4JTUA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with brequinar analogue
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 057
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 139
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtuA00
4JTFA 3L68A 3TV8A 3GDTA 2A2IA 4IJBA 4EIVA 1YPFA 5F1VA 3EWWA 2ABBA 5CPOA 3L5MA 1XBZA 4HIBA 3MP4A 4XQ6A 3TKFA 5CZJA 1R2RA 1ICQA 1TTJA 3T7VA 4QNEA 1OG0A 5D05A 1KM5A 4ZQMA 3RMJA 3QM3A 2QR6A 3QRHA 5FEPA 1FDJA 3PSVA 3HJZA 5HJLA 1H7WA 3NZRA 3BK0A 1ZAIA 4O16A 2NX9A 3VNDA 1IXNA 4O28A 3WK1A 4WD0A 3A21A 2GQ8A 4DF0A 2FDSA 3A23A 1R2SA 4K8EA 4UTWC 1OK6A 3TAKA 1TJRA 1QOQA 3R89A 2J27A 1EB3A 2VC6A 4UFLA 1LBLA 1TPFA 4E38A 1N8FA 1QDSA 3LCLA 1TRDA 2QUUA 3B03A 3E12A 3PWAA 4N9BA 1FWRA 1SPQA 1SZNA 1U83A 1OFBA 4JR5A 2FTPA 2C0AA 5DBUA 1LTDA 2ALDA 3STEA 4KFNA 4N4QA 5CZ0A 1W5NA 1XDLA 1TB3A 3W1XA 1FWNA 3AJXA 1TREA 2E68A 4XZ9A 1F5ZA 1NEYA 3N2MA 1VS1A 3G24A 3DI1A 3GKAA 4MLJA 3KOFA 4MUZA 2BSLA 3MBFA 5KZEA 2B4GA 1OYAA 1P5BA 1YDVA 4KFOA 1DORA 2OT1A 3OA3A 5LHEA 1J5TA 3C4UA 4BF9A 1R30A 5G5IA 3FYPA 4PEKA 1DQXA 1KM4A 2D73A 5DBTA 2X2GA 2JGQA 1W5OA 2A4AA 4JX5A 3NAVA 4UIOA 3ZS4A 1GG1A 4K7YA 4MYAA 3PBVA 3LCWA 3RU6A 3TSBA 1XKYA 3LTSA 3F1QA 2JBMA 5G1YA 4RZ4A 5LNWA 2HMCA 4LUJA 3UQNA 1L2UA 4YMZA 4ICNA 4ALDA 3L66A 1XBVA 4PL1A 4X22A 2I9EA 1K03A 1K7EA 1QR7A 2E1DA 4IMEA 4PL2A 2GOUA 3W7EA 3W1TA 3WJYA 2ZRYA 3TAOA 4OE7A 3THAA 3W7KA 2X1SA 3MBDA 1F6PA 2CLEA 5LZLA 1JCLA 4UMBA 3THQA 2XN0A 3UPWA 3PBYA 4QSHA 2QCFA 1XBXA 4LC8A 3KVKA 4B5NA 2QCGA 4WQ6A 3HGSA 2H8XA 2YX0A 2X30A 4ORMA 3FEMA 4JIQA 1TTIA 2QCNA 3G22A 3OVQA 4ZVJA 3SSJA 3KRZA 3UZJA 1KTNA 5F2MA 4HHPA 1NVMA 2CZ5A 5H91A 2GVJA 4C1LA 2V2DA 2ZZ5A 3TQKA 2UV8G 3HPSA 4MPQA 1HFBA 1K8XA 2WNZA 3VI2A 2EGZA 4UXDA 1G69A 4DXVA 2WNQA 4YCPA 1QCWA 3UD6A 1T99A 2FB3A 4UNKA 1G4TA 3P60A 3MUXA 3P7YA 1FQ0A 1NAL1 1FWSA 3W1LA 3TROA 2YR1A 3L5LA 3LI0A 3R5EA 4ONVA 3S1UA 1JR1A 4CNOA 3ATYA 2AAMA 1XC4A 1F6KA 4PH6A 4NZJA 2P1FA 1HO4A 4AXKA 3WJWA 3L67A 3W73A 3UXAA 3BW3A 3M7WA 2CLFA 4NJJA 3W7CA 3IIXA 3PULA 1T8XA 1JULA 1NFBA 2PC4A 4RR4A 4GUFA 4YL2A 3LXBA 1FXQA 2QCMA 4NNBA 2VFIA 3W2JA 3TW6A 4NVTA 3EX6A 1VH7A 3W22A 3P80A 1JCXA 4A21A 3GAKA 1G7UA 5AHLA 3W2MA 2QCCA 3U2OA 1TQXA 2WSYA 3GXTA 1RQHA 3W1NA 4NZFA 4MKNA 1KV8A 3NPUA 4Z1CA 1SUXA 1QPRA 3NXFA 1K02A 2A1YA 2QEZA 3S5ZA 3S9YA 4CQ8A 1VRDA 5CSSA 2QCLA 4N9EA 3A9IA 5E0KA 3B0PA 1WAUA 4O52A 2CLOA 4ZQPA 1OFRA 2XFWA 2GUUA 4K7VA 1VJIA 4S2BA 1NF7A 2YDAA 1SZFA 3NO5A 1W54A 1VCVA 3LHZA 5F2GA 3M6YA 1Z41A 3LTPA 3B05A 3DI0A 1FDZA 4AVFA 2FQIA 3N9RA 3CC1A 3UWWA 6TIMA 1A5BA 4UNLA 2WSQA 3NVTA 4LVFA 3TSMA 1ZCOA 5F1UA 3U8GA 1GYNA 2E5CA 4UTJA 1DJNA 3P61A 2ATMA 2XN2A 2ZZ6A 3UXDA 1RQBA 1XCFA 1JUEA 3LHVA 3EB2A 4TIMA 4CNNA 3PS7A 4DO5A 1KM1A 1RV8A 1VYPX 3BVJA 3G1SA 2X1UA 4IMGA 3QF0A 3N19B 4OBTA 1YTDA 5L9FA 3KVMA 4TMBA 1YDOA 2VFGA 3KX6A 3HG3A 1MXSA 4S2CA 3G8EA 2ZBTA 1W0MA 3IVTA 3W7HA 3TXVA 2J24A 3WJXA 2ZA2A 4JTGA 1Y0EA 3BGJA 1DOSA 1KV5A 4IMCA 1GVQA 3NGJA 1PL9A 3EX3A 3PG8A 3NL2A 1JCYA 3WFAA 3M43A 3UNDA 3FIGA 5FEXA 1KW1A 3TC6A 3W7LA 3W86A 3G3MA 1L6SA 2E6YA 3W72A 4FNUA 5LNSA 1C8VA 2W0UA 5K2ZA 3GDRA 1OFAA 2Y7DA 5A8GA 1DHPA 1XL9A 3KAOA 5EKYA 2YSWA 5EMUA 3LHUA 1MEWA 4UTTC 4AB4A 2DJXA 3FA5A 1H7NA 4WJEA 4LNYA 3BV4A 1XUUA 1S3HA 1IF2A 3DENA 5T26A 3EX1A 5DELA 1C9DA 3MWAA 5D30A 4FX7A 3TH6A 5D2YA 1EP3A 1QMLA 2YFOA 3WK2A 1R47A 4JDBA 4A3UA 4M6PA 2GQ9A 4IQLA 5U7SA 4NNCA 3EWXA 1TV5A 2X1TA 5D02A 3QC3A 2ZA3A 1TCDA 4LT9A 4GFSA 1L9WA 3O15A 5LKYA 3QH2A 4QJ1A 3H53A 2G97A 3PC0A 3A5VA 3JS3A 4AWUA 3ELFA 4O17A 2ZDRA 3LLDA 2OJPA 1PS9A 4HSOA 1UCWA 1H63A 4X3ZA 5BNKA 4TO8A 2VEIA 1OHLA 3N3MA 3IIZA 2YW3A 3SGUA 3W6YA 4YWIA 5AOUA 1TV8A 3F4NA 4XWUA 4KWVA 4MJZA 5D38A 3R13A 1ME8A 3HG5A 4Z1AA 1O95A 1LP6A 4MLRA 1ZHAA 2WSRA 2BWGA 1W3NA 4YXGA 3LCGA 1SO3A 4LTSA 2DU2A 1JQXA 5CGQA 3W7GA 4A22A 1OYCA 5J5DA 1G4EA 1ZY9A 3CM4A 4ADSA 4CCDA 5BRBA 4POCA 2WOQA 1IGSA 4LS2A 1TIMA 4P61A 5HQEA 1X7FA 2FJKA 1O5KA 2FLIA 1THFD 5BOOA 2JGYA 4K8HA 3SY5A 5LNVA 3GK0A 3NQ2A 4AEOA 1W37A 2Y6ZA 3LCXA 4XKYB 4BI7A 5G4WA 1I2NA 4RCXA 3W2NA 4OU1A 2QJGA 1MEIA 3L5AA 4DELA 3CIXA 3FYOA 1NF0A 5IM51 5HUOA 3GYEA 2DJLA 3NQVA 2C15A 4XKYA 5EPDA 2Q3RA 3EX4A 4M19A 2CLKA 2R94A 3S42A 3NOEA 2Z2UA 1A5AA 3NQFA 3CWNA 3LXAA 1I2OA 3CWOX 4KKXA 5F2IA 2VFFA 3IGXA 5I3JA 1YADA 4NNAA 5AHMA 4GXMA 1GVRA 3U6WA 1H7OA 3T40A 4UFIA 1TPUA 5F4WA 1FCUA 3O16A 1ICSA 4FHAA 2VFEA 3I6RA 1KM6A 1P1XA 3DKJA 3E02A 3EWZA 3NQAA 3KRSA 1F74A 1JCNA 4LS1A 4GRSA 1ONRA 2V30A 4E2BA 3SECA 5KZMA 1JRBA 2DZVA 3TU9A 3G18A 4JX6A 4LS0A 2Y7EA 5KINA 3QW3A 2ZRWA 5KTLA 3HGRA 4GNJA 5E1QA 3O6DA 4MY1A 4R7JA 3F4WA 2J88A 2QCHA 3NQMA 3RNDA 1FWTA 3W75A 2C1HA 3Q2DA 3OBKA 3PAJA 4M7TA 5HNRA 2Y7FA 4M6VA 1W3TA 3FOKA 1YLVA 4H3DA 2V2CA 4UUIA 1PIIA 1ZALA 3TXZA 5L6UA 2RKXA 3NQ8A 4IMDA 1W5MA 3DZ1A 2Y89A 3N14A 4I7WA 4RX0A 1TV7A 4WZHA 4ZQRA 3TJXA 2FB2A 5I3HA 2ZZ2A 2Z0IA 5AN7A 2IQTA 3PB0A 1QPNA 2A7NA 1QFEA 5DXYA 2YW4A 3G1FA 2WPBA 3D0CA 2NZLA 2VKZG 4U4MA 4WOZA 5AC8A 2P10A 4IPIA 1LRTA 3DFQA 5AYYA 1H1ZA 2TMDA 5CZSA 1X1OA 2B7QA 