4JTUA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with brequinar analogue
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 057
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 139
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtuA00
3JS3A 3KHJA 4GWEA 4PL2A 2V5LA 2GUUA 3MI3A 1G7VA 1Q3NA 5E0KA 3ATZA 3NZ1A 3SGZA 1VR6A 1TYGA 2V30A 3LHTA 3UWWA 4YCPA 4GRSA 4K38A 2Z2UA 4LRTA 2PRHA 4N6FA 3EXTA 3K30A 3STCA 4IPIA 1SPQA 1A5CA 3NVTA 4O4WA 3RK8A 3W7HA 3FYPA 4HPXA 4MOZA 1NEYA 3AO0A 1MO0A 2E77A 1JCYA 3G8EA 4N2YA 1KFJA 3EEGA 3DGRA 2WV8A 4GUFA 4UTTA 2E68A 3USBA 3NPWA 4GUGA 1W54A 3PSVA 3B03A 3QMTA 1LOLA 1RPXA 1EWEA 2ATSA 3O05A 4M6VA 1QFEA 1YXCA 2H3BA 5FI8A 5DBTA 3S42A 4G1KA 1ZFJA 3BARA 3TE9A 2FPYA 3HPZA 4ZQOA 3S8HA 3EXSA 2DZWA 1OYCA 2V9DA 2R14A 5F1VA 1KV5A 1XFBA 4Q33A 1F74A 2ZYFA 3B0VC 3TQKA 3P62A 1SO6A 3LBMA 1D3GA 5K7JA 3QSRA 1KLZA 1WA3A 3QPYA 3LB0A 3R13A 1W3IA 3PR2A 2YW4A 1FXPA 3DI0A 5AYYA 2X1SA 1VGAA 5D02A 1L2UA 4NZJA 4W9TA 3B05A 4GUJA 3CM4A 4JIPA 4M7TA 5HMSA 1ZAJA 4JDBA 1HUVA 1S5WA 4UCGA 1O5XA 3ZFHA 2Y89A 1ML1A 3Q94A 4K6AA 3W70A 1JQXA 3G0UA 3MYOA 4DPQA 1ADOA 3S0CA 1TTPA 1KFEA 1W0MA 1KM5A 3C3NA 4CCCA 3WJSA 5HINA 2C16A 3FJ6A 3HOJA 4FIRA 1KV8A 1KTBA 3T4CA 3UD6A 1OF6A 3GX9A 2G97A 3SY5A 4JTEA 2Z6JA 3PG8A 5CZ0A 1WBJA 3NQVA 3GDRA 2Y85A 3RLVA 1JCXA 3GYEA 2VFDA 3SR7A 1F5ZA 4JY8A 3DHDA 2CZEA 3M43A 1R47A 3GKFA 1I2NA 4DF2A 5BW6A 1ZAIA 3O16A 5K3VA 1UBSA 3NOEA 4H4IA 3W7EA 4B5NA 2WO5A 3LHUA 2TYSA 3NQ2A 1IXQA 3LV6A 1XM3A 1K8ZA 1KM0A 3Q37A 3W2KA 4LU0A 1TV5A 3I6RA 3HB9A 3GDKA 3P8IA 3NGJA 4E0CA 1TMHA 5G2WA 3FYOA 1SR9A 5AHLA 2YW3A 4LS2A 1G4TA 4K8HA 2WNNA 2V82A 1AK5A 4OBTA 2V2DA 4O16A 3EXRA 1R2SA 4UXDA 3LRKA 4M6PA 5C2XA 4YWIA 2GOUA 2OJPA 5DELA 3TA6A 3W72A 1G7UA 1SU5A 3U8GA 5FEPA 3CB8A 3NL6A 4Z0JA 3RFAA 4O1AA 3G3DA 1YLVA 2J24A 1CI1A 3NYZA 4K7VA 4O15A 5D2TA 5D2VA 3W22A 1DJNA 2CLMA 2EF9A 3CEUA 1P5BA 5AC8A 4CNOA 5K9CA 3AJXA 2OX1A 2FFCA 1TB3A 4RXGA 2CLLA 4DPPA 1FCUA 4DXVA 2GVGA 3GVGA 3W76A 1EA0A 4AAJA 4JYFA 2Y7GA 4UTKA 5E1QA 1TV7A 5G4WA 3LDVA 3L5MA 3QW4B 3LCWA 1FCBA 4GFSA 3TUUA 4RZ6A 4TR9A 4EF8A 1MXSA 2C1HA 4FHAA 4QAIA 3U2OA 1H61A 3BW4A 3W73A 2AAMA 3N14A 3WK0A 2FIQA 1K3UA 5D32A 2E5BA 4OHQA 2X16A 3MO7A 4ADUA 1M6JA 1DHPA 3W2UA 1JUKA 5DXXA 4TMCA 2ZZ5A 4BI6A 2Y70A 4R33A 1OYBA 1SQ7A 3IIVA 1TPC1 1SO4A 5KSWA 1CX9A 2CWNA 2GQAA 3O15A 6ALDA 4OV9A 1JRBA 3G0XA 2C6QA 4JTTA 4JIQA 1DQWA 4DO5A 1TPUA 3PM6A 5AHIA 1EWDA 2ZRUA 3CPRA 2P1FA 3A5FA 4AF0B 1XBXA 2VFIA 5AHNA 3OVPA 1PHQA 2QCDA 3IGSA 2DZPA 3HBLA 4J9JA 1AW5A 4AHQA 3IV3A 3BW3A 2ZA3A 2V2HA 3G1YA 4TMBA 4NT0A 5EA9A 5FF7A 4AWUA 1WYIA 3E12A 4JYDA 3O1NA 5FEXA 3W1QA 1SSGA 1I45A 4GE8A 5FESA 2RKXA 3MWAA 3PS7A 2J9ZA 4QM1A 5G4EA 5F2IA 5T26A 1YTEA 3TJLA 1SUXA 3MP4A 3G1VA 2TMDA 4UMBA 4C1LA 2ZCGA 5EKYA 4IJBA 2VFEA 1OX4A 3EWYA 2QR6A 5A8GA 4XWUA 1YXDA 1YPFA 3L0NA 4ADTA 4FXSA 1F6PA 4AMAA 1F2JA 2YYTA 1IGSA 3NL3A 2CLEA 3CLMA 3IVTA 2FLIA 2GVJA 4O4VA 2GQ9A 2YYUA 3BVJA 2X1RA 3N3MA 3VFLA 3BPWA 5LSMA 1G4PA 2YPIA 1GEQA 1SZFA 1V5XA 4CNNA 2VKZG 1LZOA 4K39A 1D9EA 5F4WA 4O12A 3NQMA 1LRNA 2QCHA 2A85A 1OX6A 2A21A 1W56A 3M41A 4WY0F 2ZRZA 3CT7A 3FOKA 2QKFA 1OFPA 2I14A 1ME8A 5DCEA 1EP2A 4O1BA 3ATYA 4TX9A 1TRIA 1EX5A 1QPOA 2FDSA 3DFSA 4KFPA 5D03A 1BKSA 1ALDA 1X8FA 2VOMA 1GVSA 1SW3A 2W79A 1H62A 3W7QA 3W86A 3NM3A 2IQTA 2X2GA 1L6SA 2Y6ZA 3HG4A 2C3ZA 1GVFA 2PCQA 3LOTA 3G18A 3QMRA 1GJPA 5C55A 1KFLA 1QPRA 1Q6QA 3BLIA 4A2SA 5EY5A 3I7QA 4ZQPA 1OABA 4WD0A 3PY2A 2YZRA 4M19A 4QSHA 2VFHA 3QW3A 4Q32A 4NXKA 4Y8FA 4CQ8A 4JXCA 1JR1A 3S1UA 3W7PA 3PG9A 3OVRA 2DZXA 4UFKA 3W1MA 3LX9A 3W7KA 3W1TA 1ME9A 5CSRA 4JDYA 3M7WA 2YR1A 1P0NA 5D30A 4GBUA 1GYNA 3BLFA 1O60A 4HSNA 1ICQA 5CZSA 3T40A 3H54A 3W2JA 5A5WA 1YDOA 2QF7A 3GB6A 3DFTA 4MYXA 3B06A 1OFDA 3B0PA 3T55A 3P80A 2DU2A 3C2EA 1RQHA 4JX6A 2O7SA 1IXNA 4QNEA 1IXOA 4O52A 4QQ3A 3KFTA 1DJQA 3HGRA 2ZRXA 4GXMA 1VCVA 5DBUA 3EKZA 1KFBA 1Q6OA 5K4XA 4ZQCA 3EWWA 3G3MA 1K03A 1H7PA 1ME7A 1B4EA 4RCXA 2NXHA 1VCFA 3TSDA 4JTIA 4ADSA 1Q45A 5HR7A 1BWKA 1H7RA 1A50A 2QDHA 3T44A 3TJXA 1ICPA 3LLDA 5LNWA 2EHHA 5D37A 1QO2A 2QAPA 3MHGA 3CU2A 1Q6LA 4N4QA 4XUGA 1FDJA 3CTLA 4UNLA 1OX5A 1B4KA 1KM4A 2BX7A 1LROA 3CIWA 1MZHA 4WXYA 3UXDA 1J2WA 4IGHA 3W6YA 4MFDA 4NJIA 3W7GA 1FWNA 3MI6A 3O06A 4N6EA 4TIMA 3BGJA 1O95A 4UMAA 4WQ6A 3LHYA 3E9AA 5LNRA 1WDWA 3QM3A 3IVUA 4TU1A 1LRQA 1OK6A 1XUUA 4JY9A 4POCA 3QQ0A 4CQ9A 3CIXA 1VC4A 3C8FA 3TK7A 3PSWA 2GVLA 4PFMA 3RF9A 2E6FA 3LRLA 1M7OA 3KVJA 2B7OA 3NL2A 3WK3A 2HSAA 1WOAA 4ZL1A 2E6DA 2RDWA 3B0UX 5KZMA 1DVJA 3CWOX 3BLEA 2V81A 4WY0B 3E0IA 3GZ3A 3NQEA 5U4NA 3GXNA 1QNVA 3UYCA 5I3FA 4O17A 4UTIA 4JTKA 3NAVA 1K02A 3QPZA 3HG2A 1G6CA 4O1DA 1Y0EA 3STFA 1T99A 2V8ZA 4BF9A 2CW6A 3W85A 3SGUA 1W5NA 3WJYA 3LLFA 4HKPA 2C13A 4O0ZA 2CLKA 4UMCA 3NQCA 3LTYA 4DO4A 4ZQMA 4ZZ9A 4YCOA 2Q8ZA 1H7OA 3PVFA 1QDSA 3ZWSA 3EKLA 4XQ6A 4XKYB 4UC5A 3TC7A 4UIOA 1EUAA 4EVZA 5G1YA 5CSSA 1X1OA 2FJKA 4ZQNA 3TQVA 3ZS4A 3LM7A 4KWWA 3A5VA 1FDYA 4UTUA 2Y62A 2VXNA 2V5BA 2FTPA 4NNAA 3N9RA 3CC1A 3PBVA 3EWUA 4NXSA 2NX1A 1LP6A 3W1LA 