4JTUA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with brequinar analogue
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
365
structure length
365
Chain Sequence
b'TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 057
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 139
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtuA00
3UXAA 2LLEA 1F05A 1ONRA 5BRBA 2Z1BA 1TPDA 2Y62A 1DV7A 3O07A 4OU1A 2I14A 3NQDA 3S9YA 3CT7A 3UWQA 1YXYA 3SECA 1NF7A 4RZ4A 1UB3A 4C1LA 4GC4A 3V75A 2J27A 3KAOA 2W6RA 1KM2A 3TK7A 3STCA 4RLIA 3W9ZA 1X6UA 1SW3A 3G1YA 2A5HA 1TQJA 2ISVA 4UTKA 3CU2A 1GOXA 4KFOA 5HR7A 1LCOA 3ZWSA 3M1ZA 5EBUA 3C2FA 1OX5A 2NLIA 1TYGA 3W1QA 1Z48A 5LNRA 3C2OA 3HGOA 3LTYA 3S1UA 3E12A 4U4MA 3QC3A 4A29A 4CLMA 1XDMA 2C15A 4WZHA 3NM3A 5D37A 1Q6RA 2QCMA 4M5PA 3L5LA 4NXKA 4RXGA 3O6CA 2Q8LA 3P5ZA 3TMQA 5C55A 3BK0A 2F7FA 1I2PA 4RKAA 3A5VA 3O1NA 2ZYFA 4UMAA 3USBA 4N6FA 3LB0A 3F4NA 3TSMA 5KINA 4UTUA 3L9CA 4QAIA 2PRMA 2QCDA 5G4WA 4YCPA 2OZ0A 1IF2A 4JTHA 3EX3A 3F03K 4WQ6A 3S6DA 4MLJA 4RJEA 4OT7A 4ADUA 1EP1A 3SIZA 3MUXA 3HBLA 1XDLA 3ZR4A 4WOQA 1TPUA 1JUBA 2ZTKA 3G1VA 1ICSA 3TFXA 3R2GA 4PC8A 3MMTA 1W56A 4O50A 2BZNA 3PB0A 3W7IA 4G1KA 4H6KA 1PVNA 3LCIA 3GR8A 3DBPA 3QF0A 1OYCA 4Z1AA 2VFIA 3VFLA 5G4EA 1ZY9A 3DHDA 5U4NA 1QPQA 1PS9A 2ZZ5A 4O19A 3LHYA 2ZA2A 2FLIA 1YPIA 4JIPA 4JTJA 3UQNA 2RKXA 1FCVA 3W88A 3P82A 2O7SA 3LV6A 3P67A 4PEKA 4JS3A 2VXNA 2H90A 4NNBA 2TPSA 2X30A 3G1XA 3OIXA 1QFEA 4BR1A 4CCCA 3BG3A 4FHAA 3MHFA 4UMCA 2ZZ1A 3GX9A 1TREA 4FNUA 4LUJA 3UWYA 1R30A 3TH6A 4DF2A 3EWYA 2ZRXA 3NVTA 1RV8A 2WPBA 4OGZA 1OFQA 1EP2A 1OK4A 3EX6A 1VGAA 1XC4A 1I2OA 1TTIA 2V81A 1XL9A 4N4QA 3QMRA 5CZJA 1TPWA 1TV7A 4E2DA 1G69A 1DJNA 3ZS4A 1TO3A 1OX4B 5G1TA 2TRSA 5AFDA 3QMSA 3NL3A 4HPXA 5CPOA 2D73A 2GOUA 4B5NA 4WY0B 1JULA 3I6RA 1TPEA 3V1PA 3S1VA 3HO8A 4ONVA 1LRNA 3BPWA 1YPFA 5HNRA 1CX9A 1O60A 3G18A 4ADSA 5LHEA 2ZRYA 4TX9A 4NZFA 1VLWA 3LLFA 4DELA 3SSJA 3W07A 2Z2UA 5J5RA 4GXMA 2G96A 1Q3NA 3G0UA 1W0MA 1TPVA 3SGUA 1YTKA 4DPQA 5EYWA 4UTMA 3NZ1A 1OG0A 1EP3A 4A22A 1FWSA 1UUOA 3UPBA 1TTQA 5J5DA 3M41A 3EX1A 4I9AA 3QYQA 3GDLA 3MHUA 4X9SA 5LNVA 1DQWA 3HIJA 4S2BA 3TC6A 3N14A 2HSAA 1G67A 4I7UA 1F6PA 4ZMGA 3QEZA 1X1OA 4ORIA 4K39A 4UC5A 3HG2A 1KFKA 3SFKA 3HPSA 4YCOA 5MHBA 5LGZA 3T7VA 3DFNA 4MY1A 1PCWA 5IBXA 4ML9A 2XFWA 2B7NA 1A53A 1TTJA 3PULA 2PE4A 1VYPX 4FIQA 3TROA 4HKPA 1RQHA 1TSIA 3FEMA 3YPIA 2ZA1A 4Y8FA 3FLUA 4O16A 4WY0F 2YZRA 1W3IA 4LW7A 3W7LA 1K8ZA 4RX0A 3UY7A 3GNDA 3PVFA 1P0NA 1OFRA 1D9EA 2RH9A 1H7XA 1FY6A 1G7VA 1GT8A 3NG3A 1TPFA 1XBZA 5DXXA 1BTMA 3SGZA 3QSRA 1FDYA 4WY0A 2GJNA 4LV9A 1KLYA 1N8FA 1G4TA 2C6QA 4NJJA 1UUMA 4E38A 3CLMA 4GNJA 3DFPA 5FESA 3IVSA 3LCHA 3W7RA 5FEZA 4Y9AA 1GVQA 3O05A 3NQCA 5K7JA 2GQ9A 5C6MA 3HGJA 2E77A 1OHLA 3W1TA 1G6CA 4YWIA 2I1OA 2H3BA 5K4ZA 4ZQMA 3F4WA 5TIMA 4JTGA 1HFBA 3E9AA 1ZENA 4CNNA 1AK5A 4O12A 3NAVA 4POCA 4S2CA 5HQEA 5D33A 1ZAJA 5A5WA 1OJXA 1BEUA 1UCWA 3N3MA 5FEXA 4IMFA 4UCGA 1SZEA 1H7OA 3GKFA 1R2RA 4R34A 3GDMA 2VOMA 1FUYA 4K7VA 3A9IA 3G3MA 3GLCA 3SR7A 1K8YA 1XBYA 4MZYA 4JYDA 4M7TA 1ZAIA 3NZRA 1W5OA 2KZHA 1GJPA 2ABAA 3BGJA 5A8GA 3W76A 3M16A 2X1SA 3S8HA 3NL2A 3OEXA 2C3ZA 5CPNA 3CHVA 4PODA 1LOQA 1DKWA 3L2IA 3BW2A 4RZ5A 1PV8A 1XBVA 4UTWA 3GNNA 3LLDA 2Z0IA 3F1QA 4FNTA 3B06A 3GZ3A 2Z6JA 2PRHA 3LGEA 1KM4A 1Z44A 4HNNA 4IMCA 5K9CA 4Z0JA 2B7PA 1ME9A 1DOSA 3LI0A 3PG9A 3P84A 1FDJA 4UUIA 5FEWA 5I3KA 4AEOA 1QNVA 4LOCA 2J9XA 4O28A 1H1ZA 4JX5A 4RCXA 2YFNA 2BSLA 1DBTA 2Y85A 2FTPA 4LNYA 1AG1O 1SO5A 5I3FA 4JTSA 4ZQNA 4IJBA 3UZJA 1BKSA 4DEFA 3MHGA 5FEPA 1LBLA 3TUUA 5IM51 1B57A 4LC6A 5FF7A 3UWUA 1Q45A 2GPTA 3DXIA 3G22A 1B9BA 2JBMA 3W87A 3PG8A 1C9DA 2Y88A 4R33A 4UFIA 1OX6A 3I7RA 2FIQA 4DPPA 1GYNA 3W7MA 2YR1A 4Y90A 2X1RA 3M5ZA 5L6UA 2Q8ZA 2CLEA 3LCLA 3HG3A 2ALDA 2FFCA 1DJQA 1A5CA 3GYEA 2NUWA 3VI2A 1GZGA 1IXQA 3EWUA 3KRSA 1KW1A 3OBKA 1N55A 3CC1A 2C1HA 3STGA 1QOQA 2CLLA 3TCEA 1ZHAA 2A21A 3BLIA 1I2RA 1GTHA 5LNWA 1C8VA 4ORMA 5LNUA 5CGQA 3A24A 3UZ5A 3W7NA 4K7YA 4MOZA 1CW2A 3JS3A 5AC7A 5D09A 3W7GA 2Y7FA 2CFFA 4AF0B 3N2MA 5I3JA 2RFGA 2R14A 3PBUA 4A2RA 1ICQA 4JDYA 1QAPA 4ZL1A 4AAJA 2Y7EA 2P10A 4JNMA 4O1DA 2VFEA 4DF0A 4MFEA 3W1PA 3G0XA 2CZFA 2HS6A 5KZMA 3WJYA 3CWOX 1NEYA 3S5NA 4HNVA 1QR7A 3EWBX 4EF9A 4O4WA 4DF1A 4GWEA 1SW0A 3CIXA 5KITA 1QOPA 1GQNA 3MYOA 3LM7A 1P4CA 4GRSA 1H60A 3GKAA 1SZNA 1XBXA 5CKSA 5F4WA 3CIWA 2WV8A 4DO6A 3QM3A 3W70A 2RHGA 3C52A 5F2LA 3W7EA 3OVQA 3MI2A 3WK3A 2DORA 5D2VA 4OQVA 4MVAA 3SJ3A 4FEZA 1JCNA 1FBAA 1WXJA 3M5YA 5D04C 2XN2A 1WYIA 4WJEA 3QFEA 4JTEA 5EPDA 3EKLA 1YTDA 3QW3A 4RZ6A 1EEPA 2QF7A 4UXDA 1G7UA 1YDNA 4Q32A 3QSTA 4R53A 3EXTA 3U2OA 3G3DA 3RF9A 1FQ0A 4IGHA 2B7QA 5LKYA 4LS2A 3HF3A 3TW6A 4JN6A 1T96A 2IQTA 4ZQPA 5F2GA 2JK2A 2OMAA 3HB9A 4NUWA 4LT9A 4NJKA 3C2VA 4O53A 3NNTA 2YSWA 4QQ3A 1F74A 2CZDA 4OWGA 1EIXA 5HINA 2VFFA 1QO5A 3UWWA 1H7NA 3MO7A 1XM3A 1R46A 1VR6A 2FB2A 3DH7A 1SZGA 1OFPA 4LUIA 2FJKA 1OYBA 1ZFJA 4NXSA 3TW7A 5KTLA 7TIMA 3DZ1A 3VE7A 1K02A 4JTKA 2GJLA 2XN1A 1FXPA 1OFOA 2UV8G 1A5SA 4LVGA 2VEMA 1H61A 2A6NA 