4XWUA

Structure of the imp dehydrogenase from ashbya gossypii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
389
structure length
314
Chain Sequence
TYRDAATALEHLATYAEKDGLSVEQLMDSKTRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYEPLASKSTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii.
pubmed doi rcsb
source organism Ashbya gossypii (strain atcc 10895 / cbs 109.51 / fgsc 9923 / nrrl y-1056)
total genus 107
structure length 314
sequence length 389
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xwuA00
4JX4A 3GKFA 1VS1A 3EXRA 4M7TA 1TMHA 5LZLA 3NEVA 3G1FA 3LI0A 1ADOA 1VHNA 2IQTA 1QO5A 4ALDA 2EF9A 4R34A 2ZQ0A 3A5FA 4DXVA 4LUJA 4GUJA 3G1HA 2NZLA 4HT3A 1SW0A 3FJ6A 2RDUA 1KA9F 4M6VA 5FI8A 4NQ1A 1GTHA 3HO8A 3GK0A 5K3VA 3ATYA 3QM3A 1AW2A 2Z1BA 1BEUA 3QZEA 4GFSA 2OX1A 1J2WA 3P74A 3INPA 4ONVA 3UWQA 1QO2A 2DZVA 3IIXA 4UFIA 1H63A 4Q32A 2BX7A 5KMYA 4EIVA 3W7MA 4NVTA 2V2DA 3G22A 3O05A 4MZYA 3TQ0A 4NJHA 4FXRA 1QCWA 2DZXA 3LERA 3UY7A 3GZ3A 2CLFA 2A2IA 5DLCA 3IIPA 2GOUA 2ZTKA 3M16A 3EWXA 2XFWA 5CSRA 1OX4A 1TJRA 4JN6A 3F1QA 3GXNA 4HPXA 4X9SA 5F2LA 1K8XA 3R8RA 3NZ1A 2ZFAA 3NZRA 5EA9A 4IX0A 3LV6A 2P10A 2QAPA 3LV5A 3R12A 4AXKA 3NQAA 5GVJA 2E77A 3BW4A 4QNWA 4UNKA 7TIMA 3BG5A 4WY0A 2DU2A 5HWMA 1VJIA 2QCEA 4JTSA 4FIQA 3PY2A 3NYZA 4FXSA 1TPUA 2ZA1A 4KWVA 4AWUA 1F7BA 3B0PA 3GDMA 5SWUA 2ZCGA 3P8IA 3W1AA 3LDVA 4HNNA 3T7VA 1D9EA 2KZHA 3BARA 3ZWSA 4NT0A 5D32A 4GC4A 3G1DA 3T78A 1JCNA 1OYAA 4TMCA 2YPIA 5LNWA 4ZMGA 1LDCA 1G69A 1QPNA 4OWGA 1G4EA 3KVJA 3C61A 3WJXA 4ZZ9A 3M5VA 3BO9A 3LRKA 1S3HA 3I68A 4MFEA 2R14A 3NM1A 4DO6A 3QSRA 1XL9A 3UYCA 1LORA 5DXYA 2FPTA 1FWNA 3JRKA 6TIMA 4MFDA 3LI1A 1NAL1 5D33A 4MOZA 1XBYA 1F6PA 3S5YA 1Q6RA 4P2VA 1VYSX 4FNUA 2WSRA 3NL3A 4KFOA 3IGXA 4PCFA 2RKXA 1RVGA 3QFEA 2V30A 4R7JA 4JX5A 1LLWA 3LCIA 1NVMA 2QAFA 2GJLA 3W22A 1ICQA 1H61A 1IIGA 4AF0A 4Z0SA 3W2LA 2Z2UA 2I1OA 2E09A 3GAYA 1TTQA 1TV7A 4XWUA 3ABQA 3B06A 1YXYA 3SR7A 4PODA 1OK4A 3IGSA 3M43A 4MYAA 2CLKA 3LXAA 2VEIA 1PHQA 4K38A 2GJNA 3PM6A 1VRDA 2A7NA 1G7VA 1F74A 2V2CA 4AVFA 3IVUA 4HNTA 5BMWA 1XDMA 4FEZA 3A9IA 5TQLA 3MW7A 4K6AA 3GYEA 2ZZ7A 5G1TA 3UWYA 1GT8A 1H7PA 1AL7A 1IXOA 1C9DA 4FHAA 1NFBA 5LNVA 4OHQA 2PRMA 4BFAA 5J5RA 4PL2A 2YCEA 4O12A 4MUZA 3KVKA 5KITA 1H1ZA 2Y7EA 3MP3A 4UTTC 4Z1CA 5D2XA 4DO5A 1XXXA 4LS0A 1KFEA 4O53A 3EB2A 4O1BA 2Q8LA 1XUZA 3NQDA 3N2MA 4DF0A 4K39A 1KFCA 1LBLA 2ZZ2A 4UNLA 1M5WA 1P4CA 3B03A 3MP4A 2P1FA 4LS2A 1O4UA 3MHUA 4QSHA 4UTWA 1EPXA 3C8FA 4HSOA 1GVQA 2B7NA 3TR2A 1JCLA 2WJZA 2DORA 3KX6A 3BV4A 1R30A 4S2CA 2V2HA 3NOEA 4A3UA 5AC7A 3C0JA 1QWGA 4FIRA 4OBTA 4ADTA 4FX7A 4EOUA 1SZNA 1B57A 1PV8A 2CZ5A 1RV8A 5BNKA 1EP2A 1JVNA 4BF9A 1W0MA 4A2SA 3KRSA 3UZJA 4JY8A 4LVFA 3W1XA 1LRTA 2ABBA 2ZZ4A 1JQXA 5D30A 1JJKA 2JGQA 3LXBA 3NM3A 3HPSA 3LGEA 5FEWA 1TB3A 3UPWA 3W07A 1MSSA 1Z44A 5HMSA 4R33A 4C1LA 3A22A 3SFKA 4EF8A 2W79A 4OV9A 4Y96A 1B9BA 5KINA 4TO8A 2E6DA 3GDLA 1M7OA 3HG2A 1SO5A 3DH7A 2BXVA 2H8XA 1YYAA 3C4UA 5U4NA 1HUVA 4N9EA 1HO4A 4MVAA 4NZFA 5I3FA 1K8YA 2FIQA 1GPWA 3W7GA 2BZNA 2A6LA 4K8HA 5D02A 1ZHAA 3ATZA 3UY8A 3L0GA 5AYYA 1TSIA 1N8FA 4MZ8A 3NG3A 5F4WA 3F4NA 2QCMA 4GJ1A 1BWLA 1H7OA 3G1YA 4RX0A 3UWVA 2FDSA 4N6EA 4D2JA 1H1YA 4NX5A 2VOMA 3W9ZA 5IBXC 1EP1A 4O1CA 2CLIA 3TKFA 2QDGA 4ZL1A 3I65A 3W7PA 4O19A 3MBFA 3VFLA 1FCBA 3QQ0A 1U83A 1EUAA 1L6YA 3TFCA 1JRCA 4GWEA 3M5YA 3EWWA 2O7SA 3PC0A 1RD5A 5CPLA 4DQWA 3P82A 4HNUA 3R2GA 3R89A 2H90A 3HG3A 3STFA 2PCQA 1AMKA 3CQ0A 1QMLA 3F4WA 3VKJA 5LNUA 1BTMA 2E68A 5F4SA 1A5AA 3W6YA 1EEPA 1DJQA 3PULA 3HGJA 5I3KA 1THFD 2FB3A 3NQMA 1YDNA 5MHBA 4WY0F 3TSBA 2A5HA 2EPHA 3PAJA 3FFSA 3B0VC 5K9DA 3W7DA 4PFMA 5T26A 4DBDA 1G7UA 4AHOA 3SJ3A 1VH7A 4MJMA 4UTKA 3L5LA 2R8WA 3DAQA 3TSMA 3ZWTA 4AAJA 1OFAA 1DBTA 3HB9A 4S2BA 1SU5A 1PS9A 3DI1A 2C19A 2DZTA 1A53A 3W2JA 3MYPA 5EKYA 3W7JA 2YYUA 2QEZA 1HG3A 1SZFA 2VFFA 1SO6A 2QUVA 3GAKA 1CW2A 1TYGA 4NJGA 2HSAA 2YX0A 2DZUA 2JKPA 1F5ZA 1FY6A 1AW5A 3EWUA 1ZENA 2GVGA 1YXDA 3ABOA 1HTIA 4JTGA 3S5ZA 4YLWA 1JRBA 4WX2A 3BK0A 4BWLC 2EHHA 3CWNA 4QJ1A 2ISVA 3TJXA 1KFBA 4IMGA 3FS2A 3W7EA 3FOKA 4JYDA 5F2GA 1QOPA 3FJLA 3GIYA 2QCHA 3E12A 4O0ZA 3L68A 4IOTA 4AMAA 1KM6A 4QISA 1LCOA 3CHVA 4LY8A 3SZ8A 3FKRA 2J24A 3LHTA 3A5VA 3OBKA 3L66A 1O94A 3EX1A 3TXZA 5E0KA 2WSQA 3PWAA 5HULA 4GUFA 3VI2A 3W88A 4EWND 1SSDA 2ZYFA 3TUUA 1IXNA 3L0KA 4I9AA 1EUNA 1GWJA 1LRQA 4A2RA 3KHJA 3MP5A 4TMBA 4HIBA 3KXQA 3SECA 1OYCA 3NA8A 3WK3A 4CCDA 3IIOA 3M47A 1H51A 2ZZ1A 5C55A 2E5BA 2VEMA 3P60A 1LOLA 3STCA 2NX1A 4XZ9A 1WXJA 1ZALA 1ZCOA 2X1TA 2G97A 1FXQA 3M5XA 4E2DA 3STEA 1OFQA 3RK8A 1G4PA 2UV8G 2WPBA 4UFLA 1NF7A 1TPEA 3NL6A 4ZQRA 3DU0A 3IGUA 2H3DA 5AFDA 5D05A 4K37A 3N19B 3PUOA 1SO4A 1MEHA 2XN0A 1LROA 2B7QA 5LGZA 4YL2A 1I45A 5D37A 4YMZA 1QPOA 3G18A 5FF7A 4GNJA 3B05A 5TBOA 2RDTA 1ZAJA 2ZRVA 2G5WA 4C1KA 3TX9A 1C8VA 1O95A 1X8FA 2VXNA 1KM4A 2JKAA 5TIMA 5DN1A 2QCLA 1TQXA 2P0OA 4WOQA 5LHEA 3CM4A 3TC6A 3QRHA 3QPZA 1U5JA 1YTKA 3P8JA 4TX9A 1EP3A 3DXIA 2B4GA 3W1PA 2XN1A 1RR2A 3NVTA 1LYXA 3PB0A 1AG1O 2OZ0A 2GVLA 1IGSA 1VZWA 4R53A 1BKSA 2WNNA 1H60A 2YW4A 