1H50A 5K4ZA 1ZAHA 5F2LA 2JK2A 1JUEA 1I8JA 3KAOA 4JS3A 1X1ZA 1OF8A 4NUWA 3STEA 5D09A 3WK2A 1B9BA 1ZCOA 4O50A 4IMGA 1V7YA 4JICA 4RKAA 4YLWA 1ZJIA 3IVSA 4MVAA 1HO1A 4DQWA 1B3OA 2B4GA 5KMYA 3W7IA 1YYAA 4Y96A 2NZLA 3W74A 1GZGA 4AH7A 4AEOA 2X1TA 2AGKA 4JX4A 4NJGA 3MI2A 1F7BA 1TJRA 5DY3A 4TO8A 4X2RA 3KXQA 1L6WA 3GK0A 1LOSA 1G67A 3NQFA 4PTNA 4UTHA 3G8RA 3WJXA 1IXPA 1H5YA 2VEKA 2ABAA 3M5ZA 1GYLA 1KTNA 4WOZA 1C29A 4IOTA 4IPJA 3DH7A 3EWBX 1XI3A 2Z0IA 3R8RA 4RZ4A 3TIMA 2EAWA 3W1PA 2YFNA 4K36A 1RZMA 2OZ0A 1X6UA 5AFDA 1QPQA 5AYXA 1XCFA 2QCFA 3EX4A 3S6DA 4JTSA 2OT0A 2QUTA 5KZEA 3L67A 1LLWA 3TAOA 2Q8LA 3W7LA 1MSSA 1PV8A 3W7NA 3WJZA 4M7SA 1W3TA 4S1FA 4DF1A 4MZ1A 3C56A 2DORA 3F1QA 2D73A 4GNJA 3NPUA 1QOQA 5LHEA 1RQBA 3DXIA 3W1NA 1EPXA 1FDZA 3WK1A 4PA8A 1TPH1 1EB3A 3NA8A 3GIYA 1OFAA 4XBKA 3LCHA 2CZFA 3D0CA 2GJNA 2YCEA 3GAYA 3W1XA 3HGJA 3W83A 1WX0A 2YX0A 3QYQA 5G2IA 2LLEA 5ABTA 1HO4A 2J9YA 4NU7A 1A5BA 1ZENA 5HQEA 4N02A 1SSDA 3EWXA 4PC8A 3WJWA 1TQJA 3TMLA 3LERA 3LHWA 5HUPA 2A6LA 3PB0A 3SW6A 3W9ZA 3BGGA 2VENA 3C52A 1GVRA 3MJYA 5FEWA 3GDLA 3NQ8A 2DZUA 1VQTA 3TNOA 5SWUA 4WXZA 3VCRA 7TIMA 2FQIA 3M5YA 1AW2A 1W5MA 3ZWTA 5BNKA 3IIPA 5AN7A 3MYPA 4IQLA 1W5OA 1DORA 3ABSA 4FF7A 3B04A 2C15A 3DBPA 4UFIA 4YMZA 5C6MA 5HWNA 3MMTA 1M7PA 4O10A 2ABBA 1O4UA 4Z1AA 4HNVA 1I2OA 1VJIA 2PRLA 4EOUA 2G96A 5EL1A 2NXGA 4BR1A 3UWZA 2YXGA 1F6KA 3M1ZA 3PBYA 3TFXA 1TV8A 1LORA 3HPXA 2NUWA 4AXKA 3C6CA 2P0OA 2FB3A 5G5IA 2WNQA 2NV1A 1T0OA 2G5WA 4RV8A 5HNRA 2XN1A 5FF3A 3C2OA 4MIMA 4OE7A 1SW7A 4FX7A 3GKAA 2DJXA 5IM51 4N9EA 3RMJA 2WSRA 4LC8A 4LVGA 1JCJA 1VHNA 3FIGA 3W88A 1EP3A 2ZRWA 1G4SA 3HGSA 2ZRYA 1FWTA 3HO8A 5U7SA 2A0NA 3DFQA 2Y7FA 4JGDA 1GTEA 3A21A 1SW0A 2CLOA 4NJJA 3TR2A 4EF9A 2Y88A 3JRKA 3LI1A 5C54A 4LY8A 1TSIA 3G1DA 3C4UA 2Y63A 2ZDRA 4ZVJA 5F2MA 3LHVA 3L5AA 3MHUA 1O5KA 3IIOA 5HJLA 3S1XA 3PUOA 2ZRVA 2CU0A 2G95A 5I3IA 1FQ0A 1AL7A 3CHVA 1GVOA 1JQVA 1VLWA 2C18A 1LBLA 3F03K 5EMUA 1M5WA 1QCWA 2F7FA 3KRSA 3O6YX 4LW7A 4LT9A 3Q58A 5KINA 1BTMA 2J9XA 3QRHA 1VRDA 2A1YA 2JGYA 4RXFA 4ONVA 5CPLA 4PODA 1DBTA 3I7SA 2RDUA 2Y61A 2CZDA 3HIJA 2FPVA 4I7VA 1ZY9A 1FXQA 5L9FA 5TQLA 3W7CA 3B4UA 4HIBA 4MLJA 4NVTA 2QCMA 1EEPA 3W75A 3VNDA 4K8EA 3QMSA 2W6RA 1UCWA 4R7JA 2A7PA 1PE1A 5AHFA 4LVFA 3W7MA 3W3OA 4PEKA 2WSQA 3W71A 5DCBA 2J6XA 1H51A 2BSLA 4LUJA 1DQXA 2EKCA 3S1WA 1IIGA 1NVMA 1FY6A 3FLUA 4OV4A 5D38A 4LVDA 3TC6A 3IIXA 2KZHA 2ZZ7A 3BV4A 3P61A 3ZR4A 3DAQA 4ML9A 4YL2A 1PCWA 1VHCA 3ABRA 2JKEA 2VC6A 3JR2A 3W2MA 1SO3A 3MBDA 4O54A 4M6QA 1RD5A 3FA5A 4N9BA 2H90A 3EX3A 4UUIA 5AB3A 5I3KA 5AYZA 4FNRA 4S2BA 4NJHA 2DJLA 4OGZA 3M16A 1VCGA 2ATMA 2E5DA 2VEMA 4DO6A 4M5PA 2A7NA 3TXZA 5DCDA 1B57A 3S5NA 3GR8A 2WJZA 3GDMA 1LYXA 3TCEA 2C14A 2JKAA 3MW7A 2E5CA 3QFEA 5AHEA 4BFAA 4QITA 3NEVA 4ZQRA 3SSJA 3LCGA 1TPWA 3TAKA 4H6KA 1OYAA 3LXBA 1KBJA 4IMEA 3GNDA 4A3UA 3ABQA 1H1YA 3NQDA 4KFOA 3P81A 1QO5A 4JN6A 1TO3A 1H63A 4HSOA 1XC4A 1HG3A 3LBCA 3FJLA 5DXYA 4UNKA 1ONRA 5CZTA 2JGQA 5L6UA 1XBVA 2RH9A 1N7KA 5D2XA 5K9DA 3SI9A 2CLIA 2NXIA 2ZTKA 3SIZA 4DF0A 2QJGA 1XBYA 4FX8A 2ZA2A 5DN1A 1FCQA 1H7XA 1GT8A 3W7JA 3RNDA 2QAFA 4AF0A 4X3ZA 1TQXA 4K7YA 3W07A 1OFBA 3BW2A 1F73A 1KM6A 3PBWA 3NZRA 4Y90A 1C9DA 2JBMA 1A53A 3MP3A 5CGQA 4CLMA 2E1DA 1EP1A 1WOBA 4RLIA 3C0JA 4GJ1A 5J5DA 3NG3A 5G1TA 5TBOA 1W1ZA 4I9AA 4ZMGA 2DP3A 2YGYA 2HMCA 1AW1A 3TDFA 3TU9A 1K8XA 4WX2A 3HG3A 4FB7A 3NL5A 1K7XA 1U83A 2DZSA 4NNBA 4O0KA 1H60A 2R91A 2WPBA 3TXVA 1FCVA 3N2MA 4O11A 3N9SA 3NQ6A 1SFLA 5I3JA 3TX9A 5LNSA 4RZ5A 1IIHA 5FF2A 2QCNA 3W87A 5AC7A 1UJPA 3LI0A 2A5HA 2I9EA 4IXXA 1FX6A 4RJEA 4O14A 4X22A 1TPEA 1W8SA 3WFAA 4IUOA 1YXYA 2YFOA 1THFD 1JJKA 3HGOA 2FPTA 1JCNA 1QR7A 4JTLA 3NPVA 2AQWA 3QEZA 4ORIA 4WJEA 4O13A 1TTQA 3EX6A 3FKKA 3DU0A 1YDNA 1W37A 4NJKA 4FO4A 5F4SA 4Z1DA 3KVLA 2C0AA 3RLUA 3UZ5A 3DKLA 5KZDA 1UB3A 3QJAA 3TMQA 4Z0SA 1KM2A 2A7RA 4XBSA 3HJZA 4MLRA 1LOQA 4AHPA 4N4PA 4AWTA 4C1KA 4FNSA 3NO5A 1XUZA 3U6WA 3FS2A 3O6DA 4O57A 3RU6A 4D2JA 2NUXA 4AVFA 3M44A 3QF0A 1VZWA 1HTIA 2JKPA 2A4AA 2CLHA 1K7FA 2X30A 4OQVA 1ZHAA 3TH6A 1JCMP 2CFFA 3NQAA 5H2ZA 4NX0A 3P67A 5D04C 3O6CA 1TCDA 4L4LA 3UWQA 3P7YA 5BRBA 5DLCA 3P82A 3VKJA 4QIUA 4HN4A 4DBDA 3DFNA 1XL9A 4HNTA 1TPB1 1TPDA 1LM1A 5F4XA 2QUVA 4HNNA 4BI7A 1OHLA 3HG5A 1U5JA 1S5VA 4OWGA 2XN2A 1LLZA 4MY9A 2CLFA 3KVMA 1FWRA 3VI2A 1FUYA 4PCFA 4BK9A 5E93A 2TRSA 3INPA 5LZLA 3L5LA 4GUHA 1QOPA 3B8DA 2ZA1A 4MY1A 1TPFA 4LWWA 1I4NA 3P74A 2NWRA 1TREA 5FF4A 5J5RA 3O63A 3TSMA 2X1UA 5IBXC 4DEFA 1OJXA 2OCZA 1GG1A 3I68A 3M47A 1TRDA 3LCLA 1S5TA 3R89A 1KA9F 4CCDA 2H3DA 3LCFA 1RQEA 1OVDA 3QSTA 1SZEA 1JVNA 2GQ8A 2ALDA 2A2IA 3OIXA 3R2GA 1R2TA 4LV9A 1N55A 4Z1BA 1FWWA 4LS1A 1GOXA 3T7VA 3P5ZA 4O19A 3OG3A 1R30A 2E6AA 5K9XA 3THAA 3NNTA 4NQ1A 4QNWA 2PURA 5D2YA 1BWLA 3I7RA 5D05A 5IBXA 5HWMA 2QDGA 4JD4A 3HMJG 3EB2A 3ANYA 3IEBA 3N2XA 1XBZA 4IXHA 1GQNA 4RR4A 4MKNA 3PWAA 5KITA 1YADA 2E09A 5D33A 2FB2A 2XFWA 1PL9A 1UUMA 2ZZ2A 4MJMA 3Q2DA 3BG5A 3T78A 3UWYA 3UXAA 5LKYA 4YXGA 4WY0A 4FNQA 1F76A 3LTPA 2YDAA 1DV7A 4R53A 5CKSA 3KX6A 1MEIA 2WKJA 4IMFA 