4MJ2A

Crystal structure of apo-iduronidase in the r3 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
613
structure length
595
Chain Sequence
b'APHLVQVDAARALWPLRRFWRSTGFCPPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-iduronidase
publication title Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 194
structure length 595
sequence length 613
chains with identical sequence B
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01229 Glyco_hydro_39 Glycosyl hydrolases family 39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mj2A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4mj2A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mj2A02
3I3EA 5KJRH 4P5TC 2P5WD 5D8JH 1VBRA 4U7SA 2CERA 3QAZC 3WFBH 3OAZK 2KDGA 4YJZL 5HHOE 4PJHE 3TT1H 5F1NB 5DJ2A 2C5DC 35C8H 1UKQA 4PJ9A 1PYWA 4P4KC 4HKXA 3RAJL 1LK2A 4X0KA 4JN2A 1FSKC 2DWEA 1T89A 4Q58C 4O02L 5GGSB 4X9YA 3IGAB 1RV6X 5KN5B 2VDQH 2J2ZA 1S7QA 1T7ZA 2YEZB 3MBEB 3EW3B 4FNLL 5DVMA 1UYWL 4W5ZA 3C08L 3OIHA 1UFUA 2GAZB 4LASH 4MNGB 4ONOA 4QY8A 4WTZG 5CWSA 1NDGB 1DQQB 3LAFA 4D3CL 5T1MA 4XBGA 4LNRB 3GIZL 5HGBB 1E4LA 2Q76A 1T1XA 4QXTB 4N0CC 4L4PA 1LO5A 5AYUH 4C56E 2QMKA 1VGKA 1BEYH 3SCMC 3K2UL 2N7BA 1HINL 4BQ8A 4BFIA 4HPOH 2CLZA 2JKXA 3ISWA 1RMFH 4RFEA 3PL6D 1FH8A 3TVMD 3AFBA 4NRZA 1E4XI 2EEAA 1QFWI 4BH8A 3MU7A 2QSCL 3V5DA 5ITFB 4M56A 1FZOA 4Z7UE 4Y5VC 2QPUA 2F5AH 6FABH 4K9EH 1P4BH 2YHGA 2HRPL 4QHMB 1T0MA 3ALXA 1E4KA 1N6UA 3N1AA 2VLMD 1I7ZA 3RIFF 3RGVC 1D6EB 1IZKA 1E28A 3TO4B 5F6HJ 3BJ91 4OCRH 3EOTH 4HKJA 4MD4B 4P9HL 3RX5A 1CBGA 2DDXA 2MOVA 2AGJH 1ZS8B 3LY6A 4DM1A 4IS6B 4M1CD 3HZVA 2UY6A 4MVBD 1CFNA 3IDYC 4KKCC 4MMXC 4YXKL 3WD0A 4GI9A 2YRLA 3KYOB 5K33A 4MS8D 4G6KL 2CRYA 5JIWA 3OTTA 1CIUA 3WDJA 4DKEH 5KVFH 1PY9A 3H9SD 4HAGA 4HZLB 1BZ7B 4BQ2A 1LNUA 2VZ1A 32C2B 4XP9L 4LX4A 3EFDL 2V2WA 4D0BB 4Y4KB 3QCTH 4X8JB 2FGLA 3SE3A 3O3BB 3P11H 4UB0H 4DN3H 2HJLB 5IHZA 3EYUL 5FO8B 1BFVH 3MREA 3PHAA 3RWGB 1E6XM 3LKRA 3FFCA 3L4WA 2NY2B 3IDGA 1OCWL 4BKLB 2R56L 1WE5A 1JMXA 2OSXA 4EBQH 1R24B 1EEQA 1CFBA 4WJXA 3ALPA 3LKQA 4UCFA 1EBAA 3W5NA 4JLRB 3IFPA 3MV7A 1TPXC 5DRWB 1JNEA 1OAUL 3UG5A 4GQPH 4RL3A 2FR4A 2ZCHL 3CH8A 4HT1H 4PS4H 4FXGB 1C5BH 2OJEB 3TIEA 2IFFH 2BFGA 2ZUVA 5CD5C 1A1MB 2D03H 5LGKA 3DUSB 2Y2WA 5SX4I 5HHMD 4PREB 3GKWL 1B2WL 3B9KA 4KUZH 4NCDA 1BMGA 3UTPD 4O51A 2BRRH 5HGGS 1F2QA 1BP3B 1KJMB 1XF5A 4RFOL 1ITXA 3EYOA 2W62A 2AI0L 5A43C 1E0WA 3MCG1 1JUFA 5D1ZD 4DN4L 4MYWB 3L3DB 2O5YH 2A73A 4X80L 5KVGH 2NY6D 4OGXH 2O5ZH 2XJ7A 4AYFA 2Y36L 2Y4SA 1ZLVH 2YK1L 4LLMA 4DK3A 4PR5A 2A77H 4EDXB 3H3BC 1H0DA 4UOQA 2IWGA 1EEUA 3O8XD 3LPFA 1XIWC 1KOAA 5CMAA 2A6JB 4R97B 4KHXH 1CI5A 3DPBA 5C6TH 5EOCH 5IF0B 4OKVB 4Z7OE 1BFTA 1T22A 4I3SH 3RTQC 1HK6A 4FFWD 4YE4L 5F9AC 1MW2A 1VA9A 1JG9A 2R0LH 2R29L 3PV6B 4MADA 1O0VA 3KDMB 2AEQL 2AK4E 2BSRA 2ZNWA 3KYMB 1CLZL 2BSSA 2Q7NA 5KVEL 3DHPA 4HUUA 1KBBA 3UTZB 3VXTB 3HCVA 4G9FE 2VQ1B 3D39A 4O4YH 1OLLA 5JW3L 1IILE 4NJAL 3AIUA 4WCYH 1LHZA 1D5XB 5HYSG 1HYSC 2MKLC 1IAOB 5K9KB 5GSRB 3SCNA 5TE6H 2XIDA 2X1QA 1FN4A 3JUYA 1WDSA 4HZ8A 1RJCA 1RZJH 3U48A 1Q0YH 2XTLA 2GSIA 5ESQB 2EXYC 2VLKE 3ZE0E 3L3KA 3NAAL 4OFKA 2QL1A 2P24A 1ZLSH 4LLQB 1N3NB 1VJSA 1PIGA 1FFNB 4XP5L 2PUQT 2VAAB 4UQAA 3QFJB 1MRFL 1W72L 3WS3B 4H8VA 1HVQA 4B9ZA 5EBWB 4PGEB 4KKAC 4HUMB 1M6OA 4W89A 5DZLA 1YJDH 4K94C 1ADQL 3S36H 4PIRF 3AYSA 1IC7L 2DMBA 1I4FA 1IQDB 1DP0A 4YHIB 5BRZE 5FDWA 3RWHB 5I1DB 3CLEH 4A4AA 3CSBA 2J8HA 3AIEA 4W8BA 3MRDB 3IVKB 1RZGA 1AKJD 2N7AA 1TETL 3ARSA 1QR1A 5ILTL 1WQVT 5GGRY 1B31A 2B1AH 1E1FA 1DQDH 3KPSD 4L8DA 1HJSA 4MCZA 3V6FA 2QADD 3AIWA 4OCXL 1TUXA 4XNMB 2A0LD 1MFUA 3MZGB 5E6ZA 3VCLB 1NBQA 1NBYB 5I73B 3WFCH 2VR4A 4XNQA 1CE1L 1MCDA 4WW2A 5C0DA 4YXLL 3PDOA 4PRIE 2IAMB 3TA3C 4LBEB 4ZEPA 4RISL 2EYTA 4TTGA 2G2RB 1SYTA 4PP1C 4HH8A 3WJLC 2FO4A 3FB7A 3T3MF 1IGJA 2R2CA 5F9JB 2IGFL 2LTQB 3ZYJA 2OTPA 2R69L 2VLRA 3O0RL 2ZXBA 2ZZUT 1KLGB 3A4WA 4U1KA 3IDIB 5DO2D 2NSXA 1GVYA 1BFOB 2FCBA 1SMDA 2XFXB 1R0AH 4WDIA 1PZ2A 1NGZB 4QHNB 1MIML 1AGDB 2JB6B 5HBBA 1EIBA 2EDFA 1N6QL 4WI9A 2ADFH 3SGDI 2MHAA 5AWNH 1JL8A 2GUOA 4IOIB 3WD4A 3C8KA 1WC7B 1FH5L 5DFVD 1HEZB 1R3JA 1B4JL 4HJGB 1S7XB 4IPNB 4W86A 5KG9A 4KRPC 3QOKA 3BUYB 1E56A 1H5BA 3MJ8B 4IRJA 2V5DA 4HD9A 4R3SA 3OV6A 1OWQA 3L3GB 1YY8B 1NBVH 1MIEL 3KHOA 4HK3N 5E9DA 5FL1A 2X4QB 3D0LB 3QXUA 1AFVL 3QXDB 4X6CE 1IGTA 5C3LD 1UACH 5C2BH 5H35A 3RAJH 3ZE2F 1W1PA 4LF3B 3P2TA 4O02H 3SE9L 1UR4A 2VDRL 4TTDC 4AD0A 4LQFL 5HYEA 4FNLH 4NOBA 2YR3A 1UYWH 2WWKT 1V5JA 3C08H 4Y88A 4D3CH 3HN3A 4S1QL 4L9LC 4C4KT 4K7FA 3GIZH 4XC1L 2VZOA 1I8IB 4PRAB 1ZL1A 4C4KO 2WHLA 3GRWA 3KNBB 1JNJA 4WGWB 3K2UH 1HINH 1C16A 3QIWC 3IJ8A 2YKKA 1JHKL 1MI5A 5HI5D 4QRRA 3BH8B 1XZ0B 1TENA 4PMUA 1M71B 5GS1A 5ENWB 1OB0A 3QEHB 4BJLA 2QSCH 3MX0A 2EDOA 4U6HB 4MCYA 1F00I 1D2KA 3HMXA 2VX4A 1PLGL 4PRNB 1NCNA 4D9QD 1MHHB 2E7BA 1SVZA 5A1AA 4OF0A 3KPMA 5A94A 2BOBB 2I26N 2D9CA 5EFIB 3GH7A 1H0IA 2XVGA 5DVKA 3BP5A 2HRPH 2D2OA 4RE4A 2A1WL 2ZUUA 4C83B 2YD8A 4JO1L 1H09A 2FO1A 1X7QA 1U95B 4XCCH 4P9HH 1A3HA 4PN2A 1SJXA 2P8MA 5DJ8B 1W72B 3B5GA 1NBZB 