2E5DA 5AC8A 1WBJA 5K9XA 5DY3A 1EB3A 1EWDA 2NXIA 3KRUA 1AMKA 4RXFA 1TPB1 2V2HA 5GVJA 2EKCA 1LRQA 4DO4A 2PCQA 4KWWA 2TMDA 1AW1A 3QW4B 3LXBA 2E5CA 3OVPA 2OT0A 3P5YA 3MP4A 4LC8A 1LBMA 5C5YA 3MP3A 2GVGA 1SZFA 4KWVA 3IGXA 4BI6A 1CI1A 3GVGA 3UYCA 1T8XA 4O14A 5G1YA 4BWLA 3L5MA 5IBXC 3IVUA 1JCMP 1VYRA 4Y6GA 3S1WA 3NPWA 1XCFA 2EF9A 3M5VA 2FDSA 2ZZ2A 3QH2A 4Q33A 2G97A 2BXVA 4Z0SA 2V30A 5D02A 5F4SA 4JICA 4O52A 3EWXA 2QAFA 1I2QA 1ZJIA 4P61A 2YW3A 1P1XA 3VNDA 4LV4A 1OYAA 4AWTA 3DENA 3FOKA 2BWGA 2PURA 1EUNA 3CB8A 4LS0A 3BG5A 4N9EA 2QUVA 4AH7A 4PA8A 1OF6A 4JIQA 4M19A 1TB3A 1KTNA 3EXSA 1WV2A 5D38A 1EPXA 1I2NA 3GDTA 3WK1A 5LHFA 1LDCA 1HUVA 3LX9A 3L21A 4N9DA 2VFGA 4XBKA 1W54A 3B03A 1JQVA 4CCDA 3G1AA 5DBUA 1VCVA 3W7KA 4MJMA 3HGRA 2QJIA 2ZRVA 4IXXA 1SSDA 1K7FA 3TXZA 1RZMA 2OCZA 4UTTA 4PCFA 3PAJA 1JRBA 2EGZA 2RDWA 1ZALA 3W72A 4N4PA 3BO9A 3H53A 1JQXA 3O15A 4XZ9A 3C8FA 3G24A 2B4GA 1V7YA 2A2IA 4E0CA 2GQAA 3S0CA 4GBUA 3T44A 4QNEA 2ZZ3A 2C0AA 3G0SA 4ZQOA 1MEHA 1TPC1 3MBFA 3TSBA 5SWUA 3QPZA 1J2WA 1ZCOA 4QM1A 4ZVJA 4PFMA 4JR5A 5K2ZA 3C56A 5TQLA 2V5LA 3VE9A 1SO6A 4HNTA 1LLZA 3PUOA 1BWLA 4GUJA 1OFAA 1ADOA 5FF2A 1DVJA 3BARA 3UNDA 4BFAA 1L9WA 2OT1A 4K8HA 2GVLA 1S3HA 3QJAA 4K37A 3RFAA 5CSSA 1VHCA 4RV8A 2NX9A 1MEIA 4O10A 2J9ZA 3CWNA 3RMJA 5EMUA 4JTIA 1RQBA 4UFHA 5BW6A 2DZWA 5D05A 5CZTA 4ICNA 1VQTA 4CNOA 2I9EA 1RVGA 5AN7A 4IPJA 4EIVA 3ZFHA 2NX1A 3HGSA 4LVFA 1W31A 4UIOA 3DHFA 5D32A 5LZLA 2NX3A 1S5VA 1U83A 2Y61A 3EB2A 4DBDA 1AW5A 5AC6A 3NQ6A 2R91A 2HTMA 1XUZA 1DL3A 4EVZA 2JGYA 1LLWA 2DP3A 4JD4A 3M47A 4I7VA 2RDUA 4NX5A 3IEBA 3DAQA 1OABA 1JCYA 3N2XA 4BI5A 2VC6A 2WSYA 1A50A 1JR1A 3I7SA 3E96A 4UNKA 4FNPA 1KBJA 4XTIA 4TR9A 2A85A 3N34A 3H54A 4FX7A 3JR2A 3QQ1A 4O17A 4D2JA 5T26A 2A4AA 1UBSA 1VLIA 2YGYA 4XUGA 3GXNA 4UNLA 4XQ6A 3VKJA 1TPH1 3FYOA 2NXHA 3KVJA 4O1BA 1GVSA 3Q94A 1TQXA 2ABBA 2R8WA 3LHZA 5HUPA 5G5IA 3M5XA 3W1XA 1ML1A 3W2MA 1F2JA 2E09A 4FO4A 3KVKA 3WK2A 2BX7A 3TNOA 2AGKA 3PUEA 1H62A 2Y7GA 1XKYA 3GXTA 5CSRA 2V8ZA 5EA9A 1QDSA 1O95A 4X3ZA 2J6XA 2CLHA 3LCGA 1JUKA 2A6LA 4DBEA 5K9DA 4XWUA 4O11A 3GK0A 3N9SA 2EPHA 4IQLA 4LVDA 4UFLA 4H3DA 3ZWTA 4WXZA 2ZZ7A 4HIBA 2Y7DA 1RR2A 1VHNA 3EKZA 2QKFA 3W1NA 3BG9A 3SI9A 5F1UA 2WO5A 3HG5A 1KTBA 2XN0A 1YTEA 2FPVA 2AAMA 1O4UA 3C3NA 3C4UA 4Z1CA 2X1TA 4WXYA 2QCGA 2PRLA 1OFDA 1M6JA 4PH6A 1M7OA 1C29A 2V0TA 1H1YA 1WX0A 1ME8A 3QZEA 1OFEA 4IMGA 4X2RA 4NT0A 3M7WA 4O8RA 3NL5A 5AYXA 1I45A 1VJIA 5AHMA 2W0UA 3LHUA 1WDWA 4NZJA 4LWWA 1LZOA 4TO8A 3WJXA 1H7WA 1Q6LA 2YYUA 1HO4A 4IMEA 4UTLA 1QCWA 5HWMA 1B3OA 3EEGA 4UMBA 3CTLA 3MJYA 3WJSA 8TIMA 3EX2A 4OE7A 4UTHA 3W2KA 5HULA 4CQAA 3B4UA 5CG7A 3QMTA 1K7EA 2YFOA 3N9RA 3L66A 5KZDA 5AHEA 5C54A 2QUUA 4KFNA 1O5XA 4IPIA 3LOTA 2A7RA 5K4XA 1OFBA 1B4EA 2ISSA 5BNKA 1K03A 5DELA 1L6WA 5AOUA 3S5YA 1FXQA 2YW4A 3IIVA 4O15A 3PR2A 2FB3A 4JX6A 4ZZ9A 2QJHA 4N02A 3DKLA 4CQ8A 1SO3A 2YCEA 4CNPA 1X1ZA 1Z41A 2YX0A 2QCHA 2CW6A 3NDOA 2O7QA 2CLFA 2Y89A 4UFKA 4MZ8A 3N73A 1U5JA 3BLEA 3O6YX 3B8DA 3TX9A 2VELA 1O94A 1L2UA 1M7PA 4WX2A 3T40A 3KOFA 4QIUA 3W2JA 3FKKA 1X7FA 3CEPA 2ZDRA 4K8EA 1G4EA 4JYEA 4O0ZA 5BMWA 1L6SA 2VFHA 2YPIA 1GVOA 2Q3RA 2A7NA 5DBTA 3NQGA 1KFBA 4L4LA 4M6VA 4M6PA 4RK8A 4JTTA 3L65A 1I8JA 1KLZA 4HSNA 4O0KA 5DLCA 3KVMA 5AHIA 3LRMA 3LCWA 1TTPA 2CWNA 3KX6A 4AHQA 4MY9A 1RQEA 4W9TA 5LNSA 1H63A 4A21A 1QWGA 4XKYA 1F73A 4UR7A 3FA5A 1F5ZA 4FNRA 2Y63A 2NZLA 1FWRA 1XXXA 3P7YA 4KFPA 3P61A 3NXFA 4LVBA 4N2YA 3LCXA 4XTDA 1NF0A 3NQ2A 4IXHA 2ZTJA 1K7XA 4ALDA 1T0OA 2G95A 3QPYA 1TCDA 2C16A 4MY8A 1KFLA 5CPLA 2TYSA 2P0OA 1K8XA 3AJXA 3L0NA 3BV4A 4J9JA 3TQ0A 5D30A 3QQ0A 3RLUA 2NUYA 1IIGA 2NWRA 2JGQA 2Z6IA 4M6QA 2JKAA 1X8FA 3NGJA 4WUIA 3BW4A 3A22A 2WOQA 3RNDA 3TU9A 2YXGA 5AYYA 4UTTC 1PE1A 4GFSA 3DFOA 4MZ1A 1GG1A 5CZSA 3M0ZA 1KV5A 3P62A 2CZEA 5F4XA 5I3GA 2DZXA 2Y6ZA 3B04A 4TMCA 3R13A 1QO2A 5FF4A 3E02A 4K36A 1SR9A 1PCKA 2RDTA 3WJZA 3EX4A 3FJ6A 2QCEA 3QRHA 1RD5A 4JGDA 2QCLA 4GE8A 2ZZ6A 2WKJA 1LM1A 2E6AA 1TV5A 1IXPA 1TJPA 3M6YA 2NWSA 1QPRA 2ATSA 5FF3A 1HO1A 1V5XA 2CLMA 3MYPA 3WK0A 1LBFA 4LY8A 3PF3A 1UJPA 3W85A 1NAL1 3I7QA 3HMJG 3THQA 3HPXA 1SUXA 5EL1A 4N9CA 5ABTA 3TC7A 2VEKA 3PWAA 1Y0EA 3NO5A 1ME7A 1R47A 1F76A 5DN1A 4X22A 4JXCA 3PBVA 3LDVA 1EUAA 4JY8A 1FCQA 2X1UA 3ABOA 4HT3A 5DXYA 1YDOA 3NEVA 1OVDA 2GQ8A 1H50A 1FWTA 2WNZA 1EWEA 4N6EA 3UXDA 1A5AA 4FX8A 5F2IA 3RK8A 1MEWA 4YMZA 1TMHA 3LHTA 1SSGA 4AXKA 4NJGA 2CU0A 3W73A 1E51A 1YDVA 3KRZA 2HS8A 2ZFAA 1W1ZA 2Y70A 3TQKA 1QPOA 2C14A 3SW6A 4UFJA 4MYXA 4HPJA 2ISWA 1P5BA 2TSYA 3TR2A 3W1MA 1R2TA 3E0IA 3UWZA 4TU1A 3E49A 4JEQA 3LRKA 1W8SA 4BK9A 3A23A 1F7BA 2QCCA 1WOBA 3IIXA 3W22A 5L9FA 1Q6OA 3DKJA 4CCEA 3PB2A 1KFCA 2WJZA 3TAOA 3C2RA 1LORA 1LRTA 4NX0A 6ALDA 3W1UA 3FKRA 4PL2A 3NQEA 2ZZ4A 2OJPA 3WJWA 1FCUA 1FCBA 2QCNA 3FJLA 3LBMA 1JUEA 1WQ5A 3FS2A 4C1KA 5BOOA 1KV8A 1KM5A 2GUUA 4Z1DA 5AYZA 2VFDA 3PY2A 3NQ7A 3B0VC 1LOLA 4IUOA 1JRCA 3UWVA 4MFDA 2VENA 5AHFA 1VC4A 2J24A 3PSVA 3ANYA 4RR4A 3MI6A 3W1LA 3L68A 5C2XA 4QISA 3TV8A 4E2BA 1OK6A 2DZTA 4BF9A 2EAWA 4EF8A 3TDFA 2V82A 3MW7A 3LXAA 1GG0A 3W75A 1AW2A 4QJ1A 