4XWUA

Structure of the imp dehydrogenase from ashbya gossypii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
389
structure length
314
Chain Sequence
b'TYRDAATALEHLATYAEKDGLSVEQLMDSKTRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYEPLASKSTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
molecule tags Oxidoreductase
source organism Ashbya gossypii (strain atcc 10895 / cbs 109.51 / fgsc 9923 / nrrl y-1056)
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
total genus 107
structure length 314
sequence length 389
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xwuA00
4O53A 2NXHA 4EF9A 4AEOA 4ZL1A 1OHLA 4K7VA 3S6DA 3RNDA 3P8IA 3KRSA 2WOQA 2VFFA 1OFOA 1TPVA 3TU9A 4JTUA 3KRZA 1KFEA 5LNSA 5KSWA 2GVJA 1DJNA 1GJPA 5AC6A 1GG0A 1H1YA 4BR1A 3NQAA 4YL2A 3O15A 4UTTC 1EP1A 3M5XA 3W3OA 2VXNA 4UTWC 3MHGA 4EF8A 1S3HA 1F2JA 1UUMA 3IGXA 1KFLA 1YDOA 2DZPA 3W07A 4LVGA 2VKZG 3C0JA 5EBUA 3IGUA 1NFBA 4UTLA 5KZEA 1G7UA 2FIQA 4X22A 3W1XA 2B0MA 4X9SA 2ZRZA 5E0KA 1X6UA 2QCCA 2Y62A 5KZMA 3NNTA 4JTEA 3ABQA 3TFXA 1GT8A 2A4AA 3VFLA 2FPYA 2OCZA 4P61A 2CLFA 3FKRA 4QQ3A 5HWNA 2XN1A 3P5YA 3CB8A 2ZA3A 4XTIA 4CQAA 3DU0A 3TNOA 3W2LA 2CU0A 3W7OA 4YXGA 1JQXA 5KINA 1G7VA 4NJGA 3LTPA 3GR7A 4PEKA 3PB0A 1SUXA 3CQ0A 1XUUA 2BWGA 3M6YA 4NX0A 4HN4A 5EMUA 3SJ3A 2J88A 3M1ZA 4EVZA 4DF0A 1YYAA 1KV5A 1RR2A 3QH2A 3T44A 4C1KA 3BG9A 3IRDA 3MWAA 2XN0A 3EWBX 1KV8A 4M5PA 4WXYA 3PSVA 4O4WA 4WUIA 2V2CA 2WQPA 5AHMA 1L6WA 2P1FA 2YYTA 2ISVA 1MEIA 5AHEA 2XN2A 1G6CA 4QNEA 3O63A 4GJ1A 4JY9A 5AYYA 4BWLA 3UXDA 4O17A 5AB3A 1HL2A 3HG2A 4FX8A 3SI9A 5HNRA 1GVFA 2WSYA 2OMAA 2V30A 2ISWA 3LRLA 1ZAIA 1K8XA 1JCYA 2NXGA 3NR0A 3W70A 5A5WA 4N9EA 3CHVA 5H2ZA 1H62A 2QCMA 3GR8A 1MSSA 3GDLA 5K9DA 3TJLA 3NQGA 2ZRUA 4FEZA 1JCXA 3THQA 4WY0B 4HT3A 2E6DA 4HNTA 3LOTA 4ADUA 3ABRA 4FNSA 4MYAA 3NQ6A 3U6WA 2QKFA 3O6DA 4POCA 1SW3A 3W7NA 1C29A 4LWWA 4NXSA 3G22A 4JX4A 4K7YA 5G2HA 2ZA2A 3SW6A 2WNNA 4FHAA 1YADA 2VEIA 3SY5A 4QIUA 4TIMA 3QMRA 1IXPA 1B4EA 1H7OA 3BK0A 4MJZA 3B4UA 1Z41A 4HPJA 1T96A 2NX9A 1CX9A 5G1YA 3GIYA 1J2WA 5HINA 2Q8LA 4Y8FA 2YDAA 4UFKA 3S5NA 4PODA 4JN6A 3MI2A 3V1PA 4NX5A 2FPTA 2A21A 2QCGA 4FNTA 4A29A 2FLIA 5AHFA 3CTLA 4MY8A 3NQVA 3W86A 3BW3A 1Y0EA 4UTJA 3CIWA 3HGSA 1O95A 1TV5A 3ABSA 4UMAA 3N34A 3NOEA 3P60A 4AVFA 3VKJA 3LB0A 2GPTA 1LCOA 2GVLA 3HF3A 3CWNA 5CPMA 1ONRA 4RR4A 1OK6A 2YCEA 3TW6A 1G4PA 5HJLA 3FKKA 5SWUA 1LP6A 3L2IA 1XBYA 5ABTA 3O07A 3M47A 2FFCA 1R2RA 2B7PA 5HQEA 4Y90A 5AN7A 3W1QA 4OE7A 2YFNA 1KM2A 4R33A 1LRQA 1VYPX 1FDZA 4UIOA 1Q6OA 2PRMA 1PVNA 2DZSA 3G0SA 3GK0A 4IPIA 4JTTA 5EL1A 3GDRA 4CLMA 1KM4A 4UFJA 3W72A 1TPFA 3O16A 1CI1A 4MY9A 5C5YA 1O5KA 2QCHA 4OV9A 4WXZA 1AL7A 3QZEA 3CM4A 1SO3A 5AFDA 3R2GA 3N3MA 2BX7A 2CLHA 3ZWSA 1GVQA 2V82A 4NJJA 2JGYA 3BGJA 1PCKA 2LLEA 1FCBA 2ALDA 3W7EA 3SFKA 2RFGA 3MHUA 3C2OA 2ISSA 3PS7A 1IXNA 1GYLA 1AMKA 4S2BA 3NZRA 5LSMA 5FEXA 1G4TA 3VI2A 2HMCA 5FEZA 1VYSX 1JUKA 3DI0A 3TK7A 4FB7A 2Y6ZA 3GXNA 3UD6A 1W31A 3UXAA 3QW4B 3EKLA 4Y6GA 3WJXA 4XZ9A 1T8XA 5EKYA 3INPA 3PBUA 3W7HA 1A53A 4O12A 3W7IA 2NUYA 5DCEA 3MBFA 2X30A 1W37A 3O05A 3P5ZA 1IXQA 2TMDA 1W3NA 3W84A 1WX0A 4BF9A 3G3DA 4FNUA 2B7NA 5FF7A 4OGZA 1D3GA 1QMLA 4WQ6A 5LNUA 4IXHA 5HUPA 3W7KA 3EWZA 4E38A 3L0KA 3FS2A 1KLYA 3R13A 4MPQA 1G4EA 4R53A 1QOQA 2NZLA 4NJKA 5F2IA 5H91A 4NT0A 3G1HA 4E0CA 4JTJA 5AHLA 4FIQA 3TUUA 3TSDA 1HTIA 2C15A 4N9DA 1PIIA 1XL9A 1K7FA 1X7FA 3NQEA 3HGRA 1N8FA 2AAMA 4OT7A 2QCFA 2G5WA 4AMAA 2F7FA 4JTGA 3WJZA 1ADOA 3G1VA 1Q6LA 2J24A 2NX1A 1A5SA 3N2XA 2Q8ZA 4U4MA 3JR2A 1GTHA 2RDWA 3EKZA 2W0UA 3M5YA 3NO5A 4IX2A 4UNKA 1MO0A 2I14A 5LZLA 3W2UA 4XKYA 1RVGA 4CNNA 1WXJA 1KTNA 3CEPA 3TC7A 3OBKA 2X2GA 4UTKA 2X1RA 3NM1A 4BI7A 4QITA 4NNAA 1FBAA 1SZEA 1UCWA 3NAVA 2QCNA 2FQIA 3PBVA 3EEGA 1YPFA 5C55A 1G69A 3EX4A 4AHOA 4CQ9A 4LY8A 1W0MA 2VC6A 1QDSA 4RJEA 4HNUA 3VCRA 3M5ZA 2VFEA 3TE9A 5U7SA 4IX0A 3M44A 4Z1CA 1CW2A 2C19A 3WJSA 3B0UX 1TCDA 1ZJIA 1HUVA 1QCWA 2TSYA 1J5TA 2JK2A 1GQNA 2CZ5A 3BARA 4NJHA 3HPSA 1LBLA 4M7TA 1DHPA 1PCWA 2Q3OA 3I65A 4I7UA 2V81A 2HSAA 2XFWA 3TKFA 3ANYA 1FWNA 5C2XA 1WA3A 3STEA 1NF7A 1EP3A 3GDMA 4IQLA 1YXCA 1O4UA 2J9XA 3IEBA 4WY0F 2A6NA 4LC6A 1K7XA 2NV2A 4AF0A 3ZFHA 2QCLA 1MXSA 3QMSA 3TQVA 5BW6A 3NQFA 4QM1A 5D2VA 3SGZA 3CT7A 3GXTA 1VGAA 4O19A 2GQ8A 4XKYB 2E6FA 4K39A 3S5YA 4DPPA 4O13A 2H3BA 4FNPA 1R46A 1HO4A 3T40A 3JRKA 3LRKA 1OVDA 3NA8A 3RLUA 3N14A 2R14A 3G1SA 1TJRA 5LNWA 4M6QA 4NJIA 3N19B 1PV8A 5D2XA 4LUJA 5LKYA 3WFAA 1WOBA 1XBZA 2C3ZA 5F4SA 1QPRA 3QEZA 3UPBA 1H51A 1ZNNA 3S42A 4A2RA 3W1MA 2YPIA 3LDVA 5EA9A 3TX9A 1U5JA 4NNCA 2ZRYA 2JBMA 1VCVA 5D04C 2QAPA 4FO4A 4PTNA 2PCQA 1T99A 3DZ1A 4CNOA 3A22A 1LRTA 2A5HA 2YXGA 1W5MA 1HG3A 1DV7A 3P61A 5AHIA 5DY3A 4YWIA 5DLCA 2QDHA 1H5YA 3LHWA 4GXMA 1IXOA 4AWSA 1LTDA 5LHFA 1KFJA 2G97A 3GKAA 2C6QA 3L5MA 4L4LA 1FQ0A 4KKXA 1TRDA 4IMFA 1PL9A 3O06A 4O1CA 3NVTA 1DORA 2CLLA 2H8ZA 1ML1A 2ZRXA 3N73A 3WK3A 3Q58A 1SR9A 5BRBA 2X1SA 1OFDA 4IJBA 4OV4A 4XBKA 2Z2UA 4UTIA 3ZR4A 2I1OA 1OF8A 4HSNA 1F7BA 4Z0SA 1SSGA 1TV7A 3L66A 4UFMA 2FJKA 4O54A 1I8JA 3ATZA 4PCFA 5AC8A 5FESA 1XC4A 