4JTUA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with brequinar analogue
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 057
rcsb
source organism Homo sapiens
total genus 139
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtuA00
3L5LA 4MFDA 3P80A 3TFXA 5J5DA 1X7FA 5EA9A 4O4VA 1GWJA 1B3OA 2YYTA 1SU5A 2B7PA 4XBSA 1LLWA 4GUIA 4IMGA 2NXGA 3VNDA 4Z1CA 1KBIA 1HFBA 5BMWA 5DN1A 1L6WA 4R7JA 1KFEA 3HG3A 3W70A 1G69A 2IQTA 3EWYA 1YDVA 1JR1A 1UBSA 1IGSA 1S5TA 2ZDRA 1GVOA 1NAL1 1VHNA 1YPIA 3UWYA 3W85A 5G1TA 4L4LA 4UUIA 2NUWA 5F1VA 1YLVA 3BG5A 2Y7GA 4H3DA 4QJ1A 3HIJA 4XQ6A 2DZWA 1SO5A 3M41A 4RR4A 2J9XA 5EYWA 4UTWA 4GC4A 1YADA 5G4EA 3LBCA 1KFCA 2G96A 3K30A 4UC5A 5LGXA 1VPXA 4IJBA 1W5MA 3LM7A 4O11A 4E0CA 3DFSA 1RV8A 2PE4A 5CZTA 3HPSA 3STCA 4CCCA 3B0VC 3UZJA 1PIIA 3PUDA 3W9ZA 3PF3A 2PCQA 1SSGA 2C1HA 4XUGA 3TROA 2BXVA 1KFJA 1TIMA 5IBXA 1QR7A 1JCJA 5F4WA 4K7YA 5BNKA 2YYUA 4KWVA 1SFJA 4O16A 3NPVA 5K7JA 3DI0A 2Q3RA 1OFPA 2QAPA 4NVTA 1DL3A 3CT7A 3MBFA 4K8EA 5AN7A 1LBMA 4Y9AA 4JIPA 3W75A 4S2CA 3PBVA 3CIXA 2VKZG 4M6QA 1P1XA 3DI1A 4ZQRA 3OIXA 3M0ZA 1LBFA 4OGZA 2ZA3A 3EWXA 4HPXA 3DFQA 3OVRA 3MHUA 3STFA 4BI7A 4A2SA 5HQEA 1N55A 5D09A 4HNTA 4XZ9A 2QJIA 2KZHA 5HMSA 1GVSA 2OZ0A 5K9CA 3HO8A 2F7FA 1T8XA 2A0NA 1YTEA 2X1TA 3OA3A 1EPXA 5L6UA 5DCEA 4UMCA 1C9DA 1LLZA 2YXGA 3FYPA 4WY0B 3DXIA 3BW2A 3KX6A 2BTMA 4JTFA 1EWEA 3MMTA 4EF8A 3HPZA 5KMYA 3N9SA 1R2RA 4BI6A 3KXQA 1I2NA 1GTHA 5LHEA 2H90A 2W0UA 4M5PA 3LERA 5D37A 5FF0A 4JTUA 1YTKA 2HTMA 3LOTA 3LRMA 3W71A 3N34A 4FEZA 3QQ1A 2C14A 2TYSA 2V5LA 4A21A 3LCHA 4WY0A 2F84A 4O10A 3TNOA 4NXKA 2QR6A 1XC4A 4BF9A 2I9EA 3NQDA 3PVFA 1XKYA 2NUXA 3MO7A 3TU9A 3ATYA 4IX2A 3T40A 5L9FA 4XBKA 1ZALA 4O14A 3IGSA 1H7NA 2E1DA 4FB7A 2ZFAA 1XBXA 3P82A 2YFOA 2QCFA 4X2RA 3ZWTA 4YMZA 2RH9A 4AMAA 1FXQA 3KVKA 5C55A 1F7BA 1YDNA 1LRQA 3PWAA 3UZ5A 5H2ZA 4AB4A 3CC1A 1WDWA 1K02A 4QNEA 1LORA 1PCKA 2ISVA 3P7YA 4TMCA 1OK6A 4MY9A 3C0JA 1XBVA 1X1OA 2NLIA 3BGGA 2JGQA 3HG4A 5HWMA 4Y96A 5LKYA 4I7WA 4LC8A 1G7VA 1W3TA 3I6RA 4TO8A 4M7TA 1H50A 1FQ0A 3QPZA 1RPXA 3PS7A 1GVFA 3DHDA 4FNSA 3QSRA 1ZNNA 3EKZA 4HPJA 3A23A 4NJKA 5I3HA 2Y7FA 2PC4A 4C1LA 1LZOA 2BX7A 2EF9A 1GTEA 1SPQA 3MP4A 5I3IA 1YYAA 3W1MA 1P0KA 3N3MA 2O7QA 3M5YA 2CZDA 2VENA 3WJXA 4YL2A 3R2GA 3M1ZA 2EKCA 1IF2A 3GAYA 3PBYA 4DF1A 1TTIA 1SQ7A 2C0AA 4LVBA 1ZY9A 4Z0JA 4DQWA 1TTPA 4IQLA 3UWWA 3A22A 4IPJA 3NO5A 3E12A 4BR1A 5HWJA 1J4EA 4PL2A 3CPRA 3PULA 4J9JA 3O06A 4P2VA 5D02A 3C56A 1ZCOA 3TSBA 3QJAA 1XM3A 1KFLA 4JYEA 3SFKA 4UTLA 5FI8A 3LI1A 2Y70A 3P67A 3BV4A 3NQ7A 4JXCA 2WSYA 2YR1A 3W2LA 2J88A 2C19A 3VI2A 2QJHA 1QPRA 2H8ZA 1E51A 3M7WA 4UTUA 6ALDA 1Q6QA 4WJEA 3I7SA 4R53A 2NWSA 3RLVA 4NJIA 3UY8A 2A5HA 4DELA 3GIYA 2AAMA 3IEBA 2DU2A 2QCMA 1RZMA 3BGJA 2B7OA 1LRTA 4Q33A 3LB0A 4AXKA 1TJPA 3TMLA 3H53A 3GNNA 3T44A 3R12A 5HNRA 2R8WA 2WNZA 3TX9A 3BVJA 3WK0A 1R2TA 4UFKA 3N9RA 3WJSA 1N8FA 3L0GA 5CG7A 4ONVA 1PVNA 1U5JA 2ZRZA 3NL3A 4ZQMA 1DVJA 2A7NA 1TPEA 4CNPA 3NL5A 4O12A 3G0UA 1I4NA 5DELA 5DBUA 1UB3A 1R30A 1OX4A 1B57A 1H7WA 1LOLA 4LW7A 1TPFA 3NYZA 1C8VA 2QAFA 2TPSA 2YW4A 3SW6A 5FEZA 4DBEA 2DZTA 1FCVA 4WX2A 1B9BA 3Q94A 1G4EA 3L5AA 1ICSA 3P8JA 2I14A 3L65A 1JQVA 5EY5A 3P74A 3CWNA 1TPVA 1TCDA 3O63A 1QPQA 5FEXA 3M43A 2JBMA 4WY0F 3U6WA 3LXAA 1VJIA 1BKSA 1EP3A 3QF0A 4XKYB 1PV8A 1TPC1 1YTDA 2OCZA 4OU1A 3RU6A 3SJ3A 3W7CA 3DFOA 1SUXA 2NXHA 3O6CA 2WJZA 2AGKA 4JY9A 2QF7A 3M16A 1LBLA 3W7QA 1SZNA 4NJJA 2ABAA 4IX0A 2BWGA 5DY2A 1ZJIA 3LCFA 4OV4A 1HO1A 3RF9A 3D0CA 3WJYA 5F2GA 1UJPA 4O57A 4EVZA 3QPYA 2NXIA 4P61A 4FIQA 3QW4B 4XKYA 4Y90A 1H7XA 2V2HA 1XUUA 3GYEA 1SZFA 3GZ3A 5E93A 3G24A 4WXYA 3LV5A 4N9DA 1HL2A 3UPBA 4PH6A 3DU0A 1TQXA 1P0NA 2NZLA 3ABRA 4C1KA 1SW3A 2E6AA 1FCBA 3LRLA 3GLCA 1W37A 3GXTA 3M5XA 2A7PA 1AMKA 2GQAA 2VFEA 3NNTA 1KLZA 3G1XA 4OV9A 2TRSA 3MWAA 4YCOA 3P8IA 4O52A 3OHIA 2A21A 3W76A 3TJXA 1IIHA 1R47A 3C2OA 3N19B 3P60A 4FX7A 1KFKA 1MSSA 2H6RA 4UTWC 1EP1A 3LI0A 1XCFA 3GB6A 2E5CA 4JTEA 3PB2A 1A5CA 1ALDA 4LWWA 1QDSA 3W7RA 1JVNA 3FKKA 1S5WA 2EAWA 4M6PA 1KM6A 4HNUA 2QDGA 4NJGA 4K8HA 3O15A 4GXMA 1WOAA 1I45A 4A3UA 4IGHA 3PUEA 1ZENA 4MZ8A 3TE9A 1RVGA 5FEPA 1EB3A 3LHZA 3SR7A 3EWWA 1FDYA 2Y85A 3R89A 3W2MA 3T78A 3LX9A 1W31A 5IBXC 3L9CA 3S0CA 2R91A 4JTKA 2WPBA 4JYFA 4LY8A 1VLWA 3PBUA 2Y7DA 3EB2A 3L67A 1H51A 1M5WA 3YPIA 3ABQA 3NR0A 3HOJA 1AL8A 5LNWA 3EWZA 1VGAA 3W1AA 3NDOA 1A5AA 1Z41A 3IV3A 2OJPA 2E5DA 2QKFA 1DBTA 3C2EA 3CHVA 3NA8A 3T4CA 1CW2A 1O94A 4CQ8A 5CPNA 3UWUA 1IIGA 3VE9A 1CI1A 1G4TA 5D04C 1TB3A 5CPLA 3EX4A 4NZFA 1JJKA 1PHWA 1I2PA 4HNNA 3S9YA 5D2TA 3PR2A 4O8RA 4QITA 3NOEA 5BOOA 2Q8LA 1XBYA 2ISWA 4IUOA 2X2GA 1L9WA 4Z0SA 5AC8A 2RDUA 2VOMA 4IMDA 4UFHA 5FF2A 2GUUA 3W7MA 1KBJA 1AK5A 3BG9A 3F4WA 3L66A 3U8GA 1A5BA 3GXPA 3HGRA 1FWNA 1WOBA 3IRDA 3KRZA 2PURA 2J9YA 1FUYA 3PG9A 2B4GA 2CFFA 1AW5A 1J2WA 4O1BA 3I65A 3WK2A 2CLFA 1W5OA 4PCFA 4RZ5A 2OX1A 3THAA 4PODA 2C13A 2DZVA 3B06A 4KKXA 4LRSA 1TPDA 5LNUA 1DQXA 2WQPA 5KTLA 1TV8A 4JX5A 5D2YA 1FXPA 1GG1A 1FWTA 3VFLA 4YCPA 4Q4KA 4RK8A 1QAPA 5D38A 1ONRA 1TREA 