4XWUA

Structure of the imp dehydrogenase from ashbya gossypii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
389
structure length
314
Chain Sequence
TYRDAATALEHLATYAEKDGLSVEQLMDSKTRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYEPLASKSTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
source organism Ashbya gossypii (strain atcc 10895 / cbs 109.51 / fgsc 9923 / nrrl y-1056)
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
total genus 107
structure length 314
sequence length 389
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xwuA00
1CW2A 3LCHA 5D02A 2OT0A 4FX7A 2Z1BA 2YXGA 1JCLA 4IX2A 3LDVA 3TFXA 3ELFA 1KM5A 3F4NA 1H5YA 3LCGA 3I6RA 3N2MA 4WUIA 3MYOA 5G1TA 4PA8A 3WJSA 3NL6A 1I8JA 4TIMA 4QJ1A 3VKJA 3P60A 2X1UA 1SW0A 1G7VA 3WK0A 3FLUA 1ME8A 4A3UA 1F05A 4S1FA 1X1ZA 3W86A 1LBLA 1SUXA 2WNZA 4NVTA 3PF3A 1TYGA 2NUYA 2ZRYA 1OFRA 5I3KA 3WJZA 1O95A 4QITA 4GUFA 4O52A 3F4WA 3UXDA 5LNRA 3LHVA 3UWWA 1GVOA 1B9BA 3VI2A 2Z2UA 1FWNA 4Y96A 3GLCA 3HF3A 3O05A 4FEZA 5AHLA 3P5ZA 1JQVA 2FQIA 2V82A 2J9YA 1PCKA 4FB7A 1UUMA 3UY8A 3CQ0A 3L2IA 3M6YA 3E49A 4AHQA 3C2RA 1OF8A 4JTSA 3RLVA 4EOUA 3CT7A 1MZHA 4KWWA 1H63A 2VFFA 4R34A 5D32A 1OX5A 3IGSA 1FQ0A 1FXQA 5EYWA 5AFDA 3A9IA 1X8FA 3EB2A 3UWVA 4I9AA 4JTIA 1B3OA 3S5ZA 1JCJA 2CZ5A 4QISA 3RNDA 3TX9A 2I1OA 1TTQA 5AB3A 1R47A 2O7SA 4IPIA 3PY2A 2B0MA 4KFOA 1HTIA 5C2XA 1H7OA 5F2IA 1K8ZA 1O5KA 4MLRA 1MO0A 2ISWA 4Z1BA 2NV1A 3OA3A 4JTKA 4UCGA 1ICSA 1KFBA 1K7XA 1DV7A 3ABRA 5FF4A 4JIPA 3DZ1A 3EX1A 5HUPA 4IX0A 3TSDA 3LXCA 3W07A 2Q3RA 3UPBA 3MHGA 3W70A 1YTDA 2H90A 3BG5A 1DQWA 4N9DA 2GQAA 3KRUA 1SO5A 2UV8G 1M7OA 3TQ0A 3GB6A 2V81A 3VNDA 1GEQA 3P67A 4RZ4A 3RK8A 4LVBA 5EBUA 4IUOA 3QPZA 1KM4A 1SO4A 3NQFA 2E6DA 1NF7A 3IV3A 2YX0A 3W7DA 2JK2A 3O15A 3FOKA 3L0KA 1SW7A 3LHYA 2E6YA 2C15A 2QUVA 3NQDA 1K3UA 1EP2A 2JKEA 1I2RA 2R94A 5LGZA 3GAYA 2HS6A 2VXNA 3TIMA 3PWAA 1L6WA 1MXSA 3LRLA 3WJXA 3NL2A 5G2WA 1B57A 3L65A 3SFKA 3C2VA 4FF7A 3LXAA 4L4MA 4GUGA 2G96A 3TMLA 2ABAA 1C29A 3EX3A 4WY0A 1FDZA 4ADUA 1RD5A 1TRDA 4XZ9A 5H2ZA 1SZFA 1TPC1 4MVAA 3O6CA 1Q6QA 5IBXC 1DL3A 1W3IA 2EPHA 1J5TA 2FPVA 3QSTA 3IGUA 4FNUA 1P5BA 6TIMA 2NUXA 2GVJA 4BI7A 3W2MA 1O5XA 4AH7A 3NAVA 3IVTA 3MP4A 3MHFA 2CLFA 3F1QA 3T7VA 1OFAA 3T55A 4UMCA 1TJPA 3DI0A 1T99A 5FESA 1K7FA 5F1VA 4NNBA 1THFD 3K30A 5FEWA 2C3ZA 4JXCA 3AO0A 3WJWA 3ZR4A 3GAKA 2ZRVA 1JVNA 2CLMA 5L9FA 3VCRA 4UMAA 4ICNA 1DVJA 2C14A 1WOAA 2ZRZA 4ML9A 2P1FA 1DJNA 3PBVA 2A0NA 3FEMA 3QQ1A 2ZTKA 1UBSA 1WBHA 3BW2A 3S5YA 1TTIA 4MJMA 4U4MA 1GVFA 4YL2A 5CPLA 1OFBA 2VOMA 4GBUA 1TTJA 2ZZ1A 3P82A 3P81A 4TMCA 4IWWA 1ZAHA 4RZ5A 3ZFHA 5CPMA 3M5ZA 2CWNA 1XC4A 2YDAA 4MFDA 3NQMA 2QCFA 1XKYA 3STGA 3Q37A 4GXMA 4LU0A 4O4WA 3SIZA 2A6NA 1J4EA 3NQEA 3TQKA 3G3DA 3UD6A 2H8ZA 5BW6A 2ABBA 2DP3A 3GXNA 2B7OA 1JQXA 3M7WA 2QJGA 3L0NA 2RHGA 1VRDA 1GYLA 1XCFA 2EHHA 2PE4A 3SJ3A 4S2BA 1AG1O 1Q6LA 3MBFA 4ZQMA 3ABOA 4NZJA 1OX4A 2E6FA 2ZZ3A 2QAPA 2QCGA 1H7XA 1H1ZA 3NL5A 2P0OA 2CLKA 2PRHA 3W3OA 1G4PA 4O53A 1VS1A 4TR9A 4ZQRA 6ALDA 2Y70A 3HMJG 2PC4A 1KM1A 1QDSA 4O8RA 3HG3A 1GPWA 4DPQA 3GDKA 3UYCA 3NQAA 1JCYA 1P4CA 4NJGA 3ANYA 5G4EA 2JKAA 2Y6ZA 2QCNA 5BMWA 4ORMA 2V5LA 2A7PA 1TPH1 2V30A 3HO8A 1JJKA 3UQNA 4LS1A 2C13A 5EA9A 3WK1A 3G1SA 5FF3A 1TTPA 5C55A 1RZMA 4M7SA 4O16A 3W7GA 2A6LA 4O1CA 1JUEA 2GVLA 3LB0A 4MZ1A 1K03A 1H51A 1W8SA 4NX5A 4UTTA 4HSNA 1J2WA 3ATZA 1ZAJA 3TC6A 5D30A 4RK8A 3T44A 2RKXA 1GJPA 3DFOA 5TIMA 1EX5A 1HFBA 1QCWA 3TDFA 2TYSA 4KFPA 4AAJA 3NZRA 4LV4A 1VCVA 1S3HA 2QJHA 1F73A 2RDWA 3G1VA 3W2UA 4AWSA 5C6MA 5HUOA 4IMGA 5J5DA 4IMCA 1FWRA 3NQVA 5LHFA 3DFNA 2ZZ7A 5BOOA 4NJKA 3W7RA 4NJJA 2GUUA 1OJXA 5HULA 3W7EA 2CFFA 4JYDA 2O7QA 4A29A 2Z6IA 1VHNA 4IMFA 1KM6A 4JX4A 4P2VA 5KZDA 4H4IA 5EPDA 5FF0A 1TPWA 3GDLA 1O4UA 4Q33A 5LNUA 1QMLA 5CKSA 4UTTC 5IBXA 1LCOA 4LWWA 1T0OA 4O4VA 5DBTA 1FCUA 4AWUA 3FKRA 4OT7A 2V5BA 3LCLA 2YFOA 3QMRA 3L21A 4WXYA 5D04C 5E93A 8TIMA 3W75A 2OJPA 2QEZA 2PRLA 2I9EA 3BVJA 4UR7A 4P61A 2E1DA 4AB4A 5KSWA 3NQ2A 3W1TA 1VYSX 3TV8A 1GG0A 1SFLA 1TCDA 4CCDA 2B7PA 1X6UA 4N9CA 4Q32A 1ZJIA 4Z0JA 1NVMA 3S6DA 4UFHA 3DGRA 1FDJA 5HMSA 1S5WA 1VLWA 3ZS4A 4CCEA 3MI6A 3BGGA 3NR0A 5K9XA 3LOTA 3OBKA 1OABA 1SU5A 3KOFA 3NVTA 2YR1A 5AC6A 3QMSA 3TW7A 2ZZ5A 3GDTA 2C1HA 3QC3A 3BLFA 3MP3A 1K8XA 4UXDA 1A50A 3MUXA 4XKYB 3STEA 3G3MA 3SR7A 3HG2A 2WSRA 4MUZA 1SSGA 1W37A 2E5DA 4AMAA 1TPUA 2OX1A 2EAWA 3PBUA 1ONRA 2Y61A 5D09A 3EWZA 5LGXA 1R46A 2XN1A 3ATYA 1TV8A 1Z42A 1LROA 3M1ZA 1ZY9A 3W1MA 5I3IA 1W31A 2WPBA 5CPNA 4X22A 3EXTA 1LP6A 1GTHA 4S2CA 3PM6A 3C4UA 3FFSA 3W7MA 4LVAA 3TW6A 1DBTA 2C0AA 3DFPA 1ZENA 1KTNA 3HGRA 3SY5A 3GR8A 3TA6A 4O0KA 3W1PA 1QPRA 3M5YA 1LRTA 7TIMA 1D3HA 2ZA2A 1P0KA 3FYOA 5FEPA 2YZRA 1ADOA 4Y8FA 2AGKA 2G5WA 3W6YA 3G8RA 2XN2A 4NUWA 3KFTA 4AWTA 1LOSA 4O1BA 3S1VA 4ZZ9A 3W23A 2KZHA 4RXGA 2DZWA 1WYIA 4BFAA 3W87A 3L68A 5LKYA 1ZALA 1G69A 1MEHA 3P80A 3PG8A 3TXVA 3LM7A 3O16A 1V5XA 1LOQA 4DEFA 3UWYA 4LW7A 4CQAA 3AJXA 3LXBA 1KFJA 4MPQA 2DJXA 2XN0A 2B7NA 3G24A 1WV2A 3C56A 2OT1A 4IGHA 1MEWA 1QFEA 3N9RA 2VENA 3L0GA 4J9JA 3NYZA 3LV5A 4YXGA 2LLEA 