4CLMA

Structure of salmonella typhi type i dehydroquinase irreversibly inhibited with a 1,3,4-trihydroxyciclohexane-1-carboxylic acid derivative
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
251
structure length
243
Chain Sequence
KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVIAVNDLRSVLMILHNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Irreversible covalent modification of type I dehydroquinase with a stable Schiff base.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
total genus 95
structure length 243
sequence length 251
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4clmA00
5K9XA 4CCEA 4O54A 5K2ZA 4BI7A 2VFGA 2EAWA 1KFEA 2A2IA 1UUOA 2DP3A 3HB9A 1ME9A 4WJEA 3OG3A 1VH7A 5HJLA 3N34A 4HPXA 1IGSA 1W3IA 3LXCA 1LBLA 3ATZA 1VQTA 2CLEA 2GVJA 3G1VA 1OFDA 4MOZA 3PUEA 4FF7A 4O57A 3W1PA 4Z1BA 3B06A 1KM6A 1GZGA 1JQVA 1Z44A 3C2OA 4W9TA 2OX1A 2A6LA 3NL5A 1O60A 3RK8A 2WO5A 3EEGA 1C8VA 4WD0A 4LRSA 3LHUA 4E2DA 5EKYA 3JS3A 3QSTA 4WOQA 4Y90A 4K8HA 2ZYFA 1H61A 4N6FA 3A5VA 4H6KA 2Y88A 4RK8A 4FIQA 5AC6A 3SJ3A 1H5YA 3EKLA 3G18A 3LRKA 1WQ5A 4NNBA 2XN2A 3TE9A 1YPFA 2ALDA 2DORA 2WSYA 3TC7A 5D2YA 2TMDA 2QCCA 3LRMA 1YDVA 5H91A 1YADA 3ELFA 1OVDA 3DXIA 2YFNA 5A8GA 1S5WA 1LBMA 3LHVA 4Z1AA 3TAKA 5G4EA 1SU5A 3E12A 1PE1A 3RFAA 1TPEA 3HBLA 2YPIA 4JGDA 3S1XA 3CTLA 5IBXC 1T99A 2AQWA 2FQIA 1PVNA 1X1ZA 5E0KA 2EHHA 1IIGA 3S9YA 2NWRA 5G1YA 1WV2A 3EX4A 2E68A 2J9YA 4IMGA 4JDBA 3NQ8A 4NJJA 4LUJA 4UC5A 1LDCA 4X9SA 2QCNA 2P0OA 5KSWA 2OJPA 4AHOA 3FS2A 4KFPA 5DBTA 4MYAA 1SO5A 1OK4A 1TV7A 5TQLA 1P0KA 3WK2A 5K9DA 1ZAIA 3C2RA 2B0MA 3F4NA 3LI0A 1XFBA 2JKPA 1TIMA 1L9WA 3H55A 4O1DA 3ZWSA 4FHAA 3R2GA 1BWKA 1KW1A 3IGXA 3TW6A 3BVJA 3TJXA 5D2TA 3NYZA 4MJMA 1ZHAA 3JR2A 1LOLA 4NZFA 3LTSA 1JCNA 4MFDA 2G95A 3DGRA 3O63A 4UFHA 1GVQA 1UUMA 1ICPA 3ANYA 3OEXA 2PRLA 1GVOA 1ZENA 3IIOA 3FJLA 1Q6RA 2YYTA 2JBMA 3WJWA 5D09A 1KBJA 2EPHA 2I14A 2Y70A 4IQLA 5BNKA 2F84A 3W7EA 2QUUA 4GUJA 4XTDA 5F2MA 2GJLA 5EPDA 2A7NA 4RLIA 2VEIA 2W79A 3P81A 4JTUA 1DOSA 3G22A 2Y7EA 4BWLA 4RX0A 5BOOA 4GJ1A 1XBVA 3W2MA 1TPC1 1NVMA 1GTHA 3LB0A 3LCGA 2HS6A 3UXDA 1J4EA 1G6CA 3H54A 3LCHA 3LERA 1OFPA 4EVZA 2CWNA 3ZWTA 3RMJA 2XN0A 4MKNA 4YMZA 3NPVA 3D0CA 3LV5A 4RZ6A 4UTWC 4HNVA 2J6XA 3TA6A 1H63A 4UTLA 3UQNA 1FDZA 3HGJA 1DL3A 4XQ6A 1EUNA 1TRDA 2YW4A 4UTTC 1VCFA 3OBKA 1J5TA 4NQ1A 1EWEA 2WKJA 2ZFAA 5D03A 3I7QA 3VI2A 1ICSA 3TQVA 1LROA 4UIOA 5AC7A 1W54A 3W7HA 4ZQNA 4LNYA 1IXOA 3G1YA 3NAVA 4O12A 3N19B 1QPOA 3A9IA 2WV8A 4ONVA 1VZWA 4TU1A 3N3MA 3TC6A 3W07A 2BZNA 3MYPA 1OYCA 3KRSA 3FFSA 1ZNNA 1SW7A 1VLIA 1JRBA 4O8RA 2QCEA 3LLFA 3UWVA 3W7QA 1ML1A 2E6DA 3L67A 2YR1A 2C0AA 2YW3A 1TTJA 1DJQA 2TSYA 3DENA 1VCVA 3NPWA 1HO4A 4FO4A 4OU1A 1ME8A 2VEMA 1MEWA 1ADOA 1YDNA 1W5QA 3WFAA 1FXQA 3R5EA 1GVRA 3NQ6A 4NX0A 3LHWA 1YLVA 1WBJA 3PULA 2X2GA 3IV3A 4O4VA 4K38A 2G96A 3L5AA 3T40A 3P80A 2ZRZA 3NPUA 3M5YA 4UTHA 4K7YA 1SW0A 1G4SA 1TPVA 1PIIA 1QCWA 4GUIA 3E96A 4ZZ9A 3WJSA 2QCDB 1NSJA 3LRLA 1TQJA 1K3UA 2QR6A 2JK2A 4LW7A 2X1SA 1WA3A 2V9DA 3WK0A 4FX8A 3MJYA 3KVKA 2FTPA 4IPJA 1VHNA 4O11A 1RV8A 1QPRA 3P62A 5TBOA 3NM3A 4YCOA 3Q94A 5EL1A 3QMRA 1X6UA 4WY0A 1L6YA 1ZAJA 3W87A 3W7OA 2B7PA 2FPTA 1YTKA 2A21A 5HINA 3CM4A 4G1KA 1LORA 1XDLA 4N9EA 1O95A 3GAYA 4O16A 3C2FA 1PV8A 1G4EA 4O1AA 3W2NA 2C15A 1YXCA 3T4CA 3DKJA 2E5DA 2VKZG 1JUKA 2E77A 4GC4A 2A0NA 4ML9A 6TIMA 3THQA 1AW1A 2IQTA 5CG7A 5FESA 3MP3A 3CEPA 1AW2A 5CZTA 3RU6A 3FIGA 4JIPA 1TQXA 4Y9AA 3PR2A 5EMUA 1OABA 1SQ7A 3TMLA 4K37A 3B8DA 2VEKA 4RZ4A 5KINA 2NUXA 5F1UA 2YXGA 1W31A 3B0UX 3O8AA 3O16A 3IVSA 3EX1A 2TPSA 1LRQA 2GUUA 3W7DA 5G4WA 3EB2A 1EUAA 4AWUA 4JY9A 3PM6A 4BR1A 1OK6A 4DF1A 4AF0B 3WJZA 1I2QA 3STCA 1KM0A 2E5BA 3BARA 4POCA 3M43A 4E0CA 5F2GA 5TIMA 1KFKA 3HGRA 4WY0F 1R2RA 2O7SA 3PBVA 3G1HA 3G24A 1TPB1 5J5RA 4CNPA 2JGQA 1TV5A 1J2WA 5AFDA 3CPRA 4EF8A 2X30A 4IGHA 2Q3OA 2YSWA 3B04A 3I7SA 4H4IA 4DXVA 2QJGA 1TO3A 3W7LA 3GXNA 3RLUA 4A3UA 2VENA 5LHFA 1Q6OA 3L5LA 1QFEA 4IX2A 3M5ZA 4WZHA 3TSBA 1TYGA 3UPBA 1LTDA 4AWTA 3IVUA 1KA9F 1K8YA 2ZA1A 3C8FA 4HHPA 2VFEA 2J27A 5DN1A 5HMSA 1Z48A 5CPMA 4PC8A 1TRIA 5CKSA 3TDFA 2R8WA 1SO3A 1EIXA 3W74A 4N9DA 1QOQA 2V5BA 1HG3A 4DBEA 4DEFA 1KTBA 1M6JA 2A4AA 4JDYA 5F2LA 1MEIA 1OG0A 3V1PA 1F6KA 3GZ3A 1OFRA 3C2VA 5FEWA 5KMYA 4ADSA 1WOBA 1HL2A 3B4UA 2Z6JA 1LYXA 1XBZA 3OVQA 5SWUA 4K39A 4LVBA 1PCWA 2QAFA 4K36A 4U28A 4PL2A 1F7BA 1R2TA 2YDAA 4LOCA 5J5DA 2ZA3A 1Q3NA 2A6NA 2NXHA 3M5VA 4MZ8A 4LVGA 1M7OA 3L0NA 3GNNA 3NOEA 4RZ5A 1H51A 2QCMA 3G3MA 2E1DA 3CQ0A 2CLFA 1A50A 3NQCA 4K6AA 3FYPA 4QQ3A 5LSMA 2V82A 4BI6A 1UB3A 2ABAA 5CPLA 3P67A 2XFWA 5AHMA 3Q58A 4MY8A 1Q45A 3FEMA 4PEKA 1C29A 3GAKA 3GDMA 1QOPA 4IMEA 4XKYB 3UWZA 3QFEA 4ZQCA 2VXNA 4P61A 1K7EA 3OIXA 3PBYA 1TTPA 4UCGA 1U83A 5C6MA 4L4LA 4IUOA 3MW7A 3HGSA 5AN7A 7TIMA 3TU9A 1QWGA 3UWYA 4P2VA 2CLOA 3LCIA 2QDHA 4X22A 3NQEA 3USBA 1G67A 3INPA 2NZLA 4UR8A 3KOFA 3DBPA 1IXQA 3LM7A 3TNOA 4QIUA 4JTHA 3W1UA 3UZJA 2HTMA 1JUEA 1N7KA 4WQ6A 3O05A 4UTMA 2ZZ3A 4UFLA 2H8ZA 1OFBA 5AYXA 3NEVA 4IXXA 6ALDA 4LS0A 4UXDA 1FCQA 1RQEA 2V2HA 4BI5A 2CU0A 5K9CA 