1FWWA 1YLVA 2QDHA 3GB6A 5I3IA 1ZNNA 2ZRUA 1VPXA 1TJRA 2QCFA 3EXRA 4H4IA 2BTMA 3DU0A 3P60A 3G8EA 4JTLA 2F84A 1J5TA 1NSJA 3OA3A 3B0PA 3NQFA 2QDGA 2DZUA 4K6AA 5FI8A 5KMYA 3DFSA 4NJIA 3AO0A 4TIMA 4GUIA 4OBTA 2YDAA 3DI1A 2R94A 3G1FA 2V2DA 3RU6A 3BLFA 3GDRA 3W1RA 2AQWA 5E0KA 3THAA 1JCXA 3O06A 4AVFA 4MJZA 4LRTA 3IIOA 3SZ8A 4R7JA 3C61A 2H6RA 4GJ1A 4UTWC 4AB4A 3GDKA 1DQXA 4LS1A 1MZHA 2ZA3A 3S1XA 1GTEA 1HL2A 2DJLA 3GIYA 1KM3A 1M5WA 3DFTA 2DJXA 4WD0A 3MBDA 2A1YA 1MXSA 4MLRA 4O4VA 2G5WA 2WQPA 3C6CA 1KFJA 3I65A 3TAKA 1MO0A 3OHIA 2WNNA 3C0JA 3LTSA 5D2WA 4DXVA 5G2IA 4IX0A 3S5OA 3W7DA 5D2XA 4JTFA 3W74A 1AL7A 1KFEA 1GWJA 1FDZA 3A21A 4FF7A 3T4CA 3P80A 1DORA 3ABRA 3UY8A 3O8AA 3HG4A 4FXSA 3GR7A 3KVLA 3LHWA 5DCBA 2E68A 3OG3A 4DO5A 3MWAA 3T78A 1WBHA 4U28A 5DY2A 1W5NA 2C13A 4FIRA 1EA0A 1GVRA 5DCDA 3LERA 4LU0A 3TXVA 4ZQRA 3DI0A 4JX4A 3PUDA 3W7PA 3HQ1A 3W86A 4O57A 2CLIA 4PTNA 3P81A 1YYAA 4N9BA 2NV2A 3IV3A 4QNWA 2HMCA 3TIMA 1OF8A 3TSDA 2GVJA 1IIHA 1G4SA 2J9YA 1W3TA 1R2SA 2B7OA 4BI7A 4AHOA 1SW7A 1H7RA 4FB7A 3B0UX 4AWUA 4CQ9A 4XBSA 4YL2A 2CLKA 3W7CA 4LTSA 4JTUA 3TJLA 4JDBA 1TV8A 2J88A 3CM4A 1XI3A 4HSOA 1VH7A 1H51A 2H8XA 1OX4A 4WOZA 3W71A 1PIIA 1S5TA 1N7KA 3K30A 5DCEA 3NOEA 3TJXA 1AL8A 3NQAA 4O1AA 2ATMA 2NV1A 4QITA 4MPQA 3NYZA 2E5BA 4O1CA 1P0KA 3C2EA 4Z08A 2JKEA 1D3HA 3TE9A 2QR6A 3TQVA 3PC0A 2BLEA 2QUTA 3UPWA 1GEQA 3G1SA 3G8RA 3FFSA 4UFMA 3W2UA 4JY9A 3LHVA 3O16A 2ZBTA 1F6KA 3W6YA 1JJKA 3W3OA 3S42A 2JKPA 2W79A 5EKYA 3D0CA 4LRSA 1GVFA 5D03A 3GXPA 3JRKA 5LSMA 3NA8A 4Z1BA 4ADTA 1VCFA 5TBOA 4NJHA 3LCFA 4IX2A 2V5BA 3O63A 1NFBA 1UASA 3NPUA 1RPXA 3LI1A 2DZPA 3TA6A 3GAYA 4UTJA 1PL9A 5AHLA 1SU5A 1PHWA 1YXCA 3PM6A 5AHNA 3TMLA 4AWSA 5D2YA 3ABSA 1SPQA 2OX1A 3CPRA 2E6YA 1WAUA 4GUGA 1LTDA 2NXGA 6TIMA 3FYPA 3G1DA 3W7OA 4DQWA 3Q58A 1L6YA 2E1DA 1FWNA 3NQMA 4AMAA 4L4MA 3RLVA 1W5PA 4XKYB 1TRIA 3LRLA 4KKXA 5HMSA 2CZ5A 3KFTA 3P74A 3U8GA 1W5QA 1W5MA 1H5YA 4MKNA 3L0GA 2X2GA 4EOUA 1VRDA 3T55A 3ELFA 4GUFA 4O18A 5K3VA 4IOTA 4Y96A 1VZWA 2B0MA 2QEZA 3G1HA 1SFLA 1KBIA 1BWKA 3ATYA 3NL6A 1HTIA 1KA9F 3TKFA 5BMXA 4EWND 3P8JA 1EX5A 2H3DA 1JCJA 4I7WA 4FXRA 3N19B 4LVAA 4A3UA 2DZSA 1SFJA 4IWWA 3PS7A 4YXGA 4GUHA 1ICPA 2VEPA 2E6DA 4MIMA 3R89A 1SO4A 3L67A 4FNQA 1K3UA 1I4NA 1O5KA 5EY5A 3Q37A 3NQVA 3LBCA 1XUUA 4PL1A 3PBWA 4P2VA 1H7PA 2ZQ0A 3Q2DA 2DZVA 3KHJA 1IXOA 2P1FA 1GPWA 3MI3A 4JYFA 3R12A 1SQ7A 1T99A 5LGXA 2WSQA 3IRDA 1KM6A 3HJZA 1A5BA 5H91A 2ZRWA 1LROA 1JCLA 1YADA 3IIZA 1KM0A 4BWLC 1WOAA 2EHHA 4ZQCA 2WSRA 3LXCA 2VKZG 1TRDA 4NQ1A 1THFD 3W7HA 3MP5A 4NVTA 2DU2A 1B4KA 4K38A 5E93A 1W3NA 2Q3OA 3W2NA 3W23A 1DHPA 2A0NA 3HPZA 3EWWA 4QSHA 3NM1A 4A2SA 1XFBA 3S5ZA 3BGGA 4Q4KA 4MYAA 1FX6A 5KZEA 3M43A 5HJLA 5F1VA 1GYLA 4O13A 2QJGA 4HN4A 1Q6QA 5D2TA 1VYSX 5F2MA 3VCRA 5H2ZA 3IGSA 2C19A 1LP6A 2C18A 1YXDA 3CEUA 3L5AA 2NUXA 3R5EA 5G2HA 1ZAHA 5G2WA 1Z42A 4IMDA 3R8RA 2QAPA 3STFA 1QMLA 3OVRA 4MUZA 2FQIA 4OHQA 3LV5A 1W37A 2WNQA 3FIGA 4OV9A 3NR0A 1D3GA 3WFAA 4HNUA 3U6WA 3A5FA 3ATZA 4FX6M 5FF0A 3NPXA 1S5WA 3KXQA 3TFCA 1KTCA 4OV4A 2V2CA 3BW3A 4NNCA 3W84A 2CLOA 3W83A 2E6FA 2ZCGA 3IIPA 4O54A 1TIMA 2VEIA 1NVMA 4UR8A 2FPTA 5HWNA 3STEA 3IGUA 3CQ0A 2X16A 4YLWA 1IGSA 1J4EA 4UTIA 1IXNA 3NPVA 3M9YA 3LTPA 1LOSA 1QPNA 4NU7A 5E1QA 1KM1A 1PHQA 2YYTA 3L0KA 4TMBA 3INPA 1WA3A 5AB3A 3W2LA 1LYXA 3PBYA 2H8ZA 3W7JA 5HR6A 5CZ0A 1VCGA 5HWJA 5CPMA 2A7PA 2PC4A 3W7QA 3GAKA 3HOJA 3NQ8A 4AHPA 1MSSA 2QCDB 3O6DA 3DFQA 1HG3A 3SY5A 4FNSA 3IVTA 3P8IA 3EWZA 4S1FA 4NNAA 3B05A 3BVJA 4M7SA 3DGRA 5KSWA 3H55A 5U7SA 3UD6A 1VS1A 1G4PA 3ABQA 4HHPA 3M44A 2FPYA 3PSWA 5HUOA 3W1AA 2ZRZA 1JVNA 1ALDA 4AF0A 5I3HA 2V9DA 3I68A
chains in the Genus database with same CATH superfamily
3BLLA 3UR7A 4B3ZA 2Y62A 1LT8A 3QY7A 3SO7A 4OU1A 3SCWA 2I14A 3S9YA 1TG7A 1QTWA 4QBXA 3ITXA 1UR3M 1YE4A 3CT7A 1UKPA 1YXYA 4ZB5A 3BQ6A 1NF7A 4RZ4A 4KCWA 1W2VA 3KAOA 4B9ZA 1DIKA 1KM2A 3TK7A 2PTYA 2Y8KA 3W9ZA 4M29A 4A35A 2O9OA 4MWAB 1RP9A 1SW3A 1TQJA 3FX4A 1LCOA 5EBUA 1HX0A 1HF6A 3L2MA 5LNRA 3C2OA 3EDEA 1NFGA 3E12A 3B9OA 1X98A 4RXGA 1NP0A 3UPMA 1W6TA 4EANA 3O6CA 3TMQA 2BBFA 3O1NA 4EX4A 4UMAA 3USBA 4NL1A 1LWIA 3TSMA 1E6XM 4O1FA 1KR1A 4UTUA 1NM9A 5G4WA 4YCPA 1IYXA 1P7TA 2HNHA 3OP2A 2D0GA 4Z2HA 4WQ6A 3S6DA 3PZ9A 4OT7A 5BXRA 1E56A 1EP1A 3HPAA 1OG6A 3N6JA 3MUXA 4FS9A 3SAZA 2VYOA 3R2GA 4I8DA 1YNPA 1CXLA 1W56A 5CJ5A 1A4MA 3WL1A 1H5VA 1PVNA 3GR8A 3DBPA 3QF0A 3GNXA 1VBGA 3UG4A 4E4UA 2ZZ5A 3WD3A 5I77A 1C90A 4YTTA 1YPIA 1XLFA 1UR9A 4XAFA 3WNKA 4DIAA 3LV6A 3AXHA 4NNBA 3OIXA 4F0MA 3BG3A 3MCMA 3GNOA 4LUJA 3PWIA 3OLGA 4DF2A 3EWYA 4JQAA 3WF3A 2ZRXA 3NVTA 1RV8A 1XRSA 4C6LA 1EP2A 1OK4A 1TTIA 3WLRA 5CZJA 1SGJA 3GTFA 3W25A 2HQAA 1EDQA 4E2DA 4PRWA 3WEOA 1EJUC 1TA3B 2HZGA 4IT1A 1A0EA 4HPXA 4B5NA 3AHVA 1A4LA 3I6RA 4L9YA 3HO8A 4ONVA 3CV7A 2WJFA 4INFA 5HNRA 3ES8A 2CCRA 4E5TA 4GACA 1Y65A 3BAYA 5I2UA 4MSSA 3LNPA 2X09A 1XDJA 3PZVA 4CUCA 1VLWA 4DELA 4DYEA 4C6PA 3SSJA 2DIJA 4GVGA 4QE5A 2BS9A 5BU6A 1Q3NA 1UR0A 1UQYA 4GXWA 1B5TA 3XISA 3WLTA 3UPBA 3M41A 1UUQA 4QP0A 2QVHA 3GDLA 4F9DA 1VFOA 3BV7A 1U22A 