1TV8A

Structure of moaa in complex with s-adenosylmethionine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
327
Chain Sequence
EQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords Molybdenum cofactor biosynthesis protein A
publication title Crystal structure of the S-adenosylmethionine-dependent enzyme MoaA and its implications for molybdenum cofactor deficiency in humans.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 112
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.1.99.22: GTP 3',8-cyclase.
pdb deposition date 2004-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tv8A00
1G6CA 3GB6A 1L6YA 3M5XA 1VHNA 4R7JA 5C5YA 1Q3NA 1SQ7A 4M6QA 1VZWA 3DI1A 3LCLA 1TJPA 3G1VA 1GOXA 5CG7A 4UTUA 3NPUA 3QFEA 1B9BA 2YR1A 3SFKA 4MVAA 3O8AA 5J5RA 3GXNA 3NZ1A 3GYEA 3LTSA 5AYYA 3DKJA 3MI6A 2RHGA 2WQPA 3P81A 1KFKA 3P80A 5F1VA 2E5BA 3SGUA 4AF0B 4Y9AA 3QJAA 1Q6OA 4FX7A 1H7RA 4K8EA 5LZLA 5LGXA 2YGYA 1EIXA 2A4AA 2Y6ZA 3D0CA 1F2JA 3NL5A 1YXCA 5HNRA 1XDMA 5AHEA 4KWWA 2YYTA 1LRQA 2HSAA 1ICPA 4X22A 4WXZA 3DFSA 4HNNA 2G95A 4O1BA 4DF0A 3NG3A 1DBTA 1W54A 1Q6RA 4NQ1A 1AMKA 3S5YA 2QEZA 4FO4A 3HG4A 4JYFA 4IWWA 3NM3A 2E09A 3F4WA 2ZZ7A 3DI0A 2QDHA 3LI0A 5G2WA 2RDTA 3LV6A 4NU7A 3LLFA 1WA3A 3STFA 3W75A 3NA8A 2J6XA 4LW7A 5FEPA 4MLRA 4AWUA 1H7OA 1WBHA 3QM3A 1F74A 1RVGA 3ZFHA 3NQEA 3QEZA 4BWLC 1AG1O 1VQTA 2ISVA 2WV8A 1EUNA 4XKYA 5K9XA 3W1RA 1IXQA 3M5VA 4M19A 3MP4A 1FDZA 2PRHA 1BTMA 3KRSA 5FEZA 3E49A 2ATSA 4CCCA 3HB9A 3MP3A 3SIZA 4AAJA 5FF0A 5KMYA 4DPQA 3G1SA 3L5MA 5G1YA 1KFJA 3DENA 2CLMA 2WSYA 1OYCA 4Y8FA 3VFLA 3LM7A 4PEKA 3THAA 1YXYA 4RZ5A 1ZY9A 5LGZA 3TU9A 2A1YA 3DFNA 4HSNA 3G1XA 3NPXA 3SJ3A 2F7FA 5F4WA 1L9WA 3TJLA 2P0OA 2R14A 2H3BA 2OT0A 3NL2A 4FXRA 4K7VA 4JICA 1OK6A 4J9JA 3TQKA 1VS1A 4DBDA 3GR7A 2WOQA 3E0IA 4XQ6A 3B0VC 3QSTA 4WJEA 3PB2A 1XL9A 4JTIA 2QUVA 1DJQA 2QUTA 3TSDA 1H7PA 4W9TA 2JBMA 4O1CA 3MHFA 2CLFA 4ONVA 4JR5A 2V0TA 2CZDA 4RZ4A 3AJXA 4WY0B 4JDYA 4POCA 3STEA 3U8GA 4NXSA 3KRUA 4TIMA 1KTNA 3L2IA 4RXFA 5BW6A 1TPFA 4R53A 2ZTJA 3PULA 3I65A 4O52A 3PSWA 2FFCA 1M5WA 1KFLA 3KVKA 1D3GA 3M5YA 5J5DA 2I9EA 1XUZA 3RK8A 3SECA 1ADOA 1AW1A 2VEMA 3KRZA 1F05A 1FXQA 1FCQA 4IUOA 2VFIA 1G69A 4DQWA 4WOQA 3HJZA 3DFTA 1IXNA 4KWVA 3BLEA 3L5AA 3CEUA 5AHFA 2A21A 1FDJA 2VFDA 1UB3A 3IIPA 3PY2A 1ZALA 3R12A 3G22A 3LCFA 3SSJA 2H6RA 3SY5A 3DU0A 3N9RA 1IXOA 1OFDA 3LERA 6ALDA 3G1HA 1S5WA 3DGRA 4NJJA 4Z0SA 3U2OA 1BWLA 2NX1A 2QJHA 3P61A 4RR4A 3W2LA 2Q8LA 1CX9A 3QF0A 1GQNA 3TSMA 1DHPA 3W87A 3W7NA 4AH7A 4CNPA 1SW0A 2NWSA 5CKSA 1JULA 3WK0A 2DZUA 1OK4A 5FF3A 5FEWA 3NQFA 3I68A 5HMSA 1T8XA 4IXXA 3W7CA 2C15A 3BPWA 5I3JA 2X16A 4HHPA 3MBDA 4TX9A 4AXKA 2E6YA 1ZCOA 5EYWA 4ZQNA 5LSMA 4DXVA 2ALDA 2FB3A 1MZHA 3O07A 3QPZA 2V8ZA 3ZWTA 3GK0A 2QUUA 5DCBA 1W5NA 3AO0A 4ZQMA 4Y6GA 2X2GA 3QPYA 1VYPX 3TJXA 3L68A 3M1ZA 2DZVA 4DF2A 2QAPA 4EWND 3C61A 1TPDA 4IMEA 2A85A 2EAWA 1UASA 4GUHA 3S1WA 3HO8A 4WD0A 1KFBA 1B4EA 4FNUA 4BI6A 1W3NA 3W22A 1EWDA 1VLWA 1PVNA 3YPIA 4KFPA 4K38A 1BWKA 3LI1A 2C18A 3HF3A 2YFOA 4A2RA 5LHFA 3W1PA 1GVOA 3HPSA 3EWWA 1DOSA 4ADUA 3BVJA 1GVSA 2ZZ5A 5GVJA 3N73A 3EWZA 4O1DA 2Y88A 2X1SA 1YLVA 3QW3A 3BG5A 3DFQA 3HOJA 3WFAA 5A5WA 1DJNA 5AC6A 1R2RA 3CIWA 3IIXA 1AK5A 1ZNNA 3LBCA 2VEPA 3LHWA 5CSRA 3CT7A 4D2JA 5KZEA 3LCGA 3DFPA 3P60A 1JRCA 5LNRA 1G7VA 3LTYA 4O12A 2GOUA 5FF2A 3TAKA 1TPVA 4BFAA 4O8RA 1A5CA 1TJRA 2Y7GA 1GVQA 2RKXA 4LVDA 3T7VA 5G5IA 1O5XA 2E6AA 2JGQA 5DY2A 3RFAA 4DO5A 2VXNA 3UYCA 1M6JA 4LVAA 3GX9A 4MFDA 1PIIA 4FHAA 4HPXA 4UNKA 2BTMA 4LS1A 1TTIA 3C56A 4RV8A 3BW4A 2GQAA 3FIGA 1YADA 4IPIA 2I14A 3I7SA 4XKYB 1VCGA 1SZEA 1WOAA 1XBXA 2WO5A 3W7EA 4UTTC 3IV3A 4H4IA 1Z42A 2CFFA 3LX9A 3OBKA 3PBVA 5HUOA 1DORA 1LRNA 1KLYA 3E12A 3EWBX 1K7FA 3B04A 4LRTA 3MI3A 2Y7DA 4HN4A 4K39A 4HPJA 3TKFA 4O57A 4UTIA 3G8EA 5D02A 4ZMGA 3M43A 4UFKA 1TTJA 3GR8A 4YXGA 3TE9A 4LWWA 3W2KA 3CIXA 1R46A 3FKKA 4EF9A 1L6WA 3W83A 5L6UA 3IEBA 3T55A 4XWUA 4JTUA 3ABRA 1FDYA 2TPSA 3DH7A 1I2NA 3HIJA 4O11A 4E38A 3TXVA 1VPXA 3KVJA 2H8XA 2E6DA 2V81A 3DFOA 3N2MA 1H50A 1E51A 3IRDA 1QPQA 3HQ1A 4PA8A 1YDVA 2FPTA 1D3HA 5SWUA 3E9AA 4U4MA 2R8WA 3GVGA 4KFNA 2NXHA 3HPXA 1KM6A 1YTEA 2QCHA 3QRHA 2CLOA 1FWNA 1I2QA 1ZENA 3TAOA 3L0KA 4IGHA 1TV5A 4JTLA 1FQ0A 3NQVA 1MO0A 3IGUA 1LDCA 1DVJA 1HO1A 2CW6A 4L4MA 3C0JA 1A5SA 5G1TA 3N2XA 1JCJA 4NX0A 3QMTA 3C3NA 3EXTA 1SUXA 3EKLA 1VLIA 2WNQA 4Y96A 1T96A 4LNYA 2JKAA 3B05A 3GNDA 3W1AA 1QO5A 3P62A 5HUPA 3TH6A 1LLWA 5K9DA 2ZRXA 4ADSA 3KHJA 5D33A 4XTDA 1YTKA 1KM2A 1OJXA 3UY7A 2GVGA 3G8RA 1FX6A 4LVBA 4A29A 2GJLA 3KAOA 4UUIA 5F2LA 3GDKA 3W7RA 1Y0EA 4GXMA 2TMDA 4IQLA 1OF8A 4MYXA 2AQWA 4JX5A 2ZFAA 3UPBA 1F6PA 4LU0A 3S1UA 4JGDA 2QDGA 3EKZA 2NUWA 2V30A 4ADTA 3L0NA 3THQA 5D09A 3GKFA 3IIVA 2VC6A 2OZ0A 3QW4B 1JVNA 4AHPA 1IIHA 5HQEA 3B4UA 4I7WA 3E96A 4PL1A 1WAUA 3VKJA 1F7BA 4LC6A 1JJKA 1LCOA 2R91A 4GRSA 1NVMA 1TPUA 4XBSA 3O06A 3DZ1A 5DN1A 4UTWC 3FA5A 2BZNA 2ZTKA 1VCFA 3DBPA 3F03K 3LCIA 4FIQA 1B3OA 4UMCA 4JTFA 3W7KA 4BWLA 1PE1A 4QISA 1KV5A 2JKEA 1C8VA 3FFSA 1K03A 5D2YA 3W2JA 3T78A 3LDVA 2ZRYA 1AW2A 1M7PA 1OX4A 