2Z6IA 4M19A 1VYSX 1TPDA 2ZRVA 2YFOA 3B0VC 5U4NA 4D2JA 4QSHA 4LS2A 4HIBA 1KTNA 1G7VA 5BRBA 1SSDA 3EX6A 1JJKA 3VE9A 3L68A 2X16A 4HSNA 2QJHA 1SZEA 3IRDA 3UYCA 3EWYA 1I4NA 4R7JA 3T7VA 4UTKA 3W7IA 4O14A 4RV8A 3W22A 4CQ9A 3W1MA 1GTEA 4O52A 1FBAA 3ATYA 3W76A 4NJHA 4LU0A 1RD5A 4AWSA 1JCMP 4RXFA 2VFHA 1KV5A 4YXGA 2DZTA 3IGSA 1SW3A 3MBDA 1HTIA 2WQPA 3R8RA 3GXPA 1PHQA 1F5ZA 2C3ZA 3MP5A 4OV9A 1WDWA 3QQ1A 5D38A 1TPWA 3KRZA 1VYRA 3KHJA 4LVFA 4RXGA 1AL8A 3PUDA 5D02A 2FIQA 2Q3RA 4R34A 5D37A 3FOKA 3E0IA 1LM1A 2V81A 4O50A 4LT9A 2QUVA 3CB8A 1KM4A 3LCFA 5D2WA 2Y89A 3LBMA 3O6CA 1HO1A 2H3BA 2YZRA 3O07A 2NX9A 2EF9A 3P5ZA 3HOJA 3DHFA 1BTMA 4ORIA 4E2BA 3PBUA 4JTFA 1HFBA 5DLCA 4YWIA 1XKYA 4S1FA 1ONRA 2WSQA 3G1XA 4OT7A 3QJAA 4FNRA 1PHWA 3W7CA 1SZNA 1TJRA 3NVTA 2F7FA 4NUWA 2ABBA 3CWOX 4KFOA 1UJPA 3HPXA 4ZQPA 2CFFA 2EKCA 3W7MA 2WPBA 4JTEA 3L65A 2E09A 3STEA 4O0KA 1YDOA 3P82A 2FPVA 3DFPA 2OZ0A 3G0SA 4OHQA 2Y7GA 1H60A 3IIPA 4IOTA 3E02A 3W72A 2CLKA 3QF0A 4FXSA 1H50A 5CPOA 3UY7A 2I1OA 1OFAA 3QRHA 4Z0SA 4WUIA 3BW2A 3ABRA 4ADTA 1SPQA 3NQGA 5L6UA 3B0PA 4JD4A 4JY8A 3PG8A 2Y7FA 3A22A 3N9SA 2BWGA 2Z1BA 3FKKA 4NU7A 2NXGA 5LNWA 3GVGA 2ISSA 4GBUA 3NR0A 1QDSA 4O1CA 1KLYA 5AHLA 2Q8LA 2ZZ5A 4TMCA 3TXVA 4ORMA 1EEPA 2A85A 4UFJA 4QAIA 3QQ0A 1KBIA 1S5VA 4Z08A 1EB3A 4MJZA 1YXDA 2J24A 4WOZA 2NUYA 3PY2A 4GRSA 5ABTA 2WSRA 2NWSA 1MXSA 3LX9A 2I9EA 1GG1A 5KITA 3NZ1A 4UR7A 5K3VA 1KM1A 2V2DA 1GJPA 3EKZA 3N2MA 5DXYA 1FWNA 4CNNA 4Y96A 1OFQA 1PL9A 2RDTA 1FWWA 3DHDA 4YL2A 4JTLA 2AGKA 1LCOA 3SECA 2P1FA 3L21A 1T8XA 3QPZA 3ZFHA 1LLWA 3LHZA 4QNEA 1SO4A 3S6DA 1F73A 1I2RA 3IVTA 4NT0A 5D2XA 1G4PA 4FXRA 3GB6A 5DCDA 3P74A 2ZZ2A 4YLWA 1IIHA 2DZPA 1WXJA 3V75A 4NJIA 1TSIA 1B4KA 4DPPA 3M44A 3K30A 1BWLA 4AXKA 1NFBA 1P5BA 1KTCA 1SZGA 2NV2A 4DO5A 4DPQA 3BW3A 4WY0B 5AC8A 2RDWA 4O15A 4NJGA 3PWAA 5I3GA 1W5NA 3E9AA 3TK7A 1CW2A 1V7YA 4PL1A 4ICNA 4ALDA 5LGXA 3STFA 5I3JA 3DI1A 5C2XA 5AB3A 4N6EA 1UBSA 3N2XA 3NG3A 4FIRA 1L6SA 5LNUA 1KFJA 2ATMA 1TJPA 3CT7A 3PVFA 3QMTA 1F74A 2A1YA 3TIMA 2QCHA 3C3NA 2GJNA 2CZDA 3W7GA 1SSGA 3MP4A 1FUYA 4IMDA 2RH9A 4TMBA 3HG2A 2C18A 3AJXA 2GQ9A 3LI1A 2OT0A 3EXRA 3LXAA 3B05A 1QNVA 2NV1A 3EWBX 2KZHA 2DZVA 4UTWA 5G2HA 1L2UA 1YYAA 4QITA 4QM1A 5BMXA 3N14A 3BGJA 3PAJA 3I68A 4FNPA 3QW3A 3G0UA 2V5LA 1ZAHA 3W84A 2WNNA 1FX6A 3W83A 4KFNA 4UTTA 3TXZA 3F1QA 1RVGA 3LCLA 1SR9A 3SGUA 3M5XA 3W88A 2ZTJA 5CPNA 3PB0A 3T55A 3W1TA 1SUXA 2JKEA 1AL7A 1D3GA 1IF2A 2B7OA 2PC4A 3BLEA 1H7OA 2FLIA 3QPYA 1VLWA 3DFNA 3VE7A 2V2CA 5F4XA 4CCCA 3VFLA 2B4GA 2Q8ZA 1JCYA 3HIJA 2ZZ6A 1KLZA 2QCGA 1EP2A 4CCDA 4GE8A 4NXSA 4OBTA 5DY2A 5IM51 3HF3A 5EYWA 4PTNA 4O10A 5DBUA 2Z0IA 4AAJA 3ABQA 2JKAA 4N4PA 3TMQA 1H62A 2YYUA 4O18A 2OCZA 4FNUA 3W1LA 3THAA 3LGEA 3PB2A 2FB2A 1XCFA 4IX0A 5H2ZA 1FY6A 1GG0A 5LNSA 2WNQA 4S2BA 3O1NA 3GLCA 4WXYA 1SO6A 3W7PA 1MZHA 4O28A 1H7PA 4GXMA 3DH7A 2P10A 2A7RA 5FF0A 1TB3A 3KFTA 2WOQA 3DU0A 3W7JA 3KX6A 1XBYA 4LRTA 4IXHA 2W0UA 4FEZA 5AHIA 4MUZA 4JX5A 3S42A 3QM3A 3EWUA 1LBFA 3L0GA 1EPXA 4NNAA 1WYIA 3Q2DA 3TSDA 5K7JA 1I2PA 2CZ5A 3GDTA 4O53A 4ZVJA 4JTIA 3QMSA 4QJ1A 3L2IA 4MVAA 3TFXA 2ISVA 2VC6A 1NF7A 1ME7A 4AVFA 3MHGA 1KFLA 1X1OA 4R53A 3M7WA 3R89A 2DJXA 3LV6A 4LS1A 3GKFA 3B03A 1U5JA 4Z1CA 2R94A 2H8XA 1ICQA 3SZ8A 3S1WA 1VC4A 5G5IA 3N73A 1LRTA 2YCEA 3SIZA 1OX4A 1WBHA 4BF9A 1F76A 1V5XA 3P7YA 4NJKA 1H7RA 1KM2A 4UFKA 1OX5A 3RLVA 5DELA 2R14A 5L9FA 4JYDA 1OHLA 3KRUA 1XI3A 3Q37A 5I3FA 5AYZA 1HUVA 4XWUA 3UPWA 4MZYA 4NZJA 3U6WA 1FWTA 3LBCA 2D73A 2Y6ZA 1ALDA 3IIZA 4A22A 1I2OA 3QW4B 4IJBA 1DV7A 1QPQA 2X1UA 5FF7A 3T44A 2BTMA 3W75A 3BGGA 1KV8A 5F2IA 4FX7A 5KTLA 1FCBA 1OF6A 3GK0A 2WNZA 1EWDA 2C16A 1JUBA 3HGOA 3PSWA 4LC8A 4JS3A 3SW6A 3HJZA 3EXSA 3NO5A 3L0KA 1W3NA 3W86A 4TX9A 2DZXA 4MFEA 2C19A 4JIQA 1K7FA 4OV4A 5K4XA 3NL2A 3DKLA 2O7QA 3S5NA 1D3HA 3QC3A 3NQ2A 5A5WA 3O6YX 3EWWA 1QO2A 3TUUA 3LTPA 4OQVA 4UFIA 1Z42A 3HPSA 1XM3A 1P4CA 2NXIA 3OVRA 1OYAA 1EP1A 3RF9A 1AMKA 1EX5A 3LHTA 5LKYA 3SY5A 1VGAA 2PCQA 4MYXA 1KM5A 4CNOA 1I45A 1B3OA 1QPNA 3UXAA 1VS1A 2ZRXA 2DZSA 1OX6A 5GVJA 1YTDA 2QKFA 4DQWA 3W6YA 1K8XA 4O1BA 2DZWA 4DO6A 4HPJA 4LY8A 3JRKA 5LGZA 4CQ8A 3W85A 3KVMA 3QZEA 4JN6A 3CWNA 1F2JA 4TR9A 1TPFA 2PURA 4I7WA 3DFQA 4NXKA 3O06A 4PH6A 3GX9A 2VELA 2Y7DA 5FF4A 1H1ZA 3NQAA 5DY3A 3HG5A 1W5OA 1YXYA 3TQ0A 4L4MA 3TKFA 5CSRA 1XUUA 1O5XA 2C6QA 3PUOA 4GUHA 5I3HA 4N4QA 3NQDA 3NNTA 1IXNA 1RZMA 4AEOA 1RPXA 5FI8A 4UTUA 1GOXA 3LCXA 4JEQA 3GDKA 3NXFA 3DZ1A 4JTSA 2ZZ4A 3NQVA 3BLFA 5D32A 1GWJA 3E49A 4RR4A 1UASA 1FDYA 5EBUA 1ZCOA 5FF3A 3FJ6A 3DFTA 5E1QA 2R91A 3PF3A 3W1AA 2QCLA 4Q32A 1JR1A 1H7XA 5EA9A 2VFFA 5FF2A 3LTYA 3N9RA 2BLEA 1TMHA 4CQAA 4HNUA 3GR8A 3S8HA 1CX9A 4K7VA 3GXTA 3KXQA 4O17A 3MUXA 3M16A 1N55A 3G1DA 4HNNA 3BPWA 4Y6GA 1JRCA 3S0CA 3TW7A 4JTGA 3S5ZA 4FNSA 1GPWA 2PRMA 1T0OA 1I2NA 5MHBA 1FDJA 4A21A 1KFBA 5C55A 1FCUA 1Q6QA 2A7PA 2ZA2A 1F05A 3S1UA 4MIMA 3PBWA 4X2RA 1LZOA 4UFMA 3HG3A 1JQXA 4EF9A 5G2IA 5FEZA 4NX5A 4X3ZA 1WOAA 3CHVA 4N02A 1M7PA 3M41A 4JTJA 1TCDA 4XUGA 3DFOA 1A5CA 4YCPA 3FYOA 4BWLC 4LUIA 2Y61A 2J88A 4FX6M 4XBKA 5D05A 4LV4A 5LNVA 4C1LA 3A24A 