4XWUA

Structure of the imp dehydrogenase from ashbya gossypii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
389
structure length
314
Chain Sequence
TYRDAATALEHLATYAEKDGLSVEQLMDSKTRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYEPLASKSTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
source organism Ashbya gossypii (strain atcc 10895 / cbs 109.51 / fgsc 9923 / nrrl y-1056)
molecule tags Oxidoreductase
total genus 107
structure length 314
sequence length 389
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xwuA00
1FDJA 2JK2A 1YDVA 4PCFA 1VCVA 1LRTA 4UTJA 4A2SA 2E68A 4JTUA 1QFEA 2OT0A 3BLFA 1OVDA 3B0UX 1KBIA 2YSWA 3L0GA 4UTUA 1F6KA 1OX5A 1TPEA 2CLMA 1L2UA 3OG3A 2ALDA 5H91A 1LORA 3NQGA 1FY6A 1LRQA 3GZ3A 3QQ1A 1FDYA 4FB7A 4Y6GA 1KM2A 2RDUA 4K36A 1KFBA 1W5PA 4FNRA 3B8DA 4IGHA 3QF0A 4JTKA 3GX9A 1P0KA 3W7LA 4R7JA 2Y7GA 1S5TA 5FI8A 4CNNA 2G5WA 2FPYA 1TPH1 1YYAA 3KVJA 3DU0A 1AMKA 1JCXA 1W5NA 4CQAA 2V9DA 1HO1A 4DELA 2RDTA 2FB2A 3NZRA 1AK5A 2WOQA 3GDTA 3CT7A 1H5YA 1SW0A 2FFCA 3O1NA 2ZZ3A 3QSTA 1S5VA 3W1QA 3W7JA 1AW5A 1KV8A 4O10A 3M7WA 4FHAA 1OFEA 3THQA 4A29A 1VHCA 3TUUA 4WQ6A 1ZFJA 3MW7A 4W9TA 4UTTC 3S5YA 1H7NA 3Q94A 3NG3A 1A5SA 3QYQA 3UD6A 2A0NA 4I7UA 1QAPA 3TSMA 1EEPA 3C2FA 3SGZA 5T26A 5TIMA 3BPWA 2QJGA 1SO3A 2WQPA 3IIOA 4PH6A 4RX0A 1NEYA 1VCGA 2CWNA 3HO8A 4AWTA 2PCQA 1LYXA 5GVJA 3LHUA 3PG9A 1JUEA 2VC6A 5DBUA 3P81A 1OX4A 4XKYA 3DENA 1D3HA 2H8XA 4JTIA 3MHGA 3BG5A 2H6RA 5FEZA 3ZR4A 2DJLA 3WK3A 2PRLA 2RDWA 2XFWA 3TMLA 2DZWA 3EX3A 3RU6A 3NVTA 1P0NA 3C2VA 3MYOA 3RLVA 4BWLC 1W37A 5AFDA 3LX9A 4UNKA 3ZFHA 5C54A 3PB2A 4ZQPA 3WJWA 1UCWA 5CZSA 1I2NA 5E0KA 5G2IA 5DLCA 3PUDA 4LRTA 1TPUA 4O4VA 3UZJA 3L0NA 3M47A 1IXNA 4OQVA 3CIXA 4ZQRA 1RD5A 2H90A 4FF7A 5DBTA 3OVQA 5FF4A 2GOUA 4O57A 4NUWA 1W0MA 3TX9A 1JUBA 3DZ1A 1ZAJA 2HS8A 4J9JA 3N9RA 1P4CA 2OJPA 2XN1A 1JCLA 3WK1A 5D30A 3PB0A 3G8RA 3K30A 3SR7A 1OFPA 3FS2A 3HBLA 1EP3A 4WJEA 4UTIA 3G1XA 4IQLA 4QAIA 5LNUA 3TW7A 3T78A 1G7VA 5C5YA 3W1NA 4IPJA 2WJZA 3LV5A 4K38A 4EOUA 1Q6RA 4DO5A 5I3IA 2OZ0A 3TFXA 5HWMA 1O60A 4Z0JA 1GEQA 5D09A 2Y62A 2C3ZA 8TIMA 4NJHA 3RFAA 2TRSA 5EA9A 3EB2A 2Y89A 4X2RA 1O94A 3QC3A 2I1OA 3OVPA 2ZQ0A 2C19A 3HGRA 2H3DA 3LGEA 3WJYA 4K7VA 4OV4A 3RNDA 2GQAA 3GNDA 5CPLA 1IXPA 5G2WA 1I45A 2ZBTA 1QCWA 2B0MA 3L66A 3W1AA 1DORA 4CLMA 3M5ZA 1KBJA 2CLFA 3NM3A 1B57A 5HUPA 4A3UA 1W31A 4CCCA 3NQMA 4PEKA 2NV2A 5FF7A 1ZAIA 5I3HA 4UMAA 3P5YA 5D02A 3NQDA 1WBHA 2AAMA 1HUVA 4JDYA 3L5AA 3L65A 2YFNA 3BLEA 1ME9A 2QDGA 3W84A 1BWLA 3CWOX 1XI3A 2X1UA 2W6RA 4JY8A 2ZA2A 3PM6A 1OFDA 1OFAA 3W75A 2YX0A 4JX4A 3LRKA 2NUXA 1FX6A 1TO3A 3S5ZA 1ZENA 3HGJA 3NGJA 4R33A 1F76A 4S2CA 3VI2A 3HMJG 1C8VA 1KTNA 3O15A 1B4KA 2PRHA 1T96A 3KOFA 5FF2A 4XWUA 2ZRXA 2DP3A 3NL5A 3TIMA 1LROA 1PHWA 2W79A 3PVFA 4DXVA 1OF6A 3TSBA 2XN2A 2QKFA 1KM0A 2ZDRA 4K6AA 3N73A 1M7OA 1J5TA 3DKLA 1OFRA 3GR8A 1LCOA 2QCFA 1NFBA 2A2IA 3SJ3A 3NR0A 1HFBA 1YPIA 3OIXA 1GVOA 3R2GA 1Z41A 1QO2A 1IIHA 3CC1A 3LTYA 3M5YA 1ZHAA 1UBSA 4MYAA 3FFSA 5ABTA 1KFEA 3LTSA 3LCIA 4N9DA 3PC0A 2V2CA 4RV8A 1J4EA 2V5LA 2E6FA 4UCGA 3UWZA 1I2OA 3FA5A 4I7VA 3C2OA 2R94A 2NXHA 3VFLA 3UWVA 3A24A 2FQIA 3QMRA 1TPFA 2QCNA 1DQXA 4YWIA 4UXDA 4X9SA 2RFGA 3IVSA 5AHFA 3LLDA 4N4PA 1HG3A 4OV9A 3DFPA 3M9YA 4K39A 4E2BA 1CW2A 5EYWA 1GTEA 3MP5A 4AEOA 3GB6A 1YXCA 3THAA 1H60A 1DJQA 3NXFA 5K4XA 1ZY9A 3N2MA 4MLJA 3EX4A 4ZQNA 3WJZA 3M16A 3NQFA 2FPTA 4Z0SA 1EUAA 4AXKA 3UY7A 4ALDA 1TRDA 1JCNA 3NQ6A 3LV6A 3M6YA 3P82A 3H55A 4O28A 1W5OA 4WZHA 4AHQA 3G3MA 4JYFA 1NF7A 3TKFA 2YPIA 3TAKA 2Z6IA 1SFLA 4FNSA 3TC7A 3W1MA 2NV1A 2CLEA 1DKWA 3W2MA 1UUMA 5LHEA 2CZEA 4UTHA 4GXMA 1M6JA 1ZAHA 4N9CA 3S6DA 5J5DA 1RZMA 3PBUA 3INPA 1QOQA 4FIRA 3W7QA 3EEGA 2Z1BA 1JULA 4K7YA 3NPXA 3IIXA 2Y70A 1QO5A 2J6XA 5EBUA 2BXVA 3R12A 1G7UA 3VKJA 4UMCA 2ATSA 1LOLA 1EP1A 1TIMA 1YXYA 2YZRA 1WAUA 5CSRA 2ISSA 3LRMA 3EKZA 2OX1A 3BGGA 3BARA 4BFAA 4LRSA 4AHOA 2VOMA 4NX5A 4FXRA 4LW7A 2JKAA 1VR6A 4Z1BA 3NQEA 1K7XA 1WBJA 1KM4A 1W3IA 1FWNA 1TREA 2BTMA 3S0CA 1G6CA 2V2DA 3HPXA 4UTTA 4LV9A 4TMCA 1H61A 3L5LA 2JGYA 3KX6A 4TX9A 4O17A 3FYPA 1TSIA 1DVJA 2ZYFA 4RK8A 1TQXA 3BG3A 3SZ8A 1TTJA 2B7PA 3UWYA 3M5XA 1GPWA 4TO8A 3M5VA 3FJLA 4X3ZA 4XKYB 1ML1A 3C61A 4WUIA 1OFQA 3O6YX 4R34A 2QCEA 3LCWA 1IXQA 3HQ1A 1JVNA 5K2ZA 3LXAA 2PURA 1KV5A 1D3GA 3MP3A 5CZJA 5HWJA 1KLYA 3BW4A 1H62A 1M5WA 3W22A 3N14A 3W72A 4B5NA 3TDFA 1ZNNA 4QM1A 4UFHA 1W3TA 2TPSA 3F1QA 4XQ6A 5FEPA 3PULA 3PS7A 2BWGA 2VEIA 2C18A 2X1RA 3PBWA 5DXXA 3B06A 2VEKA 1O5KA 1XBVA 2J27A 2Y85A 3QZEA 1TJRA 3MBDA 3NNTA 4UUIA 4NQ1A 3EXSA 3MHUA 5D2YA 2OMAA 4FNUA 3WFAA 4NXKA 3QM3A 2DZSA 1GZGA 3L0KA 4WOQA 1RQHA 1IGSA 2CLKA 1JQVA 3FEMA 4ONVA 5HULA 2VKZG 3MI2A 2FPVA 2EKCA 2QJIA 1D9EA 4GUIA 4JR5A 3FYOA 5AC8A 4ADUA 4JD4A 4O19A 3QH2A 2DU2A 1RPXA 4Y90A 1XFBA 3W70A 3W7GA 1I2RA 2ZZ1A 3HGSA 2E1DA 4CCEA 5CPMA 1RQBA 1FWWA 3LHTA 4HPJA 3IVUA 4ICNA 4CQ8A 1BKSA 2G96A 3W87A 3EWUA 3BW2A 2ZZ4A 4X22A 3KFTA 4YMZA 4HIBA 1PHQA 2V5BA 3T40A 2P1FA 3W7RA 3P8IA 1A5AA 4ORIA 1H1YA 1FXPA 4IXHA 4MZYA 1EB3A 3EX2A 2ZZ5A 1G69A 3STEA 4ZVJA 3N3MA 4H4IA 