4MJ2A

Crystal structure of apo-iduronidase in the r3 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
613
structure length
595
Chain Sequence
APHLVQVDAARALWPLRRFWRSTGFCPPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-L-iduronidase
total genus 194
structure length 595
sequence length 613
chains with identical sequence B
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01229 Glyco_hydro_39 Glycosyl hydrolases family 39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mj2A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4mj2A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mj2A02
1NOUA 2NR6D 3OKMB 3DURB 1AQMA 3RPIA 3OKMA 3FFCD 3ZDYF 1CXHA 2W9LA 2QSVA 3N04A 3NFPA 1JF1B 2B4CL 1JF1A 5T33H 4G3YL 3BJLA 3N1PC 5KOVC 4F2MA 2XWJA 3K2MC 4N9OB 4OB5H 2ADIA 4XAKE 5F9OH 4F79A 2FO4A 5JBEA 3FRPG 4RFEA 2D7TH 2BHUA 1Q0XL 2EECA 3IU3B 1S7RA 1E71M 2A9ML 2VUYA 2Q7YB 3O3UN 4XXDA 3MRMB 4EXPX 4DKDC 3BW9A 4M00A 3FCTA 3V4UH 1IM9D 3CVIL 1I8IB 2UY6A 4I77H 2WC4A 1U8KA 2FJHA 3MRJA 4PGBB 4ZO8A 2MCPH 2VL4A 3DVNA 4NZUH 2DT0A 2VITB 4OGXL 1CFSA 1FVCB 2VDOL 4CMHB 1JTPA 3JWOL 1YN7B 3QIWC 2QSCL 4Y4KC 5D71H 4YEFA 2DQUH 2QQKL 1KB9K 1EZVX 2H2PC 3W24A 4WGVB 3MMWA 2IGFL 4GKLA 1KLGB 4B41A 2HG5A 1CQKA 2G3MA 1KLGA 4PRHE 4U1GB 4JANB 1QZ1A 5C0EB 5IGXH 4PMZA 4FFVC 1CU4L 2J12B 4M48H 4IMKC 4KK6C 4O02H 3WN6A 3LZFL 2PW2B 4ESKA 1WBZA 1FC2D 1FO0B 2FJFB 43CAB 5KSUB 2OL3B 1HINL 3GGWA 5KSUA 2XKNA 4GS7B 1EV2E 4XGZB 2P7TA 4U33A 4JJ5A 1CD1B 1WWCA 4JFZL 1FJ1A 5L88L 2XQBL 3M46A 4JFSA 4ZEPA 1TQCC 3IDNA 3MRCA 4IRSB 5F96H 3G6JA 4X6DF 4S1DD 1KJ2H 4Q0XH 2NX5B 1HJQA 5EC2A 5T3ZL 1NFKA 4X5XB 5SWZD 1A1MB 1A1MA 4CADA 3S96A 3HE7B 4B3LA 5LWYL 3ZKQD 4H8WL 5T1LD 3RUGF 3MUZ1 5HTSA 4XMKH 2IPUG 3WIHA 4D9QD 2DYPD 25C8L 1KB5A 4GOSA 1BFOA 2EDEA 4PG9A 4LSTH 2YHGA 5EZLB 1NARA 5CGYC 3U7YL 4MB3A 5BS0A 2OQJA 5IB5B 2OYLA 4B9YA 4P57B 3CFEA 3WHE1 2X5PA 5HI3D 5DRWB 4HUWB 2FL5B 5KZ6A 3H9SE 4RFNC 4JHAH 1FGVH 1WFUA 2E9JA 3KWWB 5FM5O 3TNNB 4AH2B 1MFEH 1D5IH 4GAFB 2V5MA 1V03A 5GIRB 1QVOA 4CD4A 1PBYA 3RU8H 1KTDA 4MZ3A 1NMBL 5D1QC 2GK1A 3WQ6A 1OGAB 5BVPH 4I3GA 2JLLA 1YEFH 2FD6L 4QWWC 4LEXH 1GHFL 3ARDD 3CUPB 4RCAA 3RKDD 1JYWA 3BAXA 2CJUH 5IIEB 4HJJH 3T0AA 3HC3H 5DJ2B 2XOTA 2NZ9C 4EXKA 3WMSA 3CVHB 1K4DB 4U0QB 4DVBB 1C93A 3QHZL 1NCNA 5E2UH 5J56B 4UINH 3U0PA 1KTLB 2VX7A 3BP6A 4NF7A 3KPSE 3BP6B 4TVUA 4V27A 1VERA 4M1DL 3DGCR 5CILL 5FUOL 5JBDA 3RJDA 2X4QA 4FMVA 1K4CB 4GW5B 1CL7L 3CZKA 2OP4H 5HD8D 1P4LB 1X5XA 5IFHL 3AIRA 4HPOL 1B2WH 1JF5A 2XNAA 3HNSH 4OUOA 5J1TC 3WFCH 2XNAB 4WI3A 5JOPE 4JGJA 3EDFA 2VLJE 3Q2CA 3W0WD 5FOOA 3NAAH 3FOMA 5GZOD 2FEEI 1GGIH 4KJWD 3VCLB 5DD5L 5JBFA 3IRPX 4OCYH 2Y25A 5I6SA 2R2BB 5CEYB 1RUAL 3B83A 1NCCL 3VIKA 1OD9A 1IQWL 1RJLB 1T1ZB 3ECBA 4HT1L 3WLWC 1KNOA 3FO2A 2YLAA 1DUYB 3MQIA 3RVVC 1AGEA 1X4XA 5IW3A 2LTQC 4NHCL 2WIMA 2R9HD 2HJKB 2WIIB 1F4AA 3BO8A 1DQML 5HDQH 4M3JA 3VXSE 3VWJC 4RGMB 3HFMH 4NZRL 4P3DA 3F7QA 4XP6L 2CKRA 3NACL 5MEPB 3WMBA 2EE3A 4KROC 3TYGL 2UUDH 3D3VB 4I4WA 2EDKA 3WFEL 5SWZE 4HG4J 4XPAH 1ZHNB 1R5WA 1D5MA 3WL9A 3OXRB 5F71A 3OGCA 5JR1H 3MRHA 3O6LL 5KS9A 4ELMA 5ISZD 1S7TB 3C6SB 4XNYL 2NY0C 5BW7A 1JGUH 4LLUA 3MFFB 4RWYH 3VG0L 3TEUA 3MRLA 2DIJA 1G6RH 1UZ6E 3VI4E 1U8IB 1BZ9A 2AJVH 5F72S 2GDUA 1WBXB 5ISZA 5BROA 5A8MA 1AD9A 5DI8A 5CIPB 1NJ9B 1OGTB 3AS1A 4PGEB 5FHBL 2BOCA 1R0AH 1A3HA 4LPXA 4CJ0A 2BFVL 1QA9A 1QRNA 2A83A 1E73M 4F3FB 4MNQB 4PJ7A 5I1HH 3VFSA 3FQXB 1VRXA 1UM5L 3IXAB 3BH9A 4MJ4A 4XVSH 2F53E 4WHTB 2F54A 3V8CA 4P59L 1HHGA 3UEZA 2ORBH 1V05A 2P8MA 5E6ID 5D1QA 3OZOA 1RUKL 3EGSA 3OQ3B 4L3ED 3UO1H 5I78A 1QHZA 1FZMB 1GUVA 4HJJL 4MA1B 4YHLL 4LF3A 5IROA 4JPKH 4LF3B 1DUZB 3UBXI 4RX4A 1MW3A 5JLZA 4BUHA 1GHFH 4RMQA 5JHDA 2ESVE 4Y4FD 4OZGE 4KDWA 2PCPB 1CDYA 5E8DL 2DWEB 4KTDH 3RIFK 5HVHC 5FIPA 2VXSH 3QFJE 5HHMB 2NY1B 1JPGA 4GXVH 1G7JB 2UY3A 3V0VB 4ZE4A 1WAAF 3ZMRA 3ULUL 4RAUA 1UWQA 1GAFH 2IUZA 4AG4L 4FF5A 4JHWL 1XF3B 4J12A 3LKNA 4P8UA 1FGVL 3IAPA 4U1NA 1CXKA 1MNUH 3N1FC 1BJMA 4OSUL 5CINH 5IFTA 1T4KB 2DLTA 3L3DA 4OQTL 3W28A 4ORZC 1XR8A 5CJOL 3L3DB 3II1A 1Q6FA 1EMTL 5IQ7H 1S7WB 1B3JA 4MDIB 2VDPL 5J3HC 4GMSL 3VXRA 3PZIA 2BY0A 4OZFB 3SGEH 1TCRB 4JFHD 3TA3B 2GK2A 3MJ8B 5I1KH 4NBZB 4L8CB 1A6AB 4GRLA 3RHWK 4JFYB 1Y6KR 5DR5H 3THCA 1BVKA 4NYLA 4OLYL 2WCSA 3GMMB 1S5IH 1ZV5A 5LXGH 2YSSB 4GKZB 1DLHB 5TJWK 4OLZL 5EZOH 1V7NL 2J7CA 3SURA 1U92B 2D0GA 3LQAC 4XCNB 3SBWA 2PO6D 3UJJH 4PPTA 2MPAH 4PMYA 1NBZB 2V2WA 3TPUB 4LCCB 4J8RA 4MX7B 1V6XA 1H15A 3BD4A 1G94A 1KLFA 1JWMA 4A3HA 4EKXA 1UZ8A 4FXLA 1P2CA 4XZUA 1ZT4B 3MV11 2AAAA 2V9QA 2JFEX 3FAWA 3EYQD 5HDQL 3CXHJ 2VITA 1A7NL 1LEGA 1F02I 1AXSA 4FNLH 3OZ9H 4KTEL 5E94B 1KEGH 5FL0A 4CD7A 3IJSA 3PWNA 3BPCA 1V7MH 1FIEA 1AFVH 3UTQB 4X7SH 4EI6A 1MCEA 2FIKB 4GAYB 2NTFB 2V5SA 2R15A 2ZX5A 4WWKA 4IIQA 4WUUA 3LS5L 5HPCA 3VIMA 1N6UA 1GVIA 4XX1E 4IIQB 1ZEAH 3ZOAA 5ADPL 5F9JB 4CDGC 3NAAL 1YEKH 3ULVH 1XCWA 6FABH 3NBNA 4N1EA 2JEPA 3KJ6L 1OTUC 3MJ6A 4X80H 5IDIA 3BAYA 4A6YB 4LMQE 5B8CA 4GO8A 3H3PH 1E5JA 4H2CA 3QEGL 4NT6A 2F8QA 1OAKL 4BYHA 5FKAA 4P4KB 2H8PA 4JJ5B 4NCC1 3MGOB 5D1ZB 