4EPKA

Evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
331
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGGGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 115
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4epkA00
2PGRA 4ICMA 3WMLA 1DPMA 1A5KC 3KM8A 1POKA 4GX9A 3A4JA 2P50A 1A5OC 5A6TC 4AQLA 3GIPA 1K70A 4GK8A 1KCXA 2ZC1A 3SFWA 4C6LA 4G7EA 4LFYA 3CS2A 3UBPC 3GTHA 2YXOA 3JZEA 1W1IE 3EGJA 4QS6A 3NQBA 2AMXA 1M68A 3R0DA 2Z26A 1PO9A 4C5YA 1P6BA 3QY6A 1FWBC 2OQLA 1IE7C 3MKVA 3IACA 1P6CA 1FWJC 3E74A 4G7EB 3MPGA 4J35A 4YIWA 3URAA 4INFA 4KESA 3MVTA 1NDZA 3D6NA 1S3TC 3AU2A 4ZSUA 2PGFA 4DIAA 4DO7A 4HJWA 4PBFA 4RDZA 2W9MA 3QGKC 3OVGA 3URBA 2IMRA 1FWFC 1GKRA 3HTWA 2Y1HA 3RHGA 1M65A 1BF6A 4H00A 5HMDA 1XWYA 1RA0A 2Z29A 1RAKA 4R7WA 4PE8A 3UR2A 4GYFA 4ERGA 4L9XA 4C60A 3PNUA 4C65A 3GG7A 2Q01A 3S2NA 1EJWC 2VC5A 4GY7A 4C6IA 4E3TA 4C6PA 4DLMA 3GU9A 1EJTC 1KRMA 4XAGA 4BKNA 2EG8A 2R1NA 1UIPA 4R88A 3EWCA 4IFRA 4R85A 4QS5A 3K4WA 1E9ZB 4HK6A 1YRRA 2R1MA 4PCNA 4PBEA 1EJUC 2R1LA 1WXZA 3IARA 1PB0A 1O12A 4GXWA 2WM1A 3GU2A 3AUOA 1R9XA 3TN6A 3F2BA 4IH3A 4IQJA 3E2VA 4DI8A 1ONWA 1GKPA 1V79A 3S2JA 4CNTA 4LCQA 4CQCA 3B0YA 1JGMA 3TNBA 3IPWA 1KRBC 4C6QA 1R9YA 1ZZMA 2YZ5A 4DZHA 4CNUA 4GY1A 4C6NA 4V1YA 2EG7A 2I5GA 2QS8A 3LSCA 3E0FA 3OU8A 3CJPA 4UB9A 4ERIA 2HBVA 4GC3A 4XD5A 4C6MA 3K2GA 4ZSTA 4TQTA 1I0BA 2OOFA 2EG6A 3S2MA 1POJA 3CAKA 2VC7A 4HA0A 3LGGA 4G2DA 3LU2A 1E9YB 1WXYA 3A3XA 3LS9A 4OFCA 2GZXA 4LAMA 3ORWA 3O7UA 4M51A 1EJVC 4KEVA 1R9ZA 2AQVA 2QPXA 1M7JA 4UBPC 3UR5A 2WJEA 1FWIC 2D2GA 3T81A 4IF2A 2BGNE 2D2HA 1YBQB 3NEHA 4PCPA 5HMEA 2HBXA 3MDUA 4RE0A 4WGXA 1FKXA 2DVTA 4QRNA 1A4LA 3N2CA 3MDWA 2VR2A 3GUWA 4I6VA 3RN6A 4RDWA 3ID7A 4V1XA 1KRAC 4IGNA 3TN5A 1XGEA 3OOQA 3LGDA 4XAYA 1EJSC 4KETA 4DLFA 4LAOA 1NDVA 4L6DA 4XD6A 5FSEC 4C6FA 4GY0A 3LNPA 1KRCC 4NP7A 1EF2A 