1TV8A

Structure of moaa in complex with s-adenosylmethionine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
327
Chain Sequence
b'EQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum cofactor biosynthesis protein A
publication title Crystal structure of the S-adenosylmethionine-dependent enzyme MoaA and its implications for molybdenum cofactor deficiency in humans.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligand binding protein
total genus 112
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.1.99.22: GTP 3',8-cyclase.
pdb deposition date 2004-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tv8A00
3HPXA 4RJEA 4IPIA 3MYOA 3VE7A 1LDCA 3FA5A 2WPBA 2CLEA 4A2RA 4ZL1A 1JRBA 2YXGA 1TTPA 5I3HA 2Z0IA 1K03A 1VCFA 4EF8A 2HMCA 1F73A 4WOQA 3TK7A 4A2SA 3RU6A 1DQWA 1KM2A 1P0NA 2PCQA 2VEPA 1EWEA 1N8FA 4HT3A 3TX9A 3CIWA 1N7KA 2FB3A 2G96A 1ONRA 2DJLA 3G1YA 3L68A 1F74A 4LV4A 1OFDA 4DF1A 3CT7A 4NZFA 3QM3A 3W88A 5G2IA 5AN7A 3LLFA 4Q32A 2BX7A 2P10A 1L6WA 1FCQA 5E93A 2X1TA 3P8IA 5K9XA 4LVGA 2DZPA 1O4UA 5BMXA 2WSYA 4UTTC 1RD5A 4TIMA 3M5YA 1ZFJA 4UMCA 4FXSA 4PL2A 4O17A 3LCLA 5I3KA 3DFQA 4QITA 4LRSA 3W7QA 2V2DA 2VEKA 1YADA 2O7QA 3OVRA 2EPHA 2XN1A 4HN4A 5KZMA 3GX9A 1Z48A 3RLVA 3PS7A 1LTDA 4DEFA 1G4PA 3WJZA 4FO4A 5C2XA 1SO4A 1Q45A 1TB3A 1H1YA 2H3DA 3L2IA 1LCOA 3P5YA 1OFPA 4NUWA 3HPSA 2B7QA 3S1XA 2NXIA 4MKNA 1H7NA 3S42A 5TQLA 4O1AA 4Y90A 5FF7A 3S5YA 4QJ1A 2ZRYA 3R12A 2V8ZA 5C5YA 4Y8FA 3GDMA 2Q8LA 1O5KA 3RF9A 3FFSA 1ZALA 4JXCA 3E9AA 4UTJA 4RCXA 3IIVA 3DI1A 3FLUA 3SZ8A 2A4AA 2Z2UA 2E6AA 2WSQA 4JY8A 4E0CA 2QCEA 3L0NA 4JX6A 2VENA 3TW6A 1ME7A 1GZGA 3W1QA 5D2TA 1VPXA 1VRDA 1D3HA 3ATZA 3M1ZA 2ZRZA 2OT1A 2CLHA 2ISVA 4O16A 1ZHAA 5LHEA 3GKFA 4OU1A 3N9RA 1TPEA 3DFOA 4RZ5A 4ADTA 5AYXA 1TO3A 1ICPA 3G8RA 4O18A 3EWWA 1SO5A 2X1SA 4UMBA 1BWLA 3EEGA 1W0MA 1LRTA 4P2VA 3EXTA 3QSRA 4O0ZA 3G1SA 2QCNA 4Q4KA 5DY2A 1V5XA 5H91A 3PVFA 1MZHA 4M6PA 2VELA 2ZA1A 1M6JA 1QFEA 5AHMA 4PTNA 1R47A 3LHTA 4GC4A 4JTHA 4BFAA 1KFKA 1Y0EA 2VFEA 4YCPA 1UUMA 3KVKA 2YYUA 3PB2A 3TKFA 2WV8A 4A29A 3EWUA 4A3UA 1X8FA 3W7MA 1F5ZA 1T99A 2TPSA 2Y88A 4AHPA 3W2JA 3DZ1A 2YCEA 3LV6A 5AYYA 1H1ZA 1EB3A 2VFHA 2RDWA 4HPXA 4LRTA 2QDHA 3RNDA 1O5XA 1Z41A 4HPJA 3W7LA 5E0KA 2R91A 2JKAA 2OMAA 3HQ1A 1UCWA 3NPUA 4RR4A 3NVTA 4LUIA 3A23A 4XWUA 4GWEA 2ISWA 1O95A 5DCEA 3IIXA 2B4GA 1S5TA 2AGKA 4YXGA 1EUNA 3L66A 1HFBA 3KRZA 2V81A 3LBCA 5KITA 3SR7A 1MEIA 3BW2A 3A24A 2H8ZA 4AHOA 3L0KA 4H3DA 1T8XA 4NJIA 3GKAA 5D03A 3FOKA 1UBSA 2TYSA 3I6RA 1A5CA 1WXJA 4XTDA 4S1FA 5CG7A 3OHIA 3GVGA 4KWVA 5G4EA 1TRDA 4G1KA 2ZQ0A 4FIRA 3W7RA 4S2BA 1F2JA 2J9YA 3OBKA 2AAMA 3W2MA 5TIMA 5HWNA 4OV4A 5A5WA 4PCFA 4O0KA 3N19B 3BARA 4GE8A 2RDUA 1AK5A 1RQHA 3QH2A 4GUIA 3LOTA 3DH7A 5C6MA 2YYTA 2QUUA 4O10A 1XC4A 2YX0A 2ZRUA 1R2SA 5FESA 3IV3A 3JR2A 4HIBA 4N4PA 3I65A 3NPWA 3LCFA 4UR8A 2YR1A 1JR1A 2JKEA 3B05A 5HWJA 5K4XA 5EL1A 4PODA 3W71A 4O4WA 3S1VA 3TSDA 5D2WA 3W07A 1UJPA 4RZ4A 1TPVA 3F4WA 5DLCA 3QJAA 1FCUA 1SZNA 3FKKA 3NL2A 2CWNA 3DFNA 1JUBA 1NEYA 2EKCA 3MP5A 3O6YX 3W23A 3KAOA 4O8RA 4QNEA 1TSIA 3BO9A 1TPFA 5F2MA 2DZSA 2DZUA 2OJPA 4ZQCA 1G69A 2QAPA 3PULA 1DL3A 1R2TA 4HNTA 2C19A 2OT0A 3DHDA 2QJIA 4FXRA 5FF2A 1JCLA 1KA9F 1YDNA 2LLEA 1VR6A 4DO4A 1TREA 3I7QA 4UTWA 1GG0A 4MJZA 2C1HA 4NVTA 4AXKA 4O50A 4HHPA 3TC6A 1BTMA 2H90A 1X1OA 4E2DA 5KZDA 4FX6M 3W7OA 4IMEA 3UWVA 1OX5A 1KV8A 1XBYA 1XBVA 3W75A 3UQNA 3N3MA 2ATMA 3MJYA 3DU0A 3M7WA 4RX0A 4GNJA 4D2JA 3IVTA 5G1YA 1AW1A 1MSSA 3T44A 3TQ0A 3E96A 3G1HA 1T96A 1XUZA 4C1LA 3P60A 4O57A 1E51A 1KM3A 1OHLA 1Z44A 2E09A 4JIPA 4QQ3A 4JTLA 1KTNA 3GLCA 1QOQA 2NV1A 2ZA2A 4UR7A 3WJYA 2RKXA 3NEVA 3LXAA 4KFPA 2JK2A 1B9BA 3NQ7A 2EAWA 2VOMA 2C13A 5DBUA 1WA3A 4ICNA 1F6KA 2PRMA 2FPVA 1DVJA 3KOFA 4PEKA 1TPB1 3W2KA 1JUKA 3R8RA 3W7KA 1FWTA 1DJQA 1OFAA 2FPTA 3E0IA 1X6UA 2RH9A 3LHZA 1W37A 3W76A 4GBUA 5FI8A 4N9DA 2FIQA 4FEZA 4WX2A 3BV4A 1FDJA 1TPUA 3NQMA 4NNBA 3A5FA 3LHUA 1JQXA 1LROA 3MO7A 1X1ZA 2BWGA 1JCXA 4JEQA 5BOOA 1I8JA 2A6LA 2JGQA 3U6WA 1QNVA 4IGHA 4ZQOA 3PBVA 2VEMA 3M44A 4FNUA 4TO8A 3QQ1A 4W9TA 3NQEA 2CW6A 1B4EA 5ABTA 3W1RA 1DKWA 2J6XA 1IIGA 5D2VA 5MHBA 1VYSX 1ICSA 2ZBTA 3S9YA 2A21A 1KM4A 3PG8A 4XUGA 1XM3A 3UZ5A 5FF4A 3NQVA 3THQA 4KWWA 3KRUA 1ALDA 4DPPA 1FCBA 1ME8A 3M9YA 3V75A 3BPWA 2HS6A 3P67A 4GUHA 2DJXA 1KM0A 4U28A 2WNNA 3EWYA 3W1NA 4XKYA 3TC7A 1DBTA 1OVDA 5EY5A 3A9IA 2QCHA 3MMTA 2A85A 1O60A 3T40A 1DHPA 2JGYA 2I1OA 1IF2A 1CI1A 4Z1AA 5KMYA 5AYZA 3QMRA 2B7OA 2YFNA 3ZWSA 3LRLA 2FJKA 2W79A 3QQ0A 1YDOA 3WJSA 4LVBA 5IM51 4GUGA 1LOQA 3NQ6A 1K7EA 4IMCA 1PV8A 1KTBA 3F1QA 1J4EA 3TR2A 4UTUA 3SSJA 3W1AA 1PVNA 3N2MA 2G5WA 4NX5A 2FDSA 3C52A 1K7XA 3G1FA 4EOUA 3TXZA 3IGSA 3STCA 4Y9AA 1TMHA 1XXXA 3EKZA 3M47A 4IJBA 1RVGA 3UPBA 3B0UX 3P8JA 3HMJG 3W84A 1DOSA 1OFQA 1H7PA 1I45A 1H50A 2PURA 3HO8A 3OVQA 5CPNA 1MO0A 1H63A 4CCEA 5LGXA 4K7VA 1X7FA 1FXPA 2WJZA 2YW4A 2F7FA 4OE7A 1FBAA 4RK8A 4CNPA 3NZRA 4TR9A 2Y6ZA 4JTGA 3TJXA 5CSRA 3Q94A 5F2IA 4AWTA 1GEQA 2XN2A 3O6CA 4KKXA 3GYEA 2PE4A 5CZSA 1PCWA 1VGAA 3S1WA 2ZTKA 4EIVA 3VKJA 3UWQA 1YYAA 3CTLA 2DP3A 