4ONVA 5AYYA 4R33A 5F1UA 2YW4A 5I3HA 4MOZA 3EX6A 2ATSA 1DQXA 3I7RA 1Q45A 4YCOA 3FA5A 3W1NA 3OVQA 2VFIA 3W2NA 3BG3A 3LHUA 4UTJA 1F76A 1GOXA 3DHDA 1OF6A 1PS9A 2X16A 1SO6A 5CZSA 1QPQA 4O10A 2F7FA 3LHTA 3P8IA 1W5QA 3S1XA 4JDBA 4AHPA 3Q94A 3NM1A 3BO9A 1TO3A 4FHAA 2NXHA 3G0SA 3QM3A 4XKYA 1EUAA 2VEPA 3LTSA 2R8WA 1OHLA 1AW5A 4MZ8A 2H3BA 3H53A 5DCBA 1N8FA 3PULA 4NJIA 1UUOA 1SZEA 3G1AA 2ZFAA 4JN6A 1T96A 2DU2A 1KFLA 5F2MA 5F4SA 1LYXA 2H8XA 4JYEA 4K37A 3LI0A 4RLIA 1A53A 1KTBA 5AOUA 3O6YX 4LUIA 4ZQPA 1H1YA 2BXVA 3ABQA 3CEPA 5GVJA 2A7RA 1KBJA 1TRIA 3PC0A 1R2SA 4XQ6A 2D73A 1RPXA 4PTNA 1YYAA 3HB9A 2FB3A 4ORIA 3C8FA 2QAFA 5DCEA 3HG4A 3U2OA 4ADTA 3N14A 2FIQA 5D03A 4GRSA 4LUJA 4OWGA 2B4GA 3GR7A 2QUTA 5DCDA 2QR6A 3JR2A 1WDWA 4K39A 5A8GA 2V9DA 3PSWA 1Z44A 4LY8A 1I2OA 1OFEA 3MJYA 2G95A 1LRNA 1CX9A 3EX2A 3LHZA 1GVQA 1QWGA 1TQXA 4JX6A 3LRKA 3W73A 3LLDA 1WX0A 2GVGA 4DF0A 1PE1A 2V2DA 4LVDA 1JULA 3KVLA 5LSMA 4N9EA 1F5ZA 2HMCA 2Y7FA 3WK2A 3MMTA 3TSMA 2WNNA 1TPFA 4AF0A 1XUZA 2VELA 4MY8A 1M7PA 1EP3A 4JTJA 1SZGA 1DJQA 1Q3NA 1JCMP 4WOQA 1YTEA 4PCFA 3CM4A 3C52A 3N3MA 1G7UA 3LRMA 4ALDA 4FNRA 4GNJA 3W74A 3GXPA 5D2YA 3TQVA 4MKNA 2NX1A 1BWKA 1XDMA 4X3ZA 3QRHA 3HGJA 2Y7GA 1G4EA 3G8EA 1QR7A 4R53A 4JYFA 4XWUA 2FTPA 1I4NA 3I7SA 1TPB1 2CLOA 5AHEA 5HINA 3NEVA 2R14A 1EEPA 4O18A 1U5JA 3P74A 1WA3A 1ZFJA 1OYAA 1VZWA 4EWND 1FWWA 3W1RA 3W72A 1T8XA 3L5AA 5G2IA 5TBOA 1RQHA 2E77A 1SO3A 4K38A 2ZTJA 1Q6OA 4LV9A 3USBA 1XL9A 1E51A 2YPIA 3FJ6A 1MSSA 4QIUA 3W1XA 1TV7A 3GKAA 4BI5A 3GVGA 1EPXA 1ALDA 1KM0A 5G5IA 4O19A 3MI3A 4K7VA 4LS0A 5MHBA 3NA8A 2E68A 3ABSA 3A24A 3W85A 3TU9A 2ZZ2A 4UNKA 1GYNA 3FS2A 2WQPA 2QDHA 1L2UA 2X1RA 4MY1A 1I45A 3G18A 3B8DA 5K4ZA 1IXNA 1GZGA 2RDUA 3STCA 3CPRA 3NO5A 3L5MA 4FNSA 3TR2A 4CNPA 4RZ6A 3T78A 5HWMA 1XM3A 3PUEA 5LNWA 4H3DA 3BPWA 1YXDA 2YCEA 4YLWA 3DBPA 3LCIA 1TJRA 1PVNA 3W76A 2ZRWA 4EF9A 1YXCA 4XTDA 5K2ZA 4HPXA 1EB3A 1XDLA 3EXRA 3HPXA 4O12A 1PL9A 3N34A 2VFDA 3VE9A 4EVZA 4MYAA 2QUUA 4DF1A 5CZTA 4U28A 4DBDA 4QSHA 5LHEA 5D2VA 3G1XA 1KA9F 1S5VA 2J88A 3KAOA 1VQTA 4FO4A 1ZHAA 4K7YA 5D38A 5H91A 4DO4A 5I3GA 3KVKA 3M44A 3P7YA 3SGZA 3TKFA 1XUUA 3OVPA 1IXOA 4CNNA 5KZEA 4A21A 3P84A 1W5MA 3NDOA 1EIXA 1N7KA 1EWDA 2NZLA 3R13A 5DELA 3IEBA 1L6YA 3SI9A 1HL2A 3G1HA 1GG1A 1R2TA 3W7PA 4Z1AA 2NUWA 4IQLA 5BNKA 4GUHA 4JGDA 3KX6A 2C18A 3NPXA 4LVGA 3TCEA 4M6VA 2V0TA 4Z1CA 1MEIA 1LLZA 3PSVA 3W7QA 2YFNA 3NQGA 3I65A 4RR4A 3TJXA 3RLUA 3GKFA 1WOBA 4JTLA 1S5TA 1OFQA 1W3TA 2CLHA 4HNNA 4UFJA 3PB0A 1QPOA 3WJYA 2NX9A 2W0UA 1LLWA 1A5BA 4N6FA 1OYBA 3QSRA 1OFPA 1RV8A 3M9YA 1NSJA 3MWAA 4PL2A 4XUGA 3C2OA 1H62A 4UMBA 3W7OA 2QCMA 4DO6A 2NLIA 1TMHA 1WAUA 2C19A 3N73A 4A22A 4PC8A 1JCNA 2HTMA 1LTDA 3LBCA 4UFKA 3W2KA 3G0XA 3W7CA 2J6XA 1H61A 3W7NA 3W71A 3HBLA 3TNOA 4DQWA 4QNWA 1I2PA 5HR7A 5I3JA 2R91A 3H55A 1R30A 1GT8A 2V8ZA 3HGSA 5DY3A 5EL1A 4N4QA 2J9ZA 1VPXA 5CZJA 3QYQA 2GQ9A 1X1OA 4FNPA 4DF2A 4UFLA 4FXSA 5L6UA 4HSOA 2Q8LA 4MFEA 4DELA 4RJEA 3IIZA 4LC6A 3YPIA 1KW1A 1I2NA 4JDYA 5U7SA 3CEUA 4FX8A 2I14A 2WO5A 3CIWA 1W3NA 4N9BA 3DFTA 5CSSA 5DY2A 4WX2A 2RFGA 3C0JA 4JTUA 2DJLA 1N55A 2GOUA 2QF7A 5DN1A 4UTMA 1PCWA 3HGOA 4WJEA 1JCXA 5CGQA 3NQ7A 4PFMA 2QCDA 4Y9AA 3M41A 4TO8A 2X1TA 1AMKA 4O54A 1YLVA 4JEQA 5FEZA 2CW6A 3BLEA 3W1AA 2QDGA 4JD4A 3SGUA 4UTIA 2FB2A 1W54A 5F4WA 1XI3A 2DZXA 3JRKA 4IXHA 4O0ZA 2W6RA 4CCCA 1FDYA 5HJLA 3NQ8A 3A21A 4L4LA 4TU1A 1SR9A 3MYPA 4IOTA 5HWNA 4FIQA 1QO5A 3E02A 1VHCA 2NXGA 4W9TA 4Z1DA 4LTSA 2A21A 1PHWA 1W5PA 2Y63A 4OHQA 4B5NA 5K7JA 5D05A 1QAPA 1QOPA 1DHPA 5C54A 3THQA 1EUNA 2EF9A 2WOQA 1JRCA 3EX4A 2J24A 3N19B 5FI8A 1M6JA 3TUUA 4UUIA 1EA0A 4JS3A 4YCPA 3Q2DA 3O07A 1F74A 2BX7A 4K8EA 1KM3A 3W88A 4DPPA 2DZUA 4BWLA 1OX6A 4WXZA 3OIXA 4OGZA 3R12A 3C61A 2RH9A 3WK3A 1M5WA 3TSBA 5SWUA 1L9WA 1RVGA 2QCCA 3I7QA 3OEXA 1LRQA 4MYXA 3U8GA 4M6QA 2JGQA 3GX9A 1Z41A 4X9SA 3W22A 3O6DA 4AEOA 3S1UA 3LI1A 2P10A 1VCFA 5AC8A 2PRMA 3V75A 1YADA 3DXIA 1YPIA 2JKPA 3S5OA 3BW4A 5F4XA 3D0CA 1AK5A 2H6RA 2ISSA 1HG3A 5BRBA 3HJZA 1NEYA 1YPFA 2J27A 3MHUA 4JICA 3QEZA 2BSLA 4OU1A 4MLJA 4FX6M 5LNVA 4WY0F 5D2XA 3PUOA 1SZNA 1IIGA 4OBTA 2VFHA 1VCGA 2VEIA 3S1WA 1H7PA 1V7YA 5DLCA 2VFGA 4YWIA 1ML1A 1IXPA 1B4KA 4ADSA 5KZMA 4BK9A 4NNAA 2TSYA 1KBIA 2J9XA 2CU0A 2VEKA 1IXQA 1TQJA 3FKKA 3G1DA 1NF0A 3CTLA 4EF8A 3HQ1A 4UFIA 1PIIA 3UY7A 1TB3A 2DZSA 4JTTA 4PEKA 4GC4A 2FJKA 4HHPA 4RCXA 5D2TA 2ZRXA 2BZNA 2NV2A 4LT9A 3GIYA 1YXYA 1BEUA 5HWJA 1KFCA 4E2DA 4PL1A 1UB3A 2OMAA 1OFDA 4O28A 2XFWA 4O1AA 3IIOA 2A2IA 3GNNA 4BI6A 5G4WA 4QQ3A 2W79A 5LZLA 3W1UA 1FY6A 5CSRA 4UTWC 3CIXA 1SQ7A 2ZDRA 1O94A 2FPTA 1IF2A 4HIBA 3PUDA 4O15A 3B0PA 5K9DA 4GWEA 1W56A 1H60A 4E0CA 2B7QA 3NPUA 3IIXA 3VFLA 1VJIA 3OHIA 4M5PA 3GZ3A 4HNVA 4LS2A 1H50A 4AF0B 4WY0B 2A5HA 4UIOA 4O13A 2GPTA 3E96A 2FFCA 4BF9A 3W7HA 2ZYFA 4UC5A 4WD0A 1F6KA 5K4XA 3G1YA 1KTCA 3QQ0A 4IPJA 1KFKA 4UNLA 1C9DA 1K8YA 1GQNA 2QKFA 3V1PA 2GJLA 3DFQA 4LC8A 2BWGA 2Q3OA 1ICQA 2HS8A 1BKSA 2X1SA 1ZCOA 1TPVA 2NWRA 5KTLA 1H7NA 4MJZA 3A5FA 1AW2A 2Z6JA 4JY9A 4Z0SA 2CLEA 3TC7A 3T40A 1FXPA 3NQCA 1QNVA 1FUYA 3EXSA 3W1QA 1XXXA 3EWUA 4Q4KA 