0SA 4Z1AA 3TTEA 5AHNA 5IOBA 4IMGA 1XWYA 4RW3A 3M7WA 1UOKA 2WCAA 1NSJA 5C2XA 2GJLA 1MRQA 4QSHA 1U30A 3SQSA 1FHUA 1VYRA 4PBFA 4ZOAA 3AMCA 1WOBA 5I09A 1CNVA 1YDYA 2VEGA 2AL2B 2GGJA 4ZB2A 2DDXA 1EDGA 4EIVA 1H41A 2E6AA 3I7RA 2ACUA 3RM9A 4IP5A 2A85A 1JNEA 4HCDA 3CZLA 2OVLA 4LVAA 1IE7C 3W1UA 1TE6A 4J3TA 3RM8A 2OXNA 4JQAA 4FI4A 2WMIA 4J1OA 4JHOA 4RNJA 2XIJA 2WVTA 2CCRA 4XZBA 3G24A 1SPQA 4B4FA 4XZWA 5D33A 3QRHA 2W79A 1RUSA 5CSYA 3KCLA 2BSLA 4XX6A 1MNSA 4ERGA 2QCCA 2BBFA 4PTVA 1G9HA 3W28A 2VDGA 1R3VA 3KX6A 5HJLA 2ATMA 3HFYA 4NASA 3PFMA 4M8UA 2J47A 2C79A 3PZGA 1ZFJA 4U2YA 3T78A 3EDKA 3S47A 1US3A 4JN7A 4US5A 3WLOA 2EHHA 4BEUA 1S5TA 3OBAA 4MWAB 4GI4A 2O7SA 1Z44A 4NX0A 2ALDA 2CEQA 1NVMA 2RJGA 2ANUA 3GAYA 1OGGA 3WBYA 5IBXC 3O16A 2V3DA 2UV8G 5T26A 3EX6A 4M6PA 2VEMA 4R27A 2FZNA 3H12A 4HYWA 3N73A 4W5ZA 3NSXA 2OZ8A 2XVGA 4GIRA 4KERA 3SIMA 1XYZA 3DKJA 1VFSA 4O4VA 2Y24A 4V33A 2TMDA 4UFKA 3S5ZA 3U2CA 3PULA 3AALA 3LTPA 2Q8ZA 3JR2A 1RBOB 3BH4A 1MRAA 1WZAA 3AXHA 1R86A 1BG9A 2VUYA 1SO3A 4PTWA 1MXDA 2PLKA 5M17A 3SW6A 4MSSA 2DT2A 1MDRA 3MP3A 2H3DA 1VRDA 1RA5A 5CPLA 3M46A 1DJGA 3P67A 4G1KA 4FB7A 1UBSA 4GFIA 3M0HA 1PB0A 1XINA 3FX4A 2WZTA 3TTOA 3W7NA 4E4PA 5FJOA 3G2GA 3FV9A 4R7JA 1JR1A 3UZZA 1WZLA 1ITCA 2J8GA 1CW2A 2PWVA 5RUBA 2PWDA 5CJMA 2IKHA 2XISA 5HPCA 3LSCA 3KBJA 1TIMA 3OVGA 3GUWA 3WENA 3HPXA 3PNUA 1J96A 1UJPA 4KBXA 3R94A 5LXEA 2VRQA 1EZWA 2INZA 2C91A 2G8ZA 3N15A 1CPUA 2CKRA 1XCWA 2CU0A 2O9TA 3HQNA 1A3XA 1KM4A 3SGGA 3GAKA 4MF4A 4L6HA 3S1XA 3IPWA 2FVLA 4UNKA 2AL1A 1DJHA 3KRZA 4WK9A 2F6KA 4UWMA 4AX7A 1XL9A 4YCOA 3URNA 4CN4A 3DENA 4PMJA 3E9AA 4JFWA 2ZX8A 1TB3A 3ITCA 2WK2A 4FNPA 3QW4B 1V7AA 3ZWTA 3N2OA 3BMXA 3KL5A 4ICCX 1NDVA 4JIHA 4F8XA 5HQLA 4BCEA 1XLGA 1PDZA 3PVFA 3UU0A 4MJ2A 3ES7A 4Z1BA 3CUGA 5HDRA 2E40A 2OSYA 2Z27A 1Q3NA 3ZXWA 2PDLA 3FN9A 4QNWA 3KDNA 4UQ9A 1KGXA 3IVUA 3UBPC 2KAUC 4UTMA 4DZAA 3E5BA 1DOSA 1JUEA 3NZGA 