1TV8A

Structure of moaa in complex with s-adenosylmethionine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
327
Chain Sequence
EQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum cofactor biosynthesis protein A
publication title Crystal structure of the S-adenosylmethionine-dependent enzyme MoaA and its implications for molybdenum cofactor deficiency in humans.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligand binding protein
total genus 112
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.1.99.22: GTP 3',8-cyclase.
pdb deposition date 2004-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tv8A00
3UD6A 3NNTA 1W56A 2CZ5A 2UV8G 4NZFA 3LLFA 1HUVA 3H54A 4M7TA 1FBAA 2P0OA 3E12A 5I3FA 1EA0A 4UNKA 4NNCA 2ZRUA 1O5XA 4O17A 3GDRA 3LCXA 3B8DA 3Q94A 4LVFA 2X16A 4NU7A 4BI6A 1JCMP 4JYFA 5DBUA 1DBTA 4PL2A 3NZ1A 4IUOA 3TNOA 4LTSA 1L9WA 1PE1A 1R2SA 5HINA 3G1DA 3G22A 4LS0A 3PF3A 5J5RA 3UWQA 3NO5A 2GQ8A 3W86A 5HR6A 3NQAA 3O6DA 1OABA 1F5ZA 1OFPA 2DJXA 3TFXA 1XI3A 4IMCA 5C54A 1DL3A 2E5DA 1K7XA 2Z6IA 3NEVA 4N9EA 4QIUA 3OVQA 1G4EA 4YXGA 5KMYA 3ATZA 4M5PA 2Z1BA 3RF9A 1QPQA 1KFKA 1VGAA 1DKWA 4OU1A 1FWRA 4GWEA 1QPNA 4DXVA 1H50A 1SUXA 3HO8A 4YWIA 3YPIA 3PUDA 3TR2A 1KFBA 3N34A 1G4PA 4JTKA 2BZNA 5KTLA 2FB2A 3QF0A 3LRKA 2KZHA 1W1ZA 1D3GA 1EUAA 2NWSA 2ISWA 3G0SA 2QCLA 4WJEA 2J27A 2Y7GA 3NQDA 1VHNA 3NQGA 4OV9A 3SW6A 1BWLA 3ABQA 1QPOA 4MY9A 5G1YA 1C9DA 3OA3A 3KVJA 3K30A 3W7LA 1O94A 1U83A 1FXQA 3MBFA 1JQXA 5F1UA 1U5JA 4LW7A 4R34A 4NJJA 1LDCA 3GIYA 1ME9A 1TJPA 1JUEA 3TE9A 3C2FA 4DQWA 3SGZA 2E6AA 2Y7DA 4FX6M 4Z1CA 3W1NA 3W1PA 1TTQA 1W3NA 4CQ9A 1TTIA 4WUIA 1TPC1 2A7PA 2FJKA 4PTNA 5BNKA 1WAUA 4PL1A 2ZYFA 3IEBA 5D2XA 4A2RA 1K8ZA 3C3NA 4DPPA 2G95A 3EWZA 5D09A 4LU0A 2WQPA 4UFKA 1SO6A 4DBDA 5IM51 1JCLA 4GFSA 4A2SA 3GZ3A 4JIQA 4ORMA 3NL2A 1TPWA 5H91A 1FDYA 4QSHA 2YYUA 3N9SA 2HTMA 2BXVA 4P2VA 3SIZA 4CQ8A 3M1ZA 3IIOA 1I4NA 1T8XA 3NQ7A 3W1AA 4JXCA 5DELA 5ABTA 1PCKA 1OJXA 3MHFA 1B57A 2O7SA 1EB3A 2WSRA 4JIPA 1H1ZA 2Y62A 2A5HA 1H7NA 3ABRA 2TSYA 4BR1A 1FDZA 3M0ZA 3NVTA 3U2OA 1IIGA 2VFHA 3E02A 3F4NA 4BF9A 3QSRA 3PULA 2V8ZA 1QOPA 1GJPA 3C2RA 2QJIA 3R5EA 1VCGA 3FOKA 3L0GA 4P61A 3W1QA 1O4UA 1WBJA 3LX9A 4EOUA 3WK1A 3EWUA 1JR1A 2TMDA 4UXDA 3WJSA 5LNUA 1DVJA 1TYGA 1KM5A 3BV4A 2XFWA 3H53A 3GVGA 2BX7A 1V7YA 2VFIA 4DO5A 2CLFA 1AW2A 2CLEA 5D33A 3GAKA 1H7WA 2GUUA 3G3MA 4ONVA 4O19A 3THAA 4R33A 3B0PA 1T99A 2ZDRA 3W87A 1OX6A 3S5OA 4UMBA 4BWLA 1TO3A 2E6DA 4NT0A 2QCEA 1W5QA 1LRQA 1OX4A 4UUIA 4AWSA 3TQVA 1L6YA 3L67A 3W7MA 3NPXA 4CNNA 3O07A 1EUNA 1PHWA 3P60A 3IVTA 5EBUA 2ATSA 4E38A 4O4VA 4RK8A 5CZ0A 3E49A 5HNRA 3MI3A 1ICQA 1NFBA 1XC4A 5BOOA 3DXIA 2QDHA 1XUZA 1M7OA 2NUWA 3BG3A 4O8RA 4O10A 3P82A 2ZTJA 1JCXA 2DZVA 1VQTA 2VEKA 4UR7A 4HNUA 5FEZA 3HMJG 5D2WA 3LV6A 4NQ1A 2WKJA 3DHFA 4C1KA 3TXZA 5I3IA 4D2JA 1P1XA 1Q3NA 2VELA 3STGA 4OQVA 5G5IA 1YTKA 2DZTA 3IRDA 3KRZA 2J6XA 4JTSA 4LC8A 3P81A 4R7JA 4MKNA 4EF8A 4IJBA 3W2KA 3QM3A 2E77A 5D32A 1VLWA 1KTNA 4YCPA 1NVMA 4CLMA 4HSOA 3C61A 1HO4A 4QJ1A 4MZ8A 5KZDA 3W7QA 2RFGA 4IMFA 4HNNA 3F1QA 3KHJA 2BWGA 3IGUA 3L65A 4MYAA 1RD5A 2RH9A 1I2OA 3R89A 1H60A 3RK8A 3TUUA 3VFLA 2CLLA 3BW3A 4FNSA 2VXNA 3C8FA 3W3OA 3W7GA 3H55A 1O60A 3G8EA 2G97A 1YLVA 4GUIA 4JS3A 4E2DA 1AMKA 2ISVA 3L5AA 2ZTKA 3W23A 1WXJA 4XWUA 4N9CA 2Y61A 2EF9A 2NXIA 2V5BA 4GC4A 1ZHAA 2CWNA 4M6PA 1VCVA 3GNNA 5CZTA 2V2HA 3EB2A 4TMCA 2R94A 3GXNA 2V30A 1IXOA 3P84A 5E1QA 1LBMA 3O05A 1FWSA 5AOUA 1FQ0A 3TK7A 2JKAA 1KLZA 2YYTA 3HG4A 4UTJA 2DU2A 3LI1A 4O18A 4U28A 3T40A 3UWYA 3E0IA 3G8RA 5IBXC 4Z1DA 5AN7A 1UUMA 1I2RA 4K7VA 1SPQA 1R46A 4UTWC 3BW4A 3M5ZA 4CCDA 2PURA 1FY6A 1PVNA 1TPVA 1KV5A 4HT3A 3W07A 3FEMA 3PBYA 4FNQA 4IPIA 1W37A 3W85A 5AYYA 5AHMA 2J9YA 4JICA 3DKLA 4WX2A 1KTCA 3L9CA 2GPTA 3NA8A 1EEPA 1ZFJA 3UNDA 4PEKA 4OBTA 3S5ZA 4YL2A 1YYAA 5LNVA 2BLEA 5HWMA 1RV8A 3HGOA 3TX9A 4AMAA 1TCDA 3L0NA 1S5WA 4Y6GA 1FWTA 3HPZA 1WX0A 3EX2A 1VRDA 1MXSA 3W7EA 5LNRA 3DFTA 1RQEA 3TW6A 1ZENA 1VPXA 1GOXA 3S1VA 3S1WA 2WSYA 1P0KA 1JUBA 3TQ0A 3W6YA 4O52A 4IX2A 5K3VA 1K3UA 3NXFA 2H6RA 2ZA2A 4ICNA 4QM1A 4N2YA 4LT9A 1TIMA 3W70A 1K8XA 3LCIA 3PY2A 2HMCA 3PG8A 1AW5A 4RJEA 4IPJA 3QMRA 2ZZ3A 3WK3A 1RR2A 4RXGA 1K03A 2WO5A 3RU6A 2HSAA 1HG3A 1K02A 1OFQA 3R13A 4JX4A 3PM6A 3PSVA 2DZSA 3CEUA 5G2IA 1YXCA 1NAL1 7TIMA 1GWJA 3PC0A 4DF0A 2B7NA 1W8SA 3NL3A 3CB8A 3JR2A 4OWGA 2JKEA 3NYZA 2C16A 3BLIA 3DGRA 4O1DA 1Z42A 1QNVA 1HTIA 4K6AA 3W7PA 4OT7A 3CTLA 1TMHA 2R91A 4RKAA 5DXXA 2X30A 2B7PA 3I7RA 3MBDA 3A22A 3LDVA 2J24A 5DLCA 3PBUA 3B4UA 2Q8ZA 5K7JA 4JDYA 3S8HA 1R30A 4JN6A 3ZWSA 4NXKA 1OX5A 3NQ2A 3HJZA 3B06A 4R53A 5BRBA 2ALDA 4O13A 3S5YA 3W1RA 3UWZA 1XL9A 4POCA 4DF2A 1LYXA 3M43A 3PUEA 1RQHA 1TPB1 3OEXA 1DJQA 5DCBA 5HJLA 4Q4KA 2HS6A 5HULA 3NR0A 1OHLA 2ZBTA 3LI0A 3NM3A 1GT8A 3KXQA 4K39A 3QMTA 3UY7A 2RHGA 3C56A 5FF0A 1YDNA 2ZZ6A 4DEFA 3NQVA 4XBKA 4X9SA 3R2GA 1N7KA 1TPUA 3DFNA 1KM0A 1OFEA 4J9JA 2EHHA 3SSJA 3QMSA 3LHTA 3NAVA 4A21A 3QFEA 1OX4B 1ME7A 3DI0A 3QC3A 4UTMA 4JY8A 1GVFA 2GVGA 1XUUA 2X1RA 4JDBA 2QAFA 4FEZA 1QAPA 2V0TA 3PAJA 4A3UA 1GYNA 