4MZYA 3EXTA 4JDBA 3UY7A 1WBHA 1WAUA 2JKEA 2V0TA 1NVMA 2P10A 3LCLA 3G1HA 1JQXA 1VR6A 1OFAA 3LV6A 2FB3A 4AF0A 1ML1A 4XWUA 4Q32A 1HG3A 4N9BA 2VFGA 2FJKA 2CU0A 3A24A 1KM3A 4WD0A 2RHGA 4MLRA 4ORMA 4Y6GA 2GJNA 2UV8G 2W79A 3A5VA 4PL1A 2C18A 4POCA 4NX5A 1W8SA 4NNBA 4AHQA 5K4ZA 1EWDA 3JR2A 3TW7A 3LTYA 4JN6A 5KSWA 3HGOA 5G2IA 3LCXA 4UR7A 1OABA 4O0KA 3N2XA 4DXVA 3G1YA 3NQ2A 4MJMA 4UTJA 2DZXA 1V7YA 4GFSA 5F2LA 3FYOA 3AO0A 3ATZA 1KFBA 4BK9A 1KM5A 4OQVA 3N2MA 1XI3A 2VFFA 1EEPA 4FNUA 5FEWA 3SGUA 4ZQNA 1JUKA 1WBJA 1G67A 3NAVA 4MLJA 1LOQA 4NQ1A 2AQWA 4FHAA 3TXZA 3E02A 3FJLA 3LHYA 3O1NA 2G97A 2FFCA 4GE8A 4DBDA 1VZWA 1TPH1 3QMRA 3W73A 2V9DA 2ZZ4A 1EUAA 1VH7A 3W87A 2Q3OA 2Y62A 4JEQA 3EX6A 4MUZA 4MYXA 3MW7A 1K8YA 4NXSA 1A50A 1FWSA 3R13A 3TQVA 3W84A 3EX1A 2A4AA 3BW4A 3LCWA 4NUWA 2BZNA 4H4IA 4FIRA 4JD4A 4JTHA 3E49A 2OT1A 1IXQA 3EWBX 5LNRA 3UD6A 1F05A 2ZRUA 5BW6A 2QUVA 2Z6JA 2JK2A 3KRUA 5I3GA 4RCXA 3S1WA 4PTNA 3PY2A 3TCEA 1SR9A 3G3DA 3IIZA 4HNVA 1KM4A 3LHVA 1VCFA 1TRDA 2W6RA 1RQEA 3H54A 1H5YA 4W9TA 5D03A 2P0OA 1SW0A 5F2IA 3GVGA 1YDOA 2CLOA 2R14A 3G18A 3C6CA 1GVQA 1NSJA 2J6XA 3FKRA 4K39A 1FX6A 2Q8ZA 1ZHAA 4O50A 5BMXA 1H61A 1A5SA 2C16A 5IM51 5H91A 1MXSA 1OG0A 5LNSA 1W56A 1MEHA 3V1PA 4GUFA 3BLIA 3C4UA 5FF3A 5K2ZA 3AJXA 4HN4A 2TMDA 1D3GA 3M5VA 3HQ1A 2A1YA 5MHBA 3FOKA 3DFNA 3H55A 2ZCGA 2ZRXA 3CQ0A 4JNMA 1MEWA 1O95A 5D2VA 2WNQA 3FIGA 1XUZA 3W7DA 5HUPA 4O17A 3BO9A 2X16A 1VRDA 3SI9A 1JRBA 4A2RA 2P1FA 2QCEA 4JX6A 3NZRA 1JUBA 2H3BA 1OFEA 3ABSA 1Z42A 3W7LA 4WZHA 3ZS4A 2Z6IA 1Q6LA 4LVGA 1AW1A 5CZSA 4NJHA 4BWLA 2HS8A 5CSSA 1H7RA 3G22A 5E0KA 5AC7A 4XTIA 4LS1A 3CB8A 4ZVJA 1S5VA 1RQBA 1O5XA 2E6FA 1GPWA 3P5YA 4HSNA 5HUOA 3ELFA 3NQ8A 3W1TA 1VYSX 1D3HA 4NNCA 4UFLA 4NX0A 2VEMA 4DO5A 3IIVA 4WOQA 2OT0A 2V82A 2FPYA 5HJLA 4HSOA 3OVPA 1DHPA 2E77A 4ORIA 3EXSA 5AB3A 4WQ6A 4QISA 2VFIA 4G1KA 4JS3A 4X9SA 3FLUA 5KZDA 1NF7A 3MI2A 5K9DA 1I2QA 2JKAA 3QC3A 3BARA 1H60A 2FPVA 4UNKA 2CW6A 3KHJA 5D32A 3DGRA 4MOZA 5AC6A 1BTMA 1LP6A 3DFPA 4DPPA 1OX4B 5U7SA 3W1UA 3L0NA 1ME9A 7TIMA 4JTGA 3NPWA 2CLEA 2ZZ6A 1ME7A 2E6YA 4I7VA 4LVDA 1OFOA 3IVUA 1OHLA 4UTTA 3UYCA 2J27A 1IXOA 3W7NA 1WYIA 2RDWA 3W72A 3NQFA 4N6FA 5E1QA 1LROA 2C3ZA 1QO5A 1FY6A 1K7FA 3TKFA 1KM0A 2B0MA 4KFOA 4RJEA 2A6LA 2ATSA 4ALDA 5G2WA 3WJZA 4CNNA 3W1QA 2DZPA 2NX9A 4QM1A 3C2VA 3DENA 4U4MA 3E0IA 3HGJA 4RLIA 5LSMA 4UTIA 3QMSA 1KW1A 1PS9A 4FF7A 4JTJA 4E38A 3CTLA 4D2JA 3EX3A 3SZ8A 5CKSA 4MKNA 3SSJA 1BWKA 1DQWA 3KFTA 4IOTA 1Q6OA 1B4KA 1OYAA 1VYRA 1F6KA 1PHQA 3QM3A 3A5FA 1YXCA 2PRMA 3W1RA 4PA8A 3L5MA 4FNQA 1LDCA 2HSAA 5AHIA 4NU7A 8TIMA 5FESA 3W88A 3MI6A 3W1XA 5HR7A 1T0OA 1TRIA 4UFMA 3OG3A 3QW3A 4R33A 4K7VA 3TQ0A 3S5NA 4PFMA 4R34A 4XTDA 4MY1A 5AHNA 1EA0A 2EGZA 1LRNA 3GDTA 3VCRA 3M5ZA 1GYLA 3QQ0A 1TMHA 2WNNA 5DXXA 1SO6A 3I7QA 5F1UA 3PUOA 3W2JA 1X1ZA 4JTLA 3KVLA 4OT7A 3IGXA 3W74A 1W5PA 3B0PA 4MFEA 2WKJA 3TW6A 3C61A 5EBUA 1TSIA 4GRSA 1Q45A 2ATMA 1T99A 2CLHA 4K6AA 4BFAA 3LCGA 1WA3A 3NQGA 3O6YX 3UXDA 1VCVA 1NEYA 2D73A 4O4WA 4CQ9A 3IIOA 3G1VA 1GYNA 3W22A 3MHGA 4MJZA 4AH7A 1UCWA 4DEFA 2ZTKA 4JX4A 3SECA 5LZLA 3W7PA 5T26A 5K3VA 2QCHA 1DOSA 1KV5A 1TJRA 4H6KA 3PSVA 3MBDA 1SSDA 5I3KA 2H3DA 3A21A 1IXNA 4AWSA 1UUMA 5DCDA 3S6DA 1Y0EA 5DBTA 2BSLA 3N73A 3GKFA 5A8GA 4O53A 3NQVA 2J24A 1ZFJA 1WQ5A 2ZRYA 2WSQA 2DP3A 2A7RA 2NX1A 1TPUA 3GKAA 4MY8A 2A85A 2WSRA 4GNJA 5F4XA 2O7SA 3L68A 4DF2A 3WFAA 3GDLA 2FTPA 2VELA 3P62A 3EEGA 3TUUA 1GOXA 1TYGA 1VCGA 3HJZA 3R5EA 3LBMA 1FBAA 4KFNA 3LTPA 1QPNA 1O4UA 2NV2A 1W3NA 4X22A 5AYZA 3C2FA 4EOUA 1XXXA 4O19A 2CLKA 5TBOA 4O54A 4I7UA 1K7XA 2YZRA 3PM6A 3NVTA 1GT8A 3GR8A 4HHPA 4PC8A 4LUIA 1RR2A 3CLMA 2B7NA 3ABOA 3VE7A 4UR8A 1OX5A 1SZGA 2Y7EA 3INPA 3S8HA 3QRHA 4S2BA 1K03A 4BI5A 1ZAJA 2ZA1A 4U28A 5KZEA 3DBPA 5BRBA 2XN2A 4O1DA 1K8XA 2A2IA 3TK7A 3UWVA 5TQLA 3B04A 3LDVA 3RNDA 2PRLA 5C6MA 3BK0A 1DV7A 1NF0A 2HS6A 3W83A 2NX3A 1VC4A 3TH6A 3ZFHA 2YW3A 2NV1A 3LLDA 3TIMA 3TA6A 1OK4A 4DO6A 4NT0A 4QAIA 4AWUA 4RXGA 5CZJA 1G6CA 1L2UA 2YSWA 4NZJA 2VC6A 2DJLA 4GWEA 4TR9A 2V5BA 3NEVA 3BLFA 3FEMA 3W2UA 1I8JA 2C15A 2Z2UA 1W54A 2XFWA 3LTSA 2TSYA 4OE7A 2YFNA 3W1LA 5K9XA 3DKLA 2DORA 1S3HA 4JYDA 1TTQA 2Y63A 1K3UA 2V2CA 2FIQA 2CZ5A 1JCLA 2ZZ5A 4AF0B 2GQ8A 3W2NA 3LHUA 4GUHA 4N9CA 2YDAA 3NM1A 5G2HA 3CU2A 3GDRA 1X6UA 4FO4A 2R94A 5LHFA 5AYXA 2Z1BA 3W6YA 1XDLA 1T96A 4S1FA 1OF8A 2E68A 4LV4A 3LHWA 3UWZA 3RMJA 3KVMA 5HINA 3DH7A 5U4NA 4DPQA 3HG2A 5TIMA 4WOZA 4EWND 2I1OA 3RFAA 5C54A 4LNYA 4LVFA 3NGJA 3NPUA 3G3MA 1JRCA 4UCGA 3DZ1A 1HTIA 2GJLA 3OEXA 4K36A 4LVAA 4ADSA 4RZ6A 1QOPA 3I68A 3G1AA 3O8AA 3JS3A 4IMCA 1PL9A 4E2DA 5K4XA 2JGYA 3OVQA 4JTIA 2RKXA 3L2IA 1X8FA 1LM1A 4LT9A 5CGQA 3W7KA 4YLWA 3GX9A 4JR5A 1YXYA 4Z1DA 4QSHA 1PE1A 2QCLA 4FNTA 2QCNA 4AAJA 5AHLA 1SZEA 4CQAA 1FCQA 1TPB1 4JGDA 4JY8A 4OBTA 3UWQA 4O0ZA 5AYYA 5A5WA 3UPWA 2YGYA 3NQ6A 1ZAHA 4BWLC 2ALDA 1GEQA 1Q6RA 3F1QA 2QDHA 1H1ZA 2VFHA 4A29A 3STGA 4FX8A 4GUGA 1MO0A 3A9IA 4MIMA 3QFEA 1SO4A 2ZBTA 1TO3A 3O07A 3NM3A 5D2WA 2V81A 4LC6A 1LCOA 2X1RA 3W23A 5EKYA 1IXPA 1JUEA 5FF4A 4B5NA 1Z48A 