4CLMA

Structure of salmonella typhi type i dehydroquinase irreversibly inhibited with a 1,3,4-trihydroxyciclohexane-1-carboxylic acid derivative
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
251
structure length
243
Chain Sequence
KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVIAVNDLRSVLMILHNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Irreversible covalent modification of type I dehydroquinase with a stable Schiff base.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Lyase
total genus 95
structure length 243
sequence length 251
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4clmA00
3CT7A 4XBKA 2QCLA 4NX0A 2QKFA 3PBUA 3ZWSA 1ONRA 5LHEA 2J9YA 1EIXA 3O6YX 4GUIA 5FF2A 1FDYA 4X2RA 1I2RA 1BEUA 3IGSA 3O16A 4K8HA 1Q3NA 3B4UA 2C15A 3PR2A 3JS3A 3HG3A 3LCXA 3NQ8A 3PF3A 1TV5A 3M43A 1H1YA 1DV7A 2NX1A 2FPYA 4YWIA 4NXKA 2QAPA 3PB2A 3M44A 3ZR4A 4X9SA 3TA6A 1VH7A 3FYPA 3TW7A 3DAQA 3IGXA 1SW7A 4UFMA 3WK2A 5BMXA 3QF0A 1Q45A 3QYQA 4PL2A 3CB8A 1LRNA 2X30A 1DKWA 2BLEA 2ZQ0A 1QPQA 3TK7A 4K7VA 4N6EA 4UTWA 6ALDA 3TJLA 4AH7A 3P8JA 3UQNA 4UTHA 5LZLA 4HSNA 3CQ0A 3UPWA 1S5VA 5KSWA 1T0OA 3FJLA 4TO8A 1JR1A 2DZXA 3OEXA 1B4EA 3A21A 3RK8A 4BK9A 2QCEA 4O1AA 2YYUA 5DBUA 4JTHA 2R14A 3GIYA 1DHPA 3UYCA 3QW3A 3DU0A 3M5XA 4Y96A 4O28A 2QCGA 2C13A 1OJXA 4WY0B 1YPIA 1KW1A 5DCDA 2ABBA 1FXQA 5TIMA 2QDHA 3DH7A 1AL8A 3PBYA 5F2LA 2CZFA 1ZHAA 5J5DA 3EX2A 2FB3A 2ISVA 1TTQA 2DORA 4PL1A 3PG8A 3NQFA 3EX4A 1SU5A 3TKFA 5D2XA 2HS8A 2F84A 4DXVA 4O0KA 1HO1A 3MBDA 3LTYA 4UNKA 2EGZA 3TIMA 4NXSA 1R47A 1W5OA 3A22A 5EL1A 1KFJA 3BK0A 2D73A 2X2GA 2WV8A 1PCKA 3W07A 3TROA 5CPLA 5AHNA 3ZS4A 1W1ZA 3W76A 2V8ZA 1Q6QA 3E96A 1AK5A 2ATMA 2NXHA 1QWGA 2R8WA 1WYIA 2J9ZA 3B8DA 2RH9A 1DBTA 4AWSA 1H63A 1CX9A 1XUUA 5AYZA 3TXZA 1YADA 2CLFA 2JKEA 2VEPA 1KTCA 2DP3A 1VQTA 4TMBA 1OABA 2FQIA 5TQLA 1V7YA 1QO2A 3S9YA 1VYRA 5G2HA 4JTTA 4UNLA 3DFSA 2H6RA 2WOQA 4ICNA 4MY1A 4ONVA 4TIMA 2EPHA 5AC8A 4FIQA 2B0MA 3W7GA 3VCRA 1H7XA 3NDOA 5AHMA 1FCVA 2C1HA 3E12A 3VKJA 2V81A 1U83A 2Y89A 4MFEA 1DOSA 4O0ZA 3TQKA 3OHIA 3KRSA 1R2RA 3W6YA 2E09A 4IPIA 1OX6A 3L2IA 5D33A 3P80A 5EBUA 4O11A 2X16A 1O95A 4JTKA 1GWJA 1TPVA 1EP1A 3G18A 4ZQCA 4MY8A 3MYPA 1RQEA 3FS2A 3QFEA 4O1DA 4WD0A 1QO5A 3ABOA 3S8HA 3NQMA 3S42A 2ISWA 2FDSA 3NQGA 4Y8FA 5AYXA 4C1LA 4WY0F 3HMJG 3PUDA 3HBLA 3UD6A 2ZA3A 4FNPA 1PL9A 1QPRA 3BW3A 4HN4A 1LROA 1XI3A 1EWDA 1YXYA 3UWWA 5DCEA 1ZCOA 2BX7A 3LRMA 5E93A 1H5YA 5LNRA 5AYYA 2X1UA 1K8ZA 1KFCA 3HPXA 3QSTA 4ZL1A 2E6YA 3L66A 3LX9A 4JEQA 2ISSA 3HPSA 1JRCA 3EXRA 4S2BA 1WX0A 4J9JA 4N9CA 3W2NA 3GR8A 3B0PA 4UFKA 5D2VA 4QSHA 4A29A 2GJNA 5G5IA 3NNTA 4X22A 1R30A 1JUEA 7TIMA 4XWUA 2A21A 2Y7FA 1LBLA 2DZVA 4UFLA 2I14A 4UTKA 3W7IA 3CWOX 1Y0EA 3RF9A 3UY8A 3I7SA 4QITA 1XM3A 3KVLA 3P62A 3ELFA 4S1FA 4YXGA 3SGUA 1VZWA 3MP3A 4JICA 3LXCA 2NZLA 3QW4B 2ZZ5A 4FO4A 4OU1A 5IBXC 2HS6A 1SFJA 4O4WA 1TQXA 4EF8A 2ZFAA 3QQ0A 5HR6A 3W1TA 4JX5A 3JRKA 4UMBA 2YDAA 2VEMA 1NF0A 3G24A 4JTIA 4NVTA 1YDVA 3D0CA 3AJXA 3ATYA 3GNNA 1CI1A 3W1RA 3M0ZA 3WJYA 4BFAA 1C9DA 4WOZA 1OFOA 4UTJA 4LUJA 3WK0A 4ORMA 2NX3A 3W7DA 3NZ1A 3EXTA 3LXBA 3W1NA 2CU0A 4PA8A 4ML9A 1PHWA 5CSRA 1N55A 3CWNA 2Z2UA 2JK2A 1T8XA 1XXXA 2BZNA 3VI2A 3LDVA 4IMFA 3W7EA 1X6UA 2DU2A 6TIMA 1OF6A 5G1TA 3L5AA 4LWWA 4TR9A 1WA3A 3BO9A 4UR7A 2CLEA 1O60A 3NQDA 3OVPA 3PM6A 4GRSA 1T96A 1L6SA 4QIUA 3C2OA 3ABRA 1OX5A 3T44A 4FF7A 1KV5A 3NL3A 4LS0A 2ZZ1A 3W7PA 2XN0A 1VCVA 3BG5A 3T55A 1XDLA 1SO3A 4PCFA 5IBXA 2EF9A 1FCQA 2ZZ7A 1KFKA 4JDBA 3LM7A 3TC7A 1LYXA 3I65A 2C16A 3CM4A 2ALDA 2QUVA 2C18A 3NVTA 4HNTA 1TRIA 1W8SA 4OT7A 3EWXA 5G1YA 4I7VA 3C2RA 4U28A 1Q6RA 2H3DA 3MO7A 2YW4A 2C0AA 5EKYA 3N73A 3QM3A 3QJAA 4AEOA 3P74A 5CPOA 1OK4A 1PCWA 1OFEA 3O63A 3WJZA 4L4MA 2WSRA 1I2OA 3IVTA 4N6FA 1RPXA 5LGXA 1H1ZA 2E6AA 1JVNA 3L0GA 4HKPA 3IIXA 5F1UA 2Y6ZA 3W7MA 1MZHA 4PH6A 1VR6A 3BV4A 1TCDA 3EKZA 1H50A 3CIXA 1X1ZA 4IXXA 5C54A 2ZCGA 2VFIA 4JGDA 4GUJA 4O57A 5CGQA 1PHQA 3DHFA 3TJXA 2PRLA 1SSDA 3WK3A 5K9XA 3LCWA 1X8FA 4WY0A 3N9RA 2CFFA 4PFMA 1LRQA 3MHFA 4IMDA 2X1TA 3BGGA 3TCEA 3TH6A 5EMUA 5FF4A 5HWMA 3P84A 3W7NA 1F7BA 5KITA 2E5CA 4RR4A 2W79A 3DBPA 1W5QA 4JXCA 4RJEA 3C8FA 4MJMA 3UWVA 3NQAA 1A53A 1VC4A 3BLFA 3FOKA 2FTPA 4LS1A 1F05A 4K39A 4KFPA 5BRBA 2WNQA 5D05A 5DCBA 2OCZA 3M41A 1IF2A 1FWRA 3W3OA 2NX9A 1TPUA 4Z0JA 3IIZA 3E0IA 4DEFA 5F2IA 1BWLA 1TREA 3QZEA 3DI0A 1QFEA 4P61A 1SZFA 1VRDA 2V2HA 2WSYA 3T78A 1G67A 2DJLA 1KM2A 4HIBA 4N02A 4TMCA 3HOJA 3KAOA 3TMLA 1AG1O 3W71A 3EWYA 4IX0A 2NUWA 3WFAA 4RV8A 3Q94A 4ALDA 4AF0B 2ZDRA 3NQ2A 2NWRA 3NR0A 4WOQA 4DBEA 4LVDA 3R5EA 2ZZ4A 5DXXA 4R33A 4UTLA 1FBAA 1XKYA 1OFQA 2H8XA 4H4IA 2WQPA 1GEQA 3NL2A 4XUGA 4UMAA 4IUOA 1YXDA 5KZMA 2OMAA 3TFXA 3TAKA 2YGYA 5CPNA 5CZJA 3ABSA 1LTDA 3BG9A 3EX6A 4FHAA 3W7LA 1XC4A 4AMAA 1JUKA 4O17A 4FB7A 3FJ6A 3FKRA 4NNCA 1SFLA 2W6RA 3MUXA 3LXAA 3T40A 4NU7A 3E9AA 2H3BA 3KVJA 3LHTA 4UFHA 3G1AA 1WOBA 3W2MA 3USBA 4A3UA 3ATZA 1IXOA 1EEPA 1YYAA 4IWWA 4QNWA 1NVMA 3LV6A 2ZYFA 1LP6A 1GG0A 5A5WA 1ZENA 4NJKA 3B04A 5IM51 2A7RA 1KLYA 2HTMA 3CU2A 2YX0A 3C6CA 2HMCA 4LS2A 4LW7A 