4CLMA

Structure of salmonella typhi type i dehydroquinase irreversibly inhibited with a 1,3,4-trihydroxyciclohexane-1-carboxylic acid derivative
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
251
structure length
243
Chain Sequence
b'KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVIAVNDLRSVLMILHNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Irreversible covalent modification of type I dehydroquinase with a stable Schiff base.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Lyase
total genus 95
structure length 243
sequence length 251
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4clmA00
3M41A 5D03A 1FQ0A 3IRDA 3RK8A 4UTTC 4JYDA 4GRSA 1UJPA 2QCLA 1A53A 2QUVA 3PBVA 3HPZA 3QW4B 4LC6A 2LLEA 3P82A 3KXQA 1TPUA 1QO2A 1W5OA 3JRKA 5F2LA 4LVFA 1YTDA 4RV8A 4P61A 4E0CA 5U7SA 3TNOA 3H54A 1K8XA 2CLHA 4QQ3A 5F1UA 3CWNA 3W1UA 4CQ8A 2E6DA 1M7PA 1SFLA 4UNLA 5G5IA 5KZEA 5D30A 3M43A 1W5QA 3NM1A 1XDMA 3P7YA 3PBUA 5D2WA 4HN4A 3PSVA 3E49A 3UXDA 1MEIA 5BOOA 1EUAA 4EOUA 3TW6A 3W1QA 1KM2A 4YL2A 3SGZA 3CPRA 3F1QA 2EPHA 3TV8A 1ZAJA 1T96A 3KVKA 3ZWSA 2A0NA 1I4NA 1QO5A 1EB3A 3DFQA 2TMDA 4GWEA 4OBTA 2Z2UA 2Q8LA 1GZGA 1GG1A 1OG0A 4IMFA 4WY0A 3V75A 1XDLA 4ORIA 2NLIA 1ZHAA 4LVDA 1WOBA 5K4XA 1P1XA 4HNUA 3W7LA 5F4WA 3B03A 2QCCA 1TIMA 3DZ1A 2W79A 3EX6A 4JIPA 3LM7A 1LP6A 3CTLA 2A5HA 1IGSA 3HMJG 1HO4A 5CPMA 4O0ZA 4FXRA 1Z42A 2WSRA 4CCDA 1K8YA 1TPVA 2C1HA 4WXZA 5DCDA 2ZRUA 1TB3A 2E6YA 4N4QA 3G0XA 1KFEA 5H2ZA 1LOSA 4CNOA 3FIGA 4NU7A 1THFD 1I2QA 1OHLA 1F73A 3N3MA 3FJ6A 3WK2A 1QFEA 2P0OA 2X1UA 4LS0A 3IEBA 1VQTA 2CLOA 3SZ8A 1SU5A 4FNTA 3CLMA 2ZZ7A 2G95A 1G7VA 3PUOA 2QJIA 4Q32A 1AW1A 3MI3A 3DFOA 4E2DA 5E0KA 1H50A 1P4CA 3LHWA 5CPNA 3OVRA 1BWKA 4OT7A 4WQ6A 4NZJA 4IXHA 3FFSA 4ONVA 3GX9A 3VE9A 5KZMA 3M47A 4JY9A 3LV6A 3W88A 2FFCA 3UPBA 4N2YA 2ZA2A 4WJEA 3TXZA 3I7QA 3T78A 4OWGA 4WD0A 1T99A 3BG5A 2WJZA 1UASA 2J6XA 1ZY9A 4BI6A 3I65A 5BMXA 4UTLA 4JTLA 5FF4A 2FLIA 2V2DA 1Q45A 1W0MA 5D38A 5FEWA 3UWZA 3W1MA 2VFFA 2QDGA 3I6RA 1EUNA 4UTHA 5K3VA 1YDVA 4LUJA 1M6JA 3MI2A 3LLFA 2QF7A 1DOSA 4C1KA 1YXCA 3W07A 4HPJA 4K7YA 3B8DA 1S3HA 1L6WA 5AC7A 2ZTKA 3QYQA 3T55A 2GJNA 3L67A 4QJ1A 3LTYA 3NQ2A 3SR7A 3WK0A 4UMCA 1VRDA 4O1BA 3C52A 3O16A 5AHNA 1QWGA 1FWSA 1PV8A 3VE7A 5HR6A 1YTKA 4O4WA 3UD6A 3OVQA 1JRCA 2PRMA 1ZALA 4IGHA 1I8JA 1Z41A 4PL1A 5HUOA 1KV5A 2CFFA 4DO5A 5J5RA 3KX6A 4HNTA 3BW4A 2GVJA 5D04C 1B3OA 3DH7A 3M7WA 1EP2A 1X7FA 1FBAA 4JTSA 1FCQA 1OJXA 4EF8A 2XN0A 4FNPA 3Q37A 3HJZA 3RFAA 3MJYA 3RF9A 2Q8ZA 3BGJA 3TROA 2ZZ2A 3TC6A 4FF7A 2X30A 4HIBA 4UTJA 3EWXA 5CG7A 1GEQA 4Q33A 4X3ZA 5TBOA 3S5YA 3GZ3A 4K37A 2DJLA 5BNKA 4AHOA 6TIMA 4XUGA 2EAWA 3O63A 3QC3A 4IJBA 5G1YA 2ZCGA 1ICQA 5HULA 2WO5A 5AHLA 5I3JA 4S1FA 1Q6RA 1WA3A 1ZNNA 3B05A 5BRBA 3E02A 2J9YA 3H55A 1F05A 3NA8A 3MBFA 3OA3A 3LX9A 4QISA 4A29A 3L0GA 2CLEA 1FDZA 3N9SA 4JX4A 1XI3A 3G3MA 3NYZA 2Y6ZA 1DQXA 2QJGA 4DF0A 1TV8A 1W56A 1FXQA 1LBFA 1LRTA 1XKYA 5HINA 2ZDRA 3HG3A 1C8VA 1RV8A 1G67A 2Y63A 3L21A 3M44A 4IPIA 1EEPA 3QRHA 3NAVA 4JGDA 3WJWA 3QH2A 5HWNA 4TR9A 1V7YA 4Q4KA 4FX6M 4DO4A 4XKYA 1NF0A 3DGRA 3A21A 3LHVA 4MOZA 1B4EA 3A9IA 5F2GA 2QAPA 4NNCA 8TIMA 3L9CA 2UV8G 1NVMA 3YPIA 3W1RA 3MHGA 1WBJA 3CEUA 4O16A 2NUWA 3S42A 2Y61A 1VGAA 4AHQA 3AJXA 1Z44A 4RJEA 2H8ZA 1OFEA 3ABSA 3Q94A 3VI2A 1XBVA 4X9SA 1SO4A 4E38A 3U2OA 2V30A 3CT7A 1TTIA 3TE9A 3MHUA 1G4TA 2V2CA 4O15A 1FWTA 3GDTA 5I3IA 3GKFA 1F2JA 4QSHA 3WJSA 1MSSA 2C0AA 3LCGA 4UUIA 2DZPA 3T7VA 4GFSA 3PBYA 1GYLA 1K8ZA 2EKCA 4KKXA 3TJLA 4O14A 3LCXA 3ATZA 3CIXA 2BTMA 4YCOA 3ATYA 2ZRZA 4LY8A 4TU1A 4DBDA 3DI1A 1Z48A 2C13A 2GVLA 4UXDA 1NEYA 4AAJA 1LBMA 1TV5A 4AVFA 1XM3A 1KFCA 1F7BA 3LLDA 4UMAA 3THAA 4UFIA 1GOXA 4TMBA 1XFBA 2R94A 4ICNA 5LSMA 5EKYA 1WBHA 3BV4A 1D3GA 1N7KA 1DORA 4AHPA 1KTCA 3M9YA 4C1LA 5DBTA 5AFDA 1GT8A 4JICA 2A6NA 2YW4A 3M0ZA 5D32A 4JN6A 1YXDA 1ZCOA 3TR2A 3MI6A 3S8HA 2XN2A 1YYAA 1RQBA 1H51A 2NWRA 4K36A 4UFMA 4IPJA 4RXGA 4YWIA 1NFBA 3UWYA 4HPXA 1N55A 2HSAA 2ISWA 2B7QA 3FYPA 3DKLA 3ZR4A 5G1TA 2EGZA 4O50A 3SECA 2X16A 1GVQA 1TPH1 3TK7A 3W7KA 2TYSA 1ME9A 4UC5A 3NPVA 4XZ9A 2VFGA 3VNDA 3KAOA 2ZRYA 3UXAA 1O95A 2CLMA 1W5PA 1LM1A 3P5ZA 5C54A 4LRSA 1QR7A 1S5TA 1ML1A 3QF0A 3A5VA 5AHMA 3NGJA 1RQEA 5CZSA 3PUDA 3SY5A 3GVGA 4LUIA 3UZ5A 2ZYFA 1P5BA 3W1PA 2ZZ3A 1KBJA 4X22A 1IIHA 4MY1A 1UUMA 3FOKA 3W76A 1R30A 2QKFA 1UUOA 3GXTA 4UFLA 4JX5A 5HMSA 1R2RA 2O7QA 5I3FA 5EBUA 3NVTA 2Y7EA 5J5DA 3A24A 2FPTA 5EL1A 2CW6A 4LC8A 2EF9A 3W74A 4HHPA 2X1SA 3C0JA 3TX9A 2NX9A 2CZFA 5D09A 3CC1A 1K03A 3EX2A 1IXNA 4FX8A 6ALDA 1RVGA 2PC4A 4L4MA 1KM5A 3GXNA 4OV9A 5DXYA 2QAFA 2DJXA 3TSDA 4JEQA 3W75A 4WXYA 4A3UA 2JKEA 2QJHA 4K6AA 4ZQNA 3IIVA 3TIMA 5F1VA 4QAIA 3HGJA 1G4EA 3HPXA 1H62A 4Y90A 3STEA 3UZJA 4O52A 3S1XA 2ISVA 1H7XA 1RPXA 3G0UA 2TRSA 3GDKA 1U5JA 3THQA 4LU0A 1TPWA 3STCA 3P81A 2E6FA 4JTKA 5CPLA 5GVJA 3N9RA 4AF0A 2H3DA 3B06A 5DCEA 1KLYA 3L65A 3P84A 4NNAA 2F7FA 5G4EA 1PE1A 2NV1A 2YPIA 3KVJA 3TQVA 4CQAA 3EKLA 5C55A 1OYAA 4A2RA 5BMWA 1HG3A 3LI1A 3PF3A 1R47A 4AB4A 2RH9A 1I2PA 3KVLA 4JNMA 1HO1A 2XFWA 4CCEA 4AWSA 1A5BA 4N6EA 