4MJ2A

Crystal structure of apo-iduronidase in the r3 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
613
structure length
595
Chain Sequence
APHLVQVDAARALWPLRRFWRSTGFCPPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-L-iduronidase
publication title Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.
pubmed doi rcsb
source organism Homo sapiens
total genus 194
structure length 595
sequence length 613
chains with identical sequence B
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01229 Glyco_hydro_39 Glycosyl hydrolases family 39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mj2A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4mj2A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mj2A02
5J12B 2EYTA 6FABH 2EE9A 3TF7C 5M3WA 3GBNH 3V4VH 1HQ4A 2ZOKB 4PJ8A 3HR6A 5ALCL 4PJHE 4PJGF 4PJ7E 1IM9D 4O2FA 5AWNL 4B7IA 4UQDA 2UWEF 4MNMA 2BY2A 5GZND 4BFIA 1OTTC 3F12A 5D7JC 2E6JA 32C2A 3CUPA 4L9DA 4P9ML 5I74B 5IB5B 1QSFB 2J78A 4P2RA 4PMQA 2HMID 1R3HA 3IJSA 3QIBC 4CKQA 5F7NC 1L7TL 3VWJD 5BV7H 3MMDA 1PW3A 1U8IA 5BOPA 1FL3A 3LRGA 1GOIA 3CUJA 5ALBL 2VUOA 3DVGA 1DQML 4OD2A 5FYKL 2XGIA 4J3VA 4F9JA 4Y4HD 5AD0A 4ML4A 1HKLL 2F74A 2YBRA 4CBPA 3W53A 4UT9L 1CN4A 4IOIA 1KN2H 4OT1H 1UM6L 3QHOA 1EBAA 5HNNA 1A7BA 2E9JA 2PN5A 4MAYA 1AJ7H 4QTIL 2RR3A 4XVSL 2J62A 3GSQA 1XGQB 4JFOB 3WXVH 3KPNA 4HXAH 1C12B 1E3ZA 1CD0A 3PWLB 3MCLL 3OG4B 3E6FA 3RVXD 3NOIA 5E03A 4LARH 1MF2L 3MRDB 3V95A 4NHUB 1XF5A 3G08A 1HVXA 3CK0H 3U82B 2QF8A 3WNPA 1CENA 5FGBA 1NC2D 1HNYA 2WWKT 1MCRA 3LEVL 5ADOL 4MNHA 2WMGA 1CCZA 1OQXA 2J5LB 2EEDA 4XMPH 2EDYA 4QXUH 3WDPP 3SKJH 3NCOA 3R0NA 5CJOL 2V2TB 1Q0XH 4HF5L 4PRBA 3MUIA 2LU3A 2W9DL 2CGRL 3DROA 2H32H 5IB4A 1ZA3A 3RPKA 3TOPA 4NQCD 3BJLA 1AR1D 4GG8B 1ZLSL 3K8LA 1AFVH 1A9BB 1KXVC 1YYLH 3TNMA 1AR2A 2F5AH 4QRQA 3PUCA 1UZ1A 2A9NH 2DD8H 3HZKA 4PJHF 3C8KA 4P59L 4D94A 4PJ7F 2OS7A 3VXSD 4X9GA 5C08B 2GTZB 4XNMA 2VAAA 1KR0A 3BD4A 2OL3H 4JO2H 5LAXA 4XVUD 5EOCJ 2IG2H 2SEBB 3NA9H 4MA7H 3O6KL 3R0MA 5FF6A 4R90H 1XGRB 2X05A 2UY5A 4TTUA 2PYFA 3BJ91 3ZKSD 3R06A 5TE4H 4QOKD 1ZT1A 4D0DB 4GBXA 3FO2B 4GAJH 4X6CA 2EH8L 2B2XL 3VW3L 5CXPA 2D3NA 4ZAKA 2YPVH 3TV3H 1S5HB 4PJ9B 4MMXC 3RM8A 4KMTL 2H2PC 1KWGA 3REWB 1U8HA 5BRPA 2Y07H 1S78C 1A21A 2BVQA 3TA3B 5DEFA 1BVKB 2G75B 3TVMC 1QA9A 1YPZE 2O26U 4JJHA 3UTSE 4KU1A 1B4RA 5CSZA 5E8OB 4TSAL 4LP5A 3SO3C 1ZHBB 2C0HA 3MUGB 1T1XA 5TDPA 2DIAA 1LNUA 3MODH 3OKLB 1MHCB 1LLOA 3WFHA 4LGSB 3TTOA 3WD0A 3V4PH 1VBUA 3L3GB 2NR6C 5B39G 4OGAD 3O6FC 4XX6A 4ZUUA 5KG9B 3QG6A 3UJTH 3RJXA 4ELME 3DX7B 1OSEA 5IT2H 4EEEA 4ZOCA 4OV6F 4M3JA 4G9FE 5B39A 3LOWA 4CNIB 3ZQ9A 2YXFA 1JHTB 2C5DC 3FRUB 4W6YB 5DJ6B 2QKIA 5ALBH 4TNWF 1FORL 2BXZA 4JM2C 3MNZB 5F88B 3DX6B 3B3IA 1JFQH 3FB8A 4P4KC 4UT9H 1CD9B 2EYTB 2NY2C 4GJTB 2BFGA 1AQDA 1HQ4B 4PJ8B 4QTIH 4H20H 4XVSH 5DMJB 1JNDA 3NACL 1IE5A 2ERJC 5JW4R 4LBEA 4AL8L 4O2FB 2GK0A 1LL7A 2W9EH 1B30A 3GBLA 3O6LL 1U42A 3TWCL 2I25N 3MCLH 4BQ4A 4BFIB 3F12B 32C2B 3CUPB 1E4XH 4RE2A 4P2RB 4WUUE 4OTXL 3OJ2C 1R3HB 1UWGL 3IJSB 2QADD 1R3KA 3U5YA 2CEQA 1XC6A 1U8IB 1FRGH 1FL3B 5B8CA 3S9DB 3DVGB 2X10A 5EOQL 4OD2B 1V6VA 1LE5A 4A4AA 2XQYK 3QGVA 2GSGA 5ADOH 1KGXA 5AD0B 2F74B 1OD7A 5FYJU 2YBRB 4NO0D 5E9DD 4IOIB 4Y5YC 1Q6DA 4AIXA 4D6GA 3THDA 2YEZA 2DBLL 2VQUA 4MAYB 3JWDC 5JHDE 4X9IA 3GSQB 3O3DA 1P4IL 1IC4L 3KPNB 4HF5H 1J1XH 1UB6A 1X6NA 2CGRH 1ZV5A 1WISA 3CSGA 3QWRA 1YPZF 4LVNC 4KZEL 1B0WA 1T5XA 3E6FB 4JB9L 2IFGA 3BUYA 4XCCL 5ELIA 2WWKO 4FXLA 4DOHE 4MXQC 5K9QI 2YBTA 1BJMA 1IQWH 4LVHB 3FFCB 4JRXD 2JJVA 1SYSA 1XF5B 3G08B 2A74A 1IEBA 4HPHA 3RA7H 4MAUL 4P59H 2NY6C 2HVJA 4LOUC 4G5ZL 4M29A 1M71A 2XWBA 3QCVH 4MNHB 2XQYG 2PWDA 3ALGA 1MCLA 1UACH 4ELMF 3O6KH 4PJEE 5DD5L 2WQ8A 3BCFA 3HRPA 2NY0B 5I15H 4WKAA 4PRBB 1U8JA 1NAMA 1M53A 3DROB 2VLKA 5IB4B 3PG2A 1ZA3B 4JPVL 3ZKMD 2FO1A 2OTWA 4GLRI 5D1XC 2VCBA 2EH8H 4D1JA 2OMNA 5DC4B 2OJEA 3F6LA 3TNMB 2K7PA 4QRQB 4M81A 4UNIA 3RIAK 3M45A 1AGFA 3HZKB 2C3HA 3C8KB 3ARED 3C8DA 5BXFA 4XNMB 2PUQT 2VAAB 5LAXB 2FR4A 4YXKL 3KXFA 5TJWK 4HKZA 1E73M 1KCRL 2XSBA 3SDCA 1J8HA 5FF6B 2XFFA 2CRIA 3VNZA 4D0CA 4XWOD 1UKTA 2PYFB 5E1AA 3R06B 1OWRM 4MDPA 4JIEA 4RAUA 1ZT1B 4KAQL 1EMTL 4KTEL 4NC2B 4GBXB 3ZKND 3U7BA 1OTUC 4EN3D 1YQVH 5T33H 3UDWA 2F19H 4X6CB 4XVJL 4Y4FD 2XQBH 4ZAKB 3WD1A 5EA0L 2A38A 1MVYA 1HXMA 2W0LA 3BH9A 1WFUA 3VIPA 3M17A 3H9YA 1TTFA 5C9KA 1A1MA 2NXYB 3VGFA 2XNAA 2ZXQA 1U8HB 4QF1A 1IAIL 3DETD 4MJID 4Y7EA 3N12A 2BVQB 3F65A 1NSNH 4Y8AA 4N5UA 1KJMA 4PP1C 5DEFB 1ZXQA 5HY9A 1DUZA 5A6LA 1QA9B 5I1HL 8CGTA 1FORH 1OL0A 5CSZB 2O5XH 5LA0A 3FXYA 4N0CC 1OW0C 2EDFA 4E41A 2CMRH 4OCYH 5C6WH 2G8ZA 1T1XB 1GZPA 1J05A 1QNZL 5TDPB 2QSQA 4IOSD 3HRZA 3S6TA 5DGRA 1LNUB 2MSPA 5HI3C 5CEXA 3WFHB 1N5YH 5KOVC 4W4OA 1D5IL 1VGKA 4L4TA 4ZUUB 3DV4A 2ENYA 4PJEF 4U1JA 4KQ4H 5J13C 3QG6B 3WBAA 1I8LA 5TFSL 1QKZH 3CNKA 1UWGH 4CAGA 3SKNB 1WDPA 1NBVL 1FH5L 1WAAE 1MCNA 1RZKC 1UJ3A 3S5LG 3UZVB 4Z7VA 5B39B 3WUBA 2XIIA 1QHZA 4UQBA 4FABH 1MI5A 2JB6B 3HG1E 5EOQH 3GKWL 4ZDHA 1UD8A 1Z3GL 1IGYB 1J1OL 1RP9A 1N59B 1W9XA 5DT7A 5CPQA 3B3IB 3EYVA 3FB8B 1E40A 3S5LA 4F2MA 