4CLMA

Structure of salmonella typhi type i dehydroquinase irreversibly inhibited with a 1,3,4-trihydroxyciclohexane-1-carboxylic acid derivative
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
251
structure length
243
Chain Sequence
KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVIAVNDLRSVLMILHNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Irreversible covalent modification of type I dehydroquinase with a stable Schiff base.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Lyase
total genus 95
structure length 243
sequence length 251
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4clmA00
1XKYA 1R46A 1O4UA 2FFCA 3P62A 4JNMA 5GVJA 5BMWA 4XWUA 1EWEA 3O6YX 1SZFA 4MKNA 2E6YA 3W73A 3NPXA 4BR1A 3STCA 1X1OA 3DGRA 3O05A 3VI2A 3TAOA 5AYXA 3LXAA 5I3HA 3WK0A 5K9CA 3I7QA 1EWDA 1TPUA 2TYSA 1GZGA 1F76A 3ZWSA 2DZSA 2AAMA 2W0UA 4OE7A 2CZDA 5AHEA 1I2QA 3IGUA 4O0ZA 4HSNA 4CCEA 5LHEA 3PWAA 4B5NA 1EUNA 4FXRA 5CPLA 3GDTA 2E77A 1H7RA 3BK0A 3EEGA 4PA8A 1VCGA 1YTDA 2VELA 4JTJA 5D2WA 4HKPA 2PURA 5CZTA 4HPXA 4OV4A 3RFAA 4O0KA 1SW3A 2TSYA 2X1RA 2YGYA 2GOUA 4MIMA 1VH7A 3P5YA 1AG1O 3B05A 3EKZA 3KVJA 3LHZA 3CT7A 5E93A 1WOBA 1F6KA 3FIGA 3W7CA 2DJLA 5FF0A 3LBCA 1I2NA 1TQXA 4DO4A 1IIGA 5AHFA 3GNDA 1VHNA 4MYAA 2B7QA 2QCGA 2V9DA 2C13A 1IXPA 2KZHA 1K3UA 2CZFA 2WSYA 3NVTA 1F7BA 3DAQA 3V1PA 1JVNA 4DEFA 4JTIA 1FCVA 1U5JA 3OG3A 4X3ZA 5KINA 3Q37A 1G7VA 3MW7A 1VRDA 1UCWA 4EVZA 5F4XA 3CLMA 4JTUA 2NXIA 3TAKA 3G1VA 1ZY9A 3KRUA 4EIVA 1G6CA 3M7WA 1PL9A 2EF9A 1TTJA 3LHWA 3PG8A 2P1FA 1N55A 4RCXA 1W37A 1KFEA 1RQHA 4LV4A 4O12A 3R2GA 4HNTA 2NZLA 2YR1A 1UASA 5F1VA 2ZRWA 3USBA 1JRBA 2NXGA 1ICSA 2B7PA 3NA8A 1SO6A 3AJXA 3SSJA 3ABQA 3GIYA 4HHPA 4O10A 5KTLA 4NXSA 4BF9A 2ZTJA 3UWYA 4GBUA 4YXGA 1IF2A 4NUWA 2E1DA 3HG3A 1HO1A 1KTBA 4XUGA 5HUPA 2P0OA 2QJGA 5LHFA 1H7OA 1IXQA 3G22A 1EUAA 4UFIA 4N6FA 3W2JA 3I7RA 3TC7A 4ADSA 1TJRA 2A2IA 2E09A 1W8SA 1SUXA 4UTJA 3TQ0A 4IMDA 3QEZA 1W3NA 1CW2A 4X9SA 3F4WA 2CZEA 3TNOA 3LCFA 2FB3A 2GUUA 3F03K 4H4IA 1MEIA 1DVJA 1C9DA 5AHIA 3KOFA 2YZRA 3H55A 1SZGA 1TV7A 3EKLA 3G0XA 4A2SA 3GLCA 1WX0A 3GXTA 4FNTA 1EP3A 4RLIA 1M5WA 4JGDA 1KM2A 2VFIA 3MBFA 3BV4A 3UY7A 2QJIA 3W84A 4FF7A 3JRKA 3B03A 5F1UA 1JQXA 2OJPA 4YMZA 2W79A 2VFDA 4UFLA 2GPTA 1QWGA 3TJXA 3M0ZA 3W7MA 2BX7A 4XKYB 5EL1A 3NQAA 1HFBA 3QYQA 4XTDA 4FX7A 3LCGA 3FJLA 1OVDA 2CLEA 3HPSA 4R7JA 3SI9A 1K02A 1OFAA 1SO5A 4UTTA 3DZ1A 4E38A 5FF7A 1W5MA 3IGXA 2V30A 3O8AA 3QM3A 3RLUA 1NAL1 4A29A 1VZWA 2YW4A 5CZJA 3PVFA 4IOTA 3W71A 5LKYA 3BW2A 4HIBA 3CPRA 1ICPA 1YXYA 1JUEA 4O4WA 1QPQA 3ELFA 5CG7A 1IXOA 3STFA 3G1FA 1XI3A 4AEOA 4ML9A 2A7PA 4UFMA 2A6LA 2QUTA 4NZJA 3TUUA 2JGQA 1JR1A 5D04C 4JIQA 3MHGA 5BNKA 1KFCA 3STGA 3W1TA 1GTEA 1FCBA 1KFBA 1Q45A 2QKFA 4LRSA 3TA6A 1LYXA 5DBUA 2WNNA 5H2ZA 1F5ZA 3N3MA 5DBTA 3O6DA 4AH7A 3OVQA 4MFEA 2X1SA 2V81A 5F2IA 3THAA 5C2XA 2Z1BA 2Y7DA 4WZHA 1WOAA 2JKEA 3IIXA 1PIIA 3KHJA 3W1XA 2DZVA 4BWLC 3HPXA 3NNTA 1FQ0A 1ME9A 3VE9A 2Q3RA 3WK2A 1MO0A 3KVMA 3IVTA 2ZRUA 3ZR4A 3NQFA 4UFHA 1W54A 1AMKA 3LXCA 4S2BA 3IIVA 3INPA 4I7WA 5EY5A 5CZSA 4O57A 2ABBA 2Z2UA 3FOKA 1TV8A 1U83A 1K7XA 2CLKA 2VEIA 3HGRA 5I3KA 2ALDA 3T55A 1PCKA 1FWRA 3MI2A 1OFDA 4O14A 4DELA 1S5WA 1TTIA 4O50A 3Q94A 4O28A 2UV8G 4RKAA 3EB2A 2CFFA 4DO6A 2VFEA 1NVMA 5G4WA 1RR2A 3EWZA 3QJAA 1Y0EA 3DKJA 4I9AA 1QO5A 3G18A 3QSRA 3NPWA 2WV8A 4ORIA 8TIMA 2FDSA 3TK7A 3JS3A 3P74A 2Y7EA 3CIXA 3L66A 1QR7A 4BI6A 1LRQA 5AB3A 3Q2DA 3N34A 2YSWA 4JDYA 3IIOA 1XBXA 3WFAA 4IMGA 1JQVA 4CNOA 4LT9A 4NJGA 5HMSA 3SW6A 1JCNA 5CGQA 1XL9A 3WJSA 2NV2A 3S6DA 4IJBA 4X2RA 1GEQA 3QMTA 4AB4A 4AWUA 2DZTA 4IMEA 3I7SA 2ISWA 3LTSA 4Y9AA 5C55A 2Q8LA 3GK0A 1GVFA 2R14A 4MZYA 2WO5A 3QZEA 3R5EA 1H63A 4GC4A 3UY8A 3EWXA 3DFSA 1JUBA 3DFPA 2ZA3A 3KVLA 1QMLA 3FYPA 3T78A 2J9ZA 1GWJA 2TPSA 2QAPA 1PS9A 1JJKA 3SGZA 3O16A 5AHLA 3G0SA 1LBFA 3OA3A 3RF9A 3W23A 1KV8A 1ICQA 3QPYA 5EA9A 1LLZA 3PUEA 1FWWA 1VGAA 3HB9A 1Z41A 3GR7A 3QPZA 1XBZA 2OMAA 4JD4A 3C2FA 3W2KA 3W75A 4OWGA 3C8FA 3EWYA 1LOQA 2NX9A 5AHNA 3HGJA 5F4SA 3NG3A 5LNWA 3G24A 3M16A 3RU6A 4AWTA 3W1PA 3WJWA 3LLDA 5HINA 1ONRA 3U8GA 4MZ1A 3TSMA 2NLIA 4DF2A 4O15A 3NQEA 1GVQA 3P8JA 4NVTA 3S8HA 4LS1A 3QH2A 4FNPA 1WQ5A 4IXHA 1G69A 1JCYA 4YCOA 3MYOA 5D33A 1GVSA 3MHUA 4IPJA 1H5YA 2OT0A 3E02A 5FESA 2CLHA 1GPWA 3B4UA 2B4GA 4NJHA 4IPIA 5DLCA 2E6FA 1P0KA 4O16A 1KM1A 1JCXA 1L6YA 3NQMA 4K39A 2EKCA 5ABTA 2QF7A 1GTHA 4Z0SA 3NYZA 4Y8FA 4IWWA 4N4QA 2YFOA 4UR7A 1V5XA 5AYYA 4FNSA 3IVUA 4GRSA 3V75A 4DF0A 4GUIA 3OHIA 1UBSA 2GJNA 1W5QA 3BW4A 5CSSA 2HSAA 1SO4A 1O5XA 4LC6A 3GDKA 1OABA 2JKAA 1YADA 3B06A 3EXSA 5G1YA 4CLMA 3LGEA 1LCOA 3FKRA 2X1UA 1H60A 3NQ8A 4PEKA 2BWGA 4HNVA 3TROA 4TU1A 5A8GA 3WK3A 1GVRA 2Y63A 3NZ1A 1O95A 4ONVA 6TIMA 5G1TA 1YDVA 4N9CA 3W2LA 3IIPA 5KZDA 1ADOA 1GT8A 3NEVA 4LVAA 5LNUA 1DJNA 2FLIA 3GKAA 3P8IA 5D30A 1ALDA 1R2SA 2YYUA 4Y96A 1C8VA 1QDSA 4MFDA 2PC4A 3BLIA 2RHGA 3L2IA 4LVFA 3BGGA 4IGHA 3I6RA 1RVGA 2A4AA 4NX5A 1VPXA 2G95A 3NQGA 1WA3A 2F84A 2WSRA 5AHMA 3G1DA 4JTKA 1QPOA 1SW7A 3W1RA 4IMCA 4A2RA 3OBKA 1OJXA 1FDZA 3C6CA 3SY5A 3C2RA 4UMCA 