4EPKA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGGGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
total genus 115
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4epkA00
3GU1A 4LFYA 2OQLA 1EJRC 1M65A 3TN6A 1RA0A 4V1XA 4ZSUA 4WGXA 1PO9A 3V7PA 3B40A 3MDWA 4DLMA 4GBDA 4F0SA 1BF6A 4EPBC 4GX8A 1ONXA 1EJUC 3IACA 4H00A 4C6QA 4C60A 1DPMA 1NFGA 4DYKA 4PCNA 1PTAA 3S2LA 4KEVA 4GY1A 3KM8A 4PBEA 2PUZA 3GU9A 4IF2A 2AQOA 3MDUA 4EPDC 1PB0A 1K1DA 3OOQA 2WJEA 4C6JA 4H9YA 3OJGA 3F4CA 1FWBC 1YRRA 3FDKA 1M68A 4B3ZA 4B92A 3GTIA 4R88A 4G2DA 4C6LA 4HK7A 3PNZA 1EZ2A 4P5UA 2R1PA 4R7WA 1VFLA 5HMFA 2OGJA 1NDVA 4C5ZA 2YB4A 3RYSA 4J2MA 5G4HC 2FTWA 3NQBA 1FWHC 4DI8A 1ITUA 4H9TA 3DC8A 4GY7A 1I0DA 3IPWA 4XD4A 3UR5A 4JOMA 4DI9A 4QS5A 1POKA 1ZZMA 4DLFA 1POJA 4RDZA 1UMLA 4J35A 4M51A 1EJWC 4RE0A 1FWIC 4GY0A 2BB0A 1UIOA 4AQLA 1FWEC 4XAZA 3LS9A 4NP7A 1E9ZB 4C6PA 2UBPC 2FTYA 3UBPC 1R9YA 1XRFA 1YMYA 1FKXA 2F6KA 3GRIA 4QS6A 4EPEC 3NURA 3C86A 2HBVA 4KEUA 5AKQA 4LCRA 4J5NA 2Z27A 3BE7A 4KETA 3FEQA 2OOFA 1FWJC 4LALA 4DZHA 3OQEA 3UPMA 3AUOA 4LAKA 1P6BA 1I0BA 2WJFA 2KAUC 2Q09A 4C6KA 4C6IA 3B0YA 4XD5A 4Z42C 4H9XA 2G3FA 2IMRA 4EP8C 1KRCC 4XAFA 2QT3A 2RAGA 4I6VA 4GZ7A 3IJ6A 3QY6A 3QGAC 4I6KA 4RDVA 2E1WA 2YXOA 3E3HA 3S2JA 3T1GA 2HPIA 3MVTA 4ERGA 4QROA 4DNMA 1KRBC 1RJPA 4OFCA 4G7EB 3DCPA 3UF9A 4CNUA 3UR2A 5HMEA 3GU2A 2HNHA 3S4TA 4XAGA 3RCMA 4C6NA 1WXYA 2FVMA 2VC5A 1QXLA 3PANA 1O5RA 4PE8A 3IARA 1RK6A 3EGJA 2W9MA 1EJTC 4C6OA 3GTHA 3CAKA 1FKWA 1JGMA 4QSFA 2VHLA 4LEFA 2OB3A 3E0FA 3MSRA 4V1YA 3LGGA 3WMLA 2Z26A 4EPKA 2O4QA 4GYFA 4H9VA 3K5XA 3ID7A 4C6MA 4DZIA 2Q01A 4QTGA 3LSCA 1A5NC 4HA0A 1FWAC 2VC7A 4IH3A 4INFA 4LCQA 3RHGA 2Y1HA 3LU2A 1FWCC 3O7UA 3PBMA 4ICMA 4MUPA 1FWFC 4KIRA 3E38A 3ICJA 3T8LA 2HQAA 3TN3A 4B90A 4E3TA 1RJRA 1NDZA 2Z2BA 4IFKA 1UIPA 3PAOA 3LNPA 4CQCA 4H9UA 4RDYA 1KRAC 1GKQA 1J79A 3AU2A 3URQA 2PAJA 3E74A 3IGHX 3B0XA 2GSEA 1V7AA 1YIXA 2EG8A 2ZC1A 3RN6A 1KRMA 2R1KA 1NDWA 3F4DA 1XWYA 2AMXA 3WZ0E 1M7JA 1V77A 4CQBA 3DUGA 2PGRA 1KCXA 4B91A 2D2JA 4KEZA 4C6BA 3URBA 4XAYA 2EG7A 3MTWA 4RZBA 3URNA 4WHBA 4C6FA 3A3WA 3QGKC 3GUWA 1QW7A 1YBQA 2O4MA 4C6EA 2HBXA 2I9UA 4DIAA 4KQNA 1V4YA 3LSBA 4CEUC 4G7EA 3URAA 3EWDA 3SFWA 1P6CA 4DO7A 1RAKA 2BGNE 4KERA 2DVUA 4NI8A 4TQTA 4LH8A 3K2GA 2WM1A 2QS8A 2VM8A 1EJVC 2D2GA 3HPAA 2DVXA 1J5SA 2Z2AA 3MJMA 3TNBA 4IFRA 3AU6A 3LA4A 3F2DA 1EJXC 2GZXA 2QPXA 1A4MA 5FSEC 3HM7A 3MKVA 1UBPC 4XD6A 4XD3A 1FWGC 4F0RA 2P50A 3PNUA 1XRTA 4GXWA 1NDYA 4CQDA 2CZVA 3OODA 4AC7C 4C5YA 4HK5A 2OODA 4GC3A 2Z29A 2YZ5A 4UBPC 2PGFA 1K70A 3WYZA 1A5KC 4C6CA 1IE7C 2I5GA 3S2NA 3LY0A 3T81A 2UZ9A 4HJWA 4PBFA 2GOKA 1A5OC 2AQVA 1XGEA 2YB1A 3K4WA 5CH9A 4H9MA 1RJQA 2HPMA 4RDWA 3A4JA 3OU8A 2E25A 3E2VA 1V79A 2ANUA 3F2BA 1FWDC 3CS2A 3R0DA 4CNTA 1R9ZA 5E5CA 1E9YB 3HTWA 3ORWA 1RK5A 3GIQA 2VUNA 4IQJA 5A6TC 3QY7A 2R1MA 2R1NA 4CNSA 3GG7A 5LXXA 1EF2A 3GTXA 3GIPA 2XIOA 4GOAA 3NEHA 3EWCA 2Z24A 1W1IE 4LANA 1J6OA 2PLMA 3F2CA 2R1LA 1EJSC 2Z28A 2D2HA 4R85A 4BY3A 1WXZA 4BJHA 1YBQB 4F0LA 4IG2B 4QRNA 3SO7A 4C65A 4WVXA 2FFIA 4KESA 3GTFA 3IV8A 5HMDA 3JZEA 2EG6A 4IFOA 1P1MA 1ITQA 1RA5A 3CJPA 4IG2A 3ISIX 4L9XA 5FSDC 1V51A 4L6DA 1O12A 2ICSA 1GKRA 1PSCA 3OVGA 4GX9A 3MPGA 4ERAA 2DVTA 2VR2A 2ADAA 3QY8A 2Z4GA 4GK8A 4IGNA 4UB9A 4LAOA 1A4LA 1S3TC 4BKNA 1HZYA 3O0FA 4HK6A 3FDGA 2Z7GA 2P53A 1GKPA 1ONWA 4IGMA 3S2MA 1YNYA 4ERIA 2FVKA 3E0LA 2GWGA 3MVIA 3A3XA 1J6PA 3TN4A 4CEXC 4KF1A 1R9XA 2A3LA 4H01A 3IRSA 4PCPA 3G77A 4ZSTA 2Z25A 4D8LA 2WJDA 3D6NA 4H9ZA 2GWNA 3TN5A 2QVNA 3ITCA 4LCSA 4IFKB 1EYWA 1A5LC 4NG3A 4YIWA 1K6WA 2Z00A 4LAMA 1ADDA 3N2CA 4C6DA 3LGDA 1A5MC
chains in the Genus database with same CATH superfamily
4MIMA 4TU1A 5FJUA 2PDCA 3E5PA 3AC0A 3KRUA 3KS5A 2B31A 2O7SA 2HSAA 1XLGA 3M0ZA 5AZ0A 4CN6A 5IHSA 2IKIA 3SZ8A 1DP0A 1ZRQA 1TMLA 3SN0A 3THDA 2ZA3A 3FSTA 2G97A 4FAMA 3VD5A 1E6ZA 1HO4A 1PTAA 4KEVA 4C1LA 1TTPA 3VKKA 1C7TA 1W3HA 2XN1A 1WCGA 5IBXA 1LL6A 5I02A 3R10A 2V67A 4CQAA 3UWYA 4P2VA 3W72A 5DN1A 4O0KA 2J78A 4WSKA 4Q4KA 4G2DA 4QAWA 9XIMA 3QBUA 2GGGA 4YCPA 3I6TA 3PP7A 4HK7A 5KMYA 3AHYA 3H2OA 5KZ6A 1CGWA 3PR2A 2FTWA 3CQHA 2FMNA 5KZMA 2JIWA 2FB3A 2BV9A 4O19A 4RDZA 1E9IA 3TOPA 2PDXA 1XCWA 4NIRA 5T26A 1TR9A 3W71A 3T05A 4JKMA 2NZLA 1W1YA 1MQRA 3LHYA 2PDBA 3T09A 3SCQA 2Y5SA 4HHPA 2ZE3A 4EACA 2DJLA 5DFAA 3BOXA 4ORMA 2L5HA 1E4MM 2JKAA 2PURA 3OVRA 1MFVA 3LCLA 1CBGA 4POCA 2X2YA 1O5QA 3GXDA 3ARRA 4K36A 2ISWA 3ONCA 4XIMA 1WKDA 2Q09A 2XTKA 3W00A 4P8WA 4PGLA 2Y89A 1J0KA 3C56A 5JH2A 4AEEA 1V0LA 1XH0A 2OT1A 1T8XA 2NX1A 5U7SA 3OIXA 4EK7A 3UY8A 5AC5A 1OB0A 4E4PA 3ARTA 4TTUA 2DUAA 3PULA 3W7DA 1S5MA 1LOQA 4M24A 4NX0A 6ALDA 1RVGA 1PJ9A 4G1NA 1TUFA 1PBGA 5HMSA 5H91A 1H7RA 2WJZA 5EB8A 1CI1A 4MPQA 4AWSA 1BWLA 3OBAA 2NT0A 4ZE5A 4S39A 2VHLA 3AUJA 3U2OA 4IXHA 3RPTA 3WLLA 3M5YA 5CG7A 4DX3A 4H9VA 3ID7A 3WEZA 1V8EA 5BW6A 2I14A 5BCAA 2ZZ5A 3T2QA 5A6BA 4QTGA 5CZTA 5EMJA 4MUZA 3N04A 4M6UA 4M6PA 1E73M 3YPIA 1XIEA 4AZ6A 1OWQA 4U5IA 3N9KA 2XSBA 4RNHA 4GO9A 2VEFA 4O1EA 2PE4A 1Q13A 2X05A 1FCVA 