3LTYA 5K9CA 4O8RA 4DO4A 4X3ZA 3NL5A 3M9YA 3THAA 1FCVA 1I8JA 3O15A 3WJZA 3W86A 5U7SA 3GB6A 3MJYA 1GG1A 4MLJA 1Z41A 4CQ9A 1TO3A 1SZEA 4CNPA 1OFPA 3OVPA 2H6RA 3K30A 1R2RA 3TJLA 3MI2A 1VLIA 5AYXA 1UBSA 1K7XA 4Q4KA 1T8XA 2A85A 3OIXA 4HPJA 5D2WA 1WAUA 4LTSA 2GQ9A 3LTSA 4ML9A 3CLMA 3W7RA 1JR1A 1UCWA 1VC4A 3W1QA 1UUOA 2Y89A 5K4XA 1W5OA 1IXQA 1BWKA 4ICNA 4XUGA 3Q58A 2CZEA 5HWNA 3TQVA 1TQJA 4LVGA 2Z0IA 3EKZA 3IRDA 4CQ8A 4XKYA 1K7FA 1OG0A 3FYOA 4O54A 1YTEA 2I14A 4LOCA 2ZRUA 3VE9A 5D03A 1TPWA 4FNPA 2FFCA 4RZ4A 3LX9A 4FX8A 4IXHA 3W7HA 1R2TA 5A5WA 5EMUA 3DFNA 3QMRA 4FNSA 1OF8A 2J27A 3MMTA 2OT1A 4RCXA 1XBZA 3TFXA 4UTUA 1ICPA 1VYRA 2VFIA 1G6CA 3BGJA 2HMCA 1YPIA 5FF2A 1LRNA 3W7LA 1TRDA 1NEYA 1MEWA 2A6NA 3JR2A 4N9BA 1R46A 3C6CA 1VQTA 3CPRA 4TR9A 2QUUA 1H62A 1KM2A 3NPWA 3B4UA 4AWTA 3EX3A 4JICA 4I7VA 3LB0A 3MI3A 4AEOA 2WSYA 3O16A 4N9CA 5DBUA 2J9YA 3W23A 3IIZA 3HJZA 4JTTA 1DQXA 5CSSA 4YXGA 3EX2A 1KTBA 1OABA 3NQ8A 5KZDA 4QAIA 1P0KA 4O15A 2B0MA 1OHLA 4O16A 3EXTA 3W7IA 2NX3A 4MY8A 2C18A 1VYPX 4QNEA 4ZQNA 3C2OA 3PG9A 2V5LA 1RQEA 4K7YA 3QYQA 4UR7A 1KFKA 3P84A 3TAOA 3O6DA 1QOQA 1XUUA 2ABAA 3UWWA 1VGAA 1M7PA 3N9SA 1ZNNA 1O5XA 4HSNA 1I2PA 1W5MA 2TSYA 3N2XA 4J9JA 4HNVA 4Q33A 1UB3A 4GXMA 1X6UA 1FDYA 3ZR4A 1LLZA 1QAPA 2ZRXA 1SQ7A 3A24A 4RZ6A 1GOXA 1C29A 1OK6A 3FLUA 4AHQA 3THQA 3S5OA 4PTNA 3I6RA 4NNBA 1I2QA 5HINA 5BMXA 3W85A 3S1WA 4WJEA 4Z1DA 5KSWA 5BOOA 5DY3A 1LOQA 1CI1A 3NR0A 2FPYA 2YYTA 3EKLA 2NXGA 4KFNA 3BW2A 2J9ZA 3W2UA 3C3NA 3M6YA 2R94A 2CZFA 4UTMA 3WK2A 2I9EA 5CZ0A 1VHCA 3LCWA 4JYEA 4YWIA 1FWRA 5AHFA 3JS3A 1QPQA 2V9DA 2NUXA 2QCGA 3TW7A 3O1NA 4RXFA 4RZ5A 1EB3A 1K03A 3G24A 3C56A 3MHFA 3MO7A 2NV1A 4GUGA 5D04C 4XQ6A 3E96A 3OA3A 3ABSA 3ZFHA 3W76A 1P1XA 2ZTJA 2WV8A 4KKXA 1LBFA 1J5TA 4JD4A 1YDVA 3L5MA 3PBVA 5FEPA 1T99A 4O57A 3KRUA 4UR8A 5HJLA 2ZZ3A 2ZRZA 4MJZA 3KVMA 3C52A 2BWGA 3O6CA 1HO1A 4BI7A 1ZFJA 5CGQA 2PE4A 3W7KA 1FWSA 4UTLA 1M6JA 4I7UA 2FB2A 3PBUA 1OJXA 3IVSA 2QF7A 5G4EA 2VENA 3PG8A 1AW1A 3LBMA 3W1UA 2Y7GA 5AC8A 4MZ1A 1W54A 5E1QA 1S5TA 1WQ5A 2EAWA 3NQFA 3LRMA 3DZ1A 1TPH1 3L21A 4KWWA 4UUIA 5LHFA 3LCLA 5D09A 4IXXA 2ZRYA 3W3OA 5I3GA 2QKFA 3NQ6A 1H5YA 1F76A 2C3ZA 3W2NA 1OYBA 3MWAA 4IMDA 3BG3A 1I4NA 5IBXA 1TPB1 5HR7A 1KV8A 1H7WA 2QCCA 2R91A 2NXHA 3NQGA 4JDBA 1YADA 3W70A 4Y9AA 4UXDA 3TROA 4HN4A 5G4WA 2NX9A 1KW1A 3O8AA 4FNRA 4LC8A 2Z6JA 3TXVA 2CLHA 4Z0JA 4FX6M 3O63A 3PBYA 2EKCA 2QUTA 4O13A 2NXIA 1W31A 3M44A 1YPFA 4Y90A 3N3MA 1RQBA 4UMCA 4XBSA 1Q6QA 3CB8A 4IMCA 3N9RA 5L9FA 3QH2A 1GVRA 3BLIA 3S1UA 4DF1A 4MY1A 3AJXA 1UUMA 1KTNA 1Q6OA 3AO0A 3EWBX 1FDJA 3E49A 4IPIA 2ZZ5A 2YXGA 3GVGA 1PIIA 4TU1A 3LXCA 5CPNA 4GUHA 2FLIA 3OVRA 1FWTA 4LUIA 4JEQA 3LLFA 3PR2A 1OVDA 4DBEA 3I7RA 4PA8A 4JIQA 4NJJA 3TSDA 1S5WA 1PVNA 1TV5A 2ZA2A 4N4QA 5FEXA 1VCGA 2E5CA 1L6SA 3L67A 5DCBA 4GE8A 4OV4A 4AHPA 4LU0A 4CNNA 1Q6LA 1FBAA 3OEXA 2X30A 2V82A 4CQAA 3DHDA 3PS7A 3KOFA 3M7WA 3EX4A 3W7NA 4TIMA 3D0CA 1KV5A 2OT0A 1JUEA 4GUIA 1ZAIA 1SO3A 4RKAA 5AHLA 5F1VA 4BWLA 4O0KA 2DZSA 1DJNA 3PSVA 4FNTA 4U4MA 3G8EA 2G95A 1XKYA 2ATMA 4JDYA 1TRIA 2ALDA 3RNDA 3SGUA 4QITA 2NV2A 1F05A 1KBJA 3LHWA 2ZZ6A 1ICSA 2B7PA 4NJIA 5G5IA 3G1VA 4QIUA 1GTEA 5H91A 3B0UX 3W71A 4WOZA 3P61A 3QW4B 3RFAA 4GBUA 4IGHA 1TTIA 1DL3A 3PSWA 4ORIA 4NUWA 3WK0A 1DV7A 1TPC1 3T44A 1SW7A 1DVJA 1N7KA 4JS3A 2A1YA 4FO4A 5DY2A 8TIMA 4LC6A 5C5YA 2LLEA 3G1AA 1T0OA 2Y63A 4QQ3A 1KFLA 3G0XA 3H54A 1MEIA 5BW6A 2X2GA 2ZRWA 2C16A 5KTLA 3PBWA 4ZQCA 1I2RA 3TIMA 2Y88A 3TMLA 2E6AA 2D73A 1P5BA 4LNYA 4JTHA 3DFOA 2CW6A 3M0ZA 4IUOA 3P5ZA 2RFGA 3FA5A 2QJIA 3OVQA 4IMEA 1W3IA 3TNOA 3OG3A 3I7QA 4DPQA 4O52A 2VFEA 5G2IA 5H2ZA 3NQCA 4JNMA 4AWSA 5KZEA 2WOQA 3P5YA 2C15A 5AYZA 1ZJIA 3TDFA 3LHZA 3TC7A 4BI6A 2VFHA 4OQVA 4IJBA 1H50A 2YFOA 4X2RA 5E93A 4MIMA 2G96A 4XTIA 3M41A 4M6PA 1WV2A 4U28A 3KVLA 3W2MA 1X7FA 2GPTA 4UCGA 1TREA 1OX4B 3ABRA 5F2MA 5FEZA 1EWDA 3DBPA 4JTLA 1XCFA 2WQPA 3QEZA 1LTDA 3QC3A 2BSLA 1OF6A 1V5XA 1XBVA 4E0CA 3GR8A 2VEKA 3DI0A 4WY0B 3W83A 5CZJA 3UPBA 1UASA 3HIJA 3LHUA 2JK2A 4YCPA 4IWWA 3LCXA 1OFRA 3TH6A 2QCFA 2PRLA 3Q37A 3USBA 4BR1A 3W75A 4PC8A 4O17A 4Z1BA 4MKNA 4LRSA 3UWUA 3YPIA 1LM1A 5HUOA 4PEKA 4XTDA 4A21A 1SFJA 4HKPA 1ZAHA 2TRSA 1YLVA 2W0UA 5EPDA 3LOTA 2TYSA 1TTJA 4K7VA 1DOSA 1W37A 1X1ZA 3MI6A 4P61A 2OMAA 2RDWA 5DBTA 3UNDA 2Q3OA 1H7XA 3T55A 3UZ5A 1SPQA 1Q45A 3LLDA 3IIVA 2JBMA 5FESA 2FQIA 1PCKA 3C2EA 3QMSA 5AN7A 1GZGA 3S0CA 3S1VA 3TW6A 4O28A 2CLEA 2VFDA 4NXSA 2NWRA 3EWYA 2A21A 4DELA 5FF4A 5DCEA 1K7EA 3BLEA 2NUWA 3Q94A 5K9XA 2NWSA 3GX9A 5FF3A 2DZPA 3NXFA 3E9AA 3LCGA 1GQNA 2AQWA 1JCJA 1B3OA 1WBJA 3SSJA 1FQ0A 3EXSA 5DXXA 4AF0B 3QW3A 1YXCA 3HBLA 1GYNA 4CLMA 2ZA3A 4UTJA 3QMTA 4H4IA 1H7RA 3ELFA 4M5PA 1W56A 1IXPA 2H8ZA 2OJPA 3DKLA 3GNDA 3CU2A 5J5DA 3DKJA 2C13A 1HL2A 3H53A 3LTPA 4O1AA 3STGA 4POCA 2X1SA 4IMFA 4FF7A 4DEFA 3QSTA 2BTMA 2Y85A 3MBDA 2BLEA 1XFBA 5BRBA 3M5ZA 3W1RA 4JY9A 2Y70A 2PRHA 5EYWA 2CLLA 3HGSA 4UFJA 3NQEA 4NX0A 3WFAA 2ZBTA 2X1RA 2YW3A 3W74A 2QJHA 4ORMA 4UMAA 3C2RA 5AHNA 4LVBA 5C6MA 1QFEA 2C1HA 1A50A 4PL1A 4UTHA 3EX6A 3SY5A 1WYIA 4OGZA 4O4VA 1TCDA 1DKWA 