3GDLA 4UTWC 3O06A 4GWEA 4YCPA 2Y6ZA 3MHFA 3BK0A 3SY5A 2C15A 3OHIA 1H7RA 1TPVA 1W54A 3P80A 5D2WA 3LHZA 4L4MA 1JCMP 4UFLA 4HNVA 2ZCGA 2A5HA 5SWUA 4UIOA 4HNUA 3MI3A 3CIWA 4C1LA 2VFIA 4JTLA 1FBAA 3A9IA 3BV4A 2QCCA 4O15A 4WX2A 3KHJA 1TMHA 3VE7A 3R89A 3EWWA 1LLWA 4JDBA 4MY1A 1H51A 1QWGA 4UR8A 3L5MA 3PBYA 3ABQA 1R47A 4LC8A 4Y8FA 1F6PA 2R8WA 1ZCOA 4E2DA 1K03A 3UZ5A 4ZZ9A 1OYAA 3HOJA 4PFMA 2J9YA 5F2LA 1MXSA 3IGUA 2G97A 4IX2A 5DCDA 3NL3A 5DY2A 4GC4A 1QNVA 5TBOA 2NXGA 4DQWA 4N6EA 2NUYA 3ABSA 1FQ0A 4UFMA 4ML9A 3TK7A 2DZTA 3TJXA 3LI0A 3DBPA 3RF9A 2V2HA 1EX5A 1YADA 1OK4A 2X16A 3G18A 5LHFA 1H63A 3H54A 3UXAA 5D05A 4C1KA 2WNZA 4AF0A 2RHGA 1BTMA 3GDMA 2DZXA 3NPVA 2H8ZA 2HS6A 3E12A 3E96A 1Y0EA 3TW6A 1VC4A 4GRSA 2VFFA 1NAL1 3EWZA 3L68A 3ATYA 1MEHA 5EL1A 4LVBA 5FESA 3BW3A 4AWSA 4OT7A 1JRCA 3W3OA 3LBCA 2VEPA 3W83A 4WY0F 5HUOA 3G1FA 4WXZA 3C8FA 5CZ0A 1OX6A 5I3FA 2NLIA 3DKJA 1TPB1 3HG3A 1K7EA 4P61A 5EKYA 3CHVA 4M5PA 1C29A 3W7PA 2WKJA 3B4UA 4OHQA 1Q45A 1JRBA 3ZWTA 1DOSA 1XC4A 3W7OA 5DCBA 1YPFA 2G95A 1QDSA 3TSDA 4EF8A 4QJ1A 4M19A 4RZ5A 1HTIA 4KFOA 2X30A 1YDOA 3P61A 3F03K 1O4UA 1R2TA 3BLIA 3CEUA 1LBFA 4DF1A 1SZGA 5G2HA 5HQEA 4L4LA 3P7YA 1LOQA 5U4NA 4MOZA 4WXYA 3MWAA 3TJLA 1I8JA 1SO4A 5CSSA 4HHPA 4NX0A 4LC6A 4HSOA 4LUIA 2GUUA 3ANYA 2EAWA 2YFOA 4O11A 4JICA 1FCVA 1SW7A 2QR6A 4RJEA 2PRMA 3PAJA 3W9ZA 4XTIA 1K8YA 3IGSA 4JTGA 4WY0B 4N02A 1TPWA 2AGKA 1Q6LA 1TV7A 1B9BA 3M1ZA 5F2GA 1WOBA 3NL2A 1Q6QA 2GVLA 4Z1DA 4PC8A 1N8FA 4AHPA 1WQ5A 1XL9A 1GVSA 4IXXA 3BGJA 4NVTA 1VYPX 1F74A 3M43A 3NL6A 3G0XA 4IMCA 4JGDA 4MUZA 2B4GA 3UNDA 1W5MA 4DF2A 3G0SA 1KA9F 2UV8G 2EF9A 3LCLA 3IIPA 2J9ZA 1TV8A 3L9CA 1AW1A 3SIZA 3C2RA 1LP6A 5I3KA 4BK9A 4ORMA 3FLUA 5F4XA 4K8HA 4IMGA 3CLMA 4EWND 5DY3A 4O1CA 3NPUA 3LB0A 1K02A 1EIXA 4NT0A 5CG7A 5E93A 3PSVA 3DH7A 3FIGA 4N9EA 4HSNA 1JQXA 4S2BA 4FX8A 4P2VA 4H6KA 4JX5A 3I7RA 4K37A 5IM51 5G4EA 5BW6A 1XUUA 1E51A 1QR7A 3LLFA 3U8GA 3S9YA 3BG9A 1ME7A 4LVAA 2C13A 5HNRA 1OG0A 1RV8A 2QUVA 1P1XA 1LLZA 4NJJA 2A6NA 3GAKA 1G4PA 4DF0A 2VFDA 3E02A 3LOTA 4FNQA 4JY9A 3LRLA 4ZL1A 3OA3A 1ICPA 1KM1A 2V82A 5K9DA 4Z08A 1LZOA 3F4WA 1K3UA 1SZNA 2JKEA 4M6VA 3TROA 2B7QA 5DXYA 1N7KA 3S5OA 2YW3A 1SSGA 4LOCA 1K7FA 1J2WA 3LCGA 1X6UA 3S1VA 1XDLA 7TIMA 4JS3A 3UPWA 2FB3A 2VFGA 1F2JA 2C14A 4R53A 4AWUA 5C55A 3F4NA 2Y88A 3O6CA 4IPIA 3UWQA 3HG4A 1WA3A 1N55A 1EPXA 1KFJA 1WOAA 4IMEA 1TTIA 3SI9A 1ZJIA 4NJGA 4GUFA 1XM3A 2ISWA 3UWUA 4M6PA 3I7QA 5HMSA 1SUXA 4CNPA 4QNEA 3AO0A 3DHDA 4LVGA 4IMFA 4LS1A 5D2XA 3C56A 4N2YA 4NNCA 1OYBA 2J88A 1DQWA 2ZRZA 4IOTA 1L6SA 1MZHA 3RK8A 5DELA 2A6LA 4AB4A 1QOPA 3CTLA 4O12A 1W56A 1FDZA 4LS0A 5C2XA 3LHWA 4A2RA 3HPZA 1WXJA 3M44A 1VYRA 2VXNA 1X1OA 3KRSA 4DO4A 5BMWA 3GAYA 3NA8A 1AW2A 3QW4B 2CLOA 3W73A 3Q58A 1TYGA 3A5FA 1GOXA 3PF3A 2NUWA 4UTWA 1W1ZA 2O7SA 4MLRA 3O63A 1W8SA 4CCDA 3GXNA 1IIGA 2NWRA 2YW4A 1Z42A 3NQ7A 3ZWSA 3LHYA 4Z1CA 4BI7A 3TC6A 1SZFA 3TH6A 3DGRA 4N9BA 4UMBA 5LGXA 4O4WA 3Q37A 4O54A 5TQLA 5F4WA 2O7QA 3ZS4A 1GG0A 3V75A 2CLLA 3NQCA 5I3GA 1FWRA 1TB3A 4LUJA 4EF9A 3GKAA 3LCHA 1MEIA 4MY8A 3W2LA 5D04C 5KMYA 1VZWA 2DJXA 1SQ7A 1YLVA 3NAVA 4RXFA 1H1ZA 1A5BA 1VHNA 4QSHA 4O1DA 3CEPA 1LDCA 1TCDA 1TTPA 3DFQA 3W7KA 4CNOA 2ZZ2A 4GJ1A 1THFD 4HNTA 5LNSA 3M0ZA 3QMTA 2TSYA 1X8FA 3WK2A 4O16A 3CPRA 3IVTA 1GTHA 4QITA 3MBFA 4M7TA 1KTBA 1UB3A 2TMDA 3HGOA 3I65A 2D73A 1F73A 1GVQA 5F1VA 3TQVA 1SFJA 4MY9A 1IXOA 1KW1A 5K3VA 5G5IA 2R14A 3DAQA 4JYDA 3STGA 3MUXA 3TXZA 4YXGA 1K8ZA 2VEMA 1OX4B 3GDKA 4FNTA 3W71A 1A5CA 1W5QA 3OVRA 2WSQA 3B03A 3LCXA 2ZRVA 2E77A 2ZRYA 1JJKA 1VCFA 1F5ZA 4H3DA 3FJ6A 2DZPA 4JTEA 4UFIA 3E49A 3KAOA 5LNWA 1JR1A 1LBLA 1SU5A 4UR7A 2HTMA 1GWJA 1KTCA 1W3NA 4Z1AA 1U5JA 1IF2A 2WNNA 2ATMA 2Q3OA 3SW6A 4BWLA 3M41A 3IRDA 5H2ZA 2A4AA 2Y61A 3KVLA 2Y7FA 3CU2A 3W2NA 1T8XA 1H7PA 1SPQA 1QPRA 1VJIA 3O16A 4ZQOA 2VFEA 3TAOA 3IGXA 3C6CA 4GE8A 4MFEA 4OGZA 2E6YA 3G1YA 1GVRA 1F7BA 1KM6A 4QISA 1FXQA 5HINA 2QCLA 3W1UA 1ME8A 4BR1A 3C52A 1K8XA 1ALDA 5LNRA 3W86A 5KITA 4LVFA 1BEUA 3DFTA 4FO4A 3D0CA 3W1XA 3W7IA 3FKKA 3GXTA 4OU1A 3A23A 3NQVA 4S1FA 2QCDA 3MP4A 2CZ5A 3U2OA 5HWNA 5CPNA 3WK0A 3CB8A 4LV4A 5AYZA 2A7PA 2ZTKA 1JCYA 3IV3A 3W2JA 1DBTA 4WOZA 3VNDA 2GJLA 3I7SA 2X1TA 3MYPA 5D03A 1O95A 1XXXA 2QUTA 3BO9A 3LXCA 5LGZA 2QAFA 2C16A 1I2PA 4M6QA 1DL3A 5K4ZA 3LM7A 1KFKA 3EXRA 3W1TA 4Y9AA 1SO5A 2WV8A 1G4SA 2QCGA 4AMAA 2H3BA 2Z6JA 1GT8A 2ZRUA 2Y7EA 2BSLA 1U83A 3TQKA 4O52A 3GR7A 2ZA3A 2TYSA 3HPSA 1EUNA 5BMXA 3T55A 5D32A 2RKXA 4QQ3A 1OHLA 1XKYA 3W1RA 3G1SA 5AC7A 3MI6A 5E1QA 3L21A 3PG8A 1QPNA 3LI1A 3UYCA 1LM1A 2Z0IA 4O1AA 3EXTA 3TCEA 2E5DA 4RLIA 2GQ8A 4ADTA 3P84A 4RXGA 1VGAA 3DFNA 2QUUA 2V81A 4LT9A 4RZ6A 3TA6A 1T0OA 2CFFA 3MMTA 2VENA 5KSWA 4IWWA 4TMBA 5IBXC 3LXBA 4MJZA 2IQTA 1VLWA 4N4QA 4FX6M 5DN1A 3PWAA 1BWKA 2V8ZA 3NO5A 1ONRA 4O1BA 1F05A 4JNMA 3QPZA 1R46A 4UNLA 5F4SA 4YCOA 2FLIA 4LNYA 4IJBA 4GUGA 1M7PA 4HKPA 4KKXA 2ZTJA 1FUYA 2FJKA 3GK0A 4K8EA 2VFHA 3GKFA 4O0KA 4RCXA 3T7VA 3O8AA 3W7DA 1KFLA 3PSWA 1LTDA 2CLIA 1A53A 2FIQA 1JUKA 1DJNA 1I2QA 3G0UA 4UTLA 2FDSA 3FKRA 2NZLA 4OBTA 5AC6A 1KM3A 2QCMA 2ZZ7A 4O14A 