1F9CA 3IUHA 3IJQA 4RNFA 2HSAA 1G67A 3VINA 4ZMGA 2YDQA 4ORIA 3HPSA 4YCOA 2DVXA 1REQB 1A53A 3GXFA 1G9HA 2EO7A 3BSHA 2VI0A 1E6PA 5HMFA 1XYAA 3FEMA 3YPIA 3AS0A 2ZA1A 5H8MA 3UF9A 4O16A 4RNHA 5EMYA 4WY0F 1W3IA 2PMQA 4PBFA 4I6KA 1D9EA 1H7XA 4ZR8A 3NG3A 1XBZA 1BTMA 2V67A 3MKKA 1UR1A 1KLYA 3DG3A 2C6QA 1KFWA 1GQJA 3EZ4A 5FESA 4DHGA 5FEZA 3T0DA 1GVQA 3O05A 2RGMA 4WEVX 1B30A 2E77A 1OHLA 3UA3A 3GQYA 1FHVA 3F4WA 1JD7A 5H8PA 1HFBA 1LJYA 1ZZMA 4MNLA 2PLJA 1ITUA 1OJXA 3CLWA 2E40A 2QUNA 4UCGA 3R43A 1H7OA 1R2RA 4MJ4A 3UJEA 1ISVA 4Q4PA 4US6A 5A2AA 4RNJA 3A9IA 1V6UA 1OD8A 4MZYA 4XD6A 1HXJA 4JYDA 3CL8A 2ZX6A 5BWFA 1DWJM 2KZHA 3BOFA 1KRCC 5A8GA 1Q66A 3R10A 3M16A 2C1IA 1U33A 3A6OA 4PTWA 4F0KA 2POTA 1LOQA 1DKWA 3L2IA 4RZ5A 4HK5A 4Q3MA 1AQ0A 2Z0IA 2WZIA 3B06A 2Z6JA 1CXIA 2PRHA 1YNYA 1KM4A 4IMCA 5C71A 5J8LA 2DT3A 2OB3A 3LI0A 4JNZA 3IJ8A 1UR2A 5FEWA 1I60A 4AEOA 2J9XA 1H1ZA 5XIAA 1V3HA 2DQXA 2VWTA 1ELSA 4JIRA 2OQYA 2D23A 4JTSA 2XWEA 4MM1A 4RDYA 1CCWB 4GO9A 4DEFA 1TWZA 3TUUA 1Q7MA 1Q45A 3H7UA 1JYXA 3G22A 1E4NA 2CKRA 3V0TA 4QLLA 1WDDA 5IRPA 1R86A 4MB3A 3I7RA 4PUNA 1UZ1A 1BG4A 2Z1SA 3W7MA 4X2PA 2OYMA 4AQLA 2ADAA 2VJXA 2Q8ZA 1EX1A 1DJQA 1TJ1A 4I5XA 5A8MA 1DHKA 3B4YA 2WNWA 5EBAA 2DIKA 4GZEA 3GYCA 4GI9A 1KW1A 3WNLA 1OSEA 4AW7A 2YA0A 2C1HA 3STGA 1QOQA 4QDPA 1QRQA 1ZHAA 1DXIA 1GTHA 5LNWA 1C8VA 3A24A 3WLIA 3KLKA 4U2ZA 4ZENA 3M0LA 2BGNE 4MOZA 1V8EA 2Y7FA 2CFFA 4AF0B 3CHCA 5I3JA 2FGZA 4FLRA 3NURA 4L80A 1QAPA 2KX9A 2Y7EA 2P10A 4JNMA 2HCVA 4W5ZA 2VMFA 3ZO9A 3L23A 3LPGA 4DF0A 3W1PA 1ZQ5A 5B7YA 3WJYA 4BQ4A 2ZVRA 4DF1A 5BWAA 1YHTA 1R9XA 2OX4A 1K8CA 1QOPA 3UCCA 3T8LA 1ZUAX 3BAKA 3N2TA 1SZNA 1RHCA 5F4WA 3CIWA 4P8VA 5GNXA 4N0RA 1YQ2A 3WK3A 2O9PA 4OQVA 3FA3A 1M3UA 3QKEA 3BUVA 4FXFA 3SJ3A 1FBAA 1WZLA 5D04C 2XIQA 4WGXA 3IAQA 1WYIA 1DJGA 4HSHA 4RZ6A 2CHOA 2QF7A 4YNGA 4UXDA 1G7UA 3UG3A 5AYIA 4GQGA 3GU9A 3LLXA 1E70M 1HIZA 3EOOA 5CBIA 4BQ5A 3G3DA 3RF9A 4RV3A 1FQ0A 1B3YA 4JQ2A 1A5OC 2B7QA 3ZJ8A 3HF3A 2GSHA 4LT9A 4NJKA 3NNTA 4H00A 4QQ3A 1F74A 4J3UA 3UCDA 2VFFA 1V79A 3DH7A 1OFPA 3W28A 1MDLA 2YBTA 6A3HA 5JH1A 5HANA 2Y4SA 1HJQA 2XFRA 4GINA 4V33A 1K6WA 1A5SA 5GQBA 4Q8WA 5A6BD 3GXDA 2E5DA 4C6OA 1WBJA 5AC8A 2PODA 1EB3A 2NXIA 1TR1A 1QASA 2IQDA 3KRUA 1RJRA 3N4FA 1TPB1 8XIAA 5JVLA 3WLOA 3BANA 1XISA 1PKNA 1RCXB 6REQB 3OVPA 4PFHA 1XSKA 2BXYA 4RW5A 1OBAA 3E38A 3WLHA 5BZAA 2INEA 1GW1A 1LBMA 3QVQA 3Q67A 3IGXA 1CI1A 2QJMA 3H26A 3HURA 2D2HA 4E6MA 5G1YA 4BWLA 1EGVA 2WLYA 4J3TA 5IBXC 3IVUA 3VM7A 1JPHA 4Y6GA 4AU0A 1CLVA 2Q01A 3CZLA 1DJIA 3UR5A 4ZGYA 1JL8A 4NASA 1KBBA 4HHHA 4Q33A 1BYAA 1M9HA 3RUBL 2CC0A 5F4SA 4O52A 3EOSA 3UGRA 2QAFA 1I2QA 4P61A 3MUIA 3V7PA 4PMDA 1MQQA 2BWGA 2PURA 3S2JA 1YMYA 3BG5A 4N9EA 4OVXA 1US3A 2QUVA 4AH7A 1XYLA 4B4HA 4GVIA 3B8SA 3ARUA 1Q6DA 1A3WA 1WV2A 1PX8A 1FFRA 2VZUA 5D38A 1EPXA 4JKKA 1I2NA 1CXKA 1ONWA 5LHFA 3LX9A 1HUVA 3SUUA 3L21A 3TLLA 4BKNA 4XBKA 3B03A 3WQVA 4UWMA 3G1AA 6TAAA 2E3ZA 4MJMA 3ZZ1A 3F7JA 7ENLA 2Z7KA 3WBAA 1K70A 1UP2A 2YBVA 1SSDA 2OCZA 4UTTA 3PAJA 3VIHA 1U5HA 5E09A 3ZVIA 4N4PA 3BO9A 1GOWA 3H53A 1JQXA 4QXIA 1XLIA 3C0SA 2RUSA 3C8FA 1KR0A 5G1MA 4DLFA 2A2IA 2GQAA 4QTGA 1SFSA 1J11A 3TN3A 3AMDA 2ZZ3A 5I06A 2VC9A 3TSBA 1BWVA 1H4PA 3D5HA 1J2WA 3C56A 4FOJA 1SO6A 4GY0A 4QRNA 4XBJA 1R3RA 3VGEA 2ZXBA 1V3KA 2PDBA 3BARA 4BFAA 1J79A 1Q63A 3QJAA 4K37A 1UR4A 3V0UA 1ZGDA 1FWJC 1MEIA 4DLMA 5ABFA 2GWNA 2F38A 4M81A 5BW6A 3VDGA 5CZTA 1VQTA 4CNOA 3GG0A 2WM1A 4IPJA 4EIVA 3ZFHA 1GJUA 3THCA 4GO8A 3WBEA 4LVFA 3BTNA 4UIOA 4X0NA 1EL3A 3DHFA 3NGFA 1S5VA 3SB0A 2ZC1A 5AC6A 3NQ6A 4C5ZA 4HU3A 2BB0A 2DP3A 1WDPA 2RDUA 1Q4NX 2P0IA 3DAQA 1AMYA 3VYLA 5CEWA 1T40A 3OW1A 3MV01 4CEXC 1JR1A 4TVCA 2PLKA 1OQFA 3MUCA 2CETA 1KBJA 4XTIA 4R88A 1RLCL 4FX7A 4E3TA 2I9UA 3GVVA 3JR2A 1VD6A 1E5NA 1CXEA 1E5JA 2P50A 3OYXA 2I5QA 2DH3A 3KW3A 3KVJA 3U3HA 1RD6A 1TQXA 2ABBA 1BF6A 2AMXA 5HUPA 3QBUA 1OC5A 3W1XA 2ACSA 3G77A 4UQEA 2E09A 2IKIA 1GVEA 1BSLA 3KVKA 3WK2A 3TNOA 1CT5A 1UROA 2Y7GA 3CQHA 1XKYA 3GXTA 1JPDX 1F4HA 1P0DA 1QDSA 3ARVA 4L1GA 4DM1A 5K9DA 1XLLA 3F4DA 2CIPA 3B8VA 4W84A 3OLEA 4BY3A 3O3RA 4UFLA 4GXPA 4WXZA 2ZZ7A 3QGKC 1RR2A 1VHNA 3IJ7A 3SI9A 2WO5A 2XN0A 1A0DA 3Q65A 3KOZA 3LYEA 4G56A 1FH7A 2VVNA 4XVEA 3XIMA 4WXYA 2QCGA 2WC4A 4G7EA 4R7OA 2V0TA 3N13A 3OVGA 3BZGA 2J6VA 2JALA 1F07A 1ME8A 5E5CA 4IIGA 3HZ3A 3SCQA 4TXEA 1UIOA 3T9PA 3NL5A 1F3TA 1I45A 3SIMA 3WH5A 1SMDA 1BD0A 3OGRA 4CD5A 4HOXA 1EHNA 1UKOA 3UVAA 3PAOA 2HVNA 4XG1A 4IMEA 3EAUA 3H4XA 1B3OA 4UMBA 3UZXA 5CBJA 1MW2A 5AZ1A 3EX2A 3CL6A 4PRRA 3U5UA 3QYSA 3W2KA 4CQAA 4HHMA 5AECA 5CG7A 3QMTA 3L66A 1UWSA 4A8IA 3UETA 4IPIA 3DYPA 1OIFA 5K4XA 1OFBA 1B4EA 5REQB 1DJYA 5BNKA 3WLNA 5DELA 3S5YA 1JI2A 3IIVA 1TWIA 2FMOA 2BY1A 4ZZ9A 3HTWA 4N02A 3AQUA 4CQ8A 4ZODA 2YCEA 2OOFA 1ZRQA 2CW6A 5T91A 5IFPA 2EXOA 3CXOA 2BOEX 2HJPA 3UG8A 7ODCA 4MZ8A 2VDGA 1PZ2A 3N29A 1RAKA 3BMXA 3WH6A 2VELA 4M51A 1O94A 4B5TA 4H1ZA 1EPVA 4QIUA 1AD1A 3HQPA 4A3HA 1ZL1A 2VFHA 1GVOA 4AZCB 2HRWA 3WL0A 2A7NA 5H8UA 1RVKA 4DUWA 3U2ZA 4JTTA 3L65A 4NF7A 4XAYA 2VUNA 1TTPA 2OU4A 3KX6A 4AHQA 4L64A 4MY9A 1KXVA 