1OX4A 4M19A 2EKCA 1VQTA 5FF4A 3BV4A 3LXCA 1EIXA 2V5LA 4O8RA 3W7MA 3K30A 1H60A 1Q6QA 1DOSA 2J6XA 4DEFA 3GXPA 2ZZ2A 3PUEA 3WK1A 2CLEA 3M9YA 2BSLA 2UV8G 4JIPA 3VE9A 1V7YA 5BOOA 3NL5A 1XFBA 3NM3A 3SGUA 5DBUA 1YDNA 3LV5A 1TSIA 3UQNA 3KVLA 1JR1A 4TMBA 1FWWA 4CNPA 5G4WA 1VS1A 4RK8A 4XTDA 2ZZ5A 4RX0A 1GPWA 1ZENA 3HIJA 1B3OA 1W5NA 2D73A 3A9IA 4N9CA 3ZS4A 3GX9A 3TH6A 4QAIA 3UWWA 3FFSA 5D2WA 2ZTJA 5C6MA 2NV1A 4DO6A 3DKJA 2VOMA 3CIXA 3Q37A 1VLWA 3GAYA 2QEZA 2B4GA 3PBWA 3TDFA 5A8GA 2RKXA 3QPYA 1ALDA 1P0KA 2RHGA 3M5VA 4JEQA 2PRLA 3LHZA 1QNVA 3TA6A 1OFAA 4GNJA 5KTLA 2Y7EA 3A23A 4MYXA 3I7RA 5L6UA 2ZZ6A 4UFHA 4ICNA 2ZZ7A 4DBDA 3CC1A 4UTUA 3HGOA 4ZVJA 1Q3NA 1JCMP 1H50A 2GQ9A 3R12A 3EX3A 5D33A 2TYSA 3EXTA 3L5AA 5CPNA 3PG9A 3W7LA 4R7JA 3LM7A 3TR2A 3FYPA 4AAJA 5I3GA 3UWZA 1V5XA 2CZFA 1LROA 1QFEA 3A5FA 4E2BA 4UMBA 3G0UA 1L2UA 3HGJA 3P81A 2CW6A 1GVRA 1VYRA 5G2WA 3B0VC 4MY1A 3C2RA 1EUAA 1KA9F 3L5LA 4NXKA 3FA5A 4ADSA 3E96A 2J27A 1IIGA 4MFDA 1B9BA 3R89A 1R47A 5DY2A 5K4XA 2C0AA 3S8HA 1LOSA 3W7CA 4N02A 2WSRA 3C2VA 2PC4A 3PG8A 1L9WA 4YLWA 1K03A 3W1UA 4CCEA 4O1BA 2EAWA 3BG5A 2DU2A 1JUEA 2I9EA 3GAKA 2E68A 3EWUA 3TXVA 2RDTA 2PURA 4UR8A 2R94A 2G95A 4U28A 5D2TA 4GE8A 3DFTA 1WDWA 4GBUA 4YMZA 4HHPA 2ZRWA 4KWVA 1TPB1 1SSDA 4LS2A 7TIMA 1VH7A 3G3MA 1QWGA 1AG1O 4ORIA 1H1ZA 1OFBA 1QPNA 1ZAJA 3W2MA 3W2JA 2O7SA 2Y88A 1YXDA 3C4UA 1I2QA 3GB6A 1RPXA 1ME8A 4JICA 3QFEA 4RZ6A 5G2IA 3E12A 1NSJA 2ZZ1A 3NYZA 1KM1A 1KFBA 3S1UA 4WX2A 4JTKA 2NX3A 2QUVA 3W88A 1SFJA 1KM3A 1GG1A 3DFPA 1GYNA 1IIHA 1N7KA 4DQWA 2B7OA 2QJGA 1F5ZA 2A2IA 3LBCA 2E1DA 4I9AA 4A3UA 4JTFA 3HMJG 1LM1A 3LV6A 4LRSA 5K7JA 3B05A 2ZTKA 5DCDA 4JR5A 2W79A 3RLVA 2QCDB 3G18A 4O57A 4Z08A 1VHCA 4IGHA 1D3HA 1WBJA 1W1ZA 3NGJA 3N9RA 1FWSA 3N9SA 1I4NA 3TFCA 3ABOA 3OG3A 1M7PA 2WPBA 3OEXA 5E93A 6ALDA 2E77A 5CPLA 1P1XA 2ABBA 1F74A 5CSSA 2VFGA 3P80A 2RDUA 1XXXA 2HTMA 3S5ZA 3UWQA 3IIXA 2EHHA 2A1YA 3DFQA 1FXQA 1VJIA 2Y7DA 2KZHA 1SO6A 1VHNA 3TSBA 1Q6RA 3HQ1A 4O14A 5HMSA 1P0NA 1TPDA 1KFKA 3W9ZA 4A2SA 4C1LA 3E49A 2DZTA 1ZALA 2QCEA 4LOCA 4CCDA 4GUHA 3HO8A 5L9FA 3G1XA 1M7OA 4QJ1A 5HR7A 3PSWA 1FUYA 4UTHA 5D02A 1PHWA 4AHPA 1C8VA 1LDCA 3LHYA 3IIPA 1FWTA 2DZVA 2QDGA 4JYEA 5AHNA 4L4MA 4J9JA 3W6YA 4M7SA 3S1WA 3A5VA 3WK2A 3EWXA 4HNNA 4Q33A 1TQJA 1O5XA 3W74A 2ATMA 4I7WA 2G96A 5I3FA 3MI6A 1UB3A 4DO5A 5IM51 5TBOA 3WJWA 3SECA 3GDKA 1VC4A 4O1AA 4E2DA 2A7RA 1GWJA 4JIQA 3UZJA 3KVKA 3L9CA 3DKLA 4O16A 3C8FA 2PE4A 1GEQA 2YSWA 1W5PA 1DQWA 4UFLA 4HPXA 4JYFA 5CZJA 3SSJA 2ATSA 3UWVA 1BWKA 1OFQA 1KFCA 1N55A 3B8DA 3O6CA 3M0ZA 1P5BA 2ZZ4A 3W1PA 5D38A 3E9AA 4NVTA 1SW0A 3WK0A 2TPSA 2QF7A 1W56A 3W1AA 5MHBA 4UTTA 4MFEA 4YCOA 4UUIA 3G0XA 1TB3A 2GVGA 4S1FA 1JVNA 4UMCA 4LVBA 4RXFA 1ME7A 3W83A 2HS6A 2QJHA 2ZRVA 4ADTA 5FF3A 3DI1A 4LVDA 4EIVA 1EX5A 1I45A 4HSOA 3KRUA 3LLFA 5CG7A 1TQXA 1OG0A 1SPQA 3OIXA 2BXVA 3HPZA 4AH7A 3DHFA 1XI3A 1GVOA 2EGZA 3M41A 3MP3A 3QRHA 1YPIA 1SU5A 4MKNA 1ME9A 3W2KA 3DHDA 2ZA1A 3R5EA 4JTLA 1QR7A 2CWNA 5KZDA 2GQAA 3CPRA 4PA8A 4K38A 4X3ZA 1UASA 1X8FA 3DXIA 4PL1A 1ZAHA 3MYOA 1TJPA 3NL6A 1RV8A 3YPIA 1JRCA 1JULA 1KBIA 3KVJA 3LCGA 4UXDA 1HFBA 4H3DA 1OF6A 5TIMA 2ZQ0A 1A50A 5HWMA 4TU1A 1RQEA 3AO0A 3LHVA 2YW4A 3UWUA 1IF2A 3QC3A 4UNLA 1GVSA 3VNDA 4KFOA 1I2NA 3TAOA 3IIOA 3FYOA 3T7VA 3W76A 1MZHA 2H3DA 1YLVA 4O4VA 3W7QA 3B04A 3H54A 4MLJA 3UY8A 3KX6A 3IV3A 3MI3A 1D9EA 1TPC1 4GWEA 2NUWA 1BKSA 1FXPA 4EOUA 1F6KA 2ZBTA 1R2TA 1PS9A 1LLZA 4FNRA 1F6PA 4O18A 2A85A 1SW7A 5HR6A 2QAFA 4GRSA 3BLIA 5LHEA 3THAA 3H55A 4JGDA 1FDYA 3G1AA 2Z6JA 1F05A 1WAUA 1TMHA 2WKJA 3TROA 5FF0A 3IGSA 3PBYA 2JKPA 3G1FA 1VLIA 2FB2A 3W7JA 4TR9A 3UPWA 3F4NA 1QO5A 3W7DA 3LI1A 2V9DA 2R8WA 1EWEA 4XUGA 4CQ8A 3W1RA 4MIMA 3PUOA 3P74A 3L0NA 3C6CA 4ZZ9A 2ZCGA 3I7SA 2X1TA 3M7WA 4XQ6A 1E51A 3IIZA 3D0CA 1OFRA 1W3IA 3Q2DA 3F4WA 3T55A 4LVFA 1U83A 3NG3A 3TIMA 4CCCA 1X1ZA 1K8YA 3RF9A 4FF7A 3KAOA 4LS0A 3STCA 2F84A 3RK8A 4MVAA 2Y7GA 3S9YA 5I3KA 2ZDRA 1OYCA 4IOTA 3BVJA 4N6FA 4FXSA 1ZCOA 5BNKA 4KWWA 1LRNA 4PC8A 3TXZA 4P2VA 1OFEA 2V2DA 3HG4A 2BTMA 3KOFA 2OZ0A 4IWWA 1OFPA 3P8JA 3HG5A 4O0KA 2ABAA 3EX1A 3W1TA 5D2YA 2Z6IA 3QQ1A 1KBJA 1WBHA 3T4CA 4IUOA 5LGZA 1TYGA 2O7QA 3GLCA 3HB9A 4XBSA 3FOKA 5AYZA 4OQVA 3R8RA 3LI0A 1R30A 4N2YA 4RLIA 4GFSA 5C54A 1LOQA 2TRSA 3CLMA 2FDSA 3GVGA 2YYUA 1G67A 2V0TA 1JRBA 3PM6A 4MLRA 3LHTA 2P10A 3BPWA 3BO9A 3MMTA 4RCXA 4O28A 2JGQA 3BW2A 3NPWA 4K36A 4PL2A 5GVJA 4Z1BA 1TRIA 3MJYA 3NL3A 1H7XA 2A6LA 1EEPA 4OBTA 5K9CA 1DKWA 4WY0A 5DXXA 4GUJA 4LTSA 3FEMA 3H53A 3PY2A 3FJLA 1MEHA 3UNDA 1W54A 2C14A 1F76A 4UTWA 4JNMA 1HO1A 2YGYA 4LV4A 5K4ZA 2ZZ3A 3E02A 1EUNA 1KTBA 3OHIA 2YX0A 3O6YX 2E6YA 2H90A 4O11A 3B06A 4ZMGA 3C2EA 3HBLA 3LRMA 3UZ5A 3F1QA 4WZHA 2Z1BA 3NZ1A 3MW7A 1OK4A 3PUDA 1XDLA 3DAQA 1EWDA 4M6PA 2C13A 1QOPA 3TC6A 4Z1AA 3LCHA 3KXQA 1UJPA 2NWSA 4OHQA 1OX6A 4O52A 5FEWA 3P67A 1B4KA 3DENA 3P7YA 3DFNA 3STGA 5D09A 1ZY9A 1NAL1 3NQDA 4IMCA 1RQBA 4S2CA 3MUXA 4N4PA 1H61A 2DZUA 3NQ2A 2VEKA 3G1DA 4H6KA 3QYQA 1G4SA 2A0NA 4K6AA 3EB2A 1AW2A 4RZ4A 4LUIA 3C61A 5DXYA 5E1QA 1L6YA 2CZDA 1TPWA 2VFDA 3ZWTA 1SO5A 3HOJA 3W73A 3QMTA 