1JRBA 4ZQCA 4FNTA 4RXFA 2JBMA 2GJNA 3EWXA 3HG5A 1G6CA 1BTMA 4HPJA 3TH6A 4KFNA 4RV8A 5T26A 3LGEA 4YMZA 3S0CA 3EKZA 1SW3A 1YDOA 2QCHA 1U83A 1LZOA 3TROA 1JUBA 2YW3A 3RFAA 3LLFA 2FDSA 5FF7A 2ZCGA 1HO1A 3NNTA 1K7EA 4JTHA 4CQ9A 5DBUA 4JY8A 3KRSA 1FBAA 2DZTA 1SSDA 1XBZA 5AYXA 3STFA 5CZ0A 2Q8ZA 1C8VA 1P0NA 1ME9A 2GQ8A 4GE8A 5DXYA 3BLIA 3DH7A 3B0UX 2DZPA 4KKXA 1SFJA 2Y7EA 1EP1A 1DKWA 1OFOA 4TX9A 3OG3A 4CQ8A 4GUIA 1VR6A 3PAJA 3W83A 4UTWA 3UZ5A 4WQ6A 3FJLA 3NQ6A 1O60A 3VE7A 1AL7A 4HN4A 2EGZA 3LBMA 3PVFA 3UWZA 2TRSA 1B4EA 4M7TA 2EKCA 4DBEA 1Y0EA 1VGAA 5E1QA 3B4UA 1NAL1 2QCEA 3BARA 4NXSA 3LTPA 3B04A 5C5YA 1TREA 3TJLA 2C6QA 1ME7A 2RDTA 3BV4A 2YSWA 4IXXA 5TQLA 3MI2A 3HPZA 3A5VA 3S9YA 1JR1A 3P62A 4I7VA 4NJHA 1G4SA 1RR2A 4IJBA 1I2QA 3W7LA 3G1FA 1TSIA 3LCWA 3R5EA 2DORA 4OE7A 4BWLC 5CPOA 1DOSA 4A2RA 4WOZA 3EWBX 5DXXA 3IGXA 3RU6A 4CNOA 3M5VA 1F2JA 2FPYA 4GJ1A 1NFBA 2A85A 1CI1A 3GNDA 1OK6A 3BG9A 4GUJA 2Y7DA 3KXQA 3O1NA 1VLIA 2TPSA 3EKLA 1PV8A 3CLMA 4NX0A 4D2JA 4ZQNA 3R2GA 3NXFA 3TXZA 2ZQ0A 2CZEA 1OG0A 4LOCA 3GDRA 2X2GA 3IIPA 3NL3A 1W0MA 3E9AA 4OQVA 2TMDA 4K8HA 3DI1A 3U6WA 1QPNA 4FNQA 3W2LA 2Y62A 2HSAA 3QZEA 1H7WA 4ZL1A 3A22A 2WSQA 1YDNA 4NQ1A 5AYZA 1FCBA 2E09A 4K6AA 3CHVA 4O14A 3BW3A 1XFBA 3S42A 1R2RA 5KITA 1KM2A 5J5RA 3O63A 2ZA1A 2JGYA 4IMDA 4O17A 4UTKA 2VFEA 3QFEA 3IVSA 1A5CA 2CLLA 3MW7A 4ZMGA 5G1YA 1F6PA 3PBYA 2X30A 4JIQA 4LRTA 1W1ZA 4HNTA 3M5XA 3LHWA 3KVJA 3Q58A 2OZ0A 2WNQA 3HPSA 1RQEA 3QW3A 5K3VA 3QF0A 1WBJA 3E0IA 3PS7A 3L66A 1HO4A 3W9ZA 3C2FA 2QJIA 3DKJA 1BWLA 4TMBA 1IGSA 2WKJA 4JNMA 3GXTA 4LNYA 3H54A 4AHOA 4Z08A 1G4TA 4M19A 1KFEA 1KV5A 2NX3A 4HT3A 3RF9A 4UR8A 1KLZA 2YYTA 3QPYA 3UZJA 4XBKA 4DXVA 4I7WA 1W5NA 4FIRA 2WJZA 3TAOA 4Y6GA 1GWJA 5D33A 1FWSA 3HOJA 3LCXA 3LV6A 2WV8A 3G22A 2CLIA 2ZRUA 2YYUA 5E0KA 5IM51 2VC6A 3QW4B 1QO2A 1LM1A 4I7UA 1PHQA 4O11A 3CB8A 2V2HA 3FYPA 3SSJA 4C1KA 3IVUA 4AVFA 5EMUA 4EIVA 1FWTA 3W1LA 3CU2A 1A5SA 5G2HA 1XBVA 3TFCA 3P8JA 2ALDA 4FXRA 2Y88A 3PR2A 1WQ5A 3UWQA 4JR5A 3R89A 3IIVA 3NG3A 3B05A 5FEXA 3M0ZA 3GK0A 3M43A 2A1YA 1OYCA 4UFMA 4C1LA 3BGJA 4QNEA 3C6CA 3PBWA 3T4CA 4CLMA 1LBMA 3DU0A 3BK0A 1KLYA 2Z0IA 4O57A 5D2WA 1OK4A 4N6EA 3W7JA 4JTGA 3CWOX 2BLEA 1IIHA 3TE9A 4PODA 1TIMA 2ATMA 3EEGA 3NM3A 3FIGA 3LTYA 3O8AA 3INPA 3ZWTA 4RKAA 3UPWA 1W5OA 1GVRA 5AC7A 4ZVJA 3DKLA 5ABTA 3KRZA 1D9EA 3PB2A 4K36A 3R8RA 3NOEA 4WZHA 1LOLA 4BR1A 2VKZG 1EWEA 5EKYA 1Q6RA 3P5YA 4M6PA 3SW6A 4MY9A 2ZA3A 3DHFA 1XBXA 1FCVA 3SECA 4E38A 3QH2A 5F2LA 3UNDA 4NXKA 2A4AA 4MIMA 2AAMA 3TMQA 2E5CA 1KV8A 2V2CA 3KVMA 5I3FA 5CG7A 4OV4A 3HIJA 2PURA 3LCFA 3M16A 2QCDB 3MBDA 1LORA 3LX9A 3JS3A 2ZZ4A 2IQTA 2E5BA 3NGJA 5KMYA 1X7FA 1WXJA 1ZNNA 3O06A 3I68A 4UTUA 3C2EA 4O1DA 2DZVA 1ICPA 2H3DA 2Y89A 5AN7A 1A5AA 2E6AA 3NPWA 2CZFA 1SPQA 1HUVA 4LVFA 2ZBTA 4N4PA 3RMJA 3QMTA 4ZQOA 3MP5A 2ZZ6A 5K9CA 3LERA 3CC1A 5AHMA 1TPEA 2NWSA 4AXKA 5AHFA 1LDCA 2QCLA 1LBFA 3TK7A 3GYEA 4XTIA 4A2SA 1H7RA 1DORA 5D37A 5KINA 3DAQA 2G97A 3UWUA 1VH7A 4QM1A 1L6SA 4NT0A 3B03A 3EWWA 5HR6A 1D3GA 1Z48A 1GVSA 5F2GA 3UXAA 3B06A 5BMXA 4Y90A 3L67A 3IRDA 5AHNA 3KHJA 1GTEA 4PH6A 4UTLA 5FF2A 3L5LA 1TV5A 1VC4A 1AL8A 1P1XA 1YDVA 3W7KA 3L9CA 1G67A 1F7BA 1ZAIA 3W2JA 3GDMA 2BTMA 1QOQA 3TAKA 4KWVA 1AW1A 2NXIA 3W84A 3C3NA 4POCA 4LRSA 5U4NA 4X2RA 3B0VC 4MZYA 4QAIA 4N02A 1OVDA 4XBSA 1UJPA 3F03K 2C16A 4R7JA 4UTHA 1UASA 5A5WA 1VYPX 4DO5A 3DENA 3NZ1A 4JX5A 4HKPA 4GFSA 5HQEA 5AHIA 4NZFA 2ISVA 1FCQA 3M47A 1TPDA 2OCZA 1VYRA 3CWNA 4G1KA 4JTFA 1K02A 4HNUA 4JTEA 3SZ8A 3S8HA 3S5NA 3NPVA 1OX4B 2A7NA 4H6KA 4O50A 4NU7A 3THAA 3DFSA 3ZWSA 2PCQA 3PG9A 5LNSA 2VEMA 3MO7A 5HNRA 2YGYA 4RX0A 3P61A 2CZDA 3OVRA 1XBYA 2Y85A 4IMEA 4OV9A 3EWYA 3G0UA 3WFAA 4E2BA 3A23A 4N2YA 3W7IA 2F84A 4NNCA 5EY5A 1UCWA 2WSYA 3QJAA 2AQWA 1RQBA 2FLIA 1YTKA 1JUKA 3N9SA 3N2XA 3E12A 1FX6A
chains in the Genus database with same CATH superfamily
2DQXA 1DHKA 1CW2A 3M0MA 1J6PA 1HN1A 2Z1BA 3RGTA 1JCLA 1L8PA 4U2YA 3TFXA 4CQCA 5CSUA 3K5XA 4K3ZA 2WYSA 4QROA 3N2MA 3MYOA 5JU6A 5G1TA 4PA8A 2HNHA 3HJEA 4QJ1A 1QI5A 3TN3A 1G94A 3PF3A 2ZX6A 7REQB 1XLFA 2NUYA 2D0FA 1EJTC 4WDTA 4AY1A 3WH7A 4GUFA 3E0LA 3ABXA 3LEPA 4AZ5A 2GSJA 4GZ7A 3GS6A 2GJXB 1XLEA 3VI2A 2Z2UA 4Y96A 4IPLA 3FNDA 3LPPA 4A3QA 2I57A 5HOSA 3KZPA 2HBVA 3M6YA 4NRSA 1ESWA 4S23A 1V3IA 1UHVA 1HXJA 4UQAA 5AC4A 1VEOA 4GACA 3RLVA 4EOUA 3IJ6A 3CT7A 4KWWA 3A9BA 2HNEA 4QEHA 3VAVA 2ANUA 1OX5A 1FQ0A 5AFDA 1F61A 1XLHA 4LX4A 3EB2A 3GRIA 4JTIA 4XK2A 3FAXA 4ZXLA 2CZ5A 4C6FA 4UWMA 5FJPA 1R47A 2O7SA 3MU7A 2PDKA 4B2DA 3FAWA 3SFWA 3S2JA 5B7YA 1JPIA 3VNKA 1X8CA 1H7OA 5F2IA 1RUSA 4MLRA 4Z1BA 2NV1A 1LQ2A 5J8LA 2PDBA 3CQKA 1FVPA 4RNHA 3OO2A 2WNWA 4Z17A 4XZLX 1Z6KA 3MCOA 3LQLA 4HK7A 5JH2A 1QPKA 3RX3A 2D2JA 1IWAA 3IV8A 3LXCA 3W07A 1N8IA 2P3EA 4BJHA 5A6TC 2Q3RA 1V6WA 1YTDA 1DQWA 2GQAA 1EJRC 2ISDA 1M7OA 1FA2A 4RW5A 4NKCA 3RK8A 3UJRA 3RYSA 4IUOA 2W5FA 1U1UA 4AIUA 1OCNA 3MSDA 3VC5A 4I6VA 4QFUA 2GUBA 3FOKA 3L0KA 1SW7A 2E6YA 3AHTA 1HJQA 1I2RA 5LGZA 3F5LA 3ES8A 1W32A 3QY7A 1B57A 2WZHA 2OELA 4G2DA 3C2VA 4QQUA 1TCMA 3WQEA 4C1NA 2IPJA 9RUBA 2DQWA 3EX3A 2FGBA 4WY0A 