4UXDA 2ISSA 3NQMA 3SIZA 3M6YA 1TV7A 2X1UA 3CWOX 3P5ZA 3L0KA 1Q3NA 3Q37A 2CZEA 3ZR4A 3RLUA 3W7JA 1W0MA 4K37A 4DO4A 5CSRA 3GDKA 1XFBA 1TTJA 3MYOA 3P61A 1K7EA 4JIQA 1M7PA 4LS2A 3IIXA 5AOUA 1KTBA 1VLIA 3EXRA 3G8RA 4A22A 3FJ6A 5D2XA 2ZZ2A 2HMCA 1LOSA 3NPXA 3I7RA 2ZZ3A 3QYQA 4ZQPA 4FX6M 3N14A 1OFQA 4AWTA 4CLMA 1W1ZA 3MJYA 3MI3A 2PRHA 3E9AA 3V75A 5D30A 1LYXA 5F4SA 3B05A 3FFSA 3W7GA 1F6PA 1FWRA 2V8ZA 3W7OA 4N9EA 4M6VA 4CNOA 2ZRWA 3Q2DA 5J5RA 1F74A 3GNDA 4UTTC 1TQJA 3S5OA 3G0SA 1Z44A 3O05A 5F2MA 4QQ3A 2ZZ7A 3WK3A 3PSWA 6TIMA 3GK0A 1NFBA 1JCMP 5AFDA 2QCDB 3NXFA 3PB0A 3S5YA 1OYBA 3BG3A 5HR6A 4UTKA 2NUYA 5EMUA 2Y61A 1W5QA 1BWLA 1R2SA 1SW7A 1QMLA 4WUIA 3TQKA 1HO4A 1EX5A 4O15A 5C2XA 4TX9A 3CEPA 3TSDA 3EKLA 5EL1A 3S42A 1XDMA 1VHCA 5DCBA 3TFCA 3HMJG 3S5ZA 5AHMA 3W3OA 2QCDA 3TR2A 3NG3A 4UIOA 3ZWSA 4AHPA 1P4CA 4JDYA 4UTHA 4MZ1A 4O18A 3QSTA 1CX9A 1JCNA 1OFBA 3B4UA 4AEOA 4UNLA 5G5IA 4X3ZA 2CLMA 4UMAA 3MUXA 3F03K 4LV9A 2H8XA 4O13A 3GDMA 2XN1A 4ZL1A 3QH2A 4UTMA 4JICA 1TPWA 2BLEA 4HIBA 3TMQA 5C5YA 3U2OA 3NQEA 1KV8A 1H63A 1ME8A 3BLEA 3CIWA 1RQHA 1HUVA 1EP2A 3IGUA 1M6JA 2YPIA 1L6SA 2NWRA 5LNVA 2EHHA 2WO5A 3O16A 3TAKA 4ADTA 1JCXA 1P5BA 3M47A 1OF6A 3W86A 1G4SA 3DKJA 1L6YA 2JKPA 3KRSA 1KA9F 1OVDA 1OYCA 2V30A 1QNVA 3EWUA 2FLIA 2ZQ0A 3EX2A 1QO2A 5AHEA 2ZRVA 3W2KA 4KWWA 1XBZA 2QUUA 2LLEA 1FWWA 2YCEA 3MP3A 1THFD 3TDFA 3PC0A 3G0XA 1SO3A 3T7VA 3GXNA 1ADOA 4M7SA 1GQNA 1LTDA 3MYPA 1EUNA 1VQTA 3BW3A 3RK8A 4PEKA 1RD5A 3GAKA 3SY5A 1U83A 1SFLA 3KVJA 2GPTA 3QEZA 3NL2A 1N7KA 5D05A 3UNDA 4FNRA 4WXZA 4UFIA 2E09A 4ML9A 2B7QA 1H1YA 3F4NA 3DAQA 1R46A 5CZ0A 3W07A 2QJGA 4O1AA 1XL9A 2OMAA 4JTTA 4MYAA 4M19A 1OX6A 3UXAA 1FDZA 3QZEA 3HG5A 4DF0A 1KM1A 1VYPX 1ICPA 5LGZA 4GBUA 1UUOA 4Y8FA 3W7EA 3LCIA 3STEA 1KTNA 5HULA 3S1UA 3TSMA 2G5WA 4E2BA 4GJ1A 2X1SA 1QCWA 3MHFA 1DORA 1F5ZA 2ZTJA 5KINA 2VXNA 3C2RA 2GVJA 3TC7A 4ZZ9A 1GVRA 5I3FA 4N4QA 1MEIA 3G1DA 3C8FA 3THQA 1KLYA 2DJXA 3LXBA 1GZGA 2Z0IA 4IWWA 3IVSA 5HWNA 2FB2A 1W3IA 3S1XA 2GVGA 1VS1A 3VKJA 1QPOA 4MPQA 4LU0A 1I2RA 3MP5A 2A6NA 3W7HA 4ICNA 4ZMGA 1QWGA 4N2YA 3KOFA 2VEKA 4EIVA 2RFGA 4ADUA 3LXCA 4LTSA 4I9AA 3DFTA 3W1PA 3HF3A 1DJQA 1BEUA 4TU1A 3S1VA 3HPXA 3IIPA 3OBKA 3LHTA 3G8EA 2GQ9A 3FA5A 5D33A 3C52A 4LUJA 4MVAA 2C6QA 2Y89A 3G1FA 3KAOA 4O1CA 4AHOA 4EF9A 4TMBA 4UMBA 3P84A 4GUJA 5SWUA 3LRKA 3E96A 3HBLA 3W7IA 3WK1A 3TAOA 3NZ1A 3PBWA 5AHFA 4N4PA 4KFPA 3UQNA 4IMFA 1DJNA 3SGZA 1GG0A 3C3NA 3PG8A 3ANYA 5G1YA 1H62A 1MZHA 3M44A 3LGEA 4FXRA 2X30A 3CEUA 5DXYA 5G4WA 5KZMA 3FS2A 2WOQA 3M9YA 1AW2A 4RXFA 1H7OA 3R8RA 2RDTA 2VEPA 3O6DA 4O28A 3TXVA 3G1SA 3WJWA 3TJLA 1ICQA 3PAJA 1QFEA 2DZUA 1FDJA 2E5BA 1KTCA 3B0UX 1WX0A 1OFRA 1TV5A 3LLFA 1W5NA 3BPWA 2CLLA 1YXDA 2ABBA 1JCYA 2Y6ZA 4HT3A 4OHQA 3TV8A 2E6DA 3Q58A 4JTSA 1J5TA 4CCDA 2EPHA 3T55A 2GOUA 2J9ZA 2QEZA 1DKWA 2FPTA 4RZ4A 2FDSA 5GVJA 4QIUA 4NNAA 3W1NA 1QOQA 3HB9A 2QUTA 1A53A 2VFDA 3L21A 1H7PA 1GJPA 2V2DA 2XN0A 3TC6A 1JULA 2CZFA 2CWNA 2CLIA 2G95A 1KM2A 4OWGA 4RX0A 5DLCA 4FNPA 4Z1AA 4Z08A 4IXXA 4QNWA 5CPOA 2ZA2A 3USBA 5FF7A 1M7OA 1F76A 3HGSA 5KITA 1O60A 4LS0A 1V5XA 3CM4A 3JRKA 2VEIA 4IXHA 4IMEA 4HKPA 1F73A 4ZQOA 1D9EA 4YWIA 2YX0A 4RV8A 5EPDA 1ZAIA 1AL7A 1PCWA 1OFDA 1FCUA 1YPFA 2ZYFA 1WV2A 4TIMA 3DHFA 3P81A 4AVFA 4Z1BA 1UASA 4ZQCA 1WXJA 1G4PA 1G7UA 1F2JA 1AG1O 3NQAA 4N6EA 1OJXA 3QMTA 1C29A 2QCCA 2ZZ1A 3IVTA 2WV8A 1EIXA 5ABTA 3NL6A 1K8ZA 4UFJA 4N02A 4RKAA 2FQIA 5DY3A 1O5KA 3B8DA 3GR7A 4L4MA 2Y88A 3NQCA 4IPIA 4K38A 5I3JA 4LOCA 2GVLA 4FXSA 5CPMA 4CCEA 4YXGA 2DZSA 4LRTA 1I2OA 1B4EA 3B03A 2QCGA
chains in the Genus database with same CATH superfamily
5D9OA 1MUMA 2RGLA 4ZTXA 3B9NA 3EOEA 4CKQA 1X7FA 2YYTA 1SU5A 2B7PA 4XBSA 1LLWA 4IMGA 1JGIA 4Z1CA 3CHEA 1TMLA 1ZBWA 2FKPA 4QLJA 3E2SA 1OC5A 3NTYA 3TZFA 3N6HA 3P14A 1W17A 2HRWA 1Y5XA 1XC6A 1ZBKA 4P8UA 4IFKA 3D6NA 4IICA 1YDVA 3EMZA 1NAL1 2XFRA 1YPIA 2WCSA 1J6OA 1OM0A 2WBKA 4WDXA 2NUWA 3OYXA 4Y9NA 3WF4A 5F1VA 4DBWA 1YLVA 3RXZA 5I5RA 4GI8A 5IDZA 4QJ1A 1FA2A 3HIJA 1PPIA 1J8VA 4XAYA 3A3HA 2OQYA 3RJYA 3M41A 1GOMA 4GC4A 1A5UA 2G96A 4MPKA 4UC5A 5LGXA 2O9TA 1W5MA 3WY1A 2VGBA 3GC4A 3GIQA 4NP7A 3E74A 2PE4A 4PRTA 4EACA 3UZJA 3BSGA 1RCQA 2DT3A 2FMOA 3LGDA 2VD9A 1KFJA 1TIMA 1JFHA 5DRCA 4K7YA 1OC6A 1SFJA 5K7JA 2Y8VA 3VMPA 3HU7A 4J3WA 2VRQA 1E4MM 3PZUA 4S2CA 4N7QA 2BXYA 2VKZG 5I02A 1P6CA 3JU2A 5HBFA 2QUMA 3B8UA 2J66A 3DFQA 1TUXA 4HNTA 2QJIA 5HMSA 1GVSA 1ZGDA 4LAZA 3NO3A 3HO8A 2A0NA 4W7WA 4A8NA 5EFFA 2X1TA 1UWAA 1XYCA 3OA3A 1SFSA 2QVHA 5TF0A 3BV7A 1C9DA 3FYPA 2PTDA 3DXIA 2W27A 3ZT5A 3MMTA 1RJQA 1ITCA 2PDIA 3N4AA 1O5RA 3N9SA 2GJXB 1Q2SA 4BI6A 1F4AA 1NQ6A 5JMUA 1I2NA 3QR1A 4F2TA 3OG2A 4M5PA 4QE5A 1W9PA 2CBIA 1J0YA 1YTKA 3QQ1A 4UWMA 1TV2A 1S1PA 2QR6A 2WKGA 3VIPA 2I9EA 3NQDA 3FV9A 3IJLA 2NUXA 5BRPA 3H2EA 1E56A 1TVLA 5JIWA 3WUFA 3K8LA 1D8WA 3MO7A 2GJXA 2C1IA 3WN6A 1ZALA 4O14A 5EMLA 4F40A 1H7NA 4GCAA 3SRDA 2MANA 2E1DA 1RHCA 2ZFAA 3L4TA 3TTQA 4OFCA 1XHGA 2QCFA 1Q6EA 4YMZA 2RH9A 3KVKA 1YDNA 5LIXX 3WNNA 3UZ5A 1O66A 1K02A 4QNEA 4P8WA 2ZOXA 3RYSA 3H4GA 4NF7A 