1NSJA 4IMGA 4NJGA 5DELA 3TSBA 4ADUA 1A50A 1IIHA 4PL1A 1SW7A 2QR6A 1S3HA 3NNTA 4ZQMA 4JNMA 4YWIA 3TQKA 2ZCGA 3LCIA 3INPA 3UY7A 4FF7A 4RV8A 2YGYA 1W3NA 3O07A 1GVFA 2NWRA 3FJLA 2A7NA 3LCHA 2ABAA 3S1UA 4Z1CA 4Y6GA 3M43A 1Q3NA 5AHLA 2RDTA 3IIPA 1KW1A 1K02A 3O6DA 4IPJA 1QCWA 4O13A 5AHIA 5L6UA 1QMLA 4YLWA 1UASA 4R33A 5DY3A 2YPIA 5D32A 3WFAA 3W70A 1JVNA 1ZAIA 2R8WA 5HNRA 5G1TA 3S5NA 4ADSA 1GVQA 2ZRVA 3G22A 4BI6A 3NAVA 1QWGA 4DBEA 5HUPA 2VFFA 1JJKA 5U7SA 1I2PA 4UTMA 2GVGA 2ABBA 3NQFA 3QMSA 4JX5A 4AAJA 5L9FA 2H3BA 3W1MA 2WQPA 4XTIA 2QCFA 2VFGA 2Q8ZA 1K8XA 2D73A 1CX9A 2CLMA 2VC6A 4B5NA 3DKJA 1LM1A 3WK3A 3UYCA 1GTHA 2FB2A 4IX0A 3JRKA 1TYGA 3SW6A 1TQJA 5LNUA 4JTEA 2ZZ2A 2CLKA 3G0UA 5F4WA 1F05A 3QYQA 1KFCA 1KFBA 2CZDA 4R53A 3R2GA 1SSDA 4FNPA 6TIMA 1F76A 2Y89A 3QEZA 1FUYA 3MI2A 3M6YA 3SI9A 3PB0A 3EX1A 1WDWA 1EX5A 1GVOA 3MP3A 1KFEA 3L65A 5HMSA 4YMZA 2NLIA 3C3NA 4JN6A 4CCDA 1LBLA 4WY0F 2GQAA 1XDLA 1I2RA 2X1RA 2G97A 3W1PA 3U2OA 1W3TA 5DCDA 1W8SA 3H54A 3IIOA 1W5OA 3H55A 3GDLA 3W83A 1PHWA 4Q33A 5A8GA 3PAJA 5DXYA 5CZ0A 3HF3A 3EX6A 2YZRA 3S0CA 4HNNA 1SQ7A 4ML9A 5AC6A 4BWLA 5BW6A 1YTKA 3CWNA 3UD6A 1VLIA 4LS1A 4OGZA 5G2HA 4UUIA 2NUWA 4FX7A 4Y96A 4NZJA 2VKZG 3PF3A 4JX4A 2ZZ3A 2QCGA 3GNNA 2H8XA 2YSWA 3TMQA 3M5ZA 3SIZA 1B3OA 1OABA 2NUXA 3TXVA 2O7SA 2NX9A 2NUYA 4WZHA 2FFCA 3MWAA 2CFFA 1WYIA 5CZJA 2RFGA 5CZTA 1JULA 2WNZA 3TQVA 2P0OA 2CLOA 1OX4A 2DZWA 1AW2A 3P61A 5AOUA 2Y70A 2CU0A 3GXPA 4RXFA 2Z1BA 5E1QA 2QJHA 1R46A 1XFBA 3C0JA 5CPLA 3EWZA 3BLIA 4NT0A 1PCKA 5HR6A 5HR7A 5K9DA 4MVAA 4LC8A 4DO6A 4MLJA 5BNKA 3C61A 3PSWA 1KM5A 3WK1A 3GAKA 3R89A 3W7GA 1VQTA 5AHEA 1FDZA 2NX3A 3TNOA 3HIJA 1A5BA 4IWWA 1Z42A 4UNKA 4MUZA 2E6FA 1GWJA 3DXIA 3NPXA 5D05A 1TV8A 3VFLA 4RKAA 1HO4A 3ABQA 2GJLA 3TA6A 4AEOA 3O16A 4FNQA 4FIQA 4AHQA 1KLYA 2YDAA 1JUEA 5D38A 4IX2A 3B03A 3LM7A 1FWSA 5FEXA 1EPXA 4H4IA 4WY0A 3W73A 3HG3A 1OFBA 3LHYA 2VFDA 4FHAA 4AWUA 2YW3A 3R5EA 3UWWA 3TAOA 2XN0A 1AL7A 2CLLA 2Z6JA 1JCYA 3PY2A 1QR7A 1H7WA 2BXVA 2V5BA 4DF2A 3P82A 4X9SA 1K8YA 2V0TA 3TW7A 3W7NA 3E49A 1KM6A 1ZAJA 2C18A 1KFJA 3PBYA 3ZWTA 1D9EA 1RR2A 4K37A 4GXMA 4LVDA 1OFOA 3LB0A 4JTSA 4M6QA 4EVZA 3C56A 3CIXA 3NG3A 3QRHA 2FQIA 1EP2A 4Z0SA 1LRQA 1KTCA 1FDYA 1TQXA 2V30A 4MOZA 3DHFA 3UWZA 1M7OA 3P80A 3BGJA 4CLMA 3LGEA 3E02A 2E6DA 1VCVA 3ABOA 4FNSA 3Q2DA 3IVSA 2E68A 4M7TA 5K2ZA 1I2OA 3GDRA 4LVAA 3V1PA 2QEZA 4LWWA 1KBIA 3HG4A 3C2EA 3D0CA 3BVJA 3G3DA 4Z08A 1W5NA 2GQ9A 4JTTA 1GQNA 5DN1A 1PHQA 3MYPA 2WKJA 4KFNA 3PR2A 1K7FA 2X2GA 3QW4B 4NJHA 3G1DA 4K38A 3HOJA 1WOAA 3LBMA 2ZYFA 1TPC1 2VXNA 4O1BA 1M7PA 4IQLA 2BTMA 3G0XA 5SWUA 4UTIA 3W7IA 3T7VA 4U4MA 3YPIA 3IIZA 5EPDA 1JRCA 2Q3RA 3F03K 4FB7A 1F7BA 2GUUA 3PBUA 3NQCA 3W7JA 4AF0A 3LXBA 4IXXA 1QO2A 3NL5A 5CPMA 2A1YA 3PUEA 1KM1A 1VC4A 1CW2A 4MLRA 1UUOA 1WV2A 1SZEA 4OT7A 5KSWA 4Z0JA 5AB3A 5BMWA 2WO5A 3W7PA 4UCGA 4UFIA 3L67A 2FPYA 4CQ9A 3NYZA 4LS0A 1VYRA 2EHHA 4N9EA 3LTPA 4M6VA 3C6CA 3VI2A 1XL9A 1TPH1 2GJNA 4JTFA 1IXOA 3GDKA 3TE9A 2C0AA 5CPOA 2Y85A 4POCA 3GB6A 4I9AA 3HB9A 4RLIA 3C8FA 1GG1A 1EP3A 1HL2A 2YFOA 3FKRA 3TROA 3TV8A 3LERA 5FEWA 3MHFA 3ABRA 1T0OA 3G0SA 3C2OA 4DF0A 2DU2A 4ZQRA 1AG1O 4N02A 5D37A 3W7DA 3M41A 3TJLA 1SSGA 3CU2A 4HSOA 3WK2A 3S5ZA 2Y7EA 1TPDA 3DFSA 4WQ6A 4QM1A 1VYPX 2AQWA 4X22A 3G1AA 1TV5A 2PC4A 3UWYA 1QO5A 2E1DA 3LI1A 4XQ6A 5F1UA 4I7WA 3B0PA 3I68A 5HINA 1YPIA 2ALDA 5DXXA 4UTWC 4CQ8A 4UFHA 1U83A 1JCNA 4BI7A 1JCMP 3OA3A 2EGZA 3FEMA 3ZR4A 3W3OA 5C55A 3KVLA 4GUFA 1Q6RA 4HNVA 3EB2A 1VHCA 2Y7FA 3NPVA 4BK9A 3DI0A 1AL8A 1J2WA 3PBWA 5FEZA 3OVPA 2QKFA 1SFJA 3N9SA 3NOEA 3PC0A 3PUOA 4DXVA 3LTYA 4JDYA 3W87A 2Y61A 5AHNA 1DORA 1G4TA 2ZZ1A 1YXDA 1FX6A 1RQBA 1H61A 3W7CA 2B7NA 5HUOA 3W86A 3MHUA 3UY8A 4O53A 5LKYA 4JTKA 5IBXA 1FWNA 4PC8A 1K8ZA 3HG2A 3G18A 3W22A 2CLFA 4K39A 3N34A 4O14A 3DFPA 3DENA 5F4XA 4MIMA 3T4CA 1U5JA 3MW7A 4WXZA 4NXSA 1DJNA 2A6NA 4HKPA 1LP6A 2QAFA 2Y62A 1IXNA 4MZ1A 3VNDA 3BG9A 1SR9A 2CLIA 5AC7A 3E12A 1N55A 4GRSA 4UIOA 1YTEA 3CM4A 4UXDA 3W2LA 2DORA 2CZ5A 4O19A 4UNLA 3IGXA 3MBDA 1LBMA 5U4NA 3UNDA 1ZENA 1FQ0A 4K8EA 5LGZA 2PRHA 1XUUA 1QPQA 4NX0A 2WNQA 5F2GA 2PRLA 3LRKA 3KHJA 3IGUA 3G8EA 1DQXA 4NJKA 3PUDA 2ISSA 2A2IA 1FWRA 2ZRWA 4E38A 1DV7A 1LLZA 5KTLA 4UFMA 3NXFA 3EXSA 1QPNA 3LX9A 3ZS4A 4L4LA 3DKLA 3I7SA 4NNCA 1MEWA 2Y7DA 1XBXA 1G67A 1SZFA 5D09A 4LVFA 4O11A 3FJ6A 3RK8A 3CEUA 3EX3A 4YCOA 1EIXA 2W6RA 4DELA 4RXGA 1B57A 3RLUA 5EMUA 3LCGA 3NDOA 2OX1A 2E5DA 5EA9A 1W56A 1GTEA 3OIXA 4A21A 4UTTA 1G7VA 4K36A 3C2FA 2TSYA 1OX4B 1XBZA 4N9BA 4QNWA 4AH7A 1KFLA 2W0UA 3O06A 3KRSA 1PIIA 2HTMA 4JYDA 1Q6OA 1PS9A 4JDBA 2QCDA 1HUVA 5D30A 3AO0A 3M0ZA 4MY8A 2QDGA 5AFDA 5F4SA 3BW3A 4GJ1A 4ZQPA 1W5QA 4PH6A 4C1KA 3W9ZA 4NQ1A 4UFJA 2ZRXA 3NZ1A 2J9XA 3PM6A 4I7VA 4LU0A 3CEPA 1GVRA 4Z1DA 4O28A 4OBTA 1XI3A 4DBDA 4FNRA 2UV8G 3BG3A 1TIMA 1JCJA 8TIMA 1OFRA 1XCFA 1ML1A 3O15A 3TSMA 3U8GA 5LNSA 4MY1A 1G6CA 4ZVJA 2ZTJA 3GR8A 3NL3A 2R14A 4O15A 4X2RA 2A5HA 1SO6A 1C9DA 2OZ0A 2IQTA 1YLVA 2B7PA 3HBLA 3NO5A 2G95A 6ALDA 1GYLA 4CNNA 4WY0B 4MZ8A 2V2CA 1OJXA 1TTJA 1ZY9A 4IXHA 1EP1A 4WOZA 4TMCA 4NJJA 5LNRA 3DBPA 3W2UA 