4JX6A 3G1FA 1B4KA 1I4NA 4E38A 3S0CA 2E77A 3LBMA 4XZ9A 4NUWA 4O15A 4JN6A 1R2SA 2Y70A 4QNEA 3P5YA 4E2BA 2V0TA 4HNUA 4CNPA 3OG3A 1KFLA 2ZA1A 3NXFA 4JDYA 4QM1A 3TU9A 1JQVA 3PS7A 4R53A 1ZAIA 1QCWA 3QH2A 3DXIA 5AHIA 2PC4A 1IXQA 4JYDA 4PODA 2YW3A 5LKYA 4DPQA 4HT3A 4CLMA 3Q2DA 2E68A 3FLUA 3M5VA 3QPZA 1XUZA 1ME8A 1OVDA 4LVAA 2V2DA 4Z1CA 5HMSA 3CIWA 3VFLA 1L6WA 5CZ0A 1TV7A 4NNBA 5L6UA 3M5ZA 1TTJA 2A6LA 4IXHA 3KOFA 3R13A 5TBOA 1XFBA 3NQ7A 2J27A 3LI0A 3UZJA 5FF0A 2CLOA 2VFDA 4K8EA 1TYGA 3H53A 1M5WA 5HNRA 4RZ6A 2GPTA 4OBTA 3W7CA 1FUYA 3QMSA 5DY2A 3SI9A 5K2ZA 1B57A 4CCCA 2B7OA 3EWZA 1JQXA 1UBSA 2QCCA 1SO4A 3TUUA 2QJIA 2E5DA 1MO0A 4MUZA 1G4SA 3P67A 2RDWA 2WPBA 3U8GA 3NEVA 1BWKA 3I68A 4LTSA 2V5BA 1F73A 3NPUA 5D03A 4O52A 3FFSA 1OYAA 3UWZA 3W1PA 3K30A 5FF7A 1ALDA 1TB3A 1SO5A 1WBHA 2QCMA 4O54A 4RZ5A 3BW2A 4JTJA 5D32A 5GVJA 1I2NA 4LV9A 4CNNA 4YLWA 3GXNA 4E2DA 4L4LA 1H62A 1HFBA 1YLVA 1SUXA 1TPFA 2TMDA 3W7RA 4W9TA 1L2UA 3L21A 2DZPA 3W1QA 2J9XA 1H51A 1D9EA 4ADUA 4DO6A 4Q32A 1TPC1 1R2TA 3NA8A 2XN2A 1K7XA 4OGZA 1YTDA 3MYOA 4IQLA 4P2VA 4M5PA 1DJNA 4X3ZA 1AW1A 3B03A 2WNNA 4N9DA 3LI1A 3GB6A 1RVGA 3KRUA 3IVUA 4O14A 3NPVA 3H54A 3TQ0A 1XDMA 3TR2A 5T26A 3B0UX 5CKSA 1TTIA 3PUEA 1ZY9A 1RR2A 1K03A 1TMHA 1UCWA 4KWWA 1JCJA 2H90A 2KZHA 3C2FA 4UIOA 3W87A 1A5CA 1SW3A 1A5AA 4MYXA 3CHVA 1XCFA 3W1LA 4EVZA 1TJRA 3A23A 4JTLA 2YCEA 3GDTA 2FJKA 1XBVA 3G3DA 3W22A 3S1WA 3W7KA 3G1YA 3W23A 2YXGA 3PC0A 4E0CA 1W31A 3W83A 3C2VA 4H6KA 3NQVA 4LRTA 3T4CA 2CLLA 2CLHA 4Q4KA 4UTUA 3GDRA 4IMGA 1FCBA 3S1VA 2CZDA 3GKFA 1DQWA 3ANYA 4K38A 5LNWA 4QQ3A 3V1PA 1LLZA 4GXMA 1GVOA 3QMRA 4JTGA 3S1XA 3SFKA 3L9CA 3OIXA 2E5BA 3EWWA 1TTPA 1VYSX 2VXNA 4MIMA 3G1VA 3GAKA 5H2ZA 4A21A 4MKNA 4R7JA 5F4SA 1OFAA 3V75A 3MP4A 2QF7A 3MI6A 1H60A 3SZ8A 1E51A 2A6NA 4ZQNA 1AL7A 1FDJA 4AAJA 4Z1AA 3UWQA 1JCNA 4IX2A 3THAA 1YDOA 4FNSA 1C8VA 1SW0A 2C3ZA 4BR1A 3MW7A 1R46A 3BARA 1P0NA 5CPMA 3MP5A 2YSWA 2FPVA 2PURA 3HJZA 4CQ9A 1DVJA 3HIJA 1NEYA 2BSLA 1TPWA 1W5NA 2DZUA 5FESA 4DO4A 3BPWA 3L0NA 4O13A 3U2OA 4O4VA 1TPEA 3PSVA 4EWND 4FIRA 4JIQA 4RXFA 3GXTA 5FEZA 3ZWTA 1QAPA 4WUIA 5LNUA 3NGJA 3TDFA 2FLIA 1IXNA 1GVQA 1KM3A 3G8RA 2YFOA 3P81A 2ZA2A 3DGRA 3MBFA 2FFCA 1A5BA 1LOSA 1SZGA 2VEKA 1M7OA 3PAJA 2FPTA 3B05A 2GQAA 4MJZA 1WXJA 1HUVA 4FNRA 4UCGA 5K3VA 3FKKA 3IIVA 3LHVA 4IPJA 2QCNA 1K3UA 5MHBA 4O8RA 1NSJA 2E6DA 3TE9A 3P5ZA 2RDUA 2E6FA 3TMQA 1UUMA 3OA3A 2P0OA 5HULA 3BLEA 1VHNA 4UXDA 3BW4A 1VHCA 3PBWA 4BWLC 1KM5A 3DFNA 1LLWA 3NPWA 4JNMA 1GPWA 5DLCA 4LY8A 2NXIA 4O1BA 2FB2A 3EX1A 4JYEA 1H7PA 1KFBA 3G8EA 3Q58A 1ICPA 1GJPA 4XQ6A 5FI8A 1VJIA 1KTBA 3QSRA 4UTIA 4MVAA 1QMLA 3G0UA 3KXQA 1K02A 1HO4A 1JCMP 1I2QA 4FX7A 1ZALA 1J4EA 2IQTA 2GOUA 4NZJA 1IXPA 5A8GA 1WBJA 4Y9AA 2I9EA 5D02A 1ZNNA 1QNVA 1VGAA 3OBKA 1PIIA 3UZ5A 1YPFA 1TRDA 1ME7A 1NF7A 1OFRA 4MPQA 1K7EA 1L6YA 2B4GA 4GFSA 4GUFA 3SR7A 1N8FA 3G0XA 2P10A 3IV3A 3STEA 2QJGA 3TSBA 3W70A 2A7NA 1Z44A 1FWSA 1JUBA 3W85A 3GK0A 4JY8A 3DFQA 3CLMA 1B9BA 3TSMA 1ADOA 1GOXA 1OG0A 1ZAJA 3A24A 1U5JA 5G4EA 3KFTA 5G2WA 2A7PA 1P1XA 3THQA 3S5OA 4JY9A 2RHGA 4BI6A 4K36A 4UTTC 2OT1A 1TV8A 4MFDA 2A0NA 2V5LA 4JX4A 3RMJA 1S5WA 3VNDA 2NV2A 2C19A 3QC3A 4IMCA 4TU1A 4EOUA 1HG3A 2ZRWA 4O10A 4JYFA 1ICSA 2JGYA 4DQWA 5E1QA 4HNNA 3P7YA 4C1KA 3NO5A 4K6AA 2VENA 5F2MA 1LBMA 2VOMA 1JRBA 5K9CA 5K9DA 1OYCA 4MYAA 2V9DA 3BGJA 4OHQA 3C61A 3GVGA 1IGSA 2V2CA 2ATSA 3GYEA 1QOPA 4MZ8A 4A2SA 3EWBX 4PTNA 2EHHA 1GVRA 2QUTA 3SIZA 3DHDA 3LBCA 1BTMA 2AGKA 3TNOA 4LUIA 1YXCA 3PBVA 5I3GA 1KM6A 1YTKA 2VFHA 2VFFA 2G5WA 3M1ZA 4JIPA 2TPSA 1NAL1 1H7NA 5D37A 3M9YA 3NPXA 3N34A 4UR8A 5H91A 4FXSA 3L67A 3UWYA 2Y7EA 1KV8A 1GT8A 5I3HA 4FXRA 2RFGA 2YZRA 4N9EA 3UWUA 2JKPA 3GDKA 1W56A 1MSSA 4HNVA 3P61A 3LCIA 4KFOA 2GVJA 4DBDA 3NM3A 3O1NA 1M6JA 3E02A 4UFJA 3L5LA 3NQCA 3HPZA 3LHZA 4M7TA 3L65A 4UTTA 5I3JA 2EAWA 5U4NA 5AOUA 2QDGA 1ZAHA 2GQ9A 3S5NA 1EA0A 4NJIA 3GZ3A 1VPXA 1RQBA 5G2IA 4AHQA 3TW6A 1JCXA 1LBFA 2Y62A 4O50A 5U7SA 3TX9A 2QAFA 2Q8ZA 1MEHA 1FXPA 3W88A 5C5YA 5AC6A 4O19A 5LNSA 1HL2A 4Y90A 3W1UA 1P4CA 3DFOA 1GZGA 1RD5A 1TPH1 2C6QA 2YR1A 3H55A 4LV4A 4LOCA 1MXSA 1PV8A 3FYOA 3P60A 3G3MA 4FX8A 2ZTKA 2OX1A 4RXGA 2ZZ6A 2CWNA 3G1HA 3W74A 2CW6A 4AHOA 3IEBA 3WJXA 1UB3A 2QCHA 3N2XA 3SGZA 3P82A 1KM0A 1EX5A 2VC6A 3O15A 1XL9A 1JCLA 5G4WA 3C56A 1I2PA 4JTFA 2A5HA 1FCUA 5L9FA 3LTSA 4PC8A 4ZZ9A 2PE4A 4CQAA 1TPB1 1LCOA 1OX4B 2NUXA 3L5MA 2QCDB 4ZVJA 4RZ4A 1SR9A 4MZ1A 3TSDA 4RK8A 4KKXA 1P0KA 3IGUA 3R2GA 1TPDA 2J6XA 1TIMA 2QEZA 4ZMGA 4U4MA 1H7RA 1VS1A 3RNDA 5K4XA 1XBZA 2V82A 3PG9A 5F4XA 1YTEA 3INPA 4A2RA 1YDNA 3F1QA 5SWUA 4Z1BA 2YFNA 2Z6IA 3STCA 3NYZA 2DZSA 3MJYA 2Y63A 2XFWA 2QUUA 3UPBA 4QISA 4LT9A 1KM4A 1FX6A 1PE1A 3LB0A 4LVBA 4ZQMA 4BI5A 1XBYA 2R94A 1ZFJA 1G6CA 4DO5A 3W2LA 2I1OA 4M6VA 2V30A 2ZBTA 2J88A 2F7FA 3HGRA 3QPYA 4UTMA 1W54A 5HUOA 1C29A 4TX9A 3KVKA 1X1OA 2NUYA 1IIGA 1TO3A 3GLCA 5I3FA 1DL3A 1JCYA 4NJJA 4OWGA 3W7OA 4I7WA 2CZEA 3C3NA 3W7QA 1W3IA 3N2MA 4RCXA 2GJLA 1LORA 3NG3A 4UFIA 1I45A 1T99A 1LRTA 5HWNA 3LLDA 3NM1A 3W7HA 3HB9A 4JTEA 3G0SA 5DBTA 4N9BA 4UC5A 3I6RA 5EA9A 1RZMA 1OYBA 4CNOA 