1OFPA 1FX6A 4FX7A 4BF9A 2J9XA 2CWNA 4OV4A 2A7PA 3CHVA 4IMCA 3NQDA 2V5LA 1X1ZA 4O13A 5AYZA 3M5ZA 3HOJA 3E96A 5FF3A 4PTNA 3PVFA 5HWMA 3W7CA 1OVDA 2X1RA 3M5YA 2YDAA 2NWSA 5IBXA 3NL2A 4O12A 2FPYA 1C9DA 4CQ9A 4PFMA 1IXPA 4AXKA 1HTIA 3N2XA 3NR0A 4JTFA 1TJPA 1GVSA 2C6QA 2WNQA 3U8GA 2NV2A 2OMAA 2BSLA 1VC4A 3W7EA 1DV7A 2RKXA 2VOMA 3S1VA 3NM3A 5K7JA 1A5SA 3LDVA 2HTMA 1F6PA 3BG3A 5DXXA 1SZFA 3W22A 3GLCA 3QJAA 3MHFA 4U28A 3PAJA 4ALDA 3AO0A 3S5NA 3EWWA 4JIQA 1EP1A 1LZOA 4LOCA 4DXVA 3G22A 2QCMA 3IGXA 4LS2A 3W7MA 2WKJA 1TTPA 4H4IA 4UNKA 4GUGA 2DZVA 3W7GA 3IIXA 3W1LA 5FF7A 4R34A 5IBXC 4GE8A 3Q58A 3KFTA 3VFLA 1SPQA 1BTMA 3S1UA 1F6KA 1GQNA 3W3OA 3B0VC 2J27A 3MW7A 1PCKA 5KINA 4S2CA 1WX0A 4KWWA 5AHIA 3LOTA 4WY0F 4MLRA 4P2VA 4HNVA 3SJ3A 5CSSA 1G4PA 3TCEA 4NT0A 1TRDA 3SI9A 3SFKA 1M5WA 4U4MA 1MZHA 1H7PA 3HBLA 2CLLA 3EX1A 3G1VA 3PG8A 4LTSA 5CGQA 3G1SA 2B0MA 1GPWA 1L9WA 1AG1O 4MY8A 3W9ZA 1OX6A 5H91A 5I3KA 4LVBA 1PVNA 1WAUA 4PH6A 1Q6QA 4JTIA 1GG0A 3W70A 4BWLA 1ZAIA 2QCFA 1DHPA 3G24A 1LYXA 3IV3A 3NPUA 1W3TA 5CPOA 1GWJA 3E12A 3S6DA 3TXVA 4A22A 2QCEA 3K30A 1TPEA 1SO3A 3EWZA 4UR8A 1G6CA 4MJMA 3LERA 5AHFA 2C16A 3TDFA 3B0UX 2FTPA 3QEZA 3N19B 3QPZA 3TQ0A 3C3NA 3QMTA 1TYGA 4ZMGA 1MO0A 3B04A 1KM1A 1S5VA 3A23A 3FKKA 3C2RA 1QPRA 1S5WA 2YZRA 1FWRA 2RHGA 2ZZ1A 1LCOA 1M7OA 2GQ9A 2A7RA 4LV9A 2C15A 3L5MA 1JRBA 4I9AA 3W1TA 3T40A 1XUZA 1A5CA 3TFXA 2NUYA 3LXAA 3MO7A 4BWLC 3W7OA 4Z1BA 4M5PA 2OCZA 1XBXA 1YDNA 3T4CA 3R5EA 4ORMA 4UTWA 1JULA 3NQFA 2CLFA 1OFQA 3C61A 4Y96A 3L2IA 5L9FA 3FEMA 1H7OA 3PS7A 1W5NA 4O0KA 4JTGA 3IVSA 4UTUA 4PODA 1YPFA 1ALDA 3PWAA 3INPA 1RR2A 3GAKA 2V8ZA 1AW5A 3L5AA 1KV8A 1WXJA 3IIZA 2VKZG 4WOQA 1W37A 3WJXA 3UWQA 4Z1AA 3STFA 4NJJA 1HL2A 3O07A 5KTLA 3C2OA 3R12A 1VCFA 3W2KA 3SSJA 1L2UA 3LXBA 5A8GA 3ZFHA 5LGZA 1TPC1 1VHNA 4IX2A 2ALDA 4KFNA 1L6YA 3L0KA 3NQCA 2W6RA 4LS1A 4UTWC 3C2VA 1PS9A 3W7QA 4L4LA 1N8FA 3KOFA 3TMQA 2J24A 4O8RA 1KFBA 4DELA 3HQ1A 2Z6JA 1JJKA 1PIIA 3MWAA 4MZ1A 3L68A 5LNUA 3LHZA 2JKPA 3LCHA 1FWNA 5F2MA 4DEFA 3G18A 4K8HA 1TCDA 5MHBA 4EWND 2OT0A 1VHCA 3CU2A 2ZZ4A 3BW2A 4QM1A 1B9BA 2ZA1A 1YXYA 4ZQPA 1R2TA 4JDBA 1T8XA 3TA6A 1ADOA 4N6FA 1CX9A 3O15A 2VXNA 1LRQA 2ZZ5A 3DBPA 3M1ZA 4R7JA 3ABRA 3O6DA 4NXSA 5KMYA 4CCCA 5EY5A 1DBTA 1XXXA 3ELFA 1A5AA 4OHQA 3LRKA 2QCHA 2H3BA 4ZQRA 4K38A 3M5VA 4O4VA 2A4AA 1OYCA 3G3DA 2E6AA 2NX1A 3W2LA 1KFKA 3LTSA 3HGSA 3W2NA 2FQIA 4PC8A 4Z08A 4JTUA 5K9CA 5U4NA 3RMJA 1KTBA 2VEKA 1B4KA 4S2BA 1ME8A 3LBCA 2ZFAA 3G0SA 3C56A 3W1AA 5G2WA 3KHJA 5D37A 4FNRA 4HKPA 4O57A 4JY8A 2EHHA 1HUVA 1KM6A 3QFEA 4NJHA 2GQAA 3C4UA 1QPOA 2WNNA 4Z1DA 4JDYA 7TIMA 5LZLA 3BLIA 4Y6GA 3UY7A 1YPIA 5HNRA 4XTIA 4CLMA 5D33A 3TC7A 1SZEA 2VEMA 3NPXA 4FNQA 4RR4A 2ATMA 3MP5A 3IIOA 1Q6LA 1TSIA 1QDSA 3D0CA 2DZTA 3P80A 5AHEA 2QCDB 4ZZ9A 2NXHA 2BXVA 4JYFA 3GNNA 3W7IA 4PCFA 2Y7FA 2QR6A 5F4XA 1WQ5A 1GJPA 4EVZA 3DFPA 4M6QA 2GVGA 1Y0EA 2JK2A 1OK4A 3LHTA 5KITA 2YFNA 3NXFA 5HUPA 2FJKA 1SW0A 2Y88A 2DP3A 2ISSA 2RDWA 2W0UA 1PL9A 1TPFA 3LCFA 1QOQA 1JCNA 2ZA3A 1W5MA 4I7UA 4XQ6A 4Z0JA 3FLUA 1XBZA 1GVFA 4O54A 3VCRA 3QSRA 5LNWA 1I2NA 3E9AA 4FNUA 4GJ1A 4RZ4A 3W84A 1EIXA 5D02A 4IMDA 1F5ZA 4AEOA 3G1HA 3LRMA 1ZENA 1H1YA 5C2XA 1VS1A 1BWLA 1VJIA 2GPTA 2R14A 1KW1A 4MFDA 1SZGA 3W2JA 4WOZA 5F4SA 3HB9A 4ZQMA 3TW7A 1VYSX 4M6PA 3LCWA 1F74A 3BVJA 3DKJA 1RZMA 1P0NA 3PSWA 4M7SA 4N9DA 4AWUA 1X1OA 4FNSA 2QUUA 2P1FA 1KM4A 4B5NA 2TSYA 2VEIA 4IMEA 5TQLA 1XC4A 2FIQA 4N9CA 1TQXA 2Y7GA 4JXCA 1WOAA 2DZUA 4UR7A 1O94A 1ZAHA 1O4UA 4NX5A 2KZHA 1L6SA 1ZFJA 3BK0A 3UQNA 3TH6A 1LOLA 3SGUA 3BLFA 1RQHA 5E1QA 4N4PA 3A22A 3QM3A 4Y8FA 4MY9A 3V1PA 1VCVA 1KM0A 1AL8A 3F4WA 3OG3A 4GBUA 4FB7A 5BW6A 4LVAA 3R8RA 3I68A 3N34A 5HJLA 1GVOA 3G1AA 4JYEA 2E68A 3PUEA 3F4NA 1OFAA 2V9DA 4NVTA 1R46A 2ZRWA 4KFOA 4DQWA 3LGEA 5DY2A 2V2HA 1H7NA 2HMCA 4RZ6A 2A7NA 4DF1A 1FCBA 2YCEA 4N02A 4JTEA 1QNVA 2G96A 3EEGA 4R33A 2WPBA 3C2FA 1OF6A 2PCQA 1O5XA 3SIZA 3NZRA 3TJXA 3BGGA 3NPWA 2X2GA 4ADUA 2PE4A 3DI0A 2Q3OA 1OX4B 2F84A 2NZLA 2C19A 3HG2A 2WSYA 3CEPA 3SW6A 2CZDA 3B0PA 2AGKA 3NG3A 3W23A 4IOTA 3B4UA 4HSNA 4RX0A 4M19A 3UWWA 4UFKA 3RNDA 4D2JA 4RZ5A 2QDHA 1GYNA 4LRTA 2YFOA 3OVPA 1VYPX 2OX1A 4EF9A 3GDMA 3S5OA 3MMTA 1YADA 3DENA 3LCIA 3W2MA 2GQ8A 1LORA 2A85A 4E2BA 3EX4A 3WJZA 1FXPA 3HIJA 1TO3A 1W31A 4GC4A 1I2OA 1ZJIA 2ZRVA 2WQPA 3MYPA 1H7WA 3GR7A 2JGQA 5EYWA 5CZ0A 2YYTA 2CLIA 4IQLA 5AC8A 1FDYA 3TKFA 3PC0A 5FF2A 3W7JA 2QCNA 4NUWA 1WDWA 1DJNA 1JCLA 1JVNA 3GB6A 4JS3A 5D2YA 5LHEA 4DF2A 3WJYA 1TTJA 2HS8A 1SSDA 3NQGA 1LDCA 1DVJA 3WK3A 4MKNA 1J5TA 1W1ZA 3GNDA 4BK9A 4DPQA 3DAQA 3EWBX 1YLVA 3W7DA 3TSBA 2I1OA 2E5CA 1D9EA 3NQVA 4ZQOA 4LW7A 1KM3A 4QITA 4UCGA 4WZHA 2TPSA 4RCXA 1TPB1 3EKZA 4R53A 1QOPA 1GTEA 2V0TA 4W9TA 4RLIA 1TREA 4Z0SA 3IGSA 5ABTA 4I7VA 3DFNA 3RLUA 4MFEA 2NXIA 3G8EA 5DN1A 4FEZA 1U83A 5FESA 2FB3A 3IVUA 2B7OA 4UTKA 5DCBA 3FKRA 3UPWA 5EA9A 2JGYA 1VCGA 3S9YA 4GUJA 3PBWA 4IXXA 3P8IA 1QMLA 4MYAA 1EA0A 3Q2DA 5AYYA 5FEXA 2YYUA 1SW7A 2G5WA 4A2SA 1W8SA 2AAMA 3TAKA 5K9XA 4XKYB 4ZQCA 5AOUA 2V81A 1H61A 2E5DA 5FEPA 4UTMA 4O28A 1MEHA 2C14A 5LKYA 3PULA 5AN7A 5LNVA 3LHUA 