3IIXA 3W7NA 5U7SA 4O0ZA 3WK3A 4IMCA 3PSVA 1GYLA 2VFIA 3PC0A 3LDVA 8TIMA 4DELA 3SSJA 2ZBTA 3G1SA 1YPIA 3EXTA 4JX6A 3GYEA 2GQ8A 1G7UA 4IPIA 2E5CA 1SZFA 3NPXA 2WJZA 2QAPA 4ZQMA 1TPH1 1LRNA 3KVLA 3W2UA 1VCGA 1OYBA 3NL6A 1R30A 3ZS4A 3HG4A 2JGYA 4NVTA 3VKJA 1W56A 5C5YA 3W7KA 1W37A 3BG9A 1O94A 3MBFA 2TRSA 5HUPA 5EY5A 1JCLA 1KFCA 2C13A 1GVSA 5F4SA 3UWWA 4MLRA 3OVPA 1DBTA 4HSOA 4OGZA 3BV4A 3W9ZA 5D33A 3HPZA 1VPXA 1H7NA 5F4WA 5HQEA 4MZ1A 4JYEA 3L9CA 5DCEA 2Y85A 4K8EA 3QEZA 1A5BA 4AH7A 2CZEA 3TV8A 3TFCA 2CW6A 3LOTA 3GKAA 2HS8A 2VOMA 4GUFA 2H6RA 5BMWA 3BK0A 4A2RA 4RJEA 3NGJA 2YGYA 1LP6A 3SI9A 2QUTA 3OA3A 1SFJA 3A21A 1K02A 2PRHA 4E38A 5IBXA 5AHEA 2ATSA 1TTIA 1A5SA 2B7QA 5CZSA 1DVJA 3QH2A 4LVAA 3W1XA 1G4TA 3BG5A 3GNDA 1K7XA 2CLIA 1TPUA 3CEUA 3HQ1A 1OJXA 3W1NA 2ZZ1A 5CSSA 5T26A 3CIXA 4NNCA 4AMAA 1Y0EA 5LZLA 2ZRUA 2FPYA 3AO0A 1JVNA 4OWGA 5FEPA 1FWRA 1DKWA 3TAOA 1W8SA 3GIYA 1T96A 2GOUA 2NUWA 1SFLA 3W73A 2V0TA 3TR2A 3LCWA 1XXXA 3W2KA 4A2SA 2GPTA 4ZQOA 3NA8A 5HWMA 3G1FA 3C2EA 3G0XA 5CZ0A 1ZFJA 4HN4A 2QJIA 1Q6LA 3F4WA 1B4EA 3LHYA 4WXZA 4H3DA 5DXXA 3W23A 1FXPA 3OHIA 4DO4A 5HR6A 1XL9A 2OMAA 2FJKA 2AAMA 1QMLA 1QO5A 3TROA 3H53A 1ZJIA 4MY1A 1DQXA 3C61A 2BX7A 4N2YA 1MO0A 5CGQA 3A23A 1W3TA 2HSAA 3NQMA 1YTEA 1W1ZA 1A5AA 3MI6A 2CLMA 1EA0A 3MI2A 3GDLA 3NQFA 1XUZA 2GQAA 2H3DA 4MPQA 5E93A 3UWQA 1GVFA 4AB4A 5KZMA 3UY8A 2GVGA 2ZTKA 1W5PA 2V30A 1XBXA 4M7SA 1GYNA 5KZEA 1PCKA 3F03K 3M6YA 3C6CA 1XDMA 1JCJA 2E6YA 5HR7A 3FA5A 2QCFA 1BKSA 3MMTA 1DHPA 4BFAA 2RDUA 1BEUA 1Z41A 4N9CA 3U8GA 5FEXA 4UNKA 3IEBA 2W6RA 2XN1A 4KKXA 4LVDA 4TO8A 4UMCA 3SGZA 4TIMA 1VHCA 5AHFA 3S5YA 4UTJA 3TH6A 3G3DA 4IWWA 2C1HA 3U2OA 3WJXA 4FB7A 3C4UA 3A5FA 1E51A 3W2JA 3VNDA 2ZRWA 2B7NA 1DQWA 2CZFA 3SR7A 5KZDA 1VRDA 2E6AA 1NAL1 1TREA 2VEPA 5AHNA 4KWWA 3MHFA 4AHQA 1GT8A 1WX0A 1RQHA 4RKAA 4Z1DA 1LOQA 2DZUA 4GFSA 3P8JA 3MHUA 3I65A 1DJNA 1JULA 4JX4A 2QCDA 3GR7A 1S5TA 1ZY9A 1VJIA 3LXBA 1EP3A 3O6DA 3BG3A 3CC1A 2ISWA 3STGA 1R47A 1LLZA 4UUIA 5DCBA 4EOUA 1GQNA 1W0MA 5I3IA 3DFSA 4Q33A 2HMCA 5G2WA 1C9DA 4I9AA 1UCWA 3R13A 4I7VA 3TSMA 5F1VA 2J9ZA 4B5NA 4JTKA 4LC6A 4UTIA 1MSSA 1D9EA 2ZCGA 3MI3A 3S5OA 4JTTA 5D2VA 1VR6A 3UNDA 4ZQRA 2J9XA 3C56A 3O15A 4M6QA 4GUGA 4LTSA 3DAQA 3G1AA 4OE7A 4A29A 2FDSA 4Q4KA 3MWAA 2VFDA 1OX4B 5HULA 2UV8G 3W3OA 4PFMA 2NX1A 1OFOA 2TYSA 1FQ0A 4JXCA 4O19A 5AYYA 3ZR4A 4JICA 1RR2A 5BW6A 1I8JA 4JYFA 2ZQ0A 3T78A 4Y8FA 3KVJA 4PCFA 2CLLA 4EWND 1FWSA 4KWVA 3QSRA 1R2SA 2ZDRA 3FKRA 5HWNA 1B57A 4O4WA 1W5MA 4S2CA 4U4MA 1N8FA 1P1XA 3NQ7A 4UMBA 3C0JA 3FLUA 3TCEA 1TTQA 1H7WA 3EX2A 3UWUA 1F6PA 3EX3A 3HMJG 2G97A 5HUOA 1X8FA 2BXVA 3C52A 2E6FA 1OFEA 2NX3A 4Z0JA 4FNTA 4AF0A 5K4ZA 3UD6A 4JNMA 3SFKA 2ZZ7A 3RNDA 3P5YA 2V8ZA 1IXPA 3BW4A 3L5MA 4IMFA 4MLJA 4R33A 3QYQA 1ZALA 1OF8A 1GEQA 1THFD 5HWJA 4EIVA 4HNTA 5LHEA 1K03A 3BO9A 3MYOA 1H1YA 3WK1A 1RQBA 5CZJA 1S3HA 3W1RA 2PE4A 3HO8A 4HT3A 3S1VA 3P60A 2H90A 1B9BA 2Y62A 4C1KA 4PA8A 2QEZA 1M5WA 1QAPA 2OT1A 3LLDA 3PS7A 3WJYA 4M7TA 2Y63A 1NEYA 1K8ZA 1KM3A 3MO7A 5D30A 2A5HA 3M1ZA 3G8EA 1QR7A 3R12A 1R46A 2CLHA 2RFGA 3YPIA 1AW5A 3I7RA 2Z2UA 1AK5A 5D04C 5AOUA 3W71A 5C54A 4DF2A 3P84A 4UMAA 4M5PA 1LOSA 5I3KA 3TX9A 4I7UA 1O5KA 4DF0A 1A53A 1G69A 2EGZA 3GDRA 1AG1O 4XTIA 2ZRYA 1JCXA 4QISA 3NDOA 4UNLA 2GVLA 4O13A 3ABOA 2RKXA 1FCVA 3W70A 2BSLA 2G5WA 1P0NA 4JR5A 4LWWA 4FNQA 4AHPA 3W2LA 3PG9A 2C14A 3DI0A 4M6VA 3ABSA 4ZL1A 3G8RA 2FFCA 4ZMGA 3M47A 4N9BA 5LNRA 1DORA 5G1TA 3KAOA 3NL3A 4XZ9A 2LLEA 4GNJA 3TQKA 5HNRA 1O4UA 3EWXA 4RCXA 4MY9A 3I6RA 1XC4A 2RHGA 4M6PA 1NF0A 3IIVA 2X1RA 1TV8A 2DU2A 4J9JA 1X7FA 1L6WA 3L66A 3NM1A 3TJLA 4GWEA 2X1TA 3W7RA 3CIWA 3CU2A 4CLMA 4BK9A 4WX2A 1WAUA 1CI1A 4PODA 4XBSA 2QDGA 3W1QA 3NZRA 4HKPA 3CLMA 3P8IA 2QF7A 2YX0A 3P61A 2DJLA 4XKYA 2NLIA 4DBDA 1PS9A 3IGUA 3BLIA 3UZ5A 3VCRA 3M9YA 2FB3A 4LV9A 1VYPX 1MEHA 3M0ZA 4ADUA 3EWZA 4QNWA
chains in the Genus database with same CATH superfamily
3HTWA 1JPMA 1M7JA 2VFGA 1ISYA 1UUOA 1TJ0A 4ZB2A 3GXFA 4AX7A 3RUBL 1ME9A 4WJEA 3N34A 4H6EA 1Q65A 3K1DA 1XG4A 3W1PA 4Z1BA 3B06A 1GZGA 2VNCA 1A3WA 3NL5A 1G1YA 1O60A 1MW2A 3RK8A 2UY5A 3BAYA 2WO5A 3EEGA 1QHPA 4URIA 3LHUA 1TFVA 4QAWA 2IMRA 1M7XA 4WOQA 3GS6A 1WPCA 2ZYFA 1NDYA 1QW7A 4H6KA 4BF7A 1UZDA 5AC6A 3BAJA 4NSBA 3SJ3A 2E8YA 1R9ZA 3COTA 3P6LA 3DDMA 2YA1A 3WNLA 3GHRA 4Q4QA 3KBWA 1B9ZA 2PSNA 2WSYA 1UR4A 1N2VA 4B5WA 5H91A 3MWCA 4BKNA 3DXIA 4JN8A 5CC3A 7TAAA 3GU2A 4V2XA 3RR1A 2P88A 3LHVA 1AQHA 4OVXA 3TAKA 1SU5A 4DYKA 1EYWA 3WQ5A 2BB0A 2V67A 2R1PA 5IBXC 2CKSA 1X1ZA 4Y9NA 2ACUA 3WDPP 1IIGA 3S9YA 3URNA 4NZ4A 1EF2A 2NWRA 5G1YA 1WV2A 2J9YA 4JDBA 3NQ8A 3JVAA 4NJJA 1LDCA 4AC7C 4XD3A 4HK6A 4KFPA 4GZJA 4JFUA 1BF2A 5K9DA 3D46A 3OQ8A 3LI0A 1XFBA 4JTAA 1L9WA 3ZWSA 4KEZA 4JHZA 3N2TA 1KW1A 4AC1X 3BVJA 4IFOA 3NYZA 3IK4A 3JR2A 1Q85A 3L4YA 4TVDA 2YB4A 1AMYA 3O63A 3WQEA 4X61A 3VD7A 1ICPA 3LS9A 2PRLA 3OEXA 1ZENA 3WJWA 2JBMA 3GXDA 4EPEC 3MT1A 4DJFA 2PCEA 4AMCA 1ADSA 2I14A 4IQLA 3GVQA 3J7HA 2XSAA 2EEXA 2IPFA 2W27A 3AU6A 4GUJA 2GDVA 2FDMA 3WD3A 2WW5A 3P81A 1DOSA 4GYPC 4BWLA 3H2EA 2PTWA 1NTHA 3UVAA 3LCGA 3UXDA 1GTHA 1A5UA 