3C2EA 3TV8A 1GYNA 2A1YA 1TRIA 2I9EA 1MO0A 1TPC1 4DO6A 3V1PA 4ZQMA 2FTPA 5CKSA 4FXSA 3DXIA 4GFSA 4NU7A 1G67A 1Z48A 3GNNA 3P67A 1S3HA 3SGUA 5FEWA 1JCJA 1WYIA 2W0UA 4DBEA 2P10A 1TQJA 3P62A 4FX7A 2PC4A 1VYSX 2BLEA 2E5BA 4HN4A 4NJIA 5F2IA 3ABRA 2R91A 1Z44A 3S8HA 2HSAA 3IIZA 3VE9A 1YTDA 1PS9A 2E09A 3STCA 5KTLA 4JTHA 3UY8A 3L67A 2EPHA 3AJXA 3LBMA 3N19B 2PE4A 4Q33A 1OYCA 2CLHA 2AQWA 4MPQA 3E9AA 1VPXA 1L6YA 3UQNA 2YYUA 1R30A 3G8EA 3YPIA 4UFKA 3RLUA 4HNNA 3R8RA 3B0VC 3ABOA 3W7EA 2WPBA 4KFPA 2C1HA 2Q3RA 2B7OA 2QDHA 1XBZA 2JKPA 4IMDA 4TIMA 4AH7A 3SFKA 3S1WA 5KZEA 3W2UA 3LTPA 1VLIA 5AYYA 1P5BA 5BOOA 4JTJA 1KM5A 2KZHA 3KVMA 4O8RA 4YL2A 1MEWA 3USBA 1KLZA 2P0OA 3MO7A 3R13A 1SW3A 3C0JA 3B05A 1X7FA 4IX0A 2QCHA 3QFEA 2XN0A 4POCA 3GIYA 4U28A 3KRZA 4KWVA 5F2MA 2Q8ZA 1V5XA 1R2SA 4O18A 5BRBA 3GXPA 5I3JA 3S1UA 2GVJA 2EGZA 1CX9A 3KRUA 3QEZA 5AHNA 2Z2UA 4E0CA 3NPWA 3C4UA 4O50A 3S1XA 2NX3A 4UFJA 4NNAA 3P8JA 3GDRA 2V0TA 5L6UA 3CWNA 4JXCA 3OBKA 2NWSA 2VELA 5A8GA 1B4EA 4A21A 3P5ZA 3NQ8A 5AHLA 3HG5A 1HO4A 1OFOA 3W23A 4JTFA 5MHBA 3DI0A 3TFCA 2Y63A 1H7XA 2YR1A 4BI5A 1SO6A 1MSSA 2GQ9A 4BI6A 3TXVA 2GPTA 5D2VA 3VCRA 5FF0A 1EWEA 1RQEA 2YXGA 3JRKA 3NQAA 2WSRA 2I14A 3P60A 1GQNA 1ICQA 3STFA 5J5RA 2YDAA 2GVGA 4MZ8A 1XUZA 3W7MA 4HPXA 5D2TA 3S5NA 4KFNA 3QRHA 4RKAA 4MKNA 1XDMA 1Q6OA 3PBVA 4LVDA 4M7SA 1CI1A 5EY5A 3W76A 3W74A 1WX0A 1ZALA 1G4EA 3TR2A 2QF7A 2CZDA 2YCEA 4UTMA 1C9DA 1TJPA 5C6MA 1O5XA 1VH7A 4CQ9A 2YGYA 5DCEA 1SSDA 1DHPA 4JIPA 5A5WA 4A22A 2QCDB 4AAJA 1OFBA 3G1VA 3SSJA 1WV2A 1LRNA 1KFCA 1L6WA 3U6WA 3W07A 3RMJA 2BZNA 4JTSA 3I68A 5D33A 4PL1A 4MJMA 3CM4A 5AN7A 2YYTA 2LLEA 2ZZ6A 3HIJA 6ALDA 1PE1A 1FWSA 3N34A 2DZVA 3DI1A 4I9AA 1LOSA 4NZFA 3H53A 2ABAA 1GG1A 1QPOA 3HJZA 3QW3A 3TMQA 1OABA 5AHMA 1XCFA 4NJKA 2B7NA 3NEVA 3UPBA 3W2KA 3G3DA 4GNJA 4Q32A 5G1YA 3G24A 5AHIA 1PIIA 3EX1A 4OE7A 5F1UA 1GVFA 4JIQA 3GVGA 1XBYA 2CZFA 3SECA 4DPQA 4XBKA 2EHHA 1AL7A 3B04A 3T44A 4DBDA 3C3NA 4EIVA 1TPDA 4QNWA 5D38A 2WO5A 1NSJA 2E6DA 3R5EA 1FCQA 3P74A 2NX9A 3W1LA 4DEFA 1OK6A 4JTTA 2ZRWA 4GUHA 4YLWA 1GJPA 3BVJA 1UJPA 1VS1A 2CU0A 4EVZA 3KVKA 2F84A 5CGQA 3TU9A 2J24A 3PUEA 3N2XA 2X1SA 1H7OA 3W85A 4XZ9A 1ADOA 4MYXA 1AG1O 4TR9A 4ZQCA 4LU0A 1OJXA 3TQ0A 1HL2A 3ATZA 2QAPA 3ELFA 3IEBA 2Y7DA 1FCBA 4PODA 4I7WA 4JYEA 2QJHA 3WJXA 1PCKA 5IBXA 1QMLA 3Q2DA 3G1AA 3EWXA 3WJSA 1S5WA 2E5CA 3EX6A 2CW6A 5G1TA 5K9CA 2BX7A 3OEXA 1EWDA 5FF3A 3TE9A 1B3OA 4BF9A 4LY8A 4KWWA 4D2JA 2OCZA 5BNKA 3G22A 5HR7A 5AYXA 3JS3A 4JEQA 3NQ2A 1TV5A 5FEXA 4G1KA 1FWTA 3T4CA 1YXDA 3I6RA 1PV8A 2C6QA 2NX1A 4QIUA 3KXQA 4AF0B 1NF0A 3QPYA 4FEZA 1VQTA 1RVGA 3N9SA 5LSMA 3CQ0A 4XUGA 1G4TA 1EP2A 3E0IA 4WY0A 4PTNA 1QPQA 3NOEA 3HF3A 4OWGA 4O13A 5HR6A 2NXIA 1YTEA 2DZUA 1PCWA 4FIQA 4MIMA 3W1PA 4PL2A 3NZ1A 1A50A 5D37A 2Q8LA 4GBUA 5AHEA 1H7WA 2OT1A 4ADSA 2JBMA 1LBMA 1PVNA 5K7JA 4TU1A 2A7RA 4AVFA 3S42A 5U7SA 4LS2A 3UWWA 3HG2A 3B0PA 1SZEA 2ZFAA 3NM1A 1ICSA 3HB9A 1SR9A 1Q3NA 4RZ4A 5HJLA 4E38A 3PUOA 3UXDA 5EMUA 4IUOA 3DHFA 3A22A 4JN6A 4NXSA 2F7FA 1EA0A 4Q4KA 4LTSA 1OF8A 3QMSA 5K9XA 3DFSA 4DPPA 4GUJA 4NZJA 3G1DA 3O05A 3FOKA 5G4WA 3PY2A 1I4NA 3PR2A 5CPOA 4RR4A 3NDOA 4U4MA 2C0AA 2E6AA 3LHVA 5KZMA 1V7YA 1YDNA 3L2IA 2A21A 3QSRA 1WDWA 1T99A 3O6DA 1TTQA 5LKYA 1R2RA 3EKLA 5AB3A 1UASA 5AOUA 2J9XA 2DORA 3GLCA 2WNQA 3A21A 4N6FA 3W6YA 3W7NA 2ABBA 2QEZA 3A5VA 1UUOA 5KZDA 4WD0A 5L9FA 2ISVA 4LWWA 3LDVA 4O0ZA 3QQ0A 1H50A 1YTKA 3O07A 1XBXA 3W7CA 2GJNA 4MVAA 4JX6A 3LCFA 4Y96A 2HMCA 3JR2A 3QJAA 3W7HA 1VRDA 1GYLA 6TIMA 3EWBX 5EPDA 1L9WA 5CZTA 5KINA 2A85A 4UTKA 5LZLA 2V30A 1FCUA 2ZA1A 3W88A 3GYEA 1X1ZA 3NYZA 3MJYA 1DV7A 3G1HA 2RH9A 1AL8A 2A7NA 4UC5A 3LERA 3IIVA 4O53A 4ZMGA 3DFOA 2JGQA 1NVMA 3TNOA 4MZ1A 5LNVA 2X2GA 3EWYA 1PL9A 4NNBA 4XTDA 4XBSA 1RR2A 2WSYA 4FNPA 4MFDA 4HT3A 4PA8A
chains in the Genus database with same CATH superfamily
1HJVA 2OYMA 4LUTB 4UTJA 2FKPA 4Z2HA 1QFEA 5GQBA 2D2GA 3BLFA 3G1RA 5CBIA 1KBIA 3ZLGA 5BOEA 4IIEA 4C5ZA 2AGTA 1OX5A 1TPEA 1M03A 4IFOA 1MFVA 2ALDA 2BFGA 5H91A 3NQGA 1JGIA 2VI0A 3GZ3A 3SRDA 3QKZA 1OG6A 4HZMA 4IGHA 2XVNA 1JPIA 3GX9A 1P0KA 1KXTA 4GNKB 5FI8A 3VD9A 1TPH1 1AMKA 4NYYA 3UR7A 2CETA 2D23A 4JFWA 2ODOA 1W5NA 2V9DA 1HO1A 1FH9A 3NZRA 1H5YA 2WVSA 3ITOA 4A6GA 5C9RA 2PDYA 1KV8A 4XG1A 4MAZA 3M7WA 2VR4A 2PU1A 4MF4A 3BSMA 4L56A 3R6IA 2GFTA 4UTTC 3HA1A 2GJRA 1UR2A 1UIPA 3QYQA 2YXXA 2HNEA 3H12A 4JFUA 3C2FA 1ZBWA 4IM4A 4ACZB 3CMGA 2VCCA 3CAVA 4LSBA 3IIOA 3S1GA 4PH6A 1A5NC 2WXDM 4RX0A 5IHSA 3FA4A 3BUVA 1UMLA 1JUEA 4C6EA 2PBGA 2VRQA 3P81A 2HE8A 4HHLA 1Q65A 1D3HA 4S3JA 3K13A 2J75A 4JTIA 5FEZA 1JGMA 3VD7A 2DJLA 3WK3A 2PRLA 1RUSA 3UNTA 2V69A 3TMLA 5A6SA 2VNCA 2J7GA 3NVTA 3ES8A 3H2EA 3LX9A 1HZYA 3IUDA 3GXFA 2W66A 2XVKA 4ZQPA 3WJWA 3KL3A 1I2NA 5E0KA 2QS8A 1CGUA 4S3FA 4CEXC 3DFHA 3UZJA 3L0NA 4LYRA 3CIXA 2H90A 5DMLA 5FF4A 4FLOA 3NQBA 3LS9A 3DC0A 2DEPA 1VBUA 2IQDA 1JUBA 3CZ8A 4PUDA 3N9RA 4S3BA 2XTKA 3B97A 3SR7A 3HBLA 3QC0A 1EP3A 4WJEA 3TW7A 4OIFA 1G7VA 5C5YA 3HN3A 3W1NA 2WJZA 4ZB0A 4ZOCA 3AS0A 2AKZA 2FFIA 5I3IA 3FX4A 4LPCA 8CGTA 3EOEA 5CZKA 1V08A 4DWSC 4D6GA 4Z0JA 