3HM7A 2E25A 2ANUA 1EZ2A 3A3WA 4LCRA 4LH8A 4EPBC 2O4MA 4CEXC 4GBDA 4H9VA 5LXXA 2Z2BA 1A5NC 4C6KA 4C5ZA 1PSCA 1P1MA 2Z27A 2GOKA 4C6JA 1YIXA 3QY7A 4ERAA 3FDGA 1HZYA 4H9ZA 2HPIA 3BE7A 3PAOA 3OQEA 4KERA 3F2DA 1EYWA 2OB3A 1GKQA 2Z25A 3GTFA 1EJXC 3C86A 2GWNA 2PAJA 1FWHC 5G4HC 2Z2AA 4LANA 2HPMA 2PLMA 1ONXA 4IFKA 1RJQA 1YMYA 3IJ6A 2DVXA 1J79A 4C6BA 2AQOA 2CZVA 3DC8A 3GTXA 2Z7GA 4QROA 4LCSA 2QVNA 3MTWA 3GU1A 4NI8A 3DUGA 4B3ZA 4IFKB 1NDYA 3GRIA 5E5CA 1XRTA 1O5RA 2BB0A 3PNZA 4CEUC 3TN3A 3GIQA 2Q09A 2ICSA 1J6PA 3F2CA 1EJRC 2F6KA 2VUNA 1V7AA 1RK6A 3NURA 3QY8A 3ISIX 1UBPC 1A5MC 4CQBA 1K6WA 4IG2A 1FWEC 4DNMA 4RDYA 4C6DA 2PUZA 4CNSA 2XIOA 1YBQA 1FWCC 4AC7C 3O0FA 3UPMA 3MJMA 1XRFA 4C6EA 4IG2B 1PTAA 1A5LC 2HNHA 4P5UA 3ICJA 3RYSA 2G3FA 4MUPA 2VM8A 4H9TA 4XD3A 2R1PA 2Z28A 1RK5A 4KF1A 4H9UA 2Z4GA 4KEUA 2VHLA 3T1GA 4CQDA 2GSEA 3F4CA 4WVXA 3IGHX 2YB1A 3SO7A 3PANA 3RCMA 2Z00A 3LA4A 4B92A 2DVUA 3S4TA 2R1KA 2WJDA 3MSRA 1FWDC 4I6KA 1ADDA 3DCPA 4B90A 3GTIA 1V4YA 4QTGA 3QGAC 1VFLA 4IGMA 2FTWA 1NDWA 1I0DA 4QSFA 1RJPA 4EPEC 4WHBA 4KEZA 5AKQA 4XAFA 4LAKA 1ITQA 2OODA 1QW7A 3FEQA 3WZ0E 2A3LA 1J5SA 1J6OA 4GX8A 4IFOA 3EWDA 4F0LA 4HK7A 4RDVA 4EP8C 3IV8A 4HK5A 4JOMA 4GZ7A 2ADAA 4C6OA 2HQAA 4BY3A 2P53A 4DYKA 2UBPC 3OODA 1UIOA 4EPDC 4D8LA 3B40A 3K5XA 2FTYA 3F4DA 1RJRA 4XD4A 3URNA 1FWAC 4DZIA 1V77A 2D2JA 3OJGA 4J2MA 1V51A 1QXLA 4H9XA 4LEFA 4F0RA 1FWGC 4B91A 4XAZA 1A4MA 2Z24A 2O4QA 3E38A 4LALA 1RA5A 3PBMA 4NG3A 4GOAA 2YB4A 3AU6A 2KAUC 3HPAA 5HMFA 2FVKA 2WJFA 3ITCA 4DI9A 3V7PA 3WYZA 3MVIA 4Z42C 3E0LA 4H01A 2E1WA 4J5NA 4EPKA 1FKWA 2GWGA 3LSBA 4H9YA 1ITUA 2I9UA 3T8LA 3FDKA 4C6CA 4KQNA 1YNYA 3IRSA 3UF9A 2UZ9A 3S2LA 4H9MA 5CH9A 2OGJA 3G77A 4F0SA 1K1DA 1NFGA 3B0XA 4KIRA 1UMLA 2QT3A 3TN4A 4RZBA 3LY0A 5FSDC 3URQA 2FFIA 3E3HA 4BJHA 2FVMA 2RAGA
chains in the Genus database with same CATH superfamily