4AYSA 2E3ZA 5LXEA 3PSVA 1XLJA 3LPOA 3VNZA 4BEQA 4NZ1A 1HX0A 5G2WA 5CCZA 4CD5A 1GKQA 1JQXA 4MOZA 3M9YA 4A21A 1H41A 1WE5A 2WMJA 3RN6A 1UBSA 4DF0A 2J88A 4ICNA 3MU7A 2OVLA 5KZEA 4B16A 3W1QA 4IPIA 3LG3A 1ICSA 3E0IA 3WD3A 2ZZ1A 3V5FA 3W7CA 4Z2KA 1KXHA 2AGTA 4WKAA 1PYMA 3TYCA 3GUWA 3BV4A 3AYSA 5JVLA 1XFBA 3DIPA 4HA3A 3CHFA 4O14A 4MJ4A 2PDJA 1X7IA 5G1MA 1AW2A 4LS2A 4YLWA 5CPOA 3MSYA 3ZYZA 1W9VA 1GHSA 3L4YA 2A7RA 1NTHA 4MY8A 3BWWA 4PUNA 1VC4A 1V7YA 4FALA 3SN1A 2A3CA 1JUKA 3S5ZA 1XUUA 4FNPA 4IT1A 1C3FA 4PMUA 2QHAA 3QW4B 1RSCA 4E2OA 2OODA 4LV9A 1E6RA 3Q58A 3LK6A 3THAA 1K70A 3H2FA 3FOKA 2I5GA 4KCVA 3FAWA 3BTNA 3IJ7A 2ZX6A 1B57A 3HMCA 1TV3A 4S3EA 3HB9A 5FEWA 1XGEA 2D2OA 2YB1A 3K4WA 3GR7A 3AZRA 3TP4A 1RJQA 1OZMA 2DGAA 3DHUA 5JQ9A 1E51A 4JTRA 1E0TA 3CAVA 3ARPA 1XPYA 4ZL1A 1ZP4A 3EDEA 4Q8MA 1ONRA 1MSSA 2F6XA 5EKYA 5FF7A 3W28A 4GYKA 5C5YA 3OVQA 4UQBA 1SMDA 4EAYA 5HNRA 3LERA 2XVNA 3F2CA 1OFBA 2VJXA 4OOUA 5GNXA 4A3RA 2D2HA 5E9AA 4PMXA 3ZSTA 3G0SA 1A80A 1B4KA 3QW3A 4HZ7A 3WSUA 1W9UA 3N4EA 4LNCA 1W1VA 4LY4A 3K1DA 3TFCA 1Q6GA 1ITQA 3IUIA 1GW9A 4IG2A 3ISIX 1MEWA 3W76A 6TAAA 2WMKA 4JQ2A 2ICSA 1U5HA 1B90A 1VBRA 3M44A 3UESA 1EB3A 3PJUA 2CZ5A 4OTKA 5A8OA 4D8AA 4AFYA 1XLAA 2OWXA 1TA3A 2HROA 1G4PA 5ABHA 4HN4A 3GDTA 1Q6CA 1PV8A 3NOYA 4DO6A 3L5LA 3S2CA 1R9XA 4H01A 4PCPA 1OJXA 4GCAA 2J8GA 4AC1X 4D9PA 2G5WA 2POZA 1XXXA 3MA8A 3W6LA 3NO1A 4AF0A 1RBAA 2OZ8A 1W9XA 1GOQA 4IJBA 1KM4A 4ATWA 2A85A 3FYOA 1E71M 4PBGA 3LQGA 2OYLA 2W27A 4LV4A 4CUCA 1PX8A 1OFQA 4Y90A 5CLWA 3V7PA 1BSIA 3TJIA 1E1CB 4GBDA 3CWHA 2OG9A 4DUVA 1EJUC 1KM6A 2PTXA 2R91A 3PBVA 2V82A 4GY1A 3WUFA 1FOBA 5AECA 5D9NA 3A4AA 3E02A 4WDTA 1GQLA 4GQQA 1K1DA 2I5IA 3SY8A 4M1BA 3F4CA 4C7GA 3O16A 3JVAA 4F8XA 4LPCA 1MXDA 4HNCA 5A95A 5AC6A 1DWFM 1RPKA 4PFMA 2EJ1A 3NQVA 1GG1A 4AIEA 1OZQA 4DI9A 1NJJA 1ZZMA 2EKGA 1H1NA 2QGYA 2ZC8A 3HGOA 6XIAA 3Q2DA 1ONEA 2P1FA 3WDIA 2NX9A 5FJOA 1VQTA 3C2EA 3RU8X 2POTA 2PB1A 4MDPA 3NYDA 3PPCA 3PB0A 1FKXA 4ACZA 4XO7A 3O15A 1SFSA 4LVGA 4NJIA 1V6UA 1XW8A 3NQ2A 3WENA 3ZR4A 1QRQA 1O60A 4H9XA 5LNWA 3PZOA 2VX4A 3TQKA 1GOOA 3T55A 1QR7A 2UY3A 3CU2A 3QY6A 3T2OA 1OC6A 4EVZA 1YNPA 3ABQA 1EGZA 4IP5A 4QP0A 4JR5A 4XKYB 5JBFA 4FPSA 3L68A 5AHIA 3PHAA 3IJ8A 1DYSA 4YYFA 2BXZA 3AICA 1HG3A 1WXYA 3VIMA 4DAFA 3MI2A 3WQ8A 2ZRUA 1VJIA 4JYDA 2XH0A 3OYZA 5DBTA 3Q65A 3NG3A 2JBMA 5FJIA 3CB8A 2Z26A 4JNZA 3G1YA 1KXQA 1F05A 5C0QA 4RE2A 2WVSA 5AC7A 1BEUA 4O12A 4WX2A 1JJKA 5D9OA 3FGCA 3KHJA 3NM1A 2CEQA 1K7FA 4ILSA 4F9JA 5D4YA 3THCA 1EH9A 4MDOA 1JCTA 1LTDA 3UJRA 1GQJA 4AWUA 2V2CA 4OZOA 4Y9OA 2Z2UA 1ECQA 2PAJA 5A6BD 3MCMA 2QJIA 1SMAA 2ZC1A 4DJFC 3WK1A 1KRMA 1XM3A 1UR0A 3WNLA 4UTUA 1R87A 2YBTA 2J9XA 1JZ5A 2WPGA 4DBUA 2QDEA 2QAPA 1UR9A 5BXRA 5BRBA 1EC7A 3A3WA 4ICCX 4AZ5A 1HKKA 5DQPA 3W87A 1UC4A 1OYCA 1XDMA 4OE7A 4P61A 2HS6A 3ITVA 2J66A 4N7QA 3AJXA 1D7FA 5KSWA 1AODA 1YDVA 1GQIA 1UQYA 2GLKA 1S5VA 3EEZA 4LVBA 4I8YA 4AW7A 5F2LA 2DORA 3EX6A 1C29A 3TNBA 4I90A 2X0SA 3E0VA 3RNDA 5D2TA 1VCFA 1ZPTA 1KFWA 4UQCA 3HM7A 3DG7A 4O57A 1Q5MA 4XD3A 4V33A 1DJYA 2D73A 5BROA 2IQDA 2XYLA 3E49A 3CIXA 1XCFA 2FQIA 1W31A 1XSKA 2OO6A 1Q6FA 2R9RA 3B8IA 3PZTA 1V6VA 4UTKA 2BY2A 4ZVJA 1U30A 3VPLA 3WNMA 3GDMA 2ZUWA 4WK9A 1PL9A 3AXHA 1IXQA 4FK9A 4YVXA 6REQB 3P8IA 3S8HA 1IWPA 2E25A 2VEIA 1Q6QA 4RW5A 4NJHA 3E2VA 1TJ0A 5HUOA 1IR1A 2YDRA 3CEUA 2FZBA 2ZBTA 3BLFA 4OV9A 1EUAA 2BWGA 4LVAA 2HTMA 1TWWA 2QDHA 4W87A 2PCQA 4JQ1A 4C7FA 1CT5A 3LHUA 1LOSA 4Z08A 1C91A 3GIPA 1G67A 2NW0A 3RLVA 4B9YA 4GPNA 4D72A 5C9XA 4EKJA 3TIMA 2YJQA 4EXAA 1TPH1 5IBXC 4OVXA 1P1XA 4JAWA 4JIRA 2FFCA 3JZEA 4J3VA 3H6OA 5HPCA 4O8RA 1FXPA 3ES7A 3WK2A 1KBIA 1TREA 1O1ZA 3TEVA 1VYPX 3CUXA 4L5ZA 1H7WA 1X39A 3MHFA 3BDKA 5C9ZA 1YDOA 3UD6A 2BBFA 1JCLA 3WX7A 1OGBA 5LGXA 4DN1A 4K8HA 1RBOB 4NKCA 3BJFA 3OZMA 2OEJA 4BF7A 4DBSA 2EPHA 4IGMA 4Q8OA 3IJQA 1W1ZA 1J96A 3VOIA 3WH8A 3A3XA 1DKWA 3W7HA 1M01A 1P4CA 5I03A 3G3DA 3CV7A 2WANA 4FXSA 1US2A 3KRSA 3ITCA 3W1TA 3EDDA 4NZJA 4GLEA 1ADDA 2AMGA 1IT7A 3MT1A 1IF2A 2D22A 9XIAA 1SO3A 2G95A 3O05A 3BVJA 4GYPA 2O9PA 1G7UA 3QH2A 4FMVA 1WZKA 1RA0A 5ABFB 1FH9A 1V3HA 4RW3A 2EAWA 3H4XA 1MEHA 4EPBC 3TYBA 4CQ8A 3QTGA 3KM8A 1GCYA 3LUTA 3NOEA 1FXQA 2GFTA 5HINA 3W1NA 2QF8A 3O8AA 4B3ZA 1T7LA 4UFJA 2Y5EA 3KCLA 1QI0A 4Y9NA 2GDUA 1BXNA 3C8FA 3L0GA 4UQDA 4XZIA 2PDWA 4H83A 3R94A 1EPXA 4N42A 1KFKA 4ES4A 2XU2A 4UNLA 3U9IA 3RRAA 3AIRA 3SCWA 3ES8A 3CYVA 2V9DA 5F2MA 1JDDA 3SGZA 2UBPC 5TAOA 3UBPC 3SI9A 3R8GA 4FNRA 1YMYA 3CEPA 4UCGA 2D24A 3P80A 1W3LA 1PS9A 2YCLA 3O6DA 4HOZA 2VT0A 3VNYA 3WQOA 4ZQMA 4J9JA 5I5RA 1SU5A 4XBKA 4KGLA 1JDAA 2PBOA 4GGHA 1KFEA 4NYYA 1RD5A 2WB5A 2OLAA 1RD6A 2GJNA 3P2VA 4ZENA 4DPPA 2QV5A 1XG4A 3G22A 4JEJA 2QT3A 1SR0A 4RR4A 3G1RA 1X1ZA 1JAEA 4GQ0A 3EB2A 3D3FA 4UCFA 2WMIA 4ERGA 3MBDA 4QROA 1VFTA 4LC6A 2ZADA 4GMEA 4S3JA 3AMLA 2XGZA 1JZ4A 4PTNA 3G1AA 1OFEA 3PANA 1RUSA 5F1VA 2F2KA 2IXUA 4NNCA 2BVYA 1WO2A 3I4KA 1J12A 4QSFA 3S9ZA 4LEFA 3LGGA 1KBLA 1MZHA 2TRSA 4ASTA 4EPKA 4PH6A 1XLFA 1BYAA 4DZIA 1UD3A 1J0IA 4ZQPA 3SRKA 3JRKA 4FXJA 3W7NA 3HQ1A 