2J8UF 2DD8L 3BGAA 4HX1A 4Y19D 5CEZD 1J0IA 4OLYL 1II4E 1NWRA 4YXKH 3BVNB 3SUSA 4LFHD 3DX6B 5JIIA 1ZV5A 2WVTA 1E9LA 4G6KH 5FKPA 2K1MA 3WEXA 5DURB 2GT9B 1W9UA 2OYLA 4M02A 4M93C 3VXMD 3ARFB 3U2SA 4DGIL 4U1GC 4X6BA 1D5MB 2Y9RT 3EFDH 2E9JA 3IDNA 4NQDA 1DLHB 3RNQA 3MLPA 1JP5A 4HS8L 4RE2A 4PJFE 4WI8A 1BAGA 4UBDC 4IJ3C 1K3IA 3S37L 3VD9A 3V6OC 3QDMA 1ED3B 3AQUA 1WIOA 1UOKA 5F8QC 1YNTA 1OCWH 1XGPA 3I85A 4P7RA 3CPLA 5F7YC 3E0GA 2F53B 1SFSA 1KGCE 4B53A 4OSUL 4QNPE 3I3BA 5IB3B 2CUHA 1OAUH 4HMCA 4KVCL 1JAEA 1V6UA 2DT1A 1JF6A 3WFZA 2ZCHH 1MLCB 2ZWLT 4AZCA 2A6IB 1X5KA 2D7TH 5JW4N 1G7IA 1VKXB 1E3ZA 3MS8A 2VQTA 3RWFB 2VLJD 5IVNA 4QYOB 1VJZA 4L4OA 2CBUA 1JGVL 3PP3H 3SDDA 1XF2A 1B2WH 4G8IB 3FRUA 2FHBA 3HB3C 4Y4HA 5SWZD 4ESKA 3DXAE 4M81A 1KACB 2OSLA 4P5KA 1JMZA 1GIGL 4RFOH 4ZXBC 1UUQA 3V6OE 3VWKA 2AI0H 3OKKB 4L4TD 2YC1B 3V0AC 1Y6NR 2GJZB 4I0PA 4X80H 3IYLW 2E40A 3VUPA 4ODVL 1WFNA 2Z31B 4NQVA 1Q6EA 3QHOA 2Y36H 4F15C 1A6ZB 4LRIA 4D94A 4P59L 1JPFA 2YK1H 3FHQA 3VIIA 4MHHI 5FO9B 5D2LE 2XICA 3M17B 3GBNH 4M7KL 3WKMH 3VI3E 3OB8A 1JF1A 5CGYC 2DQEH 2L7JA 4W85A 3WELA 2C9AA 5A6BA 4TVPL 1MEXH 1ZOXA 4XI5C 1YN6B 1K8IB 1LO3L 4YE4H 2R29H 2AW2A 2AEQH 4R7DB 4RAUA 5J89A 4JM4H 5AUMB 1CLZH 2VO5A 1AR2A 1KB3A 4EN3D 4F79A 1JWMB 1WBYB 2D22A 1A5FL 2CDEA 5JW3H 4NKIL 4NJAH 4E41A 2Y23A 5JBFA 4JQXC 5FA3B 3ZTNL 4CVXB 2D7OA 3RDTA 1G7HA 4WFGE 4YHKH 2J25A 1DZBA 3DV6A 5IMOA 4CD8A 3LDBB 1ZAGA 3SKMB 4KI5C 3RILA 3JVGC 4PJAA 1N0LA 2CBJA 1A22B 5FECB 1EFQA 2EKSA 3BGFC 5I8CB 2FJFB 3NAAH 5ANMA 3MRQB 3ULVL 4JFEB 2DN7A 3QUYC 4XP5H 2Q7YB 3VNYA 3T8XA 4JPWL 4PJ9D 1W72H 5EO1B 4Y2DA 1S3KH 4N68A 3CTTA 1GC1L 4JO4H 2X05A 1JTTA 1JPSL 4H0HB 3W11D 3VIPA 3ZDXE 3X14B 1ADQH 4X6DF 3Q0HA 3VRJB 2X9WA 1B3XA 1OD0A 1IC7H 2V2XB 4F33A 1JXJA 2VR9A 3X3GL 1IBGL 4PLKD 3U5UA 2V5CA 3D48R 1TA3B 4QHUA 2YD9A 3EOBB 4U3XA 5CUSL 1TETH 1XH3B 5ILTH 4OOUA 3I6GB 3SJVE 2JALA 1X5IA 1IM9A 2ZUQB 4OCXH 2EDWA 4X6DB 3CZKA 3IFLL 1AH1A 4PJDE 5EZJB 4YXLH 3WUGA 2YA0A 1R5VB 2YD3A 4MX7B 4WIWA 2YD4A 1ODAA 1U92B 4JPIA 5CJQL 3PWNA 5BRPA 5JW5B 2X4TA 2IGFH 1KXVC 3ARGB 3GUTA 4U31A 2J88L 2VKXA 4IRSA 1OB1A 2R69H 3O0RH 3FO9B 3KPOB 5EUOE 4EQ3A 2R4SL 2VN7A 2RFXA 5E4EC 5EU3A 1DSFL 2C7FA 3UEQA 1K9TA 1U8IA 2FYYA 1BECA 2J7LA 4NT6A 3BEWB 3C8DA 3HC4H 4JQVA 2PWEA 1MIMH 1YMHB 4YLQT 3EYFA 3RJYA 2I5YL 5DJZA 4UZUA 1N6QH 5TE4L 5EU5A 1CS6A 1C08B 1OSZA 3GBLA 3NZ8A 3MRGA 3QHNA 4RDQF 2JEQA 1P7KA 4X5XA 3HG1B 1DBAH 1XGUB 1FH5H 1YEHL 3Q48A 3B5TA 1U3ZA 3T77B 1KN2L 3IJSB 3JTSB 4OZGA 5E94A 4JFDA 5SV3A 4PJBE 5D8WA 4H1LA 3EZJB 3VIKA 1MIEH 1A7NL 1AD0B 1UD3A 3SDXF 3FFCD 2P45B 4QWWC 4IDLA 4PJGA 1RJLB 4JDTL 4FFZL 2ADJB 4NZJA 3SE9H 4FQ1L 1Q0XL 2JB5L 3GHBL 2JK5B 2VDRH 1CFQB 2XKUA 1VACA 1ND0A 3LQMA 4LQFH 1J8HB 2WIIB 5I0ZA 3MV7D 4GRLA 4HGKC 4R7NA 1SYVA 43CAA 2O9TA 4C57C 1AO7E 2HLFC 3RM8A 3MUHL 4K68A 4KDWA 3D85B 4I18C 1XR9B 1NWTA 4E5XB 4S1QH 3VG9C 3I84A 2E5EA 4XC1H 1HHGA 4QXWA 2IXVA 4J4PA 3ULUE 2XRAL 4WI4A 3ARWA 2X1PA 3HZKB 4CDGC 4RGNC 2QR0B 2UYLB 5C9JB 4URIA 3B9KD 3VXUE 1UH4A 4D2NA 1NWSA 3P9WB 4P2OB 1MAKA 2FEDC 1JHKH 3OAYH 3TV3H 2B31A 3MV8B 2ZUWA 3CCHB 4TNWK 1LE5A 1V3HA 4FFVD 3AZSA 2EDTA 1CR9L 1O5DT 2EYRB 2NY4B 3GXFA 5GRZA 1ZJBA 2ERJB 4PTUB 3BN9C 3O2DA 1PLGH 3K8MA 1CT8A 1HI6B 3G08B 3JV5A 3L95B 2CIIA 2VSCA 4OGZA 1BFNA 2XWEA 4MB5A 5DQDL 2A1WH 2DLFL 3G6JF 2XSBA 4K8RD 3VFGL 3ZHLA 2VXTL 3LEXA 1PJ9A 5JW4Q 3CFBA 3WV0A 3P4OA 3MLTA 2A74A 2JIEA 2DD8H 5A6KA 4OLYH 3D39D 1RUQL 1RAMA 3GH4A 3KPQA 4UAOB 4MNKA 5D1QC 2V3EA 5KOVC 4B3KA 5TDOA 5BVPL 2YPLB 5TD4A 1A6TA 3DX8A 1R3KB 5EU6B 3CH1B 4DGIH 5L2KD 3CIQA 1N8ZB 4YHOL 4EIZC 4J2XA 3LPPA 4PJIE 5IT2L 4U2YA 2PYEB 1JWUB 1ZU8A 3PN8A 4HS8H 5C8BB 2EDYA 4Z76B 1MFNA 5EBLA 4AG4L 5KSAB 3S37H 1WITA 4HV8B 3KAAA 5JBDA 4BQ6A 4AENA 5CBEA 5J1AA 4XP1H 3KWWA 5MEOB 5GIRB 3BH9A 1FG9C 5H8DA 1HE7A 2PTTB 4GO6B 1P9MC 2YA2A 2YZ1A 4QXGL 1G6VK 4Z7WA 4WI2A 5J12B 1ACYH 4L3EE 4OSUH 1H3TA 2Q8AH 3U79A 3HE6B 1CLXA 2VIRA 4XB8A 2QQQA 4NGHL 4RX4A 1QEWB 4OF7A 2NY1D 3SUWA 4GUPB 1JHTB 3EJYC 4M48L 3S4SB 3OPZL 2APWA 3BAEH 3MUAA 1JGVH 3OJVC 1NOUA 3HZMB 4WRLA 3SUUA 4U1JB 2O9PA 1S9XB 2W65A 4NKDA 2YSSB 5MERB 1OGBA 3FCTA 1GIGH 2X9YA 4NKQB 4MAYC 1I1CA 1U58B 3GMQA 3P40A 5IQ9B 3RGHA 4TQEH 1NCUA 4NO5B 4MLIA 4ODVH 4UI2A 3OXSB 2E7CA 1Z32X 4P59H 4MA1B 3UBXA 1QFWM 4G9DB 1TR1A 2E3ZA 3F12B 1A6UL 1HSBA 2ZNXA 4OZIE 4M7KH 3GTNA 2XVKA 2AV7B 4ZUUB 2H8PB 2VLRD 1UCBL 4TVPH 3VXPA 3WF1A 1DANT 2NT1A 1LILA 1LO3H 3O4LB 1CG9B 2ESCA 4I5BA 5K59E 2HWZL 4DWSA 2GJXA 4JM2C 3OR7B 1A5FH 2XKNB 1INQB 1C12B 1MCRA 4Y5XA 1GHFL 1IEBA 4CN1A 3L5WB 1NGYB 5GHWL 4M1DL 4FG6C 3P0VH 5MP6L 1WWAX 2ATKB 2C3VA 2EIEA 4PJXF 4HLZH 3ILQC 2YBRA 1D3CA 3DOSA 4ODWB 3VGBA 1EAPB 1FLTX 1NUDA 4LHUB 5F71A 5IKCA 2ZSWA 2PTUA 2DDQL 3L9RA 4IRJD 3W9EA 3QI9C 5D2NB 1PVHA 2DH2A 3ULVH 2I60L 5E9DD 4JPWH 1QRNB 4OZHF 3I6KA 4C55A 4KRLB 3BKML 5L2JA 4EI6B 5BROA 2W07A 2NZIA 1GC1H 3FQWA 1JPSH 2DM2A 2DL9A 3EKCA 4GRWF 4MA3A 5JLZA 1N0XL 4XGZA 3QDGB 3MRFA 4M7JL 4PJXB 1OSEA 3T2QA 4P5MA 3K8LA 1BG9A 4G42B 4DZBA 4TVDA 3X3GH 1IBGH 3WNOA 1GGIL 1X4YA 3TN0C 3SCUA 5KSVB 5BS0A 4PYGA 3UTSB 3BRGC 5CUSH 1CXEA 