4FIQA 1IXOA 1H7RA 4FIRA 2Z1BA 1DKWA 2YSWA 4N9EA 1SR9A 1NAL1 3LCLA 1O60A 5G2IA 1TV7A 2YXGA 4GUIA 4MLJA 3HO8A 1BKSA 3LTPA 1AL7A 3MBDA 4NZFA 1SO5A 2WOQA 2JKAA 1O5KA 4HSOA 3UNDA 3NNTA 1JUEA 3W7HA 1H1ZA 3QZEA 3W1XA 5K2ZA 1MXSA 5G2HA 1FCUA 1TPDA 3G8RA 2QCDA 5CZJA 4JTJA 1DL3A 3NL6A 2DZWA 3TU9A 5AC6A 4IUOA 3TMLA 2GJLA 2YW3A 2VFHA 2YGYA 5A5WA 4LWWA 3PY2A 4AWTA 1W3IA 3P62A 1TRIA 3C6CA 3BPWA 3NL5A 3CWOX 3O6YX 3W85A 4GNJA 1MEWA 4TIMA 1K02A 1KA9F 3F03K 5L6UA 3NZ1A 2CZ5A 5CSRA 5LGXA 1H63A 1LLZA 2OZ0A 3BO9A 4IMGA 1ICSA 1PHWA 1X8FA 3A5FA 5E93A 1SZNA 3N2MA 2RDUA 4PA8A 1V5XA 4NX0A 2FB2A 1ICPA 1HFBA 2BX7A 4Z1CA 3ANYA 2CZEA 1G7UA 1ONRA 3OIXA 1LLWA 2I9EA 2PURA 3O1NA 5LNSA 5DELA 4O1AA 5C5YA 5T26A 5HQEA 3PG9A 1B57A 5K4ZA 1KBIA 3LRLA 3P60A 1SO6A 3NQAA 3QW3A 4MIMA 3FYOA 1A50A 2ABAA 4YLWA 4Y9AA 1JQXA 1OFDA 1JUKA 4JTHA 3I7SA 3RU6A 1NSJA 4M7TA 1W3NA 3ABQA 4JR5A 4NJIA 3O8AA 4X2RA 1JR1A 5D05A 3W1NA 3JR2A 2HS6A 1J4EA 2V5BA 3G1FA 3PR2A 1EWDA 1QCWA 4JTTA 3QMRA 5SWUA 3BG9A 1C29A 5D2XA 4BI5A 2VC6A 2G97A 3T44A 4HNNA 3PB2A 3S5ZA 2VFIA 4NXKA 1TMHA 5DLCA 2ZQ0A 3S1WA 2Y70A 2BZNA 4NJKA 3VKJA 4LT9A 3EX3A 2C18A 3L5LA 1K7XA 4XWUA 2D73A 1JUBA 2H8XA 2NXGA 3CB8A 1D3HA 1K7FA 3KVMA 4K8EA 3M16A 2RDTA 4AH7A 1SUXA 3IIPA 1IXQA 3LI0A 3PM6A 4YCPA 4HT3A 3DHDA 3KRSA 3M5XA 2VEPA 1VZWA 2Z0IA 4O1DA 3EXSA 3W87A 1SFJA 1OX4A 3IGUA 2CU0A 1LTDA 2A1YA 1K3UA 4H3DA 2R8WA 1EWEA 2ZRXA 4FO4A 4A21A 4O10A 5LNRA 3PB0A 5D2VA 1UBSA 2DU2A 1BEUA 4KWVA 4MZYA 3MYOA 3DXIA 1TQJA 3IVTA 4RKAA 2Y62A 1GTHA 3P67A 1H60A 2VFEA 4UIOA 3NEVA 3OBKA 3GDRA 1DJQA 2J88A 1TJRA 3JS3A 1OFBA 4QNEA 1PHQA 2ABBA 2O7SA 1QPQA 3BARA 3E0IA 1R2SA 4AF0B 2DORA 1QPNA 4TMCA 3EWYA 3RLVA 3NQ8A 5K9DA 3KRZA 2P10A 4DPPA 4MZ8A 3W73A 4CNNA 2PRHA 4NQ1A 3HGOA 3OEXA 2I14A 1KFJA 3GIYA 3EXTA 1W54A 2A21A 2VENA 5FI8A 5KSWA 1H5YA 4NJGA 4JD4A 3M6YA 1Q3NA 1FWWA 3HPSA 5HR7A 4GXMA 2Y85A 2B7NA 2OJPA 1LRNA 2R91A 3C8FA 4LV4A 3QPYA 1AW2A 1VPXA 3R89A 3GXPA 1F76A 5AYXA 4O53A 3TAOA 2XN1A 2Q3RA 3C2EA 1TTQA 1VLWA 3TSMA 1NF7A 4FHAA 2E5BA 3NOEA 1JCXA 2VFDA 2BLEA 4UFJA 3W7RA 3L66A 1G4SA 3MP4A 4ZL1A 5AB3A 4OE7A 3QQ0A 1XCFA 4YMZA 1CW2A 1JQVA 1OFRA 1YTEA 4DBEA 3W6YA 4O11A 3HGRA 1AMKA 2QCGA 1XBYA 2YR1A 2WSQA 3W86A 5TIMA 5FF0A 2WV8A 4O19A 3TFCA 2E09A 4UMBA 3P61A 2E1DA 5LHFA 3NQ7A 1FY6A 2ZTJA 3KRUA 1EX5A 1OFOA 4WY0B 3L0NA 4OQVA 4O17A 5CZTA 1EP3A 4GUFA 4QIUA 4ADSA 3U6WA 3FJLA 4MVAA 3MUXA 3LB0A 3CQ0A 2B4GA 2A2IA 2Y89A 3ZS4A 4BFAA 1XL9A 1OF8A 1SSGA 3WK1A 1CI1A 4MJZA 3N14A 4TO8A 2FPVA 2DZXA 4K7VA 4OGZA 3HG4A 3O05A 5D2TA 3UWUA 5FEZA 1XUUA 2X1TA 3NQMA 4RK8A 3W7PA 3P74A 5DY3A 1OABA 1KLZA 5DBUA 1EPXA 4O18A 4BR1A 1OK6A 2ATSA 5EMUA 3NO5A 1FDJA 3LV5A 1G69A 4XBSA 4JX6A 3CIWA 3R2GA 4XTDA 4LNYA 4YXGA 3GYEA 3FA5A 3TQKA 1SW3A 3GAYA 4FXSA 1UCWA 5C6MA 3W72A 2GUUA 2NX3A 2WNZA 3DHFA 3G1DA 5I3HA 3HG5A 4WX2A 4K39A 3EWUA 2BWGA 5G4WA 3QQ1A 4MUZA 2VELA 3ABOA 4H6KA 4UFHA 3P5YA 1FCVA 1DQWA 1UB3A 3HF3A 3NQEA 5F2IA 1FUYA 4QNWA 4BI7A 4CNPA 2C3ZA 2GOUA 4IWWA 4IX0A 1I2RA 3W83A 4LVGA 3GR8A 2Z6IA 3DFTA 3GKAA 2B7PA 4UTIA 4NNBA 2PRLA 4G1KA 5EPDA 3W71A 3H53A 4RXFA 3W7NA 1VYRA 4PL2A 2RFGA 1KTNA 4OU1A 3EB2A 1SQ7A 2AQWA 3W2UA 1WV2A 5KZDA 1JCJA 3QSTA 4M6VA 1AK5A 1PCWA 2QEZA 4DO6A 3NL3A 3N73A 1LROA 1IIGA 3TUUA 1WYIA 3P8JA 1OYBA 4WUIA 4AMAA 1VH7A 2H90A 1KFLA 1YDOA 2FDSA 1LOQA 2NUXA 4TX9A 3G1YA 2IQTA 3GK0A 3UY8A 4MYXA 4ADTA 3QMSA 4KFPA 5IM51 2JBMA 1X6UA 3O06A 3LHYA 3BW3A 3UWVA 2DZSA 3NDOA 3O6CA 3NQ6A 3FS2A 3BLEA 4O1CA 2V82A 1Q6OA 3OHIA 3STGA 1QAPA 3DFSA 4XBKA 1T0OA 2OT1A 3GDLA 4UTTA 1RD5A 4PEKA 1I45A 4GUHA 4MPQA 3ZWTA 1VR6A 3WFAA 1K7EA 2E77A 2QUTA 1LBLA 2YX0A 4I7WA 3R13A 2ZBTA 1ME7A 4ZVJA 1JCYA 3EXRA 4N9BA 4EIVA 2J9ZA 2Y7DA 4POCA 1J2WA 5HWJA 3UYCA 1P0KA 3I7RA 3S0CA 3USBA 5CKSA 5I3GA 1VLIA 3LXCA 1GVRA 1IF2A 3CM4A 3G1XA 2A6LA 4ML9A 2ZZ6A 1E51A 2CLKA 2H6RA 1OX5A 3LBMA 3MP3A 3DU0A 1JCMP 4J9JA
chains in the Genus database with same CATH superfamily
3KOXA 1FQ0A 3S5SA 1UMYA 1K1DA 3A4XA 3V5OA 1T6MA 1XD1A 3GG1A 3SGGA 2QUVA 3CQKA 4EPDC 3PJXA 3GU2A 1I1WA 1QO2A 5DF0A 1YTDA 4RV8A 1BYCA 3IARA 4XZMX 4E0CA 2QPXA 3N6HA 4QQ3A 4C6FA 1N82A 4CQ8A 3UR7A 1US3A 4UNLA 5G5IA 1PB0A 3P7YA 5AECA 5D2WA 1HX0A 1X98A 3E49A 3UXDA 5BOOA 4H9ZA 1B3VA 3W1QA 1KM2A 1V02A 1R3TA 2A0NA 1I4NA 1EC7A 1EB3A 4IP7A 1J79A 4ATWA 2VOTA 1TVLA 2Z2UA 1OG0A 2INZA 3GIPA 3V75A 1BG9A 1WKFA 1ZHAA 4PMRA 1GEHA 2QCCA 2W79A 4JIPA 3URBA 3LM7A 2WNWA 2XH2A 4Q8UA 3HMJG 4QGCA 2PEVA 5CPMA 1JIBA 3DDMA 5BXRA 1Z42A 3W81A 3E5PA 1W9UA 1GHRA 2C1HA 1IQ8A 4N4QA 1LL4A 2R1KA 3FIGA 1OHLA 4W8BA 2ZUMA 1Y65A 1B3WA 1QASA 2GLKA 4X0NA 2VEGA 2PDJA 2QMJA 3MI3A 4DHGA 1MMFA 4E2DA 5E0KA 1H50A 5GJPA 3MV11 4J4KA 3V0UA 4OT7A 5H8PA 1XH2A 4QDMA 5KZMA 4JY9A 3O2LA 5J04A 4MJ2A 2DVTA 3TLLA 3TXZA 4UB9A 4TV5A 1EYWA 1T99A 3D6NA 1UH4A 2INFA 3UYIA 3UZYA 2J6XA 1MXDA 4HMNA 3K8LA 5FSEC 1EEXA 3FA4A 3FY1A 1SM9A 2J8TA 3T0BA 2VZTA 2VYOA 2V2DA 3LN3A 5JUVA 3W1MA 4J3XA 1TR1A 3VCNA 4UTHA 5FL0A 5K3VA 4PB5A 5I77A 1KXHA 1E1CB 4PBEA 4ZENA 1YXCA 2OQLA 1AH0A 1OC6A 2VX5A 2ZUVA 1L6WA 5AC7A 3WELA 3QYQA 3T55A 4H83A 1Y5WA 2UBPC 4LB4A 3O16A 2X42A 1ZBCA 