1PAMA 4H8VA 4H9YA 1H63A 1HN1A 1QWGA 1AUSL 2BY0A 2X7WA 3R94A 4CCZA 3VDAA 1DPMA 1EF3A 1W9PA 6PTDA 4N2YA 1J9YA 3FGCA 4MNKA 3RDKA 2ZTJA 4UNIA 3RPTA 2BFGA 1I1XA 4RDVA 4MPKA 2C16A 2TYSA 1V7AA 3B8UA 3DECA 3BAWA 1V6XA 2P0OA 3KOXA 5EFFA 1HP5A 4DUOA 3BV4A 2NVDA 3HMCA 2X05A 1IIGA 1QPKA 2JGQA 4GNKB 3ARQA 1X8FA 4WUIA 2R1NA 3QV7A 4RW3A 3A22A 3GH7A 4KWUA 2YXGA 5CZSA 3SRHA 1KV5A 2CZEA 2YZ5A 3KTXA 2OFJA 5C70A 2EPKX 3R13A 1LG2A 2BOGX 3AHXA 4AZCA 3M7SA 4DNMA 2DIEA 1XLJA 4PMZA 3WDHA 2QCLA 2ZZ6A 2WKJA 3SSZA 1A5UA 1CB2A 3OZYA 4MB4A 1TJPA 2ATSA 3WK0A 4N7QA 3ZSTA 1UJPA 2Q09A 3I7QA 1Z7AA 5HXMA 3RN6A 3HPXA 1AJZA 4NRRA 3M0YA 4REQA 4QROA 2RJGA 3PWAA 1Y0EA 1ZSXA 3CT2A 3NO5A 1HJSA 5C9WA 4W85A 2X1UA 1NU5A 1CBGA 4DJDD 3UEQA 2VUYA 4HT3A 3UR8A 5DXYA 1YDOA 4YIWA 2GQ8A 4HCDA 1FWTA 2OEJA 2PA6A 4S3JA 3SRFA 4FX8A 4LAMA 1E9ZB 3DN5A 5F2IA 2OZTA 4GZIA 1OD0A 3GC5A 1Z89A 2HS8A 2ZFAA 5LYRA 4D6GA 4DWSB 1KQZA 3TTSA 2WLZA 2C0HA 5DO8A 1QPOA 1PDYA 2ISWA 4Z2JA 1BYDA 2DT0A 4KIRA 3E0IA 3RPMA 1QNPA 1DWAM 1YDYA 3H4GA 3RRXA 3VFCA 1US0A 3A23A 1JYVA 1JDCA 1F7BA 1VBHA 2GGJA 2QCCA 3W22A 3IIXA 2WPGA 2XVNA 3W24A 3DKJA 1A47A 3ORWA 2WJZA 3TAOA 1HGWA 3C5QA 3FKRA 4PL2A 1UH2A 1BTCA 2GK1B 3NQEA 4TUFA 2OJPA 2PWVA 3WJWA 1SYTA 3U0HA 4C1KA 3I6EA 4QG6A 4AISA 1KM5A 1H49A 4Z1DA 5FJTA 4OKDA 1IEQA 2VFDA 1A5NC 3CJPA 3QV6A 3RCNA 3SADA 3B0VC 3S46A 3L12A 3UWVA 3VMPA 2DZTA 4GY1A 5T9CE 4HMEA 4EF8A 2PSNA 3TDFA 3SBFA 5LIUX 4CGTA 4WF7A 2ZDSA 3LXAA 2FDMA 2GUYA 4GQQA 1QVBA 2QDHA 3CV1A 1TJRA 2BTMA 4PCNA 3P60A 4JTLA 3WO8A 4MDOA 2D3LA 2XSBA 2OEKA 2YDSA 2WCGA 3NQFA 2QDGA 5FI8A 5KMYA 1A5LC 3AO0A 4TIMA 2MNRA 4H8HA 2PLMA 2YDAA 3DI1A 2V2DA 5I6SA 1YX1A 1KC7A 1HP4A 2VC7A 1EOMA 4LCRA 4UQBA 3QLDA 4DJFA 1QW7A 1FWGC 4GJ1A 4HOWA 3A4WA 1DQXA 4LS1A 1TVPA 4PB4A 5C9XA 4MDPA 2PTXA 1J0ZA 3S1XA 3FV9A 4HVXA 3DFTA 3CHFA 1XKJA 2P8CA 2G5WA 2PDQA 1KFJA 3I65A 2PP0A 3MMWA 2XVPA 2RGLA 4B2DA 3S5OA 2QMKA 3ONCA 1AL7A 1KFEA 1GWJA 2ONEA 3A21A 3T4CA 4FF7A 4JFWA 1DP0A 2A3LA 3UG5A 1BF2A 3BJFA 4GH1A 4QDWA 3IGHX 3LHWA 3OZPA 2ZADA 1S1PA 1UPPA 3TYDA 3WBWA 3TJ4A 4NKCA 2PP1A 1K9DA 4DUXA 3BLOA 3T78A 3SQLA 1WBHA 4U28A 2WMKA 1ZPTA 1W5NA 4FIRA 3KLLA 3LERA 3TXVA 4JQ3A 4ZQRA 4JX4A 4PCTA 4DJEA 3W7PA 1BXCA 4JFTA 3E0FA 5CC5A 2HMCA 1G4SA 3DERA 4MMWA 1QBBA 1Y8BA 1W3TA 5IDZA 4J2MA 3CQIA 4AHOA 5JIPA 1EJSC 3KBVA 4H6EA 1S39A 1XWYA 3B0UX 4AWUA 4CQ9A 3U4FA 3T2PA 3W00A 2Z4GA 1VJZA 1DJHA 3H2FA 3VABA 4HSOA 3CPGA 4JNYA 1H51A 4PUEA 5DCEA 3TJXA 2ATMA 3UVIA 1W9VA 4OFCA 2Z28A 4CNTA 4Z08A 1D3HA 2J75A 3CZKA 1XPGA 1GEQA 3G1SA 2G3FA 1TJ0A 4IGNA 4JY9A 3W2UA 3WELA 1V6YA 3W6YA 4KCVA 5FAJA 3VGHA 1J0IA 3I4KA 3D0CA 4PTMA 2V5CA 4PBGA 1GVFA 2A3BA 5GPRA 3SCPA 3LN3A 4GCXA 1JZ8A 1BFNA 1Q8JA 4LBSA 3LCFA 2PB1A 3LI1A 4PUJA 4DI8A 4GD0A 3N9KA 3SURA 1C8YA 1YXCA 4FLSA 4AWSA 1SPQA 1SJBA 2GDVA 2OX1A 1JZ2A 3CPRA 1WAUA 4WRHA 2PWHA 1ISWA 2W62A 3G1DA 1J6PA 3GD6A 3W7OA 3Q58A 1VENA 1D2KA 4LB4A 2Z7GA 1QHOA 4IICA 2ZE0A 4ZEPA 3MSRA 4KKXA 2OO0A 3IACA 3T07A 3THDA 1VRDA 4M8UA 5GNZA 4GUFA 5M1TA 4O18A 1DTUA 5K3VA 2PWEA 1H09A 3SFWA 3FK4A 4H2HA 3KHDA 2DZAA 4TV6A 1KA9F 5BMXA 1FHDA 2Z25A 4I9TA 1R8LA 2XVLA 2GDUA 4FXRA 1I9CB 3N19B 4E4FA 5ECVA 4LVAA 1MUMA 1SFJA 4NYUA 2VNCA 3PS7A 2XUCA 5FA5A 2XVGA 4GUHA 3T4WA 3WUEA 3M46A 1ICPA 3TN4A 4MIMA 3H22A 3L67A 1I4NA 3Q37A 1H7PA 1I1WA 2ZQ0A 3IUDA 4J7RA 4RE0A 5FOOA 4AD3A 1X38A 1SQ7A 3GTIA 1OWQA 2G0WA 1T99A 3D3FA 2WSQA 3IRDA 1KM6A 2RAGA 1PJ9A 3UP8A 1XLKA 2G41A 4IJRA 5M17A 4C7FA 3DIPA 1XIFA 4BWLC 1MW3A 3RM9A 4ZQCA 4UTFA 4XX6A 1THFD 1P6WA 1HL8A 1B4KA 3CUJA 4K38A 4QSHA 3EWWA 3MANA 4Y9PA 5FL0A 4A2SA 1JYWA 2CERA 2ZWZA 3S5ZA 1WCGA 4D72A 4QJ3B 5CGTA 3M43A 3WQEA 2HV5A 1GYLA 4O13A 2QJGA 4L56A 4HN4A 2OYKA 1R7OA 3N3TA 1PWMA 4UOZA 4W8BA 5C2CA 2C19A 2VOTA 2E7FA 1P0BA 1YXDA 4Q4MA 1ZAHA 5G2WA 1Z42A 4IMDA 3R8RA 3FHAA 3FSUA 1XHGA 2IXVA 3LV5A 1EZ2A 4V2XA 5HPCA 2Z1KA 1GHSA 3NDYA 4QDMA 1WKEA 1W37A 4OV9A 1CXHA 1D3GA 5FF0A 1PTGA 4AD0A 4MG4A 3OPSA 4NAFA 3IIPA 4O54A 4CQDA 1TIMA 1NVMA 4UR8A 1K9EA 1EQCA 1JPMA 3T0BA 1OCJA 4OJYA 4UTIA 1IXNA 3M0JA 4B92A 4NU7A 5E1QA 4S3AA 1WE5A 4FOKA 3W01A 3L0KA 4TMBA 4F8XA 1TWDA 3W2LA 4PSPA 1CGTA 3PBYA 3DESA 2PI6A 5CPMA 3W7QA 3VCCA 4C91A 7XIMA 3HOJA 1KXHA 4AHPA 2QCDB 5AVHA 3U7BA 1BYBA 4Z2KA 3QPEA 4RDZA 3ABQA 4DBWA 4HHPA 3H7VA 1GPFA 3M44A 3V5OA 4C6FA 5HUOA 4AYGA 3GFXA 1Q4WA 2V6AA 2J7EA 3KS5A 3BSMA 2V9DA 2R82A 3PZOA 3I68A 4PEEA 2LLEA 1ONRA 2Z1BA 5BXPA 2XTKA 1TPDA 4QG8A 1E4IA 5XINA 3NQDA 3CO8A 4TTUA 4X61A 1L2QA 3UWQA 2ICSA 3GU1A 2CXEA 5DRCA 4GC4A 1Q6EA 1QT1A 2W6RA 3STCA 3RR4A 4RLIA 1XG3A 2ISVA 3M1ZA 4PMYA 1OX5A 3W1QA 1Z48A 1H1NA 3S1UA 4A29A 1JF6A 1XDMA 4CLMA 4WZHA 1PZ3A 1BPLB 2QGYA 1Q6RA 1PYMA 2QCMA 1CENA 2J47A 3T09A 3KWSA 2PP3A 3MKVA 1TZZA 2Q8LA 1I2PA 2XPKA 4U2YA 4N6FA 3LB0A 3F4NA 5KINA 1XD0A 1UYQA 4QAIA 2QCDA 4ZO6A 4QS6A 3EX3A 4JIHA 5A8PA 1JDAA 3EOEA 2PWDA 2WVUA 2D1ZA 3WH7A 1JUBA 1KQYA 9XIMA 2WVTA 3TFXA 2NQZA 4O50A 2BZNA 4LF2A 2BDQA 3PB0A 3W7IA 4XV0A 4E2OA 2Y24A 3VFLA 4WJXA 2VQUA 1ZY9A 4DB7A 2VGIA 4AX6A 1GGOA 1XQKA 5U4NA 3FN9A 4XB3A 1PS9A 1W1YA 1JPKA 2ZA2A 4HD5A 