2CWNA 4W9TA 1RZMA 1XM3A 2QCDA 4X22A 4JXCA 3KFTA 4LW7A 4O50A 4UC5A 3CEPA 3BPWA 1D3GA 3FKKA 4WQ6A 3EWZA 2PURA 5AC6A 1Z48A 4XBKA 2J9XA 3UWZA 1ME9A 3T40A 4N6FA 1SR9A 1SUXA 1LP6A 1JQVA 3LBCA 2VKZG 4NNAA 2VC6A 2ATSA 4JTIA 2ISWA 2AGKA 1O60A 4IX2A 4ZQMA 1F6KA 1VPXA 5HNRA 3Q2DA 2OCZA 2A7PA 2VELA 1TPDA 3NPXA 3NDOA 1OFBA 2EGZA 1VCVA 3P81A 2DZWA 5LKYA 3ANYA 3GDRA 3HF3A 4JTFA 3U2OA 2E1DA 1F2JA 3O6YX 1ME8A 4O11A 4KFPA 4M6QA 3WJSA 3HPXA 4MY9A 3ZS4A 1KLZA 4UFKA 1IIHA 4YCOA 3GNNA 3TV8A 3VE7A 2E6FA 2ISSA 1NF0A 1KM3A 1FUYA 3GLCA 5AB3A 4O1DA 2J6XA 5AHMA 3CEUA 4LRTA 2QCNA 2TPSA 1EIXA 3NPUA 4ZQPA 1VR6A 4N02A 4NU7A 3CWOX 1D3HA 4EVZA 1WA3A 5EBUA 3HGOA 3UXAA 5CPMA 5CG7A 4JTJA 4BI5A 3IV3A 3W1MA 3S8HA 4JX6A 1L2UA 1OX5A 4UTTA 1LBMA 3HGRA 2J88A 2WNQA 3SIZA 1KBIA 3HG4A 3WK1A 5K4ZA 1FWWA 1WX0A 3GXTA 4JTEA 4K8EA 1Q3NA 5HR6A 4DPPA 3PVFA 1KLYA 4WUIA 4A29A 3QQ1A 3DFTA 2V8ZA 5I3IA 1YDOA 4JR5A 5D2VA 2HTMA 2JKEA 4JTKA 3NO5A 1HFBA 4LV9A 1SFLA 3NAVA 3S6DA 1AK5A 2YDAA 1JUKA 3O07A 3RLUA 5AOUA 1SW3A 3TE9A 4E38A 2YGYA 3W84A 3SGZA 1A5SA 3I7SA 3P7YA 1FXPA 4H3DA 3W73A 5G2WA 4NNCA 1XI3A 6ALDA 2JGYA 4GRSA 3LCHA 1KFJA 3W7QA 1DQWA 1LZOA 1G4SA 5D38A 3HQ1A 4CCCA 1E51A 3T4CA 3PUDA 4N2YA 3P80A 3U8GA 3L0NA 3V75A 3W7CA 1XBXA 2GVJA 4EF9A 5CZSA 4OU1A 3VCRA 4UMBA 1W1ZA 2C14A 3L2IA 1G4TA 3GDTA 3BLFA 1G67A 4QM1A 4BK9A 1I2OA 4UIOA 2GQ8A 3E0IA 2WO5A 4A22A 3HG5A 4L4LA 1KTCA 2F84A 1JCYA 3MHGA 2YFNA 1QR7A 1WDWA 3OHIA 3S1XA 1GVOA 3W1TA 4CNOA 2CU0A 2Y7FA 2FPVA 3S9YA 4WXYA 3WJYA 2HS6A 3NL2A 3WJWA 4N4PA 3R13A 1K8ZA 4O4WA 1ME7A 4LWWA 4NJKA 3TCEA 1EX5A 4M19A 4JTUA 3CTLA 1SSGA 3TU9A 3BGGA 1L6WA 3KAOA 3W72A 4NXKA 4UTWC 3B04A 2H3BA 4G1KA 1F73A 2QR6A 4LV4A 3TA6A 3MYOA 3LCFA 1AL8A 5EY5A 3CIXA 1JUBA 5IM51 2B7OA 3C2FA 3E02A 2RH9A 3QF0A 1GJPA 2CLOA 4HHPA 2Q8ZA 3SW6A 1W5QA 4AB4A 4JYFA 2VFGA 2NLIA 3B8DA 2PC4A 3VNDA 4Y8FA 3C2VA 4DF2A 4M7SA 3IEBA 5C54A 5K2ZA 3LHYA 1ONRA 3P67A 3HOJA 3W7OA 3GR7A 3PF3A 4Z1AA 3GDKA 2CFFA 2Y6ZA 5K7JA 4O10A 3CIWA 4RJEA 1SZGA 1JULA 2E5DA 5LNSA 1QNVA 5HWJA 3W87A 1FCUA 2W6RA 2Y61A 5I3JA 4LVAA 3RF9A 3L9CA 2WNZA 5LGXA 3TQKA 3NQ7A 2E6YA 3G0UA 2O7QA 3RLVA 2X16A 1KM1A 4CCEA 1TTPA 4MLRA 5F2IA 4OE7A 5EL1A 1RQHA 3BW3A 1J4EA 5CZTA 1P0NA 1A5BA 2Y7DA 3W1LA 4LT9A 2YSWA 1T96A 1W5PA 1PE1A 1UJPA 1TPVA 1GYLA 2VEPA 3UQNA 4O14A 2AAMA 4FB7A 5AHEA 3PUEA 3UD6A 1OFOA 5I3HA 4LVDA 4RR4A 3NQVA 3L5AA 5G2HA 4JGDA 2QJGA 3A23A 1V7YA 3LRLA 3A21A 1VLWA 2A4AA 3GXPA 4K36A 2CZDA 5L6UA 4B5NA 1XC4A 4N9DA 5F4XA 3G0SA 3FEMA 1KM0A 1GG0A 3FYPA 5ABTA 4FNQA 1GVSA 1OX6A 2Y62A 3M1ZA 3NGJA 4O18A 1JCXA 1I2NA 2ZDRA 2V0TA 4MPQA 1WOBA 4ZVJA 1Z42A 4PH6A 5LNRA 2C0AA 3TK7A 3W1NA 1ML1A 2C6QA 3G3MA 4LS1A 3TMQA 3HMJG 3NQ2A 4ZQOA 3HPZA 4IQLA 3N34A 3BVJA 1FCQA 3RU6A 4RLIA 2CLMA 5LSMA 1PCWA 5F1UA 1X1OA 4UTIA 1XDLA 2YZRA 4UFHA 3S5NA 5G1YA 1GVFA 1MZHA 4UFMA 4AH7A 3CT7A 1OFDA 1L9WA 2Q3RA 3EEGA 1R47A 1LOSA 3LM7A 4RV8A 1B4EA 2YR1A 4XKYB 1RPXA 4IPJA 3N14A 3DFQA 3N73A 4RXGA 2NUYA 1MO0A 2F7FA 4WD0A 1W3NA 3DFSA 4E2BA 1TIMA 1QDSA 3GKAA 3DFPA 3PB2A 4H6KA 5CPOA 1W8SA 2TMDA 3KRZA 2V5BA 1JCMP 1EWEA 1O5KA 2HS8A 3IVTA 2GQAA 3UXDA 3MUXA 2QCDB 1PHWA 1FDZA 1ALDA 1VCFA 1W3TA 1MXSA 4Y6GA 3CC1A 5CKSA 1K02A 3G3DA 1S5VA 3NPVA 5FF0A 2RHGA 3QJAA 3TAKA 2DJXA 1Y0EA 1WBHA 4Z08A 3U6WA 1A5CA 3R5EA 4ADSA 2A7RA 2DJLA 1QPRA 2GUUA 4WXZA 1W5NA 5HUPA 1N55A 1TPFA 1ZY9A 1H7NA 4NZJA 2V81A 5HQEA 3DENA 1TV8A 3H55A 3L65A 2Z6IA 3G1XA 4RK8A 1EA0A 1CX9A 3BG9A 3LHVA 4WZHA 3NNTA 3P62A 5DELA 4OT7A 4L4MA 1OFEA 3DHFA 3G8RA 5KZMA 3G1SA 4S1FA 2DP3A 1B4KA 1GEQA 1DHPA 2FTPA 1TJPA 3O06A 4ADUA 3W2KA 5D2TA 1K3UA 1NSJA 3F03K 1PL9A 3SI9A 4JIPA 3FIGA 2A0NA 1FX6A 5DCDA 2X1UA 3DGRA 1YTDA 2QDHA 5C2XA 3V1PA 4MYXA 1DORA 2XN2A 3RMJA 3S42A 5D2YA 1KM5A 1WOAA 3QPYA 4I7WA 2FJKA 2WKJA 5A8GA 1IF2A 5AHIA 1R2SA
chains in the Genus database with same CATH superfamily
4JX4A 2PLJA 2XH2A 3ITYA 4M7TA 1TMHA 5LZLA 3LI0A 4LXFA 1EZWA 4ALDA 1G9HA 3FGCA 4D6HA 4R34A 2VX5A 2DSKA 3A5FA 2PP0A 2NZLA 2VCAA 4HT3A 3QV6A 4GIEA 3VCNA 3GHTA 1HW6A 3F4DA 3GK0A 1XLIA 1AW2A 2Z1BA 4GFSA 3QZEA 3VNLA 4ONVA 1WXYA 3UWQA 1DWHM 1QO2A 3WNMA 3G5EA 1Q85A 3UZXA 8RUCA 2HEJA 4MNJA 4EIVA 3O05A 3TYZA 3TQ0A 3K8MA 1JI1A 2BOGX 2FHBA 3VNMA 2CLFA 3IIPA 4GG9A 1MYRA 1MUMA 4TUFA 5CSRA 1QK2A 4JN6A 4X9SA 3RPMA 1ZBVA 4IIBA 2WPGA 2ZFAA 1OBAA 2F38A 3LV6A 3LV5A 4AXKA 4UNKA 4LYPA 5HWMA 1VJIA 3BANA 4JTSA 2ZX5A 4PBEA 2PDPA 4WLCA 1E9IA 1EF2A 5SWUA 2KZHA 3ZWSA 4NZCA 3PTDA 3QFWA 1E0XA 4C6JA 4TMCA 3BCDA 5EFFA 3AS3A 2BHYA 3SBFA 1QPNA 2VR4A 3F4CA 1DPMA 5CZKA 4Q8VA 1NWUA 4F0MA 1S3HA 2XG9A 3CQJA 3NM1A 3BAWA 4DO6A 4XSMA 4YTQA 3S2CA 4FLQA 1GYMA 3UYCA 3QR3A 3FK4A 4WDTA 3OIHA 2YCIX 3FJ4A 4QX4A 1JAEA 1NAL1 1ELSA 3E6EA 4MOZA 4NYYA 3P3BA 4P2VA 1VYSX 4FNUA 3NL3A 4KCVA 2WZMA 4GLEA 3QHOA 2HZGA 3CZJA 5JXQA 1S5MA 4R7JA 3IK2A 1UUQA 1GVIA 2QAFA 3H7UA 2HK0A 2GJLA 3W22A 1H61A 3SN1A 2XFYA 2PS2A 3ZVHB 2EKGA 1TTQA 1TV7A 1YXYA 4YWSA 2DT0A 1UR1A 4PB5A 1OK4A 1XD1A 5TD4A 5LIWX 4S3AA 4E3TA 4MYAA 2CLKA 1DJXA 3CZLA 5F7UA 3PM6A 1NWTA 3SN4A 2A3HA 1R3SA 1F74A 5LXEA 2OWWA 2WC7A 3WCZA 1ONWA 1XIMA 2XSXA 3PANA 