4AD5A 1CGVA 1BLIA 5EA9A 4PMJA 3EB2A 3OVPA 1ZLPA 2PTWA 1S2CA 2H3DA 1XICA 3WJYA 4K7VA 3RNDA 3PZNA 1JZ6A 4EP8C 2PGRA 1XDJA 5G2WA 4UNIA 1I45A 2VZSA 5DMYA 3AROA 3W1AA 1DORA 5T91A 4CLMA 1KBJA 2PDGA 1UC5A 1BYAA 2Z24A 3TYBA 4CCCA 5I3HA 3P5YA 1UW9A 3NQDA 2AAMA 2YB4A 2OODA 3L65A 3WLRA 4DUWA 1ADSA 1L8PA 1XLMA 2Z29A 1R3TA 4TV6A 1UIOA 4A35A 3AU6A 5JU6A 2OSWA 4XD4A 4PR4A 4PE8A 1O66A 1PZ0A 1ZENA 2XVGA 2J77A 3QHOA 3L2LA 2E67A 2D2JA 1OC5A 1F76A 4O1EA 3EMZA 1J01A 3KOZA 2ZRXA 2DP3A 3NL5A 1LROA 1YBQB 2PTYA 3WF4A 1OF6A 2XSXA 3ZVHB 1KM0A 3CYVA 3WBEA 3ISIX 1Q13A 4K6AA 4IIFA 1M7OA 1J5TA 3GR8A 3H2FA 3GU9A 4BJHA 2A2IA 2ZVRA 3SJ3A 4QSFA 1GVOA 3H22A 4W86A 1QO2A 1IIHA 3LTYA 1ZHAA 4H19A 3VKBA 2HJPA 4MYAA 4FR1A 3PC0A 5C7VA 4RV8A 3H70A 3I4KA 2VDIA 3UWZA 4P7NA 1FP9A 3AMGA 3T2OA 4C7FA 3MUCA 5KETA 4UQEA 1V3MA 4X9SA 2RFGA 2X0SA 3APTA 1R7AA 4DZIA 3DFPA 4OFCA 3M9YA 3EDDA 4FZIA 1QI2A 4D9PA 1UKOA 1WXZA 3VNMA 1GTEA 5M1TA 3THAA 1YXCA 2JEQA 4V1XA 1R7OA 1E6NA 1H60A 3M0HA 4FI4A 2I9UA 3M16A 1H41A 4AXKA 5FOOA 3M6YA 3H55A 4O28A 4AHQA 4YTRA 3G3MA 3TKFA 3KTCA 3EA3A 3T0CA 1PZ2A 1S2TA 2XWEA 1XKJA 2CLEA 5LHEA 4W8BA 1M6JA 4B92A 4LAOA 1ZAHA 5I23A 1RZMA 2J7CA 3W7QA 3VNIA 5BU9A 2Y70A 3URAA 1QO5A 2ESCA 2W27A 2HVMA 1ISVA 1G7UA 3CV2A 2OOFA 4AX7A 2CXEA 3SUTA 4UMCA 3N29A 1TIMA 4HK6A 1WAUA 4LANA 3HQPA 4IFKB 3LRMA 4IL0A 1DWAM 4LRSA 1ZJAA 1VR6A 2DQWA 1WBJA 3L5LA 4MHBA 2IUZA 4TX9A 3U5UA 3ITGA 1TQXA 2CBUA 3SZ8A 2FYMA 3AMLA 1KRMA 3F4VA 2B7PA 3UGVA 3AHVA 1GPWA 4ICCX 3WQ8A 2BODX 4WUIA 4V33A 2A3EA 1XYBA 3T4WA 2QV4A 1ZPTA 1Z89A 5E6YA 1D3GA 3OZPA 3MP3A 5CZJA 1XYCA 3M0IA 3ZQ9A 2ZX6A 3VKCA 2ZICA 3E6EA 3TDFA 2V3DA 4FLQA 4Z2GA 4P8UA 2DZAA 3V5OA 1VEMA 1PBGA 2BWGA 2C18A 2X1RA 3PBWA 4MNLA 4OBSA 3B06A 2VEKA 1XBVA 3A4XA 3DBNA 3QZEA 3URQA 3OTRA 3NNTA 1XH1A 3MHUA 4H8UA 5A6KA 5D2YA 2GL5A 3WIJA 3O2LA 2DZSA 1GZGA 5HULA 1J93A 2EJAA 2WAGA 4S3GA 4PB3A 2EKCA 2FZ9A 2QJIA 3BQ5A 1AVAA 3R94A 4PBGA 4O19A 1J9YA 1RJPA 3EB4A 5A69A 3AYRA 1RPXA 2F6KA 1XFBA 3KBJA 3W70A 1AJ2A 1I2RA 3UERA 4PMUA 1HKMA 2E1DA 3BCFA 5BWFA 4E3TA 3QR3A 3LHTA 2IS7A 2VX7A 2WMIA 4NZCA 2GDQA 2HCVA 2NSOA 1WDDA 3FGCA 4C90A 2F2HA 4DZAA 1C8YA 3KHDA 5MKGB 4AIEA 3Q67A 3KFTA 1PHQA 4XAFA 2WVTA 4ZBCA 1H1YA 2REQA 4MZYA 2ZZ5A 3L4UA 5KZ6A 1UOKA 1M01A 4ZR8A 3ARPA 4H4IA 2BBFA 1JXKA 3R4IA 4GWEA 4YCPA 2ZOXA 4A8LA 1H7RA 3DC8A 3WF2A 1W54A 2NQZA 2Z00A 1JDDA 4W8LA 2HBXA 3GU2A 1K70A 2G37A 3CO4A 4C1LA 4QHRA 3KL0A 3PPHA 4HTYA 1R3VA 1JCTA 3CK5A 2QCCA 4WX2A 2G8ZA 4X0NA 5BWAA 3TYDA 1IEVA 2YCLA 1V93A 3ABQA 1R47A 2JQXA 4ZZ9A 3ARUA 3HOJA 1VKFA 3D5HA 2J9YA 4IX2A 1WXYA 5DY2A 4H9ZA 2G3IA 3CZJA 2O4MA 3WDPP 3GG0A 1CLKA 4GOAA 1FH8A 4QS6A 5A6TC 1Q6DA 3TJXA 1ZCCA 1QOXA 1YADA 1J0KA 3G18A 1Z3NA 3VX1A 1H63A 1R3RA 5D05A 2WNZA 1XYFA 1JDEA 3UCDA 2BVWA 1WZAA 5BXPA 4HPNA 3E12A 1EJVC 1HJSA 1HGYA 4GRSA 1OGSA 2CIPA 3ATYA 3GTNA 3AUOA 4LVBA 4ZEPA 1E4MM 1LL7A 3S9IA 2RAGA 1V0LA 4G5DA 4L9XA 3UBPC 3GBDA 5HUOA 3G1FA 4WXZA 4PBEA 2L5HA 3FEQA 1C91A 2VT0A 1PEZA 4QQUA 5EKYA 1IHIA 1C29A 3W7PA 3ORWA 3FY1A 3ZOAA 1FWIC 1J8VA 8A3HA 3W7OA 2WVVB 2G95A 4M19A 3W53A 1J12A 1HTIA 1FHDA 2HVOA 4XAGA 4V2XA 2DDXA 4EPBC 1R2TA 1MNSA 1RD6A 1BVNP 1EJXC 5G2HA 2EG8A 2XJ7A 3LPFA 1NWRA 3P7YA 3SUWA 1TVNA 1B3YA 3UA3A 4WXYA 1I8JA 1Q5MA 2OR2A 1GHRA 4LUIA 5D9OA 2J47A 4LBUA 2FMNA 2CYGA 2W9MA 1FCVA 2D24A 2OB3A 3CASA 3PAJA 4PRTA 4XTIA 1K8YA 3V3WA 4QEEA 3IGSA 4LFYA 1E1CA 4N02A 4XKMA 1TV7A 3LZ5A 4ASTA 3M1ZA 4Z1DA 5CC5A 1MWOA 4PC8A 4Z2IA 3B9EA 3UJ2A 1GVSA 3PJUA 4CNUA 3CQHA 4INFA 3SEPA 3G0XA 3JU2A 4IMCA 4W89A 4MUZA 1GZJA 2B4GA 3UNDA 1W5MA 1S2AA 3WFLA 1KA9F 3POCA 3HFYA 2UV8G 4U33A 5GNZA 2ONEA 1ZS2A 1EC7A 3C2RA 1ISXA 4TXEA 5EFDA 4K8HA 3VYLA 3N15A 4EWND 2J7EA 3NXLA 3NPUA 3LB0A 1W1YA 4KQNA 1EIXA 3FAXA 5CG7A 2NQ9A 4RE2A 3DH7A 4BHYA 4N9EA 1R9XA 1OSEA 4S2BA 3VIGA 5ENLA 3NZPA 4H1ZA 4GI6A 4LVAA 2C13A 2R9RA 3SCRA 1RV8A 1G4PA 3MCNA 3E02A 4QEHA 1K9EA 5ABEA 4J3WA 2VHLA 3LRLA 1SVDA 3TQPA 1KM1A 2V82A 2VRKA 4YVPA 1K3UA 2JKEA 4PEEA 1ODUA 4JTRA 3TYZA 3B8UA 2W62A 1SSGA 3GG1A 4ERAA 1J2WA 1X6UA 2J6VA 7TIMA 4JS3A 3UPWA 2BG5A 3NURA 4W7VA 1TR1A 5C55A 4OVXA 1EEXA 3HG4A 1N55A 1KFJA 4DM1A 2GSHA 3WCZA 4YTTA 2ZWYA 1ESWA 2DFAA 3L4TA 4B5XA 3EWDA 1J18A 3I7QA 1A4MA 4CNPA 4QNEA 3THUA 4QDMA 5D2XA 3AZSA 3C56A 1OYBA 1XLKA 2Y8VA 1L6SA 2J7FA 2PDXA 4ZFCA 2WZTA 5A8NA 1W56A 1FDZA 2HXTA 2BVDA 1GQIA 1O5QA 4DN1A 1X1OA 4DO4A 1E3ZA 3ECQA 5BMWA 2E3ZA 1AW2A 3VGEA 1XRTA 5E5CA 4C6CA 2CLOA 2DVXA 3Q58A 4Q6XA 5IDZA 4D8LA 1TYGA 4NAEB 1GOXA 4NRRA 3FJNA 3CQJA 4DO7A 3F5KA 1XLHA 3S5SA 3WQFA 2O0TA 1NARA 1Y7VA 5FJPA 3W82A 5A6MA 4CCDA 2ZUMA 3OO2A 3TC6A 1W1TA 4UMBA 3TTSA 4RNIA 5TQLA 2BOEX 4UQBA 1GG0A 4RE3A 1F8IA 1V3JA 4MY8A 3W2LA 2DJXA 3WLLA 4BQ3A 3PTMA 4ZSTA 2OZTA 4YJ5A 4YTUA 1TCDA 2XU2A 5B80A 3RHGA 2BY0A 2ISFA 3VX0A 5LNSA 1T8QA 2KX9A 1NY1A 4B4FA 1FP8A 1UWTA 4M6UA 1X6NA 4H01A 2ZADA 3I65A 5CC7A 1F73A 1GVQA 1SFJA 5FJOA 4MY9A 1JFXA 3V0UA 1MVYA 4B3KA 5G5IA 2R14A 1I75A 2OQHA 4JYDA 3STGA 3SCVA 1RBOB 2F2KA 5BRQA 1JYVA 1DJGA 3GDKA 1E9IA 4FNTA 1ZGDA 1W5QA 4TUFA 1TCMA 1UQYA 3B03A 4KEMA 4H3DA 3FJ6A 3DESA 4LUYA 4ATWA 3CHFA 