1QNQA 4O4WA 3MWCA 1I8JA 5GNXA 2UY5A 3LY0A 4CN6A 4IP5A 3TN5A 1FWAC 1GONA 3KX6A 3VIGA 3DH7A 3DFHA 1V3IA 2GL5A 2PGFA 1E4IA 1OJXA 4E2OA 5M17A 1YQ2A 3BGJA 2DH2A 4FOUA 3V16A 5CH9A 5CJMA 2E8YA 4DUXA 1XGEA 1UPMB 3S5YA 3GZ3A 2X41A 1XIFA 5A6MA 3GQYA 4K37A 3UZXA 2ESCA 1A47A 3EZ4A 2HVNA 1DIKA 4XAGA 3LSCA 4IJBA 5HULA 1EH9A 1UWSA 5IOBA 5E70A 4X2PA 1Q6RA 1M9HA 1WA3A 1GW1A 5BRBA 3UVAA 3W28A 4PYSA 3CQIA 3NA8A 3UW6A 4YPJA 5JU6A 3R11A 1H3GA 2VWSA 4M29A 1XYMA 1BVWA 1TV8A 3KP0A 2ZUUA 2ZDRA 3OVGA 3APYA 1EEPA 1IWAA 1NFGA 3I6TA 3QV7A 3UF9A 2BGSA 3BSHA 5I23A 4JQ2A 5HWNA 5IXEA 3UESA 4Q4KA 3PWGA 4FX6M 3DGRA 3A21A 3A9IA 5F2GA 1W1IE 2QAPA 1JF5A 1M03A 5JH1A 3WNOA 4AYGA 3YPIA 4E3TA 1OT2A 4LY4A 2HV5A 4C6PA 5JMUA 4AHQA 3Q94A 3ABSA 1EXBA 3VGEA 2BY0A 3LMZA 3PN8A 2GZXA 4I9JA 3PZGA 5BXSA 3UR8A 4D6CA 4B5VA 4Q7BA 1PAMA 4ICMA 1F4HA 3UGVA 2C0AA 2Z24A 3CV6A 3VOIA 3BTNA 3AMLA 3LCGA 4GZEA 4C6KA 1NDYA 3PBYA 4AY7A 3TA9A 4RE4A 3LCXA 3CHEA 4TU1A 2GFTA 1VB9A 2GVLA 1Q6FA 4ZSTA 5EMMA 1XFBA 1UWUA 1BTCA 2AQOA 3QHMA 5EKYA 4MKSA 1EGMA 1D3GA 2PU1A 2FVLA 1RXOB 1UR8A 1YRRA 3TWAA 4C1LA 2I56A 1E0TA 1GT8A 3KWSA 4GI6A 2A6NA 2YW4A 1IWPA 1ZCOA 8XIMA 2PCEA 3MI6A 2PBOA 2XN2A 4LUSB 2WMKA 1OB0A 2OYLA 4GBDA 3W27A 1YYAA 4C6MA 4HPHA 1LWHA 2AL2A 1H51A 4RE3A 4XD5A 4K36A 4IPJA 4RXGA 2FYMA 3WBWA 3UWYA 3RJYA 2ISWA 3DKLA 2V6AA 3PUGA 3SECA 2HK1A 4PULA 1TPH1 4M24A 1Y5VA 1B30A 4IZGA 2VFGA 1EGVA 3MMWA 3N04A 4G6CA 5ABHA 4PZVA 1M53A 1UA7A 2J7DA 1O12A 3N2TA 1JDFA 3G2GA 3H2MA 3DG7A 1E70M 2IS7A 4AISA 3QF0A 4GHRA 3NZGA 1V7AA 2EEXA 3NGJA 5CZSA 2VDHA 3SY5A 3KLKA 2ZYFA 5CLTA 2DQXA 4RDZA 4X22A 4MY1A 4B15A 1GOQA 3W76A 4GQRA 3GBDA 3GXTA 4QDWA 1M3UA 5HMSA 1EF2A 2O7QA 3RPDA 5I3FA 3WUBA 3BC9A 2Y7EA 4IGNA 5J5DA 3A24A 4XSLA 2FPTA 2IKGA 3BCJA 2CW6A 5HDRA 3W74A 4HHPA 2NX9A 5D09A 4PCTA 5LA2A 1TCMA 2ZWYA 1K03A 1E5NA 3VIJA 1UR1A 1MUCA 1IXNA 2PI6A 3EX2A 4FX8A 6ALDA 2VMFA 5DXYA 2QAFA 2OQYA 3LMYA 4Q8OA 4K6AA 5CJ5A 3TIMA 4QAIA 4DY1A 4Q8QA 2PDPA 3S1XA 1RPXA 3PJTA 4IPLA 3G0UA 5CPQA 1U5JA 4DB7A 4DUVA 3THQA 4ERIA 3RDKA 2XYLA 3P81A 4XAZA 2ZX7A 2OLSA 1VP5A 1W1TA 3N2CA 1PYMA 4XZNX 1S3TC 2H3DA 5DCEA 1KLYA 5G4EA 1PE1A 2R1PA 2YPIA 3TQVA 4CQAA 3EKLA 4A2RA 3PF3A 2X1IA 1E0VA 2XH7A 3F5JA 4AB4A 2VURA 2RH9A 4JNMA 4B2DA 4CCEA 1OFPA 2IPWA 4FX7A 5IDZA 2WHKA 2CWNA 4OV4A 1W1B1 2A7PA 3CHVA 2J7EA 2V5LA 4ZOAA 4O13A 3N4AA 3U4FA 5A8OA 1UZ4A 1CXFA 3E96A 3QR1A 3DC0A 1O5QA 3MANA 4PCSA 2YDAA 2NWSA 4LJ3A 5IBXA 3VINA 1AJZA 4CQ9A 3OBEA 4G56A 4Z2HA 3C0LA 4O8AA 3NR0A 2C6QA 2FKPA 4JIIX 3WQ8A 2QVHA 1VC4A 2G3NA 3UR2A 3NM3A 2REQB 3HU7A 4Z42C 2Z27A 1XF0A 1YBQB 2QJMA 3KBVA 5BZAA 4U28A 3UJRA 2XIIA 4ALDA 4XAPA 3AO0A 1K8CA 4JIQA 4LOCA 2WXDM 3LBOA 3IGXA 1KRCC 1TTPA 4F48A 1F9CA 2OWXA 3WDPP 2DZVA 3W7GA 3E6EA 4GC3A 5IBXC 2EPOA 1RD6A 4OBSA 3XISA 3B0VC 3MW7A 5KINA 3KP1A 3MZNA 2V3FA 4WY0F 4MLRA 4NAFA 5E6ZA 1TRDA 3SI9A 1XINA 4CNTA 2ZC1A 3REQA 1M5WA 3BAJA 1C8XA 1MZHA 3BXWA 5CG0A 4B16A 5CGQA 1KR1A 4MY8A 1K9TA 3MSDA 3EB4A 5I3KA 1WAUA 4PH6A 2EG8A 3W70A 1ZAIA 2QCFA 3G24A 3N29A 2J79A 3MPGA 4QE5A 1W3TA 2GWGA 1K9FA 4A22A 2QCEA 4XO7A 1NWSA 1V77A 1PBGA 1G6CA 2BGQA 4MJMA 3BLPX 4IP4A 3QEZA 4GVHA 4EKJA 4UQAA 3GHSA 3QMTA 4GD0A 2WVUA 1FWCC 1S5VA 3THUA 4KGJA 1XLDA 3EA3A 1S5WA 4XZWA 3MDWA 1FWRA 1UR4A 1UQYA 2Z25A 2ZZ1A 2OG9A 3VU2A 2C79A 2Y8UA 1PJ9A 1XUZA 5IDIA 3VOHA 3TFXA 3PFMA 1LG2A 4JQAA 3LXAA 4JTQA 1RLCL 3MO7A 3CUZA 2OCZA 3U2EA 4H7ZA 4ORMA 1TX0A 3OQEA 3NQFA 3CS2A 3KOYA 1OFQA 1LQ0A 3C61A 4A8IA 5L9FA 3FEMA 2O4MA 1BYBA 1XRTA 3IVSA 1AODA 2E28A 1ALDA 2BB0A 4GQGA 3GAKA 4PE8A 1DE6A 3CGTA 2P8BA 1KBBA 3GUGA 4GI4A 3WJXA 1CECA 3MKVA 1UKSA 2QT3A 2FGLA 3AHZA 4C1NB 1VCFA 3ITYA 3W2KA 3SSJA 2EPKX 3ZFHA 1V3MA 1E72M 4AZHA 5A8NA 3C2VA 1O1HA 1C3FA 2I5GA 3W7QA 3DYPA 2KX9A 3ZQ9A 2E3ZA 1S38A 1J18A 2VO5A 2ACSA 2OQHA 5LNUA 3M6DA 1PKNA 5F2MA 4DEFA 3G18A 1A80A 1TCDA 1OBAA 3UA4A 1WE5A 4EWND 3OLEA 4QM1A 1RAKA 2V5CA 1W9DM 4BEUA 4KCWA 1R2TA 1T8XA 4J2MA 4BS0A 2VXNA 1UD5A 3DBPA 4B2DD 5KMYA 4S38A 1BPLB 4CCCA 2V68A 5EY5A 1DBTA 1A5AA 2H3BA 3USZA 4K38A 1ZJHA 1TMQA 3JVAA 3VNYA 3NYDA 2E6AA 1KFKA 4PC8A 1QT1A 4H8NA 4JTUA 5U4NA 3RMJA 1KTBA 2OOFA 1ME8A 2E8ZA 4F79A 3C56A 1JL8A 1E3ZA 1ZP4A 2YA1A 1HUVA 2PWGA 2WNNA 4Z1DA 3SEPA 3M7SA 2FMNA 3C0SA 3ARRA 3LQGA 4Y6GA 5EMKA 4CLMA 5D33A 1SZEA 3NPXA 2BHYA 4H04A 4JHZA 3WFZA 1JD7A 3HURA 1QDSA 1E6ZA 3WBAA 3S4TA 3B0YA 3VGHA 3VO0A 4CNUA 3RR4A 4PCFA 2Y7FA 2QR6A 5HATA 1QI5A 3DFPA 3WH8A 4BKNA 3AYSA 3MT1A 2FVKA 4J3WA 1HQTA 5HUPA 3SRKA 2Y88A 2ISSA 2ISFA 1TA3A 2QW5A 2W0UA 3RM9A 3V35A 5FJUA 2WLZA 1QOQA 3LCFA 3R8HA 4XQ6A 1XBZA 2PF0A 1GVFA 4PB3A 5LNWA 3TEVA 3PWIA 4FNUA 2H9AA 4Z2KA 2NLYA 4NRSA 4M0XA 3V36A 3SCNA 1P6CA 1F5ZA 4AEOA 4A35A 1PWMA 1ZENA 1H1YA 1WKDA 4QG6A 1SZGA 3W2JA 3TYAA 2BVYA 4Z2GA 1VYSX 2VC7A 3LCWA 3BVJA 1P0NA 1X1OA 1AQHA 3VX0A 1G01A 1KM4A 5TQLA 2WK2A 1KCLA 1WOAA 4NX5A 4FR6A 2V69A 3BK0A 3M64A 3U57A 2E4TA 4DYKA 1TJ2A 3BLFA 1EBGA 7ENLA 1SJBA 1CXEA 4P8VA 4Y8FA 5CEWA 2VHLA 1OZQA 4HNLA 2OB3A 1IZJA 4FB7A 4AVOA 1E0WA 3CL6A 4O1EA 4DX3A 1EPVA 1GVOA 4JYEA 3QXBA 3PUEA 3F4NA 1OFAA 2YZ5A 4FOKA 3KEHA 3CUHA 4KRTA 3LGEA 4BY3A 