1F5ZA 2VEIA 5LHFA 4M6PA 4JD4A 5FEPA 4LC6A 5F1VA 3TFCA 1QOQA 1ME9A 3M47A 1F6KA 4HSOA 1KM1A 3O8AA 1KBJA 4LNYA 5CSSA 1TJPA 4JTSA 1BKSA 3W2UA 2QR6A 3CPRA 2GVLA 5C6MA 2CLMA 1GTHA 3IRDA 3F4WA 2A85A 3YPIA 4NJGA 3O05A 1SO6A 1P5BA 2O7SA 1GTEA 4OV4A 4XTDA 4FNQA 3CEUA 5FEWA 2QCFA 4O12A 3CC1A 3NQ6A 3TXVA 5AFDA 4FEZA 1QPNA 1OFPA 3AO0A 4Z08A 3G22A 3LLFA 3FIGA 3QEZA 4MOZA 2E1DA 4I7UA 3UY7A 1SSGA 1L9WA 3UNDA 2Y7DA 3L0KA 5DXYA 5EYWA 1TSIA 3TV8A 3U6WA 5DELA 4NNAA 5HWJA 3TC6A 5KTLA 1DJQA 3C2EA 3M6YA 4QJ1A 3PB0A 3LOTA 3E49A 2BWGA 3VE9A 3PWAA 4POCA 2JBMA 3OVQA 1I8JA 2G96A 2J24A 4XKYB 5EY5A 1ML1A 3W2KA 2G97A 3GR7A 4Q33A 3TQVA 4WQ6A 2OZ0A 3FEMA 1GYLA 3IVSA 4GWEA 3B0VC 4FNUA 2QJHA 1G4TA 3KVMA 4FX6M 2AAMA 1EUAA 3CTLA 4CQ8A 3HF3A 4R34A 3STGA 3W2JA 4GE8A 4YCPA 2B7NA 2P1FA 2X1SA 1JULA 1GQNA 3LHWA 3W7JA 3WJSA 4RX0A 1K7FA 5KZEA 1VLWA 4KFNA 1W5PA 3G1DA 2FIQA 2VKZG 3NQEA 1SZEA 3PULA 4PEKA 2ZRYA 2YPIA 4XBSA 2PRMA 2UV8G 2Z6JA 3LCGA 1AMKA 4ADSA 3EKLA 3W1MA 3STFA 2ZRVA 3LRLA 1LM1A 1FWNA 3GAYA 4JS3A 5I3KA 2PRHA 4CCDA 1F74A 4QAIA 3SY5A 3G1XA 4YCOA 3DKJA 2TSYA 4D2JA 1WAUA 3M16A 4LVGA 1NFBA 5HJLA 4GUHA 1MEWA 3W9ZA 4OV9A 3GKAA 2A1YA 3QRHA 2EKCA 3LTPA 4UMCA 1SZNA 2G95A 5CG7A 1AW2A 1VYPX 2VELA 1O5KA 3W86A 1KBIA 5D2TA 3L68A 3KHJA 4YL2A 3LCLA 3WK1A 3GX9A 3S6DA 1FDZA 5LNVA 1IIHA 2ZRUA 1Z41A 2B7QA 2ZZ3A 4NJHA 2AQWA 5BNKA 3MI2A 3N19B 2GVGA 4DF0A 1G69A 1WOAA 3T7VA 4WZHA 3O07A 3JR2A 1M7PA 3W75A 3W72A 1W3TA 4GNJA 1O94A 3RLVA 5HQEA 4WJEA 5CZSA 1A5SA 1OK6A 2Y88A 3HGOA 5K7JA 1TQJA 4GC4A 3HQ1A 3NOEA 4MLJA 5LSMA 1KTNA 1VLIA 3NZRA 3TAOA 1VCGA 3VE7A 1S5TA 1GYNA 4FNTA 2A4AA 3LRKA 4GJ1A 1FY6A 1EPXA 1EWEA 3IIPA 3NL5A 3S1UA 1WDWA 3ZFHA 3HGJA 4HPXA 4LVFA 2VFGA 1EUNA 3W1AA 4AF0A 2ABAA 5D04C 5HR7A 2LLEA 8TIMA 2WNZA 1D3GA 1H61A 3NAVA 4ZQRA 4ADTA 3HG5A 4EF9A 5DY3A 4AWTA 2WJZA 4ZQOA 5KINA 1WQ5A 4OQVA 4HHPA 1ZJIA 3C4UA 1XBXA 4NT0A 1G7UA 3BG3A 3DZ1A 5D38A 5AN7A 3S5YA 4I9AA 5I3IA 1K8YA 1OF8A 3BLIA 2GUUA 2BXVA 3O6CA 1FQ0A 1LOQA 3A9IA 3N14A 3W1XA 3WJWA 2CZ5A 2VFEA 1QDSA 1MEIA 1Z42A 2ZRZA 4K7YA 3GXPA 2Z1BA 2Q3RA 1W37A 3O06A 3DENA 1W5MA 2W0UA 2RDTA 4LU0A 3S5ZA 1QPOA 3M5YA 1VCFA 1OX4A 1FWWA 2QCDA 3PSWA 4IGHA 2DZTA 2Y85A 5E0KA 3FA5A 3LV5A 1DQXA 3N9SA 1G7VA 1V5XA 3HG4A 3R8RA 5F4WA 2ZTJA 1UJPA 1GG1A 1DORA 3C52A 4ZQPA 3QQ1A 2WSQA 4KWVA 3KX6A 4YMZA 1N7KA 1D3HA 1RV8A 4DF2A 3Q37A 3W73A 3RU6A 5CZTA 3B06A 5D2WA 3ABQA 4MLRA 3M7WA 3SW6A 3MHUA 5J5RA 3GNDA 4IMEA 5FF3A 3UXDA 3GDLA 5BW6A 4MY9A 2Y7GA 1KFEA 2H8ZA 1KA9F 3LGEA 2X1RA 3LCHA 4O16A 4NZFA 1UUOA 2PCQA 3W84A 2OJPA 4M7SA 3PVFA 2WKJA 1G4PA 4DF1A 2B7PA 5D09A 4M19A 3LCFA 2YYTA 2GQ8A 1W0MA 4LC8A 4JR5A 5AC7A 5BOOA 4MZYA 1H7OA 4Y6GA 4Z0SA 5D2YA 3I7RA 4G1KA 4M6QA 2Y61A 1WV2A 4BWLA 1O5XA 3A5FA 1ICQA 3G1SA 4BI7A 5DN1A 4AB4A 3LERA 4RKAA 1AW5A 4O53A 5C2XA 4UUIA 4IOTA 2ZRXA 3C0JA 4RLIA 5ABTA 1THFD 1O4UA 1J5TA 2DZWA 3PY2A 1LOLA 4K37A 5EPDA 1Q6LA 1LZOA 2BTMA 2TRSA 5AB3A 4WX2A 1X7FA 3NL6A 5KMYA 3RFAA 3MWAA 1GVFA 3HGSA 2OT0A 2NXGA 4NX5A 4HPJA 1Z48A 1F6PA 3EWUA 4B5NA 1F2JA 5LGZA 4XTIA 5K4ZA 1GVSA 2O7QA 2HSAA 3EXSA 4LRSA 2A2IA 3LHYA 1OFBA 4DELA 2Q8LA 1QR7A 4JTUA 2NV1A 3DKLA 3DFPA 5HUPA 1EP3A 2Z0IA 4S2CA 4NQ1A 5FEXA 3I7QA 1PVNA 1UASA 2R91A 4A22A 1S3HA 1SQ7A 4Z1DA 3N3MA 5KZDA 3QMTA 1HTIA 1EB3A 3RLUA 4H3DA 1SPQA 4BF9A 4AVFA 3EX3A 2XN1A 3BVJA 4O1CA 4IJBA 3HG2A 1OFDA 3KRZA 5AHEA 3LHUA 3MMTA 5D30A 5AHFA 2ZZ2A 5HINA 1CW2A 3MHGA 2RKXA 3EEGA 3R89A 4N4PA 1PS9A 2DJXA 3IIOA 5F2GA 2WO5A 2NLIA 1F76A 3F4NA 4DPPA 1J2WA 3EB2A 4N2YA 4AWUA 1W3NA 2JKAA 3P8IA 1A50A 1G4EA 2CLIA 4AXKA 3HO8A 3A5VA 1K8XA 3O6DA 4OE7A 4XKYA 1EP2A 3OVRA 2JGQA 4GUGA 4AHPA 3R12A 1RQHA 1JJKA 1OHLA 4EIVA 3F03K 3PUOA 4CCEA 4UTWC 2Q3OA 4GBUA 4O18A 3DI1A 4WXZA 3SECA 1H7WA 5BMWA 3UXAA 5C55A 1FWTA 2C14A 4WXYA 2CLKA 1B3OA 2TYSA 3SSJA 2NWSA 1LDCA 4ORIA 1KLZA 4N4QA 3DFTA 3CEPA 5AHLA 1Q6OA 3MI3A 3GDMA 3SJ3A
chains in the Genus database with same CATH superfamily
3MMDA 3KP1A 2QKFA 1Q6EA 1NOFA 3RGTA 1GNXA 3O6YX 4X2RA 4F0HA 1ZBWA 3GC4A 3EAUA 2RJGA 4FS9A 3PFMA 4Q8NA 1PX3A 4K8HA 1S2WA 4QROA 2GGGA 2J62A 3PF3A 2BP1A 2FPYA 2Z00A 1TIWA 4GI6A 4CGTA 4GO9A 3TA6A 3TW7A 1FWAC 3A4AA 4PMXA 2W63A 3LSBA 3QF0A 2ZUWA 3VIJA 1Q45A 3QYQA 4JHOA 4PL2A 2MUCA 1LRNA 4HB7A 3ARTA 1R3QA 2C71A 1K4GA 3TJLA 1IEWA 4CU8A 2HCVA 3CWHA 3P8JA 1XFCA 4MDPA 4DAIA 5LZLA 1S5VA 3AUJA 3FJLA 1PX4A 3V5OA 3VKDA 3OEXA 5EMLA 2PDWA 3AZTA 3RK8A 1EQPA 2R1NA 5BZAA 5DBUA 2XZ9A 3LQGA 1K9FA 2PS2A 4WDXA 2ONEA 2VT0A 3MPGA 1SJAA 4H7ZA 4Y96A 1CPUA 3AOFA 2DIJA 2FMOA 4P7QA 1OJXA 1O1ZA 1KW1A 4NZ1A 1FXQA 3T9PA 1UP2A 1AL8A 3PBYA 3SRKA 4EXAA 2CZFA 2ISVA 4RDZA 2DORA 3NQFA 3EX4A 1SU5A 2VGFA 3WNNA 1KCLA 3RHGA 4ZO9A 5IDZA 3SDOA 4IIFA 3WBYA 2WVTA 3VXGA 3N17A 1J0KA 2EGZA 3TIMA 1HZYA 4NXSA 1J8VA 3HPAA 1W5OA 1XCWA 2D73A 2X2GA 5D4YA 4PUMA 2AGTA 1C93A 3AMCA 3A13A 4GI9A 5E9XA 3BMXA 3MQTA 4DJFA 2Z25A 1BGGA 2F6XA 2NXHA 2R8WA 3L4XA 2RH9A 1MWOA 1H63A 3ZSSA 3SAZA 3UBPC 2FVLA 2VP8A 3W4RA 4Z17A 3BLDA 3TXZA 1BXCA 4JZ5A 4FMVA 2CLFA 1D7KA 2GVEA 1KTCA 3WIJA 2G3NA 2P0IA 2Z28A 1QO2A 4U2YA 4M56A 4ICNA 3OQEA 4FIQA 3R58A 2V5KA 4KIEA 2IPWA 