2G4FA 1M7XA 1KQYA 1VIZA 4DUXA 3CZJA 1EF3A 3NZQA 2BOFX 1UR9A 3VOFA 4BKNA 5JH2A 4Q8MA 5A6MA 2XSBA 1JNEA 1OIFA 1NY1A 3A23A 2Y7FA 2VO5A 1XYFA 1JDCA 1E55A 1UUQA 4DN1A 4B16A 4B15A 2EF9A 2OZTA 2XPKA 1OGGA 4E4PA 4AD3A 2CZDA 4H8VA 4YL2A 3CHCA 3AMCA 2EKCA 3AXHA 3BZGA 1TWIA 5I77A 5LXXA 1SQ7A 2D69A 1CBGA 4UTFA 2W66A 1E5NA 1PKMA 4IQLA 3TWBA 4L9XA 3E12A 2BODX 4YU1A 4PL2A 4W5ZA 4PMZA 4U33A 3CNYA 2O4MA 3AI0A 3P2VA 4NZ4A 5MF5A 4XIMA 1NWRA 2GGHA 3MVTA 4HMCA 4P7LA 3QY6A 2R1KA 1J6PA 2WB5A 3R0UA 2YR1A 1Q8AA 2J88A 2C19A 3W29A 1BD0A 3OGSA 5A6BA 4M51A 1V3JA 1ZUAX 3M7WA 4UTUA 2VWSA 2J75A 2NWSA 1M41A 4NJIA 1US3A 2A5HA 3SY1A 1JZ3A 4DELA 1H4PA 2ALRA 1VJZA 3RCMA 3AS1A 3LEPA 3V36A 2DU2A 1JYWA 1Q4WA 3VNYA 3GTIA 3LB0A 4Q33A 4HB7A 4AXKA 3ZT6A 1ZCCA 3H53A 1TX2A 2R8WA 1X96A 3WK0A 1RVKA 2PDWA 2ZUNA 3N9RA 3H2NA 1V02A 1N8FA 1US0A 4GXPA 5E70A 3APGA 4ZQMA 1DVJA 3FNDA 4DWDA 4W87A 2QHAA 1R30A 1NARA 1OT1A 2PEVA 1P0BA 1QASA 1C8VA 3MUY1 1BVWA 2V3EA 1QI5A 2YW4A 3AMLA 3P8JA 5CJMA 2I14A 4YPJA 5EY5A 3CWNA 3O63A 1TCDA 2VCBA 3SGGA 4LEFA 3BLLA 1V6WA 3IAPA 2C8NA 4KMQA 4JIIX 1VJIA 1O12A 1EP3A 2WAGA 3AUOA 3DFOA 1SUXA 3BAXA 1CGTA 5EMYA 4R9XA 1HZYA 4KCVA 1ONEA 2XWDA 3M16A 1NDVA 3QOMA 1M1BA 1G0CA 2BWGA 2DY3A 4OV4A 1HO1A 3RF9A 1POJA 2G3JA 4O57A 4EWJA 4FIQA 3TYDA 4G8TA 4DM2A 3B0YA 1H7XA 4EXAA 1AD4A 3WQWA 2BGSA 1R85A 2OGJA 3GZ3A 1U22A 1UD4A 4GIRA 3LV5A 5HNNA 3UPBA 5C9UA 1ZRQA 4ZO9A 1ENUA 4PH6A 3THCA 1PTDA 2XHYA 1SW3A 1RP8A 1FCBA 3LRLA 1W37A 2A7PA 3B9OA 2GQAA 2VFEA 3NNTA 1KLZA 3D5HA 1G94A 3MWAA 2WZTA 2QJNA 3P8IA 4O52A 3OHIA 1G9HA 1ODUA 2BMBA 1IIHA 5LA0A 4QE1A 1TR1A 1KFKA 2L5HA 4CQDA 1QK2A 3SCQA 3K5XA 1CCWB 1MSSA 2WMFA 4UTWC 2PA6A 4UQDA 2PLMA 1DEDA 2ANUA 3PB2A 4I9MA 1JVNA 4M6PA 1ISYA 2QDGA 3NVDA 3O15A 4GXMA 4AIEA 1ZENA 3CH9A 4DIAA 3CPUA 5H6HA 1EJTC 4DUOA 2WPGA 2HCVA 1FDYA 3R89A 3W2MA 5C9XA 2OTDA 1M01A 2NLYA 4JTKA 2XYLA 3SCSA 3BTNA 1KKRA 3PBUA 2Y7DA 4DUWA 1UWIA 3EB2A 3WD1A 3YPIA 3TCSA 1JPDX 3KCJA 5LNWA 1VGAA 3NDOA 3IV3A 1JEZA 1UWSA 2F6XA 1DBTA 1CW2A 4N0RA 4MUPA 4UOQA 4CQ8A 4X0NA 3ZLHA 3UWUA 1IIGA 3VE9A 3WD0A 1TB3A 5CPLA 2FVKA 1JJKA 1A47A 1RAKA 4XZNX 4HNNA 3PR2A 5BOOA 1JPMA 4PMYA 1W3LA 1DYSA 2VHLA 1EFZA 2J78A 2OWXA 3VGEA 4PB4A 1ZB5A 1H11A 8XIAA 3AFBA 3BG9A 1MFVA 1RH9A 3F4WA 1A5BA 3HGRA 3II1A 2WC4A 1X1NA 2CFFA 2JQXA 2VQUA 3LA4A 1SMDA 1FWCC 1J2WA 4ML4A 3K1DA 4E2VA 1E6SM 4RZ5A 3AS2A 4WEVX 3V3WA 1ZU8A 3BAWA 2EO7A 3DEQA 3VIIA 4PODA 1W32A 4YYCA 4ZEPA 3B06A 4YIWA 5DT5A 4XX6A 3UZXA 1MXDA 3I3EA 3RPMA 2R1MA 3VOIA 1EBGA 1FWTA 3VFLA 1M04A 1QAPA 3CL7A 1RY8A 1R7AA 4MZYA 4LYKA 4KEZA 1WAUA 4CD7A 3OIHA 3CXOA 4DXKA 2P10A 3G1HA 4C5ZA 3ERPA 3PJTA 4N9BA 1CGUA 2OB3A 1DXEA 4YWSA 2FJKA 4GG9A 3PPHA 1KM3A 4WD0A 2RHGA 1GJUA 2GJNA 2EPNA 5ENLA 4PL1A 3TVAA 4NNBA 3AS0A 4NL1A 1KCZA 2E0PA 3LTYA 4J2PA 1L6GA 3QGVA 3HGOA 5G2IA 3ITLA 5A8MA 4DXVA 3N2XA 3GHSA 5BXPA 3NQ2A 1FWBC 3BSHA 4MJMA 2DZXA 1V7YA 4V2XA 9RUBA 2P50A 1ZTVA 3AO0A 1QNRA 5C7HA 1KFBA 1DWHM 1B3YA 4IIHA 4RNJA 2GK1B 1UP2A 1V0LA 4ZQNA 4QCFA 4MLJA 4FLQA 2YL9A 3KCLA 1MDRA 2I5GA 4FHAA 3FJLA 3O1NA 2G97A 2FFCA 1BYCA 1VZWA 3QMRA 3VDGA 2ZZ4A 3HFYA 4TOQA 1ZZMA 2Y62A 3EPMA 2ZDSA 3MTWA 4MUZA 4MYXA 3MW7A 2R24A 4IH3A 3VM7A 2GK1A 3VK5A 3W84A 3ZLGA 1GONA 3FXYA 3WDPP 3BW4A 2X7VA 4EKJA 1Y65A 4JD4A 4HGXA 1E0XA 1X6LA 3E49A 4M3PA 2OT1A 3EWBX 4UQ9A 2Z6JA 5I3GA 1CXEA 1WE5A 3GUWA 3BC9A 4RCXA 2YCKX 2FH6A 5FD0A 1I6NA 3G3DA 1QNSA 4HNVA 4E8DA 3L2LA 3LHVA 1OZQA 2CXGA 2W6RA 2OXNA 2QIIA 1B90A 3APTA 1EIBA 1PYMA 4HP5A 1Q6GA 5D03A 3GH7A 5F2IA 3ZVHB 1B30A 2WVUA 1GVQA 2J6XA 1S2VA 3FKRA 4K39A 1K9EA 1ZHAA 2HWGA 3WLLA 1DWJM 4B2DD 1H61A 2C16A 3PN8A 3MQTA 1MXSA 1OG0A 1W56A 1IWAA 1MEHA 1XRTA 3ZR6A 5LA2A 3BLIA 4PCTA 5C71A 3C4UA 3AJXA 3UXIA 4IISA 3ZVHA 2R1NA 2TMDA 1KR0A 3M5VA 1AUSL 4YVPA 2VC5A 3VUSA 4F2UA 2AMXA 4W8AA 3DUGA 5FJOA 1GZ1A 1AQFA 3BWWA 2X16A 1VRDA 3U48A 3O2LA 4RE2A 4A2RA 9XIAA 1DIKA 2P1FA 2QCEA 2WJFA 2H3BA 1OFEA 3WF3A 4DZHA 3SCNA 2A3HA 1Z42A 1UC4A 1Q6LA 3RR1A 3RGTA 4K2SA 2HS8A 5CSSA 4GVHA 3G22A 3ARYA 4LS1A 5CC7A 1KRAC 1IZCA 1WZMA 5HUOA 3ELFA 1VBUA 4A05A 2ZX5A 2YBVA 3OPSA 1XPYA 1D3HA 3EWCA 3GR4A 2AKMA 2J7FA 4NX0A 4DO5A 1HP5A 2OT0A 2V82A 2A3LA 5HJLA 3TTEA 3EXSA 4F9JA 1JAEA 3L23A 3GNRA 4L1GA 5KZDA 1EHNA 1R0MA 4HNOA 2QIWA 4KRZA 2UY2A 2FPVA 4UNKA 2CW6A 3KHJA 2Z7GA 1IQ8A 1TELA 4HU4A 4GIEA 3MUAA 4DPPA 5U7SA 3UJFA 3VABA 3W1UA 1XLEA 4JTGA 1FH9A 2POTA 3MUIA 4UTTA 2VDIA 3BH4A 3L4YA 1S38A 1JZ2A 4GX8A 3W72A 2RGMA 3NQFA 1PIFA 2C3ZA 1QO5A 1FY6A 1YNPA 1GUVA 1KM0A 2B0MA 4OOZA 3KOZA 1HKWA 3WJZA 4CNNA 1MW3A 4QM1A 1HKVA 5IHSA 3C2VA 5CEWA 3DENA 4U4MA 3HGJA 5FSDC 1UD2A 1F6YA 3GVQA 2OKOA 5C0QA 3QMSA 1VBHA 4JTJA 4FPSA 5A8NA 3ZM8A 4ZB2A 3SZ8A 5CKSA 3A4AA 3WQPA 3WMCA 3KFTA 2OWCA 1F6KA 3QM3A 2J7CA 3A5FA 1EGVA 3CUJA 2PRMA 3MO4A 4QG8A 3WBAA 5AHIA 1EXBA 3DERA 2D2OA 1JNDA 4DYEA 5HPCA 4IQEA 1P6BA 3W1XA 5HR7A 1T0OA 3QW3A 4W88A 3TQ0A 3S5NA 5CLTA 4AVOA 4I5XA 4MY1A 3FW6A 1EA0A 1V0KA 3KP1A 1W6TA 3MCOA 3WLHA 4F0KA 1TMHA 4PMUA 1TWDA 3RUBL 1EQPA 1XLIA 5F1UA 4F0RA 3PUOA 1QNOA 1E5JA 3VGFA 3EB4A 4IUGA 3NSXA 