1MEWA 3CEPA 3E96A 1C8VA 4NX5A 3P5YA 4IX0A 3E02A 3C61A 3O07A 5I3HA 2OT1A 1GVQA 2DZVA 2NX9A 4O53A 3VE7A 3TKFA 2NLIA 2QCEA 3OVQA 1Z42A 2QCDB 4XKYA 3N34A 4UFMA 2QJIA 4LS0A 3L66A 1TJPA 1QPNA 4LRSA 2H8XA 3IGXA 5AHMA 1NF7A 2F84A 3NR0A 1WQ5A 4FEZA 3PB2A 3G1AA 1F05A 3GDTA 2QUUA 3H53A 1DL3A 1NAL1 4KWVA 1ZNNA 4S2CA 4GUIA 4XTDA 5CPNA 5HUOA 2VELA 2Q3OA 5H91A 2DZTA 3HF3A 1JUBA 3QH2A 1OX4B 2ISSA 4NZFA 2PE4A 2V2CA 2WSYA 4I7WA 1KFKA 3NQGA 1VPXA 1WV2A 4UFJA 3HPSA 1TIMA 2RFGA 4QISA 2ISVA 4HT3A 1ZALA 4LVAA 2Z1BA 1OFEA 4AB4A 2VFGA 4LTSA 3M6YA 4UR8A 4DBEA 4E2BA 1I2QA 4NNCA 2ISWA 2H8ZA 2ZZ3A 2UV8G 3IRDA 1KFCA 2W0UA 4JTFA 3S5YA 1KBIA 3KRZA 4BI5A 1Z41A 4IMDA 3QC3A 4UFHA 4MZYA 4Y9AA 4OU1A 1AG1O 1I2PA 1XDLA 1YPIA 1K7EA 1P1XA 3KOFA 4QJ1A 4WZHA 1HFBA 2O7QA 3GXTA 3A22A 2EPHA 1Q6RA 3GNNA 3M9YA 2WOQA 3W1RA 1P0KA 3MUXA 3DENA 3L9CA 4UR7A 4E38A 3N19B 1OK4A 5LGXA 2Q3RA 4L4MA 1O94A 4FNUA 3SZ8A 3C2FA 1Z44A 1FBAA 3L65A 1H1ZA 3PC0A 3L2IA 1KM3A 3O8AA 3TQ0A 1NF0A 2NV2A 1SZGA 3G1HA 1DOSA 1LCOA 5FEZA 2OMAA 3FEMA 1W3NA 2J27A 1OFRA 5TIMA 4FX6M 1JULA 1G4EA 3MP5A 4MYAA 3MHFA 3BG3A 1TTIA 5MHBA 1EIXA 1H7NA 3CWNA 4U28A 5F2GA 1H7WA 3C2VA 3OEXA 5HWJA 2RHGA 3LCIA 4MZ8A 1OG0A 3TW7A 3NPXA 2BLEA 3CQ0A 3UPBA 4N9DA 4H3DA 4LVBA 3LHZA 3W2LA 3FFSA 4CCEA 4MFEA 4JR5A 4OT7A 1WBHA 1K8YA 4A2RA 3UPWA 1FWSA 4JTUA 4IMCA 2B7NA 4LV4A 1JCLA 4FNTA 4KKXA 5D2WA 3L0GA 3IIZA 3NM1A 1WAUA 2P10A 3E49A 1VYRA 1W31A 4MPQA 2B7PA 5HR6A 3NQ7A 1TPVA 1W5QA 3BK0A 3G1SA 2ZZ1A 2HTMA 4LC6A 3GAKA 1CW2A 3N73A 3UQNA 1A5AA 2ZBTA 2QCCA 5AOUA 1OFOA 3LV5A 4N9CA 3PUDA 3M0ZA 3TSBA 1LRTA 1VH7A 4Q4KA 4FXRA 1KLYA 1LTDA 2NWSA 4KFNA 3DZ1A 1W5PA 3PULA 4JEQA 1LDCA 4WUIA 3KVKA 4CQAA 3KRUA 3L21A 3C2RA 3L68A 5EPDA 1VYPX 1X7FA 2R94A 2PC4A 3ELFA 2Y7EA 3R12A 1VLIA 3TV8A 1TTJA 1P4CA 3G1FA 2GJLA 1DKWA 3L0KA 3OBKA 4UTLA 4EIVA 1SFJA 4FIQA 4JTGA 3THQA 5LNUA 2BWGA 3W1AA 4IWWA 4EWND 3P8JA 2Y7DA 1GPWA 2ZZ6A 1NFBA 3GLCA 1YDVA 2H6RA 6TIMA 2YSWA 5DY2A 4JTHA 3MBFA 2J88A 2ZQ0A 4RX0A 5LGZA 1VYSX 4ORMA 1NSJA 3IGUA 3G1XA 3S5ZA 4GC4A 1N8FA 8TIMA 1RR2A 3STGA 1SO5A 1L6YA 3W7DA 3FKRA 3G24A 3TW6A 3QQ1A 2ZFAA 5BMXA 1A5SA 4IX2A 4JTJA 1ICSA 1WXJA 1QWGA 1J5TA 3F4WA 1PS9A 3SFKA 1BEUA 5CZJA 3W2NA 4AWSA 2BZNA 1I2RA 5GVJA 3V1PA 2V0TA 4A21A 3PF3A 4A29A 4JX5A 1QMLA 3DKJA 3LCXA 2TSYA 3UNDA 4WOQA 5FF0A 4DELA 3S1VA 3G0SA 3OHIA 1J4EA 4JYEA 1G69A 1HL2A 3PBUA 1KM1A 3H55A 2QJHA 3UWUA 4XZ9A 1MEHA 2B0MA 1UASA 3A9IA 4Y6GA 3SECA 4UTJA 1XDMA 1OFQA 1R46A 3M5XA 1GWJA 3EWZA 2E6YA 4MJZA 5BOOA 1PCKA 1R2RA 1SZNA 2RDTA 3UWVA 5HULA 3HQ1A 3PAJA 4UTWC 4U4MA 4A22A 4Z1CA 2HS6A 5K2ZA 1RVGA 3W7RA 4BWLC 4AHOA 2QCGA 1KTCA 3UY7A 4HNUA 4HHPA 1D3HA 1IF2A 4O28A 1PVNA 3GR7A 2B7QA 1XXXA 4O1CA 4P61A 4FNPA 1GG0A 3LRMA 3P84A 3R5EA 1QAPA 5BMWA 1JRCA 1YTDA 5C5YA 3M5VA 3BO9A 2ZTJA 4JNMA 3DHFA 3DFPA 5CG7A 2C19A 2WQPA 4ALDA 4LOCA 3OA3A 4UTWA 5EYWA 3W23A 3SJ3A 3F4NA 2PRMA 3BG9A 2VEIA 3A23A 3I65A 3EX1A 4BWLA 2VEPA 4ICNA 3G22A 4O8RA 1T96A 2A6NA 3LXCA 2R8WA 4Z08A 3W84A 4UFLA 1LBFA 2BXVA 2VFFA 3QZEA 2NUYA 3S9YA 1S3HA 2HS8A 1L9WA 4P2VA 5EBUA 3PUEA 4CNPA 1GTHA 2GPTA 4PH6A 5F1UA 1PIIA 1YTKA 4MY8A 3TROA 5KTLA 1LBMA 2CZ5A 1KW1A 1T8XA 5CPMA 5I3GA 1PHWA 3P60A 4LNYA 4LUIA 3W1UA 3TFCA 1VS1A 3NDOA 4RK8A 4I7UA 3W7OA 2XN0A 3V75A 2QEZA 1Z48A 2NX3A 3DFOA 2WNZA 5CPOA 5LNVA 1AL8A 1XKYA 3LTSA 3UZJA 4O18A 4XTIA 2TPSA 1UUOA 3YPIA 1E51A 3GXPA 4X9SA 3ABOA 5LHFA 3DI1A 5AC6A 1EUNA 3LGEA 4HPJA 4UTMA 3VE9A 2ZZ4A 3UY8A 5G2HA 4PL1A 2QCLA 4R34A 2EGZA 3S5OA 2I1OA 1RV8A 1AMKA 2Z6IA 3NXFA 3A24A 4UTTC 4K37A 4MUZA 3LXAA 3EX2A 4E2DA 2BTMA
chains in the Genus database with same CATH superfamily
4PL2A 2V5LA 3NZ1A 2YBUA 1TYGA 1PX4A 4YIWA 3LHTA 4D8LA 3L4YA 4K38A 4WSJA 1HKWA 3VD3A 1N8WA 2KAUC 4N6FA 3K30A 1A0CA 1SPQA 3BTNA 3BMXA 5HXMA 1PX8A 1V6VA 4JQ3A 1CPUA 3MB9A 1JDFA 4US5A 2E77A 1JCYA 5A6KA 3VIMA 3OJGA 4DJFD 1W54A 1S38A 4DO7A 2OEJA 3M0IA 4M6VA 1A4MA 2H3BA 3S42A 4QG6A 2EPNA 4G1KA 3RCMA 3TE9A 3HPZA 1XLDA 1PX3A 1EYEA 1PTGA 1XLFA 2R14A 5F1VA 1CB2A 3B0VC 3Q45A 1HXJA 1MUMA 3AHTA 3LBMA 4P7NA 4S3FA 3WH8A 4C6NA 1R9XA 3LB0A 3ZT7A 2GOKA 3PR2A 1VGAA 1OIFA 4YU1A 4AZIA 3CM4A 4M7TA 5HMSA 3SB0A 4KEMA 1C93A 3CS2A 1ML1A 3G0UA 4TOQA 3MYOA 3L2LA 4DPQA 5HNTA 3C3NA 1KM5A 3DERA 5HINA 3MQTA 1TKKA 3FJ6A 3UD6A 1OF6A 1FWAC 3GX9A 2INZA 5CZ0A 4ENLA 2Y85A 4GCAA 3RLVA 5GJNA 2VFDA 4JY8A 4UQBA 1Q6EA 5DT7A 5K3VA 3W7EA 4B5NA 1EC8A 1Z32X 2WO5A 4KWUA 1MUWA 1TFVA 3AYVA 3WD4A 1K8ZA 3OBEA 4F0KA 2G37A 3I6RA 4FXJA 1TA3A 3P8IA 4GVGA 2XGZA 2I5GA 1PPIA 1BAGA 4LS2A 4HOXA 1B54A 3R7MA 1AK5A 2PTDA 1GQIA 2CETA 1A5UA 1J9YA 4O16A 1C3FA 3EXRA 5ABFA 3OLEA 1OC6A 4YWIA 5DELA 3TA6A 2OLHA 1EDGA 4H9ZA 3U8GA 3ONBA 3TZNA 1GVIA 4Z0JA 4J2MA 4O1AA 5CAKA 5H1WA 2J24A 1CI1A 1GK8A 2J7GA 5D2VA 4QS5A 2CLMA 2R1PA 2ZX8A 5AC8A 2BOEX 1UG6A 2GJPA 3GW0A 3AJXA 2OX1A 1QUMA 5I6SA 1TB3A 4RXGA 1BRLA 1UD5A 3DC8A 4C6EA 1FCUA 4X2PA 1UP0A 4DXVA 3RHGA 4G1NA 4D6HA 3HN3A 3QC0A 3W76A 2Y7GA 3MCOA 3RX2A 2OGJA 2PAJA 4AMCA 1XGDA 1W9BM 3H7UA 3M0LA 3LCWA 3W29A 3TUUA 3AFBA 1E1CB 1DQUA 2Z26A 3V1HA 1CENA 4FHAA 4L9ZA 