2A3CA 1AQDB 4F8QA 1O7VA 4G8GD 1AMYA 3DUSA 4LBEB 3PQYE 1IC4H 1XR8A 2GK0B 3RM4A 4KY1L 4PRIA 5DFWH 5D1QC 5IROC 2PW2A 4KC3B 1J12A 3HNVL 1RZJH 3WIIH 4JB9H 2E9LA 4XCCH 3GYCA 4R2GD 4HS6A 5T3XL 3T2OA 5B8CB 3S35L 4MAUH 2MWCA 4K55A 1MFVA 2DKUA 4G5ZH 1LE5B 2GJPA 2GSGB 2Y24A 4FFWC 3DBXA 2KDGA 3MSGA 4RL3A 1I7TA 2YEZB 4KKBC 2A0LD 1P4BL 1F2XK 3KYKL 3O3DB 4YX2H 1H3PL 4JFDE 2JELL 1IC7H 1UB6B 2YWZA 5JA9A 1A6AA 4F33B 4OZIA 5KSAD 2P49B 3FFDA 2EKSA 1BFNA 1SMDA 4D1IA 1T5XB 1X44A 4K3EH 3HMCA 3IS0X 3BUYB 4Y2DA 3QUYC 3S34L 4GXUN 1MH5A 1Y0LA 1SYSB 3BHBA 1QNPA 3EHBC 2KQMA 2A74B 1IEBB 2V2WA 2XWEA 3H9SD 3H7LA 2HVJB 3HB3C 4P2OD 1M71B 2XWBB 3V5HA 3MNVA 1REIA 1CL7I 4APQA 2KKQA 1A6VH 1NUGA 3GI8H 2GFBA 3G6DL 3L5IA 1WAAF 3SGKC 4DWSC 3HC3L 4M82A 1OVZA 1U8JB 1NAMB 5EG6C 3S35X 2VLKB 2OTWB 1YNLH 4XVJH 2CR6A 3WFCL 3RX7A 1Y6KR 2OJEB 3MV7E 4Q6IA 3WJJC 4W6XB 2GK1A 4HEME 1JGVL 3H3BC 4PJIA 1RMFL 1WUNT 3R8BB 5BXFB 3QDME 4QHMA 5DUML 3KXFB 4Z6AT 2NZIA 4HKZB 1OCWL 1QLFA 3SDCB 5A1AA 1J8HB 5I1HH 5IIEA 5D6CA 3SCMD 4OFYA 1KJ3L 1BM3H 1HILA 4MGXA 4D0CB 3E8UL 4KRNA 2Y5EA 5E1AB 4ORZC 4M1CD 2R0KH 3HG1D 2JLLA 4RAUB 4TVUA 3C08H 4JQIL 4JFYA 3L4VA 3OJVC 2XYCA 1B0RA 2VLRD 1WLHA 3WH5A 1A3HA 5GS1C 1HXMB 3BH9B 1VPOH 2JIXA 2Q86A 3BQUC 3M17B 4W68A 4PGZA 1J5OH 1FHDA 4QCEA 1A1MB 3PQYD 2XNAB 1TCMA 3RGHA 4QF1B 3OR7A 3DI2B 3VD7A 1NBVH 2CRZA 3ZTJG 3SY0A 5IVZA 4PRHA 1KJMB 5HHOD 2VX7A 5HY9B 1DUZB 3O3BA 4EI5D 3WF0A 3H8NA 4KJYA 3U0TA 1WO2A 1Z3GH 2ESVA 2CBIA 4CDHA 5J6GA 1JIBA 3MRRA 5C07E 5JPMA 4E41B 3O2WH 2LAAA 3ISWA 4JQXC 1GZPB 1J05B 4N90E 3HRZB 2X89D 5JXEC 2Z9TA 4L9LC 2WP3O 5CEXB 4ODVL 1MQKH 3GSVA 2E9WA 1VGKB 4L4TB 1NLBH 2CCRA 3DV4B 4U1JB 4F80A 3K3QA 4JFDD 4U1GC 4FQIL 4XNQA 4H8WC 3PABA 4RZCA 3BVNA 5T3XH 2QPSA 2HA1A 1DANT 3EJZD 1UJ3B 3QSKB 4Z7VB 3UR8A 1HHGA 4BKLA 4UV4H 5DVMA 3S35H 5K9OA 3M1BA 4ZDHB 2I24N 5IBTH 2J8UA 1CQKA 4UTBL 3P73A 1J8KA 2Y7QA 3EYVB 5DQ9A 4KDWA 3OF6A 4F2MB 1GOMA 5I0DA 2WVVA 3DVIA 2WZIA 4W81A 2JELH 3FQXA 4MNLA 4B50A 1NAMH 3GSOA 4YE4L 2R0LL 4FQXD 3DYMA 2VR4A 3RBGA 1V3JA 3A6CH 5SX4I 4BA8A 3VMNA 4HS6B 3ZYZA 3MXVL 3BDBA 3O4LD 4X80H 4JL1A 4WHCA 1FH8A 5HI5D 4FLSA 2FRGP 1CFNA 4HWUA 2Q3ZA 4JN1H 1I8KA 3QIUD 4K7FB 5HHXL 3WNKA 1CK0H 1IKNA 1J0IA 3IDYB 4B16A 1BG9A 4WWKA 3GNML 4ODUA 4L1DA 3F5KA 3DBXB 3DIFA 5AY7A 1I7TB 1T1YA 4XPAL 3OKNA 1EDQA 4R97C 2EDWA 4YHZH 5DVNA 1HIML 1HP4A 3HC3H 1A6AB 4ZXBC 3QFJE 4OZIB 4U1NA 3FFDB 1JRHI 2EKSB 1Q1JH 4AY1A 1RUML 4PTTA 2UV3A 5D8WA 3REVA 2D7TH 4Y2DB 3WFCH 5KW9L 5TF1H 3MJ6A 1F90H 1MH5B 1LP9A 3BHBB 3QXUA 4JGMA 3I85A 4TVPE 5CSYA 5IBLD 2H2SD 2V2WB 3ULVD 4F8XA 3DHUA 3WNMA 1HSBA 3BLKA 1NBQA 3RKPA 4KQ3L 3V5HB 3MNVB 5IMKA 4APQB 1HK6A 2CDGA 2ZUYA 3WEOA 3QDJA 2PNDA 1KJ3H 1P5UA 2GFBB 2E6PA 3D3VA 1MCJA 3E8UH 4LNRA 2YR3A 3TFKC 4GQPH 1Z5LA 4GRMA 3L3DA 4RCAA 3S97C 3Q5TA 1EQCA 2G60H 1DQLL 4PV9A 1XGTA 3SCPA 4Q6IB 4AZCA 2J6EA 5GQBA 3WMCA 1PKQE 1GOWA 4HPGA 3WHE1 4HH9A 2GK1B 3SDDC 4PJIB 4H41A 2Y06L 3SQBA 1S7QA 5DHYA 2XYLA 3A67H 1CDGA 4P3DA 4TULH 4QHMB 3HMWH 1J7VR 1V08A 5C70A 3W11C 1QLFB 4DGIH 5IB1A 5IIEB 3NIDE 1NCWH 3DV6A 5D6CB 4W84A 1HILB 3GJEA 3PP3K 1QSVA 3VD4A 4DM1A 5H2BA 4YNYA 1F58L 2WSPA 4JFYB 3MREB 3KYAA 1R5WA 1UA3A 1B0RB 1DVFA 1I1RA 3ARSA 5LGJA 2ICWI 2R4RL 2I60H 4NKDA 4G7YL 2JIXB 4KUZL 2Q86B 3WS3A 4HG4K 1IGML 2QLVB 4CN1A 3B9KD 2CBUA 1I8MA 2OXGA 3OR7B 3O8XC 1IZKA 3SY0B 2YWYA 5IVZB 4PRHB 1PZ5A 3SJVA 3OGOE 3O3BB 4KJYB 3U0TB 4B3KA 4V1DA 2ESVB 3S7GA 5J6GB 1RIVL 5I1GH 3MRRB 4HIXH 5JPMB 3EMZA 4GPNA 4XP6L 1UXWA 3W6MA 1IT0A 1AXIB 1YJDL 5ADPH 4JPKL 1AIFA 4H7VA 1WIPA 1ULVA 4PMNA 4KVCL 1QQDA 4YE4H 1I1YA 4TRPL 4ZTOH 3CX2A 4F9PA 1ITBB 3NIYA 2B0SH 1P9MA 2YD3A 2WBKA 1ZHNA 4XNQB 1OB0A 4XP5L 1UZ6E 5FM8A 4NC1C 5HHQA 4RZCB 2ZXBA 1HHGB 4BKLB 3T3ME 4BQ8A 4YEFA 2VCAA 5K9OB 1G1YA 3M1BB 5GS2D 2J8UB 3VOCA 3AB0C 3P73B 1JF6A 2Y7QB 3GNMH 4WSKA 4UT6H 3K4AA 5DQ9B 3PDOA 4J8RA 4WTZG 1D5MA 3QUKA 2VOTA 2WVVB 1AI1L 5H37G 3PZUA 3ZDZE 2MKWA 2VZVA 1ISXA 4M7JH 5A6JA 3PTKA 3FQXB 3PL6C 3D18A 2IXUA 4GI8A 3P4OA 2YKLL 3GSOB 3NIDF 1UHVA 4KJQD 1CVSC 3C60C 1P84J 3ZYIA 1LE9A 3V0AC 1JPTL 3VXRE 4XNXH 4DTGL 4ZNEE 1C7TA 4EDXB 2ZG3A 2EXWD 3WQ5A 2BERA 2QQQA 1RVFL 1CFNB 1PPIA 2XTLA 1K9TA 1I8KB 1TZHA 5DQJA 1TUXA 1NBZA 2JE8A 1FLTX 2HN7A 4KQ3H 4U7KA 4WWKB 4M4PA 4ODUB 2H1PL 3DIFB 3KWXA 4D6JA 1T1YB 3IRPX 4M6OL 3S6CA 3OKNB 2CXGA 3ESUF 2NXZD 1ETZA 5JBDA 1PIGA 5DA0B 2X0HA 1UQZA 1H11A 4U1NB 2IUZA 1M1SA 2EO7A 4LCWA 1DQLH 4WRLA 5BWFA 1AO7A 4PTTB 3Q6FA 1RZ7H 4QXWA 3REVB 3KHQA 2J6EL 3GHEL 1LP9B 4NJ9H 3B2VH 5A2AA 3GMNA 2DS4A 2CJUL 2J7LA 2Y06H 4IRJA 1TJIL 4QT5A 3ARVA 1HSBB 3SKOA 1CICA 4IRSD 5IMKB 2VRJA 1KXTA 2CDGB 3CDCA 1CF8H 1LO0H 2X4SB 4Y4HC 2UY2A 4GXVL 3VFRA 1LK3H 1UZ6F 2MPAH 3D3VB 2V3GA 4LNRB 3FQRA 3L4XA 1UH3A 1CS6A 1K5NA 1Z5LB 4GRMB 3L3DB 4PJCE 4YXHL 3T3MF 5LGHH 4WK9A 4PV9B 1XGTB 4R26L 1ED3A 3MLXL 1QFWM 4AZCB 3IFLH 3LMJL 4KUZH 3VFTA 3FNDA 1DL7H 3RP1A 4HH9B 3ZDZF 2HG5A 3ULUL 3LKSA 1S7QB 5DHYB 3QEUA 2CHNA 4P3DB 4YDKH 4UTFA 1BIIA 1CECA 2FH6A 1SJHA 2ICES 2YD8A 1F3DJ 1JV5A 1NLDH 5IB1B 3GXIA 3DV6B 1RHHA 2B4CL 3D39A 5D2NA 3U0PA 4O2CA 3GJEB 4MS8C 1C5CL 5C2BH 4FFZH 5H2BB 