1NF7A 2D73A 4O4VA 3GAYA 3GR8A 3P60A 3HJZA 3TMLA 4PH6A 3S5NA 3PM6A 3E49A 3LBMA 4GUFA 1W5OA 3MUXA 3S5YA 1KV5A 2VOMA 4NNAA 4QISA 4MLJA 3TXZA 3LV6A 2VKZG 4IMFA 3FKKA 4WD0A 1W31A 3IV3A 5I3JA 1EIXA 1OFRA 1KFLA 5CPNA 3FA5A 4JICA 1NFBA 4MY9A 4RXFA 4GNJA 1KTCA 3NDOA 4AXKA 4LTSA 4Z1AA 1OYBA 1WXJA 1A5CA 3FEMA 2QEZA 5D2TA 1QOQA 1GOXA 2RDUA 5DCBA 3HG5A 3TSBA 1KLYA 5HWNA 5CKSA 3QQ1A 4XZ9A 3L9CA 1H61A 2V2HA 4J9JA 4OV9A 4O52A 3S1UA 2DP3A 4Y6GA 1KBIA 3L67A 5KMYA 1YXCA 2FPTA 2ZZ7A 1YLVA 1OX5A 4DO5A 1DQXA 1OYAA 3LI1A 3MWAA 2FTPA 2VFFA 4WQ6A 1X7FA 1S3HA 4YWIA 4JYFA 4K6AA 4AMAA 1H7XA 1D3HA 3P67A 2V5LA 3LM7A 4FX6M 4JIPA 2A7RA 2CWNA 1D9EA 5FEWA 3PULA 2Y89A 4FHAA 1WBHA 4A3UA 1ZJIA 3MP4A 3M44A 3W83A 4K36A 3DFTA 3P84A 4YL2A 3HGSA 4Z0JA 2I1OA 2RH9A 5FF4A 3G1XA 3RMJA 3THQA 4CQ8A 3EX6A 3W76A 4GE8A 2WNQA 4GWEA 1TTQA 4XQ6A 4XBKA 1SU5A 4DF1A 1FCQA 1XDMA 1J5TA 1ZAHA 4BWLA 1JRCA 4UCGA 4NNCA 4ORMA 3MI6A 1TPWA 4KFPA 2VEKA 3HPZA 4HSOA 5J5DA 1H1YA 3UWWA 3DXIA 1SW0A 2Y70A 1T8XA 4RK8A 2Q8ZA 3QSTA 3NQVA 4JN6A 2ZYFA 1A5SA 2QCHA 3DENA 1FWSA 4NJIA 3TR2A 2FJKA 2YW3A 4AHQA 1FXQA 1A5BA 1TPH1 2Y7GA 3G1SA 2E68A 4BI7A 5HUOA 5H91A 2ZZ6A 4JTFA 4N9BA 1X6UA 3MYPA 4MLRA 1DORA 2QDHA 2Y85A 2QCCA 3A5VA 3BW3A 1A50A 3PSVA 1FDJA 4WX2A 5HWJA 3UYCA 4LNYA 2H6RA 3DU0A 1LRNA 3I68A 3NXFA 1TO3A 4JY9A 1I45A 1VLWA 4RZ6A 1UJPA 4UMAA 5FF3A 2X1TA 1LBLA 3DBPA 4UTKA 3G1HA 3MJYA 5TBOA 1QAPA 4JTLA 4LWWA 3SIZA 3MP5A 2ZRXA 2NUYA 3CU2A 1LORA 3P61A 1H7PA 1F05A 2Z6JA 3CTLA 4N9DA 1I4NA 2HS8A 3A21A 2E5DA 3N9SA 3WK1A 1PV8A 4NT0A 1BWLA 4DPPA 5HQEA 1FWTA 1P1XA 3KRSA 3CQ0A 2ZBTA 1EA0A 2V5BA 3EWBX 3QMRA 2E6DA 5DXYA 3SZ8A 2C1HA 5U4NA 2H8XA 3O15A 1TSIA 3EXRA 4FNUA 3RLVA 1YTKA 3CIWA 4YLWA 1KFJA 3PY2A 3G0UA 2V2CA 4ZVJA 3STEA 2H90A 4FB7A 4KFOA 2G5WA 1AK5A 2H3DA 2ZFAA 2V2DA 3BLEA 4Z1DA 1SPQA 3LDVA 5HWMA 4MOZA 5TQLA 3LLFA 2ATSA 5D03A 4JS3A 3W72A 3WJXA 3DFQA 3LOTA 4NNBA 1BEUA 3G3DA 5K9XA 2YYTA 3ZFHA 2J88A 5FI8A 3TW6A 1IXNA 1F73A 3QMSA 3DI1A 5LSMA 3QFEA 3NOEA 5K4ZA 1G67A 2WNZA 1GQNA 3W2MA 3UQNA 1DJQA 1JULA 1IGSA 1JCJA 1DL3A 4K38A 2ZZ4A 1MEWA 3M5ZA 4Z1BA 1H1ZA 5BOOA 3GDMA 2NUWA 2W6RA 1WBJA 4MY8A 3UXDA 2B0MA 2Z6IA 5D37A 2QCNA 4MY1A 1PHWA 1QO2A 2GVGA 3QF0A 2NWRA 4QJ1A 1SSDA 1OF6A 1V7YA 1SQ7A 3HGOA 5DCDA 2Y62A 5CPOA 5F2GA 4UTHA 3S9YA 4A22A 3LX9A 1HL2A 4OBTA 2VENA 3VCRA 1P4CA 3BO9A 1D3GA 1Z44A 5IM51 4MJZA 1XCFA 2VXNA 2NX1A 1MZHA 2TRSA 4EF8A 2BTMA 2NWSA 3H54A 5LNVA 3FS2A 1EB3A 3B04A 3L5MA 3W88A 4RJEA 2OZ0A 4MJMA 1QOPA 2AGKA 4RXGA 2G96A 5F4WA 3W7LA 1ZCOA 5DELA 1RZMA 1R30A 3CB8A 2XN0A 3W7OA 4ZQOA 1VQTA 4I7UA 3VKJA 1L9WA 1GYNA 1TPVA 3DHFA 4LC8A 3TSDA 5A5WA 4MPQA 3M5XA 1M7PA 3LI0A 3BPWA 3CHVA 5G2HA 1B4KA 2EHHA 4CNNA 1H7WA 4FNRA 1ZHAA 3LCLA 2EAWA 1OFEA 1J2WA 2C14A 1N8FA 1AL8A 1TTPA 1XBVA 2WSQA 1I2OA 3GVGA 3GNNA 3IEBA 3GDRA 3PUOA 2GVJA 2I14A 2CW6A 5DY2A 3W7HA 1B57A 3M41A 1OHLA 5L9FA 1H7NA 2VEMA 5U7SA 1EPXA 3IGSA 1QCWA 5E1QA 4N9EA 4ZQCA 1ZAIA 3OIXA 4Z1CA 1S5TA 2PCQA 3NO5A 1GG1A 4O8RA 4ALDA 2ABAA 3LERA 3TFCA 4ZQNA 2A5HA 4JTTA 5EBUA 2RDTA 4JXCA 4IXXA 5D05A 1GG0A 1TREA 5G4EA 3S5OA 3ABOA 3W7DA 2GQ8A 3DFNA 4KKXA 1OX6A 1PE1A 3MP3A 2OT1A 4IX0A 3UPWA 3T4CA 3UWVA 3TC6A 4I7VA 4LW7A 3TQKA 2J6XA 1K8ZA 4DPQA 2CLMA 4JR5A 1EP1A 1XM3A 1HUVA 5IBXC 3W74A 3ABSA 3B0UX 3PG9A 4ZQRA 1TPEA 3W7KA 4LS0A 3P81A 5G2IA 4LY8A 3SR7A 4Y90A 3RK8A 1BWKA 3QW4B 1ZALA 3BARA 3P82A 3GXNA 2ZDRA 4WUIA 2H3BA 1KW1A 2ISSA 4UNLA 2F7FA 5BRBA 1EP2A 3ABRA 1X8FA 3GYEA 2R8WA 2A21A 5L6UA 3UWZA 1R2RA 4AHPA 2G97A 4EF9A 3KFTA 3AO0A 3MO7A 4JDBA 1TJPA 3L65A 2QUVA 1OX4A 5F2LA 3W2NA 2QJHA 1KM6A 2ZZ1A 3GAKA 1TIMA 4UUIA 3LCWA 4W9TA 3T40A 4E2BA 1F2JA 1L6WA 4NZFA 3G1YA 2E6AA 3NQCA 1VCVA 2LLEA 3TQVA 4O13A 2I9EA 4JTHA 3TKFA 4QAIA 3PR2A 4WXYA 1O5KA 1Q6LA 1BKSA 4FO4A 4K7YA 3QC3A 5FEXA 2GVLA 3ZWTA 3YPIA 3S5ZA 3CWOX 1PVNA 2QCDA 1IIHA 2A6NA 1SO3A 5K4XA 1F74A 2EPHA 4Q32A 5AN7A 3G8RA 3R12A 3SFKA 4H6KA 3PBUA 4QIUA 3A23A 2XFWA 5KZMA 4WJEA 1VJIA 2QAFA 3LRKA 3HIJA 1NF0A 4HT3A 2NX3A 5I3GA 4M19A 1JCMP 4L4LA 3A9IA 1K8YA 1TMHA 2ZZ3A 4O11A 1UUOA 5MHBA 3LCHA 3W87A 2JKPA 4UR8A 1FX6A 3DI0A 1AW2A 1BTMA 3PSWA 5D2XA 2RFGA 1XUUA 4UTLA 2YFNA 3C2VA 4JX4A 3A5FA 3ZS4A 1R2TA 2WQPA 3G3MA 4RX0A 3L0KA 3EWUA 3BG3A 4Q4KA 1JCLA 3LTYA 3VFLA 3TH6A 1EEPA 1KTNA 4RZ4A 5EMUA 1G4TA 4CNPA 4WY0B 1LOSA 2BSLA 2ZZ2A 1H51A 1W5NA 3B0VC 3S42A 4O53A 1Z42A 1GJPA 4UTUA 3W7NA 2NXHA 4NXKA 3TXVA 1XBYA 3W7RA 2V0TA 3M5YA 2DJXA 3TJLA 3LRMA 3CC1A 3LHYA 1J4EA 4K37A 3UPBA 4UTMA 3M5VA 1W0MA 3FFSA 3N73A 5I3IA 2ZRVA 3W9ZA 2DORA 1S5VA 4CQAA 3S1WA 2V82A 1PCWA 2X16A 3NL6A 3HOJA 3NQ6A 3P80A 3UD6A 2A85A 2PRHA 1N7KA 4TMCA 3G8EA 4GJ1A 3U6WA 1KA9F 4NU7A 3NM1A 3L0GA 3M6YA 2O7QA 1W56A 5FF2A 1XDLA 4C1LA 3N9RA 1VLIA 3A22A 4JYEA 4IUOA 3VE7A 3NGJA 3N19B 3PAJA 4O1DA 3IVSA 5EYWA 1RQBA 1TB3A 2Q3OA 4D2JA 3WJYA 4WXZA 1OG0A 3W07A 1LP6A 1LRTA 3W1QA 5J5RA 2C15A 1SFJA 4O17A 3E0IA 1O94A 3EXTA 1A53A 3W7JA 3KAOA 3NR0A 4MYXA 4PC8A 3N14A 4ZMGA 4ADUA 1Q6OA 4UXDA 2QCLA 3EX3A 5G5IA 3MI3A 3B8DA 3LV5A 2WOQA 1WDWA 4LUJA 2C18A 3CEUA 3SECA 3W85A 3LRLA 2WKJA 3N2MA 3ATZA 5KSWA 1CX9A 4O19A 4AF0B 1T99A 5HULA 