1U3HB 5ABFB 3E6FB 4YHIA 1KB5L 2EC9U 5A8QA 1SYVB 1JFQL 4YFDB 4D0CB 2XI9A 1MHPH 4ISVA 4F57L 2E6PA 4PJCF 1QBMH 5FYJE 4Z8FH 4LAQL 4ATLA 4D6HA 3PJSA 1XYZA 3KYAA 5EBMB 4U6YB 4DTGH 4N8VG 4OD1L 4JAMA 2Z0BA 1IM3B 4Z7NE 3JZ7A 3VXOA 2D9QB 3DX6B 4U5IA 4X7CC 5GSVB 5BXFB 4JM2F 1IC5H 4G3YH 4HGKC 5IKCB 1NBYB 1ES0A 2J25A 3X13B 4H1LA 2ZWYA 3SOBH 1KCSL 3O6KL 4L5FH 5ESAB 1AC0A 3BQUB 5DJZA 1Q1JH 4DKEL 2E3ZA 4YHKH 3A4AA 3WSUA 3U48A 1UWSA 4WWKC 1QHPA 2CK2A 3U7AA 2YK1L 3B4NA 3KPRB 3JTTA 4FLRA 3H0TB 4YZFE 3RU8L 4AH2A 1HXMB 3WFDL 2QQLL 4XI5D 3IFOA 2EDDA 4J3OC 4ZS6C 1FG9C 2G5BB 3IVKB 3AMKA 2YPLA 1WZMA 1YMMA 3DVFA 4XV0A 1JNLH 2CUHA 4KY1H 1KB3A 3SCNA 4P9MH 4AT6B 4JKPH 2GJZB 1NUDA 3IS0X 3C6LD 4LNRB 1FYHB 3OJDB 5MENE 2DIAA 5I17A 5TDPA 1T0MA 1KENH 3QNXA 3RM9A 1GGCL 5CMAA 2VE6B 5FYLH 3NCFB 4ODHL 4AD3A 2X7LB 3O6MH 2YL9A 3QCVH 2KDGA 2ATPA 4QTIH 5B4MC 3UYPA 1MVUA 2B1HH 2ENYA 4LARL 2D2OA 5CJBA 3VXUB 5D8JH 1G7LB 1RIUL 5M03A 1UQZA 3VUPA 3LCYA 4JR9H 2IAMD 3SCTA 1DJSA 3F12A 5C09A 5KW9L 2J3SA 2ADJA 3C5ZB 3SKMA 1BBDH 2MFNA 2VLRB 4KVCH 2GHWB 4TRPL 1TG7A 4DCQA 1Z5LB 3K81A 1FH9A 5I1AB 2XTJC 1QO3A 3OPZH 1OQXA 3I3DA 2WCAA 3ZO9A 1DFBL 4TSCL 4WK9A 2V3EA 2EC9T 1W1TA 7A3HA 1AGBB 4Z8FL 2HLFC 5LA2A 4ZFMA 3TZVA 3M8OL 1QFWH 3F58L 4H1LG 3SCUA 3LOWA 4HHAB 3H42L 4P5MB 1HKLH 4XH2A 5GGSB 1A3QA 1GZQB 3IFPA 4Y1AD 3ESVF 4TUFA 4PJEF 4RMWA 3VCLA 3OBAA 4YPGA 4QT5A 1CLVA 3LKQA 1KGUA 3QEHB 2VISB 3CH1A 2D7OA 4N8VA 3QEGH 3WKZA 3MS8A 3MRDA 1XIWB 3O2WL 3MUHL 1C16A 4KGLA 2EYRA 3VMOA 4LSPL 1WCQA 2EDQA 4J23A 5IVZA 1J05A 3T65A 1NLBH 3OAYH 1NUNB 2AEIT 1FBIH 1P6FA 3VXMB 2H45A 1Q9WA 2E9WA 3PV6B 1BG4A 4H8VA 2WWMC 4WI7A 1LP9A 5CJQL 1UM6L 3HLAA 1SJHB 2EH7H 3INUH 3LN9A 4JY6A 4CVZA 4NIKB 2G41A 1ZANL 3O9NA 1JPST 1WFOA 3T1FB 4NQDD 4U3CA 4A6YH 1HYSC 4IMLB 5F7UA 2ZICA 3D85B 1LILA 4IDJH 1UD4A 2W66A 3KLHD 1MI5E 4DZ8B 2DKSA 4GSDH 1DQJB 4PJ9D 2VQTA 3FL7A 1E4JA 5TE7L 1QI2A 1CXEA 1C3FA 3DO7A 1JGLL 1EEUA 3HC4L 3V5KA 1JNHA 4OFVA 4D8PB 3BD3A 4H26A 1E28A 1F11B 3MLTA 1JDDA 2G8ZA 1TE1A 2FGLA 3DETC 4U6HA 4F9DA 1JZ8A 4HS8H 2NY2D 5SWZA 3BAJA 5SV3A 5A3IC 3ARWA 1Q0YH 2P45B 1NEZG 3G6JF 1TR1A 1LK2A 4BFIB 1R5VA 5IM7B 4ELME 4LEOA 1KENL 1BPLB 1FCCA 2BXZA 2X05A 4RNRA 5C0IB 4P9HC 3VXRE 4APQB 5T1LA 1RAMA 4OCWH 2ZWZA 3GKZA 5CINL 2PWHA 1ZL1A 3U4EB 4LU5H 4P9HH 2BMKB 3BGAA 1JYNA 4JM2A 1QRNE 3V8OA 3GI9H 2F9BT 1E4MM 4OOZA 2P43B 3T0EB 4I9WD 1EDQA 5A95A 4YZFF 3FONA 5TDOA 3LEXA 5HVGB 1QI3A 4NQUA 3WD4A 2OTPA 2DLEA 5F89B 1Z9LA 3DV6A 2KZ1B 3ESUF 4M1CC 4U1KB 2R23B 3ZHKA 5M95B 1SVZA 4DK3A 2IPUK 4XPHL 2EPOA 3O3AA 1G9MH 4Y2DC 1OD0A 1SJXA 4WHYG 1XGUB 5GGVL 3KPLA 5C0CB 3PE9A 5I1CL 3BPOB 1A3LH 1PZ5A 4Z7VA 1FH7A 4FQ2H 4C57C 2CRYA 4D94A 5C6TH 4OLEA 3W9EA 3EYPA 3PIQA 3TBWA 4M29A 5C8JA 3KPNA 4UAOB 4BCEA 3MRQB 3P30L 5EOTB 4JVWA 1PYWA 4FXGB 4WNQB 5J13C 3WFHB 1ZVSB 4L3AA 4Q9BA 3U36A 3EDKA 4MD4B 2Y9RT 4M93C 3DJ9A 3TN0B 3UR8A 4QRUA 1MJ8L 4AZCA 4KROD 2ZUTA 3ET9F 1CGTA 5AYQA 3I6GB 2JIEA 4IOIB 1UWGH 4F7TB 3N1GC 4IOIA 5E94A 3VRJB 1QLEH 1UG9A 1K8DA 4WU7B 4XVJH 2KZWA 1H2JA 3FTGA 3TCXA 1ZEAL 1E6JL 2V17H 4YDJB 3ARVA 4X98B 3NCJH 4YDJA 4KKAC 4V1DA 4ZUSB 3G6DH 1CZ1A 1QYGL 2EDBA 2X10A 4R4BA 3PZTA 4HUVB 5E4IA 1HXJA 5CP7B 5HPOA 5IFAH 3CZLA 1CTNA 5L2KB 3CIQA 2ZZUT 4U6XB 5L2KA 2VOTA 1PKQE 4DUXA 3PNWB 1MLCA 4MWFA 3MUIA 1VEPA 4X7TA 1FVEB 3EFDL 3CFDB 3V6FA 1TZHA 1B0IA 3VH8A 1T89A 3ZDZF 3VH8B 4LGRB 4OIFA 3ZTJG 5JO5B 2RFXB 1MEXH 5TFSH 4ZFOL 2XZQL 4M7KL 1I3GL 5EWIH 2G2RA 1JTTA 2G2RB 1RP9A 4PD4J 2JEQA 5KJRH 4D6JA 1NBVL 1N0LA 5C07A 2HT4C 4ONHA 1D5ZA 1AGCA 1PIFA 3HC0A 3O2DL 2X4NA 4NQCB 1QSFD 2OP4L 5C0AD 3BMWA 2VIRA 3KVQA 4AD4A 2W0KA 3KPRE 3IDIB 2YMXH 4ZOEA 1RY7B 5BV7C 4JB9L 4KMTH 4GRLC 3SJVE 5F7FA 2XG9A 1FA2A 1I8IA 3LQAH 5JMOC 2WZHA 4HGMA 1TMCB 3WN5C 5D6CA 1QR1B 3S96B 4PCTA 4KK8D 5DJZB 2C3XA 2NY6B 5DYOB 2L0DA 1HIZA 5E2TL 1HOCB 2Y6SD 1ZE3C 1QACA 1UCTA 3ULSB 4AY0A 3OKDA 3QIWB 1KELL 3G5ZA 3MBEB 2X4SB 1GOQA 4HCRL 2I25N 1TZ7A 4XPHH 3F7YA 3E6HA 4CMMB 4GRMA 5F7EH 2IXVA 4NQXA 4MNQD 3UJIL 4F9PC 2G75A 4HJGA 5GGRY 1A7OL 1F3JA 4FQIL 3V7MA 2I5YL 3ROLA 3UPAA 2CK0L 3P73A 3HJEA 1CE1L 3VDBA 3GGWB 2CITA 1RFDL 5GS0H 3SKNA 5DUML 3UTSD 3AB0C 1XSJA 4XCFL 3H9SB 3I75B 3IFLH 4PIRF 4N0UB 3TO2A 4Q7NA 3WD1A 1JMZA 3ILPB 3LKPB 2F5BH 3BPNC 2R56H 1ULVA 1II4E 2CLRB 2C7UB 1K85A 5F21B 2YBUA 4CCDA 5GGUA 2ILLA 4K94H 4R0LA 1BFNA 4UFJA 3GZKA 4PRHA 5HHNB 2YR3A 2KKQA 5F1IA 5C86A 5KSAB 1XGQB 3L2LA 3GBML 3KYKH 3SDDA 2HFFB 4OUUB 2DT1A 3LIZL 2C4FU 4KJPC 1WNOA 4JRXD 4F7CA 3RPKA 3CPLA 5IMMA 1J9YA 4WO4D 3MGAA 3CPLB 1H3VA 2CSPA 1JE6A 2NY1D 3H9HA 5E00B 5EZLA 1ZGLA 1FL5A 4V1DD 5CUSH 5JDSA 3BKCH 4DWSD 4NZTL 2VL5A 1W1PA 3IFPB 4Z7WA 5K59F 1L9NA 3UTTB 1OAZH 4NKQB 4PLKD 2NY4B 4NKOA 5EPMA 1NAKL 1QD0A 4NKOB 5EPMB 4NRSA 5KVMC 5DTFB 4XPBL 4NN7B 5JUEH 1SM3L 4X9HA 4UQ9A 1KIRB 5C09E 1WFNA 4DGIL 1I8MB 3L3IB 4N8CH 1B31A 4OT1H 3GMPB 3VFOB 1WE5A 2Y7QB 4AQOA 1UA6L 3QZWB 3RDTA 2HH0L 2GK1B 4FA8A 4QHKI 5T5NG 1XYFA 1MIEH 1H3TA 4B9ZA 3C9NA 4GUPB 4W6XB 2QADD 2EYSB 1A1NA 3NCJL 4KRNA 1U9KA 1K5NB 3TO4C 4OCYL 4P8WA 3SE9L 4JFEE 1FBIL 4OJFH 1NFDA 1UWUA 3BXWA 3P9MA 2H1PL 