4YNYB 1WBYA 3NABH 1XIWC 4NQEE 1MHPL 3WUWG 4FXGA 3EIFA 1M6OA 1R5WB 5DGQA 4JPKH 5GRJH 1DVFB 3RWCA 4X7DC 5LGJB 1L7IL 3IF1A 1K85A 5JIWA 5EUKB 4KZDH 2D03L 3F62A 4NKDB 3WS3B 1HIZA 2GITA 4EAMA 1KIRA 2V17L 1I8MB 3KNBA 3EO9H 1MW0A 2DQIH 3C87A 3RU8H 1JP5A 1PZ5B 3VXRD 3BT2L 3SJVB 2DYPA 2KUTA 1I3VA 1S7UB 4V1DB 3KPSE 1ZAGA 1IILE 2AXGA 4XCYA 5GS0D 1UXWB 4M1DL 3NFNB 4YHOH 4GIAA 1MOEA 1AIFB 3IDMA 2J25A 2R2BA 1SYVA 1UEYA 1FZJA 1QQDB 5E0CA 1I1YB 4F57H 2VXUL 1P4LB 2DM2A 5ESAA 5B4MD 1ZHNB 1YA5A 5HHQB 4PJCF 2O5ZL 1PG7W 1KB3A 1XF3A 4KWUA 5F7FA 2NCMA 2O5YL 4OUOA 3RM9A 1R3JA 4M48L 1RQ5A 1FIGH 4FTVD 3DXAE 1YEFL 5E70A 2QHAA 3EMQA 1OP9A 3ARGD 3PDOB 1EHAA 1X5FA 4J8RB 1D5MB 1DBML 3QUKB 1OAKH 3GXMA 3X14A 4LEXL 2XG5A 1W8OA 5JZ7D 1T5WA 3SUTA 3D18B 5GSRA 1AXSA 4Z7WA 3P4OB 2EPOA 2FX9L 4BF7A 2XWJA 4UINL 1LE9B 4FQHA 2FATH 3SQOL 1UWXH 4L29A 1I1WA 3L4ZA 1BOYA 5SX4H 4BZ1L 3L3KA 1C08A 3AHVA 2XY2A 2VDRH 3QCUL 4NN7B 5GRUH 4DVRH 3OB0H 4FZEL 5F70A 1KCVL 3HR5A 3RTQA 2CJUH 1MFDL 1TZHB 5DQJB 1WSST 3BC9A 1NBZB 2BX5A 2W0FA 1PKOA 2VDMH 4LSVH 2NY5L 2HN7B 4NHCL 4E8CA 1X5AA 2VAJA 4OFIA 5HYQA 5D7SL 3MSPA 4MQXD 5I19H 3NCMA 2FIKA 1ETZB 4NM8H 2JK5A 4WCYL 4CMMA 4G6ML 1BJ1J 1HJWA 4ZFGL 4YXHH 1UD3A 2GVYA 4LCWB 2VDOH 1NWUA 4K3HA 1AO7B 3Q6FB 2HVMA 2XN9E 3PBGA 1T3FA 2XXCB 1W3LA 3MLYL 3P0YL 4PGJA 2O93L 4NQED 1E1FA 2DQCH 3U7WL 2Z8RA 4JZJC 3GMNB 2HT2C 1EIBA 1NMCB 2QADC 3D48R 4IRJB 1TTGA 4QT5B 3SKOB 4RMWA 5BVPL 4KKCC 4MJ4A 1CICB 1KXTB 1OAUH 4XP1H 1QFWI 5DLML 2Q87A 3SDAD 1MCCA 3VFRB 2F58L 4KHXH 1BVNP 3FQRB 3GI9L 3MUJA 1IEAA 1XHGA 1K5NB 5I16A 5IFHL 1MREL 3L9RA 1MHPH 3HI5L 2Y6SD 4MNGE 3QNXA 3KPSD 5L88L 5ID0A 2YD6A 1WWCA 1ED3B 4XCFH 5FYJE 5IJVA 4FXKA 4JY6A 3QO0A 3KVQA 2ZUSA 3MV9E 3EBAA 4KI5E 3VFTB 2ZIDA 4PREA 5ABDE 2DQUL 1VRXA 4YHNA 1MAMH 2HG5B 2NX5E 3LKSB 3CVHA 2E7CA 4XNZB 1NARA 2YK1L 3NAAL 3QEUB 1QOXA 2LU7A 1BIIB 4U6VL 1FLRH 1SJHB 5I6XC 2RHEA 1JV5B 1SVCP 4P23D 1RHHB 2A6KA 3MA9L 3D39B 5D2NB 2EE2A 4U6XA 4O2CB 4XAKE 5EZOH 3U0PB 3D3AA 3LZFL 4QY8A 4UOJA 1WBYB 3AI0A 3DXAD 4FXGB 4M1DH 1G9MC 1M6OB 3W0WE 2L7JA 5BS0D 3RWCB 3IJHB 4P2CG 3IF1B 1R5IA 3CU7A 1PDKA 4G42A 1WWWX 1JTPA 1V03A 2GITB 3BGMA 5C6PB 5CUSL 1KIRB 3ZKQD 4JAMA 3B8SA 1G0YR 3KNBB 2DLFL 5CKGA 3VIJA 1BVZA 4KRPC 5HHPA 2EKJA 1MQRA 2BJML 2O5YH 5MP6H 3AMCA 1CLOH 5HYSG 1TQCB 2DYPB 15C8L 1WEJL 4HW6A 5FHBL 1JGUL 4H0GA 1OT2A 1MRCL 2VSDA 2AXGB 4XCYB 3TBYA 4K68A 3MRKA 4LYQA 1OPGL 5IP4A 4K3JL 3Q5YA 2YDSA 4PRAA 2FEDD 1CR9L 1CDJA 4LEXH 4K8RC 3IDMB 1GSMA 3JTSA 3T0ED 2R2BB 1SYVB 4I13B 1FZJB 4LLUA 4XPBH 2FX9H 2IAMC 4OJFL 5FHAH 4HOWA 3LEXA 5ESAB 3A3HA 1EAPB 3SQOH 3QUMA 1Q8MA 2UVFA 1PX3A 3RHWF 5F93C 3RJDA 5C7XH 3D5OF 1QRNE 1XF3B 1SEBA 4S1QL 1CGYA 1KCVH 3GH4A 2HKFH 5EWIL 1R3JB 2WMHA 1N3NA 1JJUA 1F4YL 2VH5L 3QP3A 4HIJA 4KI5F 1AHWA 5IV2A 3WQ6A 4OF7A 3BAWA 3OMZA 3G5ZA 2VRKA 4ZENA 5LA1A 5D7SH 4DFHA 1RHFA 1WE5A 3UTQA 1WIOA 3X14B 1HE7A 3G6JE 4QYOA 3VG9B 4ETYA 4EE9A 1T5WB 2GJ6E 4QRPD 5AC4A 1YECH 5GSRB 1AXSB 4Z7WB 1GVYA 5D9PA 3RZCC 3E2HB 4R4BA 2XWJB 2EEBA 4FLRA 2HFEA 4FQHB 1Z9SA 1TMQA 2EO1A 4ATDA 4L29B 3C5SA 2AEPL 1E4IA 3L3KB 1C08B 1JPSH 4OB5L 3BDXA 4D6DA 2R1XA 1CLYL 1MIML 5F7WC 3HR5B 5FYJD 1ZK9A 5JOPD 3KPRE 3MV9D 2W0FB 5GGUA 3ARYA 3QEQA 5FM5M 1GAFL 3ZE0E 2AJSH 4GAFB 4ZUWA 1IM9A 4L4VD 5HYQB 1CIUA 1DBJL 2DI8A 3PZMA 4W5UA 4FG6C 2FIKB 1F3RB 1T7XA 2JK5B 4ZPTA 5C1MB 3GI9H 4CMMB 5I30L 3MFFA 4QCFA 4HGMA 3BP4A 3KHOA 4ODTL 1FP9A 1G7LA 1BTCA 3OLGA 4LVOB 5IFHH 5GNZA 1RUAL 3VWJA 4RISL 5CJQH 2RQ8A 3SDYL 3AY4A 1T3FB 2UZIH 2EXYD 4FQLL 5IGXL 4I0CC 4YDLB 3WDQA 2AJ3A 2YD5A 2FJHA 3FN9A 1N6QL 2V2XA 3W0WD 2F5BH 4K9EH 2YS4A 4KKAD 4GSDH 4JHBA 2DQHH 2QHLA 5F44A 1K4CB 2EE6A 4LU5H 3AZSA 2YPLE 2DTSA 4HAGA 4G6FB 5KEZA 2NY3C 5T1MB 2FEEI 4NN5B 3GSXA 4N8VG 1RIHH 4S1RL 3EJYC 5KBNC 4MA8L 4AIUA 4UB0L 12E8H 1G0XA 5EU4A 1QPKA 7A3HA 2BRQA 4M5ZL 5KZCB 1PBYA 4OUUA 1IEAB 4OI8A 4GI6A 4N8VA 3WUZA 1GCFA 1NMAH 2X1PA 3SUWA 3L9RB 2V9RA 2DJUA 1HL9A 3QNXB 2ORBH 2PXYA 4DFIA 1O0VA 3OJMB 1MLBA 4WDIA 5F7MC 4OCSH 3PGFH 4L3EE 5ID0B 3AS0A 5IJVB 4FXKB 4JY6B 3QO0B 5E6IA 4PREB 1KULA 4WW2A 4AZBA 1JHKL 4YHNB 2Z31D 1FDLH 5CUSH 1A6WH 2NY1C 3G6JF 3CVHB 1WITA 4OFDA 1H3GA 3JWOC 5I17A 1HDMA 2DLFH 1K6QH 3HE7C 2YA0A 5F6IC 4GKOA 4GRLA 5D7KE 3P0VL 2CR3A 3FRPG 1QRND 1WEJH 2A6KB 3WQVA 4U6XB 4ONFL 3L5JA 4YEEA 3VILA 4QY8B 3ZKXB 5BYWA 3SE9L 1NFDA 4KGLA 5E2VL 1WT5A 2GUOA 1MQPA 3ZE0F 2YZ8A 4KVNL 5E2WL 4CU8A 1JYNA 5D5ME 1HXJA 2IXVA 3VIOA 3VX1A 2AERT 1R5IB 2FCBA 3IETA 4G42B 4WEBL 4OJFH 3DSFL 5EZJA 3BGMB 5BW7C 1IRAY 5I79A 3TZVC 4TUKL 3QUML 2HTKC 4ZO6A 4JAMB 4G6JH 2XVPA 2XG4A 5MENA 5HHPB 4QNPE 1P6WA 2XUCA 2ZJSH 2VVNA 4LLQA 4LPTA 4K7PL 3MOAH 5AYIA 3GO1L 5B21A 3TBYB 4R0LC 5EFFA 3MRKB 2XKNA 3KPRD 1OAQL 3GHBL 2CKSA 2X41A 3RNQA 1HX0A 2GSIA 2PO6A 3JTSB 3KPLB 3DURA 1H09A 1DN0A 1EHLH 4LLUB 1XSKA 4L4OA 5ABHA 1ISZA 2DIBA 1BBJA 1WFOA 1TJHL 4P5KA 4ACPA 2JCCE 3LEXB 3QUMB 1DEDA 3QOMA 3VKKA 1IAKA 2XZZA 1SEBB 4OB5H 5E0FA 1MIMH 1CD8A 1I1FA 4UFIA 3WUEA 4JO3L 1N3NB 3ARBA 1BAFL 4OIIH 1UD5A 4OLUL 2D4FA 4HIJB 5BXTA 1AHWB 3EBVA 5IV2B 3BP7A 3TBTA 5FUCE 3BPOC 1C8PA 1VF8A 5I24A 2VZSA 3G5ZB 1IGFH 