4KH2A 3WK0A 4ZR8A 1W3KA 3PN8A 1K3UA 4D71A 3DN5A 1D3CA 4ADUA 1M6JA 4DBWA 1JUKA 1ESWA 4TMCA 2OLSA 4R33A 1EFZA 3N2BA 1PKYA 3I3DA 1Q8JA 1TPC1 1YNYA 4JFUA 5JH2A 1MI3A 1CX9A 1H49A 1EJRC 1FWJC 3WCZA 5A2BA 4PUJA 4OV9A 3G0XA 2GSHA 5LXEA 4DO5A 3WX7A 4JZ5A 2DW7A 2VFIA 5AHNA 4Q6XA 1PHQA 2QCDA 2NVCA 1AW5A 1TIWA 1A80A 2ZA3A 1BF2A 3ZVHA 3ITYA 4HZ7A 4GE8A 2J9ZA 2HXUA 3WH7A 1YTEA 4D9PA 5HANA 4F9JA 4UMBA 2VFEA 3RR1A 3EWYA 3PANA 3F4CA 4ADTA 1IV8A 1F2JA 4QDPA 4AIEA 3ZT6A 3H22A 3C86A 1IEWA 1RA0A 1Q6FA 5FKYA 1UKOA 3DFHA 5JU6A 2YYUA 1ISZA 5CBJA 1EJSC 2CKRA 3VMOA 2PWGA 5I5RA 2BODX 3PWIA 1SZFA 1GORA 2VGBA 2JQXA 4C6PA 4K39A 5F4WA 4O12A 4D6GA 1LRNA 2X1IA 3EZ4A 2A85A 4CQCA 1MZRA 1OX6A 3M41A 3TC3A 3CT7A 2QKFA 4I5RA 4NRRA 3ES8A 1EKOA 2I14A 3EOOA 3FJ4A 3DFSA 2FDSA 3B8SA 2F6KA 4KF1A 4JTQA 2V6AA 4JTRA 2RUSA 1MNZA 1H62A 3NM3A 3TA9A 1L6SA 1J5SA 4AXNA 1S39A 2XFYA 3HG4A 1GVFA 4V15A 5CGTA 4J27A 4BF7A 2VVSA 3TW9A 1EJXC 1GJPA 4ZBCA 2XFFA 4CUCA 4A2SA 3EB3A 3ARYA 3WUBA 3I7QA 4ZQPA 2YLAA 4WD0A 1MW0A 2WBGA 4EE9A 4QSHA 1V7AA 1SZRA 3QW3A 4D1JA 4L7ZA 3KTCA 4Y8FA 4CQ8A 1JDAA 5A8QA 1O6IA 2FKPA 5A6SA 1JR1A 3S1UA 5CJMA 1YBQB 3W7PA 4ATWA 4NILA 1KGXA 1UOKA 1JZ7A 4BQ5A 1TMLA 3W7KA 3U2ZA 3M7WA 3QXBA 2OYKA 1GKQA 1H41A 1B3XA 1O60A 2TODA 3H54A 1GKPA 4MYXA 3B06A 1OFDA 1SJAA 2DU2A 3LMYA 3C2EA 4JX6A 1QPKA 5C71A 1IXOA 2DVXA 3RILA 3HGRA 1OQFA 4L80A 3DYMA 3EDJA 5DBUA 1HL9A 3W25A 4GD0A 1EBHA 4P8VA 1TWSA 3FXGA 1R3SA 4QE1A 2CXEA 1PDYA 5K4XA 1UR8A 3EWWA 5JXQA 1H7PA 2NXHA 1POJA 5HR7A 2VRJA 1E55A 4PSRA 3TJXA 1EJWC 2QAPA 3D3FA 3CU2A 1R3WA 1OX5A 1EQPA 1S5NA 2A79A 2QQ6A 1LROA 3SN4A 1X96A 3IPWA 2EO7A 5JBDA 3MCNA 4IGHA 1LT7A 3KL3A 4HCLA 1WPCA 3W7GA 3BAXA 4Y9MA 4WQ6A 3K1DA 3LHYA 4JIRA 5LNRA 1WDWA 4CQBA 4Q8UA 3IVUA 1CXFA 2YCKX 2PS2A 4EPEC 1V8EA 4XZWA 3QQ0A 4C6JA 4L9YA 1LJYA 3OZYA 3C8FA 3VOFA 4CKQA 2GVLA 2HQAA 2QLYA 3RF9A 2XDFA 2E6FA 3S9IA 5HPOA 1M7OA 3KVJA 1GCYA 2B7OA 4IMAA 3SQLA 4DJEC 2HSAA 1WOAA 4S3AA 1TUXA 3B0UX 3VILA 2PWUA 4L4PA 3N6HA 3MT1A 1K02A 1KXHA 1US3A 1E9YB 3DX5A 4MG4A 1W5NA 3WJYA 3LLFA 2OR2A 1XH0A 6XIMA 1XLCA 3LN3A 3VOJA 1Q85A 2XYLA 4O0ZA 2CLKA 4ZQMA 4ZZ9A 3V5CA 1OG6A 3OTRA 3LK6A 4J35A 3PVFA 2RJHA 5DFAA 4GZJA 1EUAA 3B9NA 3BGAA 1DWHM 5FOOA 2J79A 3MWCA 3ZS4A 1C91A 3V5FA 4NNAA 1O1HA 2HNHA 4NXSA 4ZO9A 1LP6A 4NP7A 4AYSA 3BOLA 3WQ4A 3E2RA 5ABEA 3D5HA 1BWVA 3KAOA 4GY0A 1V3KA 2P8BA 3EDKA 2XIQA 5FIPA 1XLLA 4QCFA 1AQ0A 4P7OA 4DQWA 3VIFA 3PZOA 5EMLA 1B3OA 5KMYA 3GNOA 4Y2WA 2AGKA 1RAKA 3MI2A 4X2RA 3KXQA 4B2DA 2VGGA 3NQFA 3WBXA 5HJXA 2GQ3A 5A94A 2V5KA 3M5ZA 1V0MA 1KTNA 1C29A 4H6QA 2PWVA 3AXMA 4RZ4A 3W1PA 3KOXA 1RZMA 2OZ0A 5AFDA 2PLMA 1XCFA 2QCFA 3S6DA 2UBPC 2OT0A 4HA0A 3TAOA 4REQB 1FHUA 4M7SA 3V7PA 1W3TA 4S1FA 4DF1A 2ZX6A 4F0LA 3WQ5A 4C6CA 3BV7A 2CPUA 3W1NA 4RL3A 1EPXA 1B3ZA 5C7HA 1TPH1 4UOZA 3GIYA 1NWTA 4JHZA 3D0CA 3L4VA 1EF2A 3ARZA 1A5OC 1TELA 3V0SA 3W1XA 1U1HA 2Z1KA 2YX0A 1RUSA 3QYQA 1HO4A 2X09A 4KBXA 4GY7A 4Y9OA 3IJQA 4NU7A 2H9AB 3BJTA 3AUOA 1XIMA 6REQB 3EWXA 4QJ3B 4ZFCA 3T0CA 1X6LA 3LHWA 3W9ZA 1BGGA 4W4QA 1FKXA 2VENA 5CC6A 4DJFC 3FX4A 3GDLA 3NQ8A 3MV11 1GGOA 2PP1A 4LCQA 4RW5A 4P7RA 3IIPA 2OU4A 2V5DA 1DORA 3ABSA 4UFIA 4YMZA 5HWNA 2VI0A 4MF4A 4EOUA 2G96A 2ZADA 3APTA 5AZ1A 4LAOA 4KGLA 1R7AA 3PBYA 4EAMA 2EPMX 4PN2A 3I4EA 3QZ6A 2E8YA 2P0OA 4X60A 1M7JA 3B8VA 5HNRA 2OODA 3WSUA 2G3IA 2AL1A 3K8LA 4OE7A 1CWYA 1R3QA 2PDXA 3DOPA 5A6BD 3GKAA 5DO8A 3WN6A 3FIGA 2ZRWA 1G4SA 3HGSA 3WH6A 2J7HA 2VX7A 3A21A 4DNHA 4GIYA 3IACA 2R1LA 5JBFA 2NVDA 1SW0A 3REQB 4I3GA 2CLOA 1MVYA 3TR2A 4FZIA 2PDKA 2Y88A 3JVAA 5J04A 2ZWZA 4MWAB 4J3VA 1US2A 3QR1A 3RO8A 1CLKA 4XD4A 1VEOA 1MDLA 3L5AA 3U5YA 2QZRA 2VJXA 3GHSA 4W7WA 5T9BG 3I6TA 4IG2B 3DYOA 4V2XA 4YPJA 4S3GA 4MWAD 2FZMA 3CHVA 5MKGA 1VKFA 4BA0A 1VLWA 3BAYA 2C18A 1LBLA 1AH3A 4YNGA 3KRSA 4LW7A 5A8OA 5KINA 2X41A 1W1TA 1EO5A 2FTWA 5HK4A 3V4BA 2YDSA 3N11A 4ATLA 2GVEA 2Y61A 2CZDA 2ON3A 5L9FA 2GJXA 2AAAA 3IUIA 4MLJA 3VNDA 1LQAA 2YIHA 4YVPA 3CMJA 4PEKA 4WDXA 3W71A 2X42A 3QTGA 5JBEA 1QWKA 4LUJA 4XD5A 1DIEA 4F48A 4TTUA 5D38A 4LVDA 1Y5WA 2FMNA 1TVLA 2KZHA 2ZZ7A 4H2CA 3P61A 1JEZA 3ZR4A 3DAQA 2G4JA 4YL2A 1PCWA 1RLCL 4PB3A 3UA3A 2VC6A 2E25A 3JR2A 5H8PA 3N9KA 3W2MA 3FGCB 1RK6A 4AY1A 3BCJA 5AY7A 1XSIA 2DH2A 3BH4A 4UOQA 2H90A 3EX3A 3A3WA 3ARTA 3LPGA 4NJHA 2WJEA 2OWWA 4OGZA 3KRBA 1XDJA 3GNPA 4DO6A 4M5PA 2A7NA 3H2MA 1JXKA 2W27A 2G3JA 3BANA 4NL1A 1LYXA 3TCEA 3W02A 3B8WA 5BXRA 1BYAA 2E5CA 1KGWA 1DHKA 1VJSA 1Q7ZA 3PBGA 4WKHA 3N04A 4GO9A 3CHCA 3TAKA 3UFYA 4IMEA 2XPKA 4PBGA 3NQDA 1Q63A 1HG3A 1OINA 2XHYA 3I4KA 4J3WA 5CBBA 1GPFA 5CZTA 3GU1A 1K6AA 1BPLB 4BQ4A 3SI9A 7XIMA 3LPFA 4E8GA 5GJPA 2NXIA 2R24A 2ZTKA 4IP4A 4ZSUA 1BYBA 1XBYA 2YDQA 4Q8WA 1EZ2A 2WJFA 3RNDA 1UP2A 3AIRA 3ARRA 1N82A 4NSBA 1UOZA 2FZDA 4NASA 1KM6A 3NZRA 4AD3A 2JBMA 4D1IA 1DIDA 2E1DA 1WOBA 1VFMA 4RLIA 1HJSA 2Y8UA 3E2QA 2V69A 2FGLA 1UD4A 3TN5A 2YGYA 3TDFA 1ZTVA 2L5HA 3HG3A 4NNBA 5DANA 4C1NB 4O0KA 1GQJA 3FNDA 3GQYA 3NQ6A 1RJPA 5I3JA 5LNSA 4RZ5A 2QCNA 4PUMA 3UR5A 4JKKA 1RBOB 1O66A 1KD0A 3FHQA 2I9EA 1AZ2A 4HJWA 5HA7A 