1HXYA 2J88L 3VIPA 3MJ9L 3UPCA 4X6EB 3QUMA 4J1UA 4LP4A 1ZTXL 4NDMB 5I8EA 1ZLWH 4ACZA 5I71C 4R7NA 2W9EL 2VZTA 4OZ4A 2V7HA 3C6LC 4ZFGH 1MHHA 1OAYH 4X6CF 1RHHA 4HIHB 4R9HA 4DKFL 2BJMH 2ZOKA 5DRNB 4I77L 1UR1A 1IGYA 3N85L 2D03H 4HWBL 5JIIA 3SKOB 1HKLL 3DRTA 3FQRB 3ABZA 1Q0XH 4H26B 4MAVA 3ES6B 5CKAA 5C0FA 5A6LA 5ALBL 4PGDB 2FHBA 5I9QB 3VG9B 1XHGA 3P4OB 3GUTA 1IM9B 3M17B 2UWFA 1DLFH 4W85A 1RUPH 5DURB 4YK4B 2B4CH 3CFBB 4MJ6A 1R5VB 3DIFA 1F4XH 1SMAA 3PDDA 5IHSA 2BP3A 4NPYB 5TGBB 2DQDH 2JJTC 5TQ0L 4U7MA 4K7PX 2DTMH 3KLSA 4EQ2A 4JFUA 1BYCA 3FRPA 4G9DB 4X9GA 3U4EA 2FBJH 2WMKA 1QLRB 1YYML 4JM2B 1FZMA 3VGEA 3TBSA 5IFAL 3W0WE 4NC1C 1EPFA 3DROB 5DRXB 1I1FB 4ZQKB 1CCZA 1LE5B 1A7QL 1DWJM 2F8XC 1E3ZA 5C0RH 4HX1B 2ZUQC 4PJCB 3TBYB 5CP3A 1P9MC 3DX9B 1RMFH 4BZ2H 2K1MA 1MQRA 4XNZB 5IG7B 5D9OA 4YBHA 5FCSH 4YGVB 1MHCA 4ZFZA 3QIUD 2NQCA 2NY3C 3RBSA 4L3CA 1LO2H 4ENEC 4DK6A 2DDXA 1T20B 3AB0B 1HQRB 3BVNB 2DKMA 5C08E 3EHBC 3SKJH 1AIFB 1JK8A 1E4LA 4GAGL 3JUGA 2R1XB 1MCIA 4F58H 3EJJX 1BP3B 3U0WH 4P3WA 2R4RL 5SWQA 4UFKA 2Z31A 3GRWH 3P0YH 5CPQA 3LRSB 2H26A 2HFEB 3W39B 1RZIA 1A5FH 2XYLA 3TCLB 3QIUB 3ZSSA 1VFBA 1G9HA 2J74A 4D1JA 3VXSA 2W0PA 2KBGA 3AI0A 5IVXB 1TMQA 4S3JA 4ZSOA 3TN0C 4XBEL 4YDVA 4AZ6A 4QNPF 4YXHL 2IXUA 4YDKH 1CG9A 1UKTA 5FM5M 3UERA 1QLFA 3QQ3B 1GQLA 1NCUA 1P7QB 2YS4A 1M4KA 1B4RA 3WLBA 1H5VA 1S7RB 1N5AA 5FYJL 2F2HA 4MXQC 4M6OL 4MCZA 5JHDB 3AZSA 4BUGA 2Q86B 1H15B 5CAYB 5DUPH 1Z0NA 1IQDB 5ISZE 4Z5RA 4LVNC 4Z5RB 2D4FA 3FN0L 2YD6A 3T3MF 5F9AC 4IRZH 3TIEB 5HYFA 1MOEA 4IDLA 2BVYA 1PLGL 2Z92A 2J7HA 2CKBL 5E2VH 3GI8H 3GFUA 3MJ9H 1D6VL 3IB4A 1WZLA 2FIKA 4GAYA 2VT0A 3RFZC 1AHWB 5L9DL 3HPLA 4L4VB 2YUXA 5KVDH 1J5OH 1L0YA 5E0CA 4IRSC 1DCLA 1UM4H 4HIIA 2Z93B 3KPMA 3TVMC 4MDIA 4S11A 3NFPB 4S0SD 4F33A 3MJ8A 4L8CA 4WWID 4PJFA 3MV8B 1BFTA 3VFGL 1UQSB 3GMMA 1YDPB 4V1DE 1UQSA 4PMRA 1SM3H 2P24B 1FH8A 5DD1L 1CK0L 9CGTA 4XCEA 5ACMA 5D7KD 3WL1A 1K3ZA 4A2MA 3GSXB 2XN9A 2W65B 4O58H 4S1RH 3QOKA 2XN9B 2CESA 5AWNH 5CUSL 3JWOC 3ZHDA 2ERJC 4E8DA 4PP1D 1NC4A 5D5MB 1KPRB 2C1OA 4OKVB 1RZ7L 4HC1H 4Z7OE 1S9VB 4J27A 3AS0A 1KIPB 1UJ3C 4JQIL 3WUWG 3GHBL 4K7FB 3IJYA 2Z8WC 5ILTH 2VUOA 3QCVL 1LF1A 1BQHB 4LSQL 3KWXA 1I3UA 2VWEC 3RILA 5J3HD 1ZS8A 1HE7A 4FLSA 1EFXB 4JFPB 4YNYB 2HMIC 4LRIC 4DGVL 5CSZA 4Q9QL 2C3VB 1XGYH 3TJHC 4ERSL 2XY2A 4FFWD 2JJVA 3JVGC 2VDKH 4FQQA 3Q3GA 5EU5A 3QUMH 4DM1A 1CE1H 3HI5H 2XT1B 3KLHC 1VBUA 1UD5A 1G7HB 3U0TA 2E4TA 4R7DA 3D6GA 3IF1B 1ED3B 4QGTA 1A7OH 4FQIH 1OF2A 4KJYB 5DWUL 4PJXE 1YA5A 4ZTPL 5J13B 5I2IA 3VXSD 4N0UA 3TO2B 3G6JB 1IEBB 1YNTA 2DTSA 4U1HA 4UMGA 3AYSA 1IC7L 1O6IA 1F4XL 3MCG1 4RWHA 1O7SA 4Q6IB 3VG9C 4OLVH 1KLUB 2GJPA 3AS2A 1GQKA 3RWCB 4N90E 4YDKL 3ARDA 4DEPC 5SWQB 1GGYA 5E5MB 4Y16C 1XSKA 2DI9A 1ZLVH 3DVIA 3SDAD 3WFBL 4PR5A 2XXCB 3AC0A 3QDHA 4JZJA 2DQXA 5GRVK 3RWJB 3A6BL 1RIUH 3ZKXC 4G6KH 3S35L 5IMOA 5I3DA 3SE8L 2VL5B 3SPVB 1VB9A 4XAWH 5BOPA 4JPIB 4NOBA 3BYYA 2BSTB 4F8TA 1F00I 1OVZA 4LSSL 3DBXB 4DQOH 3UMTA 3VFRA 1T1XA 4PUBH 1QNZL 3GMPA 4L29A 1MQPA 4UNTA 3NABH 4X4XA 1X5YA 1XGPB 1WC7A 2VDQH 3L1OH 4K94C 3S3PA 5MERA 2UWEF 3R8BB 1LO5B 5DJAA 1M7DB 4PBVC 3PHQA 1MIEL 2YPKB 4P8VA 3AXHA 1W72B 2AK4A 1A9BA 4IIQC 3PWVA 4J4PA 2QQQA 1ZJAA 1HN1A 4WCYH 5TF0A 1OLZA 1VFFA 4PJEA 4HIJA 3BHBB 3NIFE 3B6SB 1MVUB 5DQ9A 3WDQA 1Z6JT 4GXUM 1RULH 3RDTD 2IH1A 4YHNB 3SCRA 5A1AA 2WSPA 1I8KB 1D5MB 1MCLA 4YIQA 5HDBE 2UZYB 1PEWA 1PQZA 4RA0C 3CZEA 5I1AA 4AD2A 1GH7A 1WUNT 2XTJB 4UU9A 1S9WA 3MRLB 4MXVF 3LIZH 4HXBL 1RIVL 1BVLB 3MLZH 1TVDA 4LRIA 1E6SM 2A6KA 4PMNA 5C07D 5I1KL 5KANI 4QXTB 7FABL 32C2B 2X9YA 4PSRA 2EDWA 1C7TA 3SEPA 4HHAA 1T3FA 3DHMA 1QSFA 2A74A 3B9KB 4J3UA 2VZVA 1PEZA 3KAAA 4PJCE 5IK3B 4YHGA 1GHRA 3DPBA 3PHOB 4H04A 2W1NA 1PPIA 2QLVB 3R0MA 3WCYA 4YXKL 1T1YA 5FYKL 4W6WB 5J6HA 1W0YT 4NQTA 3HMXH 2YPVL 2BHYA 4YXLL 1W3JA 3SCMC 4NQCD 4WU5A 3L6FB 2B1AH 5AUMB 5C0AB 5I1JH 4UQ2B 1IAIH 2F19H 3IDJB 1QNRA 3IDJA 4KRLB 5HVFB 4HPYH 1R5WB 1NMBH 5J8OA 5A6BD 3SGJA 5C9KA 5GRVL 2FEDC 3T2NH 1B3YA 3SCSA 4I3RL 1NLDH 3O6AA 3CLFL 3LEYH 2OR7A 1JDCA 5I76A 4M9OA 1AD9B 1ONQB 4QOKD 5DI8B 5IVXE 1X5GA 3UAJD 4FFWC 3AMDA 5E9DE 4LVHB 4U1KA 1OSPL 3BWAB 5K9JL 1WVZA 4LLDA 5E8NA 1PZ3A 3H6JA 2H26B 2ZCKL 3U7YH 3JVGA 2N1KA 2KQMA 3ZTNL 4JRYA 4YEEA 5C0GB 3OX8B 1J1PL 3DOSA 3WQ8A 4PTVA 3BH9B 3PDOA 2HVJB 1P7HL 4NNPH 5JZ7D 4RDQG 1S5IL 1XF2B 3UAJC 3UTZB 5I1DA 4L9DA 1I7UA 1JWSA 4QF1A 1XF2A 1GRWA 1EO8L 5DR5L 3HB3C 5HPMB 5IMLA 4XP1L 2FWOA 2J5LC 4ODUA 2VRKA 1KCVL 4J4PC 5C2BL 3QHTC 4YFLI 4UQ3A 1EH9A 4HUNB 5IEKB 1AXTH 3VGBA 5E08L 5D7JC 1XD0A 4UUJB 3FB7B 3C5JB 5GISH 4PEEA 3L4UA 1LO2L 1QBAA 2EIEA 3DARA 5TFSL 4JL2A 4JZ5A 2FX7L 5HGHB 3AFLA 4H25B 2CDFA 5BRZE 3APGA 3KLAB 3QXUA 1KG0B 4C83B 4J4PD 3ZE1F 2MCG1 1HDMB 5CEXB 3TIEA 1UQYA 1I7RA 5IR1A 5GRUL 3IKCB 1HI6B 3GSUB 1H3XA 2OWCA 5E99L 2HRPH 3V5DA 5A2AA 3BGMA 1GOHA 4TVSa 4ONFL 1K8DB 3LKNB 2ZJSH 3PBGA 4PRAA 4HJ0C 3QEUA 5C3LD 5I0ZA 4F80A 3DXAE 4WEMB 4V1DB 4EVNB 1U3HC 1U0QA 1CGWA 3SQBA 2Z4QB 4OV6F 1KJVA 3QBTB 2NYYC 4YXLH 1A7PL 4BSWB 1OARH 1KJVB 4BSWA 4KRPB 5KVEL 3VXRB 4WUUD 4ZUWB 5D7IA 5IT2L 2D3LA 1DLFL 3EOBA 