2HRPL 4C58B 2F8XC 1QSFE 1FZMA 1PG7H 3V0VA 3NCFB 2ZCHL 3UTQB 4QYOB 4PPTA 1C8XA 1UKPA 4A3HA 1J0KA 3SGDI 2ADFH 1CGWA 3ZHLA 4R4BB 4X7SL 4L8SC 3SDYH 1HP5A 2HFEB 3MV11 1VBRA 4FQLH 3C5SB 4ORGA 5IW1A 4IOFC 3MJ9A 2V5SA 2R1XB 4L3ED 5I6SA 1NP0A 5D5MF 3CVHH 2NNAA 3QJHA 3MU7A 2PYEE 2EC9T 3JXAA 1GHFL 1PJ9A 3QEQB 5GGUB 3AS3A 1TE1A 1I8IA 1EOMA 4ZUWB 4MA8H 1IM9B 3PTQA 4EIGB 1LHZA 4MVBD 2HJLA 3MCKA 3MFFB 2Q8AH 3BP4B 1WPCA 1G7LB 4QNPF 1JWMA 1NM9A 5DZOA 1M01A 3VWJB 5LQBL 2X09A 4XXCA 1INDH 2ITCA 3LKQA 1LK2A 4LSRL 2X44D 3V5DA 1J9CT 5HPMA 2FJHB 5CGYD 1LWHA 3CZEA 2V2XB 1DQDH 2JJSC 1TDQA 4PTWA 4NO0A 3HI6L 2FD6H 4YWGL 3GSXB 1M03A 4NWTH 2JCCF 4X83A 5BRZD 1GHRA 2VDQH 3P0VH 2A1WH 4UT7H 3W29A 2IANA 2E9MA 5EU4B 5K9QG 4ONFH 3DWTA 1MFAL 4M9PA 4HA1A 1KB5A 1AE6H 4N8VB 3MO4A 4NOFA 1QYGL 2P43B 1GJWA 2CDEA 5DI8A 5C0FA 4Q97A 3TH4T 2X8RA 1MLBB 4WDIB 4KVNH 5C08E 4FQ1L 5F9OH 3SGEI 2V3DA 5E6IB 2YLLA 4WW2B 2IQAB 3C5ZA 3DSFH 5HGHA 5ESVA 5T1LD 2GEEA 5KVEH 3QUMH 5I17B 1HDMB 5CINL 3GIVA 3U2SA 1U92A 1T83A 1OD9A 3FHQA 4ENED 3GM8A 4AYSA 4Z5RA 4GRLB 3UPRA 5T5FL 4IDLA 4LLWA 1DBAL 1HZHL 2K7QA 4OM1H 5J8OA 1T04A 3UAJD 3EAKA 1EV2E 1TPXC 4W6WB 3KYOA 5EIVA 3WKMH 4LRNH 1X5IA 1NFDB 4MZ2A 2GUOB 3GHBH 1KPRA 1ROWA 4DQOL 5EOCH 2VDPH 2LTQC 1N6VA 2Q3AA 1C8YA 3AREA 1QSFD 4HFWA 4KDTC 2A3HA 3IVKA 3DRTA 5EZJB 4PGCA 3CLWA 3WD5L 1A14L 4M62L 3SE4C 4HK3J 2FX8L 4NUJA 5MENB 1A3QA 4ZEPA 5AZ2L 3HC0A 5CSUA 4TNVK 5FEBA 4QOKB 2VDLH 5F7LB 4JO3H 4LLQB 2D0FA 2CKBL 4OLUH 4PTMA 4Y8DC 3N9KA 4Y4FA 5CD5C 4ZPVA 3IB4A 2M8XA 2XKNB 1KV3A 5I8OL 5MERA 1PZ3A 2FGLA 3VUPA 2QSCL 3TH2T 1O5DT 2ZCHH 4R3SA 3RNQB 2GSIB 1A7OH 2PO6B 3KPPA 3DURB 3H42L 1DN0B 3RIFK 3MS8A 4MJIA 4X7FC 2JALA 3KYNA 4X7SH 1BBJB 5EBGA 5DK0A 4P5KB 1ZT7B 1ZVYA 3GRWA 4EBQH 3PWVA 1IAKB 3D69A 1CDUA 3GIZH 5ANMA 5FYKD 3IDXH 3RX8A 1E28B 1KB9J 3MJ9L 5D70L 1BD2D 1I1FB 5L2KD 1S5IH 1XGPA 1GHFH 4FQ2H 1EGZA 3BP7B 3TBTB 4KROC 4TTDD 1QBML 3VFMA 1RAMA 5ISZD 1JNLH 1FZMB 4P2RE 3D25A 3V0VB 4YGVA 4CD4A 4J6RL 1GGBH 3OKOA 1UR1A 3ZIZA 2HTLD 4JE4B 3JTTA 1UXSA 5T1DH 4JFUA 1VJSA 2AK1H 3VWKD 2N56A 4Y19A 4M43H 4ORGB 4HJJL 3L3HA 5IW1B 3OLIA 1FZKA 3QA3A 5DWUH 1W9BM 1A3RL 1YNKL 4YHKH 2DQEL 2NNAB 3QJHB 5I5RA 5JUVA 3DMMD 4G8GA 3HZMA 1UWTA 5F7EH 3HHRB 1I8IB 3O6AA 5IEKA 2ARJA 5IBUB 3N50A 1YMHB 1FNSH 1HYRC 4PBXA 3JV4A 3FFCE 1MEXH 2HJLB 3MCKB 1PY4A 1QHPA 5E08L 3KYMA 3BSGA 1W1PA 4G6AD 4MADA 1JWMB 2ESCA 3UEZA 1UKSA 4P3CL 2AOSA 1V3MA 2ITCB 3LKQB 1UH2A 4PJ9D 5IFPA 1Q6EA 1N0XL 5F7HA 3ARUA 2VXSL 3L5XH 4RGNC 3V5DB 4QHUA 4POZD 4DGVL 4NO3A 4R4ND 5HPMB 2ZNXA 3J7HA 4H1LA 4RIRA 2J77A 1EEQA 4NO0B 1FSKC 1RK1A 5D6DC 4OLXL 1KR1A 2DBJA 1UJTA 3VNYA 3SCWA 3EFFA 5EBLA 3BN9D 3EDFA 1HKJA 5T5FH 4HFUL 2IANB 1DBAH 3SEPA 3I2CL 2BSED 1FH9A 3HLAA 2PC8A 2WHLA 1KB5B 1V6WA 4NBZB 4QRTA 4WFHE 2C7UA 2CDEB 5DI8B 5C0FB 4DQOH 2IQ9H 2VXQL 5JHLH 1RUKL 5DVLA 2FHCA 4O00A 1E56A 3TVMA 4P2OA 1DBKH 4HLZH 4U6HA 3BX7C 1KCLA 5HGHB 4DW2H 4O58L 5ESVB 1UG9A 1FO0A 2YJQA 4KHTL 3GIVB 3U2SB 1JVKA 1U92B 5IB2A 2FX8H 4Y7MA 1JZ5A 2NY7L 3OWEA 1N5AA 1T21A 4Z5RB 1WCBA 3FQUA 5GGRA 3UPRB 4X6CE 5FIPA 1ZLUH 4LLWB 2CK2A 4F7PA 3K0WA 4OF6A 3O6FA 1VEPA 1T04B 2H26A 3ZYJA 4PJ8D 3KYOB 1YY8A 4MQSB 2Y8VA 2QSCH 4Z18A 3MRGB 2IFFL 1KPRB 1HYSC 5IFTA 2EEAA 3ZR6A 1C5DA 4K2UL 5T3ZL 3AREB 4HFWB 3SGJA 2GY5A 4PIRF 2Z91B 2DQXA 3LPPA 4RA3A 4D72A 3IVKB 3P3YA 4JM2A 1J9YA 3DRTB 4PGCB 3QRFM 4WGVB 5HPCA 3MMWA 5J9PA 2ZPKL 3GRWL 4P4KA 3JZ7A 2XICA 4NUJB 3QIWC 3HC0B 1VERA 5F3BA 3U1SH 2UWFA 3PWNA 3GKZA 3V9FA 4GW4A 3C2AL 3GZKA 4KK5C 3FMGL 4MAYD 1GCYA 4Y4FB 2OSYA 2YA1A 4ZPVB 4LSPL 4Q9BA 3BZ4A 5MERB 4HPYL 1VHPA 3JUYA 3DUUA 4EXPX 4OCXL 3LPWA 2ZNWA 3L3IA 3R4DA 4R3SB 4DUVA 3KPPB 2AAVA 4QXGH 4X4YA 3ZSSA 2AXHA 4AMKH 4R27A 3UC0L 4MQTB 4MJIB 3PZGA 3KYNB 5DUPL 4RNRA 5DK0B 5GZOC 4WFFD 5HHOA 3GSWA 1T2QH 5DHVA 3PWVB 4EI5A 4RA0C 3D69B 4Y5YA 2UZYB 5CS7A 5ANMB 1AVAA 1ZT4A 3CXHK 3VM7A 4OV5A 4M8VA 4R9HA 2D1ZA 2D31A 3N1AA 1OB1A 1ODAA 1A3RH 4GQ9L 2DQEH 2WC3A 1XGPB 2VLJA 4U4BA 3QXVA 5IVOA 3PWJA 3GBMH 3V5KA 3VFMB 1Q72L 1UWXK 3L7EA 2NY0D 1FGNH 3D25B 4YGVB 1W9PA 3OB0K 2WCAA 3OKOB 4JFVA 1XT5A 4WI2A 1RULL 1KB5H 3U30C 4QRRA 3JTTB 1UXSB 1KBGL 4X6CF 3L4YA 4P3CH 3A0OA 4Y19B 4YAQA 4B9ZA 1BP3B 2C1OA 4WFHD 2VXSH 3L3HB 4KK9C 3CPLA 3IKCB 1FZKB 5I71B 4WI7A 2OYLA 3QA3B 4J3XA 4CVWA 2XWTA 4GZJA 4PSPA 1IARB 1YEHH 3MROA 4EI6A 3F6IA 1EOKA 4OLXH 5IESL 5MEQA 4G8GB 3HZMB 3OV6A 2QQNH 5D1XA 5IEKB 1RPKA 2ARJB 3F7QA 4HAFA 1EDGA 5FL0A 2R56L 4QGTA 4N68A 3JV4B 4FQXA 5T3XE 1WB0A 4JFHD 3KYMB 1D3CA 2FLBT 4X7EC 4EQ3A 1WCGA 4JDTH 4ZAKD 4UQ2A 3THMH 2EDQA 4GO9A 4PTVA 2EH7L 2VXQH 3AS1A 4NZUH 3OZ9H 3QIUA 2NXYD 4Q7DA 1TETH 1L0PA 4QHUB 5AG9A 4NO3B 3IDNA 1EDTA 4H1LB 4RIRB 2IPTL 2CITA 4O58H 2OYMA 4JO4L 1RK1B 1OP3H 4D9RD 5GS3A 2DM7A 3SHSA 2NY7H 2CXKA 2VLKE 3EFFB 3K74B 1CL7L 5EBLB 4J12A 5HDBE 4KTDL 2GFTA 3WEMA 1TENA 2QQLH 3HLAB 4D71A 3HI1A 4MXWL 1T03H 3CSPA 3F5JA 1H0GA 4QRTB 1KT2A 2C7UB 4FQPA 4AG4H 1UYWL 3CXDH 1PSKL 1V3HA 2VZUA 4K2UH 1GQLA 4OZGA 3TVMB 3QUXA 1W9UA 4UR9A 3KXFE 4P2OB 4U6HB 1J8HE 2FWOA 5A2IH 2XPKA 1FO0B 3GRWH 1OW0A 4YHLL 5E2UH 2BV9A 4N9OB 3ULSA 5IB2B 2BNUA 4J3TA 