1KBLA 3OP2A 1V6VA 3FJNA 4INFA 1DOSA 5RUBA 3RPTA 3GR4A 4Q8TA 4GI4A 4XVEA 1OX6A 3PNUA 3TOPA 4HK7A 1E6XM 1JEZA 3G18A 1FWEC 2HNEA 4GI8A 1QNRA 1W1A1 1RQEA 2I5GA 3M0KA 1B3XA 2PLMA 4WDWA 4Y8FA 5CQ1A 4C1LA 3MSYA 3HMJG 3PUDA 3UD6A 3J7HA 4A8NA 1PL9A 1V6TA 2ZVRA 1GW9A 1XI3A 1EWDA 3T0BA 1RK5A 2XSAA 3LRMA 2WM0A 3A3WA 5M17A 4LXFA 1K8ZA 3THDA 2XINA 5HNNA 1KFCA 1EHAA 3WF4A 2WBGA 3L66A 4OBRA 4NSBA 3PWIA 1OIFA 2EPNA 4RDWA 3CAKA 2OB3A 3H2CA 3HPSA 4REQA 5CGTA 1KXHA 3O9NA 4L5ZA 2WXDM 5GNXA 3IS4A 1ISXA 2G0WA 4LGXA 4GH3A 3BJTA 4GXWA 8XIAA 1DE6A 4XWUA 3TYAA 2CZVA 4H8UA 1HJUA 2WC7A 3RLGA 3HQPA 1LBLA 3V3WA 2DZVA 2I14A 1DJYA 3CWOX 5CLWA 2A3HA 4XO7A 4MSSA 4J28A 1GJWA 2QUMA 3KVLA 1W1PA 1OC7A 3KOWA 1EC8A 1OEPA 3SGUA 2IS7A 2XH4A 1JYNA 4E6MA 1VIWA 3QW4B 2ZZ5A 1VPQA 3E2SA 3EDEA 3GO2A 1LUCA 3DC0A 3KCJA 4FO4A 4LCQA 4ZR8A 3T0TA 2DZAA 1IE7C 1J11A 4EF8A 4HVXA 3QQ0A 5CBBA 5HR6A 4JX5A 4HCLA 3UJ2A 4UMBA 3KTXA 4B4FA 3CTTA 3CAQA 3SB0A 4NVTA 4FI4A 2WHKA 1QU4A 3ZT6A 1M41A 3GSMA 3II1A 2OGJA 1XYAA 5A95A 4F2BA 4ORMA 3E38A 3UCCA 3TTEA 3EXTA 4WR3A 3CH0A 3W1NA 3IUDA 4AG0A 4ML9A 1PHWA 1ZJAA 1KGWA 2IKHA 2HVNA 3CWNA 1CXIA 2PUZA 3FY1A 2JK2A 5E9AA 3WDQA 1T8XA 2X0YA 3WDJA 1X6UA 1JZ4A 4UZSA 3NEHA 3JZUA 4LWWA 3GH7A 2J13A 4QIUA 1FP9A 1OX5A 4MM1A 2RDXA 4LS0A 2XPKA 4M3PA 5T8GA 2XGIA 4XZIA 2FFIA 1VCVA 3SUTA 1JXKA 3L7RA 4HZ6A 3LZ3A 2ZZ7A 3VABA 4N42A 4PCPA 2C16A 3AIVA 3CM4A 3IJ8A 4AD1A 3NVTA 4HNTA 1W8SA 5G1YA 3KS6A 2IUZA 6TAAA 4U28A 4J40A 2H3DA 4JFVA 3PPGA 2I16A 3N4FA 4Z1YA 4L4MA 1XRFA 4N6FA 2QNEA 1RPXA 3IUHA 4L9ZA 5LGXA 3ARPA 4MWAA 4D8ZA 1JVNA 1DJWA 5F1UA 1MZHA 4D6IA 4EP8C 3H2NA 2YL8A 2YA2A 1X1ZA 5I0DA 4GUJA 1PHQA 3DHFA 3TJXA 4B9ZA 1XD0A 2PRLA 2OOFA 3BAKA 1U22A 3NUKA 4WY0A 4BS0A 4IMDA 1PKMA 5HWMA 3P84A 1J0IA 1F7BA 1ZBVA 2E5CA 3AJ7A 2OYMA 1TWZA 5CH9A 9XIAA 3QY6A 4RJEA 4LYRA 1WKEA 2MANA 2YBTA 3NQAA 1A53A 3MV01 1TR9A 3LNPA 2FTPA 1QK0A 1JPIA 1ITUA 3G77A 5D05A 4F79A 1UP3A 5FAJA 3H12A 3BOLA 1WUEA 2YB4A 1MQPA 1TPUA 4Z0JA 1GGOA 1Q8AA 3IIZA 3E0IA 2OR2A 1P1MA 3DIPA 2QDDA 1TREA 3QZEA 1T5AA 4P61A 1VFLA 4MB3A 1D8WA 1VAHA 4GY0A 2A3CA 3T78A 3VM7A 3KEHA 4KGJA 3S6OA 3CT2A 5A2BA 3KAOA 4CUCA 2GVYA 3PANA 1A5MC 3W71A 4XG1A 4DWSD 2E0PA 5DXXA 5FOOA 1J96A 1PBGA 3S9ZA 4UTLA 1E9LA 3SY1A 1PIFA 2H8XA 4GZEA 1A3WA 3T0AA 4OZOA 3S4TA 3NL2A 4D6GA 3RM4A 2P8BA 2YGYA 5CZJA 3K8KA 1XC6A 3BG9A 3N15A 4FHAA 3VFCA 3SUSA 2EJ1A 4P5UA 4AD2A 1FHDA 1CNVA 3FKRA 1TE1A 3LXAA 3T40A 4MF4A 3LHTA 1C7SA 1WOBA 4MNMA 1FP8A 1XIJA 3USBA 4A3UA 3ATZA 3VPLA 3VIPA 1BQGA 3THCA 2PFHA 1REQA 1W3HA 3GG8A 1OADA 1LP6A 2QGYA 3EDKA 4NJKA 5IM51 2IXUA 3CU2A 3C6CA 4LS2A 4LW7A 4JX6A 1PWMA 1B4KA 2O9PA 3S0CA 2E77A 5FJOA 4QNEA 4J27A 3LD5A 4C6CA 3OG3A 1J0JA 3WD2A 3TU9A 4S3JA 3PS7A 4C6NA 2DGAA 3DGBA 1W9PA 2PC4A 4PODA 3S2JA 5LKYA 4Y9PA 4DPQA 3CHDA 4LH8A 3Q2DA 4IGNA 3QPEA 3PZVA 4IPPA 3HJEA 5HMSA 4URIA 1UC4A 2OWCA 5G1MA 5HDRA 4D1JA 3CV7A 3P0XA 4NNBA 1GOIA 4IXHA 1KCZA 5TBOA 1EYWA 3NQ7A 2PDNA 2J7HA 1EJRC 1VEOA 1P0BA 1TYGA 4RZ6A 3N04A 3CPGA 4OBTA 3AMLA 3W7CA 1FUYA 2XM2A 3NSMA 5DY2A 3SI9A 3WNOA 4LUYA 2B7OA 5GJNA 3EWZA 1JQXA 1UBSA 1SO4A 7REQB 2E5DA 3FEQA 1XRSA 2Z2BA 3SCVA 2UY2A 3ITXA 2WPBA 3NEVA 3WX7A 4ERIA 2WK2A 5D03A 3A4XA 3D46A 2O56A 2OSWA 3UWZA 2R82A 3W1PA 5JVLA 2HK0A 1ALDA 1W8GA 1YQ2A 5MKGA 1ADSA 1WBHA 2QCMA 4O54A 4RZ5A 3GXNA 3L4WA 2W62A 5BU9A 1V7AA 4WSKA 3CXOA 3WH6A 1CZ1A 3WQOA 3L21A 3Q45A 3W1QA 3KLKA 4XD6A 4ML4A 1ZBKA 2C1IA 2P3ZA 3ARUA 3NA8A 4QRNA 2WZIA 3ITOA 4OGZA 3QC0A 5LIUX 4AZCA 4LCRA 4DZIA 1UWAA 1PZ1A 4X3ZA 4N9DA 3ENLA 4QLJA 1TZ9A 3WFLA 2ZXAA 3H54A 5LIYX 2OKOA 1CLXA 3STPA 3TR2A 3WLLA 2A3BA 5CKSA 4R7OA 1TTIA 1TA3B 1ZY9A 4KRTA 2BY1A 3AU2A 3VKCA 4MJ4A 2OO0A 1FHLA 1UCWA 2AMXA 1DXFA 2H90A 2KZHA 3WLIA 4BZYA 1UWRA 3CHVA 4EVZA 3TA9A 1KC7A 4LJ3A 4S3KA 4C7DA 3PC0A 4F66A 3QV9A 3C2VA 2CLHA 4Q4KA 5CC3A 4JCLA 3GKFA 2OWWA 5JH2A 3BMWA 3C0SA 4QQ3A 5CBIA 2Z26A 3T4WA 3I4EA 3S1XA 4NY2A 3L9CA 1OC5A 2E5BA 4EX4A 1GUVA 1UUQA 1GQKA 3GAKA 5H2ZA 4AEEA 3GZAA 5F4SA 4I9MA 3V75A 3ZSTA 3MP4A 2QF7A 2ON3A 1JZ3A 3SZ8A 4KEMA 2P5NA 3BAIA 3JVAA 1AL7A 1QW9A 4Z1AA 3ARZA 1IR1A 1V6XA 2AL2B 1YDOA 1SMDA 1C8VA 2OLSA 1U30A 1P6CA 4LEQA 4F2UA 3OGSA 2WMHA 5M2FX 2FPVA 2X7WA 2E67A 3H2AA 3HIJA 4KH2A 2BSLA 1HP4A 1TPWA 1UR3M 4RDVA 3CUZA 4QE5A 1VFTA 2DZUA 1MW3A 3L0NA 2Y4SA 3FSTA 4GKTA 4O4VA 2I17A 2E1WA 3UZXA 4L80A 1XLLA 1C90A 5FEZA 2X7VA 4TUFA 3NIYA 3NGJA 2YOCA 5I7GA 2ZA2A 1QBBA 4WDUA 1A5BA 4A3HA 1SZGA 4NZCA 2VEKA 3MMWA 1FWDC 1M7OA 4QS5A 3L12A 2DSKA 2HISA 3B05A 2GQAA 3W82A 2PDGA 3ARXA 4IPJA 4X9YA 3IJ6A 3TE9A 2E6FA 3TMQA 4ACZB 2P0OA 3B3DA 1VHNA 2JQXA 3SGGA 1Q65A 4Y9NA 4EPEC 5HBFA 4LAZA 5CC6A 4K68A 3PBWA 4UB9A 3MUY1 1I9CB 2X41A 1JAEA 4KW2A 1LLWA 3KL3A 1HIZA 1GPWA 1Q13A 2Y1HA 3TJIA 3G8EA 2BY2A 1GJPA 5FI8A 2FZ9A 3AC0A 1UKTA 4JL2A 4MVAA 3D6NA 1QMLA 5E0FA 1JCMP 2VDIA 4BY3A 4NZJA 4US6A 4E4PA 1WBJA 4Y9AA 3GTHA 1ZNNA 1YPFA 4UR9A 1OFRA 4WCJA 3VIFA 4JHMA 4YHEA 3BAYA 5H8PA 3G0XA 3IV3A 3STEA 2QJGA 1Z44A 1JUBA 4J3XA 3B9NA 3EB3A 1B9BA 1ADOA 2GSHA 1ZAJA 4QDPA 3TWAA 3A24A 4IP7A 5G2WA 2A7PA 1EF2A 3R8GA 2BOFX 4JY9A 4FAMA 4UQBA 4MFDA 1TV8A 3PZIA 1KB3A 