2REQA 2I17A 4XAZA 1GEHA 2R1KA 3NPVA 1MFUA 3B9EA 4M0XA 4O13A 3EX6A 5FJIA 3FKKA 3MKCA 4W87A 1W37A 4Z1DA 3KW3A 2VHLA 2P8CA 2ASHA 1OC7A 4NKCA 1IZCA 2OYMA 3C3UA 3QJAA 4R7OA 2FZBA 1E4MM 4Z0SA 4MLRA 2PU1A 1ZS2A 4AHPA 3NO5A 3GNXA 1UJQA 2ZUSA 2PDJA 1W3LA 1TCMA 3T6CA 1KKOA 2NUXA 3KTXA 4U5KA 1UPPA 3PNZA 1A47A 1XYMA 2CLHA 1I6NA 1ZHAA 4AEFA 1PZ2A 2VO5A 1JCMP 5LIWX 1HQTA 4PSPA 2ZXDA 5KEZA 1TCDA 4C6DA 3P7YA 5BRBA 5AC5A 4P5UA 3AIBA 5EU9A 2R9RA 3DFNA 2QV4A 4HNTA 3ORWA 3VPLA 1CXIA 4FR6A 1XIIA 3WUFA 1DTNA 2QMJA 2XN2A 4LUYA 5E93A 3INPA 4YN5A 2ALRA 4GUHA 2DVUA 3SQSA 1MXDA 4PMJA 1PZ1A 5A95A 2P50A 2Z2BA 2NWRA 2X1UA 4U33A 1GG1A 1XLAA 3MKVA 4ZB2A 3I68A 1TRDA 1S5TA 4W7VA 3MSDA 4D6CA 2WWDA 2WM0A 3LCFA 1X8CA 3IAQA 4F0SA 2WCSA 1JVNA 2TAAA 5HDRA 3GVQA 1V6XA 1FH7A 4B90A 3ZJ6A 3T7VA 2PU0A 4KESA 5K9XA 5BXTA 3WMLA 4QNWA 3LSCA 2D3LA 1BWLA 4CN4A 5D05A 5IBXA 1HX0A 3GFZA 3HMJG 1QASA 3ANYA 3KBMA 1R9YA 4IXHA 2V38A 2ZUTA 2HEJA 2FB2A 1PL9A 4H9UA 4MJMA 4V28A 4FNQA 3S2NA 1DV7A 4R53A 3KX6A 4IMFA 4Q7NA 3E38A 2E7FA 3E96A 3AISA 4IX0A 3E02A 1BSIA 5I3HA 3KS5A 1WB0A 2DZVA 2PDFA 4O53A 1RBAA 1S2UA 1Z42A 3AYTA 3L66A 1TJPA 4PCPA 2QGYA 1HNYA 4V27A 1JPHA 2XGIA 3NR0A 5AECA 3VA8A 3CQJA 3KBJA 3PB2A 3C0LA 4MB1A 4I9MA 1NAL1 4KWVA 4XTDA 3W28A 4GUIA 2CHRA 5HUOA 2VELA 2AKZA 4L1XA 1KNWA 2DZTA 4UQEA 1JUBA 1PKNA 5I78A 4NZFA 2WSYA 3S1GA 2ACUA 2J75A 1WV2A 4L6HA 4JEJA 2ISVA 3K4AA 4GQGA 4LVAA 1OFEA 1RK5A 4DLFA 2CCRA 3WIJA 5CSUA 3QV7A 1MUCA 4GQ0A 3LD5A 4HHHA 3G6LA 1VFHA 4AD4A 3IK2A 2UV8G 1MW3A 1X39A 3COTA 4ERGA 4Z2KA 5LIYX 4JTFA 1LUCB 4BI5A 1Z41A 4C5YA 4MZYA 1PIFA 1XDLA 3QKEA 3KOFA 1X97A 1GJUA 3CO4A 3GXTA 1VAHA 3GNNA 1P0KA 1JPDX 2QJNA 4ZA0A 1E0UA 2Q71A 3ZZ1A 1OK4A 5LGXA 4L4MA 3DEQA 1T6MA 4PMYA 4WKFA 3MUCA 4GVHA 3ARXA 2ANUA 1FBAA 2IPJA 4LJ3A 1KM3A 2VVNA 2FHCA 3SSZA 4YTTA 5FEZA 3CQKA 3PZNA 2WZEA 1RY8A 1P7TB 1W3NA 3ID7A 1UQZA 4MYAA 4NAEA 1EIXA 4XD3A 4U28A 3ARVA 1H7WA 3H2AA 3OEXA 3OODA 3GBDA 2BLEA 2FZ8A 4IJRA 1UBPC 2GK1A 5C9XA 4OT7A 1WBHA 5AVNA 3GHTA 3R43A 4OIFA 1GW1A 4V1YA 3SCNA 1QJWA 1XRVA 5D2WA 3BLDA 4ZXLA 1W31A 3GD6A 5M1TA 1HKJA 5H8UA 2HTMA 1FWEC 2P3ZA 4AZ5A 3E5BA 1A5AA 4WDUA 2R1NA 5D4YA 3W4RA 4A8LA 3M0ZA 3SRFA 2GSEA 1LRTA 4FXRA 4HJFA 3A4XA 1NDVA 1KLYA 3N4FA 3WDJA 1JZ3A 3DZ1A 4ZGYA 4WUIA 2F9RA 1QNPA 2YDRA 4Q4QA 4G7EB 3L21A 3C2RA 3L68A 1LWJA 2VZSA 1X7FA 3ELFA 2Y7EA 4HTBA 3ABXA 3AIVA 2D2JA 1LWIA 4MAVA 3OBKA 4UTLA 2PDQA 2HWGA 4EIVA 2HISA 1SFJA 4IM4A 4FIQA 5LNUA 2BWGA 1OCBA 2ZZ6A 5AYBA 4GI9A 1VFFA 3WLMA 4B5TA 4DVOA 3MZNA 3GS6A 3MBFA 3WG6A 5LGZA 1CGTA 3GUGA 1NSJA 3IGUA 4E4PA 4XZBA 1T5AA 4LYRA 1YPXA 2PB1A 4GC4A 1IHIA 3OP2A 1V6TA 4HHLA 3W7DA 4LCSA 4C91A 4UTFA 3SURA 3AUJA 1WXJA 1QWGA 4AZCA 1E3XA 3I3BA 3RPDA 1FWFC 4AZHA 5CZJA 3W2NA 1I2RA 3OLGA 1K9FA 3AWNA 3V1PA 1OGBA 2V0TA 3PF3A 4L65A 2XWDA 3AIEA 2TSYA 2DEPA 3G0SA 3OHIA 1J4EA 3WBWA 5A8MA 1E0TA 4AZ7A 3PBUA 1TV4A 3H55A 2XG9A 3HQNA 3PPCA 4H6RA 4UTJA 3R25A 3VZYA 1R46A 3AS3A 3OZMA 3M5XA 1GWJA 4LPCA 5BOOA 3CYVA 3H7VA 1Z8AA 4GK8A 3UWVA 1XRSA 2ZX7A 2PUZA 3E0FA 1EF3A 2CIPA 5REQB 1W9PA 5I03A 4H7VA 1KTCA 2ZWYA 1D3HA 2WB5A 2XVPA 1IF2A 1B9ZA 5ECVA 5HMDA 1XXXA 4O1CA 4FNPA 3EMQA 3O7UA 1BYDA 3LRMA 1ZGDA 1KB3A 1JFXA 3M5VA 3VD4A 3BO9A 4DM1A 4JNMA 3DFPA 2XVNA 2Z1XA 2C19A 2WQPA 2OWCA 3OA3A 3UERA 4US5D 5EYWA 3W23A 3SJ3A 3BG9A 2VEIA 3A23A 2HK1A 4O8RA 4Z08A 1OT1A 4UFLA 3TTEA 2XIMA 1AUSL 2VFFA 9RUBA 2X2YA 3GFYA 3S9YA 3WQ8A 1LL6A 1YHTA 4P2VA 3CGTA 5A6AA 5IHSA 5JUVA 1JYNA 2J7CA 1YTKA 2JE8A 4MY8A 3VKAA 3FVMA 3TWAA 4LB4A 4DHGA 1JYWA 4A3RA 5I09A 1DPMA 4LUIA 3W1UA 1VBUA 1ZL1A 4BCEA 4EXQA 1UYQA 2NX3A 2PMQA 1AL8A 3LTSA 2GGEA 4H01A 3H2EA 4RDWA 3UPMA 4WHBA 3ABOA 3H4WA 2JALA 5AC6A 5ABGA 2WVTA 4J3UA 1DWJM 2DSVA 3QYSA 1HVQA 3OQEA 4UWMA 2I1OA 2EEXA 1FOBA 2PD9A 1BVWA 3A24A 4K37A 2XH2A 6CGTA 4E2DA 3W6YA 2R82A 5ABFB 3EOSA 3MMUA 3KHJA 1A5MC 1Q7QA 1GOQA 4A8IA 4AFYA 3MI3A 1G7VA 5E0KA 1VD6A 4YCPA 1XYBA 3UNTA 4ZB0A 2ZUUA 3EXTA 4IPIA 3HPFA 2SFPA 2EQDA 3NVTA 4MHBA 1XX1A 4IT1A 3AO0A 3R8HA 4I6VA 3G8EA 5CAHA 2G8ZA 3EEGA 4JTDA 4IIBA 2WV8A 4UTTA 3FAXA 1HF6A 4FLSA 5DMMA 3B03A 3QMTA 3TTQA 2ATSA 3KOWA 3TEVA 1YXCA 5FI8A 1VFOA 1KRAC 1ZFJA 1REQB 2FPYA 4S3BA 4FP1A 3EXSA 1OYCA 1RHCA 4GA8A 1KV5A 3GVRA 1XFBA 3MCMA 3TQKA 3P62A 5K7JA 1KLZA 3AZRA 3T09A 4PYSA 3T0BA 3DESA 4J4KA 1FXPA 5AYYA 3EA1A 3F4DA 1TZZA 4W9TA 3UGRA 4GUJA 4GYJA 3W27A 4D6JA 3KS6A 4PGLA 4QFUA 1YKWA 4DJDD 1S5WA 3Q94A 4K6AA 4YTSA 2YOCA 1ADOA 1W0MA 2DPEA 2W92A 4MADA 3AMKA 3F2BA 3HOJA 4GVIA 1JF5A 2G97A 3SY5A 3PG8A 3NQVA 3GDRA 3ZM8A 1JCXA 1E6NA 3KEHA 1R47A 3GKFA 4DF2A 1ZAIA 1RY0A 3NOEA 4H4IA 4C6QA 2TYSA 1X1NA 3NQ2A 3VX0A 3LV6A 1KM0A 3S6TA 3Q37A 2OTDA 3NGJA 1NDWA 1BVNP 2Z28A 4JAWA 4IL2A 3VC6A 4UQDA 3URNA 3U7VA 2WNNA 2F61A 4CNUA 2V82A 1V6YA 1MXGA 3H4GA 4UXDA 4H00A 5E6YA 5C2XA 2GVYA 1J93A 5DT5A 1G7UA 4O8AA 3CUZA 3T81A 3NL6A 3KCJA 4LAMA 3WNOA 1YLVA 4K7VA 4O15A 3ANUA 2WC7A 1E15A 3H24A 2EF9A 4TXEA 1XR2A 2VOTA 5K9CA 1KWKA 2BGNE 4B5XA 1B90A 3M6DA 1EC7A 2Z1VA 4Q4SA 1FVPA 4XVEA 1K1DA 2GVGA 5FJUA 1EA0A 4JYFA 9XIMA 1K77A 1TV7A 4WK9A 3AC0A 1U5HA 