1BRLB 4HU8A 2V3GA 4GI9A 4I9MA 3UWYA 4FHAA 5H6HA 1NFBA 3BLDA 2KAUC 2R1NA 4PL2A 4MUZA 3KVKA 3UBPC 2Y7EA 3MP3A 4MDPA 1O5RA 4I5UA 1XXXA 1RA0A 1YE4A 2WMIB 5EU9A 2FMOA 1KFCA 2XIJA 3N29A 5T91A 3QGKC 2X7VA 4I5XA 1M5WA 4GQBA 3EMQA 3AIVA 3B03A 4YS1A 4LS2A 1O4UA 2L5HA 2ZUUA 4JTAA 4HSOA 2WJZA 2DORA 2XFRA 5JUVA 5I23A 3KRBA 4W4QA 1V7AA 2V2HA 4DM2A 1US3A 4OBTA 1B57A 3TONA 1YE6A 2CHNA 4ZENA 3EDKA 1PKLA 4A2SA 4DZ5A 3OQ8A 3SSZA 4QE1A 1LRTA 4GBDA 2ZZ4A 1JQXA 5D30A 2JGQA 4QS6A 1GHRA 5I6SA 3NM3A 2XH7A 1N82A 1TB3A 4AD4A 3UPWA 3W07A 4NI3A 3WDIA 1GCYA 4R33A 4C1LA 1PWMA 4Y96A 5KINA 4TO8A 2E6DA 2GQ3A 3HG2A 1Q6GA 2BXZA 3E5BA 3XINA 4P8VA 3MS8A 4IIFA 4KETA 2R6OA 2QLYA 3LY0A 4JAWA 2INFA 4N9EA 4NZFA 4C6PA 4NAEB 5BU9A 5E9XA 3HFTA 5D02A 5C2GA 1ZHAA 1US0A 5M3WA 3LG3A 1K6AA 3NIYA 1SMDA 3WEOA 3NG3A 5DO8A 2RJHA 4GJ1A 4IT1A 4RX0A 1E6RA 3G1YA 3UWVA 5E5CA 2O9TA 4J35A 2FDSA 3PHAA 4D2JA 3IUHA 4FI4A 2VOMA 4E8GA 3K5XA 1EP1A 3W02A 3W24A 3TKFA 4XO6A 1KR0A 1Q13A 2E28A 3MBFA 3W7PA 3BURA 1PUDA 1MRQA 3VFLA 5IHRA 1CYGA 1U83A 3TFCA 4WDXA 2G0WA 4B90A 2O7SA 3BUVA 4DQWA 4RUBA 2V69A 1RALA 1IYXA 3R2GA 2FVKA 2H90A 3STFA 3CQ0A 4H9MA 3F4WA 2PPGA 1UKPA 1BTMA 2E68A 1BYBA 1EIBA 4W7WA 4CD7A 4LAZA 1ZJBA 5CSYA 4W86A 1XLFA 2RUSA 4GVGA 1EDGA 4IIEA 1KCKA 2FB3A 4RNIA 3TSBA 1VFFA 2EPHA 3FFSA 5I24A 3ARVA 3R10A 4PFMA 4DBDA 1G7UA 1ECEA 1VH7A 4MJMA 3L5LA 1TA3B 4PE8A 4I9TA 3DAQA 1DBTA 1SU5A 3CZKA 3DI1A 1I75A 1YX1A 3C3UA 3EDJA 5EKYA 1ODZA 4YYCA 2FDMA 3OTRA 1K8CA 4MMWA 1VKFA 4DYKA 2HSAA 2YX0A 3E5PA 1VJZA 2JKPA 1F5ZA 1PO9A 4JL1A 2V3FA 1ZENA 2QJNA 2GVGA 1YXDA 2ZXAA 4ZSTA 1JRBA 4WX2A 3CWNA 3NURA 3ZR5A 3VU2A 3CUIA 4O1EA 3TJXA 4BA0A 4FPSA 4JYDA 4MJ4A 3T42A 1DIKA 2QCHA 1GK8A 2FTWA 4QQUA 4HK7A 4C6OA 4GMEA 4EKJA 5JBDA 1KQZA 4FAMA 1UMLA 3VZYA 2PWDA 3EA1A 3VGEA 5LA0A 5FJIA 5E0KA 3PWAA 3RIKA 3WLLA 1W2PA 4GUFA 1W1TA 1EC8A 3DGBA 1A0EA 4RW3A 3SDOA 2ZYFA 3KBSA 4ENLA 1DWFM 1EUNA 4HIBA 3WK3A 1CGWA 3QXBA 1UR3M 5ENLA 2WZHA 3P60A 3T2PA 4NG3A 2NX1A 1WXJA 1ZCOA 4YJ5A 1UR9A 2VR2A 3GM8A 3RK8A 2OX4A 4UFLA 4GQQA 4C7DA 2GFTA 4ZFMA 4W8AA 3UXLA 3RXZA 1RLDA 1W6TA 4AX6A 4WCJA 3IRSA 3AHYA 5AFDA 3CYVA 1TCMA 2CYGA 4PMDA 3THUA 3PUOA 4DB7A 2IPGA 3FXYA 3GTXA 1I45A 1BAGA 5FJTA 3T81A 5TBOA 3VKAA 4YIWA 1B90A 2VC9A 3UJRA 3TX9A 3UG8A 1CCWB 3SN0A 1C8VA 2J78A 1X8FA 1KM4A 1WPCA 4FOKA 1XQLA 1TQXA 4WOQA 5IFTA 5RUBA 3APGA 3S2MA 4HK6A 2VDIA 3B3DA 4D6CA 3J7HA 3DG3A 3DXIA 1RR2A 3NVTA 1TMQA 3PB0A 4KEUA 2OZ0A 4GYPA 3CGTA 1H60A 3WLKX 3KBWA 4MAVA 5CGTA 3GC2A 2OVLA 4O8RA 3EPOA 4C6LA 3M9YA 1NH6A 3HV8A 3CL7A 1E3XA 3WBXA 4HOWA 2WHLA 4TV5A 4L6OA 1XH1A 1GG1A 1DWAM 4PBGA 2PF0A 2BVWA 4IL0A 2OG9A 1FVPA 1S1PA 3RO6A 4PTVA 1GPFA 1XIIA 1DWJM 1BD0A 4EPKA 3NDYA 1B0IA 1VLIA 2WK2A 3WY1A 1VFOA 5GNYA 4HPJA 4LTSA 2GQ9A 4PTDA 4ML9A 3W7RA 4F2UA 2Y89A 4W7UA 4YHGA 4PMJA 3WF4A 5K4XA 3Q58A 4YNGA 2CZEA 4F40A 1QHZA 4V28A 1K7FA 5C9UA 2NT1A 4JQ3A 1XLCA 3WDQA 3F5LA 2VUYA 1YTEA 4WSKA 5HPOA 2CITA 4Q8PA 4Y9MA 1C8QA 3WX7A 3MMTA 3G6MA 3R0DA 1ICPA 4BKNA 1GHSA 3VTRA 3BGJA 2OSYA 1OIMA 1YPIA 2NVCA 3W7LA 2O9PA 3VM7A 1NEYA 4AYGA 4HHMA 5FJJA 3KCOA 2DSUA 4CU7A 2YL8A 3EX3A 4EXBA 4JICA 3WQOA 2RGLA 1M41A 5DBUA 5AYIA 3W23A 5CC3A 3IIZA 5C7VA 3DFYA 2QF8A 1M9HA 3FVDA 3MDUA 4QEEA 4H41A 3A64A 4DZIA 2DFAA 4QAIA 1XW8A 3OLGA 4O16A 1FHUA 2NX3A 4MY8A 4PMYA 3AMDA 3WF0A 4ZQNA 3SY8A 2GVEA 3MC5A 4K7YA 3QYQA 3TAOA 1LWJA 5AYBA 3AHTA 1NWSA 1VGAA 1M7PA 2PP1A 4AYSA 2QHAA 4J27A 4DNMA 4GXMA 1SJCA 4LBSA 3K1DA 3GRIA 1LLZA 3E2SA 1QAPA 4OECA 4JZ5A 1T40A 1OK6A 3THQA 1Q6FA 2OKTA 3S5OA 4OOZA 3SQLA 2SFPA 4YVVA 3QVQA 1ZB5A 1I2QA 2OGYA 3W85A 1VF8A 4UQBA 1W1A1 2V3DA 4L1GA 3DCPA 2YYTA 3EOUA 2J9ZA 1A4MA 3W2UA 1GKRA 4F0SA 4DUXA 1UD3A 3QY7A 4DYEA 1EBHA 1J79A 1SZRA 2NQJA 3MSDA 4FK9A 2NUXA 1EB3A 5TNVA 1Q7QA 3MHFA 2Z2AA 4GUGA 5D04C 4XQ6A 3OA3A 4KGJA 3ZFHA 4W88A 3W76A 3SCTA 1LBFA 1JAKA 1JPIA 5M17A 3PBVA 4XZMX 4UNIA 1TG7A 3IPWA 3IS4A 5FEPA 1BVNP 4UR8A 2ZRZA 4PUUA 1W3LA 4MJZA 3HJEA 3KVMA 2DGAA 2F6XA 3O6CA 3TN4A 3EOSA 4BI7A 1ZFJA 5CGQA 5IFPA 2WJEA 4UTLA 4U5KA 3IVSA 1PDZA 3KTSA 2VENA 4I90A 3LPGA 1XLJA 2Y7GA 1JYNA 4BEQA 2QMKA 1E4LA 1EYWA 5C2CA 1TPH1 2VD8A 1F4AA 5LHFA 1AH4A 1XLDA 3DHUA 4IXXA 1XINA 3QLLA 3NQ6A 5BRPA 1KXVA 3CBWA 3LLXA 3VPLA 1WAWA 2WNWA 4ACZB 1KV8A 1V03A 4DXXA 2OQHA 4XD5A 2O4MA 3NQGA 1YADA 5JMUA 5G4WA 4IG2A 2NX9A 4FNRA 1QUMA 5HXMA 3WSUA 2CLHA 2YDQA 3B8IA 3PBYA 3MKVA 4TTGA 4GH1A 4KT2A 2VP8A 4XAYA 4UMCA 2QS8A 1Q6QA 3BLIA 1OZQA 4DF1A 3BSGA 4MY1A 1UUMA 2VZSA 1Q6OA 3EWBX 1B5TA 1I6NA 3P93A 4E2VA 4HA4A 4S39A 3GVGA 3WUBA 4XO7A 1WDQA 1FWTA 4OZOA 3LQLA 3LSCA 1OVDA 2DQXA 3OGRA 4JTQA 2Y8UA 3QY6A 4PA8A 4NJJA 1U2YA 3TSDA 2J4GA 2H9AB 3WQVA 4N4QA 1VCGA 1WNOA 2D2OA 4LU0A 1RBOB 3VD9A 2X30A 5BWFA 3PTKA 2V82A 2W61A 4CQAA 1UPPA 3WH5A 3KOFA 3KOWA 3M7WA 1UR4A 2XH0A 3W7NA 4BEUA 2OT0A 4OUIA 4G7EA 4LGXA 3T09A 3ENLA 1EJWC 2YB1A 3CH9A 1O68A 1E70M 2G95A 2O0TA 3GC4A 1TRIA 4KESA 3RNDA 3UGVA 3H2AA 2EPKX 3GTFA 4D1IA 2PDCA 1P0EA 4MB4A 1XLKA 4C6FA 4RV3A 2WHJA 4H6QA 1N8IA 5HNTA 3WH9A 4DJEA 4XAZA 5DFAA 2RJGA 3FY1A 3P61A 3QW4B 1YKWA 2DW7A 2JEPA 1BQCA 2ODOA 1DV7A 4PMUA 4JS3A 