1OK6A 2YW3A 2CZDA 4TIMA 4O0ZA 5D02A 1LRTA 3CC1A 2EKCA 5F2MA 1E51A 4HPJA 3I7SA 3O1NA 2NWRA 4KKXA 2A85A 1I45A 3G1AA 2CLOA 1SFLA 4RXFA 4TO8A 5F2IA 3UWUA 2J9ZA 2OJPA 3TXVA 3NZRA 2E6FA 3M6YA 3W7KA 3E96A 3W84A 1ZALA 4H6KA 2ZRYA 4KWVA 2A1YA 3TQKA 1MEHA 1R47A 4XTIA 3W9ZA 4UTIA 4NJHA 2YDAA 3EWBX 2GQAA 5KITA 2ZA3A 3ABOA 5D05A 3AO0A 5HUOA 1M6JA 3TA6A 2Y7EA 2YFNA 4FNTA 3LTSA 1A5BA 1J2WA 4FF7A 3DFQA 3EXTA 3JRKA 1M7PA 4GBUA 2RKXA 2ZFAA 4HSNA 3CT7A 3SECA 3TIMA 1H7XA 3STFA 3BW2A 1WYIA 4BK9A 4GE8A 5CPNA 3NQFA 1OFAA 2XN0A 2YSWA 4JX5A 4MVAA 1A5AA 3G1XA 4JX6A 1SW0A 3MI2A 4FXRA 2A7RA 3TFCA 2YX0A 4GJ1A 2V81A 2Q3OA 5HQEA 4QAIA 5F4WA 5G4EA 2VKZG 3P5ZA 2NLIA 3E9AA 3W88A 4ZVJA 1YXDA 5FESA 3QQ1A 4XQ6A 1D3HA 2C19A 3HG2A 3N19B 3HOJA 3WJXA 4ZL1A 3TROA 4TMBA 1KBIA 4PA8A 3PB0A 3FIGA 3LXBA 3SZ8A 1XDMA 1SZFA 5TIMA 3ABSA 4MFDA 4C1LA 3IIZA 1H1YA 4MOZA 5AYXA 1I2QA 3MI6A 4JR5A 5D2VA 4XBSA 1PCWA 5K4ZA 4FNUA 3EX3A 4GUFA 4LVDA 2E68A 3A23A 3EKLA 1XBVA 3LHVA 3WFAA 3O15A 3GDKA 2P1FA 2AAMA 3O6YX 1FCBA 3CLMA 1OK4A 5SWUA 5C2XA 3WJZA 1QCWA 4K37A 3MJYA 3UPBA 3TDFA 4FNPA 3B04A 4JTLA 1P5BA 1H7PA 3A24A 1WBHA 2QF7A 4UFHA 1TRDA 3TJXA 3Q2DA 4NVTA 3BG9A 3A5VA 1R2TA 3MP3A 3EX1A 3L5MA 2PCQA 1JVNA 2VOMA 3C0JA 3PBVA 3GKFA 3P67A 3T7VA 4YCOA 5EMUA 1F2JA 2B0MA 3HQ1A 1YTDA 3GK0A 3SR7A 1QMLA 2ZA1A 2I1OA 4ZQCA 2ZZ5A 4FO4A 3LBCA 2ZZ4A 5HMSA 3USBA 3W1TA 3N2XA 4I7WA 3B0UX 1W54A 4G1KA 4NXSA 3OIXA 3BO9A 3HF3A 5H2ZA 1KFEA 4IGHA 4O1CA 5CZJA 4AHOA 4OHQA 1DV7A 4Q33A 3UZ5A 2QCHA 4RX0A 2I9EA 3FJLA 4GUGA 4MIMA 2NUYA 3W1XA 4JTGA 1TTPA 1SO3A 3M44A 4LNYA 5AC8A 3LBMA 6ALDA 4E0CA 3FKRA 1GTEA 1QO2A 3NQ8A 3G1YA 2NUXA 5AHLA 1W0MA 2VFDA 2E5BA 3MO7A 5D03A 2OZ0A 2QJGA 1XBYA 4ZZ9A 3P62A 2CU0A 5CG7A 1SZNA 4WOZA 3L21A 5FEWA 3DBPA 5EYWA 3PS7A 4AHQA 1FX6A 3W7HA 1MO0A 5EL1A 1MEWA 3CU2A 1DORA 1OYBA 3LCLA 3NDOA 2QDGA 2G5WA 1F6PA 5HWJA 4LS2A 1THFD 1AL7A 4UCGA 1BKSA 2FIQA 4K8EA 4LUJA 5K2ZA 2PRHA 1OF6A 5LHEA 1CI1A 1HO1A 3G1HA 3QPZA 3FFSA 2QAPA 3O16A 3BGGA 4TU1A 4UFJA 1DOSA 4OE7A 1OG0A 1KV8A 1OFRA 4JD4A 4EF9A 2NXHA 2QEZA 4MJMA 1GYLA 1I2NA 1SU5A 4IMDA 2WV8A 4E2BA 1DJNA 4GUJA 4NX5A 2VC6A 1QFEA 3BPWA 1Z44A 1OYCA 4ZQRA 3C2OA 1EP1A 2W6RA 4KFNA 1Z48A 3QJAA 1ZNNA 2CLIA 1NEYA 2QCMA 3F4WA 3P7YA 2F84A 2F7FA 3W2JA 1XBXA 1JQVA 3QH2A 2FDSA 3MYOA 4UTTA 2XN1A 3AJXA 1F73A 1ZAHA 4PH6A 4NJIA 1FUYA 1YPFA 3C6CA 3VI2A 4DO4A 2DZPA 1JRCA 3L5LA 2NV1A 1D9EA 1LTDA 4JTHA 2VEPA 3L0KA 5U4NA 2CZFA 1JCYA 2HS8A 4Q32A 1H63A 4YLWA 4AVFA 1H51A 3LM7A 1VYSX 3TH6A 5LHFA 3JS3A 1IGSA 1UASA 4AWUA 1UB3A 2Z2UA 1KFJA 3EEGA 4UTKA 1S5TA 1GTHA 3QW4B 2G96A 2QR6A 5LGXA 1X8FA 1MZHA 4O16A 2EPHA 1IXPA 3GXTA 2X1UA 1VJIA 4JNMA 3W7JA 4XTDA 3KAOA 1K7FA 2AGKA 2Y85A 3VE9A 3P8JA 4RLIA 5HR7A 1QR7A 4S2CA 2R14A 3G0XA 2O7QA 3S9YA 5C55A 1O5KA 3FYPA 2WNZA 2ABBA 3G3DA 2C13A 1BTMA 3OVRA 4MLJA 3W7NA 2XN2A 2NXGA 1G4SA 3W7OA 1UCWA 2E6YA 5AC6A 3GKAA 3I65A 1OYAA 1X7FA 5TBOA 4HIBA 4O1BA 5I3JA 3CWNA 3GR8A 4UTLA 2QUUA 4ZMGA 3BG5A 1FWWA 1M5WA 2Z6JA 2B4GA 3NGJA 3IV3A 1G6CA 2C15A 1L6SA 4MYXA 3S1UA 2ZZ2A 4FX8A 3L66A 2QKFA 2FPYA 1TPDA 1QDSA 1SR9A 1TB3A 2YCEA 1EIXA 4O0KA 4XUGA 5CKSA 2RDUA 4O50A 5CPLA 3DENA 1HL2A 3CHVA 3IIXA 5F4XA 1SO5A 3GB6A 4LS1A 3UZJA 3W1MA 4MY1A 1TQXA 4WY0A 4CNPA 1L2UA 4X2RA 3V1PA 3I68A 1FCVA 3CPRA 1KW1A 3LHUA 5AHFA 4M19A 2ATMA 3NPVA 3TSMA 1FDJA 4NJGA 4KFPA 2OMAA 2C18A 1LROA 4BWLC 1GEQA 2D73A 3STCA 1FCQA 1LBFA 4RV8A 3T55A 2H3DA 3LCWA 3LV5A 2Y6ZA 4DPQA 3S5NA 3RLVA 5BMWA 4IXXA 2AQWA 1LM1A 3O63A 4X22A 4AF0A 4O4WA 3G1VA 3HGSA 3G1SA 5E0KA 1KM1A 3VKJA 3HGJA 4LVGA 1RZMA 1W3TA 5L9FA 4FHAA 2NZLA 4OGZA 3THQA 3OG3A 4Y90A 4H4IA 1XKYA 4TR9A 2TPSA 1SZGA 4WQ6A 3N3MA 4K38A 3MHGA 4GNJA 4FXSA 4NNBA 3T4CA 3W83A 4O15A 1A50A 3C2EA 1ADOA 3CM4A 3T44A 3TAOA 3IGXA 3W2NA 2WNNA 1ZAJA 3HPXA 4N4QA 4BI5A 2E09A 3VNDA 5U7SA 4S2BA 2YFOA 3BARA 4I7VA 1QPRA 2CFFA 4QNEA 4L4LA 1CW2A 3FLUA 3HIJA 5KINA 2ABAA 3GDMA 4UMCA 2A21A 1B9BA 3Q37A 2YR1A 2WOQA 1KM4A 4FB7A 4MJZA 4YMZA 4DELA 3O6CA 1YADA 4K7YA 2R8WA 3W1LA 4L4MA 2A6NA 4JYDA 3LXCA 3QEZA 3FKKA 4CCCA 4GXMA 3STEA 1UBSA 3EX4A 1QO5A 3VE7A 3LLDA 4UMAA 2E5CA 1GG1A 3W76A 2ZRXA 3M5YA 3TCEA 3PG9A 2VFGA 2YXGA 2NX9A 3I7QA 4IX0A 2QJHA 3TMQA 5AFDA 1OFDA 3LB0A 3SY5A 5AHIA 4ADSA 1DQXA 4I9AA 2YW4A 4JTJA 3ELFA 5K9DA 4HKPA 1VYPX 2Y63A 1X1OA 3OBKA 1F05A 3TSDA 5LSMA 1KA9F 3M5XA 3NPUA 2CZEA 2A4AA 1EX5A 1NF7A 3KFTA 4HPXA 4AB4A 2YZRA 1LOLA 4O57A 4N6EA 2B7QA 4AEOA 3G24A 1AL8A 2C14A 4QQ3A 3QZEA 2WPBA 3GDLA 1BWKA 1JCNA 3DU0A 4LY8A 4O1AA 3LGEA 5A8GA 3KX6A 1JCJA 4PCFA 1VH7A 5AB3A 1WOBA 4IQLA 3M41A 1TPEA 3N2MA 1W5PA 1GVOA 1XDLA 5FEPA 5EPDA 2VFFA 4DO6A 3FJ6A 4CCEA 4LVBA 5FF3A 2Y70A 3DKJA 1VYRA 5MHBA 3QPYA 2QCGA 4RZ4A 3TC6A 3TMLA 1Y0EA 5DN1A 1X6UA 4ZQMA 1RPXA 3EWYA 3SJ3A 3DFPA 1S3HA 3QW3A 2X1SA 3L68A 5FF4A 2H8ZA 5AC7A 2LLEA 1KM3A 1A5SA 3WJWA 3GR7A 1LORA 1WA3A 5E93A 3R12A 5FI8A 5AHNA 1YPIA 2QUTA 2ZZ7A 1SFJA 1H62A 3U6WA 5D37A 3MWAA 3IIPA 5C5YA 3DI1A 4I7UA 4HNVA 4FNRA 4TX9A 4XZ9A 1Q6LA 3UPWA 1J4EA 3UWVA 1SQ7A 3BLFA 2V82A 4N9DA 3L2IA 4NJKA 3NPWA 4U4MA 2VEMA 2FQIA 1OVDA 4A22A 1LOQA 4UFLA 2GJNA 2DJLA 3PUOA 5CSRA 1TV5A 