5HULA 6TIMA 3W71A 4DPQA 2OT0A 4DF2A 5AYXA 1QAPA 3W7PA 5KMYA 2DP3A 4UC5A 3A21A 3C3NA 4N6EA 3S5OA 1W8SA 5I3JA 1FX6A 1XKYA 2CFFA 3IVTA 3MP4A 4A22A 4JD4A 4BWLC 3A24A 3BG3A 3PWAA 3MYPA 1A5AA 2C16A 2E5CA 4DELA 4FX6M 3P84A 5FEPA 1O60A 3ATYA 1BWLA 3ELFA 3GDTA 4O10A 1TIMA 4FX7A 3NQ7A 1VR6A 4ML9A 3S1VA 2CZEA 4LC8A 3PULA 1VRDA 4IPJA 5CKSA 3EWWA 3LLDA 3G24A 3M43A 4PH6A 4R34A 1OYBA 5EYWA 4D2JA 3TV8A 1A5BA 1H7RA 1Z42A 2H8XA 1BTMA 4OU1A 3W1LA 3C56A 1LLWA 1ZHAA 3PF3A 2CLKA 2ZYFA 1TREA 1OABA 4AB4A 1K8ZA 2YZRA 1FCVA 3P82A 3MP5A 3EWYA 1ICQA 3CU2A 2NLIA 5I3HA 3OVPA 1GTEA 1NVMA 3C2FA 4AF0B 3LX9A 3UWYA 4WD0A 3UYCA 3QJAA 3USBA 2GOUA 1OX4B 2YR1A 3HG3A 2Y85A 1TPEA 1K3UA 2A7PA 4H4IA 4ZQOA 3L0GA 3L68A 3LGEA 4TO8A 3OA3A 4BFAA 1JQVA 4JS3A 3OVRA 3WJYA 4LT9A 1W3TA 1FCQA 1WYIA 5CZTA 2GJNA 2X16A 3NEVA 1VCGA 1TTQA 2B7QA 4JY8A 3DFOA 5LGXA 1YXYA 2RH9A 1KTCA 1LZOA 4MZ1A 1RQHA 3PVFA 3FIGA 5HUOA 4ONVA 5T26A 4WOZA 5CGQA 1FCUA 2W6RA 4A21A 1T0OA 5K9XA 3QW3A 5G1TA 3NPVA 3LCXA 4UTMA 1LBFA 4DF1A 5IBXC 3LCFA 4RKAA 4FXRA 4GUFA 4O0ZA 1Q45A 2VEPA 4MZ8A 2QJIA 4RV8A 3PR2A 4LU0A 5DBTA 3BLEA 5F4XA 3L67A 4DXVA 1EB3A 5F1UA 3FJ6A 1KW1A 4DBEA 3MO7A 4KFPA 5EY5A 1YTKA 4MUZA 2QUTA 4MZYA 1TV8A 2Z0IA 2BZNA 5F2MA 3UY7A 3BGGA 1LYXA 3QPZA 1AK5A 4AXKA 1P4CA 1RD5A 5D30A 5BMWA 2JKEA 1QPOA 4QISA 1Z44A 1JCLA 1MEWA 3LTSA 1LBMA 4O50A 2C18A 1WQ5A 1BEUA 3T78A 1TTPA 2OJPA 1SZFA 4UR7A 3L65A 2DZXA 2WO5A 1VPXA 4GC4A 2QUUA 2AGKA 1KLZA 3I6RA 1XUZA 2GJLA 3O8AA 1YTEA 4W9TA 2Y61A 2H6RA 1ZFJA 1RZMA 3GKFA 4PFMA 3MBDA 5DN1A 3V75A 4JTIA 1B57A 5EPDA 8TIMA 2AQWA 4LRTA 4UFIA 3LCIA 4FIRA 4N9BA 1TPH1 3P62A 1XBXA 3EX2A 3JS3A 1KM6A 2DJXA 4FNQA 2FB3A 3LHUA 1H7PA 5FF2A 4WJEA 2DORA 3DFSA 4I7VA 4K8HA 1SZNA 3BLFA 1EPXA 3LXBA 4O15A 1L6SA 4ALDA 2DJLA 2Q3RA 3U2OA 4QSHA 2WJZA 1GOXA 1SO4A 1S5WA 3F03K 1I2OA 2VELA 4NZFA 1JCNA 1WOAA 3U8GA 4JX5A 1H63A 3W85A 2E09A 5DELA 4TX9A 3S0CA 4LW7A 4UCGA 3O1NA 4TMCA 5G4EA 3W7RA 1EP2A 1W5OA 3M16A 4GUIA 1ICPA 1IGSA 4IMEA 3TQ0A 1S5VA 3W23A 3W2NA 4ZQNA 5F2LA 5FI8A 2NUXA 1TTIA 1OYAA 4WOQA 1I2PA 4ZQPA 1H7WA 4ORMA 5AOUA 1EA0A 1H7NA 2VFIA 5F4WA 1YDVA 3TW7A 3STFA 4IMDA 2OX1A 2V5BA 1DJQA 4BI5A 1XDMA 3N2MA 3NDOA 1NF0A 2JKAA 5BMXA 3NPXA 3LCLA 3B03A 3LBMA 1M5WA 4Z0JA 4RXGA 2J9ZA 3QSTA 3LXAA 2E5BA 2PRHA 4Q32A 3TCEA 2ZFAA 5LNRA 3IIVA 3CWOX 5J5DA 1JUBA 3QF0A 3PB2A 4NU7A 5F2GA 1THFD 2Y89A 5CPOA 1X1OA 5D03A 5IBXA 3SZ8A 1GZGA 5U4NA 2CLIA 2VEMA 3LERA 3GZ3A 3W7GA 4AWUA 3G8EA 2WNQA 3RU6A 3MHFA 3AJXA 4MOZA 1SQ7A 3TMQA 4HIBA 1KM0A 3HPXA 4M6VA 4N4QA 1W5QA 1PE1A 2X1UA 3SR7A 2FTPA 2Y70A 3S1XA 3EXSA 1VCFA 1VZWA 1PHQA 2WSQA 1SZGA 4ZQRA 3KVMA 4OWGA 3W75A 4IXXA 3QQ0A 1DQXA 3KHJA 3RMJA 4AHQA 4AWTA 4BI6A 5K2ZA 3DBPA 3TQKA 1DL3A 2CLMA 1JCJA 3W87A 4ZQCA 1R2SA 4KFNA 2QR6A 3TAKA 1UBSA 3LTYA 4JX6A 5CSRA 5CZSA 4O1DA 4LV9A 1C9DA 2R91A 3W22A 1QPQA 3E0IA 2IQTA 3NXFA 1QO2A 3G1YA 2P0OA 1K7EA 1I2RA 5F1VA 2OT1A 1Z48A 4K8EA 5TQLA 3RFAA 4X2RA 1YTDA 2J9YA 2BLEA 4DO4A 2EF9A 3BW4A 1FDJA 1M6JA 3CEUA 5CZ0A 1LORA 2GUUA 3IVUA 1XM3A 2V2HA 1SFLA 4JTHA 1TTJA 2QCDA 2WNZA 1JJKA 1O94A 2YFOA 4Y96A 1OX5A 3W1NA 2FPVA 4JTSA 2C1HA 2NWRA 3NQ8A 5J5RA 3NL2A 1XCFA 4G1KA 4Y9AA 4NZJA 5K3VA 1DVJA 4GUGA 3GNNA 3FLUA 1XBVA 3Q94A 4NQ1A 3TJXA 1FY6A 1A5CA 1AW5A 2VFHA 2CLOA 1S5TA 4Z1DA 1AW1A 3DGRA 4MJMA 1UUOA 5DCBA 1WV2A 5D32A 3HJZA 3SIZA 2WV8A 4HKPA 4LNYA 5D05A 5I3IA 2E6AA 3GYEA 4JDYA 2V8ZA 3VE7A 3NQMA 3PC0A 2NXIA 3I7QA 3KFTA 5G5IA 1J4EA 1K02A 4YCPA 2Y63A 1NEYA 2E5DA 2A7NA 4B5NA 2YW3A 5KITA 4HNVA 1TPUA 1F73A 1LOLA 4QNWA 3OVQA 4ZQMA 4IMGA 3EX6A 3C52A 3I68A 5HWJA 3DH7A 4XWUA 1DBTA 3B0PA 5D37A 4JXCA 2EPHA 2VENA 3LCWA 3TSMA 3PAJA 3GNDA 3QSRA 1KM5A 4RZ5A 4NNBA 3EXRA 4NUWA 1AL8A 4JYDA 3TMLA 1FWRA 2DZWA 4EWND 3IVSA 4Q4KA 1ICSA 4BK9A 4LVAA 3QM3A 3NPUA 1TO3A 5AC7A 1OJXA 3G8RA 3NQCA 2HS8A 4K37A 2Y7FA 3L21A 4LS1A 4JDBA 5LNVA
chains in the Genus database with same CATH superfamily
3MWCA 4O53A 3MV11 4AEOA 4BQ4A 1UKPA 1S3TC 2D2GA 1E6ZA 1KNWA 1JPMA 4MWAE 3KRZA 2PGRA 4G5DA 1OZQA 4GPNA 4A6GA 4EWJA 3NQAA 4HQVA 4TOQA 1E9YB 3W3OA 4XAZA 4EF8A 1S3HA 3K4DA 2DZPA 4H2CA 2PF0A 3TWBA 4LVGA 3HM7A 5EBUA 2OO0A 3IGUA 1NFBA 2ASHA 4NZ4A 4UTLA 4UZSA 5CZKA 3WF1A 5KZEA 3GE7A 5CCZA 4ZE4A 2V69A 2FIQA 4X22A 1A3XA 3N4FA 5E0KA 1Q66A 2BHUA 3ABQA 3CPUA 2ZX9A 3EKGA 1WKYA 2GJXA 2L5HA 4LEFA 4P61A 2CLFA 4X0VA 1R3SA 2GK1B 5CC7A 2XN1A 3P5YA 4CQAA 3DU0A 2CU0A 3LNMA 2JF7A 4Y2WA 3LTPA 1X7IA 4PEKA 1A4MA 1SUXA 2VR4A 3T42A 3TYZA 4OJYA 4HN4A 1OBAA 3T8LA 3M1ZA 3VZXA 1LG1A 4EVZA 1AVAA 3TNBA 3QH2A 1KD0A 1K9EA 3BG9A 3MWAA 3WQDA 2XN0A 4WSKA 1CBGA 1UR4A 5I78A 2V2CA 4M82A 2DVUA 2F6XA 1JIBA 2XN2A 1TWIA 3O63A 2WSPA 4GJ1A 4JY9A 2WWDA 5AYYA 1J6OA 1KFWA 1TELA 3HPAA 1HL2A 3LGGA 4CEUC 1CWYA 4JFTA 2Y0FA 3FAXA 1PPIA 2OMAA 2XIIA 3LRLA 1K8XA 1H62A 2V5DA 4IGNA 1Q8AA 4WGXA 3TJLA 2JF6A 4EKJA 2PDPA 4AZCB 4HNTA 4H8NA 4C6LA 3EPOA 1XF0A 3F7JA 3U6WA 1JD9A 1OD0A 2AQVA 1UWTA 4NXSA 4JX4A 4K7YA 5G2HA 1FKXA 1YNQA 4FHAA 3VC5A 1YADA 3BC9A 4O0QA 3SY5A 4Q6XA 4YVVA 4QIUA 3BLOA 3MKKA 1H7OA 3WDHA 2UWFA 4MJZA 2P0IA 3CS2A 1U1JA 5G1YA 4KS0A 1J2WA 2Q8LA 4CU6A 5IOBA 4AMCA 