2PGRA 4JFTA 3MYPA 1U22A 3BANA 4U28A 1J0KA 3S5ZA 5JUVA 1YDNA 1IZJA 4O17A 4A3YA 1QI5A 4GYPA 1RQBA 2VFFA 4LFYA 2ZUWA 4ICNA 3JZEA 1I2OA 1HKKA 2HCVA 4ZE4A 3SRHA 1ME9A 1AH0A 5JIWA 5DRIA 1Z42A 2ZADA 4P7OA 1EF3A 2PDHA 1KLYA 1FWBC 2QCFA 2VVNA 2PCEA 1C92A 3LHVA 3DESA 1W3LA 1H0IA 3KZSA 4JNMA 3VK5A 1NDZA 4F3HA 4ZSUA 1O66A 2GJXB 1V8EA 2XH4A 2CYGA 4PBFA 4JTUA 4HJFA 2OJPA 1TV3A 1C7TA 2GVJA 3PUDA 3B0PA 3IAQA 1DJXA 1UKQA 4WEVX 4EANA 4H00A 1VEPA 3R8GA 1LT7A 5T8GA 1QOXA 3IWPA 1VHNA 3ONCA 4ERGA 3B05A 1RVGA 3S2NA 4H2CA 1EGMA 4D6JA 1Q5MA 3RRAA 1CYGA 1EJTC 3RFAA 5D9MA 3LB0A 1P6WA 2WM0A 2CHNA 1YPIA 3D46A 5KEZA 1E5NA 3TJXA 1CPUA 4EF9A 3ARYA 3IARA 5CGQA 1UKTA 1UOZA 3S6DA 4DB7A 2VRKA 1U33A 1V3LA 3E2SA 5CLWA 5LZLA 4OBSA 1TZZA 3NQEA 4KCWA 3VUSA 4DUWA 3N17A 2WC3A 1XV8A 2R9RA 3T44A 3PTDA 3NO1A 4YWSA 3N2XA 2IKIA 5I7GA 1TJ2A 4K7VA 1QI2A 4JHMA 1CGTA 1S1PA 1BG4A 1WXYA 3RLHA 3A3XA 2A3HA 3MJYA 1QMLA 1PHQA 4M51A 4H6EA 3UR5A 1K6AA 4LT9A 3W02A 4AEEA 2Y6ZA 3L23A 3WFZA 4Z2GA 3P5YA 2XH2A 1HKWA 4PCPA 5HMEA 1M3UA 2VFIA 2GGHA 3ALFA 1E40A 3PZQA 4HMEA 3TW6A 5A8NA 3E0IA 2XN2A 4I3GA 2EPKX 1XR2A 4LYKA 4O1FA 5C5YA 3MDWA 4TIMA 3ANYA 4ZO6A 3RM8A 3ZZ1A 1H7NA 2QGHA 4LY4A 3ABXA 5A6BD 3UZJA 4PB3A 1EX5A 3KBSA 2Q6ZA 1VBJA 4K2SA 1GOQA 1W1VA 1G69A 3Q45A 2ACSA 4C6FA 1OIFA 3W26A 4CKQA 3N12A 2YL6A 4PSPA 3G8EA 3NQ6A 4EPBC 2NV2A 2ZFAA 4N9DA 3UESA 4O0ZA 1PSCA 2Q8XA 4RXFA 1O60A 3NYZA 3QY7A 4M56A 4Y90A 5A95A 5D2YA 4DXXA 3UCCA 1WO2A 4FXRA 1VPQA 6REQA 3QC3A 4NZ5A 5LGXA 3U2ZA 4MOZA 3VCRA 1GOOA 1Q2SA 3GNXA 1CLKA 2BSLA 4JTIA 3R8HA 2YYUA 2W27A 3FA5A 3NSNA 4NZ4A 5C9WA 4DJDD 2XSXA 2PDLA 2WXDM 4NI8A 4O11A 1XRTA 3LV5A 3W6YA 5FEXA 2BHUA 5CPTA 3TFCA 4J9JA 2GVLA 1K8YA 3MWCA 4OOUA 3RGTA 1JDEA 1ZFJA 2IKJA 4X3ZA 3GWQA 3IUHA 4B4FA 1IEVA 1F07A 3C8FA 1D7KA 1R3RA 4Y96A 1QOPA 4IG2B 1I75A 3RYSA 5IM51 4K39A 5AVNA 1DBTA 2ZICA 4MUPA 