4FX8A 2NV1A 5D02A 2ZRZA 4AWSA 3I65A 5EPDA 1OF8A 1VCFA 3MMTA 1PHQA 4TMBA 1K7FA 2GQAA 2PRLA 1TQJA 3CM4A 5DXXA 4N02A 2J27A 5HNRA 1WV2A 1OK6A 3W7EA 3NQ7A 2AQWA 1ZFJA 4O1AA 4TIMA 4OT7A 3NPVA 5DCEA 3PUDA 2ZRYA 2Y6ZA 2YDAA 2PE4A 3D0CA 3R89A 1KBJA 2OCZA 4RV8A 3M43A 4DQWA 3W6YA 1HTIA 5SWUA 2GQ9A 3OVRA 3NM3A 4ZL1A 1A5AA 4M7SA 1YTEA 3HBLA 3MBDA 1G7UA 4NJJA 4WY0A 3TV8A 4C1KA 1XXXA 4K8EA 3LHTA 2HMCA 1TPDA 2CLFA 2QCFA 4K7VA 1AW5A 1TPC1 4CCCA 2O7SA 3W1LA 4ZQPA 1X1ZA 4XTIA 5F2MA 3E12A 3KXQA 3W1AA 1T0OA 2X30A 2CLOA 4O1CA 2C3ZA 2TMDA 3TCEA 3PB0A 3M1ZA 3PBVA 5T26A 3OEXA 3EWWA 3R13A 1YDNA 3TFXA 3HG4A 4RR4A 3C4UA 4GUJA 1EX5A 4MVAA 5AYZA 1SFLA 3C3NA 1M6JA 3C2OA 4UTIA 1WYIA 5EKYA 1WAUA 4UC5A 4BI5A 5LNRA 1QFEA 3BG5A 4MUZA 4X22A 1G4PA 4M6QA 1W3TA 5C6MA 2H8ZA 3TX9A 3A24A 1XC4A 4WOQA 1QPRA 4UTWC 3UWQA 4PODA 4UFJA 1QNVA 5D2YA 4KWWA 3DHDA 5AFDA 4WOZA 2B7NA 1TV5A 3VNDA 2VFGA 3TMQA 1YPIA 1RD5A 3JR2A 5IBXA 3CEPA 3W3OA 2C16A 4LVBA 3GKFA 4LU0A 1UB3A 1ZAJA 1LM1A 3UZJA 4A21A 3EX4A 4QITA 1VHCA 5DY3A 3PBWA 1DOSA 2A1YA 5D09A 1NEYA 4HN4A 1HG3A 3H53A 1Q3NA 3C52A 2IQTA 1TRDA 4M6PA 4UFKA 1R47A 4NQ1A 3W1UA 1FXPA 2JK2A 3HMJG 1LLWA 4IQLA 4BK9A 3L68A 1SSGA 1VR6A 2FPYA 3BG9A 4O18A 4UMBA 3SJ3A 4IX2A 5KZEA 3ANYA 5K3VA 4AF0A 2C0AA 5LGXA 1KM0A 2XN1A 2XN2A 4FIRA 4TX9A 3LB0A 3F4NA 2J9XA 3UWUA 2J9YA 1OX4B 4H3DA 3NZRA 5BMXA 1YXDA 2BXVA 4FEZA 5BW6A 5KITA 3F1QA 2YX0A 2A7NA 1B3OA 3K30A 3NQDA 4LUIA 4TO8A 1ME8A 2RKXA 2GJLA 5K2ZA 4AHOA 5G2WA 4GXMA 3UNDA 1XUZA 2QCDB 1TRIA 1K8XA 3KX6A 3ATYA 4MZ8A 4PL2A 1Q6QA 2JGYA 1TPFA 2RDWA 1LOLA 1H62A 4Q33A 2X2GA 4GFSA 4QM1A 3LCXA 3N2XA 3LXBA 2ATMA 5AOUA 2C6QA 2DU2A 1G4SA 3W2UA 1TYGA 4KFNA 3HG2A 2BZNA 1LBMA 4R34A 4O54A 2Y61A 2FB2A 3LTPA 3FLUA 2A0NA 4WY0F 1TPB1 3C56A 3O07A 2DZPA 4LOCA 4LVGA 2CU0A 2DZXA 1LROA 3W1NA 4P61A 3UXAA 3L5AA 3W7QA 4XBSA 4DBDA 5AC7A 4O1BA 1RV8A 3KVKA 3M47A 3G1AA 5I3FA 1K03A 1ML1A 3GX9A 4CQ9A 4N4PA 5D38A 4ADTA 2YPIA 1W1ZA 4LVDA 1G4EA 4QNEA 5CPMA 3BGJA 4UIOA 1XFBA 1HO4A 1YPFA 3S0CA 3O6CA 1SR9A 3W86A 3L5LA 4EOUA 4U4MA 3U2OA 2ZA2A 1I2PA 1I2RA 3SGUA 2C19A 4FXSA 5C54A 1O60A 1W5PA 3BLFA 3O63A 1LZOA 1CI1A 3S1VA 1JUKA 4E2DA 2CZ5A 2ZZ5A 3LHVA 4AAJA 4ICNA 3Q58A 2BLEA 2P10A 3HF3A 1UUMA 2OX1A 3MHFA 5D32A 5TIMA 3O06A 2PRMA 3TE9A 1E51A 4PCFA 1DV7A 1Q6RA 3NL3A 4YCPA 5HR6A 1F6PA 3WJZA 3T44A 5D2VA 3GDLA 4M5PA 3T7VA 3IRDA 1MEHA 4K8HA 4LV9A 3W1MA 3GZ3A 1FDYA 4R33A 3CWNA 4PTNA 2QDGA 2VEPA 4M6VA 4DBEA 4OGZA 2JBMA 4U28A 3C2EA 3UZ5A 1LDCA 2FPVA 2E5BA 1RQEA 2FQIA 3S1XA 2Y88A 5E0KA 1DKWA 3PS7A 2HTMA 3PC0A 1FY6A 3W22A 1RPXA 1LTDA 4DXVA 3KRZA 4JX6A 3QQ0A 1ME7A 3E96A 3GXPA 4XKYA 3NL2A 1FCUA 1C29A 3NL5A 4CCDA 1AW1A 4G1KA 3NQ2A 4KWVA 1TCDA 3P7YA 5AC8A 1VS1A 2FIQA 1OYCA 1FWNA 1P5BA 1Z48A 4OU1A 2DZUA 2B7OA 2WPBA 2HS6A 7TIMA 4P2VA 4N6EA 3W70A 1H50A 2ZQ0A 4JTEA 4GUGA 1KM3A 4Z08A 1GVOA 1OFPA 4M7TA 1ZNNA 1M7OA 2QCMA 4UTTC 1OFOA 3EX1A 5AC6A 1OK4A 1AL7A 4FNQA 2E5CA 4LS2A 3PF3A 3FYOA 2WJZA 4PL1A 5K7JA 5FEPA 2CLLA 1KM4A 3W7PA 4JEQA 1GYLA 4S1FA 1SZEA 4BFAA 3TW7A 1T96A 1P0NA 2CLIA 3W7IA 2EGZA 1DQWA 5LNSA 3O1NA 6ALDA 1THFD 1MSSA 4TR9A 3OVPA 2Z0IA 4FIQA 1K7EA 3M9YA 2DZWA 3TDFA 1ZENA 1VC4A 3TU9A 4JX5A 4QQ3A 2ZCGA 4HPJA 1OFQA 4R53A 4GUHA 2Y7FA 3EX2A 1NSJA 5DN1A 4S2CA 4QSHA 3HQ1A 4JYDA 5CZ0A 3RNDA 4UNKA 1B4EA 1KLZA 3E9AA 5LZLA 5HR7A 3C61A 2ZTKA 4JTGA 4L4MA 3TIMA 3PBYA 1B9BA 3P5ZA 1VYPX 2VC6A 4HNUA 4ZQMA 3DFOA 1VYSX 1DHPA 3DH7A 2QUUA 5CSRA 1L2UA 1FUYA 4RZ5A 1SZNA 3C0JA 5C5YA 4N2YA 2ISVA 5LGZA 4OHQA 1YDOA 4POCA 1VYRA 4JTSA 2V8ZA 1KFKA 3PB2A 5HJLA 1W3IA 1KM5A 3B0PA 4NX0A 2R94A 2NUXA 4EWND 4AVFA 3NPUA 3NAVA 1L6SA 2J24A 3L0NA 3L21A 2ZA1A 4NJKA 2YCEA 1DBTA 2R91A 1I8JA 3FJ6A 3GB6A 3QRHA 4JY8A 4ZZ9A 4UTWA 2YXGA 4QNWA 4LRTA 3R8RA 5K9DA 4OQVA 1QPNA 3QW3A 1MXSA 5FEZA 2QR6A 4E0CA 2VFHA 3W7GA 4HNNA 3HO8A 1FBAA 2QCEA 3LHUA 1OFBA 3DKLA 3IIZA 3LCIA 1YYAA 3BVJA 4PFMA
chains in the Genus database with same CATH superfamily
2FFCA 2PWFA 1EC8A 5GVJA 4GACA 3NPXA 3WN6A 4AIUA 2VM8A 4INFA 4BR1A 3THUA 2ZWZA 3VI2A 3PJTA 3PZVA 3TAOA 3ALGA 3WK0A 2BS9A 1EWDA 1G9HA 3D47A 1Q2RA 7A3HA 1J11A 4O0ZA 4HSNA 4CCEA 4LY4A 2VX4A 2POZA 5CPLA 2HDJA 3BK0A 3WUBA 2ZVIA 4CEUC 1VCGA 4AC1X 3UZWA 4FLSA 2PBGA 5D2WA 4HKPA 2PDPA 2DW7A 3PPCA 5FJUA 1BXBA 5DMYA 3IJ8A 1P0DA 4LEFA 1XINA 4PMZA 4MIMA 1JZ6A 1VH7A 4DHGA 1I9CB 3RRXA 3OGSA 3CT7A 3UCCA 4JCLA 1F6KA 5BXPA 2PMQA 2HZGA 3GG1A 1DE6A 1IIGA 1U1JA 1VHNA 3TTSA 3R8HA 3W01A 2QCGA 1EHNA 2EXOA 3UYIA 2PZ0A 3WD1A 3NJ3A 3U5YA 2QV4A 1CTNA 1QW9A 1UZDA 3ARRA 1K3UA 4HB7A 2CZFA 1ZBKA 3NVTA 2PUZA 2WKLA 1U5JA 3SB0A 2IPFA 3Q37A 3PZTA 1JL8A 1J0IA 2FYMA 3VIMA 3KRUA 1XYZA 1XLBA 2XIBA 4R7WA 4C90A 2P1FA 2GK1A 3TLQA 5F1VA 1JRBA 2B7PA 3AJXA 3SSJA 2VQTA 3KP1A 3TYAA 5LA2A 4B2DD 1IT0A 2E1DA 1PZ3A 2QJGA 5LHFA 3SSZA 2UBPC 1EUAA 1PDYA 3NSNA 4ADSA 2A2IA 1DQUA 1E15A 4JHOA 2RUSA 3QEZA 4W84A 2EG8A 2VX6A 4H4IA 1MEIA 4CVWA 3KZSA 3QTGA 3BLKA 4H6QA 5AHIA 2YZRA 3WQOA 3EKLA 4A2SA 2V5JA 2I5GA 4QQUA 3BV4A 4XZNX 3W84A 3JRKA 3C8NA 1JQXA 1GKPA 2C79A 2OJPA 3BH4A 1XLMA 4YMZA 2VFDA 2PC8A 2UY5A 4XKYB 3NQAA 3U2ZA 4FX7A 2Z2AA 3LCGA 2C0HA 4E5TA 