3V1PA 4F0MA 4KWUA 4AZ7A 4FNTA 3QV6A 5IRPA 1IGWA 2BY2A 2Z7KA 3OGSA 1YNYA 1UA3A 2ALRA 5KEZA 3DCPA 1QI0A 5HANA 3CZGA 1GOMA 3VIJA 4AVFA 2HRWA 1V0KA 1GGOA 4S3EA 2J8FA 1EJWC 4B3KA 4GKLA 3WENA 4RR4A 2EG7A 5FJUA 2YCEA 3NO3A 4B16A 4Z2IA 3VD7A 4DJEC 1LP6A 3L2IA 4F8XA 4M0XA 4MMWA 3M47A 1EJVC 3EA1A 4W7VA 3IGHX 1R9ZA 3UG8A 1KBLA 1QTWA 2YFNA 1KM2A 3S4TA 4R33A 1LRQA 3KW3A 5I07A 3GK0A 4JTTA 1C7TA 3GXFA 5ABEA 4UFJA 1XIBA 1QATA 3R1ZA 1HNYA 1TPFA 1O5KA 4Q8MA 3RAOA 4WXZA 1BYAA 1AL7A 7A3HA 1TWSA 5AFDA 3RYSA 3N3MA 4GY0A 2CLHA 3N15A 3PWGA 4EP8C 3B8UA 3CHEA 1AA1B 4NJJA 2IMRA 2JGYA 3U2CA 5G4HC 2RFGA 4MWAA 3CUXA 1XDJA 1TZZA 1J0ZA 3NZRA 4DZAA 3LQGA 2Z26A 1VYSX 4PTDA 3DI0A 4GNVA 3IANA 1HW6A 3GO2A 3ICJA 4XZ9A 3BTNA 1I60A 3INPA 2NUYA 1WZMA 5HDRA 3NO1A 5DT7A 2E3ZA 2QJJA 3KLKA 2VCAA 1W37A 1OCJA 4IL2A 1VBUA 1IXQA 4M81A 4BF9A 4ML4A 1QK2A 3PTKA 2B7NA 3TTOA 4JIHA 4WQ6A 4CQCA 1W1YA 1KLYA 3R13A 1NP2A 1G4EA 5DF0A 4R53A 1KXTA 3DC8A 1A0CA 5C70A 3QTPA 5F2IA 5H91A 2Q8XA 4Q8VA 2VX5A 3WQGA 3HPFA 3WLJA 5AHLA 4FIQA 3TUUA 1A49A 3TSDA 4DWSD 1REQA 4N9DA 1PIIA 3D3AA 1ZPTA 3NQEA 3CWHA 3EA2A 2YCJA 3HGRA 2DV0A 4PBEA 4OT7A 3CGTA 2QCFA 3CUIA 2PDKA 4AMAA 4JTGA 1DIDA 2WLYA 4WKAA 1U1HA 4HA0A 4GC3A 4ERGA 4CU8A 3N2XA 1KKRA 2Q8ZA 1KRAC 3EKZA 4KIRA 3BAKA 3NO5A 2REQB 4M8UA 3P6LA 3CEPA 4GCXA 3ZVHA 2X2GA 3NZQA 4XD3A 3NM1A 3N25A 4BI7A 4NNAA 1WXYA 2QCNA 2A3BA 2FQIA 1H5VA 2PWVA 1X38A 4GH3A 3QGVA 1OSEA 3LQLA 4F0RA 1IHIA 1EDGA 3VCRA 4IX0A 3M44A 5LIUX 1GW9A 4GYJA 1XRFA 5HNNA 1DXFA 3TN4A 2TSYA 1J5TA 3WNOA 3IJ7A 3BMWA 1GQNA 5CXPA 2ZX7A 4NJHA 1CEOA 2Y8VA 4BEUA 4KETA 3EOSA 3CO8A 3TKFA 3SRFA 7ENLA 1Z6KA 3ANYA 1FFRA 3IJDA 3LMZA 3WG6A 1WDQA 3BICA 1YXCA 4W89A 4ES4A 4DYKA 4B4FA 4WY0F 3AC0A 4LAZA 2A3EA 2A6NA 1EC7A 2UBPC 5A6LA 4LC6A 2NV2A 3ZFHA 4OIFA 1GUVA 3ZLFA 3QMSA 5BW6A 3NQFA 4IJCA 1GOOA 5D2VA 5E70A 2Z1XA 3BCFA 2XDFA 4DPPA 4AC7C 1FWHC 2H3BA 4S39A 1V02A 3JRKA 4DM2A 3L23A 3ZT7A 3G1SA 1DTNA 2PEVA 1PV8A 3QR0A 1UQYA 1RUSA 4LUJA 1WOBA 2KAUC 3QEZA 3VNJA 1H51A 3FVMA 4C65A 2YPIA 3TX9A 3RR4A 4NNCA 3GBEA 5D04C 5LIKX 3CB3A 4ERAA 2X1IA 4BF7A 2YZ5A 1T99A 2WK2A 3DZ1A 4CNOA 5B7ZA 3A22A 1LRTA 3WLOA 1QNSA 1TZ7A 2YXGA 1E9ZB 1HG3A 4QGCA 5AHIA 3FSUA 4YWIA 3GFXA 5DLCA 2D0GA 3WF2A 2P3EA 5I03A 1T40A 2O9RA 3V7PA 3L5MA 5M2FX 4ASTA 4NY2A 4IMFA 2VZUA 1ITXA 3UCCA 4JTRA 4XZHA 1W9XA 3O06A 2CLLA 4HYRA 3Q58A 5BRBA 2QT3A 3WQ5A 1Z69A 3D47A 4IJBA 1AD4A 4OV4A 4GD0A 3QV8A 4AU0A 4Z0SA 3L66A 4OKDA 4RNJA 1CT5A 2I5QA 4LCQA 4KGJA 4CNUA 2FJKA 4L4PA 3G6MA 1I8JA 4PCFA 2D0FA 2NLYA 3UJRA 5FESA 1XC4A 1VQTA 1ECQA 5DO8A 2CKRA 3T9PA 4XISA 1LT8A 4O8RA 4IPNB 3K30A 1H60A 3CV6A 4JFUA 4L1WA 1VFFA 2XH7A 3M9YA 2BSLA 4JIPA 3RR1A 1V7YA 1FP8A 4C6CA 2YL5A 3NM3A 3GQYA 3RLHA 3QXBA 3N2OA 3QFWA 3QKEA 2HNEA 4CNPA 2XG9A 4RK8A 1LUCB 4KCVA 4RX0A 4GHRA 2IUZA 4QAIA 1EC8A 2VGGA 4V27A 3V36A 2NV1A 2BGQA 2HCVA 3WD4A 4H6EA 1VLWA 2B4GA 4IP5A 3TDFA 4AUBA 3QLDA 4GI4A 3M0KA 5HQLA 3U9IA 3OO2A 3WQOA 5HPOA 4JEQA 2PRLA 3LEPA 3LHZA 4P7QA 4F0HA 3LSCA 5IFPA 4MYXA 3U5YA 2BV9A 3GTFA 3ZYZA 1FWDC 2ZZ7A 3CV1A 3CC1A 1D3CA 3HGOA 3PBMA 1MI3A 3R12A 3EX3A 3L5AA 3MSGA 2VHLA 3FYPA 3UNTA 2CEQA 2D20A 2WBGA 3UWZA 1T6MA 3VKAA 1QFEA 4E2BA 4UMBA 3ARXA 3G0UA 4E2OA 1L2UA 3HGJA 3S2JA 5JU6A 2XU2A 4DYJA 3AXIA 2GUBA 3EDDA 1YMYA 3L5LA 3E96A 2J27A 4MFDA 4WDWA 3UVIA 1D7FA 5DY2A 4HCLA 2WSRA 2Z1KA 4ZXOA 5CJNA 2PC4A 3PG8A 1X97A 1A0DA 4YLWA 3UETA 1K03A 3UG4A 3GRIA 3AWOA 3BG5A 2E68A 3BSHA 4A3RA 1VP5A 4Q8NA 1H2JA 3MC5A 1UD4A 4U28A 1MZRA 3KDOA 4FR6A 4AFYA 2ZRWA 1XYAA 1WDSA 1M3UA 1SSDA 4N0RA 1OFBA 3WUEA 1QPNA 4Q7IA 2DH2A 2Y88A 3N17A 4AVOA 1I2QA 2BASA 2Z25A 2ZZ1A 4HMNA 1KM1A 4WX2A 3GG1A 4JTKA 2E25A 2XIOA 3DFPA 4MF4A 5T91A 4RL3A 4DQWA 1HVQA 5LA2A 3KWXA 3SCQA 2A2IA 3BMXA 2Z1WA 4I9AA 3CZJA 1PTDA 4JTFA 1V3HA 3N1AA 2A3CA 3PZVA 3RLVA 3B97A 5D9MA 2ZC8A 2QCDB 1VF8A 3G18A 4O57A 4H83A 4Z08A 1JZ3A 3SO7A 3THCA 4G1NA 1D3HA 3DG7A 3O0KA 1XP3A 3NCOA 5FAGA 1EYEA 1FWSA 1MNSA 2NVCA 3OVGA 1TUFA 3LSBA 3VOCA 3WUBA 1BPLB 1V3JA 1AJ2A 3OEXA 2RAGA 4Q4RA 4MDOA 2EHHA 5I77A 2Y7DA 1SO6A 1VHNA 1J18A 1XYBA 4KF1A 4O14A 1SFTA 2OZTA 2GDVA 4DJDC 3W9ZA 2YLAA 2ZUUA 3E49A 2DZTA 3N11A 4ZODA 3TYCA 3C0QA 4C6IA 4CCDA 4GUHA 1GQIA 5M03A 3G1XA 3PSWA 3SN4A 1QWKA 4C90A 3CH0A 2FVKA 1C8VA 1FWTA 2VZOA 1JDDA 2QDGA 4JYEA 3IPWA 3VGBA 1WDRA 4D6IA 4C6EA 3AIEA 4GY1A 3EWXA 4NAFA 4HOZA 4PUDA 1JYXA 1SJBA 4I7WA 1KCZA 5TBOA 1VC4A 4E2DA 3FXGA 2A7RA 1EOKA 1GWJA 3KVKA 4JHMA 1UW9A 3KRBA 3C8FA 3LA4A 1GEQA 2PC8A 1W5PA 4MB1A 3E38A 1QNRA 2PDYA 5I0DA 1O6IA 2PDHA 2ATSA 3ALFA 4AQLA 1OFQA 3B8DA 2GGHA 1R9YA 1VFLA 3OLEA 2FYMA 3A3HA 3W1PA 3E9AA 1S2WA 3B9OA 3PWIA 3W1AA 4UTTA 3GM8A 4MFEA 4UUIA 2GVGA 3SCPA 1JVNA 4RXFA 3UR8A 1ME7A 1UUQA 2HS6A 2PMQA 4M24A 1XLBA 6PTDA 1O66A 1EX5A 4NAEA 1TQXA 3E0LA 5TD4A 4AH7A 3U2EA 4J40A 4NP7A 1J0YA 4G7EA 1SU5A 2BODX 3DHDA 1TWWA 2ZA1A 5ECVA 1QR7A 2CWNA 3QLLA 5KZDA 4PA8A 4ATWA 4K38A 5AYBA 2XTKA 2WJEA 3MYOA 5AKQA 3N2TA 3YPIA 1JULA 1KBIA 1UD8A 1DWFM 1NY1A 3KVJA 2OOFA 4UXDA 4RW5A 1RQEA 2YW4A 3NTYA 4MHBA 3UWUA 1IF2A 2PBOA 2VO5A 1GVSA 3VM7A 1MW3A 1VKFA 2J7CA 4J3XA 2PLJA 3FHAA 4GACA 1F3TA 