4XZ9A 3IAPA 1W3IA 2BGQA 1J5TA 4PYSA 3N3TA 1ZCCA 1P5BA 4BI7A 3W2MA 3GYCA 4RE4A 3IVTA 4JFUA 3UR5A 3UXLA 3F1QA 3T7VA 2HDJA 4UMCA 1TJPA 5FJIA 2VZUA 3WLPA 4NRRA 3S6OA 2C1GA 3AO0A 3WJWA 1S1RA 1M04A 3U2EA 3ZR4A 3GAKA 3CUGA 4D8ZA 5A69A 3ME3A 4L1GA 2WMKA 3L4ZA 3WQOA 1GVIA 1UIOA 4KESA 3PBVA 1S39A 3O3RA 1UBSA 3BW2A 1O7AA 4MJMA 1GVFA 4YL2A 1ISWA 3M0VA 3NEHA 1TTJA 3JUGA 3P81A 2EG6A 1ZAHA 8XIMA 3CH9A 2R82A 4PTXA 2CWNA 4MFDA 2QCFA 4LU0A 4O4WA 1J4EA 4US5A 4P8UA 4ATWA 5G4HC 3G3DA 1IZJA 3BL3A 2H8ZA 2X1IA 3GXNA 2B7OA 3UU0A 5CGTA 1GYLA 1T7LA 4LALA 3QLLA 1RLDA 1W2PA 2JF6A 4NAFB 3MBFA 4AU0A 1XIFA 2QAPA 3AS0A 1LLOA 3FHAA 4FLRA 1H1ZA 3NL5A 3W3OA 3GG7A 4O53A 1VS1A 2PTXA 1EFZA 4ZQRA 2PDNA 5LXXA 1FHVA 3VZZA 2XM1A 1NQKA 1E1CB 1JXKA 1AH3A 1BXNA 3NQAA 2J13A 1JCYA 4NJGA 3ANYA 5G4EA 2QCNA 2A7PA 4QEEA 3HO8A 2VX5A 3B9NA 1FWAC 4LS1A 3O9NA 2DSKA 3UZWA 2QLYA 5AECA 1TTPA 3BICA 1RZMA 4WKFA 4F8XA 1R9ZA 4IHCA 5LIYX 3LB0A 4MZ1A 2E7FA 4NZ5A 3MZ2A 5JBFA 4PMXA 4CEXC 1RA5A 1S2AA 1H51A 3ZT5A 1IGWA 2GQ3A 4OOZA 3T44A 3XINA 2RKXA 3GUGA 3TDFA 1TE6A 2GZXA 3WELA 1XIHA 5EFFA 1UD6A 2CCRA 2OGYA 3W2UA 5C6MA 2QZRA 4IMGA 3N2BA 3WH5A 5J5DA 4A3RA 4IMCA 1G9HA 2CERA 3T0BA 3UJ2A 3EA2A 1CDGA 3O7UA 1DJWA 5JIWA 1EZ2A 1OJXA 5HULA 4DWSA 1GOQA 4JYDA 1E4NA 2O7QA 4A29A 2Z6IA 5DEZA 1KM6A 1C7SA 4B3LA 3RPDA 3MUCA 4DX3A 1UOZA 3ZVHB 4O4VA 1FCUA 3LCLA 4PTVA 3KW3A 1TA3A 3N9KA 4ZO9A 4GYKA 4P61A 4Q8UA 4HTBA 1AD4A 1E9ZB 4QRNA 3WSUA 3ITXA 3W1TA 3SB0A 3ZJ8A 4OFCA 3SCOA 4H8UA 4KWOA 1QK2A 4D9PA 4C6LA 3SUUA 5HMSA 3F4VA 3H4XA 4YVXA 5CJ5A 1VIZA 3MI6A 3BGGA 4GO9A 4XAZA 1YW1A 4FR1A 4WSJA 1OABA 4LF2A 4YTTA 3KOFA 3NVTA 1DXIA 2YR1A 3TW7A 3QC3A 3B0XA 3MP3A 2FHCA 4ZOAA 5DMNA 4XIAA 3G3MA 2EPNA 4AD3A 3GTIA 1AUSL 3TNBA 2OX1A 1HZYA 2EPLX 2OTDA 4PSRA 3Q67A 3V7PA 2Y61A 3UCCA 3EWZA 3EWDA 4LB3A 4OBSA 4FMVA 2XN1A 4EANA 3D5HA 3WMLA 2WAGA 1NY1A 4OECA 4X0VA 5I3IA 3ITTA 5JIPA 2IKGA 3EXTA 3BURA 2P8BA 4L9ZA 3C4UA 3FFSA 3IK2A 1W1B1 3T09A 1DBTA 3CPUA 2C0AA 3DYPA 3EB4A 1KTNA 2ON3A 3GC4A 1XJBA 3B9AA 3W1PA 4GIEA 3UETA 2HBXA 2ZA2A 1V6UA 1Z69A 2GWGA 2UBPC 3GIQA 1P1MA 4Y8FA 3NZPA 8RUCA 3G8RA 2XN2A 3KFTA 4O1BA 3JZUA 3S1VA 4ZZ9A 3W23A 2GFTA 1ZPTA 2DZWA 1WYIA 2BG5A 4Q8TA 4G56A 4QG6A 1E0VA 5A6BA 1MEHA 5D8WA 3PG8A 2PF0A 1GQJA 3O16A 3RX4A 3VXGA 3OIHA 2XSBA 4CQAA 4E2OA 4ASTA 4HZ7A 3LXBA 3N6JA 3FX4A 4IJCA 2XN0A 4RNIA 1V51A 3H4GA 3T05A 2OT1A 3A47A 4IGHA 2OOGA 4Q4QA 3L0GA 4S3CA 4YXGA 4YHEA 4F2UA 4ZTXA 4ONVA 5F1UA 4A4AA 3EX6A 1RH9A 1ITUA 4PMJA 2WVVA 4YYCA 1Z7AA 3W2NA 4AXNA 4FOJA 3LHUA 2OR2A 2X16A 1EJUC 3L4WA 1UYQA 4U3AA 3AS2A 3W38A 2IKHA 2WWCA 1IWPA 1TO3A 4MJ4A 4RDWA 2FYMA 2XVGA 3U48A 4PRTA 2H3BA 3H53A 5EFDA 1VPYA 4IZGA 4UQDA 4NJIA 1N82A 4JHOA 3G1AA 2X0YA 2ZFAA 1M7JA 1PYMA 1T96A 2MNRA 4D8AA 1KC7A 3KOXA 3QHNA 3BOLA 2CNCA 1O1HA 3VIIA 3LI0A 1KTBA 2P88A 4JL1A 5A2AA 4LUIA 1W1PA 1H1YA 3CEPA 2ADAA 3GBEA 2FTWA 1TRIA 3PC0A 4QDPA 4JQAA 3VDGA 3FA4A 2PDYA 3E0FA 3M0XA 1YYAA 2ZXAA 3HB9A 2HVMA 4ORIA 1D3CA 2BDQA 5FOOA 1KBKA 1HGWA 1VFMA 2D2HA 3N14A 4M6UA 5HATA 4PTMA 5HXMA 4GRSA 4LUJA 3PFRA 1NWUA 2VVNA 4XKMA 5FL1A 5BCAA 3RLHA 2MUCA 4ZO8A 4K39A 2V9DA 2P53A 3RMEA 4YVPA 3PSWA 2CHNA 1I2OA 2Y24A 1MMFA 2PTYA 3LHZA 1QWGA 1PSCA 2OX4A 2QS8A 4LUYA 3QV6A 4LVDA 4N9EA 1NDZA 3KUMA 1R3QA 3R7MA 3TSMA 1Q2RA 2WNNA 4PSPA 1Y65A 4PMDA 3ONCA 4HP5A 4HPGA 1TJ1A 4JTJA 2A79A 3WQ8A 3CT2A 1JCMP 3WQCA 4Q7NA 5GJPA 2E8YA 3CM4A 3C52A 1EXBA 4GNJA 4XZNX 3GE7A 4RZBA 1J0ZA 3W74A 3TQVA 5EMYA 5BU9A 4IFKB 1U5VA 4IFKA 3BC9A 2PLJA 4RPPA 3HV9A 1I4NA 1TPB1 5HINA 2CIPA 1G01A 4OVXA 3NEVA 2OYMA 1OQFA 1KWGA 3MCMA 3SAZA 1AJZA 3RM4A 3B8UA 1VZWA 3VIJA 2PWVA 3L5AA 1ZB5A 5TBOA 2E77A 4XD4A 1SO3A 4WDXA 1Q6OA 1XL9A 2YPIA 3L4VA 1MSSA 3W1XA 3AXHA 2X40A 1XYBA 3MY9A 4M0XA 1ALDA 5BROA 1UH2A 3MI3A 4LS0A 3PANA 1JZ5A 4YHGA 1WZMA 5MHBA 3VD3A 4MKVA 3P0WA 3A24A 4V33A 5C70A 3TR9A 1GYNA 2WQPA 2QDHA 3OQEA 5CPQA 1I45A 3MZNA 4HA1A 3B8DA 1Q7ZA 4W8AA 3MCNA 3F2DA 2FVLA 1X97A 1XIEA 4DNMA 2VC9A 2WJEA 1PBGA 1XM3A 3VKBA 4K2SA 5LNWA 4H3DA 1PWLA 1L2QA 4S3FA 4YLWA 1TJRA 1S2UA 1PVNA 1E6RA 2QMJA 4B3ZA 3W76A 4FLOA 1XH2A 4EF9A 5K2ZA 1W9UA 3EXRA 4O12A 3N34A 3VE9A 4EVZA 5ENLA 4U28A 3SY1A 4E3TA 2VNCA 4LH8A 3WDRA 5D9PA 5D2VA 4GZIA 4G7FA 4GABA 1R3YA 1S5VA 4AEEA 3KAOA 1UR2A 4AY8A 3CZGA 1NDWA 5D38A 5HANA 2CXGA 4IUGA 1EYEA 4MHBA 2O92A 3AALA 4J27A 3ID7A 1UR9A 4ZFMA 5KZEA 4V28A 2RGLA 1A5MC 3DYOA 3P84A 1DIDA 1EWDA 2DZBA 3T08A 1PX4A 5DELA 3R13A 4ZSUA 3SI9A 1L6YA 1JAKA 3G1HA 2ZKMX 1K4GA 3W7PA 4D6CA 3SCUA 4IP7A 3KX6A 3NPXA 1JCTA 2WVVB 4HB7A 4Z1CA 4C6CA 1LLZA 1QBBA 4M29A 2VR2A 5T9CE 3RLUA 1WOBA 3AIQA 1Z9AA 4HOZA 1KBBA 2CLPA 4KIRA 2CLHA 4HNNA 4X0NA 3CQHA 2C71A 4J3XA 3AWOA 4FOKA 3R4IA 1FWDC 1JL8A 1QPOA 2PGFA 3WQDA 1OFPA 1RXOB 2YL5A 3LNMA 1KXTA 3BAIA 3EOSA 4XUGA 3UNTA 1H62A 4UMBA 1HKJA 2NLIA 4TV5A 1XQLA 7ODCA 3AC0A 3G0XA 3W7CA 1MDRA 1NELA 3WO8A 3AU6A 3HBLA 4WHBA 1I2PA 1AH0A 1X1NA 2PCEA 5M1TA 2I16A 2Q02A 4GIYA 1XIDA 4GX9A 4Q8PA 5FAJA 1W91A 2E8ZA 1O66A 3VOJA 4DELA 4IIEA 3D6NA 3IIZA 3YPIA 1KW1A 4XAPA 3WFLA 2PDJA 2I14A 2WO5A 4QBXA 4US5D 2ZICA 3U7BA 2DSVA 5DY2A 2RFGA 2FVKA 4B9YA 