1E4LA 1S2WA 4DM2A 4JZ5A 4PEEA 4XD6A 4E38A 4ZGYA 4DO7A 4A29A 3QZAA 1HJXA 4RUBA 2OR2A 2FJUB 3LSBA 3GTXA 3CZJA 4GINA 1R5YA 1OINA 1Z8AA 1UOZA 1ICPA 3R6IA 4QR6A 4O4WA 3QVQA 3STFA 4GJIA 2Y2WA 3G1FA 1XI3A 1MWOA 4ML9A 2A7PA 4UFMA 4C7FA 2QUTA 4NZJA 3VD5A 2PAJA 3K8LA 3MHGA 5DT5A 5BNKA 2BY3A 2ZWYA 3RCNA 1KFCA 3F4CA 3STGA 5A8OA 3GTIA 4MJ4A 3VOGA 4LRSA 1UR2A 1A5NC 1BSLA 3AU2A 1VEMA 4F3HA 3N3MA 4IPNB 3APGA 3QZ6A 3QXBA 3SQSA 2DZAA 1W9DM 4MFEA 5F2IA 2X1SA 4JHZA 2Y7DA 2JKEA 3H23A 2DZVA 4BWLC 3QBUA 1FQ0A 3VE9A 4GH1A 4DJED 4R3UA 1BG4A 2ZRUA 3P14A 4KW2A 1RVKA 4Y9PA 1W54A 3ARYA 5D9OA 4S2BA 3GM8A 4F0RA 2CBUA 4GYPC 4A8LA 3INPA 5EY5A 4C6BA 4NZ4A 1B9ZA 4O57A 2Z2UA 3QV6A 3T55A 2ALDA 3KHDA 1FWRA 3MI2A 3TYZA 1TTIA 4O50A 2IW0A 2UV8G 3BMWA 3EB2A 1RSCA 2CFFA 3SUTA 4GYFA 4AD0A 1IT7A 5ENLA 3EDFA 4ZXOA 3QSRA 1EJUC 3NPWA 3VAVA 1NOWA 4JQ4A 1QR7A 3OLDA 3Q2DA 1UZHA 1XLKA 1CGUA 4HCHA 5JQ9A 1JXJA 5PTDA 3SW6A 5HMSA 1JCNA 1XL9A 3WFLA 2QXWA 3A4AA 2PWUA 1U5HA 4CQDA 3EOUA 3CBWA 3LTSA 5C55A 3UNTA 3MCMA 1GVFA 4C6OA 4K1WA 2IKIA 4O0QA 1H63A 1VAHA 3DFSA 3TONA 2YCKX 4HNCA 1QMLA 4H8NA 3CZEA 1V08A 1N82A 3TN6A 2QAPA 3ARVA 1JJKA 4D9PA 4M0XA 1UWSA 3G0SA 1KRMA 3RF9A 4H6RA 1VF8A 2GSJA 1V3JA 1LLZA 1VIWA 1VGAA 1XBZA 2R1MA 2E9MA 3C2FA 2V5KA 3EWYA 2BXZA 1VP5A 5BXTA 4GI9A 5AHNA 3HGJA 4NAEB 3EDDA 2G3NA 3G24A 3RU6A 4AWTA 1WPCA 3W1PA 4JTDA 3WJWA 2HXUA 1O1ZA 4HPHA 4MZ1A 1TZ7A 3TSMA 1VBHA 4WR3A 1KD0A 4E4UA 2WJFA 4PCTA 2IQDA 1CDGA 4KMQA 3S8HA 1KWKA 1XIEA 3VC5A 1F07A 4XK2A 1JCYA 4YCOA 3MYOA 1GVSA 1TR9A 2PDWA 1H5YA 2OT0A 3MHUA 3BSGA 4YTTA 4OBSA 3AUJA 1JCXA 1R87A 4S39A 2X8RA 1M7XA 3VUSA 4AZ5A 4PMXA 3RM8A 3NYZA 4HZMA 1JI1A 3WD3A 8XIMA 2WAGA 4N4QA 1XRSA 1V5XA 3V75A 3QHMA 3GUWA 3A4XA 4MJ2A 4GUIA 2VEFA 3OHIA 1UBSA 2GJNA 5I0DA 1W5QA 4P7NA 3NXLA 1V6TA 2YCLA 5HXMA 3A12A 3GDKA 1OABA 3B06A 3EXSA 4CLMA 1HW6A 2BASA 5HA7A 3B9NA 3CQJA 3N6JA 1GVRA 4RE0A 2Y63A 4TVDA 1O95A 3CWHA 1YDVA 3T8QA 2XPKA 4C6EA 3IIPA 5KZDA 2EG6A 3RX4A 1S2VA 3AISA 5LNUA 3V0TA 4L9ZA 3SCSA 3AS0A 4KGLA 5EFDA 2FLIA 3GKAA 5D30A 1R2SA 4QG6A 1QDSA 2PC4A 3BLIA 3L2MA 3QV8A 1C91A 3BWWA 3LBOA 2AL2B 1E1FA 4H9TA 4QJ3B 3EOLA 4ZSUA 4NX5A 1WA3A 3U5UA 2F84A 3G1DA 4DIAA 4JTKA 1S2TA 5BRPA 4IT1A 3RLHA 3UG4A 1NH6A 4A2RA 4MNKA 1FDZA 3ONBA 3C6CA 3SY5A 3C2RA 3IK2A 1FVPA 3VZZA 1RP8A 2D73A 4O4VA 4X0VA 3GAYA 3GR8A 5A6TC 2FDMA 2JEQA 2A3LA 1WCGA 1KV5A 3BLOA 4NNAA 2CC0A 2G4FA 4RZBA 3TXZA 2BB0A 1P6WA 1WZLA 2GQ3A 3LV6A 4P7QA 5AECA 4L4OA 1J79A 2YOCA 3F5KA 3W00A 1XS2A 4LCRA 1V3LA 1RA0A 3ITYA 5EMMA 2G37A 4P8WA 4RXFA 4PRWA 2PDHA 5LA1A 4Z1AA 4P8VA 5HMFA 3FEMA 5D2TA 1ZB5A 3MJMA 1K77A 3TYBA 1UOKA 3TSBA 4NAEA 5D9NA 4ROQA 1MW2A 4OV9A 1E0TA 1HIZA 3DX5A 2FPTA 1JZ5A 1OX5A 2V6AA 4V1YA 1S3HA 2HE5A 4YWIA 1H7XA 2WPGA 2A7RA 3KZPA 5FEWA 1JZ3A 1W1IE 1WAWA 1GKQA 3MP4A 9RUBA 3QQWA 1JGMA 4EKJA 2ZC8A 5JBFA 2RH9A 3UBPC 1XR2A 3THQA 3W02A 3W76A 2WNQA 1SVDA 2EPLX 1SU5A 4DF1A 4LF2A 2Y24A 1XDMA 1WO2A 3MSDA 4ORMA 3S5SA 3MI6A 2V3DA 2VEKA 1HJWA 2DSVA 4XBJA 1QASA 4U33A 2VRQA 4H9YA 1KB3A 2Q8ZA 3DENA 2HRWA 1LLOA 3BDKA 2Y8VA 1G0CA 4ACZA 1FXQA 3G1SA 4BI7A 3N9KA 3KBNA 4JTFA 4FALA 4N9BA 1UP0A 4KCVA 3EGJA 4G56A 4QJ4B 1A50A 1Y7VA 2Z29A 3GXDA 5HWJA 4MGGA 4TTGA 3DU0A 2KAUC 3R94A 4L65A 4JY9A 1RK6A 1I45A 1VLWA 4RZ6A 1UJPA 4GABA 1TX0A 1I6NA 3VUPA 2WVVB 5TBOA 3ZM8A 3EOEA 3OQEA 4L1GA 3MP5A 2VD9A 2NUYA 1RH9A 4PTXA 2YA1A 3NGFA 4G9PA 2WZEA 3A21A 3WK1A 1PBGA 1PV8A 4NT0A 2GGGA 1FWTA 1UMLA 3WG6A 3IRSA 2P88A 3PNUA 5U4NA 3T81A 3EXRA 3RLVA 1HQTA 2XIIA 2AMXA 2I5IA 4JIHA 3BMVA 2XM2A 3LDVA 3ITVA 2D1ZA 7ENLA 1H4PA 4NF7A 3MS8A 3VILA 4BKNA 3DFQA 3VIGA 1DIOA 2G41A 2XFFA 1AH4A 3USZA 5K9XA 2R1LA 1F73A 2HVMA 1OIFA 2O9PA 3DI1A 1MXDA 1AJ0A 3NOEA 2YKKA 1E6ZA 4XB3A 4U3AA 3AYRA 2VZSA 2WNZA 2EBNA 2OLAA 1Q6GA 4H9XA 1GQNA 3Q65A 3W2MA 3UQNA 1PEZA 4K38A 3T0CA 3GWQA 2ZZ4A 2ESCA 1XICA 4ZB0A 4US5A 2WVUA 2WZHA 3MUZ1 1U1UA 1K70A 3SM0A 2NUWA 1GNXA 3C0QA 2WMFA 2Z6IA 4MY1A 1QO2A 3EA1A 1OF6A 1CB2A 1YQ2A 1OB0A 5C0QA 4A22A 3IWPA 3LX9A 5BYWA 1TV3A 4OBTA 1DEDA 4Q7NA 1D3GA 3UR2A 1Z44A 2GDUA 1VB9A 2PU1A 1E3ZA 4Z2IA 1NELA 1TZ9A 1NWUA 4EF8A 2NWSA 3GC5A 1EB3A 3L5MA 3W88A 2AGKA 2F8QA 2G96A 4HA3A 1YDYA 3CB8A 1NY1A 1WB0A 4DXXA 1VQTA 5I78A 1Z7AA 1KXTA 3DHFA 4LC8A 3DECA 4A05A 3LI0A 5A6BD 3CHVA 2A3EA 1FWCC 4W85A 4FNRA 5ABHA 2IUZA 3LCLA 2EAWA 1OFEA 2C14A 1AL8A 2RGLA 3E74A 2CYGA 3GFXA 3SY1A 1JYNA 1XWYA 3O7UA 3BMXA 4XAPA 2CW6A 3W7HA 1B57A 1OHLA 3CV2A 1EPXA 4S3CA 1Q8JA 5LIYX 4UQEA 4PTMA 4LYRA 4ZQCA 4YHEA 4ICCX 2HEJA 4FS9A 2WM0A 1Y65A 4BZYA 4O8RA 2ABAA 3TFCA 1BXCA 4IXXA 1W1PA 2BY0A 5G4EA 3S5OA 1POKA 3UZYA 2GQ8A 5CAKA 4KKXA 5D9MA 4V1XA 3MP3A 2OT1A 3KTXA 3UPWA 3T4CA 3UWVA 3GE7A 1BYBA 4GYJA 2CLMA 1MXGA 1B3YA 2Y8UA 1XM3A 1HUVA 3QKZA 2PP0A 4GKTA 5GNZA 4ZQRA 4LAKA 2ZKMX 1HP5A 3W7KA 3ITCA 1XH1A 4FLRA 4LUSB 4LY8A 6PTDA 4Y90A 2J6VA 3RK8A 5DFAA 3QW4B 4PCNA 8RUCA 4WUIA 1DP0A 1QW8A 1KW1A 2ISSA 1HKMA 3CHEA 4FOUA 2F7FA 1UH3A 1X8FA 4F48A 3UWZA 1R2RA 1IR1A 3NDZA 1GOQA 4X0NA 4RNFA 2VDIA 1XYAA 3L65A 3UGVA 1GYMA 2QMJA 2ZZ1A 1QI4A 1TIMA 1TVNA 4UUIA 3GRIA 1JDFA 2V3FA 2FVKA 3NQCA 3CUJA 3OLIA 2QIIA 4QE1A 6TAAA 