3E2VA 5T9BG 5AECA 3ZLGA 5C5YA 1BKHA 3G1AA 1NFGA 4QQ3A 1MDLA 3UJ2A 3H54A 1V6UA 1MEIA 1RP9A 1E1EA 2C16A 2X8RA 3I10A 2OZ3A 3FGCB 5T8GA 1EX1A 2D73A 2NQLA 1P5BA 4LNYA 2Q8XA 2CW6A 1R86A 4IUOA 2G3NA 3GXDA 3T0BA 4W89A 2V5KA 4PMVA 3TNOA 3OG3A 3I7QA 4JTCA 1JDDA 3PPGA 4P7RA 1W1IE 1Y5VA 3WFLA 5AYZA 4ZCWA 3TDFA 1KCLA 4IHCA 1XGDA 1ENUA 1CDGA 1ZBWA 2OU4A 4MDOA 4BI6A 2VFHA 3VZZA 2EPLX 4A4AA 4X2RA 2YFOA 2FGBA 7ODCA 1SFSA 2CXEA 1XPYA 2EPNA 1XRSA 3M41A 3ZT5A 3HFYA 1Q6EA 1E73M 1TREA 2BGSA 4H83A 4J1OA 1RSCA 3V5CA 3CHFA 1OF6A 1XBVA 4E0CA 3MPGA 2XJ7A 5REQA 3UPBA 1EDTA 2JK2A 3LCXA 1OFRA 1TR1A 2PCEA 4RPPA 5CSUA 1C3FA 4LRSA 3YPIA 1UW9A 3AZTA 4XTDA 4XD6A 4GHRA 5EPDA 2TYSA 4GPNA 4PB3A 4K7VA 1KO0A 3LNMA 3MI6A 4DRSA 1LWHA 1CGTA 3UZ5A 1E6PA 2YXOA 1PB0A 2JBMA 1PCKA 3GNXA 4IPLA 3SRKA 3MZNA 3S1VA 1KXQA 4D6EA 1KR1A 4O28A 2CLEA 5CAHA 2NWRA 2OWCA 1NFPA 1AODA 2Q09A 5DCEA 2WYSA 4RW5A 5K9XA 3NO3A 1S3TC 2YOCA 2WWCA 5FF3A 3FCPA 3R1ZA 4LUYA 3BL3A 2BV9A 5A3HA 3SSJA 1FOBA 3WUEA 2CBJA 4HHHA 4CLMA 3QMTA 2WMGA 4DZHA 3R7MA 3ELFA 4Z2GA 1IXPA 2OJPA 3WQCA 3VIPA 3RM8A 2JEQA 4K8GA 3ES7A 3DKJA 1KKRA 1ZL1A 5CC7A 4POCA 2X1SA 2BTMA 2Y85A 1XFBA 5BRBA 1R0MA 3RAOA 1KBKA 1S5NA 1YW1A 2DSZA 4JN8A 1MXGA 2PRHA 3UCDA 5DQPA 3FA3A 2RAGA 5HQMA 4UFJA 4HSHA 2TAAA 2POZA 5G4HC 2VZUA 3UGRA 4ORMA 1ITXA 2OYLA 5AHNA 3NO1A 1Z8AA 1JYVA 2VQTA 1MQRA 3BLOA 1L6FA 2E9LA 4BQ4A 1TCDA 2CWNA 4V1YA 4UC5A 1JPDX 3BZGA 4C6MA 4GO8A 2ZXDA 4WQ6A 3FKKA 5AC6A 4FLOA 1Z48A 2W3ZA 1FWDC 4XBKA 2J9XA 1ME9A 3KL0A 4H2CA 3UW6A 3PAOA 3TTQA 1LP6A 1JQVA 2X40A 4RDZA 2AGKA 3PFMA 4ZQMA 4BHYA 1F6KA 5HNRA 3Q2DA 2OCZA 2A7PA 1PWLA 2VELA 3NPXA 3D5HA 2PF8A 4M0XA 7PTDA 2I5GA 4ZOEA 2BGNE 1H09A 4KFPA 1UZDA 4EPDC 3WO8A 3MMUA 4ZXLA 4FR1A 2VURA 3TV8A 1CXLA 1YEYA 2ISSA 4R3UA 3QLDA 3AS2A 3I3DA 5AB3A 2J6XA 2YL9A 1FA2A 1Q4NX 4ROPA 5AHMA 2QCNA 2TPSA 1UA3A 3GNPA 2WMFA 4NU7A 2F61A 4EVZA 1E9ZB 5CPMA 5CG7A 2J66A 3GVWA 4BI5A 5EMYA 3IV3A 4JX6A 5CQ1A 3S83A 4UR9A 1LBMA 2FZBA 4DNHA 2WNQA 2Y1HA 4IH3A 1KBIA 3FJNA 1RP8A 3GXTA 3VKKA 4GQ0A 5DMLA 3WH8A 1DIEA 3DFTA 4ZGYA 4YHEA 5I3IA 5D2VA 3ITCA 5EMMA 4W84A 2R1MA 3T08A 1SFLA 3NAVA 1XH0A 3O07A 3HPFA 3S3GA 4E38A 3I7SA 4HA1A 1W3JA 4J3XA 3W73A 2FGZA 3R94A 3B9OA 1S2WA 1UOZA 1ADDA 3AROA 1BPLB 3KLKA 3PWGA 4GRSA 2IUZA 3DFHA 3W7QA 1Z6KA 4IFKA 4NI8A 3T0DA 1E51A 3T4CA 3IJIA 3ARTA 3W7CA 2UY4A 4PMOA 1XBXA 4AWEA 1JF5A 3GW0A 1BG9A 1EZ2A 1U5VA 4EF9A 3E0WA 3VCRA 4UMBA 2ZXBA 4PSPA 4CQDA 2GGHA 3MKKA 3WIJA 3WFZA 4FALA 1I2OA 2D3LA 2GQ8A 2WJDA 1DP0A 1QNOA 1JCYA 3KDOA 1QR7A 3VD5A 1XICA 2R9RA 5LYRA 3W1TA 4CNOA 4U5IA 2I16A 3E74A 4NASA 2DIEA 3VOJA 4R5EA 2W62A 5FJUA 1H0GA 1IEXA 3NL2A 3V0SA 2XIOA 3PUGA 3TJIA 4O4WA 1EO5A 1LL7A 3OBAA 3GH4A 4HMEA 2PTDA 3L4XA 5ABGA 3NXLA 1UJQA 3BGGA 1L6WA 3W72A 3B04A 4MWAA 3QN3A 4G1KA 4L6DA 4LV4A 3SUTA 5MKGA 2VCCA 3K8KA 1CB7B 1JUBA 2B7OA 3C2FA 1B3VA 5C0QA 3QF0A 2ZICA 2ZWYA 2CLOA 4HHPA 1DJYA 3FSTA 1VD6A 2NLIA 3VNDA 4Y8FA 4Z2KA 1CXFA 3JUGA 4D9PA 2FFIA 1PZ1A 5DRIA 1FP9A 3IEBA 5K2ZA 4HHLA 3P67A 1NARA 2WVVA 1BQGA 1VFUA 4ZOCA 1TUFA 3F7JA 4Z1AA 3GDKA 1R7AA 4JQ1A 5K7JA 2ZOXA 7TAAA 4JTRA 4DJED 1DEDA 1JNDA 2E5DA 4J2MA 2VX4A 3W87A 5JH2A 2Y61A 4IIDA 4EACA 1T6MA 4NYUA 3R8GA 2ACUA 3NQ7A 4TVUA 1E0UA 3LS9A 2BXYA 2O7QA 2OWXA 2XIMA 4CCEA 2VI0A 3ZT7A 3WQ5A 2FZDA 3LENA 1A5BA 1PIGA 3W1LA 4LT9A 4FXFA 1T96A 2QPSA 2C79A 1UJPA 1TPVA 1VEMA 1GVEA 1Y8BA 3ME3A 3UQNA 3U4FA 4RNHA 1S2UA 5AHEA 3UD6A 1OFOA 2XVLA 3K13A 5G2HA 2XVNA 3LRLA 1U1HA 4KWOA 3CXOA 1VLWA 3GXPA 3NZPA 4GJJA 1XC4A 3TA9A 2YIHA 5T9CE 2GL5A 3URQA 3G0SA 1R38A 4ZO6A 3FYPA 2QW5A 4FNQA 1OX6A 1D7FA 2XU2A 4JIEA 4PUJA 2ZDRA 5ABFA 2HROA 1WOBA 1C92A 1HT6A 2VJXA 2PDKA 1VRXA 5LNRA 3F2DA 4IIGA 2C0AA 3GU1A 3O3RA 2Y2WA 5CBIA 3TK7A 3TMQA 3HMJG 3NQ2A 2BNJA 4EP8C 1V93A 2GVYA 5DRCA 1XIHA 3ES8A 3ZIZA 4QCFA 3EPNA 3UCQA 3EDFA 3TLQA 3W01A 1GVFA 3B9DA 4UFMA 3VD3A 1OFDA 1L9WA 2FTYA 3OZPA 4XKMA 1TIWA 4PFHA 4DJEC 1RPXA 3QR1A 3JW7A 4PTMA 2EXOA 4F2TA 1V8EA 1B3WA 1VPQA 4UQCA 1VAHA 1UPMB 2EG7A 4MAZA 3QQWA 4H6KA 2ZKMX 1W8SA 1T7LA 1R3WA 4NIRA 2PAJA 4KEZA 3KRZA 3N3TA 2V5BA 1JCMP 3V35A 4P8UA 3UFYA 3PZQA 5KZ6A 3EMZA 3IVTA 2GQAA 3H12A 2QCDB 3PBMA 1FDZA 2AGTA 2VM8A 1VCFA 5PTDA 3CC1A 2PLKA 4B5UA 3KCLA 2QVHA 2CBUA 3LEPA 3OBEA 1E4MM 3ARXA 1Y0EA 1WBHA 2J8GA 1A5CA 4ADSA 2DJLA 3MDWA 3I6EA 1JGMA 2GUUA 1V4YA 1TPFA 1HKIA 4HYVA 4MB5A 3OU8A 3QY8A 2IKIA 1E1CB 3G1XA 3N17A 2X09A 4TV6A 1ONXA 3NNTA 1EJXC 1A0CA 4XVDA 4KCTA 2G37A 1UWRA 1NM9A 4US5D 3G1SA 2J7BA 2QPXA 1VBJA 3O06A 3BH4A 1W1B1 1GQJA 1QTWA 3QGVA 1CEOA 4JIPA 3THDA 3DGRA 1LT7A 1HKWA 4OFCA 1KM5A 3BOXA 4ZA0A 2D24A 3QPYA 1UD2A 3MB9A 2JE8A 1R2SA 4MG4A 5CBBA 3EXRA 2IPWA 3VOCA 3G1FA 2BFGA 1ADOA 2XHYA 3T6CA 2P3ZA 2IQTA 3S6OA 3WD4A 2F2HA 5A6BD 3GUWA 3UZZA 2Z1KA 4DXVA 4LUJA 2R82A 3G1HA 1MQQA 1CXKA 4IQDA 3UXKA 1KA9F 4M6VA 4NQ1A 4Q3MA 1PEZA 4ACYA 4J2PA 1S2VA 5K3VA 2E0PA 3NDZA 3QM3A 4UQAA 1AJZA 5JBEA 3VYLA 1J2WA 3P74A 1A3HA 1US2A 2DZVA 3Q65A 4W85A 1H63A 1G5AA 2BX7A 1LQ2A 3HQPA 6PTDA 1U33A 3W7MA 3QR0A 2V2DA 2NSXA 4CN4A 4NRRA 1UWTA 1CGYA 4FXRA 5H8PA 5I5RA 2QQ6A 2DZXA 3LERA 4A8LA 3VKCA 1OSEA 2GOUA 