4JTEA 4DJFA 4UFIA 2PSNA 1LBLA 4XD5A 2VGGA 2HTMA 4ZXOA 1W3NA 4OUIA 5IHRA 1W9PA 3VAVA 3VDGA 2Y61A 1KBKA 1XF0A 3MSRA 4F79A 1H2JA 1SPQA 4TX6A 1OY0A 1CECA 3FDKA 2VFEA 3A64A 1JZ2A 2V3GA 4GE8A 2E6YA 1KM6A 5HINA 1C92A 3C52A 3W86A 4QG6A 1BEUA 3UFYA 3D0CA 1QHZA 3KOXA 4XZWA 3FKKA 3GXTA 4OU1A 1V77A 3NQVA 4Y8EA 4HOWA 3MP4A 3U2OA 1VBHA 4LV4A 4KWUA 4LH8A 4NP7A 3VNDA 2GJLA 3MYPA 5D03A 1O95A 2QUTA 3QPEA 3CNYA 5LGZA 2QAFA 2YCKX 3ARVA 1I2PA 1HKVA 3VDAA 2Y2WA 3QLLA 2WQDA 4M1BA 2OWWA 1EYEA 1VPQA 1CLXA 1D7KA 1GVYA 1L8NA 1U83A 1XSJA 4O52A 2TYSA 1TV2A 3PUGA 4UZSA 4QQ3A 4HD5A 5B7YA 2ZXBA 3BANA 1RP9A 2EPMX 2PDIA 1OINA 3EXTA 1PXGA 4RL3A 2GQ8A 5CLWA 1A80A 1VGAA 4R3UA 5FSDC 4H9TA 2V81A 3PZ9A 4HTBA 4LT9A 1T0OA 1CXLA 3KUMA 4D6JA 4Q4RA 2VGBA 5KSWA 3SADA 4IWWA 3H26A 3W25A 1VLWA 3G6MA 4QE1A 1F05A 4JNMA 3LPGA 4D1JA 4JCLA 3FJ4A 4YCOA 2FLIA 4LNYA 4AYGA 4KKXA 2ZTJA 2PU0A 2CCRA 4A05A 4K8EA 3GKFA 1DXIA 4RCXA 3B8WA 3BICA 3T7VA 1VEOA 2CLIA 1BKHA 4IICA 1UP2A 4JTQA 1DJNA 4UTLA 1AFSA 1XYAA 2FDSA 2NZLA 2DT0A 2WYSA 3GG7A 1KM3A 2QCMA 4HZ8A 1EQCA 3C2EA 2NT1A 1TRIA 2B31A 2FTPA 1LQ0A 1EFZA 1GOOA 3DFYA 1KQZA 5IFPA 5FCZA 1NQKA 2ZXDA 1XSKA 5FEWA 3G2GA 2R1MA 5D8ZA 2YDQA 3SQSA 3OB8A 2VQUA 4IT1A 2VEFA 3BH4A 2DZBA 3KW3A 3P62A 4FX7A 5HA7A 2BLEA 2PA6A 1J0HA 4NJIA 4QLKA 5F2IA 3T1GA 2HSAA 4H2CA 4Q4PA 1YTDA 1PS9A 2PLCA 1JD9A 3FXYA 3AICA 3AJXA 3LBMA 2G0WA 1OYCA 4W8AA 4PN2A 3UQNA 2YYUA 4UFKA 1JF5A 4HNNA 3ZIZA 4DJEA 5HNNA 3M64A 3ABOA 3W7EA 2B7OA 2QDHA 1CLVA 2C71A 1XJBA 4PMNA 3SFKA 4C6LA 3S1WA 4E8CA 3UESA 3KS6A 1S3TC 4Q8NA 5AYYA 5TAOA 4GI9A 1V0MA 2XIBA 3ZT7A 1YKWA 2FHCA 4EACA 1MEWA 2AQVA 5HPOA 4XX6A 2ZUSA 3R13A 3PWGA 1SW3A 2H9AA 2DT3A 4IX0A 2E7FA 2A3AA 1MQPA 3IRSA 3J7HA 4U28A 4GH3A 3W24A 3E74A 4KWVA 5F2MA 1R5YA 5CC6A 1YNPA 2DW6A 1R2SA 3GXPA 5I3JA 1U30A 2EGZA 3PTQA 3GVRA 3U0HA 3WQOA 5AHNA 3TNBA 3WQGA 1TVPA 3VGHA 3PPGA 4O50A 1PSCA 1P7TA 4KBXA 3II1A 4PZVA 2GGJA 5L6UA 4JXCA 2NWSA 2VELA 5A8GA 1B4EA 2OLAA 2QZRA 1K77A 1NJJA 3BLDA 4JTFA 4QG8A 6CGTA 5MHBA 4KEZA 4IQJA 2YLAA 4QJ4B 2YR1A 4BI5A 1WE5A 1MSSA 4JIRA 2GQ9A 2ZC1A 3BOLA 3UXKA 4BI6A 2JIEA 4WSHA 2VWTA 3VCRA 1EWEA 1R6WA 2WSPA 3O3RA 1G94A 2I14A 3GXIA 3STFA 2YDAA 3SUSA 1QATA 3PP7A 5D2TA 1J96A 4GKTA 3VIKA 1F3TA 1I60A 1HX0A 1W1A1 3BSHA 1CI1A 3W74A 4DYKA 2WC3A 3HM7A 1ZALA 2VO5A 1H49A 4H6EA 3GVWA 3W28A 3TR2A 2QF7A 1MFUA 2CZDA 4NHVA 4UTMA 3MVTA 3XINA 1O5XA 2OX4A 3AMDA 2Z2BA 4GY7A 4LAMA 5XINA 4A22A 4R5EA 3DX5A 1JL8A 3SSJA 3VZZA 1KFCA 3U6WA 1DWIM 4JTSA 4DM2A 3CL6A 3NOYA 3THDA 6A3HA 2WMIB 3VIMA 4AISA 1I1XA 1OM0A 4F8XA 3FGCB 2PDQA 1PE1A 3QGVA 1KKOA 1NELA 2DZVA 1LOSA 4KCUA 4HZ7A 3VKKA 2ABAA 1GG1A 1EGMA 3KCOA 7PTDA 2PB1A 1CB2A 1IZKA 2GUBA 2REQB 3QW3A 1XCFA 4J35A 3G3DA 4GNJA 3U57A 1XG4A 3NO1A 3TC3A 4MNKA 1XBYA 3L4XA 3C3NA 4S23A 3N6JA 3PFMA 2XDFA 4PCTA 1UP3A 1E0UA 3PN8A 4KS0A 2POTA 4I5XA 2GVEA 4W4QA 3P74A 4JBRA 5J04A 4IUGA 4GKLA 1CCWB 2ZRWA 3BVJA 5A2CA 1W9DM 1ZP4A 3TU9A 1GVIA 3ITVA 1QI4A 2JIWA 4IIGA 2X1SA 2FH8A 2AKMA 3W85A 1SR0A 3SCSA 2YCLB 3N1AA 5JXQA 4LU0A 2BXZA 1C8XA 3ATZA 3C2YA 3QOKA 2Y7DA 4UWMA 3WJXA 5IBXA 1QMLA 3WJSA 2RJHA 2J8TA 3EX6A 5G1TA 3F5LA 1PX8A 5TNVA 5FF3A 1U5HA 2R82A 4IPLA 2OCZA 4H6QA 3ZM8A 4MPKA 1GNXA 3M7SA 3OBEA 3AIQA 3BZGA 3R10A 4JEQA 3WLPA 3NQ2A 4AYSA 1PX4A 1SMAA 2WMKA 1IGWA 2UY4A 4G1KA 4XZIA 4DUVA 3T4CA 1YXDA 1Z6KA 2C6QA 4C5YA 4XBJA 4PRRA 1AQFA 3KXQA 1NF0A 4FEZA 3N9SA 1MI3A 1TR9A 2PWUA 3E0IA 4WY0A 4PTNA 3RIKA 2QIIA 4GX9A 3V0SA 1VD6A 2G4JA 1VFSA 4GO9A 1L0PA 2V67A 3VPLA 4MIMA 1A50A 3FHQA 4H83A 3BTNA 3W38A 1H7WA 2OT1A 3VMPA 1LBMA 1PVNA 4WR3A 3VNLA 1RSCA 1QW8A 2A7RA 2QMJA 4LS2A 3E2VA 3HG2A 3UWWA 1SZEA 3KOYA 1Q3NA 2WSKA 2ICSA 4D6EA 1EGZA 4YVXA 4JN6A 1EA0A 1OF8A 2WB5A 1XIMA 3QHMA 3FOKA 1XG3A 4QCFA 3GE7A 3MMUA 3NDOA 2A3CA 3LHVA 3DIPA 2QDDA 2ACRA 5DX7A 2DW7A 5EBAA 1TE1A 2HPIA 1XWYA 1QUMA 1JZ5A 4N6FA 1UUOA 5A8PA 4RW3A 5F7UA 5L9FA 4O0ZA 3QQ0A 4FP1A 1YTKA 1XGEA 1XBXA 1FHUA 3WKZA 1E1CB 1TV3A 4GGBA 4AFYA 1DHKA 4WSKA 3EWBX 3BJTA 5KINA 2A85A 1FCUA 2PWGA 2V6AA 1B54A 1E55A 3NYZA 2CZVA 3I6TA 3QR0A 4AX6A 2A7NA 1JZ8A 3N3TA 3DFOA 3UG3A 5GJPA 3AFBA 4XTDA 1ENUA 1PYFA 1VPYA 4XBSA 2VOTA 4MFDA 4DUXA 3IJ7A 3VC6A 1XR2A 2OWCA 1GJWA 1MW1A 4BKNA 4JTUA 1MW3A 1MW2A 1W32A 5JH1A 1OVDA 3B0UX 4JL2A 4W7WA 4YU1A 4HYRA 1GJUA 4NZ3A 1XRVA 3LENA 1T6MA 3OG3A 1AD4A 5I09A 1U1UA 2D3LA 4Y6GA 2RDUA 2EJ1A 4P7OA 1KFBA 1OIMA 4FNRA 4C91A 2VX5A 2NVDA 1NTHA 3TR9A 4E4UA 2GGGA 2P88A 3W7LA 2YA1A 3RXZA 3DERA 2G5WA 3GXDA 2BOFX 4Y9NA 3GW0A 3OHMB 4TTGA 1JCXA 4B3LA 4XIAA 1CDGA 3T2PA 2RDTA 2XH2A 2FB2A 3GDTA 3CT7A 3O1NA 5FJJA 1QT1A 4E4PA 4GVIA 3W1QA 3WUGA 1XCXA 3H23A 1DIOA 3CLWA 4FHAA 4TTUA 1OFEA 3THQA 1JI1A 1VHCA 3F2BA 7TAAA 3S5YA 1A5SA 2VZTA 3RX4A 4DUOA 2OEKA 2E8ZA 2A0NA 4KF1A 1Q6EA 4I7UA 3VMOA 1EEPA 1F6YA 3WLKX 1X1NA 1F3XA 4GYFA 1SO3A 9CGTA 1R9ZA 1W3KA 4ECLA 1VCGA 1LYXA 2D0FA 3PG9A 3B0YA 4Q8UA 3KRBA 5DBUA 3GTXA 1S5MA 4AD2A 1PTAA 3DENA 1IE7C 1IEQA 1YW1A 2RDXA 2J4GA 5GNXA 3ZR4A 1XLJA 2I5IA 2RDWA 4HCHA 3VCNA 4G56A 2PWHA 4Q7BA 5CPQA 1TWDA 3ZZ1A 2OEJA 2A79A 4DI9A 1QNOA 2O55A 1NDZA 3QTPA 4LRTA 4QROA 3WQWA 4QE4A 