1N5AB 1OARL 1T21B 4DKEL 1WCBB 3FQUB 5GGRB 5K9JL 2CPUA 4F7PB 3O6FB 3ARDD 2J7BA 2UUDH 2H26B 3GJFA 2OI9B 3V0WL 4PY8J 4LSPH 3CDFA 1SR0A 3AVEA 3NH7L 4OCXH 43C9A 3LQZA 4PB9H 3S36L 4F7TA 5I1AA 3L4TA 1C5DB 3UC0H 1K9EA 1QI0A 4JZ5A 5DUPH 3RY6C 4JM2B 4KMQA 1OAZH 3VA2C 5J9PB 4P4KB 1FFPA 4HX1A 2NY2B 3LS4H 4E41E 2VL5A 5AAMA 3UP1A 4GG6A 4GQ9H 5J57B 5GGQL 5F3BB 5C0DA 5I3DA 1W0YT 4PTXA 2AJZA 1MFCL 3RY4A 3PWNB 2Y36H 4GW4B 4M1RA 5JR1H 4IRZL 3O9NA 3BZ4B 4YBQD 1A6UH 4Q9QL 1G9NC 3DUUB 4ELKB 2FYYA 4EK7A 3L3IB 4O02L 4LLYA 2CUMA 3MOBH 5IHBA 4X4YB 3WMSA 5KVGL 5HDBF 1UVQA 3TYGH 3M8OL 3ZL4L 2OZ4L 3QHZL 1G01A 4RNRB 1WIUA 5T3XD 4C54A 2ZWZA 2XRAL 4QHKJ 5HHOB 3GSWB 4HUMB 5DHVB 4EI5B 5FM4A 4XBPA 4Y5YB 1ZT4B 2ZUWA 4OV5B 1GHSA 1KC5L 5F1IA 2D31B 4H1LH 3RVUD 1OB1B 2AXJA 3ME0A 4Y5XA 5KVMC 2XVGA 1N0LA 3W28A 2ATKA 2WMPA 4Z2LA 4OZOA 5IESH 2WZEA 4BK5A 2VLJB 3V5KB 3PWJB 4H25A 3V4UL 2XI9A 2BFVL 2FBOJ 5CHNA 1ZSDA 1FCGA 5D71H 3QUYA 3UTPE 3PZQA 2VLKD 3IXAA 5A2KH 3BWUC 4QRRB 3X3GH 4FQJH 4XAWH 2NY6B 1L9NA 3U57A 1S7RA 2AJYL 4YAQB 3ESVF 4FHBD 2C1OB 5JORA 3CPLB 3TT1H 5E95B 1W1TA 2XWTB 4YC2C 3WO4C 2VLLA 5I1JH 1JZ8A 1OTSD 3SGKA 4DWSA 3MROB 4EI6B 3LN4A 1FO0H 4OZFG 3TPUA 2DLIA 4S2SA 5MEQB 5FOJA 3SDCD 1FN4A 4AZ8A 1D9KC 1U3HC 3O0RL 4X9HA 3X3FH 4OZIE 5D1XB 4LHUG 3WKNA 5EU3A 2IH1A 4NYLA 4HUKB 1ZB5A 3G5YA 3ZO9A 4HA3A 4N1EA 3KR3L 4FQXB 3WJJA 4NF7A 1YMMA 3BPNB 3TN0D 3IRZA 4MXWH 5IMMA 4JFQA 1NGWA 2HLAA 1JRHL 2AW2A 4UQ2B 1UYWH 2YRLA 3ZJ6A 1CBGA 3WEZA 1U8KA 3QIUB 3WBEA 3ULVL 3N04A 4ZXOA 3EYQC 4LLAA 3IDNB 3QG7L 4I2XB 1KEML 2J7CA 1CDHA 3CZJA 1LJYA 4L3CA 4Q0XL 3MRBA 2G3NA 2B31A 4WHYH 4KI5C 2ZUVA 5EBMA 3BKYL 2YL6A 1MY5A 5IHLB 2PTTA 2CERA 2EPKX 5GS1A 3BQUA 5J3HC 1T2XA 5TQ2L 4IDJL 4ONHA 3HI1B 2RBLA 3V0WH 4QCIA 3ZE2E 1KT2B 4PJIE 3NH7H 1HF6A 4L4TD 1JN6A 1X5LA 1QNSA 3LPOA 1RZKL 2CLRA 4OZGB 3WUFA 1OBAA 3QUXB 3I9GL 5FFLA 1T66C 4ZUSA 4WO4C 2FWOB 5TH2A 4PG9A 2X4QA 2W92A 3ECQA 5DHVH 2WZHA 2ZG2A 1MI5D 3ULSB 2J8GA 2BNUB 5JXEA 2V3EA 4L9LA 3TESA 5D72L 2WHKA 4ZTPH 2B5IB 1I9JH 5DC0A 1GOOA 4O5LH 1CE1L 1D2KA 3GJFB 5J13B 1QP1A 3UXFA 3BGFB 1PLGH 1QEWA 4ZOEA 4TNVF 1A1OA 1JWUA 3CZGA 43C9B 3LQZB 4PRID 4XMKL 1KCSL 5HI4D 5I1AB 4F7TB 4X9YA 3O6ML 2E7LC 3UR7A 4OZIF 1NOWA 3U4EA 4PRHE 4NQDA 3UG3A 4JHAL 5DFVD 4J27A 4I0PD 4MDOA 4TUOA 1INQA 1FA2A 1KUMA 2ESVE 4OFVA 1ZWIA 2XVNA 1FFPB 1NPUA 5I18L 1ZEAL 4HX1B 5M17A 2W62A 2VL5B 2DH3A 4GG6B 2RFXA 4PJFA 3SDXE 1K8DA 3KJ6H 4CD7A 5C0DB 2AJZB 3HUJA 4Z0XA 1CGXA 3DTXA 4ERSH 1UM4H 2APVA 4JR9L 3V4UH 1MIEL 4HC1A 2PF6A 2FYYB 4F9DA 5JBFA 4LLYB 4EOWH 2PWHA 1BF2A 3QXWA 1UVQB 1JD9A 3BPLC 3O2LA 1NCBH 2NZ9C 2EPNA 2W0KA 1MCDA 3UERA 2BNRE 2PBOA 2AJYH 2AEWA 4UAOB 2J8UE 3W2DH 4ZOAA 4XBPB 1HQRA 3OXRA 3ZE2F 4TUJA 4PJIF 1NJ9A 1PZUB 2YDRA 1C90A 5F1IB 2NW2A 4Y5XB 2BRRL 1UWEL 1MELA 1Q6GA 2F8QA 2ATKB 2DI9A 4APQD 4NZTH 1MCEA 5C2UB 4H25B 2XWDA 2BY1A 5CHNB 1ZSDB 4OCLC 3QUYB 3VVGA 2OYPA 5JNYA 4NZDA 1JFHA 1LO2H 3IXAB 4GUPA 1ZBWA 1I75A 2C7FA 4H0HB 1KGCE 2Q7YA 5F96L 2VZTA 5DA4A 2GUYA 1ONQA 1S7RB 4U7MA 5D9OA 4FLQA 3CLEH 4X6DA 3F4VA 2GJZA 5DF0A 5JORB 5L6YL 1HH9A 3ULVH 1UZ4A 4PLKD 4FTVA 1QPPA 4FFYL 3I3EA 3QG7H 2VLLB 4D3CL 2NW0A 4DWSB 4TX6A 3LN4B 3K81A 2V5MA 3NPZB 4S2SB 3TPUB 2G41A 2Q8BL 1FN4B 4OFYD 5EU3B 2IH1B 1WDSA 2BK8A 1EJ6A 1XF1A 4NYLB 5I1KH 2C9AA 5IR1A 5JTWA 3G5YB 2EPLX 2MCPH 1DFBL 3CZLA 1X5JA 1YMMB 4GO6B 5IMMB 4G7VL 1LP9E 3SDDA 3GEWB 1HI6A 5J11C 1W2KT 4JY4A 4JFQB 3SDXF 4J2XA 2RGLA 5KSVA 1NGWB 2HLAB 1U8PA 3WLWD 3SE8L 1WJ3A 3RZWA 3NSXA 3B5GA 3WF4A 5AG8A 5DJ0A 3B83A 1U8KB 4MDJA 4F58L 5F9DC 5B38G 5BV7C 1SHMA 1YYML 4S0TD 4Z95L 3L1OH 4JVUA 3D3VE 5HDQL 1JYWA 4L3CB 3TO2A 3WUGA 1VEOA 3MRBB 1KTDA 2QHRL 3QPQC 4FF5A 4I77H 2HFTA 3VDCA 3N18A 4JY5L 1T7WA 2KL6A 4Z78B 2J8UF 5D4QA 2PTTB 5GS1B 1QFHA 3BQUB 2JJTC 4W8BA 3AM8C 3FCTA 4ONHB 1EPFA 1CGVA 3LB6C 5KTEL 4QCIB 1U58A 1E4WH 1JN6B 3APGA 3KLAA 4I9WD 1IEHA 1PIFA 2ZCKH 2DM3A 2CLRB 4RGOL 5L9DL 1EO7A 4JFEA 1GGIL 5GIRA 4PG9B 5E5MA 2X4QB 5TH2B 3SDAA 5CGYC 3EO1A 1ZEAH 2AEQL 1SM3H 4NBXB 4P5TC 4L9LB 1YHTA 4HD9A 4U1IA 4M02A 1RJZA 3BRFA 5AZEL 3MYZA 1E6JH 4NDMA 2PKDA 4JR9H 1MIEH 1GQKA 1QEWB 1IAMA 2WBJD 5CZVL 4HC1L 3AS2A 5CPSA 1A1OB 1JWUB 3DSNA 4CMHB 2MANA 1F3DH 3WQ8A 4X7CC 1F02I 8FABA 2ZUTA 4PRPD 5J4MA 3U4EB 4NQDB 1XD0A 1GZJA 3SJVE 2OWWA 4TUOB 1INQB 5IQ9A 5GHWH 4I3RL 4V1DE 1Q94A 1ZWIB 4OIBA 1LP9F 4P23A 4AWEA 4AD3A 5GS2H 3OZOA 4R96A 3WBDA 3QCTL 2RFXB 4PJFB 1K8DB 2BRRH 1UWEH 2AQ3A 4G8FA 4H0IA 4WWKD 5TE7H 2F61A 3ZDYE 1US2A 3HUJB 4U1SA 3PL6A 4Z0XB 4BQCA 1WWBX 3DTXB 2A6IA 3C60A 5L0QC 1I1AC 1TNNA 2Z1KA 1YY9D 3UAJC 1NAKL 1NGYA 5I1CL 4LPCA 1U0QA 2WC4A 3KDMA 3SCQA 3QBTB 5F96H 4D9LL 4W7WA 5I74C 3SUUA 5SWZD 5L6YH 2F53E 4XBGA 1LWJA 1HQRB 1A7RL 3OXRB 3R1GL 3HAEG 4TUJB 1B3ZA 3WKZA 1URLA 4FFYH 1NJ9B 3Q6GH 2UY7A 4LPWA 2NW2B 3S96A 1DLFL 3KLSA 4R97B 1LEKA 3QDJD 3MV01 3M7SA 1NEZA 4XB3A 1NCAL 2Q8BH 4DGYL 1ISYA 3T0EA 3I6LE 4H88L 4YIQA 3D3VD 4O51A 4YFEA 5SWSA 3DLQR 1IKFL 3S88L 3O2DA 5JNYB 3FZUD 4KPHL 1I85C 3RKDD 4GUPB 2P1YA 5HHNA 3NUKA 4GH7B 1T1ZA 2Q7YB 3SE8H 3G5VA 1ONQB 2IJ0C 4X6DB 2GJZB 1ZJAA 2DRUA 4NKIH 1HH9B 1IFHL 4FTVB 4RX4A 2W59A 