2WANA 1H7NA 3V0SA 1K9DA 2NVDA 4F9JA 1MZRA 2IPFA 1QI3A 1TMLA 4CU7A 4L1XA 1OF6A 1O5XA 3TJXA 4MADA 3R43A 3VIFA 1QOXA 2WC7A 4L4PA 3SM0A 2X2GA 2F2HA 4YYFA 4ADUA 2PE4A 3K13A 1R9XA 3CXOA 2Q3OA 2NZLA 3HG2A 4KEUA 2CZDA 3W6MA 4C5YA 2AGKA 3B4UA 5IHRA 1JI2A 4DLFA 1E6SM 1DP0A 4J3TA 1GYNA 7PTDA 2OX1A 1TVPA 3GDMA 2VZUA 3S5OA 4F3HA 3MMTA 4YHGA 3WJZA 1FXPA 3NOYA 1EJWC 4LAKA 1C8QA 3WLIA 4GC4A 3HMCA 1C90A 3S46A 5EYWA 2JGQA 5CZ0A 2YYTA 4GIEA 5AC8A 1FDYA 5FF2A 3T05A 4J3ZA 4RE2A 3LK6A 1JVNA 3GB6A 4XZLX 2R1MA 1PDZA 1UMLA 3WJYA 4S39A 3KDNA 1LDCA 1DVJA 1J5TA 4H9TA 3GNDA 4BK9A 1K6AA 2HE8A 1GJWA 1K77A 1YLVA 3TSBA 1A3HA 1XIDA 1IV8A 2ZDSA 2HCVA 3NQVA 4ZQOA 2J7CA 4LW7A 4OBRA 2VZVA 4RCXA 3QV6A 3H4GA 1EKOA 1QOPA 4OOUA 1HP5A 1GTEA 2YCKX 4IIGA 4PR4A 4RNHA 3TTYA 4RLIA 1TREA 3AZRA 2DT0A 3DFNA 4Q4RA 1U83A 1JI1A 1ZJBA 1XCXA 2HPMA 4UTKA 3FKRA 3CAKA 1NJJA 3UPWA 2JGYA 5KEZA 3PBWA 4MYAA 3S9ZA 5AYYA 3KUMA 3PPFA 4U31A 3EGJA 3HZ3A 1PEZA 1W8SA 1M65A 1JDDA 1EZ2A 4IIFA 1H61A 3LGDA 3WH5A 4OIFA 4IT1A 4LAZA 3S6OA 3PULA 4FIQA 1IXOA 3LQLA 2Z1BA 2TAAA 4N9EA 3LM3A 3CJPA 4REQA 3LCLA 3SCUA 3U2ZA 1FVPA 4MLJA 4MKVA 4NZFA 2JKAA 2POZA 5A6TC 4GIRA 2CITA 1BYAA 1JUEA 1T41A 1RBOB 1R7AA 3W1XA 3WLTA 1MXSA 5G2HA 2BV9A 2QCDA 1FHDA 2YBTA 1TX2A 2OSXA 2VFHA 3MZ2A 2DUXA 1F3XA 3UXIA 4CD8A 5B80A 1EX1A 4GIYA 1VBUA 3NL5A 3F4DA 4AC7C 4PMOA 3W85A 4R9XA 1MEWA 3F03K 1QK2A 2ZIDA 1MNZA 4GO9A 4AZBA 3WQWA 1C93A 3BO9A 5E93A 1SZNA 3N2MA 4NX0A 3BAYA 1XPGA 2BX7A 1KD0A 3OIXA 5I3DA 1OCBA 4EE9A 3O1NA 3RM8A 2D20A 4NASA 1MVYA 2EO7A 4HJFA 5K4ZA 2VGIA 1AJ0A 3G1RA 4E8DA 2GSEA 4WKFA 1SO6A 4LAUA 4MIMA 2DIKA 4YLWA 3BANA 1JQXA 4U3CA 4GH3A 2XIBA 1GQJA 4JTHA 5DRCA 4GINA 1E6PA 3PNZA 1NSJA 3VKDA 3ABQA 1GOOA 2QVNA 4GISA 1J4EA 1V03A 3AIBA 3ES7A 1RK5A 2WKLA 4JTTA 3QMRA 2Y2WA 2VC6A 4PTXA 3S5ZA 3BQ5A 1YMYA 3IV8A 5BU6A 2ZQ0A 3QQWA 3S1WA 4NJKA 3L5LA 1JAKA 1Q6EA 2J77A 1K7FA 2R82A 4P5UA 2ZE0A 4EXAA 4AH7A 4LFYA 2PGEA 2ON3A 5E6YA 4HT3A 3KRSA 1BFNA 2DSZA 4GFIA 4O1DA 3VIKA 1OGGA 3EXSA 2J25A 1SFJA 3IGUA 4S23A 2A1YA 4ZCWA 4H3DA 4LAOA 1X38A 4A21A 4JKKA 3LG3A 9CGTA 1UBSA 2O9RA 4GX8A 3B8IA 3QR3A 1TQJA 1EBHA 1GTHA 1CGUA 3EKGA 3WLSA 5I79A 3CH0A 1F8IA 3ZXWA 5EBAA 3GW3A 1QNOA 1V3KA 2BY1A 2J88A 3NO1A 4QNEA 4CU6A 1B31A 2O7SA 1G5AA 1QPQA 2CBJA 4YS1A 4QBXA 5CBIA 4TMCA 2OZ3A 3GDBA 4L9YA 4UQCA 5K9DA 1DXEA 3ARYA 3BICA 2P10A 4G7EA 5A2CA 2PSNA 2WM0A 4E3VA 1X1NA 4MZ8A 4CNNA 1TZ9A 1NDZA 4NQ1A 1KQYA 2OELA 3HGOA 3OEXA 4US5A 3VIIA 2I14A 4DBWA 1KFJA 1W54A 2A21A 1D7FA 2VENA 5KSWA 4LEQA 1H5YA 3KRBA 3MCOA 3M6YA 1V0KA 4I9MA 3PZ9A 4OVXA 2B7NA 2OJPA 1N8IA 1XP3A 4YIWA 1FH8A 4JIEA 5ABGA 3CUJA 1BWVA 1VPXA 3EPOA 3BCDA 1A0EA 3MTWA 4TOQA 3CV7A 2XN1A 3OZOA 5HNUA 4UZUA 4KWUA 3BLLA 4EACA 1MW2A 2E5BA 1XLKA 1JCXA 2VFDA 1IGWA 2AMGA 1G4SA 3HQNA 3F2BA 3KTCA 1BVZA 1WDQA 2OX4A 5DFAA 1YTEA 3UNTA 4D6IA 1AMKA 2QCGA 4PUJA 2YR1A 3ES8A 3QLDA 3W86A 5TIMA 2E09A 2OO6A 4DJFC 3U3HA 4W4QA 1WNOA 2ZTJA 1EX5A 1OFOA 4E4FA 2F61A 4TX6A 1AUSL 4GQ0A 2PZ0A 1NP0A 4QIUA 4NZ3A 4MB1A 1MW3A 2DPEA 3NXLA 3MUXA 1UOZA 3ME3A 3AXXA 1SSGA 4WKHA 3N14A 4TO8A 2FPVA 2FZ8A 4W7VA 1Q6DA 3KCJA 3VKBA 3MO4A 1M7XA 4I6KA 5JBDA 1KLZA 4WSJA 3WY1A 4H00A 5DBUA 2ATSA 3ZO9A 1OD0A 2QIIA 3AWNA 3AS1A 2Z1WA 2BMBA 4XTDA 4LQ1A 4PFHA 3TLQA 5D9PA 4GKTA 4QHRA 5T8GA 4YXGA 2QPSA 3C8NA 5HA7A 1SW3A 1TJ1A 3K1GA 3W72A 2GUUA 3DHFA 3G1DA 5I3HA 2V5JA 4WX2A 2DQWA 2XVNA 4UFHA 4YNGA 4F2BA 1FCVA 4U2YA 1UB3A 3HF3A 3NQEA 3AXIA 2CPUA 1AH4A 1W9PA 4CNPA 2J75A 3AZSA 2GGHA 1VJSA 1C7SA 1LT7A 2F2KA 3W83A 3DECA 2ISDA 4ZO9A 3DFTA 2B7PA 4UTIA 1B2YA 4OTKA 3QGKC 2A3EA 4A3HA 1VJZA 1GOMA 3W71A 3W7NA 3WH7A 4PL2A 5CLWA 3UZWA 2X05A 1WXYA 5IFTA 3TOYA 1SQ7A 3W2UA 2QYGA 3TC3A 1Z3NA 3QSTA 1LROA 2QJJA 3P3BA 1YNQA 1XLMA 4PMXA 4W84A 3TUUA 1OYBA 5BRPA 3DN5A 1HJQA 4XD6A 2VD9A 3GHUA 2PDXA 4DWSA 2NUXA 3G1YA 4MYXA 4F0LA 5IM51 3O06A 3VD7A 1G0CA 3NDOA 3NGFA 3O6CA 2X0SA 1E4NA 1UWRA 1TE6A 4JTAA 2V82A 1Q6OA 2W9MA 4XBKA 5LIYX 3IAPA 1DJWA 1Z69A 2GGGA 2FGZA 1JG9A 3GDLA 1RD5A 4V33A 2ZX9A 4GUHA 4MPQA 3WF4A 1PZ0A 3ZWTA 1K7EA 4B92A 3VYLA 2G0WA 5E0FA 4I7WA 5HNTA 1SR0A 3R13A 2ZBTA 1ME7A 1ELSA 2J9ZA 3H21A 4POCA 1D3CA 1CTNA 2X0HA 1RJPA 3UYCA 3RN6A 3LPGA 3I7RA 5I02A 4AY1A 3HQOA 4J3UA 1XC6A 1YNPA 4UOJA 1J0ZA 3BAXA 3IUHA 3KOWA 4ML9A 1UBPC 5D9MA 1E51A 2H6RA 4GYPA 3RU8X 4DJFD 3W38A 3AYTA 1JCMP 4PB4A 5AYIA 2NQLA 1CGYA 1XGDA 1UD8A 2HBXA 4AVNA 1BLIA 2QCLA 3QFWA 4HU3A 3OB8A 3HPZA 3QW4B 2QIWA 4LC6A 2LLEA 2WMGA 2DSUA 3G77A 1W2PA 2DY3A 1W5OA 5CPTA 4LVFA 7CGTA 2DIJA 3AMCA 1KKRA 4L56A 5JH2A 2W92A 1XISA 2CLHA 1BF2A 1POKA 1GVEA 1Q2SA 3BAKA 3PSVA 1PKMA 1DWHM 1MEIA 4C6EA 1EUAA 4EOUA 3N1AA 2ZXDA 1OCQA 3GU1A 1E4LA 3PNUA 4S3KA 3I3BA 3AU6A 1T96A 3RR1A 3A4JA 1XLHA 4S3BA 2C71A 1EF3A 2YBVA 4GWEA 1TA3B 4OBTA 3AS0A 3H6OA 1H0IA 4TV6A 3FVMA 3EPMA 3H22A 1WOBA 1KQZA 1P1XA 3W7LA 1XLCA 4JNYA 5F4WA 3EEZA 1Q7MA 1EA9C 1TIMA 2FTYA 2FZDA 1LP6A 4LNCA 1F3WA 2XIJA 2CBIA 4FXRA 4AZ5A 3B3DA 3V18A 1CZ1A 4CCDA 1K8YA 4IFKA 4I6VA 3R94A 4WXZA 1TB3A 4A8RA 3G0XA 1KFEA 5H2ZA 3W25A 4CQCA 1XJBA 1Y8BA 3QV9A 4UQBA 1W9BM 1I2QA 2VCBA 3UG8A 4UWMA 2QDDA 3FJ6A 3URQA 1QFEA 1BSLA 