4O4VA 1PWLA 3M47A 1XIEA 4OQVA 4B9ZA 3ALFA 3BJSA 1TG7A 2BASA 4CQCA 2ACUA 4E2OA 1Y8BA 1W0MA 2ANUA 4J9JA 1P4CA 2OJPA 1IQ8A 1JCLA 4P7LA 3WK1A 3DN5A 4WGHA 3G8RA 3K30A 1OFPA 1D3CA 2Y5SA 1P0DA 3SJNA 4Z2JA 1OC7A 4QAIA 4GY1A 3LV5A 2OTDA 1PZ1A 1Q6RA 1VAHA 2G3FA 3VCCA 2OZ0A 3ES7A 4AY7A 3RJXA 4HJFA 4LYKA 3PBMA 1O60A 1GEQA 4C1NB 3C86A 2XIJA 2C19A 3HGRA 1XLAA 4DIAA 1R38A 4OV4A 1R9YA 1RAKA 1UD5A 2GWGA 3GNDA 3VMNA 2OELA 1QCWA 1MRQA 3L66A 3OZOA 1HKJA 2OYLA 3M5ZA 2PUZA 4A3UA 1W31A 3FV9A 2PI6A 3NQMA 1ZAIA 1WBHA 3EEZA 4JDYA 3SQLA 4QDWA 6PTDA 3BLEA 3W84A 3VDCA 3WFZA 1BWLA 5BU6A 1XI3A 2X1UA 3WELA 2W6RA 4JY8A 3PM6A 1OFAA 3W75A 2FTWA 1TO3A 2ZVIA 1ZJBA 5DO8A 1YMYA 3SO7A 3CMJA 5A6AA 2YL9A 4S2CA 1O12A 2HRWA 1C8VA 1T96A 2PDLA 4JN7A 1DJIA 3MUY1 3N4EA 4M81A 1PHWA 3S3GA 3PVFA 3H2OA 3M0KA 4CUCA 4MMWA 2PZ0A 1JNDA 2HROA 3N73A 1M04A 3KZSA 3NR0A 1HFBA 3OIXA 4HP5A 4P8VA 5C8BB 3EDKA 1SJAA 3ONCA 1XPYA 1JDAA 5AC4A 1BYCA 1Z41A 3CC1A 3KWSA 4AIBA 1WP6A 1KFWA 1UBSA 3SCWA 2B81A 4QLLA 3FFSA 5ABTA 2OZ3A 3LTSA 2QVNA 2Y5EA 4N9DA 4OECA 1J4EA 4UCGA 2XPKA 1IT0A 1QVBA 3VA8A 2X09A 4EANA 3C2OA 2R94A 2VCAA 3T2QA 2W4XA 2FQIA 3QMRA 3AUJA 4QRNA 3GHTA 4NKCA 3W29A 3UXIA 3EDFA 5AHFA 4N4PA 1HG3A 1NDVA 3OGVA 3VNZA 4K39A 3NIYA 4XVDA 4GIEA 4AEOA 3BAXA 3GB6A 2EPKX 1TIWA 1P43A 3NXFA 5K4XA 3N2MA 4MLJA 1B3WA 1QBBA 3WJZA 2FPTA 2R24A 1EUAA 1DTNA 4ALDA 4AVNA 1WKYA 3LV6A 3P82A 5GPRA 1QRQA 3TAKA 2Z6IA 1SFLA 6XIMA 2WMHA 3W2MA 1DKWA 4UTHA 2XFYA 3R79A 2D2HA 3S6DA 5J5DA 1F4AA 3INPA 3KBWA 3GNXA 1QXLA 2QLYA 4DJDA 4Y2WA 1XIGA 2D20A 2J6XA 4E5TA 1XLBA 2BXVA 1XH0A 3R12A 4J27A 3F4CA 1CB7B 1LOLA 2IPFA 1A3XA 5ABFB 1POKA 4MWAE 4NX5A 3K8LA 3KLLA 3VOHA 2OLHA 4HYVA 4XZHA 3BOXA 4BF5A 5AC5A 4E6MA 4TMCA 1H61A 3AWOA 3KX6A 4O17A 3FYPA 2NSXA 5H8MA 5IXEA 1TSIA 1M7JA 1DVJA 3FVMA 1KGXA 1LWIA 1LWHA 5AVNA 3QXBA 2DT2A 3M5XA 4MM1A 3H2NA 3M5VA 1LWJA 4XKYB 3LGGA 3MTWA 1HVXA 3C61A 2YLLA 4KWOA 3ICJA 5H6HA 3E0WA 1JVNA 5K2ZA 1K8CA 3LXAA 3UYIA 1ZUAX 5I2UA 5HWJA 4XVEA 1ZNNA 4L5ZA 1W3TA 3RLHA 2JF7A 5HQLA 3F1QA 2OU4A 2P50A 4AD1A 1DE5A 2VEIA 3CAKA 4QX4A 3VUSA 1BSLA 2Y85A 5FJUA 3MBDA 4WVXA 2FZ8A 3EXSA 4F2UA 3N13A 1UD3A 2OEMA 2OMAA 1DJHA 1XLGA 3MKCA 4UBPC 3L0KA 1RQHA 1IGSA 2CLKA 1JQVA 4N7QA 5AECA 2VKZG 2FPVA 1UA7A 3BMVA 3PZVA 1HW6A 4IFRA 4JR5A 3FYOA 4ADUA 1A5MC 3FSUA 6XIAA 4PUUA 3QH2A 4LGXA 2DU2A 3GC2A 1CENA 2Z2AA 3JW7A 5AZ0A 2GJXA 1HNYA 5I0DA 4CCEA 5A6BA 3UG4A 4IQEA 1RQBA 1FWWA 3KL5A 4GG9A 1DWGM 2FVLA 1IZCA 1BYDA 3IVUA 4ICNA 3VD4A 1BKSA 1UPMB 3SN4A 2YCIX 3ZVIA 3W87A 4XV0A 1GKQA 3F7JA 2I17A 2OSXA 3IS4A 1P7TB 1J0YA 2ZZ4A 2XH0A 1S2WA 3IARA 2V5BA 2P1FA 2Z4GA 3W27A 3S47A 1V6WA 1FXPA 3WD4A 1EB3A 3EX2A 3WBAA 4HU4A 1G69A 3STEA 3H2CA 3EDJA 4WK9A 1XISA 3CH9A 2X7VA 2J7DA 3N3MA 5MF5A 1LQAA 4C6KA 4QLJA 3GDLA 1BVZA 4OKDA 5LYRA 4DLFA 2YL8A 3H2AA 2C15A 3KTXA 1VIWA 3P80A 5D2WA 3LHZA 4UQDA 2ZCGA 3VNJA 5SWUA 4UIOA 1GHSA 4G7EA 4HNUA 3MI3A 1W9VA 3AJ7A 2QMKA 3VKDA 5I02A 1FBAA 1MUCA 3MCMA 3QZAA 3A9IA 1TMHA 1LLWA 4MY1A 1QWGA 4KH2A 3UEQA 1K9DA 3PBYA 4LC8A 2V68A 4Y8FA 3WD3A 1F6PA 1BGAA 1K03A 1E6XM 3TTYA 1EH9A 4PFMA 4JOMA 2QXWA 4PSPA 1MXSA 5DCDA 2G97A 4MAVA 5H8PA 3BMWA 4GC4A 1QNVA 1UOZA 3NZGA 3WQCA 3EBVA 1KXQA 1MDRA 3RYSA 2HEJA 3GHSA 4UFMA 3P93A 4ZXLA 1YNYA 4LF1A 1RLDA 3DBPA 4LBSA 2V2HA 2YL5A 1LJYA 5LHFA 1E9LA 2XZ7A 4C6MA 3UXAA 3HZ3A 4AF0A 4HZ6A 5JBFA 3GDMA 2DZXA 2YDRA 1QW9A 3PJWA 1Y0EA 4W93A 1VC4A 3N18A 4NI3A 3LD5A 4DJFC 3LNPA 4ZENA 2Z1WA 1EDTA 9XIAA 1UKQA 4XSLA 3ARYA 3PZMA 4CD4A 3W3OA 3LBCA 5I5RA 2VEPA 1W2VA 2VC9A 4WY0F 1S38A 3C8FA 4OTKA 2WBGA 4U3CA 5CZ0A 4B16A 3IAPA 2NLIA 4P61A 2GZXA 4M5PA 3BAYA 1PKNA 3SN0A 4PSRA 3ZWTA 2ZKMX 2DY3A 1JZ4A 3UZYA 1DXEA 1IT7A 3KDNA 4JTCA 4RZ5A 4Q7NA 3L12A 1V3KA 1YDOA 4PCPA 3F03K 1O4UA 2PFHA 4DZHA 3CEUA 1R85A 5HQEA 4JIHA 1PKLA 5JUVA 2NVCA 1EJWC 4QS5A 1LOQA 1J11A 3BL3A 3MWAA 3TJLA 1R87A 2EBNA 1SO4A 5CSSA 4C7DA 5D9NA 4HSOA 1HVQA 3ANYA 2EAWA 2YFOA 4O11A 4JZ5A 4AD4A 3H7UA 1UZ4A 3VTRA 2WNWA 4IP4A 3CV7A 3I3DA 4RJEA 4JTGA 2NW0A 4WY0B 4CQBA 3QHNA 5HJYA 5F2GA 2GK1A 2P3EA 3H7VA 3PZOA 3QV8A 4B15A 1WQ5A 1XL9A 1V4YA 4B9YA 4NVTA 4JKKA 2EPNA 4MWAB 1VYPX 1F74A 2MUCA 3BQ6A 4MTVA 1AZ1A 2I5GA 2Z26A 2EF9A 1F61A 3GHRA 2QUMA 3IIPA 3WEZA 1Q6CA 1AW1A 1B9ZA 1LP6A 5I3KA 4ORMA 5DEZA 3QVQA 3TA9A 5DY3A 4O1CA 4GGHA 5HK4A 1W2PA 1RK6A 3CB3A 5E93A 3N25A 4CU6A 4HSNA 5DANA 3A12A 3DDMA 4H6KA 2DVUA 4K37A 1E51A 2FGBA 1UKPA 3AYVA 5AYIA 4W87A 1P1XA 5BROA 4MKVA 1JPDX 4FNQA 1CXIA 4AZCA 1PKMA 3WQEA 4ZL1A 1I0DA 4JN8A 1LZOA 1SZNA 2ZIDA 1DWFM 1XP3A 4LOCA 2O56A 1MMFA 4EX4A 4WEVX 3LCGA 3WQ4A 2F6XA 3T05A 3S1VA 2EXOA 4KEUA 3GG8A 3STPA 2VFGA 3TOPA 2C14A 4R53A 4AWUA 3SRFA 3O6CA 2PS2A 3WH5A 2FZBA 3D6NA 5D9MA 3UCQA 4XSMA 4IMEA 2ALRA 3SUUA 1TKKA 3VIJA 4F3HA 3GH5A 4GUFA 1XM3A 2ISWA 1ITQA 4M6PA 3EA2A 5FSEC 3DHDA 4DYEA 1UWUA 2IW0A 1FWHC 3PJXA 2J88A 3RK8A 3RX2A 5LXEA 1QOPA 3CTLA 1J5SA 4WKHA 1KBBA 2Y24A 4A2RA 3FNDA 1WXJA 3M44A 1VYRA 1E0XA 3CUGA 3MZ2A 4DJEC 2WJFA 2PDKA 3GAYA 3NA8A 4C6PA 4F48A 2FHBA 2JE8A 3A5FA 3AXXA 3AXHA 4UTWA 4ZO6A 2J8GA 2ADAA 3TTOA 4GPNA 1YHTA 1Q7QA 3ZWSA 4LEQA 1CXHA 2D22A 1E5NA 