4YWSA 3BDKA 1QK0A 4DXKA 1U1JA 3ZM8A 3U48A 3CH9A 4R7WA 3BXWA 4JKLA 3W88A 2O7SA 1RCQA 2PDXA 1NDWA 3P67A 3CS2A 4C1NB 2H90A 3B9DA 1U5VA 5I5RA 5HMEA 1QFEA 4BR1A 4FHAA 3MHFA 3T2OA 4UMCA 2NT0A 3GX9A 4TX6A 2FZMA 1O66A 1VBJA 1R30A 4JHOA 1JGIA 1XYMA 1HKWA 1XC4A 2ZX5A 3N4EA 1I2OA 2VR5A 3QMRA 5I00A 2VGBA 1TPWA 4D6JA 3TYCA 1G69A 1DJNA 3ZS4A 1TO3A 1OX4B 3CBWA 4IQDA 2E8ZA 5AFDA 3E0LA 3N12A 4LCQA 1BXNA 3NL3A 1EC8A 1EO7A 2GDQA 4WY0B 2Z2BA 1TPEA 3V1PA 4MWAE 3EDFA 5EFDA 3BPWA 3KM8A 5EU9A 1VJSA 3T05A 1O60A 2YLLA 2CBJA 4HU4A 1KRMA 4GJJA 4MTVA 3CUGA 3KZSA 5LHEA 3K4DA 5HBFA 4Z2GA 2E1WA 3AYVA 2VCAA 1W3HA 3F5JA 4FLOA 5JH2A 3LLFA 3EDDA 4CVUA 1UPMB 4FR6A 3W07A 2WHLA 4C6JA 3K13A 5J5RA 2G96A 3G0UA 5ENLA 4P8XA 2VDHA 1YTKA 1UKSA 5EYWA 3DGBA 1EP3A 3CMJA 1M01A 1IR1A 2PDJA 3EX1A 4I9AA 3MHUA 3PZIA 4X9SA 1N82A 3AS2A 4IQEA 3SFKA 2DSUA 3QR1A 5LGZA 4L1WA 3T7VA 3DFNA 4ML9A 4HK6A 4XAGA 1TTJA 3PULA 1RH9A 4FIQA 4KWSA 3WDIA 4UZUA 1JIBA 3TROA 4HKPA 2WBGA 4JHMA 1EC9A 2XM1A 4Y8FA 3FLUA 2CYGA 1IEXA 4PMRA 3GNDA 3PVFA 1OFRA 4EKJA 3A4XA 1TPFA 1UWAA 3QSRA 1NH6A 1FDYA 4WY0A 2ANUA 2GJNA 4LV9A 2UY3A 2VX7A 3A13A 4JTDA 2FVMA 1UUMA 2EG6A 4JQ1A 3IVSA 2GJRA 4AFYA 4M1BA 2ZUNA 3NQCA 5K7JA 2GQ9A 1E1FA 2ZC8A 1OADA 3RMEA 1G6CA 4YWIA 2I1OA 2PDNA 2XGZA 3V5FA 2JEQA 4JN8A 3QTPA 4JTGA 2AL2A 3E9AA 2XIMA 1ZENA 4CNNA 1AK5A 4O12A 5A3HA 5FKYA 3LEPA 3VGDA 4PTXA 5HNUA 3N3MA 1BEUA 4H9MA 5FEXA 5CSUA 1R3SA 1JF5A 1B9ZA 4GIYA 2VOMA 4H6QA 4I5UA 1NY1A 4I5RA 3PTQA 1XBYA 1ZAIA 3MC5A 4CQBA 1QJWA 4D1JA 1V3LA 3EPNA 4RL3A 2MUCA 1JAKA 3BGJA 1OM0A 3CASA 3WLSA 1RA5A 2PD9A 1Z3NA 1CXFA 3ITGA 3NL2A 3OEXA 2DSWA 5CPNA 1CB7B 4PODA 3WBXA 3BW2A 4X60A 1Q13A 1PV8A 3L4TA 8CGTA 5MKGA 4FNTA 4HMNA 3GZ3A 2DW6A 4H8NA 3LGEA 4NZ5A 4J1OA 1DOSA 2Z00A 3R11A 4KCUA 4J40A 3II1A 3VMOA 3L4WA 1O12A 3DUGA 3OB8A 4WSHA 2R1KA 2YA2A 2BSLA 1DBTA 1S2AA 4LNYA 4D6DA 3EPMA 5I03A 4ZQNA 1E9LA 4KWOA 1BKSA 2IKGA 1JPIA 1LBLA 4ILSA 3WCZA 5IM51 5FF7A 1E6RA 3UWUA 4UCFA 3ZVHB 5BXTA 2D2OA 4MKVA 2Y88A 4U3AA 4PCSA 4UFIA 1OX6A 3H21A 4LUYA 4CKQA 3SCVA 2YR1A 2YCIX 3KTCA 3M5ZA 2F8QA 5J04A 2OELA 2XWDA 2HROA 2CLEA 1E3XA 3LCLA 4LY4A 3N1AA 3A9BA 3VI2A 2GFTA 1IQ8A 1GZGA 4BEUA 1YBQA 4H83A 3OBKA 1N55A 3CC1A 4ATDA 3V1HA 2IPWA 2IW0A 3TCEA 2FJUB 2QF8A 2HK0A 1ESWA 2GGIA 2A21A 3BLIA 5HATA 2OQHA 5LIXX 4MB5A 4W93A 3OLIA 1CW2A 1UWUA 3JS3A 3PBUA 4FZIA 4AAJA 4KEZA 1IE7C 3R6IA 2AGTA 4MFEA 2HS6A 1XS2A 2FHFA 4J27A 4EF9A 3EDJA 1MRQA 3UA4A 2FZDA 2CBUA 2X8RA 3LM7A 4XISA 1P4CA 4GRSA 2CEQA 4DBUA 1AZ2A 4U33A 5F2LA 3DEQA 1KCKA 5D2VA 3MKCA 4ACZB 3RR1A 4FEZA 1JCNA 1NDVA 4WJEA 1QI3A 5EPDA 2JF6A 1EEPA 1PUDA 3F4CA 4H41A 2G50A 4Q32A 3QSTA 3U2OA 3PJWA 1HJUA 3ZYZA 1CWYA 3TW6A 2IQTA 4ZE4A 4ZQPA 2JK2A 2ZUUA 2OMAA 3HFTA 3A3WA 3C2VA 1T6MA 4S3CA 3CO4A 1R85A 3ARRA 1YKWA 4OWGA 4Q6XA 4WJ8A 5HINA 2WMIB 3QZ6A 5A6BA 4IPPA 1CLKA 3WD2A 1O7AA 4RE3A 3S2CA 1XM3A 3UYIA 1VR6A 3W38A 1OB0A 1SZGA 1EXPA 1OYBA 5CQ1A 1ZFJA 3G1RA 5KTLA 1JZ4A 1KNWA 4JTKA 3DCPA 1OFOA 4W5UA 1E6NA 1W3LA 2Y8VA 4S3BA 5K9XA 4AY7A 5DY3A 4ZOBA 4JN7A 1Y5XA 3AIVA 2VDIA 4F0RA 2V2HA 5HNNA 1LRQA 4UOJA 3QOMA 4R27A 4KWWA 5FJUA 3ZLGA 3QW4B 1XP3A 4LC8A 2WCSA 3QGVA 5HQLA 1SZFA 4KWVA 3JVAA 3GVGA 2GGEA 3UYCA 1T8XA 4HHLA 4KGLA 1JCMP 2P53A 1PTAA 2VC5A 3AIWA 2F9RA 1OT2A 3T0TA 4XZHA 1P43A 1ONXA 1U30A 1X7IA 8A3HA 2VCCA 2BXVA 4IISA 4Z0SA 1N2VA 3PNZA 4KCTA 1KGXA 1JFHA 1ZJIA 2YW3A 1PTDA 3FNDA 4NIRA 1POKA 3CB8A 3EKGA 4LS0A 2FHCA 1T8QA 4JIQA 4M19A 4GOAA 1UOZA 1DJZA 4AIEA 1I6NA 1F3WA 1S2TA 4S3FA 2W92A 1XGZA 3PTDA 3QTGA 4P8WA 4IFKA 4S39A 1JQVA 4UZSA 2XFYA 4NAEA 5EB8A 3W7KA 2G3NA 3AROA 3HGRA 5ECUA 4IXXA 1RZMA 4PCFA 1JRBA 2NT1A 2RDWA 1F61A 1P48A 3O15A 2EPMX 1QK2A 4XZ9A 3G24A 3SUVA 3SCNA 3JZEA 3S0CA 1WB0A 1LLOA 4GBUA 5E6YA 4QNEA 1EF2A 3WQOA 3G0SA 3MCOA 1TPC1 3BLKA 1R87A 3QPZA 4QM1A 3TYAA 3S47A 3MS8A 2INZA 1JNDA 4GUJA 3VNZA 4B5XA 1FTXA 1ADOA 5FF2A 4AY1A 1C93A 4KH2A 2EKGA 3WSUA 2VQTA 1H3GA 4ZXLA 1S3HA 3GFYA 1AQMA 1VHCA 4KEUA 4C7GA 2Z24A 3SGGA 5JQ9A 3WQGA 4KQNA 5EMUA 1ZJHA 4XO6A 1RQBA 4UFHA 3ZMRA 3NIYA 2DZWA 5D05A 4B15A 3W0KA 1E1CB 4EPEC 2HVMA 2PC8A 3QV9A 3HFYA 1RVGA 5AN7A 4C90A 4QLKA 1RJPA 3PBMA 3KRBA 3MQTA 1W31A 1ADDA 3MSGA 1MFUA 3FYYA 4L9XA 1F6YA 1U83A 2Y61A 4DBDA 3F2CA 1XR2A 4XO7A 4YTSA 2JGYA 4NX5A 4AUBA 4ICCX 4RUBA 3S9ZA 1OABA 1JCYA 3N2XA 1NJJA 1XRFA 1DE5A 3HQNA 4A3YA 5TD4A 5H6HA 2C91A 4X9YA 4JFSA 3MSYA 4LUSA 4MAVA 3NO1A 4DX3A 3N34A 3W82A 1JAEA 1XW8A 3QQ1A 4O17A 4D6HA 1M7JA 1UBSA 2I17A 3IUIA 3GXNA 1WKYA 2CHNA 4UNLA 3VKJA 3KBJA 3PTKA 4O1BA 4I8YA 4F0SA 3AS3A 1KD0A 2O4MA 2X41A 3KBNA 2WZEA 1NOFA 2AGKA 3WLQA 1H62A 1PDZA 4HPNA 4XSLA 4GC3A 2CLHA 3LCGA 4H9VA 1JUKA 2A6LA 2EEXA 4O11A 3GK0A 3N9SA 2PDMA 3SN1A 3B8TA 4LUTA 3VOIA 4H3DA 4C6BA 2Y7DA 3EKZA 3ZLFA 3W1NA 5F1UA 2VHLA 1KTBA 3C4UA 4Z1CA 1US2A 3E2SA 4PMUA 3S6TA 1M6JA 1C29A 1H1YA 1EDTA 4PTDA 1UC5A 1GEHA 1OFEA 5CAKA 4IMGA 4X2RA 4O8RA 1TJ2A 1W9UA 5AHMA 1WDWA 4LWWA 3N4AA 3XINA 4TO8A 4FSAA 3EEGA 2QIIA 3EA2A 1MUCA 8TIMA 1GONA 3S4TA 2HNEA 1V02E 4OE7A 4UTHA 3LG3A 2PFHA 3W02A 1QNRA 4UQDA 4I9JA 1UWTA 1K7EA 1YPXA 1XGEA 5C54A 