3H54A 3VCNA 4ZOCA 4GWEA 3OODA 2NUWA 2ZBTA 1Q5MA 1R2TA 2CERA 3RUBL 5A3HA 2ZUWA 5CLWA 3NSMA 1PS9A 2HXUA 1F6PA 2PU0A 2A85A 1SW7A 2WMFA 4U2YA 5I09A 5LHEA 3BLIA 2O4QA 2GWGA 3THAA 5T9BG 1W32A 1F05A 3WUFA 4RV3A 1HT6A 2UY2A 1VLIA 3W7JA 3AIVA 4J2MA 3BZJA 2W27A 2VR2A 3E1F1 4P5UA 3UPWA 1JYWA 5D9NA 3VOIA 1EHNA 9RUBA 1EWEA 1AH3A 3DFHA 1ODUA 4ZZ9A 4XQ6A 3IIZA 3D0CA 3F4WA 3PZGA 3S6TA 4LVFA 1ZP4A 3TP4A 3KAOA 3STCA 2F84A 2QLYA 2Y7GA 5I3KA 2ZE0A 2ZDRA 4GZIA 1RBLA 1EBHA 3ARYA 2OZ8A 1LRNA 3TXZA 1R3YA 5T8GA 4P8VA 1IWPA 3W28A 4ZTYA 2C79A 3DUGA 3CQHA 2Q6ZA 3OYZA 3XISA 2ABAA 3W1TA 3ENLA 3VOFA 2Z6IA 1WBHA 2UY3A 3U2ZA 2CLPA 4OQVA 3TTYA 3URQA 4XSLA 3KCOA 4PUWA 4PMNA 1A80A 1PZ3A 1D8WA 1EJTC 3EMZA 1RJQA 2HK0A 3TJ4A 2O56A 3K8LA 2OYKA 3BO9A 3MMTA 1KRCC 3ZMRA 1U33A 1BYBA 2EQDA 5C2CA 1D2KA 3AOFA 2OGYA 2J8GA 1TRIA 3NEHA 1EJ7L 4WY0A 5DXXA 3ONBA 3FEMA 1E3ZA 3PY2A 1MEHA 3PPHA 4DAIA 2HQAA 4QCFA 4PUEA 2XPKA 1XIMA 4DHGA 4JNMA 4J3ZA 4LV4A 3OYXA 4ECLA 5I00A 3E02A 3CLWA 3W6LA 3OHIA 2YX0A 3O6YX 2UZ9A 5HMEA 2H90A 1HZYA 1OB0A 5A6JA 3LRMA 4WZHA 4GJIA 1NIUA 1OK4A 2Q01A 4FK9A 1AH4A 2C13A 1QOPA 1B2YA 5EFDA 3LCHA 1UJPA 2NWSA 2E9MA 1UKSA 4OHQA 3P67A 3STGA 1I9CB 4GG9A 1NELA 1NDZA 1P43A 1XLMA 1SJAA 2F6KA 4S2CA 2DDXA 3VZYA 2DZUA 4QDPA 4DWDA 3OLIA 3N6HA 2OLAA 3NQ2A 4AWEA 4Q8PA 2ZE3A 1UC4A 4DJFD 2ZX8A 3VIIA 5E6ZA 1S5MA 4J3SA 4GXPA 5E1QA 4LUIA 3C61A 1SMDA 1PJ9A 1L6YA 1V3KA 5KETA 3ZWTA 5FSEC 3HOJA 4WR3A 3GVVA 2BFGA 3HQPA 2POZA 3W71A 4DF2A 2VX7A 4H01A 1UOKA 4GX9A 2PS2A 1QJWA 4ZO8A 4AIOA 1R5YA 4PMDA 1FX6A 3IVTA 1NDVA 5CC3A 4BWLC 3ARVA 3A24A 1R87A 2CETA 4DELA 4FX6M 3P84A 3U7VA 3WEMA 4IMAA 4JIRA 5FEPA 4M80A 2ZWZA 3WDPP 4XZBA 1VR6A 4GQGA 3WSUA 4LJ3A 3LLXA 2DT3A 3G24A 1JI2A 4R34A 3CASA 2VDGA 2YDRA 1A5BA 4GABA 4LAUA 1Q85A 1Z42A 4XIAA 5CPQA 2CLKA 1OCQA 4PB3A 4TVCA 4A3YA 5ABFB 5BRQA 3P82A 3MP5A 3CU2A 3WZ0E 2OYLA 3GHUA 1US3A 1NVMA 3C2FA 4BA0A 2GOUA 3KZPA 3MO4A 2BOGX 2YR1A 2Y85A 3HG3A 3KL0A 1Q4NX 3WQCA 1K3UA 2WVUA 4US5D 3L0GA 3DECA 4ACYA 5HJYA 4QSFA 1WYIA 4D9PA 3SCNA 3K8MA 3NZGA 2RH9A 2QJNA 3GU9A 1KTCA 3IARA 4MZ1A 1RQHA 3FIGA 2VX4A 2PPGA 5HUOA 1VIWA 1XLKA 2QJMA 5K9XA 4DY1A 2TAAA 2CIPA 2R6OA 3LCXA 2O55A 2WM1A 4UTMA 1LBFA 3DFYA 3UA4A 4RKAA 3AIWA 1UMLA 4RV8A 1S1RA 4MKVA 4LU0A 1G5AA 3ZR6A 4AD3A 1UR3M 1OT1A 5A8QA 1V6UA 1KW1A 4WF7A 4PMVA 1Z8AA 2XISA 1PX4A 3UY7A 3BGGA 1LYXA 3T0TA 1DJZA 5FIPA 5J8LA 1RD5A 1NQ6A 2XGBA 4ZFCA 2JKEA 1Z44A 4HBKA 1JCLA 1MEWA 3PP7A 4C6PA 3F4VA 5AZ0A 4NKCA 4ZOEA 2AGKA 3VX0A 2C8NA 3RLGA 3N6QA 1WKFA 1E6SM 3E3HA 2WC4A 4LAOA 4Z42C 1CCWB 1B54A 1J2BA 4XZWA 4C1NB 2YOCA 3BXWA 3MBDA 4PFMA 4JTIA 3XINA 1U1UA 8TIMA 4DX3A 2YBTA 1SM9A 3WX7A 5FL0A 2C1GA 3GXIA 1KM6A 1N8WA 4FNQA 1YIXA 1NFPA 2D2OA 5FF2A 3UZZA 1SZNA 3OQEA 4NHVA 1QBAA 3TTQA 5BU9A 4R27A 1S5WA 1QOXA 1EKOA 5I24A 2YJQA 3RRAA 1WOAA 4JX5A 3W85A 2E09A 4E8DA 5DELA 3O1NA 2FZNA 3WH8A 4TMCA 3M0JA 2VR5A 3OIHA 2CITA 4H8VA 1W5OA 4JFWA 1U22A 2W62A 3RPTA 1KGWA 1E1CB 4IMEA 1S5VA 3W23A 4AIUA 1E0XA 4ZQNA 1FTXA 5F2LA 5FI8A 2NUXA 5TF0A 1OYAA 4WOQA 4TQTA 4ROPA 1H7WA 3WDRA 3QR1A 2BB0A 1FP9A 6A3HA 1EA0A 3HURA 2QXWA 1AD1A 2GK1A 3STFA 2WYSA 1TUXA 2W3ZA 4BI5A 1XDMA 1BXCA 3N2MA 2XVKA 3FJNA 3H4WA 3D46A 1SMAA 2B81A 3KTXA 1CXLA 1XLGA 4HCDA 1JDFA 3LBMA 4H9UA 2FZBA 2I56A 1M5WA 2NT0A 4W8AA 4D1IA 1E0UA 5FSDC 2G3IA 2VZVA 2HE8A 1BXNA 5IHSA 2FTYA 4ICMA 1JUBA 4WHBA 1UG6A 4Z1YA 1E72M 3CBWA 1XINA 1LL7A 3KL5A 5HBFA 1X1OA 5D03A 1M7JA 5IBXA 3SZ8A 2I7GA 3VKCA 4L9ZA 2QGYA 2ZUVA 2HWGA 2CBIA 1E4IA 1Q6FA 4AD1A 1FRBA 1Y7VA 1QNPA 1SQ7A 2ZUNA 3GD6A 1EEXA 2VZTA 1X98A 4M6VA 4N4QA 2BGSA 3MQTA 1W5QA 4F2UA 5M5DA 1XICA 4IQEA 1K9FA 4E6MA 1VZWA 2CHRA 3DN5A 3W00A 2WSQA 1JGIA 7CGTA 3W75A 3WD1A 4V1YA 3OHMB 4XAPA 3DBPA 3RX4A 2GSJA 3VNZA 1R2SA 2GGIA 4D6DA 4LV9A 3RCYA 3LUTA 5FL1A 1W2VA 2GL5A 4W85A 1C8YA 4EPEC 3NXFA 3G1YA 1K7EA 5F1VA 1Z48A 2EKGA 5TQLA 3RFAA 4Y7EA 1YTDA 3PTMA 2J9YA 2V68A 1QI2A 3TA9A 1UOZA 1M6JA 2OTDA 3IVUA 1XM3A 1SFLA 3VXGA 3ZLGA 4DJFA 2OELA 1TTJA 3MTWA 1O94A 1OX5A 4I9JA 3W1NA 1BLIA 2FHCA 1DPMA 2C1HA 1MDRA 5K3VA 1Z32X 4DYEA 1DVJA 1M01A 1NJJA 2G3FA 4AXNA 1XBVA 4NQ1A 1TZ9A 1E4LA 1A5CA 4HB7A 3EB3A 2VFHA 2Z28A 4Z1DA 2OX4A 1V8EA 1Q7QA 3DGRA 5JH2A 3JU2A 5D05A 5I3IA 3GYEA 3LG3A 5LA0A 3VE7A 3AIUA 1XJBA 3PC0A 4P8XA 5G5IA 4YCPA 3LMYA 1F4AA 4L64A 3SCTA 1R86A 4V28A 1F73A 5GJMA 1LOLA 3A4WA 4QNWA 1IZKA 4RNFA 2WCAA 1UD6A 4B4HA 3C52A 1DBTA 2RGMA 5D37A 2VENA 3LCWA 3RN6A 3TSMA 3QSRA 1EXPA 3AISA 3EXRA 5E09A 3ISIX 4PRRA 2DZWA 3IVSA 4Q4KA 1ICSA 1A0EA 4LVAA 2HS8A 4K37A 2BGNE 5LNVA 3E74A 2WZTA 1E6RA 1Q2RA 5GNZA 2G4FA 5CH9A 4ZL1A 3LY0A 3S6DA 2E8ZA 2WOQA 2VFFA 1F3EA 3UJ2A 3EA3A 3TU9A 4XAYA 5LNSA 1EPVA 1TV4A 1JZ2A 2W92A 3QYSA 4YL2A 3O15A 1K70A 5BWAA 4UTWC 1UUMA 2IXUA 3IGXA 1YDOA 1WKEA 5MKGA 2VKZG 4LUTA 3KOZA 4NG3A 4BZYA 4DJEA 3W1XA 2B0MA 4X9SA 2ZRZA 3AWNA 3MUIA 5AZ1A 2QCCA 2Y62A 3TFXA 2PZ0A 3VFLA 2CXEA 2AL2B 5A6MA 1B3XA 3KBSA 1KCLA 4QQ3A 1P7TA 2IS7A 5E9XA 3WY1A 3CB8A 2ZADA 4RDWA 1WDPA 4CD5A 4YXGA 4PBFA 1JQXA 2F9RA 4M56A 4NJGA 3GVWA 3LM3A 4FALA 3LBOA 1JF6A 3CQ0A 1XUUA 2BWGA 3M6YA 4NX0A 1RSCA 2P50A 4CD6A 5EGRA 1W9DM 3SJ3A 