1XQKA 2HS6A 3H2MA 3DERA 1G6CA 3LERA 1IWPA 1OFPA 4RE4A 2CWNA 2BGSA 5CEWA 3LLXA 4GG9A 2PDHA 4PBEA 4GCXA 1DL3A 4GBDA 2YW4A 4F3HA 1VCFA 3OBKA 4S3DA 2EPOA 3H7VA 3CV7A 3WDJA 1B30A 1ICSA 3VNKA 2G4JA 1IE7C 3WQFA 1QVBA 3WL0A 1QPOA 1UWTA 4WDWA 1U1UA 3K13A 3N3MA 4C1NA 4DI8A 4L64A 3ES7A 1W6TA 1VLIA 2Z7GA 7XIMA 2E6DA 3L67A 2YW3A 1HX0A 1ZSXA 1TTJA 1DJQA 1WO2A 2PTZA 1PTGA 1BGGA 1VCVA 1L6GA 3CGTA 1AJ0A 1MEWA 1V6XA 1YDNA 4W84A 1W5QA 2BHUA 1FXQA 3ZOAA 3VD5A 3R5EA 3LHWA 1WBJA 4GYJA 4O4VA 4RDWA 2J7BA 4CEXC 3P80A 3NPUA 3EPOA 4HPHA 1SW0A 1G0CA 1TPVA 3VDBA 1QCWA 1XR2A 2PDBA 3WJSA 1IEQA 3UA4A 3H21A 1TQJA 1K3UA 3WLOA 2OWCA 3WF3A 2QR6A 1UP2A 5C9UA 2X1SA 3DC0A 2V9DA 3WK0A 4FX8A 3ALFA 3NTYA 1Q7ZA 3P62A 3NM3A 3FXYA 2NV9A 3QMRA 1B54A 3A4WA 4M24A 4R9OA 1QJWA 1YTKA 1OD0A 1YE4A 5HINA 3CM4A 3TN3A 3OA5A 4BCEA 3GAYA 4B3ZA 1BG9A 4O16A 2G3JA 2C15A 1YXCA 1TMLA 1EL3A 2E5DA 3IRSA 3O7UA 3O9NA 1WDQA 5LXEA 4QFUA 1C92A 1SFTA 4ML9A 4JBRA 3KBNA 2WBGA 2PGWA 4ATDA 1AW1A 3MC5A 2HRWA 3UCDA 3FIGA 3AYSA 1RA0A 2YL9A 4I9JA 3PR2A 4AD3A 1OABA 2VVSA 2F8QA 3WLJA 2V5KA 3B8DA 2I5IA 2DSWA 5KINA 2NUXA 4H7CA 3O8AA 1UJQA 3EX1A 1A5MC 1LRQA 2GUUA 1DXFA 5G4WA 3R94A 4OJYA 4CN6A 4AWUA 3QOMA 4UZSA 4MJ4A 3PM6A 2VUNA 4MNLA 4LQ1A 2CBUA 3AYRA 4POCA 5LXXA 5EMJA 5TIMA 5LA2A 4V33A 3PBVA 3G1HA 3B8VA 1DJYA 1ZGDA 4CNPA 2JGQA 2F61A 2HROA 5AFDA 2FGLA 3UR2A 1ONXA 4F40A 3F5JA 4N7QA 4YHEA 1WP6A 1V3JA 5CC7A 4IX2A 3M5ZA 1EJTC 1UBPC 3WKZA 2IW0A 3V0SA 3IVUA 3UG8A 2A3AA 3ZO9A 3F4CA 3NCOA 5HMSA 5IRPA 4NZ3A 1LG2A 3TDFA 1ECQA 4E4PA 1KTBA 1M6JA 4LYQA 2A4AA 3E5BA 1F6KA 1HKIA 3GZ3A 4AZ5A 4C7GA 1FWIC 1R9XA 1VPQA 1Y5VA 1Y8BA 1XBZA 3OVQA 3VINA 3A13A 4XZLX 3WUGA 1XD0A 2YXXA 4K36A 2GJRA 4PL2A 1R2TA 1Q6DA 3APTA 4A3QA 4LOCA 4DN1A 4V28A 1DE5A 3EMQA 4NILA 2A6NA 1E72M 3AJ7A 4LVGA 1NWRA 3L0NA 3AFBA 1HP4A 5DO8A 3VO0A 2OTDA 1CLXA 1MNSA 2RDXA 1KCKA 3GG1A 3N6JA 3GVWA 1WKEA 1CXEA 2E1DA 3M07A 3ZJ8A 8XIAA 4S3CA 1E3ZA 3QC0A 4BI6A 1BF6A 2IKGA 3WN6A 4WKHA 3K2GA 2XFWA 3BWWA 2Y8UA 3GAKA 4NIRA 4C6IA 5FJOA 3BLOA 2VXNA 1CXLA 4P61A 1K7EA 3VOFA 3OQEA 3OB8A 4NRSA 5A95A 3KTSA 2UY2A 2H9AB 4Q6JA 4PCTA 4B2DA 3GZAA 1ZZMA 1QWGA 4TQTA 4UZUA 3UWYA 2CLOA 1SVDA 3LCIA 2QDHA 2OLAA 2W62A 4PRTA 1TWIA 1YBQA 4GACA 3DBPA 4IIHA 3EYPA 3ZIZA 4AWEA 4JTHA 1V6WA 5FAGA 2EJAA 2VWSA 5BCAA 4UFLA 3VKCA 4UQAA 1OFBA 3NEVA 3NSNA 3JZUA 1RQEA 1IEIA 3GHSA 3MZNA 2VX6A 1AZ2A 3URBA 1XWYA 4D71A 3BOLA 3ZLFA 1CWYA 1FTXA 4AUBA 3AAMA 1KTNA 1G7VA 3QLDA 2YDRA 1JJKA 3WH8A 1W91A 4J28A 1SZEA 3IRDA 2F38A 3UYCA 5JVLA 1I4NA 4CQ9A 4B9ZA 4A8IA 3PZ9A 3QBUA 1FBAA 3W76A 4NJHA 1HGYA 3OP2A 1JYVA 4HA0A 2DZTA 3IGSA 3R8RA 3RCYA 1PXGA 4OV9A 3U2EA 1TPWA 3LPPA 1VYRA 1OADA 2NW0A 4RW5A 3PUDA 4QDMA 2PU1A 1VBRA 5D37A 3FOKA 3E0IA 1DIDA 3VDGA 1LM1A 4ASTA 2QUVA 3AALA 3W29A 8RUCA 3OVGA 1ITCA 2YZRA 2PWVA 4C6OA 5FSDC 2NX9A 1SGJA 2Q01A 4CEUC 3S1GA 3CQKA 4QGCA 1HFBA 2P50A 3QFWA 3TYUA 3WF0A 4I8YA 4C7DA 2DEPA 3G1XA 1XIDA 2VC9A 2Z1KA 1KXHA 1QHZA 4ZE4A 1H1NA 3UFYA 2ABBA 1YPXA 5AY7A 4KFOA 3UESA 1DJHA 5CBIA 3HPXA 1NH6A 3KBMA 3Q4DA 4F48A 4JTEA 3E2SA 3WFZA 3CL7A 4NZ1A 4OHQA 1H60A 4HHHA 1U5HA 1ONEA 4HU8A 5FKYA 2FZMA 3ARUA 1B3WA 4FXSA 4HCDA 1H50A 4QROA 1RALA 4LYPA 3S2CA 4FALA 3ABRA 4ADTA 1PSCA 1TMQA 3KE0A 2PWGA 2CLPA 2VDIA 3K8KA 5I77A 4NU7A 1ESWA 2VZOA 4DUXA 1KLYA 3RHGA 2FFIA 2YL6A 2ZZ5A 5D9MA 4TMCA 4AFYA 4IPPA 1JDEA 4HA4A 3TXVA 2A85A 1FA2A 3QQ0A 4Z08A 1EB3A 1YXDA 3EB4A 1IR1A 1A4MA 1TUXA 3OTRA 2WSRA 4O1EA 5BYWA 1EC8A 3ZM8A 1MMFA 1GONA 1PX8A 3A4XA 5DXYA 3H2AA 5T8GA 2PDCA 5KETA 1UR0A 3FXGA 3DHDA 3KCOA 2AGKA 3OHMB 4BHYA 1CXKA 3PTMA 3OZPA 3DFHA 4PUJA 1RHCA 2VHLA 4QNEA 1F73A 1ZJAA 3R7MA 1V0MA 4FXRA 1KWKA 4YLWA 3U2CA 2DZPA 1TUFA 4HCLA 4J3UA 3QVQA 2HBVA 3TP4A 3M44A 3LSBA 4LANA 4FLSA 3KCLA 3K30A 1NFBA 4AQLA 1P5BA 1REQB 1SZGA 4Z2IA 2HE8A 1IWBA 2Y8KA 1RD6A 4PE8A 1P48A 1NOUA 1L6FA 1UOZA 2VURA 3HPAA 1VB9A 3PWAA 1NFGA 1CW2A 1V7YA 4ALDA 3DEQA 4ICNA 2FHBA 5I3JA 2G4FA 4KW2A 4N6EA 3NG3A 4MNKA 4FIRA 4XK2A 3QZAA 5LA1A 1KFJA 3ZLGA 3PVFA 3QMTA 4AY1A 1BHGA 2A1YA 1ZLPA 2GJNA 5REQA 1SSGA 1GKRA 4RL3A 1GGOA 4AIEA 3AJXA 1S2UA 2CBJA 1L8NA 5A6LA 3PZIA 3B3DA 2OT0A 4H6RA 4HP5A 2NV1A 2BOGX 3WIJA 1YYAA 3MSDA 4QM1A 3JZEA 3VZXA 4G2DA 3I68A 3VXGA 2PDQA 1JFHA 1TWWA 3W84A 1JYXA 3ARRA 2UWFA 4KIEA 3GBDA 4UTTA 4OBRA 3W1TA 1F3EA 4ICCX 2OZ3A 1FHDA 1D3GA 1EEXA 2WMJA 3BLEA 2DH3A 4H7ZA 4KGLA 2FLIA 4DY1A 4XISA 1HKJA 3DFNA 3VE7A 3IJQA 3N1AA 4LXFA 2B4GA 1ZL1A 4U33A 1BWVA 3PZVA 2ZZ6A 2QCGA 4GE8A 4NXSA 2YA0A 5C0QA 2VCAA 2D0GA 3L7RA 3PK7A 4PTNA 2AL1A 1JPHA 3SCWA 3IK2A 3U5UA 3AUJA 3NQBA 3MKVA 1EHAA 1C9WA 2OCZA 3W1LA 4OUIA 1XCFA 3A9BA 3UYIA 3T8LA 1GG0A 3PANA 5LNSA 1MI3A 2QPXA 3O1NA 1CEOA 3VOJA 1EJWC 1V93A 1R3YA 1H7PA 3B9AA 1CDGA 2P10A 2CHNA 1TB3A 2V69A 3KFTA 3DU0A 3KX6A 2OEKA 3MDUA 4LRTA 4IXHA 3SCTA 2W0UA 4HA3A 4AU0A 4FEZA 4PBGA 2OWXA 5AHIA 4MUZA 1E40A 4KBXA 1MQRA 2ZX5A 3M64A 1LBFA 3Q2DA 2NQ9A 4XZHA 5K7JA 2DIJA 3GDTA 4ZVJA 1R3TA 4HOWA 7A3HA 3NIYA 2WBKA 3QMSA 4MVAA 5GNZA 2VT0A 2ISVA 2VC6A 3WQVA 2ZUTA 4LYRA 3ZVHB 4R53A 4LS1A 3GKFA 5JBDA 2H8XA 3GR4A 3SZ8A 4HNCA 5G5IA 2POZA 3PJXA 4DJEA 1OX4A 2XISA 