5LZLA 3CQ0A 1IXQA 1WDWA 4UR8A 1SSDA 4EIVA 1KTBA 2Q3RA 5CPOA 3S6DA 4JGDA 2W79A 1UJPA 5KZEA 1S5VA 4IMEA 3N73A 2VENA 1AK5A 4JTUA 3LCGA 4UNLA 4PFMA 1ONRA 3W2MA 1IF2A 3MW7A 2EGZA 3PVFA 1G67A 1Q6RA 4CNOA 1EWEA 3LHYA 3ZS4A 2WSQA 3UYCA 5I3GA 3PB2A 4MUZA 4ZQPA 1F76A 5I3KA 2TRSA 2BTMA 1J5TA 4O54A 5J5DA 1W5MA 3PSWA 3CIWA 2ZCGA 1QOQA 5EA9A 5FF7A 3HPSA 4RR4A 4JEQA 4RZ6A 2C3ZA 2NV2A 4O11A 4WY0F 4LV4A 3LTYA 3DAQA 1Z41A 1PIIA 1YDOA 4WY0B 3C2VA 1LCOA 1ICPA 4ADTA 5D38A 3U8GA 3KRSA 1P4CA 5DCDA 3ZFHA 1KM6A 1PL9A 2I14A 4OV4A 4Z1AA 1BEUA 1ALDA 2W0UA 5G2WA 1DQWA 3W7RA 3NM1A 1GPWA 4MFEA 5BW6A 3RNDA 4RZ5A 4JTEA 3PR2A 2FPVA 1R2RA 3UQNA 2H90A 3MP4A 4ZQNA 4DBEA 3LCFA 2V2CA 2GVLA 5IBXA 4AF0B 2OCZA 5G2HA 1TJRA 2X2GA 4AXKA 5F4SA 4UTHA 3W72A 2A0NA 5CSSA 2JGQA 1X1ZA 2GVJA 2CW6A 1TPH1 4HHPA 3B05A 2DZXA 3GDTA 4UTWA 2V2DA 1LLWA 1VHCA 2J88A 1TRIA 3CIXA 1AW1A 5LNSA 2Z0IA 4XKYA 5CGQA 4LUIA 3HBLA 4Z0JA 4PODA 3S42A 2ZRVA 4Z1BA 4UC5A 2ZZ1A 1XCFA 1TV7A 5LNWA 1UUOA 4UFIA 3M47A 4N02A 3KRUA 1V5XA 5TQLA 1RQBA 2FFCA 3R8RA 4JTIA 1L6WA 2CLHA 1B3OA 1EPXA 1GVSA 4IMGA 1A5CA 1DHPA 3W2UA 4GUHA 2TYSA 2ZRZA 2A7NA 4N6FA 5FEXA 2P10A 3EX6A 3ZR4A 3EXSA 3P74A 3QQ0A 2QCDA 2QCFA 1O95A 3M5VA 3INPA 2ZRWA 1FWNA 2FTPA 3T78A 3UY8A 3TU9A 1NSJA 1HFBA 4NZJA 4NX0A 2YGYA 5EKYA 2IQTA 2VEIA 1PV8A 4MZ1A 4WXZA 3W73A 3NOEA 3EXRA 1YTEA 1F7BA 3M16A 1TSIA 5F1VA 2RDWA 1WQ5A 3HGRA 3SI9A 1F74A 3IVUA 3LOTA 3B03A 3CWOX 3FA5A 4WOQA 4AHPA 3DH7A 5KSWA 4FIRA 2PE4A 3TKFA 3W1UA 3NL5A 1SO4A 4UTUA 2CLMA 5DBTA 4H3DA 2BSLA 2FB3A 4ORIA 3TJLA 2EAWA 4WD0A 3G1FA 4UFMA 1ML1A 3LTPA 1K7EA 3HG3A 2Y7FA 1KM2A 3A21A 1FXPA 3W7IA 5F2LA 1GG0A 3CEPA 3LRMA 2DZUA 4S1FA 1GVRA 1AG1O 2OX1A 4PC8A 3NQMA 1T0OA 3QYQA 5C6MA 1GQNA 3W71A 1QWGA 4QISA 2V5LA 3TV8A 3TSBA 1ZJIA 2H3BA 3OVPA 2WJZA 1Q6OA 4GRSA 3ATYA 3A9IA 4NNAA 3BK0A 2FLIA 1K8YA 3SGUA 3C52A 1SSGA 3EWWA 3KVKA 5K9CA 3SFKA 3UWWA 4ML9A 2C1HA 3NQ6A 5DY3A 5EY5A 2H8XA 4WXYA 3C4UA 1GZGA 3W74A 4ADUA 1VCFA 5CZSA 1T96A 4JTFA 1Q45A 4FX7A 1VS1A 4W9TA 3TW7A 3LHWA 1JUKA 5LKYA 1OFBA 2YPIA 4JYEA 5HUPA 1ZCOA 2B7OA 2NX1A 3P8IA 1PHQA 3EWXA 2X1TA 3IIVA 4EVZA 3B0VC 2RDTA 3P80A 1G4TA 1W31A 3M9YA 4M6QA 3WK0A 3QSTA 3I6RA 3S1XA 1YDVA 1TQJA 2ISSA 2GJLA 2QUVA 4NUWA 1XXXA 2PC4A 1MSSA 2Y89A 3GNDA 3GLCA 2A6LA 2VFEA 1ZY9A 4LWWA 3TC7A 2C6QA 1I8JA 4O53A 3LHZA 3BVJA 3MYPA 3GX9A 1EWDA 2GQ9A 1N8FA 2OT1A 1VR6A 4UIOA 4HNTA 1F6KA 1FCUA 3GXPA 5DXYA 1ICSA 4IWWA 2ZQ0A 1NF0A 3KOFA 5I3HA 1W5NA 2JK2A 3ZWTA 3N14A 1KBJA 1TPFA 1EP3A 3HG5A 3LRLA 3NL6A 6TIMA 1OFOA 4DF1A 3NG3A 5GVJA 3QRHA 4Y8FA 1VLIA 1LZOA 5K4XA 1VZWA 4HN4A 1IIHA 1TREA 1WV2A 4EWND 5BMXA 1XFBA 5DCEA 1VC4A 2PRMA 4X3ZA 3W7CA 3PBWA 3HB9A 1RVGA 3G0UA 4BFAA 1LLZA 5L6UA 1WOAA 1LOSA 3WJYA 2DZWA 3BGJA 3GYEA 5T26A 3W22A 1H61A 2JBMA 4MPQA 4Z0SA 4B5NA 3BLEA 3DHDA 5DY2A 1KFCA 1SW7A 1SZEA 3O8AA 4N4PA 1JULA 2V9DA 3TAKA 5D2YA 5CPMA 8TIMA 1N55A 3P5YA 4ZQOA 3GAYA 1XM3A 3LCHA 5G1TA 1H7OA 1P0NA 5AYZA 4IXHA 1ZAIA 1IXNA 1PS9A 4N9BA 5D04C 1SW3A 4MZYA 4O12A 4Z08A 4O28A 4LC6A 3DFSA 2DORA 3DFOA 3S0CA 4LRSA 3D0CA 3VCRA 2CLKA 1C29A 1LP6A 2C0AA 2GOUA 3FS2A 1KLYA 4UTTC 3UXAA 4FIQA 2Q8LA 2E1DA 2J9XA 5A5WA 4AAJA 1OF8A 3RFAA 3DZ1A 1ME8A 2JKPA 3KVMA 2OT0A 1JJKA 4BI7A 4LV9A 5KZMA 3FYOA 1LBLA 5D2TA 3W7DA 4AWTA 1B4KA 2Y88A 4CQAA 4M6VA 4Y9AA 4LRTA 4A29A 4ALDA 5FF2A 5K9XA 1I2PA 4JTTA 3IGSA 5HWNA 3M7WA 1MEIA 1EP2A 4RCXA 1KFLA 3F03K 4XKYB 3RMJA 1JRBA 1G7UA 5F2GA 4M7SA 3EKZA 2A2IA 4Y96A 1CX9A 4K36A 3P61A 3LERA 2QCCA 4IOTA 4MY8A 3MHUA 4KWWA 3A5FA 3LXAA 3NQEA 3Q58A 2PRLA 1H5YA 4KFOA 1A53A 3OHIA 4LVAA 3O06A 2JGYA 3MUXA 1B4EA 1XBZA 1W5OA 5D30A 1H7RA 4QITA 5AHEA 4MLRA 1G7VA 3WK2A 4K8HA 3NQCA 2DP3A 1TV8A 1G69A 1TTJA 1C8VA 1LRNA 3MP5A 1GVQA 3RLUA 3G18A 2QCDB 2WNQA 1Q6QA 4LOCA 3IVSA 3W75A 3PWAA 2QCNA 4AH7A 2NX3A 3MMTA 5G4WA 2FPTA 4QNWA 3W2LA 4O14A 1W3IA 3ANYA 3N9RA 5LGZA 3V75A 3KVLA 3UXDA 4WZHA 4JY9A 1YXYA
chains in the Genus database with same CATH superfamily
1B0IA 4RE0A 3MUCA 2CZ5A 3GTIA 4NZFA 1ZSXA 4LCSA 3H54A 5LIYX 1JPHA 3REQB 1TWIA 2O56A 1FBAA 2DIJA 1EA0A 1O5XA 4Q8UA 2VZVA 3LCXA 2F6KA 3WLOA 4EPEC 4NU7A 1Z32X 2ZICA 1JF5A 2XISA 5DBUA 1JF6A 4J35A 1TG7A 2HBVA 3I10A 3OIHA 4CD5A 5LA2A 1KQZA 3BCDA 3CO8A 4OOZA 3TNOA 1PE1A 1R2SA 2Z00A 4LS0A 2R1KA 3XINA 2PWEA 1WB0A 1HJVA 2ZVIA 3T2QA 3NQAA 1F5ZA 4KH2A 1E4NA 4NAEA 2DJXA 1BGAA 3BOFA 4H1ZA 3RPMA 1TVPA 4B3KA 1X97A 2XIMA 1XLMA 2P3EA 4KCWA 3KE0A 1SMAA 4BA0A 2O55A 4JTRA 4J28A 3HO8A 4YWIA 1UZDA 1PKMA 2XIQA 4D8ZA 2BZNA 5CLWA 1ZJHA 2KZHA 3WBAA 4D6IA 1DWIM 3BMVA 2PC8A 4TVCA 1K9DA 1QPOA 5G1YA 5J8LA 3S9IA 2QF8A 4XZHA 1PAMA 1U83A 1EH9A 3MBFA 3QHNA 1U5JA 4LW7A 4R34A 1LDCA 3O3RA 2BY2A 4XG1A 3TE9A 3RM4A 3GG0A 3WQCA 2Y7DA 4FX6M 4Z1CA 3W1PA 2P8BA 1DJXA 4TTUA 4CQ9A 1TTIA 1K70A 1EJUC 4MHBA 3PHAA 2A7PA 2FJKA 1E9IA 1Z3NA 4US5D 4PL1A 1JIBA 4HTBA 3ITYA 2ZYFA 5FSDC 4AVOA 5D2XA 5HJXA 4LEQA 3WL1A 2G95A 3EWZA 5D09A 3W38A 4KWUA 3S3GA 5IM51 2XIIA 1W3LA 1JCLA 1A5LC 1VBGA 3GZ3A 2Z1SA 4ORMA 3NL2A 1TPWA 1XLJA 4ILSA 5C71A 2HTMA 1V3KA 2BXVA 4P2VA 4LSBA 3BL3A 3IIOA 1T8XA 2VR5A 5HPOA 5ABTA 4JXCA 3CK5A 1B57A 2OLHA 1EB3A 3F7JA 