4MJ2A

Crystal structure of apo-iduronidase in the r3 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
613
structure length
595
Chain Sequence
APHLVQVDAARALWPLRRFWRSTGFCPPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-iduronidase
publication title Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 194
structure length 595
sequence length 613
chains with identical sequence B
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01229 Glyco_hydro_39 Glycosyl hydrolases family 39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mj2A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4mj2A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mj2A02
3V6OA 1N4XH 1A7NL 3UYRH 3EOYG 5HHQA 5I71B 3FB5B 4IS6A 5I8OL 1U92B 3PIQB 1HSAA 3EFDH 4KK9D 1L0YA 3FTGA 2ENSA 2AXHA 5E2VH 1GC1H 1A6TA 1YY8B 4P23A 5FO8B 3SGKC 3ZLQC 3DXAA 2DJUA 4WFFD 5KSAB 1KBKA 2AK1L 1X5KA 3MJ8A 4WU7A 4A4AA 2R9HC 1XGYH 4NJ9L 4GKSB 1CICC 5GS3A 2YA1A 3VXUB 2BDNL 5A43C 2IQAB 3RWFA 4PJAB 4PRAB 3S4SB 3CJJA 4WY7L 3MRPA 4PJIE 3PHOB 4KK5C 3PDGA 1C5DB 1J1OL 4WTZA 2YPLE 5FGRA 3VNZA 4FQIH 4JRYB 4G9FA 5GGRB 3VIJA 3MUHL 2XFFA 4M48H 5IG7A 1TXKA 4LARL 4I3GA 1EEZA 2O5XL 2YBTA 3U7YH 3C6LB 2D23A 3QUXA 1IGFH 3PWJB 4X80L 2VDNL 4ZPTB 4HT1H 4Y5XB 2DWDB 1EBPA 1ISVA 5C0CA 3P0VL 1B3WA 2P45B 3E6FA 3QI9C 4KAQL 5CKGA 3IJ8A 5F88A 1M7XA 1MLBB 2DQUH 1CTOA 2Y6SC 1U8PA 4FTVE 3F7YB 1UZ8B 3VMNA 4TUKL 1T83C 3T4AA 1ODAA 5FYJE 3SGJC 1TVBB 4D6GA 1IAOA 4Z0BH 3OGSA 2ZXQA 4GKNB 5D70H 4DKEL 3H9SE 3SDAC 4PG2C 1R3IH 1C5CL 5FV1L 4X8JB 1JTTA 1E1FA 1EUUA 4X9FA 3RPIB 4MDOA 1BLIA 2WHLA 5K9JL 1JWUA 3RL2A 4RRPG 5C09E 4PJDF 1R24A 3WKNA 1FL5B 1KCKA 1YQVL 3KPNA 4JQIH 4MD4A 4QTHB 1UKSA 3VINA 2VITB 1LE9B 2B8OT 4ZFZB 5DO2C 1U8QA 2DIAA 3VI4F 2Z4QB 3CDGA 3TFKC 4E41D 5FFLA 4GRLA 3MRJA 5D7KD 1OY3B 4AYFA 5JTWA 4TQEH 2I9LB 3LN4B 3UR7A 4KZEL 3ALPA 5C08B 2Q86A 3V0WL 3V5HB 3DGGB 4RBPK 4NWTL 5TE6H 4N5EC 1PW3A 4JGUA 1VPOH 1GPOL 2HVKB 8CGTA 2AJYL 5DEZA 3LH2L 5DVKA 1VCAA 1V3MA 3FB5A 5CWSB 1U92A 4QCFA 3PIQA 2VWEE 5DQDL 3E0GA 2OJEA 2ZUUA 4M03A 3RVVC 5C0RL 3ARDD 3TYGL 4PUDA 4MJ4A 2E7BA 1IT0A 4BK4A 2WLZA 3BKCL 4HWBL 1YY8A 3F5KA 1B6UA 3DMMC 1L7TH 4DK3A 5FO8A 2CKBH 4YDLC 1WEJL 1FDLH 1HF6A 2WBJC 3MA9H 4JHZA 1H15B 5LWYH 4GKSA 2NMSA 4IJ3B 5F44A 3GSWB 3VXUA 2IQAA 5GZND 4PRAA 3SE3A 3S4SA 3CFBB 3SGEH 2WIMA 3GSUB 2ZCLH 3PHOA 4QRPA 2AEQH 1UZ6E 1C5DA 2PYEB 1OP9A 4JRYA 2A3EA 3THML 2VXSH 1NUNB 5GGRA 2BY1A 1YPZB 2HYMA 1FGVH 5FM8A 4UUJB 43C9A 2D9QB 1NCAL 2F54D 4PBVC 3C6LA 4YXKL 3HG1E 4IRSB 2YUWA 2VQUA 3QJHB 1DWGM 2LAGB 4R27A 3HUJB 3PWJA 3BAEH 4ZPTA 4Y5XA 3RIFK 3KHOA 3V4UL 1UWTA 2DWDA 4L8DB 2IMMA 4JFDD 5INCB 4JFWA 3TA3B 3EOTL 3TGXA 1ZLVK 1U2YA 1I75A 1G7PB 3UTPD 3O3EB 2WCSA 2QHAA 4Y4HD 4UQBA 5HHPB 1OGGA 1OTTD 3UG4A 1NSNH 1MLBA 2WNWA 2DQEL 3RWIB 3F7YA 1UZ8A 4DOHB 1H0GA 4C59B 4Z76B 1XGZA 1UB6B 5EZJB 4IISA 4GKNA 3SDCD 1HXYA 1KIPB 1XCWA 1DBBL 4UAOC 4JQXA 3UO1H 2EKJA 3VU2A 1F45A 1YY9D 4X8JA 1EGJH 4AIXA 1M71B 3RPIA 2PC8A 1RQ5A 2QTEA 4YUEH 1IGMH 3RY5A 3V5KB 5K33A 1P2CB 5F6IC 3CUHA 1FL5A 4BS0A 2DI9A 2EDOA 4GI6A 2CPCA 5LVEA 2F5AH 4LCUB 3TNNB 1NGQL 2VITA 1LE9A 4Z0XB 2AXFB 1FNLA 4ZFZA 1AE6H 2OL3H 3OMZA 1BVKB 4IMLB 2Z4QA 5JW4R 3JWOL 4NQEE 3TVMC 3ZE1E 5HVFB 3MV9B 2I9LA 3LN4A 1H3WM 1ZSDB 3NFSL 1OSPL 4OLWL 5C08A 4OJFL 1J1XH 1FFRA 3V5HA 3DGGA 3O45B 4QP0A 5EC2B 3A67L 1G9EA 1NFDF 3WF2A 3L95B 4GBXC 3KL5A 2HVKA 3N85L 5CWSA 5I1AB 2BXYA 4FA8A 1XFPA 4FABH 3UX9B 1K9TA 1UKQA 3BRFA 5JBEA 4TYUA 2ZXAA 1UYWL 1FIGL 4P3CL 3RAJL 1ACYH 3PWPD 4Y19A 3QIWD 4QHUB 5MP6H 1MCWM 1SBSH 1V3KA 1H15A 2HWZL 4FZ8H 4LPXA 1MFUA 3AM8A 3GSWA 4KK6C 4K3GA 3CFBA 4YWGL 3CLEH 3GSUA 3N0PB 1WCBB 5K9OB 4P2YA 1BFOB 1EFXB 3G9VA 2PYEA 1NDGB 4RMQA 5IB2B 2WZEA 4OLYL 1PKOA 3KLDA 2FJHB 4RBPH 1I85A 3L3OB 1YPZA 5LGJB 3WQVA 3LEYH 3VIMA 4UUJA 3QHOA 1R87A 2BSED 4JY6A 2CRZA 2C1OB 3FQRB 4KROC 4PB9H 5EZOL 4IRSA 3QJHA 1OF2B 5M03A 3HUJA 3G9AB 1NQBA 4PJCB 4GJTB 4L8DA 4OQTH 5INCA 3TA3A 2EDYA 2EO9A 1G7PA 2O9OA 3O3EA 1OGAA 4BQ6A 3U7BA 4POYA 3RI5F 5HHPA 1QBLL 2ESVD 2Z31C 1RZFH 3RWIA 4QLLA 1T1YB 3G5VB 4NUGL 3NCJL 1Q4NX 1XRVA 5DURD 5JA8B 2IBBA 4Z76A 1UB6A 5EZJA 4P7RA 1IFHH 3PQYD 1KIPA 3MUY1 3GI8H 3FJTA 4PRPE 2G3MA 1LEKB 1XIWD 3UCQA 1M71A 1NL0H 5M94B 3SQOL 3PHAA 3HMWH 1YYML 4JO4L 3SDDB 5C0FB 3ULVH 5GS1C 4L8SB 5AYIA 5B39B 3TNNA 2YPKB 3LIZL 3TONA 4Z0XA 3BRDA 2AXFA 2RJMA 3HPLB 4Q9QH 4RMSA 1BVKA 4IMLA 2NXYD 1BQSA 3K2MC 1LD9B 1QFHA 4XP5L 5IB3B 2DSZA 3MV9A 2J8GA 1U36A 2J4GA 1ZSDA 3IDNB 1ZBVA 2ZICA 1ZVYA 4ELKA 1MREH 5D6DA 4UDUB 1CF8H 5JIIA 5EC2A 1NBQA 1BZ9B 2C8NA 3L95A 4NZDA 5EO1B 1KBBA 3LQMA 5DRNB 4G5ZH 3C8KB 3VFUB 5I1AA 1QNQA 1C7SA 1WLHA 3WH8A 3MACL 3EJJX 2O26U 3H3BC 4BSJA 2Z8WC 2GJJA 4JHOA 2ZOXA 3TZVC 4GLRI 1INDH 4NO2B 3AOFA 4GMTL 2HAZA 4V1DE 1BREA 2D1ZA 3K81A 1EERB 4TNVF 3W9EB 4QHUA 5I19L 2Q8BL 2QADC 5I1GH 1L9MA 1QSED 3QDGB 3WD0A 5CGYD 4X6CB 3FB8B 3S35H 1JNHA 4LLMB 2ZUQC 4XMKH 2ICCA 1WCBA 4I0PD 5K9OA 1BFOA 1A7QL 1EFXA 1P4BH 3HNVL 1NDGA 5IB2A 3O6FD 4XHJC 4PMXA 2FJHA 3L3OA 5KJRL 1WDRA 2R69H 1I9RL 4U05A 5E8OB 5I8EB 1EJOL 1R3KB 3HI5H 5DR5L 4MJIE 