1V5XA 1D7FA 3P7YA 4NJKA 4ZSUA 3W28A 1H7RA 2VVNA 3SY8A 1KM2A 1U1JA 2XIOA 4UFKA 1OX5A 4YJ5A 5DELA 5T9BG 4LB3A 4HYRA 1Q6CA 4JQ2A 3TJ4A 3KRUA 2AAAA 2Z2BA 1XI3A 1LL6A 3Q37A 4GH3A 2E3ZA 3C8NA 3A3HA 3PHAA 3EPNA 3HU7A 4GH1A 4GABA 4LSBA 3U6WA 2BMBA 5B7ZA 3OZMA 1IV8A 4XSLA 3QW4B 1DV7A 2CXGA 1JD7A 2FYMA 5FF7A 3T44A 2BTMA 1J8VA 3AYTA 3TYZA 3DYMA 4FX7A 3C0SA 3IGHX 3RN6A 4MFEA 3FVDA 4JIQA 5DEZA 5CGMA 4ZB0A 3TW9A 2EG6A 3WLSA 1D3HA 4WDUA 5AZ0A 1NQKA 3LTPA 4IP7A 4L80A 5HPCA 2NXIA 5ABHA 4GK8A 1OYAA 1EP1A 1VBGA 3FHAA 3OPSA 4CD8A 1K70A 2PCQA 4MYXA 3M0LA 5DX7A 2DZSA 3STPA 4DQWA 4L9ZA 2BNJA 4RPPA 2DZWA 4DO6A 1XLBA 3JRKA 5LGZA 2XSXA 3KVMA 3SN4A 1BYDA 2Q6ZA 2PTDA 3CWNA 1W9DM 3KLKA 1D8WA 2VD9A 2WKLA 1TPFA 3EDKA 3DFQA 1UPMB 1SJDA 3GX9A 3CT2A 2DT3A 3KM8A 3E5PA 1O1ZA 3NQAA 1YXYA 3TKFA 1UR9A 2HNHA 2L5HA 2O4QA 2PDMA 1OIFA 2XTKA 2FZBA 2Q09A 3B9OA 3REQB 1WUEA 1RPXA 4XKMA 2GJXA 1Q7MA 3UPMA 3VUPA 1GOXA 3WLQA 3E2RA 3H7RA 4JTSA 4WRHA 5LIUX 3NQVA 1T8QA 1S5NA 4RR4A 2VR5A 3CUGA 1UASA 3IARA 5EBUA 1ZCOA 1E6PA 1E6NA 4FR1A 3PF3A 3W1AA 2QCLA 4HU3A 5FL0A 1V03A 1FHUA 5BZAA 1JXKA 3CASA 2BLEA 4RDVA 1TMHA 4HNUA 1CX9A 3KHDA 4K2SA 4K3ZA 3MUXA 3M0IA 4DAFA 1I75A 3BPWA 4ES4A 3CUZA 3TW7A 2WNWA 1EXPA 3GIQA 4DZIA 2GK1A 1GPWA 1T0OA 1KGUA 4LCSA 3O3RA 4I6VA 3CMJA 4GYFA 1Q6QA 2A7PA 1F05A 2X0YA 3S1UA 4MIMA 1FKXA 4GLEA 1S3TC 1XLDA 2E28A 3FX4A 4ENLA 2VDGA 3R25A 4NX5A 3C0LA 3CHVA 4XD5A 4JTJA 3QY8A 3B9NA 3CAQA 4YCPA 2XVKA 2QIWA 1VFMA 3A24A 3E2VA 3IIXA 1JZ7A 2D3LA 5U7SA 4IMCA 2EPKX 2P0IA 3CNYA 4LCRA 1LT7A 3SSJA 3G1SA 2OWWA 2PDIA 2GQ8A 4C7FA 5LIXX 1SZFA 5A8OA 3VABA 1TPH1 1LRNA 3W2UA 5HQLA 1VCGA 4GJIA 1OYBA 5JIPA 1R30A 3ZS4A 1VEOA 3KBVA 3VMOA 4ZENA 3RPMA 2YLAA 1O94A 3CV6A 3PP7A 2FKPA 2A79A 1BVZA 5F4SA 3WDQA 3OVPA 1Z89A 1ZBWA 1BTCA 2GYIA 4WKFA 3N11A 1VPXA 1H7NA 4D8LA 3DX5A 1VFUA 4JYEA 4C6QA 3L9CA 3HJEA 3W0KA 2ZUNA 2WZMA 3E38A 4DWSB 2XG9A 4L6HA 2PP3A 4DZ5A 1GJWA 2CW6A 2F2KA 1FH7A 4UOQA 2WMKA 4A2RA 3NGJA 4L4PA 4PYSA 3N18A 2D0FA 3OA3A 1GQKA 2OSWA 3LPFA 3KLLA 3A21A 4E38A 1J6OA 5IBXA 4H6QA 2ATSA 4FAMA 1A5SA 5ENLA 5JMUA 3RX2A 3C2YA 1AJ2A 5CZSA 1C8YA 2PD5A 4LVAA 3W1XA 2V6AA 3V18A 3I3BA 1C8XA 2OQHA 2ZC8A 1RPKA 3MZ2A 1FWAC 3ZZ1A 2PEVA 4BEQA 1Y0EA 5FEPA 4P7OA 1A47A 3EEZA 1TWZA 1T96A 8XIMA 4LCQA 4BQ4A 3K46A 3TR2A 3W2KA 4A2SA 2GPTA 3NGFA 1EDTA 2XWEA 5CZ0A 1QWKA 1MUCA 4F2UA 3NEHA 4WXZA 4H3DA 4HTYA 5DXXA 1HKMA 3B9EA 3WLMA 3WNPA 3OHIA 5G4HC 1NP0A 2F6KA 3F5KA 3SRFA 3TROA 1UWAA 4B5SA 3NDZA 4Q22A 1DQXA 3C61A 2Y0FA 1JZ3A 3FAXA 4DZHA 1CGXA 3QGKC 2FZDA 3QV9A 1W1ZA 1YKWA 3MI2A 3FY1A 3GDLA 3I10A 3NQFA 3QTPA 4YWSA 4F2TA 2GQAA 5KZMA 4MPQA 4AB4A 1GVFA 1RY8A 2ZTKA 3DC8A 3F03K 2CHOA 3M6YA 3N04A 3S4TA 4Z42C 1UWUA 3FA5A 2DVTA 1B90A 1E43A 2RDUA 4HN8A 4JIHA 3P93A 5FEXA 4QG9A 4S3GA 3CK5A 3U3HA 4S38A 4US5A 3FSUA 4IWWA 2BFGA 4WDXA 1VBJA 4H9TA 1E51A 2UZ9A 2CBVA 3ARXA 3SR7A 1ZPTA 1VRDA 1AA1B 3GTFA 4KWWA 3MHFA 1GT8A 1RQHA 3TZFA 4H9MA 1CNVA 4AZ7A 3I3DA 4FLOA 2R1NA 4GFSA 5CPTA 3MHUA 5M5DA 1U5VA 4P8XA 4JX4A 2QCDA 3BSGA 3GR7A 1QI0A 2V3GA 3VTRA 4Z1YA 2KX9A 1PX3A 2HDJA 2QHAA 4C6EA 1LLZA 2WJFA 2J75A 1GQNA 2DPEA 3AS2A 3WUBA 4LF2A 2VO5A 1AH0A 2HMCA 5G2WA 3GW0A 4R5EA 4I7VA 2J9ZA 2WB5A 3UJSA 4LC6A 4UTIA 2FZ9A 2ZCGA 4EK7A 4LAUA 2J9XA 3C56A 3AI0A 4LTSA 1V3LA 3GDBA 3DAQA 2FDSA 2FHFA 4HHMA 2UV8G 4WSKA 4ZO7A 1LUCA 1E3XA 2V5DA 3LZ5A 3W24A 3SUSA 4O19A 4DO7A 2B81A 2NT1A 1EGZA 2YZ5A 1XD1A 4H19A 3G5EA 4PCFA 4EWND 4KEVA 4KWVA 4JQ1A 1Q8JA 5M2FX 1UKPA 4TUFA 4O4WA 1UD8A 1W5MA 4S2CA 3OYZA 4U4MA 1N8FA 2P8CA 4UMBA 4TV5A 1WKYA 1F6PA 2AGTA 5GNXA 2D23A 2G97A 4B15A 2BXVA 2V5JA 2E6FA 5I3DA 2NX3A 1AJZA 2V3DA 4FNTA 4YIWA 4Z0JA 3UD6A 3P0WA 4JNMA 1Z7AA 2Y2WA 4MNMA 4RNHA 3FDKA 5BXTA 5HMDA 1UR2A 3RITA 4YTTA 1RQBA 4R9XA 3W1RA 3KW3A 3EDFA 3N2OA 2H90A 3UXIA 1IEWA 4C1KA 2DSKA 3FVMA 5FJRA 1A3XA 1QAPA 2OT1A 1DJXA 2NQ5A 4M7TA 3L4XA 2W9MA 4QG6A 1US2A 3M1ZA 3QKZA 4US5D 3R12A 2CLHA 2J8TA 3EDJA 1O66A 2X42A 1N8WA 1E6XM 1AK5A 5C54A 1Z69A 4BF5A 6REQB 1W3HA 4I6KA 1O5KA 1G69A 4XAYA 3WNMA 5I5RA 2XH2A 2ANUA 1AG1O 4XTIA 1JCXA 4QISA 1EYEA 5E70A 4GQBA 2GVLA 4HBKA 5CLWA 1V7AA 3WD4A 3RJXA 1JGMA 3GO2A 2G5WA 1P0NA 1BSIA 2XFFA 4AHPA 1ZQ5A 3W2LA 3PG9A 1XV8A 4M6VA 4EPKA 2EJ1A 3M47A 4N9BA 3KAOA 4NAEB 2QIIA 5HXMA 5HNRA 1K4HA 4J2MA 1O4UA 1GOOA 1UG6A 2WC4A 2YCLA 3H4WA 2Z25A 4MMWA 5IOBA 3FGCB 3DYPA 4GGHA 1L6WA 4GWEA 2X1TA 3UR5A 4BK9A 4WX2A 3TYCA 1WE5A 2AKZA 4AZIA 3BGAA 1UD5A 1KBKA 3W1QA 5I00A 1Q2RA 1RCXB 2DJLA 2PTYA 4KIRA 1KCZA 1X1NA 2VGGA 3VCRA 4LV9A 4LY4A 4ADUA 2EPLX 4CCEA 4H8VA 2EAWA 3UG3A 4OUEA 1V79A 2I56A 3OG3A 5HJLA 1CIUA 2WVVB 3UW6A 1W3IA 1LBLA 1VQTA 1BFNA 3W37A 2W67A 3NFUA 3G1VA 4MOZA 3PUEA 4FF7A 3PZNA 1FWEC 3L4VA 1EDQA 4M0XA 2P5NA 1JQVA 2PLKA 3CHDA 2ACRA 3C5QA 2WJDA 4ZXOA 3ES8A 2WHKA 4MM1A 1H61A 1E6SM 2V5CA 4JQ4A 3BV7A 2VR4A 3QHOA 1GJUA 3EKLA 3G18A 3LRKA 4NNBA 4U5IA 5I79A 3TE9A 1YPFA 5DMLA 2ALDA 1X8CA 2TMDA 2I5QA 9CGTA 1HKKA 3WG6A 4UBPC 4F66A 1KKRA 4HOZA 1QW8A 1PE1A 3R79A 2YPIA 1V0LA 1XLAA 2AQWA 3QGAC 3EAUA 1YRRA 5E0KA 2CPUA 5DFAA 4H2HA 4GXPA 1WNOA 4I5RA 4UC5A 4LUJA 1TWSA 4J1OA 2G0WA 4X9SA 5BOFA 2P0OA 