5A6MA 1DVJA 2AQWA 1O4UA 3ME3A 4H9UA 1DHKA 3AISA 1KM0A 3AIWA 4XIAA 4BEUA 1QPNA 3DX5A 4YU1A 4JNZA 1SJBA 1E0XA 3GH4A 1H51A 3SECA 1BYAA 4YMZA 2OYMA 1WUEA 1R87A 3M46A 3ZSSA 1GJUA 2PWEA 3UJEA 1V4YA 3LCFA 3WK3A 4NAEB 2CXGA 3CZKA 4PODA 1UCWA 2GVEA 4DY1A 1GOWA 2BP1A 1GVEA 2NX1A 2REQA 4MFEA 5DMMA 2JFEX 3P81A 4HCLA 3N1AA 2BVDA 2W4XA 3NQDA 5MHBA 5U7SA 1MYRA 4IMAA 1TWSA 5G1YA 3G0SA 2WW5A 3LMZA 2OO0A 1PXGA 4P8XA 3LPFA 4KFNA 5I06A 5E0FA 3W7PA 2CBUA 1S39A 3ANVA 3OLDA 4O12A 4H9XA 4KPLA 2ZWZA 3GVRA 1P0NA 5REQB 1MNSA 1BG9A 1OT1A 3SY8A 3AYSA 5GNZA 3CMJA 1EIXA 2CEQA 4FX6M 3WDHA 4JIPA 3ZSTA 3CYVA 3HPAA 1X1NA 1LBMA 3OLIA 1G4TA 4IOTA 3TYZA 1EBHA 2WK2A 1SSGA 1T40A 2DIEA 3G22A 3EOOA 4H01A 3WUGA 4EE9A 2E7FA 2CESA 3B8VA 4EACA 2FHFA 3N4FA 3NQ7A 3MMWA 2UZ9A 3L5MA 1E6XM 4H6KA 2PU0A 3GC5A 4LC8A 3GE7A 2QT3A 4MKNA 2FHBA 3HQOA 1XSIA 3KE0A 3UWUA 1MFUA 3VM5A 5A5WA 3LCIA 2E9LA 1PWMA 3HG3A 3APTA 3RU8X 2I1OA 1L9WA 1X7IA 4PUKA 1OX6A 3ZJ7A 1S2TA 3HOJA 2VX4A 4Y9MA 2XIMA 4QLKA 5FI8A 1A5BA 3UPBA 1W1IE 4DF1A 3BAYA 2AMXA 1OX4B 1CZ1A 2OEKA 5CC6A 1LTDA 3A5FA 1UWSA 5L6UA 3V1HA 3KWSA 3VIKA 5GNYA 4TXEA 2OWCA 3E74A 3ZO9A 4INFA 4KESA 1U1JA 3MCOA 4WSKA 3DFQA 2OO6A 4S3KA 3TXZA 1I2NA 3OZPA 1TUXA 1CXHA 4JIRA 4PTWA 4HN4A 3O07A 3HTWA 2OTDA 2HSAA 5CPMA 2Z1VA 3AHTA 4XAPA 2Q01A 1G67A 3VOGA 3DGBA 2R91A 2PP1A 3FYPA 4DLMA 4TU1A 4ES4A 4BKNA 4J3TA 1JI1A 1XLGA 4A21A 1ADOA 2ZYFA 3EMZA 3L4VA 4Y7EA 2R1MA 2GVGA 1VIZA 1OY0A 4MIMA 4M3PA 1KV5A 2Y61A 1AD4A 3OG2A 4UTUA 2BASA 4DWSA 1FDJA 5DF0A 3S83A 2R82A 4BK9A 1ONWA 2ZA3A 3RR1A 1EX1A 4LCQA 3NEVA 2G3JA 1UB3A 3NTYA 1DIDA 2FZBA 3IGXA 1E0VA 4WUIA 1XUUA 4P8WA 4A05A 3VINA 2HS8A 1IXOA 3OZOA 4I9AA 1VFFA 1HKJA 2BBFA 4TVDA 2BY2A 1QDSA 3RO6A 3P80A 3CAKA 5EMJA 1P7TB 1FHUA 4MPKA 4GUIA 4QIUA 3DFPA 1TR9A 2ZRUA 4L6OA 4B4HA 5I79A 3T4CA 4M8UA 2G41A 3G1DA 1VS1A 4A4AA 3MO4A 4DJEC 3EB2A 4OGZA 