3LDVA 3VNYA 2GFTA 5FJRA 3PPGA 3AWOA 1FCBA 3BAKA 4PFHA 2QMKA 3CZJA 4GNKB 3AI0A 1M03A 3OHMB 3PZGA 3U2OA 3W73A 3KCLA 4F4RA 1J96A 3QBUA 4GACA 2OEMA 5D32A 4OHQA 1FP8A 4QQUA 3BAJA 4E2OA 2ZZ5A 1UWAA 1RPKA 1CTNA 2Y70A 3APYA 4PUNA 5IFTA 3UG5A 2OB3A 4J5NA 5KSWA 2CWNA 3VNJA 1KCZA 4C7FA 1G01A 4JIHA 2E8ZA 3OGVA 3PM6A 5AHIA 5LA1A 4J3TA 3HQOA 3UG3A 1XBXA 3GY1A 2INEA 1G9HA 2CBVA 2D23A 2OX4A 2RAGA 3OVPA 3APGA 1HKKA 2DZPA 3VM7A 3NQBA 1NDZA 1EC9A 3L2MA 2IUZA 4MJ2A 1UWUA 2V2HA 4TMBA 4GG9A 3FW6A 4K1GA 4AWUA 1WYIA 2VD9A 3JZEA 3GNRA 4MNMA 3W1QA 1I45A 3VYLA 5FESA 2XZ7A 3CASA 2WWCA 2J4GA 4QM1A 2WVSA 2Y5JA 2UY5A 3UCDA 3MTWA 2YLLA 2TMDA 4C1LA 1OX4A 1XYZA 2QR6A 2ZE0A 4AX7A 1GOOA 4XWUA 4LY4A 4FXSA 1IGSA 3NDZA 2HCVA 3CPGA 4V33A 2GQ9A 3MC5A 1JZ2A 3N3MA 3BPWA 4CD6A 5LSMA 4I6KA 2W62A 1NWSA 1GEQA 1B5TA 2VKZG 3UT0A 2E3ZA 2FYMA 5CPSA 1O1ZA 2A21A 3R58A 1W56A 1XQLA 4ZEPA 4X63A 2ZRZA 3FOKA 2CERA 2O92A 3E74A 1CXKA 1DEDA 3N12A 2YBVA 3R79A 3U5UA 1EP2A 2QPUA 4X9YA 3SUSA 3VM5A 4TX9A 4KFPA 4C7DA 1BKSA 3KBVA 1X8FA 1E56A 1MMFA 3UCQA 3W7QA 2IQTA 3VMPA 1JI2A 4DI8A 2Y6ZA 1MNSA 1WAWA 3G18A 2VC9A 3GO2A 3C0QA 3ITOA 4LAZA 1Q6QA 2PDYA 4PMXA 1K4GA 2C1GA 4RPQA 3EAUA 2I5QA 3GWQA 3WYZA 4LEFA 1ONXA 2VFHA 4AD2A 4HYVA 3OZOA 3R11A 4MM1A 1OWQA 4UFKA 3W1MA 1OGGA 4PEEA 1Q2SA 2YR1A 4RE0A 1IEVA 1MRAA 2J7EA 1V3IA 1I1WA 3IS4A 5D30A 4S39A 4GBUA 1GYNA 4PCSA 4HSNA 4YVXA 1ICQA 2IPGA 1IT0A 3SUTA 5A5WA 1YDOA 4KEZA 3S5SA 3PUGA 1I0DA 3GB6A 3DFTA 1QI4A 3B4YA 3B0PA 1HJVA 1KRMA 3T55A 3G5EA 1RQHA 1S2AA 3QY7A 2O7SA 4O52A 3KFTA 1DJQA 4GGHA 1SR0A 1NTHA 1YE4A 3LPPA 2DIJA 4GXWA 3HMCA 3FA3A 3G3MA 3KP0A 1RJRA 3QHOA 1CLXA 3H7RA 4ADSA 2XVGA 1H7RA 5GQBA 5E0CA 1XCWA 1QO2A 3BMVA 1Q6LA 1PTAA 1FWGC 3NO1A 4UNLA 1GVEA 2ZUWA 2ACRA 1HJQA 4KCTA 3CIWA 1MZHA 3LSBA 4WXYA 3UXDA 1J2WA 2MUCA 5EFFA 2DQWA 4NJIA 4N6EA 4I9TA 3ZIZA 1E5JA 2XUCA 1FWCC 1LRQA 2D2HA 3MSYA 1A5NC 3TK7A 3WLNA 3RRXA 2IMRA 4W7UA 1UH2A 4PFMA 4XSLA 3Q65A 3P0WA 3LRLA 5GNXA 1UD8A 3WDQA 4QLKA 2ZXBA 4PBEA 4MPKA 3CZGA 3CWOX 2VQUA 1TVPA 3ZSSA 3AHXA 2VCBA 3GXNA 5I3FA 4O17A 3NAVA 1A4LA 1G6CA 3HG2A 3TTYA 4IQDA 2HVNA 3TQPA 3FSUA 4IIFA 2BVWA 3LTYA 3N6QA 4L56A 4YCOA 1E6PA 1HN1A 2GYIA 4MKVA 1QDSA 1FWDC 4UC5A 1ZQ5A 3LA4A 3MV01 3TC7A 4KT2A 2YKKA 4QEHA 5LYRA 2ZUMA 5MF5A 1TZ7A 4DJEA 3LYEA 3LM7A 3IANA 4KWWA 1FDYA 4UTUA 2Y62A 3UG8A 2FTPA 3PBVA 2O9OA 3W1LA 5K4ZA 3O2LA 1E9LA 1JUEA 1CDGA 4JS3A 1X1ZA 1IT7A 2GGIA 5D09A 1DYSA 4K8GA 3WK2A 1ZCOA 1G1YA 4IMGA 1VBJA 1V7YA 4HVXA 4YLWA 1HO1A 2B4GA 4W93A 3RJXA 2NZLA 2X0SA 4QLJA 4AEOA 4JX4A 4NJGA 1KC7A 3GH4A 1F7BA 1UWIA 1UIOA 3GK0A 1G67A 4UTHA 1XIFA 4JQ1A 3WJXA 1IXPA 4QCEA 3N6JA 4A35A 2ABAA 1QHPA 1XICA 4ZO7A 4RW3A 4WOZA 2V5JA 3SAZA 1XI3A 4C6KA 2Z0IA 3R8RA 3NEHA 1Z6KA 2YFNA 4LUSA 1XRTA 2XJ7A 2BB0A 1ZLPA 5AYXA 4IFKA 3EX4A 4DI9A 3Q67A 4K3ZA 3W7LA 1EHAA 3DG6A 1PV8A 3W7NA 3WJZA 4DNMA 2BOFX 3TYAA 1X98A 4QLLA 2DORA 3F1QA 3TN6A 1Q13A 1QOQA 3SCPA 1KQYA 4PTWA 5EMYA 3RM4A 1Q8AA 1MQQA 3AYSA 1EB3A 4QXIA 5D9NA 3LCHA 1RXOB 2GWGA 3WQPA 1QNOA 1A5LC 2ZE3A 3S83A 3ARSA 5DRCA 2ZXQA 3G2GA 3LU2A 1Q6DA 2J9YA 3CYJA 1A5BA 1XWYA 5HQEA 3USZA 1OGSA 2A6LA 3MO4A 2YXXA 5A2AA 1GVRA 3MJYA 3WO8A 2DZUA 1VQTA 1P43A 3K1GA 3U3HA 5SWUA 5BU9A 5AN7A 1W5OA 1UUQA 1IZKA 3B04A 2C15A 1XV8A 3VNLA 2OKTA 1M7PA 4FAMA 4XKMA 4QROA 1I2OA 3AXKA 3UWZA 2YBTA 1LLOA 1F6KA 1E6SM 3VINA 1JZ5A 1J79A 2NUWA 2GDUA 3M0KA 3CUJA 4HA3A 3C6CA 2FB3A 2OOGA 1KGUA 5G5IA 2WNQA 2NV1A 4RV8A 2NQ5A 1WNOA 4JTAA 2QPXA 4DJFA 1V0NA 3WBAA 4DJDC 4GBDA 5JH1A 3OGSA 3CUFA 3VGFA 4FX7A 1TR9A 4M81A 4N9EA 2WSRA 2W66A 4G56A 1HKMA 4C6MA 1TJ2A 1XJBA 2A0NA 1POKA 3DFQA 2WANA 2Y7FA 1GTEA 4NF7A 2PZNA 3WMSA 2JIWA 4EF9A 2BOGX 4XAFA 1Q65A 4TV5A 3LI1A 4LY8A 1E0WA 3A9BA 3VMNA 4A3QA 2PI6A 1NWRA 3OYXA 1FH9A 2ZDRA 4RNJA 3PK7A 3TONA 1NH6A 3MHUA 1O5KA 4JL1A 1TVNA 2POZA 2CU0A 2AQVA 5I3IA 4CEUC 3AS0A 2YA0A 2PGFA 3BSGA 3CXOA 1XLBA 3N2OA 2PC8A 1QCWA 2F7FA 4LT9A 4JQ4A 3VKDA 1VFLA 3R94A 3WEZA 2EJAA 1W9VA 3D3AA 2XIOA 4KIRA 1AFSA 2A1YA 3CMGA 2JGYA 3H2FA 4GIAA 5ECUA 3T8LA 1M68A 3VXGA 3BLKA 5PTDA 3F5KA 2VC5A 3T9PA 4B5VA 5I2UA 2XVKA 4KCWA 4J40A 1ZY9A 1FXQA 2J25A 3B4UA 5C2GA 3W75A 1K9EA 2W6RA 2PLCA 4MWAE 1DJGA 4GCXA 2VZOA 1UCWA 3W26A 5M17A 1PE1A 5AHFA 4LVFA 1GQLA 4CVWA 1GOIA 1AVAA 3VIOA 2WKLA 1E5NA 5HAOA 3E5PA 2DSWA 3RAOA 3OIHA 1DQXA 3S1WA 4L5ZA 4YVVA 1FY6A 3W53A 2OG9A 1CGYA 3UJFA 4LFYA 4ML9A 1VHCA 3ANVA 3PZ9A 1SO3A 3CAWA 5EMMA 4O54A 1B0IA 1PUDA 4GOAA 9XIAA 3BZGA 4UUIA 3EDFA 3B9AA 4FNRA 2Y8VA 2E5DA 2VEMA 4QEEA 5DCDA 2WMGA 3S5NA 3MUZ1 3RLHA 2XU2A 2RDXA 4GYPC 3MUY1 2DT3A 4K1WA 1GKRA 3U57A 1ODZA 1E1CA 3QFEA 4B4FA 4QITA 3NEVA 2PWDA 2OVLA 1OYAA 2BHYA 3LXBA 4I5XA 3S3GA 3VZZA 4KFOA 3P81A 3GVWA 1QO5A 4JN6A 2WPGA 1NJJA 4XZLX 4FR1A 4FOKA 3F2DA 1LQ2A 1N2VA 2DZAA 4UNKA 1ONRA 4QE5A 5F7UA 1UKSA 1N7KA 1OEPA 5K9DA 4DZHA 2CLIA 4LYQA 4DF0A 1QTWA 5DN1A 1FCQA 1H7XA 1GT8A 3W7JA 2QAFA 4E8CA 3FEQA 4K7YA 3W07A 1GONA 1OFBA 3BW2A 4GLEA 1CYGA 2HZGA 4HQVA 4K68A 1A53A 1ECEA 1HGYA 5CGQA 4CLMA 1EP1A 5G1TA 1YE6A 5IFPA 1AW1A 3WLSA 4WX2A 1J18A 1FCVA 3T42A 4US6A 3N2MA 