1L6FA 2A0NA 4JX4A 4DLFA 3LN3A 1QW8A 1WXYA 2UY3A 5E6ZA 4IMCA 3V7PA 1HG3A 2ZRWA 4JYFA 2VO5A 3LPOA 2V3GA 4DQWA 1ZS2A 1V3IA 4S3EA 4C1KA 4GO8A 4EXQA 2VENA 5F2MA 3AMKA 2VOMA 3B40A 2WAGA 1OYCA 3TQPA 5D9NA 3C61A 2BVWA 1YPXA 3GYEA 4MZ8A 5EGRA 5LIKX 2DVTA 1RHCA 4ZENA 2EHHA 3AS2A 2QUTA 4D6JA 1YHTA 2AGKA 2PDJA 2ZWYA 4G7FA 4GZ7A 3N2OA 1H7NA 3M9YA 3N34A 2BXYA 1T40A 5H91A 2EPKX 2WJEA 3SCNA 3CQIA 1TG7A 5DRCA 2Y7EA 4NAEB 4UOJA 3FK4A 4MAVA 2TAAA 5I3HA 1AMYA 2XFRA 1BXBA 2RFGA 4N9EA 3GDKA 1W56A 3SQLA 3W37A 1MSSA 3UGVA 3P61A 2OO6A 4UFJA 2EAWA 5U4NA 2P3EA 1TE6A 2R24A 1HVXA 3WDIA 3GZ3A 1JDDA 3TW6A 1XWYA 3W88A 1TJ2A 4I5RA 1BYBA 1GVIA 2VX5A 3DFOA 1DXEA 2C6QA 1BLIA 3FYOA 4H9XA 2ZTKA 4B15A 4RXGA 3VILA 4AHOA 4AD3A 3IUIA 1KM0A 4TTUA 1EX5A 3E0FA 1UWUA 2KX9A 1Q7ZA 3C56A 3U3HA 3KBNA 1E72M 1I2PA 3BSHA 2OZTA 4TV5A 2CXEA 5L9FA 2BY3A 4XZMX 5B7YA 2Z1VA 1JNEA 5HNUA 3ITGA 2PE4A 3L5MA 2QCDB 1XQKA 4AY7A 4KKXA 1P0KA 3UFYA 1TPDA 2V3DA 2ZVIA 4U4MA 3RNDA 1RLDA 3PG9A 4B3ZA 4WF7A 1YTEA 1MUCA 4GQRA 3OGVA 1QUMA 1E0VA 4Z1BA 3OTRA 2YFNA 5I07A 1MQQA 2O0TA 3OHMB 5B80A 3UPBA 3CASA 1DJXA 1VBGA 1E9IA 2H9AB 3GE7A 4LQ1A 1FX6A 1PE1A 4BI5A 4EAMA 2VGGA 2PGEA 3A4JA 2NW0A 3W2LA 4M6VA 2ZBTA 2J88A 4UTMA 4HYWA 1ZP3A 3PP7A 1YE6A 4YU1A 3KVKA 4C6OA 3GLCA 2QDEA 5CSYA 3WLPA 4XAPA 4XIAA 5I3FA 4GGHA 4O8AA 3B9OA 1N82A 5AZ1A 1V8EA 4HOXA 3W25A 4I7WA 5BYWA 3C3NA 1W3IA 1LORA 3KLLA 5HWNA 2I5QA 3TW9A 3NM1A 3W7HA 3I3EA 4NRRA 3G0SA 1RZMA 1OYBA 4H2HA 3VOFA 4JEJA 4M6PA 3AZSA 2BDQA 2DIKA 4M81A 1QOQA 4J7RA 3F4CA 1ME9A 1E40A 1EC9A 3M47A 4HSOA 5HNTA 3GTFA 2J7BA 1IYXA 4JTSA 2CNCA 4NG3A 1K77A 1QBAA 3W2UA 3CPRA 1KRMA 5EMYA 4ZSTA 3ZJKA 3T05A 3MV11 3MCOA 3YPIA 2YCLB 4NJGA 4OFCA 3BAXA 4Q3MA 1SO6A 2XSXA 4OV4A 1UQYA 4JNZA 4FNQA 4IL0A 3CEUA 3WSUA 3NQ6A 3TXVA 4H01A 3ZXWA 1VD6A 1BGAA 2XJ7A 3G22A 3FIGA 1BYAA 3QEZA 2E1DA 4NL1A 1EH9A 5I78A 5D8WA 4F0KA 3TV8A 2J7EA 3TLQA 5KTLA 3FW6A 3UU0A 4BJHA 3LOTA 2OG9A 4RDYA 2BWGA 3MJMA 3VE9A 4I5XA 4LF2A 4LAOA 4AISA 2G96A 1I6NA 2BHYA 1ML1A 4Q33A 1J0HA 3EMZA 3FEMA 4IMAA 1GYLA 4GWEA 3TTOA 4K1WA 5JH1A 4FX6M 1EUAA 1A5UA 3RUBL 3STGA 4GE8A 2X1SA 5FJRA 3K46A 3SRDA 4RX0A 2J8FA 3VIHA 1XX1A 3A64A 4KFNA 1W5PA 3HFYA 1SZEA 3VGHA 3B97A 3POHA 4AZHA 3B8WA 3LQLA 2ZRYA 1XLMA 2PRMA 3GTNA 3A9BA 3ITCA 2Q71A 3MKKA 4FSAA 1MUMA 3F7JA 1AMKA 1E6NA 4HP5A 2FZNA 4LUSA 5CSUA 2DVUA 2EPOA 3LRLA 1Q63A 1FWNA 3WH7A 2PRHA 4CCDA 3N9KA 4YCOA 1DWGM 4GJIA 2UZ9A 4D2JA 1WAUA 5HJLA 4GUHA 1MEWA 3CNYA 3KBWA 3LU2A 3LTPA 3M07A 1I0BA 1ZJHA 1E3XA 1SZNA 1G1YA 1VYPX 3C0QA 1KBIA 1W3JA 4DJDA 1HJQA 3DG7A 4M1BA 3WK1A 2L5HA 3VD3A 1CGUA 1FDZA 2XVKA 3CJPA 2YL9A 3WLKX 4MHBA 1XS2A 2ZRUA 1Z41A 1XGZA 1NJJA 2ZZ3A 4AIEA 1ONEA 5BNKA 4H6RA 4FLSA 3BLLA 1QXLA 3N19B 3VDHA 7XIMA 1G69A 3JR2A 1M7PA 3ARQA 5FIPA 1X98A 3AIWA 1F3XA 5HQEA 1A5SA 2BS9A 3HQ1A 1UD5A 3GFZA 2GZXA 4JCMA 3VE7A 1S5TA 1ECEA 4B5XA 4FNTA 2A4AA 4UOZA 1QNSA 3IIPA 3NL5A 3MVIA 1WDWA 1W9VA 1EUNA 2GDUA 4C1NA 3EOOA 5JXQA 4MWAD 2WNZA 1D3GA 4Q8WA 2V63A 1VFUA 4XUYA 5DY3A 5KINA 1WQ5A 2W66A 4OQVA 1US0A 5M03A 4MNKA 1G7UA 4E5TA 4ZSUA 5D38A 5AN7A 3R7MA 3IJQA 4I9AA 5I3IA 2XIJA 4H9ZA 5FACA 1LOQA 3OB8A 1JYWA 3W1XA 1BYCA 1UZDA 1E6QM 2WM1A 4GIEA 3GXPA 4HTBA 4HMDA 1QI2A 3O06A 4AD0A 1FOBA 4NZ5A 1S39A 3M5YA 1XLJA 4IGHA 3RAOA 3FA5A 3CH9A 1DQXA 1YNPA 5HPCA 3HG4A 6XIAA 5LXEA 1DORA 2WSQA 3VNMA 3WYZA 1BWVA 1N7KA 1D3HA 4XKMA 4L6DA 3FVMA 3RX4A 3UXDA 1LL4A 2VJXA 5BW6A 4YVPA 2DUXA 2PDMA 1KA9F 4DNMA 3E2RA 3UESA 4D71A 3W84A 2OJPA 1G4PA 3F5KA 1C8QA 3QTGA 1I1WA 3F2BA 4O0QA 4M19A 1W0MA 1XISA 5AC7A 5BOOA 1GEHA 3I7RA 2Y61A 3VGGA 1O5XA 1EF3A 1ICQA 3G1SA 3K2GA 1MRQA 4AB4A 3BV7A 3CQJA 3HFTA 3ZJ8A 2WSKA 2PWUA 1UWTA 5IHSA 1THFD 3KTCA 5LIWX 4IPNB 1A5NC 3QBUA 4PUWA 4JQ4A 2G3FA 2BTMA 3CUIA 5AB3A 1NU5A 3NL6A 4G1NA 2OT0A 4HPJA 1Z48A 4DUVA 1F6PA 1RJQA 4ROPA 4XTIA 1P48A 3CL7A 4AZGA 3NZGA 4C6PA 4DELA 2PC8A 2NV1A 3DKLA 5A6KA 1LL6A 3U7VA 1ITXA 4V2XA 4S2CA 5FEXA 2PDBA 2R91A 4AIBA 4QG6A 2DSUA 5KZDA 4DX3A 1AD1A 1EB3A 3S2NA 3HPFA 3F2CA 4S38A 1T8QA 3BLOA 4IFOA 1EL3A 2ZZ2A 3OA5A 2RKXA 5CJMA 4DZHA 2DJXA 2DSZA 6ENLA 2HVMA 1GQLA 2NLIA 4U5KA 3UJSA 3F4NA 1J2WA 3P8IA 4FLQA 1ZBCA 1G4EA 4AXKA 4PRTA 1ONWA 3HO8A 4OE7A 2RJHA 3OVRA 1JDCA 2JGQA 3R12A 1JJKA 1ISYA 2G37A 1YBQB 1ENUA 3T8QA 3B0XA 1FH7A 4A4AA 3C5QA 1P0DA 3S5SA 4PFHA 1BF6A 3UXAA 1W1YA 3DUGA 4WXYA 1V08A 3QN3A 2WMIA 1LDCA 1QT1A 3TZFA 3MI3A 1K70A 3MSDA 1AQMA 3BURA 2Z24A 4L7ZA 2QCLA 4NX0A 4PUJA 5LHEA 2G50A 2DQWA 4GUIA 4B90A 2V5JA 1TJ1A 2BXZA 4GYKA 3CUGA 3KTSA 2OXNA 4FP1A 4XBJA 2GGEA 2ALRA 2XZ7A 3B4UA 3JS3A 2HNHA 3HG3A 3LG3A 3NQ8A 1TV5A 3WLNA 4OIFA 2VRKA 4GISA 1H1YA 4A8RA 5C9XA 2O92A 1AJ0A 2PGRA 4NILA 4PBGA 1UP0A 4YWIA 4H6EA 2WJFA 1VH7A 3FYPA 1KGUA 4HZ8A 2X42A 3IGXA 2CETA 4UFMA 5BMXA 3UCQA 4JFUA 4JPGA 3CB8A 4DZ5A 4DJFC 2ZQ0A 1ECQA 3PWGA 4E4FA 2JF7A 3SCRA 4K7VA 4N6EA 3DC8A 5DX7A 6REQB 1MDRA 3H2EA 4OTKA 1AZ2A 2WMFA 3ZT7A 4PB5A 2OZ3A 3E0WA 1DWFM 3HU7A 2Y5JA 2ZWZA 3WN6A 4H9MA 2GJXA 4L6OA 1B4EA 1EOKA 4BK9A 4O1AA 1W2PA 2R14A 2UY5A 3GIYA 3NZPA 1B54A 3BJSA 1DHPA 1C8YA 2QXWA 1QHPA 2CESA 3BZJA 3QW3A 3DU0A 4QS6A 1A80A 1Z89A 2QCGA 