4O13A 3TKFA 4QAIA 4XISA 4FF5A 1KQZA 1VFSA 1BKSA 3GVVA 3QC3A 5FEXA 4G7FA 2FHCA 3AXHA 3YPIA 3W4RA 1PVNA 3MTWA 4XAYA 5K4XA 2EPHA 4Q32A 3RR1A 1XIFA 3A13A 3SFKA 1ZSXA 1PKYA 3PPGA 2XFWA 5KZMA 3LRKA 3KS5A 4M80A 4HT3A 4PMYA 3BAIA 1A3HA 3COTA 3CUHA 4L4LA 3LMZA 4JFUA 1Z32X 2HBXA 3A9IA 3URAA 1K8YA 1TMHA 1ODUA 3W87A 1XYMA 1DJZA 4WKHA 1E3XA 4YVPA 2NQ5A 1ECEA 4KWSA 3WL0A 3I3DA 3LNPA 2FVMA 1F61A 4CNUA 3CHDA 4UTLA 4I6KA 3A5FA 2OSYA 5FJOA 1R2TA 2WQPA 2O0TA 1GPFA 3EWUA 1I1XA 2JIEA 4PUWA 1JCLA 3UG3A 3O6AA 3VFLA 3GNXA 3MKVA 3ARPA 3VOIA 3MVTA 5BCAA 3U0HA 1EHAA 2ZZ2A 3CO8A 2VZUA 1Z42A 3DCPA 1MUWA 3GNOA 3W25A 4NXKA 5KETA 1XBYA 1EJSC 2V0TA 3VC6A 2V3GA 4NI3A 3TJLA 3CC1A 3LRMA 3VVGA 3S2NA 3UPBA 2HK1A 3KTCA 4UTMA 3OYXA 5C71A 1V0NA 5C9WA 4QG9A 1UQZA 2PU0A 2V82A 3HJEA 1XSJA 3HOJA 4LSBA 3NQ6A 3UD6A 3UGRA 2A85A 2PRHA 4Z2LA 2XH2A 5BXRA 3L0GA 4Z42C 2ZICA 3M6YA 4N0RA 3T0BA 2O7QA 3P6LA 4MWAB 3RITA 1E5NA 1AJZA 3TTYA 2NQZA 1W3LA 1QT1A 3KS6A 4LUTB 3A22A 4JYEA 5MKGB 2WCGA 1LUCB 3PAJA 4H6EA 1HJQA 3BXWA 4YHGA 3PBMA 3N2CA 1MFVA 4HPGA 4I3GA 3WJYA 1ISXA 4WXZA 3ZVHA 1LP6A 1LRTA 2D0FA 2QHAA 4O17A 3RIKA 4PCSA 3MT1A 1XYFA 2DUAA 4XZMX 3KAOA 3KWXA 1TX2A 4DWDA 4ADUA 4WIWA 5M17A 1GQJA 3BLDA 3EX3A 4LFYA 5G5IA 3M6DA 1MNSA 2VT0A 2WOQA 1WDWA 4LUJA 2C18A 4AXNA 3W85A 1GZJA 2AAAA 2NQLA 3MDWA 1UWTA 1IGWA 4I9TA 2L5HA 4AF0B 1T99A 3RU8X 2J66A 2NV1A 1NARA 2C1GA 1J12A 4R88A 1PO9A 1PHQA 2QYGA 1PXGA 2PRLA 1VBGA 2FTWA 2Q01A 3QYSA 2Y8KA 3HQNA 1HP4A 3N12A 3MV11 3EMCA 1J6PA 3GG7A 3T05A 2VOTA 1Q66A 2AQWA 1GHSA 1B2YA 1ZFJA 2NSXA 4TIMA 4TVCA 3NPVA 3M0HA 2QUNA 3MSGA 3OODA 3D0CA 4IIFA 4B3KA 3OGRA 1XG4A 1W2VA 2OCZA 1Z3NA 3D46A 3M43A 3RPMA 3ALFA 4C6IA 3D3FA 4C7DA 1YNYA 3NWRA 4J4KA 3WDQA 3TA9A 1A5AA 2ZX8A 1YTEA 4S3EA 2GFTA 4UZSA 3TV8A 4HOZA 4GZEA 4B16A 2HMCA 2CLFA 2A3HA 4K7VA 5HATA 3PTMA 4CCCA 4ZQPA 2YJQA 1X1ZA 1XLJA 2UWFA 3JZUA 3M0KA 2IPJA 3KXQA 3W1AA 2CLOA 1QHPA 2ADAA 4D6CA 5T26A 1NU5A 1YDNA 3TFXA 3E0FA 1ISZA 2F2HA 3VTRA 2E9LA 3C4UA 2D22A 4MNLA 2PDIA 1KNWA 3C2OA 5A8MA 4IUGA 1WYIA 4BI5A 3L4WA 5LNRA 3BG5A 1XRTA 1PX4A 1K9DA 4X22A 1G4PA 4LBSA 4HK5A 3WEZA 3MB9A 3UG8A 1XC4A 5I23A 3ARWA 5C7VA 4PODA 4LUTA 1Q85A 4KWWA 3DHDA 1UZ1A 2OYKA 1TV5A 2YL6A 3VNDA 3TMQA 1OCJA 5A6KA 2BY2A 4PB4A 3HURA 1UB3A 3VK5A 4A21A 2HPIA 4J3SA 1VHCA 3PBWA 4KS0A 4AD2A 4FAMA 5D09A 4V28A 1HG3A 3ZYZA 3PZOA 2X42A 4PMOA 2ISDA 1J0HA 4UFKA 2YZ5A 1GGOA 4GCXA 2IKJA 2YA2A 1F3WA 1FXPA 2ACRA 3CYJA 1J2BA 3HMJG 1AD1A 1LLWA 4IQLA 1SMAA 1Z6KA 2FPYA 1E0XA 3BG9A 1V3IA 1E6NA 2D0HA 4CN4A 4DZAA 1R3RA 4AF0A 2W67A 5LGXA 4HTBA 1JNDA 1UD3A 3LB0A 4H3DA 2CHRA 3OYZA 4FOJA 4NILA 3EOSA 2P8BA 4FEZA 1UIPA 4LBUA 4HQVA 4JN8A 1QBAA 2YX0A 1B3OA 4H9VA 4G7EA 3NQDA 4DBUA 4B90A 4IICA 3VM5A 4AHOA 4GXMA 2QCDB 5A6AA 4AX6A 1R85A 4ZE5A 2BDQA 3ECQA 3B8VA 4PL2A 2TODA 2VHLA 5GJPA 2X09A 4IP4A 2X2GA 4GFSA 4E4PA 4KWUA 3TYUA 2ATMA 5AOUA 1VFUA 1XGDA 3WLLA 4DNHA 4R34A 4CN6A 4ASTA 4GC3A 2FB2A 4GY0A 3GY1A 5CPTA 3SY8A 3FLUA 1JI2A 1K4GA 3O07A 1WKYA 3HV8A 4C6MA 4P61A 4ZTXA 3PZNA 3L5AA 3IJIA 3AYVA 4PUMA 4PSPA 3TZFA 5AC7A 4O1BA 3M47A 2ZXBA 4V27A 2WWCA 1NFGA 4KRTA 3B0XA 3GBEA 4DBSA 1BQCA 4QNEA 4OKDA 1VFHA 4KESA 1E1CB 4IGSA 1V79A 1SR9A 3S1GA 4GMEA 3U2OA 1I2RA 2YL9A 5CPSA 5C54A 1O60A 1T8QA 3UJFA 1LZOA 1CI1A 3TYCA 4CNTA 3VO0A 2NW0A 3RXZA 3HF3A 4JHMA 4J3WA 3MHFA 1KBBA 3O06A 4DJFD 3TE9A 1E6SM 1E51A 1ZQ5A 5HBFA 1UWQA 4PMJA 2GGHA 1D8WA 1RP9A 4PB5A 3WJZA 5DRIA 2D69A 3GDLA 3T7VA 1MEHA 4K8HA 4LV9A 1L6GA 4R33A 4PTNA 4AIBA 1TVLA 2E3ZA 4MNJA 3RYSA 5IOBA 4OGZA 3UZ5A 1BWVA 2E5BA 3F2DA 5D4YA 5E0KA 3RRAA 1DKWA 3PC0A 3BAWA 1WDDA 1RPXA 1LTDA 4DXVA 1MDLA 2X0SA 4DWSA 3IANA 3B40A 1FCUA 1AW1A 2CZVA 4H7VA 3DUGA 3NQ2A 4WGXA 2VURA 3AWNA 3IJ7A 2H9AB 2WHJA 1P5BA 5TF0A 3BOLA 4P2VA 4N6EA 1O6IA 1P7TA 4YTQA 4M7TA 1ZNNA 4KEMA 3EX1A 4V2XA 1ECQA 1XKJA 4D8AA 3UR5A 3VNMA 3PF3A 5CXPA 3N6HA 4HOXA 1JZ8A 3IK4A 3KEHA 1E0UA 5FEPA 3E3HA 3Q67A 2CLLA 3WH7A 4LXFA 1A5KC 1TJ0A 5I6SA 1GYLA 1SZEA 4RE2A 2CLIA 3G5EA 5LNSA 1K8CA 2YDQA 2NVAA 4QDPA 4C6JA 1THFD 1MSSA 4FPSA 1BQGA 2BBFA 5FJTA 3DG7A 3TU9A 1EQPA 2VX7A 4R27A 4AZHA 1H09A 5ECUA 1UHVA 1OFQA 2Y7FA 4P8UA 1JZ4A 4WJ8A 5AZ1A 3RX3A 1R7OA 2I16A 2XHYA 2GWGA 4S2CA 1TUXA 4Q6JA 2JEPA 1Z9AA 3LSCA 3GVWA 5CBIA 3CASA 3C61A 4JTGA 4L4MA 1VYPX 4ZQMA 1OGGA 1E1CA 5H8UA 1K6AA 3K4DA 2D20A 1L2UA 3UESA 4TV6A 1N2VA 4OJYA 3RLGA 5C5YA 4RDYA 4LH8A 4POCA 1YDOA 2J7BA 2WC4A 2V8ZA 3PB2A 5HJLA 1HGWA 4XO6A 4LB4A 3B0PA 4ZOAA 3LGDA 3IJQA 1ZP3A 4A6GA 3NAVA 2J24A 4BQ4A 4KF1A 5E5CA 2WHLA 3IARA 2YCEA 1UD8A 4KEZA 3VGFA 1EDGA 1A4MA 2XZ9A 3GB6A 3KCLA 4J3ZA 3TTOA 4ZZ9A 4QNWA 4HU8A 4LRTA 1W1B1 3LEPA 4OQVA 2QDEA 1MXSA 2AKMA 5CEWA 2QCEA 3LHUA 4QJ5B 1OFBA 1RUSA 1JXKA 3IIZA 4MWAD 4D6IA 1OCQA 4DUOA 4PFMA 4NZ5A 4GX8A 1R46A 1O4UA 2R82A 4XWUA 3MMWA 4Y2WA 1M03A 3O6YX 1SZFA 2E6YA 3FHAA 1UP3A 1EJWC 1JDCA 3RGTA 4I6VA 3GFZA 3O05A 3RO6A 5A2AA 2OG9A 1EKOA 4LX4A 8CGTA 5K9CA 1SM9A 2TYSA 4HHHA 3O0KA 1GZGA 1V93A 1F76A 2W0UA 4PUEA 4OE7A 2G4JA 3GC2A 1I2QA 4E8DA 3H6OA 1OC6A 1KBKA 3PWAA 1H11A 3N1AA 2OWWA 5T91A 4FXRA 3GDTA 1QVBA 2E77A 2Z4GA 2YXOA 1H7RA 4QGCA 3H70A 5EFFA 