4M29A 3M16A 1EBGA 2WJFA 4QDPA 3R8RA 3NZ1A 2D3NA 3IARA 2O9RA 4QNWA 3BDKA 7TIMA 2GJRA 1F3WA 1SVDA 2QCEA 1QU4A 3W53A 2VC7A 4FXSA 4Q8TA 2J79A 4KWVA 4IJCA 5FD0A 1F7BA 1VFLA 2ZCGA 3LDVA 2OZTA 4HNNA 3T7VA 1D9EA 3BARA 2DUAA 5D32A 3G1DA 3LGGA 7ENLA 3T78A 4J3VA 1JCNA 2YPIA 4ZMGA 4KCWA 3RM9A 1FKWA 3AXMA 3KS6A 3C61A 4RE3A 3BO9A 3WG6A 3I68A 4PUWA 1IGWA 1K9DA 2IXVA 3IWPA 1GEHA 2R24A 3U2ZA 2FPTA 4FMVA 1FWNA 1V77A 2R1LA 4IG2B 4MFDA 5D33A 3CHCA 4LF1A 1XBYA 3TN3A 1H0IA 1CPUA 2PWEA 4PN2A 4R9OA 2RKXA 2W66A 2OLHA 4KIEA 1KRMA 4BF5A 3LCIA 3A9BA 1ICQA 4DBSA 1L8NA 4Z0SA 1DJHA 4JTDA 1LG2A 4AIBA 2BB0A 2I1OA 3GAYA 3LPFA 3VC5A 1S2AA 3W29A 4PODA 3M43A 3ARSA 2V5CA 1K9EA 3LXAA 4J5NA 2VEIA 1AUSL 1PHQA 5FJOA 1VRDA 1G7VA 4HNTA 4MTVA 3A9IA 3MSGA 3OO2A 4FZIA 5TQLA 4DAIA 4H2HA 5A1AA 3S2NA 3T0CA 4K6AA 1BF6A 2EG6A 1XGEA 3U48A 1EJRC 1AL7A 3DOPA 2XUCA 3WQWA 1F6YA 2XIIA 3BV7A 1GVYA 5LNVA 2YL6A 3WD2A 4BFAA 2BVDA 5J5RA 4O12A 4C7GA 1KBLA 1H1ZA 3CNYA 4M1BA 4G7EB 5D2XA 4DO5A 3GY1A 2P50A 3EB2A 2Q8LA 3H6OA 3N2MA 3U57A 2WBKA 1P6CA 1K1DA 2E3ZA 1Q4WA 1Z32X 2VGIA 4MWAD 4NRSA 1XIEA 4IQJA 2OO6A 4QSHA 4UTWA 1EPXA 4V1XA 3AHXA 1DE6A 5M2FX 3BV4A 3B9AA 2PDIA 4DY1A 3C0JA 1QWGA 3F5KA 4MNMA 4EOUA 4OOUA 1CBGA 1PV8A 2CZ5A 2ZE0A 1PX4A 4W93A 1W0MA 1A5KC 3KRSA 3UZJA 3CAKA 2JF6A 4JY8A 4LVFA 2DT2A 1DJWA 1KGXA 2VWTA 4A3YA 4PUMA 4B9YA 2ABBA 1JJKA 1E40A 2VD9A 3LGEA 5FEWA 5HMSA 3NZQA 3SFKA 4Z2JA 5JIWA 2ZE3A 3TZNA 1M7OA 3O2LA 1SO5A 1ONEA 2J8FA 4O1FA 4REQA 1V51A 1HO4A 1XYLA 5I3FA 1K8YA 1GPWA 2BZNA 2A6LA 4K8HA 2I17A 3ATZA 4WEVX 3L0GA 1UIPA 1RHCA 1TSIA 1N8FA 4MZ8A 4PRTA 5F4WA 3F4NA 5I3DA 3SCVA 4DX3A 4A3HA 1J10A 5IBXC 3BAJA 3V0UA 3W4RA 2O92A 2QDGA 5KETA 3B0YA 4ZL1A 3QQ0A 2P0IA 1EUAA 4H9VA 4Z2HA 4GWEA 3M5YA 3PC0A 3U9IA 2PCQA 1JIBA 4AD2A 1JNEA 5LNUA 1A5NC 1JG9A 1MW1A 5F4SA 4AZCA 4PMXA 3GG0A 1DJQA 3HGJA 4S3FA 3D6NA 1FTXA 3UA4A 1THFD 1HL8A 2GSHA 3NQMA 2C7FA 1YDNA 4XAPA 4PUDA 4WY0F 2A5HA 3B0VC 3DERA 4KPLA 1TR9A 4HP5A 3WD3A 4H8NA 3TSMA 3ZWTA 2J7GA 2XTKA 3HB9A 1PS9A 3CZEA 1CLXA 3UA3A 2I5QA 1TZ9A 4LX4A 4L9ZA 1DTUA 5A2AA 2QEZA 3TCSA 1TYGA 4B2DA 4AC7C 1M65A 1M1BA 4L7ZA 4ML4A 3OW1A 1Z69A 1AW5A 1O5QA 1W1YA 1E15A 5AC4A 4PMRA 1OG6A 1EC7A 4ZO7A 2EHHA 2INZA 2PGRA 8XIMA 1GOKA 7A3HA 4XISA 3FS2A 1W9DM 4FA3A 2BOEX 3FOKA 4V2XA 3F2BA 4HA3A 4W8BA 4MPKA 2VRKA 3WELA 2RDXA 4G5DA 1E55A 4AMAA 1QNPA 4IOTA 1KM6A 1LCOA 3GU2A 3LSBA 4LY8A 3LHTA 3W37A 3A5VA 4XIAA 3OBKA 3QOKA 3L66A 4IFOA 3EX1A 3AXKA 4D8LA 3Q4DA 2HJPA 4EWND 1K4HA 1U1UA 3L0KA 3MP5A 3SY1A 3SECA 3GVVA 3IIOA 2WSKA 1TZZA 1I1WA 3DIPA 3M47A 2DT1A 1HJWA 1LOLA 2PTWA 5GQBA 2G97A 1FXQA 4WF7A 3L12A 3M5XA 4E2DA 3H23A 1OFQA 3CL8A 4C6EA 3SRHA 3VFCA 1TPEA 1J11A 3IGUA 1TELA 3AIRA 4IGNA 4A8NA 5D05A 4QBXA 3WDRA 4W5ZA 1CB2A 1GOOA 1LROA 3HZ3A 2A3BA 4YL2A 2YCLA 2CCRA 1YBQA 3H2NA 4RDYA 1ZAJA 2ZRVA 2G5WA 2VC5A 3MY9A 1O95A 2VXNA 3SCOA 2JKAA 2VR5A 5DN1A 2R1KA 3CM4A 1HJQA 3TC6A 3QRHA 1FH8A 3QPZA 1GUVA 4YTUA 3B9NA 1U5JA 1JDEA 4GH3A 1YTKA 3KP1A 4IJRA 1YQ2A 1Q2SA 3M0HA 2J7CA 1VZWA 3QKEA 3P2VA 4C1NA 3LTYA 5K9CA 4QJ3B 3THAA 1VFTA 1FCVA 2BGQA 3WNLA 3NQBA 1A49A 5U7SA 3GB6A 5LIXX 5DANA 4JQ2A 4B9ZA 1QATA 1CNVA 1BXCA 4GVIA 4IP5A 2ONEA 1VB9A 1PIFA 1K7XA 5HNNA 2A85A 3OIXA 2QDDA 4V33A 1EQCA 1JR1A 1UCWA 1VC4A 1NP0A 1GJUA 3SCRA 4XAFA 4ICNA 4XUGA 2XDFA 4Q8MA 4LVGA 2Z0IA 1SGJA 3VKDA 1BXBA 1WE5A 1JD9A 3CZ8A 4XKYA 2XM2A 3FYOA 1ITUA 2I14A 4LOCA 2ZRUA 4DUVA 4JKLA 1R2TA 4IFKB 3DFNA 1CIUA 1OF8A 5EGRA 1HKJA 2OT1A 4RCXA 4KQNA 5BZAA 4LJ3A 3TFXA 4UTUA 1VYRA 2VFIA 2IKJA 5CXPA 2PDWA 2HMCA 3C2YA 4AUBA 5I02A 5FF2A 1LRNA 1W32A 3RMEA 3UR5A 1A47A 4GVFA 3GXMA 3C6CA 1VQTA 3CPRA 4TR9A 2BP1A 5I7GA 1KM2A 4WDWA 3NPWA 1HJSA 1OY0A 2VQUA 3CMFA 4HA0A 3LB0A 3WDPP 4QHRA 3B8SA 2WSYA 3O16A 2J9YA 4JEJA 4G8TA 3EOLA 5KZDA 4XZBA 2XGZA 1B3ZA 2WVUA 4DBUA 1OD0A 4O15A 2NQ9A 1UWIA 4QR6A 2C18A 1BHGA 2FZ8A 1O1ZA 1BWVA 4MNLA 2VUNA 3P84A 1QOQA 1XUUA 3H7RA 2ABAA 2W92A 4MWAB 4AZGA 3VDCA 1ZNNA 1O5XA 4J7RA 2OQYA 1I2PA 1FHVA 4CEUC 5MKGB 5G1MA 5EB8A 3QV8A 3TP4A 1FDYA 1UD8A 2QNEA 4HMNA 1QWKA 1RAKA 1XQKA 1UR8A 4BY3A 3VO0A 5JBFA 4AHQA 3LMZA 4NSBA 5HINA 3DDMA 3V36A 3S1WA 4RE2A 3TQPA 4WJEA 5E9AA 4Z1DA 2WVVB 3W38A 1YPXA 5BOOA 1O66A 3WNNA 2IKGA 5CBJA 5DY3A 4HVXA 4QCEA 4KFNA 3EKLA 2NXGA 3AS1A 3BW2A 4UQDA 1QXLA 4GQRA 4ECLA 1E6QM 4P5UA 1WXZA 2R94A 4UTMA 3WK2A 5CZ0A 2VRJA 2CPUA 3TW7A 2EPOA 1K03A 3V1HA 3CYJA 3G24A 1L8PA 1QW9A 3MO7A 1A5LC 1J93A 3E96A 3OOQA 4K3ZA 4KW2A 3WQEA 4PBFA 1J5TA 4LUTA 1UD5A 2PP3A 3W0KA 3HA1A 3P14A 5EMLA 1T99A 2DV0A 5BXRA 1M3UA 4DO7A 1IEVA 4WJXA 2BWGA 1OGBA 4M81A 3FW6A 1DYSA 2DUZA 2PE4A 3W7KA 2V67A 3F2CA 1XPGA 1FWSA 3RR4A 2W9MA 4I7UA 2FB2A 2EPMX 3UYIA 1F07A 2QF7A 2YDRA 3PG8A 1AW1A 1V02A 8CGTA 1D8WA 3RLGA 1H3GA 1E3ZA 2ANUA 5E1QA 1HKMA 3LRMA 4XZHA 4UUIA 3LCLA 5D09A 3QYSA 3CLWA 4LEQA 4S3EA 2VWSA 1F76A 4ATWA 1AD1A 3MWAA 3BG3A 1TPB1 2G8ZA 3ARZA 3MSYA 4WGHA 2VEGA 5BOFA 2J7EA 3TROA 4HN4A 4EPBC 1KW1A 3GIQA 3O8AA 3L7RA 4FX6M 1R7OA 2A3CA 3VGFA 3GSMA 4B3KA 1FFRA 1RK5A 2NXIA 4Y90A 2UY2A 3N3MA 4MUPA 2ZVRA 4XBSA 3RN6A 2QULA 1GKQA 3ALFA 2VRQA 2YBVA 1MVYA 3ZJ6A 3AO0A 