2QCCA 1LOLA 2KZHA 3W1TA 2A0NA 3LXCA 3R13A 3EWXA 1MEHA 4WXYA 1I2NA 2P1FA 2NWSA 2Q3OA 3W6YA 1RV8A 4AB4A 4S2CA 2QUTA 3GNDA 3B0VC 3LI0A 4LTSA 3K30A 3KXQA 3LV5A 3HPZA 1UB3A 2ZZ7A 3KVMA 5G4WA 1VH7A 4MPQA 3T78A 4ZMGA 5KINA 3IRDA 1WQ5A 3TH6A 3GAYA 3W1XA 3G1VA 1GT8A 4HSNA 1VLWA 4DPQA 3L21A 3B04A 4JYFA 1QPRA 5I3IA 2WSRA 3C2RA 4UTKA 1G4EA 1Q6LA 4N9CA 1GPWA 3QMTA 5CGQA 1WAUA 4JTUA 3B8DA 3Q37A 2NZLA 5I3GA 4HNUA 2CZFA 3QPZA 4I7UA 3L5MA 5I3JA 1VCGA 1D3GA 4LOCA 4LT9A 1HG3A 1EWDA 2DZTA 5F1VA 1SZGA 4IOTA 3TIMA 1OK4A 1FY6A 3ELFA 5D33A 1AMKA 1W5PA 3EKLA 3LCWA 4JYEA 1RQEA 3BLFA 1VHNA 4JICA 4ORIA 2TRSA 1I4NA 4AF0B 3CWOX 2FTPA 3EX2A 3LDVA 1ADOA 4EWND 3S6DA 5I3FA 1PE1A 3P81A 3STGA 3NM1A 2QJGA 3NGJA 1THFD 3ANYA 4CNOA 2A7PA 3B06A 3A22A 3KFTA 3W7HA 5K4ZA 4UC5A 2GVJA 1NFBA 1F6PA 3QSTA 1ZCOA 3O1NA 4UFLA 3OEXA 4JIQA 1L6YA 1A5SA 2ZFAA 3SGUA 1P1XA 1H60A 3VE9A 3MUXA 1OX6A 1A5AA 4DO5A 1ZAHA 4JTIA 4ONVA 2QUVA 1H7RA 4LUJA 2HSAA 2C15A 2E6YA 2TMDA 3LTSA 2ZA3A 2ATSA 1QAPA 4BWLC 3SECA 4QAIA 5K9CA 3Q58A 3FIGA 4MYXA 1OYAA 3WJXA 1W31A 4DQWA 1RPXA 2QCMA 3N14A 2B0MA 4ALDA 2C14A 3WJWA 1A53A 3NA8A 3NL6A 3MI3A 1GJPA 1W54A 3VCRA 3OG3A 1EEPA 1KV5A 1EUAA 1SW0A 3UZJA 1ICQA 2OCZA 4FNTA 4XBSA 4MY9A 3G24A 5G2WA 5HQEA 4EF9A 4N6FA 3W7EA 3ZFHA 3EWBX 3HJZA 1IXQA 5T26A 4RZ6A 2A7RA 3W85A 3FS2A 4M19A 2HS8A 2Y7GA 3IVUA 1YXYA 2E5BA 3ATYA 2VEIA 1JQVA 2V5LA 4YL2A 1TJRA 3W1LA 3UWUA 1TRIA 2ZDRA 3HGSA 4O12A 1IXPA 1C29A 4K6AA 4TMBA 1H7OA 1J5TA 5DBTA 5LZLA 7TIMA 3T55A 3LRMA 4JGDA 4BF9A 1TPWA 2FLIA 4IMDA 1LLWA 5AC8A 4QIUA 3O8AA 4PA8A 4MFDA 4ZZ9A 3DFTA 1FCVA 2NXGA 3IEBA 3QC3A 4LV9A 4XKYB 3DGRA 4AVFA 1LYXA 3QW3A 1KLZA 1H7XA 1R2RA 3HGRA 3THAA 5LNWA 1WBJA 1OFEA 2GQ8A 3P7YA 3TAKA 2VFIA 4N2YA 1AW5A 2BLEA 3AJXA 3GZ3A 4N6EA 3CC1A 3QF0A 1YTDA 3BW4A 1XDMA 2JBMA 1OG0A 3NQDA 4AWSA 1VZWA 4LS2A 1OF6A 5AHFA 3GXTA 4OWGA 4FX8A 5DCBA 1O94A 3SGZA 3W2NA 5LHFA 2J9ZA 4CCCA 3FYPA 3PSVA 1TTIA 3G1XA 4KFOA 5D04C 4CQAA 2DZXA 3GDTA 4H6KA 4E2BA 3QPYA 4JR5A 3TFCA 4OV9A 4UMAA 1XKYA 3FYOA 5D02A 5EKYA 3UXAA 3L0GA 2Y63A 1LOSA 2J27A 1TTQA 1K3UA 3EX4A 5FF3A 1ZJIA 4UFKA 3DAQA 5G5IA 2C3ZA 4M7SA 1M5WA 4LC6A 5KZEA 2DZVA 1LZOA 1BKSA 1NAL1 3EXRA 2X16A 1HO1A 2JKPA 3F4NA 3P74A 3S8HA 3B4UA 3C4UA 3KVJA 3MHGA 3STEA 3RMJA 1WOBA 3BGGA 4JTJA 1WX0A 3STFA 4PFMA 2NXHA 1OYBA 4J9JA 3SY5A 1GYNA 2E77A 4R7JA 4N4QA 3BK0A 1SUXA 1VS1A 1GOXA 2J24A 3NR0A 1G7UA 4BR1A 3USBA 3LHVA 1Q6QA 3KX6A 3GIYA 1S5VA 4GUJA 2QCDB 1SO3A 2BSLA 3M5XA 4TU1A 5CSSA 5HWMA 3A21A 3CHVA 1FXQA 3M5VA 4UTHA 1OF8A 4NNAA 1W3IA 1S5WA 4O54A 1QPOA 1WBHA 4L4MA 3TU9A 2QCLA 4GFSA 5LNVA 3QZEA 4O52A 2QF7A 1H5YA 1V7YA 4X3ZA 4NU7A 2I14A 3WK0A 3HGOA 3GXNA 1QOPA 4XZ9A 3CQ0A 5BRBA 1L2UA 5LSMA 4LNYA 1BEUA 3NM3A 1OYCA 1SPQA 1KBJA 3GK0A 1BWKA 2X30A 5J5DA 4JS3A 4K7YA 3TFXA 2J88A 2XFWA 4WUIA 3TDFA 3W74A 5CKSA 1FWWA 2ZZ4A 4IUOA 1NF0A 1LRNA 1SFLA 3LLDA 4LW7A 1YXCA 1G4SA 1R30A 3HGJA 1TJPA 4AMAA 4WD0A 3PWAA 1B4KA 3I7RA 5HJLA 1P4CA 3N2XA 1LORA 1QDSA 5D2XA 1NVMA 3L9CA 1RZMA 1TCDA 2V82A 2V2HA 3PG9A 1OK6A 2I9EA 3W1UA 1IGSA 1W5MA 1I2QA 3QFEA 4M5PA 4NXKA 5K7JA 4A22A 2C16A 2Z6IA 3BLEA 3L5AA 5TBOA 5J5RA 3P5ZA 4WJEA 4LY8A 3O63A 3CB8A 3MI6A 2GPTA 2EF9A 3GR7A 5H2ZA 1VJIA 4Z1BA 1EA0A 3P62A 1MXSA 4IMFA 3JS3A 1SW3A 4TX9A 3LCXA 3MBFA 2GOUA 2F84A 2H6RA 1C8VA 3O05A 3G3MA 3CLMA 5K3VA 1YDVA 2X1UA 4OHQA 1SU5A 4OQVA 2CZEA 1L9WA 3NQ2A 3C2VA 4MJMA 4XBKA 2BZNA 2R94A 4P61A 4ZQNA 2NV2A 4ORMA 5D2YA 3NQGA 5FF0A 1W1ZA 2WOQA 5GVJA 1NF7A 1ME9A 2V9DA 2ZZ6A 3S5OA 3P84A 3NQAA 3ABSA 2C6QA 3L5LA 2ZZ5A 3TMLA 5EYWA 3A5VA 4QSHA 4O1DA 5C54A 4MFEA 1GVSA 3HG5A 5IBXC 1HTIA 1ZNNA 3UXDA 3CPRA 3N73A 4MYAA 3TCEA 4O1CA 1PL9A 4MZYA 4O4VA 3RFAA 1P5BA 1LBFA 4JY9A 5FEPA 3SFKA 1P0KA 5HULA 3TUUA 2NX1A 3SJ3A 1H51A 1H62A 1L6SA 4R34A 5F2LA 1YPFA 3UPWA 1TV7A 4BI5A 2RHGA 3H53A 5EBUA 3M16A 3LHWA 3W72A 4JD4A 3MP4A 4UTLA 3BG5A 2E5CA 3NQ8A 2GVLA 4K8HA 4QISA
chains in the Genus database with same CATH superfamily
3RAOA 3VE7A 5FJRA 5RUBA 2CLEA 4ZL1A 4OOZA 1TTPA 1UZ4A 2Z0IA 2HMCA 4YS1A 1X39A 1LT7A 2PCQA 1N8FA 4HT3A 1CXKA 2DJLA 3RCYA 4E3VA 3G1YA 4EX4A 1CENA 2QJMA 5I07A 3CT7A 4NZFA 1MZRA 2BX7A 2P10A 5E93A 5K9XA 2R6OA 3AOFA 4JHMA 3HN3A 4JTQA 2WSYA 4XAYA 1RD5A 3VGDA 3EWDA 4TIMA 3M5YA 2JF6A 4O17A 2NQJA 3LCLA 4JBRA 1KKOA 4NYUA 4QITA 2VEKA 2DV0A 3TVAA 1CB7B 1FKXA 1N8IA 3FVMA 3A64A 2EPHA 5KZMA 3BAXA 2AGTA 1W3LA 4FO4A 2YA0A 5C2XA 1VEOA 1SO4A 2UBPC 1H1YA 4AD4A 1XLJA 1TMQA 1W1YA 1JFXA 1LCOA 1FRBA 4NUWA 3HPSA 4KW2A 4LXFA 4MB3A 1H7NA 1TG7A 1AQMA 3DGBA 5TQLA 2BDQA 4XZIA 3HA1A 1V3KA 5BRQA 1EC9A 4J3WA 3R12A 4Y8FA 1L6GA 3RF9A 2DT0A 1M03A 3ZJ7A 1EGVA 4R7WA 4UTJA 1XX1A 2EBNA 2PI6A 4RCXA 3BJFA 3NQBA 2E6AA 2FH6A 3MVIA 2WJEA 3WLMA 4IGSA 3TW6A 1UP0A 4A6GA 2H9AB 1D3HA 2OFJA 1FHDA 2NSOA 1VFFA 2ISVA 5LHEA 1E0UA 1Q6DA 5ABFB 2CPUA 3N9RA 4OU1A 2EJAA 3RCMA 1RBLA 2ZICA 1X6NA 1XGEA 3EWWA 4PTWA 5J8LA 1ZUAX 1VFOA 2O92A 4NY2A 4Q4KA 1FWCC 2POTA 1MZHA 1O1HA 2XM2A 1TVNA 1QUMA 1QFEA 4EPDC 4GOAA 5H8PA 4Y9PA 1OC7A 4JTHA 4MGGA 3A4AA 4LBUA 1R3WA 4JFVA 3SSZA 5A1AA 1XH2A 3EWUA 2CBUA 1X8FA 4RUBA 1UR2A 1F5ZA 1CNVA 4S3FA 2Y88A 2CWXA 