2CXGA 4JIPA 1OGSA 2Y62A 2A5HA 4A3RA 1F07A 1JYXA 4BR1A 1FDZA 3M0ZA 4GXWA 3U2OA 2VO5A 3A9BA 4NYUA 4BF9A 4MAVA 4XZMX 2ZX7A 1QOPA 5J04A 3H2MA 1PTGA 1R7AA 3R5EA 1EHNA 4KGJA 4DJED 2UBPC 3L0GA 4Q8MA 4AUBA 1DJGA 1Q6DA 3N6HA 4P61A 3W1QA 3M64A 4XAPA 3SCVA 1BPLB 1WBJA 1UC5A 3U2CA 5LNUA 1DVJA 1KM5A 1DWAM 2XFWA 2YXOA 3GVGA 3MCNA 4JTCA 4WDTA 4DUOA 4M24A 3WUGA 5D33A 3GAKA 2GUUA 4K1WA 4GD0A 4O19A 4R33A 5XIMA 4OBRA 4DUWA 3H2EA 1OX6A 4BWLA 1TV4A 2E6DA 4NT0A 2QCEA 1KWKA 4AWSA 2WZTA 1L6YA 3W7MA 4OOUA 1PHWA 4JIIX 2GGJA 4HOZA 3AXMA 1LUCA 5HNRA 3MI3A 4C6QA 1UR8A 2FYMA 1NFBA 2VC9A 1U1JA 2FMNA 2QDHA 4O8RA 3A4WA 5HOSA 3ME3A 2DUXA 2DZVA 3WLKX 3KBMA 3GVRA 2DY3A 2IS7A 2PA6A 4I8DA 2O4MA 5FEZA 5FJTA 4HK6A 1E6NA 4AY1A 2ZUWA 4H04A 3UERA 4AX7A 4IIFA 4C6EA 4DY1A 4D2JA 3WEMA 3STGA 2V5JA 1TWWA 2DSUA 5EFFA 4LC8A 1TE1A 4JCMA 4I9JA 4MKNA 3QM3A 2E77A 5D32A 1VLWA 4G7FA 4Z2LA 4CLMA 4HSOA 1QOXA 3V5OA 1HO4A 4DRSA 5MKGA 3WD2A 1CXFA 4L61A 4AYSA 4IG2A 1ONEA 3GD6A 5KZDA 3D3AA 3EMQA 4NF7A 4IMFA 2IPWA 1L8PA 1H60A 4D6HA 3SCNA 5A6BD 3VFLA 2VXNA 2VZTA 3C8FA 3H55A 3G8EA 1L8NA 2G97A 1E71M 4FLQA 1JAEA 3CYJA 2ZTKA 3W23A 1WXJA 3ZYZA 1XGZA 2Y61A 2EF9A 2FFIA 1HKWA 3OGSA 4M6PA 1R9XA 1XH2A 4LGXA 1EF2A 3LA4A 1J93A 4YN5A 3EB2A 4TMCA 2R94A 2V30A 1IXOA 2BXZA 7XIMA 1JXKA 4Y9OA 3VNJA 3OYZA 1FWSA 1XYFA 5DT7A 3RXZA 3HG4A 1VBJA 4BY3A 4U28A 4S3EA 3UWYA 2ASHA 4RL3A 5IBXC 1DWFM 1UUMA 1Z6KA 1SPQA 5GQBA 4JFSA 3FSUA 2XGBA 3GXFA 3LN3A 3VOGA 2REQB 2BGNE 4CCDA 3AU2A 2C8NA 3FEMA 3N25A 2WZMA 3ID7A 4JICA 2GFTA 4WX2A 1KTCA 4P7RA 1UKQA 1MW1A 5FCZA 1EEPA 4JFUA 3AMCA 4BQ3A 3ITGA 5JH1A 4PEKA 4QCEA 3VDAA 4ZTYA 4YL2A 3GVQA 1MUWA 5JU6A 2FH8A 5LNVA 1JL8A 3ABZA 2WQDA 3HPZA 1WX0A 1VRDA 3KTXA 1XYZA 4JKKA 3DFTA 1JFXA 1JNEA 4GQGA 4A35A 1UW9A 1VPXA 1JUBA 4HMEA 3OO2A 2WM1A 1K3UA 1ESWA 4QE5A 4LT9A 1TIMA 3W70A 4KGLA 2HMCA 2KX9A 1E15A 2E9LA 3PG8A 3BAYA 3QMRA 3AHXA 4QE1A 3WK3A 4W7WA 4R27A 1K03A 2WO5A 3GIQA 4Q8VA 4GJJA 3SCOA 3MSRA 4GX8A 1M3UA 3R13A 3C5QA 2PU0A 4DXXA 2DZSA 3CEUA 3RR1A 3IANA 2B7NA 3CB8A 2W66A 2C16A 5CC5A 2XSXA 3DGRA 1LJYA 1NWSA 1QNVA 4OT7A 1DJWA 3FJ4A 4DYKA 3CTLA 4WGHA 2R91A 4B90A 2X30A 2B7PA 1BSLA 2J24A 1TX0A 1H0GA 2Q8ZA 2NLYA 4BQ5A 4JDYA 1KD0A 4LH8A 2GGHA 2BHYA 4GQBA 3HJZA 4B5VA 5BRBA 4O13A 3S5YA 4B5WA 4KEMA 2NW0A 1XL9A 1FH7A 3PUEA 3BAIA 1TPB1 4GYJA 5HJLA 3UXIA 3EA3A 2AKMA 2ZX9A 3UY7A 1UH3A 4Q4SA 1YDNA 1RJQA 2V6AA 3PPCA 4DEFA 3PZNA 3CZ8A 2VGGA 3AZTA 1RLCL 3FN9A 1N7KA 1CXIA 1KM0A 1LT7A 1QHZA 2EHHA 2V63A 4X2PA 1OX4B 1KCKA 1WE5A 3QC3A 2FHBA 4X60A 1YBQA 1QAPA 1J96A 1ZB5A 4DZ5A 3CC1A 2XDFA 3GFXA 5B7YA 4HPJA 3UG4A 1MQRA 3UXKA 3WH5A 1I45A 1I60A 4QGCA 3W01A 1SFLA 5BU6A 4RXFA 4F0HA 4IQDA 4FXJA 2OJPA 4MTVA 3TXVA 4IQEA 1WKFA 2HQAA 3NZRA 4FF5A 2E6FA 3E96A 3GW0A 3VGHA 3TQKA 1MEHA 1R47A 1UJQA 2DT0A 3W9ZA 4WLCA 4U5IA 4NJHA 3MDWA 5KITA 2ZA3A 3TA6A 4L6HA 3AFBA 4ATLA 2I5GA 1G94A 1JPKA 1EJWC 1M7PA 1JZ7A 3UG3A 1ZZMA 4XZIA 2FJUB 4Q7NA 4HSNA 1U22A 3CT7A 3STFA 1UH2A 2Z29A 2QXWA 2J66A 4EANA 1DXEA 2XN0A 1G5AA 5CJMA 1WNOA 4MVAA 4XUYA 3MI2A 4G7EA 4MB3A 2V81A 2WZEA 4QAIA 5F4WA 3VKBA 2Z26A 3QQ1A 4XQ6A 1D3HA 4M81A 5T9BG 4B3ZA 3HG2A 3N19B 1FWEC 4ZR8A 4R7WA 4I6VA 4YPJA 4PA8A 4PCNA 3SZ8A 3S9ZA 1XDMA 3TC3A 4X63A 3ABSA 1H1YA 4MB5A 5D2VA 4XBSA 1V0KA 1D3CA 3WUFA 6CGTA 4LVDA 2VI0A 1AJ2A 1J8VA 1XYBA 4J3XA 4P5UA 3ZLGA 1F3TA 1FWBC 3ITXA 3MUAA 3EPNA 3IJIA 4CQCA 1V7AA 1VFTA 2JEPA 3DYPA 1H7PA 2QF7A 4UFHA 3T2PA 1TRDA 4ZB0A 4NVTA 3HFYA 5IFTA 3BG9A 1R38A 5DRCA 2BVWA 3OOQA 2PCQA 2VVNA 3ARPA 2XU2A 4GI9A 2VOMA 3C0JA 3PBVA 3P67A 5EMUA 1B2YA 4PMVA 1NWRA 3SR7A 2WLYA 3FHAA 2PSNA 2VZSA 4Q6JA 1XF0A 2ZZ4A 3USBA 2D20A 4I7WA 1EJRC 4LBSA 4G1KA 3HF3A 4E8DA 1ZS2A 3MKVA 2D0GA 3AHVA 2QJMA 4OZOA 4OHQA 1H2JA 3B97A 3S47A 1O12A 4UQAA 3TZFA 2OU4A 3IS4A 4GUGA 4MIMA 1GKQA 3GH4A 3C86A 4R5EA 4LAKA 3W1XA 2HCVA 2X7VA 3MUIA 4LNYA 1SO3A 3L4ZA 4BCEA 2QPXA 3FKRA 1QO2A 3NQ8A 2VGFA 1XD1A 1PX8A 1W0MA 2VFDA 2E5BA 4REQA 5D03A 4QLJA 3R4IA 2QJGA 1A0CA 5DMNA 4Q8OA 3JW7A 2XYLA 5CG7A 1SZNA 3L21A 3WKZA 2QJNA 1Y8BA 2ZWYA 3CBWA 4AHQA 5EMMA 3BOXA 5E70A 3W7HA 5EL1A 3CU2A 1V3IA 5I09A 5C2GA 3EZ4A 2G5WA 4H2HA 5HWJA 4J2MA 3GE7A 1BKSA 4V33A 4D1JA 1ZLPA 3AJ7A 1CI1A 3G1HA 3HV9A 4TU1A 3COTA 4UFJA 4OE7A 1KV8A 1RXOB 2RDXA 2NXHA 2QEZA 4MJMA 2G3MA 3U3HA 1SU5A 1VJZA 3OHMB 1UD6A 4E2BA 5HMEA 4GUJA 4NX5A 1TJ1A 1EP1A 4UQEA 4HHLA 1HKJA 3VD9A 2QCMA 3F4WA 5A6LA 4YTRA 3P7YA 1C8XA 4UTTA 3AJXA 1F73A 4GPNA 3VXGA 3OZOA 1AD4A 3BOLA 1YPFA 3C6CA 1V3MA 2DZPA 2YBTA 1ZL1A 4YVPA 1LTDA 5U4NA 1JCYA 3AQUA 4YLWA 1GHSA 3BE7A 3LM7A 3TH6A 2VUYA 1RCXB 1UASA 3OLGA 3PN8A 3B9AA 4CKQA 1S5TA 2J7HA 3UNTA 3QW4B 5C7HA 2OGJA 2QR6A 3FW6A 1EX1A 3IK2A 3IPWA 1MZHA 5PTDA 2V3EA 2EPHA 1HVXA 4GISA 3VD5A 2D2JA 4JNMA 3W7JA 1K7FA 1XLEA 5AYBA 5HR7A 3MUZ1 1QR7A 2R14A 4US5A 2O7QA 4IPPA 3M0YA 3M0LA 5C55A 3KL5A 4MPKA 2WNZA 4JIHA 1AQ0A 1WXYA 2WMKA 3IJ6A 3MCMA 4W8AA 4LAOA 2E6YA 3BJFA 3DHPA 4AC1X 2IPFA 1X7FA 3WBWA 4DWSB 4DZAA 4UQBA 3GR4A 1EGVA 2JEQA 5EU9A 3KP1A 4Q4PA 4W8LA 1X38A 1NDVA 1E5JA 3BG5A 2Z6JA 4LYPA 2FMOA 1Q63A 1FWDC 3CUXA 3WH8A 4A8LA 1D7KA 3L66A 1MRAA 2FPYA 4QBXA 4L4PA 