3EOYG 4JCMA 1F8TL 3SKMA 3LHPL 2IBZY 4XMLH 5E4EB 1KJ2A 5BMFL 5HDQH 5J0BA 1JI1A 3CO4A 4WJ5A 3CDYA 4OKVA 3UO1L 2UWEA 5IEHA 2XSAA 1XF4A 2IGFL 4LCWE 4KGJA 4WKFA 3VFSA 1AO7E 4QRPA 5IR1B 3IFNH 2AAAA 5CP7A 3MRFA 3MLUL 1AQ0A 1WZ1L 1EK3A 5KTEH 3SDDB 1HI6B 5GISL 4JO1L 4JY4B 3O2VL 5LCVL 5I1EL 4F15B 4PMZA 5KSVB 1JPGA 3DVFA 3ZDYF 5GJSH 4M9OA 1U8PB 5DQDL 3TPKA 2DQTH 4Z8FL 5DJ0B 4MDJB 3WFEH 3ULUD 1XH3B 3ZJKA 3HZYB 3EKCA 4HZLB 4BS0A 1BJ1H 2UYLA 4EVNA 1ZGLA 2WWDA 5CP3A 2A3AA 1VENA 3TO2B 3EJJX 5CEZD 1XIWA 2AEQH 1VSCA 2PWGA 1E0VA 1YZZA 1KTDB 3NFSH 5D7LE 4DKDC 1H2JA 4XTRD 1JTOA 2GDUA 1A1NA 4DJMA 4KJWC 4LQFH 4MQ7A 1LO4H 4I1NB 2V38A 1OGAE 3ARWA 3QH3A 5AZEH 1JPST 3MLPA 4AXNA 3X11A 2FNBA 2D7MA 5CZVH 1U58B 1CBVH 3KLAB 5F89A 1ZLUK 3CUGA 1DBBH 2DICA 2HVKA 3I3BA 2P5WA 4JFEB 2FBJL 1K3ZA 3PWUA 5GIRB 5E5MB 2D22A 4I3RH 1HJQA 3D39E 5D2NE 1D6VL 3T77A 2D7OA 4WWID 2GHWB 4POZC 3SDAB 4A6YA 3EO1B 4BYHA 3TCLA 4G6KH 1CE6A 3SCUA 1FAIH 3OLDA 3MLTA 3TA3C 3FT4A 1TR1A 1CXKA 3HTLX 3WL0A 3S4SG 2VWEE 1PD6A 4JHWH 4U1IB 5GS0H 2V5TA 1P7HL 1RJZB 5JW4Q 3CHEA 4NDMB 2VIRA 1NBYA 4HLZG 2HLFC 2W60A 4HPOH 1UQSA 1NAKH 1CXIA 3I50H 1UR4A 2P8LA 4LSUL 4NN6B 4O2EB 4D9QD 4PJ7A 3MOQA 4UQ3A 2DJ4A 3I6LD 8FABB 3P77A 5FO9A 5IQ7L 2D20A 4OCRH 1ERNA 4OJYA 3OAUL 3AB0B 2APTA 5IQ9B 1ZTXH 1BGGA 1Q94B 4H26A 4FOMA 4P23B 3PZNA 2XTJB 1QI3A 4R96B 1DLFH 1C92A 4G8FB 2BSSA 3B2UD 4U1SB 3PL6B 4HWNA 1CFTA 4AEHL 5FDYA 3RVVC 1X5XA 2A6IB 1CDIA 4DGYH 1A02N 5E8NB 3IU4L 3C60B 4EUPH 4M8QA 1MSPA 4H88H 1FG2A 4U0RC 4GKZA 1IKFH 1NGYB 3S88H 5FECA 1F2QA 4U1MA 5CZXD 2RAMA 1UWIA 3O2DL 1MNUH 4HU0A 3FT2A 3KDMB 2WHMA 3BXNA 1I3GL 4U2ZA 3ZYOA 3UYPA 5C0BD 4R4FH 4JPWL 1XGYH 2R2CA 2F8VA 3AHTA 1SMAA 4S1DC 3AIEA 3LPGA 3EDDA 4XBGB 5AYQA 3T0AA 4IRJD 1F8TH 4PJXB 4JREB 3T1FB 3S96B 5BMFH 5ICXA 3VFNB 3UTOA 1KJ2L 1LEKB 1HNFA 1NEZB 4W8AA 4Z7WE 3JSSA 2AEIT 3T0EB 2DSWA 3MYJA 4YIQB 2R29L 4O51B 1BREA 2EDJA 5EU6D 5SWSB 3L3JA 1BQHA 1UA6L 1YEEL 4UILL 1KFAL 1WZ1H 1JF1A 4JZJA 2DT3A 4LSTH 3L2LA 3DO3A 5HHNB 5FO7A 5GISH 4JO1H 5LCVH 5I1EH 2YC1A 1MAJA 1KACB 5GRVL 4PR5A 1KXQA 1T1ZB 1OY3B 1JK8A 3G5VB 5ACMA 5DO2D 4OLVL 1OD0A 5HD8D 5F7UA 4OM0L 2WUCH 3JV5A 3QUZD 4HIHA 3WN5C 4CD5A 3SKMB 1UYQA 1P7QD 1Y6NR 5INDA 1QBLL 1J1PH 1KJ2B 3T4AA 4H5SA 5FGBC 2MFNA 4M7LL 2J1KA 3HZVA 3P11H 1XGZA 4ZSOA 1NGPH 3RUGA 5ESQA 4WJ5B 1INEL 4OKVB 2UWEB 3QISA 5GGTA 3D39D 1XF4B 4B3LA 3FQTA 1BYCA 3VFSB 1C5BL 4QRPB 5CP7B 4I3SL 3MRFB 2FGWL 3F7RA 3B8YA 5FK9A 2IADA 4QWWD 1OP3K 1JPGB 5E8DH 1RZJC 5CILH 2C4FU 1E4NA 4PV8A 4G8EA 1LDPL 1TXKA 4RMUA 4POYA 1DTUA 4GQQA 4XBEL 4FZ8L 3T8XA 4PUDA 1RIUH 4HEPG 2ZCLL 2WIIA 2UYLB 5D8JH 4EVNB 2VT0A 1ZGLB 1QNRA 5A69A 1MJ8L 4PGEA 4A6YL 2J4WL 4BZYA 4LGRB 4G8IA 1KBBA 5ICZA 5J7CC 1A1NB 1RH9A 1MWAB 3G04A 3O11A 4MQ7B 4WI5A 2XKUA 3QH3B 1V02A 4YGAB 3GDBA 3X11B 1U2HA 1MPAL 1NFKA 1JAEA 4GBXC 3OGRA 4LSUH 5A94A 1UWUA 4HP5A 5AAWA 2R2EA 4Z7WF 5C92A 1E6SM 4FRWA 4OAWA 5IM7A 5F89B 3O9WC 1FBIH 2P5WB 3RVTC 3PWUB 5EC1A 2UUDK 4OD3L 4YHYB 1HVQA 3T77B 2B1HL 3MLVL 4A6YB 5DFTA 3TCLB 4G9FA 1CE6B 5SX5H 5I1LA 3MLTB 5IOPA 3FT4B 2PR4H 2DMCA 3G5XA 4MA3A 2EC8A 2W91A 3VA6A 4N0UA 4XB8A 3N85L 2PB1A 4MJ6A 2VIRB 1NBYB 3QXTA 1GQJA 5LBSL 2W60B 3ROLB 4YDIH 5FUZH 1E6PA 1UQSB 1Q9WA 4I0KA 2W1NA 2P8LB 1A3LL 1BPLB 4PJ7B 1CXEA 1BVLA 4X0NA 3P77B 3LVEA 5FO9B 1I3GH 3AIQA 2LVCA 1JCKA 4NSKA 1VFMA 4JPWH 1FNEA 1MFBH 1DR9A 4H26B 1HHIA 4AD2A 2X5PA 1MQQA 3RTQD 4XC3L 4NWUL 1BLIA 4NP4H 3C5JA 4UBDD 3P4NA 3A6BH 3FAXA 1CLZH 2BSSB 4RWYH 1CFTB 1PX4A 5DMYA 1MJ7L 5DD1L 3RZCA 1I9IH 4QP0A 4NJAL 4M8QB 1E4XI 3MA7A 1HSAA 1QLEH 2DLGA 1FG2B 4X9FA 4MWFA 5JHDA 4GKZB 2ED8A 5FECB 1UA6H 1YEEH 1FP8A 4U1MB 4UILH 5AYUH 1NQ6A 2XKSA 1T7YA 3BXNB 1QRKA 2DSVA 3MUHL 1PAMA 2DLHA 1R8LA 1W1VA 1TITA 2NYYD 4PRDA 3HNSH 3T65A 3CFKA 1NUFA 1SEQL 1H1NA 4P9HC 1KN4H 1A7PH 1FFRA 3UG4A 3F5WA 1QBLH 1VGEL 5INCA 5B8CC 3CH1A 5EBWA 4P8WA 2FX7L 5ICXB 5HGAA 4M7LH 5CP3H 2DSKA 1OWWA 3UBXA 4EDWH 3MYJB 3B5HA 1C5BH 3VXMA 4J4PD 4OF3A 1B3XA 3L3JB 1MWAH 4I3SH 3L4UA 3F7VA 1BQHB 1FC1A 2WYSA 1JF1B 4FFVD 5FO7B 3CX5J 1OGGA 2YC1B 2YMXH 4PR5B 5DD6A 1RV6X 1JK8B 3WQ4A 1BD2A 3QEQE 4V28A 2ZUQB 5L2KA 5IMLA 2R0ZL 4XBEH 4FZ8H 3B9AA 3HMXA 4HIHB 5CIPA 2BNJA 1N7ML 2ZCLH 3ETBF 4P7LA 3T4AB 4H5SB 5ISZA 4D0BA 3CIQA 3HZVB 3NSNA 4ZSOB 3RUGB 5ESQB 4LASL 4XI5D 1G9ML 4MA1C 3EYUH 3FQTB 1DUYA 3AXXA 1Q9LA 5ITFA 1E6ZA 2AK4D 3FKUS 3VWKA 1KCUH 1MW2A 2XZAH 5FK9B 2IADB 1R24B 1YEKH 4K3GA 4PV8B 4G8EB 4OF0A 2P45B 2X40A 4GAGH 5ENWA 1EEYA 3T8XB 3MBED 3DMMA 3MRJB 2WIIB 3GZAA 3CFBA 5JOEA 3UTTD 1JYXA 4U3CA 2EBNA 3T2NL 1M05A 4PGEB 5FCUH 3WJLC 3QHFH 5JXAL 3NJ3A 2MOVA 1IAIM 3L7FB 4Y2OA 2V5DA 2OTPA 4XCNA 3N9GL 4F7CA 4ZS7L 4G8IB 3OKMA 5ICZB 4K8RL 4AD0A 3G04B 3O11B 1QNOA 4ZG1A 1F4WL 4PYGA 2V9QA 1AGDA 3N85H 4UFLA 1AXTL 1PX8A 4JGUA 5BW7A 1TZGH 3LKRA 4ODSH 3TZVA 3N1FC 4J3OC 3IS1X 4DKAA 3ZHDA 2R2EB 4KV5E 1BHGA 3FAWA 3HS0A 3OB8A 1KEGH 4KRUA 1U41A 5D8ZA 3QQ9D 4LCIL 5EC1B 4JLRA 5A16B 1WP6A 3C6LD 4NQCE 1G84A 1VFUA 4R0LA 2OBGA 4G9FB 4DKFH 5I1LB 5I1IH 5IOPB 1TLKA 3NBNA 3G5XB 5F7DA 4MA3B 2Q1EA 4OQTL 5IB3A 1CFVH 5TDOA 4M5YH 2BZDA 4N0UB 5LGKA 1V6YA 4MJ6B 1Q0YH 