3IEBA 3A13A 3SZ8A 2FGBA 1G7VA 2QJIA 1KFWA 4KIEA 1IE7C 1AW1A 5D9OA 1RH9A 1TWDA 4DNMA 4DRSA 5ABFA 4LEFA 3WLOA 4GMEA 1TV3A 1A5LC 3FFSA 4ONVA 4FK9A 1KXQA 2PZNA 3W88A 1D8CA 3GHTA 3WQVA 3RRAA 1XIMA 3BMXA 3I65A 2WCGA 3AFBA 5C7VA 5FF4A 2FLIA 1CPUA 3AIEA 2DT2A 1XSIA 2Q09A 3UWZA 4F0KA 3I6RA 1W6TA 1OCJA 3L23A 1DOSA 1XLAA 4C1KA 3SJNA 1EZWA 5A6BD 2CHRA 1SZRA 5DMYA 4D6JA 1W3LA 2ZTKA 4ZSUA 3L67A 1VBJA 4F2UA 1VRDA 4O1BA 3C52A 1QWGA 3P93A 1FWSA 1PV8A 3VE7A 4XD3A 1YTKA 1GUVA 1ZALA 4KEVA 4EAMA 4IH3A 4PL1A 1KV5A 2FTWA 2CFFA 5J5RA 2GVJA 1T40A 3RPTA 1B3OA 1EP2A 2JEPA 1XRSA 2RGLA 4LBRA 2XN0A 3VOJA 4D6EA 1JDCA 4FNPA 3Q37A 1ZBWA 1QUMA 3MJYA 3RF9A 2XVGA 4ZBCA 2ZZ2A 4YTUA 2D1ZA 4DI9A 3UJSA 1BXBA 3GYCA 3EWXA 5CG7A 1A0DA 3CZ8A 3NSNA 2VNCA 1GEQA 5DT5A 2WJEA 4Q33A 4X3ZA 1MUWA 4RNJA 1BXNA 2D0FA 4XUGA 2GDVA 1YKWA 2ZCGA 1ICQA 2PPGA 2WO5A 5I3JA 4R9OA 4S1FA 3AS3A 4Y9OA 3EB3A 3WQOA 2ZX5A 2D69A 3CV2A 1KCXA 1ISXA 3OA3A 3LX9A 1I1XA 4JX4A 2R6OA 1XI3A 4PCNA 4AXNA 2XWDA 4J3SA 3T09A 3D46A 1W56A 1FXQA 1XKYA 2FHFA 2XWEA 2Y63A 1WZKA 3L21A 3M44A 2Z28A 3GSMA 1FH7A 1XYZA 1V7YA 5CXPA 2VQTA 3Q65A 3LHVA 1FOBA 1U5HA 2IKJA 2YA0A 3M0IA 3W1RA 3TNBA 1WBJA 3HM7A 3CEUA 2I16A 1FWIC 1Z44A 2YCLB 1MFUA 4E38A 1BRLA 1R9YA 3GKFA 3TVAA 3KOZA 5GQBA 2VRJA 3NFUA 3O9NA 1GYLA 3GTNA 1K8ZA 1R0MA 4HD5A 2EKCA 4KKXA 3K2GA 4S3GA 1R3VA 3CIXA 1IYXA 1IT7A 4WDWA 2NV9A 4LY8A 4QG8A 1Z48A 3VTRA 3VD9A 1TV5A 2VDGA 5IHSA 3LLDA 2YOCA 4TMBA 4L61A 3OLDA 5FSDC 1V6WA 3WMCA 1ONEA 3E74A 2O9PA 1KTCA 1WDDA 1DJGA 4JICA 1AMYA 5GJNA 5D32A 3NEHA 3WBYA 4BCEA 4UOQA 3T8QA 3TTSA 2G3FA 3TONA 3S8HA 4W7UA 4V15A 1RQBA 4C6JA 2NWRA 4PRWA 4YWIA 1W91A 4HPXA 1N55A 2B7QA 1Q8JA 3UXLA 1JD9A 3HV9A 1JZ4A 2TYSA 4H6QA 1U1HA 4XX6A 4XZ9A 3S47A 3KBSA 3GFXA 3UXAA 3IACA 1W5PA 1LT8A 1MDLA 5C54A 1ML1A 1RLDA 3WD0A 3W26A 1EDTA 3A5VA 3AXHA 2ZXBA 4M1RA 1P5BA 3W1PA 4GY7A 3RO6A 3ZJ6A 1GQKA 1UUMA 1DHKA 5HPCA 1KBLA 1Z6KA 1OT1A 2QKFA 2Y5JA 4GXPA 5BWFA 5LXEA 2I5QA 4YVPA 2BHUA 3M4HA 1L0PA 1M01A 5EBUA 5FACA 4B9ZA 3OGVA 4LC8A 1E1CA 4JFUA 2X1SA 3TX9A 1ZPTA 3CC1A 5I03A 5ECUA 2WMIB 4GY1A 4XAYA 3MKKA 4L4MA 1B5TA 4I8YA 2IQDA 4GKLA 3TSDA 3W75A 4BQ3A 4WXYA 1HJVA 3WMBA 2NQ9A 1N2VA 3HGJA 1H62A 2CBUA 4Y90A 4PCPA 1EIBA 3STEA 6XIAA 2D0GA 3UZJA 4O52A 5TD4A 1H7XA 5F7UA 3GDKA 4LGXA 3VUSA 2GDUA 1CGWA 5FIPA 2G4FA 2AOSA 1QRQA 4JTKA 3CL7A 5T9BG 3N9RA 3J7HA 3L65A 3P84A 4XBJA 3RX2A 3KVJA 5C55A 1B3ZA 1VPQA 3WD4A 5BMWA 1WB0A 3GXDA 2R1NA 3GM8A 3R1ZA 1HO1A 1EDGA 2XFWA 3M0LA 1A5BA 3N6QA 4BF9A 2J9XA 1RA0A 3S9IA 4WJXA 2GVEA 4U33A 3AROA 2PTYA 4WHBA 4H01A 1DJZA 3GTFA 4NF7A 5FF3A 3VIHA 5HWMA 1OVDA 1K9EA 3BJSA 1S39A 4A6GA 1CEOA 3I4EA 3M5YA 2X2YA 3FX4A 4O12A 2WZHA 1C9DA 2VGBA 4IQJA 3N2XA 1DEDA 1TJPA 2WNQA 3U8GA 2OMAA 1DV7A 3TOPA 3S1VA 1A5SA 1GOWA 4F40A 3QZ6A 5DXXA 3AMGA 1SZFA 1QTWA 3EA1A 3MHFA 4XZIA 3QKEA 3CHCA 5C70A 3S5NA 3EWWA 3CHDA 1B3XA 3UWEA 3FNDA 3G22A 3AAMA 1VF8A 2XSXA 4D6DA 1EHAA 3W7MA 3SDOA 3PTKA 4GUGA 1E1FA 1ODUA 5FAGA 2PMQA 5FF7A 4R34A 5A8PA 3VFLA 3K4WA 1BTMA 3H2CA 5D8WA 2J27A 1UR3M 1A5MC 4KWWA 1UUQA 3LOTA 4HTBA 2XG9A 4GCXA 4Q6JA 4HNVA 5CSSA 3OYXA 1G4PA 3ITOA 2GJPA 4NT0A 1JYVA 2J62A 2A3CA 1NWRA 3MDUA 3ITCA 3MUCA 4U4MA 4JL1A 2WKGA 1CWYA 1H7PA 3T0CA 4TQTA 2CLLA 3PG8A 3SUTA 3G1SA 1AG1O 2VR4A 4IIBA 3W9ZA 1PVNA 2F9RA 1DHPA 2OO0A 1UP0A 1VFLA 5CPOA 1GWJA 3E12A 3TXVA 4QE1A 1TPEA 1SO3A 2V3GA 3EWZA 2Q8XA 4UR8A 3SO7A 4YTRA 2GUBA 4F0RA 3NO3A 3UR5A 1X8CA 3LERA 5AHFA 3TDFA 4ZXLA 3DHPA 8RUCA 3I4KA 3HTWA 1E73M 3FVDA 3URAA 4HCDA 4LUSA 5DANA 4ZMGA 4YTSA 3B04A 3FKKA 2OODA 4LH8A 2PWFA 2JQXA 3IJIA 3II1A 2YZRA 4GXWA 2RHGA 2QZRA 4LYQA 3T0AA 1LCOA 4U3AA 2PUZA 3AI0A 3CPUA 4LV9A 2C15A 4TTGA 3VGFA 3BGAA 1Z7AA 1AVAA 1VFFA 1XFCA 3D3FA 3SY1A 1BHGA 1XLBA 3ZLHA 2Z1KA 3ITTA 3T4CA 1F6YA 3ZZ1A 4F66A 4B5UA 1TUFA 1SFSA 4JCMA 1U1JA 2XIQA 3DCPA 1JULA 1UP2A 1MXGA 4ZO8A 2GGIA 4Y96A 3MUAA 2GK1A 3PS7A 4UTUA 3GHRA 2J74A 4C6CA 3CZJA 4W5UA 4LYKA 2RJGA 1JZ8A 3INPA 1RR2A 1HXJA 3IIZA 5JIWA 3TZFA 3BSGA 4IICA 3UWQA 4Z1AA 2WM1A 1OWQA 4L80A 4C60A 5KTLA 3ARSA 3WDIA 4JPGA 1FWBC 3LXBA 5A8GA 4M6UA 4IX2A 2VM8A 2ALDA 4KFNA 4DXXA 2HROA 4LS1A 1J0KA 4D6HA 1UYQA 2IPGA 1PS9A 1VFTA 1M7JA 1TWWA 1Q8AA 3NSMA 3F2CA 1N8FA 3KOFA 1KFBA 3HQ1A 4HNOA 4AYSA 4XUYA 5FAJA 1E71M 3MWAA 1J6OA 4MZ1A 4IG2B 3AHVA 1NOWA 3LHZA 4ZTXA 4QAWA 1FWNA 4HZMA 4ERGA 4K8HA 2OT0A 2PWEA 1VHCA 3IUIA 1P43A 5JBFA 4CD6A 4AUBA 4N6FA 1CX9A 1GKRA 5AKQA 4M56A 3V1HA 3M1ZA 3VDBA 1S1PA 3JUGA 2XJ7A 3WQ6A 1H5VA 1PXGA 3E2QA 2BS9A 1VEMA 2FZMA 2NX1A 2QUMA 1P0DA 1FWFC 2CNCA 4F0HA 3W2NA 4FLRA 2PP3A 5I09A 1XIEA 4DNHA 3VNIA 5G2WA 3KHJA 1AZ1A 4BF7A 4PUUA 4FS9A 2EHHA 4L9XA 1UR2A 1W3JA 4NJHA 1L8NA 4W85A 4O0QA 4IPPA 4DJDA 4ZO7A 7TIMA 3VM5A 2YIHA 3F5LA 5HNRA 4E4UA 4XK2A 3TC7A 1XICA 3IJ8A 5IRPA 2REQA 3RCYA 3MP5A 3WD1A 4TVDA 1YBQA 2QGYA 2Z29A 2P50A 3D0CA 2XIMA 2DZTA 3V5CA 5FJIA 1R87A 4ZZ9A 1UC5A 2BXVA 7REQB 3W7IA 1XIHA 3R0DA 4XZHA 3VDHA 4M6QA 2GVGA 2ZX6A 1Y0EA 3GVWA 1OK4A 4FAMA 5KITA 1QW8A 3NXFA 3ZJKA 1SW0A 4JKMA 4DJDC 1PL9A 1TPFA 1JXJA 1JCNA 4I7UA 1W5MA 1W9VA 3H70A 1PKLA 3E9AA 4JFTA 3KE0A 4NZCA 1POJA 1V0NA 1W2VA 4RZ4A 