3REVA 4YHML 2VN4A 4KK5D 3HNSL 3EOBB 3REVB 3MMEB 2X4PA 4Z7VB 3PG2A 4I5BB 1US2A 3MO4A 1B2WL 2JJSA 2X4PB 3BZEB 2R1YA 4LCYA 3QIBC 5D7KE 5EMYA 4M82A 1YQ2A 3PIQB 3BIBX 1KEMH 3BUYB 3O2DA 1T1WA 3ULVD 3QQ9D 3WD2A 4Y2DA 4TQEL 5LAXA 2BRRH 1S78D 2WW5A 5CILH 3L3HA 2A3CA 1Z9SA 5FYJH 2C4FT 3UCQA 5DJ8B 2VQ1A 1RIVH 5DJ8A 2XWBA 1U8QA 4UINL 4LDEB 2Q6WB 4UI2A 4W4OC 4ZMAT 4HA4A 4PJXA 1KXTA 4B50A 1LNUA 5K9QI 1MFCH 1QBLL 2NW0A 1SJEA 4D6CA 3WFZA 2ADGA 4UQCA 4ZDHB 3PTMA 4OV5B 3QR3A 4I18C 2WKLA 4CW1B 1T7VA 3SGJC 3IJ9A 4KKCC 2A9NH 3GRWL 4QHMB 5D8JL 3Q6FB 1EK3A 5F3HB 3CUFA 2C3VA 1QW8A 1CFSB 3Q6FA 4RGNE 1CTOA 5F3HA 2AEQH 3JBG7 2HH0H 1P4BH 2EPKX 1RJZB 2ITCB 3QQ4B 4PJBA 4F9LC 3QIWA 1NFDF 1I1YA 3OKDB 3QEQD 3ALXA 3CJJA 4OFKA 3SE4C 1GGCH 2EEXA 4U6VL 4FQLL 5AZEH 4PRPD 1GGTA 5JUEL 2VVNA 4FMKA 1IQWH 5DRZA 2J62A 2HN7A 3BI9X 2LVEA 2NNAA 4GBXA 3QIUC 4BQCA 1JTOA 3MNWB 4GMTH 1Y6NR 3N1QC 5I2IB 1QNOA 4YHIB 3QWQB 2LABA 5JO5A 2ED9A 2V5DA 5DD0L 4PRHD 5E08H 5I66B 3PHSA 2HKFL 1F6AA 2NZ9D 5FYLE 1P53A 1TUXA 1TVHA 3WF4A 4LSSH 1VGKB 4ZOCA 2NX5D 1X7QA 4LSQH 5F3BB 1SYTA 1VGKA 1YJDH 2AEQL 5D7LA 4IRSA 4KI1A 3DHJA 2K7QA 3ILPA 1J1PH 2OJZH 2VIRB 5C08B 4IISA 4WV1A 3VXPA 4P5TB 1MRDH 5E24E 4R8WH 2YXFA 5HXMA 1E6PA 1Z5LA 1H3WM 2UY7A 3KPRD 5E7FA 5T3XE 2XQBH 2IAMA 2UV3A 1XGQA 4KUCF 5GS0L 4K8RD 2UY5A 1FHDA 3BAIA 4C7DA 5B3JF 2Q8AL 4OAWB 4M43H 2BVOB 3QHOA 1U8HA 2BVOA 4IDJL 2QQNH 3OGSA 1G7IB 3GJEA 2GITB 4I3SH 1GL4B 3VD5A 3C8KB 2AV7B 1B3ZA 1A2YA 4NSKA 2EC8A 2F19L 2DQFA 3N85H 4PTUA 2EIZA 4LP5A 2QHAA 1LL7A 4D72A 2RGLA 4N0FB 3NN8A 4HWZB 3O45B 1U33A 5GGSY 5KOMC 1J8HE 5I8CB 4JFQB 2DQUL 4DZBA 3WDRA 2Y7QA 3D5OF 3FHAA 3GI9L 4WSJA 2V3DA 5I16B 2X7LA 5JA8B 3S9DB 2VDKL 4OJFL 4PB0H 4AMKH 4ERSH 3H9SA 1KFAH 4EDWH 3RNKB 1XF1A 5SX4I 3CVIH 3EO0A 3MRFA 2UWEE 2VN7A 4P7RA 1W9BM 1I8KA 3I6LD 3CC5B 3KPPB 3SKMB 5B22A 4BQ5A 1T2JA 2YD9A 4D71A 2OR8A 4H8WH 4OLUL 3QJFB 5I24A 3MV9B 3BE1L 1ETZA 2FO1A 1U8OA 1NBVH 4QXUL 1DQQA 2Q1EA 2F5AL 3SDDB 1U8LA 1FN4A 1HNGA 3BP4B 3GIVA 1BD2D 5BXPA 4OTXL 3QG7H 1TVBA 1Y0LB 3QA3B 2AK4E 3MA7B 4P2RB 3HA0A 1JGLH 4QXTA 4D9LL 5IOPB 4LBEA 1KQYA 4EK7A 1OP9A 5JDSB 5DJDB 3UJTH 2DB8A 2CKSA 4YUEH 3GIZL 3OL2A 1NCWL 3P0YL 3SE4A 5EZOL 4JO4H 3CAFA 3UC0H 1JZ7A 1H0IA 1LDPH 1FFNB 2WZEA 4RRPA 4JFDB 1BHGA 5E9DA 4BFIA 4KUZL 3F6LA 4P8XA 1PDKA 1T1YB 3RWGA 1BJ8A 3MUAA 5CBAB 1RH9A 5FK9A 2E9MA 2P4AB 2X2YA 3QXTA 2FLRT 1JGVL 5C0AA 2V17L 4X8JA 3VNZA 2A38A 5BCAA 3NSXA 1MCNA 3VGDA 1UR2A 5C0BB 3UBXB 1NPUA 5IWLC 4KPHH 3VGGA 4K7PL 1NFDB 1VAHA 1KJMA 1U42A 3PQYB 4PRBB 3K7UA 5AZEL 4OZFG 4QRRD 3OTTA 4DQOL 5C6WH 2E7LC 2R2HA 5FO9A 4W87A 4PJCA 3BWUC 1B0RA 1RZJC 2JJWA 4Z77A 1UWRA 2YK1H 2XVGA 4O2CB 2YD2A 1ZGLP 1U95B 2ZIDA 2BVDA 1WWBX 4HIHA 5JDJA 4QAWA 4QRRB 3TFKC 1OL0A 3OXRA 2DTML 1VESA 3A6BH 4NRZB 3QWRD 4LLDB 5E8NB 3DO7B 5HHXH 4NRZA 1IGJA 2EO9A 2QQNL 2ARJB 3HMXL 1E6QM 4OLXH 3QIBD 3ARZA 4G8EB 4FQ2L 1E6ZA 4ATWA 2QL1A 5KSVA 2ZNXA 1NFDE 5FXCH 2LAGB 4KVCL 2J7GA 1NANH 1AO7A 4UR9A 4L9LA 4FQPA 1MJJB 3VFTB 3FQXA 3VX1A 4WW2C 2OCFD 3LS4L 4JR9L 4WHDA 2YMXL 1ZBWA 1L7TH 5DK2A 3QDJE 4LCIH 1PX8A 3KL0A 3WEOA 4F58L 1CT8B 4MA7L 1UA7A 4MA1C 1H0GA 2HT4D 1XGRA 1LO3H 2ZG1A 5IWLA 5DRXA 1LE5A 3EOAB 3GJFB 4HULB 1IC1A 3O4LB 1N5AB 15C8L 4M4RA 3D0VA 1ZLUK 3S4SA 2IMMA 3QQ9C 3ISWA 3KGRA 1M7IA 1J0HA 4CGTA 4N5EC 3TYFB 4CKQA 3LQMA 2VLJA 5JOFB 1CVRA 5FGBC 1J1OL 2SEBB 2ZX7A 4BQBA 3VFNA 3O3AB 1DEEB 3N17A 2Y06L 1XGUA 1KXVC 2GSGA 1EAJA 4QTHA 5E9AA 4KUZH 2A73A 4G7YH 1NAML 3FQUA 3P11H 4HS6B 3AICA 3MMUA 4PRDB 1WCGA 4CBPA 2YUZA 5C70A 1D5XB 2OWXA 2R2EA 2AK4D 3DTXA 3T0ED 3GSRB 3MROA 5F93C 1NCWH 1WIPA 1A6VH 2Z31B 4R4FH 4MLSA 4NM8H 4WDIA 5E56A 1DZBA 2F61A 2CDEB 5HD8C 3E3QE 4KI5F 3RVXD 3PZ9A 4WSKA 3WQ4A 4PJBE 3J8F7 1ISWA 1EBAA 1JHTB 3IETA 4IHOA 5FEBA 4IHOB 4ELKB 3P77B 4NKIL 3VPLA 1ZMYA 2JIXA 4XP1H 1FZKA 5I6XC 4UV4L 4MA7H 3N0PB 1F4WL 4OQ1A 3GSXA 5J1SC 4K94L 1I1CA 3ZJKA 1EHLH 5I9QC 1WIUA 3UESA 4LLQB 4JQVA 2IANE 2OK0L 3G08A 3LS4H 2PYEA 4R0LC 1LJYA 1GOFA 1DVFC 3WIFB 5K9JH 3IJYB 3PL6C 5AC4A 1FVCA 3U6RB 1EFQA 4MA8L 2EDJA 3AJ7A 1TFHA 2UVEA 5DO8A 3CLFH 1I7ZA 1R6VA 3BYTA 3GM0A 1KBBA 4MNGA 4AEEA 3O2WH 2CXKA 3WNPA 4HKJB 3FO1A 1R87A 2EEBA 5ADPH 2I9TA 1NCTA 1AP2A 3QWRA 5B39B 1AGFA 4G43B 1WZ1L 4M1CD 2WSKA 3QIBA 3BPNB 3E8UL 5B21A 1E4IA 1AFVL 5FA4B 1FRGH 1I1RA 1XR9B 2DSUA 4AD0A 5AC5A 2IANB 1BQSA 1CICA 3LDBB 3SDAB 2WBJA 3P73B 1XGTA 1MF2H 2DLHA 2BSSA 4M7LT 2DM7A 5D9SA 3SDAA 5HBBA 1ZBKA 2OL3A 1MFAH 3L5HA 4JO1L 4AYSA 5A6AA 3P9LB 2FCBA 1U3HA 1H0DA 1KT2A 3LKRB 1FJ1B 5ESQA 3BRDA 4W4OA 3T04D 3W26A 1G6RB 2J47A 3TO4D 2J8UB 2FHCA 1BD2E 1MIMH 5HVHB 3QO0A 1HJUA 5TD4A 3L5XH 4P48A 3PJSB 1HHJB 1IAMA 1LP9F 2WC3A 3KPQA 2YDSA 3DX6A 4D0DB 2YD8A 2KUTA 2VXUH 4MLIA 4ZXOA 4NO5B 1WDRA 4LHJB 1ODZA 4JO2L 4D3CL 3DI2B 1OIFA 4TPRH 4RZCB 2OMBA 4NQED 5EC1A 1DANT 3G6AA 3VGHA 5ESAA 1TCMA 4K23L 3BQUC 4JFXB 4M3KB 1BQUA 2A6DB 5DS8B 4G5ZL 4M80A 2CHNA 4XHJC 3ARYA 1UXWA 4DOHB 2FH6A 3EDDA 4PBXA 3L4TA 1HXMA 3QFDB 2FYYA 2LU3A 4KKLD 2K7PA 2VKWA 4POYA 3FN3A 1HL8A 1OF2B 2MJWA 4KJYA 4W6YB 1IBGH 3VJ6A 4ODSH 3S6CA 1L6XA 2OWWA 5EBAA 2BSRA 3G6MA 3TNMA 4H20L 