3TX9A 1VJZA 1XRFA 3P3BA 5AC7A 3FSTA 5CJNA 1P1MA 2A5HA 4UZUA 3TTOA 5BYWA 1FX6A 4RJEA 4O14A 1DIOA 1W8SA 1D7KA 4IUOA 1Q6GA 2DVTA 1YNQA 2YFOA 4H8NA 1JJKA 3HGOA 4LQ1A 2FPTA 1R6WA 1KKRA 1FH8A 4ASTA 4JTLA 4S3CA 2AQWA 5HMFA 2PDPA 3VC5A 4WJEA 2WNWA 1LG1A 3DU0A 3GW3A 1T40A 1YDNA 3ISIX 6TAAA 4NJKA 4FO4A 1AQMA 1J6PA 1QNRA 4W88A 1PDZA 4GISA 3WD3A 1GW9A 2QVNA 3BXWA 1UB3A 2QS8A 4L1WA 3TMQA 2X0YA 4WDTA 1V3JA 2Z27A 4XAYA 4QJ4B 4XBSA 3HJZA 4HP5A 3B0XA 4JOMA 4N4PA 4DYKA 4C1KA 2Y5SA 4FNSA 1XFCA 1RCXB 1XUZA 3BQ6A 4D2JA 3WH9A 1VZWA 3FYYA 3DECA 4Q22A 1EO7A 4W8BA 3EWDA 2PBOA 1ZPTA 3TH6A 2W63A 1W2VA 3NCOA 3EOUA 5H2ZA 4Y7EA 4RZBA 1YQ2A 3P67A 5C7VA 4L4LA 2YA1A 3SGGA 5CLWA 3UWQA 4HTYA 1ADDA 1YBQA 3P82A 2J8GA 4QIUA 1TPB1 2C7FA 1LM1A 3V16A 4DUXA 3GU2A 2PTZA 4BI7A 1ZSXA 3HG5A 1J2BA 1U5JA 3BURA 1UROA 1LLZA 4MY9A 3GG8A 3KVMA 2IXUA 3TN3A 3VI2A 1FUYA 2WHJA 2ISDA 3TCSA 4BK9A 4GZ7A 3L5LA 1OCQA 1HKIA 2R1MA 2Z00A 3HQPA 3RN6A 2ZA1A 2NT1A 1E1EA 2WCAA 4PMRA 3U2EA 1UR9A 1TREA 4DRSA 5FF4A 5J5RA 2C1IA 2YL8A 4DM2A 4B5SA 1P6BA 4M80A 4UQCA 2BXZA 5BU6A 2BVYA 1E6RA 3MU7A 5I79A 1F3WA 1KA9F 1L6FA 3WLHA 3GC2A 1CXEA 1XG3A 3QSTA 3NWRA 2ALDA 2A2IA 2GGJA 1R2TA 3TOYA 1NOWA 2CBIA 1FRBA 6XIAA 1RVKA 2G3MA 1R9ZA 3CJPA 4NQ1A 4LF2A 2PURA 5D2YA 3I7RA 1ITUA 4PRTA 3LNPA 3N2XA 1XBZA 1AQHA 4RR4A 3SUWA 4YJ5A 5D33A 2XFWA 1UUMA 2EXOA 2ZZ2A 4Q8TA 2E1WA 3BG5A 3UWYA 4IZGA 4YXGA 1I9CB 1PYMA 2QNEA 2YDAA 1BD0A 1X38A 4Q4OA 1MEIA 1FP9A 2WKJA 1UA7A 4BY3A 4NX5A 4Q8PA 2NV9A 1JFHA 2FJUB 1H2JA 4XZHA 3ONCA 2UY3A 2OT1A 1XIJA 4DWSB 4AC7C 3VE7A 3V35A 5CG0A 5A69A 2EBNA 2MANA 4DXXA 2QCEA 3FCPA 3OVQA 4H2HA 2QJIA 3TN4A 2H8XA 1S46A 3IGXA 1NF7A 1ECQA 4DWSD 1CIUA 2WZTA 5CQ1A 4FXFA 5IXEA 2EG6A 4FEZA 5LA0A 1NWUA 1W1A1 3G1AA 3HV9A 4LAUA 3WUEA 2EPKX 4S2CA 4I9JA 5D8ZA 4DAFA 2ZC8A 2PDMA 3QH2A 5JMUA 2ISSA 1KFKA 4IIHA 3NQGA 4OOZA 2WHLA 1XINA 5C9ZA 1TIMA 4QISA 3SEPA 1ZALA 2AGTA 4LTSA 1KWGA 3M6YA 1R3VA 4OTKA 4E2BA 1I2QA 3II1A 5I23A 4NNCA 2ISWA 3M7SA 2H8ZA 4JBRA 2W5FA 1ISVA 2VDHA 1KFCA 2A3LA 4GZEA 3CL7A 2BY2A 4AIOA 1KBIA 3NSXA 3QC3A 4ROQA 4BJHA 1I2PA 1K7EA 2OZ8A 1M01A 3SJNA 4H9XA 1F8IA 1HFBA 2O7QA 1UWQA 3LENA 4REQA 3M9YA 3D6NA 4OUEA 4QDMA 5JIWA 3DENA 3L9CA 5XIMA 3R4IA 3N19B 3SZ8A 4FNUA 3C2FA 5I06A 1Z44A 2BG5A 3GTIA 1RJQA 4JN7A 4PMNA 3PC0A 2PDNA 1UKQA 4H83A 3H2NA 3O8AA 3TQ0A 1NF0A 3E0WA 3EPMA 4ROPA 3VCNA 1DOSA 3T2PA 4AISA 2V5CA 2GGHA 4BHYA 4HU4A 3L12A 1KXVA 1BG4A 4FX6M 4QSFA 3MHFA 2IPFA 5MHBA 4X0NA 3CL6A 5F2GA 2H9AA 1VFSA 3A4AA 6REQA 1PXGA 1OG0A 2WVUA 4JIEA 3GTNA 3UPBA 1U1UA 3CUHA 2J62A 4LVBA 3LHZA 5B7ZA 3W2LA 3EOEA 1U22A 4CCEA 3RM9A 1L0PA 4A2RA 4P8WA 1FWSA 3N15A 3U4AA 2PLJA 4KKXA 3L0GA 4MNJA 3RMEA 2HBXA 1TPVA 3L23A 3NQ7A 4WCJA 3JU2A 3G1SA 1E4LA 4LC6A 3GAKA 1CW2A 1XLHA 3W82A 2QCCA 3TZFA 1OFOA 1UZHA 2D0GA 2DSKA 3TSBA 1JXJA 5A6BA 5HMEA 4EPDC 2NWSA 2EG8A 4KFNA 3URBA 4C5ZA 3PULA 3URAA 3BC9A 3N29A 2OO6A 1LQ0A 5FSEC 4CQAA 3KRUA 4LSBA 5EPDA 4WJXA 2R94A 3SQMA 2PC4A 2FHBA 2PA6A 3G1FA 2GJLA 4WGHA 5H6HA 2HRWA 4XO7A 5KETA 4JTGA 4AIUA 2XSAA 3W1AA 2DV0A 3REQA 3H4XA 3P8JA 4HBKA 1NFPA 1YDVA 2H6RA 6TIMA 3ZLFA 3TYCA 1TJ1A 1E4IA 4MWAA 3WLTA 1J11A 1VYSX 3S5ZA 2Q8XA 2CEQA 1RR2A 5CC3A 4TVUA 4IG2A 3G24A 2BBFA 2ZFAA 1T41A 4JTJA 1ICSA 1NP2A 1CCWB 2JF7A 1J5TA 4ZB5A 3F4WA 1PS9A 2DFAA 3MANA 4XUYA 3CTTA 3CHEA 4XB3A 3SFKA 1BEUA 4RUBA 1JDDA 3NTYA 3UXKA 4A29A 4JX5A 3UNDA 5FF0A 4DELA 2PGRA 1G69A 1HL2A 1KM1A 2QJHA 4XZ9A 3RM8A 3A9IA 2OQHA 5BRPA 1XDMA 1OFQA 3UGVA 1XISA 1HT6A 4MJZA 1WZLA 1R2RA 5BRQA 2EPOA 2RDTA 1MYRA 1WXYA 5HULA 4YHEA 3UR2A 3HQ1A 3PAJA 4UTWC 4PB5A 4A22A 3GTXA 1EDQA 4BWLC 4AHOA 2NQZA 3UY7A 4GO8A 1R5YA 3ZYZA 2PF0A 3E2SA 2DH3A 2HVMA 4EKJA 3GR7A 2B7QA 4CCZA 3NO3A 1GG0A 3AU6A 4GKLA 2G50A 5LA2A 2ZVIA 3UG4A 3ITVA 3U0HA 3TJ4A 3CUIA 4HPHA 3CT2A 4LB3A 4HD5A 3DHFA 4L64A 4CD5A 3RX4A 1QW8A 4ALDA 4EACA 4LOCA 4KWOA 3FDGA 3SADA 4TX6A 1TUFA 3F4NA 2PRMA 3O6AA 2XM2A 1SJBA 3OPSA 3FJNA 2CWXA 3EKGA 4ICNA 3NYDA 2D3NA 3W84A 1ZBWA 4G5DA 1S3HA 2QT3A 3GC5A 2YL9A 5E70A 4CNPA 5F1UA 3T0TA 4DBUA 1IEXA 2XIJA 2GDQA 2OO0A 3IV8A 5KTLA 1LBMA 2CZ5A 1T8XA 1YEYA 5CPMA 1NU5A 5I3GA 2O9RA 4JFWA 1V02A 4W8AA 4LNYA 4XIMA 1XG4A 5A6JA 4RK8A 4I7UA 4PMVA 4W8LA 4XG1A 3W7OA 1AMYA 3WEMA 3V75A 1SFTA 3MVIA 2XM1A 5TAOA 1Q6CA 3VOCA 5LNVA 4FMVA 1XKYA 4IIEA 3UZJA 2TPSA 3WF2A 3UZXA 1J0KA 3YPIA 2WBKA 4X9SA 3DI1A 1EUNA 3LGEA 1B30A 4QE4A 4HSHA 5G2HA 3MSGA 3M0XA 5BCAA 3WBEA 3S5OA 3GIPA 3PTMA 1G94A 1XYFA 3S2LA 3WZ0E 1AMKA 4XZIA 3NXFA 3CAQA 3QPEA 3SCQA 4O0QA 2XVLA 3LXAA 4D8AA 3EX2A 2WMIB 2GUUA 2G3FA 3BICA 1Q3NA 4AX6A 2DY3A 3ATZA 1VR6A 2V30A 1S2WA 3A47A 3AXIA 4GRSA 4C1NA 1KXTA 1WDRA 4LRTA 2PRHA 4AVOA 3STCA 2A3CA 4M6UA 4J2PA 1E6QM 3WQVA 1C8YA 3A64A 4HMNA 1ZUAX 3W7HA 4MOZA 1MO0A 1UQYA 4N2YA 1KFJA 1K8CA 1OD0A 5E9AA 2EJ1A 4GUFA 2E68A 3NPWA 3IJ9A 3WLLA 1FHVA 1LOLA 1EWEA 3KWXA 3LZ3A 1QFEA 2W91A 2ZICA 4WR3A 3I3EA 4FLOA 4ZQOA 2GDVA 2V9DA 3PAOA 1M3UA 2VX6A 4Q33A 1F74A 1NY1A 2ZYFA 3SDOA 1B3VA 1SO6A 4PMUA 4QAWA 1S2CA 3QSRA 2Q02A 2GGGA 4Q7BA 1Y5VA 4DB7A 2BFGA 4MJ4A 2FGZA 1DJZA 1L2UA 3LGDA 3B05A 