3LV6A 2HBVA 4S3JA 2AQOA 2QHAA 3TN6A 1SR0A 3NXLA 1EB3A 4QE5A 3RM9A 3RNDA 3LD5A 4HPJA 3EMCA 5E0KA 4GMEA 4MWAD 2D24A 4QE1A 4AC7C 3A23A 3ZLHA 3L4TA 4M80A 2A3BA 2B4GA 4S3AA 3FSUA 2PLKA 5KITA 4B92A 1T8XA 2XTKA 4ERGA 5JMUA 3I4KA 4S23A 2JEQA 4MB1A 1E6XM 1PWMA 2WVVA 3EDKA 1TRDA 4G1KA 4FIRA 5A6SA 3VD3A 1POJA 4S2BA 3BZGA 6XIMA 4KEMA 3W2MA 5HWNA 5A5WA 2INEA 5LIYX 4GE8A 2RDUA 2CYGA 1RQHA 4GUIA 1F4AA 2R24A 3DH7A 2NT1A 3M07A 3OB8A 4KESA 2YYTA 2QUUA 1XC4A 3GIQA 2YX0A 4HTYA 5FESA 1S2WA 5MF5A 4HIBA 4N4PA 4HZMA 3I65A 3ARUA 3OQEA 4L1WA 3GH4A 3NEHA 2VC5A 3QKZA 2KX9A 1Q85A 4REQB 3S1VA 5D2WA 4M1RA 4AIOA 1UJPA 4KWOA 3BCDA 4MWAB 3UR7A 1SZNA 3FKKA 3WH9A 5FAGA 3VZXA 1B90A 4MKVA 2WNWA 2ZXBA 4ZO6A 4U31A 2OJPA 4S38A 3FJ4A 3FA4A 2OU4A 2QJIA 4FR1A 4EPKA 5DT7A 1I9CB 3QTGA 4O50A 1PWLA 3T0CA 2PDCA 3LA4A 2H90A 4E2DA 1TZ9A 2PDLA 1VAHA 3BQ6A 2OZTA 3CQHA 4QQUA 2YOCA 4PCTA 1XBYA 1XBVA 3SN0A 3WNLA 4NRRA 2DY3A 2JE8A 5GQBA 2QLYA 4GNJA 4D2JA 4HN8A 3G1HA 4DWSB 4YIWA 3VGFA 2VWTA 3N6JA 4JIEA 7ENLA 2OSYA 1KM3A 3AIUA 2PTZA 3TOYA 4JTLA 4QXIA 3UA4A 4UR7A 4KFPA 2Y2WA 1BF2A 1XCXA 3NQ7A 1RJQA 4D6EA 4F0SA 1J01A 2Z25A 4ICNA 2ZUNA 4DBSA 2PRMA 2FPVA 3FAWA 1JUKA 3W7KA 3QHMA 1W1PA 4CNSA 2BGQA 2WC7A 1OZMA 3E0IA 4ZCWA 2CXEA 2HISA 1W3HA 1W37A 3W76A 3OBEA 2XFRA 1QI4A 4N9DA 1BF6A 3O6AA 1FDJA 1TPUA 3V0TA 3A5FA 1F8MA 1G1YA 2A3EA 2CBJA 1XQKA 1LROA 3RLHA 1X1ZA 2WW5A 4E4PA 1J18A 2PLCA 1G94A 4JEQA 3GHTA 2JGQA 1R85A 3U6WA 2VEMA 4JFWA 3N2TA 4TO8A 4W9TA 3NQEA 3ME3A 1DKWA 2J6XA 5HMEA 4XUGA 3UZ5A 3NQVA 4KWWA 5CC3A 2ON3A 3W26A 3M9YA 5HPCA 4GUHA 4Q8PA 4U28A 1ZJBA 2Q6ZA 1EJSC 4XKYA 2BOGX 4GY0A 1B2YA 2QGHA 4PCNA 2ZC8A 3CV1A 4L4OA 3T40A 3UG4A 1DHPA 2DSWA 4B5VA 5AYZA 5FA5A 2B7OA 2R9RA 3ZWSA 3LRLA 2FJKA 4M1BA 4XSMA 4LVBA 5IM51 3FNDA 4PMVA 2WZMA 4XZHA 4IMCA 4LCRA 1KTBA 3WD1A 4HJFA 3W1AA 1PVNA 2FDSA 3H4GA 3G1FA 3KOYA 3RR1A 1AFSA 4YHEA 3PZTA 4TVUA 1TMHA 1LQ2A 3EKZA 2QT3A 3HTWA 3W53A 2WMJA 2W9MA 1XGZA 3P8JA 1FWDC 3TWAA 4PMRA 2QVNA 3ARTA 3H2MA 5CPNA 3T0BA 1G5AA 1H63A 4K7VA 1FXPA 1M41A 2I5QA 4FALA 2BHZA 3N2CA 4CNPA 4J27A 3WLHA 1UR4A 2PU0A 4PMJA 2WJFA 5F2IA 2D3NA 3EPMA 3S1WA 2ZTKA 4EIVA 2WPGA 3VKJA 4GI6A 3GTHA 2HCVA 2DP3A 2WAGA 3B8IA 4IMGA 2FVMA 4NKCA 1IIHA 4PL1A 4JNMA 2HK1A 2ZCGA 5C2GA 3LCIA 3E2SA 3INPA 4FF7A 4RV8A 4C6MA 3O07A 2A7NA 2J13A 2ABAA 3R4IA 4QDWA 5CZKA 3PZNA 1Q3NA 5AHLA 3SUVA 3IIPA 4Q8QA 3ES7A 5AHIA 3ITCA 1C92A 1QMLA 3RO8A 3WKZA 4IIHA 1UASA 4R33A 2PAJA 4TTUA 1JVNA 4Z2GA 3VUPA 4U2YA 3I4EA 5CAHA 1YE6A 3TTOA 3LNMA 5FKYA 2R8WA 4C6DA 2J8TA 1GVQA 2ZRVA 3NAVA 1JJKA 3Q67A 3N04A 2ABBA 1A0EA 3QMSA 4JX5A 4AAJA 3NO1A 1OEPA 3LSCA 3EDFA 2H3BA 3W1MA 4LPCA 3P0XA 2WVVB 1S2CA 1TZ7A 2D73A 1JIBA 4MNMA 3DKJA 4FOJA 3B40A 2CEQA 3BE7A 3OG2A 4IX0A 4NYYA 2GGIA 2P88A 5LNUA 3PZQA 3M0KA 5A2BA 5GJNA 1KFBA 3VOGA 2PTDA 3R2GA 3WUGA 6TIMA 2Y89A 3QEZA 1YIXA 3VMNA 3EX1A 1WDWA 1YPXA 1A5NC 3MO4A 2NLIA 3DFHA 2GQAA 1XDLA 1EO5A 2DUAA 2ZUTA 4B3ZA 3AHZA 4EPBC 1E1CA 1TX0A 3AHTA 1XPYA 2WMGA 3RILA 5LIXX 4JIRA 4L1XA 3PAJA 2VNCA 5DXYA 3KRBA 4YHGA 1J0YA 2UWFA 3T0DA 5AC6A 3LBOA 3B8TA 5BW6A 3AXHA 3WF0A 3CWNA 3QXBA 3UD6A 4XO7A 1VLIA 1XYLA 4OGZA 2OXNA 2PDYA 4HZ8A 4HOZA 2NUWA 1R3YA 5JXQA 1JDCA 2EQDA 2O56A 3GVWA 2VEGA 1RPKA 2VT0A 1RHCA 3TMQA 4KEZA 3LS9A 1B3OA 3SIZA 3VIIA 3BGAA 3OZYA 4PUJA 3WUFA 2JIWA 2ACUA 3MWAA 1EYEA 2CFFA 1R6WA 1GGOA 1WYIA 4RNIA 5CZJA 4ZOCA 3CJPA 3N25A 4L4PA 4MDOA 5CJNA 5CZTA 3BANA 2P0OA 2CLOA 1OX4A 4LF1A 1FWGC 1GHRA 5T9BG 3P61A 3QY7A 1Q7MA 4H9VA 2CU0A 2F2KA 5E1QA 1U5VA 1XFBA 5CPLA 2NQZA 4JQ3A 4UOJA 1HF6A 5K9DA 1ODUA 4LC8A 4TXEA 4QX4A 4AXNA 4MLJA 3H2OA 4X63A 3BOXA 3WK1A 3SCWA 3R89A 3W7GA 1GOIA 1UKOA 4PSPA 1UD5A 2NX3A 3KTSA 3HIJA 1A5BA 3UT0A 3SBFA 1Z42A 3NPXA 2ISDA 1TV8A 1BHGA 4RKAA 1HO4A 3TA6A 3S6TA 3U4FA 1JUEA 5D38A 5EFDA 4IX2A 5EMLA 1PSCA 1FWSA 3OZPA 3U7VA 4X61A 3K1DA 3LHYA 4WIWA 1F07A 4HSHA 3R5EA 3TAOA 2W4XA 2CLLA 1JCYA 2FFIA 4W7VA 3H4XA 4X9SA 3TW7A 1KM6A 3WL0A 3PBYA 3P14A 1D9EA 1PTGA 1AH0A 4L80A 2YDQA 4LVDA 1WO2A 4M6QA 3C56A 3C0SA 2QF8A 1LRQA 1KTCA 2WHLA 1DWGM 2PB1A 3UWZA 3PUGA 4JZ5A 4WGHA 3UJ2A 4S3KA 1OGSA 3P80A 4CLMA 2PC8A 3KP1A 1E6RA 1VCVA 5KETA 4G2DA 1Q7QA 1E4NA 4M7TA 3THCA 2FHBA 1I2OA 5IDIA 5K2ZA 3GDRA 1EQPA 4J4KA 3PTKA 4LVAA 3KOXA 3WEMA 3V4BA 3BVJA 4Z08A 3HJEA 1PHQA 3MYPA 4JIHA 4KFNA 1K7FA 4PMOA 2PDXA 1WZLA 1MW2A 4K38A 3HOJA 2QS8A 1Q6CA 1ZL1A 3VKKA 1XH1A 1XIGA 4L9YA 3K8LA 4U4MA 3BTNA 3YPIA 2NQ9A 4AD0A 3ABXA 3GW0A 2VGFA 2XVNA 4AF0A 2Z1VA 3LXBA 1B0IA 2OTDA 3NL5A 1HKWA 4MLRA 3S1GA 2WSPA 2FH8A 4PMYA 3U4AA 4UQBA 4OT7A 5KSWA 4Z0JA 3IJQA 2EG7A 6TAAA 5BMWA 4LS0A 1QTWA 2EHHA 4N9EA 3VMPA 4M6VA 1TPH1 1UR8A 1WDSA 3WQGA 4GQQA 5IHRA 1IXOA 1Z7AA 4POCA 4I9AA 1UPMB 2XYLA 2PWDA 3MCNA 2P8CA 4DUOA 3LERA 2J7DA 4PTMA 3E0WA 4IUGA 3C2OA 3RDKA 4N02A 5I24A 5B7YA 2VVSA 3DFSA 1JDAA 3QOMA 3G1AA 1JZ7A 4F3HA 3UWYA 4GINA 4DJDC 1UP3A 4DJFC 1U1UA 1YPIA 3PAOA 4UTWC 2HE5A 4UFHA 3HQNA 1W17A 1JCNA 1BGAA 4ZR8A 4DUVA 3V5FA 3KVLA 3WH6A 4AY1A 1PKLA 2BY2A 3AIQA 2ADAA 3R0KA 4MB5A 1VHCA 3NOEA 1EBHA 4QEHA 3DG3A 1CBGA 3WDIA 1WZMA 1YXDA 1RQBA 1H61A 2B7NA 3APGA 4INFA 4WDUA 3W86A 4HOWA 