4WI9A 1C3FA 4XNYL 1Q9WB 1LD9A 1BQLL 4OI9A 3RWJB 3CC5A 1EGJH 1BVLB 4HHAA 5MENE 1LG1A 3BUTA 1D5ZA 4P57A 5CBAA 4QOKE 4PY8I 3BXWA 1FNEB 1I8LC 3MRCA 1H8OA 1IVLA 3UYOD 1HHIB 2JF6A 1EJOH 4MYWB 4N5ED 1F6AA 1UJ3C 2OXHA 2OJZL 3C5JB 3QEQD 1VGEH 3P4NB 2XIDA 3EZ8A 3LH2L 4OCMC 3STBA 3WDRA 2E7MA 3MLWL 3RZCB 5C0NC 1EX0A 1J86A 2KH2B 1T4KB 3NTCH 4L8SA 3KL5A 5GGTH 1LVEA 3MA7B 1BZ7A 1IGCL 4MWFB 5JHDB 1A64A 1MVUA 1CZ8H 3HNTL 4WVRA 4IMKA 4XZWA 1I4FA 1IT9H 1CU4H 1NGQH 2DMKA 3UX9B 1BIHA 4PRDB 1H15A 3T65B 3CFKB 4YFLF 4JM4H 2X4UA 4WI4A 1J0YA 4WW2F 3O3UN 3D2UD 3HMXL 2VDNL 1N7MH 4M93B 5DT1H 1UG6A 3GH7A 3U0WH 1XCQA 5INCB 4CN6A 3CH1B 3P30L 5EBWB 5HGAB 4KV5F 3IDGA 4QHKI 4FNLL 3IDYC 5B3NA 2AJVL 1WFTA 1MCOH 2IF7A 4OLZH 3UBXB 3V52L 3BCDA 1XAUA 3VXMB 3RIKA 2H45A 3K8MA 1M04A 3RVWC 3F7VB 5GGVL 3ZR5A 4NGHL 2PXYD 2JJSA 4F37K 5DD6B 1P84K 4U1KA 2NY3B 4HWEL 1BD2B 4OGYH 3JWOL 1A2YA 5E6ID 3HFMH 4UNTA 4Y2DC 5IMLB 5L2KB 4P46D 4MJ5A 4WNQA 1IBGH 1H3UA 2RCSH 3H9HA 4MAZA 4OBRA 3L5HA 4JFXA 2QTEA 4X4MA 1BFTA 3T09A 4LPYA 1MCFA 4D0BB 5ISZB 3T2NH 1WV7T 1BGXL 1CIDA 1GZQA 1RUPL 4GRLD 3BLPX 3ZM8A 4U3XA 1B2WH 4ZS7H 1GYAA 1LQSR 1YEIH 1DUYB 4IBLT 1NCCL 1Q9LB 1DZBA 5DRZA 5ITFB 4NZRH 1F4WH 3K7UA 1RUQL 3VWKB 1E4JA 1RZFH 2FZ3A 1MVFA 3T0XA 2GJXA 3V6OC 3MBXL 1CYGA 1D5XA 5LYRA 4CUCA 1JWSB 1V7MH 5E9DE 4JGJA 3FQNA 4Z0BL 4KK6C 1F45A 1GGTA 2D7QA 5HXMA 1YN6A 1BPVA 5ENWB 4DN4H 4B15A 1EEYB 3U4BH 1N8ZA 4Q6IC 5F6IB 4HCRH 4BM7A 3MLZL 4BSJA 3DMMB 4LCIH 3CFBB 2HT3C 2IANE 3H6JA 4TPRH 3PZVA 3MJ8A 8A3HA 5MEND 5D1ZC 1M05B 1P6AB 2XA3A 2ZUUA 5MI0C 1A6TA 5CJ5A 3NCEB 1U91A 4ZO7A 2YRPA 4XCNB 4F7CB 4JRXE 3OKMB 3LCYA 4P99A 1IAOA 4JFZH 3RDKA 5C07A 1AGDB 7FABH 1HNGA 4GW5A 1JPFA 2PO6D 3LKRB 3V6BR 1GH7A 3VG0H 2CHOA 1WGOA 1X4ZA 3ECBA 3MLSL 4HBCL 3SE4A 3QI9C 1OAXH 3MACL 3WDIA 1T0NA 3WLBA 3HS0B 5I8KL 4Q9RL 4R8WL 1TVDA 4ODXA 4K3DH 3EYFA 4JLRB 3TO4D 2AKRA 2D7PA 4ALAH 2O61A 4R0LB 5FA4A 1CG9A 2PW1A 1SBSH 2VABA 3ARBD 4O9HL 2OJZH 5BRQA 5F7DB 1H8NA 5CGMA 5ALCH 2Z8SA 3LH2H 3PZIA 5IB3B 2DTML 5TDOB 3WNNA 4HMEA 5AWNH 1B3YA 4KUCD 3PZ9A 3IDJA 2X4RA 4OGZA 2FB4L 4P9MH 1FHGA 2VR5A 3MGOA 3WNOA 1NKRA 2ZX7A 1P1ZA 3DRQA 1LD9B 4UUJA 4F7EA 3OR6A 3CHCA 2C3XA 1ND0A 3CC5B 1L7TH 1G0CA 1CLVA 4HHAB 1BJ8A 2Z4QA 4OZHA 4U2YA 1D5ZB 5ITBL 4P57B 5CBAB 4HUXA 5I75B 1DQMH 5FYKH 1R6VA 3MRCB 1JZ3A 4LIQL 1HKLH 1UM6H 3MO1A 3ARDA 2EZ0C 4XPGL 5DD3L 5TE6L 3IGAA 2CKRA 5GNXA 4NCC2 1NFIA 4HS8L 4MJIE 1I1CA 4AMCA 1FNHA 4KK8D 1BZ7B 4Y88A 2LVEA 1MF2H 3GUTA 1MVUB 5ANME 4HJ0C 1W72A 3OPZL 3BYTA 3QFJA 1I4FB 3BRDA 2EDRA 4HWEH 3LEVH 1H15B 5KN5A 1G9HA 3WHE0 2X4UB 5A6BA 2LABA 3H3KA 1S7SA 4NQUA 4HWBA 2F54A 1RPQA 2WWMC 2V7NA 3TJEL 1XCQB 4ZE5A 2NLJA 3QFDA 3CFEA 4FA8A 2O9TA 5CJOH 3IDGB 5HSFA 2ZZUT 5DZLA 2W9DH 4WIWA 2X1OA 2IAND 4KXZH 1ZLSH 1A7NL 3LD8B 3K80A 3PHSA 4OSUL 1G0DA 1MCPL 3QJFA 4YJZL 1PZ2A 1KLUA 1MJUL 5D6DA 5I2UA 2FJFA 1FVEA 2COQA 4U1KB 4JAWA 2GCYA 1A2YB 4TVSa 5JUEL 4G8GE 4MJ5B 3C5ZD 4WNQB 3EYPA 3H9HB 5CPTA 3ARFD 1NCDL 5C0EA 4KH2A 4OBSA 4OIFA 1GZQB 3WH7A 3QO1A 1Q38A 3SCRA 3BEWA 2J47A 4S1SL 1A7QL 2IH3A 3AFBA 5DRZB 2B2XH 3VW3H 1GQIA 5ETUA 2FZ3B 2DMBA 4KMTH 2GJXB 1KG0A 1D5XB 3OL2A 4OGXL 5E5UB 4NT6A 4PJAA 3M6DA 4DEPB 3RWGA 3MACH 3FQNB 2IMNA 3WD2A 1YN6B 1U6AL 4OF5A 4TOQA 1N8ZB 2VN7A 4AZGA 3NCYP 4PMRA 5FM5O 1VCAA 4UOQA 4NFCA 3MJ8B 4OD1L 3MRLA 3Q0HA 4TSAH 1IL1A 4CD8A 3P4MA 1DHKA 1ZLVH 2FJGA 3BZDA 4JDVA 1A6TB 4HUNB 4HTYA 3TN0A 1U91B 5EU7C 4HWZA 1OTTD 5D7JD 1IAOB 4CRPA 4K94L 3H9SE 3K1DA 2X0YA 5C07B 4BQBA 4KJPC 4HXBL 1Z9LA 3QIBD 3UTZA 4GW5B 1JPFB 5T3ZD 3ECBB 5CG0A 3WFLA 5J1AA 3U83A 1T0NB 1DVFC 4ESKA 3WLBB 2DDXA 4LAQL 2YHGA 5HTSA 1NWTA 3RJQB 5ITBH 3RY5A 4ODXB 3EYFB 4WI3A 3POCA 3PGDA 1P2CA 3P2TA 5JOFA 2AKRB 3BDYL 4HLJA 4LIQH 2O61B 1A9EA 5FA4B 4FK9A 2PW1B 4GKSA 2VABB 4XP9L 3BAIA 1AKJD 3NACH 5TE6H 3N11A 4M6ML 4AL8H 3BSHA 1L6XA 3WHXA 4IIQA 3RL1A 3O6LH 3TWCH 5EFIA 2X4RB 4LX4A 4ACYA 3MGOB 1P1ZB 4OTXH 2XXMB 3DRQB 1H5VA 4UUJB 4F7EB 3OR6B 2MTPA 1UENA 2DOCA 1ND0B 2DQDL 4MCZA 3BMWA 3OPZH 5TDNA 2VQTA 1BFVL 1W72L 2Z4QB 4OZHB 4Y19D 3A4AA 3Q1SL 2QKIB 3DYOA 4HUXB 3BMVA 1CWYA 4ZS6C 1P9MC 3CUIA 4KROB 4L4PA 3T2PA 2VLRE 3MO1B 1C16A 3PP4L 1G7QA 2B1AL 3ARDB 4HWBL 4TVPL 5ILTL 2DBLH 3TJEH 4O4YL 2AGJL 1V0LA 4NQSA 1P4IH 3IGAB 3VI4E 4UQCA 1ZBVA 5F1NA 5JW3L 1NFIB 2EDOA 3MGAA 4RFNB 5CWSA 4KZEH 4ZD3L 3X12A 3IAPA 4Z7UE 2EDDA 3ZJ7A 5HHOE 3N13A 2CUHA 4I0PA 3V8CA 3GUTB 4CU7A 1R3KB 1H9VA 1W72B 3QFJB 3V7MA 4HIEA 5DK3A 4JZNA 2ZUXA 4S10A 5KN5B 5T5NF 4JFTA 2VLJE 3RRQA 3HE6C 1S7SB 3FT3A 2F54B 3SCVA 4L5FL 2V7NB 5DD5H 2NLJB 3QFDB 1NCDH 3CFEB 2Q20A 2QQKL 4X6FA 4QRRE 4X9BA 4M56A 3AOFA 4JPVH 1W1YA 1CFBA 1HXYA 3B2UC 3KL0A 3FONA 5DSCA 2H2PD 4ZUTA 5I77A 4KKLC 1NGXA 2ICCA 4LGPB 4RGNB 1F4HA 4CN4A 1IGIL 1S78D 2JIEA 4PJCA 4UU9A 4RDQF 5GPRA 3QAZB 1FSKB 1OGTA 4OGXH 3W82A 2FJFB 1V0MA 1FVEB 3TVMD 4E2OA 5F1OB 3KJ4C 3TCXA 1JI2A 5LWYL 4BH7A 4F79A 5GRXG 4I18C 1VFOA 4YXKH 4JM2F 1KCRH 1C1EL 1WC7A 3RGVA 1NMCC 4OD1H 5C0EB 5CJXC 5KAQF 2ID5A 4BQ2A 3QO1B 1DWAM 4XUYA 1KENL 3B43A 4KAQH 4XP4L 1CICC 1EMTH 2W38A 2GJJA 2LQRA 3BEWB 3QZWG 1HHKA 3DGGA 3O4LE 3LEYL 2NR6D 3O6FD 2EPMX 1II4E 