2IQ0A 1B3ZA 1V8EA 2HISA 2POZA 2CLHA 1HJUA 2JF6A 2P5NA 1WA3A 3NQGA 3UXDA 1VCVA 2INFA 1JYNA 1LUCB 4O4WA 2O9PA 3G1VA 4AEFA 1NOFA 4HA0A 4QDPA 1UCWA 4DEFA 4GJJA 3SECA 2YDRA 2CLPA 2V3GA 5LZLA 3W7PA 1DWAM 4ZOAA 4L5ZA 3PSVA 3W4RA 3A21A 1DJXA 3O6AA 4IL0A 1AH4A 2HVOA 3WYZA 3VD9A 3S6DA 5A6LA 1N2VA 1LUCA 3VKKA 2OPJA 4AC7C 4ZFCA 2INEA 2VYOA 3NQVA 1WQ5A 2FZ9A 2DP3A 2NX1A 1CDGA 3QR0A 1B54A 1RLCL 4JZ5A 1OB0A 5HNTA 1V3MA 5I78A 1E15A 1GOXA 3JZEA 1V79A 3LBMA 3NGFA 5TAOA 3TEVA 2NV2A 4YNGA 1W3NA 1UWQA 3C2FA 3EWDA 1RALA 2CLKA 5TBOA 4ACZB 4GISA 3ZR5A 3NVTA 3OTRA 5ABGA 4HN8A 1JI2A 1UQYA 2B7NA 3ABOA 3VE7A 2PTYA 2Y7EA 1Q66A 4BI5A 5RUBA 5KZEA 3DBPA 3SQLA 3S9ZA 4QBXA 4B9ZA 4ZSTA 3UWVA 3B04A 4ACZA 3RNDA 2WANA 3H7UA 4GYKA 2P0IA 2HS6A 1CEOA 3W83A 1FHDA 3VAVA 1UR0A 1YHTA 5LIKX 3IJQA 2BY0A 2NV1A 4MMWA 1SYTA 1OK4A 4DO6A 4NT0A 2I57A 1AMYA 1G6CA 3OLEA 3IPWA 2ICSA 4Q3MA 2W9MA 2V63A 2DJLA 8CGTA 2V5BA 2YBUA 1RPKA 4AZHA 4HK7A 2Z2UA 3TJIA 1VFLA 1W54A 3CUFA 2YFNA 3W1LA 1EHAA 3FXGA 4Q8VA 3GC2A 2VOTA 4XD6A 2CZ5A 2ZZ5A 4AF0B 2DFAA 1LWIA 2NT0A 4IQDA 4N9CA 3OB8A 4AD1A 4WKFA 4JNYA 3WX7A 2J13A 4S1FA 4LV4A 3LHWA 3UWZA 5I06A 3RMJA 3KVMA 5HINA 4UOZA 3S4TA 3HM7A 3O0KA 4PN2A 3GBDA 1EJSC 1A3HA 4XZHA 4LVFA 2INZA 4U2YA 1WDSA 4H6RA 3U0HA 1JRCA 3N29A 2QYGA 3DZ1A 2HROA 1HTIA 4ADSA 4GOAA 1XWYA 4RE3A 2VEFA 5EB8A 2WM0A 2JGYA 4WK9A 3AYRA 3I4EA 4FSAA 1EBHA 1LM1A 3W7KA 2PTZA 4YLWA 3IJ8A 1YXYA 3J7HA 1H41A 1R3YA 3U2ZA 1KB3A 3ONCA 4UQCA 3QC0A 2QULA 2Y8KA 3WDJA 4O0ZA 3VOHA 3WLSA 3BAIA 3V5FA 1UJQA 5JUVA 3NQ6A 5HQLA 1N82A 2ALDA 2WLYA 1Q6RA 1LL4A 2KX9A 2QDHA 4A29A 4PTDA 4FX8A 5CQ1A 1MO0A 5D8WA 4DNHA 4FMVA 1ZJAA 2ADAA 1GQIA 4MWAE 4GFIA 3O07A 5FIPA 5IOBA 2WM1A 2J47A 5IFTA 3TYUA 1Z48A 4H2HA 1GGOA 4FS9A 3SIZA 2EJAA 1BAGA 3UYIA 4A8LA 1Q3NA 3Q37A 3LGGA 1C92A 1JDDA 1W0MA 4RZBA 2BG5A 5CSRA 1XIHA 3TWAA 2GWGA 2IKIA 3QY8A 4GQGA 1M7PA 4LS2A 4J4KA 1W9DM 1X8CA 5I23A 1LOSA 3QYQA 3RAOA 4W5UA 3PZ9A 4ZQPA 3BQ6A 1VPYA 1OFQA 1AH3A 3N14A 4FX6M 4CLMA 2G3NA 4DM1A 2PRHA 1UH2A 3V75A 4PCSA 1LYXA 3CHDA 3H23A 3STPA 4L64A 3L4WA 3QFWA 1AZ1A 3AU6A 3W37A 4TX8A 4AW7A 4GI4A 3F4VA 1YBQB 2CBUA 1V6UA 3OBAA 3WK3A 2Z7KA 3ZOAA 3PSWA 1RUSA 4EX4A 4E3VA 3BGAA 3LENA 3KW3A 3PB0A 1Q5MA 1V77A 3BG3A 1DP0A 4URIA 1A0CA 1QMLA 2CEQA 3OLIA 4WUIA 1HJQA 1RJPA 1HO4A 4I3GA 4ATWA 4HPHA 1JDEA 1YBQA 3AXXA 1VHCA 3AIQA 4GZEA 4MHBA 1GOKA 2F6UA 3KRBA 2Q09A 1CB2A 4JFTA 4Z2KA 3OGRA 1WDPA 3FGCA 4QTGA 4MZ1A 1ZBVA 1DIDA 3QSTA 1CX9A 3VIFA 1I1XA 1JCNA 4S3BA 3SADA 1MZRA 2PLCA 4UNLA 1CYGA 3DDMA 4KBXA 4AIUA 4DBSA 1EYEA 2H8XA 4NHVA 1BFNA 2XN1A 3TC3A 1JPIA 4ZL1A 3QH2A 4GI6A 1TPWA 4HIBA 1XIGA 2QDEA 4DJDA 1S46A 1RQHA 4LBSA 1T7LA 2GQ3A 2V67A 1Q7ZA 1L6SA 5E9XA 3GS6A 3KL3A 3M47A 3W86A 2Y5JA 1AODA 3KRSA 2E3ZA 1KA9F 2O0TA 2V30A 2XM2A 2FLIA 5J8LA 1DPMA 3EX2A 3T05A 3W2KA 4KWWA 1XBZA 3NCOA 3SAZA 1SO3A 4P7OA 3W28A 1ADOA 4FLRA 3WMSA 3VIGA 4CNTA 1PWMA 1QI0A 3SY8A 1JF6A 5AYBA 1UQZA 3QHNA 2DIKA 3WLRA 2PUZA 2VZSA 1U83A 5HJXA 4PMNA 1N7KA 1JZ6A 1PX3A 1R38A 2B7QA 4RL3A 1F3TA 4DUVA 4JPGA 1R46A 2QJGA 2OX4A 1XL9A 4JTTA 4H8HA 2FGBA 5LGZA 1UUOA 3E2QA 4L6HA 2NQHA 3S1UA 1DORA 4AY7A 3C2RA 4WRHA 3I3BA 4NSBA 3TYAA 4ZZ9A 4PEEA 1D3CA 2VVSA 3EA3A 3G1DA 5XIMA 3HPAA 1Q85A 1WAWA 3IVSA 3W38A 5TD4A 2FB2A 1VS1A 5BCAA 2PDCA 4Z2LA 3VKJA 2YCLB 4P8XA 4M1RA 4FK9A 4GQQA 3TYBA 1AH0A 1IEQA 5A69A 1VKFA 4BA0A 3N4EA 3RM4A 4V27A 4AIBA 4DWSC 1PZ1A 2XIBA 1DJZA 4ADUA 4I9AA 4AYGA 1FWIC 2ZIDA 3MT1A 2GZXA 2Q01A 3ENLA 4TU1A 2J7HA 3BAJA 2GQ9A 5D33A 4LUJA 3N2TA 2YCLA 3G1FA 3IJ9A 3GWQA 2CKRA 1E4LA 4BQ2A 2PDJA 1ISWA 3RPDA 3SUTA 3E96A 5I7GA 3MU7A 3S46A 5MKGB 3W7IA 3GW3A 5AHFA 3ITTA 1AJ2A 4IMFA 1I1WA 3SGZA 1IEVA 3FYYA 2V5CA 4ZOEA 3UFYA 2P8BA 3OO2A 4FXRA 3TW9A 5KZMA 3FS2A 1X98A 3NWRA 4PMJA 3UGVA 4AZIA 2RDTA 3O6DA 2NW0A 2OYLA 3TJLA 1ICQA 3PAJA 1REQA 2PMQA 2CYGA 1FDJA 2DZUA 5MKGA 1W1B1 2IXVA 2V3FA 1UMYA 5CCZA 1TV5A 3LLFA 2J25A 4PUJA 2WHKA 1YXDA 2CHNA 1JCYA 4MADA 1A4LA 3Q58A 3PTKA 4CCDA 2EPHA 2FDSA 4D72A 2TAAA 3N13A 1K6WA 5JIPA 1QOQA 3CZKA 4AZ5A 4E5TA 1BG4A 2VFDA 1H7PA 1GJPA 4I8YA 2XN0A 3ZVIA 1XSIA 5LIYX 4Z2IA 1KM2A 3UJRA 2PWVA 2X1IA 4BF7A 4DNMA 1CXKA 1V6YA 6CGTA 4OZOA 1IV8A 3LPGA 3VKBA 4MB5A 2VEIA 2QPSA 1F73A 1QI3A 4ZQOA 4RV8A 3BAKA 5EPDA 3S2NA 1PCWA 5EGRA 3P81A 4AVFA 2VDHA 1XLDA 3NQAA 4GQRA 1OJXA 1C29A 1J18A 5ABTA 1EZ2A 1K8ZA 4UFJA 3CUIA 4N02A 2FQIA 4ZO7A 5BRQA 1YNYA 4JKMA 2X40A 3GR7A 3RITA 1M53A 2EPMX 3VIJA 2GVLA 1RY0A 4WCJA 1LQ2A 1OIMA 3XIMA 4JIRA 4YXGA 4YHGA 4PMQA 5DX7A 2DZSA 5AY7A 1UD8A 3OA5A 2DW6A 5B7YA 4NZ5A 4AZGA 3B03A 1HKJA 3UCCA 4ILSA 2QCGA 6TAAA 3A6OA 3SCVA 4ZO6A 5EA9A 1GWJA 3WNOA 3CASA 4AQLA 2OVLA 2NXGA 2MUCA 3GVWA 1HFBA 5BMWA 4HVXA 1PYFA 3DG7A 4AD5A 4C6JA 5DN1A 1L6WA 1TG7A 4R7JA 1OEPA 2VZVA 1KFEA 1OT2A 1H49A 2MNRA 4PMVA 3GDBA 4PMRA 3WLQA 1V6XA 2PCEA 3WMBA 2YL5A 1IGSA 1S5TA 2ZDRA 1GVOA 3OGVA 1D7FA 4FOKA 3BMXA 3UWYA 4FI4A 1SJBA 1W1A1 3W85A 3IS4A 3T09A 2DDXA 1V0NA 2Y7GA 4H3DA 2HDJA 4WDWA 4NRSA 3AXIA 5I07A 3P93A 4RR4A 2YDSA 1TV4A 5EYWA 3VNZA 5G4EA 1KFCA 3H24A 4KCUA 3KBMA 5CJNA 1UC5A 3VUPA 3CZEA 4D6JA 