4KFNA 3H70A 1UP0A 2OXNA 3G6MA 5GJPA 4A8LA 2QXWA 2W63A 5AOUA 1L6WA 2YW4A 4NZ3A 3AHZA 1S2WA 1HKIA 3GTXA 1AQHA 2CKSA 3SCUA 1Q7QA 1PIGA 3QR0A 2QJHA 4CNPA 2UZ9A 4WIWA 2YX0A 1UA7A 1D8WA 5HK4A 2CLFA 1WP6A 3PPCA 3PZTA 2BNJA 3N73A 1E0UA 5JMUA 4IPLA 2DZBA 1YEYA 4JCMA 1L2UA 2ZICA 3SUWA 4FP1A 4KBXA 3W2JA 1X7FA 4PE8A 3NEHA 3W29A 1DWHM 4GJIA 1G4EA 2Z1WA 4QCFA 4O0ZA 2VO5A 1L6SA 2YPIA 1RBLA 1D7KA 1XLGA 1KFBA 3VD5A 1R0MA 2BVWA 4KGJA 3AZRA 3HQOA 2Y2WA 4RK8A 4HZ7A 3O9NA 1I8JA 1O6IA 3PPHA 1KLZA 2R1LA 2WK2A 5DLCA 1NQKA 1JYNA 1GOKA 3ERPA 2GJPA 3GVWA 1AJ2A 1T5AA 4RE4A 1VFLA 2VEFA 5LNSA 4XD5A 4K68A 4XKYA 1F73A 1B2YA 4WK9A 1P1MA 2NZLA 1FWRA 1OINA 3K4AA 3LCXA 1E6QM 4O1EA 2WVSA 2YXOA 4YS1A 1K7XA 2XGBA 4A6GA 5KEZA 3AJXA 3HA1A 3QQ0A 4IL0A 1FFQA 2GL5A 2Z6IA 4NY2A 1QHZA 2JKAA 3MPGA 2PU1A 3ECQA 1E0VA 1PPIA 1XIBA 3BW4A 2WYSA 3DOPA 4JAWA 4X63A 3RNDA 3TU9A 2O56A 1H0GA 4GFSA 1SJAA 2QV5A 1GG1A 3F4VA 2O0TA 3M0ZA 2IMRA 5I3GA 3CHDA 3ZOAA 4TMCA 4MGGA 5FF4A 4MB1A 1SR9A 1PCKA 4ROPA 3EX4A 5LIYX 5HMDA 5M03A 4JGDA 1MFVA 1HKKA 2ZOXA 1XQLA 1KRBC 1TV5A 4GGBA 1IR2A 4XKMA 4AZ5A 1LQAA 4I9MA 1GKPA 2CLMA 4B5VA 1B0IA 3RRAA 2O55A 3GW0A 2D24A 4DJDA 2FZNA 1ECEA 3VDHA 1EJRC 4AZIA 1SUXA 5EL1A 1J93A 1BVWA 4N9CA 3U9IA 3AUJA 3VUSA 2A3HA 1ME7A 3E3HA 1ISYA 4X22A 4JXCA 5AZ0A 4G2DA 3LDVA 3PJTA 4GI4A 3VNJA 1DQUA 3P2VA 4KETA 1XYCA 3NEVA 1GQLA 4AEEA 4LF1A 5C0QA 1TVLA 2G4FA 4P8UA 1TMHA 3KOWA 1SSGA 2R24A 4AXKA 4DAIA 2CU0A 2PGRA 3IJLA 4PUMA 4GYPA 3WLPA 2C7FA 1E51A 4PUKA 4H7CA 3KRZA 4UOQA 2ZUSA 1QATA 4HTYA 3LY0A 3TQKA 4MYXA 4ROQA 1H0IA 3FVMA 3TR2A 3BOXA 3W1MA 1R2TA 3T42A 3UWZA 1LWHA 2WMHA 3E49A 2PDLA 2CZVA 1Q85A 3LRKA 1W8SA 4BK9A 1WOBA 1XIMA 3W53A 2ZWYA 3H24A 4FAMA 4GX8A 1B3ZA 3GZAA 5I7GA 4EPDC 2QCNA 3LBMA 5M5DA 1HVXA 1N8WA 3RM4A 3PY2A 1OZQA 1PXGA 1WDRA 4PTVA 1QW8A 5I07A 1E0XA 1WAWA 4QJ5B 1XRTA 3MI6A 3W1LA 2V63A 5E0CA 4AC7C 3L68A 5C2XA 1XLMA 4OZOA 4BF9A 2G8ZA 2EAWA 5AC5A 5I3DA 1UG6A 3EA3A 1W1PA 1AW2A 4Q4QA 4QJ1A 1LQ2A 2VX6A 3AOFA 1ZNNA 2ZRUA 4PYSA 4H4IA 3AFBA 3G8EA 2F84A 1J5TA 2PDYA 4MWAA 3KZPA 4MNJA 3E74A 4NJIA 3GW3A 3GO2A 4IF2A 4OBTA 2ZUMA 3NJ3A 2VX5A 3NXLA 3AMKA 4RNIA 4GZ7A 1U2YA 7REQB 5CPQA 3WF2A 4HA1A 1ZBWA 1S46A 3URQA 1AODA 4I6VA 2NVCA 1OT1A 3GDKA 1MZHA 2E4TA 4LBUA 3TTOA 1GZJA 2QPXA 3GIYA 3DC0A 1KM3A 1DXEA 2DJXA 2A1YA 4MLRA 4O4VA 4HGXA 4URIA 2XIBA 3C6CA 2OSWA 3DYOA 4KEVA 1MVYA 5D2WA 4B91A 4DXVA 5LIKX 2VZSA 4CN6A 2V3DA 4G1NA 3P80A 4QG9A 4QX4A 4Y8EA 5A8NA 3GR7A 3IJIA 2V3FA 1DJXA 1L0PA 4DO5A 2OGJA 4LH8A 1A5MC 4YN5A 2DSKA 3MWAA 2FVLA 2DSVA 2HISA 4M0XA 5DY2A 2C13A 3A3HA 2E25A 3OGSA 1EA0A 2DW7A 4JTRA 1E0TA 3MDWA 2OO6A 2F6UA 2W61A 1GCYA 4O57A 4PTNA 4HQVA 1C9WA 4F4RA 4N9BA 3VIMA 1OF8A 2GVJA 3WENA 1R2SA 2XM2A 4D8LA 1GORA 3PBGA 1A49A 4DN1A 3ITVA 3AJ7A 3EMQA 1OGSA 3CTTA 4U3CA 2J66A 3M0XA 3WMCA 4EAYA 4PCPA 2OSYA 2Q71A 4JDBA 1TV8A 2J88A 5I24A 1E6ZA 3VA8A 5A6JA 3EYPA 4M1RA 2H8XA 4WOZA 1TA3A 3W71A 2VGGA 4UQAA 1C7SA 1R9YA 3K30A 4YHGA 3NOEA 1AL8A 2AAAA 2NV1A 4MPQA 4E8CA 1CGUA 3VNLA 3BCDA 4O1CA 1P0KA 3SM0A 4NHVA 2JKEA 2QR6A 3TQVA 1BRLB 3PC0A 2BLEA 2QUTA 4LYPA 3UPWA 1L6FA 3G8RA 1B3WA 2WHKA 3WNPA 4AIOA 3LHVA 2QZRA 3O16A 4EPKA 1F6KA 1NIUA 1JJKA 1IZKA 2REQB 3SY8A 1LG1A 4AY8A 4CU7A 3E5BA 5HNTA 2W79A 5EKYA 3VTRA 3G2GA 3AWOA 3LZ3A 3JRKA 3TZNA 5D9OA 4ADTA 4YTRA 1VCFA 4WDWA 4NJHA 4IX2A 2V5BA 1MI3A 3VNYA 1RPXA 1TKKA 3QC0A 1PO9A 1A3XA 3PM6A 3WD4A 1LF1A 1UD4A 3ABSA 2XZ9A 1WXZA 3VXGA 2PDCA 4HCLA 2GZXA 2NXGA 3MA8A 3H8AA 4CD8A 3WNMA 1REQA 1M53A 1FWNA 1WNOA 3H7RA 4L4MA 4XZNX 4DAFA 1TUFA 1W5PA 3LRLA 3U8GA 1W5MA 4MKNA 1UC4A 4F48A 2X2GA 3MY9A 4EOUA 4B9YA 2PGEA 3ELFA 2FH8A 3IRSA 4IOTA 6XIAA 4Y96A 2IPGA 1X6NA 3G1HA 3W6LA 2W9MA 3ATYA 4K1GA 1D7FA 6ENLA 4EWND 4RPQA 1JCJA 4I7WA 2VR2A 4G8TA 1FWEC 1VBRA 4A3UA 3CNYA 4H7ZA 3VU2A 5AC4A 2NQJA 1BRLA 2ZXDA 3G5EA 3H2MA 4JFVA 3VIPA 3WYZA 5M3WA 4HPGA 3R89A 1E73M 1PKLA 5CC3A 3U5YA 2DQWA 3NQVA 4BF5A 3LBCA 1H2JA 4PL1A 3PBWA 2NVAA 2DZVA 3ABXA 3ENLA 2P1FA 1W32A 1GPWA 4Q8VA 3MI3A 4W7WA 3CQKA 1PKYA 1W8GA 1JZ7A 2XH0A 4ZB0A 3ZT7A 1SJCA 4GISA 3J7HA 1A5BA 1TMLA 2ZRWA 1JCLA 1QI5A 4EWJA 1PWLA 3W37A 5HAOA 1WOAA 1J2BA 3B0XA 3LXCA 2VKZG 3MP5A 4NVTA 3W2NA 1DHPA 3SCSA 2A3CA 3BGGA 2VD9A 3T08A 5A6SA 1FX6A 5HJLA 3LNMA 2L5HA 5F1VA 5C7HA 1VYSX 1MQRA 3IGSA 5A6MA 2PDUA 2OEMA 2C18A 3PZNA 2PF8A 3CEUA 4QEEA 3SDOA 3MT1A 1V0MA 2PWUA 5G2HA 5A8OA 4HCHA 3STFA 3GM8A 3OVRA 1CZ1A 1BGAA 4MUZA 3AXIA 4HP5A 2WVVB 4NI3A 1Q2SA 1QXLA 5DF0A 5BRQA 1ZB5A 1MXGA 2W5FA 3ATZA 4FX6M 3NPXA 5DANA 4OV4A 2DUAA 3BW3A 4GQ0A 4NNCA 1MYRA 1FWCC 2CLOA 2YIHA 3W83A 2ZCGA 2QS8A 1PBGA 2VEIA 3DX5A 3IGUA 4YLWA 3H2NA 5FJJA 3MVTA 1XIEA 3NPVA 2FGLA 4CNSA 2DFAA 1NWUA 3SN4A 4GX9A 3PZUA 3ARWA 1PHQA 4G7FA 3HU7A 5CC6A 2VVSA 1E15A 3CZ8A 1MRAA 1B3VA 3URAA 3LPOA 2H8ZA 5HR6A 5HWJA 4Q7NA 3TWAA 3VOGA 2A7PA 3HN3A 4PGLA 3SY5A 4IG2B 1Y5VA 1BGGA 4FNSA 3IVTA 3EWZA 1Z32X 2BHUA 3BVJA 4M7SA 1ZLPA 5KSWA 3H55A 3UD6A 4ENLA 3WDQA 1G4PA 4TV5A 1PYFA 4HK7A 2GJXB 2P8BA 3W1AA 1QNOA 4AF0A 3UXAA 5D8ZA 4XIAA 1E6SM 5BRBA 1FWFC 2J78A 3AIQA 2WVVA 3IJ6A 3BAIA 3VGGA 2XSAA 4Z2IA 3OBAA 