3QUML 2H2SC 3BPOC 5E2WL 3OZPA 3QWOB 4XVUD 2KL6A 1OHQA 1S78C 3PABB 1HL9A 2Y7QB 4O9HL 2Q3ZA 1EXUA 4W4OA 3IKKA 3WDIA 3QUZA 1QLRB 1J87A 4YHNA 3AROA 3IFLH 4EQ2A 1BG4A 4EZMA 1WAAA 3CZEA 4NRSA 1MI5D 4QRRD 3RX8A 1OSPL 4D6FA 4P8UA 5E00A 2XNAA 2I9TB 4PYSA 2QHRL 4P2CG 1C5DB 5CJQH 3KYNA 1KEGL 3HI1B 2DJSA 1WT5C 4FXKA 4HKZB 5JOFB 5A3HA 5JHLL 3ZJ8A 4PJ7E 1JTPA 3TA9A 2V2TB 3EGSA 3PQYB 2N1KA 3AVEA 4GH7B 4WUUB 4BSWB 3PE9A 2X10A 1DSFH 2BNRB 2GK0B 4H20L 2CR6A 4QCIB 2NNAB 4G6JL 3HUJA 1CFTA 3BPNC 4JHAL 1OTTD 3VTRA 4NNYA 1CTOA 4G8FA 2I5YH 5I2IA 5TE4H 5F6IB 1ZA6B 1CDIA 4XCYB 5MEPA 1MQRA 1I1YA 1WZKA 1CD8A 1QLEL 4RE3A 3ES6B 1PBGA 3WEMA 4LCUB 5C07B 1MCEA 5D7JC 1YEHH 4K71C 4P5TA 2XZAL 4F3FA 3AYRA 4OUEA 2CDGA 2G9HA 3VWJC 4KJYB 2J5LC 2SEBB 3B2VL 4RSVA 1HOCA 3GMMB 4I4WA 4XZBA 3ZKND 4ML4A 3PWPB 5BQ7B 4OBRA 3R8BB 1J1XL 4NQDD 2E8YA 4UTBL 3D5OF 4NM8L 4JPKL 3RHWF 1A7NH 3ZDYE 4EUPG 3VFNA 4N8VG 4W7VA 4P4KA 5BZWA 4I3GA 3QDMD 1FDLL 2HMID 1BYCA 4QRPE 2RQ8A 1A14L 1CXIA 4JDTH 4FFZH 4AD3A 4FQ1H 1Q0XH 2JB5H 2Z93B 5C8JB 3GHBH 3TPUB 4H8UA 4Z7UA 4E0RB 5F9WC 1KQZA 1ZVYA 2F8XC 3SO3B 2ARJQ 4KJPD 4LARL 1BVLA 4GKZA 1UWXH 3STLB 2XRAH 3DRTB 2P4AB 1E43A 1KBKA 1KGUA 4RQQB 4HAFA 3SCMA 3SDDD 2Z8SA 3QQ4A 4ODSL 4Y4HD 4LLWA 3DO7B 5AC4A 1KBGL 3NIYA 5IHBA 4AZ6A 3VWKD 5I9QB 2FHFA 3O2VL 3RI5K 2YUWA 5CZXD 2E7LC 2P7TA 4I0PD 1CR9H 1KNOB 3GSXA 43C9B 2X4RB 4DVBA 1YQVL 4R90L 1IM3A 4Y5VA 4XP4L 4GO9A 5GGUA 2GSJA 3EJJX 4B50A 1QVOA 4JZJB 3V6BR 3LMYA 2PW1B 4R4ND 2OM5A 4AD1A 5A6BD 3NFNB 4JY4B 1XSJA 5DQDH 2DLFH 3MLRL 4MXVE 3BIKB 4PRPA 3RGVA 2QSVA 1TITA 2NY3C 2XSAA 2YPVL 4UFKA 3VFGH 4Z2IA 2VXTH 2XTKA 3VIHA 2HFEA 4ONGL 4FQXC 4PGCB 2Y6SD 5I1HL 4OV5B 5TH2B 3O6FC 5F7EL 3V4VL 3BZEB 1RUQH 2D4FA 5C71A 4HW6A 1UB6B 4NQEB 3WIHL 1F3JA 4E41D 4Z2JA 3EBVA 3KJ6L 5FYKE 5E5MB 5BVPH 3DVNB 3RDTD 2J7HA 5E8EA 1OGAA 1B0RB 4Q6IB 4RMSA 3ZKMC 1QFUL 4LKCB 4MJIE 2F8OA 4YHOH 5L8JB 4PTMA 5IT2H 3QUMB 1RI8A 2OL3L 2A6KB 3NIGF 4J1UA 1PKQB 3MGTB 4AG4H 4CD4A 4FTVE 5D7KE 1T2XA 1YC7A 1V8HA 1FAIL 3DRQB 1U8NA 5IB1B 5C0AE 3X13B 3QO0A 4MDIB 2AERT 4Y2DD 1QA9B 5ID1B 4H25A 1ZS2A 4QXGH 2DL2A 3CHEA 4PCSA 1O7VA 3O11B 4X9HA 2APVA 4IM4A 2R4RL 2WW5A 5KANI 4NGHH 1FPTL 4OTXL 3FQXA 3N85L 3KLHC 1F6AA 1TZGL 4ODXB 3C6LB 3S88H 2CGRL 3CSPA 3MRKA 5J3HC 4PSRA 2MPAL 3HI5H 3F7VA 5ICZA 4M48H 4OD3L 3VXNA 3O4OB 1SBBA 3OPZH 1UYQA 4PSPA 4X9GA 4RAVA 4JB9L 1F02I 4G9FA 3IKCB 1BX2A 5IVXB 1IM9D 2ICEB 1HKIA 3A4AA 3AOFA 5A8MA 3D2UA 4OUUA 2G3MA 3OHXB 4M9PA 2HG5A 4NRXA 4TNVK 1WZMA 3GSUB 1R5WA 1MCKA 4JFFA 3MRPB 3AMGA 2QHLA 3LKSB 1D6VL 1JI2A 3U36A 3WLWC 1Y6KR 1V7ML 1IZJA 1A6UH 4DGYL 1MYRA 2DSUA 1XIWA 2XQYG 3VGGA 4D6IA 3E2HC 3OG4B 5EOTB 4R2GC 5LCVL 1JBJA 4IRSD 4OZ4A 3RTQA 1UCBH 4HOXA 1MQ8A 4UILL 4JRYE 1UVQB 1RHHB 2IALA 3SCVA 1C90A 4S11A 5DRNA 2YD7A 2HWZH 3S98A 1PQZA 5EO0A 4NDMA 2RBLA 3BPLC 3VIMA 1G9HA 3DHMA 4IOFD 2H26B 3NPSB 2BSTA 1OP9A 4AWEA 4U6YB 5GHWH 1FC2D 4M1DH 3A6BL 5MP6H 4MQ7B 1PIFA 4ZOAA 4MJ5B 3TYFB 5I15L 1C7SA 1ECEA 2ED9A 4WTZA 2CUIA 1FVDA 3FMGH 4QRUA 3S2CA 2G3IA 4EAMA 2DDQH 4JFDD 3BCFA 4KRNA 5FF6A 4Y5YC 1RPQA 2I60H 3CFJA 4KFZC 2ZKHL 4QRTB 5AZ2L 4I77L 4PRIA 2V3DA 3BKMH 1AJ7H 3GXIA 3B2UC 2Q1EA 4QCEA 1QSFE 4M24A 1DR9A 4WKFA 1N0XH 2NXYD 4M7JH 4ISVA 3NPZB 1UWTA 2VLLA 1AGBB 1E4JA 1GGIH 1V05A 4GRLD 1U8HA 3AMCA 3QNYB 3VI4E 1YA5A 1MLBB 2YN5A 4UT9L 1FH9A 1YEGL 2X7LA 3QUMH 5I75C 4YDVA 2C1PA 5E2WH 4J4PD 4JGJA 3RKDC 2JJTC 1A9EA 2KKQA 3BZ4A 4O9HH 2QQKL 1G9ML 4X98B 4HUNB 2GJRA 3QH3B 3MLZL 5GS0D 5JNYB 2AXJA 1YNKL 1E6NA 3D5HA 4G8GE 4U1MB 1FFOB 3TA3A 5A2LH 1I1XA 3ULSA 1OSPH 4F9LC 5IFHL 5EU7C 1KJVB 3WJLA 4PG9B 4U6TA 2QHRH 2WXDM 5IHLB 3MNVA 5A40E 3FOLA 3M07A 4ACZA 1BQLL 3QUKA 5JHLH 1UR2A 5I1IL 1IL1A 3DX9A 2EECA 3QSKB 4G43A 2XTJB 2OL3B 4X6CA 4CW1B 1TCRA 4H20H 2R23A 5DWUH 2XN9A 1HHJA 3NGBB 3WNPA 3UC0H 4G6JH 2YL8A 4JHAH 1ZKAA 1G6RA 3K80A 3MBEC 1R3LA 4X99B 4JFSA 1MF2L 1HNGA 3GMRB 2VL5A 3BP4A 5FD0A 3AMDA 1UENA 1CECA 3K74B 1QLEH 4NP4L 4ZPTB 1Q8MA 3VOCA 1YEFL 4KV5E 2XZAH 4YBLB 4JL1A 3LD8C 5FM5O 2FIKA 3V0WL 3WDHA 3B2VH 5E9AA 3DVGA 2AEPL 5C08E 3QOMA 1I8KA 3V6ZB 1LD9B 4YNYA 2VDNL 5TGBA 3HAEB 1J1XH 3OG2A 3APGA 1A6AA 2VE6B 2HTKC 2EEDA 4N5EC 1HSAB 4NM8H 3STZB 3L3JB 2P1YA 4X7FC 4JPKH 1Q6FA 4XPGL 2AXGB 2PO6B 3BMVA 5L88L 1GGYA 1EA9C 5IFJA 1EO8L 1UADC 4PJ5E 1FDLH 2EEXA 3DGCR 3WO3B 1MFAL 1A14H 4NSBA 5JORB 2V9TA 4R4BA 5E24E 1PPIA 5DJ6A 1EOKA 2JJWA 4JFOA 3MRRA 3REVA 4UUJB 2YMXL 1RP8A 3I02B 4R96B 4HDIB 2OLDA 4RX4D 1N2RB 4IISA 3PZMA 2Q86A 3TO4C 4U6VL 2IANA 4L4VE 4L9LA 1AQDB 1BM3H 4YDJB 2VDKL 4YC2B 1WIPA 3VFVA 1Q9LB 1FYTB 4R6UA 4NZTL 3MRMA 4JFQA 4NQCE 1YJDC 3KS0H 1QUNA 5B38A 5IMLB 4QLJA 5I6SA 2X44D 4ODSH 2F5BL 3RPKA 3QIWA 2ARJB 2E9MA 1VFBB 3H8NA 2FZ3B 4DEPC 3VVGA 5L9DL 3O2VH 1A7BA 2AKRA 3PBGA 5C0GB 3L7EB 4UQ2A 4Y4KC 5FA4B 2PWFA 1HQRA 5EWIL 5HYSA 5IVZB 3VX0A 2W0FA 3BD4A 3D9AL 5E8DL 3PL6B 1YQVH 4P57A 3TVMB 4R90H 5C0CB 4FQHA 4WLCA 4XP4H 4D0CA 2NY2C 3FO1B 4MXQD 5F3BB 2UZIL 1Z9MA 4YHLH 4N0FB 4FZ8L 3MLRH 5A6MA 1QO3B 2YPVH 2HKFL 4ACYA 5DHXB 4ONGH 5EB9A 5T3ZL 4XAWL 3W4RA 4DWSD 8FABA 5I1HH 4PJCA 4Z5RA 4C59B 5D7LA 3B43A 5F7EH 3V4VH 3F4VA 