3QH2A 3TE9A 2EKCA 3BSMA 3UFYA 2EGZA 2I17A 6XIMA 4Q8NA 4JIIX 3UZXA 2BOGX 5K7JA 4UR9A 5FAGA 1EJSC 4MF4A 4E0CA 5T9CE 1N8IA 3RITA 2C18A 3W7LA 5D05A 2X7VA 5F1UA 2E25A 5IBXA 3QSTA 3SIZA 3NQGA 1F76A 5LXXA 3R43A 3EDJA 3A6OA 3YPIA 3MSYA 3L66A 1R3WA 1YTEA 2NUXA 4Y9OA 3MUIA 1IIGA 1VFSA 2E4TA 4WD0A 1OD0A 1XYAA 3E5PA 2ZA1A 3MCNA 2JEQA 1XSKA 1FWWA 3CQ0A 4YTTA 5B7YA 1R3YA 4ATDA 4C6BA 3GG0A 3BAJA 4DRSA 3EKGA 4MHBA 4AHQA 4RW5A 3OIXA 2PF8A 2PLJA 2D23A 3WSUA 2JE8A 3PULA 4LCSA 1CXIA 4JL1A 4PEEA 1Z8AA 4ORIA 3DUGA 3I7QA 1NDYA 3ABSA 4QEEA 4GQGA 1UWAA 3EYPA 3VTRA 3FS2A 1W3JA 3KL0A 3NPXA 4AD5A 2Z6IA 3AZRA 1TV5A 3IJQA 1GOXA 2A3BA 2VUNA 2HVNA 3T7VA 3OBEA 4QQUA 3BG9A 4V2XA 5GJPA 4JZ5A 5D38A 3SJ3A 4P7QA 6CGTA 4TR9A 2YXGA 3CUIA 4GUHA 9CGTA 1RV8A 2E3ZA 4YLWA 4DZAA 4U10A 4QNEA 3O0FA 1D2KA 4KFPA 4QCFA 1XL9A 2DQXA 4KT2A 1XIJA 2DZSA 3CT2A 1JZ7A 3PZTA 4HU0A 1DXIA 1H7PA 4ZZ9A 4KGJA 2J8FA 3CZLA 1Y65A 3CPGA 2WMKA 3KOXA 4DHGA 1JCYA 4FNTA 4OE7A 2FFCA 4MZYA 3P3BA 2XSAA 5CAHA 3HQ1A 2C1GA 2C91A 4IMGA 2W5FA 2OPJA 3PB0A 2A3CA 2G0WA 1BKHA 5IFTA 1IEIA 2OLSA 1C3FA 1W3NA 3M7SA 3S5SA 5D30A 4O0QA 1A0CA 1ONRA 5K2ZA 2X7WA 1YQ2A 2VRJA 2NW0A 4EPEC 3G3DA 2DT3A 1L0PA 2WCAA 5D2XA 3O2LA 4L4PA 1ECQA 2DP3A 5I6SA 4XTDA 3WLNA 3R94A 4E38A 3F4NA 3HFYA 1EXBA 1JL8A 4PUUA 3NSXA 1R3TA 1CXKA 4JTAA 1BWKA 1VFOA 2YBUA 1HW6A 2DSZA 2V67A 3Q94A 3MCMA 1JPDX 3QTGA 1S2UA 2ZX5A 1KBLA 1X1ZA 3M47A 1OK4A 3VGDA 2A5HA 1JAEA 1M7PA 3WLPA 4LU0A 1JXJA 3I6TA 3ONBA 4EAYA 4HPXA 1OC7A 2C1HA 2EHHA 4DEFA 3BL3A 4G8TA 4PMVA 3BJTA 1A5UA 1E1EA 4EPKA 1FKWA 4U2ZA 1ZENA 4LVBA 3M5ZA 2DT2A 1FCBA 3UR8A 3W75A 4KQNA 1KFLA 4RV3A 3S2LA 3U5UA 3W1PA 2PDWA 3GNDA 3KRBA 1LUCA 1HJXA 5GJMA 3MU7A 1VJIA 2FZNA 3G1FA 1SO3A 4XZWA 1QAPA 1PZ0A 3G8RA 1PL9A 3WX7A 2WSKA 5AC4A 4ONVA 3EX6A 2QAFA 4AZCB 4ICMA 4F48A 4D6FA 2XWDA 3GIPA 3W71A 3CIXA 4FNUA 1VCVA 3STCA 5ABHA 