4JL1A 5E70A 1UB3A 5FJIA 3I10A 2W67A 1X6UA 2OR2A 3G1YA 2A5HA 4UTKA 4GA8A 4KFOA 3ZWSA 4IIBA 2NLIA 4K8GA 3VKCA 4QAWA 1CPUA 3MU7A 3HGOA 3LTYA 4LAZA 4U4MA 2ZX8A 3NM3A 5D37A 3AZSA 3EMCA 4AX7A 1NDZA 4M5PA 1XD1A 5GJMA 4AVOA 1S5MA 3SUSA 3F2BA 3P5ZA 5C55A 2EPNA 2F7FA 1B31A 1HKJA 4RKAA 2ZYFA 2FZ8A 2G3MA 3DHPA 3GY1A 4C6CA 2PRMA 2XFFA 3S6OA 4UQCA 1IF2A 2QUMA 4OUEA 2QDEA 5TAOA 5BU9A 3U2CA 3VILA 1TCMA 2H9AB 1W1VA 1NDYA 4V1XA 3MMDA 1XIGA 4L61A 3CQJA 1UIPA 3R8GA 2G4JA 3SIZA 1OC7A 4JHZA 2XYLA 2OVLA 1BVZA 3HBLA 4EXQA 1W17A 4PUUA 1S2CA 1TPUA 1W1TA 3G1VA 1ICSA 3BMWA 3PZQA 5HA7A 4PC8A 2V5DA 3MMTA 1XLEA 3B8WA 3NSXA 4M80A 1IV8A 3FA4A 4G1KA 4H6KA 3LCIA 2D20A 4W87A 1OYCA 2D22A 2BOFX 3ZR5A 4JTCA 2VFIA 3ZR6A 3DHDA 3S5SA 1OGGA 4O19A 1P6BA 2FLIA 3VKKA 4JIPA 4RE2A 3C0QA 2JIEA 4DZHA 1E0WA 5EMKA 3H23A 2WWCA 3ME3A 4ATWA 3UQNA 3VC5A 1AFSA 4UBPC 4GKTA 5D9MA 4Z17A 4PEKA 1K77A 4JS3A 2PDHA 2HBXA 2PTZA 3V35A 6REQA 2TPSA 2CXGA 3VIGA 4CCCA 3VIFA 3I6TA 2ZZ1A 3UWYA 4E3VA 2XINA 4F66A 1XCXA 2WPBA 1OFQA 3K4WA 2V81A 2X40A 1WKFA 2PF0A 3LGDA 1XL9A 4N4QA 4GPNA 1WDQA 4HTBA 1TV3A 2TRSA 4DJFD 5LA0A 3PFMA 3QMSA 3VO0A 1JULA 2YL8A 1KCXA 1YPFA 3AIEA 1FWHC 4ADSA 3ARXA 4GLEA 2C8NA 2ZRYA 4TX9A 1D3CA 4GHRA 4N42A 4C6KA 3AWNA 1W9BM 4AVNA 1KWGA 3RLGA 2PZNA 4GXMA 5CSYA 4B2DD 4GG9A 1IT7A 5PTDA 4DPQA 4UTMA 3WDPP 4A22A 1UUOA 5J5DA 1JNEA 3N6QA 1VFTA 1XFCA 3HIJA 1T41A 3TC6A 4FA3A 1JZ5A 1F6PA 3UZWA 4K39A 3HG2A 2W66A 4MY1A 1PCWA 5IBXA 2XFWA 1FRBA 1EXBA 3SCTA 4DRSA 1E1EA 1PKMA 3PPFA 4P7LA 3K5XA 4DJED 1RQHA 1TSIA 6CGTA 5FL1A 3EBVA 2JFEX 3FEQA 2OGYA 4LW7A 2Y5SA 3WQFA 2WZHA 3UY7A 1FY6A 1G7VA 2BGSA 4AMCA 5DXXA 3KE0A 1M1BA 3BMVA 3GXIA 4KEMA 3RYSA 2ON3A 1N8FA 4HA0A 2V3GA 3KP0A 4NJJA 4HPHA 1X97A 3CLMA 4GNJA 3M0KA 2IPFA 4W8LA 1X8CA 3VKAA 4Y9AA 4ZE5A 1EJTC 2Z1XA 3W1TA 3V18A 1U1HA 2H3BA 3VNMA 3URBA 4XSMA 3UZYA 7TAAA 3NAVA 2CPUA 1ZAJA 1UCWA 4W4QA 1R38A 3MO4A 4A4AA 1GVYA 1V02A 5LA1A 1FUYA 3GLCA 2P5NA 1K8YA 1QNSA 2XH4A 4M7TA 5DQPA 2BY2A 2VD8A 3NZRA 1W5OA 5RUBA 2QLYA 1GJPA 2WM0A 2J62A 1TMQA 3W76A 2IKJA 3AISA 3KCJA 2BHZA 2C3ZA 4KRTA 3CHVA 3M0MA 2V38A 3BE7A 2EPLX 1XBVA 3PN8A 3GNNA 1TV4A 3EWDA 4RZBA 3F1QA 3CAQA 2R9RA 3RLHA 2ESCA 4CN1A 1Z44A 4HNNA 1UOKA 5K9CA 2B7PA 1ME9A 4GFIA 3P84A 1FDJA 2J25A 3AC0A 3BH4A 4BJHA 4DXXA 4LOCA 3RJXA 4JX5A 2D3NA 4LEQA 3CAWA 2Y85A 3CZGA 3MVIA 2FTPA 1RY0A 1VKFA 5FJOA 1SO5A 5I3FA 2E8YA 3THUA 2EBNA 4MHBA 3WEZA 4HYVA 1R3WA 1CIUA 1FWBC 1B57A 1PZ0A 2GPTA 1B9BA 4J35A 1VFSA 3W87A 3UFYA 3JUGA 4LFYA 3KOYA 4DPPA 2FIQA 2ZXAA 2G37A 1GYNA 2OLSA 4Y90A 1QI4A 1EZWA 2Z26A 2QGHA 5L6UA 2WMJA 1BXBA 1EA9C 1E3ZA 4L9ZA 3HG3A 1A5CA 1L8NA 2NUWA 2I56A 3TW9A 1VEPA 2XVKA 4Q6JA 1IXQA 3V3WA 4L6DA 1A0CA 3LA4A 1GHRA 4J3ZA 4MUPA 3KL5A 5FSEC 2WWDA 1S2VA 2BG5A 3R58A 3ARTA 2J8FA 1I2RA 4QS5A 3L4XA 4R3UA 1WZMA 4ORMA 4W89A 5CGQA 1UQZA 3UZ5A 3EB4A 2QMJA 3WLMA 1R3VA 5AC7A 3W7GA 2VCBA 3N2MA 2J77A 3P93A 2EJ1A 2RFGA 4IMAA 3EWCA 4A2RA 3VIIA 3OYZA 4JTAA 1ICQA 4OBSA 4JDYA 5EMMA 1JZ6A 1XX1A 2NLYA 2Q8XA 4HJWA 3KCOA 3G0XA 4ERGA 5REQA 2CZFA 1J12A 1B1YA 1VRXA 2E9LA 4HNVA 1CECA 1QR7A 3EWBX 4BZYA 4PMQA 1SW0A 1RCOB 1KWKA 1RK5A 5IHRA 1GQNA 3MYOA 5JBDA 4W7UA 1H60A 3GKAA 2XH2A 4UR9A 1Q6FA 2WV8A 1XLBA 4DO6A 3QM3A 3W70A 1EGZA 2RHGA 3C52A 3N2OA 3C2YA 3OVQA 2DORA 4Z1YA 1W2PA 3BJTA 4EE9A 3M5YA 5D9PA 2YA1A 2C71A 2D0FA 1EO5A 3WH9A 3EKLA 1LWJA 1YTDA 1GOQA 1C8XA 1YDNA 5MF5A 1P7TB 3AU6A 4R53A 3EXTA 4IGHA 2C1GA 5LKYA 4LS2A 5F2GA 1V4YA 1KKOA 4E8GA 1VFHA 3GHRA 4NZ4A 2CZDA 1J10A 1QO5A 1RY8A 4IPNB 1H7NA 1EJ7L 3WDRA 3MO7A 1R46A 2FB2A 3BWWA 4XZIA 2FJKA 1H11A 3IANA 4ZTXA 5XIMA 1GOMA 2ZX9A 3DZ1A 2PBOA 1L8PA 3OG2A 3KUMA 4JTQA 4F2UA 4UQ9A 2XN1A 1FXPA 2UV8G 3OU8A 2XG9A 3CZEA 2DH2A 3D6NA 2A6NA 1EWDA 1UW9A 5E6ZA 1AMKA 2UBPC 4LYRA 1F3EA 2EKCA 2FKPA 2WW5A 3TWBA 1AW1A 5BROA 3LXBA 2E5CA 2UY5A 2OT0A 3KL3A 3SUTA 5C5YA 3MP3A 5IHSA 4CN4A 1CGYA 4MAZA 4WHBA 1RSCA 4O14A 2ODOA 4HMDA 2WKLA 1POJA 2I57A 1VYRA 3KEHA 3MUAA 3R25A 3E2VA 4CEUC 3M5VA 2I7GA 4TVUA 2EPOA 4A3QA 2FDSA 1W3JA 3QH2A 2G97A 2GWGA 2FZBA 1PB0A 3S1GA 1ISZA 4CD6A 1GOOA 1F3XA 4JICA 3ABZA 3EWXA 4JZ5A 1XJBA 3OBEA 3TOYA 1HJXA 1WUFA 1MW1A 1P1XA 3GR4A 1OYAA 5IFTA 3FOKA 2OKOA 1EUNA 3OHMB 4PA8A 1TB3A 1KTNA 3A3XA 1SM9A 2WKGA 3L7RA 3WK1A 4PR4A 3LS9A 1LDCA 5LXEA 1HW6A 4N9DA 4P5UA 1FWIC 5FSDC 5DBUA 1GK8A 3IJ9A 3I3DA 2PTDA 4ZA0A 1W3KA 3KL0A 3I3BA 2J7CA 4V15A 3NCOA 2QJIA 3JW7A 2W3ZA 1K7FA 4D6CA 3GG1A 4C6MA 3W72A 4PMOA 3CV2A 4E4PA 5A1AA 2YCLB 1RLDA 2GYIA 4DZIA 5I78A 4OOUA 2B4GA 2AKZA 4WKFA 1V7YA 4EK7A 4J4KA 3UXIA 4DWSA 3H4WA 4Z2LA 1S38A 2RJHA 4ZVJA 1ZCOA 3G6LA 5A2CA 4EXBA 1HNYA 2FTWA 3K2GA 4Q8TA 3PUOA 1OFAA 3GBEA 1DEDA 3AXMA 1QNQA 4ERAA 2GVLA 3CV6A 3ES7A 3RFAA 2GK1A 4RV8A 4IIHA 4O10A 3EOUA 4JTIA 4ICNA 3WMLA 3NZPA 3IARA 4AXNA 3ISIX 2NX1A 5C9RA 4PMXA 3HGSA 1EYWA 1QBAA 4XAPA 4YVPA 3APYA 3H2AA 1UZDA 1AW5A 3Q4DA 2R91A 2HTMA 1XUZA 1DL3A 5T8GA 1J0JA 2Y0FA 1LLWA 2YCLA 3M64A 4I7VA 3IEBA 4RPPA 3V4BA 3FXYA 2Z27A 5FCZA 1M68A 4BI5A 1FOBA 3VIOA 2WSYA 1QI0A 2W91A 1A50A 1XH0A 3VOJA 4UNKA 1J0HA 3SJNA 4LALA 1IZJA 4TR9A 2A85A 3JZUA