2ZRZA 4LRSA 4OWGA 4LUJA 2CLKA 4NUWA 1T99A 1FWRA 2R94A 1XC4A 3EXRA 2J88A 4UXDA 3KOFA 2OMAA 5TQLA 3UWVA 4B5NA 3KVLA 4N9BA 5HR6A 7TIMA 1C29A 2WPBA 3G1DA 1H63A 1K02A 5BMWA 1H7WA 2Q3RA 4CQ8A 3W2UA 3MHGA 3RF9A 2H90A 1ZAHA 4JTTA 4A21A 4CNOA 2RDUA 4UFHA 3BW2A 4XTIA 4PTNA 5DCEA 4JYDA 4K6AA 3LHTA 1SR9A 4AVFA 1LYXA 5CPNA 4MPQA 4O0KA 4O18A 2CLIA 3OVRA 2ZRUA 3R5EA 4NNBA 4TO8A 2J9YA 1G7UA 1ZJIA 5D05A 3PUDA 4A3UA 4MZ8A 5AOUA 3TX9A 4UTMA 2WJZA 3NQMA 1V5XA 2NWRA 3Q2DA 3GDRA 3W1TA 4NNCA 2ISWA 5KZDA 3NPWA 4JDBA 4MJMA 3LLDA 4MIMA 5CPLA 1SO6A 2VOMA 4IPJA 3A22A 3LBMA 1NEYA 3CPRA 4NJHA 5BOOA 4NJKA 3L65A 5D2VA 2V2HA 3NVTA 3ZR4A 2TSYA 5L9FA 4BK9A 4C1LA 5K4XA 2YPIA 4UMAA 4HNUA 5K4ZA 4M6VA 3LV5A 1I4NA 1G4TA 1OYAA 2FIQA 1PCWA 2FJKA 4WQ6A 3GZ3A 1VRDA 3GLCA 3W88A 4BI5A 4TMCA 4YL2A 5K7JA 5KSWA 5DXYA 4AHQA 3A24A 1BKSA 4ALDA 1LOQA 5I3KA 3TSBA 4RXGA 2Y85A 4JTGA 1DQWA 2C3ZA 1NFBA 2ZCGA 1G4PA 3W1LA 1G4SA 2NV1A 4ZVJA 2O7SA 1P1XA 5F4SA 3T44A 2GJNA 1O94A 4NVTA 1W1ZA 1ZHAA 2QKFA 4G1KA 4Z1DA 2I1OA 3W1MA 4IXHA 2CZ5A 1SO4A 1SSDA 1JCXA 2ZA3A 1LZOA 3NQCA 4O14A 2O7QA 3A23A 4JTHA 4WXYA 2J9XA 3MP5A 1SO3A 2DU2A 5EY5A 3NM1A 5IBXA 4UFMA 3P67A 3WJSA 4H6KA 3PWAA 2ZZ1A 5D38A 1FUYA 1XBYA 4OE7A 2ABAA 4LV4A 3MI2A 2V9DA 1I2OA 4K7YA 3NQAA 3USBA 1TRIA 5CZTA 5CGQA 3HG5A 1MEHA 1KFEA 1SZNA 2DZWA 1H60A 3IIOA 3PBUA 1T0OA 3C2RA 5D30A 4Q33A 1V7YA 1OFEA 1UCWA 4O13A 3GKAA 5D04C 2C19A 3ANYA 1AL8A 2A7RA 3ABQA 2CWNA 2VEKA 4JXCA 4QNWA 2ISSA 1QOPA 5FI8A 1W5MA 1XDLA 4FEZA 2NXGA 1FXPA 4YLWA 1GVFA 5G4EA 3PBYA 3W7HA 2A7NA 3GAKA 3P8JA 1SFLA 1HL2A 1WXJA 3TUUA 4HNVA 1RD5A 1VHCA 5CPOA 3W7QA 4WX2A 4ZZ9A 1OFRA 1PL9A 3O05A 3W7IA 2WNZA 5FEXA 4TR9A 2TRSA 1X8FA 3UWQA 4GJ1A 3E02A 4FNTA 3QH2A 4Z1BA 1MEWA 1NSJA 1ICSA 3PG9A 1W37A 3ZWSA 3O6CA 3P7YA 4OGZA 2QAFA 3MBFA 1QPRA 3W23A 3UPWA 1GJPA 1SPQA 5T26A 3M44A 3M6YA 1XFBA 3S5NA 1TPB1 2HS8A 1PCKA 2YX0A 3CC1A 1LROA 4JYEA 2GUUA 1KTCA 2C0AA 4AMAA 3L5LA 5C6MA 4WY0F 2B7OA 3NXFA 4E2BA 1TPWA 3ELFA 3KXQA 4ML9A 2D73A 2QCDA 4FX6M 3PG8A 2E5CA 1O4UA 4LS2A 3S6DA 4DO4A 2AGKA 3V1PA 3PAJA 1KM5A 3JR2A 3SR7A 1I45A 1YPIA 2EF9A 2Y63A 3L66A 4GNJA 5D2WA 1ME8A 1JQVA 5AHIA 4MJZA 3W86A 4O16A 5EMUA 3NQGA 1P0NA 3G0XA 3QMSA 4QJ1A 3C52A 1UUOA 4ORMA 2V2DA 3IGXA 2FLIA 3M0ZA 4UC5A 3CLMA 2QCNA 6TIMA 1IF2A 3K30A 1EP1A 1EUAA 3MHUA 3KVMA 4LUIA 1M7OA 2UV8G 1N8FA 2GVLA 3GDLA 3I6RA 3W7MA 3FLUA 4JY8A 3C2EA 3N3MA 1Z48A 1XCFA 1JCYA 4K37A 1TCDA 5EKYA 1SW7A 3T4CA 1W5QA 2NV2A 4GUGA 3LTPA 5K9CA 2GQ9A 3HGSA 3IVUA 1XM3A 3W2NA 3B0UX 3C8FA 4Z0JA 3HGRA 3O16A 2VKZG 1FCBA 2Y89A 3NAVA 1H1ZA 1KBJA 4JNMA 5BRBA 5LNSA 3NYZA 3N19B 4ICNA 5EPDA 1H61A 5F2IA 2WSQA 3P82A 1TB3A 3TDFA 5LKYA 1GVRA 3OA3A 1TQJA 4LVFA 3TIMA 1KW1A 1RQHA 5AC7A 3W9ZA 1IGSA 3L0GA 1SZGA 3R89A 3HGJA 3UWZA 1VGAA 4Z1CA 1X1ZA 4UTLA 3H54A 3NGJA 4O19A 1KBIA 2Z6JA 3TK7A 1JUEA 3LHUA 5KITA 3BARA 4S2CA 5C54A 3NQ2A 4AHOA 5H91A 4P61A 2TYSA 2V82A 4LOCA 4QITA 3TW7A 3BLIA 1KM0A 5TBOA 3SZ8A 2BLEA 1G4EA 1O5KA 5HULA 1YYAA 1VCVA 8TIMA 4FB7A 2A6NA 2W6RA 2CLHA 4UMBA 5DELA 1R2TA 3QSRA 3QMRA 3N34A 2PRMA 3QC3A 1K8YA 3OHIA 1HG3A 3EB2A 2Z6IA 1W56A 3SGZA 2JKPA 4IMCA 2Q3OA 3EWUA 4GUFA 1S5TA 2B7QA 2ZRWA 4N9CA 2EGZA 1VYRA 1TO3A 3DHFA 3IVSA 1WBJA 3W74A 5CZJA 1W5PA 3QQ1A 2KZHA 2E6FA 4N6FA 4PC8A 2G96A 1JCNA 2OJPA 4M7SA 2FB2A 3EX2A 1XXXA 4CQAA 3Q94A 3G18A 3LRLA 4ZQPA 5DLCA 3UQNA 1U5JA 2A0NA 2ZDRA 4JTKA 4R34A 3NL3A 1O60A 2Y61A 1GTEA 3LRKA 4WUIA 3W1XA 1XKYA 1QO2A 3CTLA 2DZSA 3O15A 2A6LA 3C2OA 4K36A 4N9EA 3GIYA 3S8HA 3NDOA 4AB4A 4FNSA 1ME9A 4UR8A 2YZRA 3BG9A 1LTDA 1QMLA 2NUXA 4LTSA 2X1TA 4LV9A 4MY9A 1H1YA 3LHVA 1GG0A 3W71A 4FNQA 2W79A 4JTSA 4O50A 4C1KA 2VEIA 2FTPA 1H51A 5DBUA 1NF7A 5E1QA 5BNKA 1W3TA 2ZA2A 1W8SA 1UBSA 3NQDA 4UTHA 4RZ6A 1JRBA 5HWMA 3W07A 5AHMA 3F4NA 2RDWA 3UY8A 2FDSA 1EB3A 2Y7EA 4NZJA 3UD6A 4RX0A 2YW3A 1EWEA 3KFTA 3NR0A 5DY3A 3I7QA 2Q8ZA 1HFBA 2ZA1A 4RK8A 1X1OA 1FBAA 2QCGA 3LXAA 5CZ0A 4IOTA 2VFEA 4FNPA 1AL7A 1GG1A 3TV8A 3GDMA 4QAIA 2B7PA 4GFSA 3UZ5A 5HWNA 3PF3A 1H7NA 1NF0A 3BW3A 3R13A 3PUEA 3OG3A 3M41A 3WK2A 1SFJA 1JUKA 2HMCA 1H7XA 1KA9F 1TREA 1GEQA 5AB3A 3WK1A 3O63A 4JIQA 2P1FA 3NEVA 1UUMA 4N6EA 4JX6A 2VELA 2OT1A 1W0MA 5AHLA 4R33A 3UXAA 5D37A 1PHWA 1LOSA 1XBVA 1XI3A 4X2RA 3W7JA 2B0MA 3NOEA 4UFLA 3IIZA 3A5VA 4O17A 3BK0A 2QCMA 3NZRA 1FY6A 3GAYA 2FPVA 3HG2A 3HPZA 2A2IA 4GUIA 4OBTA 4UTJA 3UXDA 5MHBA 2QCDB 3G0UA 1ONRA 1HUVA 1TSIA 4AWSA 3WJXA 2QJGA 1TIMA 4JTEA 5G2HA 3BV4A 2B7NA 1W3IA 2FPYA 3PM6A 2YXGA 1LRTA 1K7XA 4IX2A 1FWSA 5D03A 4NNAA 4DO6A 4O15A 3F1QA 4UFJA 4UTKA 1TMHA 2OX1A 4MOZA 1KFCA 2CLLA 1QCWA 3WJYA 2ZZ4A 1YXDA 3EX6A 3NO5A 1ZAIA 1FCUA 1N55A 5AFDA 2DP3A 3VNDA 4RKAA 1KM4A 2YCEA 5ABTA 1GTHA 1KV8A 4Q32A 4DEFA 2VFFA 5EL1A 4JIPA 4OV4A 1OHLA 1VYSX 3W84A 4GC4A 4NXKA 4TU1A 1LORA 1DKWA 1TPC1 3G1YA 4OT7A 3ZS4A 5FF7A 3PC0A 1PS9A 1ME7A 1YTDA 3W85A 1GPWA 4ZL1A 1OFPA 3C4UA 4HIBA 1I8JA 2NLIA 1J4EA 2F84A 4O54A 1OX5A 3JRKA 1TTQA 2VENA 3EXSA 2QCCA 5C2XA 2X30A 1UJPA 3O1NA 1QNVA 4ZQCA 4UFIA 3Q58A 1EPXA 5DBTA 4EVZA 2DZTA 3MJYA 3TC6A 3M5ZA 2Y70A 2PCQA 1WX0A 1QOQA 1LOLA 1X7FA 5D2TA 5AHNA 1HTIA 4S2BA 4RCXA 5AC8A 