1FTXA 1AQMA 1TE6A 3OZOA 3R6IA 4IZGA 4XZHA 4Z1DA 4J2PA 2Y1HA 2WV8A 3EOSA 3NJ3A 1YDYA 3BZJA 4XG1A 1GOMA 1FWFC 1S3HA 4PMVA 3M5ZA 1W3JA 3HV8A 1R3TA 4E3TA 1PKNA 2B0MA 3M6YA 4MWAB 4IPLA 2UY5A 4DZ5A 2FGLA 4XZWA 5I6SA 5D2YA 1ML1A 3AU2A 1W2PA 2VX5A 4JHZA 2GGIA 3QYQA 3VOGA 3WIJA 5EMUA 5CC6A 4UOQA 1XWYA 3H54A 4LU0A 3MKCA 1M7JA 3GAYA 1CENA 4Y6GA 1U5JA 3W1XA 1H0IA 1EIBA 1WAWA 1UROA 3WKZA 3IS4A 2OWWA 4H8NA 4JCMA 1D3HA 3WN6A 2VCBA 3STGA 2QIWA 3ABOA 2FGZA 3PK7A 3TKFA 4WHBA 3RUBL 1YYAA 2YA0A 2GVJA 2ZRWA 1X8CA 1G4SA 3F7JA 3S1UA 1XIGA 2AL1A 4F2UA 1W1TA 2OJPA 2J25A 4PODA 4MB1A 5T9BG 4DO7A 4E38A 2X42A 2QCGA 4QE1A 1DJXA 1VLWA 1ISXA 4PL2A 5PTDA 4M8UA 4WOQA 1ZCOA 1EDGA 1WXJA 1EKOA 1W3NA 2Z2AA 1EEPA 4WDWA 1H4PA 3MI6A 1L2UA 4AH7A 3SDOA 1YW1A 3FX4A 4EANA 1OG0A 4LB3A 2WVTA 2DH3A 4U33A 4EF9A 5LNRA 3AISA 4GFIA 1N8WA 1G9HA 2BXYA 4MLRA 3OPSA 3TW9A 4WGHA 1XH2A 3AOFA 4IL2A 2HPMA 3GNNA 1TG7A 1UHVA 3C3NA 3W75A 1KKRA 3GYCA 3TA9A 2BOGX 4KT2A 1SW0A 1NFPA 2W6RA 3NZRA 2ZUVA 2WZHA 2E09A 3GIQA 3DOPA 5JXQA 4PMQA 2VWTA 4ZB2A 1GZJA 2AKZA 3OHMB 4MAVA 4GUJA 5CJ5A 4LANA 1IEQA 1ZSXA 1JDFA 1PZ2A 5CAKA 5DXYA 2VRQA 3W84A 5JBEA 1IIGA 3CHDA 4WDUA 2NVDA 3TC7A 3O6YX 3B9OA 4LTSA 1AJ2A 5CGTA 3UR8A 3QC3A 4AXKA 1P0KA 4WKFA 5A6KA 3EZ4A 2A79A 5FIPA 3HPSA 5F2IA 2E9BA 3EX4A 4OQVA 3KTSA 3WLTA 1V6YA 3E12A 3LCIA 3M0MA 3MPGA 3VD3A 3PTDA 3AMDA 4E4UA 5BRPA 1P43A 3V3WA 1OX4A 3SQLA 4LW7A 4S38A 4GK8A 4BS0A 4LAOA 3P84A 5LKYA 3RPMA 1GVFA 4BKNA 3O0FA 1XP3A 3AIWA 1GKPA 3T42A 4ERIA 3WD2A 1N82A 2GWGA 1XYBA 3NQEA 1RPXA 3G77A 1MO0A 3AYRA 4JFWA 4HSNA 1MNSA 2FZNA 3W6YA 1EYWA 1A5LC 4RJEA 1Q4WA 2P0IA 3TC6A 1TV5A 3WFZA 2GJRA 1YE4A 4J27A 2WNZA 1KBKA 3TMLA 7PTDA 1NWTA 2CC0A 3ANYA 3TTEA 2FTPA 2NQLA 1OFRA 3NNTA 4LF2A 1F74A 1PZ0A 3ZLHA 1B3OA 4LRTA 1XLMA 3CUJA 3KRBA 4Q8PA 2QDDA 8CGTA 5I0DA 1LBLA 5C7HA 3AYTA 1MYRA 3R4IA 2ZDSA 3F5LA 4Q8VA 3AJ7A 3TTSA 5F4WA 3VC6A 4LSBA 4BEUA 2WYSA 4S1FA 3GTIA 3B8DA 2PRLA 3NL5A 3PZGA 1JI1A 1HJWA 1FQ0A 1M5WA 3GXPA 4GZEA 1D8CA 3Q94A 1V3MA 2QUVA 4W93A 1CYGA 3L65A 1HVQA 2J7BA 7XIMA 4FHAA 3BGAA 4P7QA 3OZYA 5JMUA 4ZR8A 1SFTA 3W53A 3GRIA 3E9AA 4WEVX 1T41A 3ABSA 1KM0A 1QDSA 3QEZA 2C7FA 3E0WA 3EKZA 1VEMA 1K9TA 1LCOA 2GGEA 1U2YA 2BLEA 2OSXA 1IV8A 3AI0A 2D0FA 3GTNA 4WUIA 3BMWA 3AUOA 5FKYA 3TYZA 3C0LA 4LUIA 3FY1A 3H12A 2YCIX 1PKMA 1R46A 3LM7A 2IMRA 2RUSA 3N73A 3W2NA 3TA6A 1AVAA 3DXIA 1X7FA 4LUTB 1MNZA 4J7RA 4RNJA 3IVUA 4I8DA 1H1YA 2BODX 3RO8A 2Z1BA 1QATA 3MANA 1LG1A 3J7HA 1EIXA 5AHNA 5CPNA 2ZX8A 3UF9A 3GE7A 2X7WA 3E5BA 2VKZG 3WEOA 4YVVA 3UXKA 6ENLA 3BUVA 2ISDA 4HNLA 1BGAA 2ACUA 5A3HA 2C71A 1VFOA 1G5AA 3PTKA 2WMHA 4JEQA 5EU9A 2OEMA 2F8QA 2XWDA 3KVJA 4IGSA 2V3EA 3QVQA 1DTNA 3NZGA 5BNKA 3EOEA 1MUCA 1A50A 2Y8KA 3LSCA 5I00A 4A3UA 2QEZA 2VC7A 2QVHA 3VIHA 1Q45A 2CLOA 3TX9A 1YPXA 3O7UA 3B06A 5B7ZA 5A2AA 3EX2A 2YSWA 3R8HA 2B81A 3G18A 4B90A 2QCNA 1OBAA 1ZBCA 2Z2BA 5JH1A 3LNPA 3QZAA 1IZKA 2NUXA 2MNRA 2YCLB 1XRSA 1E72M 3DH7A 1UUQA 3UPBA 2QJHA 1NDWA 2A3AA 2YIHA 2IKJA 4EE9A 3KW3A 2VURA 3T4CA 4Q33A 1V77A 3OLIA 4CVWA 1R3YA 2Y88A 4Y2WA 3LXBA 1WUEA 3U57A 4ADTA 1UJPA 2DQWA 4NXSA 4Q8WA 2D23A 3B9AA 4I9AA 3V36A 3BAKA 2A5HA 3SW6A 3AXMA 2FHCA 5FL0A 3N1AA 2G3MA 4M6VA 2HV5A 5IDZA 1N8FA 2PDQA 4YTUA 1E15A 1AA1B 1OCQA 3NDOA 3S1XA 3P61A 4KCTA 2BGNE 1ALDA 1JF6A 4PYSA 1QK0A 1C8QA 2IW0A 3V1HA 3TWBA 1Q6OA 4XWUA 5C7VA 1QOQA 4NASA 4K39A 3GH7A 4IFRA 3BCJA 3I7SA 1UR1A 2GZXA 2BHYA 4PA8A 1D3CA 3MKVA 2AAMA 4XD6A 5BOOA 1K02A 4UTMA 4JZ5A 1KC7A 3CYJA 1DWGM 3GKAA 4GC3A 1OY0A 4UBPC 4G5DA 4K68A 2VVNA 3WYZA 6CGTA 3DX5A 2J4GA 2QUNA 1S5WA 3KE0A 3NQ6A 5BWAA 4MNJA 2BGSA 3K30A 4Y8FA 5FJTA 1EXPA 2ASHA 4CVUA 1US0A 3WJSA 2XISA 3KOWA 2XIJA 1ZB5A 1QPKA 1Q8AA 1PDYA 1R9ZA 1M1BA 5HULA 4UR8A 2WHKA 4XZ9A 3QY7A 2NXHA 3LBMA 3QHMA 1AJZA 4QDWA 1DJZA 4AY8A 3SY5A 1DXEA 4AVOA 3UCDA 4RNIA 1QOXA 3EWBX 3E96A 4C65A 2HZGA 4BK9A 1MFUA 2FDMA 4R7JA 3Q45A 2XFYA 1E1EA 5GNYA 4PEEA 1P1MA 1WOBA 1VR6A 3ITGA 1TZZA 5EBUA 4JTFA 2PU0A 1O12A 1OIMA 3CWOX 4MWAE 4TX6A 3UWWA 2C0HA 5LA2A 1QHPA 3AO0A 4GYPC 1E40A 1S3TC 2NQHA 1W37A 1TR1A 3QJAA 4Z1YA 1ONWA 3V0TA 3H4WA 1YNYA 1I2PA 1GTEA 2WSRA 4M1RA 3MO7A 5DMYA 3ITLA 2XUCA 2GUBA 2JIEA 4QJ4B 4GCXA 4WSHA 4WY0B 5BXSA 1PPIA 2VCAA 3FKKA 3OO2A 2PWHA 4Z0SA 1LG2A 3MS8A 1HN1A 1Q4NX 4A29A 3U5UA 1JF5A 2Z1VA 2VDGA 4E5TA 3UNDA 3HURA 2WSYA 3SURA 4P8XA 1DHPA 5CJMA 4EX4A 1DHKA 4HKPA 4XVEA 4C60A 4LJ3A 4R9XA 5HNUA 1XSJA 2PBGA 3DHPA 4K38A 2INFA 2EPMX 4Q4SA 3RM4A 1H11A 1M68A 1EX5A 4B92A 4D6FA 4B5XA 3E6EA 4QDMA 4ZB0A 3EKGA 3TMQA 1XBXA 1NU5A 3M46A 3OA3A 1FX6A 2YCJA 3RRXA 4P5UA 1WUFA 2PC8A 4YWIA 3N9SA 4JICA 1ITUA 4PUWA 4KFPA 4LYPA 2QJJA 4XD4A 1YPFA 4QS5A 1XIIA 2IQ0A 4J35A 4DPQA 3A4WA 3VILA 4JN8A 2WVVB 4E2BA 1W17A 1H0GA 3SFKA 4KWSA 4XSLA 4DZAA 4Q4RA 2UWFA 2XG9A 3WNOA 1F76A 1U33A 3CZKA 1LRTA 1ITXA 2RGMA 3FEQA 4QM1A 3KOYA 3RFAA 2V68A 2GQ3A 3UPMA 3HQOA 1XIFA 5AC4A 4Z42C 1J10A 1WB0A 3BPWA 3CWNA 1K6AA 1DJNA 2W92A 5A6JA 5HNTA 5ABTA 4UZSA 1UWQA 2E1WA 2V3GA 4FNSA 2OXNA 3LCXA 1W56A 4L7ZA 3W81A 2PLCA 4AWTA 1VJZA 2RKXA 1HVXA 5SWUA 1FP8A 