3OKEB 2C1OA 3FQRA 3BZEB 1DBJL 1OF2A 4MB4A 4GRWF 4PJCA 1V7NH 2E7CA 2EXWD 1K8DB 4PRHD 1VFAB 4ODHL 5A2FA 5D1ZB 4UBDC 3WFBH 1C5BL 2ZOKB 3LPWA 4ORZC 1W72L 2A6KB 3KJ4B 4D0BB 1KEGL 2PWEA 1RV6X 3FL7A 3VMOA 2HKHL 4XTRD 1T1YA 5KS9E 3G5VA 5JUEH 5CPTA 3SDXF 5CSGA 5EC1B 3V8CA 4HIEA 3BEWB 5E08H 1NGZB 1KN4H 3O81A 1JF5A 2R23B 4YPGA 1EOMA 2BFVH 1LEKA 4CJ0A 3ULUE 4JDZB 1GONA 1F2QA 2IG2L 5LQBL 3VXME 1KEML 3I50H 4LRIC 2ATPB 3UTTE 3SDDA 3E2HC 5A6LA 3WNMA 1KN2H 2ZG1A 3KYOB 1G0CA 4L8SA 5FCZA 5B39A 1DN2A 5K59F 2ESCA 5E99H 2YPKA 4FZEL 4FFYH 5C2BH 2VC2L 1AQ0A 4B9ZA 3HPLA 5BW7C 3WSQH 1FYTE 1OWWA 1LD9A 2EC9U 3T3PF 5IB3A 5I73C 3MFGB 5EUOF 5HYJE 3IDNA 2OS7A 4A2MA 4UDUA 1MCBA 3OAYK 1HL8A 5FV2A 4K07A 3A6BH 4XBEH 3KYKH 4EQ2A 1CFSA 3VPLA 4FG6C 1BZ9A 1MF2L 4Y5YB 3S34L 2J47A 1Q1JL 2D22A 5D4QA 3N1QC 5EO1A 3WDIA 2AXJA 5IDIA 2FSEB 2IH1B 1WUNT 2NY4D 3IAQA 5DRNA 3NSNA 5M17A 3I9GH 3C8KA 3VFUA 3LPFA 1RMFL 5GGVY 5AD0B 5CSBA 5KVGH 1XH3B 2DLFH 4NO2A 5JO5B 3ARGC 2X0YA 3ZQ9A 5TE7H 1HSBB 3W9EA 3BKMH 4M43L 3OPZL 1NFIB 4FOMA 3SCSA 3MLRH 1UENA 3QDGA 4X98B 4H8HA 4X6CA 3FB8A 1Z3GH 4PJDB 4LLMA 2MSPA 2FECL 5I76B 2G60H 1MHHB 2FL5B 4NZRH 3TTYA 3AIWA 3HB3D 5HD8C 2W66A 2NR6C 1GQJA 4EXPX 1KFWA 1ISWA 1MFAH 2YWYA 1O5DT 3QQ3B 5I8EA 4C56E 1R3KA 4LOUC 3U7WL 2RCSL 2JJSA 1HH6B 3G5YB 3OKEA 4NC0B 3W11D 3BZEA 3QG7H 1TZIB 2OYKA 2ARWA 5GS2H 5T5NG 1M03A 4W4OA 2MPAL 5A6AA 1K8DA 2Y7QB 2OR9H 4GXVH 2EE9A 1VFAA 4W6WB 5D1ZA 3IYLW 4BFEA 5TF1L 1WPCA 3UG3A 1U8LB 1RIVL 2ZOKA 1U6AL 4D0BA 1FGNL 2A6KA 5I6XC 1AJ7H 5CSUA 4K7PX 1R6VA 2NY5C 4D6JA 1QNPA 2DMCA 5EC1A 1LK3L 2ED8A 4PJFE 4MXVE 1HQRB 1R5IB 2LAAA 3BEWA 3SE4A 1MFEL 1NGZA 2KBGA 4N1EA 4NQXB 5IBUG 4X7TB 4M61B 2DGAA 4JDZA 5DJDB 3NVQA 3OQ3B 1AXTH 3ZO0A 2ATPA 1BAGA 1MCOL 4P5TB 1MCPH 1W3KA 3KYOA 5CZVH 2Q8XA 1RUAL 3JVGC 1JZ8A 1MVYA 3OAUH 3L4UA 4G8FB 4AZBA 2OYPA 3WSUA 3MJ6A 1OGTB 3AB0C 4WEUD 4NO0D 2H9GB 2WMFA 4B9YA 2E9IA 3HNSH 3NGBB 1ZLWK 1A6VH 4L3EE 4HS6B 1G7HB 3KLHD 3U9PH 3CK0H 4TX6A 5BO1L 3WY1A 1XF5A 4Q6IB 1RU9H 2X9WA 4ZS7L 5E9AA 5EU6E 5E1AB 2NXZB 3D5OF 4EBQH 4Y5YA 3MUGB 4N1CA 2MKLC 4NBXB 3VIFA 2DRUA 3MREB 5C07D 3CSPA 5JPMB 1AD9B 1MCIA 2FSEA 2IH1A 4JN2B 1A0QL 2J7GA 3MBXH 5F93C 4DKFH 2DYPD 3KPQB 5DFWH 2UWEB 5FUZH 5AD0A 4PTMA 4PS4L 1YMME 5CP3H 4PUEA 1CIDA 1XH3A 2OTWA 3D1MC 4I2XE 3S36L 1LO2H 3R1GL 4DGIL 5JO5A 2PBGA 3EYUH 3B4NA 1HSBA 4UINL 1SR0A 1FLRH 3ULSB 1GGCL 3WQ5A 2WP3T 3R0NA 4X98A 4QY8B 3RHWK 1TJIL 4PFEA 4PJDA 4BFBD 3MO1B 3L1OH 4M5ZH 1IAMA 4K3EH 1T04B 5I76A 1CE6A 1MHHA 5E2TH 3ESUF 2FL5A 3IGAB 4XZUA 4CD6A 3W0WE 3P0YL 1K3ZA 3NMEA 3QQ3A 1Z2KA 4OD2B 3NIDE 1XAUA 4LEOB 1YEKH 5B38B 3G5YA 1HH6A 3AHXA 3DUUB 3UERA 1TZIA 2YPLD 1T2QH 2JJTC 4XMPH 4BFIB 2Q20A 1MEXL 5JNYB 4KJYB 4Z8FH 3PABB 2Y7QA 3SPVB 5C0NC 1NFDB 4L4OA 3U83A 1YYLL 5IQ7L 1U8LA 4R90H 1GHRA 1QFPA 4DFIA 2Z1SA 3MODL 2YL9A 1VRXA 1ZK9A 3Q6GL 5FHAH 1Q6EA 1UA3A 4LCIL 2W1NA 4OV5B 3HMXH 1AGDB 1KCRH 4HWNA 5BV7H 2CESA 4LLWB 4NZTL 4CMHC 1JYXA 1Q72H 2VAAB 4N0UB 1QNSA 5E09A 1AFVL 4HA4A 1HQRA 1R5IA 1FRGH 3HPJB 4NQXA 3OX8B 4OZGE 3U36B 4WENB 3HI1B 4M61A 2G3NA 4P49A 5E6ID 1ZANL 5DJDA 3QEQD 4K3DH 2RFXB 2CMRH 1AO7D 5I1LB 3ZKNC 5DQ9B 4P5TA 3SGEI 4LVNB 3H9SD 1WSST 4XC3H 3CUFA 3TJHD 5JORB 5KG9B 1FSKB 4G8FA 4P23C 4TSBL 4ZO9A 4HXBH 4F7EB 1OGTA 5BRQA 5C09D 2H9GA 5DRZB 5ALBL 2FX9H 5GHWH 1HX0A 4HS6A 1G7HA 2CH8A 4M00A 3RUGF 1NMBH 1V6UA 3TBYB 1QRKA 3VW3H 1RPKA 4JB9H 5E1AA 4NN7C 4HXAH 3MUGA 4MAYB 1HILA 1FVDB 3MREA 1CGSL 1ZXQA 5JPMA 1A7PL 3V6ZB 1AD9A 3U9UB 2E27L 4JN2A 2W9DL 1OP5K 4CD5A 5DGRA 4XNQB 1UT9A 3KPQA 2UWEA 2B5IC 3ARFB 5FKYA 5ECJE 4A3YA 1ZHLB 4QOKD 3T1FB 2J8UE 5A6JA 4WUUE 4XVJL 3HZYB 1MQRA 4HC1H 5KAQF 4G6KL 3ZKSD 2FIKB 4RAUB 3P0GB 1JGEB 4RMVA 4X5LA 5EO9B 1ZAGA 5EBMB 3JUZA 1IC5L 1PYWB 4PY8J 1N4XL 5IJKA 3H42H 5IBLD 1JV5B 1JNLH 5KSBF 3UESA 4QY8A 5F9WC 1I8IB 3MO1A 1QYGH 3SO5A 2AJSL 1T04A 1DQDH 4E42B 5I1HH 1FZJB 4U1HB 2GJRA 1BVZA 1OT1A 3IGAA 4KHTL 4ZD3H 2GK1B 2XQYG 1GC1L 1N64H 1QRNB 4MDPA 2DQIH 5EOCH 1ADQA 4ELMF 4X9GA 4OD2A 3SCMB 4F8TA 4LEOA 4TUJB 3QXUA 5B38A 3DUUA 4G8EB 4JZ5A 1K6QL 2BVQB 1M4KA 2A6DB 1QFUH 4X99B 1D5ZB 2Y4SA 4BFIA 4PJEF 5D6CB 5JNYA 4KJYA 3PABA 1K9DA 3SPVA 3X14B 1WISA 4HUUB 1E9LA 5JHDE 2CNCA 1NFDA 4TSAH 2YN5A 3S36X 3D39E 5JZ7D 2WINB 4APQB 3HG1D 4GQPH 5HI3C 4GRLC 4M48L 3LKOB 4JZJB 4TTDD 1OPGH 5ABHA 4M9PA 3TWCL 4OV5A 3NIYA 1AGDA 4PGBB 4OCNC 5D7JB 1L0PA 1RZJC 4LLWA 1NLBL 2VAAA 3MJ7B 4N0UA 5JIHA 3ET9F 4E4PA 2XPGB 3S37H 3RWCB 3BZDA 4YHZH 3EYPA 2CDGB 3HPJA 2Q87A 2HMIC 4N8PA 3HAEG 1S7RB 3U36A 3SUWA 4IPLA 3HI1A 4WEMB 4P2RB 1RHFA 3RM9A 1CFBA 3D3VE 2R39A 3SCTA 2RFXA 5I1LA 5DQ9A 5J6GB 3GI9H 1YJDH 5EOCJ 2R2HB 1BVLB 1RZGA 5JORA 5KG9A 4TN9A 2EDTA 2E7LA 4F7EA 2UZXB 4FQXD 3BO8B 4S11A 4OGYH 1FE8L 5DRZA 4HWZB 3P11H 4HV8B 3H3PH 1E4NA 2JIXB 3C5JB 2NY2D 4GKZB 5HVWA 3SE3C 5I1JH 1EOKA 5L2KB 3A47A 3EMCA 5IFPA 3WBAA 1JHTB 3TBYA 3RJYA 5I8CB 1JYWA 4JQIL 3ZDYF 3BN9D 4MAYA 1FVDA 3MRCB 2R4RL 2WZIA 4NQED 5H35B 3V6ZA 1IKNA 3C6LC 3MLYL 4UNUA 1M01A 5A6MA 3L5WB 5I1EL 3O9WB 4XNQA 3ZTNH 3TIDB 3ARFA 1ZHLA 3T1FA 4UILL 3HZYA 3FT2B 4Z7OF 1H5VA 2FIKA 4RAUA 2CBIA 3RX5A 4D6HA 1HZHL 