2D22A 2ZX9A 3T2QA 4IPIA 4CUCA 2XIQA 4YYFA 2YXGA 3GG1A 1NU5A 5CPNA 2FLIA 3PR2A 4DBEA 3I7RA 5B7YA 3ID7A 2AL1A 2FZ9A 2G3MA 1S5WA 4B2DD 1TV5A 3ZSSA 2PDNA 1QI5A 2D0FA 4Q6JA 2PD5A 3L67A 3QPEA 4OV4A 4AHPA 1VFMA 4LAKA 3ZOAA 2YA2A 3M07A 1HGYA 3NFUA 3OEXA 2R1PA 1BFNA 2Z26A 3DHDA 1POKA 5BXPA 2J7HA 3EX4A 2QGYA 4CKQA 1JUEA 1Q63A 5CGMA 2F9RA 2OFJA 3VMOA 5F1VA 2ZC8A 1DJNA 3V16A 4MKSA 4S3JA 4AG0A 1FWHC 1XLAA 4JHOA 4Z17A 1XKYA 4HCDA 4JDYA 4EANA 4HPHA 3P0WA 4QITA 3WLIA 2Z7GA 4PYSA 3E0FA 4ZEPA 5G5IA 3G1VA 5I2UA 1PDYA 1XYZA 4XK2A 1Q7MA 1UOKA 1GTEA 5H91A 1M01A 4WOZA 4MM1A 1R3YA 3JZUA 1DL3A 4NUWA 2E7FA 3T44A 3RLHA 3AZRA 1N7KA 2GSJA 2A1YA 3QV9A 3ITLA 8TIMA 1DJGA 4LC6A 3WMLA 2OTDA 1KFLA 1DIDA 3G6LA 3S6TA 2ZRWA 2Z1VA 4F2BA 4XD3A 4B5VA 2NVAA 4FS9A 1QI0A 3DFOA 3M0ZA 4Y9OA 1MNZA 1XLLA 1REQA 3P5ZA 2RFGA 4LF2A 3BSMA 1R8LA 2ZDSA 1KWKA 4B16A 4UQEA 4AWSA 2VMFA 5KZEA 2WOQA 1MUWA 3P5YA 1IR2A 1ZJIA 3ZZ1A 4Q7BA 3CWHA 4MKVA 3ARWA 1AH0A 4AY1A 3ZM8A 3AIWA 4QTGA 3VDAA 2ZWZA 3S47A 3GTHA 4U28A 3KVLA 3AWOA 1X7FA 4NILA 4UCGA 1ISXA 2I56A 5FEZA 3TYCA 4JTLA 1XCFA 1XD0A 4AMCA 3KBNA 2BSLA 3WQFA 2FGLA 1IE7C 1DWGM 1UASA 2V6AA 2PWHA 2OEKA 3VGBA 3ZVIA 4PC8A 4L4PA 1X39A 2NLYA 1S39A 5HUOA 2J8TA 2XZ9A 4PRRA 5JQ9A 5AKQA 4A21A 5BYWA 2TRSA 1YLVA 2W0UA 3TTYA 1BVZA 2BG5A 3EGJA 1X1ZA 3OYZA 2OMAA 3I4KA 3UNDA 3R8HA 4BJHA 2X0SA 3L4WA 1SPQA 3LLDA 1XV8A 5FESA 4B5XA 3C2EA 1XC6A 4IGMA 4GYJA 1GZGA 2FHFA 1C90A 3EWYA 3OQEA 2J62A 3IAQA 1FWFC 2NUWA 3GX9A 3LCGA 2E67A 3N6QA 1VPYA 1WBJA 3EXSA 3WQ4A 2DSWA 1GONA 4KMQA 1D7KA 4HYRA 2ZA3A 3MU7A 1H7RA 1Q7ZA 1UWAA 4PMNA 1WCGA 5DT5A 3DKLA 3SFWA 2WBGA 3VIFA 3LPPA 2FH8A 2E1WA 3H53A 3ARYA 2X0HA 3QSTA 2BLEA 2Y70A 5EYWA 4AX7A 4NKCA 4WGXA 3GFXA 3NQEA 3I4EA 3RX3A 3WFAA 1KNWA 1RCQA 4UMAA 4HJWA 2PU1A 1QFEA 4A05A 4PL1A 3EX6A 2PTZA 3K4AA 2HWGA 1DKWA 4W9TA 1RZMA 1XM3A 1YRRA 3KFTA 1CTNA 4JFVA 3AMKA 4LQ1A 3BPWA 1D3GA 4AZ6A 3E3HA 3UWZA 1XWYA 3ANUA 4ZR8A 3NVDA 4P8WA 4R27A 1R9XA 4K1WA 3STPA 1RBAA 4NNAA 2Q01A 3NJ3A 3O9NA 3N4FA 1WUEA 1VPXA 4GY1A 3UG5A 3BICA 2WXDM 3KUMA 5CLWA 3CH0A 1OFBA 2WANA 1VCVA 2ESCA 3P81A 5FOOA 3ANYA 5LKYA 3HF3A 4JTFA 3HM7A 3U2OA 3IJDA 4W7VA 1ME8A 1BSLA 1C7SA 2VYOA 2FH6A 4HN8A 4UFKA 2E6FA 2WZEA 1KM3A 1FUYA 2EG8A 4H7VA 3QOMA 2BVTA 5DX7A 3CPGA 5D4YA 4OJYA 4REQB 4ZB5A 1EIXA 3NPUA 2GDVA 3CQIA 3T0TA 1LJYA 3CWOX 1D3HA 3GXIA 4J3SA 2ZADA 1Q6CA 1G94A 2OPJA 1XS2A 4JTJA 1RLCL 3PPCA 4M6UA 1WZMA 4UTTA 3A47A 3SIZA 3EAUA 1NQ6A 1FWWA 4ERGA 4KEVA 3PVFA 4Y8EA 5CCZA 3CMJA 4WUIA 1YDOA 4JR5A 3WD1A 1RCXB 2JKEA 3NO5A 3N2CA 5I06A 2NT0A 4QFUA 4JKMA 2RGMA 1P0BA 1KBBA 2D0GA 1J5SA 1AH3A 2CWXA 4H3DA 4UWMA 1S46A 1IHIA 2OYKA 6ALDA 1B3YA 5CAKA 1M7XA 1HF6A 1FH9A 1UG6A 3VVGA 1G4SA 1J8VA 4HU4A 3U8GA 1KWGA 3V75A 1QVBA 4G7FA 2PTXA 4A8IA 3N15A 3GS6A 4HBKA 1W1ZA 4F66A 2C14A 1G4TA 4HB7A 5HBFA 3GDTA 4F0RA 1G67A 1V6VA 4UIOA 4U10A 1J0KA 3HG5A 3WUFA 1IR1A 3MHGA 4B91A 3OHIA 4PMQA 3I3EA 5IRPA 1PZ2A 3GE7A 2CU0A 1WB0A 2VX6A 2FPVA 2JIWA 3RYSA 3KCJA 2CBIA 3D47A 1R5YA 4S38A 3EOEA 4N4PA 3IGHX 3NSNA 1LQ0A 4MSSA 3KBMA 1K8ZA 4KS0A 1DHKA 1ME7A 2Z00A 5HQLA 1GKPA 1WP6A 4JTUA 3CTLA 2REQA 3TU9A 2WVTA 1QW8A 1X6NA 5HMDA 3ITOA 1BSIA 4NXKA 1Q6DA 2DT3A 2H3BA 4JFTA 3MYOA 1AL8A 1QT1A 4HPGA 1IQ8A 4C6BA 2WCAA 4ILSA 2XVKA 4RNFA 1GJPA 1GOIA 2Q8ZA 3M0VA 1T8QA 4JYFA 2VFGA 2G50A 5LIUX 2PDMA 4OBRA 1C91A 4DF2A 1XLHA 3JU2A 3LHYA 4X61A 1QI2A 3PZIA 3WNOA 3CS2A 3N18A 4D8AA 2PDLA 3WZ0E 3WNKA 4A6GA 3GW3A 3ZMRA 1Z3NA 1QNVA 4M8UA 3TN5A 4ASTA 4AZHA 5I3JA 4J4KA 4X2PA 3RF9A 3L9CA 3FDKA 1XSJA 1ZJHA 3BQ5A 5LGXA 2E8ZA 1PZ3A 2Z7KA 3RLVA 4MLRA 2YCLB 5F2IA 4OE7A 3QZ6A 1YBQB 1RQHA 4KWUA 1TE1A 5CZTA 4L65A 2Y7DA 1GOQA 4C5ZA 1JXJA 1EJVC 2VEPA 4UBPC 3USZA 4A8RA 3CUXA 4FB7A 1TWIA 2OOFA 3CHEA 4LVDA 3L5AA 1ZBKA 4DI9A 2ALRA 1ZP4A 4G2DA 4ZBCA 3OZOA 4B5NA 2CZDA 2WWDA 1GQLA 4C1NB 3CQKA 2OKOA 3FHAA 3R0UA 1XJBA 5KEZA 2VTFA 3GH7A 3N12A 2HXUA 1GVSA 2Y62A 1QK0A 1JCXA 4ZVJA 1VBUA 2D20A 2NSOA 1ISYA 3R6IA 4WK9A 3S2LA 4AD1A 1ML1A 3VM5A 2C6QA 1BYDA 4JFUA 2YZ5A 2IQ0A 4Q8NA 2OXNA 4CCZA 1UH4A 4PUEA 1MQPA 3LZ5A 3N34A 4PSRA 1P0DA 3RU6A 4RLIA 3UWEA 5HA7A 4M82A 1A0DA 1ZP3A 4DLFA 1QJWA 1HJXA 4GCXA 4UFHA 1E6ZA 4NL1A 1MZHA 5A6MA 2MANA 4X0VA 4F9DA 1LOSA 4R88A 1V3KA 4XKYB 3CUGA 3N73A 2NUYA 4P7OA 4E2BA 1QDSA 5I09A 2FHCA 3GKAA 1XIJA 3FSUA 5B7ZA 5I07A 2BHUA 3URAA 1IT0A 1PX3A 1PHWA 1XLEA 4HZ7A 4EPEC 3KL3A 4QEHA 1W3TA 1MXSA 3C8NA 3KS5A 1K02A 1LLOA 3APTA 1ECQA 3NPVA 3TAKA 3VX0A 4L5ZA 3U6WA 1AQMA 1JEZA 3NUKA 4G1NA 3BQ6A 1W5NA 4IUGA 1H7NA 4HMDA 2V81A 4NZJA 4LYRA 3CAQA 4FF5A 1EA0A 2W63A 1EA9C 4WDUA 1TA3A 1YNPA 3GR4A 3LHVA 4WZHA 4GNKB 4L4MA 3ZYZA 1M04A 1K77A 3DBNA 3G8RA 5KZMA 1BXNA 1CXIA 2YB4A 1UR0A 1V3MA 3AI0A 1GEQA 5E0CA 4DVOA 5D2TA 3PTMA 2PZ0A 4QE4A 1PL9A 3SI9A 4PZVA 5DCDA 2X1UA 3BOLA 2XM1A 3N4EA 2QDHA 4R85A 5D2YA 1B1YA 3SAZA 4FP1A 1E5NA 4ZO9A 5AHIA 3T05A 4GKLA 5LA2A 2W67A 3GKFA 5FJRA 1VS1A 2WHKA 6REQA 3NEVA 2AMGA 2GGIA 3VINA 5A8PA 1QO5A 4F9JA 3TYEA 3SCNA 3VC6A 3TTEA 4GUJA 1SW0A 4GA8A 3FJ6A 2RDUA 4XX6A 5E6ZA 4QG8A 3ATYA 3RPDA 4H19A 1BEUA 2OX1A 4JCLA 2W27A 2HK1A 4YPJA 3ZSTA 5BWAA 3IIXA 3WQGA 