2VENA 4NJKA 1ZFJA 1I45A 4Z1BA 5DY2A 3W7IA 3N2XA 4O1AA 3TJLA 1K8ZA 2J9XA 4HN4A 6ALDA 2J9ZA 1QPOA 4WOQA 1QO5A 4BWLA 5K4ZA 3W1UA 4HSNA 4FEZA 1TJPA 4JX4A 3ANYA 4IX2A 1EUAA 3DH7A 3IIVA 1K7FA 3P84A 2NUYA 1G4PA 2HS6A 1H62A 3P81A 2OMAA 3Q37A 1DVJA 3GR7A 1HO1A 3QMTA 1H7XA 4JTUA 4UTIA 2NV1A 1OFDA 4CCCA 3T78A 1LLZA 1TPEA 2YZRA 3IGSA 3NPVA 3S5YA 1CW2A 4H6KA 4TX9A 3LLFA 5K7JA 2NUXA 4K39A 1B4KA 2DP3A 2YPIA 4AWTA 1AG1O 4IX0A 4BK9A 1GT8A 1PHQA 1KBJA 3MHGA 4LU0A 4O4VA 1NSJA 4FO4A 3GKFA 3GNNA 1R46A 4NJHA 4JTJA 3UY7A 1XXXA 5K9DA 3LGEA 4OV9A 2F7FA 1F2JA 2VFHA 3DFOA 4JYDA 3W70A 3G1DA 1QAPA 1VR6A 1AL8A 1LYXA 1W8SA 1FX6A 4ML9A 3G0SA 4A2SA 2PE4A 4MYXA 3QW4B 2EF9A 4HNNA 3S5OA 3W7JA 3G0UA 3UWQA 1HUVA 1N7KA 1KFKA 3O6YX 4JS3A 2FPTA 2WO5A 4HKPA 1J2WA 1YXYA 3CQ0A 2GJNA 1SW0A 3C8FA 1JUKA 3GB6A 3B0UX 1KM0A 3LTYA 2EHHA 4CQAA 4E0CA 3E49A 1WXJA 3W2KA 5CKSA 3UZ5A 2OX1A 4LOCA 1BEUA 1ME7A 5D2TA 3C2EA 4BI5A 4NT0A 1GWJA 1ZNNA 2TSYA 4N2YA 1EPXA 2ZFAA 4GUGA 3E96A 1ML1A 1C29A 1EP2A 3P5ZA 5I3KA 3TMLA 3LRMA 2V82A 4BWLC 2QAPA 1IIGA 3T4CA 2QCDB 5EL1A 4N9DA 1FCBA 4JTEA 4O50A 2NXHA 1GZGA 2C16A 4JD4A 3LCHA 3MI3A 1PHWA 1PVNA 2QCDA 4EOUA 4GJ1A 2CU0A 3LCFA 4W9TA 4JTLA 4K6AA 2Z6IA 4TR9A 3LX9A 4QAIA 5D04C 4WUIA 5CPNA 1AL7A 3UWYA 4JNMA 4K37A 5SWUA 3MMTA 2Y62A 3P5YA 3NQGA 2NWSA 2GVLA 3FJLA 5J5RA 4EF8A 1M7PA 2C18A 1OX6A 2DZWA 3N73A 3UWUA 3M47A 1OF6A 4MVAA 3W87A 4O53A 2J6XA 1VPXA 3W7OA 2XN1A 3HF3A 3M9YA 4DF1A 4Z0JA 4BR1A 5HWNA 1X6UA 4N4PA 5C55A 1RQEA 1Q6RA 4JY9A 4HNVA 3KVLA 2AGKA 3NQEA 2CZFA 2VEKA 3NZ1A 4X9SA 2CWNA 4UTTA 1EIXA 1R2TA 2X1RA 3LB0A 1TMHA 3UY8A 4QNWA 3INPA 3DFNA 4AF0B 4LY8A 2PCQA 4EVZA 4Z0SA 2DORA 2WJZA 4NJGA 3ZWSA 2YFNA 4QM1A 2AQWA 2V5LA 2V9DA 3B4UA 4AF0A 3HBLA 3BARA 4O12A 2FPVA 1GQNA 3NPXA 3TSDA 1FY6A 4HNUA 1MSSA 1OX5A 4FXSA 3UYCA 3DBPA 4MZ1A 3S1XA 4ZQOA 4IUOA 3PSWA 1VZWA 2V2HA 2W79A 4QITA 4RLIA 3TQ0A 2NLIA 4OQVA 1KFLA 3GXNA 3PB2A 3TCEA 5TIMA 1EWDA 3DFSA 1LRNA 2E6FA 3LV5A 2QDGA 4NU7A 1B3OA 2KZHA 1SFLA 5C5YA 1BWKA 4O19A 5F4XA 4X2RA 4JTTA 1KFCA 1DKWA 5D33A 5IBXA 3IRDA 2Y70A 3L0KA 4FNRA 4UMAA 5MHBA 4O54A 4I7VA 2P0OA 2GQAA 1JJKA 3TIMA 3NG3A 5HULA 4RXGA 1D3HA 4R34A 1GVSA 2BXVA 2DZSA 1TQJA 2E77A 3STGA 4HNTA 3IIOA 3M5YA 2NUWA 2EKCA 3W23A 2Z6JA 4LRSA 3GAYA 2V5BA 4IMFA 5I3FA 1YDNA 1TPB1 4DF2A 2BZNA 2Q3OA 2V81A 5G1TA 2QUVA 3M16A 4Q33A 3ZR4A 3FFSA 4AMAA 1SSGA 2YXGA 3GDLA 4FF7A 1KA9F 3RLVA 3DHFA 3PUEA 4K38A 3ATZA 1SO4A 3LHYA 4OHQA 4O11A 4JDYA 5A5WA 3M5VA 3NQ6A 2YYUA 3TMQA 1SZEA 3EXSA 3LRKA 2O7SA 3QPZA 1W3IA 1FBAA 1B9BA 1FXPA 4LC6A 1PCWA 1VHCA 3P74A 5D2VA 3M41A 4P2VA 3BG5A 2H3BA 1VQTA 3GVGA 5LNUA 4OGZA 3I7QA 3EEGA 3DGRA 3LXCA 3MHUA 3IEBA 3HG4A 1G6CA 4A2RA 2C19A 2HS8A 3HGJA 3W2UA 3NM3A 3BLIA 3W71A 1OYBA 3DFPA 1EEPA 3PUDA 1LOLA 4MJMA 4JEQA 4ZZ9A 2RFGA 3MI2A 3L2IA 1LDCA 4FNTA 4JTKA 1FWWA 1F05A 4EWND 1VYRA 3NQ7A 4MY9A 1GPWA 1N55A 3N34A 1LBFA 2C14A 2Q8LA 1IXOA 3BG3A 1YTKA 1T96A 1YYAA 1FUYA 3DXIA 3BLFA 1Q6QA 2QKFA 3RLUA 3HPXA 4O13A 1B4EA 3OVPA 1WA3A 4M5PA 3R12A 3MI6A 2E6AA 4UTMA 1RD5A 3GZ3A 4JTIA 4C1KA 1QNVA 3MYPA 1GEQA 1WDWA 2Y88A 5IBXC 3FJ6A 5LGXA 2TPSA 3BGGA 3TNOA 2PRMA 3FLUA 3W84A 4L4MA 4NX0A 3DU0A 3BPWA 3HQ1A 1L6WA 3PUOA 4Q4KA 3IVSA 4IWWA 3SJ3A 1VCFA 1JCJA 5F4SA 3EKZA 3F03K 4PODA 3UPBA 4GC4A 3HB9A 4NQ1A 4XBSA 2O7QA 4LV9A 2Z1BA 3QMSA 4O57A 3T44A 2QUTA 4M7SA 1F7BA 3KFTA 1PE1A 4UR7A 1X1ZA 1LORA 1AW1A 5BMWA 2E5DA 1AW5A 4UMCA 2TRSA 1SZGA 3LHWA 2QJHA 2OZ0A 5G2WA 3DFTA 5D32A 3CHVA 2NX1A 2E6DA 5LHFA 1I2RA 3KVJA 1SR9A 4I7UA 2ZRZA 2A6NA 3L0GA 4DPQA 1H1YA 4O0ZA 1SU5A 2J9YA 1TSIA 3GIYA 3O05A 3HO8A 1KLYA 1XDMA 1HG3A 2H6RA 2PURA 3CPRA 1RR2A 4O4WA 4MZ8A 1TYGA 3TE9A 1OJXA 4IPJA 1KFEA 3I68A 3KRUA 3PBUA 4EF9A 2RDWA 4UTUA 3S0CA 1DV7A 2ZTKA 3DAQA 3W7QA 2VFDA 5G2IA 1K7XA 2QJIA 3NA8A 4UFKA 1S5TA 1XI3A 1VHNA 1UJPA 2A85A 3SGZA 1EP1A 4J9JA 3W9ZA 3OHIA 3W7NA 3HIJA 5AHFA 1PCKA 3P8JA 3EWBX 5EY5A 5D09A 3O6CA 1JQVA 5AC6A 3W7PA 3LI1A 5LNRA 4UFJA 3G1HA 3W1MA 2A7PA 1F76A 1AW2A 5HUPA 1FCQA 1H61A 3S1WA 1BTMA 3IV3A 1KTBA 1KLZA 1SW7A 4JGDA 5LGZA 5FF3A 5HR7A 3C2VA 1M5WA 1A5SA 3MP3A 1OFPA 1SW3A 1MZHA 3VCRA 2CW6A 5C54A 2DZPA 5FESA 3G1YA 5KZDA 3S8HA 4MY8A 1RVGA 1TPWA 4UTHA 3NR0A 4D2JA 1TTQA 2HSAA 1K3UA 3NQDA 4NJIA 3A5FA 3W7DA 2VEPA 3EX2A 3W85A 5HWMA 1LM1A 4PC8A 2ZQ0A 3BG9A 2RDUA 3QQ1A 3R8RA 3TA6A 4MIMA 5FI8A 3C0JA 4AAJA 3AO0A 1W5PA 1LZOA 1CI1A 4N02A 2RDTA 3MYOA 4A29A 4LRTA 5FF2A 2CZDA 1K8YA 2ISSA 1E51A 4LVAA 1EUNA 4O8RA 5FEWA 1TTPA 3H54A 1ADOA 4ORIA 1I8JA 1Q3NA 1AK5A 2I14A 2W6RA 3QJAA 3S6DA 5K4XA 1A5CA 5K9CA 1BKSA 1O4UA 5EBUA 4WXZA 1OABA 1HL2A 1GTEA 1Q45A 2Y85A 4Z1DA 5HWJA 1YTEA 1HTIA 4UR8A 2H8ZA 3STCA 4PFMA 3MO7A 3V75A 3C56A 3NEVA 4S1FA 4DPPA 4L4LA 1D9EA 3VFLA 5G4EA 3SR7A 1GTHA 4Y96A 2CLHA 3O06A 4DBEA 3QSRA 5TBOA 1SSDA 1WQ5A 4LVBA 1A53A 4G1KA 2QDHA 4RZ5A 5KSWA 2WV8A 1JRCA 1YPIA 3SZ8A 3W1QA 1O5XA 3CU2A 4R33A 1GYLA 3P8IA 5C2XA 4AHPA 3NQCA 3G0XA 5GVJA 3PY2A 4OT7A 2E09A 5I3GA 1QPQA 2A7RA 1ZENA 4O14A 5DLCA 4DQWA 2EPHA 4WY0F 4IXXA 3L65A 5KITA 1DL3A 3G1XA 3ABSA 4UC5A 4ADTA 4GBUA 4O1CA 3MJYA 3PBWA 