1JGEA 4DM1A 4JCMA 3UBXI 5EO9A 1VPOL 5EBMA 5D5MF 1KSRA 1TUXA 4JFQB 1PYWA 3FQWB 1CXIA 3I2CL 3TJEL 4JFOB 3EO9L 3K0WA 1JV5A 3D48R 2VRJA 3KPLB 4G7VH 1CDHA 1FZJA 4MD0A 4U1HA 4JQXC 5FCSH 2GK1A 1EIBA 3NCYS 2AV1B 3VFGL 1QRNA 1L7TL 1F90H 1QNZH 1RUMH 3D87B 3QHFH 3SCMA 1E56A 3DC0A 5JBDA 3M7SA 3THCA 1FDLL 1SMDA 2WXDM 2WAGA 2W9LA 2BVTA 2YD4A 5LWYL 4G8EA 1F3RB 1JAKA 4HWUA 2HG5B 2BVQA 4ESKA 2A6DA 5D96C 4H8VA 1D5ZA 4KPHH 4PJHE 2ZCLL 4K8RH 2OYMA 5D6CA 4RFOH 3BP4A 3X14A 3V2AR 2AEQL 1A1NB 4HUUA 1MI5B 1GGUA 3X11B 3C09B 2D0FA 1JGLH 2WINA 4APQA 2VXSL 1G0XA 3NABH 4JM4H 4DWHA 1NWRA 3LKOA 4JZJA 4ZTOL 1EQPA 3QR3A 3HI6L 2WWMD 4PGBA 1JMZA 2MQ0A 5D7JA 5DMGD 1E1EA 3AISA 3KE0A 5L9DL 3MJ7A 1NCCH 1T0PB 3BAEL 3QDME 5F7EH 3ZYOA 2XPGA 2YRPA 3RWCA 1H9VA 2CDGA 1W91A 1A3QA 3GKZA 1UKTA 1CDYA 5F8RC 4P2RA 5AC4A 2WUBH 3TO4B 1NSNL 2X4SB 1H5BB 5FOJA 1L0XA 5C7XL 4MWFB 1MOEA 4OD1H 1UD3A 1BM3H 4KRTA 5J6GA 4NZUL 1YEEH 5F7FA 4J3SA 1GOMA 3VGBA 1DFBL 2J4WH 4PRPD 3R8QA 2OZ4L 1BVLA 1T7VA 2F19H 2JCCB 3T3MF 4XZBA 1EGJA 3UO1L 5KVEL 3WDJA 3BO8A 2QSQA 4PRBB 1E0XA 3O3UN 2CKNA 4HWZA 4HV8A 4LSTH 3AM8C 4IJ3C 3IKCB 3KJ6L 2JIXA 2Z91B 1YNKH 3C5JA 4GKZA 3ZE0E 5L2KA 4P0DA 4URIA 4Q74A 4DJMA 4U3CA 5SV4A 1JHTA 2F8XC 1V3IA 5I8CA 5JR1H 4HZ7A 5F9OH 3VRLF 4FQLH 2F5AL 1I85C 2BSSB 4UNTA 1DQLH 3MRCA 5IGXH 1WITA 3JV4B 5H35A 4X6EB 3SOBH 5GGTL 3WQ8A 1P84J 4IRSC 3L5WA 4QHNB 1JPFB 1SM3L 3O9WA 5BRZB 1OWQA 3TIDA 4Q9BA 2J1KA 3VG0H 3J7HA 5D2NB 1TZHB 2D2OA 4LEXL 3TA3C 2NSXA 4CJ1A 2OXHA 3GIZL 3FT2A 2B4CC 5DJAB 4NFDA 1WE5A 2XVLA 2Q6WB 1I8KB 4WO4C 4I3SL 4HIJB 2EH8H 2FGWH 2X1QA 4JFQA 1GQLA 3FQWA 2APFA 3QZWG 4XP6H 3MLPA 4JFOA 1QFWM 3KPLA 3CSYB 2DTSA 1WGOA 5FUOH 4MLIA 4OBSA 4KVCH 4KI5C 3Q2CA 4V1DD 9CGTA 1QSFB 2NZIA 4GO9A 5T3XH 2AV1A 4XT1C 2LE9A 1E6JH 2EIDA 1BFSA 1NCWH 4OLVH 3TBWB 3P9MB 1H4PA 1DBAL 3QQ9D 4I13B 5MP6L 4PBGA 5GS0C 3TN0B 1SBSL 3OA5A 1RSFA 4DN3H 4WI2A 4FZ8L 2HG5A 3HZKB 2X8RA 1BOGB 3QHMA 2J6EH 1A1NA 4AD4A 1QR1B 3PBGA 4X4MA 3HA0A 3X11A 1A5FH 4MJID 1U30A 1W9PA 1CD9B 3FB7B 3MRMB 1PAMA 1XZ0B 1RVFH 4KTDL 4LSRH 1O0VA 3ARBD 1MJ7L 5JHLH 5A40E 3NAAH 3S7GA 2JLLA 4OZIF 1V0LA 1FP5A 5D6DC 1JVKA 1JFQL 1ZEAH 1G1YA 3CX2A 1VDGA 4OQTL 2JIWA 2QHRH 4P8WA 2DT3A 1M7DB 3SDYH 1CLYH 1U8IB 3FN0L 1YN6B 3TO4A 2X4SA 1H5BA 5MHSE 4MB1A 1T03H 4MWFA 3DI2B 3WLWC 1SQ2N 1XEDA 1JXKA 4P7NA 2IPUG 2FWOB 4AD3A 2JCCA 1MCKA 1M7IB 1UJTA 1X5HA 3VCLB 1V08A 3ULUD 3QOKA 1ETZB 3GI8L 2AGJL 4OLXH 3VXMD 4PRBA 3U2SB 3ZKXB 4HG4K 2XYLA 3IKCA 4XAKD 5EDXA 3D9AH 1NL0L 5DD5H 2TAAA 1NOFA 4AEHH 1GJIA 5T5NF 4NGHH 1MRFH 1A1MB 1IGIL 1SMOA 5GGUB 5BJTB 2BSSA 1FYTD 2NPLX 2PETA 3JV4A 4CGTA 4HEME 4JFEE 4R2GD 3T8XB 5HYJD 2DMBA 2VN7A 4P9HH 4H20H 4QHNA 3HE6D 5LA1A 3NIFF 1JPFA 5BRZA 3WN5B 2GUOB 3CIVA 4AZGA 2EDJA 5D2NA 2A38A 1C1EL 4KRPC 1QPKA 2VCCA 3V5DB 1TZHA 4W6XB 2CD0A 4PUBH 5DJAA 2FLRT 3EZ8A 4E2OA 2Q6WA 1MW0A 1I8KA 4NRZB 4HIJA 1OLZA 1E6NA 1BYCA 1DE4A 4F9DA 3VDAA 3ESVF 3VFVB 4V28A 2W07A 1I1XA 3CHFA 4L5FL 3CSYA 1XSKA 2H1PL 1JCKA 2YLLA 3BDYH 4EOWH 2MCPL 4AMKH 1QSFA 4KMTH 1TMCB 5JMOC 1KJ2B 4NQCE 5BXTA 4MXQD 1EDGA 1NGPH 1W1YA 4R7DB 3JV0A 3TBWA 3P9MA 4JDTH 4BF7A 5M5DA 3W5MA 3IFNL 5ABFB 3BKYL 3TN0A 1WCGA 2YZ8A 4PJ8D 3SDDC 5I1GL 1ULVA 4LSVH 3RNQA 3HZKA 3PZGA 4DN4H 3BDXA 1BOGA 3S35L 3SKJL 4IIQB 4L8SC 3WD5H 1YNTB 4NI3A 3W37A 4DUVA 1HIZA 1JXJA 1QR1A 4Z2HA 3VM7A 3V4VH 1KACB 4C56D 4D0CB 5E03A 1NUDA 2GJ6E 4JZOB 3NSXA 4XVUD 3FB7A 3MRMA 3W26A 1XZ0A 1WZ1H 4KDVA 1MFBL 3HAEH 4R4FL 4P8XA 2J77A 1G9NC 3ORJA 2VCAA 5KVMC 4HLJA 4AD0A 3MV7E 4HWBA 4TPRL 2XZAL 2UV3A 3O4LE 4LL9A 1QI2A 1RFDL 5FGCB 1M7DA 4MTVA 1DWFM 3A4WA 3MLUL 2FCBA 1U8IA 3WFBL 1YN6A 4GXUM 4M7JL 3P9WB 5KSBB 1CD1B 4P7LA 4KRUA 3UTSE 2OSWA 4RRPA 4JKKA 3WNOA 4GXUN 2VISB 2FWOA 2X89A 3Q1SL 3QGVA 5C0DB 2FJGB 3RFZC 2W67A 1M7IA 3VCLA 1ETZA 5E08L 5L6YL 1KN4L 1PG7L 3KPRB 3U2SA 4ELMB 4PSRA 4EKXA 1A2YB 1S3KL 3VGHA 2R56H 3DHMA 4J6RL 4GS7C 3L3JB 1OB1B 4MA8L 1JN6B 2E9WA 3UTZB 1IAIL 4HPGA 4HMDA 3FZUC 5D9OA 3VDBA 1A1MA 5GGUA 5BJTA 2JJWA 5HI4C 1GGBH 3UC0H 4L3ED 4FFYL 5C2BL 3PXHA 5HYFA 3ZJ8A 4R4NC 3T8XA 2JJSC 3WSQL 4BQ8A 3FW6A 4FQPA 2GDVA 5EU6D 2HLFD 2D4FA 2XN9D 3WN5A 2GUOA 3K46A 4W4OC 1CL7H 1AXSB 2R8SH 2HFGH 5D72L 3VWKB 4X9BA 1A6WH 1FCGA 1N5YH 5JW5A 3BEVB 4GSDH 3A6BL 3O0RH 3X3FL 1EO7A 4I8DA 2NY1D 4NRZA 5F7NC 2XSAA 2XA8H 2CQVA 3QPQD 4ZO7A 5JW4Q 1KJMB 2VRAA 5TDPB 1YMMD 3VFVA 1UA7A 4U49A 4LRNL 1FPTH 5T33H 2O5YL 4JRXD 5CGTA 1ORQB 2IPUK 3SE4C 4NRSA 3MV8B 2D7OA 4PY8I 3U5UA 3I02B 3BPOB 5T3XD 1IT9H 1KJ2A 3KWWB 2P7TB 4O2FB 5KVGL 1KXVA 2BVUA 2H2SD 4PYGA 2ICWB 3L3IB 4ENED 5IESL 4XNUH 1OIFA 5EFDA 3WH6A 3G6LA 5ABFA 1GH7A 2DQGH 1F97A 4W70A 5SV3A 2VLJE 1Z3GL 4IIQA 3W0WD 1HOCB 5FIEA 1BF2A 4RFNC 3ZJKA 1AC0A 5HHOB 4P46B 4NZRL 5DC9B 4D0CA 1D3CA 3ZKMD 4C57C 2DPEA 4JZOA 5AY7A 2W63A 2PI6A 1RY7B 2ZX7A 2DQCH 3OAZK 4JFHE 3GBDA 4U1MB 4L4VB 4G7YH 1WFNA 3L4XA 2VLLB 2QR0B 1HI6B 4MQ7B 4Y5YC 4NO3B 1FAKT 2OR9L 3SHSA 3D69B 1TQBB 3GSRB 1J18A 4HG4J 1PY9A 2WC3A 3VXSE 1TVNA 4OIFA 1RZ7H 3LSOB 2BC4B 4U6YA 5E00B 5KSBA 1CD1A 1FCCA 4H41A 2V3FA 3WS6A 2HLAB 2VISA 4KJWD 3VIPA 3G6JE 5C0DA 2FJGA 5CSZA 2BVYA 1UM6H 4KDTA 