4FMFA 2C26A 3OJDA 2C7UA 1U8MA 2FGZA 3MRRA 5JW5A 2PBGA 5GGUB 1GOKA 4YXKH 1QPPA 2CKBH 5LGHH 1P69B 4OD1H 4RSVA 1T0PB 4X6BB 3VRLE 1URLA 3AAZB 2R0KL 3MRNA 1ETZB 3FN0H 2GSIA 5ERWA 5BZDA 2F53A 3GBEA 4LOUC 3FKUS 2J4WH 4NWTL 1KWGA 3PL6A 5HY9A 3WD5H 2ZOXA 3JTSA 4GW5A 3AISA 4J3SA 5IW1A 2X4QB 5EH1A 4M1DH 4XRCB 1E72M 3W81A 4QRPA 2EH8L 1Y18A 4HUXB 4HUXA 1C7SA 3IDXL 4JZJC 3BRGC 2O61A 2K9UA 4W4NA 5BXTA 1DVFA 1C08B 2OI9C 2B5IC 5I1CH 3HE6C 1TNNA 1BPVA 4HKXB 4M7KH 5DC4B 1NGZA 4YAQB 1EUTA 5B38A 3VWJA 4E0RA 3FOLA 4AD1A 4HZ6A 1UKPA 2J7LA 1OP5H 3TYGH 1A6VL 4R4FL 1B6UA 1KN2H 4ZFFA 3S34L 1MCPL 1N7ML 1PY9A 1T1ZA 4MJIA 1LQSR 2FHFA 3DXAA 4QLKA 3OF6A 2ZUWA 3PTKA 3O3EA 4PRIB 3DHPA 2C3GA 1L8NA 4X6EA 4QYOB 3QSKB 1LE9B 1D5BA 3F5LA 4HZLA 4F15B 5ESVA 4UOZA 1AQDB 2V7HB 3KDMB 3BKYL 3CNKA 1PIGA 5DZOA 5E9DD 4PRID 4Z77B 5TH2B 4OFYA 3RUGA 1B3XA 2VMFA 2J8GA 3QULB 5GHWL 2FX7H 2CO6B 3U46B 3S36H 1L7IH 3OGCB 3Q48A 4BZ2L 5HYJA 1Y7VA 3R1GH 2W67A 2E8YA 1QEWA 2GUOB 2HRLA 4PJ7E 1X5KA 4TVCA 1KCVH 1S7TA 1EEZB 2AI0H 1BZ9B 3HG1A 1BYAA 2V5CA 4PY7A 1INDL 1EQPA 1OGTA 1NJ9A 4XHJD 3SGDH 4Q6IC 3GUTB 5ISZB 4NQEE 1T04B 3OB8A 2ZPKL 4XVUD 5I73B 4LYQA 5GNZA 1LHZA 3MZGB 3HG1D 4JQIH 3ARBD 1RK1A 1E15A 2W4XA 2AOSA 4LVOB 1YY8B 3EZ8A 4YUEL 4BZ1L 4ZXLA 3CMJA 1W9PA 4O2FA 4P2OB 4LK4A 4PMQA 4WHTA 2HISA 1UACL 4OSUH 4CN6A 5D93C 3JV4B 3CSYB 5DK2B 1SBBA 1CICC 2J6EA 4IM4A 1I7UB 1JWSB 3EGSB 3NDYA 4S0TD 4KMLB 1JHKH 4FXKA 3V52H 3EMCA 4EIZC 2NXYC 1PFCA 2ZUVA 3O8XA 2O9TA 3D0VB 3KPOB 4E41B 3MNVA 4JRXB 5FL1A 2DWEA 3CUGA 5IVXF 4NRRA 1BIIA 3ARSA 2MQ0A 1MYRA 5E8DH 4ACPA 2EH7L 3INUL 2GDVA 2RBLA 5I71B 3CD4A 4C83A 4MD0A 1V02E 1HDMA 5CEXA 4E9LA 1B3VA 2IGFH 3VFNB 3MSDA 1ZAGA 1MCKA 3RZCC 1FL3A 3BGMB 2P5EA 5IBLD 5KANG 1AVAA 1OSEA 1W1YA 2ORBL 3LQZB 4K7PH 2IFGA 4U1NB 3LQZA 2EIDA 3PGDB 4LU5L 4P2QB 4TULL 1AKJB 1CFQA 4I0PB 4MNLA 2VDRL 2YRLA 2Z4QA 5E0QA 5C3TA 1M71A 3RPIB 1ZU8A 3KPLB 4MAYD 3ZE0F 5HSFA 2E7HA 2LFGA 1R0AL 5DJCA 1YNKL 1HHHA 1UA6H 3EYUL 4LGPB 4HV8B 3PDOB 1Q0YL 4G9FE 5T1DH 1V3IA 2DQEL 3S5LG 4I5BA 3ZR5A 4XMLL 2OSLB 3WENA 5J06A 2NY5H 1FHLA 4JFTA 4POZD 3KPNB 4G80A 4WKHA 5D7JA 1BOGB 3OKYA 1F3DH 4MD4A 5CZXD 3BKCL 1ZHBB 5ADOL 2V2WB 1VHPA 3TPUA 5DXWA 1OAUH 4NKDA 4J3TA 5JW3H 2XV6B 3U0WL 2ZPKH 1R5IB 2Y8VA 1BEYH 4JIEA 3O2VH 1YMME 4JKWA 3VU2A 3P11L 3QUZD 4Y4KA 3VI3F 1W3HA 4FHBD 2E3VA 1M53A 2GK0B 2OTWB 4NUJA 2HKFH 2GK0A 2EDNA 4Z2KA 5DURD 1AHWA 3R1GL 4G6FD 5CJOH 3VDAA 1PVHA 1SMOA 3FQWB 1L7IL 1A4JA 4TULH 2VDQL 4IMKA 8FABB 4F15C 1MXGA 1TA3B 3NABL 2W92A 4NGHL 2PYFA 5E2WL 43C9B 5CP7A 2WAHA 4WFGE 2UY2A 5E8OA 1UWGL 5D4QA 5D7IB 4UDTB 2XFRA 4ODVH 3B43A 4FQLH 4ZTOL 5GQBA 1WP6A 4JM2D 5JUVA 4HIEB 2CMRH 4ZNCD 1CXFA 1I75A 1YYMH 5GGQL 1X5FA 4CNIA 4GKSB 3SE8H 3MNWA 4CNIB 3WDPP 1KCSH 3NCYS 3Q1SH 3VIOA 2J8UA 2NY4C 2D9CA 2VTFA 3UCRA 4PJAE 2JCCF 5T3XD 4Y4HD 5KTEL 4PV8A 5EFDA 4PV8B 4FOMA 1RUPL 3L7FB 1VEOA 2D31B 5F3BA 1AGCB 2VABB 1UD3A 1D3CA 1IM3A 1YY9D 4E41D 3KL3A 4HXAL 2YD4A 2J7BA 4JZOB 1G7PA 2MNUA 2WVVB 4ZS7L 2CIIA 4JZOA 2BVTA 3O9WB 5EOQH 4OIBA 2UVFA 1MRDL 5BS0B 1UR9A 3FO9A 4KI5D 4TQEH 3UBXG 4N5UA 1CYGA 4HF5L 3TBTA 1YJDC 1YC8A 3G5YA 1M01A 3G5YB 3O9WD 4JRYD 5KG9A 4TSAL 3TNNA 2W60A 1JVKA 2E40A 4GXPA 5I23A 5J1AB 1JHLL 1S5HB 3MR9B 1OT2A 1MFBH 1BREA 4BKLB 2XM2A 2JCCB 4X7FC 3CU1A 4ZYKA 4NQXB 1QI4A 4WW1A 3M6DA 5GHWH 1I9IL 4LFHG 1CLXA 4JPWL 2EEAA 2WWCA 2BSRB 4OZIE 3K80A 2DDQH 2YPKA 1VJSA 2WWKO 4I9WE 3SO3C 1J7VR 1SHMA 2WBKA 1LMKA 3OLDA 2N56A 3VGAC 3EYSL 4HWNA 2ATPB 1LDPL 2VLME 1RURL 4TNVF 4Y16D 5DJ6A 2OR9H 1DWIM 1QPXA 4DVRH 1FG2A 3PN8A 2FIRT 4PR5B 3V4VL 4UT7H 3QWOB 3UJTL 3RKDC 5D7IF 2EPMX 3AS3A 4K8RH 4R3SA 2CUMA 3PL6B 5HY9B 2H32B 4MQXC 1IAIM 5FO7B 5TE7H 5BO1H 2IAMB 4C4KO 1ZSDB 4D3CH 2DBLH 2ZXBA 1CK0H 2X4TB 1MPAL 1UYWL 3LRHA 4M7JH 4HPOH 4LCCC 3VXNA 1DSFL 1CGYA 1RUQH 5FYKU 3F7PC 4QCIB 5IMMB 4OBRA 4NNPL 4RGOL 4M61B 1Z3GL 2RCSL 1GZQA 2VDPH 3FOMB 5D2NB 5GGSA 2L7JA 4DFIA 4E0RB 2V38A 3CPUA 5CJQH 2BJML 4PTUB 2WP3T 2G5RA 2XPGA 3ZDXF 1OSPH 5INDB 3SDAC 2E0PA 3L3GB 1UENA 5EU6A 5GRXG 2CBJA 2VR9A 4JFDA 5D72L 2BVPB 2CDGA 3IK2A 5E2VL 2NY7H 1FYTA 3MXVL 1L0QA 3RX8A 5BQ7B 2VDOH 4AM0B 1IKFH 1T7XA 3SE9H 2OYMA 3MXWL 1AI1H 2YD5A 1FRGL 3I2CH 1V0MA 3S97C 5C92A 1NFIA 3DSFH 4GRLD 1VKXA 2P5WB 1RZJH 4AYFA 3BMVA 2DLGA 1BAFL 5MEOA 3L4VA 4YIQB 3CHDA 5E6ZA 4W8BA 1KULA 4HCRH 3BSHA 4ACZB 1YC7A 5DC0A 4J3XA 5ICXB 4GRWF 1P4IH 1HKJA 3QJFA 4DUWA 3L3KA 2R1WA 3VXQB 3QEQA 3QUXA 5M94B 2WBJD 4IBLT 4TYUA 2AEWA 4P9HL 3JXAA 1GQIA 4QHUA 1IE5A 1V02A 1NP0A 3AU1A 3W5MA 1IGJB 1BVZA 3EDJA 4U49A 2VAAA 3D25B 4EN3B 3TH2T 3B9KA 2BFVH 5BV7L 35C8L 3IDYC 2AAVA 3UTZA 5LXGL 4GQRA 5FDWA 5I2UA 1SMDA 5FDWB 3OAYK 5D1QB 4HG4K 4EANA 1ITCA 4UIKL 4UT6H 4ZODA 1NDMB 4YQXH 5K9OB 4QRTA 1OAQH 5JR1L 1UR0A 1ZJBA 5C0IA 2WVTA 4JRXA 5HYSB 4NQEA 1EXUB 5H37H 1LGVA 2XKSA 2XVPA 3TT3H 4JLRA 3PV7A 4GSDL 3LHPH 4UTBL 4OGZA 1RU9L 3ALGA 3NSNA 3K3QA 2X89D 4YDLB 2WMIA 1I3RA 3PZMA 3ARGA 3CZJA 1OPGH 5CJXC 3GO1H 3VOCA 1Q94A 1E4XH 4A6YL 3X11B 1FNSH 2MSPA 5F89A 4CCEA 3UTPE 3S34H 1Q1JL 1NUGA 2JKXA 1NCCH 2LAAA 1YZZA 3O6KH 4L5FL 1AY1H 4GIAA 3GM8A 2FBOJ 2CGRL 4PMVA 