2Y61A 3DHDA 2PRHA 2H3DA 3B06A 4O15A 3G1AA 5FEZA 3KXQA 3W74A 1TPH1 2E5BA 4FNPA 1W5QA 2DZTA 4JYFA 3C6CA 3MW7A 1UASA 1S5VA 1SO6A 4FIRA 3KHJA 5BMXA 3W3OA 3EWYA 3B04A 3C2RA 4GUHA 4WY0B 5CPLA 3ABRA 1F73A 5DCEA 5G2HA 2CLMA 1P4CA 5D2WA 4MFEA 4NXKA 3WJSA 4WY0A 2NX3A 3GNDA 4IOTA 1MO0A 2QAFA 3EXRA 1ZJIA 3HGOA 2VOMA 3NL5A 1XM3A 2ZCGA 4K36A 3L21A 4YCOA 2NXGA 3MP5A 1G67A 5D37A 4HT3A 4QQ3A 3SFKA 3W2LA 4I9AA 2VXNA 3W7MA 3QYQA 4LV4A 1LRQA 2RH9A 2ZYFA 1DQWA 1UBSA 4JIPA 4TU1A 1GJPA 1WV2A 5FF0A 2CLIA 5EA9A 2OCZA 1OVDA 4O18A 4ADUA 3R2GA 5CSRA 3TUUA 1Z48A 1LBMA 2JKAA 3BO9A 1OFEA 2YGYA 1X8FA 2HTMA 3M5ZA 3SIZA 2GVGA 4UFHA 1Q6OA 1ALDA 1OF8A 1DBTA 2FPYA 2A6LA 4JICA 5AC7A 3W07A 3S5NA 3NPWA 3GXPA 2NXIA 1H7PA 1IIHA 3PM6A 1UUMA 1KFJA 3C52A 3Q58A 4Q32A 3ZWTA 3M44A 3QZEA 2FIQA 3PR2A 3O1NA 2Y7GA 4IGHA 4XBKA 3QEZA 3RK8A 5KMYA 3NL6A 2A5HA 3ABOA 3CT7A 1AMKA 4AH7A 3GDKA 3NL3A 1GVFA 1G4SA 5DN1A 5AYXA 3STFA 4OWGA 1I2PA 4CCEA 3A22A 1H51A 4MOZA 4BI6A 3OVRA 1WBHA 1JUBA 1M6JA 3DKLA 4GUJA 3P67A 4RZ6A 1SQ7A 3PG9A 2B7PA 3C61A 3LOTA 3VE7A 3UWVA 3T55A 4LVGA 2YYTA 4R53A 4UTKA 5I3IA 1I2QA 1FCVA 3EXTA 1LCOA 3C3NA 4CQ9A 4XTDA 3CEUA 3W7RA 2G5WA 3FKRA 2I1OA 1QO2A 1LLWA 3M5XA 1P0NA 3LV6A 3EKLA 4U28A 3LM7A 4LVDA 1L6YA 1H60A 1KBIA 3BLEA 2ZZ4A 4MFDA 5AHEA 1OFOA 1UB3A 2JK2A 5C6MA 5K9XA 3CEPA 3V1PA 2QCEA 3HG2A 2CFFA 4UTLA 4UFMA 4NUWA 1EA0A 5E93A 4CLMA 1PV8A 2EAWA 3L0NA 4Y6GA 1YXCA 5FF4A 4M6QA 7TIMA 2B0MA 3GLCA 3FKKA 3JR2A 4O10A 2BTMA 3USBA 1V7YA 4JTHA 5HMSA 4GUIA 1KFBA 3P62A 4XTIA 2GPTA 4JY8A 4BFAA 3O07A 1RZMA 4ZQNA 2ZTJA 1I4NA 1UUOA 1WOBA 4FNSA 4ZQCA 1YXDA 1FDYA 4AHOA 3RF9A 1OFQA 2ISWA 1TPDA 3LBCA 3GDMA 3TDFA 1LOSA 5DCBA 3W83A 3BW4A 3TR2A 4NX5A 3I65A 1TPVA 4AHQA 5AB3A 1H7RA 3C2FA 5BW6A 3ABQA 5ABTA 1SFJA 2V8ZA 3P82A 4DBDA 1XFBA 3TX9A 2JKPA 1MEHA 1W1ZA 4GWEA 3W88A 3QPYA 2WQPA 5LSMA 2ATSA 2H90A 2R8WA 3O63A 3E0IA 2VEMA 2ABAA 4Y90A 1Q6LA 3C2OA 3GX9A 2F84A 3HPZA 4PTNA 4RK8A 2R91A 4HPJA 4FNQA 3YPIA 5AHIA 4QISA 5U4NA 3M1ZA 3VKJA 3B0VC 3M0ZA 1WYIA 1M7OA 2RHGA 3W1PA 4TMCA 2C13A 2QF7A 4LW7A 4N9CA 3TFCA 4JTSA 3IIPA 3LDVA 1D3GA 2DZUA 2ZA1A 1VYSX 4O1BA 3CIWA 3Q94A 3MHFA 4KFPA 3O8AA 3NM1A 4UCGA 5HINA 2ZRVA 3TFXA 4WXYA 3NYZA 3GR8A 1H5YA 4PA8A 4E2DA 1S5WA 3IGUA 1Z44A 3HOJA 2ZZ1A 3EWUA 5AYZA 4FX6M 3QFEA 4JYEA 1EX5A 1O60A 2Q8ZA 4AWSA 1EWEA 1JCMP 5CZTA 2C3ZA 2X16A 1QWGA 4NXSA 2BX7A 1GOXA 3PVFA 3W1RA 3HMJG 2CZEA 2YCEA 5AFDA 4N6EA 4KWWA 4Y9AA 5EYWA 2B7NA 1SO5A 3QSTA 1WBJA 5H2ZA 4O1DA 2NWRA 1G7VA 1OX4B 1ZAHA 1WOAA 2BLEA 2CLLA 2NV2A 4FXRA 3W76A 1OX4A 3LERA 3OG3A 3QMRA 3JRKA 5AHNA 4FB7A 4GE8A 8TIMA 5D2XA 4JXCA 2DZXA 3W1AA 1KTCA 5HR6A 5F2LA 2PRLA 1VLIA 3G1VA 3TK7A 4RJEA 1RPXA 3OEXA 2FFCA 1KM2A 5TQLA 4Z08A 1LROA 3VE9A 4XUGA 3SI9A 3CLMA 4FX8A 3L9CA 3B8DA 5K3VA 1WX0A 2TYSA 4LUIA 4HPXA 1IXPA 1GVOA 1P0KA 3IVUA 1ME9A 4FIQA 3E9AA 2ZZ7A 4MZYA 4PCFA 5FF7A 3BW2A 3I7SA 1J4EA 4N6FA 3PF3A 4UTWA 1Z42A 1QOPA 1DJQA 3N9SA 4RV8A 5DXXA 1B57A 3RFAA 1VC4A 1O94A 4H4IA 4O0KA 1T0OA 4DO6A 2ZRXA 1KM3A 1GG0A 1A50A 2OT0A 2ISVA 3TW7A 3H55A 3WK0A 4LWWA 4DEFA 1W56A 2VELA 2GJLA 1VLWA 4DO4A 3CB8A 3TC7A 1W31A 2WKJA 3K30A 3QQ0A 2V0TA 2C6QA 1IXQA 1TPC1 3WK3A 2B7OA 2G96A 3TQVA 2LLEA 1ICPA 4Y8FA 2A0NA 4IXHA 1BWLA 3OIXA 1H50A 1OK4A 4ZL1A 3A24A 1XUZA 1JVNA 3LCIA 3I7RA 4ZMGA 3LHTA 3FS2A 1CX9A 1TRIA 4YLWA 4JN6A 2Y63A 5DCDA 3G3DA 3NDOA 5CPMA 3NNTA 3LBMA 3WJZA 3S1VA 5DY3A 1V5XA 3CTLA 4QIUA 4WX2A 4RXFA 5CG7A 1ZAJA 1VCGA 4RKAA 1U5JA 2G95A 2ZRUA 2ZZ3A 4OV4A 2R14A 3UWZA 1XBYA 1TO3A 3G8RA 3LRLA 5D03A 3ZFHA 4CNPA 2A21A 2WNNA 1LOQA 3SW6A 2JKEA 1VGAA
chains in the Genus database with same CATH superfamily
3E0VA 2WSPA 3GE7A 3L68A 4NF7A 4DAFA 7REQB 4IJBA 4EIVA 2VOTA 1YPFA 5CQ1A 5F1VA 2IQDA 3AS3A 2Q09A 4HIBA 1S3TC 3KL0A 3MP4A 1ICQA 2NQLA 2VR2A 2YB4A 1A0CA 1I0DA 1XYFA 5DMYA 3QRHA 5FEPA 3HJZA 4PMDA 2WVVA 1H7WA 2BY2A 3ZVIA 3BK0A 3VNDA 3VIMA 1IXNA 3HMCA 1OIMA 1XYAA 3WN6A 3B8SA 4XK2A 1CCWB 2F6KA 3TAKA 1EB3A 5HQLA 1LBLA 1UG6A 1TPFA 4HZMA 1IT0A 4WKFA 4E38A 1TMLA 3EPNA 5C70A 4OBSA 1SFTA 4JR5A 4UB9A 4C6JA 1OB0A 1OC6A 4N4QA 1W5NA 1XDLA 2P5NA 3KW3A 3T05A 4XZ9A 4ZO7A 1WCGA 2R82A 3ZSSA 3CAKA 2BSLA 3MKCA 4TOQA 4DJDA 4L1WA 3AXXA 2A79A 2JQXA 1P5BA 3T2QA 2OT1A 2G37A 2JALA 2CYGA 4X61A 4ICMA 3UZYA 2PWVA 5HBFA 4B92A 1KM4A 4GQBA 1Z6KA 4JX5A 3ZS4A 2G3MA 3PZQA 2WC7A 1GG1A 1BQGA 4ZE5A 1H3GA 3CZEA 3TSBA 3MMDA 3CH0A 4D6FA 3F1QA 3PHAA 5G1YA 4RZ4A 4XUYA 3RM9A 1NOWA 4REQB 2VRQA 1L2UA 2D24A 4ALDA 1KFWA 4C6BA 4PL1A 1W1IE 3AS1A 4X22A 1F8MA 2PDXA 1YRRA 4IMEA 2J75A 4XD5A 3WJYA 3TAOA 4OE7A 2HK1A 3WDJA 2WZTA 3THQA 1SJDA 2WHLA 2UY2A 3PBYA 1EBGA 4ICCX 1JI1A 3WBXA 4WQ6A 3HGSA 3M0KA 5JH1A 1IEWA 1X96A 3G22A 3F5LA 4PCTA 5CSUA 1LQAA 1BYBA 3OVQA 3ABXA 1YHTA 4QS6A 1YBQB 1WDDA 3GU1A 3SSJA 3UZJA 5E70A 3WQEA 1KTNA 2QV5A 4Q4RA 2UY3A 4C1LA 2ZZ5A 3HPSA 4MPQA 1K8XA 1E9YB 4HU8A 4F40A 3UD6A 3VOIA 4AQLA 3TN6A 4MB1A 3R10A 1G4TA 3E5BA 3MUXA 3P7YA 1O5QA 2CEQA 1NAL1 2DSKA 4HZ8A 3LI0A 3PZMA 4XISA 3S1GA 2HWGA 3EA1A 1KXHA 3ATYA 1V6TA 4KIRA 3UJRA 4XV0A 4LX4A 2PF8A 4OKDA 5EB8A 1QTWA 4HNCA 1PAMA 