3UY8A 3VOCA 5LKYA 3MTWA 3VGHA 4NL1A 4B5TA 3HG2A 2CLFA 4K39A 4Y9MA 1UMLA 4FAMA 3VTRA 3DFPA 3N12A 3DENA 1LT8A 4H9ZA 1JDDA 2YJQA 3WX7A 1IXNA 4WDWA 1CWYA 1XLMA 3TN4A 1N55A 4UIOA 1YTEA 2PLMA 4UNLA 5B7ZA 1LBMA 5AKQA 3VILA 1V08A 3UNDA 3T2OA 3KWXA 3WD2A 3IJ6A 1FQ0A 4K8EA 3CHFA 1S1PA 4NX0A 1Q63A 2V3FA 2WNQA 2PRLA 1YKWA 3CL6A 4W85A 4P5UA 3AFBA 3G8EA 1DQXA 3BXWA 4NJKA 3QLDA 2HQAA 3PZMA 1V0LA 4GISA 2EXOA 4LBSA 5KTLA 3SJNA 1KCZA 3IS4A 1DXFA 4UFMA 3EAUA 1OWQA 3LX9A 2PP3A 3ZS4A 3SCOA 3I6EA 4NNCA 3FV9A 3GC5A 1XBXA 5D09A 4GNKB 1VIZA 1AH3A 4ZXLA 3TJIA 4DELA 1R9YA 2HROA 3NDOA 1PIGA 3OIXA 4UTTA 4F2UA 2NVDA 3L4ZA 3ITLA 2OGYA 3VC6A 1W3JA 1OY0A 2TSYA 1E4LA 1OX4B 5TD4A 4WLCA 1RUSA 3JVAA 5HOSA 3STPA 5D30A 3M0ZA 3H21A 1M1BA 2IPGA 3APYA 5AFDA 5F4SA 3BW3A 3LZ5A 2GYIA 3KBMA 3PM6A 3VFCA 1JGIA 4LU0A 1GVRA 2BY3A 1XI3A 4ZB2A 1CDGA 4AG0A 1TIMA 4PUDA 5HQMA 1T6MA 5A69A 1XCFA 1DWJM 2WWDA 3O15A 2ZXDA 4GXPA 3U8GA 4CKQA 4MY1A 2YXXA 1EJVC 3ARRA 1SO6A 4PULA 3NO5A 2PU1A 2G95A 6ALDA 4CNNA 4AZCA 4C6QA 3JU2A 2X8RA 3FY1A 1TTJA 4GCAA 5A8NA 1EP1A 3DBPA 1I60A 3LXCA 2YBUA 3OTRA 1HJXA 4DN1A 3LM3A 1JXJA 1U1JA 1JYWA 1W1B1 3O2LA 3LI0A 4I5UA 3KXQA 2ZDSA 1QVBA 3KVMA 1TA3A 5G4WA 4MPQA 1OCJA 4AU0A 1GT8A 2DVTA 3CT2A 1X38A 1VLWA 2DT2A 3M46A 3ZR5A 3L21A 4MNLA 3IANA 1QPRA 3CV2A 5A2CA 1HVXA 3B8SA 4LX4A 4J3VA 1W3KA 1WAUA 2EG6A 3Q37A 4FF5A 4ZOEA 1X96A 2F9RA 3QPZA 4NAEA 1Z3NA 2PCEA 1RSCA 1EDTA 1RBOB 1W9DM 5F1VA 3UR5A 3TW9A 4OIFA 4KMQA 1TV4A 3WO8A 3EKLA 3LCWA 1RY8A 2W92A 1YE4A 3CWHA 1RCOB 4JICA 3QN3A 1ITCA 4ORIA 1FH9A 1O6IA 4AF0B 2O4QA 3EX2A 2PDMA 2E40A 1ADOA 3MU7A 4EWND 1AQHA 3V16A 1GOKA 1W1A1 4H9MA 4LFYA 1ZBVA 1PE1A 3KLKA 1BQGA 3STGA 2XHYA 1EJUC 2QJGA 4O1FA 3ANYA 1UOZA 3KFTA 4C1NA 2GVJA 1S46A 3QSTA 1ZCOA 1UR3M 3O1NA 4NZ5A 4UFLA 4O0QA 1L6YA 3CIVA 3AUOA 2GK1A 4C6EA 2ZFAA 3A3WA 1P1XA 3MUXA 3WQFA 4DO5A 1UQYA 4LCSA 4RE3A 2C15A 1AZ1A 3LTSA 3OO2A 4LAZA 1QAPA 2GGJA 1DYSA 2YCKX 3WJXA 4DQWA 1HL8A 1BYAA 1ZJHA 2B0MA 2VHLA 3EOOA 3NA8A 1MFUA 2X41A 3MI3A 4HCHA 1XIFA 1KV5A 1PUDA 1EUAA 4CEUC 1ICQA 4XBSA 4EF9A 3KBWA 1W1VA 3DYPA 3VGBA 3QKEA 3NWRA 3ZOAA 5JBEA 1DIEA 3FS2A 1J93A 1N2VA 3GTFA 4IFKB 2RGMA 4X60A 3UWUA 1K70A 4CD8A 1DP0A 1JL8A 1WE5A 3EDEA 3DECA 3TZNA 4K6AA 1EJTC 2O9RA 4QAWA 4OFCA 5DBTA 3KUMA 1VBJA 2V38A 5LZLA 3LRMA 1OT1A 2XIJA 1TPWA 1LLWA 4GXWA 1PDYA 2E28A 3K4WA 2J7GA 1XIBA 1GKPA 1ISZA 3ITXA 2O0TA 3LYEA 4LV9A 2FZ9A 1UD2A 5FJOA 1KLZA 1H7XA 1CGUA 1WBJA 3TAKA 3E0FA 4EKJA 4BQ4A 2BLEA 2PWUA 3RM8A 1OBAA 4Q7BA 2D2OA 4J3ZA 1XDJA 1OG0A 4GGBA 1Y5VA 3ARSA 3EOEA 3VK5A 1CGWA 4M82A 5AHFA 5AVNA 1KBLA 2OOFA 1D7KA 4OWGA 2Y1HA 3GSMA 4FX8A 1H0GA 1RK6A 2J9ZA 3RYSA 3PSVA 3BMVA 1TTIA 3G1XA 2DZXA 4E2OA 4YYCA 5XIMA 3UVIA 3GDTA 4I5RA 3QPYA 4OV9A 1XKYA 5D02A 3UXAA 1P6WA 3L0GA 2QW5A 3BAKA 3EX4A 1GNXA 5FF3A 3DAQA 2TAAA 2C3ZA 4H8VA 1XPGA 5KZEA 3V0SA 2PDKA 3KE0A 2VI0A 5FJJA 5CPTA 2F38A 2UZ9A 3F4NA 3B4UA 3STEA 1ZZMA 3SFWA 2OEMA 3BGGA 4JTJA 3MKCA 4HVXA 4RW3A 3OPSA 4BQ5A 1GYNA 3BICA 4B5UA 2QULA 2D22A 3ZT5A 3OLDA 5CAKA 2ODOA 2C91A 4FMVA 4XSLA 3IJ7A 1H3GA 4TU1A 3TYUA 1FXQA 1KRMA 4WF7A 3H7VA 4CD6A 3IJ9A 4GFSA 3OU8A 2X1IA 3NZQA 1YNYA 4E5TA 7PTDA 2QF7A 3NZGA 1EJRC 1XFCA 2YLAA 4NU7A 3WK0A 1MQRA 3HGOA 3ICJA 2AAAA 3REQA 3PJTA 1A3WA 3WD3A 3WFZA 1L2UA 1PJ9A 3WLIA 1JZ3A 2R82A 5LSMA 3KWSA 4Y2WA 3NM3A 1SPQA 1KBJA 2QDEA 3CZ8A 1UIPA 2X30A 4ZBCA 3WQEA 3TFXA 2XFWA 2JFEX 3TDFA 1KQZA 3QLLA 5CKSA 1NP0A 2ZZ4A 1P6BA 1LRNA 3TONA 4S3CA 1R30A 3HGJA 1TJPA 4AMAA 4V33A 4WD0A 3E74A 3PWAA 1B4KA 1WZAA 5CXPA 3NSNA 1LORA 1CCWB 5D2XA 4XIMA 3N13A 1TCDA 3N4EA 1TA3B 3RU8X 2I9EA 3QYSA 3W1UA 1IGSA 2FZBA 1I2QA 3VDGA 3TA9A 1E4MM 2VDHA 1P43A 3L5AA 3M0MA 4DBUA 3EPNA 4A3QA 5IXEA 1WDDA 1DJIA 1FHUA 2EPNA 1RVKA 4QSFA 3JS3A 4NAEB 4L65A 5HNNA 3E2RA 1TJ0A 1C8VA 1NFGA 1DWHM 5FJIA 2FGZA 4R9XA 3DBNA 2X1UA 3GVRA 3CZGA 3SY1A 2CZEA 4JN7A 1A5KC 3ZT6A 2R94A 4P61A 4XZWA 4ZQNA 2OKOA 5D2YA 2YDSA 4G8TA 5GVJA 4WEVX 3UBPC 4CN4A 3P84A 3ABSA 3SM0A 2OQYA 3TMLA 2F6XA 5I5RA 3IUHA 1HTIA 4OZOA 4J7RA 3R6IA 2UY3A 3CPRA 3N73A 2XH0A 3QV6A 4IIEA 3H8AA 4C1NB 3RFAA 1SJAA 3CL8A 3TUUA 5CCZA 2A3HA 2WVTA 2VUNA 2GK1B 1H62A 1L6SA 3RUBL 3FDGA 3SJ3A 1NELA 1TMLA 1IT7A 2XFYA 1PZ0A 2WQDA 1TV7A 3M16A 3UETA 3LNPA 3W72A 4KEVA 2VQUA 3NFUA 3WQCA 4EP8C 1XLHA 4IICA 1GYMA 1M9HA 3HPXA 1D3CA 1ZP3A 1CXFA 3MYOA 1T40A 3OGVA 3FA5A 4A2RA 3VNKA 2XSAA 2A3AA 4F8XA 3UZWA 3GHSA 1J0ZA 1FA2A 3RU6A 1KM2A 3CUJA 4JQAA 3ZXWA 4Z1YA 3VZZA 2PD5A 3VD7A 3OLEA 3TWBA 3RPMA 2PDGA 3CIWA 1N7KA 3IWPA 1ECEA 4URIA 4R85A 1B54A 1TJ1A 4P7LA 1MQPA 1RD6A 4NP7A 3QM3A 3W88A 5G2IA 3LLFA 2Z1XA 3P8IA 1OCQA 2DZPA 2GJXA 3OGSA 5DQPA 5BMXA 4YU1A 3DHUA 1FHVA 3VCNA 4GI9A 2HPMA 3DFQA 2X0SA 4LRSA 2WSKA 2V2DA 4OECA 2O7QA 3OVRA 1AA1B 3CHDA 4DIAA 4HN4A 1NH6A 1OQFA 3GX9A 3PS7A 1VFHA 2GUBA 1G4PA 4B2DA 1F61A 4ACZA 1TWDA 1XLEA 4W89A 3P5YA 1V79A 3UZXA 4NRSA 3L2LA 2XIQA 4Q8TA 1VEMA 2E9LA 2UY4A 3CASA 1OADA 1OSEA 4C6NA 2DGAA 3ITVA 5FF7A 2C0HA 5BZAA 2ZRYA 2PODA 2V8ZA 5C5YA 1E0TA 3GNPA 3GDMA 4JXCA 4RZBA 3IIVA 3FLUA 3USZA 2WCAA 2XWDA 3R79A 1QI2A 3SZ8A 2A4AA 3VX1A 4JY8A 4GVIA 4TVDA 2QCEA 3L0NA 1NQ6A 