2J88A 2IKHA 4S3DA 4DZIA 2QYGA 3T44A 3STPA 4C1KA 4AG0A 1KV8A 4WXYA 3PSVA 1P6BA 2W5FA 3H8AA 3ZQ9A 3OOQA 4MPKA 2WQPA 1L6WA 3A3XA 2ISVA 2TODA 1G6CA 4QNEA 1HX0A 2WMIA 5AB3A 2P5NA 4IJRA 1GQLA 5HNRA 2D23A 2OVLA 4U33A 3PJXA 1UP3A 3APGA 4NL1A 1ZAIA 2NXGA 3CHVA 2X8RA 3VMOA 3MPGA 2QCMA 4IF2A 3GR8A 1MSSA 4H41A 3GDLA 5K9DA 4DZHA 1FHUA 1YBQB 4H9YA 4WY0B 2E6DA 1ZP3A 4KWSA 2NT1A 4ADUA 3ABRA 3MUCA 4MYAA 2AAAA 1YHTA 3NJ3A 2P88A 4POCA 3UZXA 4FXFA 4H7CA 2R1KA 3G22A 4PUJA 2XSBA 3PNZA 5B7YA 2ZA2A 3QV7A 4IH3A 3SW6A 4A3HA 1XIEA 5BXTA 2VEIA 4HZMA 1GKPA 4R7OA 1O5QA 1JDEA 2YCKX 3SRHA 3KCLA 2FMNA 3B4UA 1R3WA 1CX9A 2HXTA 3QKZA 4LUSB 5HINA 4Y8FA 4KESA 4UFKA 3NXLA 2G41A 3PBGA 4U3AA 4GIEA 3CAQA 4NRRA 4Q22A 3V1HA 2QCGA 2FLIA 3VOGA 4ZB0A 4IFOA 3NQVA 1J0HA 4AW7A 2FKPA 4UTJA 3WFZA 3HGSA 3S1GA 1TV5A 1BRLB 3ABSA 3AQUA 3N34A 5D4YA 2I5IA 5GJPA 3P60A 2FGLA 3VKJA 1H0GA 4LB3A 4EE9A 1OK6A 2W67A 3B3DA 2J75A 2IXVA 2IPFA 2WC7A 4XUYA 5BXPA 4I90A 4E2VA 5ABTA 4CN6A 3O07A 3QOKA 1IV8A 2XWDA 4DB7A 2OXNA 1SVDA 2B7PA 1Z9AA 4ZTXA 1KCKA 5AN7A 3GHSA 3H22A 3WH9A 1V6WA 2ZWYA 2XIJA 5EL1A 3GDRA 3KOWA 3WQPA 1W6TA 1CI1A 5D9OA 4DWSA 3T1GA 1GVYA 2AL1A 3QZEA 2FJUB 1SO3A 3R0UA 3WDQA 3I3DA 2DGAA 3ZWSA 3ITXA 5BOEA 2V82A 4AZ6A 4GK8A 3BGJA 1PCKA 4TVUA 2EEXA 2X0YA 1DIKA 4ZEPA 3UT0A 3PS7A 1V4YA 1GYLA 4S2BA 2V5KA 3GHTA 3VI2A 1W3HA 5FEZA 3EAUA 4RE0A 1FWBC 3IK2A 4UBPC 5HATA 3H7VA 3UXAA 3R7MA 4CD4A 3HMCA 3MBFA 3WLKX 1WP6A 3AYRA 3KZSA 1K9TA 3LD5A 4DVOA 1QNOA 3P5ZA 4I5UA 4MSSA 3GTNA 4F2BA 5REQA 3G3DA 1V51A 2WQDA 5FF7A 1QMLA 5LNUA 3ARRA 4FZIA 2IPWA 1AJZA 1BYDA 4ICCX 2PTXA 4MPQA 1IT8A 1QOQA 4WEVX 3N13A 4NJKA 3MCOA 4X63A 4NT0A 4UQAA 3JVAA 2J6VA 3T8QA 2C15A 2RJGA 4AEFA 4PEEA 1K7FA 4RUBA 1X7FA 5CAHA 4Y9NA 3UJFA 2AAMA 1LL4A 3L4ZA 3Q45A 1ADOA 3UERA 1UZ1A 3V5OA 1Q6LA 2NX1A 3BOLA 3MSDA 4NI3A 3NSXA 4IIDA 3A3WA 3JR2A 3PZOA 2RDWA 4IX2A 4UNKA 3AI0A 3SUTA 3BAXA 3VGFA 2GSHA 3W2UA 4H6RA 2EG8A 3RMEA 1WXJA 4AY8A 1MWOA 1VBRA 3OBKA 5DMNA 1F8IA 2CNCA 1D8CA 2X1RA 5BOFA 1FBAA 3MMUA 3NAVA 1ISWA 3O6AA 4E4PA 4LALA 3PBVA 2MUCA 1TR9A 4HA3A 5C55A 4BQ3A 3AYVA 4OECA 1FH7A 2VC6A 2VX6A 1QDSA 4RJEA 1IYXA 3M5ZA 2Z7GA 2VFEA 3TE9A 3T0AA 5U7SA 2E67A 1W2PA 4Z1CA 1EF3A 2CC0A 2C19A 1K4GA 1RP9A 2R9RA 1GOWA 1HUVA 1O68A 4Q3MA 3A4AA 2CZ5A 3R25A 3BARA 4R7WA 3HPSA 1PCWA 2Q09A 2E8YA 1UKOA 3I65A 3GC5A 4I7UA 4IQDA 1FWNA 5BXRA 1EF2A 1WA3A 3KE0A 4A8NA 1NF7A 1EP3A 2WC3A 2WMKA 3GXMA 4IQLA 2WSKA 1UA7A 1XCWA 4ZB5A 2KX9A 3WH5A 2XIQA 1ESWA 3H4XA 1QHZA 1OCBA 2W4XA 1MXSA 3TQVA 4QM1A 3GXTA 4FR1A 2GQ8A 1ADDA 4K39A 1H09A 1JFXA 2VUNA 1R46A 3RX3A 1HO4A 1KR1A 3NA8A 3MKCA 4YHGA 4Q8TA 3NDYA 4DAFA 2JALA 4C5YA 3N19B 2CXGA 1TX2A 5LKYA 5CC6A 3C3UA 2CYGA 4PMJA 3FDGA 1ZNNA 3N04A 4A2RA 3W1MA 5IDZA 1UQZA 1W17A 3EYPA 4CNTA 3ORWA 4ZGYA 2QF8A 3UP8A 4G2DA 1JGMA 2H9AA 2V6AA 3VIFA 5EB8A 1XH2A 3VGGA 2DIKA 1IXOA 1POJA 2OPJA 1XS2A 2Y4SA 1DXEA 3ZJKA 2G97A 3PANA 1FQ0A 4KKXA 1PL9A 1MVYA 1CXHA 4O1CA 2H8ZA 3BLKA 2ZRXA 1JAKA 4I3GA 1CZ1A 1SR9A 4ZSUA 4LANA 3AMGA 4W86A 3NSNA 1J5SA 2I1OA 1OF8A 2QULA 3UGRA 2V3DA 5EBAA 3CUJA 4W8LA 4DM1A 4B5XA 3WNMA 2G3JA 1XQKA 4ZBCA 5C9WA 1B30A 2G4JA 5DRCA 4JOMA 4YTSA 1RBAA 5FF4A 4C6KA 3U0HA 3LXCA 1EIXA 4UB9A 5A2AA 1Q6QA 3CZ8A 1X6NA 3S9ZA 3WK1A 3CHCA 2UV8G 4QDMA 1XKJA 2Z2AA 3NL5A 1XLIA 1YDNA 1W3JA 3LV5A 1TSIA 3UQNA 3KVLA 1JR1A 1FWWA 1MW1A 1W1PA 1JYVA 2SFPA 2ZZ5A 3AMLA 3PJWA 1ZENA 3HIJA 1B3OA 5XIAA 3A9IA 3NVDA 3ZS4A 4G7EB 3CZLA 3GX9A 4P8UA 2DT2A 4RDVA 3FFSA 3M7SA 3AUJA 5D2WA 4U2ZA 3DKJA 4PB5A 3CIXA 4KEUA 2XVPA 3QZ6A 4GYPC 3TZNA 3AS0A 3VMPA 1ALDA 1QNVA 3TA6A 2PTYA 2NQZA 2REQA 2YXOA 3CIVA 1XG3A 1E6NA 4E3TA 3KLLA 4UFHA 4ICNA 3F2DA 1EQCA 4UTUA 4LBRA 3GFYA 4J27A 1XC6A 1H50A 3ZXWA 2GQ9A 2PZNA 1J12A 5D9PA 4M6UA 2NSXA 3TLQA 4AZ5A 1P0EA 1SJDA 2GJXB 4B5TA 5CPNA 3PG9A 4REQB 3W7LA 4JIEA 3LM7A 4L1GA 3TR2A 2CZFA 3DHUA 2VZSA 4Z2GA 4JZ5A 5H8PA 1US2A 3ITCA 2YDQA 4DLFA 3RX2A 2CW6A 4PMYA 1F8MA 1GVRA 4WVXA 2BVWA 2GZXA 1BGGA 5G2WA 4QCEA 3B0VC 5T9CE 4MY1A 5EMYA 4NXKA 1KA9F 4FAMA 4ADSA 2F8QA 2ZVRA 3H7RA 1R47A 2ZVIA 4AD5A 2C0AA 5K4XA 1KXQA 3S8HA 3E0WA 3W7CA 4N02A 3RM8A 3PTQA 3C2VA 1L9WA 3GTHA 1XYZA 3CYJA 3WNLA 3W1UA 4GY7A 2EAWA 4IISA 1JUEA 1O1ZA 3EWUA 1F9CA 4PRTA 1BTCA 4LH8A 5A95A 1F3XA 1J0JA 1UYQA 3H23A 4GE8A 3DFTA 3DYOA 1WDWA 1IT0A 1G01A 1TPB1 2Y5JA 7TIMA 1QWGA 4MWAC 1BVNP 1T8QA 2FZDA 1ZAJA 3W2MA 3G5EA 1UH3A 3KCJA 3RCNA 3AIBA 1BD0A 1ONWA 5JBDA 2OWWA 3E12A 1NSJA 3NYZA 3UFYA 2QUVA 3VYLA 1SFJA 2X42A 5C9XA 5BWFA 1CIUA 4H6QA 2B7OA 2QJGA 4K68A 1OINA 4A3UA 4ZSTA 3A4JA 4CD7A 3HMJG 5E0CA 4MJ2A 1HXJA 3QY8A 4LRSA 2PDBA 1UZDA 2ZTKA 5DCDA 2W79A 3NYDA 1G1YA 1W1ZA 4FPSA 1R6WA 3NGJA 3N9SA 3TFCA 1ZBWA 2Z1SA 2ZXBA 5E93A 6ALDA 1R3VA 3P80A 4JL2A 3WQ8A 1JCTA 2Y8KA 4JNZA 1Q6RA 3HQ1A 4D8AA 3HN3A 2HISA 1XLAA 1WZKA 3QV9A 4YN5A 1ZALA 4LOCA 4C6FA 2FGBA 2OEKA 2VL4A 3GH7A 3GW0A 1F3WA 4GCAA 4UTHA 3KBWA 1LDCA 3LHYA 3OU8A 2DZVA 2WW5A 4YPJA 1IWBA 5D8WA 3SB0A 4M7SA 3OQ8A 4PB4A 4FLOA 3S1WA 5FCZA 3A5VA 1FHLA 3WLPA 3WLHA 4H7VA 1TQJA 3W74A 3MMWA 2G96A 4NILA 3R8HA 4AEEA 3WJWA 3SECA 4O1AA 4MUPA 2AOSA 1E70M 3IWPA 4GI9A 3UZJA 4AD0A 3L9CA 