3DFSA 2D0GA 2FHFA 3STCA 4CCCA 3B0VC 2R9RA 1PIIA 3PF3A 2PCQA 3AYSA 1QOXA 1SSGA 5IBXA 1QR7A 1XQLA 4H9UA 4W7UA 4XB3A 2I16A 3DFHA 3DI0A 2Q3RA 1OFPA 2QAPA 4NVTA 3W27A 4MGGA 1R3QA 3LMZA 3KTSA 4K8EA 1P7TB 2VJXA 4XSLA 4X9YA 2YLAA 3PBVA 1MW1A 4JFUA 4RV3A 4DJFA 4M6QA 1P1XA 3OIXA 2DV0A 5HMEA 4OGZA 5EMKA 3EWXA 3RLHA 1V3IA 2PWDA 4BI7A 4A2SA 4IZGA 1N55A 5D09A 1EC8A 1P7TA 3R1ZA 4ERGA 3TN5A 2OOGA 2WW5A 1LLZA 3BW2A 3KX6A 4JHOA 4JTFA 1K6AA 1EWEA 1IEWA 2WVVB 4EF8A 3JZUA 1LQAA 3XINA 3SCRA 5KMYA 1R2RA 1U33A 1L0PA 5JBDA 4HZMA 3KXQA 1GTHA 3AWNA 4HOWA 2OR2A 1QNQA 3M0KA 3LERA 4KERA 3EMQA 1XLHA 5D37A 5FF0A 1HGYA 2QJJA 3N34A 3U9IA 4A21A 4XAPA 2F84A 4O10A 3TNOA 2RDXA 4Q4OA 1UA7A 4CVUA 2WVVA 3AROA 3PVFA 1XKYA 2WVTA 1ZQ5A 3ATYA 1SGJA 4XBKA 4WKHA 3IGSA 3K46A 3VYLA 4PB5A 3VVGA 3KDOA 4AZCB 2YFOA 4X2RA 4AMAA 1FXQA 1TMQA 5C55A 5AVHA 1R8LA 1LRQA 4HMEA 4AB4A 1XP3A 2AGTA 4TMCA 2P53A 3C0JA 2QJMA 2WMKA 3BGGA 1E1CA 4JQ4A 1PZ2A 4Y96A 5HWMA 3HV9A 2Z00A 1W1IE 3VX1A 1H50A 4AZCA 1BWVA 1RPXA 1GYMA 3URAA 4FNSA 4XV0A 1B1YA 1ZNNA 4RUBA 4DJED 2NSXA 3AC0A 2VD8A 5I3HA 1HJWA 4EE9A 4C1LA 2BDQA 1LZOA 1BQGA 1GTEA 1SPQA 5I3IA 5C70A 2O7QA 3M5YA 1ESWA 3WJXA 2VX7A 3R2GA 4A6GA 3M1ZA 1N8WA 1IF2A 3PBYA 4QDMA 4OOUA 4DF1A 4LVBA 2FZBA 2PDPA 4Q8WA 1ZY9A 4W8LA 1TTPA 1EC7A 3A22A 4IPJA 3UWWA 4PCPA 1X97A 1OQFA 3CPRA 3PULA 4P2VA 3O06A 3SCWA 3C56A 1ZCOA 1ITUA 3QJAA 1XM3A 1XYMA 3T0DA 4JN7A 3P67A 1Y5VA 4Y8EA 1VFFA 3HA1A 4UZUA 3ZJKA 4YJ5A 1LF1A 2G3FA 4Y2WA 3W2LA 3W6MA 1QK0A 3ZXWA 2BVDA 3FHQA 1QPRA 2DT1A 4W86A 4J28A 4F48A 3I7SA 4CD5A 3RLVA 3MSDA 2VTFA 3CLWA 4M0XA 2PF8A 2BXZA 1QU4A 4H7ZA 2A3CA 1LRTA 3DFYA 4Z2GA 5LIWX 3L4VA 3T44A 3R12A 5HNRA 1TE6A 1GJWA 1XLGA 4DY1A 1P0DA 2QUNA 2PDUA 3ME3A 4U5KA 4QXIA 1OG6A 1QW7A 2FZDA 2NQLA 2ZRZA 3NL3A 3E2VA 4ZE4A 4Q4PA 3CQKA 3NL5A 3G0UA 4G1NA 5DELA 5DBUA 1YKWA 1OX4A 1PZ3A 1X6NA 2WBGA 4G2DA 3KTCA 3T8QA 3DC8A 2G37A 1G4EA 1U1UA 2YA0A 1SMAA 4CNUA 3S47A 3R8GA 3IACA 3C3UA 1JQVA 4F3HA 4FA3A 4I5UA 1MQPA 1UWTA 5FEXA 2W62A 7PTDA 2ZXDA 3U6WA 4XKYB 1YTDA 3RU6A 2XGBA 3O6CA 4JY9A 3HMCA 2QF7A 5HDRA 4MNKA 2PDQA 2ISDA 2BOEX 3W7QA 3F2BA 4NJJA 5HMFA 2ABAA 1XKJA 3LCFA 3WF2A 1DTUA 4LCRA 5FL1A 3D0CA 3WJYA 2F2HA 4EVZA 2WJDA 1IZJA 2CIPA 3QPYA 3E2RA 3V0SA 1I9CB 3QPEA 4XKYA 1A5OC 4RDWA 3GYEA 5J04A 3ARUA 2GGEA 5E93A 3G24A 3EOLA 2PDGA 1OGSA 4IM4A 3FA4A 2PWUA 2ZXQA 3EPNA 4MB4A 2NZLA 3ABRA 4C1KA 2E6AA 2CESA 1WP6A 1OCNA 3M5XA 1M65A 3N6JA 1UZDA 3ORWA 5GJPA 5FL0A 2A21A 3WD4A 3W76A 4D6FA 2YL6A 3C2OA 3K4DA 5AVNA 3MS8A 4I5RA 3QV9A 3ZIZA 1UWRA 4TVUA 1EP1A 3LI0A 1XH2A 1XCFA 2E5CA 4JTEA 4YVVA 3S83A 3FVDA 3UZWA 1XX1A 1WOAA 1I45A 4A3UA 4IGHA 1KXTA 4MZ8A 5AC4A 3TE9A 1RVGA 5FEPA 2FDMA 4B90A 4QEEA 2E9LA 2PB1A 2XVNA 4DLMA 3WH7A 2WPBA 4R27A 4JTDA 3GHRA 4JYFA 3PJXA 1H51A 1M5WA 3N2BA 3ABQA 3HOJA 3W1AA 4E2OA 1CXIA 2OJPA 4B5VA 1UR2A 3NA8A 4GX9A 1J2BA 4LUYA 2BVYA 1GVYA 3ZLFA 4WSJA 2JEPA 3FCPA 4DWSA 3ABXA 1JZ4A 2QZRA 3WNPA 4S23A 1XYAA 5D2TA 4W8BA 2Q8LA 1IZKA 4EAMA 2ISWA 4J5NA 4IUOA 2X2GA 1L9WA 3AJ7A 2PP3A 5AC8A 2RDUA 4UFHA 2HBVA 3W7MA 1L8NA 2F61A 4RW5A 3S1GA 3L66A 4KGLA 2YOCA 1WOBA 1YE6A 3IRDA 1JAKA 1QATA 3PG9A 5DT7A 2PDNA 4XD3A 3W26A 1ONWA 2ZX9A 2X42A 3FVMA 1EJ7L 4FR1A 1W5OA 4PCFA 2J79A 3VIOA 3W81A 1XIDA 3THAA 4ERIA 4HNCA 1UMLA 2GUBA 2I5QA 2DZVA 2GUYA 2ZC8A 4KKXA 4LRSA 4HBKA 2WQPA 3T0BA 4R3UA 1HGWA 4M29A 5D2YA 4DBUA 1GG1A 4YCPA 2Q71A 4G5DA 4RK8A 3EXTA 3VIKA 1GOOA 4JDBA 3UY7A 1WBHA 1PO9A 2JKEA 3R4IA 5DFAA 2EPOA 3LCLA 4EPKA 1H2JA 1HW6A 4BS0A 1KQZA 3WIJA 3VDHA 1I60A 3GFZA 2X09A 4JL2A 4ORMA 2VGFA 3UPMA 1OADA 2W79A 2UV8G 3A5VA 4PMOA 3IJIA 4NX5A 3MKCA 1EWDA 2UBPC 3PZMA 4ZFMA 1UBPC 1QHOA 4MTVA 4HPNA 3LCXA 1CXHA 1XQKA 4F0MA 5FJTA 2EEXA 3IK4A 1UKPA 3RDKA 1FWJC 1C8YA 1IT7A 4BK9A 1KM5A 3V4BA 4DHGA 1XI3A 3VCCA 3B8SA 4XG1A 5FEWA 4F4RA 1H5VA 3SGUA 3ARRA 3PFMA 3TA9A 1VBJA 4PB3A 3FAXA 3AICA 2AQWA 4OIFA 4GE8A 4CU6A 1XJBA 3IARA 1TPH1 3W73A 1ISVA 2PS2A 4RNIA 5LIUX 4BHYA 3W87A 4Q8UA 2PD9A 2YZ5A 1S5NA 1FHLA 1ITQA 1FWSA 3R13A 1NFGA 3U2EA 1R9ZA 2A4AA 4K1WA 4Q4RA 4WSHA 4NUWA 3F2CA 4JEJA 4K68A 4H4IA 1EXPA 4JTHA 5FJIA 5LNRA 1F05A 2ZRUA 5BW6A 2QUVA 2JK2A 3KRUA 1B3VA 1Z7AA 3GNXA 4S3GA 1V3HA 3PY2A 3TCEA 2PGWA 1KGWA 4IFOA 2O4QA 5LXEA 1KM4A 1EL3A 3CT2A 2ZWYA 1TRDA 4MWAB 3H8AA 7CGTA 3WUEA 3H54A 3WSUA 1H5YA 4NZ1A 4W9TA 1EGMA 4ASTA 3TN4A 1JXKA 1CTNA 3GE7A 1RP9A 1NSJA 3M7SA 4IIEA 3DBNA 3KM8A 4AG0A 1A5SA 5H8MA 4GD0A 4H9MA 4MWAA 2G8ZA 1NFPA 1Y8BA 4LUTB 4GACA 4AD2A 4Z2JA 4B3LA 2VCCA 1XSKA 2BFGA 2GWNA 2ONEA 5FF3A 4HN4A 1GORA 2PU0A 4QE4A 3PBGA 4RE0A 1RCOB 2IMRA 2A1YA 3HQ1A 3N25A 4GKLA 4IF2A 4HMNA 4MKVA 2DVTA 2ZRXA 1WNOA 4JNMA 1TJ0A 5A6JA 2WNQA 3FIGA 3W7DA 3CV7A 4LUTA 3ZSTA 3ARPA 4L6DA 4JX6A 3NZRA 3WDHA 1JUBA 3CO8A 2OEJA 3OLGA 2UY4A 2FH8A 3ABSA 3W7LA 2QT3A 1YNQA 4B91A 4WZHA 3AALA 1J96A 1CECA 4LVGA 1IGWA 3T9PA 3N17A 4CEUC 1JG9A 4NJHA 4BWLA 1YE4A 5BROA 5I24A 3QR3A 1GOIA 4JAWA 1QUMA 4HSNA 1UZ1A 3NQ8A 2XH0A 2F38A 2VX6A 4ZR8A 1Q6CA 3AU2A 3CQHA 3IWPA 2VEMA 4H9TA 3IIVA 4J3UA 3GG7A 4MNLA 3TTYA 4QG6A 2P3EA 4H6EA 4A3RA 3WH5A 1P1MA 1Q8JA 