1XR8B 5F70A 4AJ0A 3W27A 4ZOBA 1M71B 2APXA 1UZ4A 3OX8A 5E1AB 3MACL 2NY7L 3MXVH 1IZJA 4TX6A 1UXSA 4V2BA 2Q20A 4JFEB 4JN2A 4NNYB 2P42B 4AIEA 2GYSA 5KSVB 3LRSA 1DQLH 5ANMB 1JZ6A 3VO0A 1CDJA 4W68A 5FB8A 2P44B 4HAGA 5JOEA 4LLYA 5F1NA 3FRUA 1CL7H 2Z91B 1KB5H 3U36B 2DQTH 3G9AB 1BZ7A 4AEIH 5CG0A 4MHHG 4LCCA 1EHLL 4ZSOB 1RPQA 5TDNA 4NKDB 3UP1A 2LTQB 1CE6A 2AJVL 2JIXB 1QSEE 1DSFH 3MLZL 4JGMA 4UV4H 1OOAA 4E8CA 4DM2A 4NKIH 1XCTA 4DJMA 5L6YH 1HI6A 3CTTA 5IMKA 1AQKL 2YC1B 2CJUL 3FCTB 2YC1A 3OKOB 1OTTC 2PYEB 4PRAB 4DWHA 3RGVC 1DE4A 1F3RB 3NFNB 3OB0H 1XH0A 4FFYH 4PCSA 4KZDL 2B1HL 1DEEA 4CVXB 2VX6A 3QDGA 2BV9A 4Z0XB 4OZGB 1S9YB 1N26A 4GAGH 4A2LA 2X1OA 3AMGA 3QUXD 4X6FB 4NC0B 3NGBC 2WUBH 3FW6A 1K8IB 2B31A 4UTBH 1I1AD 2R1YB 1NMCC 2IWGA 4NZDA 3C5ZC 3WE6B 1KIQB 1G1YA 4K07A 4HIIB 1BBJB 3GXMA 2PW2A 4P5TC 4UAOC 3BZ4A 2EPLX 4AK1A 2V6HA 5HHOE 5CGYD 4XHQA 1AXTL 4X7DC 3RIAF 4YQXL 4TPRL 5BMFH 4XTRC 2BSSB 4YO0A 1GCYA 4XT1C 1KC5L 2O93L 1IJ9A 3E3QC 2WAGA 3VXOB 4WJ5B 1ISZA 2AXFB 4C56A 4OI8A 4U1LB 4G8IB 5JW4M 5KBNC 1EMTH 1Q9LB 2WHLA 3MV8E 1RZ7H 4HC1L 4X5XA 5D7LD 3U9UB 1ODUA 2XTKA 4LSRL 3G08B 2F5BL 4MQTB 4D9RE 1Q6CA 5HHVL 4QWWD 3ARBA 3PZGA 4IPNB 3RVWC 4HUMB 1OGBA 4EJ1C 3SDCC 2GI7A 1R3JA 3REWA 4R26H 3REWB 3WNNA 2ID5A 1MFAL 2YIHA 5IXEA 2JB6B 1P4IL 3KZSA 2HTKD 1GIGL 4WF7A 1W72H 2FZ3B 1MFDL 2FZ3A 1EGJA 3UX9B 1ZANH 4O02L 5F1KC 3GMOA 4HGWB 1YMMB 1CU4H 1UM4L 4TTGA 2VDNH 3NN8B 2M26A 2CLZA 1P7KA 3GMNA 5FUZL 4M6AA 3QP3A 2CMRL 2YPVH 1FZOA 4LNRA 2ARWA 2HTKC 4P23B 2O5ZH 5GIRA 4PMUA 4WUUE 1T0MB 5CLTA 2IANA 5INCA 5FO8A 2QQKH 5DDHA 3L7EA 4WFHD 4KJPD 5I16A 1ZXQA 2V2TB 3OHXA 4NGHH 4KPHL 1OGAA 4OI9A 3GSVA 8CGTA 2MCPL 3U1SL 5JOPD 1IEBA 1YNTB 3MLPA 3VFMA 1B0GA 3D1MC 3WUGA 1QFUH 4W5UA 4HP5A 1B0GB 4TVDA 5EU6E 2BNRE 4LSTL 4Q6YA 3CC5A 3KPPA 2E5EA 4HOWA 4P2QD 2VLKE 1U2HA 5JIKA 2K3TA 1Q4NX 2R29H 3ARPA 3UC0L 2HFFA 4OUUA 3UDWA 3RNQB 5BO1L 1JZ5A 4MB4A 3STLA 1KB5B 5T33L 1CFNA 1S7UA 3HPJA 4LBEB 3JTSB 3HC4H 1WBYA 3G6AB 4JHOA 4MADA 2YRZA 4U0RC 3GSNB 4YX2H 3TVMD 2VCBA 3CFEB 1P4LA 4LKCA 3V4VH 4FQJH 4MAYB 1A7RL 1UWIA 5GS2H 3D3AA 4DWSB 2PB1A 4QXUH 3L3JB 4Y88A 3QEQE 5INDA 3WO4B 3I3BA 1BX2B 1C5CH 3VFGH 5EU6B 4HMCA 5BRZD 4OLYH 2CIKB 3SE3C 1AJ7L 5DUBA 3QUYC 4NO2B 5MHSE 5IBTH 1LEIB 1FFOB 1EZVY 3KS0H 3C9NB 4GMSH 4GUPA 1WC7B 3GMQB 3WH7A 2DMBA 2EJ1A 3HI1B 3GSNL 1QFUL 2YEZB 3UYOD 1FAIH 2FECI 2RHEA 1A21A 1G7MB 3UBXA 1W3KA 1XMWA 2OJEB 4UBDC 5KZCD 1PJ9A 1QNZH 1MFBL 1SEBA 15C8H 4LSPH 3TH3T 2R2HB 5FO9B 4OGXH 5A2KH 1W0WA 1W0WB 1HIML 5FUZH 5BZDB 4I18A 3IU4H 1R24B 5IHBA 4PRIE 3L5WB 2CKBA 3RY6C 5T3ZD 3N13A 1ZOXA 5EOQL 4X0KB 3AU1B 5C6PB 4ELMB 2H41A 1GORA 4X0KA 3P30H 1RUML 1ZA6B 1H8SA 4KHXL 5EIIB 3G6JE 2GSJA 5I1LB 1QBLH 3RO8A 3GJFK 5CIPA 5CLWA 2PTUA 1EUUA 4MQ7A 4XB7A 3M17A 4Y4HA 4ZAKB 4O5LL 3SQOL 3Q0HA 1OY3B 1JNDA 4PMDA 2DLFH 1FDLH 5EZJB 3RA7L 1XF5B 2BNRD 1NAMB 2IALB 4BA8A 5C08D 4Z2HA 5IVNA 3IDMB 2R0ZH 3CFCH 3MBXL 4G6AC 2R39A 5H8DA 1Q6DA 1JG9A 2NLJA 5L2KD 4QTIL 3QG6A 1OAKH 1KNOB 3FO2B 1TIUA 2OX5A 4LPWA 4WFHE 3WO3B 4YFEA 1GOIA 1J8HD 1TLKA 2XICA 1J1XL 4PRBA 1Q9OB 2WHKA 5HGAB 2IPTL 4YHMH 5A2LH 4HKZA 4MCYB 4WIWA 4WENB 1H49A 4X80L 5BYWA 4P3DB 2H1PH 1NCDH 3NPZB 5E2WH 5BOZG 3TBYA 4MHHI 5IG7A 1AXIB 1I8LC 3DX9A 4KY1L 1S7VB 4PJFE 3QULA 2Z31C 4Y19E 2V7NB 2OSXA 4MD0B 3MO1B 4DW2H 3QYCA 1FNEB 1I1AC 1S7XB 4TX8A 5HYQA 3VIGA 1YPZF 2VLJD 1A7QH 4JZNA 1JCKA 4R97C 4LLUB 1AJ7H 4L8BB 2N4IA 1U8IA 4YHPB 4ZSOE 1C1EH 3KS0J 4HT1H 4NNYA 1IVLA 4YHPA 5FYKD 1QYGH 1T04A 1U8JB 4JO4L 5D2LB 4MAUH 3S5LA 4Z2LA 2OMNA 1HSBA 2HMID 1RK1B 1XRVA 3BDBA 2B2XL 2F54D 1E6JH 5CBEB 2QPUA 4EDXB 3UDWC 4HCRA 1IGFH 3BEWA 2DM2A 4XMPH 3QG7L 5IVXA 2Y1VA 5C2BH 1HHGB 2R69L 4K71B 3GRWA 2OSLA 2F5AH 5D2LF 3OXSA 4RFEB 1J01A 1HJXA 5HYSG 3DLQR 2YPLE 4HWEH 4UQ3B 1MJ8H 3D39A 1JJUA 1ROWA 4HLZH 5D7JB 1QNQA 5EFIA 3IJ8A 1M6OA 1GW1A 3BESR 3WD5L 1PKQB 1KEML 2WMHA 4FFZH 1KFWA 3K2UH 4K3JL 1N64L 1R5IA 4N90D 1JV5B 1SY6A 1CDHA 2QLYA 2Y2WA 3NCBB 3PZQA 1BMGA 4WTXA 4QTHB 4IOFC 1NLDL 2EXOA 1DBAL 3SCQA 1BD2B 4HKJA 5K9QG 4FLOA 2OTWA 4NUJB 4UT9H 4NZUL 4IRZL 4X9FA 4WTZA 5C0EA 1AY1L 3BIKA 4L4TD 3DURA 3PXJA 3V4UL 1TA3A 4NP4L 1XCQA 2NT1A 2COQA 1QFWL 1HL9A 2J75A 4OZHB 1VFOA 3VD3A 1KELH 3P4LA 1IEAB 3RGVA 3AROA 1I85C 3NPSB 5FYKH 4IRJA 1QSED 4M7ZB 4YBLB 1JYXA 3P9LA 5DFWH 4UFLA 4QHNA 4W8LA 3LKOB 5E2TH 3SCVA 3BD5A 2PUQT 4XCNA 3RHWF 1BOGA 1BBDL 4TRPH 5M7QA 4R5EA 4L4TB 1R7AA 1D9KA 4JB9H 4KMTL 1MREH 4ZUUA 3VIJA 1NC4B 1LVEA 4L3EE 4PJ5A 3RWIA 1PD6A 4Q9CA 4ZUUB 1J10A 4O4YH 3DC0A 4UIKH 1OGAE 3CDFA 4OZFH 1FH5L 4GI8A 4JDTL 3RVVD 1CDUA 1B4JH 2Z8VC 1RZGB 5EC1B 3DYMA 1I3GH 2C4XA 2HVMA 4BZYA 4P57A 1CQYA 4XPAL 5DRWA 5E2JA 3ORJA 1NWTA 1NMAH 3D9AH 3HI6H 4NQVB 1MNUL 4P49A 5KG9B 2ZCHH 1P7KB 1XD1A 1I3VA 1MCDA 2ESVA 5I19L 1HINH 2X4UA 3KYMB 1FVDA 5FDYA 3X17A 3KYMA 4L3EB 3VW3H 2JCCA 5ABGA 1QRND 4PMOA 4D1IA 1H8NA 3BEVA 3WN5B 4R7DB 3MODH 2EXWC 5ITBH 4OD3L 2IFFL 5F7EL 4HDIB 3DNKA 2DWDB 1U58A 3MSGA 3EO1A 4LCWE 2ICEA 1BFSA 5IIEA 1XZ0A 1A6ZB 2B4CC 4K3HA 1QFPA 5D71L 3UG4A 4MB5A 3WFCL 5DHVH 4JAMB 5C9JB 1B3WA 4TVPH 3AAZA 3IDXH 5JW4R 4TTDD 1H3GA 