4JX6A 2OELA 2VENA 1R5YA 3W1QA 1VRDA 4HTBA 3WLLA 1X6LA 1KQYA 2OT1A 4O16A 1ZHAA 1W2PA 3GKFA 1TPEA 1U5HA 1AODA 3T0AA 1TO3A 5GNZA 3PTDA 1SO5A 1EHNA 2X1SA 3E0VA 3AXMA 2ZXAA 4EWJA 2HVMA 3EEGA 4O0ZA 1S1RA 4HHHA 2WCGA 1PBGA 1V6YA 4NZ4A 1V5XA 3KL5A 3U48A 4GQ0A 1HX0A 4EE9A 4A8LA 1M6JA 2GDQA 5AHMA 3WQWA 5M1TA 4BFAA 1KFKA 4OTKA 1DWAM 1UUMA 3KVKA 2YKKA 2YYUA 3QHNA 3TKFA 4F9DA 3AJ7A 3L12A 4GH3A 4HCDA 1X7IA 2WZTA 3I3DA 4AMCA 5CQ1A 4IPLA 1XISA 3K8MA 1FWFC 2OB3A 3MSGA 2VFHA 4HPXA 4LRTA 3SUTA 1GOQA 1QW7A 1Z41A 3REQB 4KETA 4LYQA 5H1WA 2Y5EA 3UYIA 2JKAA 2CERA 1RP8A 4RR4A 3NVTA 4HZ7A 4ERIA 1U30A 3MPGA 3M4HA 4LUIA 1OIMA 1NQKA 3KDNA 4EXBA 3SGGA 2Z24A 3ONBA 2AGKA 2YBTA 1EJWC 1A5UA 3GNRA 3LN3A 3SR7A 3A24A 4AHOA 4H3DA 4DJEC 3HU7A 3GKAA 3IJDA 2G3NA 1B3ZA 3EKGA 3FOKA 1UBSA 2E3ZA 3M6DA 3I6RA 1R8LA 1A5CA 5CG7A 1TFVA 1BGGA 4S1FA 4KWVA 4JPGA 5BXTA 3AHYA 3W7RA 3NSXA 2HBXA 3MUCA 2ACRA 2YCIX 3OBKA 2AAMA 2WLYA 4Q8UA 1VFSA 3ARXA 5TIMA 1VD6A 3N19B 3QGKC 3VVGA 7ODCA 2IQ0A 3QH2A 3CK5A 5BWFA 5HNUA 4KRTA 4GIRA 1TELA 2ZUVA 3VKDA 3IV3A 5CSUA 4UR8A 5CGTA 4QFUA 5HWJA 4PODA 5LA2A 5C0QA 3W71A 4GYJA 3TSDA 5I3DA 4W5ZA 4JQ1A 1TPVA 3F4WA 2OG9A 3QJAA 1FCUA 3MY9A 3KBNA 3NL2A 2CWNA 2DH3A 1JUBA 2EKCA 3O6YX 3GO2A 3KAOA 4O8RA 4QNEA 1TPFA 5F2MA 2DZSA 2QAPA 1TWSA 4HPGA 2PMQA 3DHDA 4FXRA 3NZPA 4MJZA 4JFSA 4Q7NA 4G5DA 1HL9A 1EBGA 2FMOA 4CN6A 4US5A 4FX6M 3W7OA 5BOEA 4IMEA 1OX5A 2XDFA 5LA1A 3W75A 4ZSTA 3UQNA 1L6FA 3O0FA 3N3MA 3RRAA 3MJYA 4ILSA 1GORA 3M7WA 4B2DD 5G1MA 4RX0A 3VIKA 5G1YA 1AW1A 2CHOA 1EDQA 1MSSA 5BCAA 3E96A 4DLFA 3EBVA 4LF2A 1XUZA 4C1LA 3V35A 3SCPA 1J0KA 1OHLA 4LYRA 1Z44A 1BYCA 2E09A 3SUUA 1KTNA 3GLCA 1QOQA 2NV1A 2ZA2A 3B8UA 2RKXA 3WBEA 1JGMA 2EPOA 2VUYA 3GTIA 5DBUA 3KHDA 4L64A 1WA3A 1VF8A 1F6KA 1CLXA 4PEKA 4GVHA 1TPB1 2IW0A 1PX3A 3OBAA 4ZB0A 4RDVA 3LHZA 1YBQA 3QY8A 5DO8A 3BOLA 4WX2A 3NQMA 4D8AA 2HZGA 1UD3A 1N8WA 1UWRA 2X05A 2GJXB 4M3PA 4ZO8A 3MO7A 1JCXA 3RR4A 1E73M 4M8UA 3GG7A 4WSHA 1K9TA 3OLGA 1DE5A 4IPPA 2FZDA 2AKMA 3ARZA 4KH2A 1XSJA 3M44A 1S5MA 3N9KA 4BJHA 3LMYA 1QASA 5ABTA 1B31A 1IIGA 3AROA 5D2VA 4OUIA 3T05A 1ICSA 2BVTA 1VPQA 2VC7A 3DHPA 2A21A 5AC5A 1KM4A 3NDYA 1Q8AA 4ACZB 6A3HA 1AMYA 5CC7A 3BPWA 2HS6A 1XIMA 3P67A 2DPEA 3WBXA 3T6CA 1LJYA 1H5VA 4D6JA 2IMRA 1O60A 1IZJA 3GR4A 5KMYA 1S5NA 4CNTA 3QMRA 2YFNA 3I3BA 5B80A 2W79A 3QQ0A 5D9OA 1NWRA 3MANA 2WC3A 3WDRA 4AZ7A 2BY0A 3DYOA 1XYMA 1FKWA 3RG6A 3U0HA 3T4WA 4UTUA 3TR2A 4D1JA 2G5WA 4NX5A 3WL1A 4PB5A 2WMIA 3C52A 3BAJA 3UJRA 4PR4A 4OKDA 1JNDA 4BF7A 1XXXA 4X0NA 3SAZA 2NQLA 3HMJG 1MVYA 3MUZ1 1OFQA 3HO8A 1MO0A 2V3EA 4AVNA 4G1NA 2OX4A 1PZ3A 5A6LA 4OE7A 1PEZA 3NZRA 2PTYA 1BPLB 4TR9A 5CSRA 3MZNA 1A5LC 3GYEA 5CZSA 3R43A 4AEFA 2YXOA 1ISVA 1O5RA 4YTRA 1XD1A 2OQLA 3OP2A 4J1OA 5AVHA 3UESA 5DELA 3TSBA 1A50A 2ZVRA 2QR6A 4WJ8A 1S3HA 3NNTA 3TQKA 4FZIA 3AIWA 4MWAC 3AXIA 3BMXA 3UY7A 1NJJA 1W3NA 4XO6A 1V8EA 1K4GA 4PB4A 3U5YA 4H9TA 3LCHA 4DNHA 4LAOA 1DWFM 3W81A 3U57A 4C6FA 3O3RA 1K02A 3O6DA 4IPJA 4UB9A 3ZSSA 2POZA 3VXGA 3SCNA 2W3ZA 5G1TA 4NSBA 2VFFA 4M6UA 5U7SA 2ZE3A 4UTMA 4LBRA 5DT5A 1OGBA 3T42A 4DLMA 1EC7A 4XTIA 3WUBA 2VFGA 4US5D 2FJUB 2XIMA 1CX9A 3EPOA 1LM1A 4LJ3A 3WK3A 4GKLA 3UJSA 1NDWA 3UYCA 5H8UA 1YEYA 4DWSC 3SW6A 1TQJA 1AVAA 1SGJA 2BVDA 1F05A 3QYQA 3M64A 4R53A 1SSDA 1D2KA 3UJFA 3BC9A 1FUYA 4RDWA 3M6YA 1C8XA 3PB0A 3AS0A 1GVOA 1Y65A 1V03A 1KFEA 3L65A 5HMSA 2GQ3A 1HJWA 4CCDA 4HU8A 2G97A 2Z29A 3KOWA 1KBBA 4D71A 3IIOA 3H55A 1Q13A 3D3AA 2E8ZA 4H6RA 4B91A 1UR0A 2BHYA 5CZ0A 3CV6A 3U2CA 2ZKMX 4Y9OA 1XG3A 3CUXA 1MW0A 4ML9A 1SQ7A 1T41A 4GQRA 3UR8A 4PBFA 3VNZA 3II1A 5AYIA 3WQPA 1E9IA 1TE6A 4LS1A 3MMDA 4UUIA 4FX7A 1VIWA 4ZODA 4EAMA 1ZS2A 3U7BA 1BXCA 1P48A 3ZYZA 4QCEA 3RX4A 3FGCB 2H8XA 2R1MA 2WCSA 3TXVA 5I0DA 1XCWA 5GNYA 2FFCA 4CEXC 1QBBA 2R1PA 4W87A 1AQFA 1PZ1A 3TLLA 1LF1A 3RIKA 3CAKA 1MUWA 3ERPA 2WNZA 3TQVA 3GBDA 5EB8A 3MDWA 4L5ZA 1QNRA 2DZWA 1VBGA 3GXPA 2Z1BA 4K8GA 3C0JA 4C60A 4B4FA 3EWZA 4ATLA 3BLIA 1GW1A 1PCKA 5HR6A 1NOWA 4MVAA 3W29A 2AL2A 3BUVA 3MMUA 2CETA 5BNKA 3RRXA 3GAKA 2CBVA 5AHEA 1YBQB 5KZ6A 3LPGA 2PBGA 4MUZA 2OPJA 3UCCA 2GGEA 5A95A 2E6FA 2Q71A 3VFLA 2P53A 2MANA 3O16A 4B3KA 4XZLX 4GPNA 9RUBA 2ZX5A 3WEZA 2XVLA 4BKNA 2QQ6A 1D8WA 5REQA 2G4FA 2XN0A 1AL7A 3EYPA 1QR7A 1H7WA 2BXVA 5HMDA 1H09A 4Q6JA 4XAZA 1CTNA 3FXYA 3N3TA 1OFOA 3LB0A 2XGZA 4EVZA 3W37A 3MCOA 3MT1A 1TE1A 3CIXA 3FHQA 3NG3A 2XWEA 4HK6A 1HJQA 3C3UA 2WVUA 4GYKA 3GXMA 1TQXA 2V30A 1M7OA 4IF2A 1XRTA 3LGEA 3E02A 3SCVA 4ICMA 3ABOA 1MXDA 3Q2DA 4FNSA 4GYPC 3SB0A 3WUEA 1GCYA 3W00A 4LWWA 1W5NA 3LK6A 7A3HA 4JTTA 1JZ6A 1GQNA 2Z4GA 3EB4A 4NJHA 1QW8A 2WMIB 2VXNA 4O1BA 4WSJA 1M7PA 4IQLA 1CYGA 2JALA 4UTIA 3W7IA 2IKGA 2V63A 1LWJA 4NILA 2GLKA 3GWQA 2VGGA 3IIZA 5EPDA 1JRCA 2Q3RA 2ASHA 1E71M 1F7BA 2GUUA 4PBGA 1J2BA 1U22A 4IXXA 3EGJA 3V18A 2A1YA 3PUEA 1VC4A 1CW2A 4XAPA 1UUOA 5ABFA 3AUJA 3VAVA 1B5TA 3RPDA 3PBMA 4XKMA 3W7PA 1SM9A 2C8NA 8CGTA 3L67A 2FPYA 2I9UA 1K6WA 2WMKA 3UERA 4MJ4A 2ZE0A 4F0MA 3C6CA 3NJ3A 2GJNA 5I7GA 2DIEA 2BASA 3TE9A 1H0IA 1WNOA 2VX7A 1RLDA 4KCWA 4RLIA 1GG1A 5FEWA 2YFOA 3TROA 3TV8A 1BYDA 3QVQA 3DIPA 