3G1AA 2RFGA 3VCRA 3BGJA 4FIRA 4O0ZA 1RR2A 4MUZA 4JS3A 3W72A 3FOKA 1Z44A 3GXTA 2DORA 3UWUA 5I3IA 3W1NA 5K3VA 3TROA 1JCLA 1QAPA 3KX6A 4IMDA 3VI2A 1D9EA 1JQXA 1MEIA 3PBWA 2B4GA 4O1AA 4OU1A 3MUXA 5HWJA 3S5OA 2IQTA 4L4LA 2QCEA 4BI7A 1F73A 4QSHA 5F2MA 1SSGA 3U6WA 3QZEA 2YFNA 5H2ZA 2DJXA 3CWOX 1FWTA 3NPVA 1BEUA 4MZ1A 1SZFA 4I7VA 1K8ZA 1OYBA 4JY9A 3M7WA 5TIMA 4IMFA 3OVPA 3PSVA 1OVDA 1FWWA 3WK3A 3EEGA 4QM1A 5LNVA 3M47A 4O28A 3LXCA 4WOZA 3P5ZA 1VC4A 2J27A 1K7EA 5I3GA 2AAMA 2C14A 3DXIA 2A5HA 4IX0A 3P8IA 2PRLA 2NX3A 4YCPA 3B06A 1TPEA 3JS3A 1F6KA 2QCFA 3MMTA 1K3UA 3TQ0A 3LRMA 1WV2A 1Z41A 4JTJA 2RH9A 3HG3A 3C6CA 4E0CA 3B03A 4FXSA 4S1FA 2OCZA 3ATYA 2VFGA 2YDAA 5HJLA 3CEPA 3FJ6A 1P4CA 4MFEA 2YSWA 3H55A 1I2PA 3UWWA 4E2DA 1GYNA 1TRDA 1P5BA 1C9DA 4NX5A 3HMJG 1OABA 2H8ZA 4LS0A 2YW4A 1SO5A 3B0PA 1SU5A 3NQ8A 3TR2A 3VE9A 1DQXA 4PODA 4Z1AA 4UCGA 2C16A 3W6YA 1WYIA 1CI1A 1EX5A 2WKJA 4XBKA 1F5ZA 1EEPA 5EBUA 4MY1A 4X9SA 2CZEA 5CZSA 3R2GA 3CU2A 2E77A 4P2VA 2PE4A 3MWAA 3L21A 3GXPA 4O4WA 1EP2A 2J24A 4HNTA 4AWTA 3PR2A 4UNLA 5D2XA 3N14A 4NJIA 3BLFA 1FCVA 1LM1A 2A7PA 2EHHA 1IXPA 4N02A 4IMGA 3LHZA 1VH7A 4ORIA 4BF9A 3LOTA 5G2IA 1S5VA 4CNNA 1EA0A 1KM3A 4A22A 4DELA 4RJEA 3S1XA 1XUUA 5E93A 1LLZA 3FS2A 4PFMA 2ZYFA 1S3HA 3MW7A 3B8DA 4A2SA 4EF8A 3CM4A 2W0UA 3W73A 3WJZA 1P0KA 3C2FA 2C13A 4GUJA 3A21A 3TCEA 3GDTA 1ZFJA 2CLEA 4N2YA 4QIUA 3PVFA 3P74A 4DBEA 4M5PA 3UZJA 5G4WA 3ABSA 1DV7A 2V2CA 1W5OA 3W7GA 3SI9A 2X1UA 2NUYA 1OFQA 2Y7FA 3PB0A 5IBXC 1A5BA 5BMXA 4MYAA 4N4QA 2XFWA 4PCFA 4MZYA 3NL6A 1RPXA 4LT9A 2BXVA 1QDSA 2H3DA 4NT0A 4QNEA 1TTPA 3DHDA 3VE7A 4JN6A 5DCDA 3W2MA 1ML1A 4O4VA 1OX6A 3G1FA 5CPMA 5F4XA 4YWIA 3SW6A 2LLEA 3TNOA 1LBFA 3G0SA 4UTTA 4EOUA 1OX4B 2G97A 3W7OA 1MXSA 2EPHA 4KKXA 3BO9A 3STGA 3LB0A 2QJIA 4FX8A 1H5YA 1GWJA 3EWXA 2XN2A 4DPPA 2C1HA 3QQ0A 5I3FA 1RQEA 2YYUA 3QYQA 2E1DA 4M6PA 1GZGA 2ATMA 2E68A 1R47A 2DJLA 3W3OA 4XZ9A 3BGGA 3IVTA 3ABOA 5F2GA 1GT8A 1RZMA 2GQ8A 5LHEA 3R8RA 4AF0A 5LNUA 2JK2A 5U7SA 2ABBA 3MYPA 2QR6A 3S1VA 3I7RA 2BWGA 1LBLA 3P84A 2BX7A 4CLMA 3CQ0A 3CHVA 2BSLA 1H62A 4AEOA 1A5AA 1J5TA 1N7KA 4LVGA 3PUOA 3Q37A 3FKRA 4MLJA 3S5ZA 4I7UA 2XN0A 5F1UA 2Z0IA 3O6YX 2QF7A 4NZFA 1SW3A 3HGOA 1XBZA 5AYZA 2Z1BA 5C55A 4MKNA 2HS6A 1G67A 3EX4A 1K8XA 2PURA 3TFXA 2ZZ6A 3P5YA 2EKCA 4O53A 3TA6A 5I3HA 3MO7A 2Y62A 2V5LA 3G3MA 2E5DA 1ZAJA 1HO4A 4UIOA 3CWNA 3W76A 4H3DA 3STCA 4PL2A 3H53A 3G24A 2NZLA 1OG0A 3LXBA 2J9ZA 4M7TA 2P10A 1O95A 4JEQA 1A50A 5U4NA 3RLUA 5FF4A 3OIXA 4Z08A 3TC7A 5HR7A 1VR6A 5D32A 4MY8A 4QQ3A 5DXXA 5AN7A 3W7DA 5KTLA 3RLVA 4BR1A 1I2RA 2FQIA 5AYXA 4DF1A 4FNRA 3WJWA 4YMZA 3TMLA 2G5WA 4CCDA 4WZHA 1YPFA 3FJLA 3S9YA 5KZMA 2GPTA 1W31A 5HINA 3M16A 1KM1A 3HBLA 1Q6LA 1VJIA 2V5BA 1L6SA 3LCXA 1CW2A 1JCMP 1QPOA 4HT3A 4NJGA 1L2UA 3PS7A 1KLZA 1JUBA 3N9SA 4Q4KA 4HKPA 2Z2UA 1DL3A 1AW5A 1LBMA 1IIGA 3LCWA 2WSRA 4U28A 3RU6A 3L67A 4JX4A 4ZQOA 3FYPA 3TQVA 4UTWA 4LY8A 1OF6A 2HTMA 1A53A 4RLIA 3G3DA 2GVJA 1F76A 3TFCA 4I9AA 5KINA 4UR7A 2XN1A 3LGEA 3INPA 3LHYA 1YDNA 3ATZA 4OHQA 3RMJA 3NQ7A 4CCEA 1OFAA 1B57A 1Q45A 2DZPA 4FF7A 2QCLA 4WY0A 1RV8A 2JGYA 5FESA 4IJBA 4ZQRA 3W7PA 2ZRVA 3O6DA 4EIVA 1OFBA 3S42A 5CSSA 1QPNA 1Q6QA 3MYOA 1YDOA 3T40A 4OV9A 3A9IA 3FEMA 1ICQA 4PH6A 4TMBA 4K8HA 2NXIA 2ZZ2A 1TV8A 3DAQA 4GBUA 2WNNA 3DKLA 2ZBTA 1TQXA 4XUGA 3W1UA 2ZZ3A 3M9YA 3RNDA 3UWYA 1OFOA 1R2SA 1LP6A 3S0CA 1GYLA 1TV7A 1TYGA 3NNTA 2ZQ0A 1R30A 1RQBA 3W70A 4GE8A 3UNDA 2C6QA 5K2ZA 3TMQA 1WOBA 3W7LA 2CU0A 1KTBA 5LNWA 1ALDA 3EWYA 3TW6A 2DZXA 1U83A 3EX1A 1MSSA 3BG3A 4N9DA 4Y90A 5EA9A 3TXZA 2NX9A 3W1QA 1B4KA 1NAL1 3OEXA 4GWEA 4KFOA 5E0KA 4JD4A 3EX3A 2VFHA 5IM51 1X6UA 1WQ5A 1WDWA 1QWGA 3LCHA 4HSOA 5A8GA 1THFD 4CQ9A 4X3ZA 4OQVA 1PHQA 1EP3A 3NQ6A 3CB8A 4YCOA 1JR1A 3C2VA 4LC8A 1PV8A 3FYOA 3GNNA 4O10A 2PC4A 3IGSA 4N4PA 3L9CA 3OVQA 1J2WA 1TPH1 3A5FA 3V75A 2CZFA 2X1RA 1QFEA 1QR7A
chains in the Genus database with same CATH superfamily
1PDZA 1L6YA 3M5XA 1VHNA 2DV0A 4L1GA 3KE0A 3BV7A 4IIGA 4GY7A 1R3SA 2PODA 3UJEA 1LWIA 3LCLA 4MM1A 1HKJA 4OIFA 1GOXA 3QFEA 3W0KA 5AYYA 4ICCX 4MKSA 3P81A 3P80A 4XD5A 3OW1A 1Q6OA 5LZLA 1H7RA 4K8EA 2EQDA 3WD0A 4EXQA 3A64A 1XDMA 2YYTA 1LRQA 2F9RA 1HJVA 3QGAC 3M0IA 2WMIB 2GL5A 2XIQA 4G56A 4XIMA 3I3DA 1PKNA 4X22A 1XHGA 1ZZMA 2G95A 3L23A 3VPLA 1QHOA 1GOOA 4G2DA 2OGJA 4DF0A 2VVNA 4GG9A 1WP6A 1O1ZA 1AMKA 3L4WA 2F61A 1KFWA 3ENLA 4L65A 1EYWA 4PMVA 4ZE5A 3HG4A 3QHNA 3P0WA 1IQ8A 3DI0A 1MYRA 3KBJA 3LI0A 3KBMA 4G7FA 3LZ5A 3LLFA 3RLGA 2J6XA 2J77A 2IMRA 1WBHA 3QM3A 4H8HA 5HNNA 4MWAD 3QEZA 3OYZA 3CZGA 4YPJA 1IXQA 1T41A 1BTMA 3MCMA 2QUNA 2CHNA 2ATSA 3HB9A 3AROA 4GC3A 1JDDA 2WVUA 3MP3A 1Q13A 3V0TA 5KMYA 4P7OA 4DPQA 3L5MA 3M7SA 4V15A 2ZC1A 3B3DA 1YQ2A 5REQA 3QHOA 3E5BA 1XINA 3GW0A 4D6IA 4PBFA 1L9WA 3TJLA 3FYYA 1B3WA 5A6BA 3URQA 2OT0A 4FXRA 3VTRA 2QW5A 4HZ8A 4GVHA 4K7VA 3SUSA 5A6KA 4J9JA 5D9NA 5JU6A 3TZFA 3GR7A 2ON3A 2QJMA 2QUTA 2J7CA 1V3MA 3AIRA 1V8EA 3GIPA 1NQKA 2CLFA 5AZ0A 1W9XA 3SUTA 2V0TA 1BGGA 4DXKA 2WVSA 4GIRA 3U8GA 1W32A 4TIMA 1KTNA 4YYFA 3P0XA 1LL7A 3OG2A 1TPFA 1TZZA 5D8WA 1R6WA 3UGVA 1JFHA 4R53A 2ZTJA 