4IH3A 4C6PA 1OD8A 1PIFA 4QDWA 4XUGA 4RE4A 3CHVA 3M4HA 2HJPA 3KOXA 3GU1A 1IWPA 3VMNA 3F2DA 4DJEA 5HDRA 2Y5JA 3MTWA 3I68A 3DC8A 3W6LA 6A3HA 3CPRA 3LHUA 3VPLA 3H21A 1A4LA 1OADA 2ATMA 1B1YA 1FDJA 3UVAA 5FACA 4KFPA 2OMAA 1LROA 1YRRA 2XIJA 3JU2A 1GEQA 3IJ7A 4BEUA 1OZMA 3STCA 2OZTA 3WNPA 3S5NA 5BMWA 5BU9A 1LM1A 4X22A 3N11A 4DVOA 2CITA 2GOKA 3HGSA 2FZNA 3CMFA 3HGJA 3V16A 3MANA 3AIEA 1CEOA 4J3WA 3THQA 4ZODA 5FJIA 4FK9A 1ELSA 4GQ0A 5T9CE 3LPFA 4WQ6A 1NH6A 1JG9A 4K38A 1TZZA 3WYZA 2VNCA 3VC6A 1TWSA 4ERGA 3FA3A 4XD6A 4U33A 2WNNA 4DYEA 3HPXA 4BI5A 2E09A 4ZGYA 1FWIC 3BARA 2ZXAA 4QNEA 3M0KA 3HIJA 3WLPA 5ABFA 3GDMA 3T08A 4CU6A 3Q37A 3WF1A 5JMUA 4FB7A 5DANA 4K7YA 1ZJAA 3CHEA 1Q65A 4QS5A 1KFWA 3LXCA 3PBMA 3QEZA 4CCCA 2NSOA 1UBSA 3K4AA 4BHYA 1QO5A 1OIFA 2E5CA 3W76A 4AX6A 3TCEA 3CQKA 2PTDA 1OFDA 1RUSA 5AHIA 4I9AA 3B40A 4QCFA 2YW4A 1EDTA 3ELFA 2WBGA 3GNOA 4DI8A 5A6BA 1VFOA 2AL1A 2J8FA 5LSMA 1KA9F 4GIAA 4GVFA 3BAKA 3NPUA 2A4AA 2QW5A 1F8MA 4MJ4A 1U5VA 1D7FA 3ARRA 4AEOA 3P0WA 4GFIA 4QQ3A 2WPBA 3GDLA 1BRLB 3DU0A 4AD4A 2Z24A 1Q7MA 3LGEA 1ZBWA 1HGYA 3KX6A 3UGRA 1DQUA 2NVCA 1FWGC 1TUXA 3M41A 1QT1A 2VC7A 4IJRA 3WO8A 3W24A 1KKRA 3VU2A 4FSAA 5FL1A 1SZRA 4XO6A 3FJ6A 2WMJA 1W9BM 2BHUA 1VYRA 3G6LA 3QPYA 1Q13A 2BVDA 4HPGA 3TMLA 4C91A 3F5JA 4NRRA 4ZQMA 2BDQA 1J18A 3UP8A 1YMYA 1S3HA 3QW3A 2X1SA 5LIXX 2H8ZA 1EIBA 1VBHA 1KM3A 1DIKA 5E0FA 4AVNA 6XIMA 2BOEX 1VF8A 2BY0A 1XV8A 1VP5A 1YPIA 3O7UA 1TA3A 4XK2A 4L5ZA 3SCQA 4CCZA 5D37A 3MWAA 3IIPA 2DH3A 4Y9PA 3T1GA 3MV01 5JIPA 1JD7A 1XIGA 2OXNA 1Q6LA 3KOYA 2WNWA 4PUWA 4G56A 3BLFA 1CBGA 3L2IA 4DBUA 4A3YA 3QPEA 5AYIA 4U4MA 1AQMA 4KPLA 2HISA 3PAOA 5H8PA 1FRBA 5CAKA 1FWHC 1BSIA 4DB7A 1MRQA 4CN1A 1WDWA 1SSDA 2VR4A 3S6DA 1ONWA 2ZX8A 1UD5A 1DP0A 5AECA 4JTUA 3LCGA 2HDJA 4UNLA 4DYJA 1UA7A 1IF2A 4NY2A 2EGZA 2QIWA 4PCTA 1EWEA 3MSYA 1M9HA 3UYCA 4EAMA 3SUTA 3PB2A 3TYCA 2FDMA 4S3CA 1J5TA 1W5MA 3PSWA 2ZCGA 1CGUA 4HHHA 1S1PA 5AC5A 3P6LA 1M1BA 4RZ6A 4PBFA 4LV4A 1X6NA 4IFOA 2PWDA 1PIIA 4O1FA 4WY0B 1LCOA 5IRPA 1ZTVA 4HD5A 4XIMA 1VBUA 4AD1A 2NV9A 3E5BA 1KM6A 3N04A 2I14A 4HOWA 2POZA 1E40A 1Y5WA 1BEUA 3URBA 2W0UA 3R10A 3W7RA 3AOFA 4MFEA 4MWAD 3MY9A 4JTEA 2PDXA 4ZENA 5ENLA 3ZLFA 2FPVA 1R2RA 4C6DA 2H90A 4HPHA 3VM5A 3T8LA 1K4GA 3ALGA 4H9YA 4AXKA 3OW1A 5CSSA 3CAWA 2VEGA 2VDGA 3GDTA 3KL0A 1VHCA 4FR6A 7PTDA 3CIXA 3VOJA 3FJNA 4XVEA 5CGQA 4JN7A 3GBDA 3HBLA 3DC0A 3SCPA 4PODA 4UC5A 3FX4A 1K1DA 2GGEA 4GI6A 3IJQA 3JZUA 1Y7VA 3VNKA 3B8VA 3NDYA 2WM0A 1B3OA 1J0ZA 3P2VA 1JGMA 3UCQA 1A3HA 2OVLA 2TYSA 1J6OA 3H12A 2P10A 2W61A 3EXSA 2HVOA 2OTDA 1O95A 3M5VA 3EDEA 1FWNA 1IGWA 2Y0FA 4DWSC 3ECQA 1IZKA 4AW7A 5CEWA 2OG9A 4WXZA 4MZ1A 3QN3A 4N7QA 5HMFA 4ZO7A 1WQ5A 1F74A 1DXFA 2DGAA 3SUVA 4PB5A 3DESA 4KCUA 4AHPA 3UF9A 3WD3A 1ODUA 4HK7A 5A69A 4IICA 4H6EA 1SO4A 1XQKA 2VQUA 4AZGA 2WCGA 4WD0A 3E0VA 4X9YA 4X61A 4XAFA 1KM2A 1RALA 2OSWA 4S3JA 2OX1A 4CD7A 2PDBA 5C6MA 3WLMA 4QISA 1ZJIA 4EXQA 3OVPA 2DT3A 3MU7A 3GTNA 4F9JA 5CC3A 4PBEA 3SGUA 4LQ1A 3KVKA 5K9CA 1EC7A 3UWWA 1KXHA 5DY3A 4HMCA 3RR4A 2H8XA 4LUSB 2JIEA 4E2OA 5JUVA 3FDKA 2GUBA 1Q6FA 1DXIA 2X1IA 2VURA 1HKIA 2YPIA 3PTMA 4LCQA 3PFRA 4JYEA 4EACA 3PTDA 2B7OA 2NX1A 3RPTA 1LWHA 2X1TA 3IIVA 4KETA 3S5SA 3G77A 1X96A 3WK0A 1P0EA 4S3GA 1T41A 2ISSA 4NUWA 1J10A 3HMCA 4IQJA 4GNKB 4LWWA 3TC7A 1JYWA 1YIXA 3GX9A 4ZBCA 3V18A 3W37A 4I9MA 3W81A 3JVAA 3MB9A 3SBFA 3UWEA 5DXYA 1F61A 4LB3A 3VOFA 4F4RA 1NF0A 3H4WA 5I3HA 3ZWTA 1LWIA 1EP3A 4ZOBA 3WDJA 3WY1A 2RAGA 1R5YA 2CNCA 3NL6A 3I4KA 3UESA 6TIMA 5GVJA 1VLIA 3WNMA 4FMVA 1IIHA 2GJPA 1TREA 1WV2A 3I3DA 1O66A 1CZ1A 4DUXA 3PBWA 3HB9A 3G0UA 1E55A 1A5NC 1BG4A 4NASA 3WJYA 1XKJA 4EP8C 1NIUA 3GYEA 1H61A 4S3KA 4Z0SA 3BLEA 1VEMA 3HJEA 1PX4A 3SAZA 3O8AA 1JULA 2V9DA 3TAKA 5D2YA 4F66A 1HXJA 2XINA 1N55A 3WDHA 5G1TA 2TODA 3FNDA 4M0XA 5M03A 3NZGA 3VD7A 3S2JA 1PS9A 1SW3A 4Z08A 4O28A 3P93A 3DFSA 4PMUA 2DORA 4QQUA 4UR9A 5KETA 3TYAA 2HXUA 3D0CA 3VCRA 2GOUA 1A0EA 1UIOA 3UXAA 2Q8LA 1NELA 1VJSA 3MMUA 2ESCA 4AAJA 4LJ3A 5I7GA 1RCOB 2JKPA 1J0HA 2IUZA 2OT0A 2PP1A 3TQPA 1UWQA 3FYOA 3L4XA 3RLHA 3APYA 3W7DA 1HF6A 3VNLA 4HGXA 4CQAA 3H2CA 4FALA 1Q6GA 4JFVA 4PFHA 4GZEA 1I2PA 3BWWA 3IGSA 4JTTA 1CXHA 1DHKA 3OVGA 1RJPA 1W9DM 1E6QM 3MKKA 5I07A 4M7SA 3CZJA 1PZ2A 3A5FA 1H1NA 3NQEA 1H5YA 4KFOA 4QTGA 2WMHA 4LVAA 3MUXA 3PJXA 3ITTA 3H8AA 1EHAA 4ZFMA 2HE8A 4OUEA 4QJ4B 3WK2A 4A3HA 4HZ8A 1MVYA 3BZJA 3WH6A 2J13A 2Q01A 1C8VA 4KW2A 3WCZA 5EMYA 1T7LA 2WNQA 2VZOA 4EE9A 1Q6QA 3GW3A 4LOCA 3WLNA 3B9NA 1WAWA 4AH7A 4QFUA 3ZSSA 3MMTA 1JDDA 1HL8A 1VIWA 1XYMA 1W3IA 2CKRA 2OLAA 3KWXA 1QASA 3WLIA 5LGZA 3NZPA 4GKTA 1NU5A 3PJTA 4WZHA 5CAHA 3UD6A 3AUOA 1EF3A 3LLFA 1XINA 1HUVA 1H5VA 3MPGA 2WHKA 4M7TA 3M0VA 1YX1A 5I3FA 3E12A 3GHRA 4UNKA 4NNCA 2PDFA 2ZRUA 1MW3A 4O17A 3GDRA 4JNYA 4ACZB 3R11A 2CBIA 4BI6A 2G0WA 4KCVA 2X0HA 4JYFA 5BCAA 4PL2A 3NZ1A 3OBAA 3THDA 1L9WA 4C65A 5HINA 4W93A 1W2VA 3G22A 5C9UA 1K77A 5E9AA 2E7FA 3UWQA 3FXGA 4IF2A 2GQ8A 3WENA 4KIRA 3N6JA 2PDCA 1WCGA 2ZXQA 2IKHA 1H09A 4IMCA 3NEVA 1RK5A 1P7TA 3H4GA 4YXGA 4M5PA 3RF9A 4HBKA 1QPQA 5A6MA 2XFFA 4OU1A 1AJ0A 3UCDA 4GWEA 