1EIXA 4P7NA 2WC3A 8A3HA 1VS1A 1KW1A 2QV5A 2UY2A 4WOZA 5F4SA 3HB9A 4ZQMA 4C6LA 1XH1A 3TTOA 1F74A 1RZMA 4M7SA 3QGAC 4N9DA 3MY9A 5XINA 1UR9A 4IMEA 2FIQA 3S2MA 4N9CA 4JXCA 2DZUA 3H2EA 2QHAA 3BLOA 2F6KA 3VDAA 1Q6GA 1J2BA 3WENA 3MUY1 4KT2A 4QRNA 1LOLA 1ZLPA 4HCLA 3N15A 1TV2A 4Y8EA 4NYUA 1OCNA 3A22A 5FJTA 3A9BA 1WKEA 1AL8A 1DQUA 1QWKA 3OG3A 3FSUA 4LUTB 3R8RA 1CLKA 1EOMA 2BOEX 2E68A 2V9DA 3GNXA 4S3JA 1DJIA 1R46A 4PSPA 5HMDA 4KFOA 4DQWA 3L4TA 2XM1A 2HMCA 3RCMA 4RZ6A 4DF1A 1FCBA 4JTEA 1LL6A 4XVEA 1EHNA 1MNSA 2CZVA 3DESA 4LYPA 2J8FA 4QFUA 2VC9A 2L5HA 4AD0A 3GH4A 4D8AA 3DI0A 1O68A 1OX4B 3GG8A 2C19A 3CEPA 3SW6A 1J11A 3B0PA 1DWAM 3SCPA 5FJPA 5CSYA 1RK6A 4IOTA 3FYYA 1QJWA 2WZTA 3UWWA 2R1LA 3AIWA 3QHNA 4HSHA 4LRTA 2FZBA 2PLMA 2YFOA 3OVPA 3VIMA 3GC5A 4KERA 4EK7A 1XLEA 3CZLA 3VNJA 4EF9A 5BROA 4W86A 3BJTA 3W2MA 2GQ8A 1LORA 4AX6A 3HIJA 2QDEA 3SQLA 4DZIA 2YB1A 2ZRVA 4J5NA 3MYPA 2FH6A 3DG6A 2C91A 3GR7A 4QG9A 5I06A 2CLIA 4LANA 2XINA 3W7JA 2QCNA 4ZTYA 1EDQA 1JCLA 1IR2A 2ZVRA 4DF2A 3WO8A 3EDDA 1J01A 4CU8A 1W1ZA 3B8SA 1ISVA 3DAQA 3CYVA 4D6GA 2I1OA 3T1GA 4WZHA 5GNZA 3RUBL 4WLCA 2WAGA 3WF3A 4YTTA 4XISA 1FTXA 5ABTA 4I7VA 3RLUA 4EXBA 4MFEA 4N0RA 5DN1A 5HQLA 3IVUA 2B7OA 2WPGA 5A6KA 1DPMA 3U9IA 4JFSA 1VCGA 4IIHA 4IXXA 3Q2DA 3W01A 2Z1XA 4GQBA 1SW7A 2G5WA 5DMMA 1KXTA 2G3IA 3T4WA 3VDCA 4FA3A 2V81A 1VENA 2E5DA 4K68A 4UTMA 3O7UA 4DJDD 3LHUA 1H7RA 4ATDA 1DKWA 1SR9A 1C92A 3S2JA 1NAL1 1O60A 1TV7A 4HTYA 1ITXA 1V93A 3KDOA 2DZBA 3R0UA 3HO8A 1BKSA 3T81A 3MBDA 1UPPA 3VOFA 1O5KA 3UNDA 1DIOA 1BRLB 4PTMA 1H2JA 2P5NA 2JEQA 3WYZA 1H1ZA 1X6LA 4E8CA 1TPDA 1FCUA 2VEFA 1I75A 4HZ7A 3H26A 5CZJA 4JTJA 3NL6A 2DZWA 3TMLA 2GJLA 2YW3A 5JVLA 1W3IA 3P62A 1GQLA 1TRIA 4OOZA 1JPDX 3W37A 3BAWA 3BPWA 1LQAA 3BLKA 3PPHA 3GRIA 4KW2A 3H7UA 2PDHA 5A1AA 1E40A 3TQPA 1K02A 3WD3A 1EOKA 3FW6A 4NY2A 1X96A 3NZ1A 3WBXA 1X8FA 1V5XA 2DFAA 2PBGA 4A4AA 7TAAA 3VNLA 3H8AA 2WJFA 2W27A 3UJEA 4O1AA 1JZ2A 5CPSA 5HQEA 1NELA 3LRLA 3FXGA 4WGXA 3MVTA 3DEQA 3ABXA 2PWUA 3OA5A 1E15A 3RG6A 2I9UA 1B1YA 3I7SA 2VVSA 3RU6A 2DW7A 1I0DA 1J0YA 4X2RA 3T9PA 5D05A 1HNYA 1GVYA 2HS6A 2VGFA 4L6DA 2D3LA 1LWJA 2FMOA 5SWUA 1C29A 3T44A 4HNNA 3PB2A 3ECQA 2RUSA 3VKAA 2VZOA 4JTDA 3D3AA 4ZOCA 4KESA 5EMYA 4LT9A 2C18A 1JUBA 1ITUA 3VMNA 3EBVA 5T91A 1BXCA 1UH2A 1D3HA 1QHZA 1KWKA 4K8EA 2CESA 2EJ1A 5A69A 4PTWA 3IIPA 1IXQA 4KCUA 3PM6A 3T0DA 3EOOA 5BRQA 4YCPA 3DHDA 3EDEA 2Z0IA 4J7RA 1Z9AA 2F8QA 1TVNA 4EX4A 1LTDA 1EWEA 2ZRXA 4O10A 3AICA 4DXKA 5FL1A 4KWVA 4MZYA 2VCCA 2GSJA 3IVTA 2PF8A 2O92A 1UP3A 2JIWA 3P67A 1H60A 4UIOA 1OC7A 2X0YA 4BJHA 3R7MA 3OBKA 1OY0A 5BU9A 5I07A 4ERAA 1DJQA 2P0IA 3GG7A 1TR9A 3JZEA 2ABBA 3S2NA 4D8ZA 3E0IA 1U22A 4LCQA 4A3RA 2DORA 3EWYA 4UTFA 1ENUA 2VD8A 3KRZA 1XH0A 3RHGA 4GNVA 4NHVA 1VFHA 4AZCA 2ZE3A 5MF5A 3QY7A 5FI8A 1DTNA 4IJCA 1YIXA 2EPLX 4JD4A 1UH3A 3R10A 4R3UA 4DM2A 1Q3NA 1G9HA 3T2PA 5LA0A 1FWWA 4C6IA 4GXMA 2Y85A 4QLJA 1OGSA 1KO0A 1LRNA 2PDQA 3C8FA 3VZZA 2UY3A 2IMRA 3QPYA 2GJRA 1F76A 2WVVB 2X8RA 4URIA 3OZPA 4HQVA 4U5IA 3TAOA 2WWDA 2CXEA 4GNKB 1TTQA 4RDYA 3CT2A 4ML4A 1NF7A 4FHAA 3WLHA 1KKOA 2BLEA 4GYKA 4MSSA 1HW6A 2PDKA 2XVKA 5AB3A 4OE7A 3QQ0A 4PMUA 1S2CA 1CW2A 1JQVA 4Q22A 4H2HA 2IXUA 4O11A 2VR2A 3ZM8A 1MW1A 2WSQA 2BODX 1KWGA 3TFCA 4UMBA 2DT3A 3PFRA 3P61A 2E1DA 1LWIA 3RMEA 4H9XA 3WLJA 3UU0A 1JZ3A 3AMDA 5M2FX 4WY0B 4OQVA 1CBGA 4H8UA 3L12A 3WBEA 1C9WA 3HFTA 3FJLA 4MVAA 4MF4A 3LB0A 3N11A 2E1WA 1A49A 4Q8MA 4BFAA 4AEFA 4LBUA 3WK1A 1HT6A 2YCIX 4K7VA 4B5TA 4OGZA 3HG4A 4A3QA 3SCSA 3UWUA 4J27A 1XUUA 2X1TA 4RK8A 4HVXA 1XYBA 5MKGB 3IS4A 3AUJA 2HVMA 5CGTA 4QXIA 3VGBA 1EPXA 4O18A 4IIEA 2Z4GA 2NQJA 1R3WA 3KS5A 3NO5A 3CZGA 4JHOA 4I5RA 1Y5XA 3WUGA 3AIRA 2PU0A 1KNWA 4IL0A 4JNZA 2AKMA 3ARTA 3GYEA 4GZJA 2YLLA 1UCWA 4GA8A 2YA2A 2PDMA 2VP8A 4X63A 1F61A 3WLPA 3HG5A 5E9AA 3MSYA 1I0BA 5C9WA 4P8WA 3EWUA 2BWGA 5G4WA 1EQCA 4MUZA 4IF2A 4H9UA 2YJQA 1EFZA 3ABOA 4WIWA 3UG5A 2Z2BA 3P5YA 5C9ZA 3CAWA 8CGTA 4BI7A 3P0XA 1L6GA 3THCA 3OGSA 2GK1B 1I2RA 1EQPA 2Z6IA 4QLLA 4NNBA 5DMLA 2D23A 4QE4A 5EPDA 4RXFA 5XIMA 1AA1B 2RAGA 2V3EA 1HZYA 3AIUA 4AD4A 3EB2A 3U0HA 5KZDA 4M6VA 4AZGA 4DO6A 1WXZA 3H12A 4F0MA 2XHYA 2HZGA 2A3LA 1H0GA 1WYIA 3P8JA 1B3YA 4WUIA 2H90A 1KFLA 2HBVA 2PDBA 2EPNA 1LUCB 3OQ8A 5CBJA 3WQGA 1HKIA 4TX9A 2IQTA 3GK0A 5EGRA 3QMSA 5BXTA 2YLAA 1X6UA 1MWOA 3BW3A 2DV0A 2DZSA 2PFHA 4HP5A 1UZDA 3BLEA 3WQCA 3TJIA 2FH8A 2C1IA 4MB3A 1GVIA 2EKGA 1AQMA 4EXQA 1XSJA 1H41A 4UTTA 1BAGA 1V51A 2UWFA 3QOMA 3WFAA 2QUTA 3N2OA 3CZKA 4Q3MA 4Q8PA 1GQIA 4CKQA 5ECVA 1JCYA 3WDHA 2XGBA 3VC5A 5HWJA 4YTQA 2Z7GA 4Q8WA 4YU1A 3UZZA 4EANA 5CKSA 5I3GA 1QW7A 3GFYA 3BL3A 1DXFA 3LXCA 1GVRA 4D71A 3DGBA 3CM4A 1ZGDA 2CLKA 3LBMA 2EPMX 1Q4NX 4CNSA 4NIRA 5D03A 2ZX8A 3RK8A 1NARA 4UTTC 4JYDA 3UA3A 4E4PA 1UJPA 3V0TA 2NVAA 1XS2A 2PDNA 3PBVA 3P82A 3A47A 1ZBKA 3L7RA 2QMKA 3HPFA 4R85A 3JRKA 3SCOA 5F2LA 1S2AA 3GVVA 1QI0A 1W32A 1T8QA 2CKSA 1GORA 2VCAA 5U7SA 3TNOA 3B40A 3KZSA 1UIPA 3RILA 5I6SA 2R24A 4M82A 4FLOA 2E6DA 1M7PA 1AD1A 1SFLA 5D30A 3M43A 3WDJA 3PBUA 4C6BA 1RVKA 4HN4A 1VFMA 4PUEA 1Q7ZA 2WJDA 5KETA 2BXYA 4US6A 4HA4A 