5F7UA 2EJ1A 4UTMA 3DECA 4E8DA 1PCWA 3VM7A 3ARQA 4ZO6A 3NQ7A 4FALA 3EDDA 4J4KA 1L8NA 3CL6A 4TO8A 4PUJA 1U30A 4EPDC 4H9MA 3CAKA 2Z28A 5F4WA 1XI3A 4O0ZA 1GUVA 3GXIA 1XLLA 1U5HA 2XZ9A 1UWIA 4CCCA 4ERAA 4N0RA 2PEVA 2JIWA 3E02A 1VHCA 2NXGA 4W9TA 4Z1DA 4LTSA 1HNYA 1VB9A 1J6OA 4OBRA 5K7JA 5TF0A 1J11A 1QAPA 2DUAA 3ZYZA 4FP1A 4LAKA 2WOQA 2VRKA 1R3SA 1GJUA 5FI8A 4C1NB 5DANA 3TUUA 3V36A 2WBGA 4QX4A 1ITQA 3GH4A 1ONEA 3W88A 3BAXA 1EJWC 2VRQA 1OX6A 3R12A 3SY8A 3C61A 3WK3A 4L6HA 1RVGA 2QCCA 3I7QA 4ERGA 1LRQA 1PIFA 1BSLA 2DDXA 1E6SM 1VFUA 4DJFD 4CKQA 3W22A 2XFYA 3O6DA 4AEOA 4HZ8A 3LI1A 1PKYA 3VGHA 3V75A 4Q7BA 3DXIA 3G2GA 5F4XA 2ISSA 5BRBA 4ACZB 2J27A 1IT8A 3EA3A 4MB1A 1UWTA 3EMQA 2BSLA 3KWSA 5LNVA 5IHRA 4FPSA 3IAQA 3EZ4A 1IIGA 4OBTA 3URAA 1UZHA 3V4BA 1E9LA 1UD8A 5DLCA 1E72M 1B4KA 5CC6A 1BFNA 5KZMA 3FDKA 2CU0A 2JEQA 2C79A 1BYCA 3MMUA 4M81A 5C9UA 1IT0A 1TB3A 3GNPA 4GC4A 2FJKA 1PZ2A 4MTVA 3VD9A 1G0CA 3TN5A 4DJFC 4L6OA 4MNJA 4O28A 3CIVA 1NFPA 2XFWA 4F0LA 5G4WA 1ITXA 4QQ3A 3MB9A 1CBGA 3UP8A 2FPTA 4HIBA 3CUZA 4O15A 4AW7A 4B15A 4PTWA 4KPLA 3S2NA 1H60A 1HJVA 4E0CA 1TFVA 3NPUA 5A8PA 3IIXA 4JQ2A 3VFLA 1IE7C 1E6PA 1XQKA 1JDDA 3GZ3A 3PBGA 3KEHA 3F2CA 3W7HA 5K4XA 3PPFA 3WX7A 4IPJA 1KFKA 2PSNA 3V1PA 5KETA 4A8RA 2HS8A 1BKSA 1ZCOA 2NWRA 4C6JA 1SFTA 2IKJA 5KTLA 1EC8A 1OC5A 2Z6JA 1HVXA 1C90A 5GNYA 3NQCA 4DWSB 4HCLA 3UT0A 4D6EA 1UD5A 1VEPA 2BY0A 2NQLA 3W1QA 1XXXA 2QULA 3O0FA 1R3TA 3EPOA 1UIPA 3BZGA 3KBNA 1JGIA 4RXFA 3ZMRA 2JFEX 4QS6A 3HG5A 2DIJA 4HPJA 4ZFCA 2V3EA 3TH6A 4RV8A 1UG6A 3LQGA 2BODX 1VFLA 3S0CA 3EKZA 4WR3A 2WJDA 1U83A 4BEUA 5M03A 5EMLA 2YW3A 1NWSA 3KP1A 5FF7A 3ARXA 2REQA 1XBZA 1S46A 3APGA 3STFA 2DUXA 1GOIA 4CVUA 4GE8A 5DXYA 3UWEA 3BLIA 3B0UX 1GK8A 2DZPA 2J75A 4KKXA 1SFJA 3XISA 3POCA 4TX9A 4Q8OA 3S9ZA 3GO2A 1F6YA 4CQ8A 3C0LA 1VR6A 3UZ5A 4WQ6A 3FJLA 2YJQA 2VEFA 3LBMA 4Q4PA 3GZAA 5LA1A 3S1GA 1Y0EA 3N17A 3LM3A 5RUBA 1QI2A 3ES7A 1BD0A 2XGZA 3TJLA 2OFJA 1ME7A 3UVIA 2XM2A 4E6MA 3BV4A 4IIDA 4YVVA 1FFRA 1MFVA 2WHJA 4I7VA 4NJHA 1G4SA 4IJBA 4ZXOA 2IKIA 3LCWA 1CXKA 3KCOA 3R5EA 1TWZA 3TEVA 4R9XA 5CPOA 2E9LA 1DOSA 3ZR5A 4A2RA 1QU4A 3EWBX 5FSEC 5DXXA 3WF2A 1IEWA 4CNOA 2INFA 1SJCA 4LCRA 2FPYA 3NGFA 4TX6A 2WC7A 4J7RA 2X8RA 2OLAA 1OK6A 4GUJA 4KEZA 3KXQA 3WDJA 3ZM8A 4AIOA 1PV8A 7REQA 4GY7A 3RHGA 2RAGA 1MUCA 3NXFA 4CEUC 2ZQ0A 1BG4A 2CZEA 4LBUA 1OG0A 3GDRA 2X2GA 3E2RA 3IIPA 3NL3A 4DM1A 3E9AA 1PZ3A 3NDZA 3U6WA 1EEXA 2Y62A 1VPQA 2HSAA 3A22A 1YDNA 3CHVA 4O14A 1XFBA 3S42A 4BQ4A 2NQZA 4GY0A 1JYWA 2CLLA 4ZMGA 3WDHA 3PUGA 1F6PA 3MVIA 5DRIA 4LYKA 4LRTA 2FKPA 2CBIA 4HNTA 3AI0A 3NZQA 2O56A 3A3XA 1Y7VA 1RQEA 2XSAA 3HMCA 2WHLA 3PS7A 4NF7A 1VFHA 2XH0A 4IIBA 4J1OA 1HO4A 5DRCA 3W9ZA 3S6TA 3DKJA 3VU2A 5REQB 3VX1A 3LUTA 4JNMA 3GXTA 3REQB 3H54A 3QQWA 4Z08A 4UOJA 2NX3A 3H2CA 4PMRA 1GHSA 4UR8A 1V3JA 1DPMA 1BGGA 3E2SA 1XRTA 3EOUA 3H26A 3WLQA 4L80A 2WJZA 1J18A 3TAOA 4Y6GA 1YBQA 2J74A 2XWEA 1TJ2A 5E0KA 1J2BA 4XD3A 3TTOA 2XH2A 5IM51 4F4RA 1QO2A 4I7UA 5M2FX 1RAKA 3OGVA 3V3WA 3OGSA 4ML4A 4KEUA 1GNXA 3W0KA 3WFZA 3TJIA 3CB3A 1Q2SA 1ODUA 4DZHA 1RBLA 1XLBA 3TWBA 4EIVA 1FWTA 1LJYA 2F6XA 3VDCA 1A5NC 5A8OA 3L23A 4UQCA 1XKJA 3B05A 3GK0A 3MS8A 2QJMA 3WNLA 4CN1A 3WF1A 4W5ZA 5IXEA 3AMDA 3DC0A 1X39A 3T4CA 3DU0A 3CV1A 3W81A 2QGYA 2DEPA 3WH8A 2VX6A 4JTGA 3TP4A 4PODA 4S3GA 4RKAA 1W5OA 2PDFA 4Q4SA 1JZ2A 1CXHA 3ITGA 2EQDA 3VNYA 1M7XA 3TJ4A 1UA3A 3VK5A 4K36A 3R8RA 1EF2A 1LG1A 4Y9NA 3OTRA 4DWSC 5CLWA 3RR4A 5CC5A 4FA3A 1Q6RA 3GHTA 4F0MA 3CS2A 1XBXA 1FCVA 4E38A 1EJVC 5F2LA 1B90A 2AAMA 1KV8A 1JDFA 3KVMA 2Y8UA 4JQ1A 3GDBA 2GGEA 1DJHA 3TN6A 3SEPA 2QCDB 4Z1YA 1V3HA 1XWYA 5H6HA 2ZZ4A 4XZBA 1QVBA 2IQTA 1X7FA 3FXGA 2Z29A 1FH9A 4KWUA 2C0HA 4UTUA 3C2EA 1R38A 5AN7A 4R85A 1A5AA 2E6AA 4HHLA 1XYMA 1DXFA 2CESA 4ZQOA 5K9CA 3CC1A 2PGRA 4HMDA 3LMYA 3BLPX 5EBAA 1R3RA 4MWAB 5DX7A 4MM1A 1US2A 3V18A 1QTWA 3CUIA 3UWUA 5HR6A 3WNNA 2ZUNA 5CC3A 2YCIX 1XYLA 3GHUA 3PPGA 5I09A 1XRVA 3CHEA 4H9VA 1WDRA 2VCAA 1XCWA 4UTLA 1LT7A 2DT2A 3N2TA 3N4EA 5BOEA 2VD9A 2Z00A 3W7KA 3BLOA 3SCSA 5FCZA 2XINA 2BTMA 1XGDA 3U5UA 4LPCA 4K1GA 1E6NA 4GYJA 4K8GA 1UP2A 3W82A 2OG9A 2QF8A 2GWNA 4MZYA 3WL1A 4XBSA 4Q8VA 4UTHA 1OINA 5I77A 3BLKA 5A5WA 1VYPX 4DO5A 2R1LA 5IDZA 4HKPA 2J7HA 4HN8A 1Q7QA 4EXAA 4NZFA 4ES4A 1EL3A 1ZJBA 3C2YA 4S3KA 1V6XA 1TPDA 2PU1A 1C3FA 5E70A 3P93A 3S5NA 4D6GA 1CGXA 3QV9A 2PODA 2CBVA 2C8NA 3VUPA 3M0IA 2ZX7A 2DIEA 3THAA 3WUGA 3H2FA 5DQPA 1CZ1A 1Q6GA 4P7NA 1S3TC 2YGYA 4RX0A 2OOFA 3ONBA 1LG2A 2Y85A 4IMEA 4OV9A 4TQTA 3VOCA 3AIRA 4N2YA 4NNCA 1XGEA 3IJDA 2EKGA 1RQBA 3H24A 2OQHA 1K77A 4QE5A 1TVLA 2FLIA 1KO0A 3EDJA 3WQ5A 1W1VA 1VFFA 9CGTA 3WQ6A 2OSYA 1FX6A 1TKKA 1TA3B 2WKLA 2HWGA 2OT0A 3PZMA 4PUUA 3S9IA 2HJPA 3PTDA 2CEQA 3AYRA 4EWJA 4KERA 4F0HA 3LCGA 3I6RA 3UR7A 4DZAA 2CKRA 4TIMA 3R25A 3VKJA 1UR0A 1SW0A 4IF2A 1G7VA 3LS9A 2XFRA 2WVUA 3KLKA 3WK0A 3FLUA 1ADSA 2XU2A 4I8DA 1FTXA 3R1ZA 1UBPC 4F0RA 2FZ8A 4HNCA 3OLDA 4B5TA 2WNZA 3I3DA 1R9YA 1BYAA 1EGVA 3B9OA 5C8BB 1XDJA 5H8PA 2PMQA 1FRBA 4MSSA 1F9CA 4QITA 1M65A 3PWIA 3F4WA 3B40A 3FJ4A 4AVNA 5GJNA 2WM1A 2VX4A 2J7DA 4FR6A 3TYBA 