1ITQA 3CUZA 3EEGA 1YTDA 3EWDA 3CZ8A 1AUSL 2Z1VA 4UB9A 2PURA 3N17A 3V1HA 3DFHA 3RFAA 2Q09A 5JH1A 1TELA 2CXGA 1UROA 1KGWA 3PANA 2YGYA 2GOUA 4GQBA 4XVDA 3B05A 3EKZA 3LHZA 3WYZA 2BVYA 2F6UA 5E93A 3W7CA 3WD4A 4DO4A 3ITLA 4YVXA 2B7QA 3EPMA 1P0EA 4GZJA 2CCRA 1E6XM 5CGMA 3ZQ9A 4GI6A 2WLZA 3DN5A 4ERAA 1V3MA 3NCOA 3VDCA 1B90A 2FKPA 3DAQA 4MM1A 2YL5A 4JTIA 1FCVA 4X3ZA 3MUY1 2QUMA 1G7VA 4H9UA 3MW7A 1CNVA 4D72A 1HVQA 4PB3A 3RM9A 3TVAA 4GVGA 1EGVA 2ZUSA 1ZY9A 4EIVA 3M7WA 4GYPA 6CGTA 3AHXA 4REQA 4UNIA 1CIUA 1PKMA 3R0DA 1N55A 1W37A 1RQHA 5EMJA 4LV4A 3R2GA 2WYSA 4HNTA 2NZLA 1KXVA 2Z27A 3LMYA 4A8RA 3PZUA 2VWSA 4M1BA 3VD3A 1GHRA 3APTA 3ABQA 3GIYA 3CAKA 4HHPA 4O10A 5KTLA 4NXSA 4BF9A 3PZ9A 2ZTJA 4HYRA 3FDKA 4YXGA 5LIXX 4MKVA 1KTBA 4FXJA 3F2CA 3HQPA 4JKKA 4N6FA 4UFIA 2ZUNA 3W2JA 2PDYA 4KH2A 4URIA 3TC7A 2UY4A 3SUSA 1ADSA 1TJRA 4UTJA 3TQ0A 2OODA 2J74A 4X9SA 2CZEA 3OZYA 3TNOA 3LCFA 5EGRA 4C7GA 1RLDA 4DVOA 1C9DA 3GD6A 4GO8A 5HK4A 3GXTA 1EP3A 4G1NA 3UY7A 3MBFA 2WBGA 3SCTA 2QJIA 1C7SA 3UG5A 1S46A 1XD0A 3B03A 1X96A 5MKGA 1R7AA 3U4FA 1A49A 2W79A 1QWGA 3TJXA 4F4RA 3M0ZA 1NQ6A 1KR1A 5IHSA 4JNYA 4DB7A 4WCJA 3RPDA 3HPSA 4R7JA 3SI9A 1OFAA 2WC3A 4GI4A 1TJ2A 3DZ1A 1W5MA 2BG5A 4B91A 3JVAA 4RDVA 4H8UA 5CZJA 3PVFA 3DYPA 1RALA 3W71A 4JIEA 3CMJA 1JUEA 1QPQA 2VZOA 1XYBA 1IXOA 3T1GA 1LF1A 3N3TA 3DGBA 4GVHA 3WLMA 4M29A 5D04C 3P3BA 4GXPA 3N25A 3W1TA 1FWDC 1UPMB 1Q45A 2XIOA 3OJGA 1EC7A 4XZBA 3HN3A 1YHTA 3BCJA 4AH7A 1TMLA 2YBVA 4NRSA 2Z1BA 1V3KA 1WOAA 2BHZA 4JFTA 1F8MA 3HPXA 2PGFA 1K9FA 3IVTA 1M01A 2OEJA 3DG3A 3WH6A 4C5YA 2QQ6A 4PSRA 3SRHA 3C0SA 2JIWA 1NQKA 3FOKA 4CD4A 1TV8A 3TJIA 2ACUA 4HGXA 3TWAA 5I09A 4O14A 4DELA 4PR4A 2OXNA 4V33A 3Q94A 4DO6A 1NVMA 3ZXWA 4ZO6A 3W24A 1Y0EA 1XIBA 4DAFA 2GUYA 2O9TA 4IFOA 2WV8A 4ORIA 3KTSA 2FDSA 1LQ2A 3JS3A 4H01A 3L66A 4BI6A 1LRQA 3MANA 2GGEA 3PZGA 3TQPA 1ELSA 3S3GA 3IIOA 4ZR8A 4AUBA 3WFAA 4E4FA 4E6MA 1JQVA 4EXBA 4LT9A 4NJGA 4LCSA 5CGQA 1RY0A 3BTNA 4ICMA 4Q8PA 4IJBA 1GEQA 3QMTA 3CXOA 2OEMA 4AWUA 2ISWA 4PUKA 4Y9AA 2Q8LA 1SZRA 4H04A 4MZYA 3QZEA 4GC4A 4IQJA 1TA3A 2WMGA 1PB0A 5GJNA 2EPNA 2J9ZA 3WNKA 3OPSA 4RW3A 1UR8A 1PS9A 1WDQA 3TTQA 2XIQA 5AHLA 2PBOA 3DFYA 2BP1A 1ICQA 3THDA 2FZDA 4I8DA 1FWWA 3B8TA 1UYQA 3LGGA 4QFUA 3QPZA 3CAWA 4QROA 2OMAA 1NIUA 4OWGA 3QY7A 2ZX5A 1S5NA 3RAOA 3WDPP 2X40A 5LNWA 3M16A 2J47A 3LLDA 4RNHA 4E8CA 7REQA 1CLXA 2NLIA 3FSUA 1F3EA 4O15A 4NVTA 1W3JA 1BYDA 3QH2A 4LF1A 4IXHA 1G69A 4FR1A 4IPJA 3E02A 3B4UA 2B4GA 4ZEPA 4IPIA 2E6FA 4PCPA 4O16A 3NQMA 4K39A 1L6YA 1J10A 1EFZA 5ABTA 2QF7A 1GTHA 4Z0SA 3SDOA 4AY1A 4UR7A 5AYYA 4Q4MA 1Q5MA 3IVUA 4DF0A 1JGIA 1Q6EA 5CSSA 1KCKA 1SO4A 3N13A 1O5XA 2Q02A 4W8BA 2JF6A 2BHYA 1Q65A 1LCOA 2HBVA 4A4AA 4RDZA 2HROA 4PEKA 5DMMA 2BWGA 3TROA 4TU1A 5A8GA 3NZ1A 4EK7A 1ADDA 4N9CA 1J5SA 3W2LA 1IWPA 1GT8A 3R0KA 4P7LA 4I90A 5HMEA 4I9MA 1YW1A 3P8IA 4JKLA 2YYUA 1C8VA 4MFDA 1PSCA 5DRCA 2MANA 3SJNA 2Q71A 1BAGA 3CHFA 2VTFA 4WSJA 3AMDA 4FR6A 3MQTA 3I6RA 1QHOA 2A4AA 4LBRA 4BCEA 4XV0A 2E67A 2Y4SA 1M68A 1T6MA 3A4JA 2ACQA 1KR0A 1SW7A 4IMCA 4MF4A 3RM4A 3OQ8A 1NF7A 3P60A 1OZMA 3TMLA 2JF7A 1QXLA 1KC7A 1UQYA 3EA3A 2OTDA 4L61A 4GUFA 1W5OA 4NP7A 2XVPA 4MLJA 2DDXA 1ZPTA 3RCYA 3M0LA 2VKZG 4IMFA 4WD0A 3Q45A 4UQAA 1H3GA 3IV3A 4GBDA 1LL6A 5I3JA 1IZKA 5XIMA 3SGGA 2WC7A 1XRVA 4MY9A 4TX6A 4LJ3A 3NDOA 1OYBA 2OLHA 3DESA 2DSZA 3H12A 3AZTA 4ILSA 1KLYA 3QQ1A 3AZSA 1H61A 4O52A 3ZLHA 1KBIA 3KBMA 3L67A 4GNKB 3WLJA 3U3HA 1SJDA 1YXCA 5KMYA 2F6XA 2ZZ7A 3W27A 4NYUA 4ZBCA 3PZMA 4GHRA 1DQXA 1OYAA 1UKOA 4JYFA 1RPKA 1NOFA 3B97A 4AMAA 2OWXA 2P5NA 4GO9A 2VR5A 2V5LA 1UBPC 1J8VA 4JIPA 3UFYA 3K4WA 3AU6A 4UOZA 2Y89A 1E6QM 3LS9A 1WBHA 4ZXLA 3PNZA 3HU7A 3CV7A 3ES8A 4PTVA 3WQ4A 3M44A 1DWIM 3G6LA 3C5QA 3SCUA 2FFIA 1WE5A 4AIEA 5C9RA 4CQ8A 3EX6A 4PN2A 5AZ0A 1TTQA 9XIMA 3B8IA 5HDRA 4Q8NA 5BROA 2OQHA 1W1TA 1TWDA 1EDQA 4NNCA 4WF7A 4TV5A 4R5EA 4HD5A 1H1YA 4NL1A 4W8LA 3ORWA 4GX9A 3H22A 2Y70A 1T8XA 4RK8A 3NQVA 4JN6A 3M07A 2ZYFA 1FWSA 2YW3A 4AHQA 3NTYA 2Y7GA 1QNPA 2ZZ6A 3MYPA 2Y85A 3V35A 2QCCA 3UR7A 3A5VA 3BW3A 2VEGA 1T5AA 1VJZA 1LRNA 3I68A 2PD5A 3MDUA 3M0IA 2DPEA 5HJXA 1LBLA 2XGBA 2PF0A 4JTLA 3SIZA 4GIAA 4S3DA 2W61A 2XJ7A 1F05A 2Z6JA 3CTLA 3W37A 3FA4A 1C93A 3U7BA 2CBVA 2AGTA 4G5DA 4DPPA 2PDKA 2GSHA 3KRSA 3CQ0A 3AIQA 1EA0A 2V5BA 1DHKA 2E6DA 1M41A 3C3UA 1KGXA 3SZ8A 1QTWA 1NDZA 2H8XA 3CYVA 3O15A 3AIRA 1TSIA 3BCDA 1YTKA 4UOQA 4YLWA 1KFJA 5REQA 4WSHA 3PY2A 3VDBA 4FB7A 4EPEC 2DUZA 4JFWA 3TCSA 4Q4SA 1AK5A 1MQPA 4DI8A 1RXOB 3BLEA 2INFA 1SPQA 1GOKA 1ZUAX 4MOZA 5TQLA 3LLFA 2ATSA 4F40A 1YRRA 2D24A 4JS3A 3W72A 3WJXA 3CTTA 4NNBA 2MNRA 4TQTA 1BEUA 2YYTA 2J88A 4WKFA 2YL8A 5CG0A 1IXNA 5F7UA 1XYCA 4NASA 3QFEA 1HT6A 4B4HA 2PDGA 2FH8A 4UWMA 7XIMA 1HL9A 4IG2B 2E4TA 4WKAA 3MPGA 1PIFA 1XH0A 4NAFA 4AD4A 2UZ9A 2FGBA 1HKWA 1IGSA 1JCJA 2YLLA 3AXXA 1CLVA 3ANVA 2XUCA 1J0JA 3QHOA 2B0MA 3D3AA 1UR3M 2GVGA 4CD8A 3QF0A 2NWRA 1WZAA 2XM1A 3H26A 3VOJA 5E6ZA 4GYKA 5CPOA 5F2GA 1SYTA 4JIRA 1TWZA 3S9YA 2E40A 2YDSA 2VENA 4D1IA 4Q8TA 1E1EA 2VWTA 5IM51 3C0LA 4DUWA 3QN3A 3UZXA 3IS4A 2VXNA 1MZHA 2TRSA 3H54A 1GCYA 3UR8A 