4WQ6A 2E28A 1DWGM 3DCPA 4QISA 3AYVA 4JS3A 3HURA 3FLUA 4HZ7A 3BSMA 3V0UA 4DAIA 3MI2A 1BXNA 1I2QA 6XIMA 3QC3A 3BARA 1H60A 4GVFA 2NQ9A 5C9RA 4MOZA 4GH1A 5AZ1A 3BCFA 1BXCA 2VZOA 4XAGA 1WKEA 1XH0A 3L0NA 4JHMA 1C8XA 1K77A 1VPQA 7TIMA 3AMDA 3GXDA 1UROA 2ZZ6A 4I7VA 3UEQA 1RCXB 3OU8A 3IGHX 3IVUA 4UQAA 2J7GA 3NXLA 2RDWA 1K70A 3GQYA 1QI2A 4C6KA 1MW0A 3BAYA 1QJWA 1V4YA 3LMYA 4RJEA 4ES4A 3VTRA 1SJAA 2OKTA 2DZPA 1LQ0A 3E0IA 4RLIA 5LSMA 1UKSA 5CSUA 1KW1A 3MPGA 2HPMA 1TIWA 3EX3A 1R3TA 4MKNA 3H4WA 1W8GA 3Q65A 5I03A 1B4KA 1VYRA 1YXCA 5D9NA 1LDCA 1U1HA 1PTGA 1A0DA 2HSAA 4WKAA 5FESA 3MI6A 3VX0A 1HT6A 1S39A 4F2BA 4UFMA 1XIEA 1OINA 4MAVA 3EDFA 3R0DA 1J93A 4XZBA 2W63A 1AZ2A 3MV11 5T91A 1TX0A 1M03A 4KEVA 5AHNA 3OJGA 1AQMA 3AIEA 4Q8QA 5I09A 5BYWA 3M5ZA 3QQ0A 1UD3A 1MRAA 1Q63A 2IUZA 3U5UA 1SO6A 3WNLA 1XR2A 3I7QA 5EBAA 1HJVA 3A4WA 4LALA 2Z1VA 5C9WA 2IS7A 1W9UA 3W74A 3B0PA 3PBMA 3SUSA 2GDUA 1F07A 2WKJA 3C61A 5EBUA 3UR5A 1B9ZA 4GRSA 1TSIA 3VD4A 2BP1A 1NEYA 1E6NA 2D73A 4CQ9A 4R88A 3UF9A 3IIOA 2VT0A 4JN8A 3RRXA 2G41A 3MHGA 4MJZA 4AH7A 1XIIA 1NM9A 4JX4A 2AL1A 5K3VA 1KV5A 3K4WA 3L12A 4UR9A 1QPKA 4H9VA 3B0XA 2ZUMA 1Y0EA 1L2QA 3N73A 3GKFA 3VGBA 5REQB 2DIEA 4MY8A 3MJMA 4QP0A 1HJSA 3L68A 4DF2A 3H70A 2FTPA 2VELA 4LCQA 3NOYA 2XWEA 3R5EA 4C6DA 3I4KA 4JFWA 1FBAA 2V5DA 1GK8A 1YIXA 1O4UA 3VOCA 2Y0FA 3QTPA 1Q4NX 3L2MA 4Y9MA 3FA3A 3PM6A 1QWKA 4HHPA 1UP3A 2YB1A 4P5UA 4LUIA 3TQPA 3CLMA 4WSKA 5A2BA 2XSAA 2BV9A 4S2BA 2WHMA 3BJFA 1K03A 1ZAJA 1XDJA 4Y7EA 4AX6A 1K1DA 3PK7A 1RD6A 1XRVA 1K8XA 1V6VA 1TVPA 3TK7A 2XFFA 2OO0A 3QQWA 4J1OA 2D0FA 4J2MA 4BZYA 1SJCA 1PTAA 1UKQA 3EBVA 9CGTA 1ZS2A 2Q6ZA 4XKMA 5DQPA 3TA6A 3TIMA 4GLEA 4AWUA 4DZAA 4PBFA 4NILA 3DYMA 4YTUA 2XDFA 1XLFA 1MNZA 4DYJA 4ZE5A 5M3WA 2XFWA 3R58A 4OE7A 5K9XA 5M17A 3DKLA 1E71M 3WNMA 2IPFA 2XIQA 4JYDA 5BWAA 4HK6A 1K3UA 2V2CA 3ARTA 4N42A 3M0XA 4GUHA 3NM1A 4K3ZA 3WQOA 2FVMA 3IANA 1R87A 1TV3A 2NVDA 4FO4A 5LHFA 4AU0A 3FY1A 3R8HA 3LU2A 3CV6A 3L4ZA 3R11A 4HOXA 3DH7A 4GYPC 3QXBA 3TN3A 4WOZA 3WBEA 1JD9A 2I1OA 4PUMA 2EKGA 3LM3A 5C54A 1KFWA 3NPUA 1EH9A 3OEXA 1VFOA 4K36A 4LVAA 2HBXA 1FWEC 3I68A 3G1AA 4IMCA 4OBRA 1QTWA 4IPNB 2HK1A 1X8FA 3CYJA 2V69A 5CGQA 3GX9A 1XIFA 4Z1DA 4FNTA 1XLBA 4AAJA 5AHLA 1FCQA 1TPB1 1V93A 1R3RA 1JL8A 2X2YA 1E0TA 3TLLA 3VPLA 2YGYA 2YA1A 2JF7A 2JALA 1X7IA 3BANA 3WD3A 3T0CA 2XINA 2DQWA 3K13A 1C90A 1GEQA 3F1QA 1H1ZA 2BY3A 2VFHA 1PZ0A 1EJWC 2ZBTA 3G77A 1TO3A 4C65A 3NM3A 1LCOA 3W23A 6ENLA 4KGJA 4MNJA 4RNHA 3UR2A 4UQEA 4B5NA 2XSXA 3OODA 2E7FA 3NQMA 4JQ1A 3HJEA 1NIUA 4INFA 5IRPA 1PEZA 4HU0A 4DVOA 1TVNA 1DWIM 1ZP4A 3W7JA 5GJNA 4DO4A 1YMYA 3T8LA 1TTJA 3MYOA 3P61A 4JIQA 3BICA 2ZUUA 3IIXA 4A22A 5D2XA 4LB4A 4ENLA 5B7ZA 4AWTA 3VOJA 1W1ZA 3SURA 1PKNA 3MI3A 4PR4A 2QW5A 1OWQA 2EG6A 3E9AA 4ZSUA 3B9AA 3WBYA 3FFSA 2XZ9A 3I6TA 1U5HA 4M6VA 4CNOA 2ZRWA 2C7FA 3GNDA 4UTTC 4XZWA 1TQJA 1IYXA 1FWAC 2WSKA 3S5OA 5F2MA 3PUGA 1NFBA 5T8GA 3OW1A 5ECUA 1S5MA 2QCDB 3S5YA 3VZYA 1NWSA 1FHUA 1SW7A 4D6IA 1M9HA 3RG6A 3TQKA 3SQMA 1ZSXA 1EX5A 1W9BM 5C2XA 3SCPA 3BDKA 2XH4A 4RE4A 3TSDA 5EL1A 3S42A 1XDMA 3DYPA 1VB9A 3KOYA 1JZ7A 4D8LA 4WGHA 2Z1SA 1JZ5A 1ISXA 3W3OA 3ZJ8A 2QCDA 2AL2B 4YN5A 3PNUA 1UZHA 3LPFA 1ZJHA 3ZWSA 1P4CA 4JDYA 4UTHA 2AQOA 3QYSA 1MXGA 4GA8A 1F4HA 1WUEA 1RBOB 3B4UA 3MA8A 1KD0A 4X3ZA 1PDZA 2YXXA 4LV9A 4O13A 2AL2A 3SFWA 4EANA 4GY7A 4HYWA 4JICA 3U2OA 3NQEA 4I6KA 2FZMA 2IQDA 3BLEA 3CIWA 4O0QA 3IGUA 1M6JA 2NWRA 3MSRA 3ZSSA 1NP0A 2PDXA 1S1RA 3O16A 4Q7BA 3TAKA 1A3WA 3UCQA 4ADTA 3DKJA 1J9YA 1P48A 4B4FA 1OVDA 4KEUA 3EWUA 1WXYA 2ZQ0A 5M5DA 3EA1A 2ZRVA 2YCEA 2LLEA 1FRBA 3LK6A 4A8IA 3MKKA 3NURA 1HVQA 1W3HA 3RM9A 3BW3A 3EDEA 1EDQA 4S38A 2XIMA 1F3EA 5HANA 3KVJA 3UJEA 1SM9A 1CGVA 2FHCA 1FOBA 2YJQA 4UFIA 3W07A 4S3KA 3WLJA 2OMAA 2PP0A 1OX6A 3UXAA 3FN9A 4HPGA 3ARZA 4QS5A 4DF0A 4Y8FA 3STEA 4C6OA 4KH2A 1TUFA 4WGXA 4C90A 4GJ1A 1BPLB 1QCWA 4OJYA 5KINA 1GVRA 4Z1YA 1MEIA 2OZ3A 1KLYA 2DJXA 2DT2A 3V7PA 4D6GA 2Z0IA 5PTDA 3H7RA 1CB7B 2FZNA 1KBBA 1QPOA 3N04A 4LU0A 1I2RA 3SN4A 2A6NA 2WNWA 1W1TA 3W7HA 4GO8A 4US5D 1UR1A 4ZMGA 2VEKA 4EIVA 1CLVA 3HF3A 1P6WA 2GGJA 3HQOA 3CO4A 3T42A 2P3ZA 3HPXA 3R7MA 5CLWA 3LHTA 3G8EA 3FA5A 2XIJA 3C52A 4EPEC 4MVAA 3S2JA 4O1CA 3KAOA 3S2LA 4HTYA 4EF9A 4JKLA 5FAJA 4HZ8A 3LRKA 3A47A 5IFPA 3TAOA 3PBWA 5A94A 1DJNA 1E1FA 1PDYA 5FOOA 1P43A 5G1YA 1H62A 1EYWA 3LGEA 1I75A 1YDYA 5DXYA 1AW2A 5IDIA 3KZSA 4HCDA 3NZGA 4MB3A 1QFEA 2E5BA 4XD5A 3RX3A 5CGTA 4HHMA 4LFYA 3BPWA 4OHQA 4HT3A 4JTSA 1J5TA 2GOUA 2J9ZA 2XGZA 3H21A 5GVJA 4LX4A 4GIAA 1U1JA 3W1NA 2ZUVA 3MUZ1 4B5XA 4HMDA 1A53A 5I2UA 2V2DA 1JULA 2CWNA 2CLIA 2G95A 4OWGA 1VBGA 4RX0A 1J5SA 3PJWA 4FNPA 4RPPA 1JYXA 5E0CA 4Z1AA 1FKXA 4IXXA 4QNWA 2PPGA 3ARWA 2ZA2A 3ANUA 1M7OA 1NDYA 3HGSA 2OELA 1O60A 4LS0A 4C7DA 4GABA 3JRKA 4IMEA 3OQ8A 5I79A 4H2CA 1XLMA 3V5CA 5HXMA 4U2ZA 5A2AA 2PGRA 1ZAIA 1AL7A 1YPFA 1WV2A 3DHFA 2D20A 4PSPA 4A8RA 1G4PA 5E6YA 1AG1O 3QMTA 1FH8A 2ZZ1A 4L9ZA 2OSXA 2BGNE 1EIXA 2WV8A 3NL6A 4IMAA 3AHYA 1NDZA 3URNA 4RKAA 4IJRA 2BS9A 5DY3A 4LAUA 4HCLA 4L4MA 3NQCA 2YXOA 4IPIA 