2WQDA 1L0PA 2R8WA 1Z48A 4Z2LA 3TCEA 3RPDA 1ITCA 2GK1A 3O06A 3CB3A 3ENLA 1FCQA 2C6QA 3GTHA 1TV8A 2BS9A 1TTQA 1RBLA 1D3GA 3W73A 2V38A 3AHXA 5DF0A 2O4QA 5I09A 3IGXA 3O0KA 1PHQA 4TVCA 4TVDA 3W70A 3I65A 4NZCA 4AISA 3ARXA 4LCQA 4L56A 5I7GA 2Q8LA 3PN8A 1FY6A 4D1JA 1ME7A 2BGQA 3ERPA 3DGRA 3WD0A 3HPZA 2HK1A 3T8LA 4DAIA 5E6YA 3BARA 2QCCA 4HSOA 4JY8A 1CGTA 1M9HA 2YKKA 4H9UA 4FIRA 2BY3A 4IX0A 3VI2A 3WY1A 1P7TB 3KBMA 5A6AA 2R1KA 3RMEA 4E8CA 3TWAA 1BXCA 2DZUA 3STPA 1BTCA 1NQKA 3FN9A 5CC7A 3NFUA 4F48A 1H7XA 1KFLA 1S1RA 1OFAA 2C19A 2DZSA 3WF4A 3GFYA 2OLSA 1R3VA 4KFOA 4XKYA 4E4FA 4YHGA 4RK8A 2VQUA 2EGZA 4HMNA 4HNOA 1UH4A 2G4JA 5D02A 3IAQA 2VWSA 2WCAA 5G2IA 1XCXA 4TQTA 1OFDA 1CLXA 3K2GA 2AL2B 1S5TA 5C2GA 3WLQA 3HG3A 2NQJA 1K4GA 1I75A 3LA4A 3F2DA 4XO6A 3AROA 3RM8A 3CPGA 1X6UA 3WK3A 4DHGA 3TDFA 3IRDA 1I4NA 2ZTJA 1ZAIA 4HB7A 4L6HA 2GL5A 1X6NA 2G0WA 1IE7C 2C18A 2QDGA 5ABEA 2GQ9A 4NRRA 3T81A 1XRVA 4AVNA 4RLIA 3D3AA 4J4KA 2OKOA 5HXMA 3LMZA 4DBDA 2KX9A 3ZJ7A 5CAHA 4BHYA 3QXBA 5CPSA 3GO2A 5BU6A 5BOFA 3GXMA 3VIFA 5DMMA 5DY3A 3UW6A 4BI6A 4V2XA 1HJSA 2TSYA 3SM0A 4HA1A 1F07A 5D09A 4WCJA 1OF8A 3R7MA 4WD0A 2PLJA 4HPHA 3NEHA 2XWEA 4LBSA 3EWCA 1O6IA 4YTRA 3GG1A 1Z69A 3I3BA 1OABA 3EA2A 4QE4A 4GQBA 3UWZA 3M4HA 4V27A 1QOPA 4ZXOA 1P48A 2G4FA 2ATSA 4H8HA 4QRNA 3QV8A 1OIFA 3PG9A 1DOSA 4Q4QA 3ZS4A 5DLCA 2GUUA 4TR9A 2EG6A 5AC8A 2VR5A 4DF2A 1GVIA 2IKGA 1AQ0A 4J3ZA 1I6NA 4GIAA 5C55A 1VEOA 4L9XA 2VX7A 2J77A 5XIMA 2XIMA 1GGOA 1JPDX 5A6MA 1N7KA 3OVGA 3ARZA 3PUEA 4YHEA 3RITA 2XGIA 4AZHA 1N2VA 5DCDA 2HVOA 3D5HA 1M7XA 2RH9A 4HNNA 2J13A 4HK6A 1FWNA 3W7PA 3LX9A 5JUVA 2CWNA 2FVKA 3TN4A 2A3LA 2V6AA 3CV1A 2X7VA 3PWGA 3W25A 5FF3A 4PUKA 4HCDA 1V93A 2F6UA 1M3UA 3ARYA 4LCSA 1QI3A 2OKTA 4ZOEA 2DIJA 4IMDA 2PDFA 2QXWA 5HDRA 3LGDA 1L9WA 5C54A 4M5PA 2NSXA 2YL6A 3MHGA 1C7SA 3BQ5A 4C1NB 4ATLA 1JPHA 4W7VA 3DENA 2RGLA 4M82A 4TIMA 3USZA 1RP9A 3OYXA 1AH3A 4IGHA 4JTJA 4QBXA 4GX8A 1AH0A 3BQ6A 1NFGA 3PY2A 4PCNA 2XFRA 3DEQA 3WF1A 2PTDA 3KBWA 4JN6A 1NWUA 4ATDA 3C2OA 3NM3A 1NOWA 3VD4A 4PL1A 1FWBC 1GOKA 1D9EA 3DYMA 3P93A 1SW3A 3V4BA 4BQ2A 2DZTA 4R88A 3M7SA 1JAKA 4BI7A 4G8TA 3L2MA 2DZPA 2XN2A 1EZ2A 5ABFA 3VMNA 2Y63A 1F2JA 1BXBA 4IPJA 3VCCA 4EWND 1JCNA 4Q8QA 1J2WA 1S39A 3NQBA 3KBJA 4H9TA 2OLHA 4IIHA 3PJTA 5AB3A 5D38A 3GDLA 4HZ6A 5D2XA 5IFTA 2P10A 3HGRA 5LHFA 4URIA 3H53A 4XQ6A 1EC8A 1FH8A 3LS9A 3BLLA 4WR3A 2NQ5A 3VNKA 4H6KA 3DFYA 3M47A 3ZT5A 1EPVA 3UT0A 3AMGA 1R8LA 2AAAA 4ZCWA 4LCRA 1J0HA 2Z27A 3BE7A 4Y8EA 4JYFA 4UOZA 3TYAA 3C0SA 1H7OA 2OOFA 1LYXA 3B0YA 3EPOA 1EP1A 2ZXDA 4K37A 3K8LA 5AYZA 1XJBA 3VM7A 2CBVA 1MQPA 3DI1A 5HQEA 1NH6A 4GZ7A 1RQEA 5J5RA 3LRKA 4F0MA 3LD5A 1DV7A 3ITTA 5D2WA 3CXOA 2YR1A 1R2RA 3FJLA 1TJRA 3UWQA 3TU9A 2DQXA 1DJQA 3DCPA 5HMEA 4I5UA 4K8EA 4BI5A 4XAGA 4H6QA 1XLCA 1KM1A 3LHWA 3N17A 1R3SA 2WPBA 1HL2A 1TRDA 1R47A 7A3HA 2X2GA 1ISVA 2A3HA 3GDKA 4GVHA 2PWVA 1TUXA 3CAKA 2DSUA 2VO5A 5I3JA 3E0FA 4B9ZA 1E6QM 2Y6ZA 3O9NA 4A22A 2SFPA 1VFSA 1EWEA 4JIEA 1JNDA 2Q01A 3PS7A 3P14A 3HGJA 2YYTA 1UKSA 4FF7A 3P7YA 5D8ZA 4INFA 1C92A 1A5BA 3NVDA 4L1WA 3K13A 1OX6A 2PA6A 1U1HA 3GNDA 4MUPA 4AEFA 4QITA 4LRSA 1KRAC 4MB4A 3SCSA 2IPFA 2GDQA 3TROA 2WBKA 3IGHX 1BRLA 1FWTA 2GSEA 3SECA 1DTUA 1JZ7A 4IISA 3NQAA 4HHMA 2CXGA 2PD5A 3L4VA 3UGVA 2VYOA 2ZCGA 1ZCCA 1EA9C 5AHEA 4MNLA 2PCEA 2Z6JA 1QW7A 4HYVA 2ZRVA 1UJQA 1JD9A 2D3LA 4DIAA 2HK0A 5CPMA 2ZZ7A 4F3HA 1FVPA 3VGHA 3B04A 3OA5A 3VM5A 4Q32A 4P8VA 1OD0A 1B31A 4WY0A 5C6MA 3TONA 1TVLA 5F2GA 3HGSA 2WLYA 1O5XA 3I4EA 3C2FA 2OU4A 4GQGA 4LAUA 3EEGA 1EZWA 4LBUA 1V08A 1KR1A 1EO5A 2BFGA 1A0DA 1ZENA 1DJGA 1EQCA 3ARSA 3S5YA 3NSXA 1A49A 1CGYA 2WXDM 3GVWA 1UD2A 1ZAHA 4K6AA 9RUBA 4DJEA 2D20A 2GQAA 4NZFA 1GOIA 4QLLA 3I68A 3WQ4A 2GOKA 3GY1A 1DIOA 2CZDA 3W7LA 3W38A 3QQ0A 1WNOA 5C8BB 4UTTA 4US5D 3M6DA 8TIMA 2D3NA 1BFNA 3GHRA 2YA2A 2Y70A 2J75A 4N4QA 4JYEA 1VBJA 1UG6A 2WKGA 3WDQA 1AJ0A 3GVQA 1L6FA 4HMCA 2BZNA 3VDAA 1FUYA 3BAJA 3CZ8A 1DEDA 3LI0A 1JRBA 4MZYA 4CLMA 1E6SM 5T8GA 1ELSA 3HN3A 4FOKA 3RR1A 1DE6A 2DW6A 2Z28A 3VIJA 1WXZA 2VTFA 3P67A 2YCEA 2ZYFA 4MSSA 3CL8A 3CV6A 1E9LA 4AAJA 1CXLA 1HGWA 5CPLA 4JTKA 3E2RA 4JQ3A 1G4TA 5DY2A 5FAGA 3ZMRA 3BCDA 1OYAA 3V0UA 1MXSA 3RLGA 4ZQNA 1W5QA 2WVUA 2VFIA 4HOXA 3CC1A 3O07A 3KOZA 5HATA 1VLIA 4IMGA 3AIVA 1GOWA 1LOLA 2XJ7A 2PU1A 4IQLA 1CCWB 3TNOA 3AWNA 1JUBA 4XB3A 3K46A 4DWSB 2P53A 3WDJA 3T40A 3SUVA 5HUPA 4E3VA 1TX0A 3SQMA 4L9ZA 2QMJA 5G4WA 3GK0A 1AW5A 1FFRA 4UTIA 2X1UA 1OD8A 3ZXWA 2Y8VA 3CMGA 5HPOA 2PGWA 4LAMA 2ZRXA 2DZVA 1WKYA 2B7NA 4CCEA 4OGZA 1GJPA 5BYWA 2PDGA 3BK0A 1E6PA 4QLKA 2GVGA 2ON3A 3GHUA 4ZZ9A 1PO9A 5IHRA 3QM3A 4HHLA 5DELA 3IIXA 3L21A 3QKEA 1J01A 3UCQA 3P5YA 1FWWA 4ZOAA 4DJED 1K9DA 1G7VA 2DW7A 2EPLX 5IM51 1NP0A 4TTGA 2D0HA 1VIZA 3FIGA 5HOSA 4PCSA 3L4XA 1SPQA 5H2ZA 2I1OA 1GW1A 3IEBA 3K1GA 4GC4A 4P7NA 3BSMA 3QRHA 1JQVA 1SJAA 1WYIA 3T0BA 1PEZA 2CPUA 3JS3A 1T40A 1J0ZA 1FHDA 5A8MA 2EHHA 3CMFA 3R12A 2CBJA 2R1PA 3CH0A 4E6MA 2OGJA 1NDVA 3U3HA 3WLJA 4O0QA 3N2XA 1PX4A 4GKTA 2WHLA 4NT0A 3UR5A 3AFBA 2ISFA 4DB7A 4IMEA 1YTDA 