3FS2A 1EXBA 4J40A 3M46A 3ZT7A 1NP0A 1MRQA 4GCAA 4Q8UA 4DN1A 4I7UA 5E09A 2E7FA 5A5WA 2Z24A 1M7PA 4PMQA 3BPWA 5G2HA 1R3SA 4DYKA 5HAOA 5LYRA 1B4KA 1HN1A 1B3WA 4CNNA 1ZHAA 4HJFA 4C6KA 2Y5SA 3N6QA 2J7DA 1I2OA 1GQKA 3IUIA 1UC5A 2I14A 4EACA 1AQHA 1W9XA 3ZT6A 5L9FA 1M3UA 2VEMA 3CMGA 4GJJA 1E72M 1OY0A 3IGSA 3VDHA 4B15A 3EMZA 1UWRA 4N9EA 3WQ5A 2A3BA 4Z1CA 2PCQA 4RW5A 1GG1A 3HTWA 4R7OA 1E9LA 4B2DA 2VX5A 1VKFA 3ABOA 3W7DA 5CC3A 1BPLB 1OX6A 1CCWB 2ZVRA 5BRQA 2XWEA 4F2BA 1K8ZA 2EJ1A 3OBEA 3B0UX 1LL7A 1EIBA 1TPEA 1QUMA 1KCXA 4LS0A 3P81A 3VNZA 2BVWA 3SR7A 1QOXA 1ZZMA 4DBWA 2OKTA 3IGHX 5CJ5A 3BARA 3GXNA 2ZDRA 1BF2A 5BRBA 1EP2A 3PTDA 2R1KA 4IG2A 2G97A 4EF9A 3B3DA 4F66A 3ABXA 3AO0A 3MO7A 4JDBA 1XP3A 1OX4A 3W2NA 2QJHA 4W9TA 3T07A 1BD0A 3KDNA 5EBAA 3G1YA 2E6AA 1BVNP 2LLEA 3W28A 3H2AA 1DTUA 2I9EA 3LG3A 4H2CA 3SCPA 1O5KA 2X0YA 2WZMA 3ZWTA 2VC7A 3UW6A 1SO3A 2PI6A 2DQWA 3GTFA 1MQRA 2CKRA 1Y5VA 5C8BB 1VJIA 2QAFA 4XO7A 4P7OA 1NF0A 5M03A 5B80A 4IJRA 4Z2JA 2XGIA 1FX6A 1O5RA 1AFSA 3DI0A 5FAGA 3T2QA 5EU9A 3PSWA 5D2XA 3BJFA 4DNMA 2D2HA 1XUUA 3EPNA 3WLSA 1YE4A 3C2VA 4JX4A 3ZS4A 4H1ZA 1GOWA 4DJEA 1JAKA 3BG3A 1CT5A 1UR9A 4J35A 1RCOB 3LTYA 2O9RA 1IEWA 3BLLA 1KTNA 1QK2A 4Q8VA 3AHZA 1ZS2A 3N2BA 1LOSA 3E2QA 3MVIA 4O53A 4C6NA 8XIAA 3W7NA 3ARQA 2NXHA 3W7RA 1U30A 3ZO9A 3R1ZA 1ZJAA 3WNPA 4PTWA 4K37A 2GJXB 2PPGA 1NWRA 3TOYA 3M5VA 1Q6DA 5HPOA 3FFSA 3N73A 5I3IA 2ZRVA 2BOFX 4CQAA 3T0AA 2GGIA 1PCWA 4U2ZA 4HTYA 3K4AA 3P80A 3WF4A 4TMCA 3PFRA 1W9BM 1OGSA 3REQA 4LANA 4PULA 5AVNA 1AH3A 4C1LA 3N9RA 4KCWA 4IUOA 5EMYA 1IWBA 3N19B 2FGZA 4ZFMA 1R9XA 1S2CA 1A0CA 5I03A 3G2GA 3H7VA 2HV5A 4GD0A 4D2JA 1EJXC 1OG0A 3W07A 5J5RA 3W1QA 1Q2SA 5KZ6A 3IUHA 3E0IA 4PGLA 4DWSC 4KBXA 1A53A 1Z89A 4JQAA 3NR0A 4MYXA 4PC8A 3RHGA 3EAUA 4KWOA 4XD3A 1YBQA 4U3CA 3LV5A 1UPPA 3SECA 3CEUA 5HNUA 2G50A 3KRBA 4OBRA 4FX8A 5D02A 2ZRZA 4AWSA 3WLRA 1EZWA 3QGVA 1WZMA 3WH5A 1V3HA 4U31A 1OEPA 4TMBA 5CSUA 1TQJA 4MB4A 4E3TA 2J27A 1PKNA 1WKFA 4AYGA 3R25A 1KCZA 1OK6A 2VNCA 3W7EA 2WK2A 1QK0A 1DWFM 4O1AA 2BMBA 4HHLA 3AIBA 3PUDA 1W8GA 5DT7A 2YDAA 3T09A 3R89A 1AZ1A 1GJUA 1OC7A 1X7IA 2EEXA 2QV5A 2CHNA 3NO1A 4CKQA 4DQWA 1GK8A 3W6YA 5SWUA 3MSYA 3OVRA 3NM3A 4C6FA 1UKTA 4MKSA 2Z7GA 2V63A 3HBLA 3MBDA 4WGHA 1G7UA 4DYEA 4C1KA 3OZPA 4CU8A 5C9XA 3S83A 3H2NA 1KFWA 1TPC1 2O7SA 3U48A 5H8MA 2PA6A 1JDEA 4HP5A 1T0OA 2X30A 2EPMX 3QHNA 2GJXA 2J8FA 1C90A 3PBVA 3VD9A 1LQ0A 4L6HA 3HG4A 4GUJA 3GO2A 4JL1A 4EAMA 1XH2A 3C86A 4UTIA 1FFRA 1QFEA 1ITUA 4MUZA 1S39A 2H8ZA 3TX9A 3A24A 3PWIA 3VCCA 3HQOA 1QPRA 3WQGA 3SAZA 3IPWA 3JR2A 3WQVA 2R6OA 3CEPA 3W3OA 3VD7A 2J8GA 3GKFA 1ZAJA 3WEMA 2X0HA 3CMFA 3CNYA 2G0WA 3AHVA 1JFXA 1ZJBA 1UD4A 1WXZA 4DZHA 2BV9A 3H53A 1GEHA 2VCAA 5BWAA 1XV8A 2WVTA 3KBWA 2J62A 1R47A 1RJRA 1W1A1 3TN3A 3PBGA 5C7HA 4BK9A 3ITOA 1SSGA 2AL1A 4UMBA 3SJ3A 4IX2A 1GVEA 3AQUA 3BOXA 2C1IA 4ZB5A 1OIMA 2XN2A 5BU6A 2ACSA 3F4NA 2J9YA 1K6WA 5BMXA 1W9UA 1L8PA 3WDJA 3ZIZA 5KITA 3F1QA 1P48A 4JN7A 4L1XA 3MWCA 1EJRC 1EA9C 3V5FA 4AD5A 4LUIA 1AH0A 2GJLA 5K2ZA 3OZMA 1XUZA 4JTRA 1TRIA 1K8XA 4KERA 1E6PA 2EO7A 1B0IA 1Q6QA 5BOFA 4FMVA 1H62A 4Q33A 4QM1A 3ABZA 3N2XA 1PKLA 4CD5A 1G4SA 3NSXA 3CQHA 1TYGA 4KFNA 1DIKA 4XAFA 4O54A 4BJHA 4QEHA 2Y61A 2J8TA 4DLFA 1ZU8A 3DC8A 3S2LA 2A0NA 4EP8C 1XRFA 4GVIA 2X1IA 1GJWA 3C56A 4LOCA 4KIRA 3V0SA 1CGTA 2NQJA 3W1NA 3FXGA 2BVTA 4XBSA 2QW5A 2EPOA 4YTSA 1RV8A 3NUKA 4ROPA 5I3FA 1ML1A 4CQ9A 4N4PA 2SFPA 5D38A 4Z2HA 2YPIA 1W1ZA 2PDUA 1V03A 3WCZA 3NVDA 2NSOA 4B4FA 5CCZA 4YWSA 3SUWA 1HO4A 2GLKA 3S0CA 3VD4A 4KCUA 4QEEA 4DRSA 3W86A 1X98A 1MRAA 1XJBA 2B81A 1I2PA 4L5ZA 2C19A 3HFTA 3O63A 3PTQA 2DW6A 4E2DA 2PD9A 4QDMA 2CZ5A 3LA4A 4AAJA 4ICNA 4X63A 3SRDA 3Q58A 3AIUA 2P10A 1L8NA 3SRKA 2ZUVA 5TIMA 3C2YA 4HVXA 1PTAA 4DLMA 4PCFA 3WH9A 5HR6A 3QGAC 2ICSA 4N42A 5I3DA 1E9ZB 1NDYA 1MQQA 1F6PA 4LYKA 3GIPA 1CPUA 3T44A 3UXKA 1D2KA 1EJTC 4XAZA 2FPVA 1PZ1A 1RQEA 1UD6A 3E6EA 3LK6A 2CERA 1DXIA 5HPCA 3W22A 3B8UA 3VOHA 1IYXA 1J0YA 1R3QA 1XDJA 1PAMA 3E96A 3QQ0A 4XKYA 4DX3A 3VZXA 5FL1A 1MYRA 2VO5A 4KEVA 3W6MA 2AQOA 1TCDA 5AC8A 1E55A 1JPIA 1FWAC 2DUXA 2O9OA 3O3RA 1FWNA 1Z48A 2P0IA 2WHKA 3UXIA 3W82A 3WX7A 1GVOA 1CECA 2QCMA 5AC6A 1E9YB 3SO7A 3TLLA 3GHSA 3RUBL 3FYOA 4PL1A 5CLTA 1SR0A 5CC5A 3WF3A 4IIEA 4BFAA 1T96A 3W7IA 1QI3A 1KXQA 3S2MA 3PWGA 4EPKA 1MDRA 3S9IA 2CKSA 4L9YA 2Z0IA 3TDFA 1VC4A 4JPGA 6XIMA 1D3CA 2RDXA 1RBOB 3KWSA 4C6DA 2ZCGA 2OWCA 3RO8A 4C91A 1R38A 1NJJA 4J3XA 4MSSA 2O92A 1TJ1A 2OYMA 3AI0A 4QSHA 5BXSA 3WD2A 3HQ1A 5CZ0A 5IFPA 5A6BA 5LXXA 4UNKA 1B4EA 3E5BA 3BZGA 2ZTKA 3F5LA 2VC6A 3DFOA 3A9BA 1F4HA 1VYSX 2F6KA 3AS3A 2BOEX 3CZKA 5JUVA 3N4EA 3CL7A 4CU6A 3C0JA 3WBWA 4N2YA 4S3GA 3WLNA 2Z1XA 4JTSA 1KFKA 5BOEA 5FD0A 3TR9A 2R94A 5DO8A 1GQIA 1L6SA 3L0NA 1IQ8A 5FSEC 2R91A 1PX3A 1XSKA 4JY8A 3V36A 3MMDA 2Z26A 2DVXA 4ATWA 3KLKA 2IXUA 1QPNA 3U9IA 1S38A 1NTHA 3MZNA 1OCNA 2QJNA 1R9ZA 1XHGA 2WMJA 3W7GA 1DJIA 3U4AA 1FBAA 4GIYA 3DKLA 1YYAA 3MA8A 4PYSA 1DJGA 5H1WA 1XKYA 1E9IA 2R1PA 4MAZA 1XIDA 2XH0A 3P62A 4YTRA 4X60A 2QGHA 2P50A 1REQB 5BMWA 1I75A 3SCOA 4ZFCA 1QU4A 1YNQA 3VIFA 4NHVA 2CWXA 2QT3A 3STCA 