3WQ4A 2PDQA 2C13A 1YPIA 5DCDA 2ABBA 2QDHA 3DH7A 1R85A 3WLHA 1QTWA 2F6KA 5J5DA 3KL5A 5A2CA 4PL1A 3PG8A 4QCEA 4W8AA 3WMCA 3T81A 1WZMA 3VZYA 3LTYA 2R1KA 2V6AA 1R47A 4IUGA 1KFJA 1JZ5A 1D3CA 3QGKC 1NARA 3TROA 5EMMA 5AHNA 4MKSA 2ZUUA 3E96A 4X61A 3NGFA 2ATMA 1WYIA 2J6VA 2G4FA 4B3LA 4AWSA 2OPJA 1CX9A 2WVVA 1UKPA 5AYZA 1YADA 3ALFA 3BAJA 4WK9A 3SJNA 3PTMA 5TQLA 1VYRA 1PDYA 3BQ6A 4JTTA 1HKIA 4MY1A 5JIWA 4ONVA 3GIQA 1ESWA 2EPHA 3S2MA 2B0MA 2V68A 3GC2A 3VCRA 3W7GA 3GHRA 2PDFA 3QOKA 3GNRA 5AHMA 2C1HA 1IWBA 2E9MA 3SUUA 1CGVA 5A8OA 4O0ZA 3TQKA 3VDAA 3POCA 3G2GA 3W6YA 3AYSA 2E09A 2PTXA 3BICA 1QATA 5EBUA 4IPLA 3GG7A 4K1GA 1O95A 2WZTA 1GWJA 1TPVA 1V3JA 2DH2A 1W3KA 4H7CA 2ZADA 4R3UA 3A47A 3VNYA 2PDHA 3PFRA 2YLAA 3QFEA 4YTUA 4HU0A 1XH1A 3ABOA 3S8HA 2QZRA 1LF1A 2FDSA 3NQGA 5AYXA 3KHDA 1XSIA 3NOYA 3VZZA 2IKJA 2WVSA 4HN4A 1FH9A 3Q4DA 3N4AA 4GCXA 1YXYA 3M7SA 1E4NA 3NQBA 2V5DA 3SEPA 3L4VA 1DEDA 1H5YA 3GU2A 3MT1A 3MTWA 1SJBA 1Q5MA 3HPXA 5A8NA 3QSTA 4ZL1A 3RRAA 3LX9A 4L9YA 2ISSA 3I10A 1JRCA 5LXXA 4S2BA 4J9JA 1YNQA 4N9CA 1WKDA 1ZSXA 4QSHA 1XHGA 3CZJA 3Q65A 2GJNA 1UD3A 4LAUA 4LBRA 1OZQA 1JUEA 1YRRA 3H23A 2A21A 2ADAA 5H6HA 4YVVA 4LYKA 3PTQA 2VQUA 4XZNX 3VX1A 5C0QA 3W7IA 4S3AA 6A3HA 1Y0EA 3RF9A 3UY8A 3I7SA 1XM3A 1YDYA 1VZWA 2PODA 4JICA 4ATLA 3R4IA 2W92A 4J5NA 4LAMA 1TQXA 3MZ2A 2VCBA 4F9JA 2YDAA 4DXXA 3MCNA 2X8RA 2J75A 4XV0A 4JTIA 3VGBA 1EPVA 1DWHM 4HU3A 3AJXA 3ATYA 3GNNA 4I5UA 2ZE3A 1CI1A 3W1RA 1TX2A 3H70A 3WJYA 4BFAA 1C9DA 2XUCA 3EMCA 1L0PA 4L61A 3WK0A 5FKYA 1AQHA 2HZGA 4XIMA 2I56A 1A5OC 5DT5A 2DH3A 5A8PA 1FKWA 2CU0A 3IJIA 3ONCA 1N55A 4MWAC 2Z2UA 1OZMA 3WUFA 2BZNA 3W7EA 4IMFA 2JF6A 1GOQA 1UR1A 2WC3A 5EBAA 3TN3A 3H6OA 3FDGA 4UR7A 1XICA 5CJ5A 3NQDA 3PM6A 1B30A 3WMLA 4BQ3A 4W5ZA 3T44A 1S38A 4HHHA 1AH4A 3OYXA 3NL3A 1NY1A 3SCWA 5IBXA 2EF9A 1FCQA 4YN5A 2GL5A 1Q2SA 4CQCA 4DRSA 1IT7A 2QUVA 3OZPA 1TRIA 3RPDA 4GCAA 3R43A 3SRHA 4QE1A 3H4GA 3UP8A 3MO7A 2VZUA 1B3YA 1XIGA 3G1RA 3N73A 4XO6A 3ZVHA 1UPMB 3P74A 2WLZA 1PCWA 1OGGA 2EQDA 2WSRA 1A3HA 3QFWA 1I2OA 2X2YA 3IVTA 1NFPA 2WJDA 2PBOA 4DI9A 1VR6A 3SQSA 1VFMA 4GHRA 1GQIA 4BQ5A 5C54A 2ZCGA 1AQ0A 4JGDA 2BV9A 3RITA 5IOBA 3WK3A 3N9RA 2CFFA 1OINA 2BOGX 1PWLA 3SCUA 3MB9A 5FF4A 2QW5A 2QF8A 5JBDA 2O55A 2YCLA 4EE9A 2R1PA 1Y65A 2OEKA 3OZMA 2P76A 3AYTA 4JBRA 3BLFA 3EEZA 4IP5A 4KFPA 3HM7A 1F9CA 4U3CA 2OCZA 5XIMA 3M41A 1WDRA 2CHRA 3WZ0E 3WO8A 4C6FA 1GJUA 3OBAA 4DEFA 5F2IA 1BWLA 1OCBA 5FA5A 4US5A 1Q7MA 1R9YA 3S46A 3RIKA 3DI0A 4UOQA 3UEQA 2V2HA 1FHUA 3VCCA 1R7AA 4RE2A 5E70A 4Q7IA 1KM2A 3GU9A 3TMLA 2WSPA 3GHTA 5MF5A 3TCSA 2NUWA 3LUTA 4HK6A 4RV8A 2XU2A 1EOMA 3IJ7A 4ALDA 1NP2A 3NQ2A 2NWRA 3NR0A 4DBEA 5IFPA 2GJPA 2I9UA 1JPMA 3W81A 1CXKA 3TONA 4GYPC 1VRXA 1AJZA 4CEUC 4IUOA 5I02A 1JZ8A 4RE3A 3QHNA 1QNOA 3TN4A 4YYFA 1J79A 1YEYA 4C7GA 4GZJA 1K9TA 5FL0A 4PZVA 1PTAA 4AMAA 1JUKA 4O17A 1WE5A 4FB7A 3MUXA 3T09A 4F2TA 3EPMA 1F3TA 3QZ6A 3E9AA 2H3BA 4KCUA 4CQDA 1NDVA 4UFHA 3G1AA 1E0TA 4NZ3A 3W2MA 1IXOA 1FH8A 1K4HA 4QNWA 3TYEA 1JI2A 1WCGA 3LV6A 2J78A 1DP0A 4HK5A 3WH8A 5A5WA 3B04A 3VDGA 2A7RA 1GKRA 2YX0A 3APGA 3PZMA 3WBEA 2DUZA 4NUWA 1L6GA 4JN6A 1W91A 2Y70A 2PP0A 1L2QA 4HNUA 4CNPA 3E2VA 2OEMA 1KFLA 2ZA1A 3EDDA 1JQVA 2VZOA 1ZAIA 1QCWA 3PTKA 3QH2A 3DXIA 1UOKA 3DHPA 4HT3A 1NOUA 4CLMA 3FLUA 3M5VA 2VR5A 3QPZA 1XUZA 2FGLA 1ME8A 4LVAA 2ZXDA 3WF1A 3OLGA 3VFLA 1E0WA 3HN3A 1TTJA 2A6LA 3W6LA 3KOFA 1CGWA 3QV6A 4Y8EA 4HNCA 3GVWA 3UZJA 5FF0A 2CLOA 2VFDA 3BQ5A 1M5WA 1W1VA 4QEEA 4U33A 1OCNA 3KDNA 2FZ8A 2INFA 1IT8A 4PSRA 1CECA 4EPKA 3R11A 4IM4A 2QJIA 3ZM8A 3NZQA 1QOXA 3P67A 3U8GA 2V5BA 1F73A 3NPUA 4ZB5A 4PB4A 2NVAA 1OYAA 4G7EA 5I77A 2QLYA 3REQA 1WDDA 3W6MA 1W17A 5D32A 5GVJA 2J47A 4MKVA 2Y8KA 3TYDA 4L4LA 3HQOA 3VIOA 4DJDD 1H62A 1HFBA 3KE0A 1GK8A 2TMDA 1KO0A 2DZPA 2EBNA 4F0MA 2ANUA 1BAGA 1D9EA 4ADUA 4DO6A 4Q32A 1A3XA 3EGJA 3WBAA 3MYOA 4IIBA 1E4MM 1EX1A 4M5PA 3AROA 2Z2AA 1AW1A 1XYFA 1PKNA 3RYSA 4IIGA 1WUFA 2ACRA 3AS0A 2NQLA 3TQ0A 1CB2A 3E0LA 3PBGA 1R3TA 4QQUA 1X7IA 4YPJA 3B0UX 3EBVA 3PPCA 2ICSA 4ZO8A 1RCXB 1R86A 3CQHA 5BOEA 1TV4A 5C7HA 1K03A 1KR1A 1TMHA 4DB7A 4AQLA 1JCJA 5H8MA 5AC5A 1I75A 1XCFA 4DJEA 1TJRA 4JTLA 1ISVA 1QVBA 4IIHA 3G3DA 4XD4A 1RJRA 1KNWA 3ORWA 3VVGA 3W7KA 3W23A 2R1MA 4PMZA 4UBPC 4AC1X 4KT2A 1W31A 3W83A 3U57A 3CBWA 2D20A 3NQVA 4LRTA 3T4CA 4F48A 4UTUA 4L4PA 2HQAA 3S1GA 2CZDA 5LNWA 3V1PA 1LLZA 4GXMA 3G6MA 3WF3A 4QLKA 3NDYA 4QAWA 1E56A 3EWWA 2D23A 3FAXA 4IJCA 2VXNA 1X6NA 1M03A 1TWSA 5ABFB 4R7JA 3JU2A 1XIIA 5A8MA 1E1CA 1OFAA 4D8AA 2FZBA 2D0HA 2PEVA 3MI6A 3A6OA 5A94A 1E15A 1E51A 4AYSA 5JMUA 1K8CA 3UWQA 4IX2A 1VF8A 2FYMA 3LMYA 1FWJC 2BNJA 1L8NA 1JG9A 3WQEA 2C3ZA 4BR1A 4L4OA 4F0LA 3MW7A 1SMAA 1FWFC 1Y7VA 3LGDA 1W5NA 4DWSB 4PRWA 4RNHA 2DT2A 1KQZA 4LAKA 2ESCA 5FESA 2CXGA 4DO4A 3WL1A 3U2OA 1JPHA 3PSVA 2JIWA 4M1RA 3GXTA 1FWGC 1B9ZA 3TDFA 4ZO7A 2UBPC 1IXNA 1KM3A 2D2JA 3G8RA 3M0HA 1A5KC 2J79A 2Y5SA 4R85A 5BXTA 3V1HA 2RUSA 4BF7A 4GVHA 4PUKA 2XH2A 3RO8A 4A3RA 4HA4A 4GH1A 3MC5A 2YA0A 2QCNA 4XISA 3P5ZA 1UUMA 1B0IA 3AXHA 3H2OA 2GGJA 2UY4A 1VHCA 2Q09A 1KM5A 3QY7A 4QJ3B 2Z27A 4JNMA 5DLCA 