3N50A 5HHOB 3QDME 3DRQA 2WLYA 3QDJB 3UTSB 1MHPL 4F57H 4AZHA 4TUOA 1NEUA 2FB4L 4UQEA 2CIIB 3S35H 3HKFA 2VLRA 1QBBA 1A6PA 2ENSA 3AXLA 5GSRB 1G0XA 3O3DB 2J4WL 3MJGX 1Z3GH 4NWTH 3O3DA 2NXYB 4QRPB 4Z7UA 2WW8A 4ZUTB 1RUQL 3OKEA 2GTWA 2HKHH 5MHSD 2W9EH 2VZOA 2QADB 4K8RC 4FQXD 4QRPD 2VC9A 3ILQD 5IT2H 1G7QA 3HC3L 4BSVB 3UYRL 3SUVA 1CWYA 3VWJB 1XGPA 1AC6A 4KUCD 4HMDA 3EYOB 3HZYA 1U3ZA 5J9PA 3DUUB 3LS5H 4OJYA 2NW3A 3TA3D 1H5BB 4AT6A 5DJYB 3EFDH 2GCYB 4R2GD 1U93B 2ESCA 3UTTD 4ZTPH 3RGVD 1WDQA 2MQ3A 4W84A 2BNQE 2DL2A 3T08A 1HJSA 1XCXA 1W72A 3LSOB 4OT1L 2APWA 3CX5J 1NDGA 3CH9A 1AQDA 1N4XH 3FMGL 4XNQA 5CEZL 1AH1A 1FHGA 1A22B 3KHOA 3BHBA 4JHBA 3C5SB 5I19H 3U79A 1W32A 1PG7X 2J6EH 4JY6B 4P9ML 4P5KA 4CAGA 4CVZB 1RZKC 3CZGA 4HFUH 3B9KD 4XVJL 3ULUE 5HYJB 2DI8A 4YJZL 3FB5A 3QQNA 5E4EC 1S9WB 3MFFA 1DBKH 4UT6L 1EEZA 3M45A 4OLZH 5HYJD 1D7FA 4PY7B 2VXUL 4RMTA 3VXQA 5LYRA 3QUXB 4CN4A 4MB1A 5A6KA 1OM0A 4EI5D 1X5LA 4XAWL 3A6OA 3FQNA 3HZMB 1MI5D 5BV7H 1UB6A 3HCVA 4O4YL 2IJ0C 3T77B 4P4KD 1JRHI 1T66D 1UZ1A 2H2SC 1HH6B 4LYRA 3FB6A 5KSBE 2CLVA 1IC5L 3RX7A 2JB5L 1KACB 1BLNA 3CMOL 5IHUH 1XF4A 3UZEA 3ZE2E 3L95B 1DUYA 4NCDA 3ELAT 1F6LL 5DVNA 2F8VA 2HP4A 5DEFB 4G6ML 2YBTA 4QYOA 3K1KC 1OCWL 5J6HB 1I1FA 1SYSA 2FEDD 4ZQKA 4S3KA 5D1ZC 12E8H 1QBML 2WVSA 5CS7A 2XTJE 4E41A 3A6CH 4NC1E 3HZKB 2FX9H 5GZND 4PBWD 3TTSA 1IAIL 1AGDB 5F6HI 1CS6A 3RVTD 1P6WA 3D48R 5KVDL 3HZVA 2DRUA 3GXFA 1ISYA 4GZIA 4KDTA 4RAUB 4MNQE 5DT7A 4Q97A 1NLBL 4KK5C 3QNYA 2ZXDA 1NC2D 4BQ4A 3RZWA 3SCMA 3JWOH 5KAQF 1G0CA 4MA8H 4GQQA 2AXGA 4XBGB 3AZTA 1EXPA 1B9ZA 4GG8B 4MAYC 1MUJA 4P4RB 3UTOA 1CI5A 1YMHB 2WWKT 1TCRA 2YN3A 3NCEB 1EJOH 1VFBB 7FABH 2QMJA 5I8KH 4XVUC 3KXFD 5EORH 1PZ5B 4FQXB 3SY0B 3UPRB 3ZIZA 5F44A 3MLYL 1CDCA 1ACZA 5ILTL 1G6RL 2I9LA 3QFJA 3MV7A 3GHBH 1JGUL 1QLFB 3T0XA 4NBXB 4JHZA 5JPNA 3O41B 1P7QA 3FRUB 2O26U 1E0VA 3GIZH 3AZRA 5F6HJ 3MGTB 4RNRB 2P8PA 3VGFA 5AEAA 3FB7A 1ACYH 3TA9A 3KLAA 5ACZA 4RGMC 3VFWA 4WI5A 5J57B 3LN4B 1TETH 3OAUH 1V7NH 3ZYIA 4AL8H 2RGMA 4F7MB 5DD1H 2NY5L 3V0VA 4F7MA 3TVMA 3BPLC 1RURH 3OJ2C 1NGXA 2JE8A 3O6ML 1NAMH 3ARGB 1I1AA 3KJ4B 2HYMA 3Q5OA 5DEGB 4UOW1 1A0QH 5F7DB 3RWHA 4XNXL 1A4KA 3AREC 3AMLA 5HGDB 1I8LA 3UXFA 3C2SA 3D39D 3PGFL 4EVNA 2JF7A 1J1OH 4MVBC 2FJGB 3U30C 1J5OL 1DL7H 2R23A 4JPVH 4R96B 2AMGA 3BIKB 4XWOC 2E27L 4KJWC 3CX2A 1OGSA 1GC1H 4M5ZL 3KYOB 2XKUA 5C0CA 5B8CB 5C0RL 1W9VA 3JWNC 4NFCA 3SJVA 3WUEA 1EO7A 1DLHA 2CD0A 3V6FB 3ZYZA 3NPSC 3WS3B 4TSAH 3ARTA 4P4KA 4QHNB 3IKKA 1U92A 2EXYC 5EOTA 2VXSL 5A16A 3CHCA 4H5SA 3CFCL 3MBXH 5GRJL 2WMJA 2A9MH 3LPPA 4GFTB 3ZDYE 4L4TA 1SY6H 2C1OB 1LLOA 2XVNA 2Y5TB 4WKAA 2DSKA 4LPUA 1KIPA 1MAKA 1P2CB 4XZUB 1P1ZA 3BAEL 4Y8AA 1G9EA 4RGND 3HC0B 3CXHK 1KCUH 2PXYD 1N3NA 5D6DA 1MQ8A 3EDEA 1NBYA 2Z8RA 4IRJD 3BLPX 1ITXA 4LAQH 3BPCB 4JY4A 4EI6B 3TWCL 4JQVC 2CBVA 4R6UA 4ONOA 3FTGB 3MPCA 2FD6H 4G42A 4POUB 1DE4B 5HGBB 3ARBB 5IBUB 1OCQA 5HGBA 5D6CB 4Y2OA 4PUEA 2OJZL 4BFGA 4QHMA 3JV5A 2AJ3B 3KPTA 5F9JA 1BSIA 3WUFA 4ZNEA 1QFOA 4OUEA 1LO4H 1YN7A 4R4BB 2VXQH 5BZWA 3WXVL 3EHBD 5C71A 4MNGB 3WY1A 2P8LA 4KQ3H 4JFVA 3PNWA 4ELMF 1MFEL 5HYJE 4YR6B 5B39A 2A3HA 3KJ6H 1XFPA 2XA8L 1KF9B 4OFPA 4PJ8D 3GMOB 1W9UA 3L5IA 4HMEA 5ABFA 1JI2A 1ITBB 5HBFA 3BZ4B 1E5NA 4OCWL 3GH7A 4WO4C 4M24A 4ONGH 25C8H 4P23A 4BK4A 2WBJB 2ICEB 4U6VH 2PWEA 4MD5B 4NHCH 2V2TA 4PY8J 3TO4B 1A7NH 1C5CL 2FBJL 1YY9C 1K6QH 2ZKHL 4HH8A 5T1MB 4WLCA 4P5TA 4XC1L 4L4OA 3LB6D 4FQJL 5D1XD 2DLIA 4MJ5B 3U9UA 1UH4A 1FORH 5D1QD 4GH7B 4PGCA 5IMOB 1QR1A 5GS2D 1R3HA 3UJJL 1HWHB 3B9VA 4LGSB 5JXED 5KN5B 4CRPA 3JTTB 1KJ3H 2J7DA 3U4AA 5IFHH 2PR4H 3MOBH 5J0BA 3WUZA 1U8HB 1S5HA 4OCXL 5T1KD 2BCKA 4KI5E 4PMXA 4W70A 2AV7A 3WBEA 1VIWA 1Q8MA 2YPLB 3EBVA 5A6BA 1VPOH 4QT5B 1UXWB 4CVWA 2QKIB 2G9HB 4XX6A 2EYTB 3E2HB 4AMKL 1IGTB 3OGRA 5D8WA 1PG7H 1IGTA 4S10A 4P3CL 3OZPA 2QSCH 4JFQA 3GI8L 3DUSB 4JRWA 5DDHB 4GXUN 4D6IA 4S1SH 2C1PA 1WSST 1I4FB 1YEKL 3ULVL 3AHZA 1BYDA 1JIBA 4JFFB 1H4PA 4P2RD 1MCSA 4ZUVA 3QPXH 1LP9B 3C5SA 5D96B 3KXFE 4G9FA 2HAZA 4RE3A 5DUPL 1MY5A 3RWDB 4M8UA 2EDFA 3QCTH 2CLRA 3TF7C 5EN2A 1A7BA 3VKKA 4HH9B 3QUMB 4J1UB 3LVEA 5CZVH 3QUYD 3MV9A 3LPOA 1QO3B 4KHTL 4LSVH 5GRUH 5A6MA 5TPWL 4YHLH 4JKKA 4LKXB 4TSCH 4XPBH 3TIDA 1N59A 5DF0A 3JWDL 1KB9J 1TVBB 4XXCA 3MC0A 3GIVB 2IC2A 4QCIA 1QSVA 3D87B 3L3OA 1S9KC 4XVSL 1GGBL 3H9HB 1OD7A 2DSZA 1J0ZA 1U91A 1U8PB 2NY1C 1E28B 1F11A 4MMZC 4U0RB 4MGXA 3STZA 1CENA 1Y18B 4EBQH 3RM8A 2GIYA 5BVJB 1HZHL 3ARGC 1EO8H 4PB9H 1BLNB 5BS0E 4BH8A 3NJ3A 3AIQA 5FYLL 4ZXBC 2DMKA 3RBGA 3RWGB 5IM7A 3BDYH 1SFSA 4YWGH 3NTCH 3AHVA 4NO2A 5BQ7A 3N12A 1J11A 3POCA 3I02A 3L4XA 4C55A 3ZTNH 2W9DL 4NPYA 5TGBA 1GVYA 3VVGA 1KSRA 3B2VH 4Y5YA 5A8OA 5ETUA 3LEVL 4ZFFB 5A6SA 4X8JB 4N9GA 3BKML 2R4SL 5J4MA 1AGEB 4HKBA 4P2CG 3NACH 3CZ8A 2FGWL 4FZ8H 3LY6A 3P9MB 3BKYH 4XUYA 4R90L 4JO1H 2VVSA 4Y5XC 1YNLH 1HJWA 5ICXA 3T2NL 4OLWL 5GRZA 1N8ZA 3IDGB 4O2EB 3L3KB 2ESVD 4GAJH 1JRHH 2HVKA 2XJ7A 1CGSH 1T0NA 4P23C 5H35B 3AIBA 2GFBA 3KE0A 4OZHE 2GT9A 1T0NB 3ULVF 1DN0A 2ZOKB 1MCPH 1CF8L 2E6JA 4MNMA 2VR4A 4Q2ZA 1GQJA 2XZCL 1BM3L 3VFPA 4I48B 4Z76A 4ZS6D 