4NQUA 4FQ2L 4TN9A 2UY5A 3WIHH 4LYPA 3KXFE 4OJYA 3KJ6H 4NKMB 3E6FA 3X11A 1AR1D 5ETUA 5HYJE 1UJ3B 1G7JB 1NH6A 3MRLB 3QBTB 3ILPA 5IVOA 2G75B 1SY6L 4JAMB 1QFUH 4ZODA 3R0NA 5CHNA 2VJXA 4Q9BA 4D6JA 3QA3A 2DM3A 3S96A 3IJHA 1W3JA 2BOCB 4HU8A 1AHWB 4OZFB 5C0JA 5HGHA 3V6OA 4PJ8B 4N0UA 1AQ0A 3VW3L 3PHOA 1G01A 4OCMC 1TIUA 3KPNA 1AXTH 5L8KB 1KXQE 3Q6FA 2WP3O 4TRPL 3FQUA 4AH2A 3TBVA 4NFDA 4R97C 2DQUL 4TXEA 2WVVA 2R9HC 3OAZH 5D2LA 3IJ9A 4D6GA 4GS7B 2Y25A 2DOCA 2DQFB 5H2BB 5L7XL 2R4RH 1A4KA 3EYQC 1UKTA 1YN7A 4HK0B 4L1DA 3N85H 3T0WA 1TZGH 1X5GA 4WF7A 5HJ3A 2CGRH 3PTMA 3HNTL 2XOTA 2MPAH 5BS0D 2P5WE 3VFOA 4M00A 3HAEH 2NX5B 1NLBL 2XKSA 4HWEH 1D5IL 1EO5A 5FK9B 4PP2A 4PUDA 3CDYA 4JB9H 3AI0A 5EB8A 4WW1B 4ZXBA 3MLVL 1KPVB 4PRHD 3VFUA 3OZOA 3QUZD 1B3JA 1I1RA 4F8XA 2F54A 5IG7B 1NC4B 1FLRH 3MRJB 1K2DB 4ZUVA 3QCVL 3VD3A 1H5VA 1MHCB 2HJFA 1H3XA 1Z5LB 3W0WB 1D6VH 2GUYA 1WBZA 3LN5B 1V7MH 3THML 1W2PA 5LKNA 3VU2A 1LP9F 2WZEA 2NY6B 5HHOD 5LGJB 5DMIL 2YBUA 3WMCA 4LSDA 5DK2A 2DTML 3I75B 4UILH 1RVFL 5I0DA 2B5IB 3G5YB 3ZJ6A 1T0PB 5DQJB 4P2QB 3EO1B 4HC1H 1YZZA 1K5NB 1ZSDB 3D3VA 3GB7A 3BFOA 4E42B 3SKNB 5DHVA 5H37G 3DYPA 4JQXA 4XB3A 5D9SA 5F1IA 5EIIA 5FAAA 2X4SB 3SKJL 3L4UA 3MNZB 4F58L 5A2JH 4P5TD 3NSNA 2YD6A 4W5UA 3JVGA 1FZJA 4KPHL 3W39A 2QPSA 1KTDB 3OXRA 3Q6GL 1GGBL 2WMIB 4PTXA 4IDJL 1CZ1A 3V5HB 1F3DJ 1V7NL 3QUYA 3VXSA 1IC1A 2ZKHH 3WO4C 5TFSL 1FO0L 4PJDA 4UOJA 1ZB5A 3BOVA 5AZ2H 2VLME 3P4MA 4P4KD 4I77H 3QRFM 2E9BA 3MMEA 1J0YA 4ZO7A 2OWCA 1J1PL 1B88A 3QHZL 4NOFA 2LTQC 4GO8A 5JQ6L 3VFWB 5DHYA 2OZ4L 2YJQA 2DIJA 1J0HA 4DOHE 3UTQB 3DVFA 5CEZL 1QHZA 3WIFB 4HSQA 2E7MA 1YEGH 3U0TB 4DK6A 3H9SE 4JZ5A 4N0CD 1ZT1B 1S7RB 1U8QA 3PUCA 1A4JA 4OZFH 1F2XK 4Y4FC 3SCMD 2QQKH 4BH7A 5KS9A 1VESA 1G9MH 2P8PB 1AC6A 3MLZH 4BSVA 4LEXL 5CP3H 1BBJB 1YNKH 3L4TA 5F96H 2AP2A 3KPLB 1BVNP 3VDHA 4JANA 4TULL 1JZ2A 4QO1A 5J6GB 2B20A 5CIPB 1IEAB 4KKNA 3PXHA 5C86A 4BQBA 4UFHA 3EO0A 1FCGA 4PJBA 1OAXL 3ESUF 5I1IH 2VCAA 2BDNL 2L0DA 4H88L 2Q87A 1T0NA 4PRPD 5GJSL 3RGVD 5FHBH 3WL9A 4HUVB 4JFYA 5HHME 3S7GA 2YUXA 1HJUA 5EFDA 1S7UB 4AXNA 3UTPE 1JGEB 3RUGF 4KGJA 4KKCD 2DMCA 2OR8A 4YHPB 2NMSA 3CXHJ 4NP4H 3TTYA 1WCQA 1G7QB 2EPOA 4TPRL 3H9HA 1BZ9B 3HRZA 4K3HA 4HFWA 1NM9A 4D8PA 1J10A 3KLAA 2M26A 3MC0A 1OGAD 3CFEA 5L0QC 3TP4A 3GJFB 4V1DE 2AEPH 2D7MA 2VQUA 4D6HA 2ILLA 2HAZA 4FQQB 2ESVA 1I1AB 1Y18A 5CZVH 2IPUG 5SWSB 4XPGH 2IH3A 4Q9RL 1AQKL 2R1WB 5L88H 5ELIA 3RUGB 1L7TL 5IQ7L 2V3GA 2BJML 5I1GL 4JFWA 1MFAH 4LPVA 4QT5B 2PKDA 3CFDA 4LFHG 1XF4A 5GRUL 2DBJA 1NMBL 2YMXH 4KRUA 1VADA 2G5BB 2NPLX 4R8WL 5DO8A 5I76B 2ZOLB 4PRDB 4I18A 3MBXL 2BCKA 1P4LB 5CD5D 4MZ2A 4QRQB 1MAML 4HWNA 4NZTH 3TONA 4AEFA 1UQSA 4HPYL 4OF6A 1HL8A 1KPUB 3SY0B 2ADIB 2YBTA 2F5BH 4G9FD 3HZYA 2V38A 2ICWA 1V03A 2OLHA 4G3YL 3ARFC 3D2UD 5L9DH 1UXSA 4LVEA 3QDJB 4XPTL 1W0VA 1ONQA 3WDQA 4P2RE 3VH8A 2HKHH 2GYSA 2V9QA 4JFFD 5EWIH 3EUUA 5DD6A 2XWBB 3D9AH 5E8DH 3QXTA 3U46B 1RK1B 4PJIA 4L5FL 5D7IE 3CVIL 4XRCA 1XIWD 3G04A 1JYXA 1MNUL 1FVEA 4G7YL 3R0MA 3RTQD 4CNIB 1JGDA 1YDPB 1C93A 5IOPB 4FZ8H 1HKMA 1IKNC 4H04A 5GSVA 2HKFH 3O9WA 1T5WB 4NQTA 3KPSE 1FO0B 1JV5A 3MXWL 1E55A 2A3CA 4PFEA 1CDHA 5CSZB 4P8VA 3C09B 2EE9A 3DIFA 3PHSA 3BRDA 3LKOA 3CZ8A 1R6VA 1F6LL 2Q8XA 5D1QA 3IB4A 5DFAA 1HN1A 3FTGB 5ABFB 3LH2L 1HYSD 5CIPH 5I8EA 1JPTH 4F7MA 1H3UA 1JJUA 5I78A 4Y19B 4GXUN 1BYAA 2BP3A 2EDRA 1NCDH 1ZGLM 2R0WL 2XFRA 1M7DA 3AXLB 2J8UE 3HA0A 4NNXB 4GAYA 2EXYD 5IW3A 1UZ6F 3MR9B 5ISZB 5IJKC 2Z31C 1S7WB 3VW3H 4MLSA 2CLRB 5DS8B 4EK7A 3RWJA 2R2BA 4M7LT 3G5ZA 4ZNEE 2CHOA 4PRID 4KKAD 4TRPH 4CJ1A 1P9MA 4HPHA 5DK0A 5DR5L 1T3FA 2DQUH 1GCYA 4OZIA 2BY1A 5F7MC 5L7XH 1U3HC 4WI6A 3VD4A 5E8NA 1JGLL 1I9JL 4WFFD 3HNTH 3GJFH 4XTRC 5BJTB 1MHEA 5DJDB 4NF7A 2OP4L 1NLBH 3WKNA 5KSBA 1D5IH 2ZSVA 5IMMA 1W3KA 2YZ8A 2O61A 1GOIA 3CZGA 2RCSL 1ZVSA 5JR1L 1FNLA 3VXQB 4WHTA 4DZ8B 5F93C 1UWSA 3OJ2C 3GIVA 3MLVH 3T04D 4MAYA 2H32A 4FRWA 4S1RH 5D5MB 3CFKA 3QEQA 3LDBC 4F7EA 1RUMH 3QCVH 3TA3D 1TTGA 1GZQB 4W4NA 4NC1C 1RZ8B 1RIUL 4AMCA 4PP1D 1AGFB 1NGXB 1ISZA 1XV8A 4PV8B 1HIZA 5F7KC 3THMH 3FNDA 3TWCH 2A3BA 1OT2A 1NGQH 5DMIH 4LLYB 2DTMH 5FYJL 3TH3T 4POZC 3FY1A 3LRGA 5JDSA 2R39A 2XN9D 3WXWL 4MNQB 1UXWA 1F11B 2DF3A 1KULA 4JM2A 4P9ML 3OKMA 3D25B 2H6PB 1V6VA 5C0EA 4POUB 1I7UA 2OQJA 1P4IH 3WH5A 2C1OA 3SKJH 1TQCB 1AE6L 5IJVA 2R2EA 4F58H 1P84K 4NC1E 1CICC 5EBMA 3WNLA 4EN3B 5JXEC 1E73M 1HJWA 2A3AA 2X4UB 3H3PL 5DFTA 4YDLB 3V52L 3P4NB 4M6OL 4KPHH 4KRPD 2J6EA 2EDEA 4FP8L 3ZT5A 5DRZB 3Q6GH 4D9QE 3PZUA 1GGBH 3QI9A 4IDJH 3CUFA 3AS3A 2ZCKL 3GMNA 4H5SB 4QRSA 4LLUA 2D31A 2FSEA 1HH9A 2WIMA 1FO0H 3BPCA 1MW1A 4BA0A 1CTNA 1YEDA 3MSDA 3P4LA 4NZUL 4Y8DC 1J1PH 3QHZH 1HH6B 1NQBA 1Q9OB 1KG0B 5DEGB 5EDXA 3F5LA 5JQ6H 2AJZA 3S4SG 3S6TA 1NAML 1MCLA 3GSRA 4TTDD 4HQQL 2OZ4H 4PJ9B 3BKJH 1FFPB 3IXAB 1PYWB 3PP4L 4HKXB 5LAXA 4GW4A 2HTLC 3TN0A 1LK2B 5CEZH 2BC4A 1H3VA 3U4EA 4X0KB 4JN2B 1IAKA 4OAWA 4Z7VA 4WJ5A 4X4ME 1IVLA 2IAND 3VXME 3ZKXB 5JHDB 3Q5YA 1W1YA 3O81A 5T1KA 2VISB 2F74A 4AC1X 4PJEA 3QULB 1ACZA 1S5HB 3A6CL 3LEVL 2ZUTA 1OQXA 5CWSB 3QIWD 5I74B 5T1MB 5IW6B 4ZFMA 4GG8A 4HXBL 5T1LA 