3JWDL 3WFCH 1QZ1A 3AICA 4AH2B 3MLWH 5GZOD 3KPRA 1MWAL 4UQCA 1JE6A 1A2YA 1PSKH 2V9RA 4LGSB 1A1OB 2CLRB 1WWWX 2IEPA 3L3JA 1OB1A 2IUZA 1JN6A 2Y5TB 3PDOB 3S96B 3UTZA 3O8XB 5BVPH 4J8RB 1GOIA 3PZQA 5EU7E 1NMAL 2P43B 2DH2A 3CXHJ 1BF8A 5CZVL 2NZ9C 5I23A 1QSVA 1W72B 3MRKB 1U95B 5DZLA 1L7IH 4LBEB 3E3QC 2NY0B 1MNUH 3HNSL 1KLUB 3SUTA 4W93A 1J87A 3CK0L 3U9PL 3FQTB 1AXSA 2PR4H 4JY5L 3RVXD 3VWKA 2UZIL 3CLFH 4ODBD 3BEVA 3QUKB 3ARUA 1UQYA 4ZODA 4OF6A 1PG7X 1LO4L 3WUGA 3IJ9A 1KB9K 1KJMA 1EHAA 2AVGA 4Z2IA 3P77B 2HT3D 5TDPA 3MBXL 4WUUD 5CP3A 5ADPL 3QOMA 2J7LA 4LSSH 1ORQA 3WUEA 1F3JB 4CBPA 3MV8A 4HHAB 5D1XB 1GJWA 3I02A 1KJ3H 2ZX9A 3KWWA 4O2FA 4N8CH 2EPOA 5MENB 2YN3A 4OGXH 2ICWA 3L3IA 3O3BB 3EYUL 4GQ9L 3TNMB 1ESWA 5JDSB 2ZKHH 3VTRA 1QFWH 2VXTH 2O5ZH 1A3RH 3MQIA 1AKJD 3TIEB 5GRJL 1AVAA 2Y06L 1S9YB 1EGZA 4YHIB 5C6TH 4RCAA 1LEGA 4MJ6B 4CKVX 1PLGH 3L1OL 5HDOA 4K3EL 1HOCA 4HOXA 5E2TL 4S2SA 35C8L 4N42A 1EO8H 1LO0H 1J11A 4FQ1L 1QNRA 4XNYH 2DIEA 1OAUL 5T1DH 2DWEB 2CJUH 4EK7A 3NGBC 1FFOB 3TH2T 1QA9B 1TIUA 3NPZB 2VTFA 1OAZL 1YEKL 3VD3A 4DEPC 3VO0A 3BD5A 5A2IH 5I30L 4AL8H 4U1MA 1CZ8L 1WP6A 4L4VA 3I6LE 5JHDD 1CFVH 2VLLA 3D39D 2QR0A 1HI6A 4MQ7A 4PSPA 2NXZC 2WWCA 5ERWB 4NO3A 5DWUL 5LG1A 2JTDA 1JGUH 3D69A 3BZFB 3GSRA 2XICA 3VGEA 5AG9A 1GOGA 4R90L 5DT1L 2XVNA 1RAMA 3LSOA 2BC4A 4QXGH 5E00A 4ZXLA 5HSFA 3HMXL 2VABB 1BG9A 4PLKC 4GRWE 4OGAD 5EA0L 3ISWA 5BV7L 1C16B 3WL0A 1Q72L 4XPGL 1ITBB 3WHXA 4XB8A 3VWJD 3D3VD 2F5BH 1FRGL 4AH2A 3VX0A 5AG8A 5D7IB 1JYNA 2VR4A 3FRPG 5D7LE 5IJKC 3LS4L 2I5YH 1A6ZB 1A1OA 1DZBA 2LV4A 2CDFB 5DC0A 4K3DL 4B0MM 1UWXK 2Y5TA 3PDOA 3S96A 5A69A 3O8XA 4J8RA 2K1MA 3PZUA 3OAZH 4XC3L 5F7DB 4MA1B 2Y07H 4X83A 3BYYA 3HTLX 3MRKA 1U95A 1NGYB 4HXBL 4IDJH 1XF1A 1A14L 1TVHA 3QFJD 4LBEA 2R9HD 3UJIH 1CICD 1S9XB 4MAUH 1IGYB 1RJCA 3MV01 1KLUA 2FX9L 5GHWL 1CG9B 4CW1B 4WIWA 4KK5D 3AXLB 4KFZC 4TOQA 1BX2B 3FQTA 5BZDA 3GMNB 3QHZH 5K59E 3VW3L 4M3JA 4JB9L 4ZTPH 4Y7EA 3QUKA 3BSHA 4P2OB 5FECB 4GPNA 3AMDA 3MBEB 1D6EB 5LBSL 2JB5H 5DVLA 3P77A 1IL1B 1LNUB 1MY7A 3H9ZA 4G6FB 4WI9A 1F3JA 3EDFA 3EIFA 4HHAA 1U41A 3DURB 1UEYA 2M26A 2WKLA 2PCPB 4NM4L 4HC1L 3QI9D 3WMSA 1EXUB 3CXDH 1DUYB 4AXNA 5MENA 4Q0XL 1P9MA 1UYQA 2QMKA 3O3BA 4HBQA 3TNMA 5JDSA 1NAKH 3L5IA 2JF6A 3DVGB 1N6QH 1KC5H 3TIEA 4LYQA 2P5EE 1S9YA 2Z8SA 5DRXB 1JNLL 4YHIA 3MRIB 4ONFL 4MJ6A 4X7SH 5LCVL 1PKQB 1FSKC 3SDAD 4FLSA 2DQHH 1DQDL 4Y1AA 5I1HL 3CFDB 1IC4H 1NC2D 2DWEA 4F7TB 1FFOA 2DI7A 1MJUH 2DQIL 5EOCL 4E41B 1QA9A 1HH9B 2IBZY 4XXCA 3CU7A 3WF3A 4YE4L 1BFVH 3LPGA 2D31B 4B41A 3EZJB 1KENH 3F65A 3QWQB 2YD5A 1SY6A 1GGYA 3MSPA 1GIGH 3GRWH 4MAYC 5ERWA 2WSPA 1CBGA 1KTKE 3BZFA 4H8WL 3TFKD 1IKNC 5IBUB 2OJZH 5EORL 3FXYA 2J5LB 3U0WH 3IDXH 3BESR 3QDMD 4J7RA 3ZHDA 4RSVA 4WEBL 2VABA 4UOQA 4AENB 1C16A 2VDPL 4N5ED 5C0CE 4D9RE 3O2WL 1J10A 1XCTB 5JQ6H 5D7IA 1FZMB 5FYKE 3AVEA 1CDBA 4OCRL 3QIBB 1A6ZA 3ZSTA 4WTZG 1QPXA 3RVVD 4M6AA 4WU5B 2YPVL 4DVRL 1OM0A 2UYLB 2YBRB 3KR3H 5F7DA 1TETL 5KBNC 3DMMD 3GHBH 5SX5H 1D6VH 3WQ4A 1NGYA 2WBJD 3ULUL 3HC3L 3SCMC 4OT1L 3EYOB 3B83A 5HI5C 1S9XA 4OGYL 5DDHB 1IGYA 5F70A 2F58L 4DW2H 1LK2B 3DECA 1RIHL 1CG9A 4CW1A 1HKLL 2EICA 5I1JL 5IVNA 3AXLA 3P4OB 3R4DA 1BX2A 1F42A 5EBWB 3MCG1 4HJJH 5DD3L 3ARVA 3GMNA 4HH9B 4Y4HB 3K3QA 2WB5A 4FQ2H 4U1LB 2YSSB 4P2OA 3UCRA 5FECA 1A7OH 4JZJC 3MBEA 1D6EA 3ARZA 5GRZA 5IKCB 2D7NA 4BUHA 2GSGB 1CFNB 1IL1A 5D7JC 3G04B 1LNUA 4HKJB 2VQTA 8A3HA 3WIHH 5A2KH 1E73M 4PJXB 4PJ9B 5JIKA 4PRIA 4P2QA 2AJ3B 1UWXH 3GSNH 3DURA 2PCPA 2EZ0C 4KUCD 2X9XA 3GJEB 3CX5J 3EAKA 1EXUA 2R1WB 4OZFH 1DUYA 4FHBD 4NN6B 5ELIA 2P5WB 4Y4KC 1HEZB 3DVGA 1DBML 3BAIA 1NWSA 5DRXA 4Y5VB 3MRIA 4KKAC 2HKFL 2ICES 5DA0B 1PKQA 1Z9MA 3MSGA 4QAWA 2ADJB 4ETYA 3CFDA 1JGVH 2OR7A 1OWRM 2XRAL 3BPNB 5E2UH 5FYLH 6FABH 3EDKA 4E41A 4DUXA 4WV1A 4PJIF 1HH9A 1RUML 4XB7A 3BPCB 3VXUE 2WSKA 3LRGA 2DKUA 3T2QA 1A8JH 1JRHH 5FDWB 2D31A 4QRPE 4OFKA 1LQSR 4M1CC 1FH5L 4LLUB 3VD9A 1F4XL 4W8AA 4PREB 5GRWA 1IC7H 2VH5L 5F3HB 1JGLL 2WKGA 2QSCH 3TVMD 4YO0B 3O9WC 3PXJA 32C2A 5F1KC 3C9NA 3PE9A 1IKFL 4ZYKB 3RMEA 4AENA 1CE1L 1WWCA 3S98A 1Z32X 4PTWA 4WFGE 5F7EL 1NCCL 1V6YA 3LZFH 1ZWIB 3OKYA 3QUYD 3HR6A 4JO3L 1XCTA 1DBKH 4GBXD 1FHDA 5MHSD 4HIIB 2JIEA 1IE5A 3X13A 1AGCB 3QIBA 1W32A 1G7IB 2WUBL 3WXVH 1H8NA 2P46B 1QTYT 3ME0A 4WU5A 3K8MA 4XAWL 5HY9B 3WO4B 3ZOAA 2UYLA 1BM3L 4PB0L 2YBRA 2J4WL 4ODUB 3MLXH 4UNIA 2YMXH 1AGFB 4ERSH 5IW3A 4XP9H 4HFWB 3KPSD 4NHCH 3QA3B 3EYOA 3O9NA 4HPHA 2DICA 5DDHA 4KK6D 4E8DA 2FBOJ 4LQ1A 1LK2A 2H6PB 4YHKL 4QRUB 4D6FA 5FYJU 1YNKL 5FDYA 3P4OA 2B31A 5GIRB 5EBWA 3LD8B 4HH9A 5DK2B 1I3GH 4Y4HA 3BSZH 3IFLL 4JFED 4FQLL 4U1LA 2YSSA 3PF2A 1Q9OB 1WZLA 5IGXL 5DK3A 5HHNB 3L9RB 4KROD 4F79A 3KPMB 3WH5A 5IKCA 4LCCB 3PNWB 3SOBL 2GSGA 4KRMB 1CFNA 3G04A 4HKJA 1QLRB 3RUGE 2WVTA 5FL1A 2OCFD 4PJXA 1YEFL 3FOLB 2VDQH 4PJ9A 5C08E 3VG0L 1MFCH 2FLBT 4FFWD 2AJ3A 5E7BA 4LMQI 1N6VA 3GJEA 1FBIH 2R1WA 5CCKH 1PBYA 2Z31D 1XIWB 4ONOA 3TO4C 1RULH 1PVHA 1MQKH 1H5BC 1NAMH 2P5WA 3TBSB 1HEZA 2FGWL 2NY5H 3MMDA 4Y5VA 5J6HB 1QOXA 4K3JH 1UM4H 4NQCD 2R0WL 3MSDA 2ZG2A 4UCFA 2ADJA 2ZNXA 1E6ZA 4O2CB 4YDVA 1EMTL 