3ZSSA 5M5DA 4AUBA 2CPUA 3LNMA 3V75A 3LBOA 5CEWA 4LUJA 2PC8A 4UTFA 2VZVA 3LCHA 5D04C 3CUXA 8RUCA 1SQ7A 3WNLA 1VHNA 4O1DA 3APGA 3CEPA 3TWAA 1TTPA 1MXGA 4AMCA 1HKIA 4LUSA 3VNKA 4GJ1A 2VZUA 3VDBA 3CZLA 3WEMA 3SDOA 3NO3A 1I1WA 4J7RA 5HQMA 3F5JA 3IVTA 3VIFA 4DXXA 4G1NA 2OKOA 1KTBA 1UB3A 2IXUA 5AKQA 1G9HA 3EOLA 2D73A 5F1VA 3TQVA 3E3HA 1KW1A 4ML4A 2IMRA 2YDSA 1T5AA 1K8ZA 1NOUA 5CAKA 2E28A 3PTDA 4KESA 3OVRA 4M56A 2ZRVA 2E77A 3SRHA 1JJKA 1VCFA 3ID7A 5LNWA 3MY9A 1EL3A 4GMEA 4LAUA 3NSXA 4E8DA 4V27A 1PKYA 1KTCA 1XINA 4NI8A 1IF2A 4HJWA 1JAEA 1LL4A 5A2BA 1V3LA 3WNKA 2WNNA 4HMEA 3SW6A 4EK7A 3G6LA 4R7WA 1PUDA 7ENLA 2Q01A 2A4AA 2Y7FA 1GYMA 4A8RA 4GVHA 3W2NA 2PWDA 1VJIA 4BEUA 2CC0A 3Q4DA 5JQ9A 4YTSA 4RZBA 3DYMA 4OGZA 2C79A 1EKOA 3ARSA 1GVRA 1F7BA 4KW2A 2YA2A 3W02A 1KRAC 4BR1A 2HBVA 2O9TA 4O8AA 3GTIA 5LNRA 2FH6A 4BQ5A 5KITA 4A8NA 3Q45A 3DFTA 4DAFA 1J6OA 3DUGA 2BVYA 1WKDA 1GK8A 3CB8A 2D2OA 5AYZA 2A7PA 1JCYA 1TV4A 7ODCA 1DBTA 4WOZA 2HK1A 1XXXA 2VD9A 3SSZA 3SFWA 1JD7A 5K4ZA 1NWUA 4DWSA 3EXRA 3W1TA 4Y9AA 2QCGA 3LUTA 4CD7A 4AMAA 1B30A 4ZO9A 2H3BA 2Z6JA 2FHFA 3GR7A 3T55A 1OHLA 3E5PA 4PBFA 5E1QA 3L21A 2CHNA 1J6PA 1HJUA 1DIDA 3PG8A 4B5VA 5CPSA 3N2BA 3LI1A 1LM1A 2EPOA 1QI5A 4O1AA 3ZO9A 4KRTA 1NOFA 4RLIA 4ADTA 5HMEA 1HJXA 4AZBA 3AS1A 3GFXA 1MQRA 2CFFA 1P6CA 4X2PA 4ZCWA 3ME3A 5IBXC 4TMBA 1AQMA 4N4QA 1YQ2A 3UPMA 4G9PA 5T9CE 5DN1A 3KCJA 5CXPA 1MW0A 3QPZA 4GX8A 1R46A 4GZIA 5A6BD 2E40A 4GLEA 4IJBA 1BF6A 4M51A 2Z1XA 4V15A 4ERGA 3AISA 1KFLA 3PWIA 4HB7A 4ILSA 1A53A 1JUKA 1VENA 4D72A 3G0UA 2E25A 2J66A 1PPIA 2GQ3A 1WUFA 4LXFA 3VOIA 4P8WA 3T42A 4GABA 1MO0A 1TPC1 4DO6A 5XIAA 1E0TA 4ZQMA 2GLKA 3WQ5A 4N42A 4GFSA 4AZ6A 4ROPA 5J8LA 1HQTA 4XAPA 5C70A 3SCPA 1Z48A 3GTHA 4MWAC 1EJUC 4Z1YA 1JCJA 4CNSA 1TX0A 2P10A 1TQJA 2HDJA 1J0ZA 1F3EA 2E9LA 3MMDA 3P0XA 4HN4A 1UPPA 4ZO7A 4JQ1A 2MANA 2QGYA 3IIZA 3CT2A 4YPJA 2P8BA 1O5RA 2E09A 3B9AA 5KTLA 2QPSA 3V4BA 4AZGA 3ARXA 1X96A 2V5DA 3GC5A 3N19B 4M3PA 3TCSA 4BCEA 2ZX5A 4I8YA 3RRAA 5I3DA 3K8MA 2CLHA 2AQWA 1QW7A 4DBUA 3G8EA 3RPMA 4EAMA 2DH3A 2G3JA 1VIZA 2FZDA 3TVAA 2Q3RA 3TLQA 3KS5A 4IMDA 4AH7A 1O1HA 3BOFA 5KZEA 1DJZA 2ZUTA 3W2UA 3LTPA 1KRBC 3UCCA 1OZQA 1RA0A 1C93A 4JTJA 5EB8A 3V7PA 2WBKA 1FWDC 3E0LA 4Z42C 4E4FA 2KZHA 2SFPA 4F0MA 1OB0A 1XV8A 4YL2A 4Q4MA 1QHOA 3USBA 1KLZA 4AD0A 1BHGA 3B05A 2CHOA 3KCLA 1WDPA 2QCHA 3QFEA 1MYRA 4POCA 3IV8A 4HN8A 3DHPA 3GIYA 2W5FA 1VFOA 1FTXA 3RRXA 1GKRA 5BRBA 2C8NA 1GONA 5AYBA 2Z2UA 3WLMA 4E0CA 2W61A 3NPWA 3GDRA 2ACQA 1AQHA 3CWNA 4AY1A 3RX3A 3NQ8A 3RLGA 1H0GA 1Y5XA 4F0HA 1HO4A 4JKLA 4Q8QA 4IMAA 3MKKA 3POHA 3DI0A 3TFCA 4WDWA 3WMLA 1H7XA 4LCSA 3IUHA 2WVUA 2GPTA 3CL8A 3CZKA 2V5JA 5FF0A 5A8QA 1XLEA 1XIHA 3GUGA 3P60A 2WMFA 1ICQA 2QUNA 4H9XA 3W7MA 3S5NA 3E2SA 1MUWA 3QRHA 3AHTA 2D3NA 2G3MA 1NM9A 1TZZA 1Q6OA 3W76A 1FRBA 4JFSA 3D46A 1YIXA 1Q8AA 1M41A 3RCYA 2CITA 2DUXA 5C6MA 2JF6A 2AAAA 1POJA 2YGYA 1HKKA 1K6WA 2INEA 2P3ZA 2GJXB 5A5WA 2QCDB 1CXKA 4AAJA 3G1VA 1ZTVA 1WZMA 1S46A 3KBSA 3W07A 1KGUA 1U1JA 2BZNA 1B0IA 2FVMA 3EOOA 4PL1A 4HOXA 3ERPA 4Q8MA 4RV3A 2ZZ6A 4HK5A 5AY7A 6ALDA 4GI8A 2PMQA 3BV7A 1AH3A 2PP1A 5ABHA 2D0GA 2E8YA 4ZOBA 5DQPA 1HP4A 1PIFA 9XIMA 1CGXA 3W2KA 1KB3A 5F1UA 1GVFA 1LG2A 4JIQA 4FAMA 1QI3A 4DPQA 4XBKA 3B04A 4CN6A 3GH4A 1V03A 4NAFB 3R43A 3LLXA 2E6DA 4RNJA 5HAOA 4K1GA 2HISA 3QTGA 2OQYA 5AZ1A 1F07A 1MNZA 2UY2A 4G7EB 2HQAA 3A4WA 2WHKA 1MZRA 1V02A 4X0VA 1W9XA 5A1AA 3IK4A 1UJPA 3B8IA 5ECVA 3AOFA 7A3HA 2W63A 1H7OA 4K2SA 4XZ9A 4TR9A 4OBRA 4M82A 3AAMA 2HV5A 2QAPA 1EZWA 1FCBA 4PODA 4I7WA 4JYEA 3RN6A 3REQB 4Q8OA 1PCKA 3QOMA 1Q7ZA 9RUBA 2PTDA 1DIKA 1S5WA 2E5CA 3GO2A 3ZJ6A 2BX7A 1XYMA 5DMNA 3B9DA 4LY8A 5BNKA 5CLTA 1UD4A 4GVFA 2I56A 1IWAA 3OIHA 3JS3A 4GQRA 3QKEA 3GNPA 5HMFA 3MU7A 2G41A 1E1FA 2MNRA 3AWNA 2VJXA 4HPHA 4AF0B 4C6NA 4H9UA 4KT2A 3QPYA 3CQ0A 2BY3A 1UR0A 4R88A 4OOUA 3CUJA 2NXIA 1PCWA 3WH6A 4GC3A 4KETA 4GBUA 3MV01 1AUSL 5AHEA 4G7FA 4ADSA 2JBMA 3AYTA 4FOUA 1W3JA 4LCRA 5E0CA 1E4NA 5U7SA 2QVHA 4N0RA 3CAQA 3UA4A 1GOIA 3AC0A 4L1XA 4GZJA 2CKRA 2P5NA 2BVTA 4E38A 3PUOA 3UXDA 3DHFA 3V36A 3A22A 1WNOA 2VVSA 6REQA 4RPQA 1XLCA 4DNMA 1E56A 1QWKA 4NZJA 3O05A 5G4WA 4ZSUA 3R8GA 2G50A 1I4NA 3PR2A 4IJCA 5CPOA 2C0AA 1S1PA 4U5KA 3QSRA 4PTMA 1WDWA 5CJNA 3UVIA 4W5ZA 3MUIA 4ZE4A 1D8WA 4H8NA 4FS9A 1YBQA 1UASA 4P7QA 2O4QA 3ZVHA 5FAJA 1SJBA 2C1GA 3LDVA 1TUXA 2XIOA 1CNVA 1CZ1A 3O07A 4JIEA 3W7CA 3LCFA 4Y96A 1RPKA 5EPDA 5CZTA 2C7FA 1Q4NX 5LZLA 3GYEA 2WHLA 3UZXA 1GGOA 1P1MA 1CGYA 4F2BA 2XVPA 2RH9A 1AL8A 1LF1A 1P0BA 4O53A 3S6TA 1RY8A 4B5SA 1J2BA 1NVMA 2X42A 3TNOA 4MZ1A 3ZT5A 2X2GA 5I24A 2YBVA 3NCOA 4PMYA 1HGWA 2CXGA 1FDJA 2J8FA 5FA5A 1F9CA 1YDVA 4PCFA 4A2SA 1LRTA 1RVKA 2E68A 2WCAA 2OT0A 1RBLA 3NJ3A 1A3WA 4UTUA 3VZYA 4V28A 1F6KA 1YDYA 4IIBA 4R9XA 3MUZ1 4U3AA 1LRQA 3VFCA 1FDYA 1E43A 1NH6A 3WLJA 3BGAA 1JI2A 5FD0A 3B8DA 3GUWA 3QF0A 4M80A 4GYPA 3E2RA 5HDRA 4R7JA 2Y7GA 3UG5A 1TX2A 3VD5A 4DJDC 4AZCB 1YYAA 3T6CA 3KVJA 1ELSA 4TQTA 3LY0A 3WD0A 4JCMA 4MNJA 4CQAA 4DWSD 1AK5A 1XLDA 1PDZA 1D7FA 1S5VA 3W00A 3W7JA 1HJWA 5T9BG 3PZIA 1AW5A 4DBSA 4UOZA 4O10A 1FA2A 