2G8ZA 5T8GA 1FWNA 3GLCA 2INZA 3TQPA 3HF3A 3O05A 2GDQA 4W7VA 4FEZA 3P5ZA 2ACUA 3UY8A 3L2IA 5BWAA 3MUZ1 4IIFA 1OF8A 4D6IA 4CN6A 2BOEX 3GUWA 2XIJA 3DFYA 1Q5MA 2Y8KA 4W7UA 2DIKA 1W3HA 5EYWA 4YTRA 1E9IA 4E5TA 6PTDA 1VIWA 5AYBA 1WXYA 3AJ7A 1RJRA 3S5ZA 1JCJA 2FZ9A 3RNDA 2P8CA 4N42A 2I1OA 5AB3A 1KCZA 4MPKA 3UPMA 4IPIA 1P7TA 1W1A1 2B0MA 3BAWA 3VOIA 4XD6A 1UR3M 2R1MA 3N2OA 5C2XA 1MO0A 1CXEA 3OA3A 2DZAA 1KFBA 1K7XA 3JU2A 3ABRA 5FF4A 1R6WA 4PULA 3ZJKA 4IX0A 1NQ6A 4D8LA 3UCDA 3CHCA 4KRUA 3VM5A 3CQIA 4DI9A 1VFOA 1F8IA 2G50A 2ZXQA 3MHGA 3W70A 4KCUA 1K9DA 2ODOA 2V81A 3EDFA 4RZ4A 3XIMA 2WANA 3NJ3A 4LVBA 5EBUA 4MUPA 1WNOA 2HVOA 4HK6A 4B16A 1KM4A 1SJAA 2Z1WA 3OQ8A 2E6DA 1E70M 4JOMA 1NF7A 4B3KA 3BCDA 3CWHA 1ZS2A 2ZX8A 1HW6A 2C15A 1UKTA 2QUVA 1EP2A 2JKEA 5XINA 2I5GA 1E15A 4QJ3B 4XZMX 1IT7A 3M0YA 3LRLA 3SO7A 1JD9A 3WJXA 4HJWA 2GUYA 4L9XA 3NL2A 5G2WA 3V5OA 4BQ2A 1SFSA 3LXAA 2VDIA 3TMLA 2G96A 2XVKA 3E3HA 4J3VA 1TRDA 5H2ZA 2DY3A 1TPC1 3O6CA 1DL3A 1IHIA 1AQHA 6TIMA 5CH9A 3SQMA 4Y9OA 2NT0A 3MP4A 1GQKA 4LAOA 4JTAA 3NFUA 1PKLA 3CYVA 1T99A 1OGBA 4AYSA 2DV0A 4M51A 5CCZA 2HK0A 4W8BA 1UR4A 1THFD 5C2CA 1XYAA 3GY1A 4JXCA 3VIGA 1EJ7L 1UUQA 2ZRVA 3AROA 1JVNA 2CLMA 4LUTA 4EK7A 5L9FA 4B91A 3B3DA 1HP4A 4ICNA 1WOAA 2ZRZA 4ML9A 2P1FA 3FCPA 1DJNA 3JVAA 3SJNA 2A0NA 1M3UA 2ZTKA 3A64A 1WBHA 3S5YA 6ENLA 4S3DA 1TV2A 2OWXA 1SYTA 2ZZ1A 2HPIA 2X09A 4IWWA 4RZ5A 1KNWA 3M5ZA 3HQOA 3NQMA 4CQBA 1XKYA 4GXMA 1PPIA 3SIZA 2ZXBA 1WZLA 2A6NA 3TQKA 4MAVA 3ARWA 1NTHA 5BW6A 2ABBA 2DP3A 2XVPA 4C91A 4Z2HA 4J3UA 5CBBA 3PJUA 4JKMA 5FAGA 2QJGA 4ATLA 3L0NA 2RHGA 1VRDA 1B2YA 1R87A 2Y5EA 4S2BA 5HDRA 4C6IA 4Y7EA 1EO7A 3G6LA 3ABOA 3E0WA 2ESCA 2ZZ3A 4RV3A 5PTDA 1E9YB 3WDQA 1H7XA 2CBUA 3DN5A 2PRHA 3GXFA 4MJ2A 3WMBA 1ZJHA 1MQQA 3ANVA 3HMJG 1KM1A 2XJ7A 4O8RA 1W9PA 3QTGA 4LAZA 1GPWA 4MNMA 3GDKA 3UYCA 1P4CA 2BHYA 5IDIA 3AUOA 4C90A 4GXWA 1TPH1 3H8AA 4NAEA 1X96A 3KP0A 2WSPA 4P7LA 3WK1A 5EA9A 4NAEB 2UWFA 2P5NA 1I1XA 3ITYA 2A6LA 4Q22A 4O1CA 1ADDA 1JUEA 4UTTA 1KQZA 4HSNA 3WLKX 2PWFA 2YXOA 3TC6A 4RK8A 3PFMA 5TIMA 1HFBA 2TYSA 4KFPA 4AAJA 2XTKA 3KCJA 4LV4A 1VCVA 1S3HA 3UXIA 4H6RA 2J25A 2OKTA 2RDWA 3GFYA 3GTXA 4AWSA 2V38A 5XIMA 3VGBA 3UJFA 2XIIA 1FWRA 2XH7A 4ZA0A 4GK8A 2HK1A 1DJZA 3RITA 3W7RA 2GUUA 4W84A 2CFFA 1UC4A 4IMFA 4JX4A 1FWFC 3OLIA 4H4IA 5EPDA 1LQ0A 4Q33A 5LNUA 1EHAA 5JBEA 1VEMA 5D9MA 5CKSA 3WG6A 3OG2A 5DBTA 4ACYA 4OT7A 4WXYA 3QMRA 8TIMA 1XISA 5E93A 4US6A 2QEZA 2I9EA 1K6WA 4IPNB 3VGDA 1GG0A 1KD0A 3CHDA 4H9ZA 2Q8XA 2W4XA 2B7PA 1YNPA 1RJQA 3S6DA 5DFAA 1FDJA 1JFXA 1Q6FA 5A6MA 3F4DA 4CCEA 3RO8A 3GTNA 1I60A 1QK0A 1SU5A 1CNVA 3QMSA 3GDTA 4LYPA 1LUCA 1KBLA 2XGBA 3VMOA 2VUNA 3MUXA 3AZSA 3E74A 4HNLA 2WSRA 1SSGA 4AMAA 2EAWA 3PBUA 4GH1A 2ACRA 2HE8A 3QOKA 3GVQA 1GHRA 3G6MA 4D1JA 4ECLA 3E6EA 3W1MA 3VOGA 2DVTA 2WPBA 1LP6A 1GTHA 1XS2A 4LVAA 2PDCA 4WF7A 2L5HA 1ZENA 1JYNA 4L6DA 3S2LA 3TA6A 1D2KA 4GCAA 4O0KA 1QPRA 3M5YA 1FH7A 1LRTA 1XLJA 2F6UA 1P0KA 4HK5A 2YZRA 2CHOA 3AIUA 4CVWA 3UJEA 3A3WA 2KZHA 4BFAA 4ZGYA 3RM8A 3L68A 4BKNA 5LKYA 3QLDA 4W85A 3SADA 4HOXA 4HU0A 4HTYA 1NIUA 1R85A 4AMCA 3P6LA 2QUNA 1HJUA 1CB2A 4H6EA 4DLFA 2CWXA 2ZOXA 1V5XA 3VZYA 4NZ1A 3VIOA 4Z42C 1KFJA 4MPQA 4LANA 1QHOA 1WV2A 1GYMA 4RW3A 4Z2KA 1W1IE 3NYZA 1FFQA 2NSOA 1PKNA 5AYYA 3EEZA 2ATSA 1Q45A 5M17A 3W1NA 1KXVA 3OVQA 3BG3A 2TAAA 2V3FA 4GI9A 1F76A 4ZTYA 1GOXA 1K8CA 4KGJA 1E0TA 1OF6A 1PS9A 2QJNA 1QPQA 2Z1KA 3LHTA 4YPJA 1UR1A 4ZOEA 4AG0A 2GL5A 3W26A 4AHPA 3OHMB 3BO9A 1J8VA 4H8VA 4FHAA 3SM0A 3BAKA 3ARZA 1H49A 2R8WA 4XAGA 3CYJA 4B5UA 1CPUA 1R0MA 5E9AA 1UUOA 3N18A 2OZ8A 2C91A 2GSHA 1LYXA 5HAOA 2H8XA 4BS0A 4JYEA 3A4AA 4HYWA 4UTFA 3V1HA 1XRFA 3O6YX 3CV2A 5LYRA 2V5CA 5GVJA 2A7RA 1HX0A 2D73A 2P50A 4PTNA 4E2VA 3PTKA 2WVTA 2FB3A 4GIRA 2G3NA 5DMLA 3V0UA 5DCEA 3HG4A 4ADTA 1OM0A 2FIQA 3APTA 5D03A 3KWXA 4PGLA 2IQ0A 1IQ8A 2WMIA 1UPPA 4OWGA 2B4GA 3C3UA 3W37A 1E55A 1WDWA 3IRSA 5E0FA 2DT1A 1Z44A 3C86A 4F79A 4LBSA 4LY8A 4N7QA 3MJYA 2PP0A 4IQEA 1LRNA 3EX2A 4L56A 2Y4SA 1R3WA 1YE6A 1WX0A 5FJUA 2V2DA 4Q4RA 3AAMA 2BVYA 5ABEA 1IWBA 3MMTA 1TPFA 2WBKA 3T2QA 4AF0A 5HMDA 1O12A 2VWTA 2OB3A 2VELA 1M7PA 4MY8A 2YDSA 1Q3NA 4E8GA 5CJMA 1V79A 4PCFA 4IT1A 4ZB5A 3WLTA 1NOUA 4A3HA 4GQBA 5D2YA 1RLCL 5CBJA 4LCQA 1FWIC 2NX1A 1XDMA 2G4JA 3G8EA 5BOFA 1E1CA 1BQGA 4JYFA 1BF6A 1S2VA 4XWUA 5FJOA 1TMQA 1HT6A 3WF3A 4LEFA 4PN2A 1JDAA 1EEPA 5BU6A 4O18A 1U5JA 1ZFJA 4GOAA 2PDIA 3W1RA 3OZOA 3GSMA 4DI8A 1BLIA 5G2IA 1XYZA 6REQB 3BSMA 2YCLB 2ZTJA 4LV9A 3WDPP 3KE0A 5C7HA 3GWQA 4QIUA 1UWQA 4H9YA 1TV7A 2XGIA 2ZE3A 3TTYA 4BI5A 1N8WA 3Q4DA 3ZSTA 4O19A 4C6KA 4K7VA 1S2WA 3QZAA 1MZRA 1DWAM 4BZYA 2E68A 1B5TA 4GY1A 1O5QA 4CD8A 3W85A 2PS2A 1HKMA 4GIAA 5MKGA 4QCFA 1L2UA 4MY1A 3G18A 3PTQA 1IXNA 2OWCA 3WNPA 3GTHA 2FFIA 3AMLA 2RJGA 4S3BA 3L5MA 5CG0A 3R11A 3TR2A 3T78A 2SFPA 5BWFA 3VYLA 1YXDA 1CXFA 2YB4A 2YCEA 4UNIA 2PBGA 1YXCA 3ARUA 4LUSB 1EB3A 3HPXA 4DBWA 2QUUA 4DF1A 3CTTA 1V6TA 1O68A 4DBDA 4QSHA 5LHEA 2O9OA 5EMKA 1PZ1A 3G1XA 2J88A 4DIAA 3V16A 1ZHAA 4K7YA 1T40A 3E5PA 3M44A 3P7YA 3EWCA 3SGZA 3TKFA 1XUUA 4HBKA 3OVPA 4CNNA 4CU8A 3NDOA 