3ICJA 3PULA 3SCWA 3MMUA 1ISZA 2DIKA 3OOQA 4B91A 4HU0A 1BF2A 1XGDA 2VD9A 3P80A 2I56A 4I9MA 1K9TA 3DHUA 5I0DA 3U2OA 2X0YA 2PBOA 3GXTA 1ADDA 4S3KA 4QE1A 1GVEA 2GUBA 3VXGA 1XR2A 1SUXA 1A5UA 2QEZA 3S5ZA 1Q6DA 4L7ZA 4CQ8A 1XYZA 1UJQA 5A6JA 2QCLA 1IQ8A 5J04A 3B0PA 3ZR5A 4JHOA 4S2BA 2J7HA 4ERIA 1W54A 5EMKA 3JVAA 4IP5A 4RE0A 3M6YA 4DRSA 2ZE0A 2C0HA 2FQIA 4TVUA 4H6QA 1A5BA 1KGUA 2AQOA 5XIMA 3TSMA 3TZFA 3FVMA 4HYRA 1MQPA 1WKFA 1UOKA 2C1IA 2ATMA 5M2FX 3E0WA 3UXDA 1CXEA 1RQBA 3CMFA 2X2YA 3V16A 3LHVA 4TIMA 4RDVA 2OFJA 3FJNA 3CJPA 3BVJA 4ZB5A 2DH3A 3N19B 4OBTA 4LBUA 1ITUA 4TMBA 3UF9A 1MQRA 2PP1A 2ZBTA 3SN0A 1BPLB 3RIKA 3H23A 1A5KC 4IFRA 1FWBC 4IH3A 2PA6A 3P2VA 3SUWA 4CD6A 4M3PA 1TZ7A 1Y0EA 4IMCA 3NGJA 1PL9A 3MUY1 5CJNA 1JCYA 3SBFA 2CLPA 3FIGA 3QHOA 4GINA 3DDMA 2V68A 1MI3A 5LNSA 3NEHA 4DLMA 4QEEA 4D6IA 3U2EA 1OFAA 4C6LA 2Y7DA 3BAYA 5A8GA 3AXHA 3PTMA 4H83A 2D20A 5EKYA 1E55A 1UR0A 1MEWA 5A8OA 3H22A 4UTTC 1GPFA 2P8BA 1H7NA 4HMNA 1S3HA 3N2TA 1IF2A 5T26A 1B31A 2Q6ZA 1XJBA 4PUEA 2G50A 3TTSA 3MWAA 4B4HA 3TCSA 3TH6A 4KETA 1EP3A 2A3EA 3CXOA 2YFOA 1Y5WA 1R47A 4A3UA 2GQ9A 3BANA 5U7SA 3KM8A 3WQDA 3QC3A 2ZA3A 1TCDA 2D3NA 1AD4A 2Y5EA 4OZOA 3O15A 4S3DA 4N42A 3UJEA 3JS3A 2FFIA 1UCWA 3H21A 1H63A 4GO8A 4X3ZA 2XM2A 2VEIA 1NTHA 1ZQ5A 3WQVA 2ALRA 3AC0A 3H7RA 5AOUA 9RUBA 3F4NA 1UR4A 4DJDD 2PEVA 4ATDA 2CPUA 4Q8NA 3T4WA 3UZXA 5LIXX 3OZPA 5DT5A 2NV9A 2BY0A 1EF3A 4YTQA 4IJRA 4YXGA 3ONCA 2DU2A 1ZPTA 1CB7B 3N12A 4CCDA 4ROPA 3KTSA 1IGSA 1PWMA 4QCFA 4LS2A 4GNVA 1UQYA 4G8TA 5HQEA 1C8YA 3WUBA 4PCSA 3S47A 2FLIA 4NI3A 1VAHA 3WQ8A 1W1B1 4K8HA 3SY5A 5LNVA 4S3FA 1W37A 3LCXA 1PB0A 4XKYB 1RCXB 3EMCA 4Q7NA 3CZ8A 4ZOBA 2G3NA 4JTDA 4Q7IA 3W00A 1G01A 2WBGA 3EX4A 3AUJA 2CLKA 1QW7A 3S42A 4G7FA 3ITXA 4H9XA 1CLVA 1AZ2A 3KL5A 4A6GA 3IGXA 5I3JA 2PZNA 4GGBA 1GVRA 5FJRA 1TPUA 1FCUA 7ENLA 4GACA 2FZDA 2NLYA 1VB9A 4ZODA 2P3ZA 1B1YA 3I6RA 3DKJA 4AD2A 1F74A 3KL3A 1JFHA 3L4XA 2CNCA 1TVPA 1UD5A 4GXPA 5KZMA 3G18A 4JX6A 4QROA 1HGWA 5KINA 2E0PA 5E9XA 1O5RA 4GNJA 3AMKA 1YDYA 3QHMA 5E1QA 5F7UA 3I6EA 4E4PA 1RBAA 1XLJA 3O6DA 2BV9A 2QCHA 3NQMA 1R3VA 1KKRA 3OBKA 3PAJA 4UOZA 3VIHA 2Y7FA 5HNRA 3SSZA 1YLVA 4DBWA 2V2CA 5IFTA 1PIIA 3VYLA 4XO6A 4IMDA 5DO8A 3V36A 2ZOXA 4GIAA 1TV7A 1NOFA 4H01A 1FWJC 3TJXA 1BHGA 1CBGA 3PJTA 3IANA 2ZZ2A 1RA5A 2Z0IA 4PMZA 3C5QA 3PB0A 2A7NA 3QKZA 2UZ9A 3KRBA 3PNZA 3WH9A 4AVNA 3G1FA 5FCZA 3FNDA 4WDTA 2PDBA 5AC8A 3GHUA 5AYYA 2XIJA 2TMDA 2CC0A 5DY2A 1XP3A 4O1AA 2QGHA 3URBA 6ALDA 1FTXA 4HA0A 1WKYA 1QPOA 3B8TA 4DWDA 3PZGA 3GFZA 1QO5A 2PLMA 3BLKA 1JDEA 3OODA 4JX4A 3GHSA 1EEXA 1MWOA 2OQHA 2WC4A 2NQ9A 2OMAA 4Y9OA 2WZIA 1DVJA 1M68A 4FALA 1H7XA 4JTUA 1CGTA 4WR3A 4GZEA 2NV1A 4CCCA 1LLZA 3V5FA 3RX4A 3LLFA 5K7JA 4OBRA 4K39A 2YPIA 1L6GA 4PMJA 1AG1O 4H6RA 4HVXA 4BK9A 4JIRA 4M1BA 3GNNA 3O9NA 4JTJA 4LYKA 2ZX6A 1CYGA 5K9DA 4GO9A 2VFHA 3G1DA 4PBFA 4B4FA 2FZNA 2NQZA 4RNJA 2Z25A 4C91A 7XIMA 3ZOAA 3W28A 2XDFA 4XZWA 3ME3A 4MYXA 3QW4B 4J1OA 1RY0A 1S39A 4ACYA 4HNNA 2GJRA 4IMAA 3S5OA 3W7JA 3G0UA 4O1EA 4L9ZA 1M7XA 1KFKA 3H2CA 2YDSA 2DVXA 5A6BA 1YXYA 1SW0A 3BLLA 2VR4A 3DG6A 3B0UX 1KM0A 4CQAA 4E0CA 1JGIA 4P7LA 3W2KA 2DUXA 3D3FA 3UZ5A 3GW0A 2VJXA 1ME7A 4BI5A 3C2EA 3A3WA 2X05A 1V3LA 4MM1A 4I90A 2Y24A 2ZFAA 5I79A 1C29A 4GOAA 2UY4A 5I3KA 1UD4A 2V82A 1Y7VA 3SY8A 2OKTA 2UY5A 5FSDC 2XVPA 1A3HA 4O50A 1GYMA 3CUIA 2O56A 1RLCL 2OG9A 3BLOA 4DYJA 4J28A 2VT0A 3KEHA 2FKPA 2YBVA 4QAIA 1XLGA 4DZ5A 2WBKA 5REQA 1XX1A 4JNMA 2Y62A 2PDHA 1DIKA 4WK9A 2XZ9A 4JBRA 1E6NA 4MADA 1Q66A 1BSLA 1TA3B 3LMZA 1GNXA 2C18A 3TTQA 1OX6A 2I5IA 3VMOA 1OF6A 4O53A 2J6XA 1PEZA 3HF3A 2VDHA 4B9ZA 4Y8EA 1X6UA 5C55A 3KVLA 5BXPA 2AGKA 4NRRA 3NQEA 2CZFA 3LN3A 2PUZA 3VZYA 5D8WA 2DDXA 3QQWA 4PTVA 3WDQA 3RO8A 1UWSA 2W4XA 4X9YA 4AF0B 3CB3A 4EVZA 2DORA 2REQA 2YFNA 3D47A 3WD1A 2J8TA 3BARA 1S46A 3WX7A 1GQNA 4F48A 3NPXA 1GJUA 1V02E 4GJIA 3NCOA 3WFLA 1W3HA 3KOWA 4CQBA 1F3XA 4NHVA 4V28A 4IUOA 3PSWA 2HZGA 3ZJ6A 4YYCA 2I57A 4QITA 1UWQA 3Q65A 4LF2A 1RA0A 4MF4A 2NLIA 1EQCA 1RP8A 1KFLA 5TIMA 2QW5A 1E1CB 1HKVA 3BSGA 1SFLA 3PZTA 1A5LC 1BWKA 5F4XA 1IEQA 2HNEA 1A5MC 1RPKA 3POHA 1DKWA 1LL4A 3EKGA 5D33A 2Y70A 4EXAA 2BMBA 3E5PA 1XLDA 1XGEA 3ZIZA 2P0OA 2NQJA 3OTRA 3BV7A 3W81A 4R34A 4NILA 1GVSA 2NVCA 2OODA 3WLKX 5BRPA 2IUZA 4HNTA 2WM1A 3T09A 3RCNA 2FVMA 4L6HA 2Z6JA 3LM3A 3UW6A 4HK7A 4DF2A 5FL1A 2BZNA 2Q3OA 2QUVA 3AIBA 4Q4QA 2CHRA 3THDA 5FJPA 1AD1A 1VEOA 4FF7A 1O12A 2OLSA 4EAYA 3IJ8A 3ATZA 1XC6A 4YWSA 3M5VA 2OELA 3VA8A 3RPTA 4E3VA 1W3IA 1FBAA 4HMCA 1PCWA 1QI0A 4WDXA 1M41A 1HIZA 2BOGX 1B30A 1PX8A 2GDVA 3N2OA 4HD5A 3HG4A 3UG3A 1CGYA 2C19A 3HGJA 1NH6A 3BLIA 1OYBA 1F6YA 1MXGA 1EEPA 3U7BA 3O2LA 4JEQA 4ZZ9A 4JTKA 1FWWA 1F05A 4PUDA 3NSXA 3WELA 3NQ7A 5FOOA 1GPWA 1N55A 2Q8LA 1YTKA 4LQ1A 2J47A 4JTAA 3DXIA 2WJDA 4S39A 2PWGA 1EXBA 3NURA 3OVPA 3R12A 4OOZA 1S2TA 2E6AA 1E4IA 5CLTA 1QNVA 2O4MA 5A6KA 1SZRA 3BAJA 3OBEA 1V3MA 4NL1A 4F4RA 3W84A 1ISVA 4L4MA 2EBNA 1XLBA 2TAAA 1L6WA 1US3A 3SJ3A 3AOFA 2B31A 3L4UA 1E6XM 4PODA 3UPBA 4GC4A 4NQ1A 4XBSA 5C9ZA 2O7QA 4LV9A 2Z1BA 3QMSA 