4I5XA 2WHJA 4ZGYA 1U2YA 3NQBA 1CWYA 2E77A 4OU1A 5BCAA 3PVFA 1WKYA 1SFTA 3R8RA 1TJ0A 4BF5A 3MKVA 3WDPP 4LPCA 4YIWA 4J35A 1Q6GA 1AW5A 4BWLA 4D2JA 1MEHA 3VD5A 3UWEA 1MXDA 3GXDA 1JCNA 5EMLA 1S2AA 3AU2A 3BJFA 1EDTA 1A5SA 5T9BG 3THUA 4HSNA 1JZ3A 3CAWA 1Y5VA 3EWUA 4NILA 2D73A 3H7RA 1XWYA 1LT8A 2QUNA 1R46A 1V6VA 5LGZA 1GVSA 4K37A 2YFOA 3PNUA 3HJEA 4RLIA 1HP5A 3IIXA 1MEWA 4C6IA 2WHMA 2F7FA 1LQ0A 2O9RA 2E6YA 3LZ3A 1YNQA 4ZOBA 1P5BA 1UW9A 4Y6GA 4LUJA 1NWSA 4BQ3A 3L0GA 4DO6A 3FA3A 3TQPA 1J0JA 1EP1A 2WM1A 2DZPA 4RUBA 3VOIA 1N55A 3VD9A 2FZDA 5A6KA 1F5ZA 3VNMA 1HO1A 3AIUA 4HN8A 4N02A 5E6YA 4RXGA 5J8LA 2I5GA 3LSCA 2Y5JA 1XG3A 3HA1A 2OVLA 5TD4A 4C1NA 3FJ4A 4LUIA 1GYMA 1P0DA 1OG0A 1UKOA 5JH1A 4GQ0A 3TIMA 1W2VA 3LS9A 1JR1A 4LAMA 3VC5A 2V30A 2VEIA 4Y9NA 4BHYA 3CO4A 5JBFA 4ECLA 3UWYA 4GXPA 4HNUA 3CIWA 1UWIA 2B7QA 4IX2A 2F6UA 3KVKA 4TVCA 2J27A 4B9YA 1ESWA 2J6VA 4QG9A 5LA1A 1VIWA 3M7WA 1XBZA 1XGEA 3W1QA 3LGDA 1O94A 1XLIA 1W5OA 1RD5A 3DFOA 3W2NA 5FSEC 1WE5A 4NP7A 1BFNA 4GNKB 4Q4SA 2QZRA 5DBUA 4WRHA 3UGVA 3WG6A 1W56A 3BLEA 3U2CA 1L8PA 3KCOA 3BE7A 3QHOA 4Q22A 3B4UA 4M7TA 5AYBA 2PAJA 3BSGA 1CDGA 3AS0A 3HPFA 4TOQA 3KP1A 1H7WA 4LUTB 2DVXA 1R2TA 4D6HA 4MSSA 4MZ1A 2BOEX 1LZOA 4GMEA 1E0UA 3GTXA 5I3KA 3MP3A 1GQIA 4JTQA 5EBAA 2ABBA 4B3ZA 3AZTA 3H21A 2C71A 3H2EA 4D6DA 4L9ZA 5HWMA 4ZXLA 3KRZA 3GIQA 3UERA 1W31A 3ITGA 2NLIA 4MWAC 4K1GA 1SR0A 4FIQA 1DJIA 3QV9A 1V7AA 2CHOA 4K3ZA 4ZENA 1JDCA 4FMVA 2FQIA 1ZAJA 3E49A 5A8QA 4DNMA 4NNCA 2XJ7A 1WYIA 1VJZA 4QLJA 1KFWA 1A3WA 1H62A 4NU7A 2QCNA 2CLMA 1E9IA 1RY0A 5I0DA 1UASA 4PTDA 1KBJA 3N2TA 1F3TA 4XWUA 3ICJA 2G3FA 3VGHA 3AS3A 3FSUA 4M6PA 3AS1A 3SGUA 4HCHA 5AC5A 5C55A 1UUMA 1XLMA 1ZTVA 4JXCA 2YXXA 4WDUA 5D8WA 5HBFA 1XIHA 3EDEA 4XV0A 2VZSA 4GA8A 4KGLA 3PG8A 3PUGA 1YADA 2YB1A 1VRDA 4Z0SA 7CGTA 4JR5A 4MNLA 2XU2A 3EAUA 3MSRA 1C91A 1C8YA 2J9XA 4QNWA 