4IJRA 4G9PA 4W7WA 3CUIA 3CH0A 2DU2A 1AG1O 3SCQA 3URAA 4MSSA 1TWWA 1QATA 1WCGA 3S5ZA 1GOOA 4WQ6A 3MZ2A 3WBWA 2AQWA 2FHCA 3VDAA 3LUTA 2Y24A 5CBJA 2PC4A 4AISA 1QO5A 4IG2B 3LI1A 4GQGA 5F1UA 2BOEX 3I68A 4CQ8A 4QR6A 4KIRA 4BI7A 1V0NA 3OA3A 3WY1A 3FEMA 1DHKA 2UY2A 3VD9A 1FFRA 1GONA 5HXMA 4UQAA 4HNVA 2WHKA 2F6UA 3EB2A 2Y7FA 1V0MA 4BK9A 3NUKA 3SURA 1J2WA 3OVPA 2QKFA 3N9SA 3PC0A 4DXVA 4F4RA 5GNXA 3KBSA 4LAMA 5CPQA 5CG0A 3W87A 1HKVA 3VC5A 2OZ8A 1Q66A 3R8HA 2ZZ1A 1K77A 3TOPA 4LGXA 3WLQA 5HUOA 1BVZA 3ABZA 1O66A 3U9IA 4O53A 5FD0A 3PPCA 5IBXA 4W7UA 3PZIA 5HJYA 4O14A 4P8XA 4RL3A 1BG9A 4MIMA 1J0IA 1U5JA 4S3BA 4WXZA 1RA0A 4FLSA 1RLCL 4AY7A 3L4VA 2ZX9A 4GRSA 1TJ2A 3W2LA 2DORA 2CZ5A 3UWEA 1HJVA 3IGXA 4ZENA 2DVUA 1KXTA 3WD0A 1V02A 1A0DA 4V2XA 3HQOA 4REQA 2HXUA 1E43A 4NZCA 4MWAA 3FYYA 2P8BA 2ISSA 1W9UA 4IIFA 4AZHA 4E38A 7REQA 1DV7A 3BSGA 3GG8A 1V3HA 1UKTA 1KD0A 2XIBA 4TOQA 4HOXA 4L4LA 2WM1A 1G67A 2QJNA 3CEUA 2RJHA 4H6EA 2W6RA 2QV5A 3IRSA 5EMUA 1VP5A 2D0GA 3LCGA 2OX1A 3S47A 1VEPA 2Z7GA 1G7VA 2WANA 5HPOA 4QNWA 2G3JA 1KFLA 4C6LA 3O06A 3KCJA 1HT6A 1PS9A 2PDPA 1HUVA 1KGWA 3AO0A 3W02A 4GVGA 1E40A 2QDGA 3MUY1 4ZQPA 2VQTA 4IIGA 1DXEA 3NZ1A 3D6NA 3CEPA 4Z1DA 3WELA 3CQKA 2WC4A 4FNRA 2UV8G 3CUGA 3R25A 3WDHA 1JCJA 4HK7A 8TIMA 1M68A 4JTAA 2YB4A 3UZYA 3G2GA 5D9MA 1OFRA 3ZQ9A 1ML1A 2PGRA 2E25A 1J0HA 1FWEC 4X2RA 2R14A 4O15A 3OIHA 3N6HA 2A5HA 1C9DA 5HNTA 2IQTA 4H01A 1YLVA 2B7PA 3PZUA 3WLSA 5REQB 4IH3A 5C7HA 2HEJA 2V2CA 1OJXA 1E9YB 3GM8A 5DANA 4IXHA 4WOZA 5CBBA 1IEQA 1PIFA 4BY3A 2VCCA 3UJEA 3R13A 1RH9A 4KWSA 4WXYA 4XZNX 1FH7A 2CZVA 1FTXA 3W6YA 1PYFA 4AB4A 2BVYA 3GNDA 3B0VC 4LTSA 3LV5A 1UB3A 1E72M 1GZJA 3V5OA 1VH7A 4ZMGA 4IFRA 4O1EA 3OQ8A 3TH6A 1E6NA 3GAYA 3W1XA 4HSNA 5JBDA 1H49A 4DPQA 3B04A 3AQUA 1GQIA 3POCA 4UTKA 4N9CA 1GPWA 3FCPA 3QMTA 4DHGA 3WF3A 2PWHA 3B8DA 2NZLA 1IWPA 1V93A 3TR9A 4QBXA 1W9PA 5I3JA 1VCGA 1FWAC 5TNVA 1D3GA 3B9OA 4LOCA 4ZFMA 3R1ZA 4GABA 1UD8A 2DZTA 4A4AA 3TIMA 1OK4A 3ELFA 4K3ZA 2DH2A 4JYEA 4ASTA 4EPEC 1C91A 3LGGA 4TX6A 5DMNA 2TRSA 1I4NA 2J7FA 2FTPA 4P7NA 1B3WA 3S6DA 4K1GA 3COTA 3P81A 3B8VA 1THFD 3QHOA 3F4DA 4CNOA 2A7PA 3B06A 4GKTA 4PTXA 3M0JA 1HGYA 3WENA 2PWGA 3PWIA 3CB3A 4PUUA 1KGXA 3SGUA 3KTCA 4UOZA 1DWIM 1LQAA 4JTIA 2BGSA 2QUVA 4NI3A 4IQEA 4G7EA 1IEIA 2HSAA 3NO3A 2E6YA 5M03A 3ARPA 4E4UA 3KOZA 1CLVA 1PYMA 4DYEA 1AD1A 1V6XA 3Q58A 4QAIA 3BLKA 3FIGA 4MYXA 1OYAA 4DUXA 3N14A 4ALDA 2C14A 1A53A 2ICSA 3NL6A 3S9IA 3KS6A 1W54A 2IKJA 2D3LA 3UXIA 3VCRA 3WIJA 5I06A 2WZEA 5A2AA 1E4IA 2OCZA 4FNTA 3G24A 3W7EA 1KRAC 1PAMA 3EWBX 4GYPA 3A3XA 4RZ6A 4AD3A 4I3GA 4EXAA 2AKZA 3BL3A 3DYMA 4M19A 1JCTA 2HS8A 3ATYA 3DDMA 4ACYA 2VEIA 1DPMA 2V5LA 4YL2A 2ANUA 1RCQA 3S2NA 3W1LA 1PX8A 1F4HA 3MC5A 2ZDRA 4IIDA 4V27A 3F2BA 4TMBA 1K6AA 1J5TA 2IKHA 1E1EA 3T55A 4JGDA 2XH2A 1SMDA 4AZGA 5AC8A 3O8AA 2DEPA 4ZZ9A 1FCVA 3QC3A 1NDVA 3DGRA 4AVFA 1LYXA 2W67A 4GI4A 1CT5A 3AMGA 4MADA 1R2RA 1R3TA 3HGRA 3IK4A 4IM4A 1QOXA 1J6OA 4Q3MA 1M53A 3D47A 1ZB5A 1EGZA 2GSJA 3E0LA 1V51A 3TP4A 3VA8A 1YTDA 5HJXA 2JBMA 3CO8A 1VZWA 3VM7A 3LG3A 1OF6A 4RPPA 1U33A 4AD5A 5DCBA 3PPGA 1O94A 5BWAA 5LHFA 3FYPA 2PBOA 4GC3A 2GSEA 5D04C 3H2FA 4H6KA 3OA5A 4JQ4A 4DM1A 7REQB 4UMAA 1WKEA 1GZ1A 2Y63A 4V1YA 1LOSA 4JTCA 1K3UA 3THDA 1FH8A 3CHCA 4M7SA 1BRLA 5EBAA 2WK2A 1V6WA 3AAMA 2X16A 4GIAA 3UXLA 1WUEA 3GBEA 1HO1A 5BXSA 3QR0A 3UPMA 1IYXA 4JHZA 4MNKA 3WNOA 1OYBA 4J9JA 3FN9A 1Z89A 2E77A 3BK0A 1SUXA 4N42A 1F9CA 1GOXA 1G7UA 4BR1A 4GX8A 1R38A 3IUIA 3USBA 3KX6A 3GIYA 3VDHA 4Q4RA 4IZGA 3CHVA 4ZOBA 4Z17A 3BH4A 1US3A 4HMNA 4L9ZA 3F4VA 4UTHA 1OF8A 4NNAA 3M0IA 1W3IA 1CEOA 1XYAA 4O54A 1QPOA 4E8CA 3TU9A 4FI4A 1KR0A 4UQDA 2QCLA 4H9YA 4O52A 3VCCA 3NSMA 1PTDA 1S2UA 1QOPA 1GJUA 3AZRA 4PUKA 4MHBA 5BRBA 2VZTA 3FSTA 3RJXA 3QV9A 1DXIA 3TYBA 2Z2AA 5J5DA 4W4QA 2J88A 4X0VA 3AI0A 4C6IA 3W74A 3E5PA 1FWWA 4IUOA 1SFLA 3WQ6A 3PZ9A 1C9WA 1TVLA 1V4YA 2VYOA 4D8ZA 2VO5A 3ZVHA 1OGGA 3EWCA 1QDSA 3TN3A 1GUVA 1FP8A 1CGVA 1SZRA 5D8WA 2V82A 4Y8EA 1CECA 3VUSA 4M5PA 1XYBA 5K7JA 3LQLA 2C16A 2D0FA 3WZ0E 4QRNA 1PKNA 4YTTA 1ZCCA 2WHJA 1A0CA 3ORWA 4LY8A 1JZ8A 2GPTA 3UCDA 3WMBA 1VJIA 4Z1BA 3P62A 3W25A 4CGTA 1ZBCA 2GOUA 3D5HA 3EB3A 4RNFA 1W6TA 3NQ2A 1OG6A 1GK8A 3TQPA 2HJPA 4XBKA 3AU2A 4CU7A 4ORMA 1W1ZA 3KEHA 4PMDA 3UNTA 3NQAA 1XINA 2Z1WA 2O9PA 2ZZ5A 4Y9NA 5EYWA 3A5VA 4Z2HA 4AZ6A 4MFEA 1GVSA 2PDNA 4FOUA 1IZCA 2I56A 1G9HA 2FYMA 4QJ3B 3UXDA 3M7SA 4MYAA 5E9AA 3TCEA 4H2HA 1C8YA 1PL9A 1P5BA 1S38A 1P0KA 3THUA 2FVLA 1E6QM 2FTWA 2XIOA 1H51A 2YDRA 1W9XA 5GJPA 3B97A 4BI5A 2V69A 2RHGA 3H53A 5EBUA 4AUBA 4G7EB 3S3GA 4H19A 1EEXA 4IPNB 4UTLA 5EMJA 4B5WA 4K8HA 4TV5A 4RJEA 4C7GA 3L2MA 3S2LA 1F3XA 4KS0A 2RDXA 2WPBA 4YYFA 3QFWA 3AXKA 2I5IA 1R3VA 2BHUA 5I3HA 1K03A 3TK7A 4A2SA 1P0NA 2VEPA 3I3EA 2J78A 4WCJA 1HKIA 4QP0A 4N7QA 2A3CA 1ONRA 5HBFA 4PTVA 1F74A 2WZHA 4LV4A 1EDGA 4NI8A 3R58A 1OFDA 4DF1A 5J04A 4K2SA 3AIRA 5AN7A 3PZVA 2RUSA 2GZXA 3SEPA 5C7VA 3RHGA 3AMKA 4UTTC 1ISXA 1ZFJA 4UMCA 4FXSA 1A49A 1LWHA 2BODX 3FK4A 2D2JA 4IP7A 4PRRA 2IUZA 3QOKA 1BVWA 2E8YA 3RLVA 4GYFA 4ZA0A 3AIEA 3WJZA 1BSIA 2D0HA 3O9NA 2I57A 