4NI8A 3WFZA 4F0HA 4JDBA 4DN1A 1F3TA 4UCGA 2WW5A 3ZFHA 4G2DA 3W70A 1FFRA 3IRSA 1ELSA 1CGWA 3S0CA 1TTPA 1KFEA 5D9PA 3U9IA 3VZXA 3GRIA 3T4CA 1F61A 1UR1A 2WQDA 3GYEA 3BLLA 3SR7A 3PPFA 1I2NA 1UP3A 5IDIA 1ZBCA 4GI8A 3KZSA 1XM3A 1A3WA 4LU0A 1TV5A 8RUCA 3R1ZA 3IGHX 3GDKA 3IJDA 4E0CA 2PGEA 1SR9A 3BWWA 5AHLA 1G4TA 3A13A 4K8HA 3WF0A 1EBGA 3TLLA 2VCCA 4OBTA 1SYTA 2V2DA 5T8GA 4M6PA 1UD6A 3QOMA 3W72A 4GX9A 5FEPA 4B16A 3G3DA 3K2GA 2PPGA 3MMWA 3NYZA 2I7GA 3T8QA 3W22A 2WMJA 1EHNA 4A3YA 1P5BA 4LGXA 2XTKA 2FFCA 2CLLA 3CK5A 3S2MA 3WNPA 1WKDA 4DPPA 2UZ9A 2PDUA 4UTKA 3N4EA 5E1QA 2D2GA 2Y4SA 3L5MA 4W86A 2ACQA 3QW4B 4HMEA 4IICA 4GFSA 5FL0A 4RZ6A 2VDIA 2JFEX 4TR9A 4WKAA 3UXIA 2C1HA 2VRQA 4EP8C 4QAIA 3TYEA 3WMBA 1H61A 3BW4A 3UETA 2AAMA 3PP7A 3N14A 2FIQA 3MO7A 5XIAA 1ITQA 2CYGA 4BI6A 4GZIA 1BHGA 3SCRA 6ALDA 1JRBA 3UJRA 2C6QA 1E43A 3LPOA 1EGVA 3IJLA 4CN1A 1QK0A 1XF0A 4E3TA 4AZ6A 3B40A 4F0RA 3MY9A 3U48A 1EWDA 2ZRUA 2P1FA 1XLKA 4AF0B 5A8PA 2HPMA 3IGSA 3TVAA 1EEXA 4J9JA 2OFJA 3B9OA 4AHQA 1KRBC 3IV3A 3BW3A 3G1YA 1IWPA 3LZ5A 4IGMA 5FF7A 3E12A 5FEXA 2XH7A 2RKXA 3OU8A 4QJ5B 3PS7A 3B8UA 5T26A 4PUUA 1R85A 5CGMA 3K8KA 3G1VA 1A49A 4CGTA 2ZCGA 5EKYA 3LLXA 4UQAA 5A8GA 4OVXA 1F6PA 1HL8A 3EBVA 4U2YA 2CLEA 3CLMA 4R5EA 4PZVA 4L1GA 3IVTA 4J3SA 1XW8A 2ZUNA 3THDA 2FLIA 2NT0A 4O4VA 3OW1A 2X1RA 3N3TA 4K2SA 4TUFA 4E4FA 5T91A 4F9DA 1G4PA 2YPIA 2D0HA 3SFWA 4CNNA 4DY1A 1LZOA 1D9EA 3WLJA 4LUTB 2AL2B 1QBAA 2QCHA 1GOMA 3UVIA 3PZIA 4WY0F 3RXZA 4CD7A 1LUCA 2YCLB 1OFPA 3PJTA 3KBSA 3ATYA 3BJFA 1O5QA 1QPOA 5D03A 3PJWA 3SCWA 5CEWA 2VOMA 1GVSA 1SW3A 2VGIA 5LIKX 2X2GA 1ZJHA 3ME3A 4D6IA 1R0MA 1UPMB 3VUSA 3QMRA 3WF1A 1KFLA 1QPRA 3BLIA 5EY5A 1VB9A 1OABA 2A3EA 3PY2A 4GI4A 1LL7A 4WLCA 3V5OA 2VZUA 1UZDA 3BLOA 4Q32A 1GYMA 3BDKA 1MQPA 1P7TA 4QBXA 1PKMA 3CZEA 3NOYA 4J7RA 3SN1A 1CT5A 3S46A 8XIAA 3LX9A 3CV1A 4FLRA 3W1TA 3IARA 1JPIA 2Q6ZA 1P0NA 1V03A 1EZWA 3KOYA 1J8VA 5B7YA 3P80A 3IUHA 1IXNA 4R88A 4NZ4A 4JFVA 3LQGA 4O1EA 3R6IA 4GXMA 1E71M 1AD4A 1ONWA 1M65A 1S5MA 1LF1A 4Q8VA 3K4WA 1ME7A 1B4EA 4HOWA 1VCFA 5DMNA 3VNZA 3M07A 2OSXA 1UMYA 1A50A 3T44A 2XINA 3I6EA 3LLDA 1J0JA 2Z1WA 4G7EA 3CZKA 3MUAA 2DT1A 2PTXA 1W9XA 3N1AA 1IR2A 4ACYA 4IFKB 2VGFA 4IP5A 1DE6A 3H8AA 2PFHA 1KM4A 2BX7A 2BV9A 2DIKA 4QP0A 3HURA 2ZUVA 2Y5EA 3MI6A 2BMBA 3DCPA 4DWDA 4TIMA 4J28A 4UMAA 2I56A 4LXFA 1PO9A 2DGAA 3E0LA 4Z42C 4FALA 4RDZA 1ZBKA 3WNMA 2J7BA 4HYWA 4LBSA 4JY9A 2DT0A 4LCRA 2DUXA 2BP1A 1VC4A 3I10A 2DSUA 1W9UA 3WH5A 1R8LA 1AJ2A 2QF8A 2W67A 4LBRA 3WK3A 1CEOA 3CLWA 2C71A 2YCJA 2E6DA 1A0EA 4ZL1A 4IPPA 5KZMA 3BLEA 4WY0B 3E0IA 3GZ3A 3NQEA 5U4NA 3TJIA 5E9XA 3CL8A 3UYCA 2FH6A 4UTIA 4JTKA 3GH5A 1Y0EA 3STFA 2V8ZA 2Z4GA 3W85A 1B1YA 3BE7A 4AY8A 1Q66A 3XIMA 4HKPA 2C13A 3M4HA 1VPYA 1CNVA 1P48A 4DO4A 1HJUA 4H7ZA 1IT8A 3ZWSA 3EKLA 4XKYB 5HJYA 4UIOA 3AHYA 4E5TA 5G1YA 5CSSA 4ZQNA 2E40A 2ZX9A 1ONEA 3TYBA 4DYJA 2ZC1A 3A5VA 2VXNA 1ZJAA 2V5BA 1W8GA 2E0PA 5LIUX 3N9RA 1Q7MA 1OY0A 2J77A 1XSKA 5F2LA 1XPGA 2JK2A 1U2YA 1I8JA 1SMAA 3CHFA 3STEA 3WQGA 1EXBA 1B9BA 2YL6A 5REQA 1R7OA 4YHGA 2Z1SA 4O50A 1EGMA 1RH9A 1UKPA 1O68A 4RKAA 3VTRA 1ZJIA 3IVSA 1YYAA 4AH7A 1TJRA 4TO8A 3GSMA 1L6WA 1LOSA 1J0YA 4EXAA 3G8RA 3KLKA 3S2CA 3V0TA 2VR2A 1OSEA 1GUVA 3HM7A 4ZSTA 1W1YA 2G41A 4IPJA 2OKOA 2NSOA 3OLDA 3TIMA 3ZJKA 2EAWA 4K36A 1EH9A 1IEIA 3CUGA 3FVDA 5A6MA 1XCXA 1F8MA 1QPQA 3U2CA 4JTSA 7TAAA 4LF1A 2QUTA 1OM0A 1LLWA 3SCVA 1F4AA 3AHVA 3CV2A 2Q8LA 1MSSA 3NFUA 4WSHA 4IIDA 4D6DA 3LS9A 2BASA 1XQKA 2R6OA 5LHEA 2D20A 2ZOXA 1FDZA 3WK1A 4L6OA 4PA8A 3T08A 1OCNA 2D2OA 5GNYA 1VBRA 3VIKA 1OFAA 4XBKA 2C8NA 4JQAA 1UW9A 3MZ2A 2GJNA 1AH4A 2YCEA 2X7VA 1GHSA 4CN6A 3GAYA 3GC4A 3HGJA 3W83A 4FLQA 4PUDA 3R0DA 2LLEA 5ABTA 1BTCA 4HNOA 1TWZA 3WJWA 1TQJA 3E1F1 3TMLA 3O0KA 1KBBA 3SW6A 3PB0A 3BGGA 2XH4A 1WE5A 3C52A 1YX1A 2I9UA 2WC3A 3CB3A 1RA5A 3TNOA 3DBNA 4WXZA 3H2CA 3WEOA 7TIMA 3M5YA 3ZWTA 1W5MA 5BNKA 3M0MA 3MYPA 4IQLA 3UR8A 4P7QA 3SN0A 3BJSA 3CZLA 3BQ5A 1HGWA 1HZYA 2J6VA 3BL3A 1S3TC 5EL1A 5A2CA 3GE7A 2YXGA 3W6MA 1DTUA 1TV8A 4EPKA 3ITLA 1LORA 3HPXA 3HA1A 4AXKA 4KGJA 2DT2A 3G6MA 2ISFA 1I60A 3MS8A 1NM9A 2BVTA 2G5WA 2XN1A 5FF3A 3C2OA 1J0IA 1SW7A 3RMJA 4LC8A 4LVGA 3UJ2A 2ODOA 3N17A 1EP3A 3VDGA 3UF9A 2NQ9A 2ZRYA 1FWTA 1U1JA 5U7SA 4GXPA 2NSXA 4RPPA 4JGDA 3GXFA 4HK6A 7PTDA 4PUEA 2MNRA 2VRKA 3RJYA 2J74A 2IKIA 3S2JA 5C54A 1REQA 3PZVA 3G1DA 4NYYA 3M0HA 4R85A 3K46A 4GVFA 3ZT5A 4AD1A 1Z69A 2ICSA 3GVVA 3BSMA 4DJDA 4Z2GA 4Z2JA 4CU6A 3IIOA 4M3PA 4NI3A 5HJLA 2VT0A 3PUOA 2G95A 4PULA 1FQ0A 2WLYA 1GVOA 2X05A 1TG7A 2PDWA 4ZOBA 4U31A 3EDDA 5T9CE 2FHFA 2OLAA 1B2YA 3TNBA 1QK2A 4JFTA 3F03K 4NG3A 1PSCA 1CXLA 3O6YX 1VFTA 1VPQA 5DX7A 1R38A 1QBBA 3AMGA 3DG7A 4MMWA 2BY0A 4HYRA 1VRDA 3RRAA 4B9ZA 3SBFA 3QKZA 3RYSA 4GHRA 1GVYA 4PODA 4JTCA 3I7SA 4C6LA 2RDUA 4G7FA 4S3DA 1QU4A 3HIJA 2FPVA 1W91A 2YB4A 5TQLA 1UD3A 2QIWA 2QJJA 5ENLA 4JFSA 3WELA 2QCMA 1BXBA 1W1IE 5BWAA 4UZSA 1K6WA 4EK7A 2A7PA 3W3OA 3DIPA 1NDYA 2WSQA 4RE2A 5DCBA 4IQEA 3FXYA 2J6XA 1ZRQA 3SRDA 2BSLA 3TYUA 1BXCA 3B97A 2EKCA 2A3AA 2P76A 1P0DA 3H21A 3LUT