1W17A 3LBOA 1E1EA 1KFBA 3N34A 5KTLA 3ZLHA 4GVGA 3LRKA 3TEVA 1LL4A 1OCQA 2X05A 2ZX5A 3CZKA 3LNPA 4J3UA 4WJEA 4PCPA 3II1A 3SCWA 1OG6A 3ABQA 1XIFA 1C9DA 2ZWZA 3R94A 2NVDA 1O94A 4H01A 4PTVA 1W9VA 1S2AA 3C3UA 3GIYA 1KBBA 1ME9A 3WLSA 2WKLA 3CB3A 1AVAA 3GXDA 5JVLA 1DJIA 1MFVA 4PRTA 1J11A 2PDJA 5A1AA 1TPC1 2O9RA 5BNKA 3N17A 2FKPA 3N29A 5CH9A 4GZ7A 1ADDA 5D9NA 1K8ZA 4JQ3A 3LU2A 4NZ3A 2YIHA 2Z2BA 3N2BA 3VNZA 1B3XA 2WQPA 3VDHA 1TFVA 3OZMA 4A2SA 4JIQA 2PP3A 3BSHA 3C0SA 3QOMA 3FY1A 2XJ7A 1LQAA 2YYUA 2PODA 3SIZA 3M1ZA 1I4NA 3NQ7A 4NRSA 2O7SA 3AIWA 1K4HA 4M56A 2WSRA 3D6NA 5GNZA 1H7NA 3H7UA 2TSYA 3AXIA 2VFHA 3F4NA 3TTEA 5TAOA 1EXBA 1B9ZA 3EOSA 3MMDA 2OFJA 1XLDA 1GJPA 1VBRA 3C2RA 3K46A 4GO8A 3VIOA 3H26A 4JPGA 6PTDA 3H2NA 3ABXA 3LX9A 4EOUA 3VDCA 2XH0A 1CNVA 3DECA 2PAJA 3QV6A 2R1MA 2QLYA 5CQ1A 5I00A 4DO5A 5C70A 1AW2A 4ZCWA 4DHGA 2OEMA 1OT1A 3G3MA 3THAA 1KRMA 1X6LA 4M80A 4C5ZA 3W87A 1PDYA 4KERA 4UMBA 1TO3A 1W5QA 1ITXA 4UUIA 3TQVA 2Z2AA 3VOHA 4CNNA 4K3ZA 1M65A 8RUCA 1TVNA 4H9TA 2EKGA 2ATSA 4O4VA 3ARWA 4I5UA 4ZSTA 1XC6A 1K8CA 1O5RA 4GCAA 4WIWA 3ZXWA 1M7OA 1K9FA 3BG3A 2ZTJA 3QV9A 2VEKA 2OO0A 4UR7A 3RGTA 4AZHA 1RA0A 4QXIA 1R3YA 3POCA 2E9MA 4DJFD 1EC8A 3EA1A 3T2OA 5I3IA 3FAXA 1P1XA 4F9DA 4OQVA 1MUMA 3UEQA 1YTKA 1BKHA 4FI4A 2DSVA 2P88A 3GTHA 4R7JA 3KDOA 1UZHA 1BYCA 1KTNA 4YCPA 5A8OA 3EOEA 3VOCA 3C61A 1KCXA 4QJ1A 4MZ8A 2I5QA 2DSKA 1RA5A 3W7QA 2RFGA 2D1ZA 2C91A 4K68A 3L23A 2BWGA 3CAQA 1RD5A 3R89A 1I2OA 3TUUA 4GYKA 2CLLA 3BW3A 1NFPA 2MUCA 3ZVHB 3W7GA 3W3OA 4GUIA 2ISVA 3ANVA 3PTQA 4N9CA 2OWCA 4ZXOA 2CWNA 3GNNA 1V0NA 1VEPA 5CZTA 2V2HA 4D6FA 1R3TA 3UXLA 1DWJM 3FXYA 3M0HA 2PD5A 1LBMA 4JHZA 4NAEB 4B9YA 1FQ0A 2JKAA 1KLZA 3LZ5A 3E2SA 3W26A 5HPCA 1MWOA 1J12A 2B81A 2BP1A 4O18A 1QW7A 3KCLA 1V6XA 4MWAA 4Z1DA 5RUBA 3AMLA 1I2RA 1OGGA 3F5LA 3S6OA 3ARXA 4J27A 1BVNP 3CPUA 1MW0A 2BOFX 3W07A 3PBYA 4FNQA 4IPIA 3UVIA 5BWAA 3QR0A 5AYYA 1X39A 1KNWA 2PD9A 3DKLA 3KZPA 3L9CA 1HJQA 4D6EA 1MQQA 2WBKA 3N15A 1HKVA 2BLEA 1RV8A 3HGOA 4HK5A 3L0NA 3WNOA 2MANA 4S3BA 2XWDA 1J0IA 3UETA 5A6TC 3TW9A 5LNRA 1RQEA 2MNRA 3CUJA 2BMBA 2DFAA 3TW6A 1XWYA 1DE5A 1CB7B 1P0KA 2PGFA 2PTZA 1KGXA 4O52A 3FGCB 4ICNA 1K8XA 3WQ8A 1DIEA 3LCIA 1A49A 3V1HA 1U30A 1XRTA 2J8GA 5I6SA 5BZAA 3TWBA 4IPJA 2QV4A 4PUDA 4KT2A 4U3CA 5C7VA 5HK4A 2WJFA 3RU6A 2HSAA 3NVDA 1QK2A 2DVUA 4B9ZA 1OFQA 3AIBA 3PSVA 1SVDA 4TVDA 3NJ3A 4LCRA 5G2IA 4IGNA 7TIMA 2Z1XA 1IT0A 4CD8A 2FZDA 4OWGA 4QEEA 2Y1HA 4CGTA 4DJDD 1PO9A 2VZUA 1HP5A 3AHYA 5LIUX 3ZM8A 3K1DA 1TMHA 4RKAA 4M6UA 1SJCA 3WUEA 3A22A 3PBUA 5K7JA 2HEJA 4ZE4A 4JN6A 3Q67A 3NQ2A 3B06A 4R53A 1MXGA 3W1RA 1LYXA 1RQHA 1C7TA 4HTYA 3R8GA 1D8WA 1GEHA 4L1GA 3NR0A 1OHLA 2ZBTA 4TOQA 3LPPA 2QDEA 1S3TC 1V51A 5FF0A 3D46A 3RDKA 3NQVA 3R58A 4X9SA 3WEOA 3R2GA 1TPUA 3DFNA 4PMJA 4J9JA 3CHCA 4A21A 4RDZA 4D1IA 2EPMX 4R7OA 1OD0A 1W1YA 3DEQA 2OLSA 4LUTA 1G01A 1DEDA 4B16A 1ZBCA 2QAFA 5CPTA 3UR8A 1LUCB 1OK6A 3AIQA 5M17A 2YL9A 3ZJ7A 4O0ZA 4RNFA 1C7SA 1V6VA 2EKCA 1CGXA 1F3EA 4ERIA 3I7SA 3S2NA 4ERAA 2CLOA 2XM1A 2PS2A 5BOEA 3AI0A 3UWUA 4Z42C 4LAMA 4U5KA 4E2VA 3UJRA 1QHPA 2WHMA 4KWVA 3OZPA 3L12A 5A6AA 3VK5A 1PSCA 3BXWA 3ABOA 4JHMA 5JBDA 3AO0A 1GKPA 1Q2RA 1A5BA 1J2WA 3DFQA 1T8QA 3EXTA 5MKGB 3PZGA 4DM1A 4IG2B 4FLSA 1TZ9A 1WYIA 3NQFA 1W2PA 1XIJA 5KEZA 1UPPA 2YSWA 4IIHA 1QATA 4JX5A 3TN3A 2XFYA 4FXRA 4RNHA 7ENLA 3WQFA 2E0PA 2WHLA 4GHRA 3TFCA 2YX0A 1C90A 2EG7A 3K8KA 3E2QA 5G4EA 2NLIA 3W88A 2X7WA 6REQA 1YXDA 5FESA 5E6ZA 4Z2HA 4YWSA 4B15A 4N42A 1IWBA 3WJXA 1C91A 2D24A 3IJDA 4ZL1A 4JBRA 3UBPC 4IHCA 2E9BA 2F6UA 2QGYA 1GCYA 3FIGA 2WMFA 1Q85A 1W3JA 4A3QA 1SZFA 4MFDA 4C1LA 1MXDA 3B8SA 1KGWA 1N2VA 3WSUA 5AYXA 3PZQA 1EYEA 3QHMA 5HQLA 1M7JA 1QI3A 4GUFA 3RX4A 1R3VA 1TMQA 3EKLA 1XBVA 3LHVA 4P8XA 4HZ7A 1V77A 2O9OA 5EMLA 3BZGA 8CGTA 1ZUAX 2QUNA 3GDKA 3T0CA 2EJAA 2V69A 1YW1A 3EDDA 3MQTA 1FCBA 1JI1A 2CWXA 1E9LA 3CLMA 3UCCA 3HQNA 3KZSA 5SWUA 5G4HC 4PMOA 3WJZA 4ZFCA 5M5DA 5LIKX 4K37A 3TDFA 4P7OA 5IOBA 3T07A 3A5VA 3L5MA 3M6DA 4MGGA 1JVNA 4ZO8A 2DSZA 3GKFA 5H6HA 3T7VA 4HNCA 1F2JA 2B0MA 4WDWA 4WF7A 3GK0A 2WC3A 1ISYA 1EQCA 4BZYA 4ZQCA 1F4HA 3W1TA 3GC2A 3B0UX 4NXSA 1E1FA 3BO9A 3OIXA 5H2ZA 1KFEA 3RILA 4O1CA 3ZT6A 3WN6A 4CUCA 4AHOA 5I2UA 4Q33A 1V0LA 2I9EA 2HPMA 5E09A 4X0NA 4GZIA 4QG6A 1GTEA 3PK7A 3G1YA 2NUXA 5AHLA 5A8NA 2PTWA 2I9UA 3MO7A 1YPXA 4B5TA 2F38A 2W9MA 5JQ9A 2CU0A 5FEWA 2CYGA 4KWOA 1A0DA 3PS7A 4C90A 4LNCA 1FX6A 6ENLA 3CMJA 3LZ3A 1MO0A 5M3WA 1OC6A 1GQKA 1OYBA 4K1GA 2D0HA 1NOWA 5CJ5A 1WKYA 3NDOA 3QKZA 2WMGA 3A4AA 2AGTA 4K8EA 4LUJA 5K2ZA 1GHRA 4QEHA 3E38A 2J6VA 2F9RA 5LHEA 1HO1A 3HM7A 1V4YA 3CUFA 2QAPA 3CQJA 3W25A 3BGGA 1FFQA 4JTAA 5I5RA 4JD4A 1OFRA 4J3VA 2FGLA 4ROPA 1GYLA 4IMDA 3B4YA 2J7CA 3LS9A 3U57A 4ZQRA 3C2OA 2I7GA 4HHMA 1V6WA 1A5MC 4S3DA 4C6OA 4KFNA 1Z48A 3RM9A 1ZNNA 2CLIA 3FDGA 4LFYA 2F7FA 1JQVA 3MYOA 1TWDA 3QGKC 2XN1A 4ASTA 1ZAHA 4PH6A 4NJIA 1FWFC 2ODOA 2ONEA 1TE6A 4L6OA 1JRCA 1YBQB 3L5LA 3OODA 1D9EA 3SDOA 4ES4A 4ZB2A 2VEPA 3ARZA 3L0KA 5EMJA 3SQMA 2YOCA 3TYEA 1H63A 2XVLA 5MF5A 4EKJA 4AVFA 2ZXDA 5FIPA 4MADA 5LHFA 2HVNA 4HCHA 1KFJA 1X1NA 1XLBA 