4W4QA 4O16A 4PE8A 2PE4A 3FA3A 4UFLA 1Y5WA 5EMMA 2PDQA 1SYTA 1KFCA 1N55A 4BY3A 1P5BA 2ZZ4A 4XZLX 3WL0A 4AX7A 4NVTA 3WK0A 1W56A 1BAGA 6XIMA 2AQOA 3G0XA 1TB3A 1NWTA 4S1FA 4UMCA 2V5CA 3VDCA 3W83A 2QHAA 4ZOAA 1GHSA 2QJHA 4IFRA 9XIAA 4LVDA 3BOFA 5CG7A 2YCLA 1SPQA 2WJFA 1UH4A 1XI3A 2E0PA 4F9DA 3GG0A 2DT0A 2HDJA 4MKNA 3W2KA 2GQAA 3CPRA 3AYSA 4X3ZA 3M07A 1UASA 3DXIA 2ONEA 1V3LA 4RDYA 1ZAHA 1SR0A 1TJPA 1RV8A 3CH9A 4L5ZA 4XO6A 4LAKA 4YVXA 2DEPA 4DNMA 3PPCA 3VNDA 4KFOA 1I2NA 2FDMA 3IIOA 1E1CA 3HA1A 4WK9A 3T7VA 1GOQA 3GFZA 1N8IA 1MZHA 1NH6A 3B04A 4MLJA 2I16A 2MNRA 3IV3A 3W4RA 1C9WA 1BKSA 2ODOA 4EOUA 1F6KA 4A3QA 1W1TA 4FOJA 3F4CA 3L4XA 3VDBA 1LLZA 2EPOA 3BDKA 3MZ2A 1FWJC 5HR6A 2QAFA 4GRSA 3GNRA 4HD5A 1PIGA 2EPNA 3W53A 1FDYA 3U5UA 4K1GA 3ITOA 1TMHA 2WKJA 3TROA 3SFWA 3G1FA 3MVIA 1BRLA 2P76A 3WO8A 1HJQA 4WLCA 3W7DA 2V9DA 4GQBA 2VD9A 3PUOA 3L0NA 2ZCGA 4FLRA 3RO8A 3UW6A 4PULA 3T55A 1U83A 3NG3A 3A9BA 4CD8A 1U2YA 1KGXA 3RF9A 4WDUA 4L65A 5JMUA 3RK8A 3S9YA 3R0DA 3BVJA 2WPGA 1ZCOA 5BNKA 4YU1A 5DX7A 4KWWA 3SCUA 1CENA 2V2DA 3HG4A 4JN7A 4IWWA 3THDA 1OFPA 3TQPA 1RY8A 3T0CA 1KBJA 3T4CA 3E0FA 1TYGA 2O7QA 1LF1A 3GLCA 3AIRA 1JYNA 3PPFA 3E5PA 4XBSA 1XX1A 2X40A 3T0BA 1R30A 4U5KA 4N2YA 4GFSA 1LOQA 2HVOA 2MANA 3RU8X 4AIEA 3SN1A 4GQQA 3LHTA 4RCXA 1E1FA 4O28A 4PTWA 2GGJA 3BW2A 3CQJA 3AXKA 1GOIA 3NPWA 5DQPA 1Y5XA 4HJFA 3H2AA 4Z1BA 1XPYA 4OBTA 5LA1A 3B8VA 4LTSA 3GU2A 4I5XA 4OTKA 7REQB 3O9NA 1OWQA 1PIFA 1HO1A 4LUYA 1V6YA 1ZTVA 2XJ7A 2ZKMX 1EUNA 3AIQA 3GYCA 4BHYA 5H8MA 4XZIA 3REQA 2E6YA 2FZMA 4ZMGA 2Z1BA 3NZ1A 1BF2A 3MW7A 4EXBA 3PUDA 1XDLA 3G2GA 1ZBVA 3TC6A 1LWHA 4GYKA 2QMJA 2HK1A 3VD4A 5LIWX 4WIWA 5FEWA 4UCFA 4B5UA 3KBJA 2XGZA 2PDUA 3K2GA 1NAL1 2INZA 3SIMA 1KGUA 3NQDA 2ZXQA 1RQBA 2CPUA 2YL8A 5JXQA 1JDCA 2WCSA 4GINA 3FJ4A 4QE4A 1Q65A 2VNCA 4Q4QA 3EB2A 1AW2A 1REQB 4A4AA 1TPWA 1MQPA 1DJYA 2FFIA 3T2QA 3S6OA 6TIMA 3LN3A 3QR3A 2WZHA 1QAPA 2PP3A 1B90A 3A21A 1JG9A 4N6EA 1W8SA 2CFFA 3Q4DA 4LF2A 1SJCA 3BCJA 3BURA 1X1NA 3BG3A 2FHBA 1DQUA 3PWAA 2C16A 2CBUA 3HV8A 4P7NA 1F6YA 3CPGA 4QLJA 1FFQA 3S1VA 2CZEA 4IPLA 3PULA 2XM1A 3LLDA 4LY4A 3M43A 5EYWA 1TJ1A 3BAJA 1NDWA 2H8XA 1BTMA 3W1LA 1LLWA 1ZHAA 4NASA 3DG3A 1DWGM 1TREA 4AB4A 4HZ6A 3QTGA 1FCVA 3USZA 3O7UA 3U4AA 4GYPA 3OZYA 3VFCA 3QPEA 4AF0B 3UYCA 3HZ3A 3QJAA 3USBA 3SAZA 2DSWA 3RCMA 3TYAA 4YTTA 2VQTA 1DHKA 1TPEA 1WXZA 1ZS2A 1DJWA 4H4IA 4ZQOA 1FH8A 4C91A 3ANVA 3MVTA 3OA3A 3VIHA 3MSRA 3N3TA 4QP0A 1W3TA 5CZTA 2X16A 3OTRA 4F66A 1VCGA 1VEPA 2XVGA 1TTQA 2DY3A 3DFOA 5LGXA 1YXYA 2WVTA 2P8BA 5DFAA 3SUWA 5H1WA 5T26A 5CGQA 4XZNX 4F40A 3M0LA 3QW3A 5I2UA 3NPVA 4PCSA 3VD5A 1R0MA 5IBXC 3GWQA 1E73M 3LCFA 1S2CA 4QBXA 4O0ZA 2QPUA 1F4HA 4RE3A 3CO4A 3URAA 5E0FA 3DIPA 3HQOA 3UXIA 3F2CA 4DXVA 1XW8A 3H2FA 1J0IA 2QZRA 4DBEA 3MO7A 5EY5A 4MUZA 3AHYA 2GYIA 3ARQA 3DBNA 1DE6A 3H7UA 1AK5A 4AXKA 3KM8A 4KIEA 5D30A 5BMWA 2I57A 1BQGA 3VOJA 1QPOA 4QISA 4CN4A 2PDCA 1A5KC 4HA1A 3LTSA 1E0WA 4KCUA 1BEUA 4S38A 2PDFA 3EB4A 1DEDA 4UOJA 1TTPA 2OJPA 1TFVA 1X39A 3AHVA 2A3LA 1VPXA 4KRZA 3L2LA 1JD7A 3E2VA 3KWSA 1XUZA 1S46A 4H9ZA 3VKDA 1BXBA 3O8AA 1MW0A 4Z2HA 2EG6A 2J79A 2PFHA 4H7ZA 1JZ4A 1RZMA 3CUHA 3WF3A 4B9YA 3PJTA 5EPDA 3SCOA 4EAYA 2QVHA 5DMLA 4JHOA 4LSBA 3UG3A 3LCIA 4KQNA 1A47A 1OGGA 1XBXA 3EX2A 1NTHA 3NZPA 1AQMA 1UWSA 3ZSTA 4WJEA 4JKMA 2DORA 3II1A 3DFSA 2B31A 4K8HA 1UWUA 3LXBA 4HHHA 3WL1A 3FVDA 1J01A 1GPFA 5A6KA 3K46A 2WJZA 1GOXA 1KQZA 1TG7A 4REQA 5FJRA 1VJZA 3U8GA 4EAMA 3B9DA 3T4WA 1H63A 3BQ6A 3PK7A 4TX9A 3S0CA 4LW7A 3BCDA 3GNXA 3MDWA 1CXFA 5G4EA 1ZGDA 2FMOA 3LGDA 3M16A 4GUIA 1KXVA 3VNYA 1K1DA 2GWNA 1R3RA 1XPGA 1DE5A 2XM2A 5CEWA 1I2PA 4ZQPA 2PDGA 1JL8A 3PN8A 4ORMA 5AOUA 1H7NA 2QPXA 4AZBA 2I9UA 1UC5A 1HKJA 4IMDA 2V5BA 1EGVA 4XD5A 4ENLA 4Q8UA 3NDOA 2JEPA 1N82A 5BMXA 4M1RA 3B03A 2CWXA 1LT7A 2DQWA 4H9TA 1ENUA 3VGHA 2J9ZA 3LXAA 2VWSA 4IIGA 4Q32A 4RW3A 2BXZA 3V0UA 3IIVA 3CWOX 3CTTA 2WWCA 3WN6A 4DUWA 5F2GA 5HNUA 3Q65A 1WE5A 4QROA 3LERA 3GZ3A 3W7GA 1KWKA 4FXJA 4A05A 2WNQA 3I10A 3MHFA 3GXDA 3AXXA 3OBAA 4H04A 2DUXA 3ECQA 1B3VA 2YXXA 3G1RA 2XVNA 4FS9A 2X7VA 3PNUA 1QW9A 3WLRA 4HOXA 2BBFA 4G7FA 7XIMA 4GZEA 4IIEA 4M1BA 1WZLA 2X1UA 1ZJHA 1XYMA 3SR7A 2FTPA 2OYMA 3NQBA 4W88A 4UNIA 3ALGA 4MAVA 3WELA 3S1XA 3EXSA 3VZZA 2AKZA 2OLHA 4ZQRA 1YNPA 3PTDA 3KVMA 5EFFA 3B8IA 4IXXA 4AHQA 3TQKA 1MUMA 4K3ZA 1W1A1 1DL3A 4PTVA 1V3IA 2PA6A 4JIIX 4P7RA 5CZSA 3KTCA 2C7FA 3GVRA 1FVPA 1UHVA 1C9DA 3POHA 2R91A 1EO5A 3SEPA 4I6VA 4PBGA 2P0OA 2OT1A 2GFTA 2VVNA 3BW4A 1MQQA 1FDJA 3B8SA 5CZ0A 2GUUA 2V2HA 3T08A 1MRAA 1PYFA 3MUZ1 2QCDA 2WNZA 1JJKA 2FPVA 3H12A 2NWRA 3BJTA 3NL2A 1XCFA 2DIJA 2JQXA 4Y9AA 1VFOA 3GNNA 1HP5A 1DJIA 1FY6A 4R85A 4GGBA 3W26A 1E4NA 1A5UA 4XD6A 1TIWA 4XAGA 5D32A 4EXQA 2F6UA 3I3EA 1XLCA 3AFBA 4HZ8A 2VEGA 1OD8A 4W7WA 3WBXA 1Q6EA 3KFTA 1XCXA 1J4EA 1NEYA 2E5DA 1GKQA 2A7NA 2O9TA 3ARTA 5DMMA 4J5NA 5KITA 1TPUA 3VILA 4PFHA 1W9VA 3U7BA 3ZT6A 1J11A 2XIMA 1ODZA 1WKDA 3UGVA 4ZQMA 1XRSA 3K1GA 2ZX5A 3TJIA 4Z2LA 4IUGA 1AFSA 1XV8A 4ZE5A 1FWEC 2IPGA 4GI8A 5HWJA 3DH7A 1V02E 3OZOA 4XWUA 2Z00A 1E6XM 1XSKA 2XINA 4ACZB 4X9YA 1KM5A 