4A29A 4WQ6A 1ZFJA 4W9TA 4IG2B 3Q94A 1M68A 3UD6A 1C9WA 1QAPA 3TSMA 4LX4A 5T26A 2BNJA 1UWQA 2QJGA 3QGKC 1J0JA 5BXTA 1NFPA 4Q8TA 1NEYA 2CWNA 1E9ZB 3N4AA 3LHUA 2PGEA 2PD5A 2V63A 2FMOA 3VZXA 3MV11 2VC6A 2VL4A 4U10A 4WIWA 1OX4A 2H8XA 2BGQA 2XIQA 2TODA 2FDMA 3EX3A 1KKRA 3TYUA 3M0XA 1P0NA 2X0YA 1E72M 1SJCA 3MYOA 4EXAA 4HYWA 4BWLC 1W37A 5AFDA 5EGRA 4UNKA 5C54A 3BJFA 3PB2A 1ZL1A 5CZSA 2BXYA 3PUDA 4L7ZA 3LSCA 4JFTA 2VUNA 4H2HA 4ZQRA 1RD5A 4FF7A 5LA0A 5DBTA 3OVQA 3ZT6A 4H04A 2GOUA 4NUWA 5LIWX 3WQ6A 3DZ1A 1ZAJA 2HS8A 4I90A 2J13A 4QGCA 2WWCA 3FS2A 3EOSA 3G1XA 5LNUA 2G3NA 4LUSB 3OA5A 1DWHM 4IPJA 4XB3A 5ABGA 4K38A 5CCZA 3ZR5A 2PGFA 2OWXA 2WKGA 3VUPA 2CBJA 1NQ6A 3TFXA 5HWMA 1AQ0A 5D09A 3RFAA 2TRSA 1B5TA 3QC3A 2ZQ0A 5DFAA 1A5KC 2Z1VA 2CEQA 3UT0A 3LGEA 2XH7A 2GQAA 1VJZA 3CPGA 3VOCA 4IL2A 3OQEA 5CPLA 1IXPA 4PB4A 1UMYA 1A47A 6TAAA 2B0MA 3OLGA 3URNA 3MC5A 1UH4A 2CLFA 3NM3A 1B57A 1OZMA 3R58A 5FKYA 4PEKA 2ZX7A 5FF7A 4UMAA 2W3ZA 3TYEA 4PTDA 3L5AA 4L80A 1ME9A 1BTCA 2QDGA 3U4AA 3XISA 3JVAA 3CWOX 1M1BA 3AMKA 2PLKA 2BHZA 4KWSA 6ENLA 2YX0A 3BMXA 1AH0A 4HCLA 3LRKA 3LQLA 1FX6A 3SUVA 4LYPA 4R33A 3UJSA 3GH7A 4WSJA 1E40A 1OC6A 3EMQA 3VI2A 3HMJG 1KTNA 5GJNA 4FF5A 1B4KA 1K4HA 5FF2A 1UP0A 1BXBA 3HV9A 1WPCA 4L9YA 3TIMA 2ZWZA 1V6YA 4DXVA 2XN2A 4LF2A 4GNVA 2ZDRA 1EJTC 5E9XA 4GJIA 4E8GA 3DKLA 1OFRA 1LCOA 3IUIA 2QCFA 1NFBA 3F4DA 4KRZA 1YPIA 1TFVA 4EE9A 1PJ9A 1U2YA 3WNNA 3M5YA 3TTEA 2VGIA 1SMDA 1MXDA 3M46A 3AS2A 2ISDA 3RPDA 4DAIA 1KFEA 1W3LA 3H24A 3LCIA 3SRKA 4YYCA 3TN5A 4C6JA 1R8LA 4E3VA 4QG9A 2DSZA 3FA5A 3ZYZA 5I7GA 3A24A 1US3A 1O7AA 3B40A 5M3WA 4J3TA 2QCNA 3S6OA 4YWIA 5CG0A 3IVSA 1J79A 3T0BA 1E70M 5GNYA 2Q8XA 4OV9A 2NQ5A 1CXFA 3NEHA 1VP5A 2ZUWA 1CW2A 4ATLA 5EYWA 3UW6A 3AHYA 3TLLA 1DJQA 1A49A 3NSNA 1QHPA 3EX4A 4ZQNA 2WZMA 1YNQA 1HL8A 3NQFA 3DG3A 4WGXA 5C2GA 3KTSA 3IWPA 1GOMA 5FL0A 3WLIA 1NOWA 3SQMA 3NQ6A 1W5OA 4JYFA 4UOQA 4FNSA 3TC7A 1A0DA 3B0XA 5C7HA 2NV1A 1YX1A 3GNRA 1UR8A 4GXMA 2YIHA 4R7OA 1R0MA 1IEWA 1QOQA 1H4PA 5C9ZA 3EEGA 1JULA 3GD6A 4K7YA 3IIXA 5BXRA 4I9JA 4FXJA 1W1IE 5EBUA 5BRPA 5EMLA 3S2JA 4PTVA 4Z2LA 3VKJA 2YZRA 4OUEA 5CSRA 4PUWA 1CXEA 1R3SA 5LIYX 2ISSA 4UQCA 1QNPA 4BFAA 3KP0A 4AHOA 3HURA 4L1GA 4C6OA 4Z1BA 3NQEA 4BA0A 1KM4A 4RNHA 1DYSA 1W3IA 2QIWA 1FWNA 3KM8A 2BTMA 2WLZA 3HPXA 3OYZA 4J4KA 2JGYA 4ZOAA 1L2QA 2ZYFA 4JQ3A 3BG3A 1TTJA 3WUFA 4FXFA 3UWYA 1GOKA 4TO8A 4X3ZA 1IYXA 1ML1A 3GNOA 3N2OA 2XISA 3LCWA 2GDUA 1EYWA 1V79A 2PURA 2QULA 3BW4A 3C0SA 3UR8A 1M5WA 3VINA 1XLLA 3N14A 4P7RA 4C6FA 4QM1A 1EZ2A 3SCNA 1WAWA 2TPSA 4XQ6A 5FEPA 3VGDA 3TW9A 3EAUA 3R8HA 4PGLA 1WKEA 1AMYA 3AYSA 5DXXA 2PODA 2V38A 1O5KA 4Q4SA 2J27A 5DMMA 1EC8A 1E9YB 4NQ1A 2PWEA 4FNUA 5FACA 4LBRA 3GBEA 4NXKA 4CNTA 3QM3A 5E0FA 2VGFA 4PYSA 3FEMA 1IEXA 4ONVA 4WOQA 2XHYA 4L6OA 3MI2A 4UB9A 3MSYA 1KR1A 2GJPA 5JH2A 2W92A 5AC8A 1W8GA 4JD4A 1OBAA 4F0SA 5A6JA 1EF3A 3U4FA 4C60A 3IJ9A 3S2LA 1AODA 1EHNA 3T07A 4ROQA 4TOQA 1XIFA 1FWEC 3TJ4A 1JYWA 2OGJA 3UJRA 3L4YA 5CPMA 4B90A 4HPJA 1GCYA 1W1VA 4GA8A 2GGEA 2Y1HA 4J3ZA 3MUAA 1M9HA 3GXMA 4FOJA 2G96A 4FK9A 3KOWA 2Z7GA 4DZ5A 1E0WA 3WNOA 1LG1A 3BW2A 4FALA 1PTDA 1CIUA 2ZDSA 1GW9A 1HF6A 2VR2A 4X22A 2IPWA 2BGNE 1H1NA 1U22A 2XG9A 3ZJ8A 1B3XA 3F2DA 3D3FA 3NGFA 4IHCA 3OU8A 3OP2A 4IXHA 2IKHA 1BWVA 1RCOB 1T40A 4GQBA 1PTGA 3BZJA 4UTWC 3TONA 3BK0A 1TPVA 2CESA 1EIBA 3AIVA 1JCMP 4HNVA 3MWCA 1JXJA 2A5HA 2GYIA 4NAEA 2BDQA 2Y8UA 2QGHA 3U48A 4BS0A 3CZGA 1I6NA 1XYZA 3BV4A 3KHJA 3WMCA 3VE7A 3EWWA 1ZJHA 3AIWA 3N2CA 4LAZA 3L5MA 4HA3A 1KNWA 3UZ5A 5C71A 3NVDA 1UKTA 4C6IA 3ITTA 5TBOA 5T8GA 1PX3A 3S46A 1WO2A 3WUEA 3MA8A 1E15A 1FQ0A 4QTGA 2DZTA 2EQDA 1NP2A 2DIJA 3RF9A 2ZUUA 1KR0A 1Z32X 3I6EA 2X16A 4IJRA 4W5UA 2FZNA 4F0KA 2RHGA 3WQDA 1BTMA 1FWCC 5I79A 1Q63A 1JDCA 3NPVA 2H8ZA 3N17A 3E96A 2XINA 3TW6A 2ZUVA 1NAL1 3EWZA 3WQVA 3NZQA 1XD0A 5EL1A 1ZBKA 4S38A 4HQVA 5FESA 2BY1A 1DIEA 3U7BA 2WWDA 3FHAA 3W83A 4YTQA 1QNRA 3AXMA 3O9NA 2FTYA 5I3FA 2PZNA 2YBTA 1HL9A 2E0PA 2HNHA 4ES4A 3HG3A 1E6ZA 1K7EA 3DOPA 4IIHA 4D8AA 3CWHA 3DG6A 4PMQA 2UY5A 5LIUX 2WKJA 3B4UA 2O9RA 1Q45A 1JRBA 4GBDA 1ZU8A 4A4AA 3EPNA 2YL6A 3TSDA 1QDSA 3URBA 3K4WA 4XZBA 3KE0A 4KFOA 2X30A 1QU4A 3P61A 4NZ1A 4AEEA 4EXBA 3ARWA 3BLIA 4DF1A 2VQTA 1XH2A 4L4LA 3VO0A 4MOZA 4GFIA 3WDQA 1V0KA 4NX0A 4LC6A 2BP1A 4L64A 1EHAA 4DXKA 3IACA 2UZ9A 4QJ3B 1SW7A 2QR6A 4GZ7A 3KBNA 2PRMA 1E3XA 2AGKA 1Q6LA 4CN4A 1YRRA 3BLLA 1FWAC 1WOBA 5FIPA 3HQOA 5CH9A 4H8HA 2X2YA 3NL2A 1Q6QA 2GVLA 1N8FA 3VIPA 4AHPA 4WKFA 4IXXA 3L23A 3RPTA 3BGJA 2PDHA 4AU0A 2J7HA 1LT7A 3M43A 3AHZA 4JGDA 4S3KA 3G0SA 1E0VA 2XGIA 1VJSA 1MUMA 3LCLA 2Z1KA 3GR4A 5LA2A 1UZHA 4BK9A 3VIOA 3FLUA 2OXNA 4KCTA 6REQB 4ICMA 1K02A 2CBVA 4GCXA 1SM9A 4NT0A 3OGRA 1MRAA 2IQ0A 3FIGA 3KEHA 4HHMA 2XM1A 1W6TA 4YHGA 1JYXA 4JX5A 2XYLA 3A47A 3I7RA 5BW6A 5I6SA 3A6OA 4C65A 1E6QM 3U8GA 2BS9A 1ME7A 5HNRA 2QUVA 4JKMA 4NJJA 3GAKA 4DF0A 1GZ1A 1XIDA 2OG9A 3W0KA 4NZ5A 2EKGA 2WK2A 1EJRC 4JY9A 1ICPA 2TAAA 3F4WA 1TWWA 3MANA 4P5UA 2R1NA 4M6VA 3OBAA 1UBPC 3LPOA 3D3AA 3S5OA 2YW3A 4CD6A 3GFYA 1XDLA 3LA4A 2FB3A 4MB3A 1F2JA 2GOKA 1Y5WA 4GISA 1L6GA