4W8LA 3IJ7A 1FWAC 3T0CA 2QHAA 3K4AA 4GQ0A 3AXIA 3LPOA 4UR7A 4MPKA 1LORA 3GSMA 5BMWA 3D46A 3UVIA 1F4HA 1HJWA 4QS5A 6XIAA 3ID7A 5MKGB 2WQDA 3CHVA 2NX1A 1I2RA 1FOBA 3TC3A 4IIDA 1FHDA 4C90A 2A6NA 1NWRA 4Q3MA 1IZKA 1JNEA 1SU5A 1Q7ZA 2A3BA 2Y8KA 4IGSA 4R9XA 3O05A 1HG3A 3SJNA 4I9JA 3CPRA 1RR2A 3AIRA 4GFIA 4HJFA 3I68A 3N4FA 3WNLA 2J62A 4GI6A 1P43A 2I7GA 2VURA 1KXTA 5BXSA 4G7EA 5JVLA 1HN1A 1EP1A 4J9JA 3OHIA 4A05A 1J0JA 2WK2A 3M64A 5TF0A 3PBMA 5LNRA 3LI1A 3E2VA 2A7PA 1V3JA 1AW2A 3UR7A 4ZSUA 4CEXC 5D9MA 1V6UA 1NU5A 1KTBA 2EPOA 1KLZA 4JGDA 4HYWA 1V93A 2PDGA 3DGBA 2IKGA 1DWGM 3ITGA 3CV2A 3WMBA 4DJFC 3G1YA 1XD0A 3SCOA 2J7CA 4KH2A 1MUCA 3BAXA 3EA3A 3NR0A 2HSAA 1K3UA 4EAMA 5CZKA 2O9RA 2VEPA 4EANA 2WCSA 1LM1A 4JIIX 3KOYA 2ZQ0A 3BG9A 2RDUA 3LSBA 4Z2LA 3RR4A 1Q6EA 3AO0A 1W5PA 2YDRA 5FF2A 2CZDA 2ZUWA 2ISSA 3LYEA 2XIOA 4O8RA 4HPHA 2I14A 1YPXA 3QJAA 3KBSA 3S6DA 5K4XA 4HK6A 3MKKA 1GTEA 3GR4A 4UR8A 2H8ZA 3STCA 3C56A 3GC5A 2EQDA 4S1FA 2NSXA 3GTHA 4Y96A 3R25A 4MDOA 1ZSXA 5I23A 3VIIA 1YE4A 4LVBA 4KEMA 4G1KA 5KSWA 1JRCA 4XZBA 4R33A 1W9DM 1GYLA 5C9UA 3P8IA 1WXYA 5C2XA 1NDZA 1DJWA 3G0XA 2WZEA 1E4LA 1U33A 4OT7A 2E09A 1KR0A 1ZENA 4WY0F 1KWGA 1EHAA 1K70A 3L65A 2XU2A 3PJWA 4BQ5A 3F4DA 3BMWA 3AZSA 3PBWA 2F8QA 4UTFA 3IV8A 2Y61A 3IK4A 3ES7A 3N6QA 1AJ2A 2BNJA 3MQTA 3B06A 2VEFA 3S6OA 5FEZA 1M9HA 2EJAA 1U30A 3A4AA 5A94A 2DY3A 4UQEA 2DZTA 2YCLB 2DSVA 4QDPA 4J3XA 3PWGA 3UT0A 1QWKA 3B04A 5D4YA 5EFFA 5G2HA 1IR1A 3QHNA 5GPRA 1P4CA 4NAFA 4F0HA 1OG6A 2PLKA 3W6MA 3CHEA 4DZIA 2ZWZA 4IZGA 4NIRA 1A3WA 1P0DA 5TAOA 5LA1A 1ZJIA 4LH8A 2DUAA 3HGOA 3EOEA 4FOUA 4C7FA 2DPEA 3ITYA 1A4LA 4ZTYA 1TUXA 3PN8A 3MP5A 1G67A 1US2A 4QQ3A 3T0BA 3WEZA 4HU4A 1E70M 3EOLA 2RH9A 4C7DA 2R1NA 5IDIA 2CESA 2ACUA 4DXXA 3EDDA 3VCCA 2AMXA 1WPCA 5EA9A 5CJ5A 4RE3A 3F4VA 2JKAA 2YGYA 2DFAA 1X8FA 3SIZA 3M5ZA 3SCRA 1MVYA 4Z1YA 1Q6OA 1PZ2A 1Q2SA 2GOKA 1ALDA 2BXYA 1DBTA 1XD1A 1FWEC 3VINA 4GXWA 1NDYA 3S5NA 3W07A 1H7PA 3PM6A 4W4QA 1UUMA 3EDEA 2FGBA 2HDJA 1XRFA 3LENA 2Y7GA 3EEZA 3RK8A 4S23A 4Q4SA 1BRLB 4FP1A 3SGGA 3SUVA 4EPDC 4MWAB 1ZL1A 5EMJA 3STFA 1I2PA 2G3FA 2ISFA 2CITA 3N6JA 5A6SA 1JUBA 1M6JA 3P67A 2OOGA 1SQ7A 4DY1A 4G2DA 5CH9A 3WLHA 1FH7A 4R53A 5I3IA 4CQ9A 3MC5A 2I1OA 2YL9A 3M5XA 2VGGA 4AZCA 1DPMA 3CQIA 1L6YA 4YNGA 1H60A 2X09A 2ZZ4A 4MFDA 3R1ZA 3VX1A 3T2OA 1UB3A 3BURA 1HQTA 5K9XA 1OEPA 3HG2A 1VRXA 4UTLA 4NUWA 1XCXA 2OB3A 1HKJA 4MNJA 4CLMA 1YW1A 4PTXA 1SJBA 1YXCA 3UCQA 3GLCA 3MUCA 1V7YA 2YL6A 4GUIA 3U5YA 3P62A 5H8MA 1S38A 4JY8A 3O07A 3CAQA 1PX3A 3RR1A 4FNSA 1FDYA 2WNWA 3RF9A 4AHOA 1FWCC 5JMUA 1KCKA 3WNMA 1OWQA 3TDFA 4F9DA 3W83A 1Q7MA 3BW4A 4XZNX 1JFXA 3TR2A 3I65A 4AHQA 2ODOA 3C2FA 5BW6A 4PUNA 4DJEA 2OYKA 1UR2A 5D9OA 4WSKA 1JG9A 2V8ZA 3ISIX 1HX0A 3TX9A 4L80A 4GWEA 3TN3A 3W88A 3QPYA 3VGHA 2W62A 4JTRA 5LSMA 3NYDA 1XW8A 2H90A 4NP7A 3GZAA 1XQLA 2ABAA 4Y90A 3ZSTA 2Z24A 2F84A 2DSZA 4PTNA 4CQDA 4RK8A 4L6DA 5LIWX 4B3KA 4HPJA 4FNQA 2D0GA 2HBXA 1XQKA 1WYIA 2POZA 2BXZA 2GVYA 4DZHA 2J4GA 5ABEA 2VX4A 1VYSX 3G2GA 1S1PA 3GW3A 1WKEA 9XIMA 4KFPA 1UD6A 3ES8A 4MB4A 3AMLA 1VFSA 1H0GA 1H5YA 4E2OA 2RUSA 2BOFX 1K77A 1V03A 4HNOA 5AYZA 4JYEA 2Q8ZA 4L6OA 4AWSA 1JCMP 2VC5A 2X16A 1QWGA 3SRDA 1WDQA 1EZ2A 4GK8A 5BYWA 5HOSA 1QJWA 4GX9A 4P8UA 1GOXA 2HEJA 3PVFA 3W1RA 3V0UA 1UC4A 1ZP4A 3C3UA 4QJ3B 3REQA 1I1XA 1E56A 4N6EA 4ENLA 3AAMA 3OLGA 5H2ZA 1YE6A 1G7VA 1ZJAA 1OX4B 4FXRA 1R9XA 5I6SA 1DWIM 2BY3A 3QMRA 4AZBA 5AHNA 4AMCA 4PMVA 1B3YA 1XLEA 1UROA 3ARSA 1KTCA 1VLIA 3TK7A 3F4CA 1B3XA 2WB5A 4L1GA 1OD8A 3UXLA 5TQLA 3E2SA 1LROA 2EG8A 4IF2A 2AKMA 1OCQA 1EOMA 3L9CA 1QUMA 4V15A 3PPHA 4HPXA 1I0BA 4PTWA 1IXPA 4BQ2A 3CL7A 1GVOA 3IVUA 4AUBA 5FF7A 3E6EA 1MUWA 4QG9A 4PEEA 1DIEA 3RGTA 3AU6A 1W1PA 4UTWA 1GOKA 3RJYA 3HQNA 4B5TA 4PMYA 3GO2A 1GG0A 3D6NA 1I75A 2ISVA 4MNLA 3WBWA 2J7BA 4P7NA 3OPSA 2VELA 2E1WA 3TC7A 1W31A 3UCDA 2WKJA 1UHVA 2D2JA 3WK3A 3B97A 3VOFA 3H2AA 4ACZB 1ZBCA 4L56A 3PTDA 3G5EA 4Y8FA 1BWLA 1H50A 1GW9A 7ODCA 1ITQA 3A24A 3I7RA 3V5OA 3IACA 2O9OA 3P93A 3LHTA 2Y63A 4RPQA 3NNTA 1J0YA 1RUSA 3BAIA 4RXFA 3LQGA 4LUSB 5CG7A 1LUCB 2G95A 2ZRUA 1TO3A 4EP8C 4NZ1A 2XIMA 3L2MA 2QMKA 3PWAA 2PWDA 2WLYA 1WDSA 3TR9A 2A2IA 4HCHA 3SQSA 3BCJA 3EWWA 3L5MA 1XBZA 4XQ6A 5CZJA 1R2RA 4B3ZA 4TTGA 3UXIA 3EDFA 3W25A 7REQA 4ZQMA 3QM3A 2XFRA 2QR6A 4PCNA 1YIXA 2PZ0A 3NZRA 4O28A 2W63A 3A21A 1BWVA 2GQ8A 4DF0A 2FDSA 3A23A 1S1RA 3VMNA 4UQ9A 2PDMA 1OK6A 3WF3A 2X1IA 5GQBA 1QOQA 1EJXC 3R89A 3WZ0E 3MWCA 1E5NA 1ENUA 4H6EA 4UQCA 3K8LA 2FZ9A 1TRDA 1OY0A 4YTTA 4BY3A 1OFBA 4XO7A 3FSUA 2C0AA 1F3EA 2VCBA 1LG1A 1YMYA 2G3IA 5CZ0A 1UC5A 1F61A 1NEYA 1VS1A 1VENA 3GKAA 1F07A 4MUZA 4F0MA 3THUA 1OYAA 2BVDA 2OEJA 4KFOA 3OA3A 4AYSA 4J3VA 2ADAA 1E72M 3RCMA 3THCA 1IHIA 2X2GA 1IEXA 1W5OA 2VEGA 3RPMA 3URNA 3MSGA 4MYAA 5CBIA 3LCWA 3HN3A 4EXQA 5FJTA 3JZUA 2Z7KA 3K1GA 2W67A 3LTSA 1TUFA 4GVGA 3QOMA 5LNWA 4KMQA 4J4KA 3UQNA 4YMZA 4BS0A 2HQAA 2VZTA 3GQYA 3APTA 4ICNA 2J78A 3L66A 2OQYA 4RZBA 1XHGA 1HKKA 4J35A 4REQA 5GNYA 1QR7A 2E1DA 3W7EA 1EJWC 3RDKA 3MBDA 1F6PA 1PDZA 1RJPA 1QU4A 5LZLA 4UMBA 2CERA 