3VC6A 3SGZA 4YL2A 3KTSA 1GW9A 3CPRA 3FV9A 2VVNA 3RITA 4A05A 2GJXA 3ZWSA 3NQBA 3BUVA 1KR0A 3W0KA 2BHZA 2NLIA 1XLIA 2ZKMX 4LVDA 1UJQA 5ENLA 1VEOA 3WQFA 5K4XA 4HNUA 3B03A 3KTXA 3DZ1A 3CTLA 2A5HA 2JIEA 1PTDA 2WSRA 3SIMA 2D2GA 3FHAA 1DTUA 2ZRUA 4JOMA 1H49A 1TJ0A 3R8GA 4CNOA 2D2JA 1F73A 3SQSA 4QX4A 2OSYA 4HZ6A 2P0OA 4LS0A 1W1YA 2CLOA 4Y9MA 1SU5A 4FNTA 3CLMA 3WF1A 1GOIA 3NJ3A 3CZEA 1GPFA 2WLYA 3ZT5A 3AZTA 1E5JA 5M03A 2OVLA 4Q4QA 3DFOA 4D72A 1JFXA 1JYWA 1P4CA 1EO7A 3OVRA 2YDRA 4WQ6A 3VE9A 4U10A 3UPBA 1P48A 4WJEA 3VX1A 3T78A 1GJUA 4WD0A 2OU4A 3MMUA 3E0VA 3BG5A 1NOFA 2WJZA 2IQ0A 3CL8A 3U5YA 2QF8A 4BI6A 2VJXA 2ANUA 2PP0A 3EDKA 4FXJA 1Q45A 2PDWA 5FEWA 2QDGA 1EUNA 1YDVA 1M6JA 3NZPA 2OFJA 4DI8A 1BGGA 3W07A 2PS2A 2ACRA 2VC5A 4K7YA 2G3MA 1S3HA 1MQPA 4Q6XA 3GW0A 4B5SA 2GJNA 4QJ1A 1UROA 3WK0A 4QCFA 4UMCA 3SUUA 3CPGA 3PP7A 5AHNA 3PPGA 4M51A 5HR6A 4PMZA 4OUIA 3OVQA 4ZOBA 1JRCA 2PRMA 2DEPA 4IGHA 5A6AA 3KBNA 2G41A 2GWNA 3ISIX 2XISA 4AD3A 2Z7KA 1Z41A 4HNTA 3SUSA 4B4HA 5LYRA 4UQDA 3GXIA 2OEMA 5C9RA 1EL3A 4HHMA 1CIUA 4EF8A 1YEYA 2PDCA 3VD4A 3HJZA 3BSMA 1ADSA 1N8WA 1A4MA 4C90A 5DEZA 1YX1A 4UTJA 5DO8A 3L4UA 1XCWA 3MSGA 3GH5A 4KEZA 4I5UA 5BNKA 1RUSA 3R58A 1A3XA 2W67A 4RPPA 6TIMA 2EAWA 3AU2A 3O63A 2PAJA 3EDJA 1KBKA 2Y0FA 5JBEA 3B05A 1QI4A 3E02A 3G6LA 3FAWA 3H55A 5BOFA 1TZZA 1F05A 4F8XA 4H2CA 4Q4SA 3PJWA 3N6JA 3MBFA 3OGRA 4QISA 5A2BA 4A29A 3AIQA 3N9SA 4I3GA 3AIVA 2QJGA 5LA1A 5I24A 5HINA 3HG3A 1C8VA 1FFQA 4K1WA 1LG1A 3CB3A 3QRHA 5C9UA 2XSBA 4GVFA 1W3HA 3ARVA 3EOUA 4TR9A 4JL2A 4QCEA 5CQ1A 4DO4A 1NF0A 5CJNA 3H2AA 2Z1SA 8XIAA 4NNCA 3WH6A 3VOCA 4D1JA 1GKPA 3L9CA 2O9TA 1JFHA 1NVMA 1R8LA 1OINA 3GNPA 3MHGA 3EWCA 4LB3A 2NUWA 3S42A 2X7VA 2WBKA 3VI2A 1KGXA 1F3TA 4Q7IA 4DAIA 4W7WA 3U2OA 3A3WA 3TN4A 4ICCX 3TE9A 3MHUA 3C3UA 2V2CA 2BNJA 4O15A 1FWTA 1H11A 3GDTA 5I3IA 2NSXA 3CMGA 1F2JA 4GACA 4QSHA 3WJSA 2O4QA 3H2FA 4MB4A 4HZ8A 3CAVA 4M1BA 2WHLA 3T7VA 4GFSA 2BFGA 4NAEA 3ZIZA 2R9RA 5HJYA 1PIGA 4O14A 3T0TA 2ADAA 3ATZA 1ZCCA 2BTMA 4YCOA 3ATYA 4GGHA 1DJYA 1E0XA 3F4VA 1E6QM 1NEYA 1MQQA 2GUYA 1JYNA 4F9DA 1F7BA 3THAA 3GVRA 3DYOA 2XU2A 3HA1A 5LSMA 1WBHA 1RBLA 3VVGA 3QBUA 2PDFA 3MUIA 5DBTA 2Q71A 4H6EA 3WF0A 3DX5A 1YXDA 4HK6A 3A64A 3IJQA 3FA3A 3ZR5A 3CH9A 3RRXA 1H1NA 2WMHA 2JF7A 1PUDA 3JW7A 4IJRA 3RJXA 5HQMA 3N4FA 1S5NA 1NFBA 2W3ZA 3ZR4A 3FGCB 2EGZA 5JQ9A 1C91A 1GVQA 3W7KA 3TK7A 3BOXA 1ME9A 4HU0A 3WEZA 4UC5A 1XLGA 3GR4A 3VNDA 3UCQA 4BQ5A 2Y24A 2ZRYA 1FH9A 1O95A 3P5ZA 3SAZA 4LRSA 1S5TA 3LD5A 5I78A 4PN2A 5AHMA 3P14A 3PUDA 1GKQA 1GZJA 1FWGC 4H7CA 1NY1A 4LUIA 3UZ5A 4INFA 2ZZ3A 1KBJA 4AIUA 3NUKA 3FOKA 2AL1A 2QLYA 2OOGA 2D22A 3D47A 4OUEA 3LPOA 3AHTA 4JX5A 1XYFA 4NZ5A 4BQ4A 1VBRA 2OYMA 3PTQA 3NVTA 3H2NA 5REQB 4TVCA 1F4AA 2CZFA 3ZVHB 4GYJA 3LZ3A 4ZE5A 3OLIA 3CYJA 3MU7A 1EYEA 1YPXA 1FHUA 2IKIA 1WP6A 3KL3A 2QJHA 3BDKA 3IIVA 5F1VA 1G4EA 3HPXA 4KCTA 2IPJA 1DJHA 2ISVA 3PZMA 4W88A 2TRSA 5H8MA 3ZJ8A 3FAXA 3I3DA 4GJJA 4P7QA 1JPMA 4PBGA 5CAKA 1L8PA 5GVJA 2PWVA 4R7OA 3O3RA 4AF0A 3AMKA 3WEMA 1CGVA 4NNAA 2F7FA 3G6MA 1HGYA 2NV1A 1ECEA 1BQCA 1HG3A 3LI1A 3OLGA 3VM7A 4AZCB 3RGTA 3K4DA 1AJ2A 1I2PA 3KVLA 4MAVA 3DUGA 4AWSA 4N6EA 1PWLA 3AOFA 2WZIA 3NQDA 5AYZA 3WLKX 2VQUA 3GWQA 3MV01 3HOJA 3AHYA 3GTXA 4HB7A 1IEVA 4V28A 3OO2A 3PVFA 5B7YA 1HKVA 3B9EA 4S3FA 3RIKA 3LNMA 1XGZA 4XO6A 3NL2A 2FZ9A 2FPYA 4PFMA 3UG3A 1IXPA 4KBXA 1XQKA 1PX8A 4AXKA 4PRTA 1HTIA 1GVSA 5LXXA 4JFVA 4JKLA 7A3HA 3WDRA 2BSLA 4PUWA 4B5XA 3IJDA 3W7EA 3GU9A 3TZNA 5K7JA 1DWGM 3LDVA 1F6PA 3BG3A 4LBSA 4JN7A 2J13A 4M3PA 3QJAA 1E6RA 4HHHA 1CCWB 2WSKA 3LENA 2PODA 3EOLA 4GG9A 2QCMA 4P7OA 4LS2A 2WKJA 1JPKA 3OOQA 3WLMA 4H4IA 1AH3A 2YCLA 3IIXA 2OYKA 4XVDA 1CXLA 1ZUAX 1SPQA 3WNLA 1PCKA 2HWGA 5AHIA 4RL3A 4P2VA 3KBWA 2J6VA 2HK0A 3TCEA 1JNDA 2A3HA 4MWAA 1IEWA 2WVSA 3SFKA 3N4EA 1XLJA 1J5SA 1HVXA 1LLOA 3PZQA 3G5EA 3HBLA 4FLQA 3RYSA 3G1VA 3HV8A 4K1GA 1GPWA 1M68A 5PTDA 4GX9A 3UJ2A 1OX6A 5H91A 4FXFA 2DVUA 3VMOA 1Q6QA 4JTIA 1GG0A 3MQTA 1LYXA 1HKWA 1ESWA 3M0YA 3SRDA 3FCPA 3VK5A 2MNRA 1KCKA 2C16A 2DVXA 2FTPA 2IKHA 3N19B 3TQ0A 3C3NA 4GCAA 1TYGA 4DZHA 2PWDA 1MO0A 1Q13A 1KM1A 3UCCA 2I7GA 2HNHA 1AFSA 3E0WA 1QPRA 5D4YA 4MWAC 3WF2A 3QHOA 4GLEA 3K1DA 3CLWA 1VFOA 4RDVA 3W02A 2GQ9A 2A7RA 3U48A 4K8GA 3W1TA 1HVQA 1A5CA 2YL9A 2NUYA 5FJJA 4L64A 2OWWA 3UJFA 4PMDA 4EP8C 1YDNA 3TYCA 1UWQA 3TTEA 1VKFA 4UTWA 1YDYA 3BE7A 3KHDA 2ZC8A 1ISZA 1H7OA 1Q2RA 1W5NA 4O0KA 3HPAA 3AC0A 2AGTA 1YPFA 1XKJA 3PWAA 3MMDA 1U33A 2V8ZA 1AW5A 4WOQA 1DYSA 1UD2A 2XVPA 5FD0A 3STFA 4HJWA 1CT5A 1R3YA 2BVTA 4G5DA 3C2OA 3R12A 2VWTA 1GCYA 1L2UA 5G4HC 2WMIA 1VHNA 1OSEA 2WZMA 3L0KA 5JXQA 2CETA 3NQCA 2W6RA 3DYMA 3UEQA 4UTWC 3N18A 3K5XA 3E2RA 4L4LA 4E6MA 2AQVA 2J24A 4C7FA 3ZT7A 4DELA 1PIIA 1XRFA 1ZSXA 3MUZ1 3L68A 3VILA 3WDQA 2C1GA 4ROQA 5FCZA 2HQAA 3LCHA 3OYZA 4JAWA 2PTWA 3MKCA 5DMNA 5MHBA 2BGNE 4EPKA 3LLXA 2NT1A 4UR9A 3BW2A 3A12A 5DRIA 1B9BA 4CN4A 5I0DA 3KBMA 4ZQPA 4KETA 1IT8A 3HJEA 3TA6A 2XFYA 4NG3A 1IEQA 1LRQA 2ZZ5A 4D1IA 3OIHA 3ONCA 2W4XA 4OHQA 3LRKA 3U5UA 4ZQRA 3E2VA 2FFIA 4O4VA 3H4WA 4DUOA 3UETA 1HJUA 3W2LA 4P8XA 5A6LA 3ICJA 3HGSA