2PTXA 4AHOA 5DBTA 2Z24A 5TQLA 1ZAIA 3C2RA 3HZ3A 3M7SA 3B0XA 5FJPA 2JKPA 1R3VA 3R4IA 3H55A 4O1DA 1NDZA 4Q8NA 3WLPA 3CHEA 3IGXA 5DQPA 3PJTA 2YB1A 4U3AA 5GJPA 5D2TA 1LL4A 3VVGA 1ZHAA 1LOLA 1US3A 2VJXA 1JCNA 2G95A 4YTSA 3BAKA 4UFHA 1UUMA 3WLIA 1FWHC 3IIOA 4CNUA 3RO6A 4C5YA 2EPHA 1J10A 3BLDA 5AKQA 5CGTA 3HMCA 5BNKA 2NQHA 3MKKA 1QI5A 2GJLA 4Q8MA 3T9PA 4PTMA 1S2TA 2VEIA 3LNPA 4J7RA 4MWAB 4F0HA 2GGEA 4RX0A 5BOOA 5KZ6A 2PUZA 3LB0A 2J7HA 4F9JA 3LCHA 4B3LA 3WZ0E 4L6DA 4EVZA 1A3HA 2O55A 3CIVA 3NPVA 5A6JA 4L5ZA 4PMYA 2J6XA 3TA6A 4HNVA 4QRNA 3VK5A 4JTCA 4UTLA 1OCQA 4KQNA 3VM7A 4MAVA 4CNTA 2JFEX 1JD9A 2CERA 4TX8A 1J5TA 4NQ1A 2VQTA 6PTDA 3I7QA 5CQ1A 4LNYA 4HK7A 3EOUA 3NAVA 2GOKA 3N19B 3A9IA 3DIPA 3W07A 1ZNNA 1SW7A 1XLGA 3BL3A 3MSYA 3W25A 2W5FA 4XVEA 2FH6A 3LLFA 3UWVA 1CGYA 5CZKA 4UQCA 3DENA 4QEHA 2QUNA 4ZR8A 4Y9PA 1BXCA 4FO4A 1HIZA 4OU1A 2HNEA 3H26A 5C9WA 4W7VA 1ADOA 3MQTA 2IUZA 4NX0A 1YLVA 3PULA 1CTNA 4KCVA 1KD0A 3ITVA 2ZRZA 4A05A 3M5YA 4UTHA 4K7YA 3U7VA 4GUIA 2ZUVA 3E96A 2G3NA 1NSJA 1UWRA 3KVKA 1MZRA 2FTPA 2V68A 4KGJA 4GQ0A 2V3EA 1VHNA 4AXNA 1QPRA 3Q94A 2QDEA 3TTOA 1X6UA 4WY0A 3W87A 4KETA 2B7PA 5MKGA 3WQ8A 4G1KA 1W8GA 1E1EA 1O95A 1UC5A 4QTGA 5EMYA 1VFFA 3A3XA 3W2NA 4O1AA 3ITYA 1PZ3A 3CJPA 5RUBA 3VM5A 2HJPA 2QLYA 3DKJA 1EFZA 2VKZG 2GZXA 4GC4A 4DBWA 1H11A 6TIMA 3OG2A 1XG3A 3THQA 3WYZA 5CG7A 5CZTA 4Q7NA 3RU6A 4PMOA 4Y9AA 3FDGA 2DT2A 5F1UA 2YXGA 1KWGA 1OQFA 1EOKA 2VRKA 3IVSA 4H9UA 2CC0A 2TPSA 5A2CA 3W7DA 4FPSA 5CH9A 2RAGA 1ZTVA 2DSUA 2E5BA 3WH6A 1GYMA 3M43A 4E0CA 3RLGA 5ECVA 3Q45A 4Q4PA 1MRAA 3HQNA 2CESA 4CU7A 3IUIA 1E71M 4WSJA 4A4AA 4REQB 1HKVA 3PZQA 1G5AA 4EF8A 2X30A 5IHSA 3VIJA 2YSWA 3B04A 1SMAA 3I7SA 4DWSD 5EGRA 2QJGA 4JIIX 3RLUA 2VENA 1SZRA 4QBXA 3U7BA 3TLQA 3F4VA 1LTDA 1KA9F 3DHUA 1JPKA 4B90A 2J27A 1IHIA 4PC8A 4CCZA 5CKSA 1R7AA 1UA3A 3H2NA 3QV6A 1E73M 1SO3A 4LGXA 3GQYA 1EIXA 2OKTA 2QV4A 1QOQA 1LL7A 2V5BA 1GPFA 3AXHA 4V1XA 4JDYA 3W27A 1MEIA 3V1PA 4IJCA 4S3KA 4LUSB 1TG7A 5FEWA 4US6A 1WOBA 3VMNA 1C8QA 2VOTA 5A3HA 5A8NA 1XIJA 3GE7A 2EO7A 1YE6A 2QAFA 5A6SA 2OQLA 5CBBA 1B2YA 1E0WA 1CECA 1F7BA 3BLLA 2VR2A 5I24A 4IL0A 4GY7A 2PODA 4LBUA 3GNNA 2ZVIA 1XS2A 3PZMA 4PUUA 1F61A 4ICMA 4EACA 2WMIB 5E09A 1A50A 4K6AA 1T41A 3FYPA 4QQ3A 1Z6KA 3UZYA 3GTNA 5LSMA 1UB3A 4TOQA 5CPLA 4J2PA 5AYIA 3BSHA 3TR9A 5AECA 5AHMA 1RLCL 3FEMA 3H2FA 5FJTA 3GDMA 2QVHA 2X0HA 1H0GA 4IMEA 4XKYB 3UWZA 3QFEA 1JZ8A 3VKDA 5BRQA 3THCA 1OY0A 3N6QA 1JEZA 1OIMA 2XGBA 4HSHA 1U83A 2R9RA 5C6MA 4L4LA 4WCJA 4S3EA 1O7AA 2CXEA 5DF0A 2E9BA 1QI2A 2NZLA 3DECA 4QIUA 5A2BA 5GPRA 3W1UA 3G1RA 5CPQA 2EKGA 4M29A 1DWGM 5AYXA 4IXXA 2HPMA 4UXDA 5CJMA 4BI5A 3CPUA 3KL0A 3VCCA 2Z6IA 5FCZA 5C7HA 3CHFA 2YFOA 3ERPA 4X0NA 3TEVA 4JQAA 3ONCA 3VE9A 3L68A 2X16A 4I8DA 2HISA 3RGTA 1BXNA 1K8CA 3T7VA 2PC8A 4GZEA 4RV8A 1OEPA 3W22A 4C6LA 4KRZA 4RUBA 3TTYA 4HOXA 3W1MA 5XIMA 4RNIA 4EE9A 4O52A 2PWEA 2INFA 4HA1A 2EBNA 1XGEA 4RXFA 2VFHA 1KV5A 4YXGA 4Q6XA 1KXQA 3WNOA 2WQPA 4NL1A 4KEMA 2C3ZA 3AWOA 2YCIX 3TN6A 4HPGA 5D38A 2GVEA 4LVFA 1XRSA 1AL8A 3CXOA 2Q3RA 5FACA 3GWQA 3UERA 1ODUA 4PUNA 5MF5A 1H3GA 3SADA 3LCFA 4KWUA 5D2WA 5E5CA 3O6CA 3LBMA 1HO1A 1V6YA 2XIJA 3F2CA 2EF9A 3P5ZA 3FCPA 1BTMA 4ORIA 4E2BA 3VOIA 1DEDA 1JZ5A 4HZ8A 1OZMA 1XKYA 4M3PA 1ONRA 2MNRA 1DIOA 2YBVA 4HMNA 1NWSA 4FZIA 2OSXA 1PHWA 3VDHA 4L1GA 1WXZA 3HA1A 4XBJA 2IQDA 1TJRA 3NVTA 1UD3A 2DQWA 2F7FA 4KPLA 3D3AA 1P7TA 2XVNA 1Y5WA 3IUHA 4IICA 4AZBA 5EBAA 3MSGA 1QBBA 2EKCA 4A35A 3GG0A 2E09A 2Z1XA 1DQUA 4O0KA 3JU2A 1B1YA 3BAXA 2IPGA 4PTXA 2PPGA 2OZ0A 3G0SA 1NU5A 3W72A 4DX3A 2VZSA 1OFAA 4Z0SA 4MWAC 1XYAA 4WUIA 4GX9A 3TWAA 3P2VA 3B0PA 4LF1A 4UTFA 4J40A 3N9SA 2BWGA 4UCFA 4E8CA 4BQ3A 4GC3A 5GJMA 2BVDA 2ISSA 3NR0A 4WGXA 4GA8A 1QDSA 4O1CA 2XUCA 1K9TA 4J27A 3AIEA 4F8XA 1EEPA 3V4BA 3IACA 4UOJA 1RCQA 3R6IA 4UFJA 4K1WA 3B97A 1KBIA 4C1NB 1S5VA 2BY3A 1UKQA 4DYJA 1HJSA 4WOZA 2PD9A 3SRHA 3H8AA 3ARZA 3RILA 5ABTA 2FVKA 3KBJA 2XFRA 4GJJA 2NWSA 2DVXA 1GG1A 3NZ1A 3CS2A 2V2DA 1OINA 1V3IA 3QV8A 4CNNA 5I2UA 3N13A 4Y96A 1GNXA 1LCOA 3RM8A 4BS0A 3LENA 3ITCA 3ZFHA 1W1TA 1SO4A 3IUDA 3HN3A 4ACZA 2HK1A 2AMXA 4JIRA 4E2VA 3B8TA 5DCDA 1TV3A 3P74A 1IIHA 3V75A 4NJIA 1R9YA 3IAPA 1B4KA 4AXKA 1V51A 3QV7A 5D9NA 1U1HA 4DO5A 1MWOA 4DPQA 1QATA 1VFHA 2QUMA 3BW3A 2NQJA 5AC8A 3CPGA 4Q8TA 1VBHA 1W5NA 3TK7A 5LGXA 4PL1A 4FSAA 5HOSA 5FJUA 3F4DA 1UBSA 4HMCA 3ECQA 1OM0A 1L6SA 1BPLB 2ATMA 4CD4A 2ZKMX 3WEMA 3TIMA 3BLPX 2X2YA 3VOCA 2QS8A 1GZ1A 3OGSA 3PTQA 3O0FA 3R10A 2RH9A 4NAFA 2C18A 1CZ1A 1XCXA 4WSHA 1W3JA 1Z3NA 2J7GA 2KZHA 4UTWA 3WMBA 1X7IA 4GQGA 4QITA 1POKA 1AVAA 5BMXA 4V1YA 3PAJA 3QW3A 3G0UA 4EAMA 1UIPA 2R1MA 3W83A 3TXZA 3KP0A 1V3MA 3F1QA 3SGUA 3M5XA 4QQUA 2ZTJA 5CPNA 3PB0A 5A94A 1SUXA 4B5XA 2CETA 4A8RA 1JXJA 1AL7A 2Z1WA 3UBPC 5HNNA 3BXWA 1XW8A 1VLWA 3M0XA 2DUZA 1M03A 2V2CA 3ZT6A 4CCCA 3VFLA 4G7EA 2YLLA 1KLZA 4CCDA 1MFVA 2AQOA 4OBTA 2VD8A 5IM51 4L9YA 3HF3A 1J5SA 5EYWA 4O10A 4JL1A 3PZTA 3SUVA 4PTDA 3ZR6A 3TMQA 1UMLA 3KOWA 4FLQA 7ODCA 4J5NA 4FNUA 3THAA 5T91A 4IX0A 4JTQA 4ZFCA 5H2ZA 2WNQA 1R8LA 3WD1A 3HFYA 1FFRA 1MZHA 4O28A 5HA7A 3DH7A 