1Y0EA 4O0ZA 1Z6KA 1IIGA 5E93A 2E6FA 4TR9A 1L6YA 1MUWA 4Y8EA 3OP2A 2QDGA 5DANA 4D8LA 4O12A 2QIWA 2ZUSA 2P3ZA 2NVDA 4GNVA 1IT0A 1SFTA 3WKZA 1V3IA 1B1YA 1S1RA 4HNTA 5ABTA 1UH2A 3BMVA 3PM6A 4LVDA 4QXIA 1JPKA 1D2KA 1UA7A 2HMCA 4ZQRA 3VZZA 1AFSA 3R79A 1GUVA 4B3LA 4FIRA 4DEFA 4HYVA 4PGLA 5G1TA 4IXHA 2C71A 4FALA 4C6LA 3RJYA 1EXBA 4ZXOA 2REQA 3IEBA 1DORA 3I3EA 3CL7A 2CKSA 4CNPA 3P0WA 5C0QA 1E9LA 1US2A 5BOFA 3OLGA 1HGYA 2P8BA 2ZRXA 1C9DA 2EG7A 4JTIA 1GQKA 4PTMA 2ZX7A 1EJWC 2V0TA 3QY8A 4JTTA 4AWTA 3RLHA 2BODX 3ZJKA 2IPGA 5DF0A 1X1OA 4RXGA 4ATLA 3LXAA 1FHVA 1UWQA 4JR5A 5LA1A 1GJUA 3F7JA 1HX0A 1HJQA 4ALDA 4N9EA 3NQBA 5PTDA 3DC8A 3O63A 2NV9A 1P1XA 3QYQA 3P74A 4LCQA 1POKA 3OHMB 4RNFA 4QGCA 1A5OC 4AWUA 1R46A 4F0SA 3QPZA 1R2TA 3GFZA 2AKMA 3W7QA 1ZAIA 3WD4A 1L2QA 3LBOA 3M0LA 3IIXA 3LQLA 1J93A 4YMZA 1NAL1 2D20A 4AG0A 3NOEA 3OTRA 3R1ZA 1JCNA 4E2BA 4HSNA 4DWSD 4L6OA 2ZDRA 2EXOA 3A3WA 4ROPA 4O8AA 3H21A 4HZ6A 3LI1A 3NQ7A 1O5KA 5BMXA 2Y7FA 3TN6A 1MVYA 4AEOA 3W7DA 4Y7EA 1JF6A 4UFMA 5D30A 5A8PA 3EOEA 3TKFA 2WZHA 4BI7A 1DIKA 1XGDA 4GVGA 2QCHA 2VR2A 5I7GA 2XGIA 2VC6A 1UW9A 3B3DA 4R7WA 5CPSA 1W9DM 2V38A 2X2GA 1HQTA 1E1CB 4Q8WA 1Z48A 4GC4A 4LNCA 5IFPA 4GNJA 3QYSA 5G4WA 4MAVA 3WLHA 1XSJA 3APTA 1EJRC 3QOMA 1T96A 4PC8A 1ZTVA 1EBGA 1NWRA 2QHAA 3V1PA 5D38A 3Q45A 3WO8A 1LWJA 3PY2A 4WIWA 2Y4SA 1DJQA 3G6MA 4H9TA 1UD2A 2C13A 4YWSA 4ZO7A 5F2GA 2Y0FA 3NQFA 5G4EA 3CIWA 4ADSA 2QKFA 1N8WA 4ACYA 2I5IA 4OQVA 4J3VA 3WQ5A 4HHMA 3R5EA 4R88A 4QEHA 3GB6A 3LM7A 1PHWA 3EMCA 1RBLA 1XYLA 1ZJHA 3WLLA 4N0RA 1JAEA 4LV9A 1PPIA 3PFRA 3UG4A 4TUFA 1RK6A 1V93A 1WO2A 3N6QA 5AYYA 2FIQA 3MT1A 2QXWA 1RQEA 3UWEA 5AVNA 5HJXA 1WDRA 4NAEB 3RX2A 3S6TA 1XIMA 2YL9A 1OF6A 1HJWA 3I4EA 1LCOA 3K4AA 1G4SA 2F38A 1ODZA 3TU9A 5A69A 1HNYA 2MANA 3TXVA 2WPBA 1NOWA 2HRWA 2GJPA 3VTRA 1LM1A 3VNLA 3A9BA 4LVFA 4YTRA 4KIRA 4MOZA 3TTSA 2OQLA 4S2CA 5I07A 3A3HA 4FOJA 3UJRA 3S9IA 2YBUA