1CBGA 5FJIA 4IQEA 5GJNA 1M5WA 5KETA 4GI8A 1KFLA 3KVKA 3WFZA 2WM1A 1XR2A 4LALA 3A47A 3SECA 3TYAA 3BOFA 3H7RA 2ONEA 3FX4A 4DBSA 5FJRA 4RW5A 4AUBA 1VFLA 4IUOA 1ZU8A 1PDYA 1CB7B 4FOJA 1GOKA 4ZXLA 4DQWA 3HJZA 5IFTA 1GQIA 2A21A 3PAOA 3QLLA 1YBQA 1EHNA 3SSJA 2C0HA 5LA0A 3SY5A 2OWWA 4W8BA 1S5WA 4CUCA 3U2OA 1BWLA 2GJXB 2QJHA 5HANA 3W2LA 4YJ5A 1J0JA 2Q8LA 3QF0A 2HBVA 1JYXA 4AH7A 4CNPA 2NWSA 3WEMA 3F2BA 3WK0A 2VGGA 3WELA 1MI3A 5F7UA 3NQFA 3I68A 3AI0A 1T8XA 1I0BA 5I3JA 1X7IA 4MPKA 3VKDA 4B9YA 5EYWA 2OXNA 3G1RA 2QV5A 4GD0A 2ALDA 1D3CA 2WMFA 3AU2A 4PMDA 1LT7A 1W5NA 3TN5A 4ZQMA 4Y6GA 5CCZA 3SCUA 3TLQA 4B5VA 5EMYA 1UASA 4JNYA 3B97A 2XINA 4HCHA 1B4EA 4C6KA 4DWSA 3D47A 1PVNA 2FTWA 3GVVA 1BWKA 3LI1A 1CGWA 1EF2A 3I6EA 3VIJA 4BHYA 4ZB5A 3KOZA 3HF3A 5LHFA 2DGAA 1O6IA 4EANA 5AZ1A 4ADUA 3VMPA 1GVSA 1V0NA 4NAFB 2C8NA 3CASA 2X1SA 3HOJA 4X2PA 1IEVA 3TJ4A 1R2RA 3LHWA 5I3DA 4HA3A 2C1IA 1HVQA 2VRQA 3GY1A 1QNRA 3WMLA 2WKGA 4IIFA 4TV6A 4W8LA 4C5ZA 4EAYA 3EOUA 2PU0A 4O8RA 2OZTA 3AHVA 2VGBA 1GVQA 5G5IA 4S3KA 3GUGA 2JGQA 4D71A 1TCMA 4DJFA 2VXNA 1CTNA 4LBRA 3NXLA 4MSSA 1M6JA 3GX9A 2DT3A 4LB4A 1UG6A 2PZ0A 5T91A 3TR9A 3WQ6A 3W02A 1XFCA 1TTIA 5ABHA 3E0LA 1F8IA 2VC7A 3O6AA 2G8ZA 2VDHA 2WO5A 4LJ3A 3W7EA 1VBRA 1P1MA 5B7YA 3BAKA 1XD1A 3PBVA 2PB1A 2Q8XA 1DORA 1KLYA 1VBHA 1M68A 3EWBX 3UJ2A 4LRTA 1ZQ5A 4YTQA 2Y7DA 4IZGA 4JKMA 4OFCA 4HPJA 3TKFA 2VC9A 4UTIA 3G8EA 5D02A 1IEIA 1YHTA 4WKFA 3BC9A 1QWKA 3W83A 3ZSSA 4XWUA 1FDYA 2BY1A 4J4KA 4E38A 2HXUA 1DTUA 1AZ1A 4BQ4A 4H8UA 3BLOA 2E6DA 1KXVA 4Q8MA 2OWXA 2Z28A 3PBGA 3S46A 3PWGA 1PXGA 4WDWA 1O12A 1XG4A 1E5JA 4U4MA 2PC8A 2XSAA 3DGBA 4D6FA 1WDDA 3BAJA 3QRHA 2CLOA 1GGOA 3TAOA 3L0KA 4IGHA 1TV5A 1PB0A 1P7TA 2OYLA 1FQ0A 3IGUA 1LDCA 3D3FA 4L4MA 3FA4A 1XYLA 5CGMA 1JCJA 3T0DA 1SFTA 3C3NA 4LXFA 2P53A 5E09A 3RRAA 1QVBA 1VLIA 3AS2A 2WNQA 1QOXA 2PF0A 4DI8A 4R5EA 3B8SA 2HK0A 4W89A 5D33A 4XD3A 1A5KC 1YTKA 2PDIA 1JZ3A 2Y1HA 2OO0A 4E6MA 1FX6A 2GJLA 4JEJA 1KBKA 1R3VA 3GDKA 3E1F1 3EDEA 2YLAA 2DUXA 4JX5A 4L5ZA 1MFVA 2GZXA 4DBWA 4L64A 4JGDA 3T8LA 4ADTA 3THQA 3IIVA 2VC6A 2OZ0A 1AA1B 1DWGM 2FKPA 5HQEA 4GO9A 2ZKMX 1WAUA 4PL1A 3VKJA 4KIRA 1NVMA 1TPUA 4M56A 5DN1A 4UTWC 1G1YA 1VCFA 2E7FA 1B3OA 1FH7A 4ASTA 1ADSA 4HYRA 1K03A 5CC7A 1CLKA 2QQ6A 3R1ZA 3HV9A 4LRSA 4OWGA 4LUJA 4NUWA 4QHRA 1FWRA 3EXRA 2YCKX 3PJXA 1LUCA 2X41A 3KOFA 4ZOBA 4DAIA 2DZAA 3II1A 4N9BA 3C2YA 3RX3A 4EK7A 1V6VA 3K1GA 7TIMA 4MMWA 5BMWA 1K02A 1H7WA 3MHGA 1ZAHA 1H09A 4JTTA 4LH8A 4A35A 4CNOA 2RDUA 3WD4A 1GZ1A 4XTIA 4AVOA 3N12A 3VA8A 1FHVA 4HA4A 1Z3NA 4AVFA 1WCGA 3VOHA 5JIPA 4MPQA 4DN1A 5DMNA 4P8UA 2J9YA 3WF2A 1ZJIA 5D05A 3ZJ6A 2OELA 4A3UA 3GNRA 8CGTA 3NQMA 4FF5A 3U2EA 1A3XA 2GWGA 3RXZA 5KZDA 4KPLA 1NFPA 2CETA 4G6CA 1SO6A 2VZUA 1NM9A 1ZBWA 5D9PA 3A22A 3E5PA 3RM8A 2PTWA 1XCXA 3QTPA 3M0JA 4ZTXA 3L65A 4ERIA 4HMDA 1JPHA 4C1LA 1J11A 2YPIA 5K4ZA 5I02A 5HATA 1I4NA 2BOGX 1YNQA 2FIQA 2J4GA 5I77A 1PCWA 2GFTA 1G5AA 3VIMA 2D2OA 4B3ZA 5H8PA 4YL2A 5K7JA 5KSWA 3HZ3A 3A24A 4Y9MA 1BKSA 3SSZA 4ALDA 3AXKA 2NV1A 3EGJA 4Z2JA 2O7SA 3MUY1 4AD4A 4PUMA 1UJQA 2WVVB 4Z1DA 3DG7A 1W1B1 4AIEA 1WNOA 2CZ5A 2OTDA 3P2VA 4AZCA 1SSDA 3E74A 2PWFA 2REQB 1UHVA 2O7QA 3BSHA 3GTIA 4JTHA 4WXYA 2J9XA 1EJ7L 1SO3A 3V5CA 1REQA 4EXBA 1KKOA 3DX5A 4WVXA 3PWAA 3RM4A 1NH6A 1XBYA 1YRRA 2V9DA 1W6TA 3SFWA 5XIAA 3H24A 1HX0A 3HG5A 2VR5A 4WK9A 4UQDA 2J8GA 3R0UA 1H60A 4D6DA 4Q33A 1V7YA 4FLOA 4C91A 1YNPA 1Q85A 1ISWA 4L7ZA 4AZGA 1BYAA 3ABQA 5JMUA 2CWNA 2VEKA 4B3KA 3AXXA 4G5DA 1UKQA 3DCPA 3LEPA 5JBFA 1WE5A 5FI8A 4FEZA 4YLWA 5EMKA 3GAKA 4CQBA 1FWCC 4FXJA 3CL6A 1GK8A 1RD5A 1VHCA 1RAKA 4DZIA 5EMJA 3MO4A 2FZNA 2G50A 1PL9A 3VNYA 1YIXA 1A3HA 4CNUA 4FNTA 5LIUX 3SDOA 3QH2A 1UR0A 1PKLA 2VR4A 1ICSA 3OZPA 2J75A 5XIMA 3P7YA 1QPRA 3WL0A 1GNXA 5C9RA 3R25A 2WYSA 3S5NA 2C71A 3VNKA 4HA0A 1LROA 3PFRA 2GUUA 2B7OA 3NXFA 4H8NA 4RUBA 2P8CA 1CGTA 1I75A 3AHTA 3QC0A 4A05A 4PTWA 3G5EA 2NVCA 1UWTA 2QCDA 2CBJA 2E5CA 4CD7A 4LS2A 5B7ZA 3CUHA 4DO4A 2R1KA 1NIUA 3GH7A 3ES8A 1I45A 4GNJA 4B4HA 4A6GA 5BU6A 4MJZA 4O16A 1P0NA 3C52A 4ERGA 4ORMA 3NO3A 3M0ZA 4H01A 4UC5A 1FKXA 1Q4WA 2PDWA 3BLLA 1EP1A 1XYAA 5CG0A 3KVMA 4LUIA 5H6HA 1RPKA 3W7MA 1DWIM 5MF5A 3FLUA 1JDEA 4JY8A 1RCXB 3OZYA 1Z48A 2CEQA 1XCFA 2HK1A 4W93A 3VKKA 3TN6A 4H1ZA 3I6TA 1W5QA 2V63A 2WXDM 2WJEA 3CQHA 1XM3A 5C9UA 1XLCA 3B0UX 1XLIA 3CQKA 1JI2A 2WC3A 3HGRA 1FCBA 1OD8A 4RE2A 1H1ZA 2OODA 5BRBA 3N19B 4DJEC 3CTTA 5EPDA 2WSQA 3P82A 1TB3A 4J1OA 1U5HA 3OA3A 1TQJA 2W62A 4L6HA 3V0SA 1XLDA 3SURA 3AMKA 1RQHA 3VNMA 1IGSA 2DSKA 1HJXA 3HGJA 5C0QA 1VGAA 4O19A 1KBIA 1JUEA 5A2BA 3LHUA 5B80A 3NQ2A 3PK7A 5HA7A 4P61A 2V82A 4ZGYA 1DJIA 3TW7A 2WZHA 3SZ8A 1S5MA 3FA3A 4S3FA 1G4EA 3KEHA 5HULA 8TIMA 1DWAM 3U57A 4FB7A 1BXCA 2W6RA 4UMBA 3N34A 4JKKA 1HKKA 1IT8A 1K8YA 2J6VA 3EB2A 2Z6IA 2QMJA 2VDIA 3VIKA 3LBOA 3FGCB 4GUFA 3GW3A 4QRNA 4N9CA 2QGYA 3USZA 4DX3A 3H12A 3UZZA 3WIJA 4F2TA 1BVWA 4LX4A 5CZJA 3MCNA 2FB2A 1XXXA 1S2WA 1JI1A 3Q94A 4RDWA 4BQ5A 1XSJA 4AMCA 1UMLA 2Y61A 3LRKA 2W63A 4M0XA 5HBFA 2J62A 4FNSA 2QIIA 1W9UA 3BG9A 2PCEA 2IPJA 1QMLA 1PTDA 3ES7A 2X1TA 3WSUA 3LHVA 