1V3LA 2IH3B 2WCSA 3QHMA 2V5CA 4K94H 1JYVA 3OTTA 5EA0H 5C9JA 3ABZA 2CKNA 3BD5A 5ETUB 4HXBH 3WF2A 2WHJA 1S9YA 1KG0B 4YHIA 4I2XE 1AGFB 3IJ7A 1XD1A 4NT6B 4PJAB 3RWGB 3VXNA 1IAIH 1XGUA 3VI4F 3BESR 3MX0A 1MFUA 4JM2D 2FR4B 5A3HA 4Z7UF 4P4KD 4QRSA 5HD8C 4UCFA 3WV0A 4MCYA 2NY2D 3QDGD 2VC2L 3MRLB 4XNZC 5FGSA 3QEGL 1IL1B 3P4MB 2APFA 1VDGA 2FJGB 4LFHD 1UEMA 1T80A 2DT0A 4JDVB 3TN0B 1QNZH 3ILQC 5JDSA 5C6TL 3TTQA 2R1YA 4HWZB 4PJBA 3BO8A 5E2JA 3W5MA 1S9VA 4PB0L 4Y16C 1QI2A 4R5EA 4OZGE 1D5IH 5KVDL 3ULVE 5D2NC 5FB8A 3D85A 3RY6A 3TP4A 3D5HA 3FL7A 2J7HA 4E5XA 3SN6N 3UTZB 2VYRE 4Y4KC 5TFSH 2R9HC 1WDRA 4U05A 5SX5K 1WAWA 2VWEC 2DQDH 1ZANL 1FH5H 2EEXA 1BFVH 1W72H 2IPKA 3N1QC 1LL4A 1N4XL 1DDHA 4LLMA 3BIAX 4K9EC 3GKWH 3GSRA 3PGDB 4X99A 1G7MA 5JOFB 4TQEL 1J1OH 2P47B 1K6AA 1A9EB 1BEYL 2ZWLT 4G43A 4DK3A 4GKSB 3PP4H 4HWBH 1UR8A 5AYBA 4M03A 2VLJD 2OCFD 2C4FT 2X42A 4HZAA 3QDHA 3VXQA 4BFBD 2J7EA 3WHXB 5I9QB 4V27A 4MXQD 4KY1H 5C86A 4IIQB 4WFED 3RL1B 3KLHC 1E72M 1DQTA 2VE6A 5EFIB 3HNVH 5C8BB 3SCNA 1B2YA 4OLWL 4YO0A 4QRRD 3VGDA 2NY6D 4MCZB 3CFCL 4LOUD 5TDNB 4CW1A 2APXA 3UPAA 4GG6E 3MJ7A 4CVZA 1MI5B 5FYKU 5IG7A 1HKIA 3R8QA 2N7BA 1TQBC 3GNPA 2O9OA 3S5LB 1ZLWH 4Z7NE 1C16B 1G7QB 1OT1A 4CDGC 2D0GA 1W91A 1P4BH 3KYKH 2OM5A 3DUSB 4NQSB 2WBJA 5D1XD 1H3PH 1XR8B 4MLSA 2QQKH 3RHWK 3U30B 2JJWA 5E24E 5F1NB 4PRIB 4LPXA 4TTGA 2PW2B 3RWEA 1ZHKA 3X12B 4PRPA 1ORQA 4WTXA 2WMIA 1W0WA 4I0PB 1KIUA 5MHSD 3S34H 3VH8G 2FDBP 3VG9C 4UFHA 3VMOA 4WHTA 5ABFA 1H0DA 4HIEB 5JQ6L 3E2HC 1CEOA 2XN9A 3VO0A 4JZNB 4OZGF 2DWEA 3FO1A 3G9AB 3ULVF 1D9KA 1U3HA 1HJVA 4P49A 4U7SA 1EFQA 2MQ0A 3IAQA 3FT3B 4OCWL 1NUNB 2ZSVA 2VXVL 5CLWA 4F37F 3EGSA 2ZP0T 5I2IA 2X70A 1TNMA 2M2DA 3G6DH 1DCLA 1OTUD 2X9WA 3GMPA 4KMLB 3GK8L 3W6LA 4Y5VA 5L2JA 5D93C 4C7DA 1HXYB 2X4NA 1N64L 5F6HJ 3FONB 1CGSL 4ZUTB 5DSCB 1NGXB 5EB8A 2A83A 1EA9C 3RBSA 1F4XL 1Y0LB 4PJCB 4UU9B 5SWZA 4LVOC 1JGVH 1RURL 1OGTB 4PP1D 3AZRA 1H8SA 1RMFH 3QUXD 3SURA 3TJHC 4Z2KA 2ZG1A 5DUMH 4BH7B 5IVXA 1EZVX 4N0CD 1OCWH 1LDSA 3QEHA 1TA3A 2A73A 3WMBA 1Q9KA 4YBLC 1WC7B 1OM3L 1T22A 3DHPA 3D1MC 3RGVB 4UFKA 4BQ5A 4X4ZA 2E8YA 5E2TL 4OFKA 4GG6F 5HI3D 4UFMA 4JQIH 2LAGB 1HHKB 3DGGB 5C6TH 1JAKA 3L95A 1QTYT 1UD4A 4TVDA 1ESWA 5DD0L 5C9JB 4Z7NF 1R86A 1S9YB 2G9HA 2FECI 1JFXA 4ZFZA 4EANA 3VXNB 1XGUB 3TGXA 4L8BA 1S7XA 2VMFA 2Y4SA 3WFDL 3W24A 1MCIA 4HK0A 4JQVC 1N4XH 2Y5TA 4QRSB 3KZSA 2YA2A 4MCYB 1NWSA 1QVBA 4UZGA 4NO5A 4PLJD 1G9EA 1F3JA 3SPVA 4H8UA 1LILA 3BAEL 4P7NA 5JDSB 4X8XA 5D1QD 2R1YB 4PJBB 3BO8B 1KOAA 1S9VB 2AJUL 4ODVH 1W2PA 4X0VA 2Y23A 1ZGLP 2VX4A 1RJCA 5IMOA 3D85B 5C3TA 1J88A 4E5XB 3ZKXC 3NFPA 3BIBX 1QW8A 5A2BA 5HHMD 2XA8L 4OLWH 2WVUA 1DP0A 4FQIH 1GUVA 5L7XL 3CFCH 2AMGA 4P8VA 2IPKB 3DX8A 5EMYA 4HUWA 4FFWD 1MRFL 1DDHB 2AQ2A 2OX5A 1W9DM 3GSRB 4X99B 4KKBD 3NCYS 2YD7A 4UTBH 1VJZA 4G43B 3I02A 1ZA6A 1FFOA 5IHRA 2EDKA 4RGMC 1X5KA 4GZIA 2I5YL 1BYBA 5IK3A 1F13A 4E42A 3VXQB 1VB9A 3GSVB 5FYLD 3DJ9A 3VRIA 1CXHA 2R0LH 3QUYD 2R23A 2VE6B 2P44B 1KJVA 1TVBA 3EHBD 2ZX9A 2D9CA 2LE9A 4YO0B 5GGSY 1OWQA 3WD3A 3PABB 5BZDA 3BVNB 3MXVH 3HB3D 4CW1B 2QMKA 3RDTC 1T7VA 3MJ7B 4HSQA 4PJFE 3TT3L 4CVZB 5DS8A 5HHXH 3T3PE 3HUJE 5IG7B 5M94B 1WTGT 1IGTA 1NCUA 3DI3B 4OCWH 4XPTL 5EN2A 4DWSD 1WCQA 5K9KA 4XPAH 3MUZ1 5IJKA 1Z2KA 5KSUA 1GGYA 4ZFOL 1HIMH 2WBJB 1AHWC 3RWEB 4ONGL 1YMMD 1ZHKB 4N0RA 4PRPB 1ORQB 1RUMH 4WTZA 2EIZA 1R0AL 2WMIB 3SCTA 1W0WB 5KW9H 4YZFE 2X9YA 4LHUD 1GOQA 3CIVA 4N0YL 3CU1A 4YC2B 3MRPA 3WO4B 1KPUA 1RURH 4WHTB 5LVEA 1JZ4A 1OGBA 5ABFB 1H0DB 5KSBE 1BX2A 1I9EA 4YLQT 4FMFA 2DWEB 3FO1B 1D9KB 1U3HB 4UZSA 3GXDA 3BWAA 2J7GA 3G6AA 2BVPA 2ZSVB 2F2HA 1KB9K 2ED9A 3EGSB 5I2IB 2X70B 4Z7OE 3CH8A 5DMGC 3OQ3B 3V7AE 3DHJA 2VC9A 2WUBL 4D6CA 1HJUA 2DH2A 3GMPB 3CLFL 2XM1A 7CGTA 4DN3L 3VD5A 4GS7B 4Y5VB 5L2JB 3BQUD 2ENSA 2X4NB 3LDBB 2CUIA 2HFGL 1B3VA 4X6DE 4JFFA 4P48A 5DD0H 5C0BA 2A83B 5GZNC 2A9ML 4FTVE 4WI6A 4P7OA 5SWZB 4LSSL 5DEZA 3PTMA 4LRIA 2HMIC 4UQAA 3W5NA 5C0RL 3VWJC 3AFLA 2YSSA 3AY4C 1L0YA 3JUGA 1KFWA 3K2MC 5IVXB 2DDQL 4IJ3B 4JRYA 3QDJB 3QEHB 4YUEL 2A73B 3JV0A 1Q9KB 2ICWJ 1T22B 2JJTA 3QQ4A 5DUBA 1XEDA 5JXED 1DANU 4D6IA 5EU6A 1PEWA 5BROA 4PJFF 1F58H 3ZTJH 2M1KA 5A6SA 4LAJH 4YQXL 3UYRL 1EH9A 3T3PF 3HUJF 3L95B 3VFVA 3CHFA 1HL8A 3TYFA 4MNJA 5CGTA 2R4RH 3RVXC 4G7YH 1IGMH 2G9HB 3CSYA 1YUHA 3V8OA 3WS6C 1LL6A 3SCSA 1UWSA 3QUZA 4ZFZB 3AIRA 1GGUA 3H3PL 4NQDD 1P7QA 4CJ0A 5L7XH 4W5ZA 5D5MA 4XRCA 2OP4L 5FIEA 1GORA 2ADJA 3F58L 4L8BB 2EO9A 1LF1A 1S7XB 1EXUA 4PFEA 4HK0B 2Y5TB 4WW2C 2ZSWA 5CEZL 4NQVA 5KJRL 4YZFF 3RI5K 4K23L 4AYFA 1MFNA 2MKLC 1RIVH 4M7KL 4NO5B 1P7KA 2H32A 2J8FA 2DQJL 4I8DA 1F3JB 2R8SL 3UJJL 4PJ5D 4XP6H 5KSBF 3SPVB 3AIUA 4XX1E 3LQAL 1ACYL 4BJLA 3BAJA 1YJDH 5BO1L 1NDGA 3D0VA 1OINA 3FY1A 5FKAA 5TPWL 5IMOB 4KVCH 4TRPH 1AR1C 4Z7OF 4LSDA 4JFEE 4JDZA 2BVYA 3NFPB 3WUWA 1FNFA 5E7BA 1WT5C 5DRWA 5EIQA 4XP5H 1GVIA 1XFPA 3DX8B 3WY1A 1JZ7A 6TAAA 1YNTA 4WHDA 2P24A 4HUWB 1JGLL 2ADIA 4X6DF 3I6GA 3PZOA 4LLDA 4XVUC 4MX7A 1HHHA 3QNZA 3FJTA 5A40E 3I02B 1ZA6B 4XPTH 1FFOB 1MCHA 4UMGA 4ZXBD 1AI1H 5IK3B 1BLNA 4E42B 1GRWA 3BAKA 1MHHA 4NI3A 4IEFB 3BPLB 3VRIB