2XN0A 4KWUA 5LXEA 2HPMA 3QYSA 4XSLA 1TVLA 3VD3A 4DJED 1XBXA 3BC9A 3RXZA 2QCGA 3V0SA 3DC0A 1BF6A 2YX0A 2X30A 5HJYA 1ZBKA 3FXGA 2GWNA 1I60A 3NO3A 2E8YA 3JUGA 2A3LA 4FF5A 4XZIA 4HHPA 3CIVA 2HISA 3GFXA 2CZ5A 2GVJA 4MWAE 4LEQA 1EYEA 4UXDA 1R3SA 4DXVA 4J7RA 2WNQA 3M0IA 4F0LA 3RRAA 2AL2B 3EGJA 4W7VA 2ZC8A 3P60A 5C9RA 4DJDC 4PBEA 3OU8A 4Q8MA 4GC3A 2YR1A 2HV5A 1B9ZA 3L5LA 4KBXA 1CDGA 1POKA 1ZU8A 1EJSC 3PUGA 4CNOA 3OLIA 5FSEC 2AL1A 4JIEA 1EIBA 4AXKA 3V0TA 3R7MA 3W73A 3UXAA 2GUYA 2NW0A 3W7CA 1DEDA 1KCXA 4KIEA 1I6NA 2PP3A 3DCPA 2PC4A 1NFBA 4RR4A 1DJYA 1ITCA 2XZ7A 4GUFA 4H7VA 1HKWA 4HP5A 3VKBA 1FXQA 3H8AA 4NNBA 5KETA 2E9BA 3TW6A 4U33A 2ACQA 4NZ5A 3WLMA 1JCXA 5AHLA 1AFSA 3GVWA 4Q4PA 4CU7A 2JFEX 1RQHA 4NZFA 1Y8BA 4JFTA 1R9YA 1KV8A 4Z1CA 1QPRA 1A0EA 3NXFA 4W85A 2XVNA 4DIAA 3VC5A 4DYKA 3OZOA 2PF0A 4JN8A 3A9IA 4E4UA 1OGGA 2VD8A 4O52A 4ZQPA 1OFRA 1J9YA 1VJIA 4KEZA 2YDAA 4YVVA 2DH2A 1VCVA 4CVWA 4L4PA 3GY1A 5F2GA 3CHCA 3BZJA 1BG9A 1UZDA 5DX7A 1DJXA 1FDZA 4AD1A 1U5HA 4S3AA 4PRTA 2WSQA 4EWJA 4GHRA 3WFZA 1VIZA 2V6AA 6ENLA 4R85A 1GYNA 2E5CA 4BCEA 1UKOA 2OSWA 2XN2A 3O7UA 1BQCA 3A4XA 2BODX 3PBGA 2PDLA 4U3CA 3EB2A 3GS6A 2R24A 3G1SA 2X1UA 3AMCA 1NJJA 1FP8A 3QF0A 4HGXA 1MFVA 2VFGA 4AY7A 3RG6A 2W9MA 4C6CA 3U2ZA 3KDOA 1W1TA 3HJEA 1W0MA 5HMFA 2VGIA 4RW3A 3MSDA 3W7HA 4KF1A 1J11A 3TXVA 4JTGA 3VGGA 4KEUA 3G6LA 1V02A 1R3WA 1E0XA 2V5DA 3NL2A 3GYCA 4E3TA 1FWHC 4DUVA 4W88A 3MANA 3ARYA 1A80A 3W86A 3A9BA 2E6YA 5JH2A 2DEPA 4QDWA 4FNUA 4HMEA 5K2ZA 4JFUA 2FH8A 3GDRA 3IJ9A 2INFA 4J3TA 4BKNA 4WIWA 3UYIA 4D6EA 3UETA 5EMUA 4QX4A 4AB4A 4B5VA 3FA5A 4GYPA 3VABA 2VX5A 2D2GA 4WJEA 4LNYA 2HBVA 2QS8A 4IIEA 3QGAC 4GKTA 2IPGA 4OTKA 4M6PA 3CK5A 1TFVA 4Z2HA 1XLHA 2VO5A 1EGVA 1HL8A 1KWKA 3BH4A 1H11A 3WNNA 3QH2A 3H53A 4BZYA 4AWUA 2OJPA 4HSOA 1MDRA 1GW1A 5BNKA 1B90A 3IIZA 2YW3A 1IEIA 3W6YA 1K9DA 3TYCA 2FJUB 4YWIA 3WNOA 3KWXA 1ZBWA 4QDMA 2O4QA 4E5TA 3II1A 1ZRQA 4FR6A 4MLRA 1LG2A 4IQJA 3K46A 1S2UA 2WSRA 2BWGA 1XLKA 3WY1A 2GSJA 3GWQA 4L1XA 4LTSA 2GJPA 3W7GA 1JZ4A 5J5DA 2WCAA 1G4EA 2WMHA 3CM4A 3P0XA 3KLLA 1FHLA 4E2VA 4DWSB 4P61A 1X7FA 1UKTA 2ASHA 3UEQA 4FA3A 1PKLA 5BOOA 3S6TA 2WMFA 4B5SA 3WMCA 3QTGA 2FDMA 4RCXA 1E0WA 3W2NA 1MEIA 4DELA 3CIXA 3FYOA 3CPGA 4D1JA 5HUOA 4QJ4B 1MFUA 4U2ZA 2QIIA 1UP2A 4S3JA 4XKYA 1ECQA 1QHPA 4M19A 2ZX5A 4W7WA 2Z2UA 2IKHA 1FHVA 3NQFA 1QK2A 3CL8A 3SCVA 1XF0A 2XH0A 3UU0A 1YADA 5AHMA 1RY8A 4OECA 1GKQA 2XH4A 1XRSA 4A8LA 2WYSA 3O16A 2VFEA 1W3JA 3EWZA 4NKCA 3E02A 5E5CA 3IWPA 3KRSA 2VI0A 3ANVA 1WO2A 4DO7A 5AZ1A 4E2BA 3VNJA 4W93A 2Z00A 1UA3A 1E6QM 3C0SA 2DZVA 4A3RA 1N2VA 3DYOA 3TU9A 3ITOA 3AWNA 2SFPA 2VP8A 3CHFA 1U1JA 2OPJA 5A8NA 3I3BA 1UH2A 2PWEA 1QHOA 3AI0A 4X2PA 1K6AA 3EMZA 4NYUA 4UUIA 1SMAA 3L2LA 4URIA 3TXZA 4NYYA 3NQ8A 1QHZA 3DZ1A 1J96A 4JKMA 4WZHA 3WDRA 1D2KA 3WLTA 1R3QA 2VUNA 1QFEA 5DXYA 1R5YA 2QMJA 2XGBA 2I9UA 3UG8A 2WPBA 4UOJA 2NZLA 1XRVA 4IPIA 1LRTA 4MAZA 1H1ZA 2B81A 2FHFA 3GVVA 2EKGA 4AC1X 1ZFJA 3UR5A 1JAEA 1FFRA 3AMGA 3W7IA 1SMDA 1V79A 2GDQA 3LPPA 4WOQA 3W1UA 4HSNA 4IP7A 1RJQA 1TJPA 2RGLA 3ANYA 4IX2A 2V5CA 1Z89A 3IIVA 1K7FA 2J8FA 3COTA 4JFWA 1QI2A 4Q6XA 1DE5A 3TQPA 2NUYA 3P81A 1JD9A 2H9AB 2HE8A 3QMTA 5T91A 2OO0A 3IAPA 5HJXA 1OFDA 2C71A 2YZRA 4IQDA 3S5YA 1CW2A 1GVYA 3CV6A 1UZ4A 1J93A 4RNIA 2D3LA 3MDWA 4IX0A 1PHQA 2Y1HA 4NAEB 3TWBA 4GABA 1XXXA 3OJGA 2F7FA 3DC8A 3W6LA 3T8QA 1P48A 2GYIA 4H8NA 5H1WA 1TWDA 4LAMA 4HU3A 2HVMA 4XD4A 3H4WA 1VFLA 3VUSA 1HUVA 1N7KA 3O6YX 2WLZA 4R7OA 4HKPA 1NARA 1J2WA 1Q6FA 5AYIA 1AQMA 2ON3A 3E0LA 4C65A 1JUKA 3GB6A 2QUMA 3GRIA 1UP3A 2Q71A 4DN1A 1WXJA 2OWXA 1CXIA 4LOCA 1HF6A 1BXNA 2Z2BA 2TSYA 4BF7A 4NZ3A 4GUGA 3G1RA 3QGKC 3E96A 4YIWA 1ZLPA 1UD2A 9XIAA 1UWTA 1Z69A 5C7VA 4LJ3A 3TTEA 3T4CA 2QCDB 3T42A 4N9DA 3WUFA 1SJCA 1TX0A 1XIFA 2C16A 3LCHA 6CGTA 3DHPA 3BQ5A 4LY4A 4GJ1A 2CU0A 1DWHM 3KBNA 3LX9A 2ACRA 5CPNA 1AL7A 3T0AA 1EC8A 3N6HA 4WDWA 1XG3A 3TWAA 1Q8AA 4K37A 1PWLA 3H4XA 5AKQA 1H41A 1VEMA 2GVLA 4HBKA 3IPWA 1HJVA 4YU1A 1XIEA 8XIAA 5LYRA 4EF8A 1M7PA 2IXUA 2IPJA 5BOEA 1B3ZA 4MVAA 1VPXA 1GEHA 2AKZA 3W7OA 2XN1A 1TA3A 1LWHA 3M9YA 3AICA 4MNMA 4H9TA 3OG2A 2PDJA 1Y65A 4M1RA 1HJUA 4I3GA 3T81A 4UTTA 1EIXA 3GU9A 2X1RA 3AIWA 3LB0A 3QPEA 1TMHA 4Z17A 2F9RA 2VL4A 4PULA 4ZB2A 3DFNA 4FMVA 3VILA 2OLAA 3E2RA 4GPNA 1V08A 3H70A 4G5DA 2XSXA 4ZSTA 3TOYA 1W1YA 4QM1A 1W3LA 2AQWA 4AF0A 4GI9A 1TE6A 3TSDA 2JF7A 4HNUA 1OX5A 1TR1A 2DQWA 3L7RA 3CUFA 5AY7A 4KWSA 5FJJA 1PJ9A 4KERA 1VZWA 2ZC1A 3EDJA 4RLIA 1JXKA 1ECEA 2VR5A 2J7FA 1DWJM 1LL7A 3UVAA 3ZZ1A 2BHUA 3DFSA 2PU0A 2QDGA 4NU7A 3BZGA 1QNOA 4GD0A 1VEPA 2EPLX 1J0ZA 1TMQA 4O19A 1E1CA 3WMSA 2OZ8A 3POCA 3VU2A 3EB3A 3VM5A 4A8RA 4GBDA 1OC7A 2YL5A 3PPGA 3GHTA 1AODA 3AYRA 3O0FA 2PGWA 1TQJA 3KCOA 2E77A 3PPFA 1XYBA 3V18A 3IIOA 5FJUA 3KHDA 3PNUA 2ONEA 3W23A 4IMFA 1JZ3A 5G1TA 1DXIA 4Q33A 1ISXA 1HJXA 1UIPA 4PUKA 3TP4A 3GXMA 4JNYA 4O1FA 4M80A 1JPHA 2YXGA 3DHFA 3HURA 1GZ1A 1E43A 1SO4A 3LHYA 4WEVX 1OT2A 2G4FA 1RSCA 4K2SA 4DX3A 2YYUA 3WLQA 3EWCA 4IP4A 2E25A 2YDQA 2O7SA 1B9BA 2MUCA 5D2VA 1RVKA 3M41A 3BAWA 4IPNB 