1HXJA 1X1OA 3S9ZA 5I3HA 2AQVA 3ZZ1A 1TPUA 1E70M 4B92A 1CWYA 2VGFA 3ZWSA 1AQ0A 2GGJA 2CZDA 2JALA 3L4YA 5LHEA 4YVVA 4XZWA 4W8AA 5HMDA 3GXMA 4PA8A 2ZX6A 2RAGA 1XLFA 2VELA 4JTJA 2XIMA 3GG8A 5CZTA 1UH2A 4H7ZA 4QLKA 4DZ5A 1YPXA 1RCQA 1RCXB 3H2FA 4OV4A 2V68A 2XFRA 1XLGA 4D6EA 3THCA 2TSYA 2X1RA 3CK5A 3DIPA 3H21A 5HJYA 1HGYA 3PZQA 5T9CE 4CVUA 1IZJA 1X8CA 3NOYA 1WOBA 3A3HA 3UETA 2DJLA 1JG9A 5FF0A 3LBCA 1I2NA 2DGAA 3LENA 2HNHA 1GW1A 5AHFA 5CJNA 3GNDA 3RILA 4MYAA 1KKRA 4D8LA 1EGMA 1OZQA 1WDSA 3I4EA 2C13A 4H7CA 1FP9A 2A3AA 1BGAA 1W1VA 4C6CA 2KZHA 1GQLA 4HJWA 1DWGM 1UWUA 1Z69A 4MMWA 3KBJA 3CB3A 1FA2A 2O4MA 3AMCA 1F7BA 3V1PA 4WRHA 1M1BA 2D3NA 5KINA 3SEPA 1UCWA 7CGTA 5F4XA 7PTDA 3CLMA 3FVMA 4XD5A 2NXIA 3TAKA 3G1VA 1S1RA 1PL9A 3HPAA 2INEA 4D6HA 3LHWA 2WKGA 4RCXA 4L1WA 1KFEA 4O12A 3ARTA 3PHAA 2I57A 2XZ7A 6REQB 2NXGA 2AL2A 2W62A 3NA8A 4L64A 1LWIA 3EB4A 3BC9A 4GGHA 4IP5A 4PZVA 1U5VA 4NZ1A 1WDRA 1FKWA 3CUGA 4B5TA 1RJPA 1IF2A 1HO1A 4Q4RA 3KP0A 4XUGA 5HUPA 2I17A 1H7OA 5A6LA 2PTZA 2ISFA 3I7RA 3CAQA 4PUNA 4QHRA 1DXEA 1SUXA 3ZVIA 4IMDA 2W92A 3WUEA 2FGLA 3ARUA 3F4WA 3ZT5A 1UP2A 2GUUA 2CLPA 3WLIA 5A8PA 4W7WA 5LIWX 4MADA 2R1NA 3G0XA 3WDIA 2FZNA 1ZJHA 4GIEA 4FNTA 1WNOA 1XIGA 1K1DA 3ENLA 1FKXA 3VGHA 1M5WA 4JGDA 1KM2A 4EAYA 2DVUA 1TV4A 5F1UA 2W27A 2OX4A 3E1F1 4FLOA 4R9OA 1C8QA 4UFLA 3T0DA 3F7JA 2WBKA 1R3YA 3TN5A 2BX7A 1HFBA 1ITCA 1VD6A 3QYQA 4XTDA 3FJLA 1OVDA 2CLEA 4MG4A 4LUYA 1K02A 1SO5A 3QR0A 1XISA 4ML4A 1ZTVA 2WB5A 3IGXA 2V30A 2VRJA 1OWQA 3RLUA 3ZJ6A 1NAL1 2QS8A 3OBAA 1V4YA 2YW4A 4IOTA 3BUVA 3ZJ8A 1JYVA 4IGNA 2HNEA 1GVYA 5LKYA 1JEZA 4L80A 1XYLA 2WANA 3PAOA 4TX8A 1RHCA 1DWHM 2W4XA 4AEOA 2WSKA 3BGAA 2DH2A 4WDXA 3W0KA 1G01A 2JGQA 1JR1A 4GIRA 4JIQA 3AMKA 4GKLA 2VRKA 1XPGA 1FCBA 2Z1WA 1OG6A 2REQB 3K2GA 2WCSA 1LYXA 4FZIA 2PDXA 1V6WA 5E9XA 4NKCA 1TG7A 2WNNA 3O6DA 5C2XA 3BAJA 5RUBA 4WZHA 3IIXA 4ZODA 4P7RA 3W1XA 3MC5A 1ME9A 3FN9A 2Q3RA 1G94A 3WK2A 1FWEC 1MO0A 1TZZA 2F38A 3KVMA 5BWFA 3ZR4A 3NQFA 4UFHA 3VPLA 4KCTA 1C8YA 4DJDA 3WQ8A 3LXCA 3CHCA 4S38A 3OIHA 2WZTA 3H8AA 4Q4QA 2ABBA 4J5NA 5GNYA 2PCEA 1E0VA 3ISIX 4IIGA 2CLKA 3HGRA 5I3KA 1PCKA 3QOMA 1EF2A 2NVDA 2WVVA 4RKAA 5G4WA 5FOOA 3EWZA 3QJAA 3RCMA 3DKJA 4I9AA 1H5VA 3G18A 2J13A 8TIMA 2BODX 3P74A 2Y7EA 1ZCCA 5AB3A 3H7RA 3N34A 2YSWA 1XBXA 1U2YA 3GQYA 4QBXA 4CNOA 5I2UA 3F5JA 2P3EA 2XG9A 4Q4OA 3AUOA 2J7FA 1OQFA 3APYA 3S6DA 2QJJA 4Y8EA 2BNJA 3W81A 3CJPA 2A3CA 4X2RA 3LNMA 3E2SA 1Q7MA 3ID7A 4IIHA 2DZTA 3I7SA 2VR2A 4Y9MA 4AZIA 2R14A 2WO5A 2OOFA 1B31A 3GH4A 3R5EA 3A47A 3UY8A 3M0MA 1JUBA 2VQUA 2ZA3A 3DFPA 1UA3A 3KVLA 4MB1A 4PMDA 4W4QA 1TMQA 1DYSA 3PJWA 3S6OA 4B5VA 3SGZA 1DPMA 1LBFA 3EEZA 2KX9A 3OA3A 2HWGA 4XD4A 1MW1A 1KV8A 3QPYA 3EDKA 4EANA 5EA9A 1O7AA 4A35A 1JZ7A 1B3XA 3PUEA 3VU2A 3HB9A 1Z41A 3N11A 5AVHA 3UPMA 3GR7A 3UWEA 1MMFA 3K1DA 3QC0A 3C8FA 2NX9A 4HMNA 1N8WA 5F4SA 5FKYA 1F9CA 3OP2A 3NG3A 3QLLA 5HINA 1IEIA 1B30A 3U8GA 3NZPA 1BYAA 3JW7A 1UIOA 4I8YA 1M04A 4DF2A 3AIEA 3NQEA 1GVQA 1QPKA 3CQIA 1DXFA 1EZ2A 3PPFA 1WQ5A 1TFVA 4FOKA 5FESA 3VXGA 5JH2A 2CLHA 5JU6A 4JEJA 3WDRA 3POHA 5DLCA 1P0KA 2HE8A 4B5UA 3NURA 5JBEA 1XGZA 3M0JA 4WSKA 3FY1A 2YFOA 5E6YA 1CXLA 4GRSA 4CN1A 2HSAA 4OTKA 2DSUA 4AQLA 4IIBA 2ZX7A 4LC6A 2XGZA 3GW0A 2JKAA 1AMYA 3WLKX 3N29A 3LGEA 3FKRA 3UJRA 2X1UA 5JMUA 3WK3A 1F6YA 2ZUUA 3SQLA 4LVAA 1PIGA 3OLGA 2GK1B 1XCWA 1S1PA 1DJNA 1WUEA 1ALDA 4JTAA 2GJPA 4OUEA 3L2IA 5DMNA 4AVNA 4DJFA 4LVFA 3W29A 3BGGA 4IGHA 5C9UA 4QXIA 2IMRA 3K8MA 1VPXA 2G3MA 3RR4A 3NQGA 3VDGA 2WSRA 5AHMA 1ISYA 1KGUA 1CXKA 1ONWA 2YIHA 3OBKA 1OJXA 1FH7A 3L4UA 4LUSA 2GUBA 3BQ5A 4EXQA 5A95A 2G8ZA 5E70A 4GISA 3F4DA 3UCDA 3S5NA 4G6CA 5I00A 3LBMA 3MUXA 1EO5A 1IR2A 2YCJA 3FKKA 4D8ZA 1SMDA 2V3EA 1EIXA 5CPNA 1E0WA 2D2OA 3H7UA 2OEKA 4AXKA 1LWHA 2OPJA 1A5CA 1VEOA 3V16A 3EDJA 2QEZA 1QOQA 1B54A 1GOXA 1QWKA 2RDUA 5DCBA 3HG5A 5I77A 4XZ9A 2QLYA 3L9CA 4GPNA 3K13A 2V2HA 3AICA 4ZO8A 4WLCA 3BQ6A 3BE7A 4Y6GA 3W26A 5I24A 3ZOAA 3CH0A 5AC4A 5I06A 2YB1A 3WBXA 2OQYA 2BGSA 3MWAA 4WQ6A 4KIEA 3CH9A 1X7FA 4NZCA 1EGZA 2YB4A 4YS1A 3P67A 3TZNA 4FX6M 2CWNA 2OZ3A 4IGMA 1A5UA 3PULA 4FHAA 3WNMA 1TWSA 4A3UA 3BURA 4XZHA 2J78A 4K36A 3IAQA 3P84A 4YL2A 3VMOA 4MB3A 4Z0JA 2I1OA 4NIRA 1JD9A 3TYDA 3G1XA 2ZUMA 3EYPA 4GI8A 3MO4A 4GE8A 4GWEA 1TCMA 3RX2A 1BFNA 3A3XA 4LAOA 3KDOA 2ONEA 4MWAE 1FTXA 1FCQA 1GOIA 1IZCA 2E0PA 1SFSA 1ZAHA 4UCGA 4KFPA 1TPWA 3VKKA 3LM3A 3UXLA 1RJQA 2PP1A 4HSOA 5J5DA 1PJ9A 4DJEC 4XG1A 2PDQA 3GTHA 1FH8A 1SW0A 3VYLA 3ZR5A 3WLQA 1A5SA 2A79A 1E43A 1YX1A 4X61A 1TPH1 2E68A 4B3ZA 4DJDD 4CQCA 2PWDA 1X6UA 3GH7A 1DORA 1J0KA 3PSVA 4WX2A 2INZA 1OD0A 4DM1A 3UERA 3UYCA 2H6RA 3B0YA 3BCFA 5G4HC 3NXFA 4Y9NA 1TO3A 3F2BA 4WJXA 4QLJA 2X1TA 4WDTA 3WLOA 1NDVA 1QAPA 4DXKA 2ZRXA 3CU2A 1LORA 2WLYA 2WJEA 3P61A 1V6YA 3WEOA 4AC7C 4ZO7A 1I4NA 2HS8A 2P3ZA 2E5DA 1LT8A 1DWAM 4ECLA 4MWAA 1OBAA 5HQEA 1P1XA 1C92A 2ZBTA 1TE6A 3EWBX 3QMRA 2E28A 1R9YA 1LUCA 2EQDA 2CITA 2DZBA 3G0UA 1EEXA 5AY7A 2Y0FA 5HNNA 3ZJ7A 2H3DA 3H4XA 1FH9A 2ZFAA 2V2DA 4Z1DA 3CV1A 1XC6A 2PSNA 1BVWA 5FJJA 5IDZA 1SJCA 3ZR6A 4PUUA 2E8ZA 4ENLA 4L6DA 2DQXA 3G3DA