1TB3A 3HM7A 3B8WA 1DTNA 1OFPA 2WWCA 4XVDA 5T9CE 4I90A 2B7QA 2NXIA 1M7JA 3VGEA 4O8AA 3ZSTA 4PUEA 3S42A 4O1AA 4Y90A 7XIMA 3S5YA 2VEFA 1UWUA 1R86A 4NAFA 2Q8LA 3FFSA 2VRQA 1ZALA 3E9AA 5I03A 3DI1A 4I9TA 2VOTA 1C8QA 4JEJA 2GUYA 3FXGA 2WSQA 4E0CA 2WB5A 1ME7A 2BV9A 3F7JA 2J7HA 2O55A 3M1ZA 3HZ3A 1DE6A 2CLHA 4P7RA 1BSLA 1Q2SA 2VZSA 4U2ZA 4AYSA 1BRLB 1FFQA 4RZ5A 4ADTA 5M3WA 4GZJA 1SFSA 3MSYA 3LSBA 1X1NA 2DUZA 4UMBA 4GA8A 4KQNA 4DWDA 1BWLA 1E9LA 4P2VA 3EXTA 3G1SA 3UFYA 3BLOA 3PVFA 3Q4DA 4RV3A 2CLPA 3R0UA 4M6PA 2VELA 2ZA1A 3DG7A 5C9RA 1QHZA 3LPPA 1ZBWA 4PTNA 1KNWA 4I9MA 4WJXA 2CHNA 3MJMA 5EFFA 3LHTA 1Y0EA 4YCPA 5AECA 4FR6A 1JPKA 2PGFA 2I16A 3JZUA 4HGXA 2WV8A 4A29A 4HZ6A 3BDKA 4KPLA 1HIZA 4H7ZA 4AHPA 1UA3A 3IJIA 2ALRA 2YCEA 4PMNA 4D8LA 4GY7A 1ZU8A 5I77A 5LIKX 1O1ZA 1O5XA 2VCBA 3W7LA 4J3UA 4S39A 1MQQA 2OMAA 3HQ1A 4CQCA 1UCWA 3NPUA 1PDZA 3T0TA 3H6OA 1ZSXA 4GWEA 5DCEA 2YA1A 1S5TA 1PKMA 1HGWA 1JEZA 1S2AA 4YXGA 3L66A 1HFBA 1UA7A 3KRZA 2V81A 3LBCA 1MEIA 1Z69A 2HVNA 4KWUA 3BW2A 1HJSA 2H8ZA 3L0KA 4NJIA 3RO6A 3N2BA 3A47A 5D03A 1QI3A 3WLJA 4P8WA 4QLKA 1WXJA 2DSZA 4XTDA 3ZVHB 3OHIA 3R10A 2REQA 2WBKA 1F2JA 3VMOA 2GDUA 3AYVA 3LPOA 5EU9A 4DZAA 5FL0A 1EC8A 4V28A 3BARA 1AK5A 4H2CA 5I09A 3L4XA 3LOTA 5FJUA 1WDPA 2HVOA 1D7FA 3ZIZA 1IR2A 4O10A 1P0EA 3BAWA 2XINA 3JR2A 1SYTA 2HXTA 3LCFA 2PP0A 2E9MA 1JR1A 2JKEA 3PJUA 3GTNA 4D72A 5EL1A 1A47A 4PMUA 4O4WA 4LUTA 1REQA 4RZ4A 4Q6XA 1E6PA 2VZUA 5DLCA 5A6KA 1UQZA 4TQTA 4ZOAA 3KBJA 3DFNA 3MP5A 3W23A 4JOMA 1TSIA 3BO9A 1EPVA 2FKPA 2W62A 1GKQA 3EA1A 1G69A 2HNHA 2VX6A 3GXDA 1JCLA 3VU2A 1T5AA 4JAWA 2LLEA 1TREA 3O0KA 2C1HA 3TC6A 3NCOA 1HKKA 1X1OA 4XAFA 1BKHA 4ZFCA 1EZ2A 4YWSA 1M7XA 3KP0A 3UWVA 3UU0A 1KV8A 3SADA 3V3WA 1UWIA 2PF0A 2DT3A 3EDDA 3DU0A 4KEUA 4H04A 3IVTA 2QUMA 4Z42C 1XIIA 3T44A 1BXNA 3ZVIA 2XSBA 2VC9A 4NG3A 3P60A 4O57A 4EAYA 2W27A 3B0YA 4JIPA 2OZ3A 1MUMA 3AALA 3TN5A 3NEVA 2W5FA 3GU2A 3LXAA 3D3FA 2JK2A 1B9BA 3DEQA 4OUEA 4U5KA 2EAWA 1AUSL 1QNPA 1XRFA 4GACA 3W2KA 3R8RA 2OR2A 4L61A 1FWTA 1DJQA 1OFAA 2FPTA 4E2VA 3WLKX 2P5NA 5FI8A 4FEZA 3BV4A 1XLFA 1PX4A 1YDYA 4ZTXA 2WJDA 1JQXA 3RXZA 2AOSA 2J4GA 2YCLB 5AZ0A 3M0HA 4IFKA 1QNVA 1POKA 3V7PA 2C1GA 3GY1A 4LH8A 3AZSA 3T2PA 4FNUA 4CU8A 1GQKA 2CW6A 1B4EA 2VWSA 3CAQA 2BB0A 5MHBA 1VYSX 3S9YA 1NDZA 2O9TA 1EA9C 3LQGA 3PG8A 4AYGA 2IS7A 3KRUA 3GG1A 3CMJA 1ALDA 1FCBA 1WP6A 4IHCA 3WF4A 1G0CA 4MF4A 1KM0A 2DUXA 2WNNA 3EWYA 1TR1A 3ARYA 3TC7A 2X7WA 4NIRA 3UP8A 1FWIC 3MMTA 2A85A 3L4YA 2JGYA 2I1OA 2I5GA 4Z1AA 1V77A 4KF1A 1Z9AA 4NAFB 2XH7A 3WJSA 3HFTA 2PTWA 2CKSA 4JFTA 4Q4QA 1KXVA 3N6QA 2XSXA 1ZJAA 3S2JA 4RE4A 1PV8A 3NDZA 3F1QA 1VB9A 3A13A 4E8DA 1J4EA 1R7OA 3N2MA 1R3QA 1K7XA 1XYFA 4EOUA 3TXZA 3IV8A 4IQJA 4AIEA 4Y9AA 1E6ZA 2PZNA 4IJBA 1RVGA 3M47A 3UPBA 3B0UX 4BEQA 5I23A 4W84A 3CS2A 3W84A 1H7PA 3NYDA 1H50A 5A8MA 1AJ2A 5IFPA 4QG9A 2WJZA 3BMWA 3SQLA 2QYGA 2F7FA 1JAKA 1CXHA 1XF0A 3TJXA 1RA5A 3Q94A 4AWTA 1IHIA 6CGTA 3O6CA 1YX1A 4KKXA 1IV8A 2BG5A 2B31A 2VR2A 1F8IA 3R0DA 4A8IA 4UWMA 3UWQA 3TYCA 4L6HA 3WBAA 2G0WA 2WMFA 1Q4NX 1NSJA 4KBXA 3ALGA 3R7MA 3QR1A 3G5EA 4XK2A 4ADUA 4PUWA 1SW7A 1Q7ZA 1UWAA 5DF0A 4ZQMA 2VURA 4IISA 3UZZA 3P2VA 1Q5MA 2YGYA 1GVFA 4HJWA 2X2YA 3S1UA 1QHOA 2RDTA 2B81A 4XBJA 1BYBA 4O13A 4HK5A 1AZ2A 5L6UA 5CSYA 1JFHA 2P3ZA 2V5DA 4MMWA 4KGLA 5DY3A 3WFAA 1CPUA 1ZAIA 3KZPA 1JI2A 4DUWA 4ZO7A 3D46A 3S5NA 2BGNE 4ADSA 4BI6A 3GNOA 1QWGA 2CITA 2G41A 1I2PA 3W4RA 5ENLA 3NQFA 4IL0A 1WZKA 3EEZA 4FLOA 2WQPA 2Q09A 2QCFA 2Q8ZA 3E3HA 1K8XA 1IT8A 3GH5A 1CGXA 2CLMA 3W24A 2REQB 2VC6A 4B5NA 5FIPA 4QE4A 3K13A 3PPHA 2P0IA 2FB2A 2YIHA 1QNSA 3IAQA 2INZA 4D9PA 2ZZ2A 2CLKA 1XLBA 3RX3A 2QZRA 4HMCA 2GL5A 1F76A 5IRPA 4X2PA 1CGTA 4JN6A 4Y7EA 1U1HA 1DJHA 3W1PA 5D9NA 4AC1X 3U3HA 3GC2A 4DNMA 1W3TA 4LUTB 1LLOA 1REQB 1W8SA 3H54A 1NU5A 1PHWA 1UH4A 5A8GA 4ML4A 3EX6A 3QZ6A 1VENA 3S0CA 1QJWA 2OYLA 1XLLA 3K8KA 4HNNA 4BWLA 1LUCA 5FSEC 3AS3A 2DQWA 1YTKA 1FWHC 3ZJKA 1ONEA 5G2HA 3EOUA 1EHAA 3IPWA 1PO9A 4ZE5A 4Y96A 4NZJA 1V6TA 3W6MA 3PF3A 5CPSA 2BS9A 4Q4PA 1C93A 4JX4A 3GNNA 4DZIA 4HU4A 4CVUA 4XV0A 3M5ZA 3SIMA 4Z2IA 4W86A 4NZ1A 4PRTA 2O7SA 4J2MA 2NX9A 4DZHA 2GGGA 2NUYA 1DJXA 2FMNA 2XVPA 4MB4A 5FAJA 2V3DA 1JULA 3UVAA 1UZDA 4GFIA 5HK4A 4AEEA 3LGDA 3ZM8A 5AOUA 4GO9A 4RW5A 5HANA 1O12A 2QJHA 3Q45A 4NT0A 3F5JA 1I75A 3DFYA 2NSXA 4UR9A 3UGVA 3C61A 2Z28A 1FP9A 1Z8AA 4GGHA 3AYSA 3TNOA 2ZADA 3W01A 4IWWA 4AZBA 4UNKA 5I6SA 3DXIA 1JD9A 3ABQA 4AEOA 2QMKA 3CTTA 4AHQA 3GDBA 3PNUA 1KLYA 1YMYA 2YDAA 2Z26A 3WLRA 3B03A 3M0XA 5FEXA 1EPXA 2W91A 4H4IA 3ITGA 1OFBA 2QPXA 4AWUA 1DEDA 3UWWA 4PCSA 2Z6JA 4Q8OA 2UY5A 3PY2A 4A3YA 2V5BA 3MB9A 4JCMA 3P82A 1JYVA 2V0TA 5BXPA 3W7NA 1UD6A 1TIWA 2C18A 3TC3A 3AU6A 2DDXA 3CPUA 4K37A 1P1MA 4JTSA 2XH4A 4DWSD 1J10A 2FQIA 1EP2A 3QRHA 1BXBA 3ARWA 1L8PA 3DHFA 1UC5A 4D6FA 8RUCA 3BGJA 3GXIA 2HK0A 2E6DA 3BV7A 4B15A 6REQB 1E9ZB 3H26A 2E68A 3TYAA 4QEEA 3V1PA 2QEZA 3C2EA 3G3DA 3GE7A 2GQ9A 2ESCA 3WNPA 2WKJA 2X2GA 3C0LA 3H24A 2QIIA 5BROA 3GD6A 4LUYA 4QHRA 4FXJA 4CN1A 1TPC1 5A6AA 2BTMA 3G0XA 5SWUA 3EMZA 3T7VA 1Q65A 4S3GA 4YVVA 4MJ2A 2EPKX 3F03K 4HA1