3VXOB 5T3XL 4Y19E 4Z7NF 1E6JL 2HRPL 4OLVL 5FK9B 3IU3A 3ULVC 4YHLH 3PP3K 1UZ6F 3T1WA 1SEQL 3Q5OA 3BPCA 3B9DA 4M3KB 4XCNB 2GDUA 4DN3L 4ZENA 1CL7I 2ZP0T 5FDWA 1N0LA 2XG5A 2QV4A 2OSLB 3HC4L 1NC4D 4KJQC 4WUKH 5EOQH 5DD0L 1I1YB 5JXEA 3WBEA 2PYEE 2OWWA 1RHHA 4OBRA 4JQVA 4LLUA 3MLSH 2EYRB 1J0ZA 2J6EL 2BNRB 4PREA 4NFCA 1Y6MR 1WIOA 2Z8RA 4HZLB 5F3HA 3UZQA 3SIMA 1KGUA 1A5FL 3HJEA 3G6DH 5AWNL 1MQQA 4YO0A 1RVFL 4MX7B 4R8WH 5D2NC 5JHLL 5GSRB 3NAAL 4DQOH 3S3SA 3B8YA 3MJGX 4U5IA 5T1KB 1QKZL 3MNZB 5J1TC 2H2PC 1ZEAL 1ZWIA 1NKOA 1OGAE 1UFUA 3VILA 3QDAA 1A6AB 3MRNB 2RGLA 4HIIA 3D0LB 4AEIH 3PZTA 3UTSD 1AGCA 1G7IA 1QSEB 4UT9H 4HCRH 5DD1H 5HY9A 4LQFL 1T03L 4ZS6D 3GNML 4I0PB 3NZHH 2V2TB 4H7VA 3TZVD 4P9MH 3O6FB 1BJ1H 4ODUA 3T0EE 2AQ3A 4KI5E 2P47B 1AGFA 4WI6A 3RDKA 2QADD 4HFWA 4OLXL 4JG0H 3QA3A 2V5TA 1X9QA 1UR1A 1NBYB 3TN0C 1RURH 4YHML 4WI4A 3L3GB 4NCC1 2H6PA 4QRUA 1W1TA 3GIVB 1MW3A 3AHYA 3CFIC 5DD5L 5GIRA 1X3DA 1EDQA 2A1WL 4P7OA 4KV5E 3HZMB 1HDMB 4QTIH 4XHJD 5DK2A 2ZSVB 4XB3A 3BXWA 4U6VH 2Y36H 1MRFL 1HHKB 4JGJA 3STZB 2C7UB 2EPLX 3ZE1F 5HNNA 1Q9OA 1TJGL 4L9DA 4FN0A 3BJLA 3QUMH 4JHAL 4NC2B 3V4PL 3L9RA 1JZ3A 3FMGH 3KPMA 3KGRA 4LCCA 3PNWA 1FOBA 1IJ9A 3GBLA 4P9HL 1QLRA 3MYZA 2EEXA 1NBZB 3FOLA 3U7AA 4Z7UB 2WQ8A 4W5ZA 2FATH 3EYSL 4NNPH 1QI0A 1ZHBB 2ZXDA 3WN6A 4UBDD 3GMQB 3ZDYE 4JPIB 1OAYH 4PUBL 4NCC2 5IW1B 1V6WA 1J1PH 1XIWA 4KJPC 3SCNA 3TBSA 3GH7A 1W3JA 1EHLH 3VFSB 2YD3A 1JTPA 1CI5A 1BJ1J 3BYTA 4GFTB 5BOPA 1JNNH 1J05B 5J6HA 1Q6CA 3D85D 1AR1C 2P44B 1ZA3B 3NACL 5FYLD 1TPXC 4O2CA 3VXOA 1CXFA 1JWSB 3MLZH 3UZVB 4M9OA 1QG3A 4XVTL 5D5ME 2VLJD 4JDTL 5FK9A 4YH6A 1NARA 4OF7A 1P4IH 1OTUC 3FHAA 2GAZA 4RFEB 4PGDB 3LKPB 5L2JB 5BQ7B 4HOWA 4MXWL 1GCYA 4PN2A 1A7RH 2FHFA 2IFFH 2OSLA 4DN4L 1QBML 3WD1A 1I1YA 4UQ9A 3WD5L 3L4WA 2BNRA 4AG4L 4HZLA 1UM5H 1J7VR 4JFXB 1E0VA 3E1F1 3AS0A 5DT5A 4RL3A 4AY0A 4LFHD 3OJ2C 3DNKA 2IMNA 1XMWA 4MX7A 5FGBA 3WN5C 2JEQA 3F7RA 1E4WH 5GSRA 4JO1H 1PY4A 1F8TH 1T1ZB 4RDQG 3SCPA 5T1KA 4MNQB 4PJCE 1N2RB 4POZD 3E6HB 3MNZA 4JM2B 4FG6D 1R3HB 3RVUC 3W82A 1MRCL 3VXSD 1A6AA 3MRNA 4DFHA 4OFYD 4U6XB 5H2BB 1RZIB 3D0LA 5A94A 1W0YT 5F3BB 1JZ4A 5I18L 1QFWI 1QSEA 5EH1A 3S6CA 3BAWA 4BQ2A 4IM4A 3H7LA 4QFUA 1UG6A 3CVHL 4I0PA 2J8OA 3CH1B 3PP3H 2V2TA 3RVWC 3X3GL 1B3ZA 3O6FA 3ARGD 5IB1B 1KXVC 2YUZA 3JWOC 5BRPA 4AD5A 3ZR5A 3CPUA 1AQKL 1NBYA 2DLTA 2MOVA 3MLTB 1FG2A 3L3GA 3GIVA 3PWVB 1EEUA 3F7VB 1XCXA 4IIQC 3I6GB 1T89A 3HZMA 5IMKB 2CIKB 3GFUA 3ZTJG 5HD8D 4LF3B 4D9QE 2EDRA 1LL7A 1HHKA 3STZA 2BP3A 2C7UA 4QXWA 2GJXB 2O93L 5I0DA 4LOUD 5DLML 1KYOJ 1RPQA 1FG9C 1WZAA 3OLDA 5BYWA 3QZWB 3WEZA 1XGPB 2HFFB 1NBZA 1P6AB 4Z7UA 1CL7L 1XF4B 4FQCL 1ZHBA 2XKNA 3M07A 4JPIA 3STBA 1NLDL 5DHVB 1ZT7B 3GHEH 3QJFB 5C0EB 3O0RL 2XKUA 5IW1A 3MRDB 3VXRE 3VFSA 1A9EB 1U2CA 4LLDB 3MUIA 3WS6C 4OF5A 3SCOA 5KZ6A 2NCMA 1J05A 2YKKA 1UR8A 3AZTA 5DZOA 2P24B 3CUGA 4ZUSB 4KDTC 1ZA3A 2P42B 1IVLA 4NQVB 4NO0B 3RILA 1IT9L 2NYYC 3ARWA 4KGJA 1G6RL 5GGTA 4D6CA 4XNUL 3B8SA 3R0MA 1BYAA 1BSIA 4JFTA 4PGDA 3LKPA 43CAB 5L2JA 5BQ7A 4X6CE 2FX8L 4OCWH 5CD3B 2M2DA 1HHHB 4F8QA 1KR0A 2PO6D 2YWZA 2A74B 3CSGA 4JANB 5C3LD 3M46A 5BMFL 5ISZB 4ODWB 2COQA 5C07B 1FVEB 4JFXA 3HRZB 4WWKB 3L5XL 1PBGA 1UACL 3EOBB 3W24A 1XR9B 5MI0B 5IMMB 1WFUA 2ADFH 1X6LA 4LLAA 2DQCL 1T1ZA 3VWKC 1H3UA 3OJMB 3RHWF 1GAFL 5CZKA 4U1JB 4MNQA 1N2RA 3E6HA 4URTB 4JM2A 2DH3A 3SCUA 1R3HA 4G8IA 4LSPH 5C0AD 5FCUH 1E5JA 5KS9F 1T5XB 5H2BA 1RZIA 4F3FB 4LPWA 5HGDB 4OCMC 3CZ8A 5F3BA 4X9YA 2YIHA 2FYYB 1RZ7L 1VGEL 1AY1H 2H26B 4OZIE 2ZWZA 4D71A 5I15H 3VXTB 1JGDB 3CH1A 4RWYH 2C26A 5E5UB 3BPOC 3OB0K 3QPXL 3ULUF 5IB1A 1EEYB 1UM6L 2X1WL 3EDJA 5D7LD 2NTSP 3WFCL 2AJXL 3U4BH 1LWJA 2ARJB 1FAIH 1CGTA 3MLWL 2VJXA 1J9CT 4PJIB 4XPFL 1BGGA 3MLTA 3MJ9A 5I1CL 2XJ7A 2YOCA 3PWVA 5D71L 4MCYB 3F7VA 4G80B 1HQ4B 1WT5A 2C4FT 5D8JH 5BVPL 1UVQB 3P4NB 3I6GA 2XA3A 4MQTB 4XH2B 5M3WA 5IMKA 4ZG1A 1MCJA 2CETA 4LF3A 5DYOB 5DD6B 5J7CC 1E6OL 1CK0H 2GJXA 5IXEA 2NX5B 4LGRB 3HMCA 3AXHA 1Q0XL 3VOCA 4BZ1H 3EUUA 1MNUL 1YEGL 3QZWA 1YC8A 1IRAY 5CINH 2WPGA 2J12B 1XGPA 2HFFA 3O6LH 4PRNB 4G9DB 4S1RH 5C0ND 4CNIB 1VFFA 1DLHB 1XF4A 1BPVA 4FQJH 5DHVA 1TZ7A 1ZT7A 1TQBC 3CLFL 4FTVB 4UQAA 3QJFA 4F15C 5C0EA 4M93B 4TTUA 2BY2A 3MRDA 1A6UL 4C7FA 2BJML 2ZNWA 5D7KE 1JHLH 5GXBB 4LLDA 4HD9A 3QYCA 4JFFB 4I4WB 3H9SB 4AZIA 2P8LB 3JSSA 3OL2A 1OM3L 1JK8B 1LO3H 2P24A 2CITA 4ZUSA 5DRWB 4QGTA 2D7PA 4M6NH 1NOUA 4NQVA 5LAXA 1PX4A 4NO0A 4MAVA 2Z0BA 3DX6A 3RDTB 5C09B 1FV1B 1Y18B 3VVGA 3TT3H 3QRGH 3ZKND 5L88H 2VXTL 4XCEB 5FIPA 2O5ZL 3LEVH 3O8XC 43CAA 5CD3A 2FGZA 4LU5L 3BHBA 1HIML 2C5DC 4NRYB 3GBML 4P23D 2A74A 4U7MA 5ANMB 1KPVB 3DXAD 4JANA 4NKOB 3PN8A 4NJAH 2ADIB 1EO8L 5ISZA 1LO0L 4ODWA 1UJ3A 5C07A 3RJQB 1FVEA 3HRZA 4WWKA 1D5IH 3U0PB 2CJUL 1FH8A 2X9YA 3EOBA 2FZ3A 3E3QE 5AC5A 5IMMA 2FBJH 3WFEH 3W38A 2VKXA 3ALXA 3CZGA 5I2UA 4J27A 1EVUA 4Y8DC 1C91A 4AL8L 2HP4A 4U1JA 4Z2GA 4G9FD 1CFVL 3EO1B 2IQ9L 3BP6B 4EI6B 1I3UA 2ZCKH 3F5WB 2XQBH 5E5MB 4RWHA 1JGUL 1W8OA 4F3FA 1T6WA 5HGDA 2F54E 4O5LL 4PYSA 4TVCA 4PJFF 2FYYA 4MXVF 5TPWL 4S3KA 4OFPA 4QXGL 4X6FB 2H26A 1JF1B 4D9RD 3VXTA 5C0CD 