3VA2C 1U41A 1OAZL 3N9KA 2WAGA 5F1SA 5B3JF 4NWUL 1NOWA 1LO5B 1FAKT 4TULH 2DSKA 1EV2E 1MRCL 1NOFA 1T1WB 2GCYA 4BUHA 4BFIB 1WT5A 4RFEB 1SR0A 5CD3B 5F88A 1MH5A 1EEYB 4HIXL 5D6DC 2PYFB 3KLDA 3MMDA 5ACLA 1JXKA 2FGZA 4GMTL 4YPGB 4V28A 1OLZA 1UA6H 2RGMA 1FRGL 3QDHA 5EOQL 5J6HB 3T3PF 2VITB 2VLJE 5GJSH 5B4MC 2A2QT 4QRPA 2WCSA 5INDA 4JKPL 4WEBH 1IC4H 1FZOB 2CIKA 2VX6A 1F6FB 1FJ1B 1UKSA 3KPRA 2CBIA 5SWZE 3LKNB 1WTGT 4OIIL 2V5TA 5F89B 4NZRL 2ADGB 5D7LD 4MJ2A 3HPJA 1U6AL 4GKSA 5D7JA 2CJUH 4LCCA 4TPRH 1WCGA 3LIZL 3SCQA 4L4TE 4TVCA 1ETZB 4WHYG 3VIFA 3OKYA 3HS0A 4F2MB 1JPGB 3VWJA 4B7IA 1JNLH 1KT2B 2QKIB 4I0KA 3QWRA 3BCDA 2W5FA 3CDCA 1U8OA 1LEGB 4P2OC 2BNQA 3UG4A 2ENSA 4ZUTB 2WV3A 1U3JA 2HLAA 3RVVC 4YIQB 4NWTL 3FO2B 5GZOC 1GJUA 4Q9RH 4OD2B 5CLTA 5CILL 2NY4C 3TBWB 5I1KL 1L7TH 4ELMA 4NPYB 5IQ7H 2XWDA 2BJMH 2BFVL 5I1GH 4TNWF 1ODZA 3VA6A 2DAVA 4P0DA 4LVHB 2UZXB 4Z77B 3RPIA 5JUVA 2GKIA 4GW1B 5GRUH 4Z7NF 1LO0L 3BYYA 2WMHA 1NMBH 4JREB 1JZ3A 3V95A 4AIOA 4R8WH 4ZUWA 4ZOEA 4N8PA 3TH4T 4CVZB 3ARYA 3SDXE 4KXZH 1BJ8A 5IGXL 5MEQA 1MAMH 5ADPL 2WKGA 3SHSA 1I1FB 1GC1C 5JO5A 4BF7A 3MV7B 4HPYH 4WFEE 5EZLA 4HIIA 1GXEA 3HB3D 4LPWA 4ZSOA 3GM0A 4UV7L 3V5KA 2FL5B 1XGQA 2FJHA 3TIEB 4G3YH 3R4DA 4ZXBD 1UD2A 3L6FA 1FHGA 1HNYA 2E7LA 1KPRB 2F54D 4LNVA 4XPTH 2Y24A 3CLWA 5FKYA 4XCEA 3B9KB 3REWB 5BO1H 2OXGA 3AHVA 5LA2A 2CITA 5FGCB 1EGJA 2FGWL 5KSAC 5IR1B 5IMKA 4L5FH 5E09A 1OTSC 2EXWC 1US2A 2DPEA 3CVIH 3SDAB 4FMFA 4EVNB 5CGYD 1UH3A 2A73B 4YDIL 3RY5A 4G7YH 3MLUL 4YHZL 4XI5D 4OCSL 3DX7A 5JBEA 3S97C 5C0AA 3UESA 4TSAL 3K4DA 3AS2A 1AGEA 3HE6C 1D9KB 5CMAB 3N06B 1M4KA 2FECL 4FQXA 5LXGL 1ISXA 3BYTA 3D3VD 3WFDL 3O6FA 5HGDA 1OP5K 4WWKD 3CDFA 5CGTA 3S8WA 2JEPA 3OGCA 4WU5A 2NTFA 5E6IB 3LH2H 1NAMB 4KQ4L 2F58H 4NN6B 2FD6L 2Y5TA 3G6JE 3PDGA 3OB0K 3NDZA 3IFOB 5HY9A 3HCVB 3C5JB 2H1PL 2FJGB 3SKOB 3KL5A 2VXVL 4KI5D 2R0WH 4UQDA 3NA9L 3SJVD 3UJJL 4G80A 3MO4A 3MROA 3HHRB 4MSWA 4X6FB 3Q3GB 1W3LA 1QPKA 1NSNL 5BXSA 3VXSD 5L2KB 3OG6B 5A8OA 5DDHB 1EBPA 4KJWC 5HYQB 5KOMC 4ZD3L 4TOYL 5ESAA 1UH2A 1X5FA 3TNNA 1F13A 3VFRA 5DR5H 4DUXA 4XPHL 1CLYL 1C5CH 5E2UH 1LF1A 4OF5A 2HVMA 2IQ9L 5FEBA 1X1NA 4LEOB 2NY5L 1UCTA 3T0AA 1JGLH 1KIPA 1I9JH 1M6OB 3LRSB 3BDYL 4LMQI 1VHPA 5AYQA 1M7XA 4QKXB 2EDBA 2NY1B 2CLVA 5FDWB 3UTTA 2RCSH 3V2AR 5JR1H 5FHAL 1US3A 4KAQL 2CMRL 3WUWG 1G0XA 1W0WA 5I1LA 3IRZA 3PNWA 3FFCE 1T4KA 2IBGA 4X83A 1BTCA 4RNRB 3DARA 3P9MB 1RIUH 5D2NC 2DB8A 3JV6B 3PXJA 5C6WH 4HS6A 4KHTL 1MWAL 4XNQB 3P73A 2CKBA 3DUUB 5BXRA 3MNWA 3PDOB 4JDZA 2EYTB 4OFYA 5F7DB 3FB7B 3MLXL 4LL9A 4DUWA 3W27A 3NIDF 4N8VA 1L0YA 1ERNA 3OKEA 1ZWIA 1QSFA 2UZYB 3CX5K 1T7XA 4FMKA 4P9MH 3TO2A 3TNMB 4EDWL 1UR9A 1MWOA 5I6XC 1FVCA 3SURA 1IQWL 5EUKA 1YEIL 3JWNC 5BRQA 1AE6H 1OOAA 4OM0L 5DSCA 3H3PH 3V52H 4M6OH 4NKOA 1TNNA 5LG1A 2MHAB 3O3UN 4FP8H 5GISL 4QLRA 2GUOB 1FV1B 5TDPA 3CUPA 2ZWZA 1UWGL 3D0VB 3C8KB 3PWLA 4Y5YA 5CG0A 2BRQA 2ESVD 4C54A 2ZCKH 4C7GA 4S1SL 4X9FA 4LVOB 4ERSL 2AJ3B 1KUMA 1XCWA 4NZUH 1WF5A 3CVHL 4QWWD 1P1ZA 2XG4A 1NUFA 3ME0A 4K8RH 1NAMH 4U1IA 2AJVL 2X4OB 1IGTB 4HQQH 3D39E 1ZJAA 3PP4H 3UR7A 1QLFA 1P6WA 3Q5OA 3VMPA 2HLFD 4OZHE 3NYDA 5IHRA 1BOYA 3AB0B 2H3NA 4PB0H 1XH0A 4DM2A 5F6IC 1E6OL 5D6CB 1K9DA 1SEBA 2C3GA 5HHPB 1NFDF 1MUJA 4B15A 4GRWE 2JJTA 4RGND 3L3OB 1CXLA 1GQJA 3A6CH 2F61A 4XVTL 3WNMA 2C3XA 3LEVH 3W0KA 4XB7A 4P3CL 3WH8A 1A7RL 2FEDD 1P2CB 2PNDA 5C0IB 1OAZH 4NWUH 4F9LA 4DQOL 3O3AA 3BAIA 5F1NA 4HGWB 2DH3A 3I6LE 1BSIA 2Y5EA 3BN9D 5KAQF 4GMSL 3S3PA 4HIXH 2OYKA 3ZO9A 3CZLA 5KS9F 4W7UA 4GMTH 4P4RB 2VXQL 3PIQA 1QI5A 2DIEA 3AHZA 5GGSA 3WL0A 1FRGH 3IGAA 3GSNL 5EOQH 5KN5A 1CXKA 3RY4A 3WHXA 5SX5K 3M8OL 3WEOA 1CLOL 2WC7A 2YEZA 3GMPB 3MBEA 2ITDB 4JKPH 3KPMB 5B8CB 4KTEL 3VG0L 4OIIH 2GAZA 4MNGA 3SO3C 2VVNA 3N13A 4RMVA 1NDGA 1DQQA 4HWBL 4NZRH 1EDTA 5C0FA 4JZOB 1I7RB 4LNRA 4MJ6A 5HGBA 5HPOA 3KPPA 1U6AH 3HMWH 4QXTA 5D1QD 5D4QA 3T4AB 5IM7A 3VIGA 4KMQA 1MCSA 3BKYL 2YKLL 3TZVB 2UWEF 5EU4A 5BZDA 3RP1A 1KYOJ 3BHBB 1UR1A 3ZR5A 1AQHA 5E99L 4PRBB 3PWUB 1NMCB 4UQCA 5I9QC 2CD0A 5IROC 4E2OA 4EI5B 1H5BC 1KCVL 4NWTH 2VLRE 1T7VA 1I9RH 1MQQA 5CILH 5HDBF 3RI5F 5I1KH 2W63A 4LSVH 3IJ7A 2BFVH 5A2CA 4YDKH 1UB5B 4NQDB 3OJMB 1Y0LB 3VDAA 4G6FD 5TPWL 1EEZB 4MDPA 4HF5L 2UWEB 1C8XA 4JZJC 1LO0H 4Q6YA 2EDXA 1NGPL 1BVKA 5JUEH 1DWHM 4MWFB 4HWZA 4PMZA 2JCCF 3TO4A 3WL1A 1MWAB 4OLZL 5FOJA 1ZS8A 4JR9L 4PMXA 2B1HL 3EJYD 5IGXH 4IS6A 1SMAA 4DTGL 1CU4L 5ADPH 2YDQA 4UMGA 1H0GA 4PCTA 4ZS7L 3E6HB 3KYOA 2YD5A 3FAWA 5DMGC 4UV7H 2BSED 4ZPVB 4AZCB 3CPUA 4MAYD 4M8QB 5E9DE 1BZ7A 3U6RB 5J1TC 4Z2GA 3V9FA 4Q6IC 32C2A 3GKZA 3PGFH 4D0BA 4Y4KA 2EICA 4X8JA 3CAFA 4XVJL 3W2DL 2JCCB 3FRUB 3ARZA 3O3BA 3H0TA 3VDCA 2HJLA 5HYIA 2FGWH 3QIBB 2ZXQA 3GBML 4NZCA 4MA7L 1RJZA 5JPMA 2AABH 1R24A 3MLUH 2DQHL 4JO2L 4YHZH 3HC3L 4OCSH 3O6ML 1KXQA 1IGML 4TSAH 1W91A 4Z6AT 4A6YA 1SMOA 5LXGH 1YHTA 4JM2D 3WFDH 2XG5A 3CVHB 2OJEA 3C6LC 4B5EA 2WHKA 5C70A 2HVKB 3DUSA 3WF0A 4KQ4H 1UG9A 3O4OC 3U9PL 4PREA 4D9LL 1MI5E 2FD6H 5GS0L 2L4OA 4QRRE 4FG6D 2VKWA 5BOZG 4IHOA 5E8PB 3ILQD 2X8RA 2H1PH 1J0JA 1F8TL 5EPMB 2VXVH 3NCFB 1KJMA 1J1OL 4ORZC 2J75A 3NA9H 