2I17A 2OQYA 1W6TA 1J10A 4GISA 1W9XA 4U5IA 1UJQA 4CD6A 1PAMA 3WQWA 4GUHA 4ICMA 2V0TA 1MEIA 4DJED 4H8NA 2YKKA 2PBOA 4JNYA 3TJXA 1GQIA 3VNIA 2NW0A 2ZE0A 4F66A 2AOSA 2DH2A 4NILA 3R79A 4WIWA 2I56A 2HVNA 3WJYA 2NX9A 4A35A 3QSRA 4DNHA 2V5JA 3M9YA 3MWAA 3TYEA 3WKZA 1OB0A 2EJAA 3TTQA 1RK5A 2C19A 1WAUA 4A22A 3N73A 5A6JA 4PC8A 3GD6A 3W2KA 3AMKA 2INEA 3S2MA 2J6XA 2F8QA 3QR3A 3W71A 3HQPA 4AZ6A 1RY0A 1XD0A 4Y9MA 5HR7A 3TOPA 4DLMA 3H55A 1R30A 3T0AA 3SCWA 3TLLA 5CZJA 1GW1A 2GQ9A 4UFLA 4FXSA 4HSOA 4ROPA 1V7AA 1TG7A 4LC6A 1I2NA 1IZCA 3MVTA 1YE4A 3CIWA 5CSSA 3C0JA 1N55A 4AEFA 1JCXA 1OGGA 5CGQA 3RCNA 1YLVA 4JEQA 4H2CA 5FEZA 2NVCA 3W1AA 1PJ9A 2EBNA 1Y5XA 4JD4A 1W3KA 2FB2A 2YIHA 1TELA 4GH3A 1BTCA 2QVNA 3ICJA 2CETA 1EJSC 3H22A 1REQB 1TVNA 3GIPA 4TU1A 1W17A 1SR9A 3URQA 4FIQA 1QO5A 3DIPA 3PZIA 4L1XA 2A21A 4Q6XA 5AZ0A 3B8TA 3GH5A 1XGZA 2BHUA 1WCGA 1DHPA 4QJ4B 4FSAA 2BVWA 3THQA 4YIWA 1EUNA 2PPGA 2EF9A 3MKKA 1JRCA 1B30A 5TD4A 5C9WA 4B5XA 3NZGA 2J24A 1XINA 3V0SA 1WUEA 3N19B 2W62A 3EDEA 4H8HA 4C6NA 3RRXA 1EC9A 3E2QA 3RM9A 3RUBL 1F74A 5ABHA 2NT1A 1OD0A 1KXHA 1KM3A 4DPPA 2OSWA 4Q7IA 2DZUA 2QIIA 1XD1A 4OGZA 4WXZA 4BF5A 3VDBA 4RPQA 5BRQA 2RH9A 1M5WA 3TSBA 4M24A 4YWSA 1B3VA 5HQMA 4MYXA 3U8GA 2EG8A 2WHMA 4GYPA 3WD3A 2XISA 4H19A 5I7GA 1MW1A 4A6GA 5I02A 4NAFA 4FAMA 2D0GA 1AK5A 2W61A 2H6RA 4GCXA 3HJZA 4GGBA 3MHUA 1UOKA 4P7QA 1YQ2A 1HKVA 2E0PA 3QEZA 3AXMA 1W3LA 4WY0F 1CYGA 4DUXA 4WJ8A 3GW0A 2VFGA 1V93A 2G3FA 2TSYA 2J9XA 3CMGA 1TQJA 3T0CA 3G1DA 8CGTA 4EF8A 3CTLA 3HQ1A 4UFIA 1PIIA 1TV3A 4GJJA 3WUEA 3PJWA 4JTTA 4RCXA 2ZRXA 2BZNA 1OWQA 4LT9A 5C2GA 2YLLA 4URIA 1KFCA 3CBWA 4E2DA 3OB8A 1OFDA 2P0IA 3IIOA 3GNNA 3K4WA 1NP2A 3WEZA 3W1UA 3R58A 3HURA 4JFWA 3CIXA 1RPKA 1O94A 3G77A 4E8CA 4G8TA 3B0PA 4MB5A 1XSIA 3WF0A 4DN1A 2OKOA 3ZLFA 1VJIA 2DSWA 4M5PA 1S5MA 3QN3A 1BVWA 2A5HA 4O13A 1UW9A 1R7AA 5M5DA 4C5YA 2ZYFA 2B31A 4CNTA 1VBHA 5I06A 2VGGA 3IS4A 4NY2A 1C9DA 1K8YA 4HPHA 3DFQA 4LC8A 2XVLA 2BWGA 4DZ5A 5LIWX 1ICQA 4GYPC 2OZ3A 1VRXA 2CLEA 3TC7A 1FXPA 4ZENA 2HQAA 4ICCX 1V0MA 1FUYA 3M4HA 4UQ9A 4AD4A 5I6SA 1J01A 4Q4KA 1CXLA 3SRHA 2E67A 3SCRA 3VD7A 4I90A 1Z89A 3KL5A 1QRQA 4FNTA 4PBEA 1IEQA 4GC3A 2DUZA 3GW3A 3GXDA 4H9UA 4KFNA 3DUGA 5BXTA 4JHMA 5BXRA 5T26A 3LGEA 4C6PA 3WD1A 1X98A 4YMZA 1WKFA 1YDOA 4BY3A 3SUWA 1JUBA 1P0BA 3M0JA 3RFAA 3DOPA 1HO1A 2XSXA 4CQ9A 4JKLA 3KRSA 2Z2BA 4V1XA 3WMCA 3CJPA 1Q4NX 1DE6A 1XPYA 2Q8ZA 1C8VA 1P0NA 1ME9A 1QOXA 4H00A 2W91A 3GVWA 3VPLA 4UOQA 5E6YA 3TLQA 1KKOA 2XZ7A 1AL7A 1JZ7A 4QP0A 5LXEA 1EIBA 1I75A 2TRSA 1KQYA 1B4EA 4DAIA 2OO6A 2YCJA 3DHPA 2QCEA 4HYVA 4NASA 1W8GA 3OP2A 4DJFA 1QNQA 3CZ8A 1B3XA 2C6QA 1E73M 2BXYA 3QOMA 1WZKA 5TQLA 3MI2A 3WBAA 3E38A 1UD3A 4H83A 1JR1A 3P62A 2PU0A 1I2QA 4DJDC 2PWGA 3KS6A 5I24A 4BWLC 4F0SA 4IQJA 3KBMA 3RU6A 1UWSA 1MFUA 4GPNA 2J7FA 2F38A 3MQTA 3VOHA 2CHRA 1MVYA 3NURA 3KOYA 2Y7DA 2Z2AA 3O1NA 1VLIA 3ITCA 1J9YA 4NX0A 4PMZA 4D2JA 4ZQNA 4Z2GA 3R2GA 4GI6A 4IICA 4H7VA 4Q8NA 2POTA 1QATA 4JEJA 1POKA 4OQVA 2TMDA 4GJIA 3DFHA 4K8HA 3DI1A 1TIWA 3W2LA 2R9RA 3QZEA 4ZL1A 1US3A 4PUKA 2E09A 1UQYA 3BLDA 5KITA 1YKWA 4KBXA 2JGYA 4IMDA 4UTKA 4NP7A 4JBRA 3N1AA 5G1YA 3TC3A 3U9IA 3SSZA 4XZHA 3GXMA 1W1ZA 4HA3A 1RP9A 1BG9A 3Q58A 2D69A 2WNQA 5FACA 2RDXA 3HPSA 3QW3A 5K3VA 1E5JA 5HQLA 1OGSA 3HPFA 1A49A 3L66A 1EJXC 5H8MA 1ECQA 1UZ4A 1IGSA 1EDTA 1AZ1A 3GQYA 1G4TA 3UG3A 1KFEA 4J5NA 3RF9A 4HT3A 4KS0A 2VJXA 1B3WA 2YYTA 3PNUA 2YBVA 3UZJA 1W5NA 3KRBA 3O2LA 1GWJA 5D33A 2DVUA 3ITVA 1OCJA 3LCXA 3LV6A 2WV8A 2ZRUA 1TWSA 2YYUA 1Q66A 1GKRA 4GGHA 1PTGA 1PHQA 2QDDA 3IK4A 4QCEA 3AYSA 3FYPA 1DIEA 3SSJA 4C1KA 4GQ0A 3EGJA 3W1LA 1A5SA 1LWJA 1XBVA 1ONWA 2UY2A 1QNSA 2Y88A 1WKDA 1WQ5A 3T0DA 4EACA 3NG3A 1EC7A 1QBAA 5A6BD 1KRMA 1XG3A 3M43A 3OBAA 3VIMA 2YL9A 3PBWA 4CLMA 4M1RA 4E4PA 4O57A 5D2WA 2NSXA 4QE4A 3B97A 2O9PA 3CZLA 3FJNA 3TE9A 5I2UA 5AVNA 1DWHM 3NM3A 1OCBA 3LTYA 3O8AA 3UPWA 3HTWA 5LIUX 3CAVA 3OYXA 1GVRA 2VHLA 3GTFA 4ZVJA 8A3HA 3KRZA 3PB2A 1VJZA 1O1ZA 3PJXA 4RE2A 5EKYA 3VC6A 4EP8C 4JTCA 4DXXA 3SW6A 2D20A 4MY9A 3DHFA 3LYEA 3QH2A 3N2CA 2DPEA 2A4AA 4MIMA 2XG9A 3EB3A 4HCDA 3CHFA 4OV4A 3H21A 4AWEA 3HIJA 3M16A 2PP1A 4WJXA 1TR9A 3CAQA 3MBDA 1OY0A 3VDHA 1A4LA 3O6AA 5KMYA 1ZUAX 1MRAA 1M03A 3PZQA 1XFCA 4R7OA 2DZVA 2Y89A 3GC5A 3HFYA 2ZUMA 1XC6A 1MQPA 1OG6A 1HUVA 1ZQ5A 4N4PA 5CBIA 3RMJA 2HISA 2WXDM 1JI1A 5HJYA 4AXKA 5AHFA 3WLMA 3FGCB 1V03A 1LBFA 3GYEA 3MSGA 4XTIA 3WEOA 4A2SA 1DORA 5KINA 3UVAA 5LA0A 1VH7A 3ZT7A 5E09A 1GVEA 4XBJA 3UXAA 3AMGA 5F2GA 4OOUA 2BVTA 4P8VA 5HMEA 3VDAA 1XSJA 1VENA 1XYCA 1CB7B 4CU6A 2E1WA 4PMYA 4FZIA 4Q8MA 1BPLB 1GEHA 4PCTA 1VC4A 3MDUA 1S5NA 4HA4A 1P1XA 3UJSA 3L9CA 1F7BA 1ZAIA 3GDMA 5I07A 4XISA 1QOQA 3KTXA 3AOFA 1HKIA 2NXIA 3W84A 1J0YA 1C93A 1W2VA 3VFCA 1VBUA 1OVDA 1O6IA 2C16A 4LY4A 4PUDA 1DWFM 2PAJA 3MANA 1QI4A 3H2OA 3NO1A 3G1RA 2ISVA 3WMSA 3RCYA 4QLJA 1VYRA 2W67A 4J3SA 2C1IA 3KS5A 4JTEA 5EMJA 3S8HA 4PMNA 3NPVA 1OX4B 2A7NA 2KX9A 3JZEA 2TODA 4S38A 4FK9A 3U4AA 4NU7A 1US0A 3S4TA 4B5WA 3ZWSA 2PCQA 3PG9A 4H6QA 2VEMA 2HZGA 2QXWA 2CZDA 1XBYA 2GJPA 3WFAA 2R24A 2RUSA 3E1F1 3NYDA 2FHBA 