4QX4A 1CW2A 1Q6EA 1X96A 2BDQA 2DH2A 3P62A 2C3ZA 4CU8A 4P7OA 4S3FA 4J3SA 3B9DA 3IIPA 4AIBA 4GJ1A 5FD0A 3W2KA 4JTHA 1K4HA 3SEPA 3R43A 3N6QA 4HQVA 4QISA 3W29A 3H8AA 2PZNA 1OGSA 2CLKA 1JXJA 3TAOA 1KCKA 4G6CA 1JPMA 1RHCA 1UP3A 4JPGA 2YW4A 2KAUC 4LBRA 1VZWA 2V5BA 3FK4A 4U5KA 2REQB 3IVTA 1L6GA 3A5VA 2OO0A 1GVEA 4XAFA 3T1GA 5A6LA 4IIGA 4HNUA 3DFTA 3NQDA 4YMZA 4KWWA 3HV9A 1TX2A 1VBGA 4F40A 3POCA 3S4TA 4GZJA 4ZA0A 3U2CA 3WNNA 2QJNA 3ABZA 1BWVA 4I5XA 2IUZA 2E67A 1TYGA 2YL8A 3EWWA 3A24A 2OX4A 4GNKB 7ODCA 4BWLC 1EJTC 1UA7A 4W7UA 2YX0A 4OU1A 5EY5A 4HPNA 3MSRA 4V1YA 5CG0A 1Y7VA 4C1NA 1NWRA 5G4EA 2WNQA 1W5NA 3PTQA 1EHAA 1I60A 2PWUA 5AYXA 4HBKA 5LIYX 1FCUA 3QV9A 1AMYA 3H7UA 4HA0A 1EF3A 4K8GA 5CZ0A 4Q8TA 4IQEA 4Q3MA 3RHGA 4L6OA 2G41A 2QW5A 1WDRA 1DIEA 5L6UA 1JRCA 5K7JA 2H8XA 2PC4A 3II1A 5IDIA 2CITA 1KGUA 3KBSA 2VGIA 2WM0A 5DMLA 1UIPA 2ZZ2A 2H9AB 1V6TA 4QHRA 3DKLA 3SCVA 1KV5A 1VBHA 2Y4SA 5D2VA 2OZ3A 4RX0A 3THQA 4PB5A 1TELA 1V3IA 2PF8A 1JCJA 3SUWA 3LTPA 4HN8A 1HXJA 1SJCA 3URBA 1P0DA 3AS2A 4XAYA 1E43A 1VENA 3PUOA 1DIDA 3JZUA 2I9UA 4AZCB 3TE9A 1B4EA 2R94A 4U2YA 1SSGA 1UCWA 2VC9A 4FNUA 4GI6A 2V81A 4X61A 3T0AA 3UZZA 3UNTA 1OFPA 2YL5A 1Q2RA 1SZNA 1JD7A 1F61A 3OP2A 3T2PA 4EF8A 2GSJA 3VA8A 2V5KA 2XGBA 4X63A 5FSEC 1VRDA 4N9EA 1TPDA 3VMOA 4XZLX 4F0RA 1GJUA 3UZYA 4FLQA 5AHMA 2PODA 2ZUUA 4AD3A 4EAMA 1KQYA 3R2GA 1DQXA 1X1OA 3S2NA 4LQ1A 4PMDA 4D6DA 1EDTA 2QQ6A 5BMXA 1IYXA 1JCXA 2J62A 4RDWA 3WMBA 3M0KA 4REQA 3ARUA 2VRKA 1FWDC 1B3XA 4O11A 1E9YB 3TXZA 1VFHA 5CC3A 3U4AA 3GNOA 2V5DA 1A5SA 4PUEA 1XHGA 2P5NA 1VFUA 2PLMA 1RLCL 5GNZA 1EJSC 3N3MA 3NQ7A 1UR8A 1IXPA 2X1TA 3UP8A 1TJPA 1LUCB 1B9BA 1YBQB 4IG2B 4DWDA 4QEHA 4PEKA 5C70A 3WLSA 5HMDA 2ZOXA 3KZPA 1O94A 1QMLA 2ZRZA 1MW1A 3QPYA 2G37A 1CB7B 1EJ7L 2PTWA 2FYMA 1YDNA 3MB9A 2ZVIA 4JNYA 3TJLA 3N34A 3QFWA 3TH6A 4KRZA 1WX0A 3MMTA 2ATMA 4XTIA 1XS2A 3NPVA 1Q66A 3SJNA 3AYVA 1HZYA 2C91A 2Z7GA 5DCEA 1HTIA 3IWPA 1DORA 1R3WA 4Q4PA 1UKPA 3D6NA 2NXGA 4X0NA 3KFTA 2C8NA 3DG3A 2ZX5A 2JEPA 1KFCA 3G6MA 2Z00A 3M0HA 3T6CA 2YDQA 2E1DA 3W01A 4QDPA 1Y0EA 3USBA 3L5AA 2OQLA 4Q7NA 3O2LA 4JTIA 2PMQA 1OYBA 4Y7EA 3CAQA 2I7GA 1AG1O 3LCWA 1OT1A 4MF4A 1TFVA 3FA4A 1GEHA 1BSLA 3WF2A 2XH7A 4MLJA 4O1BA 2XINA 2OYKA 4A4AA 4DLMA 3LTSA 4F0SA 2NLYA 4H00A 3N12A 3W82A 3BLPX 4MKNA 4DYKA 5EYWA 4KH2A 4JIIX 1PB0A 1KW1A 4KIEA 1Q8JA 3WQGA 2XZ7A 3UZ5A 1XKJA 4HOWA 5HJLA 2WWDA 3PZ9A 3N2OA 3HG2A 4ZQRA 2PDYA 1LRQA 4GISA 4JTCA 1LP6A 5C9UA 3TV8A 3RYSA 3INPA 1WV2A 2PDKA 3W7JA 3DC0A 1OCBA 3DAQA 1KKOA 4DLFA 3MKKA 4OUEA 1E0XA 4L1XA 1NF0A 3M0IA 1K8CA 1DJHA 4RE0A 4D6CA 2E68A 4W8BA 1VPYA 3UZWA 3NQGA 5H8UA 3FXGA 2WC7A 1BHGA 2VZTA 3H2NA 2NUYA 2Y61A 3WH5A 1SW7A 3QPEA 4A8IA 4JFVA 3OBKA 4JIHA 1RCXB 1BQGA 1DBTA 3UZJA 9CGTA 3UYIA 4MZ1A 5CEWA 4X60A 2G3IA 3STEA 3ZJ8A 1V0MA 4BFAA 5CSRA 1LM1A 2WJFA 3SGUA 1S2WA 2FH6A 3XIMA 4IICA 2V0TA 5J8LA 1XQKA 4FSAA 3WFAA 4NRSA 2WMIB 4IQDA 3OLGA 1W9PA 4AWEA 2ZE0A 5GJNA 4JN7A 5DXXA 2PDIA 2PTYA 3GXFA 3AALA 3L9CA 3UR7A 5A69A 1Z44A 4O1CA 4X2PA 3ZR5A 3UG8A 4PUDA 3BAXA 4LC8A 1GVQA 3GC5A 4PRWA 4IMCA 1UR3M 3VOJA 3ABRA 3WQEA 4PE8A 4QJ3B 3IIOA 3WMCA 2O0TA 3WJXA 1NAL1 3Q4DA 3VCRA 1KBJA 3GYEA 1YPIA 1YKWA 3VOFA 4ROQA 2OB3A 4GINA 5IXEA 5D30A 1U22A 1U5VA 3BW2A 1QHZA 4NUWA 2WCGA 3U5YA 4HCLA 3L0NA 1LL4A 1C9DA 3P3BA 3W74A 3GW0A 4IH3A 1O66A 3NQMA 2W67A 3VIKA 3TYDA 2VZUA 1DQUA 3S83A 3CQ0A 3TZNA 4O0ZA 3DU0A 3WFLA 2ZVRA 4X3ZA 4RZ6A 3HBLA 3VIGA 4IFKA 3IJIA 1Z8AA 1I45A 5HBFA 4CQCA 1J4EA 3QMTA 2WK2A 1R7OA 1L6WA 3FKRA 3E74A 2A6LA 3QMRA 2TODA 3NPWA 4QEEA 3M0XA 4W89A 4D6JA 2QCHA 2OT0A 4DO4A 1X98A 1HKMA 4RZBA 1KCLA 4YJ5A 3FFSA 2JEQA 2EPKX 1IHIA 2YFOA 3C6CA 4DJFD 4C6EA 3C2RA 4G1KA 3AZTA 3W85A 3HA1A 3LENA 2W91A 2WVVA 1T8QA 4G7EA 3KS6A 5AVHA 3WLNA 4R7OA 1VD6A 4LS1A 4UTWC 2ODOA 4A35A 2DVUA 2Z0IA 3O63A 3HG5A 1EBGA 4NF7A 1IGWA 3ZFHA 1UPMB 4JTTA 4FB7A 2H3BA 3V18A 3PC0A 1F6YA 4AXNA 3TOYA 1DWAM 1UP0A 3LTYA 2DIKA 5FCZA 2ZZ4A 1XUZA 2OOGA 3G0UA 1SO6A 4C6CA 4ENLA 3NA8A 3QF0A 4JTEA 3LY0A 1QNVA 4HA4A 3RK8A 3NZQA 1RR2A 4UUIA 3WUEA 3JR2A 1GVSA 3RM9A 4N4PA 1TWZA 3NYZA 3OU8A 3SN4A 4HTBA 2JALA 2EPOA 3IJ9A 4YYCA 2J6VA 3CZJA 1BRLB 3G1HA 1ZAJA 4DXXA 5LNUA 1T6MA 4NHVA 1V0NA 5HANA 3ZIZA 2BASA 1C8YA 4QR6A 1RK5A 3PSWA 4BF9A 3VCNA 2OELA 2RFGA 2R82A 1WBJA 3LHVA 1XYCA 1J6OA 2A21A 4H41A 4OECA 3RXZA 1DWIM 1YX1A 4IXXA 3W7IA 1F3XA 1UKTA 3SCPA 4C1KA 3GKFA 4GO8A 5AHLA 4MJ2A 3BAWA 5XIAA 3LEPA 3LN3A 4Z1CA 4DWSD 2ZZ3A 1WZMA 3ARWA 1TV7A 3GW3A 2DVTA 3V1PA 3VGEA 2Z4GA 3NL6A 2WSQA 4D8ZA 3N29A 2HVNA 1UWTA 3ZR6A 5A2CA 2REQA 3E0LA 3IJLA 1E4IA 1LT7A 2FPYA 2G8ZA 1KTNA 3VTRA 4TUFA 3ANVA 1KM2A 3TN5A 4DWSC 2PS2A 3CO8A 4IFKB 4YIWA 3VGGA 3QKZA 4FF5A 3W2JA 5ENLA 1L2QA 1TTJA 3VD7A 3IANA 1UC5A 3EPMA 3KP0A 4LFYA 3PFRA 3MV01 3CZGA 3GZAA 1LBMA 5D37A 5DCBA 1R86A 1M03A 4NL1A 4S3KA 4YTTA 4K3ZA 1AZ1A 3B40A 1W3TA 3BICA 1QJWA 3LLXA 1TCMA 1W91A 3KWXA 1ONXA 3GVRA 3IACA 1A0CA 4MFDA 3V5OA 2DJXA 3CQIA 3O1NA 1Z41A 3R58A 3GU9A 4IF2A 4O1AA 3MSGA 2ZXAA 3F5KA 1CIUA 4J1OA 2Y85A 3ALGA 4H9YA 1TV2A 1E5JA 3N15A 1FDZA 