1Y65A 3RPMA 1XPYA 1E0TA 4FNQA 2W79A 2ZUTA 4UCFA 1QI3A 2GK1A 4OTKA 1HKVA 3DDMA 1NF7A 5DBUA 5E1QA 5MKGA 3N4AA 2ZA2A 1UBSA 4BA0A 2UY4A 1ONEA 1W3JA 1SJDA 3F4NA 3UY8A 4NZJA 3SY1A 4IP7A 1EWEA 4QEHA 3KS6A 4MAZA 4US6A 3NR0A 2FH8A 1FH9A 3I3EA 3PZUA 4FI4A 3NZPA 2ZA1A 2X7VA 4GNVA 3LXAA 3PZMA 1AL7A 1GG1A 4QAIA 1GOIA 1BAGA 4J3VA 2B7PA 4GFSA 3UZ5A 4PEEA 2KX9A 1H7NA 7XIMA 3VNIA 3BW3A 1IEWA 3OG3A 1EL3A 1JUKA 2HMCA 3EAUA 3ZOAA 1H7XA 3GHRA 3EA3A 4DI9A 5AB3A 2V5DA 3WK1A 3RX2A 4CEUC 3NEVA 4N6EA 1QI5A 1W3KA 5C7HA 4JX6A 2P8BA 2OT1A 1WUFA 4IP4A 4HOZA 5D37A 4XV0A 1GZJA 1PHWA 3SIMA 1TE1A 2PGWA 2WAGA 2BOFX 1J0YA 1XI3A 5RUBA 3W7JA 4KRTA 4YHEA 3NOEA 3QV8A 3VNLA 3IIZA 1CXLA 3KTSA 4IJRA 2A2IA 5MHBA 1E6XM 3BZGA 1ONRA 3G0UA 2IKGA 4PUUA 3LSBA 3WJXA 2QJGA 3CL7A 3BV4A 1W3IA 2FPYA 4LUSB 1S38A 1P6WA 5E5CA 1K7XA 4IX2A 1US0A 2ZWZA 3AIBA 2GWNA 3B8TA 1R3QA 3V3WA 1TMHA 4AIBA 2QV4A 1OG6A 7PTDA 1FCUA 2BB0A 4RKAA 1KM4A 5ABTA 1UWUA 1KV8A 4DEFA 4HU4A 4PRWA 5C71A 4JIPA 3VK5A 4IL0A 3W84A 1W17A 2OSWA 3KHDA 4TU1A 1W8GA 3IJIA 1M04A 1TPC1 3ZS4A 5A2AA 3OLIA 3PC0A 1ME7A 5T9CE 4FOKA 1OFPA 1XP3A 5M03A 2NLIA 3RJYA 4CVWA 1GEHA 1LT8A 4F0KA 5FSDC 1FRBA 1AD4A 2X30A 1UJPA 4JQ3A 4ZQCA 1G94A 3AMDA 1C92A 4R88A 4EVZA 4BS0A 2Y70A 4KCVA 3WD3A 2PEVA 1QOQA 4TTUA 5AHNA 3VC5A 1OINA 4S2BA 5AC8A 4NSBA 2RFGA 3BGJA 2FHFA 4NI3A 3OGRA 1QI2A 1R3TA 3EDDA 3GXTA 4HPHA 3O9NA 3RN6A 4LAMA 4JQAA 3B40A 4IMDA 1KRCC 2PDHA 2HCVA 1MEIA 2B4GA 3WNPA 1LF1A 4WDXA 2IQTA 4DJDC 2HVNA 3DN5A 2O56A 1KGXA 3VX0A 4YNGA 1X97A 4QSHA 5IHRA 5H2ZA 2HZGA 3CWOX 1FWTA 4IPPA 3NPVA 1MRAA 3SUWA 3M7WA 3RO6A 5TIMA 3PSVA 2NQ9A 1FWWA 3CPUA 1BLIA 1EEXA 5GJPA 1KC7A 4QM1A 3U2CA 4QG6A 3WDPP 4GYKA 4HK5A 5A8OA 3N4FA 1PSCA 2XM2A 3WO8A 3AYVA 3DXIA 5BWAA 4WDUA 4IX0A 1LQ2A 4YCPA 1TPEA 2BNJA 3QV7A 3RO8A 4M1BA 4LUTB 1RJRA 1DTNA 4ML4A 3KCOA 3E0VA 4C6PA 2I5GA 3LRMA 1WV2A 3KL3A 3UG3A 4WR3A 4JTJA 4JFVA 4MJ2A 2FZ8A 5J04A 2NQJA 4IG2A 2VFGA 5HJLA 3WLRA 3CEPA 3FJ6A 3DHPA 4V1XA 2NSOA 1FFRA 1I2PA 4PMYA 5HAOA 3ARYA 4FXFA 1C9DA 2VZTA 5DMLA 1G0CA 1OABA 2WBGA 5ABGA 1SO5A 5JH2A 2ZX5A 1SJBA 3NQ8A 4G7EA 1DQXA 1GOWA 3W6YA 1WYIA 1CI1A 3AMLA 3H2CA 4X9SA 3GVQA 4PMOA 3R2GA 3APTA 2E77A 4HNLA 4M3PA 3VD7A 3L21A 3EPOA 1J01A 4OOUA 5D2XA 5AVHA 3N14A 4NJIA 3BLFA 1FCVA 4NKCA 3LHZA 1SM9A 3P6LA 1KM3A 3RCMA 4A22A 1UR4A 5CZKA 1XUUA 4QBXA 1EO7A 2IUZA 3GH5A 3RUBL 4AEEA 3AYSA 4MB1A 4A8NA 2BXYA 1EBGA 1U22A 2ZYFA 3VILA 4A2SA 5JXQA 2D0GA 5FCZA 4Q3MA 1QNPA 2VEFA 3TCEA 3GDTA 4OECA 1KWKA 4GQ0A 1QW7A 3P74A 4PMXA 3N2CA 4RNHA 1RBOB 3UZJA 5LXXA 3VC6A 3ABSA 3NOYA 1W5OA 2X1UA 1ZSXA 5IBXC 1A5BA 1V0MA 4HPGA 4W5ZA 4MYAA 1PTGA 1TJ2A 1IR1A 2XFWA 1NDYA 4LT9A 2BXVA 1JNEA 4C60A 1GVIA 1TTPA 1E55A 3SCQA 3VE7A 1CXHA 1DP0A 1KCLA 2LLEA 3CMGA 5CJNA 1HQTA 3O0KA 3G0SA 3OVGA 2Z1KA 1OX4B 4F9JA 3PN8A 4P5UA 3NGFA 4LFYA 4PB4A 1J18A 3OZOA 3ISIX 3VINA 3W6LA 3LB0A 5HDRA 1GWJA 4DPPA 4B15A 5I2UA 4AD5A 2PP3A 4M6PA 1GZGA 2E68A 1R47A 3HA1A 3L4VA 3A4XA 3R94A 1C9WA 2WSKA 4IFOA 3BGGA 3SCNA 5A6SA 1QK2A 3WNOA 3PZ9A 5A94A 3R8RA 4JQ4A 4HCDA 1NELA 5U7SA 3VZYA 9XIMA 2Y0FA 2QR6A 1V0KA 2C79A 3P84A 4OZOA 1MW0A 4KBXA 2AMGA 2WMIA 2NQHA 3GVWA 3DG6A 3FDGA 1H62A 3QY8A 3WG6A 2XM1A 3Q37A 3F4CA 1QU4A 1CLXA 3O6YX 1XBZA 4PYSA 1ZUAX 3KZSA 2HS6A 2YXXA 3UJSA 3TFXA 2EKCA 4O53A 2P76A 3KDOA 1IWPA 1E1FA 1TMLA 3MO7A 3RGTA 2GSJA 3CWNA 4AW7A 3STCA 1UZ4A 3H6OA 1OG0A 3LXBA 1K9TA 2HXTA 2DDXA 4NAEB 3WLPA 2OX4A 5FF4A 4B5WA 5A8PA 6REQB 2WPGA 5HR7A 5I5RA 3OU8A 3VOCA 4QQ3A 2JF7A 4Q4QA 1Y7VA 5KTLA 5HQLA 3W29A 4FNRA 4S3CA 1JD9A 1BFNA 2WVTA 4WZHA 2BS9A 2GPTA 2RJGA 2FGLA 1VJIA 1L6SA 5CAHA 4JAWA 1JCMP 1QPOA 3FHAA 4H7ZA 3PS7A 4HKPA 4ACZB 4HZ6A 5JUVA 1LBMA 1IIGA 2FGZA 4B3LA 3IK2A 2PDMA 3PTDA 4M81A 2XVKA 3GC2A 3UR5A 3Q65A 3UR7A 2VCAA 1UWAA 4UR7A 2OR2A 3LGEA 3INPA 1HIZA 4CN6A 3F2CA 1VFTA 1EJWC 2OYMA 3B9AA 2QCLA 3M46A 3EDFA 1S2CA 2PFHA 3OLGA 1SFSA 2PTYA 2PLMA 2JGYA 5FESA 4IJBA 2NT1A 4ZQRA 1K70A 1MDRA 5CSSA 4B91A 3T2OA 2X2YA 1E3ZA 4Z1YA 2XIMA 1VIZA 3APGA 3S2LA 3AQUA 1UR8A 1XIMA 3TCSA 4J5NA 4F4RA 1BG9A 4GJIA 4AD1A 2V67A 1UKPA 1R2SA 1LP6A 4Q8OA 1S39A 3S0CA 4HP5A 1TV7A 2XIJA 3CT2A 1SGJA 4GE8A 3UNDA 3SCWA 2YB1A 3WNNA 3W7LA 3W24A 1EFZA 2CU0A 4LF2A 2D3LA 2BHZA 3GTNA 2GJXA 3ALGA 4N9DA 1MW3A 1UQZA 4ZR8A 4V27A 2FYMA 1L0PA 2BOEX 3OEXA 2YB4A 2X40A 5E0KA 4JD4A 2OEKA 1JDCA 3QV9A 1JZ6A 1RCQA 2VFHA 1XSKA 4UQEA 1BYCA 1WQ5A 2BXZA 1WDWA 3M64A 4HSOA 1K4GA 5A8GA 1E40A 2HISA 4CQ9A 1KB3A 1PHQA 1EP3A 4EWJA 3VIIA 3CB8A 4ZBCA 4YCOA 4V2XA 2XVPA 2VR2A 3BLKA 1V6WA 3CZLA 3W6MA 4I9JA 4NILA 2J8FA 3IWPA 4XAYA 5CSYA 1H0IA 4HGXA 3RDKA 1TPH1 1A0EA 2X1RA 4RDZA 1G6CA 3GB6A 2GGIA 4R7JA 4QP0A 1Q3NA 2ASHA 2PD5A 5C5YA 3CZ8A 5BXTA 1SQ7A 4M6QA 1VZWA 2PLCA 2QNEA 4FSAA 3W4RA 1AFSA 2UWFA 3NPUA 1B9BA 2YR1A 4MVAA 3VVGA 3GXNA 3NZ1A 2FGBA 3LTSA 4UOJA 4S3BA 4XKMA 3MI6A 2I57A 1KFKA 4AF0B 1MNZA 3GTXA 2A4AA 1F2JA 4NAFA 2VGIA 1JZ4A 1F3WA 1K4HA 1UD5A 1YXCA 1U1JA 2H9AB 4BEQA 4FP1A 3EMZA 1S1RA 2PAJA 1XC6A 3B0YA 3DFSA 2WJDA 2WMJA 4HNNA 2VNCA 3MQTA 3RIKA 2Z1WA 3EOSA 1W54A 4BY3A 2YBTA 1OADA 1HGWA 4IWWA 1OZMA 2E09A 3QGVA 4JTCA 1H5VA 2J66A 3BZJA 4ES4A 