3CS2A 3EX1A 4JYEA 2XDFA 3Q58A 3UYIA 2BVDA 1MFVA 4G9PA 1VJIA 1D8CA 1U5HA 4B2DA 4IG2A 5EMKA 2E8ZA 3DYMA 1HO4A 2IQ0A 4FX7A 3SBFA 1ZALA 3CAVA 4LF1A 1N2VA 1PXGA 5A6LA 2IQTA 2GOUA 4CEXC 3WD0A 1TZZA 4M82A 2EEXA 5A8GA 2I9EA 5ECVA 4WKHA 2D22A 1FWHC 3C2YA 3KDOA 3OBKA 4YTTA 3GRIA 2EG7A 2CWXA 3AUOA 1K7EA 1HX0A 1VKFA 1XGDA 2B4GA 2CKRA 5IHRA 1N8FA 1V0KA 2P10A 1MW1A 3V0TA 2P50A 3AQUA 2A7NA 1FWSA 3VX0A 3W85A 4JY8A 3CLMA 1RD6A 3TSMA 4D1IA 3M0LA 5M3WA 1U5JA 1F8MA 1XQLA 5G4EA 2CCRA 4JOMA 3B8TA 1R0MA 4K36A 1XYZA 3QKEA 1WKFA 3TP4A 4IIEA 1EKOA 2C19A 2E4TA 4F0RA 1A4LA 1VJSA 3WQ8A 5GPRA 4TU1A 1YMYA 4O10A 5DEZA 1F6YA 4CD7A 3P7YA 1H1NA 3RO6A 4K6AA 1PZ2A 4B5SA 1LBMA 3OO2A 4MYAA 4UQAA 2OYLA 2V9DA 3ZOAA 3BGJA 4OHQA 1IGSA 2V2CA 1A5LC 2ATSA 3W29A 2P8CA 1DHKA 3KOXA 3EWBX 2EPMX 4HMEA 1AH0A 2J7DA 3TNOA 4LUIA 1YXCA 2V69A 2XGBA 2WC4A 2FZDA 4ZO6A 1C7TA 3PZNA 1XYLA 2GSJA 3PK7A 5HA7A 4JIPA 4KCWA 1B2YA 1AVAA 1NAL1 5D37A 3R0KA 4UR8A 3RJYA 3L67A 3UWYA 4M51A 1KV8A 1QWKA 1GT8A 3FJ4A 2YZRA 1OC6A 3AHZA 1Z6KA 3M0XA 2PWVA 4DYEA 1VJZA 3NM3A 4H00A 3T0CA 1M01A 3CYVA 4UTTA 4PMRA 5AOUA 2QDGA 2GQ9A 1B3ZA 2DW7A 1R38A 3S5NA 4B5UA 3IJ9A 2C8NA 3VCNA 1RQBA 3AZRA 3PJWA 1JCXA 1LBFA 4QTGA 3QVQA 1MEHA 3GXIA 5A2AA 5AC6A 3N6HA 3GBEA 5LNSA 1P4CA 4LOCA 2YR1A 5A3HA 5D9OA 4FX8A 1E1EA 1QPKA 2ZZ6A 1ZCCA 4WDTA 1RXOB 3QTPA 1XYCA 5CC5A 1H11A 4PMVA 3WJXA 1U2YA 3AICA 3CPUA 1JCLA 2WANA 2OZ8A 2O4MA 4UQEA 2A5HA 4Q8PA 2WNWA 3BUVA 3BC9A 2IKGA 3WNMA 4PYSA 2HXUA 3SUVA 2NVCA 1LCOA 4FLRA 4XAYA 1SR9A 2B81A 1BRLA 3TSDA 4RK8A 3R2GA 3DYOA 3ZLFA 1TIMA 2QEZA 4KCVA 4E4UA 1XBZA 2E3ZA 3KW3A 4KRZA 2HRWA 1EHNA 1M7XA 3VM5A 3U9IA 2Z6IA 4GKLA 3STCA 2Y63A 2XFWA 3UR5A 2QUUA 1E6RA 2YXOA 3OQ8A 3LB0A 2R94A 2OELA 1MZRA 1YKWA 3QPYA 1X6LA 2PF0A 1S2TA 1KR0A 2DPEA 1V93A 4AZIA 4QGCA 4TX9A 1S1RA 1X1OA 2FTWA 2NUYA 2D3NA 1TO3A 5FJTA 2WZMA 1DL3A 1JCYA 3TJ4A 2ACSA 4NJJA 4OWGA 2FDMA 2CZEA 3N2MA 4UFIA 4DXKA 3WBXA 2XSBA 3LLDA 3WBWA 3HB9A 2RGMA 2J25A 4UC5A 1EBGA 5F1VA 3W01A 4I8DA 1KGXA 1QNPA 3N6JA 2PTYA 1KM1A 2WHJA 2HV5A 3S83A 5HXMA 3F4DA 3B0YA 1PYMA 4AU0A 3S6TA 4TX6A 4RE0A 4JIRA 3F4WA 2A85A 4WGXA 4DYJA 1XGEA 2PWFA 3O05A 3V35A 1GTEA 4G2DA 4XTDA 3WUBA 4ZXOA 1JF5A 5HANA 4FEZA 1NFGA 3AO0A 4Z08A 4OUEA 5JIPA 4V1XA 5GNZA 5M1TA 5DXYA 1TSIA 2JEPA 1PSCA 4NNAA 5IDIA 5HWJA 5HMDA 3TC6A 1DJQA 4E8GA 3GVQA 2PDKA 4H8HA 3WLSA 3PUGA 2PGFA 3WUGA 1V3KA 3PWAA 3VOHA 4POCA 5GJMA 3QR0A 3EA2A 1DJHA 2J77A 2HBVA 3ZJ6A 3DYPA 9CGTA 4XKYB 3W2KA 1UJQA 3GR7A 3TQVA 2OZ0A 3IVSA 1MXDA 4LPCA 1G4TA 2BFGA 1B1YA 4JQ2A 4CVWA 3URAA 4YCPA 2Z7KA 3NSNA 2G41A 1T41A 4W7WA 4QR6A 3WD3A 3G1DA 3WLJA 2FIQA 2VKZG 3NQEA 3MMUA 3PULA 1P43A 1XH0A 5AC4A 3W38A 2BODX 3LLXA 1UR0A 4PTXA 1X97A 4PTDA 4ADSA 3SN1A 2ACQA 3FGCA 3EDFA 3W1MA 1J10A 4JS3A 5I3KA 4QAIA 3SY5A 1Z32X 4HZMA 3DKJA 1PTGA 3E1F1 1CBGA 4NAFA 4E8DA 3W9ZA 3DDMA 1TZ7A 3D3AA 3GXMA 2G95A 5CG7A 4QJ4B 5C8BB 4PE8A 5D2TA 3KHJA 1CYGA 1G9HA 3LCLA 1DTUA 1F61A 5JUVA 1HGYA 1IIHA 3GNOA 4RUBA 3ID7A 2B7QA 4GGBA 4NJHA 2F2HA 4KF1A 1W9XA 4BKNA 4L1WA 3E6EA 2DQXA 3LBOA 2GVGA 4DF0A 3T7VA 3T6CA 1OD8A 4H8NA 1H4PA 4WVXA 3O07A 3W75A 1W3TA 3SCPA 5I06A 4WSJA 4GNJA 1YW1A 5ECUA 3HGOA 3TOYA 1M68A 3ARVA 9RUBA 4GC4A 3AI0A 1CGYA 5LSMA 1R3RA 5XINA 4Q6XA 3NZRA 1VCGA 1GYNA 3QLLA 4GVFA 4D72A 4GJ1A 1FY6A 4RW5A 1OBAA 5DF0A 4HPXA 4C6DA 4LVFA 2VFGA 3W1AA 3OZYA 2ABAA 3VINA 4C65A 5D04C 1E0UA 2LLEA 4ZQRA 4G6CA 4Y7EA 4ZQOA 1R9ZA 2RGLA 4JKMA 3C4UA 4NT0A 3BG3A 3CV1A 5DO8A 1M9HA 2BOEX 2CHNA 5C2GA 1R3VA 1E9YB 3BLIA 1UMLA 1UWSA 1FQ0A 1KXVA 3N14A 2VFEA 1AA1B 4WGHA 2C7FA 1JZ6A 2Q3RA 1W37A 3AHTA 3DENA 4MB5A 4JAWA 4H19A 4PBEA 1OX4A 3FVDA 2Y85A 5E0KA 3KP0A 1CB7B 1G7VA 2DZBA 3R8RA 4GY7A 2XISA 2ZTJA 1UJPA 1GG1A 1E1FA 4KWVA 3KX6A 2AOSA 5CEWA 2NV9A 1GVYA 3TN5A 3NYDA 5CZTA 3B06A 3PZOA 3ABQA 3OGRA 1NTHA 4D6CA 3CO8A 4I9TA 4MMWA 4US5D 4MY9A 1KFEA 3LGEA 5GJPA 4NZFA 3MWCA 3PVFA 3N6QA 4E2OA 4FXJA 2BVTA 3PTDA 2ZXQA 4TOQA 4KMQA 4BHYA 3GY1A 3LCFA 1WNOA 2YYTA 4IGMA 2VGIA 3U48A 4LC8A 1AJ2A 3TN6A 3ANUA 4G1KA 2NQ9A 4M6QA 3FX4A 1J6PA 1WV2A 3FV9A 2YJQA 2GJRA 4DY1A 4BI7A 3BXWA 4GZIA 3ZR5A 1Y5VA 4JTCA 3LERA 4RKAA 1W9BM 2POZA 1NWSA 1OT2A 1Q4WA 3QY8A 1TX0A 2NSOA 3CK5A 2ZRXA 3C0JA 3FYYA 4RLIA 5ABTA 1O4UA 3PY2A 1LOLA 2BMBA 4K37A 1TMLA 3IJDA 1LZOA 2WB5A 2TRSA 1CEOA 3ABXA 4PMNA 3GG1A 3HGSA 4NX5A 3U5YA 4G8TA 2PP3A 5LGZA 5K4ZA 1EZ2A 1OSEA 1Q2RA 2O7QA 1SR0A 3LHYA 1OFBA 4YNGA 3DFPA 5HUPA 2PSNA 2Z0IA 3H4WA 4W7VA 1PVNA 5C7VA 1S3HA 3U2ZA 1SQ7A 3P6LA 3EWDA 3HV8A 3RLUA 5FSDC 5HK4A 3ZLGA 2VX6A 4LYQA 2XN1A 2R1LA 3BVJA 4IJBA 3HG2A 1ZRQA 3KRZA 4PGLA 3LHUA 1LUCB 5D30A 5AHFA 4JQ3A 5HINA 1CW2A 1FWBC 1QRQA 3EEGA 4AFYA 2XIQA 2WW5A 5F2GA 4WRHA 2WO5A 4GABA 4JKKA 1F76A 3UJFA 4GNVA 3KWSA 1W3NA 2JKAA 3WH5A 2F38A 1MUWA 4GXPA 4FPSA 3ITVA 4W8LA 4QSFA 3W24A 3O6DA 1FVPA 5KZ6A 3SN0A 1RY8A 3I3DA 1A49A 1OHLA 4EIVA 2GQ3A 2PF8A 1E71M 4XZBA 3KCOA 4CU6A 3NCOA 3LS9A 3NO3A 2C14A 1UKQA 1JD9A 1B3OA 4D8LA 2TYSA 4I6VA 3SSJA 4ORIA 1KLZA 3GHSA 4MAZA 1DQUA 1Q6OA 2WCGA 2F2KA 4JN7A 5CJNA 1KQYA 3CT7A 4XBKA 2OKTA 3PZ9A 3PBUA 1XLGA 1ONRA 1V3MA 3GM8A 3UG8A 2J9YA 2VX4A 3MDWA 2CERA 1XPYA 