3WLMA 1C90A 2CHOA 1WOAA 2CLPA 4K7VA 5BZAA 3ZSSA 2FH8A 4JTSA 2IKHA 3BW3A 4GXMA 3C0QA 1CPUA 2Z1SA 4I7UA 1KM3A 1MDLA 4Z2GA 3OTRA 1PXGA 6REQA 2OQHA 3WLOA 3M16A 3ZZ1A 4NNAA 2ACQA 1VS1A 2X41A 4XAZA 3W0KA 1IT0A 1KNWA 4W7WA 3PPHA 1MRQA 1L6YA 1Z32X 4JXCA 1LWHA 2DSWA 4DJEC 4O52A 1GYLA 2NT1A 1TB3A 4ZO8A 2W61A 5E93A 2VZOA 1VEPA 4ACZB 3NCOA 4ZE4A 4DZHA 1E0WA 2PRHA 1PIFA 2I17A 3DDMA 3UU0A 1P6BA 2X1RA 4HU8A 4A8RA 1TMQA 3C2YA 4ONVA 3W7GA 1KRCC 1JZ2A 4IIFA 1JR1A 4XSMA 1S2TA 4RDVA 1J11A 2YXOA 2A7PA 1TIMA 5K9DA 3UVAA 2VNCA 1XG3A 2WCSA 2HE8A 2DT1A 5IRPA 3UR2A 1IIHA 1VRXA 3GU2A 4PCTA 3DFHA 3RCMA 3VD9A 1TWDA 5DRIA 3BJTA 3LM3A 1V02E 4B5SA 1PTDA 3QQ1A 3B4UA 3C52A 4KPLA 4PR4A 3IARA 4HJFA 2INEA 4AG0A 3EGJA 4PB4A 3NL3A 3AHTA 4OBSA 2Y5JA 5I3IA 1R2TA 3WMLA 3SRFA 1OX5A 4ZGYA 4O17A 4O54A 4XUYA 5BU9A 3K5XA 2OEKA 5KEZA 1JPIA 2CHNA 3NDZA 3CIVA 3IIVA 3GXNA 2XIQA 3OZPA 4IJCA 4QNEA 1REQB 1H51A 3G24A 2CLIA 5HJYA 4XZMX 4RDYA 1GWJA 3QTPA 3G2GA 1H50A 3D46A 1J79A 1NOUA 1YXCA 5HQLA 3AS0A 4WLCA 3WD4A 2F7FA 3SBFA 3H7VA 1NQ6A 3DBPA 4NI3A 3F4WA 2V2DA 2D2JA 1QBBA 1XKYA 2W0UA 3WLPA 2DZWA 1HKVA 3MTWA 3QN3A 3WQPA 2DDXA 4YWSA 5K4ZA 1VH7A 3SCNA 3SUSA 4UOJA 4JCLA 1XISA 2YA1A 3TLLA 4JX6A 1JVNA 2CBIA 3FA3A 3BG3A 3BMVA 1FRBA 3EOOA 2YDAA 1R30A 1PCWA 3W7QA 1JZ8A 4B2DA 3A5FA 2E28A 1PAMA 1O7AA 3WL1A 3CL6A 3M64A 3P0XA 3Q67A 3AU6A 3W7OA 4CGTA 3BGGA 3EWXA 2VFDA 4IOTA 1FH7A 4LX4A 2EEXA 1UBPC 1K8XA 1PDZA 3BH4A 3NDYA 3WQ6A 2YW3A 2W3ZA 3QHOA 4NYUA 5JU6A 4GH3A 2PGFA 1C93A 2ZXQA 3N11A 1RQBA 4PRRA 2QJGA 5K2ZA 5DEZA 3CO4A 1ADOA 2NLIA 4GWEA 3TYUA 1XYAA 3VZXA 4JIQA 2C1HA 3I6RA 5FEPA 3E2QA 3FVMA 4IPNB 1XLDA 1XIHA 4N9DA 2X1IA 3U4FA 5H6HA 4AX7A 3MMDA 3NTYA 4IQJA 1TPB1 2Q8ZA 1W1PA 1EF2A 1W8GA 2XM2A 5LA0A 3GR4A 1JDCA 1ZBWA 5CBIA 3MWAA 3A12A 3CLWA 1VF8A 1EHNA 4PRTA 4FZIA 2OYMA 2QMKA 4F0LA 3GX9A 2BSLA 4WVXA 4BF5A 3GTFA 3IV8A 1WZAA 1XIJA 2BTMA 3N18A 2W4XA 4IFOA 1RY8A 1ZJHA 1QVBA 1V51A 4JKKA 2VEPA 3ZM8A 2G50A 4S3AA 4DF1A 1CWYA 3VOCA 3LPFA 4NAEB 3IV3A 4A2SA 2OTDA 3VC5A 3U0HA 1H09A 3PPFA 5CGQA 3NGJA 1IZJA 4R27A 1K77A 3QLLA 5I3HA 3VZZA 2RDTA 5LZLA 4BZYA 3KWSA 2Z25A 5FOOA 3BURA 2J6XA 3L0KA 1SFLA 5DANA 2FLIA 3U2EA 3MUZ1 1EP2A 4L64A 1WZLA 3HQNA 4N9CA 4W88A 2ZX7A 4V15A 3PB2A 4WSJA 2Q3OA 3NGFA 2CZEA 6A3HA 1EX1A 4ECLA 2GJLA 5FJRA 2XFFA 4Q4OA 4AZ7A 1M65A 4KFNA 4XBSA 1BQCA 1ZS2A 2QYGA 1K9FA 3A47A 3RMJA 4ZSUA 4IUGA 1YNQA 3FHQA 4O16A 4O53A 2F9RA 3GXIA 1R2SA 3KBVA 3MJYA 3A9IA 1DPMA 2VC6A 3POHA 1H3GA 2UY2A 4EPDC 3SUTA 3MMWA 3OOQA 4AX6A 3KEHA 2H8ZA 1LDCA 1QHOA 4GQRA 1F4HA 4QFUA 3GNRA 4L1GA 2Q3RA 4QNWA 1PYFA 2FIQA 1LROA 1TQXA 3GVVA 3PNZA 4L4OA 1FBAA 5FA5A 4NZ5A 3SQSA 4MVAA 1BVZA 2A6NA 1SYTA 2E6DA 3SRHA 1B3YA 1E1FA 4GNVA 1PE1A 1B54A 2EKCA 1R9YA 2QAFA 4AY7A 3A64A 2VGBA 2UV8G 2O9RA 2F6KA 1WKEA 4PMJA 1MQQA 1N55A 1LQAA 3L4WA 4JS3A 3KTXA 1X6LA 1F8MA 5HJXA 1J8VA 4P8UA 3WUBA 1MW0A 1S2VA 1GPFA 2YBVA 4UMBA 5HAOA 1WDPA 3DHDA 3LPPA 1TSIA 1GPWA 2J7GA 2WHMA 3HOJA 2E77A 4I6VA 4I9TA 4PMYA 3BLKA 4I6KA 5MKGB 3UG4A 4O4VA 1NIUA 5B7YA 3PJWA 4OFCA 1NVMA 1Z3NA 2HNEA 4CN1A 4K7YA 4GFSA 2J7EA 4C6NA 4D2JA 1W6TA 2PPGA 3VMPA 1PTGA 1RK6A 1EP3A 4WJ8A 1L8NA 1FDYA 1LWIA 1JGMA 3TSBA 3VXGA 2NQZA 3C61A 1ZJIA 4XAPA 3W4RA 2BXVA 4M7TA 3EDJA 5CSUA 1KR0A 4O13A 5C9RA 2XVGA 3VKJA 4GJIA 3SB0A 3A22A 1QPRA 2G96A 4JL1A 3SADA 1JFHA 4CD6A 2NX3A 2Z7KA 1XD0A 1MWOA 1S46A 4K1WA 3TTQA 5FF2A 3LU2A 1WDDA 3N2MA 3VYLA 1OSEA 1KO0A 4X22A 4ZEPA 3E38A 2WMGA 2HQAA 4A3YA 1VHNA 3BW4A 5D9PA 1I1XA 5I3KA 4ZFCA 1QUMA 3L4TA 4GBUA 1Q7ZA 3S3GA 5GPRA 3T0CA 3URQA 3GSMA 2E9MA 1V7AA 4O8AA 1I2RA 5AN7A 4ML9A 3WF3A 2J27A 4DUOA 2ISVA 3WNKA 1Q6RA 4PTVA 2PGRA 2JGQA 4C6BA 1ZUAX 3EDKA 2C1GA 2IQTA 1TPEA 2ZWYA 3MQTA 2PI6A 1Q6DA 4D6HA 5CZJA 2DU2A 2PTZA 4FOUA 3L2IA 1QNSA 1TZ9A 3EWDA 3VZYA 3G6LA 3SFWA 3DFSA 4FXFA 4GE8A 2GQ8A 4JFUA 2JK2A 3MP5A 4G7FA 1TQJA 1KLYA 4A6GA 4Q6XA 3VINA 2H6RA 1W8SA 3KVMA 1W5PA 2ABBA 4GVGA 4HSHA 3S1GA 3AMKA 5M2FX 1JYWA 2HWGA 3BV7A 4NZ4A 1SSDA 1EGMA 2ZICA 1FWGC 1ODUA 2VOTA 3LB0A 2ABAA 1NDYA 3OHIA 2CZVA 2W5FA 2QCMA 1OC5A 1W3KA 3MI3A 1JDEA 3RJYA 1QO5A 2WNNA 1GORA 1OFOA 3AMCA 4OBTA 3CL7A 4TOQA 4H8UA 1QNRA 2XM1A 3D47A 4MKVA 4FNQA 5CH9A 3IK2A 4YTQA 1OM0A 4MWAA 2H3DA 2OGYA 2PDPA 3RCNA 4LYQA 4ALDA 2GDVA 1RCQA 4ZQOA 3R0DA 5E5CA 2BY1A 4MWAD 1R0MA 4GYJA 3TUUA 4Y96A 2X16A 2YFNA 3WQWA 3ATYA 4KRUA 4US6A 3WH6A 5LXXA 1XF0A 2W66A 1JGIA 4AMCA 2NV2A 2Z24A 2PP3A 3H24A 4P7LA 3DFOA 5AY7A 4GIYA 2EBNA 4LS0A 2FZ8A 1CTNA 3A4XA 1KCZA 3MUAA 4MM1A 3GBDA 1OEPA 2WAGA 2VDIA 4QLJA 1EDQA 1CB2A 2JQXA 4HYRA 4DUWA 5C9WA 1PSCA 5A6SA 2X1SA 3G1DA 1SM9A 2PFHA 3QY8A 2HXUA 1S1PA 1A4LA 2J9YA 4QIUA 4FOJA 4I9JA 3SRDA 4JD4A 1TJ2A 1A5AA 3M43A 1REQA 3IRSA 4XZNX 4ZSTA 2P8BA 1ZTVA 4XZBA 3PZMA 4H9ZA 3L7RA 3EX1A 4JTLA 1IEVA 1QT1A 1ZALA 5GVJA 1BVWA 3S1WA 4HPGA 3EXRA 2ZFAA 1QPNA 3WJWA 3WEMA 1UB3A 3FV9A 1W9BM 1ENUA 4IIEA 3WMSA 4GNJA 2O9TA 1DJWA 5A8NA 2GUYA 4NAEA 1M6JA 4M7SA 5HWJA 3WUGA 1EBHA 2Y7FA 2CWXA 2GGHA 5C71A 2E7FA 1K3UA 4UWMA 2OX1A 4XTDA 2V30A 1GYMA 4QJ1A 5EMYA 3GG0A 4XV0A 1AZ2A 2PWDA 3OG3A 2W62A 