2DIKA 4LYKA 1Q2SA 1SJAA 4FR6A 5FF0A 1ZP4A 4AD4A 3W7JA 3WQWA 1KFWA 4QJ4B 2ODOA 1CYGA 1EZWA 3VFCA 1YNQA 3S42A 3N25A 3L0GA 1EPXA 1WYIA 3TSDA 1I2PA 4IFRA 4O53A 1OC7A 4ZB5A 3O0KA 3V5OA 1FWGC 2BGNE 3ABXA 1OCBA 3APYA 2YL8A 4AVFA 1VJSA 3M7WA 3R89A 4JNYA 1UR3M 3LV6A 4FXFA 4AZHA 1U5JA 3ENLA 4TV6A 5BXSA 1WDSA 4U5KA 2E9LA 3SIZA 1WBHA 2C8NA 3N17A 4BF9A 3AMCA 1VFSA 4Y9MA 3PFMA 3GHUA 5FSEC 2ZX9A 1T6MA 1GUVA 1Q6EA 4XWUA 3UPWA 1K6WA 2EXOA 1UROA 1FWTA 2D69A 2D73A 4J3WA 3V36A 3MUAA 3IIZA 4M82A 1JNDA 4IJBA 1A80A 1ZUAX 1QPQA 1QPKA 3W75A 3A4JA 1F3WA 2WKGA 3B0YA 3GK0A 4B4FA 1JUBA 4WVXA 2BY1A 1YBQB 1FRBA 4JS3A 4DBUA 3EXSA 2J13A 3W86A 4TX9A 2DZXA 1ZBKA 1XLKA 2GWNA 4FI4A 1K7FA 3DKLA 3CQHA 3QC3A 4B5VA 4XSMA 4GIAA 1NOFA 1BYBA 2HEJA 4OQVA 1L0PA 1UZHA 4LBSA 3T1GA 3OVRA 5DRIA 1B5TA 3T6CA 3RF9A 2D20A 1EX5A 2G8ZA 3LHTA 1VGAA 2E7FA 3VUSA 4CNOA 1B3OA 1QPNA 3UXAA 1VS1A 2QJJA 1K9FA 5BROA 1YTDA 1J0ZA 1K1DA 2QKFA 3A3WA 5I09A 1K8XA 1FH8A 4LY8A 2DZBA 3KP1A 4CQ8A 3W85A 1KCLA 2HE5A 4Q4OA 1OSEA 2WCGA 1F2JA 1JI1A 4TR9A 1X98A 1RVKA 4HMDA 2PWDA 1PKNA 1QNPA 1E55A 5FF4A 1H1ZA 5DY3A 3PUOA 4GUHA 2EQDA 4XZBA 2XDFA 1VIWA 5IHRA 5HK4A 1HKWA 4AYSA 3CMGA 2VI0A 1J11A 4PCNA 4UTUA 4W88A 4JEQA 3GDKA 3NXFA 1O1HA 2ZZ4A 7ENLA 3WQ6A 3BLFA 2GLKA 4GI8A 1GWJA 1O68A 3QKEA 2R91A 2CCRA 1ZBCA 4RNFA 1HL8A 1NDVA 1TZ9A 2D24A 1H7XA 2VFFA 5FF2A 3U5YA 4EPBC 2R1KA 2WLYA 4O17A 2J8GA 1N55A 1EJRC 4HNNA 3RIKA 3R11A 5EMMA 4MDPA 4PMUA 2OO6A 2J74A 2GDUA 4A3YA 3AIVA 4FNSA 3ICJA 2JE8A 3AZSA 3I6TA 3WH5A 3EDEA 1PJ9A 1KFBA 1BAGA 1PZ2A 1IT0A 2ZA2A 3V5CA 1JQXA 4EF9A 5FEZA 4X3ZA 3XINA 5AC4A 2UY4A 1KKOA 3ITGA 2DZAA 4D6CA 4XUGA 1DJZA 4E3TA 4Z17A 1M41A 3FYOA 1VFTA 1BD0A 3ZQ9A 4BWLC 4LALA 5B7YA 5D8WA 4LV4A 5LNVA 4IZGA 1YIXA 2X05A 4C1LA 3O2LA 1GVEA 4JAWA 3V1HA 4PGLA 1DTNA 3T2QA 5EFDA 3W7NA 1UWQA 4O0ZA 3WK3A 4KRUA 2J62A 2VFIA 4L6OA 3LDVA 5XIAA 2ZBTA 4PMVA 1M65A 1XIHA 4LAKA 3L4WA 1BGAA 1YPIA 4JX6A 1P6CA 3IS4A 3GYEA 3AYVA 5GQBA 5EMKA 2WJZA 4GZ7A 2IPWA 2QAPA 4MDOA 3NL6A 3CUJA 4GY1A 1EJ7L 3HG4A 2JGYA 2Y5JA 1A5OC 5FJJA 1PPIA 1XRFA 3W7KA 1W37A 3BG9A 3MBFA 2TRSA 1JCLA 1TZZA 3AXKA 5DMMA 1DBTA 3LQLA 4PUWA 3N4EA 5I23A 3KL5A 3APGA 4J35A 1F8MA 3RR4A 2Y85A 4Q8OA 2CZEA 3TV8A 4ERGA 1MDRA 4ZXLA 2HS8A 2Z1SA 2H6RA 2XZ9A 4RJEA 5CJ5A 1RCOB 1QI3A 1LP6A 4MB4A 5J8LA 2WANA 2HXUA 3LGGA 2WZIA 2E67A 1AD1A 3SIMA 3LA4A 1TTIA 1HN1A 2B7QA 5E0CA 1Q13A 1WCGA 1DIEA 1G4TA 3USZA 1GQJA 3HQ1A 2OOFA 5CSSA 5T26A 3KTCA 1M68A 5LZLA 5REQB 4WGHA 1DKWA 1W8SA 3W73A 1RSCA 5M1TA 3WMCA 3VYLA 1XYFA 3G1FA 3G0XA 1JDCA 2QJIA 1H09A 3M46A 4IGMA 5CXPA 1ZRQA 3LHYA 5EMLA 1IT8A 4XIMA 4YTUA 1NJJA 2POTA 1DWJM 1E9YB 2EG8A 2OMAA 3R58A 3NO1A 1QO5A 3GXMA 3MUZ1 3VKBA 1OC6A 1POJA 4MY1A 2MUCA 3MKCA 3HM7A 3SCSA 2VQUA 3G2GA 1WB0A 2W91A 5CG0A 4QP0A 4UQ9A 3WBEA 2CLMA 2ZUUA 1EA0A 4PUEA 1XLHA 2YBTA 2H3DA 3UWQA 1ONWA 3UT0A 3IJ7A 4GX8A 3RX4A 2GVGA 4Q8UA 4YU1A 1XBXA 2BXYA 4UQBA 3C6CA 2E6YA 2CITA 1MYRA 5HR7A 3TZNA 1DHPA 4BFAA 3V0TA 4N9CA 4UNKA 4KKXA 2BVYA 4TO8A 3SGZA 4TIMA 3S5YA 3S2NA 3TH6A 2VGBA 2ZC1A 3G3DA 4MB3A 1DWIM 4V15A 1F6YA 1UQYA 3VNDA 3MTWA 2ZRWA 2B7NA 1YEYA 2E6AA 1TREA 2W3ZA 3SB0A 4E4UA 4AHQA 1WX0A 3N9KA 4XZNX 4RKAA 4Z1DA 3AU2A 4JPGA 3E2QA 4GVIA 1EOMA 5LIWX 3I65A 1DJNA 4DJFD 4C90A 2G41A 4ERAA 3LXBA 1EP3A 2E9MA 5FAJA 4QLKA 3CC1A 1J96A 3STGA 3KZPA 4IFKA 4XIAA 2X09A 2E4TA 1LG1A 1E0VA 4OFCA 2WMFA 1RJRA 5F1VA 3L12A 2XIQA 1D9EA 3MI3A 3I4KA 3Q67A 3UNDA 4IHCA 4LUTA 4M6QA 4GUGA 4JCMA 1R86A 2VRQA 4GFIA 1XSKA 3G1AA 4A29A 1EGMA 1FHLA 4GISA 1OX4B 4YS1A 3VIMA 2GFTA 1M9HA 3OLGA 3W3OA 2DFAA 1LF1A 5TF0A 4EAYA 4JHMA 2PLJA 1FQ0A 2CIPA 5AZ1A 1QNOA 1LT8A 1QHOA 5ECUA 5AYYA 5EFFA 1K4GA 1RR2A 2BBFA 1TX2A 4JYFA 2ZQ0A 1MXDA 4P8WA 2CLLA 1FWSA 1R2SA 3TTSA 2QMJA 1OT2A 1S2CA 1GHRA 1E70M 1HNYA 1V3KA 4GI6A 4Y9OA 1JG9A 1QNRA 2WMHA 3CO8A 3UWUA 3UXKA 4RE3A 2A3CA 4PBFA 5HUOA 2J25A 3B8WA 4RNJA 4AF0A 3DYOA 1S2AA 1W9UA 3B8SA 3RNDA 3WBWA 5C9XA 1IXPA 4R33A 4Q8PA 3KCJA 4PR4A 1Q66A 3TYDA 1UYQA 1ZALA 2PBOA 4J3SA 5GNYA 1OF8A 5I6SA 3K5XA 4IQJA 1SJBA 1THFD 1A49A 1M01A 5HWJA 4EIVA 2E1WA 4HNTA 3BO9A 2PDKA 1JNEA 1Y65A 1Y5XA 1DJIA 3HO8A 3RCMA 4HT3A 3S1VA 3CHCA 4GXWA 1S5MA 2Y62A 1GVIA 4PA8A 3RU8X 2JIEA 3PS7A 5DMYA 3WJYA 2I57A 3AS3A 1NEYA 1K8ZA 1KM3A 1VEMA 3MO7A 1JFXA 1U22A 3G8EA 5CSYA 2V63A 4CD6A 2WVSA 3SBFA 3YPIA 2Z2UA 1Q4NX 3BOFA 3AIQA 4EPDC 4S39A 4GPNA 1WDRA 3WFLA 4KT2A 2BS9A 2VZVA 4UMAA 1LOSA 3EMZA 1W2PA 3MVIA 2EGZA 2R24A 1V0KA 2ZRYA 1XYBA 2FZNA 1DWAM 2GJXB 1XCWA 3NDOA 2FVMA 4LNCA 3ABOA 4ZO8A 4JR5A 4LWWA 3F7JA 1F07A 3ONBA 2FFCA 1HF6A 4UB9A 2VYOA 3NL3A 1UD2A 2ALRA 4P7RA 6ENLA 4PRRA 4C6MA 4U10A 2G37A 2TODA 4RCXA 4Z2KA 2O9OA 1WUFA 4M6PA 1X6NA 1OCJA 3TJLA 3CU2A 1WAUA 3GRIA 1XICA 4H7VA 4PODA 1EQPA 4XBSA 3DCPA 3CO4A 1C93A 1Q5MA 2REQA 3NXLA 4GO9A 1TVLA 1KQYA 1VJZA 3P61A 3KZSA 4ZA0A 4DLFA 4RW3A 4QG8A 4DBDA 1GOMA 3IGUA 4GY0A 2X1IA 1MEHA 2I9UA 5K9XA 3SCVA 3NOYA 4O54A 5D9OA 3T05A 4BI7A 5D9PA 2DW7A 1KFEA 2RGLA 2A2IA 2BGQA 1OBAA 5EU9A 2DP3A 5I07A 4HPXA 1IGSA 3LXCA 4AY8A 1CBGA 2DIEA 2IKJA 4R88A 2GVJA 4GO8A 3CH9A 4GCAA 3PFRA 4QCFA 1EGVA 5HMFA 4O57A 4EP8C 3H6OA 3S2MA 