2WSYA 4O1EA 1UKSA 3P14A 4HQVA 3CUFA 4H2HA 2RGMA 2BY3A 4PUMA 5LIXX 1XSKA 1ECEA 3N9SA 3E12A 2X05A 3LCHA 5D02A 1SMAA 5I03A 4INFA 1M1BA 4C5ZA 4A3YA 4HGXA 3F4NA 1H5YA 4WUIA 2OYKA 1H5VA 3WJSA 2AL2A 3WH6A 1I8JA 3P60A 1E0XA 4HVXA 5C9ZA 1CGVA 4S1FA 1X1ZA 2YCLA 1SUXA 4NVTA 3GNOA 3B9EA 3AMCA 2QJJA 1OFRA 5I3KA 1SR0A 5TAOA 3MDWA 4UQEA 4O52A 3WNOA 4XAFA 3UXDA 1UPMB 4WCJA 2Y0FA 3SRFA 2Q09A 1E5NA 1X6NA 1W3JA 1LL4A 1UUMA 4IQDA 1C7TA 4GNKB 4AHQA 2QVHA 4XUYA 1EQPA 4JTSA 3AU2A 3W4RA 3RPMA 2WB5A 1CENA 1H63A 2PI6A 3UXKA 7TAAA 4R34A 3QV7A 3A9IA 1X8FA 2X7VA 2H9AB 4I9AA 2BASA 6CGTA 5IOBA 4IPPA 4LUSA 1A47A 4I9MA 3TX9A 1TTQA 2J66A 3HN3A 2OQLA 2GVEA 3PY2A 1GOKA 1HTIA 3VINA 1OT1A 4MG4A 4S3EA 1O5KA 2J6VA 3UW6A 2ISWA 1BQCA 3ZLHA 3RG6A 1ICSA 3RAOA 3VGGA 3ECQA 2YOCA 1DV7A 3ALFA 3QHMA 3EX1A 5A2CA 4TXEA 1WKYA 1ZSXA 4C6QA 3TSDA 4CNUA 1JNDA 4WSHA 4L64A 3ZJ7A 1XP3A 3SQSA 2ALRA 1V6VA 2IPFA 1U22A 3UPBA 4N9DA 1KFWA 1DXEA 3KRUA 1DTUA 1NM9A 2PWHA 2UV8G 3OW1A 3TQ0A 3GB6A 1GEQA 3HPAA 3POHA 4LBRA 3N29A 3GG0A 1C8XA 2WW5A 1K9EA 2VMFA 1SO4A 3NQFA 1HQTA 3FK4A 2JK2A 3LHYA 1IR2A 4LYRA 3NQDA 3I4KA 1XH1A 2R94A 2HS6A 2VXNA 3TIMA 3R43A 4FLQA 1MXSA 4TVUA 3H7UA 4OKDA 3L65A 1YEYA 1U1JA 1E0UA 3WBYA 1LWHA 1C29A 3KBJA 1MI3A 4MVAA 1XLAA 5IBXC 3T4WA 1L0PA 2EPHA 2PTWA 2FPVA 3QSTA 3V35A 3IJ7A 2GVJA 2BOFX 4RNFA 3NAVA 4Z2IA 4ZB0A 2JE8A 1K4HA 1Z32X 1OFAA 3T55A 1DEDA 3DI0A 2YCKX 2WCSA 3J7HA 1K7FA 3KHDA 5F1VA 4NNBA 1A3XA 4E4UA 3K30A 3WIJA 3BCFA 2WZMA 2C3ZA 5DMMA 2GK1B 2QV5A 4ENLA 2VQUA 3MSYA 3OODA 3WD4A 3VCRA 1PIGA 4B9ZA 3FEQA 2C14A 1UZ1A 8XIAA 3LNPA 4FF5A 3BQ6A 3K1DA 3QQ1A 2DSZA 1C8QA 1TTIA 1JNEA 5CPLA 2VOMA 4GBUA 3R0KA 4FLSA 2C7FA 3P82A 3S83A 2PDWA 1WUFA 5CPMA 3KBVA 4B4HA 2PLCA 5HNTA 1RA0A 3UD6A 3S2CA 1MWOA 1QNOA 2PWDA 1JQXA 4JTDA 3GVRA 3T2OA 4BF7A 4C7DA 2Q6ZA 3R6IA 3R8GA 2Y5JA 1XCFA 4QE1A 1I0DA 3PZGA 1EPVA 3WLRA 3SJ3A 1Q6LA 4ZQMA 4NZJA 2E6FA 1RCXB 2GJRA 2Z26A 4HYRA 2QCGA 3SUTA 3L7RA 3VD5A 1JAEA 2NQHA 3GG1A 5EMMA 4TR9A 2J7CA 2WJFA 3M0LA 2Y70A 4H9TA 1IEVA 3NSNA 5ECUA 4NZCA 3H7RA 4DPQA 3VTRA 2Y6ZA 4GVFA 5BMWA 4ORMA 2WKGA 3EPNA 4HHHA 3UQNA 1DWGM 3AXXA 3ANUA 2A3AA 2OLSA 3TYUA 4ZOCA 2Y8VA 4M7SA 4M8UA 3URNA 3QGVA 4KIEA 3UR8A 3PP7A 1K03A 3AWNA 1W8SA 2PGWA 4NX5A 1UH4A 1REQA 2Q71A 2WWDA 4U31A 3ATZA 5J04A 4DZIA 3GFXA 1GJPA 1EX5A 1QCWA 3NZRA 2P76A 2IW0A 2QJHA 3B8WA 5DT5A 1MUWA 3G1VA 2HXTA 5HUOA 1MDLA 2V69A 4RNJA 3PZOA 3TA9A 1P43A 1PX3A 3DFNA 2ZZ7A 3IARA 4NJKA 5BOOA 1XW8A 3NCOA 1Z3NA 4IJRA 4OTKA 5CQ1A 1UP3A 1CLXA 3KDOA 1RD6A 5KZDA 5FF0A 3TYAA 3GDLA 1AJ0A 1HGYA 4ZE5A 4UTTC 4ILSA 5IBXA 1T0OA 1QASA 3WY1A 4AWUA 1EF3A 2QGHA 3H2AA 2V5BA 2YFOA 5D04C 3L21A 4D6FA 3E2VA 5E6ZA 3FSUA 4XO6A 2E1DA 4AB4A 5KSWA 3NQ2A 4BQ3A 1V02A 3QV8A 3GNXA 3T8LA 1SFLA 1BVZA 1WKEA 4A05A 1B9ZA 4L9YA 1TCDA 3BSGA 3ORWA 4XVEA 4CCDA 1X6UA 3VCNA 1ZJIA 1MW3A 4Z0JA 3TW9A 1NVMA 4XVDA 1QWKA 1A5KC 1S5WA 3NO3A 5LA2A 1ONXA 1EOMA 2WHKA 2VD8A 1PB0A 3NR0A 3MJMA 1HP5A 3I3BA 3SBFA 1KRCC 3OBKA 1FKWA 1RBOB 3GVVA 2ZZ5A 2C1HA 3BLFA 1K8XA 3WN6A 5E5CA 3DG6A 4NYYA 3ZIZA 1NOWA 4WEVX 3SR7A 2E5DA 1TPUA 3VIPA 3AIEA 2IPGA 4GVHA 1R46A 3ATYA 1TV8A 1Z42A 3M1ZA 1MYRA 2WCAA 1QW7A 3U2CA 4X22A 4S2CA 3W7MA 3MSRA 3V0TA 4GKTA 1MXGA 4DYJA 3SY5A 1KCXA 3AS1A 1XIIA 5G1MA 3APYA 3MPGA 7TIMA 1D3HA 4R7WA 3FYOA 5FEPA 4AISA 4IFOA 4LFYA 4XX6A 1HJWA 4IM4A 1LOSA 3N25A 4RXGA 4CNSA 3W87A 1ZALA 1J0KA 1G69A 3P80A 5AZ1A 3TXVA 2DFAA 3LM7A 3B8SA 1E56A 3VA8A 1LOQA 4TUFA 4GI4A 3UWYA 4LW7A 4J35A 3AJXA 1W1YA 5A6KA 2BXZA 2DJXA 3G24A 2B7NA 4YN5A 3LENA 4JIRA 3VX0A 1MEWA 1QFEA 4LGXA 1E40A 3RJXA 4J9JA 4WGHA 4JTRA 3ZT6A 3BJSA 2LLEA 2FVMA 4R33A 5I3HA 5I23A 4V27A 1J96A 1DQXA 3I7RA 3REQA 1VBRA 4NL1A 3WLLA 4QS5A 4HU4A 2VFIA 2E9BA 2H9AA 1TWWA 4MWAC 4KMQA 4RUBA 1BRLA 5CZSA 4O10A 2F7FA 1FHLA 3CAWA 4XZIA 3S1XA 1Z8AA 2BB0A 4DYKA 3BCJA 3Q94A 3NM1A 2ZUVA 4UB9A 4PCSA 1PWMA 3SN4A 3QM3A 1H1NA 4XKYA 1EUAA 1ISZA 3LTSA 1OHLA 3CMFA 1QHPA 1F3WA 1AA1B 5DCBA 1N8FA 3PULA 4C65A 2ZWZA 4C6BA 4JN6A 2DU2A 4JQ4A 1KFLA 3RIKA 3IACA 3DESA 1L6FA 3ARYA 1A53A 5AOUA 3VGFA 2VQTA 1JF6A 3K1GA 2BXVA 3ABQA 1KBJA 5CSYA 1LQAA 1RPXA 3C8FA 1HL8A 1RP8A 3U2OA 1OBAA 1EHNA 2BMBA 4CCZA 4X61A 3ZO9A 4H04A 2ZX9A 3GR7A 4YU1A 1ZBVA 5DCDA 5A95A 1WAWA 5A8GA 2Z24A 3A4XA 2EO7A 4DB7A 1OC7A 2OU4A 3W73A 1ISXA 4I9JA 2GVGA 1PE1A 4L65A 2D24A 5JBDA 1JULA 5I3DA 5LSMA 1KGXA 2PC8A 1F5ZA 4PBFA 2Y7FA 3QKEA 4ZSTA 3AHYA 1XUZA 1EP3A 1GONA 1OZMA 1SZGA 2XFFA 1EYWA 3DBNA 1DJQA 4X2PA 4PMQA 5BXPA 4JNZA 2Z25A 4PUWA 3PNZA 4WOQA 1YTEA 1G7UA 2WMFA 4FNRA 3JW7A 2VCBA 3GXPA 1E3XA 4MKNA 1BWKA 1M41A 4LCSA 1SVDA 3QRHA 3HGJA 1YHTA 4R3UA 2Y7GA 1FWEC 1QI3A 1K1DA 1QR7A 4F2BA 1QNPA 4IISA 3ZZ1A 1WZAA 3I7SA 3TYCA 2CLOA 3P74A 1WA3A 3V5FA 1OYAA 1FWWA 3W72A 1T8XA 1W9DM 3NTYA 7XIMA 5D8ZA 1KR1A 4PE8A 1RCQA 2VM8A 2PFHA 4K38A 5A8QA 1SJDA 1S38A 3USBA 3AUJA 3FJ6A 3VKAA 3T0TA 1KM0A 5G5IA 1QW9A 1KGUA 2DW6A 4AD1A 4IFRA 3ARVA 4CD7A 1LF1A 2X0SA 4UNKA 4NHVA 4D6JA 3UGRA 3BANA 1W9BM 3WENA 5K4ZA 3FN9A 1GZGA 2RDUA 1ISYA 2VI0A 3ITOA 3LLXA 4C7GA 1XRSA 3STCA 1TWDA 3NO5A 4HZ6A 2O4MA 4FNSA 4XO7A 1H11A 5C71A 1EXPA 5DMYA 5HWMA 1PDZA