3PAOA 1BEUA 3IGSA 3VD7A 3T2QA 2PDYA 2XWDA 4MDOA 1IGWA 4OOUA 3PR2A 2VYOA 4C7FA 5ABFA 1CGXA 2YCIX 1HL8A 3M43A 4YIWA 3L4ZA 3R94A 2NX1A 1BTCA 4NXKA 4P7OA 1TVNA 3PB2A 5FJUA 1KCXA 1NWRA 3ZR4A 4X9SA 1G94A 3DAQA 3WK2A 7CGTA 2OODA 3UA4A 3PJXA 1Y5WA 4J3ZA 2X30A 1DKWA 2ZDSA 4IJRA 3R25A 2ZC8A 1QPQA 3TK7A 3B8IA 4MNJA 4JIEA 3H7VA 4PMYA 5FSEC 1JFHA 1VBUA 4AH7A 3UQNA 4UTHA 1NM9A 4GPNA 4HSNA 3CQ0A 4MWAB 4TO8A 3CZKA 1JR1A 2DZXA 3VU2A 2QVHA 3VD4A 3AHXA 2QCEA 1EIBA 2A3LA 3R1ZA 4DJED 4IL2A 1PEZA 5CG0A 3T07A 4WSHA 3VOGA 4O28A 3RM8A 1CXFA 4WY0B 1PB0A 5F2LA 1ZHAA 1UOZA 1R5YA 4U31A 3EX2A 4RNJA 3VZXA 4C90A 1UR2A 3TKFA 5D2XA 3RDKA 3WKZA 1ADDA 3O7UA 3H24A 4O0KA 1HO1A 4W8BA 4UNKA 1E4LA 2C0HA 4YWSA 1XIMA 4U10A 1EGMA 5EL1A 2W67A 2OVLA 2D2GA 2WHLA 1PCKA 3W07A 1ZUAX 1US3A 1MQRA 4FXFA 4CD8A 3QYSA 1UR9A 2V8ZA 1Q6QA 2GUBA 1YX1A 5A8QA 1QWGA 3B8DA 7ODCA 1DBTA 3R0DA 2REQA 1J9YA 3LY0A 3V36A 3ARSA 4JQ1A 2DP3A 4FOKA 4TMBA 1OABA 2FQIA 3TYCA 1HKMA 4NYYA 5G2HA 4IFKA 1BF2A 4UNLA 3H7RA 3DFSA 4Q4RA 4IIDA 4OECA 3M0VA 4TIMA 1XSKA 2PDUA 5AC8A 2JE8A 1S2CA 4MWAE 1H7XA 1RP8A 4R7WA 3L4UA 3NDOA 2V81A 2Y89A 3LYEA 4XZHA 3KRSA 1R2RA 1Z9AA 1QHOA 5GNYA 3L2IA 4GNKB 4JHZA 1IR2A 5D33A 1VBHA 2VZVA 3AYRA 2IPJA 3EKGA 3IAQA 1IEQA 1QNQA 1S5MA 4ZQCA 4MY8A 3MYPA 5E09A 1E4IA 4ICMA 3FS2A 4NRSA 1V0NA 1XYMA 2Z4GA 3MS8A 3SIMA 4W5UA 4WY0F 1OCJA 3ITLA 4MUPA 3HBLA 1J2BA 1HJVA 4QEHA 4FNPA 1QPRA 1LROA 2ZUSA 1REQB 4QBXA 3RN6A 5DCEA 4B9YA 1EFZA 4HPGA 3ES8A 1N8IA 2BHZA 3BDKA 4DM2A 5LNRA 5AYYA 2X1UA 3U2EA 2E9BA 3WELA 3VUPA 4B2DD 1LQ2A 1EGVA 1XRTA 4UQ9A 1WX0A 3W2NA 1OY0A 3LA4A 2NQJA 3CYJA 2JEQA 5G5IA 4X22A 7TIMA 3OVGA 3ABZA 2Y7FA 1UD2A 1UH2A 4UFLA 1WZAA 3P62A 7A3HA 1RA0A 1NQ6A 3A3XA 4S1FA 3MP3A 1VPYA 4OU1A 5IBXC 4FR1A 3WF0A 2HS6A 1SFJA 2ISDA 3A3HA 1RCOB 2ZFAA 1JYVA 3KBJA 3W1TA 1Q7QA 2XTKA 3LPPA 3JRKA 3AHVA 3GNXA 5IFTA 3LK6A 2VEMA 5A6JA 5A6AA 3G24A 4PMDA 3D0CA 4D6FA 5HQLA 2RAGA 4WOZA 1MXGA 1HF6A 4PCTA 7TAAA 2NX3A 3BZGA 1XG4A 3SFWA 4W93A 4PA8A 1KXTA 4Z2IA 5CSRA 3AXKA 1XV8A 1R7OA 2DT1A 1RH9A 4PMJA 3KS5A 3F2DA 1XXXA 2QGHA 3LDVA 3VI2A 4EKJA 1RBOB 3WUEA 4GBDA 2DU2A 1XSJA 3AIBA 3WQDA 3WLRA 1V0LA 3B9AA 2V5CA 4TR9A 1WA3A 1CCWB 1R8LA 1JL8A 1O60A 3BAWA 3OVPA 2J7CA 1L6SA 3C2OA 2J7FA 3T1GA 1UMYA 4AZCB 1QI0A 3GXFA 4IGSA 3S3GA 1MNSA 3MA8A 4ZBCA 1JI1A 2ZZ1A 3JW7A 4HN8A 3EPOA 2XN0A 2PDLA 3GBDA 3T55A 1XDLA 1SO3A 2W5FA 4AW7A 4JDBA 3LM7A 3TC7A 3CV2A 3I65A 2HWGA 2ALDA 2C18A 4YTQA 4OT7A 3EWXA 4DWDA 4I7VA 4OUIA 1Q6RA 4RL3A 3HZ3A 2C0AA 4AEOA 3QM3A 5CPOA 3KWXA 1OFEA 3QZAA 1C9WA 3O63A 3TZNA 3LM3A 3MANA 2PDCA 3LSCA 4M6UA 4GQGA 6XIMA 1H1ZA 3ZMRA 3SCQA 4JFWA 4HKPA 4PCSA 3IIXA 2Y6ZA 3W7MA 4PH6A 1HT6A 4AUBA 1KXQA 3EKZA 1H50A 1DJZA 4EAYA 3CIXA 4W87A 4IXXA 2OLHA 2VFIA 3K8MA 5BCAA 4O57A 5CGQA 2DV0A 2O9RA 3K5XA 2POTA 1S3TC 2DVXA 5K9XA 3LCWA 1X8FA 4DHGA 4PFMA 1LRQA 3MHFA 2X1TA 3BGGA 1XJBA 4HYVA 3TCEA 3TH6A 8A3HA 3K4AA 5EMUA 5FAGA 3W7NA 5KITA 1XLEA 4C6EA 3FHAA 2W79A 1HW6A 1LWJA 2ZX9A 2OYKA 1TWIA 4MJMA 2QMJA 3GQYA 4Z2KA 1VC4A 4Q8VA 3TLLA 3FOKA 3CZEA 4LS1A 1MVYA 5BRBA 2WNQA 1G0CA 3VOCA 3BTNA 4Q8QA 1VFSA 4PTWA 2HVOA 2V3FA 3W3OA 3VTRA 5REQB 3URQA 2PDIA 1F4AA 1QFEA 1RBLA 1SZFA 1VRDA 5EFDA 3HV9A 4GFIA 4GMEA 4GQQA 5ABHA 4HNLA 2OX4A 3COTA 5GQBA 4IX0A 3VMOA 3MUCA 4AF0B 2ZDRA 1CXEA 3R5EA 4GYFA 3N25A 4R33A 4E2VA 2JIEA 1FBAA 1XKYA 3GXDA 2W9MA 4HTYA 2WQPA 1GEQA 4M80A 1YXDA 2OMAA 3TAKA 3ABSA 1LTDA 2J66A 1RLCL 2PI6A 1XC4A 1F3WA 4DWSC 4CKQA 3UJEA 2ZC1A 3FJ6A 3WLMA 1EBHA 1GQJA 3EDJA 3AU6A 4NU7A 3VNKA 4IICA 4XK2A 3N3TA 3KVJA 4MJ2A 1JF6A 4EACA 2XM1A 1ONXA 5LA0A 1EEPA 1YYAA 1B3WA 4IWWA 3RCNA 4RNIA 4C6IA 2JFEX 3EB4A 3NDZA 1NVMA 1QJWA 5DMMA 3AFBA 5CPQA 2W3ZA 1W9UA 1ZENA 1KLYA 2HTMA 2WKGA 4AZ6A 1NQKA 2HMCA 3G1FA 3PZGA 1GCYA 3LBMA 1J12A 3K4DA 1X96A 2X0SA 3WQGA 4O15A 3CHEA 3P5YA 3R6IA 1PJ9A 2FVKA 3TYZA 3T2PA 5AHIA 4JYDA 2YW3A 3VIKA 4HCDA 1OVDA 4Z1CA 2V2DA 3RU8X 1YIXA 3CIWA 3VNIA 4PBFA 1S2VA 5CZ0A 4HJFA 1BD0A 3M5ZA 1JGMA 3R13A 4WJ8A 2J27A 1LL7A 2QULA 4HA3A 3TNBA 1EJUC 3V0SA 4Q4OA 1CWYA 3VGEA 2VC7A 5HNRA 2XH0A 4LEFA 5I3DA 3M6DA 3WD1A 4Q8OA 3H7UA 3QMSA 5K2ZA 1PKYA 1B57A 4CCCA 2D1ZA 5AVNA 4MUZA 4Q8MA 1G4SA 3IAPA 1NH6A 1UWIA 2Y8VA 4DJEC 4Q7NA 4O52A 3KOYA 3EA3A 3K30A 2NQHA 2HE5A 4U5IA 3VC5A 1TB3A 4JTJA 1I2NA 5J8LA 4LV9A 3BGAA 4CNNA 1V6UA 1GOKA 1XIFA 3RJXA 4E2DA 1R3YA 4ICCX 4Q6JA 1ITCA 4EPBC 1IWAA 2IMRA 1YLVA 2GK1B 3MUAA 1TPFA 4AZBA 5BXPA 3W7RA 1L2UA 2J9XA 4L64A 1LT7A 1R2TA 3B8VA 2XN2A 3UG4A 1K7XA 1MNZA 1DXIA 3VOJA 1JZ7A 3QV8A 1WZKA 2BHUA 1XKJA 4IQLA 1W3LA 1ITQA 1DJNA 2NLYA 3B03A 2WNNA 3QV7A 3WQ5A 3GB6A 1XDMA 2F6UA 4DI8A 1RR2A 1K9EA 3MZNA 1F3EA 1GKPA 3C2FA 4J35A 4UIOA 3W87A 2WCAA 1HJWA 1SW3A 1A5AA 3W1LA 1UROA 4EK7A 4QDWA 3D47A 3NVDA 1FWIC 1XBVA 3W22A 3UETA 2YXGA 2ZUNA 4M0XA 3V5FA 4ES4A 4E0CA 1P0EA 1MFUA 4H6KA 4ATWA 4ZOAA 1T6MA 4WIWA 4IMGA 5E0CA 1FCBA 3S1VA 1RCQA 2PP1A 3N18A 3ANYA 4K38A 1GKQA 1M1BA 2Z7GA 1OGBA 4HU4A 2ISFA 3M46A 3OIXA 3OIHA 1CDGA 1UKSA 2QV4A 1TTPA 1KD0A 4IQDA 4A21A 5IXEA 4MKNA 3AMGA 1FWCC 5I2UA 2QQ6A 1JGIA 3RG6A 3PJUA 3EYPA 4AAJA 1FDJA 2XIOA 3THUA 2PZ0A 3THAA 3N13A 2HK1A