2DSZA 2RDTA 1YEYA 3UGRA 3LLXA 1WA3A 3WDQA 1KKRA 4LW7A 4X0VA 1F74A 5BZAA 2PDUA 2Z1XA 2ISVA 4XX6A 3W1RA 4HHHA 1UIPA 4M19A 2OZ3A 3ITYA 3R43A 5FEZA 2VUYA 3KP0A 1WDRA 3E49A 4CCCA 1VD6A 3IANA 3SIZA 4EACA 5FF0A 1XYBA 5JBEA 2PWVA 1E6PA 2CLMA 3DENA 1BSIA 3S1GA 1ITUA 3LM7A 4J27A 3CNYA 4PEKA 3THAA 1YXYA 3M0MA 4RZ5A 2A1YA 3PZOA 3DFNA 4HSNA 3G1XA 3NPXA 2WKLA 4NZ5A 1S5NA 3K4WA 2ZC8A 3LK6A 3GG1A 3TQKA 3W38A 3RU8X 3UZWA 2WOQA 4L80A 3QSTA 3CUGA 3GBEA 4JTIA 2QUVA 4MWAC 4HTYA 4XZMX 2JBMA 5FL0A 1HJSA 1K8CA 1UZ1A 4JR5A 4RZ4A 3AJXA 4WY0B 4POCA 2QPSA 4J35A 3STEA 3VKCA 5JBDA 4K8GA 2J7GA 2VX6A 3GYCA 3L2IA 1V6UA 5DRIA 5BW6A 1EDGA 3I65A 3M0VA 4O52A 2YCJA 3NEHA 4QEEA 5TF0A 5CBIA 1D3GA 4D6EA 5J5DA 3V5FA 2G0WA 1C90A 1F6YA 3RK8A 4L56A 1ADOA 2VOTA 3SBFA 1O5RA 2BFGA 1FCQA 1CT5A 2VFIA 4WOQA 4C6FA 3DFTA 1Q4NX 2R1NA 3RRXA 3CYJA 3EPMA 3E2SA 3L5AA 3CEUA 1BG4A 4LGXA 1UB3A 2VQUA 1RK6A 3PY2A 1ZALA 3WMCA 3OTRA 3W28A 2CWXA 1OFDA 3DGRA 4XSMA 2NX1A 3BSMA 1A5MC 4IMAA 1TX0A 4CD6A 1GQNA 4AX6A 2DZUA 1MNSA 5FEWA 1JPMA 2ZDSA 5HMSA 2HQAA 4IXXA 3LS9A 1EC8A 1K9EA 3BPWA 2PTZA 3S2CA 2EJAA 4HHPA 4EP8C 3L2LA 3MBDA 4DXXA 4TX9A 2ANUA 4AXKA 4GZIA 3FEQA 1UWIA 3UWEA 5LSMA 3TNBA 3UA3A 4JHMA 3WNLA 3O07A 2V8ZA 2ALRA 3WDJA 3GK0A 1RY0A 3SCOA 4GYFA 3TJXA 3M1ZA 2DZVA 4V33A 4DF2A 3C61A 4IMEA 2A85A 7REQB 4FA3A 3WCZA 5A8MA 3DOPA 4FNUA 4MJ4A 1W3NA 3W22A 3CYVA 3PTMA 3YPIA 3TLLA 4KFPA 4F66A 4K38A 1WKDA 4PZVA 3RMEA 4TVDA 2DPEA 1KCZA 5I79A 3R8GA 5BRQA 4EE9A 2J7FA 4RPPA 4HU3A 1DIDA 1RJPA 3BVJA 2ZZ5A 1H0GA 1TV2A 3B8UA 3W27A 3N73A 4ATDA 4O1DA 1H41A 1RD6A 2Y88A 3QW3A 3BG5A 3DFQA 5A5WA 1DJNA 1LLOA 1AK5A 1ZNNA 1GORA 3CT7A 4H00A 1NJJA 3GG7A 5KZEA 2I7GA 3P60A 4B92A 3CAQA 2YBUA 5FF2A 5CPSA 2PWGA 3UJFA 4FS9A 2W61A 5A6LA 3LQLA 3MZNA 3FDKA 1TJRA 2RKXA 3T7VA 1A5NC 4KETA 3LPOA 1GVYA 3VOJA 1N2VA 3TP4A 4LVAA 3CAWA 1PIIA 1ESWA 4MF4A 4LS1A 2HV5A 3ARPA 4GYPA 3BW4A 4W86A 4YIWA 4C6CA 2PDNA 4YVPA 4AU0A 3R4IA 2I14A 3I7SA 4XKYB 1WOAA 1WZLA 1XBXA 3GIQA 4UTTC 1U1UA 2VRKA 2ZX6A 2WVVA 1Z42A 1QJWA 2ZICA 4U10A 3W37A 1LRNA 2YDRA 1PZ3A 2FMNA 4EX4A 1K7FA 2FHCA 5DX7A 3E2RA 2REQA 4DY1A 1PIFA 4HN4A 4K39A 3LA4A 3T0BA 2CERA 3L4TA 3V16A 3E0WA 2IQ0A 3M43A 4UFKA 3G77A 3TE9A 4LWWA 2VD8A 2MNRA 4C6OA 4EF9A 1DIOA 3T55A 2WMGA 5HMDA 2J7BA 4AC7C 1VPXA 3O2LA 3AZSA 2V81A 3XINA 2DSUA 4LCSA 2BASA 1QPQA 1CXEA 3WQ5A 1XYMA 1YDVA 2FPTA 3BCFA 4YTSA 3OOQA 2RGMA 3VKBA 4S3AA 1QHPA 4J40A 2FVKA 4I6VA 2R8WA 3GVGA 5TAOA 4KFNA 2D0FA 3HPXA 1KM6A 2QCHA 1VPYA 1I2QA 4CGTA 2XU2A 2O9TA 3NQVA 4JIRA 1DVJA 2CW6A 3OO2A 5G1TA 3N2XA 4I3GA 4NX0A 3BURA 4ZEPA 1UD4A 1SUXA 2GDQA 3EKLA 3ZVHB 3WEOA 4Y96A 1T96A 4E8GA 1LWJA 2O9OA 3W1AA 3NDZA 3TH6A 1Z8AA 1JAEA 3B9EA 3C0LA 5EGRA 5AY7A 2ZRXA 4ADSA 3DERA 2DVUA 1XICA 3N29A 4HJWA 3QTGA 1KM2A 1OJXA 2GVGA 2VC5A 2VDGA 6TAAA 4IICA 3LUTA 7ENLA 5F2LA 1W1VA 4PUWA 3T08A 1E6ZA 1JG9A 3UCDA 1JF6A 1OF8A 2W92A 1J96A 2CBVA 1F6PA 3S1UA 4XZIA 4PSPA 5FSEC 2V30A 4JIEA 4M51A 3ZT7A 3GKFA 4IFKB 4WSHA 1SMAA 3U0HA 3QW4B 1KCXA 3B4UA 4IQJA 3E96A 4PMJA 3WBWA 4LC6A 1LCOA 3B9OA 4XBSA 1IYXA 3O06A 2WCAA 1HKMA 1W9BM 2CC0A 2PS2A 3L7RA 2ZTKA 3WQCA 4CEXC 2QXWA 4A8RA 3CV2A 2IPFA 4JTFA 4BWLA 1V0LA 1Q66A 4RNJA 5D2YA 1OCJA 1OCNA 3C0QA 3C5QA 3CAKA 3CH0A 1T99A 3ECQA 1DWHM 4UXDA 4CCZA 2WBKA 5TQLA 1PBGA 4ROPA 2HE8A 4A8LA 2WPBA 3G1DA 3RPTA 4W85A 3RF9A 3OGSA 4B5SA 4IGSA 3THCA 1FVPA 1MMFA 3BW2A 3DUGA 3NUKA 1P48A 3CL8A 4K6AA 3LHTA 2JEPA 2CHOA 2CLIA 4HNOA 2ZRUA 2WHJA 4MZ8A 1AD1A 3UZXA 4TV5A 2WJZA 1V5XA 3Q2DA 1JXJA 2E25A 3GDRA 1V51A 4O1FA 2ISWA 3FAXA 3GTHA 4MJMA 2C1GA 2WCSA 3TTEA 5LIXX 3B4YA 1QRQA 2VOMA 3CV1A 4IPJA 1H1NA 4FLSA 4GK8A 5BOOA 5IDIA 3N18A 1EJSC 3S6TA 3BXWA 3AS1A 3CJPA 3ZXWA 2E40A 2FVLA 5L9FA 5CGTA 1JZ8A 4J3ZA 2X09A 1OYAA 1B5TA 2AL1A 2FJKA 2XVLA 1VRDA 1TX2A 4U5IA 4TMCA 1A4MA 3FGCA 1PX8A 2D22A 1LOQA 5I3KA 4MB3A 3TSBA 2Y85A 4KEZA 2DIJA 1NFBA 2ZCGA 2YL5A 1Q8AA 1BF2A 1UPMB 1Q2RA 1P1XA 2E1WA 1E1CB 4NVTA 4GQRA 4AX7A 3IUDA 1W1ZA 2QKFA 3LPPA 3KP1A 4ZOAA 4IXHA 1SO4A 2PDBA 1LZOA 3NQCA 3A23A 4QE1A 5EY5A 2NQ5A 1I1WA 1PO9A 4UFMA 1JD7A 1R9ZA 4H6KA 4ZO9A 5D38A 3IJDA 4S38A 4OE7A 1HJWA 2ABAA 3UR8A 1UKSA 2AGTA 1ECEA 2OQYA 5CGQA 3NSXA 1MEHA 2DZWA 1IGWA 1T0OA 2YA0A 2Q71A 3EDKA 3C2RA 1JYWA 1XISA 1OFEA 1M03A 4O13A 3GKAA 2OQLA 4HTBA 5D04C 1A49A 4I5XA 2C19A 4GQQA 2XGIA 1AL8A 1OQFA 1VBJA 5G1MA 1EKOA 4AZ6A 1HNYA 2J8TA 2ISFA 1LQ0A 1W5MA 2JALA 1FXPA 3COTA 3W7HA 2A7NA 3K46A 4GIEA 5A6BD 1UKOA 4ZO6A 1SJAA 3TVAA 4F8XA 4L6OA 3W7QA 4WX2A 5FL1A 1VF8A 3EB3A 3W7IA 1R3WA 2Z26A 1SMDA 2ACRA 4TR9A 2TRSA 1P0EA 3R10A 1OWQA 4Z1BA 1MEWA 2YA2A 2DW6A 1FHUA 2R1PA 1FWGC 3V5OA 2ZUUA 3W23A 5FAGA 4L9YA 3VKAA 1FFQA 2F2KA 3OLEA 1XFBA 2ISDA 3ZZ1A 2AMXA 2HS8A 3CC1A 4D6GA 4KWUA 5CPQA 4AMAA 3L5LA 1TPWA 4KCTA 3ELFA 2PWHA 2I56A 4FX6M 4C6QA 3LMZA 3S6DA 3ITXA 2AGKA 3Q4DA 3MDUA 3PAJA 1DIKA 3JR2A 1XRVA 3L66A 5M17A 4LUSA 5AHIA 3W86A 5EMUA 3G0XA 4E2VA 4PMRA 1UUOA 3C86A 3SB0A 3CLMA 2QCNA 3GXIA 4NIRA 4XVEA 4WHBA 3ONBA 5HNTA 2VT0A 4KMQA 4HD5A 2Z4GA 2UV8G 1PX4A 2INFA 3H7VA 4D6HA 1N8FA 1QNQA 1TUFA 4RW3A 3F2DA 4O1EA 3C2EA 3QOMA 2POZA 2BV9A 1B9ZA 2DT0A 