2D0HA 3UJJH 3UYRL 3WQ5A 2VAJA 3GBDA 3L3DA 3RX7A 3QI9D 1G7HB 1W32A 3JBG7 1A2YA 3HMXH 1EGZA 2B2XL 1CDUA 5DJAA 4UT6L 5I66B 4EDXA 4TNVF 4ZD3H 1W3HA 4TOYH 3FHAA 2A6JA 1AP2A 2DTSA 2XPKA 5IF0A 5LGHH 5ANMB 3OX8A 1CLYH 2D7NA 4TSCL 5LA1A 1WNOA 2IQ9H 1JK8B 5EORL 3WSUA 3PV6A 2NY5H 3KDMA 2DEPA 3KYMA 5D9PA 1AVAA 4R0LB 1MREL 3TN0D 3EMCA 3BDYH 3UTZA 3VXTA 4FLSA 2EE6A 2VQ1A 4Y1AB 3AUVA 3DO3A 1E5JA 2AMGA 2H2SD 5FV2A 5T1KD 3GSNB 3ELAT 4H1LG 1S78D 5M94B 3UO1L 4LOUC 5E4IA 1D5XA 3NPSC 5ID0B 2DLEA 2IEPA 5IHSA 1KLUB 4OIBA 5FHAH 1IAOA 5K9KA 4KAQH 2CMRH 3JWDL 3ZJKA 4K07A 3T0EC 1E0XA 5F3HB 4KDTC 3BXWA 3NCCB 5T1LD 3QDME 1N7ML 5JIPA 5ESQA 2X0HA 1QI0A 1G7PB 4V2CB 5ABGA 4LLQA 1N3NA 3BLKA 4H26A 1FFNA 4KHTH 1MWAH 3QFJA 1U30A 3GNRA 3OAUL 1VCAA 1B0GB 2CRZA 3NBNA 3SQOL 5EBWA 4PGEA 3BQUB 1H1NA 5DD5L 3GSVB 4RZCA 1X44A 5I19H 1P7HL 2OTWB 2XA8L 3MLXH 1E27A 1IQDA 4YHIA 4QRPD 3LV3B 3GUTB 3RWHA 4IRSB 5FV1L 5I1DA 4OI9A 3MV9B 1DHKA 3KPRD 2DGAA 2RFXB 5L6YL 3MRDA 1UJTA 5FO7B 3T0XA 1U8IB 4EDWH 3FRPA 4JG1L 3T0EE 1Q6GA 1IQWH 5D7JD 1YEIH 3RL2B 3T09A 5EH1A 2V5MA 4OM0H 5T3XE 5IWLC 5DJZB 4BSJA 2E8ZA 4XNZB 3VWJD 1YEEL 4XNMA 1C91A 4X7SL 3MRGB 3VRLE 1QR4A 4NUGL 3VCLA 3QWRD 5GISH 1NBYA 1S7TB 3O6AA 1GPFA 1XF3B 2KZ1B 1UWGH 1UM5L 2BNQD 5DC0A 1WDPA 4EJ1C 4LBEA 4P7OA 5T33L 2G2RA 4S1SH 5IEKB 2IF7A 4ERSH 1G9NH 2ICES 5F9JA 1E4MM 3CVHH 3GMOB 1EH9A 2J8OA 4HGMA 3UETA 5LBSL 3TEUA 5GRXG 5D4YA 3RIAK 2XTJC 3IDIA 3C5ZB 2YDSA 1LO4L 1BFOA 4I2XB 4H8WL 2XFXA 1KGXA 3NGBC 3T08A 3PWVA 1NGZA 4QHNA 4E41E 1F4WH 1AGDA 2JB6A 2P46B 1WCBB 4DKDC 4RWYL 5DEFA 2XACC 5IV2B 2PWGA 3BXNA 4ONFL 2O5XL 1ND0B 4IOIA 4Y4FA 1U2CA 4PJAE 1NUNB 1LQ0A 5ERWB 1E1EA 1SYVB 1JZ8A 1WC7A 4XVTH 2ICWJ 1QKZL 4KDVA 4PD4K 1VB9A 4P3CH 3UDWC 1S7XA 5FUCC 5IDIA 5BXTA 3MYZA 3TT3L 3MJ8A 4PMYA 1I3VA 2R2HB 1H2JA 4DQOH 1BJ1J 3L3GA 1YY8A 4Q7NA 4U3AA 1LEKB 3PWJB 3KG5A 4QHKI 2X4QA 4V1DA 4ZQKB 3QXDA 3SCOA 2PO6C 4GMSH 1FFRA 1HCFX 4PJEF 4OCNC 4W84A 2GITB 1SJVA 2CIPA 3UR8A 2VXQH 4LF3A 2IBZX 3HLAA 3MGOA 3GSNH 4NO3B 1JDCA 3M8OH 1CLOH 5C0AD 5I8OL 4UZSA 1GYAA 1CT8B 3PV7A 1NDMA 2QQNL 4KTEH 3VG0H 4QOKE 4FQXD 5TDNA 5EN2A 2A38A 3W28A 3RWCA 3O6FD 4HWBH 5FUCE 2J7DA 3TTSA 4BK5A 4YC2C 1I8IA 4PRAA 4QHLA 3LN4B 5F9DC 4W7WA 4MDJB 3BKYH 2YKLH 3KNBA 2I07B 2VXUL 2EDQA 5KJRL 3MLTB 3ARUA 3ZKMD 1G0CA 1V3MA 1VSCA 3KPQB 4LGSB 3NIFF 3BH8A 5JIHA 5IBUB 2YDRA 1XZ0A 1TTFA 3CHFA 2E6QA 5TDOB 1JRHL 1M71A 1CE6B 5ENWA 3QEHA 4K7PX 2CETA 4U6HA 1KJ2L 3UPRB 4JFHD 5DRXB 1L8NA 1E70M 5A2AA 3PL6C 4PUEA 1NARA 1E4WL 1MHHA 1E4NA 4P2RA 1FP9A 3VXRE 4YH6A 5HDRA 1LJYA 5EFIA 1JHLL 5DMJB 5TPWH 4HF5H 2E6PA 4UNIA 1V6WA 4K2UL 1WBXB 1NGPH 4C83A 5HVWA 2LU3A 3MCLL 4N9GB 4AENB 4MAUH 5CBEB 3KLHD 4OLZH 5C0BB 4HZ6A 5DJ8A 3PZNA 1W72A 5J3HD 1NBZA 4JR9H 4LCWB 2B1HH 1XGYH 4ODUB 4ELMF 4DTGH 1CU4H 1ITCA 1E0OB 3BVNA 3DX6A 1ADQA 2OI9B 1MCCA 1IT9H 4KKBC 4OZGE 3TM6A 3UTTD 1CENA 2GT9A 4JFDE 3ARFA 1IGFL 1UJ3C 4BA8A 3EYSH 3HNSL 1BD2E 4XVJH 3W2DH 4PJGE 4GG6F 3WLWD 3FCTB 1WWCA 1R3HB 4PJ8C 2FX7L 4XWGL 1ED3A 3BWAA 5FM5M 2VVSA 3GBMH 1G9MC 4MA7H 1OWWA 4R2GD 2JIXA 4K9EL 1ZGLA 4JO2H 3HC3H 4OFYD 1IKNA 2WINB 3O6MH 1NEZG 3UBXB 1IGMH 3SOBL 4Q9CA 4Z0XA 3CZFA 4ZNEA 2BNUB 1HHHB 2DM4A 5IB3A 5JTWA 1RY7B 1MLCA 2AGJL 1QSFD 4Q0XH 4GSDL 5J13B 3WQ4A 3MUIA 1VKXA 4IUGA 3QNXB 4I3RL 4N90E 2YXFA 2XM1A 2ZX6A 1TXKA 4QYOA 1GNXA 3MUY1 3MGAA 5A69A 1GGUA 4MNLA 4HP5A 3O9NA 5GS0H 3BAYA 3AIBA 4G8IA 3ZJ7A 2C3WA 1GHRA 1W2VA 2WSPA 1F8TH 5CSYA 1J1OH 2GFBB 3WBAA 2FH6A 3UYRH 1KQYA 2YC1A 2GJZA 3N1QC 3MACL 4PY7B 2Z31A 3P11L 3O2DH 2C3VB 1A6ZA 4UB0L 3RKPA 2B2XH 4UT6H 2NZ9C 3FB5B 4BCEA 3B2UD 1OGTA 3RFZC 2NY0C 3M46A 2R8SL 1YN6A 3VM5A 1K8IA 2FECI 3RM4A 2B5IC 4GQ9L 2R0ZL 5EORH 3I6KB 2G41A 3RNKB 4KUCF 1NP2A 2RR3A 3MRNA 1MREH 5ECUA 4HT1L 3ARTA 1WBYA 4MA3B 4Z0BL 2NW3B 2ENYA 1B0WA 5HNNA 4P5MB 1RSFA 1ZT4B 4RMRA 4YZFE 4QF1A 3UO1H 3RKDD 5FA3A 2W9DL 3F5WA 4CVXA 1M05B 2VDLL 1F3RB 3SIMA 2J4GA 3NCYP 1TVBB 4PJHF 5TF0A 3OLDA 5EC1A 1N7MH 4JKKA 5CBAB 2X42A 5FECA 5KVGL 3CLFL 1ISYA 4L8BB 5I8CA 2FJFA 3VXOB 4PRHB 2APXA 1ZGLP 4P7LA 3QUZB 1C8QA 3DSNA 2Y8VA 4Z7WE 1WIUA 2QSQA 5DUBB 3OAUH 1R86A 3L4ZA 4PBGA 3QEGL 4XCNB 5EO1A 5DD5H 5E00B 4JE4B 3X14A 5JA9A 3VRJA 5F9OL 2EO1A 5D8ZA 2XA8H 5E03A 2V2XA 1A0QL 3LHPL 1KJ2B 5HHOB 5KZCB 4PJHB 3H7BB 4OI8A 1GOMA 1TA3A 3SCPA 1IAIM 5L6YH 4UFLA 1LP9E 4R27A 1X4XA 4E9LA 1XH3A 1QZ1A 4JG1H 3I6GA 15C8L 5JXEA 1CICA 3D69B 4ELKB 4G8FB 5CAYB 2WCAA 3D3AA 5E08L 4L3CB 5E56A 3DJ9A 3OKLB 4W6WB 5I2IB 5MEPB 1YEEH 3SN6N 1QPPA 4PLJC 4WIQA 1I1YB 4X7SH 4I48A 4NUGH 4X6DA 3BP6B 3QNZA 2R1XA 3RMEA 1UD8A 1P5UA 1UM5H 1Z3GL 4YHEA 2HTKD 4N5ED 1KGWA 1R5VA 3NZHH 4P5TB 4MX7A 5T33H 4AIUA 4MQTB 3QAZB 1U92A 3DMMC 1GVIA 1MCBA 1Z6JT 5JW5A 4C56B 3RA7L 1XYZA 5BVJB 3FO9A 3KPOA 5LBSH 4URTB 1NGWB 5I24A 3IXTA 4HIEB 1LO4H 1OVZA 2DYPA 3QZWB 3BEWA 4H8WH 3TO4D 4U6XB 5CZKA 5KBNC 1T2QL 1OINA 3WUEA 2P5EE 4RWYH 3AIQA 4X0VA 4RGMB 5T3ZE 4ONFH 4JFXA 4YGAB 2O5XH 3GJEB 4Z7UB 2HJKA 1QYGL 4GQQA 2V7HB 3CD4A 5IP4A 1QKZH 3C5SA 3T77A 4GKZB 2PN5A 1CGUA 3FZUC 4S1DC 1G7MB 1FNSL 3IJSA 3JTSA 5ICYB 4KK5D 2ED8A 3TT3H 1GOKA 1URLA 2ZXAA 4Y4KD 3ARBB 1YPZF 