3KX6A 4IMAA 4W85A 1F7BA 2ESCA 4AD1A 3CTTA 5I24A 3MYOA 3FDKA 5ABGA 4JTUA 1YLVA 5HWMA 1UKOA 4ZFMA 1RQHA 4E8GA 1QNOA 2VDHA 2E5DA 1KTCA 4AMAA 3QC0A 3AXKA 4I9MA 3KL5A 4C6LA 4U4MA 1UWIA 3CHEA 4UQAA 4C5ZA 2FPTA 4GG9A 2QZRA 3NQFA 4Y9AA 1QU4A 1QASA 4AVFA 5LYRA 2DT0A 4PTWA 2TAAA 1Z89A 2OWCA 1HJVA 1XR2A 2BB0A 4S3CA 1PWMA 4LXFA 1ZJBA 3VKAA 3CUGA 2ZZ6A 1QI5A 1ZQ5A 3UA3A 3FHAA 3G1FA 4GVIA 4EPEC 1TWSA 1HL8A 1TVNA 3F4NA 1PUDA 1I2OA 5AKQA 3QR0A 3AXIA 4R34A 1AQHA 4BQ5A 4J40A 4GIEA 3KDNA 1YEYA 3KTCA 2YBUA 4C6KA 3KAOA 1HKJA 2XH4A 3CUFA 4UFIA 3T7VA 1PZ1A 2FZDA 5EPDA 3W1RA 2CERA 3TFXA 4I7VA 1FDJA 4KWOA 1F6KA 3BLDA 5A8GA 4DYJA 5BXTA 3ITXA 4CNNA 4G7EB 4DBWA 5KTLA 3GFXA 2CLEA 2HNHA 1Y8BA 3PM6A 5BOEA 3FJNA 3EPNA 3DKJA 2VC5A 1QXLA 3NO3A 2WNWA 3CHCA 3UPWA 1LQ0A 1P5BA 3GC4A 2R14A 1TVPA 3P82A 4DM2A 3ZVHA 5FAJA 4DO5A 2NV9A 1TPFA 3TTYA 3S46A 1KBBA 4MB3A 4GYFA 4J28A 3BAIA 1K8YA 3CAWA 3G1SA 3RX4A 3V35A 3FA5A 2I57A 3PJXA 3GH5A 3UG5A 1EUNA 4R33A 2VOMA 3I7RA 2HCVA 4GUHA 8RUCA 4WOZA 1N8IA 4H4IA 3PBMA 2QULA 3C5QA 2E8YA 2X0HA 4S2BA 3DFNA 3ZLFA 5A94A 3DYOA 3N4FA 3VX1A 4HT3A 1HKIA 1TE1A 3AWOA 2F84A 4FX6M 2Q6ZA 1ZNNA 1W2VA 1QWGA 1VB9A 4LVFA 2QUTA 3B0XA 3W2LA 3WNPA 2I56A 1ODZA 3FAXA 3VVGA 5E0KA 5D9MA 4ZODA 5ECUA 2AMXA 3UWUA 1SR9A 3FJ4A 5F4SA 1W3IA 3QYSA 4U3CA 1AL7A 3S5OA 4JQAA 3VIIA 1ADSA 4C6FA 2Z6IA 3EB4A 3HPFA 3OW1A 1E3XA 4E2VA 3OVPA 4CEUC 1DXIA 1CGVA 2YZRA 2BMBA 1XYZA 5M3WA 3PFMA 1BWKA 1NFBA 1RAKA 4LUJA 3NEVA 4KERA 1EFZA 2P0OA 5HWNA 4GUIA 4KEMA 1LUCA 4UR7A 2V5JA 6TIMA 3VO0A 1EJVC 2D2GA 4Z2HA 3S9IA 1F3TA 1XLLA 5LNSA 5EGRA 4RPQA 4ZO7A 1IR2A 1GEQA 3BO9A 4R53A 1E56A 3NQ8A 1A4MA 3H2CA 5LIWX 4I3GA 3T44A 2WQPA 4CCCA 4MNMA 1UH3A 4UQ9A 2V5CA 1KXVA 1GUVA 2EQDA 4CQDA 4MWAC 4NZ3A 1T5AA 3I7QA 4B15A 5EMKA 3H70A 1ZBKA 4DY1A 3C8NA 1A5KC 3SIZA 1E6XM 3BSGA 1VCGA 2J47A 2IPJA 2FHFA 3KL0A 1A5OC 2AQVA 2E5BA 2DP3A 4Q8NA 4AZIA 7ENLA 1OK4A 1Z6KA 3RG6A 4PUJA 5KETA 1EOMA 2O56A 2DUXA 4JTDA 4FX8A 4RPPA 4CNOA 4RNFA 2EF9A 1R7AA 3F2BA 3CS2A 3WD1A 3TCSA 1LWJA 3B3DA 4XUGA 1OG6A 5LIXX 3REQB 3GG7A 1AL8A 1XIDA 4I7WA 3G3MA 1KGXA 1OX4B 4CKQA 3OG2A 3T4WA 1OHLA 4XX6A 2VGGA 4S3GA 4HU4A 4G56A 4JGDA 3IGUA 3R1ZA 1DJIA 1BYBA 2J24A 4RXGA 2WW5A 1DL3A 3MUIA 1I1WA 1M41A 2XVPA 1UD4A 4GA8A 1XGZA 3HMJG 3PAJA 1EGVA 3KZSA 1HFBA 1JFXA 2Z1XA 2QCDB 3ZVHB 5TIMA 3FW6A 1FWSA 4J3UA 1VCVA 4J3XA 1DQWA 3UGRA 1IWBA 1S2CA 1CEOA 2QPUA 3EOUA 4HVXA 4UZUA 4M80A 2BNJA 3CTLA 3FDGA 4FP1A 3S2MA 2CESA 3BGJA 4WZHA 2QIIA 2GSHA 3PG8A 1PIGA 4B5NA 3W86A 1VFMA 2QUMA 3EMCA 3PZVA 2LLEA 3LV6A 3CV2A 3TTOA 1VAHA 1MW3A 3TK7A 2XZ9A 3HJEA 3T0TA 3AIUA 1GYNA 2QVNA 4YPJA 4OIFA 3KDOA 3LYEA 1FCBA 2DPEA 4NAFA 5I2UA 2P76A 2Q02A 3W1UA 4GABA 2PRMA 1THFD 4C6DA 3UJEA 1FA2A 3S6OA 2G3NA 4RKAA 3NPUA 3VUPA 4QG6A 3TN6A 3G8RA 4WGXA 4EIVA 1YADA 4GGBA 3BLEA 2GVYA 3FNDA 5CC5A 4CU6A 1IQ8A 5CQ1A 1VGAA 3LZ3A 4AHQA 2PF0A 1XICA 2PUZA 1O68A 5CPQA 1R85A 2J79A 2ACRA 3OJGA 4U3AA 2Y62A 4D6EA 3RLHA 3SJ3A 3WBYA 1ICQA 4N6EA 4C91A 4NX5A 4X0VA 3BOFA 4DELA 4JTQA 4DJDA 2QKFA 2H9AA 3B0PA 4R3UA 4L65A 1F6PA 1J0JA 3GBEA 1JUEA 2YYUA 2QCFA 1GOXA 4PSRA 4J2MA 1OF6A 5M03A 5CBBA 3IPWA 3LOTA 3KBNA 2YCKX 5HK4A 4OV4A 2VZVA 3VU2A 2VGFA 2BOEX 1J5TA 3BSHA 4NP7A 2OQYA 3W1PA 2IXVA 2GVLA 4H3DA 2OPJA 1CXEA 3GDBA 3I6EA 2EJAA 3GDRA 3CT7A 3L5MA 1G69A 4E0CA 1WAUA 3TSDA 1LZOA 1EC9A 3NURA 4YTSA 1T0OA 1H7PA 1JNEA 3PBUA 1E70M 5I3FA 4LUYA 2O9OA 2OZTA 3WH7A 4LALA 1MEIA 3W1AA 2JE8A 3AIQA 3APTA 5L9FA 1X97A 2JKEA 4F4RA 4GVFA 3NQCA 2E6FA 2G3FA 4ACYA 4X9SA 4EXQA 1BG4A 4EP8C 3N9RA 3QSTA 3IJ6A 3QGAC 4TVUA 1V6XA 3LXCA 1D8WA 3VGBA 3TR9A 1IWAA 1NF7A 3TXVA 4DNMA 4BA0A 1I9CB 1H49A 3EMZA 3MV11 1QPQA 3MCNA 4HNTA 3ARVA 4PMRA 3MP4A 2I16A 3DZ1A 1E3ZA 2NQ9A 5B80A 1VPQA 1JYVA 1KWGA 3VABA 3TR2A 3CUHA 3N25A 1BYDA 4JIPA 4J3WA 2NVAA 5FEXA 1UQZA 2W79A 1AUSL 2E8ZA 4QXIA 2G3JA 2TMDA 4C6OA 5M17A 1FKWA 3QOKA 5K9CA 1XLKA 3WDPP 1XV8A 2A3BA 3P81A 1G94A 1HJUA 1Z7AA 3CNYA 1H5VA 4DUXA 3F1QA 3PPGA 3LLFA 4Z2IA 1LQ2A 3AXXA 2KZHA 1CXHA 1HT6A 5CSYA 1A5NC 3AIEA 3HQPA 2XSXA 3U8GA 3VDCA 3GFZA 2C14A 3NXLA 2WWCA 3MBFA 4TX8A 3W22A 3GUGA 3GWQA 4ZXLA 3T9PA 4DQWA 5I23A 1XL9A 4XIAA 5A8QA 2E5CA 1XC4A 4TMCA 3BMXA 3U48A 4UTFA 2XN0A 3KVLA 5DX7A 2A7NA 3T07A 3MP3A 3R5EA 3P60A 1NP2A 4B91A 4KEZA 3DERA 3KCJA 4O1DA 4AHOA 1G4EA 1KGWA 5ECVA 1BYCA 4Q22A 1VKFA 2EPNA 4MJZA 4DVOA 5REQB 1V5XA 1XLEA 1KTBA 3K4AA 1UASA 4YU1A 1W5MA 4UR9A 3T08A 2OCZA 1P6CA 1P7TA 3E1F1 2PSNA 3U2ZA 1Q7QA 1XLHA 3B9NA 3LGEA 4LH8A 5C2XA 5IFPA 2QS8A 4QJ5B 3HPAA 2DVXA 1J5SA 2VELA 2P8CA 3MJMA 2INZA 4YXGA 3LXAA 1EJXC 2B7PA 4MMWA 4PUUA 5AYYA 3QLDA 4HNVA 2CLLA 2ZTKA 3A23A 5J5DA 2P50A 5TBOA 1GVOA 3OODA 3LNMA 1A0EA 3O3RA 1OK6A 4C5YA 2VD8A 4Z1BA 3M41A 3WQDA 1RV8A 3VDGA 1R5YA 3FYPA 3ONBA 4HJWA 3CK5A 3LCFA 4PMZA 1V02A 2PDHA 4FLSA 4YCOA 4C7DA 1BGGA 1S38A 3W9ZA 3GC2A 3EXTA 3ZLGA 4LF1A 4HCHA 1JIBA 2HS8A 1V79A 4H7CA 4IPPA 2ANUA 2GYIA 1SQ7A 1HP4A 4CNTA 2WZMA 1UP2A 1XDLA 3S47A 4NXKA 4ROPA 3WQCA 2CXEA 3ORWA 2W63A 4Z0JA 3ITYA 3UVIA 3WG6A 3LDVA 4GOAA 3ZJKA 5F7UA 4UTTC 3P5ZA 4A3HA 1DWJM 