4L61A 4AY1A 4GUGA 2OWCA 2XZ7A 2F6XA 1C8YA 5M5DA 2QDEA 3C8FA 3K5XA 4QCFA 4C7DA 1OCBA 4F0SA 2VKZG 1EO5A 3EMQA 1KBJA 4ICNA 3ARTA 1XYCA 3K13A 1V02A 2VX7A 1U5VA 1KW1A 3APYA 5AC7A 1SZGA 7A3HA 3KBNA 4Z1CA 1YMYA 2W3ZA 3NGJA 5FIPA 3BARA 4REQB 4S2CA 1XLBA 2WC4A 4AHOA 5H91A 2TYSA 4LOCA 4DWSD 2PDXA 3BLIA 5TBOA 4K2SA 3IJ6A 4FMVA 3CUIA 4F0RA 4H9ZA 1VCVA 2ACSA 2A6NA 1R2TA 3VD3A 3RAOA 4IUGA 2Z1VA 1XIFA 2WLZA 1W56A 4J28A 1TMQA 1TV4A 4IMCA 1I1XA 3S9ZA 3A3XA 3EWUA 1XJBA 4D1IA 2B7QA 3KL0A 1VYRA 2F8QA 3IJ9A 1UMYA 2G3JA 2AKZA 8XIMA 3KCJA 4DM1A 3DHUA 3FCPA 3EB4A 2E6FA 1P6BA 3LGGA 1MUWA 4R9OA 2OJPA 4M7SA 3L4YA 1OBAA 1TKKA 3LRLA 3UQNA 1MFUA 1V02E 2OKTA 1WAWA 4WCJA 1B90A 5AC5A 4LUTA 4JNZA 4DJFD 4HQVA 3RYSA 1ODUA 2ZWYA 1U1HA 4LTSA 1ISXA 5GNZA 4LV9A 1V93A 1H1YA 2W67A 1X39A 4A3RA 2ZOXA 1JGIA 2ZADA 2W91A 3U5UA 5DT5A 3WDHA 2FDSA 3CZJA 2Y7EA 2QULA 4OOZA 1EIBA 2YW3A 4LEQA 2FDMA 5I23A 2Q8ZA 1E0WA 1ZP4A 4RK8A 3CUJA 4UZUA 1X1OA 3IARA 3CUFA 1M01A 2GYIA 1V79A 3GDMA 3PNUA 4D1JA 3SUUA 3LSCA 4QX4A 5HWNA 2GDVA 5BU9A 4Q8TA 1NF0A 2HROA 1OIFA 1XDJA 3R13A 5H1WA 3WK2A 3S83A 4CKQA 2EXOA 4K3ZA 4JIQA 2XUCA 5FJOA 1B3YA 2VELA 1W0MA 2UY5A 3UXAA 1W1PA 2J7DA 1ZB5A 4X2RA 4BQ2A 4B2DA 4R7WA 2QYGA 3A13A 4UFLA 3FVMA 4BKNA 2QCMA 1FWEC 1PJ9A 3NZRA 5D8ZA 2FPVA 4FR1A 4OBTA 1A0CA 3HPZA 4UTJA 1R7AA 1GW9A 3WNMA 1UYQA 1TIMA 5G2HA 2DFAA 2B7NA 3ABZA 4J3XA 2VZOA 3BMVA 5D4YA 4V28A 1FWSA 5I24A 4IJCA 4WSJA 3F1QA 4MOZA 4RDYA 2GGGA 1BWVA 2CLLA 3WL1A 4PCPA 3EX6A 5AFDA 2DP3A 4HMCA 3NTYA 3EPNA 1MQQA 3VX1A 4Q32A 5D9MA 2QVHA 3F5LA 1F3EA 1QI4A 4M24A 3FK4A 4GC4A 2PD9A 5GJMA 5GNYA 1FWBC 3KLKA 4ZE4A 1KQZA 4ZL1A 5EBAA 4H9UA 3O3RA 3FVDA 3BICA 4IT1A 1GW1A 3EXSA 2QCCA 4PSRA 1TZ7A 4NY2A 3MJYA 1PIGA 4P7NA 3WLTA 3EWDA 5D2TA 1HTIA 1NP2A 4C6NA 3VCRA 4O0ZA 1DJZA 4LAOA 2YCLB 3FOKA 1XRSA 4QAWA 4NAEA 2DORA 5K3VA 3TROA 3BAXA 4A3YA 1TJ0A 6REQA 4GI9A 4YHGA 3S5OA 4BI7A 1F73A 1DJGA 1SSGA 3QZEA 3WBYA 1RCOB 3R58A 4URIA 2DJXA 1NFGA 4JQ2A 3CHFA 1BEUA 1XIHA 1SZFA 4IMFA 3OVPA 1R8LA 3AISA 3WK3A 2RDXA 1CGXA 4DUXA 3MV01 3P5ZA 1VC4A 4ACZA 1JDAA 4PTVA 1QASA 3JS3A 4DWDA 3LU2A 3MS8A 4RE0A 2DZBA 2FVMA 2WJFA 1VFFA 1EX1A 4LY4A 3WQPA 2RH9A 3C6CA 1LQAA 3KBVA 1FKWA 4FXSA 3WQWA 4IH3A 2V5CA 3ARUA 5IDZA 2YSWA 3H55A 4E2DA 4F0HA 4BCEA 2WM0A 1GYNA 4WRHA 2WANA 1P5BA 4K1WA 1Z9AA 4TVUA 3TW9A 2V3GA 4KGLA 3N6JA 1W3HA 3VXGA 4PODA 2DIKA 4US5A 2ZE3A 2PSNA 1MQPA 3AXMA 1J0KA 1JPDX 3K2GA 1TWWA 4P2VA 4LQ1A 1E72M 2J24A 4HNTA 4AWTA 4UNLA 3VCNA 5GNXA 3ITOA 4MNKA 3E2QA 1V03A 4N02A 4BF9A 2KAUC 1P43A 3PPGA 5G2IA 4LYQA 1S5VA 1TJ1A 3PPCA 4NYUA 4DELA 4DVOA 3JZEA 1EGZA 1ODZA 4N7QA 5E93A 4E4UA 1LLZA 2BVDA 1DWJM 2ZE0A 3CH9A 1Q8JA 1XLLA 2G37A 1E6RA 1S3HA 3RJXA 3B8DA 2YZ5A 3CM4A 2F38A 2W0UA 2ZX8A 4QDMA 3VDCA 1W1YA 4HYVA 3WJZA 4EAMA 1JCTA 2C13A 3H70A 5CSUA 4H8VA 1J8VA 4Y7EA 5HPCA 1RBLA 4N2YA 1CECA 3PVFA 4M5PA 2A3EA 2V2CA 2RUSA 3A12A 4Q6JA 1OFQA 2Y7FA 4MZYA 4B90A 4FOUA 3JZUA 5IXEA 3BH4A 4JN6A 4LAZA 5DCDA 1ML1A 3M07A 4OBSA 1OX6A 5CPMA 3SW6A 4AZIA 3PUGA 4EOUA 3MKKA 3ARWA 3W7OA 3A6OA 2EPLX 2PUZA 4XISA 4KKXA 2ZXBA 4GKTA 4KWSA 4KGJA 1UWQA 3T2PA 4MADA 4Y9OA 4XD6A 3SRHA 4XZ9A 4DLMA 3VNJA 3K4DA 1E6NA 1GT8A 4W84A 1V6TA 1MUCA 5LHEA 1C7TA 4AF0A 9XIAA 2JK2A 1A5LC 4ZENA 3FY1A 3QR1A 2DQWA 2H9AA 3PPFA 2WWDA 3DC8A 4MWAB 3CHVA 2BSLA 1AJ2A 4EPBC 2PF8A 2VX4A 4LVGA 4WKHA 3GRIA 4I7UA 3ZT5A 1KGUA 4C7FA 3GSMA 3V7PA 2GLKA 4CD4A 1PUDA 2A3LA 4L1XA 2Z1BA 4MKNA 1K8XA 3A4WA 1E6SM 1M41A 3P5YA 1EQPA 3TA6A 2IQDA 2Q09A 2Y62A 3PZGA 3ABXA 3IJ8A 1HO4A 3VGBA 4GGHA 3MCOA 5M1TA 1J2BA 5DMMA 4PL2A 3H53A 3FXYA 3G24A 1IZCA 1H11A 4W7UA 5U4NA 4CVUA 3N2TA 3ID7A 4MHBA 4Z08A 1VR6A 2AOSA 4PMQA 2WZTA 3AALA 5DXXA 3AUJA 2FMOA 1PX3A 3SRDA 3OZMA 4CCDA 1YPFA 1OCQA 2Q01A 3W81A 4JCLA 5KZMA 4Z17A 2WZMA 3M16A 1KM1A 3HBLA 1F07A 4MB4A 1Q6LA 4XG1A 3TA9A 2J74A 4DAFA 1XQLA 4UZSA 3L4XA 4HT3A 4NJGA 1JZ2A 1JUBA 2GSEA 2D2HA 3LCWA 4U28A 4NP7A 2I16A 3RU6A 4YWSA 3VMOA 4JX4A 3FYPA 2G4FA 3AXHA 4XAPA 4UTWA 4RLIA 1J5SA 2GVJA 3BCJA 4I9AA 3V1HA 2XN1A 4QLLA 5HNUA 1VFSA 1YDNA 4XB3A 3ATZA 4OHQA 3RMJA 3E6EA 4A4AA 1Z32X 3OYXA 3QBUA 1Q45A 2QHAA 4GISA 1B1YA 1XG3A 4WY0A 1RV8A 4F48A 4RZBA 3UCCA 2Y8KA 4BEUA 4L9ZA 3MYOA 1YDOA 3L4ZA 3UEQA 4KEVA 3C3UA 1S46A 4H6QA 1DJYA 3A9IA 2E9MA 3ZJ7A 1ICQA 4HMNA 4TMBA 8RUCA 5PTDA 1ITQA 2WNNA 4H2HA 4I8DA 3VGHA 2Y8VA 3WNKA 3W1UA 3GNOA 3M9YA 3UWYA 5A95A 2IKIA 1GYLA 2ZQ0A 3VIFA 3WLJA 3UXLA 3WLSA 3TMQA 4R85A 2XPKA 3CUZA 1ALDA 1GHRA 1U83A 1RBAA 3AIUA 1MSSA 3ANUA 4ZXOA 4IIHA 4JHZA 3TXZA 5E9AA 1TIWA 2Y5JA 2TODA 2NX9A 3W1QA 1J93A 1B4KA 1EZWA 1R5YA 1HVXA 3DYMA 2F2HA 4B5UA 3NO1A 3H2NA 1FTXA 5CC6A 5IM51 1X6UA 4KF1A 3LGDA 1V3IA 2WK2A 2X1IA 1RP9A 1THFD 2DH3A 4KEUA 1U33A 4OQVA 4X3ZA 5JIWA 3NQ6A 3TTOA 1JR1A 1OGBA 3FYOA 3GNNA 2BHYA 3CLWA 3WH5A 4ATLA 4N4PA 2GQ3A 4JTDA 2WHMA 4GVIA 3OVQA 1J2WA 3GM8A 4PUDA 3V75A 2ADAA 1HL8A 2CZFA 1QFEA 1LJYA 5HJXA 2R6OA 5BOEA 1OB0A 2Z2AA 7REQA 3DI1A 4JN7A 1QK0A 1XIJA 3EA1A 4INFA 5J8LA 2GUYA 1TJPA 3G1VA 3IV8A 3GYEA 2INZA 3DKJA 2WQPA 3LENA 5F1VA 1U2YA 1BRLB 3QJAA 5T9BG 1DWFM 9RUBA 1TWDA 2YGYA 1EIXA 5I06A 2Y6ZA 4DUVA 3SQMA 1BXNA 