4J3WA 2XQYK 1I1AC 1HVXA 3MJ6A 3WS6C 5D6DA 2DT2A 3EDKA 4Z2HA 2NY2D 4XX6A 3CSGA 1W1TA 3X3FL 1MRDL 1RJLA 3JUZA 4FHBD 2ADJA 5BS0E 1C8PA 3DV4B 3GSXB 3K2MC 4DVBB 1CFQA 5I8OH 4AIEA 2MNUA 4Y5VB 2QQNH 1PEZA 4OFIA 5GGUB 5KZ6A 1L6XA 3D85A 2ADFL 1XR9A 2QQLH 4E5XA 1TMQA 4HU0A 3WMBA 3NMEA 3RGVB 3MCKA 4FMVA 1XCQA 1LK3H 1E0VA 3SQBA 1WAAE 3WNKA 3U7BA 5C9JA 2UYLA 3SDXA 4P23B 5HI4C 5I79A 4M8VA 4P2OA 1N59A 4AM0B 2FBOJ 1HILA 1F58L 4RGOH 1F3JB 3L4VA 1U91B 3MV8A 3CCHA 4G6ML 1JRHH 3DURB 3K1DA 2ZUSA 1V3KA 1NBVL 1DBKH 1A8JH 2EYRA 5E7BA 4WY7L 3L4YA 3AZRA 1KJ2H 3E3QE 4OLWH 1UACL 2EDKA 5E95B 5DMYA 5C2BL 4AT6A 2QLYA 4N9OB 1E4WH 4Z7OF 2ZXDA 3T2OA 3HUJE 3G08A 2WMFA 4P7NA 1JHLH 3OKOA 1DQML 3BC9A 2R9HD 2OCFD 3WFLA 1EPFA 2V6HA 4K2UH 5CCKL 1S5IL 2X4NB 3MCLH 3V8CA 1NC2D 2QTEA 1E6SM 1OWRM 3T65A 1INEH 4NZDA 3KJ4B 2V3FA 2KBGA 3EOYG 4H25B 3K1KC 4DW2H 1L7IL 4E8DA 2WQRA 1F6AB 1CK0H 1CXFA 2YPLA 3BI9X 2OS7A 1FL5A 1WWBX 3U0PB 1R3KA 3F7VB 5ICZB 1WB0A 1IGFH 4ODHL 3CH1A 4PGBB 1B3YA 2AK4B 1N8ZA 4GW5B 3G6JA 3HNSH 1U2YA 2PYEA 3LZFL 5J0BA 4JVWA 4G9FB 1BX2B 3RJDA 4OIAA 5KSAA 2PF6A 2JTDA 3QWQB 1MW3A 4M1GL 4D9RD 4HV8A 3RU8L 3CHDA 2FX7H 3LS5L 4XWGH 3NA4A 4PUBL 3RVWC 4JGMA 3QFJD 4Z18A 4NRXB 3ROOA 1A3RL 3H2WA 5GIRA 2P48B 3O6KH 3SOBH 4RWHA 3MRCB 3HE6A 2HFGL 1ZBCA 3BZDA 4M3JA 4XCCL 4BQ5A 4ONHB 4KROC 2VLKB 4OZ4B 4GSDH 4GUPA 3DHUA 1JHTA 1XHGA 4I3RH 3QXAB 1GOOA 1AQMA 3MPCA 3S4SA 1NCBL 3G5XB 1DJSA 4F7CB 1PFCA 1ZT7A 3STBA 5AG8A 2F8QA 4LLAA 1QFOA 5EO0B 3HZMA 5FUOH 4QFUA 4AZHA 3ZTJG 2VH5L 5HD8C 1SJHB 2YSSA 5MERA 5BRZB 3MMWA 1U58A 5FYLE 4FLOA 1CIDA 4CGTA 3MACH 3QXVA 1XYFA 3NCOA 3BGMB 3OXSA 4WI5A 2KQMA 4NYLA 2OR9L 4LDOB 3MZTA 4G9DA 3VGEA 2VZSA 3PZ9A 3F12A 4PRPE 1LE9A 1IFHL 4QRUB 3W6MA 3PZVA 4ZUUA 1ZE3C 2H8PA 3U0WH 1M1SA 2R8SH 5ADOL 2WZHA 3O4LA 1CG9A 1UZ6E 2Z91A 2R0ZH 4GQ9H 4RBPH 4QLKA 3X12B 4WO4C 2D7TL 4Z0BH 3V4PL 4XT1C 1INQA 4OKDA 1ZLUK 3T1WA 1OGAE 1C12A 3UCRA 4X6EB 5IFTA 3WDRA 3BD3A 4M1RA 4Y4FD 3UYOD 3L5WA 2W9DH 1T80A 3EDDA 2ZUMA 4A3YA 2VDLH 1TQCC 4MD0B 2ATKA 3FKUS 2CKSA 5DUPL 4ODWA 4YDLC 1EAPA 3OGVA 2I25N 5C09E 4ZFFB 3BZ4B 3CLFH 2LFGA 1H3GA 5D2NA 3S35X 2W9EL 1MAJA 4G6AD 1A1OA 1F4HA 1F97A 5GGVL 4V1DD 5DI8A 1QRNA 5FM4A 4AD4A 3GBNL 1ZHLB 3WKML 3QEGH 1YUHB 5IHUL 2IG2H 2DQEL 3BD5A 4QEGA 1RZIB 4EI6A 3IAQA 1BIIB 1JFQH 4KMTL 3AM8C 2ZG3A 4UDUA 4HTYA 1MEXL 5I77A 2WAHA 4PJXA 5F9OH 5B38G 4OCWL 5GRWA 1A0QH 3LHPH 4G42A 2K7PA 4JM4L 1RPKA 3F7QA 4G43B 5KSVA 1DL7L 3UTSA 1DDHB 7TAAA 4X6CB 2HT3C 5EOCJ 2XZQL 2R23B 3ZKXC 2WWDA 3MV11 1HHJB 2FEEL 15C8H 4ZXLA 3QWOA 4LLVB 4OZHA 3WH6A 5KTEH 3PABA 2NLJA 4UQ9A 2Y7QA 4YHKL 5E08H 2Y07L 4JFFE 3QR3A 4GOSA 3BW9B 1H15B 1A6PA 3ARDC 1IEHA 1Z3GH 5AAWA 3CUJA 4QCFA 4IIQC 4KTYA 5AAMA 1U8PB 1S9VA 5EG6C 3LPOA 2Q6WB 4HKZA 1I8KB 1YMME 5TGBB 5JOFA 3RA7H 4P2RD 1ZK9A 1UWEL 1S3KL 3AAZA 2V2TA 3F6IA 4JO4L 4BSWA 4WUUA 1VEOA 5INCB 3WYRA 1UWQA 1V08A 3IF1B 3ZIZA 2ZCLL 2BNRA 2HT4C 4AD5A 1DE4B 1EZVY 2XHYA 3DNKA 2ZIDA 3LN9A 2FBJL 1T2QH 4LSSH 5FIEA 4X4XB 4JFOB 1FH7A 4KY1L 3MRRB 3REVB 2VX5A 4AY1A 2PXYC 2EXOA 4LCUA 1KF9B 4ZOCA 5C07A 1RD6A 1QYGH 2Z92A 4H0GA 2BV9A 1BHGA 3MOQA 4HMEA 3VILA 1CWVA 3U57A 3IAPA 2AK1L 4KJYA 4OT1L 2SEBA 4N8CL 2OR7A 3ARFD 3GMMA 1FNSH 1DQLL 4YQXL 5IEHB 5BQ7A 4JFQB 1UD4A 3HC0B 3QIWB 1I3RB 4NHCL 2DQIL 3BEVB 3D1MC 4YBQC 4LPXA 1DWGM 4K94H 2X4PB 5GGRA 1KB9J 1M01A 3RBSA 1R8LA 4BQCA 5A16B 3X3FH 1MRDH 2JIXD 1HQRB 4QTHB 4WFFE 4QNPF 5HYSB 4LVHC 1C7TA 1D5BB 2Z93A 5C8JA 1MCQA 4P57B 3TPUA 3HC4L 2M1KA 4E0RA 5HDOA 2AV1B 4PJFB 4R26L 3MV01 3AS1A 5HVHB 3STLA 1EQPA 1HCVA 1EQCA 1W9DM 4JRXE 2P8LB 4UTAL 1DBAL 4RQQA 1K6QL 3T3PE 4JY5L 3JWOL 1BLNB 8FABB 2DSZA 3MJ9L 1GONA 1XEDA 3RZCB 1F58H 5IROA 4FFYH 1E15A 1JWSB 4G6MH 4MAVA 4W8AA 4M93B 4GZJA 4BS0A 1JFHA 2R0KL 3CUHA 2Z31D 5CLWA 5BMFL 4WY7H 2BVYA 3GI8H 3ILPB 3VI3F 1KNOA 43C9A 4AMKH 3GJFK 5DJYB 3WUWA 1W9BM 2XN9E 4C7DA 3SDAC 3QA3B 3A67L 3DXAB 4HKBB 1MVUB 4IJ3B 3GZKA 4JZJA 1CD1B 1DQMH 2PW1A 1GQLA 3WN5B 5CCKH 3BIKA 1S5IH 3KPNB 1U3HD 3LOWA 1MCIA 4W70A 3L4XA 1GRWA 5FYJE 1OY3B 5IB5A 2FDMA 4S2SB 1OF2B 1D9KC 1QSEE 2EH8L 2CEQA 4XTRD 4AZIA 4PGCA 2BVPB 5E0CA 5D2LB 5TH2A 3BZEA 1X5LA 3UJIL 1L7IH 2IBZY 5T1DL 7A3HA 2ATPB 5E6IC 1XR8A 3AU1A 3L3HA 4NN6C 4AYSA 5E5MA 4ATWA 3ULUL 3DVNA 4XH2B 2LV4A 1VFOA 1FHDA 3RO8A 3C9NB 3CDGB 4ODHH 1B0RA 4MNHB 4Q6IA 3WCYA 1JRHI 1A9BA 4LKCA 3C8HA 3TV3L 3QUMA 1TE1A 3MRBB 3LZFH 2GFTA 4JGUA 4CKQA 2A6KA 5AYIA 1VAHA 1N4XL 4ZXBB 4HG4J 3IJYB 4M1GH 4YHGA 3UG3A 3RU8H 4MD5B 1CD9B 5D71H 3LS5H 3DRQA 4PUBH 3RVUC 5IB1A 4KJQC 3X13A 5F44A 4MDIA 5EC2A 4ZUVB 1OAQL 1A3RH 1QA9A 4NO2A 5ID1A 2HJFB 2B4CC 2BVOB 1CFVL 4NQXB 4POZD 2IANE 1V6YA 4NQSB 1WBZB 5KAQG 1T20B 1LLOA 3EZ8A 2HFGH 4HIHB 1OARL 1PZ3A 1ORQB 4ZAKB 3C6LA 4JFPB 1V0KA 2QHAA 2EJ1A 2YXMA 1NCBH 4EIGB 1WICA 5JXED 1CICD 3RWIB 4WWKB 3IKCA 3QQ3A 2VH5H 2ICEA 1T83C 2WLZA 3V8OA 1IGCL 3D6GA 2IPUK 3MANA 4Z95L 1X5XA 2Y1VA 3W53A 3VGFA 3OHXA 3TYGL 5F1IB 5EIIB 4EANA 2NYYC 3GSUA 3BDBA 3MRPA 1OT1A 1D5ZB 1MCWM 3F7YB 2OR9H 2X1XR 4MMZC 3GDBA 4F9DA 5EUOF 3SJVB 5IK3B 1IFHH 3OXRB 4P8WA 4XP1L 2BVUA 2AXFA 1DN2A 5LA0A 4LXFA 3KPTA 5ADOH 1UVQA 4PJCE 