3WEZA 2VUYA 3JW7A 5DT7A 1V4YA 3NSXA 3PWIA 4W9TA 1XIMA 4HU0A 4MHBA 4D6EA 4AVNA 4KWOA 4Y8EA 4E2DA 3CUFA 7PTDA 3JS3A 3PTKA 4K8HA 4ML4A 3A5VA 2Y88A 3GU1A 4RK8A 4FIQA 1H5YA 4Q8VA 3T0BA 2XN2A 3GFZA 3IJIA 4OKDA 3THUA 2DORA 3TC7A 4M1RA 2QCCA 5BXRA 1YDVA 3K8MA 3WD2A 1OVDA 4R3UA 1UD6A 1EBHA 2J78A 2ZOXA 1S5WA 1LBMA 4Z1AA 4JZ5A 5G4EA 2DV0A 3E12A 3RFAA 3ZJ7A 4JGDA 2WM0A 2CBIA 3GU9A 5ABFA 1T99A 2FQIA 1PVNA 3NUKA 3ZXWA 4LEQA 2EHHA 2DGAA 3T0CA 3EX4A 2WC3A 4IGSA 1HVXA 2QCNA 2OJPA 2FMOA 1WDPA 2DUXA 5AYBA 2GUYA 1OK4A 4D9PA 2VC5A 4I5XA 3F4NA 1TIMA 1LQ0A 3DBNA 1B3VA 5M3WA 3ZSSA 2QZRA 1TCMA 4J3VA 1XIFA 1TVNA 3S5SA 4B2DD 1W1IE 3LTSA 3TLLA 4AISA 4MFDA 1J79A 2BP1A 3DGRA 2ACQA 1BSLA 1GVQA 1GVOA 1Q6RA 2B31A 1P1MA 3WDIA 2BXZA 1CXIA 1KBJA 4Q7IA 2Y70A 1OT1A 1I0BA 3CZGA 1E1FA 2OPJA 3RAOA 5DMNA 5EPDA 3SCNA 1GORA 1J0IA 4RLIA 2W79A 1RBLA 1XBVA 1QOXA 3AZTA 1FWBC 4S3BA 3F2BA 4W7UA 1W9VA 1J4EA 3H54A 1XPYA 5JIWA 2XM1A 2PB1A 4MKNA 2W63A 3LV5A 5IXEA 4LH8A 1WZLA 1H63A 1FDZA 2YBUA 5BRPA 1EUNA 1TRDA 2O92A 1PKYA 3N2CA 4UTTC 3UZWA 2ZFAA 5D03A 3VI2A 4D72A 2VX4A 3OYXA 4WEVX 1LROA 4ZQNA 1M3UA 3G1YA 1I60A 1EJXC 2WV8A 4MWAA 2W61A 1VZWA 3H4XA 4ONVA 2BZNA 3MYPA 3KRSA 1JRBA 2QCEA 1ML1A 1K77A 2C0AA 3CAKA 4CQDA 2TSYA 3ME3A 3U48A 2VCCA 2QMKA 1HO4A 2AOSA 1ME8A 1W1B1 3K4WA 3DG7A 3NQ6A 1DP0A 1EC7A 2X2GA 1JZ6A 1QU4A 3IV3A 4QE1A 4ZO9A 3WLHA 3IJDA 1AD4A 2G96A 3ARWA 2OO0A 3T40A 3RX3A 1JIBA 4HMEA 4MKSA 1ENUA 1US0A 3AWNA 4ZZ9A 2PGRA 2QCDB 3KOZA 4M81A 4CU8A 3LRLA 5AC5A 1OGGA 5CLTA 2XVPA 4LW7A 1WA3A 1OCNA 4X63A 1DWHM 4IPJA 4PEEA 2PWFA 4O11A 2PDGA 3A47A 5TBOA 4W8LA 5EL1A 1FH9A 1GKQA 3W7OA 1AH3A 2HV5A 3BTNA 3RRXA 2A21A 2WJEA 1XP3A 3ID7A 3UA3A 3LY0A 4N9EA 1TZ7A 4GQQA 3U4AA 1HXJA 5TNVA 3CQIA 3C2FA 1BLIA 1PV8A 1G4EA 2FGZA 4UR9A 1OWQA 4JNZA 3TONA 3HPFA 3T4CA 4HU4A 2WM1A 4DHGA 2A0NA 4IM4A 1EXBA 1DJWA 2ZXDA 4CN4A 1AW2A 2BVTA 3N2BA 3LNMA 4EX4A 3BCFA 2WHJA 1SQ7A 3TMLA 3RYSA 3MMWA 3LM3A 3II1A 1W31A 1UA7A 3EOSA 2DSVA 4DYEA 3O16A 3ZVIA 3WY1A 4IIDA 3EB2A 4JY9A 1Z32X 3SDOA 4Q7BA 1D2KA 1TE6A 4C5ZA 1OK6A 3POHA 3EWDA 2NSXA 5JU6A 1KM0A 3WQDA 2DVUA 2ZXQA 1JDAA 4MKVA 4ZE5A 1R2RA 4M51A 2WSPA 1DWFM 2QPUA 5IDIA 1S46A 1H5VA 1XHGA 1TPB1 3VIIA 1RP9A 2RJGA 1TV5A 3NZPA 2BG5A 2PDLA 4DXKA 3HURA 1OGBA 3GNRA 3GH7A 2Q3OA 2VGFA 1JZ2A 3HFTA 3CUIA 4H4IA 3SUWA 3TCSA 1UKTA 2W92A 2O56A 1E56A 2ZE3A 3L5LA 3CMFA 2OR2A 4MSSA 1TYGA 3UPBA 4AWTA 1YX1A 2ZA1A 2VFEA 5DN1A 1Z48A 5CPMA 1TRIA 2ZX7A 2DT0A 2NQZA 3W74A 3VGBA 4N9DA 4IG2A 1HG3A 4DBEA 1KXTA 2XIMA 1JAKA 3W38A 4XZIA 1OG0A 2PZNA 4AIUA 1UHVA 4JFSA 2G50A 1K9DA 4J4KA 1E4LA 3FA3A 4ADSA 3DUGA 4XG1A 4GI9A 3B4UA 2Z6JA 1LYXA 4DXXA 2GQ3A 5SWUA 4TXEA 3AHZA 3URAA 1TVPA 1XH2A 3WNKA 1NARA 4LVBA 1PCWA 1DTUA 3N4AA 1S1PA 4U28A 1CPUA 4W93A 4BY3A 1AH4A 3PPGA 5J5DA 2FH8A 3CV1A 2NSOA 3UCQA 4MZ8A 4YVPA 2WWCA 2YCLB 1BRLA 3BURA 2J6VA 3NOEA 2F6UA 4WF7A 1EA9C 2QCMA 3WF4A 1TA3A 2CLFA 2VL4A 4HCHA 4JIEA 4HYWA 2YDSA 4IQDA 2V82A 3TOYA 3LSCA 2ABAA 2YOCA 3UR8A 3Q58A 4MY8A 1Q45A 4PEKA 4G7FA 1QOPA 1HJVA 4MB5A 5I0DA 4UCGA 2WHMA 1XF0A 3MW7A 4D1JA 2NVCA 1AQMA 1YW1A 4X22A 2QGYA 1G67A 3INPA 3S46A 4UR8A 3ZSTA 3KOFA 3RJYA 3MO4A 5JBFA 5F7UA 4DJDA 4WDTA 3W6LA 3UZJA 3T0TA 1N7KA 3O05A 6TAAA 4UTMA 2ZZ3A 2H8ZA 3N3TA 2PDUA 6ALDA 4LS0A 2A3LA 3AMGA 2V2HA 4K8GA 3FA4A 2CU0A 5K9CA 1XYCA 1A5KC 4M19A 3ABZA 1TPDA 5HQMA 4QSHA 4ZOBA 1MDLA 1HW6A 2WYSA 5BRBA 1SSDA 3KDOA 3M0VA 4WIWA 1J93A 4HSNA 2QJNA 3EWYA 4R7JA 3MCMA 2BASA 4O14A 4GNVA 1O5RA 2ZXAA 5IFTA 3VGFA 1GTEA 4LUYA 4D1IA 3GH4A 3ATYA 1JDFA 4J3XA 4OTKA 1JCMP 1F3XA 3JUGA 4DJED 1OD8A 1SW3A 3WELA 1J2BA 1EF3A 1HTIA 2C79A 4XAPA 3QQ1A 2XFYA 3KRZA 3CBWA 3DOPA 4RXGA 1ITXA 5D02A 4IP5A 3U0HA 1U2YA 3OLIA 2V81A 4O50A 4LT9A 4DUOA 1P43A 3KBSA 3CB8A 2VEGA 3VAVA 3O07A 1RY0A 2WVUA 3DHFA 5BOEA 3RLHA 4UOZA 4D6FA 1IZJA 2GGHA 4S1FA 4OT7A 1BQGA 4FNRA 3DESA 5FD0A 1ZJBA 5A8PA 3LPGA 4QDWA 3CZLA 4GVFA 1P0BA 3CWOX 3FEQA 3LBOA 4IIBA 4AZCA 3DG3A 5C7VA 2WPBA 1HL9A 3WQPA 1UH2A 3STEA 1PYMA 4RPQA 2OGJA 3DFPA 2SFPA 3LUTA 3RO8A 3BMXA 3IIPA 1V3HA 3UJRA 3E02A 3VNYA 1JYWA 5PTDA 2G3FA 1P0EA 3ITLA 4WLCA 5CPOA 2I1OA 5ABGA 4AD2A 4IL2A 2E40A 4JD4A 4HJFA 4JY8A 3PG8A 2Y7FA 3A22A 2NXGA 4DJDD 5LNWA 2P76A 4GBUA 5I7GA 2QXWA 3NSMA 3PBGA 2Q8LA 5E9XA 1Q6FA 1B3ZA 4ZGYA 4ORMA 3WENA 3CV2A 1DHKA 3IPWA 4QAIA 2D3NA 5JBEA 3V7PA 1DXIA 4HNOA 4MJZA 3UZXA 3BJSA 2F6XA 3PY2A 5A6KA 1LJYA 2KAUC 4PZVA 4UR7A 3SO7A 3EKZA 1GJPA 4R7WA 1FWNA 3AS1A 1UW9A 3PTDA 1MQQA 1PL9A 2VCBA 4MGGA 4YL2A 2OZ8A 4I9TA 1T8XA 3WQGA 3LHZA 2YJQA 2D2JA 4DUWA 3S6DA 1I2RA 2ZWYA 3IVTA 4Z2GA 2GSJA 5D2XA 2TAAA 3ZMRA 1CB2A 3GB6A 2IPJA 1WXJA 1TSIA 3SCQA 1TX0A 3S3GA 1IZCA 1ITUA 1J0JA 1EX1A 5C71A 2V38A 2XJ7A 3H23A 1KTCA 3CZKA 2HVOA 2NV2A 1TV2A 1I6NA 2XIIA 5G1MA 3FN9A 4WY0B 2XVLA 2RDWA 4O15A 4NJGA 5MKGB 3TN5A 4QE5A 5I3GA 4DM1A 1XH1A 3P0XA 3TNBA 1PB0A 3DI1A 5C2XA 2ZIDA 3GG7A 3N2XA 2ZVRA 4IQEA 3LU2A 1KNWA 2XH4A 3AS0A 3GBEA 3CT7A 1XINA 3PJUA 2DUAA 1F74A 5I06A 1KRCC 2PU0A 2QCHA 5A69A 4GYPA 3MP4A 1FUYA 4IMDA 4LJ3A 3PPCA 3AOFA 4TMBA 3V16A 1XLIA 5H1WA 3LI1A 3TN4A 4HNLA 5HATA 2FMNA 3B05A 1QNVA 3EWBX 5G2HA 1L2UA