2XIBA 2NV9A 2HSAA 4DYEA 1UWSA 3N2OA 1K77A 5FJPA 4AEFA 1ICPA 3TTSA 4J3WA 3MTWA 1EJTC 3UVAA 4TX6A 3BOXA 3MVTA 4KEMA 1DBTA 4NQ1A 1D7FA 4XO6A 4P8WA 4ROQA 2B31A 4IM4A 4UR9A 2PDLA 1DE5A 2XIIA 3F4WA 4XZBA 2CBUA 1ZTVA 2ZZ7A 1UP2A 1BVZA 4Q7NA 4KW2A 5G2WA 4GI4A 3LV6A 4NU7A 4H9VA 3ZSTA 3N17A 3GXDA 4F3HA 3STFA 3W75A 5I07A 2J13A 4U31A 2E8YA 4MLRA 1H7OA 1XLAA 3ZFHA 3NQEA 1UD8A 4BWLC 1VQTA 3IJQA 4XKYA 1EUNA 5K9XA 5JQ9A 3KOWA 2EPKX 2XWDA 3MP4A 1FDZA 2PRHA 3VGGA 3NZGA 4E8CA 2GGHA 1I0DA 2DVXA 3AMCA 1HKIA 4GY1A 4GVGA 4AAJA 1DQUA 3G1SA 3GC5A 3EOLA 1F4AA 1E73M 1OYCA 4MDPA 3VFLA 1UR1A 3OLDA 5LGZA 3TU9A 1ZY9A 1B0IA 1MVYA 3QKEA 3BCDA 5F4WA 1KXTA 4JCMA 4XZHA 4XZWA 4IIDA 1FH8A 4JICA 1MXDA 1OK6A 2O92A 4F2UA 1VS1A 1ENUA 5IRPA 4DRSA 3E0IA 3B0VC 3PB2A 1XL9A 5LA1A 1DJQA 2W4XA 3PWIA 1Q7ZA 4FR6A 4NZ1A 4O1CA 2PLKA 1E15A 3VIPA 4Y9NA 4J3SA 2CCRA 2CZDA 1UKTA 3SGGA 2WC7A 4E4PA 1ZLPA 3KRUA 4GIYA 1OM0A 5IFPA 4RXFA 4DB7A 1ISYA 1GQLA 3FAWA 3TJIA 2FFCA 3ZVHA 1S1PA 2PDGA 1HN1A 3QXBA 3GBDA 2QJNA 1V6XA 3U48A 3V36A 2NVDA 3WQGA 1AW1A 1F05A 1FXQA 3NIYA 2VMFA 3WLOA 1BF6A 3T8QA 1G69A 2P5NA 5DT7A 4TTGA 3CUXA 1IXNA 3BLEA 4Z2GA 3AWNA 3THDA 1FDJA 3REQB 4C1NB 1Q6CA 3BJFA 3IIPA 4JL1A 3BE7A 3G22A 2H6RA 3DU0A 1IXOA 6ALDA 2AL2B 4NJJA 3LZ3A 2EG8A 3LPFA 3P61A 2VHLA 4IFKA 3TSMA 2DVTA 5TNVA 3W87A 1SW0A 5CKSA 1AH4A 1JULA 5FF3A 1F4HA 2BVWA 2VP8A 2FH6A 5CJMA 1D8WA 3W01A 4EPEC 4NYYA 2PLJA 4HVXA 2C15A 4PB3A 1F3TA 2ZUNA 1HP4A 2OFJA 2E6YA 4OVXA 4ZQNA 4UOZA 2RAGA 1E4LA 3CO4A 3WUFA 3Q67A 4Q7BA 3FSTA 3QYSA 3MMUA 3GHTA 1XW8A 2VZSA 3BAWA 4E3VA 2X2GA 2XH4A 1VYPX 3WYZA 4KIEA 2QAPA 1TPDA 2NT0A 3WQFA 2EAWA 3TONA 1A5OC 3AHZA 4GUHA 1SZRA 4WKAA 1QHZA 2GGEA 4BI6A 3R6IA 9CGTA 1VLWA 3WF3A 4WSKA 2C18A 4UWMA 3WQVA 1US3A 2NQLA 4A2RA 4QE4A 3K8LA 3HPSA 1BD0A 2XWEA 3EWZA 1AJ0A 1VFOA 4ZFMA 1YLVA 3GFZA 3GU9A 4L4OA 2VM8A 6ENLA 4S3EA 4GX8A 5AC6A 3CIWA 3UETA 2A3CA 3IIXA 3LBCA 5CSRA 2VEPA 3LCGA 1HP5A 4JN8A 1JRCA 3G6LA 4B9ZA 5M3WA 2MUCA 4O12A 1AH3A 1JL8A 3TAKA 3M6DA 5I00A 1TPVA 4W87A 3T42A 2C7FA 2XDFA 4BFAA 1J6PA 1A5CA 4LSBA 2Y7GA 4LVDA 4UBPC 1O5XA 2E6AA 4S3DA 5DY2A 3RFAA 1AUSL 1Q65A 4DO5A 4I5UA 2WNWA 1EC7A 5C70A 2EKGA 2PDCA 4MFDA 4UNKA 4GFIA 3C56A 4RV8A 3IAPA 3MSYA 2P3EA 3FIGA 1YADA 3FNDA 4IPIA 4U33A 1SZEA 4UQCA 3IV3A 5ABEA 3WQ8A 4HNCA 4U2ZA 1E1CA 4H4IA 4D8LA 3LX9A 2HVMA 5HUOA 1XLFA 1AQ0A 3E12A 3GQYA 4KWOA 1NY1A 3WQEA 2WZEA 3MI3A 3IJ7A 4QDWA 1BYDA 3KW3A 4I8YA 1TTJA 2WMHA 4YXGA 4GXPA 5CLTA 3W2KA 4PCTA 3F4VA 3CIXA 1R46A 3FKKA 2YJQA 2CPUA 2G3IA 5L6UA 3GNXA 3ABRA 2TPSA 4CD5A 3S2NA 3DH7A 1I2NA 3HIJA 4O11A 3N2MA 2QPXA 1WDQA 4KRUA 3IRDA 4AFYA 3WLIA 1PEZA 3HQ1A 1C3FA 1XYZA 1DEDA 1Q6FA 4HYWA 3H2AA 1D3HA 5E6YA 4C6LA 1B30A 1GCYA 1Q6GA 3WBAA 1W9PA 1OSEA 2V5JA 3VD4A 1FWNA 4QFUA 4O0QA 1MO0A 3NJ3A 2CLPA 5DO8A 3ME3A 3SN0A 1A5SA 1AJZA 2HWGA 1Q7MA 3QMTA 2GSHA 2ZIDA 1P0DA 1CXFA 3TTQA 1XIBA 2D20A 4JIHA 3ARZA 1X6LA 2GOKA 3LYEA 2CESA 5C7VA 4LNYA 4ICMA 3GE7A 1EYEA 2JKAA 3B05A 5A6MA 1VEPA 3GNDA 1W9VA 1XLKA 3IUHA 5HUPA 3P62A 3T0AA 1RP8A 3CXOA 3UG5A 3FV9A 2PDQA 5K9DA 3KHJA 3G8RA 4GVFA 4CN4A 2Q02A 4LYKA 1CWYA 3KAOA 4Q7IA 4UUIA 1RA5A 3W7RA 4IQLA 3RHGA 4MYXA 2AQWA 4LU0A 2P0IA 3IACA 1FWAC 1LL6A 2QDGA 4N0RA 3WF0A 1JVNA 4AHPA 1ECQA 1IIHA 3KUMA 1PTAA 1F7BA 1GJUA 4WJXA 1JJKA 4V1YA 4GRSA 4PMZA 4TUFA 3F03K 3LCIA 1V3JA 4FIQA 1JYVA 2R82A 3BDKA 3CS2A 3GU1A 4A3HA 2JKEA 4LANA 1C8VA 1RH9A 3W2JA 3T78A 2ZRYA 1M7PA 2IW0A 2CLKA 2R94A 1XC4A 3A4JA 2J88A 2OG9A 2PU1A 1KR1A 3UWVA 3V35A 4B5NA 5HR6A 4FAMA 4WJ8A 1C8XA 3AIVA 3SN4A 2DY3A 4CQ8A 1H63A 2HNEA 2Q3RA 3VDBA 1OD0A 2H90A 2TAAA 2Z7GA 1UOZA 4PTDA 4XD4A 3HQPA 3R7MA 2FZBA 1J12A 5DCEA 4JYDA 1SR9A 3N9KA 4ZOCA 1V77A 3LPGA 2G41A 4O0KA 4O18A 1MW1A 3OVRA 3ZJKA 1KRBC 4NNBA 1G7UA 3PUDA 3N15A 4U3AA 2NWRA 5FACA 3W1TA 4NNCA 3NPWA 3MY9A 3M0YA 3LLDA 2BY0A 2PTDA 3K8MA 3K8KA 4WGHA 3SUVA 3LBMA 3CPRA 4NJHA 3R79A 4NJKA 5ENLA 5AECA 4REQA 3CQJA 4UTFA 1GHSA 3NVTA 4TXEA 2WQDA 5K4XA 3MANA 4M6VA 3UR2A 3LV5A 3CZKA 1G4TA 3UA4A 3ZM8A 4WQ6A 3GZ3A 1E1EA 1D2KA 3CAVA 3GLCA 3H4GA 3W88A 1BQCA 3UXIA 4F2BA 4FLRA 2GUBA 4IF2A 2J7HA 3RLHA 4AHQA 1IEXA 1CNVA 5BXPA 4F79A 4MGGA 3B8VA 3V0UA 4PBEA 3JW7A 3ICJA 1GJWA 2YL6A 4H04A 4HCLA 3AHXA 1DQWA 4YS1A 3SCTA 1Q2SA 1VBGA 1G4PA 3W1LA 1G4SA 1UW9A 4Y9PA 3VABA 2FZ9A 3T44A 2GJNA 3WN6A 2VWTA 1ZHAA 2QMKA 4GXWA 1LWHA 3W1MA 1K1DA 3BQ6A 1TFVA 1VRXA 1JCXA 1G01A 3SAZA 2DU2A 5IBXA 3P67A 5A2CA 1AODA 5IHSA 1FUYA 3QZ6A 3AHYA 4ECLA 4QTGA 1TRIA 3OODA 4HK6A 4IISA 3WFLA 2QZRA 3HQNA 3ARSA 3A3HA 3IIOA 4KQNA 4K68A 1YE6A 1TWIA 2IXVA 3QLDA 2PBGA 1EZ2A 3KBSA 5CH9A 5BRPA 2AKMA 4JFWA 2EG6A 1LL4A 2A7RA 5LYRA 1Y5XA 1C8QA 4DYKA 4S39A 1TUXA 1EH9A 4AC1X 3BTNA 1O68A 4QNWA 2ISSA 1WDSA 2OSXA 5G4EA 3PBYA 3P8JA 1SFLA 4HHLA 3WQ4A 1HL2A 1A80A 1WXJA 1JPIA 4HNVA 1UPPA 2V3FA 4P7QA 3MSRA 5FEXA 3BJTA 1X8FA 3UWQA 4GJ1A 3E02A 1K9DA 1NSJA 1W37A 3ZWSA 3O6CA 1XLJA 4B5TA 4ILSA 4GA8A 3MBFA 3UFYA 3WD2A 3EWCA 5T26A 4M80A 2Y5EA 1TPB1 3T1GA 1ZCCA 1FHDA 1VENA 4JYEA 1KTCA 1J0HA 3WBXA 5C6MA 3TZNA 3VIOA 4WY0F 3M0KA 1NWSA 2FFIA 4J7RA 4ML9A 4I9TA 1PWLA 1PZ0A 4BF5A 3AUOA 1HL9A 1O4UA 3