1ACYL 2LE9A 5D7LE 2Q8AL 2ZOKB 4PJDB 3WQ6A 1BQHG 3JTTA 1UZ8A 3P4MB 3W9DB 2DYPD 1KTLA 2HTLD 5MHSD 4LKXB 4OLVH 4JFZL 3V4PH 3C2AL 3BAEL 3H9ZA 5EUOB 3DI3B 4U6YA 4OD1L 3ARXA 1TZIB 1T2JA 4CDHA 1ESWA 3T0EA 4MJ5A 4PGZA 4KDTA 5F1KC 5DUPH 1E6JH 3RM9A 2D7PA 4N0UE 5F21B 1V02A 4TQEL 2DWDB 4M43H 4BH7B 2FHCA 2W9EH 4JHZA 2G3JA 3PGCA 5GGVH 2OMNA 2GK2A 4LVOC 3S5LG 2PW2B 4MB3A 5IHUH 2WB5A 4KMTH 3MOBL 4BYHA 4MAZA 3QUXB 4B9YA 5B4MD 4OCWH 1TZHA 5BOPA 1AGBA 2W92A 3O3EA 1HWGB 4PJBB 2IH1A 1HWHB 4O2CB 4QGTA 3ULUF 1DL7H 1KIQB 4J12A 1F45A 1JZ4A 1SEQL 3D85D 2XZQH 3SEPA 1T0NB 5D96C 2AS5M 4M5YH 2RB8A 4TVPD 3WL9B 3VH8G 4JFYB 1KXTB 1Q9KA 2F54E 2VERN 5IWLA 3RVXC 2Y07H 3P0VL 3NIDE 4X98A 1RIHL 3QH3A 2WWMC 2R1YB 1I1WA 1VIWA 1Q9WA 4P2OD 1FFOA 1J12A 1UC6A 4U1MA 5KSUB 1S9KC 4WFED 3EJZC 1MJUL 3GO1H 1AO7B 1OP5H 1T04A 1WZLA 3RVVD 3MV8D 3HRZB 4D0DB 4D8PB 1KJVA 3DGGB 3WIHA 5GZOD 4PG9A 5DT5A 3KLAB 2NY4D 2H41A 3IDUA 3RIKA 5C1MB 3B8SA 1QOXA 3MRIB 4YPJA 3OB0H 1UWEH 1MCPL 1UGNA 5GS2H 3VXUB 1QI4A 3LRHA 3D3VE 2OL3A 4AISA 2IH3B 2ZCLH 4CW1A 2H45A 4LVNC 1I3GL 1NANH 4OLXL 1QD0A 1ODUA 5DEZA 4J8RB 5A2FA 2PETA 2FBJH 1SHMA 4X99A 5B8CC 4CN4A 5HSFA 1XF4B 3AFLA 3BAWA 1NP0A 4KY1H 4KI5E 4DKFL 1NL0L 5CSGA 2DQXA 4QOKA 5L8LB 1NCTA 2YPLD 1TCMA 3AREB 3UDWA 3TZVC 2KZWA 2AK1H 2NY5C 4OT1H 4N8CH 3VXSE 1RFDL 4YQXH 1DQLH 1N5YH 4JKWA 1NMCC 3V6ZA 3HAEA 3NTCL 2PYED 4AZ8A 1HSAA 1NFDE 3STZA 3L3JA 4XZUB 4EI5C 3BAJA 3HZYB 2PO6A 4NHCH 2DQIH 5I1CL 5KSAD 3G5VB 5M3WA 1J5OH 1OTSD 2EXWD 1FL6B 4WV1B 4RFNB 5JORA 1CGXA 2BX5A 4LSPL 4O2EB 5TF1L 1ZA3B 2LU7A 3I3DA 3BN3B 4UUJA 4PJIB 1Z9LA 1FNEA 3VXRA 3HE6D 3I02A 3QJHA 2G60L 4R96A 3G04B 2YWYA 4HDIA 1N2RA 4R26H 5FL0A 1ZHBB 1E3XA 1OCQA 1AQDA 5KS9E 1JGDB 4YDJA 1WZAA 1Q9LA 1FYTA 3S34H 4UTAH 1HXMB 2QV2A 1WPCA 1OAYL 1K6QH 1JV5B 1PGRB 1RIVL 4JY5H 3JWOH 5IMLA 1JPST 2VWEC 1DUZB 1JNDA 5FKAB 1HKKA 4L3EB 1G84A 1VFBA 3LKOB 2FZ3A 3MJ9H 1K3ZA 1HKJA 1HKFA 1MQKL 3IU4H 3MUJA 5CPQA 1GOFA 3K81A 5ICXB 3L7EA 5I8EB 2R0KH 5FA4A 5BMFH 4L9DA 2VNCA 1PDKA 1W9PA 1OD7A 3K4ZA 3PL6A 1WWWX 2GJ6E 1M7DB 3I50L 4KJWD 1BD2A 3QIBC 5C0CA 1U33A 1S8DB 5CZXC 3FO1A 3A67H 5F3BA 2WK2A 1L9NA 3ZQ9A 1A1NB 1JCKA 4ODTH 5K59F 2XZCL 1CEOA 4H0IA 3O4LD 4EOWL 4MA8L 5I71B 5HDBE 4G6FB 1QBAA 2EH8H 5ACZB 2H9GB 1EXPA 2VWEE 1SYSA 2VX7A 5J1SC 5ACMA 4AQOA 3UJIH 4U0RC 4OZIB 5T1DH 1RU9H 3U9UB 3GSQB 3T0BA 4NKMA 2BY0A 3LCYA 4X7TB 3ULUH 1L6ZA 5CEYA 2ESVE 4HA4A 1UJ3A 3L5JA 1G7JA 3MRLA 3ULVF 1U8LA 3NFPB 1AI1L 4YAQA 4PRWA 2DJ4A 1BQSA 1OD9A 4RIRB 1AHWA 1N4XH 4LSQL 4UQ3B 3GIVB 4PJ8A 2H32B 4XHJC 3WNNA 2APTA 4QXUL 1QRND 5HPMB 5CP3A 1AXSA 1TVDA 3HE7B 1OAQH 3LB6C 5FYJU 4UDTB 4Q2ZA 3LQAL 4AQ1B 1CFVH 4APQC 4CRPA 1CNVA 1FP5A 1J01A 1ROWA 1FZKB 2DQFA 1OARH 3CK0L 3B9VA 3O9WC 4RGNE 4OFDA 4GI6A 1PZ5A 2MWCA 4XAKE 1PG7H 4R0LC 1TVHB 4U2ZA 4KK6C 2HT2C 3L3IB 3UTSD 1ORSB 2NX5A 5DTFB 5CPSA 3OLEA 5DVLA 5FK9A 3N1FC 2W0LA 4M4RA 1GPOL 4JM2B 3OJDB 3P0YL 1GGTA 2PI6A 4C7FA 3IFNL 5SX5H 5EMYA 1IGCH 1H9VA 3B6SA 1KPVA 3O45B 4Z95H 3B3IA 5FYKL 2HISA 2EE2A 3HTLX 5BV7C 1NC4A 3TYGH 5IG7A 5A3IC 1HHKA 4AD2A 1K2DA 4N5UA 1MHCA 5HTSA 1Z5LA 4UOW1 3W0WA 3U82B 3LN5A 4C58B 4PJ7F 4JY6B 4D6CA 4CN6A 2CR3A 2P42B 2V17H 3F5JA 2AVGA 3ZL4L 3C6SB 5LGJA 1HZHL 3VRIB 3BQUC 2WANA 3I75A 3I6LD 4WUUD 2D31B 2BNRD 5DQJA 4P2QA 3EO1A 1FC1A 3U4AA 3QIUB 6TAAA 1K5NA 1ZSDA 2GI7A 2YOCA 4PMRA 4E42A 4K3EL 3S88L 5FB8B 4JFZH 1JVKA 4J7RA 4W81A 3CU1A 4GBXC 3HI5L 2AJZB 4HH9A 3SKNA 3C2AH 5ECJE 4PJ7B 3CH9A 3B83A 2HA1A 5B39B 4S3KA 1NCCH 2X4SA 4OD1H 5C07D 3F7RA 2BC4B 3MNZA 1LP9A 5JZ7C 3RY6C 3BPOB 5T1KB 3WMSA 2HVJB 1KTDA 3PJSB 2GSGB 2WMIA 5D1XB 4P46C 2RGSA 3FT2B 2QJDA 2GDUA 3VGAB 1HHIA 2X5PA 3LS4L 4Z78B 1FG2A 4J28A 1HYRC 1JZ7A 4JJHA 3WENA 2Q20A 4ATDA 2DQJH 3EO9L 4O00A 2VRKA 5F7UA 4DKAA 3MOBH 2M2DA 3TF7C 4UZGA 3OF6A 1ISWA 3MO1B 1VGEH 4J3XA 1R7AA 5F88B 3C5ZC 3AZTA 5KSBE 4PPTA 3R06B 3WIFA 4LSUL 1G7LB 2ZP0T 3RIAF 4B16A 4P3DB 1SEQH 1Q1JH 3U0TA 5IBTL 2D4DA 2I27N 4KWUA 1ZT1A 4QRPB 4GJTB 2ZUYA 5INDB 3QEQE 2JJSC 4YO0A 2CIKB 2P5EA 2H32H 3BUTA 5IB2A 2E0PA 1RIHH 2P8PA 1RJYB 1BBJA 3TCLB 1EAJA 2DQTL 3KPLA 2YWZA 1MJUH 3FMGL 2YRZA 1A6WL 4OV6F 1REIA 3OKNB 3FONB 2ZICA 3HS0B 5J6GA 4FQPA 4XV0A 3DMMA 1IEAA 3FB8B 5A2BA 2DQDL 4Y16C 3RHWK 4UFMA 3WJJC 1U8OB 3ROLA 3I9GL 1AJ7L 1SY6A 3OKDB 1MCPH 1Z9OA 2D23A 2DLIA 1DBBH 1I3GH 4OLXH 4K55A 4HUVA 3TIDB 1CF8H 1RUKL 3IDJB 4LGPB 1S7UA 3JZ7A 3TESA 4PMNA 2FEEI 3WH9A 4HCRL 1JGEA 3DSFL 4XMPH 5ALCH 4AL8L 4DKFH 1NL0H 4YHPA 3EFFA 1P7QB 2X9XA 1NEZA 2AAAA 3NN8A 2MKWA 3Q2CA 4WKAA 5DMGD 3BDXA 4PG2C 2O92A 4HHAB 1JGIA 3M6DA 1IMHC 2J6EH 4P7QA 4NHUB 2VZVA 1RFDH 1MFCL 3FQTA 4FQQA 5EZLB 3NTCH 1N6VA 1I1AA 3QDAA 2VDML 5SWSA 1XGQB 2NW2B 5F1OB 3WS6A 3CU7A 2FWOB 4NUJB 5I1CH 2R1WA 3L6FB 3RUGA 4UTFA 5FOBB 3RWDA 2HP4A 1DBJL 2ZJSL 1E5NA 2HH0L 1HDMB 2J7CA 4LU5L 4QT5A 1IV8A 2YD1A 1V0LA 3JWDC 1NANI 4LSPH 5TF1H 4Z7VE 1BGAA 4MJIB 1T5XB 5DWUL 4J3SA 3UC0L 2G5BA 1XFPA 2G60H 2FX8H 2ZOLA 5I76A 4IEFB 4PRDA 4Z9KB 4PJEE 4FTVB 4U1SB 4D6EA 1P4LA 3C6LD 3DX7B 1QI2A 3TH2T 3SE4C 4QRQA 4K7PL 5C0AB 2XWJA 2DQGL 5DJCA 3K7UA 1QACA 3QJFB 1OAYH 1RIVH 3T1FB 3TBYA 4LCCC 4JZNB