3BLOA 2DSKA 5H8MA 1M53A 1TJ1A 1MZRA 3FGCB 3AS3A 1W0MA 3OB8A 2VEMA 5LNVA 4KGJA 2RDUA 3VKCA 1HQTA 4DBEA 1J9YA 2QCEA 3THUA 4Y9PA 5BWFA 2A3EA 4QCFA 2V63A 4UMAA 3N13A 2XH2A 2C13A 2BX7A 5CPTA 2XVKA 3QV6A 4ZMGA 4GX9A 3UA4A 4ERAA 3TLQA 1MVYA 4W5UA 1UD5A 4HMDA 4B3LA 4M6QA 1EWDA 1GONA 4FS9A 3VK5A 3EBVA 1JULA 3RJXA 1A53A 4FO4A 2Y7GA 1SJBA 3H7RA 3MVIA 4H8VA 3CBWA 1UR4A 5DMNA 2EXOA 2CKSA 1W1B1 3TZFA 4K2SA 3U6WA 3F5JA 3S1VA 4MNKA 5D33A 1D2KA 5EL1A 7TAAA 5AYIA 3EA3A 3H4GA 4B5WA 4ORIA 4U2ZA 3F4VA 3G1VA 1XQLA 2TPSA 1F4AA 4AD4A 4PMNA 1EJRC 3GS6A 4RZ4A 1GTHA 4V1XA 3JUGA 5E6ZA 1AFSA 1OCNA 3EAUA 2PDNA 1LL7A 2VFGA 2PLKA 3ZOAA 3PWAA 4F9DA 3MDWA 3UEQA 4CU7A 1U1UA 2PWGA 3RX2A 3ALFA 1BF6A 2C15A 4AIUA 3LMYA 3ATZA 4A8NA 1XLIA 2NWSA 3S5NA 3MUCA 2NWRA 2AKMA 3W07A 4N6FA 4D6IA 1OINA 1ME9A 4KWUA 2AQOA 4PULA 4OBRA 2XSAA 1OADA 5I3GA 2WJEA 4FEZA 3QPZA 2B4GA 3WH9A 4FI4A 3APGA 3L67A 3WF0A 4OKDA 4A2RA 4ZQCA 3EMQA 1IEXA 1UWRA 3T8QA 5HMFA 3CPUA 3PBGA 5G4HC 1CECA 4JFTA 3AHZA 4DI8A 2X40A 4YVPA 4GY7A 1I0DA 2V8ZA 3M0YA 3ZO9A 1POJA 5JBDA 1LLOA 1OGGA 1MMFA 4M51A 1EJWC 3IVSA 4N02A 2YOCA 2BG5A 4ZBCA 3VIPA 2QF7A 3S0CA 3P6LA 5CZKA 3S6TA 1IXOA 1L8PA 3NL2A 2VEGA 4H7ZA 4LWWA 2ACSA 3COTA 4ZO6A 3VGFA 4Q6JA 4TXEA 2HBVA 3ECQA 1X8FA 1O95A 1QK2A 1OT2A 4GIRA 2CCRA 1BF2A 4GI9A 3KUMA 1C9WA 3RAOA 2E0PA 1BLIA 2PP1A 2VD9A 4TV5A 2FGBA 1G6CA 3NSMA 2DT2A 2RAGA 3QSRA 4GACA 4DXKA 2JGYA 2D0GA 3E3HA 3OGRA 1QAPA 3EWYA 1BD0A 3DHFA 2QV4A 4DJDC 1NARA 3PZUA 5GJPA 4H2CA 4MYAA 4MZ8A 5E0FA 4CNUA 3CUIA 4HYWA 4O18A 2GGJA 3SR7A 1Z9AA 4R9OA 4RV8A 2FVMA 1SO4A 2WOQA 4JBRA 3OIHA 3IAPA 1B9ZA 4LYKA 2C0AA 1WQ5A 3QFEA 2YXXA 1UPPA 1R6WA 3MHUA 4OOZA 4C6MA 1GVYA 5MKGA 2DZXA 4MFEA 2VX6A 4HU3A 1HO1A 5A8PA 3S42A 4HHHA 1EEXA 3PUGA 1WA3A 3G0XA 4X9YA 4L9YA 3FEMA 4TV6A 2BOFX 4KIRA 4JDBA 1K03A 4DM1A 1S5NA 2XIIA 4UFMA 6XIMA 1ZHAA 3EDFA 3ZJ6A 1NDZA 1CX9A 1E4LA 3HFYA 5RUBA 3DG6A 3L66A 3IUDA 3E2SA 4MB5A 2CNCA 1KXTA 2AQWA 1NSJA 4REQB 1TPC1 1U1JA 2ALDA 3WZ0E 2AL2A 4NSBA 1XFCA 2I9EA 4CQBA 3DUGA 4GHRA 3B05A 3VDBA 2GJPA 1R38A 3UXDA 3W1LA 3KL3A 3B8VA 4PB3A 5I79A 4RE3A 3NUKA 4OHQA 3QGKC 4FIQA 2ZIDA 2O4MA 2Y24A 4DJDD 3R8RA 1E6NA 2GPTA 2NSOA 1F9CA 3VNLA 1G01A 2E6YA 3EA1A 1KWKA 3G8EA 4TO8A 2FMOA 2V5LA 2DZBA 3PVFA 1RVKA 1V3LA 4WF7A 3FSUA 3MYPA 1UD6A 1UUMA 3TQPA 1GZGA 2WM1A 4M0XA 3NIYA 4Q7BA 3UXAA 2MANA 3GD6A 1Q2SA 2HRWA 2YXGA 3CGTA 3UWVA 3LV5A 3CMJA 5LIKX 3KCOA 1J0YA 4S3DA 1UMYA 1DXFA 3MO4A 2QCLA 3HG4A 3DECA 1MDRA 3EWUA 4FR6A 4GXWA 5I06A 3H2EA 4MG4A 4OJYA 3R89A 5BMWA 4ZB5A 1ZL1A 2F61A 2YZ5A 3WBEA 4D1IA 1IZCA 2Y8UA 3F03K 4UIOA 1VHCA 5G1YA 2E40A 3GHSA 2VRJA 3B8SA 3AS1A 4UFLA 4H9MA 1E0VA 3CUZA 1K9EA 1KM5A 3UWEA 3A4JA 1S2UA 1XGDA 1GG0A 4L4LA 3CQJA 3VOHA 1QPOA 3RIKA 3WJZA 3HTWA 1H7NA 4MADA 4BR1A 2XIBA 4LAZA 1XINA 1R3RA 3BOLA 1SZEA 2VR4A 4CNSA 3W88A 4N0RA 3GIYA 1W1IE 1B0IA 1BVNP 3MC5A 4HD5A 2QJMA 4KKXA 3B03A 1LLZA 2CLMA 3BXWA 3WBXA 4R85A 4BY3A 3UY7A 3CZLA 4JTAA 1VYRA 1X1NA 3VX0A 2I5QA 1UWAA 2DSZA 3U7BA 4DXVA 1WDSA 4B3KA 1TWIA 3P74A 3SAZA 1X38A 2MUCA 4L6DA 1SO5A 1GKRA 1JYNA 4BQ3A 1PX3A 2VR2A 3W24A 2OZ0A 5LSMA 1RZMA 1YXYA 4MTVA 4IHCA 2VXNA 2CU0A 2DT3A 4AYGA 3LZ5A 3MSDA 1H1ZA 2R24A 4KCWA 5JIPA 3H21A 4CEXC 5AFDA 1Y5WA 1PWLA 3GXTA 4QAIA 2VMFA 2VFFA 3MMUA 4NY2A 1VFFA 1JCMP 2RDXA 3KP1A 1K6WA 1YTEA 4A8LA 5BXPA 2C1IA 2CYGA 3QOMA 1AQFA 3ABXA 1XYFA 3BG9A 4YNGA 3WLKX 3H26A 4P7RA 4GUGA 2GJXB 2WZIA 4W4QA 5T91A 2ZDRA 3W7KA 2VEKA 4UQEA 2FZMA 5LGZA 4OT7A 4M29A 3S2LA 1YQ2A 2ONEA 4PTMA 1UKQA 3NWRA 3RLUA 4LY8A 4NJKA 2V2HA 4IWWA 1HKWA 3EOLA 1JL8A 4NAFB 3SY1A 3UJFA 5LHEA 4RXFA 4MY9A 4JX4A 2HMCA 3LQLA 4FLRA 3W2UA 1I2NA 3TW7A 3XINA 1UR2A 2TYSA 3A3HA 3M0JA 4PTDA 4L80A 4FA3A 2YB4A 4PMOA 4ZTYA 1ESWA 1CLKA 1F3EA 2P88A 4LYRA 1A5CA 1AH4A 3FLUA 1DVJA 1FWIC 4GY0A 4WRHA 3R25A 3SSZA 1B3VA 2FB2A 4NVTA 1QCWA 1I8JA 2H90A 4RE4A 3NPXA 3TJ4A 1P0EA 3C86A 3KXQA 3HPXA 1WP6A 3DBNA 3RCYA 2DV0A 4KEUA 2ZA1A 4Y9MA 4CD7A 1TZ7A 2C79A 1ISYA 5HR6A 2GK1B 4MHBA 3DI0A 5MHBA 1I0BA 1IT8A 4XD5A 1UZ1A 4GRSA 5FF4A 1UOZA 1VBUA 1RALA 2CIPA 1QW9A 2CLHA 1GQNA 3LHZA 3W7RA 1TA3B 4AY1A 3DFPA 1CDGA 3L4UA 3AZSA 2HPIA 3MVTA 2WSKA 3AQUA 1Q3NA 3LCHA 4AZCA 1H63A 1XYLA 3HU7A 4DWSA 2ZUNA 1CGUA 5T9CE 3B8TA 1BKSA 2F38A 5FL1A 1HNYA 3ITOA 1LLWA 5I78A 2NXIA 4QCEA 3WL0A 3ZQ9A 3A13A 4QQUA 4LVDA 3SCRA 4CD4A 2O55A 3JU2A 1S2AA 4V28A 1AK5A 3C2VA 4W84A 4GUFA 1CZ1A 2DZAA 4N9BA 3PF3A 4Q7IA 3VNDA 5D05A 1FWAC 3M0VA 5DO8A 2IPWA 1GNXA 4UTLA 4CCZA 4UMCA 4QGCA 5G2HA 3S9YA 3KOXA 4UTHA 4L61A 3MCOA 5DRCA 3FCPA 3VAVA 3CM4A 3L23A 3PUDA 1H62A 3B0VC 3LHTA 2CBUA 1XBZA 5HNNA 4HZ8A 3T78A 4LT9A 1BAGA 1JYXA 1YHTA 4JKLA 2FDSA 1ISZA 3F4DA 3VFCA 3KVKA 1OCJA 3HJZA 1A47A 7REQB 4AZGA 4D6GA 1NWSA 1WKFA 2J7HA 3T0DA 4GH1A 2VQTA 1EYEA 3LBCA 2EG7A 3WJYA 5D32A 5G5IA 3FYYA 1FHLA 2HBXA 4KQNA 3APYA 4X2RA 1V4YA 3LSBA 3B8WA 1V03A 3SSJA 3PBWA 4XISA 4AD2A 3CQKA 3ANUA 1SFJA 2WKLA 2F2HA 3A21A 5EA9A 2BY0A 5DT7A 5AHFA 3N6HA 4MKSA 4LUSA 4NJJA 3W3OA 3CH9A 2JF6A 4PTXA 1YTKA 1A5UA 2E6AA 1TPVA 1H60A 1GQKA 1W54A 3UXLA 2WMFA 2DUZA 4RUBA 5FJJA