3F5KA 2QJJA 1VQTA 1IV8A 2FHBA 3DFYA 3LXCA 3MHUA 3SUUA 2A3HA 2HS8A 4PB3A 3W2UA 4PR4A 3W71A 3PUDA 3QGVA 2DW7A 2RFGA 4Y2WA 1HVXA 3MUAA 3SQLA 1JZ2A 5GNZA 4RUBA 4CUCA 2C14A 2QF8A 1OADA 1FUYA 4CQCA 3RLUA 2CETA 4IPLA 3B8WA 2QJNA 3NDZA 1OM0A 3OGVA 3GZ3A 2YIHA 1MZRA 3MYPA 2WSKA 2Y88A 5LGXA 3ARWA 2X0SA 4Z2IA 3PK7A 3FLUA 5DRIA 5CSYA 3DU0A 1PIFA 3BPWA 3MTWA 3MSYA 4Q4KA 2W3ZA 3S2LA 3GIPA 1JCJA 1FWFC 5IDZA 4O57A 3T44A 2Q01A 3TN5A 3H2FA 1F7BA 1E0VA 3VFCA 3KFTA 1MNSA 3EPMA 4KWOA 1DQUA 2V3EA 1AW1A 1XIGA 3LA4A 4N7QA 3TYZA 2QPUA 2TRSA 2CBVA 5G2WA 5LIKX 5LA0A 4GI4A 5D32A 1EQPA 1FVPA 2E6DA 1SR9A 4I7UA 4WJ8A 3L0GA 2IXVA 5MKGA 5M1TA 3S2JA 1ODUA 4AY1A 2CCRA 3GM8A 1KLYA 4O4WA 4MZ8A 4ZBCA 3UA4A 3FDKA 4KW2A 3KBWA 3S2MA 3TE9A 1OJXA 4IFOA 4IPJA 2Z7GA 1YKWA 1ZJBA 3KRUA 1VPYA 4QLLA 1E1EA 3ZT6A 3ZYZA 4UTUA 2RDWA 5I06A 3W7QA 5G2IA 3LPGA 3GH5A 2QJIA 4UFKA 1S5TA 2EPKX 1Q4WA 2QVHA 3SGZA 1E0UA 1PCKA 3P8JA 3O6CA 3EPOA 5AC6A 3MUIA 3G1HA 2ZUTA 3W1MA 1JPMA 1F76A 6PTDA 5HUPA 4GY1A 5GNXA 1HT6A 5DT7A 1H61A 4FXFA 1BXCA 1BTMA 1X7IA 1FKWA 3UJFA 5FF3A 2VHLA 3GTNA 3MP3A 1OFPA 3A12A 3KTXA 4GYFA 4DM2A 2BDQA 1WAWA 4PMOA 4GMEA 2CW6A 3IJQA 1T40A 5C54A 2O9TA 5IHRA 4HPGA 3QC0A 4GKLA 2YCKX 3B9OA 4UTHA 2GZXA 5CLWA 1GOMA 1XRTA 3M7SA 1P6CA 1TTQA 2WKGA 1XINA 4Z2KA 3AYTA 3EX2A 5T9BG 3KWSA 2E4TA 3FA4A 4A3QA 4U5KA 1E6SM 2QDEA 3QR0A 4MIMA 5FI8A 3S83A 1E9LA 1PKNA 1BAGA 3MYOA 4A29A 3CUXA 2HXTA 2OEKA 3WLSA 3H54A 3RRXA 1Q3NA 2W6RA 4PB5A 3S4TA 5K9CA 1BKSA 5EBUA 1HL2A 1Q45A 1UQZA 1V6WA 1YTEA 2QLYA 1JGMA 4PFMA 3MO7A 2X0HA 4GI8A 3AS0A 3AFBA 3NEVA 4DPPA 3I4EA 4L4LA 1D9EA 4OUIA 4LAUA 2CLHA 5A1AA 3M6DA 4DBEA 3QSRA 5A2AA 1JDAA 2XWDA 3HU7A 2QDHA 4RZ5A 1NWTA 1YPIA 3SZ8A 1O5XA 2X42A 3NWRA 3NQCA 3R8HA 5IRPA 4ZO9A 3A47A 4ZTXA 7A3HA 2J66A 1QPQA 1XIHA 4O14A 1XSJA 4DQWA 2EPHA 4PTDA 2YKKA 3ZXWA 3ABSA 1ONWA 2R1KA 4O1CA 3MJYA 4AFYA 2OEMA 1V77A 4JAWA 3DHDA 4ROQA 3BLPX 4OOUA 5C9XA 3G1AA 1QASA 3KXQA 2J8GA 3W74A 3FJ4A 3F7JA 4H8HA 4MB3A 5DMNA 3Q4DA 1N82A 3WDIA 2ZUMA 2BFGA 3C2YA 1AVAA 1S5VA 3IK2A 3BMXA 1JDDA 3W3OA 3EWYA 3C2RA 4GUHA 1ZUAX 2YCLA 1XSKA 1A49A 2CLMA 2DVUA 4AZGA 3MVTA 4NXKA 2OO6A 1K4GA 4IGMA 1K6WA 3OYXA 4IOTA 3IRSA 3U4AA 1XM3A 4K36A 4LPCA 3OVGA 4GQGA 5D37A 3PTKA 4GNKB 4HT3A 3SFKA 3W2LA 2FMNA 1VBUA 3W7MA 4P7RA 1LRQA 4ATWA 1PDYA 5FL0A 4JIPA 1GJPA 1WV2A 2CLIA 4O18A 4ECLA 4ADUA 2VVSA 3OBAA 4X60A 3EOSA 3TUUA 1LBMA 3BO9A 1OFEA 2XVKA 4LB3A 1MQQA 4B16A 1OF8A 2FH6A 5I09A 2A6LA 4IG2B 5AC7A 3TYEA 6XIMA 5JBDA 3NPWA 1SVDA 3M44A 2XHYA 2FIQA 3NQBA 3VMPA 3AU2A 3NL6A 1R9ZA 3VNKA 1UUQA 4QSFA 2BBFA 3N1AA 3ABOA 4GIYA 1UZHA 3L4WA 2NT1A 1UMLA 4NZCA 3ZT5A 3GDKA 2P3EA 1BRLA 3ZM8A 5AYXA 5JXQA 4OWGA 1H51A 1EH9A 3OVRA 3TYBA 4MWAA 4ZXLA 3DKLA 3UPMA 4GUJA 4BF5A 5JU6A 1V3KA 5I77A 3PG9A 2B7PA 3C61A 3LOTA 3H4GA 2DSUA 2I5QA 1I2QA 1FCVA 2WCGA 2REQB 4O0QA 4AYGA 2OTDA 5DFAA 4DUWA 3CEUA 2QV4A 3LNMA 3FKRA 3M0VA 3A64A 1LLWA 3IUHA 1W9BM 3O6AA 2OOFA 1O6IA 3EKLA 3LM7A 1ZCCA 3GG7A 4LUYA 3BLEA 3CLWA 2W91A 5HAOA 4LUTB 4LAKA 1RD6A 3U5UA 5DEZA 4J3SA 1KCLA 5C6MA 3CEPA 3V1PA 2QCEA 1SFSA 3GC4A 1P6BA 1Z32X 2WHMA 2CFFA 5E93A 1LWIA 4YTRA 4GG9A 3R58A 1P7TB 7TIMA 3FKKA 3JR2A 1EC7A 3USBA 4TTUA 5EBAA 2PU1A 4AIBA 5I24A 1Y5VA 3B9NA 1CXFA 4XTIA 3OLEA 4BFAA 4ZQNA 3NSMA 2P8CA 1XH1A 1YXDA 2ISWA 3OLDA 4C1NB 4HHHA 3W26A 3LBCA 1PBGA 1LOSA 4Q8UA 4XSMA 4W8AA 3T8LA 4Z2JA 4NX5A 1D7FA 1TCMA 3ABQA 6A3HA 2PS2A 3VGFA 3BOLA 1XFBA 2JKPA 2VUYA 1RBLA 1WUFA 2WQPA 2ATSA 3WQ4A 2VC7A 1M7JA 2R8WA 3V1HA 3XISA 4FLRA 3VIFA 2PTYA 1Q6LA 3K4DA 1WP6A 4QISA 5U4NA 5BZAA 3M1ZA 4DI8A 5D8ZA 3WL0A 1ZBVA 2C13A 2QF7A 4LW7A 4N9CA 4ML4A 3TFCA 3L12A 4JTSA 4GCAA 3SCTA 1SYTA 2BOEX 2DZUA 4O1BA 1IWPA 3CIWA 2TODA 3Q94A 3WF1A 1CGUA 5AECA 1MW0A 4UCGA 4MJ2A 2ZRVA 3TFXA 3GR8A 4PA8A 4E2DA 5CBBA 3HOJA 4AIEA 3EWUA 5KZ6A 3QFEA 2Y5SA 1O60A 2OR2A 2BX7A 4B90A 3HMJG 2PTWA 5LXXA 1FRBA 3QKEA 4KGJA 3WEOA 5EYWA 2V63A 4JQ3A 4O1DA 2NWRA 1O7AA 1OC5A 1WOAA 2WAGA 3WL1A 1HJSA 5FIPA 1QOXA 2PTXA 1OX4A 2HVNA 3OG3A 5XIAA 4LYRA 3K8KA 4PRRA 1CECA 2X40A 2ZDSA 4FB7A 3TONA 8TIMA 4NRSA 4JXCA 4JNZA 5D2XA 1E71M 1PKYA 3SRFA 5F2LA 4A35A 1ONEA 5A69A 4UWMA 3OEXA 1AJZA 1XLMA 4XAYA 3FXYA 4Z08A 4DJEC 2CXEA 4PRWA 3SI9A 4GA8A 5MF5A 1RXOB 3S3GA 3B8DA 4PUJA 5K3VA 1WX0A 2RJHA 2VYOA 4FIQA 3T08A 1C93A 2ZZ7A 4PCFA 4D71A 3V5CA 4CD4A 4N6FA 3KOZA 2G41A 5A8PA 3PF3A 3CNYA 4JL1A 1Z42A 1ZGDA 1DJQA 2EPNA 1W91A 1GOIA 4H4IA 5I7GA 4O0KA 1T0OA 4DO6A 3ZVHB 2ZRXA 1KM3A 1J12A 1CLXA 1Q6GA 3VZXA 4DEFA 2F61A 1XLLA 1UOZA 2GJLA 1QNSA 1VLWA 1T8QA 3CB8A 4H8VA 3K30A 1LLOA 3QQ0A 1W9UA 1HP5A 2UBPC 4F8XA 2B7OA 2G96A 4GIRA 3FX4A 1ICPA 2A0NA 4IXHA 1D7KA 3OIXA 3CQKA 3DEQA 3LCIA 4IISA 5PTDA 4HA4A 1CX9A 5FA5A 3H2NA 4Q8WA 1PX4A 3VDCA 1XFCA 4F2TA 1TELA 3DIPA 5HQMA 1V5XA 3CTLA 4WGHA 4WX2A 1T6MA 1U5JA 4IIGA 2R14A 3CYVA 3G8RA 1R86A 3LRLA 4XB3A 1EA9C 4ASTA 3UG5A 1HZYA 4JKLA 3OO2A 4LUSA 3WD0A 2WNNA 3H2MA 2ZXDA 2F6XA 3VUPA 2PDKA 4YN5A 2WZMA 4LFYA 4E8CA 2JKEA 1E6RA 2W66A 2W27A 2XH7A 1EBHA 3TV8A 1EYWA 3FGCB 3TEVA 2PDWA 3TKFA 4HHLA 1TTJA 2CKSA 1GQKA 3ZMRA 1OG0A 1KM5A 