3GC4A 1WUEA 4NUWA 1AL8A 5LIYX 4BK9A 1XLEA 1J10A 3QC0A 4D6GA 5AC7A 1TCMA 3L21A 1X6LA 3PFMA 4Q8WA 3UXKA 1RK5A 5JH1A 2CKSA 3S46A 3WIJA 4LUTB 3VINA 4I6KA 1PO9A 4PMXA 4K7VA 3P8IA 1EZ2A 4LNCA 3KRSA 2ON3A 3VDHA 4CVWA 1OFOA 3GTIA 3FA4A 4Z17A 1EYWA 1AZ2A 4U5IA 1KFEA 4PR4A 5KSWA 2GVJA 1HJWA 4IFKB 1DWAM 1GJPA 1GG0A 3W37A 2NVDA 4BEQA 2J7HA 4BR1A 4L6HA 4UTTC 1EP1A 1PTGA 1GONA 3MHGA 4DJED 3E5BA 4LF1A 4JQ4A 1KFLA 4PUNA 3BE7A 3THUA 3C0JA 5ECUA 1V0LA 5XINA 1G7UA 3ZZ1A 1P0BA 1X6UA 5KZMA 3NNTA 4JTEA 1QPKA 2ACSA 2FH6A 2VI0A 4I5RA 3QHMA 4DXKA 2OCZA 3JZUA 3K8KA 4Z2KA 3FKRA 5AVHA 2XWEA 1OEPA 1ITUA 2FZ9A 5HWNA 3LYEA 1J93A 2EJ1A 2ZA3A 4XTIA 1WNOA 3R43A 3TNOA 3W2LA 3TYUA 1TR1A 5KINA 1G7VA 3WNKA 2XZ9A 1H3GA 3GR7A 2ZX6A 4DJFC 3PB0A 1H41A 3T81A 3CUZA 2E1WA 4BF5A 5C7VA 5EMUA 2NQJA 2WKGA 3GTXA 3UESA 3CK5A 3UR2A 4DF0A 2CZVA 4FI4A 1KV5A 1RR2A 1W9PA 2V5JA 3IRDA 1EC9A 1PZ2A 3EWBX 4H00A 4M5PA 4AD2A 6XIAA 1JZ8A 2YYTA 1MEIA 4M51A 5AHEA 4E8CA 4GH1A 4X61A 5BRPA 4DUOA 1CGXA 1QASA 1GVFA 2O0TA 4QEHA 4P8WA 2WSYA 1XRVA 4I9TA 2V30A 3NR0A 1E9LA 5A5WA 4N9EA 4XIMA 1XLHA 4DRSA 2I5GA 3NQGA 1ISVA 2DPEA 2ZRUA 4FEZA 2Y8UA 4MAZA 1TV2A 3THQA 5HQMA 1ZJAA 1LL6A 1A5LC 3LOTA 3GC2A 7ODCA 3NQ6A 4XKMA 2NQHA 3O6DA 1SW3A 3GHRA 4RDZA 4JKKA 3W7NA 1XLJA 4LWWA 3C2YA 5A94A 5XIMA 3W6MA 3PZUA 2F61A 3GH4A 1T41A 1MW2A 4B5SA 4TIMA 5JBFA 3QMRA 5CBIA 1XWYA 3S47A 3ZSSA 1IXPA 1OADA 1T96A 2NX9A 3SGGA 4GBDA 3GIYA 4CVUA 2YDAA 1HJXA 2IQDA 1JXKA 4YWSA 4XB3A 1LQAA 1BSLA 3IJ8A 1UZ4A 2GGGA 2PDNA 2FPTA 3CQKA 3VM5A 1Q63A 5AHFA 2PI6A 4C7FA 1Y0EA 3ONCA 1SZRA 3PZTA 3CIWA 1O95A 4UMAA 3NOEA 3WNPA 2PP1A 4OZOA 5A2CA 4LBSA 1LCOA 2GVLA 3HF3A 2EO7A 1V93A 3TW6A 5HJLA 4ACZA 4AZIA 5SWUA 4F0LA 4CKQA 2INEA 1HIZA 2FFCA 4L61A 3GR4A 5DEZA 5HQEA 2J7BA 3CHFA 4OE7A 3B9NA 1FDZA 4UIOA 1DJGA 3TTEA 3R8GA 4IPIA 5G1MA 3ZO9A 1KM4A 3L12A 1Q6GA 4MY9A 4HPGA 4L80A 4OV9A 4UTFA 4UQ9A 2G37A 1L2QA 3V16A 2HE5A 1UWIA 2BHYA 5M1TA 4HPHA 1JPHA 4B3ZA 4D71A 5KZ6A 2LLEA 1M9HA 4EPDC 3SFKA 1EJSC 1RH9A 4XZMX 2ISSA 5CLTA 2ZUMA 4OBSA 6REQA 1VPYA 4GI6A 5LSMA 1OIFA 2ZXAA 5FEXA 1G4TA 1GCYA 4C6BA 2HMCA 1JUKA 1HJVA 1HJUA 3T2OA 4FB7A 4UZUA 3EZ4A 2Y6ZA 1C93A 3GXNA 3UD6A 1W31A 3L4WA 3LU2A 1MMFA 2PODA 1T8XA 1A53A 4NYYA 4DI9A 4O12A 1IEVA 5DCEA 2HZGA 3WMLA 1EIBA 1M7XA 3O05A 4A8LA 3S2CA 1W3NA 3W84A 1WX0A 5JQ9A 2ZC1A 4WJ8A 1OZMA 1E3XA 4IXHA 5HUPA 4QG9A 3VMNA 3W7KA 3EWZA 1PB0A 2YBUA 3URNA 3WNNA 3FS2A 4PMRA 3PPGA 4UOQA 4HU3A 2WMHA 1WCGA 4W8BA 3DEQA 1RAKA 2VC9A 1FHDA 4RPQA 4JTJA 1Y65A 3GG8A 1HTIA 1TKKA 3LPFA 3TW9A 3VIPA 3QBUA 3ES8A 4XAFA 1N8FA 4HYWA 2VURA 2ZUSA 2Y5SA 2BXYA 3IV8A 4F0KA 2HBVA 3G1VA 4WKFA 2DZAA 1CLXA 3WLIA 1XD1A 3LENA 2OLSA 2PDJA 4W84A 2W0UA 3EOEA 1NOUA 2I14A 1Q6CA 4AISA 5LZLA 3VO0A 4XKYA 1OT2A 2GUYA 4B9ZA 1KTNA 3TC7A 2VVSA 2XFRA 4QITA 4JQ2A 1FWAC 4D6HA 3ARWA 4HGXA 5CGTA 3SQMA 5C9UA 1YPFA 1G69A 4AHOA 4U3CA 1JI1A 2AL2A 3OGVA 1LJYA 1W0MA 1JZ7A 1KB3A 4HNUA 3BMVA 1NFGA 3GUGA 4US5A 3RXZA 2X0HA 4MB5A 1LG2A 3TTSA 1CW2A 3WJSA 1PSCA 2GQ3A 3B0UX 4B15A 1ZJIA 1HP4A 1QCWA 1MYRA 3QZAA 2JK2A 4ATDA 2OO6A 2ZDSA 4M7TA 1DHPA 1XLLA 2WMGA 2Q3OA 3AAMA 4GQRA 3MT1A 4PRWA 2V81A 2HSAA 1RA5A 2PTDA 3S2MA 2DQXA 1ZSXA 3GDMA 1MUWA 4S3CA 1O4UA 4E3VA 4EANA 3QHOA 1EGMA 1M53A 2PCEA 1C8XA 4TTGA 2X2YA 4M29A 4JCLA 5IXEA 1QVBA 3BWWA 2J62A 2BOEX 1VGAA 2XSAA 4F3HA 2O9OA 2E6FA 5A8OA 3V0TA 4O13A 4FNPA 5BROA 3C5QA 1BGAA 1KR0A 4CQBA 3LRKA 1OVDA 2R14A 1TJRA 3EMCA 3WLMA 4M6QA 4NJIA 4UR9A 1XBZA 3TVAA 2C3ZA 1KC7A 5F4SA 1QPRA 2CCRA 3S42A 5EA9A 1S38A 5I02A 2JBMA 1VCVA 4YTUA 2QAPA 1GVIA 4QS5A 1EBGA 2QQ6A 2A5HA 1RCQA 1BVZA 1DV7A 1ZQ5A 3BZGA 1YEYA 4JEJA 3BLLA 1H5YA 3KOXA 3LHWA 4GXMA 5CC5A 1RK6A 2VQUA 5LHFA 1PTAA 1MXDA 2JIWA 4L4LA 4IG2B 1KRMA 1TRDA 2QNEA 1EOMA 1W1IE 2JFEX 4D6CA 1DORA 1E5NA 1VFMA 1UKQA 3N73A 3WK3A 4BS0A 2X1SA 1OFDA 3I3BA 1AMYA 4XBKA 4MJ4A 3ZR4A 3ID7A 4HSNA 1PKMA 5A6AA 3WQEA 1TV7A 3N18A 3UZYA 4GOAA 3BOXA 1Y8BA 4PUKA 1OX4A 3E2SA 1TE6A 3QN3A 3LK6A 3W7MA 4KT2A 2BP1A 4GISA 2WANA 4OVXA 5BU6A 3GXPA 3PUEA 3SM0A 4DEFA 2CLEA 2PF8A 3VE9A 3PZNA 4W7UA 2BMBA 2Z29A 2HVMA 2WMIB 5DBUA 3I6TA 4B92A 1BYCA 3QQWA 4TMBA 2C1IA 3WEOA 4XTDA 2VEFA 1GVEA 2YA2A 1ISYA 5A8MA 2D73A 4YYCA 4QDWA 4N9CA 1U30A 3TH6A 1ELSA 2VMFA 4KRTA 4IHCA 4QEEA 2QPSA 3Q37A 3P14A 3PBWA 1AZ1A 4LCSA 3SADA 4BKNA 1NM9A 1P0KA 1MUCA 3CXOA 2HV5A 4FA3A 1O5RA 4GNJA 5KTLA 5ABHA 2Y7EA 3A23A 3DOPA 4DBDA 3B9AA 4ZVJA 1Q3NA 1JCMP 5D33A 1UZHA 2BOFX 3RHGA 1TE1A 2WZEA 1CLVA 3N6JA 2Q02A 3TN6A 4AAJA 5I3GA 3MCNA 1V5XA 3A5FA 4Q8QA 2D2HA 4IFKA 4MNMA 3P81A 2WVVA 3PZMA 4MNKA 2PAJA 4I9MA 2E7FA 1VYRA 3M0VA 3M0IA 4V2XA 1V6XA 3C2RA 1JNEA 3RILA 1EUAA 4L7ZA 3FA5A 5GNXA 3TN5A 2P53A 1IIGA 3SRKA 2YA0A 1Y5VA 1B9BA 2HNHA 2YL6A 3R89A 3BAWA 4PZVA 1LOSA 2ZOXA 4RE2A 1E1EA 3NIYA 2PD5A 2WJDA 4QS6A 4CCEA 4O1BA 3V3WA 2DU2A 3CNYA 3GAKA 2WBKA 4G6CA 2EPKX 3TXVA 2RDTA 3T07A 2PURA 2R94A 2G95A 4PUUA 1QT1A 5D2TA 2PGWA 4YMZA 2ACQA 4TV6A 3MANA 4KWVA 4GFIA 1H1ZA 3KTSA 4HK5A 2OWXA 3WQ6A 3W2JA 2O7SA 3ZM8A 2WXDM 3GB6A 3PHAA 4JICA 4RZ6A 3QFEA 4IPPA 4DXXA 3FGCA 3S1UA 2NX3A 1W3LA 3T6CA 1BF6A 4JTQA 1GG1A 3W0KA 1E43A 3URBA