1D7FA 1MPAL 1JGDA 4JFDE 4P4KC 3S8WA 1J0JA 4Y16B 1F2XK 4MA3B 4FQQA 2C3WA 5FYKD 5D4YA 4ODTH 1N0XL 1EEYA 2A77H 1P9MC 2F5BL 2ARJA 1X4YA 4PJIA 2FD6L 3AMKA 3OLIA 2I5YL 4QF1B 1AP2B 2WCGA 2CSPA 3EDEA 3QNXB 1B3JA 1HQ4A 4BA0A 3VUPA 1JRHI 1UVQA 5EU5B 4XH2A 1T7ZA 4UIKH 4X6DE 5DYOA 1MHEB 5DD6A 3EMQA 4H0HB 1UCBH 3P30H 2NX5A 4M1DL 3LRHA 4IDJL 3STLB 5JA9A 4F57L 3SKUD 4XXCC 2I25N 3UJIL 4J4PA 3QCUH 3GXDA 4MAUL 3OGCB 3MR9B 1C90A 1GOKA 4RA3A 4CNIA 4PRNA 4G9DA 4D3CH 3EBVA 3ZR6A 2F53E 2UY6A 5BVJB 1DLHA 2R0LL 2XIIA 3WH9A 1NCUA 3NCFB 4W5UA 1MWAB 1OW0A 4OM0L 4YHYB 4FTVA 1HCFX 5HI3D 1YMHB 1ODZA 4GRLD 2DSKA 3MU7A 3IDIB 1ZBKA 2JB5L 2W5FA 4JFFA 4I4WA 2UWEE 2XZQL 3H9SA 4MCZB 2E7MA 4POUB 1JK8A 1MFDL 2NW3A 2XVGA 1K85A 5DRWA 3ILQC 3DETD 2HMID 3CLWA 1MYRA 4YDKL 3WNNA 2G2RB 3CXDL 4JKPL 5C09A 3RDTA 4LSQH 1YJDC 2NY2B 4UI2A 3TO2B 5EB9A 3V7AE 4XCEA 5IW6B 2VDKH 2EQDA 2XVKA 2EE2A 5LGHH 4Q7DA 4NRYA 5ANMA 1FO0L 1KPVA 1WAAE 4NKOA 3NDZA 4KZDH 4PJGE 2ADIA 3SJVE 1VFMA 4NOBA 1L4IA 3VXUD 3RZCB 3U0PA 4GG6E 1G9HA 1MJUL 1E4XL 1DANT 3QDHA 1INEH 4QRPD 1YEIH 3GK8L 4DAGH 4NP4H 4TULH 4UV4L 4HMCA 4O2EB 3EO1A 4YBQC 4EJ1C 3LDBC 3ALGA 5F21B 4EI6A 4P2OC 3GRWL 3F5WA 5DC4B 5E5MA 3MBEC 2A83B 3QWOB 1CENA 5CQ1A 2XUCA 2XFXB 1KR1A 3FB6A 3BCDA 4R26H 4YLQT 1I4FB 4WFGD 4X6FA 4K2UL 3V0AC 1JF1A 5KZCB 4OZGF 4Y16A 4MA3A 4E9LA 2DL2A 4WW2F 1N6UA 1B4RA 2ZCHL 3U5YA 1G7QB 5C3TA 2AOSA 15C8H 2ESVE 3ZTJH 1X4ZA 5JQ6L 1IEAA 2AEPH 5AYQA 1N3NB 4WCYL 1X5GA 4QF1A 5MERB 1AP2A 4LSDA 3KEHA 4EN3C 3QNXA 1GOOA 3PQYE 2XXMB 4L8BB 5EU5A 3KR3L 5BWFA 2BZDA 7TAAA 5HYSG 2B7DT 1D6VL 4WV1C 3STLA 4JR9L 3N04A 2DQFB 5EPMB 3ZE2E 1FNEB 3NA9H 3OGCA 3MR9A 3ZDZF 4DW2L 5SWQB 3OB8A 2BX5A 3IT8D 3WFDH 5BVJA 1MIEL 2XKSA 4HJJL 1MWAA 4HLZH 5DJYB 1H41A 1YMHA 3DJ9A 3PGFL 4FQ2L 1KWKA 4RMWA 2XG4A 4HUKB 1A7OL 5IFAH 5DA4A 3IDIA 3WIHA 3CDCA 5C08D 5J57B 2V3DA 2VRQA 4HEPG 4MCZA 4F9PA 1F5WA 4PRPB 2GFTA 3AY4A 4QT5B 5E8NB 3GKWL 4HPOL 1QHOA 1UWEH 3IDMB 5JMRA 2QHLA 1S7WB 5TE4H 5JW4M 1GYAA 3RWHB 5IOPB 4S1QL 1B9ZA 3CCHB 1TZGH 4X7EC 2G2RA 2OMBA 5JW4N 3UJJH 3QIBC 3GUTB 4DM2A 4F37K 5GZNC 4ONGH 3UAJC 3TO2A 5HHVL 5T3ZE 4G6JH 3MXVH 5IW6A 3RM4A 3PGCB 4LASL 1B3XA 1FZKB 1URLA 1MIML 3P40A 1JPGB 4JJHA 5TFSL 1G9MC 4Y19D 4XPAH 4H1LG 2BOCB 1CGWA 1LO5B 1JGVL 3INUL 5E2UL 5E6ZA 1FVCA 4YK4C 5J1SC 1SYTA 5SWZA 3RZCA 1CEOA 3Q3GB 4Z7VE 2D7MA 1H3XA 1VFBB 2C7FA 2PYED 4YN5A 1BHGA 1FNFA 2I9TB 5ACZB 4AIUA 5CD5C 4LAQH 4O2EA 2QSTA 1NEUA 3FT3B 2DM7A 1FORH 1CLOL 5CZXC 2UVFA 2EXYC 3WFLA 2BNUB 3ZMRA 3QWOA 2A83A 4PJ5B 1IC7L 3D2UA 2BSTB 3CNKA 4IRSD 4QRRB 3AIQA 1FNAA 3OZ9L 3X17A 2VXVL 2QSCL 3EO0B 2XFXA 3QNZB 4C83B 5CBEB 1I4FA 4PJ9C 3GBEA 2FNBA 5I66B 2MANA 1OGAD 1KPUB 3PHSA 4U2ZA 4S3JA 3WCYA 3WL9B 4WO4D 3WKMH 1G7QA 3LZFL 3OGVA 1NMCB 2X4UB 4F7PB 1BYBA 4NN6C 1DWAM 3PTQA 1J8HB 1LDPH 1DSFL 1N3NA 1C8XA 5DJCB 3KL3A 5MERA 3WXVL 4Y5VC 1MCSA 3WIIL 1VJSA 4KI5D 3ZYJA 1HJXA 2CLVB 3IDYB 3BPNC 1U0QA 3MNWB 4IEFB 1J0YA 5GS0D 2DDQH 4M6ML 1JD9A 1K2DB 1H09A 4NHCL 2DQFA 5EPMA 5HVGB 3C8DA 1IGCH 4FMVA 1FNEA 3MO4A 4MNJA 4GW5B 4AM0B 2VXQH 1WK0A 1P5VA 5SWQA 3QCVH 4Z95L 1XD0A 3VRIB 2J2ZA 5JXEC 3SBWC 4JQVC 4K94H 1W1PA 3C5ZB 4L4PA 5DJYA 1E43A 4BYHA 1BGXH 4FRWA 5KS9B 1HKFA 5DFVC 2HVMA 4FXLA 2L7JA 3MV9D 2XZCH 4ODXB 3B43A 5B3JE 1QW8A 5EMYA 4EI5B 1HK6A 4XBGB 3AI0A 1JIBA 5IVZB 4R97B 4PRPA 4QT5A 5E8NA 1NUGA 2VDQL 3HCVA 1MFCL 1WIPA 3IDMA 4LKXB 5K9QI 5T1LB 3WIFB 3CIQA 1E15A 5LYRA 3RWHA 3VXMB 2D03H 5IOPA 1UQZA 3CCHA 4MA7H 1U8OB 3UTTB 1FBIL 3POHA 3BT2L 1S7VB 1G0YR 3CMOL 3WLWD 1MQKL 4YQXL 3N12A 3WO4C 3NSMA 2EIZB 3PGCA 1FZKA 2NY5L 4F80A 1JPGA 3WENA 3IETB 1C12A 3TCLB 1Y7VA 3PGDB 3MCLL 1EHNA 3BGFB 2UWFA 2BOCA 3QO1B 1DTUA 1LO5A 3WFZA 2RGMA 2Z8VC 1N8ZB 2AABH 3AS2A 2N7AA 2X1XR 3MUZ1 5I74B 2APBA 2ORBH 2JJUA 5JDJA 4PJHF 5JLZB 5HHME 1ZHNB 1ES0B 3Q3GA 4RGOH 4Z7WF 4IOFC 4YHLL 1VFBA 4I9WD 1EFXD 1P69B 3LD8C 2I9TA 1HXMB 5ACZA 1CGXA 4WUKL 1T7YA 3FT3A 3IFOB 3WXWH 1ZVSA 1J9YA 1JHKH 2QPSA 4X4ME 2BNUA 3MLSL 5F89B 4PJ5A 5E56A 2BSTA 3KVQA 4QRRA 4LCCC 3FRPA 3EO0A 3QNZA 1JPSH 4KRPD 5CBEA 4C83A 1H0DA 1VKXB 4R8WL 3A6CL 1ZJAA 5I66A 4OIIL 1KPUA 1XR8B 2EYSB 3N06B 4CVXB 5KANI 4AEFA 2OMNA 1H3PH 1B0WA 3WL9A 1XIWC 2X4UA 4F7PA 5D8WA 3K74B 4RE3A 1J8HA 4G6MH 3EHBC 1KGWA 2FX7H 4AEIL 1NQ6A 5DJCA 4M7LH 4UT9L 3VD7A 2NY3B 4H26B 1CWYA 4HCRL 1VFOA 5DD1L 3RI5K 3U4AA 5IT2H 4W8LA 4LYRA 2CLVA 4NRRA 3QXVA 1JZ7A 2JCCE 4P9ML 3MNWA 4C56B 4EVNB 3F5LA 3ZE0F 3AQUA 2YD2A 3DRTB 7FABH 5DF0A 1K2DA 3SDDD 2UZYB 2FDBP 1BFNA 5DMIL 5ALCH 4DVBB 2ITCB 1NKRA 4GW5A 4AM0A 3ULVE 2J75A 1KB5H 4K9EC 3T2NL 2X0HA 4NKDB 5F7YC 2DM3A 4D9QD 2DM4A 5ENWB 1RJYB 3VRIA 5ICXB 2BRQA 3MOQA 3SUUA 1U3YA 4YHNB 3C5ZA 5DEFB 2OP4H 4XCCL 5L7XH 4QTIL 4HWEH 3FO9B 3WNPA 5EZIH 4XCYB 2Y8KA 4U6VL 2Y36L 5KS9A 1RI8A 1B2YA 2W9EH 3CFCH 3RX8A 1I8MA 12E8L 5FGBC 1H8SA 4EI5A 4PJFB 3NDYA 2YS4A 2VX7A 4XBGA 4ZNCD 2A9NH 5D2NE 3RGVB 1IM3B 5D1QB 2D7TH 1CDCA 2B1AL 4UOW0 1QACA 5JW3L 4KUCF 2QBWA 4LKXA 3PZIA 2GTZB 2ATKA 5T1LA 1Z5LB 3IDGB 3VXMA 2ZUNA 5E2WL 3VXRD 5DT7A 1OAYL 1U8OA 3UTTA 1YECH 2FEEI 1E71M 1S7VA 3MRGB 1MCRA 2WYSA 3DV6B 1EHLL 1F4WH 2EIZA 5IVXE 2WMJA 