3IJ9A 1UWRA 2G96A 1HJWA 4XVDA 1N8IA 3MJMA 1AH0A 3GXTA 2AMXA 2X1UA 3LM3A 1VJIA 4MG4A 2A3CA 3W27A 3CL6A 3KAOA 4QJ3B 2AGKA 3SQSA 3LMYA 1UKOA 4RLIA 3LSCA 2YCLA 4IISA 3EPMA 4S2CA 4IFRA 1SM9A 3CTTA 2Z1VA 2ABBA 1VEOA 2C13A 1BQCA 3G3DA 3QKEA 3W7NA 3S46A 3BLDA 2XN2A 2NXGA 3W7OA 4HMNA 5AC6A 3I6EA 3I65A 1OYAA 2E40A 5TBOA 4O1BA 5I3JA 5DFAA 3WFZA 1G0CA 1C8QA 2NQ5A 3MSGA 4PSPA 4WSKA 4Q4QA 1NWTA 1FP9A 1FWWA 2F2HA 4G7EB 1BVZA 2B4GA 2ISFA 3IV3A 3T0DA 2DH2A 3TVAA 4EXAA 2ZZ2A 3BGAA 1E1CB 3LEPA 2QHAA 1TB3A 1UP0A 1EIXA 4O0KA 5CKSA 3UR5A 3BLOA 4H41A 5CPLA 2Y24A 1HL2A 3DENA 3LSBA 1W91A 5F4XA 2VEFA 4W86A 2XIOA 3WBEA 1GPFA 2PDUA 4LXFA 1TQXA 4CNPA 3ZSTA 1GQIA 3AIVA 1L2UA 3VGDA 2YCIX 1XGEA 3FV9A 5A8QA 1ZU8A 2YXXA 4M19A 4F0MA 2NT1A 5ABHA 1XISA 2C18A 1XLHA 2PEVA 4F2UA 4BWLC 4XZBA 3UT0A 4RV8A 4RPPA 3QY6A 3LCWA 2DW7A 2JF7A 3VX1A 2AQWA 3O63A 4D71A 4OKDA 4AF0A 2G3JA 4G5DA 4PUKA 3G1VA 1YNPA 3G1SA 3CH9A 4CD6A 1R9ZA 1C9WA 3G5EA 3N13A 1W3TA 3UU0A 2HNEA 4JQAA 5L9FA 4LBUA 4H4IA 1XKYA 1I75A 3MZ2A 2OEKA 1W3KA 1ZCCA 1SZGA 3N4AA 5CC6A 3MHGA 4GNJA 4NNBA 4O15A 1A50A 3CM4A 4C6MA 3EDKA 1V3JA 3QLLA 3DYOA 1ZAJA 4N4QA 3VNDA 3RYSA 5U7SA 2VL4A 1F3WA 3ES8A 3LPGA 4S2BA 3NWRA 2YFOA 4I7VA 1QPRA 3E74A 4DJFA 5TD4A 1T40A 1FHUA 3AISA 3VIIA 5KINA 4UMCA 4XD4A 1EYWA 1ZRQA 2YR1A 2WOQA 3NURA 4DELA 4E4UA 3O6CA 1EOMA 5BOFA 1WKEA 4JYDA 5A95A 4GXMA 4I3GA 3UGVA 4PMDA 9CGTA 2JE8A 1PKYA 3LLDA 4REQB 1GG1A 1E9ZB 2ZRXA 3K8LA 2QJHA 3TMQA 3WDQA 1KXVA 3URQA 3SY5A 2B31A 2UZ9A 4QG9A 3CO4A 5K9DA 1XFCA 5C9WA 5GJMA 3KL3A 4PUMA 3M5XA 3CPGA 1E0WA 2CZEA 3VFCA 1PTAA 1EX5A 2Z1WA 2OYMA 4HPXA 1CLKA 1LOLA 4O57A 3LY0A 1AL8A 2C14A 3PPFA 3I3EA 3QZEA 1XX1A 4O1AA 5A8GA 1JCJA 1FHDA 2CHNA 5FAGA 4DLFA 5AB3A 3QXBA 1S2TA 2PGWA 1GOQA 4AIBA 1XDLA 3GHTA 2VFFA 3D3FA 5FF3A 1WUFA 3A6OA 5MHBA 4RZ4A 1Y0EA 3OZYA 4YTSA 4DIAA 4Z17A 5I3DA 1Q5MA 3P3BA 4B2DD 5I79A 3WQPA 5FF4A 4W89A 3OBEA 2LLEA 4M3PA 4WR3A 3GR7A 1LORA 2ACUA 4H2CA 5E93A 3W4RA 3R12A 5AHNA 3WF0A 1NY1A 2QUTA 3EEZA 1SFJA 1M53A 3U6WA 1XRFA 5C5YA 3OJGA 4I7UA 1HZYA 4TX9A 3UPWA 1J4EA 3UWVA 1SQ7A 4IMAA 2XVGA 3B9DA 2V82A 1QVBA 1EDQA 2H9AB 1HW6A 1XCXA 4NJKA 4IGSA 4BF7A 3PUGA 2EG8A 4GABA 2GJNA 3TLLA 2DJLA 5BROA 1TV5A 1C8YA 3WD1A 3KLLA 2W3ZA 4AZBA 5LZLA 1N82A 4EIVA 1KTBA 2Q3RA 5C2CA 4AZ7A 3XISA 2W79A 4B5XA 2XUCA 3JZEA 4IMEA 2VVSA 3N73A 4MKVA 4WDUA 3WEZA 1AK5A 5FJJA 3AMGA 4WKFA 4PFMA 3MW7A 1VFMA 2D2HA 2ZUUA 4MWAE 3W28A 3TN5A 1Q6RA 1K9EA 4HN8A 4KBXA 4F0SA 1PYMA 1GORA 3AYSA 4JZ5A 1UQZA 2PZNA 4JAWA 1DTNA 4C6JA 5I3KA 1TV3A 3H70A 2VYOA 4JEJA 4ZSUA 4PTXA 2BTMA 4DJDA 4GVHA 2WWDA 4QROA 3JUGA 2XH4A 4PUNA 4IJCA 4H8UA 1QOQA 4DM2A 1XHGA 1YHTA 4M8UA 3TTYA 3HPSA 4RR4A 4JEQA 4R9OA 2C3ZA 2NV2A 3VZYA 2NQHA 3C8NA 4WY0F 3LTYA 3R1ZA 4L9ZA 4JN8A 1YDOA 4WVXA 3C2VA 2EQDA 3ZT7A 4EX4A 3KRSA 2WCAA 4HPNA 3ZR5A 4UQ9A 5D9PA 4EPBC 4ZB5A 3FSTA 4Z1AA 4LYQA 4PMZA 1IT8A 3V36A 3NM1A 1GPWA 4L9XA 4M29A 4RZ5A 3RM8A 2V3FA 4US6A 4DBEA 3LCFA 3W6MA 2X8RA 2YL5A 1BTCA 1CENA 1W1IE 2E8ZA 2OCZA 1TJRA 4Q8TA 2X2GA 2OQYA 4M51A 5F4SA 3W72A 4UTHA 2A0NA 5CPQA 2JGQA 1OCBA 4FZIA 1UOKA 2C71A 2DZXA 4UTWA 4U2YA 1TRIA 2YBVA 3ONBA 4XKYA 3SCRA 3OPSA 4J7RA 1UWTA 3H7RA 3APTA 2ZZ1A 2BOGX 1LL7A 1XCFA 3ITOA 4J2PA 4GG9A 4PRRA 1R87A 5M1TA 4AMCA 2J74A 1V5XA 4Q8PA 1L6WA 1ONXA 2CLHA 5AVHA 1EPXA 4GK8A 4AFYA 1A5CA 4V15A 3TYZA 1JYVA 2A7NA 4N6FA 5FEXA 4UCFA 3P74A 3EYPA 2JALA 2BODX 3GUGA 1R0MA 4TX8A 5GPRA 3T78A 3TU9A 1SFSA 1NSJA 1DIOA 1HFBA 2WZHA 2BFGA 2PLKA 1IE7C 3W73A 3EXRA 1YTEA 1TSIA 4ZTXA 5F1VA 2RDWA 4GY0A 4MUPA 2WC7A 1RJRA 3B03A 4QR6A 1W32A 3FA5A 4WOQA 3VABA 4FIRA 2R1NA 1JI2A 4UTUA 2CLMA 5DBTA 3S2CA 4H3DA 2J75A 1F8IA 2J7GA 1I1WA 5BXTA 2EAWA 4UFMA 2ICSA 1CT5A 1K7EA 4ZOEA 4AD0A 4KESA 3HG3A 4XKMA 1XRSA 2PDYA 3U7VA 1MMFA 3S4TA 5XIAA 2GJXA 1O5QA 3APGA 3S2MA 2ZOXA 4PC8A 1T0OA 3V5FA 3WG6A 1GQNA 3M0JA 4IIGA 1PIGA 3U4FA 2H3BA 3POHA 2WJZA 3A9IA 1OIMA 1K8YA 3SADA 3C52A 1CGWA 3EWWA 3R0DA 3SFKA 4PMRA 1A5KC 3K5XA 3B8TA 1T5AA 4DN1A 3VUSA 3C4UA 1C3FA 1GZGA 3W74A 4ADUA 3WMSA 2PDKA 5DO8A 1NM9A 1Q45A 4W87A 4W9TA 2QJJA 2W63A 1TA3B 5HUPA 1ZCOA 4FP1A 2YCJA 4A8RA 3EWXA 1BVWA 1XP3A 2VX4A 4EVZA 3B0VC 2RDTA 4KWSA 3P80A 4G1NA 3M9YA 2DQWA 4M6QA 1YDVA 4HU3A 2PC4A 1MSSA 1XSKA 2I5IA 2VFEA 2YBUA 2GWNA 1I8JA 3BVJA 2GQ9A 5LXXA 1N8FA 3SRDA 4MB1A 1VR6A 1FCUA 3E2VA 1E43A 2W27A 3GXPA 2J47A 2ZQ0A 1QTWA 4DAFA 1E0VA 2QPSA 3CHDA 2JK2A 1KBJA 4GA8A 3B8WA 4Q7BA 2BY1A 2GUYA 3QRHA 2QT3A 4RE2A 1LZOA 2ZDSA 1GVIA 4C7FA 2Y5SA 3IK4A 1XFBA 3GXIA 2DVXA 5DCEA 2PRMA 3UJFA 1RVGA 1M01A 4HZMA 1LLZA 2YA0A 4AZCA 2OYLA 5L6UA 1V3HA 4GY7A 1J0JA 2I57A 2G3FA 3GO2A 4YTUA 2FTYA 5T26A 1ECQA 5E9XA 4IL2A 2I17A 5DQPA 4WK9A 2YB1A 1KFCA 4HNLA 2G4JA 2V68A 2FZMA 3G1RA 3P5YA 3WH7A 4ZQOA 1XG3A 1XM3A 3LCHA 4J1OA 1P0NA 4L56A 5AYZA 1B3VA 3SURA 3N2OA 5CZKA 1JGIA 3SCSA 1ZAIA 1IXNA 5C9RA 4N9BA 4KQNA 5D04C 4D9PA 4S39A 5CLTA 1Y5XA 4U3AA 3DFOA 3FA4A 1RH9A 3S0CA 4LRSA 2FHCA 1C29A 1KLYA 2HVMA 4UTTC 1V6YA 4FIQA 2E1DA 2J9XA 4HYWA 5A5WA 3LGDA 1OF8A 1UP3A 3RFAA 1POJA 1PBGA 3KVMA 1JJKA 2VMFA 3WQ6A 3HPFA 3AMDA 1LBLA 2Y88A 3QY7A 4QE4A 3V0SA 3NSNA 3UR7A 2QZRA 