2X2YA 4LAMA 1QOXA 1XLGA 4Q32A 1X98A 3G2GA 4AY7A 2B81A 3KL5A 1KXHA 4IP7A 4NVTA 4D71A 3G22A 4MZYA 1W3KA 2CC0A 3BZJA 2CKRA 4NJHA 3BAIA 1QASA 1QCWA 3W26A 3UY7A 2HPIA 3GZ3A 2A2IA 4FXJA 5DLCA 2ZTKA 2HISA 3I3BA 3EWXA 1FH7A 1RVKA 4J3WA 3V4BA 1OX4A 1TX0A 3F4VA 3GXNA 3PZTA 3UZWA 2GJPA 1GOWA 1K8XA 4ZFCA 3MVIA 5EA9A 4IX0A 4PR4A 3WEZA 3R12A 2P10A 3FYYA 3NQAA 2E77A 3ITGA 3BG5A 3UESA 4WY0A 2DU2A 3RUBL 3PPHA 3A3WA 1H1NA 3BE7A 3HTWA 2ZA1A 3W81A 1A80A 3B0PA 3GDMA 3M0IA 3L4YA 3W1AA 4IZGA 2QIWA 2BY2A 4WKHA 5LNWA 2XINA 1J6OA 1G69A 1LL4A 4OWGA 3N9KA 3E1F1 4EAYA 3BCJA 4ZZ9A 3M5VA 4CN1A 1XSKA 3OVGA 3AU6A 1VEOA 3LRKA 2VGGA 2R14A 1K9FA 2A3LA 4YU1A 1WZKA 3QSRA 1XL9A 4PTXA 3CAVA 1QPKA 2D2JA 3E2RA 5DXYA 5A6SA 5GNXA 4DWSA 3JRKA 1KKOA 4C6KA 6TIMA 3PZ9A 4JL2A 1Q6RA 1HJUA 3K46A 1XISA 1UKTA 4WKFA 1Z7AA 5D9PA 3OPSA 1RVGA 9RUBA 3QFEA 1VBGA 2V30A 4C7FA 1V0NA 1CGVA 1FRBA 1LLWA 1NVMA 4GGHA 1ITCA 4AF0A 3W2LA 3T1GA 2Z2UA 1IZCA 4XWUA 3VX1A 3GG7A 4F0LA 3ABQA 4ERAA 4FSAA 1I1XA 1RY8A 3VIOA 5FKYA 3VMNA 4K38A 1T5AA 2GJNA 1TWZA 2A7NA 2V2CA 1XDMA 3MUZ1 3GC5A 3UR8A 1IT7A 2OO0A 1GT8A 2AOSA 1GZ1A 2PDJA 3PK7A 1IXOA 1C9DA 2BS9A 4NP7A 1I0DA 5HNUA 4OHQA 2PRMA 2YCEA 1RJQA 4XVEA 4UTTC 3ITXA 4Z1CA 3FAWA 1JZ3A 1KFEA 4O53A 4O1BA 2WKGA 1BF2A 3NQDA 4K39A 4H8VA 4S23A 4QP0A 3MUCA 1LBLA 3LPOA 2ZZ2A 1P4CA 3HU7A 2AKMA 1JZ5A 1M7JA 3MP4A 2P1FA 3G1RA 3MHUA 3E2QA 5FCZA 3VMPA 1QI4A 3KX6A 3UERA 4F8XA 1OGSA 4DN1A 3UP8A 4Y2WA 3NOEA 5AC7A 3OG2A 1GZJA 4ADTA 1SZNA 4ATLA 3B40A 4PUKA 1OCJA 1RV8A 5BNKA 4NZ3A 1EP2A 1JVNA 1C9WA 4BF9A 3VIGA 4BF7A 3A4AA 3QKZA 5XIAA 2JQXA 3W1XA 1B9ZA 1M68A 4A3RA 1VIWA 3WBAA 4PB4A 4F3HA 4B3LA 2I5IA 3MCMA 1MSSA 1Z44A 3A22A 1REQB 4KCUA 4OV9A 3GDLA 3WYZA 1ZZMA 2P8BA 2H8XA 2Z1XA 1YYAA 1ZTVA 1UKOA 1HUVA 2AQVA 4MVAA 1GNXA 3IAPA 5CG0A 5AYYA 3N11A 3OA5A 4GCAA 2ICSA 1BWLA 3VILA 2VO5A 1H1YA 1W1PA 4NX5A 4IL2A 3TYDA 3BSHA 2G3JA 3I65A 4O19A 1G1YA 1BLIA 3KP0A 3TC3A 1FCBA 1L6YA 1JRCA 4NZ1A 1EJSC 3VUPA 1E4IA 3MCOA 4LUSA 1RD5A 5CPLA 3P82A 2G41A 4JQ4A 4HNUA 1IEIA 3R89A 2YCKX 1AMKA 1OINA 2Z1SA 3W82A 3VXGA 1FWBC 4W8LA 4CU8A 3ITVA 1B3XA 2W5FA 2EBNA 4D1JA 4GI8A 4YN5A 4DZAA 3CAWA 3KBJA 3M4HA 3QBUA 4NAFA 3TOPA 5MHBA 4H8HA 1PXGA 1Z89A 4P7NA 5K9DA 3W7DA 3EWCA 4OUEA 4JHMA 4AHOA 5AY7A 1U30A 3A12A 3ARQA 5A6AA 4S2BA 4L9XA 1R87A 5D8ZA 3R4IA 3BC9A 1HG3A 1SZFA 2VFFA 1SO6A 2QUVA 3GAKA 3MA8A 1CW2A 2YXXA 4NJGA 2DZUA 4JNZA 4PRWA 3EWUA 3S1GA 4X63A 1YIXA 3ABOA 4JTGA 2C0HA 4JIHA 5B80A 4YLWA 4BWLC 3UJEA 4IMGA 5JU6A 1VJSA 3MKCA 1EKOA 2J47A 1QI3A 2Z1WA 2XYLA 1H2JA 4DJDD 1QOPA 1RCOB 3FJLA 2CBVA 1AFSA 2NQZA 4O0ZA 2IKHA 3DX5A 3L68A 2CETA 4QISA 1J0IA 4ZB0A 2WMJA 4I6KA 4HQVA 2BY1A 2CLPA 3FKRA 2GGEA 2D0HA 3SB0A 1O94A 3TXZA 2WSQA 5HULA 3WH6A 3O6AA 3VI2A 3W88A 4N42A 2X41A 1G01A 1UZ1A 3TUUA 3I6TA 2ZUNA 1IXNA 1UH3A 4I9AA 4I3GA 4A2RA 1LRQA 3KHJA 1AJ2A 1CENA 3KXQA 3NA8A 2JALA 2ZZ1A 3OLEA 3STCA 4UOZA 3ONCA 3H2OA 3QHMA 4XZ9A 1ZALA 4DIAA 1SM9A 4AFYA 2PSNA 2BODX 4EXQA 1J0ZA 3WBWA 1G4PA 2ACQA 2UV8G 2WPBA 3GBEA 1NF7A 3NL6A 3V0TA 1HKKA 1W9BM 9XIMA 4J28A 3DHPA 2CESA 3N19B 4YTRA 2XN0A 4J3ZA 4EWJA 1AQHA 5LGZA 5D37A 4YMZA 2ZXQA 2GJXA 3B05A 4AXNA 4C1KA 1TVPA 4Z42C 3TN6A 5CC6A 1EJ7L 3BLLA 5TIMA 2P0OA 4XBJA 5C71A 5LHEA 3CUZA 1Y65A 1WZLA 2CNCA 1UYQA 2AQOA 3P8JA 3WF3A 1EP3A 3V5OA 3DG7A 2YDSA 4M80A 1EGMA 2B4GA 2PWGA 3W1PA 1GOMA 2XN1A 1LYXA 3MT1A 3RCNA 4GC3A 4DJDC 3M0KA 3VIIA 4F48A 1IGSA 4R53A 1TV2A 4W5UA 2YW4A 4W87A 3DYOA 1KRCC 3HV9A 5A8QA 4X3ZA 2YA0A 4QSFA 1I8JA 2WSPA 3W86A 4PCSA 3MJYA 3V18A 3N6JA 2OSXA 4JCMA 4MLJA 1Z41A 1WKFA 1ZPTA 3QGAC 1H11A 3OVPA 2H6RA 1UKSA 3L4ZA 1H49A 2WQDA 1UBSA 2PDGA 3L4UA 5ABEA 5D2WA 1WAUA 1K4GA 3CLMA 3W1QA 4JFSA 5FL1A 1UUOA 4B5TA 1W5OA 4U33A 1BWKA 4US5A 3TQVA 1TQJA 3EKZA 1VENA 3AIEA 3IRDA 3RCMA 4WJ8A 4CQ8A 4ZO8A 1OG0A 4O54A 2D23A 1FWAC 2Y5SA 3TYAA 3VE9A 1ZS2A 1TPWA 3BWWA 4FNPA 3UZYA 3R0KA 5EMUA 4K2SA 3B8TA 3RHGA 1TV4A 3HQNA 1PX8A 2DEPA 1XBZA 3AMGA 1G6CA 4AISA 4DWSD 4QGCA 1XSIA 3WNPA 3MQTA 2A6NA 2OEMA 3JR2A 4N9BA 3K2GA 2QUUA 1XDJA 5A6BA 4DAFA 1AVAA 4AWTA 3GO2A 4QXIA 3MUY1 4L64A 3VK5A 1TJ0A 3MI3A 1I60A 3A13A 2V5JA 4L6HA 3AYTA 4AQLA 3HJZA 1TUXA 2QYGA 1EFZA 1ZLPA 4GX9A 5BXTA 1DQXA 4YXGA 1OABA 4IIHA 4AU0A 4MJ2A 1JYXA 2F6KA 1J0JA 4PUNA 5GJNA 4HJFA 2B0MA 3EXTA 3W7IA 3LN3A 1VYPX 3PG9A 2V5LA 1RQEA 2REQB 3B8UA 5FAGA 3O6DA 5I79A 3N9SA 4LFYA 4HSNA 4XG1A 1OC6A 2EO7A 3N2XA 4J9JA 1XCXA 4Q33A 1UB3A 4QG6A 2GSEA 1O1HA 3WBYA 4ZSUA 1FKXA 4HU0A 2ZRXA 3OGVA 4IM4A 2EEXA 1W9XA 3A24A 4RZ6A 4E6MA 1GOXA 3FLUA 4MHBA 1WZAA 3I6RA 4NNBA 4BQ2A 5BMXA 2E8YA 4S3BA 3BOFA 1HKVA 1EOMA 4QROA 4M3PA 2EJAA 3NR0A 3V7PA 2GGJA 2XGBA 4DWSC 1VHCA 1GQIA 3LCWA 1FWRA 5AHFA 1QPQA 2EJ1A 2V9DA 3U5YA 4RXFA 2WLZA 2J7FA 3GXFA 3SCPA 1AJ0A 4Q6XA 3URBA 1R85A 3ABSA 5C70A 2C1GA 2VL4A 2IXUA 2ZTJA 2WV8A 4UOQA 1A4LA 4L9YA 3VZXA 4JD4A 1HVQA 1P6BA 4D6IA 1RA5A 1PKNA 3KRUA 2NVDA 2ZZ3A 4ATDA 1WUFA 3C52A 3PJUA 4UOJA 2DW6A 5HATA 3W25A 1HO1A 1KCZA 1F3TA 4U2ZA 1MW3A 2EQDA 3C86A 4CGTA 1UD6A 1GQKA 3PBGA 1UMYA 3H22A 3H2CA 1M6JA 3UT0A 1Q8JA 3H70A 2BASA 2G3IA 1OJXA 3C5QA 3Q67A 5CC5A 4DJFA 5G4EA 3RRAA