2R0ZH 2UY3A 1YHTA 5DJ6B 3IETA 1WC7B 1LG2A 1TQCB 5E7FA 3TCLA 1FNSH 3QO1A 3RTQB 2NNAB 4L3EB 4HX1B 4IM8A 4JVPA 1EJ6A 1N8ZA 3QDGD 4U1NB 5IMOB 4LIQH 3SO3C 3N9GL 5EU6B 3PZVA 4X0NA 1ES0A 2YA0A 5E0FA 4U1SB 5GGSY 1P4IL 2XY1A 3FZUD 1T89C 2AS5M 2X1IA 1A7RL 1HXMA 3T04D 1XH2A 3PV7A 5HI4D 4CMMB 3H7BB 4EEEA 3IFOA 3OJDB 1ADQH 2YD8A 2NY1B 5F89A 4R4ND 2J7BA 2VE6A 4NF7A 1GHSA 4TRPH 3L4TA 2WNGA 3A4XA 2EH7H 1XGTB 1VKXA 3BWAB 3CVIH 3WDRA 1XR8A 3RA7H 2EYSA 4CVXA 2W61A 1MCQA 3S88H 3T2OA 2NLJA 1RZKH 5F71A 3DSFH 1WZMA 1UC6A 3D5HA 4ZXBB 2W62A 1IQWH 1KIQB 2K3TA 1V0KA 5LXGH 4FLOA 2E5EA 4RIRB 2ENYA 4Y4FB 2F9BT 4YX2L 2DMKA 2YL5A 2MMXA 1AGBB 4H26A 3W0WB 2CERA 5CJQH 3QIUA 2OLDA 2DTML 3BI9X 4AYSA 2IC2A 4ZOEA 5FA3B 1G6VK 5I1DB 2R29L 1JYVA 4YC2C 4C56A 4EVNA 1B1YA 5FYKL 1JPST 3MRLB 1LP9F 1A3LL 3DRTA 1GW1A 3BAKA 3PZ9A 3QEQE 4RMRA 5ICZB 1BAFH 1AO7E 5HBFA 4J3TA 4DVBA 1S7TB 2ITCA 1XGUB 4NKDA 1BZ7B 4ZAKC 1E6QM 3AHVA 2YK1H 1KELH 1RJYA 5ENWA 3CD4A 5ICXA 2ZX6A 1MFNA 1HHGB 4YDIH 3WEOA 4YHNA 5DEFA 4OUUB 5DJ0B 3FO9A 1DVFB 4XCYA 1MJJB 4M7LT 3V6FB 4TVUA 1W9VA 4MZ2A 4PJFA 4OUEA 1W0WB 3C5SB 5A16B 4JM2C 1IM3A 5D1QA 5F6HJ 3RGVA 5HJ3B 5ADOH 1AQHA 2J8HA 4WW2B 3MV11 1Z5LA 3IDGA 4HBCL 3WHE1 2ZPKH 1U8KB 4KUZH 4EAMA 1MQ8A 3DX7B 3EOAA 2WW8A 2QKIB 1F4YL 5I77A 3MRGA 1FHGA 3VRJB 4N0RA 3BXNA 4HDIB 3DV6A 3H9HB 4XWGH 1DP0A 4QOKE 1J86A 1RZJL 4XCFL 5DJ6A 1WC7A 1JFHA 3FQXB 5DMJB 2UVEA 4OD3H 3RTQA 2CCRA 2NNAA 4L3EA 4XNMB 4AIOA 4HX1A 4U1NA 3GNOA 2D0GA 5T3ZH 5IMOA 4UT6L 2OK0H 5EU6A 3BGMB 3ZT7A 3A0OA 1DCLA 4U1SA 1WT5C 3CC5B 2DQDH 1EA9C 2NZ9D 3MUAA 3TPUB 3OHXB 3VX1A 4HS8H 5KSAA 4S10A 4CMMA 3H7BA 3OJDA 2BRRH 1PFCA 1CCZA 5J11B 4Z7NE 5ECUA 4PJAA 3RJDA 1BECA 1ZOXA 2X09A 3MTRA 1OHQA 2J8UB 1CGVA 4WUUB 3BP7B 4KXZH 2X44D 4MS8C 2X42A 2ADFL 3BWAA 4E0RB 1HJSA 4M56A 4KMLB 3D6GA 2AV7B 3VIKA 3QISA 5CEZH 4ZXBA 2VO5A 1KIQA 5FCUL 2Y1VA 3LS5H 4MPKA 4RIRA 4Y4FA 5AEAA 2WUCH 3OLGA 3TF7C 1AKJB 4J2XA 4PEEA 5IFJB 1HINL 1AGBA 3NFNB 5FF6B 1G7JB 1MHPH 3GYCA 4H88H 3W0WA 5BXFB 5I75B 4AW7A 3HR5B 3F58L 5FA3A 3D18B 1ZV5A 4JFPB 4RWYL 5I1DA 2B1HH 4K71B 4HA3A 1G5AA 1UR2A 3WUZA 1UG9A 3MRLA 3KPRE 5I5RA 4F9LA 4OCYH 1TVBA 2FEEL 1VADB 1FAIL 5ICZA 4MNMA 1P7HL 1WDPA 4RMTA 1S7TA 5KAQG 1XGUA 1BZ7A 4KTYA 2DQTL 3DWTA 5JHDB 3BH9B 3GJFB 2C0HA 3D39B 2WWDA 2HJFB 4PP1C 5D8JL 1HHGA 1R5WB 4OUUA 4ZOBA 5DJ0A 3LQZB 1UJ3C 1DVFA 4HGKC 1T80A 1MJJA 2MHAB 4WWKC 3W9DB 3V6FA 1H0IA 1CK0L 1VENA 3MGAA 5MI0C 2MQ3A 2EEAA 2Q8AH 1BTCA 3CVHB 4PBXA 2X4TB 4QTHA 2F53D 4BZ1L 4YXLH 3U1SH 5C70A 1W0WA 2R4SH 3C5SA 5A16A 4IOSD 2NXZD 5CINL 2DJ4A 2ERJB 2L0DA 3O6LL 4DZBB 5HJ3A 2YKLH 3RBGA 3U30C 4WW2A 2NT1A 2VDMH 4WJ5B 4ACYA 4LVHB 3A4AA 1U8KA 2F15A 2MJWA 3DX7A 1V02E 4AZCB 4DGVL 5DQJB 2QKIA 4EIZC 2R1XB 3BE1L 3VRJA 5IUSA 2W0FB 2CK0L 1JHLL 4HDIA 1T66C 3H9HA 4PLKD 2D3NA 4JPKL 5CEYB 4Y2DB 1QI3A 3MOBL 3GB7B 3FQXA 3H8NA 3QT2A 5GGSB 4M6NL 1BD2E 4QXUH 4XNMA 4M80A 1KULA 3IAPA 1CICB 4X5XB 5E95B 2E4TA 5J12B 3BGMA 3BQUB 2Z1KA 1LQ0A 4RGNC 3CC5A 4KQ4L 3TPUA 3OHXA 3VM5A 3SJVD 2GW5A 3AIRA 1AGEB 1PEZA 4I0CC 4QCIB 1ZU8A 4UT7H 1ZTXH 4J4PC 1D5IL 5A2LH 2WIIB 4BQ3A 3MNVB 2J8UA 4F58H 4WUUA 3BP7A 4XI5C 4U3AA 4PJ7E 2EPKX 4E0RA 1GUVA 4L4VE 3RP1A 1OGBA 2AV7A 1MQPA 3O2DL 1G6RB 5CJ8A 4N90E 3QI9B 5E6YA 1A7NH 1ZT4B 3IU4L 2PWGA 2ZCKL 4P8VA 2XQBL 4ZOAA 4JVWA 3UPCA 3DO7B 2HT4C 3G6JF 5IFJA 5B8CB 1UZ4A 3ZSSA 1T6VN 3NFNA 4BKLB 1G7JA 5FF6A 1A4KB 2VZ3A 3QQ4B 3TM6A 5BXFA 2HTKC 2UY4A 3SDAB 4W7UA 2VLRE 3HR5A 2AK1H 5DHXB 3D18A 4JFPA 5IHSA 4NJ9H 2B4CL 3RDTC 2IFGA 4U0RC 3NPSB 4Y88A 4WY7H 3L5HA 1VADA 1J1OH 4PJHB 3LKSB 2E9BA 3BH9A 3GJFA 5A3IC 1OSEA 3D39A 2HJFA 1YDPB 4Z7QE 1G01A 1R5WA 3DI3B 4BQCA 2O5XH 2WM0A 3RIAK 3LQZA 4UIKL 3ZDXF 2MHAA 3W9DA 1EEQA 4L3AA 3V5KA 4W7VA 3IFPB 2FO1A 4X80H 1P2CA 2VDNH 2CRIA 4YHOL 4HFUH 3AIEA 5GS0L 5GNZA 3CVHA 3MRRB 2X4TA 4PJBF 3P0VH 4MB3A 2BVDA 5E8DH 2EPNA 4LCUA 3UP1A 1MCEA 4PLNC 1U3HC 5J06A 5E0QA 1S5IL 4P57B 4MB5A 2IPKB 4MAYD 1EUTA 1OVZA 4GO8A 1OAKL 4ETQB 3V0VB 1PQZB 4WJ5A 1MAML 1GJUA 4TUKH 4KK8D 4PG9B 4WK9A 1WFOA 5BROA 4AZCA 5DQJA 1SJEB 4UIMB 5C6PB 2R1XA 2HH0L 2W0FA 3U7VA 3O45A 1A02N 5BXPA 5CEYA 4Y2DA 3IXAB 4Y16C 1C5CH 3FT4B 4U1GB 3GB7A 3GDBA 5A1AA 3SGKA 3W0KA 4G6AC 4NQTA 5E8EB 3SE8H 5K9JH 2WBJB 1GNXA 2XY2A 5T3ZD 5MENE 1CICA 1JPTH 4X5XA 1YQVH 1YEHL 4NQDE 3L5JA 3LQAC 3TBTB 4O9HL 3BQUA 4UQ3B 3Q48A 2VDKL 4PTUB 2VDLH 4Y1AE 1AGEA 2G9HB 3QXDB 3NN8B 2XTJE 3LCYA 3SCMD 1S5HB 4KZDL 3AYSA 5HI5D 3NCOA 1R0AL 3BIKB 3T0BA 4KZEH 3BOVA 5EIQA 1HKMA 2WIIA 4JZNB 3MNVA 4NWTH 2CXKA 1IV8A 2RIKA 2IANE 2EC9T 4Z5RB 4BH8B 5I8KH 4NP4L 2G5BB 5LGJA 4PPTA 1G6RA 3QI9A 3LH2H 1ZT4A 4YHYC 4U7KA 4OZHF 5IVOA 5DQDH 5C0RH 1FC2D 5FKAB 1B4JH 3TYGH 3DO7A 3MPCA 5D7JD 4UDTB 4ZE5A 2PXYB 3BKCH 4HWBH 5B8CA 4FLRA 3LPPA 4JPWL 4BKLA 3AY4C 1A4KA 1VJZA 3QUZB 3QQ4A 3U48A 4Z77B 1WEJH 4KY1L 2EZ0D 4J3XA 1SVCP 1WO2A 1WZKA 4P2RD 4M1GL 2VRKA 5EO0B 1KTRL 4Y4KD 15C8L 5H37G 3VA2C 2VVSA 5I1KL 5LKNA 3VDHA 4PJHA 2QV2A 3LKSA 4KKAD 5H94B 3SE9L 1L0QA 3NH7H 5LA0A 1YDPA 3UG5A 4GW4B 5I1IL 2Q1EA 4XP1L 5HDQH 4YXKH 1I7TB 3RZCC 5C0FA 3IFPA 4MHHG 3V4UH 5L2KD 4XAKE 1F00I 4JKMA 2D9CA 1ODUA 