1FDJA 3PSVA 1EHNA 2WMIB 4O16A 4WD0A 3LBOA 4TXEA 3L4TA 2QXWA 3U3HA 2CWXA 1V51A 3JZEA 3SADA 3I3DA 4K8EA 4UTWC 2Y8VA 4GQQA 3VIJA 4TVCA 1TJRA 3QVQA 2J27A 2D0HA 2VC6A 4UFLA 4UR9A 2J7DA 1EDGA 1QBBA 1QBAA 3FYYA 3LCLA 3B03A 2QUUA 3E12A 4AZ5A 4N9BA 1FWRA 1SPQA 2CBIA 4MWAD 5DBUA 1LTDA 1TV4A 4WRHA 3FW6A 3K1DA 1FWNA 1ESWA 3EOOA 3AJXA 4H9UA 4D8ZA 1TREA 2ZIDA 3UZWA 2E68A 1F5ZA 3QOKA 1VBHA 1XIMA 3G24A 3DI1A 3KOFA 1L8NA 1YDVA 5E6YA 1R0MA 1XLAA 1DORA 3W4RA 3CL6A 1J5TA 3C4UA 1R30A 3D5HA 3VNIA 5G5IA 4PEKA 1DQXA 4J5NA 1HXJA 1M3UA 2JGQA 2A4AA 1GQIA 3NAVA 4UIOA 3PJUA 4K7YA 4LXFA 4U5IA 3GDBA 4D8AA 4TQTA 5A6AA 3GNRA 1F8IA 1H0IA 2JBMA 4Q8PA 4L4OA 1UR9A 1JAKA 2HMCA 1JPKA 4DM1A 1DP0A 3MS8A 1V3HA 1WZAA 3P14A 3BJSA 4XKMA 5JIPA 2ANUA 1IYXA 2I9EA 3OIHA 1K7EA 5A8MA 4PL2A 2GOUA 3W1TA 4G56A 1OGSA 3W7KA 3T6CA 1JCLA 1EX1A 2C7FA 1Q85A 3SB0A 1C8XA 4QSHA 3KUMA 3UG4A 4XAPA 3KVKA 3LMYA 3AYVA 3BTNA 4ORMA 3FEMA 4JIQA 1TTIA 2QCNA 3AHZA 3IJLA 3KRZA 4HZ6A 1BSIA 5EMLA 6REQA 3D3AA 3SRHA 1NVMA 1UYQA 2J7EA 3TTYA 2V2DA 4CN6A 1J2BA 3LQLA 4GVIA 1HFBA 1MW1A 1CXHA 5FAGA 1UW9A 2EGZA 3VDBA 1G69A 1YNYA 4YCPA 3CO4A 3MDUA 3SN4A 3SQMA 1LJYA 3MSRA 3GG1A 2X41A 1XH2A 2F6UA 4JQ1A 3RX2A 4DNMA 1JIBA 4NG3A 2AL2A 1FQ0A 4GVHA 3W1LA 3R5EA 1R7AA 1JL8A 3SIMA 2AAMA 1XC4A 3E74A 1YQ2A 5A6TC 1RK6A 1X1NA 1X97A 4PH6A 3GTXA 4FPSA 2P1FA 1Q8JA 1DTNA 3WF2A 2D2OA 4TVDA 4YVXA 4WVXA 1O66A 1U1HA 3IIXA 1T8XA 2XGIA 3CUZA 2YXOA 1D3CA 2FVKA 3WQ5A 1HKIA 3LXBA 1PIGA 2QCMA 2WANA 2VFIA 3W2JA 4NVTA 3EX6A 3H7UA 3W22A 1ITXA 4A21A 2IKJA 3S2CA 1BYDA 2GL5A 3ZT7A 1AMYA 1TQXA 4AZCB 3W1NA 4MKNA 2O92A 5D9NA 2OX4A 3U0HA 1K02A 2A1YA 3S9YA 3VC6A 2E7FA 3VPLA 1UKPA 4GISA 2Z1SA 2GK1B 3MO4A 1JXJA 5E0KA 1WAUA 2GQ3A 3MU7A 2CLOA 3K13A 3K8MA 4K7VA 2YBTA 1JYVA 1XSIA 3IUIA 3VOGA 5H8PA 3LTPA 1CNVA 3B05A 3T1GA 3DI0A 2F38A 2J13A 3N9RA 3UWWA 6TIMA 1WE5A 1QK0A 3UBPC 4WDUA 4LYQA 5CBJA 1ZCOA 2NSOA 5AC5A 3UCCA 1DJNA 3WDPP 1A4MA 3P61A 4XZMX 4H9MA 4QG6A 4EACA 1XCFA 1V7AA 2Y2WA 1JUEA 3M0JA 3GNXA 2WJFA 2DSWA 2VZSA 1TKKA 2WVUA 2IS7A 3OGSA 4DO5A 1TG7A 2FTYA 4PB4A 4K1GA 1KM1A 1RV8A 4IMGA 2Z1XA 3PZOA 1YTDA 1B2YA 5L9FA 1YDOA 3KX6A 3KZSA 3VNYA 4WGXA 3A13A 3HG3A 3G8EA 1TVNA 3IVTA 1YEYA 4GZIA 1AZ1A 4LCSA 2J24A 3WJXA 3FY1A 3V35A 1TV2A 2V3GA 1JZ8A 2BP1A 2YA2A 3EX3A 4OVXA 1XLCA 3WFAA 3M43A 2DGAA 4B15A 3W7LA 1L6SA 3W72A 5I07A 1C8VA 2W0UA 1DHPA 3KAOA 4UCFA 2YSWA 2WXDM 1TIWA 5CC7A 1JZ5A 1C92A 4IJCA 2DJXA 1R3YA 1E15A 2PD5A 3BV4A 1XUUA 3EB4A 3RO6A 1R85A 3DENA 1XIJA 3EX1A 5DELA 3WH7A 1C9DA 2R6OA 1T5AA 3UGRA 3WLRA 3WQOA 4D6GA 2W61A 3WK2A 4JDBA 4I5XA 3VKDA 4AVOA 1C3FA 4NNCA 3VIGA 1TV5A 2X1TA 5D02A 1MUMA 1Q5MA 4LT9A 1J6OA 1Z7AA 4GFSA 4QJ1A 4UOQA 2G97A 3A5VA 3ELFA 1HL9A 4O17A 3LLDA 3QZAA 1J10A 1VP5A 4QQUA 1PYMA 4TO8A 1XLFA 1CIUA 3SGUA 1GHRA 4BQ3A 3KE0A 1R3TA 1TV8A 4XWUA 4MJZA 5D38A 1U2YA 3R13A 1ME8A 4XG1A 3ARZA 3UA3A 4Z1AA 3VAVA 1LP6A 5CPTA 2GGIA 5TNVA 1ZHAA 3WBEA 3ZLGA 1W9XA 3LCGA 1JQXA 4QR6A 5CGQA 2J7GA 1EGZA 1ZY9A 2IW0A 4PSPA 1IT8A 3KP1A 2JEQA 2WOQA 3ITTA 4KESA 3TN4A 3A3XA 1DXEA 3NZGA 1TIMA 2CXGA 3DFHA 2WWCA 1NWUA 1JZ7A 3VD7A 3VIKA 3SCSA 1O5KA 1FH9A 3J7HA 1AJ0A 4DWSA 4QE5A 4PUMA 4CCZA 1UWUA 3AWOA 3GK0A 4DUOA 3ZR6A 4KT2A 5G4WA 3L5AA 4U31A 1NF0A 2PTZA 3GYEA 2DJLA 3S5SA 3NQVA 2O9PA 4LNCA 4A4AA 4L9YA 3AJ7A 4GYPC 3VIOA 5I3DA 1JI2A 3NOEA 3R43A 2OZTA 2WMKA 1I2OA 3CWOX 4KKXA 3RCYA 2VFFA 3DERA 3UXKA 4NNAA 1WB0A 1UKSA 1JYXA 1H7OA 4RL3A 4UFIA 3ARQA 1ICSA 2XIBA 4FHAA 4H9YA 5A6BD 4XIAA 2ZUNA 4GZJA 1UR1A 5E6ZA 4MB5A 4LS1A 5HDRA 1X39A 1ONRA 3DYMA 2V30A 3SECA 1H49A 3WQFA 4R88A 2BGSA 2Y7EA 3W02A 1TWZA 4JKKA 4ZA0A 1FH8A 3WENA 3GXIA 1EJTC 4R7JA 3F4WA 2J88A 4LAOA 5M17A 3W75A 1J6PA 3U57A 1XIDA 3NUKA 3F2BA 2C1HA 3Q2DA 1M1BA 2BGNE 1W3TA 1W2PA 4QAWA 3ZJKA 1ZTVA 5L6UA 5BXTA 2F2HA 4I7WA 3N14A 4RX0A 9CGTA 4I9TA 3R4IA 4ZQRA 4Q8TA 2PC8A 3AZRA 5I3HA 1KKOA 3AQUA 2FGLA 5AN7A 2IQTA 3WMLA 4FI4A 4ZCWA 1QATA 1W3KA 2VKZG 3DFQA 2YXXA 1R3RA 3QY6A 2WVSA 5M5DA 3B9AA 4AEFA 5LA2A 2B7QA 2VENA 3OYZA 4NJKA 5AVNA 1I45A 2FHCA 4Z1BA 1LL6A 5BRQA 2J9XA 4HN4A 4OUEA 1EGMA 3IGHX 1PXGA 2J9ZA 5I78A 1Q13A 4BWLA 3BCFA 1GCYA 1TV3A 4KCUA 3P84A 1MXDA 1DJHA 1M53A 2HS6A 1PZ0A 4Q8VA 3Q37A 3VIPA 3GR7A 5HNTA 3CAWA 1WDPA 4UTIA 2NT0A 3SCNA 3GTIA 2Y0FA 4I8DA 3T78A 1TPEA 3IGSA 2H9AA 4H6KA 3TNBA 1VFMA 2NUXA 2DP3A 4UQDA 4JQ4A 3MKVA 3KBJA 4AWTA 1JF5A 1CXLA 1KBJA 3MHGA 4O4VA 3VX0A 2PDNA 1NELA 3GKFA 3TYAA 4NJHA 4M81A 3UY7A 2VCCA 4NAEA 1MYRA 1QI3A 4F0SA 3UNTA 3TZNA 1NY1A 1AL8A 1LYXA 1W8SA 1FX6A 5H6HA 4A2SA 2PE4A 3BL3A 4K3ZA 1C7TA 1QW9A 2FPTA 4UZUA 2WO5A 5EFDA 3V7PA 3BOXA 2I16A 3C8FA 1MDLA 3VO0A 4RV3A 3F5JA 3CT2A 1EXPA 3IARA 2GSHA 5CKSA 1UP0A 1UD3A 1PYFA 4AX7A 4A8NA 1ZNNA 1E5JA 2ZUVA 4RDWA 1EP2A 3GXDA 3P5ZA 1GUVA 3Q67A 3TMLA 3LRMA 4YTSA 4DYEA 1IIGA 3LEPA 1FCBA 2XPKA 1EJVC 4JTEA 2NXHA 3SO7A 1PVNA 2BHZA 5JBEA 2QCDA 2G4JA 3CYJA 3LCFA 4JTLA 4K6AA 3M0MA 5LIYX 2V5KA 2Z6IA 2XISA 4TR9A 4FZIA 4WUIA 3BCDA 4GY7A 3N04A 3UWYA 1S5NA 5AC4A 2XSBA 3GHRA 5SWUA 1TWIA 2V5JA 3P5YA 3NQGA 3CUHA 2YA1A 4J27A 3FJLA 3ITLA 1XG4A 1S2VA 4JTCA 4WLC