5IHSA 1MEIA 3L4UA 1KFLA 1G7UA 3C0QA 5ECUA 1CX9A 2WVVA 1KRAC 2QCCA 1JNDA 3DFHA 4IOTA 3VIMA 4KWWA 2PRLA 1B5TA 4XB3A 2OYKA 3VOIA 4Q7IA 2AMGA 2JGYA 1B4EA 1XBZA 5D30A 2NQJA 1H7RA 4D6CA 4CU8A 3A12A 4K8HA 2DP3A 1S2CA 4NKCA 1G69A 3IWPA 2TAAA 3ITLA 1HJSA 2WJDA 4AWEA 3G18A 1OC5A 1M03A 3IVSA 5G4WA 1S2WA 4QNWA 3W2LA 1TV2A 1PTDA 3V75A 4JFTA 1YXYA 5GJNA 2ZUVA 1X98A 3N18A 1GW9A 2G8ZA 2QGHA 1IEXA 1XG4A 3ICJA 1XYCA 2PBGA 4QRNA 3VCNA 2WLZA 3B8DA 4K2SA 3BDKA 4G9PA 4JQ2A 1AODA 3FCPA 3PWIA 1WKDA 1ZP4A 2BG5A 4DJEC 2CBJA 1DBTA 4IUOA 3HPAA 2UY3A 3WLHA 4GQRA 4Z2GA 4QHRA 2CHRA 1UZ4A 3W86A 2PWFA 4A8NA 4S3AA 1OFPA 3SFWA 2GVEA 2BBFA 2YZ5A 3TFXA 3PZOA 2Y8VA 3B0XA 2E5DA 1K7XA 1XPGA 2P8CA 4HU0A 4KEVA 3WLTA 4N9EA 4HYRA 4QIUA 1VFUA 3OVQA 5KMYA 1RY8A 2Z1BA 3VO0A 1LQ0A 3V4BA 1IZJA 1KFKA 4OUIA 1VAHA 1DKWA 4PZVA 4A4AA 1FWRA 1BXCA 4DXVA 1H50A 1LG2A 3PUDA 1B3ZA 3DBNA 2D0FA 4JTKA 4IGMA 3QF0A 2IKIA 2PDNA 1EUAA 1MUCA 2NWSA 2ISWA 2YA2A 3G0SA 5BRPA 2J27A 1QNSA 4F79A 1GOMA 3NQDA 4OIFA 3NQGA 4L6DA 4S3FA 4OV9A 4XBJA 4D72A 3SW6A 1PKLA 3N3TA 1CGVA 4MY9A 3WNNA 4YVXA 3U0HA 3FHQA 3K30A 2YL8A 4GYPC 4W8BA 4E3VA 1QI0A 5F1UA 1RP9A 4NJJA 3AYRA 4C7DA 8A3HA 4ATWA 1RD6A 4NZ4A 1XLIA 1JUEA 4C6IA 1EL3A 3EB3A 7CGTA 3QR3A 3SGZA 2E6AA 3W1NA 1BYBA 1TTQA 1W3NA 4PTNA 3H2FA 3S83A 1MNZA 1WAUA 1RBLA 1R7OA 1AQHA 4L7ZA 4A2RA 4A05A 3RG6A 2YKKA 1OEPA 3NDZA 3H2OA 2C7FA 3RU8X 3WNLA 1TX2A 1GJUA 4P7NA 5H91A 1IEWA 4OVXA 3N9SA 4F0RA 4AYGA 2IPJA 3W1AA 1E4IA 2VOTA 3GIPA 1QWKA 1H1ZA 4GIRA 3QTGA 1GK8A 1E9YB 5BXSA 3CWHA 3ABRA 4DBSA 1W6TA 3CL8A 1IIGA 1EZ2A 3E02A 3WQVA 3QSRA 3PULA 1LT8A 1GVYA 3QZ6A 3CAKA 4HNOA 1HJUA 4HCDA 4GH1A 2FVLA 1O4UA 4Y7EA 3WK1A 1RPKA 2C79A 3WJSA 1TYGA 2CIPA 4YYFA 3CZEA 1BGGA 3GFYA 2BX7A 4Y8EA 1V7YA 3UG5A 1TR9A 2CLFA 4B2DA 2CLEA 1H7WA 3B0PA 1T99A 2ZDRA 2HWGA 4WCJA 5I06A 3S5OA 2X2YA 5I03A 3ZO9A 3CS2A 3NPXA 1YNYA 3O07A 1CWYA 2QYGA 4OECA 3P60A 3IVTA 5EBUA 4AD5A 3M7SA 3GY1A 3GS6A 4RK8A 5CZ0A 3E49A 3HFTA 3OLDA 1ICQA 5CPSA 2NUWA 4O10A 4ROQA 4Q22A 4MF4A 3VA8A 2PZ0A 1EZWA 3WQDA 3HMJG 2BXYA 3LV6A 3DX5A 3BJTA 4NQ1A 2R82A 3TA9A 1TR1A 2WKJA 3DHFA 3KBSA 4C1KA 2BGQA 3OU8A 2NQLA 1Q7QA 3AWNA 1SJAA 4PBGA 5G5IA 4OBSA 3KRZA 2J6XA 3QLDA 4EF8A 4IJBA 1XYLA 3R8HA 1CCWB 3UYIA 4AY8A 1NOFA 2E28A 3BAJA 1OWQA 1XIIA 3KBNA 3VILA 3ZMRA 3DCPA 3F1QA 2INZA 3KHJA 3IGUA 2RH9A 5IDZA 4RNJA 3NQBA 3AMKA 1HVQA 1MDLA 4W5ZA 2E1WA 3CUIA 1O60A 1YLVA 4JS3A 2DVTA 4W7VA 4E2DA 1AMKA 3L5AA 3ZZ1A 4GYFA 3P14A 2V5BA 2PB1A 4GC4A 1NWUA 2YDRA 1ZHAA 1VCVA 3B8UA 5HXMA 3GXNA 3WELA 3P84A 5E1QA 1FWAC 3R43A 3O05A 5AOUA 1E6RA 3KOZA 3EDFA 3TK7A 3DOPA 3BLPX 2YYTA 3AWOA 2QVNA 1P7TB 4UQCA 3CAVA 4LYRA 1R8LA 2W62A 5AN7A 1AZ1A 2JF6A 3L4WA 3H22A 1FTXA 4K7VA 3URNA 4B92A 1REQA 3VAVA 1TPVA 2DIKA 2WAGA 2PDLA 3W85A 2J9YA 2OPJA 4DZIA 4CNSA 2GPTA 2WC4A 4L4OA 1GQLA 3AIUA 1YYAA 2PDWA 4A8IA 1ITQA 1P0DA 4Y6GA 3MS8A 1FWTA 1EO5A 3EX2A 1MXSA 4GI8A 3W7EA 2Y8KA 3EKGA 1BYAA 3H6OA 1ZENA 1PJ9A 2XGIA 3PPGA 3WBYA 3H24A 3S1WA 2WSYA 1QRQA 3TQ0A 3W6YA 2R24A 1JDCA 3NXFA 2H6RA 4N2YA 3F2CA 3KDNA 3GTXA 3HN3A 1AW5A 1Z7AA 4RJEA 3TP4A 2OEJA 3BJSA 4RXGA 3C2YA 1XCWA 3RAOA 1K02A 3VIHA 1C93A 2VX5A 5A2BA 4NP7A 3PM6A 3QC0A 1NDYA 1DJYA 1MDRA 3ONCA 1NAL1 2Q71A 3PC0A 4DF0A 1QK0A 1W8SA 3NL3A 4QLLA 3BLIA 4O1DA 4IFKA 3AALA 1HTIA 3PTKA 4UZUA 5DXXA 1OT2A 4GYPA 1AQFA 2FVKA 3ITCA 3I7RA 3DN5A 1V6UA 3B4UA 2Q02A 3WBXA 3B0YA 3ZWSA 4NXKA 3EMZA 4XIAA 1QNQA 1L6FA 2PDPA 1EGMA 4PR4A 2PGRA 1CPUA 3H7VA 1CXLA 2VDHA 4J3ZA 3OEXA 4Q4KA 1FH9A 3AHTA 2WXDM 2XH2A 5KZ6A 3LI0A 3NM3A 3QMTA 4V27A 2F2KA 5T91A 3C56A 1JD9A 2GSJA 4ZOCA 4KRUA 2ZZ6A 1FHLA 1DIDA 3WMLA 4XBKA 3AXXA 3HZ3A 2Z1KA 2X40A 1O7AA 3WLJA 1ME7A 3DI0A 3B9OA 4MNLA 1JZ5A 1GVFA 1XUUA 2X1RA 2J4GA 4JDBA 4FEZA 2RGMA 2NQZA 3PAJA 4A3UA 2OGYA 2YW3A 3GDBA 4QP0A 7A3HA 4TIMA 3T0AA 4AZ6A 5D02A 5F2MA 1O1ZA 2NWRA 2A85A 2QUMA 3G1AA 5REQA 2OQHA 5F2IA 1ITUA 3A4XA 3BMWA 3ZVHA 3SUSA 3W84A 4AG0A 1ZALA 4H6KA 1OZQA 2ZRYA 2VJXA 4XTIA 4UTIA 3T6CA 3EWBX 5HA7A 2GQAA 5IXEA 4XV0A 5HUOA 1M6JA 2Y7EA 4FNTA 4FF7A 3A4JA 2ZVRA 3JRKA 2ACRA 1OM0A 4GBUA 1LG1A 4E8CA 2ZFAA 5DF0A 3TIMA 4GE8A 3WH9A 4NZCA 3A64A 1OFAA 2E25A 1KO0A 1AZ2A 4LYKA 1S2VA 1V6TA 3EB4A 3G1XA 4JX6A 2R6OA 4GQQA 1HJXA 3GTFA 2BV9A 5FJUA 2VRJA 1WZKA 3URAA 1Q4WA 2VRKA 1JZ2A 3VKKA 2Q3OA 3GRIA 3E0LA 3ARSA 4ZVJA 2QMKA 4HA3A 3HOJA 3TROA 1R86A 4H9ZA 1SFTA 1KBIA 5LYRA 2NVAA 3PB0A 1K6WA 3IIZA 1VFSA 1I2QA 3VMOA 4MWAB 4KS0A 2HXTA 3BLLA 1PCWA 6TAAA 5K4ZA 2O9PA 4FNUA 3EX3A 3U7BA 1I9CB 3EWCA 3WFAA 2PDMA 5IDIA 3EMCA 2XZ7A 3FGCA 2P1FA 3LPOA 1NQ6A 2HRWA 5C2XA 5FAJA 1QCWA 4W5UA 3A47A 3UPBA 4FNPA 1MI3A 2ZC1A 4JTLA 4F2TA 3A24A 4FOJA 3Q2DA 2DDXA 1R2TA 3AZSA 3EX1A 3U4AA 1US0A 2WYSA 2JQXA 3VIKA 3RO6A 4BS0A 3HQ1A 1B90A 3UG8A 3OG2A 1YTDA 3MSDA 1QMLA 1UH4A 2ZA1A 3LBCA 5HMSA 5CC7A 3N2XA 5A6KA 4H6RA 1W54A 4QAWA 1EXPA 1UKPA 4IGHA 3ENLA 2VT0A 1HL9A 4WJXA 2YJQA 4RX0A 3UZZA 2NUYA 1FFRA 2OWXA 3M44A 3LBMA 3WQGA 5FJRA 1UQYA 2CBVA 1OCJA 2WMIB 1GONA 2OZ3A 2VQTA 5BWFA 1NDZA 3KRBA 1WO2A 2QV5A 1HQTA 1XBYA 3P62A 2EXOA 3SGGA 4WOZA 4ZEPA 1UR2A 5CGTA 3B9EA 3DBPA 5EYWA 1GUVA 1MEWA 3U9IA 4GINA