2WZHA 4GJIA 4PULA 4LOCA 4KIEA 1WKDA 3RU8X 3FJNA 7XIMA 3OBEA 2KAUC 3GHTA 5CPMA 1G5AA 2BY2A 4CCEA 4DZ5A 1NQKA 2OOFA 3GO2A 1C93A 1B4EA 3RX4A 3DECA 4MFDA 1VFMA 1XRFA 3TFXA 5J5DA 3WKZA 4PMDA 4CU7A 4O4VA 1CGXA 3PZQA 2W67A 3KS6A 5KEZA 4GUIA 3H2FA 2WSPA 2AOSA 3KOXA 4K1GA 2CXEA 4P7RA 2HQAA 2FVLA 4GO9A 1G69A 3EWYA 4J7RA 5JU6A 1UBSA 3CMGA 4L4LA 3PNZA 4UUIA 3UG4A 3HZ3A 3Q67A 1A5LC 2OLSA 4YYFA 4H9YA 2HE8A 4I6VA 4MDPA 4XQ6A 1SO5A 3LBCA 3TN6A 1PXGA 4GZIA 2D24A 3K30A 2FTWA 1FKWA 1MQRA 3LM7A 2ZUWA 2X05A 4C7GA 1S2TA 4R85A 1UR3M 3L7RA 5CZTA 3HPSA 2O56A 3PUDA 2HNEA 5CC6A 3NDYA 3TROA 2BXVA 4LGXA 4ECLA 2X0YA 2OQHA 5BNKA 2WVSA 2YYUA 4KWVA 3WQ5A 3NPVA 5JBFA 4TQTA 7ENLA 5H8UA 5AN7A 1LBMA 4AWEA 4DJDC 3W75A 4GYFA 2QNEA 4GY1A 4D71A 2VVNA 1I0DA 3DI1A 4ZQRA 1KBKA 1RA5A 4NZ3A 3KBJA 4M1BA 5BOEA 3MHUA 2ZX8A 4L56A 1R9YA 2C79A 2KZHA 3U57A 2OZ0A 2FYMA 2F7FA 1T8XA 1A49A 4J35A 2VC7A 3A4JA 2H9AB 5DCEA 5L6UA 2YXGA 3T2QA 1QW8A 1TCMA 4ERAA 1J11A 3HPZA 4AC1X 4IQJA 4KT2A 5D8ZA 1FTXA 4FOJA 1MW2A 1FWFC 3VM5A 3UG3A 2ASHA 5LHEA 4IJCA 2H90A 2W0UA 3B8VA 5GNZA 3ID7A 1BYDA 3LOTA 3LRMA 3W71A 3ES7A 2H9AA 2TYSA 3WEOA 1FHVA 1MUWA 4NXKA 1XC4A 4BF9A 4JCLA 3T1GA 4PRWA 4QX4A 5KETA 3TU9A 4IX2A 2XVKA 5JQ9A 5L9FA 3VD7A 2A3EA 4GYPA 1JCTA 5A6BD 3GVVA 3P82A 3BMVA 4U5IA 1XYBA 4PRRA 5HA7A 3ZWTA 5FA5A 1MVYA 3VDBA 1WDWA 5CXPA 2YKKA 1ONXA 1PCKA 2ISVA 1UIOA 4MY9A 1WZAA 1EF2A 2NLIA 2JGQA 4GIYA 5LKYA 4I7WA 4LC8A 1G7VA 1W3TA 3I6RA 4TO8A 2FJUB 3EDKA 1XIJA 5HNUA 3E0LA 3PS7A 1GVFA 3K4AA 4ICCX 3QSRA 5FJRA 1S2CA 1DJHA 2FGLA 2WZEA 3LN3A 2PC4A 4Z2HA 4C6IA 2BX7A 4B4HA 5DANA 1BF2A 3GNPA 4MAZA 1P0KA 3N3MA 2VENA 3SRFA 3RCYA 1TTIA 3KWXA 2FZ8A 1J12A 1UD5A 3GD6A 3VKAA 2HK0A 1EDTA 2BASA 3AZSA 3GIPA 4W85A 1K4HA 2VGIA 1A5MC 4M56A 2Y8UA 2VURA 1KFLA 4UTLA 3LI1A 1HX0A 2Y70A 3BV4A 3GM8A 2GL5A 3NQ7A 4JXCA 2WSYA 2X41A 4C6PA 2CPUA 3GZAA 4JFVA 1NU5A 4CUCA 4J27A 3LUTA 1Q6QA 4WJEA 4R53A 4IIDA 4CD6A 3UY8A 4QHRA 3GIYA 2NT1A 4MNMA 3IEBA 2QCMA 1RZMA 3BGJA 2B7OA 2VM8A 3V0TA 5FJUA 3WUBA 4JOMA 3KBWA 2J8FA 2WNZA 3BVJA 1R2TA 2R1PA 4UFKA 3IUHA 3L0GA 1PVNA 1U5JA 3CHFA 3KBVA 2XIIA 4O12A 3LNPA 1I4NA 1RXOB 2I9UA 1B57A 4DLFA 3M0YA 4GC3A 3UJSA 1HQTA 1TPFA 3NYZA 2QAFA 1PKYA 1JIBA 5I6SA 2TPSA 2CHRA 1KXQA 4LYPA 5BOFA 5FEZA 3Q94A 2CKSA 4R7OA 1ICSA 2VR5A 3WZ0E 4U10A 3L65A 3VGGA 1H0IA 5IXEA 4YTRA 1TPVA 1XGDA 3DHUA 1DTNA 1AFSA 1KRBC 1QPQA 3M43A 4GZ7A 2E8ZA 1C91A 2JBMA 2PODA 2XUCA 3LXAA 1BKSA 3QF0A 4YTQA 3GXIA 3B40A 4IG2B 3W7CA 4EAYA 5KZ6A 5AZ0A 2NXHA 2WJZA 2AGKA 2EQDA 1XH1A 3P0WA 2PBOA 3LLXA 4IX0A 5DY2A 2JFEX 3CTTA 4JIEA 3CUXA 4P61A 3WEZA 4JBRA 3QW4B 3SEPA 3KCOA 4IG2A 2V2HA 1XUUA 3CAWA 3M0IA 4RDZA 1SZFA 2NV9A 1VRXA 1XLLA 1QHZA 4IIFA 4L9YA 4WXYA 4ZBCA 4N9DA 2X7WA 2AMGA 1HL2A 2GSJA 2F8QA 3DU0A 3E3HA 1HXJA 1T5AA 1CXLA 2OYMA 2DVUA 2PGEA 5AC5A 1AMKA 3GSMA 4LAKA 4DB7A 4OV9A 2TRSA 1ADSA 4YCOA 5H8PA 3W82A 1EQCA 2FHBA 3TJXA 1R47A 2CBVA 2XFYA 3PWGA 4KESA 3T0AA 2YBTA 4BY3A 4H7VA 3GB6A 1A5CA 1ALDA 4LWWA 1QDSA 1S5WA 2EAWA 1KM6A 3EOOA 4UB9A 1V0MA 4K8HA 3M0JA 1WCGA 2NQ5A 4Q6JA 4XAFA 4BQ3A 3PUEA 5HQMA 3KE0A 1EB3A 3SR7A 3CQJA 3EWWA 2Y85A 2PTWA 4A3QA 1AVAA 5IBXC 3L9CA 1AA1B 1HP4A 2ACUA 2R91A 4DXXA 1ZLPA 1J0ZA 1XYZA 3BQ5A 4HNLA 4H41A 1AQ0A 4LY8A 1WB0A 2G3IA 3UZZA 1DXIA 3A64A 2ZUTA 3QHMA 5BU9A 3EWZA 3RILA 3APYA 1A5AA 1Z41A 2E5DA 4JKKA 3E6EA 2WXDM 1IR2A 3C2EA 1BTCA 5CPNA 2ZICA 2W91A 4DJFC 1C9WA 4WDTA 3QV6A 4AY1A 1G4TA 3GG1A 3EX4A 2QV5A 2QPUA 4GKTA 1I2PA 3S9YA 4O8RA 1EX1A 2IKHA 3RMEA 3NOEA 1XBYA 1E6ZA 4IFKB 2VOMA 4IMDA 1E0UA 4J3VA 5FF2A 2GUUA 1K9FA 1NWUA 1KBJA 3U8GA 2YA2A 3GXPA 1M7JA 3U4FA 4CCZA 2RUSA 3LPOA 4H19A 4S3FA 2J9YA 2B4GA 4LBUA 1AW5A 3DC0A 3GTXA 4O1BA 2VDGA 3I65A 4HU3A 3WK2A 1R3VA 3Q45A 9XIMA 2ZKMX 1PWLA 2Q02A 2PF0A 3B4YA 1TPDA 1PUDA 5CAHA 3PP7A 3GG0A 4ZOBA 3ZZ1A 4AISA 1RK6A 4CNSA 4MM1A 2VGGA 4KWOA 1E72M 4Q4KA 1A4MA 5D38A 2XH7A 1A5KC 4OUIA 1TREA 5D9MA 2A79A 1E9YB 3LV6A 3CUZA 2FB3A 3NSNA 4AF0A 1ML1A 4B5SA 4XWUA 4Q32A 3SRKA 4L4OA 1DJGA 7ODCA 2CU0A 3A24A 3HTWA 5BZAA 4J3XA 4MLRA 4Y6GA 3WNKA 2C18A 3W0KA 5BXRA 1F3XA 1G1YA 1W8SA 4AHQA 4YTSA 3JR2A 3H7VA 2G50A 3TW7A 3AUJA 5CJ5A 4JN6A 5HOSA 5KSWA 3H2CA 1OABA 4O0KA 3UWEA 4QLKA 4UTJA 4IP5A 4NAFB 4GFSA 3FYOA 3ATZA 4OQVA 3ABZA 4KCWA 2VFFA 3WH6A 1EEPA 4FNUA 1Z89A 3AOFA 4ZENA 1G67A 1KO0A 3NAVA 1IHIA 4AIOA 4NQ1A 4HOZA 2XISA 3E02A 3LHYA 2XIOA 1IWPA 4NYUA 4DBDA 4NAFA 4C6QA 1GQLA 2Q3OA 1XIMA 3BLPX 4JEQA 2PDBA 1K8YA 4NXSA 1A50A 5CH9A 3TQVA 5A1AA 4MDOA 3WL1A 1OD0A 3HQNA 3ITCA 3SM0A 1US2A 3UD6A 3BXWA 2F9RA 4HYRA 1PB0A 3S1WA 1DJIA 4MB1A 3IIZA 4OKDA 2W4XA 4B3ZA 1VCFA 3QZAA 1YEYA 4A35A 5FACA 3A3XA 2P0OA 1SW0A 4L6OA 2D3LA 3XISA 2VP8A 2EPKX 4KIRA 1YDOA 2CLOA 2R82A 3C6CA 3JVAA 2PDHA 1FX6A 2Q8ZA 2ISFA 5BMXA 1E9LA 3BL3A 5IM51 4R5EA 5H91A 1YQ2A 4QS6A 1Q7QA 1D3GA 1ODZA 5MHBA 4B5UA 1JI1A 3FOKA 4LJ3A 3DFNA 4XZMX 3WF0A 2ZCGA 3HN3A 3CQ0A 4I9TA 5A3HA 3PPGA 4RPQA 1O95A 1K9DA 1XUZA 4O17A 4H8UA 4AXNA 3SI9A 1JRBA 1CXFA 3GBEA 3N6QA 5CG0A 2WC7A 3WQDA 4J40A 3N2CA 2XJ7A 3ZS4A 2Z6IA 2FFIA 5CZSA 2WMJA 2QV4A 4ROQA 4AUBA 4DI8A