2W63A 1MCCA 3MRHB 5KS9B 3CU7A 3ULVC 1E40A 1G5AA 5HYQB 3GEWB 1OB1B 2DBJA 3L4YA 3R06B 4WI6A 4JRYB 3KPSA 4M8QA 3HG1B 4G8EA 3EJZC 4PGDA 4XP5L 1MFCL 2HVJA 2DYPB 1WBXA 3RUGE 4Y5VB 3KLDA 5LQBH 3SY0A 3C8HA 1MAJA 3CFJB 4KVNL 1QRNB 2EH8H 3CMGA 3MRQA 4NZJA 4HK3N 4MNQA 4PJ7B 1JNJA 2XQYG 3DIFB 3HUJA 3T0EE 5HDLA 5KVGH 2BRRL 4UNUA 2PXYC 1BGXH 5EO0B 2D03L 2F54B 2VXVH 1ISVA 2GUYA 2PETA 2CDFB 3VXTB 2OYPA 3MLSH 1FP5A 3TBSB 4LLAA 1HILB 1YMMD 4JG0L 1X6NA 1MJUL 1Q72H 3O8XB 4F7TA 3SIMA 1TJHH 3LEXB 1BWMA 1M6OB 6FABL 3QR2A 4OD2A 3VXRD 5JW4N 3EYFA 5JOFA 5EU7E 1PSKH 5D4YA 3QUYB 4NM8L 4ETQA 1RULL 5E1HB 4ETQB 3CGTA 3I9GH 3MCKA 2W61A 4ODXA 4X7SL 4Z0XA 5A2CA 3QUXC 4HS6A 4ZUWA 1XF3A 4FNLL 1CL7I 5E99H 5A3ID 4U05A 4QGYA 4ODWA 1A02N 3QDJD 2Y06H 3GXDA 4JFEA 3HPLB 4EUPH 4MVBD 1JNNH 4JCLA 3WS3A 4LPTA 4JREC 2I60H 4H1LH 5A2FA 2HFEA 1XCQB 5CBEA 3IDYB 3QH3B 4A4AA 1FV1B 1R86A 1A9EA 3WFHA 1QLEL 3WEZA 4H8HA 4OFYD 5EDXA 3ZJ8A 2ZUNA 1JHTA 2BY2A 3L3HB 4PUBL 5ENWA 1S9XB 2IPKB 3TZVD 2IPKA 4I2XA 1DWAM 2X9WA 4PP2A 4W5ZA 4WJXA 3D5HA 3MRMA 5IP4A 1F45A 3JV6B 1QVBA 4KV5F 3ZKMD 2XIBA 4MNGE 4EI5A 5DVKA 4HUUA 1CN4A 3ROOA 4EI5B 3KR3L 1PKQA 3HMWH 1U8KB 4GLRH 4YHZH 4W89A 4XWGH 3NFNA 1TZIA 5EU3B 5L88H 1AXSB 1BECA 4HUVA 4EAMA 1YNLL 1A3LL 1E6OL 1U6AH 2DJ4A 1I1YB 1MF2L 5D5ME 4OLVL 1MCFA 1QFHA 4MWFB 3BKMH 5FKPB 2HG5B 1KBKA 3WF0A 3G04A 5AD0B 4QXWA 3EW3B 1JD9A 3HU7A 3G04B 3U4BL 2HN7B 1AE6H 1JPFA 2ATKA 1V6UA 1ERNA 1JPFB 3RJYA 4KTDL 2X0HA 1RZJL 1JGDA 1KXQE 3ARED 4FS0A 3BDYL 4UDTA 3VXUE 3VMNA 2BZDA 1QNSA 1CICB 3QXWA 3PTQA 3ROLB 4JPKL 2WBJC 3WELA 4XVTL 3CK0H 4OGAC 1EA9C 5DC9B 4XGZA 1EHXA 1AMYA 5CJXA 4OCNC 1Z0MA 4P46B 1KWKA 2D23A 1MVFA 3HHRB 5GS1C 4WJ5A 3GKWL 5IUSA 3RWFB 1NSNH 2BERA 3IDNB 3MRCB 5LBSH 1P5UA 5A2IH 4GW1A 1HYSD 3LQAL 4WV1B 3I6KB 4D0CA 3EOTH 2A3BA 1D9KB 2WP3O 2OLHA 4LASH 1HHJA 4MS8D 5AYUH 1SBSH 2ICWI 3NUKA 4PRHB 4K3EL 5DLMH 5HHNA 3O2DH 4NFDA 4RMRA 4E42A 2QV4A 3MUJA 3DUHA 5FF6B 3KXFA 3RNQA 4BH7B 5IHZA 3S37H 4GJTB 1G7PB 2WVVA 1RZGA 1UR8A 5GNXA 1CIUA 4M1GH 4HOXA 1JUFA 2XZQH 4W7UA 2OQJB 5IB5A 4P5TD 3DMMB 4M02A 1V3KA 4KRPC 2XXMB 4WI2A 4OF6A 5DVLA 4AWEA 3KWWA 4OCSH 4OTXH 4M1RA 2H6PB 2YXMA 2ZSWA 3DX8A 1IGCH 5TE4L 3QI9A 2V5RA 3FO0L 3MLWH 3DX8B 3OKKA 3OR6B 5A40E 3LN5B 3BE1H 4JFED 3S4SG 1QR4A 3H3KA 4L3EA 4PJ5E 2VLKB 3OR7B 3DUSA 3GMQA 2QHLA 5KSAC 2I24N 5D9MA 3QHFH 2DDQL 2LVCA 4M48L 5IROC 4DGYH 3NCOA 4ZUVB 1E27B 3QDMD 4HDIA 4FABL 4RMSA 3VD4A 3IXTB 3TNMB 1CR9H 5I17B 3EO1B 4X6DA 3ZKND 4ML4A 3FT4B 4MA3B 5FOBA 3VDHA 1VGEH 2DEPA 4ZO6A 4X6CE 4QRSB 5EU4B 4AIXA 4QNPE 3RWCA 3WIHH 4YN5A 5DK0A 4MDJB 2ZWLT 3HRZB 5D8ZA 4B3KA 1RZFH 3G9VA 3TIDB 1S7SB 5KAQG 2F58H 1B0WA 1OM3L 1FN4B 4MXWH 1G0YR 3UTSA 3X12B 3L5WA 5IB4B 4P2RA 2W0FB 1CNVA 5T5FL 1NGYA 3P0VL 2AVGA 3AXLB 3M8OH 5GSRA 5SWSD 4HFWA 5CJ8A 3SCWA 4J6RL 3V0WL 4CU8A 5DO2C 4QP0A 1TTGA 3WDJA 2XZAL 2YKLL 3FFCB 4AENA 2RGSA 3WFBH 5I1LA 4GINA 2NR6C 2XWEA 4NC2B 4JM2C 3T0EC 3UETA 3D3VE 1G0DA 5IQ9B 2WVUA 4AEHL 3MYJA 1DWGM 1MCHA 4JO3L 4JDVA 1OTUD 5DJXB 1DVFB 4RE4A 5KTEH 4GW4A 5IB3A 1GOMA 3P4MB 1ZVHA 1F8TL 1NAMA 5KW9H 2PO6A 1YPZA 2WUCH 3IDMA 4JM4H 5SX4H 2AK1L 3ZT6A 1YEFL 4YLQT 4N42A 1E56A 5DJYA 3MRDB 1M7DA 1H41A 2AJSH 4Y1AB 4KKBD 1XF4B 3M07A 4LMQI 2OSYA 4HKBB 1TTUA 3DXAB 2WK2A 4IRJC 3M7SA 1KCLA 1LE9A 4RGNB 3NIYA 5J7CC 4RRPG 5HYEA 5D5MF 4LSUH 1KPUA 2ZUSA 3B6SA 1J8HA 3MRBB 1T5WA 2APVA 4YGVA 4ZFZB 4X9IA 2AABL 3WEMA 1A6WH 3FZUC 3MO1A 3VD7A 4HZ8A 4DGVH 3SN6N 3FQRA 4C7GA 2XRAH 4IS6A 1BFVH 4H8UA 5GS1A 4DZ8A 2R1WB 1MCBA 2UWEA 2DYPA 1KN4L 3EFFB 1C5BL 4F7PA 4AMCA 4WFFD 1P4BL 4XWOD 5EBLA 1SY6L 4V2CB 3RL2B 3AQUA 1YEGL 3BQUD 4HEME 4YHKL 3WQVA 2VZSA 4PJGA 5EOCH 3W9DA 5IEHA 3ULVE 3WDHA 5C8BB 32C2A 4KI5C 3UR7A 2YWYA 2OYKA 1AR2A 1T3FB 3ZO0A 5C0JB 3SOBL 2IALA 3D18B 1HKIA 1E43A 4PGZA 2Z35A 3WIHL 1R3LB 3CCHA 5EUOF 4ZXBA 1FCGA 3MRGB 1NBQA 4TVPD 5ALBH 5AAMA 2ZCLH 1I9EA 4OCRH 5DMGD 3WLBB 5T1DL 2X8RA 4GRWH 4AIOA 3B3IB 3MTRA 3L6FA 5AUMA 3KPOA 2Q86A 5AYIA 5ACZB 4HWBH 2VRJA 3PP4L 1V6YA 2VDRH 3TYFA 3MKKA 4Y4FA 5C0CD 5D2LE 3ZKXB 4CKVX 5JIWA 3TVMB 1JXKA 4Y16B 5DMGC 4PLOB 1BVNP 4K9EC 5LGJB 3V5DB 1KXHA 1DN2A 4RQQA 4AL8L 1CDIA 1QW9A 1WTLA 1PLGH 5EU6D 4WHYH 5BRZB 2EKSA 4O51A 4X8XA 4X5LA 5I76B 1ONQA 3GSWB 5JHLL 4RAVB 4W8AA 5SWSA 5I8OL 5E0FA 4QDMA 4WDIB 3NOIA 2EDOA 1WT5A 3QIUA 1P5VA 4V28A 3BN9C 3F58H 2NY6C 4H8WC 3I50L 1HHIA 3VE0A 4JFWA 5M3WA 1FLTX 4I13B 1JXJA 4Z0BL 4G7VH 1VFAA 4NYLB 3IETB 2P46B 3BEWB 4XP9L 3K46A 2D7TL 4ELKA 1T6VN 1LK3L 5HHPB 2YSSA 4GKZA 5I8KL 1DFBH 2EICA 1RUKH 4YPJA 2DT2A 4U5KA 2FR4B 3ARXA 1PG7W 3BOVA 3SDXB 3VFVB 1DBJL 2HTLC 3DMMC 5GJTH 4Y2DB 2LU4A 3MGTA 2VAJA 4XXDB 1TJIH 2Z31D 1NUFA 3VWKD 1S9VA 5I1HL 1XC6A 1IT9H 3STBA 4XC3H 1JZ2A 1B90A 1LG2A 2VQ1B 4Z2IA 2FJHB 2OI9B 4PGBA 2R4RH 5FHBH 4KJQD 1LEGB 2YLLA 5FV1L 4Z18A 4XBPA 1N3NB 3BT2H 2HT2C 3WH6A 1LO0H 3VG0H 3A67H 4RWYL 4N0RA 4PJ8A 5DEGA 3TJEL 1H5BC 2V5TA 1V8HA 4XNYH 1N2RB 4HU8A 2Y07H 3UG5A 3CDGB 3O6LH 2NTFA 3CDGA 4YHOH 3BH8B 4OQTH 3FQTA 1UH3A 3BH8A 8FABA 1R3KA 4BF7A 1JNLL 4Y89A 1A4JB 3QNZA 2BXYA 2A77H 1H09A 4UQAA 1ZLWK 4G6FB 4ORGB 2GEEA 1EAPA 4XP6H 4PJ9B