3EOTH 3MRRA 4OM1H 1FHLA 4OI8A 3NA9L 3K1DA 4BQBA 4P57A 1KCVL 2IPKA 1RUQH 1V0MA 4M1CD 2NW2B 3UROR 2KUTA 3QUYB 3QXAB 3WFDL 2DQEH 1KXTB 3WS3B 4ETQA 3V0VA 2P4AB 1PQZA 1RP8A 3W2DL 1Y0LB 1X5FA 3UJTH 4LHJB 4PG9A 4LDOB 3B9EA 2CKRA 2AJVH 3O9WD 1SJEA 4UIMA 1G7MB 1DBBH 5IFAL 4MGXA 1G9NL 4UFHA 3BZ4B 3T0XA 3IXAA 1MRDL 2G5RA 1NOWA 3FT4A 3QEGL 4PRIE 2XWBB 1S78C 4P2QE 1AD0B 5HTSA 1EDTA 5FHBL 1UWEL 3ETBF 2HISA 5E8EA 2AERT 5ID1B 2Q76B 2WBJA 1JP5A 5FAAA 5EFIB 3TP4A 4X8XA 3TBTA 5TDNB 1US2A 4UQ3A 1NGQH 4G6JL 3MXVL 1GRWA 5JIPA 4PTUA 2CGRL 1K5NB 5J13C 5I6SA 2G8ZA 1PKQE 1KJ2H 2VZSA 1KIRB 1NEZG 2DM2A 4JFEB 2G9HA 3QXDA 3NN8A 3JWOH 4JFZL 5GNXA 1S5HA 5AYUL 5HHMD 5IEKB 4G43B 3NFSH 2EE3A 3BIKA 1OSPH 1T4KB 4OLWH 5MEQB 5ITBH 3QULB 3ZIZA 3CAFA 4JZNA 2JB6B 1HP4A 4ACZB 5DMGC 3DO3A 3A67H 4BH8A 3PZNA 2K7QA 1NUFA 4GMSL 2G5BA 4GG8B 5E8OA 4P59L 5AZEL 2DIBA 2Z31B 4PLOB 4HZ8A 5FKAA 1J12A 4N0YL 1MWOA 4OOZA 3REVB 1YC7A 1ZBWA 4UDTA 1UKOA 2PXYA 2Q7YB 1KUMA 4HKBB 3W25A 1GQIA 1FIGH 4P3CH 4NQCB 3RAJH 3M45A 4NM8L 3QUZA 5ESAB 1GVYA 4Z77A 2EDEA 5BS0B 1GZJA 3RKDC 2AQ1A 5EO0A 3TO4D 2BNQB 5ESVB 3WKML 1QVBA 5HXMA 2GCYB 1E6PA 3N17A 5H94A 1ZHKB 3QXTA 4JFVA 4KVNL 2G75B 2ZUYA 4NBZB 4U2YA 4N68A 2R23A 4ZFGL 2AP2A 2GJ6B 4GW4A 3FHQA 1T22B 4FFZL 2DD8L 1HYSC 5EZOH 1INQB 1I7TA 3ULVD 1J88A 2SEBB 3MV7B 3O11B 1FH9A 2WC7A 1KB5B 2DDQL 3EBAA 4LHUD 4X7CC 1I1AB 3O4LB 1F58L 5GJTH 1MY5A 4KJQD 4LCWE 2X4PB 4AWEA 1VESA 2NW2A 1QBLH 3QUYA 3QXAA 3WS3A 5BXSA 1KXTA 4MNGE 5F1OB 3GNPA 4RGMC 4GZEA 5C0BB 4NUGH 1Y0LA 3NCJH 4Q9RH 4M5YL 5F6HI 3UTSB 5BRZD 1P6FA 3CDFA 3ES6B 3CFKB 4GAGL 4MMZC 3VGAB 1G7MA 5EB8A 1OAXL 2XZCL 2XN9E 3NJ3A 3ZT5A 2FEDC 4EUPB 3NZ8B 1BWMA 2E40A 3BZ4A 1T3FB 3KXFB 3T0VA 2H2PD 1MFVA 4PJXE 3TZVB 4B3LA 2XWBA 3V9FA 4Z18A 3VIGA 1AD0A 3LMJL 6TAAA 1NMCC 5ID1A 1OAQL 2Q76A 4QLKA 1QLEH 2YUVA 3H6JA 4XV0A 4JO4H 3AGVA 1FNGB 5EFIA 4IOIB 5HDLA 4UFMA 5L8JB 1GOFA 2W0LA 2P5WE 2ZUQB 4UFJA 4XNXH 3RWGB 3LIZH 4JRXE 4X9HA 2QLVB 4R96B 1G94A 3IDYC 4H8WC 1I1RA 5T3XE 1KIRA 3VE0B 6CGTA 1K4DB 4JFEA 4W89A 5KTEH 1NFIA 4LYPA 4QWWC 3TN0D 2BCKB 1AI1L 5IEKA 4G43A 4ZFMA 1T4KA 3OKKB 4KU1A 1E4MM 5MEQA 4ALAL 3QULA 2G3IA 1VBUA 2JB6A 3SKNB 4ACZA 2ORBL 1WIUA 1IGJB 4RGOL 2XIDA 3GMRB 3WIJA 3OKLB 3GBNH 4ZSOE 5DFAA 2V17L 2CYGA 3C5ZC 4GG8A 4XX1G 4A6YB 2J88L 1HJUA 4KKCC 3SEPA 2Z31A 1S8DB 5CIPB 4HUWB 5J0BA 2GQHA 5KVFH 2ZJSH 3W6MA 3OKMB 1KPRB 3REVA 1EFQA 3L3DB 4EI5C 1HNYA 1B90A 2Q7YA 5B4MC 5IQ9B 4R0LB 4HKBA 4X0KB 1R86A 4R97C 3D85B 4GMTH 5ESAA 4I77H 5BS0A 1CXEA 3HE7B 4MNHB 4NCDA 4PGEB 2Q8BH 5I19H 4LPYA 5D8ZA 4KJPD 2FH8A 3TH3T 2BNQA 4K7PH 5ESVA 2CUHA 3B9KB 5HYSB 4M02A 2DT2A 5AZ2L 3KHQA 4ODSH 3HNVH 2D0HA 2ZUMA 2GCYA 3U4EB 3M6DA 4OI9A 1ZHKA 2X89D 2F8QA 1AR1D 2G75A 2ICWJ 4M7LL 2IPTL 1Q38A 5KJRH 2HVJB 2PF6A 4X7TA 1W9XA 4O4YH 2ZSWB 3V6OC 2GJ6A 3BGFC 1T22A 3GSOB 4BH7B 2VUOA 1UD2A 1EJOH 1E3ZA 4J3WA 4X7DC 3PL6B 5IHBA 4Z2KA 5DR5H 3V7AG 5A8OA 1INQA 5JBFA 4AIEA 3ARSA 1BJ8A 4MQXC 5I74C 2F2HA 2X4NB 3MV7A 3O11A 1OTUD 7FABL 2X41A 1KB5A 5I73B 1YNLL 4ONHB 3KNBB 1I1AA 3O4LA 3GO1H 4KXZI 4ODHH 3WNLA 2GITB 3K8KA 2X4PA 4YFEA 3GEWB 1KEGH 1W72H 2BHYA 3O2VH 3TH4T 2HKHH 3D0VB 3VXSB 1A7BA 2OP4L 5L7XL 5C0BA 4HWEL 1LL6A 4CADB 5EZIL 3N15A 2XNAB 4UB0L 3UTSA 4PCTA 3CFCL 4L1HA 3ES6A 3CFKA 4Q6IA 1UR0A 5IV2B 3G6JB 3ZDZE 4EUPA 3NZ8A 1T3FA 3KXFA 3PDDA 4G3YL 2A9NL 4XPBL 3B5TA 4LLVB 4LVOB 3O6MH 2D7TL 5I2IB 4EKJA 2IG2H 3QUXC 4H1LB 1BYDA 1FNGA 4O02H 3T09A 4IOIA 1YECL 4NWUL 1CDUA 1V0NA 2NY3C 3RWGA 4FZEH 2ZWLT 3RVWD 2I60H 3QIUC 4U5KA 4EDWH 3TT1L 3BLKA 4R96A 4DCQB 2IAMB 2I07B 1TE1A 4PMUA 3WD4A 5C6WH 3ULSA 3VE0A 1K4DA 1NANH 4WRLA 4GRMB 2X4OB 3UYRL 1W3LA 1P84K 2BCKA 3SCRA 1FL3B 3OKKA 5F7LB 4GH7B 1IM9B 3EFDL 3AREB 3SKNA 5KOMC 2CBJA 1IGJA 2CXGA 3PZOA 1MF2H 5E2VL 3HNTH 1PZ5B 3GMRA 5IWLA 1Z6JT 3OKLA 5LGKA 4A6YA 2CHOA 3TV3H 4L1DA 3OF6D 1S8DA 5CIPA 4W4NA 5C2UB 2BNRE 3F7PC 2FR4B 1XGYL 1RMFH 2DKMA 5GS2D 5I6XB 2ZWYA 1Q9LB 1VIWA 3OKMA 1KPRA 3L3DA 4TRPL 5IMLB 5IQ9A 4R0LA 4X0KA 4U7SA 3RGVC 3D85A 4Q6YA 4FQIL 5D1QC 4AC1X 1SY6H 3RA7L 4PGEA 3HE7A 4MNHA 3DSFL 1LLOA 1F11B 1IQWL 3U7YL 1DLFH 1NCDH 3B9KA 4BK5A 5HYSA 5LXGL 1CWVA 1IGFL 5GGQH 4HT1L 3FRUB 3U4EA 5FM4A 4KI5F 1CTNA 3ARTA 3OX8A 5E9DB 3T77B 2HVJA 2PO6B 1DL7H 4LMQE 2VLMD 2ZSWA 5CJQL 3RPKA 2ZUWA 3GSOA 4BH7A 2NYYD 3KPRD 3RTQC 4PMYA 3PL6A 4N5UA 2DQUL 3U7WH 5I71C 4L4TB 2X4NA 2MPAH 3CFEB 1D5XB 4ONHA 3KNBA 1BAFL 4KV5F 4Z0BL 2GITA 5D70L 4NT6B 5TF1H 5GRUH 2EJ1A 5KSAC 3II1A 1U6AH 4ZE4A 1R3IL 4CKQA 4YDIL 2K9UA 3D0VA 1HT6A 4OFYA 3QFJE 2VB5A 4CADA 1C8YA 3PHQB 5GGRY 1LK3H 4GRWB 4NIKB 3WQ6A 4JAWA 5A6BA 2E3VA 3G6JA 3VWKD 1MFEH 3WBDA 4Z7UE 2JKXA 4LLVA 4QKXB 1CNVA 2DJSA 4YBHA 4ZXBC 5I2IA 4ZMAT 4W86A 5D7LB 3U9UA 4HSQA 1I9IH 5HVHB 4H1LA 2OSYA 2FDMA 1T20B 4KUZL 1MCOH 2BVOB 2XACC 4Y4FC 3SDXB 4KRLB 4YHGA 2X6MA 4Y5XC 2VURA 4TQEL 1VB9A 3NYDA 3PWNB 1ERNA 5TE6L 4XWGL 2A3CA 4ZPVB 4DCQA 2IAMA 1BD2D 4IRJD 1FH7A 1LL4A 5ITFB 2DLIA 2X4OA 4OD3L 1SMAA 4F9LC 3RGHA 1I8IA 1FL3A 1VBRA 3AS1A 1MVUB 4F7CB 4KRNA 1IM9A 2AQ2A 5T3ZL 4NKMB 4E42A 3AREA 1VEPA 2YR3A 1HKJA 1PZ5A 1N26A 3LN9A 3CUJA 3S5LB 4Q2ZB 4PMRA 4LP4A