4D9PA 2V63A 5G2IA 1Q4NX 5A8PA 5M5DA 2F84A 1NDWA 1H0GA 1PIIA 2PRLA 1UWRA 5AKQA 3UVIA 1BYBA 2OMAA 4AX6A 3CL8A 4FF7A 3EWBX 1VCFA 5LIWX 1HF6A 4YHEA 3TA6A 1FWRA 2YR1A 2UBPC 4Q8QA 5HR6A 2QYGA 3GW3A 3CH9A 1P0EA 1TB3A 3K5XA 3SRFA 1DWJM 3H22A 1TJ1A 3LQGA 4AYGA 5A1AA 4HYVA 3MSDA 2DGAA 4O14A 5DRCA 2BODX 4JTCA 1AG1O 1GNXA 3VDGA 1SW3A 4WGHA 3N04A 3SIMA 4JIEA 2O4QA 4FI4A 4JDBA 4Q6XA 4XZHA 3PBMA 1UHVA 3EOUA 1NP2A 1BQCA 3C5QA 5HMFA 2MNRA 1S2CA 4Z42C 1RCOB 1SZRA 2FPVA 1O6IA 2YPIA 3VIHA 3QBUA 1OFDA 4UMCA 4L9YA 4S3FA 1I6NA 4UFKA 2GVYA 4LY8A 3MMTA 3G3MA 3VDBA 4OIFA 3NPWA 1JG9A 2Q71A 7ODCA 3GKAA 4RZ5A 4XQ6A 4PUNA 1J2BA 1AW2A 4ZO7A 4QDWA 3VIFA 3WN6A 4Q7NA 4PRTA 2VZUA 2CKSA 1QNQA 2Z0IA 3EDKA 4BR1A 4K1WA 4PC8A 2QJNA 5D33A 1QOQA 4S3JA 3VGGA 4DAIA 4B5WA 2QUVA 2ZC1A 5AY7A 2YDRA 2CLIA 3QRHA 3UJSA 4C6LA 4O53A 1WKEA 2R14A 2XPKA 1M68A 2DY3A 2IKGA 4ENLA 2QPSA 1SMAA 3SUUA 3O06A 4WK9A 4JTSA 4UFLA 3TUUA 2JIWA 4HU4A 2BZNA 5C7HA 3RO8A 3TYAA 5DLCA 3FGCA 4FOKA 4XKYA 2Q8LA 5JVLA 4A3QA 3HGOA 1BSLA 9RUBA 1BF6A 2G5WA 2Z29A 1VFMA 3V75A 3UR2A 4LRSA 3QGVA 2ZUMA 3UJ2A 1XISA 4C65A 1N7KA 4NL1A 3PZOA 3HMJG 2ZE0A 3WLSA 1DWFM 5IDZA 4C6PA 2QUUA 4TMCA 2EPHA 3QHNA 4XAGA 3A5VA 2A3AA 2AKZA 3I4EA 1X96A 1GJWA 3VA8A 1H1NA 4HBKA 4PUEA 4QS5A 1J0YA 2VCAA 3L4ZA 4JHOA 3HZ3A 2P0OA 1SJAA 1PB0A 1ITCA 2ZUSA 3PZIA 1QR7A 2NSXA 4XK2A 4E4UA 2Y5SA 3VD3A 4Z1DA 2J8GA 4F2BA 4S38A 1TVLA 2QJHA 4F4RA 1CLXA 4AF0A 3EWXA 4IHCA 5HJXA 4GY1A 2CFFA 5D8ZA 2VENA 2EG7A 3CQJA 4QJ5B 1B3WA 1I0BA 4CU6A 2PDCA 2HXUA 2PWHA 3A22A 4AXNA 3OW1A 4PUWA 3PBWA 3LHZA 2OYKA 1TFVA 3HN3A 2BGNE 1ODZA 3C0QA 1YBQB 1RALA 4O4VA 1OFRA 2PLKA 3CYJA 4GIYA 1TZ7A 5DBTA 2PDQA 1DQWA 2DVTA 4WXYA 4IZGA 1F3WA 3ID7A 4PB5A 1WP6A 2VC6A 4GUGA 1Q2RA 1OCJA 4L1GA 4Q3MA 4A35A 5HPCA 4M6UA 4US5D 2BG5A 4J3XA 3AXXA 1BWLA 4J3WA 4N6FA 4GBDA 4WJEA 2PWFA 1P1MA 4MDPA 1QK0A 3GZAA 3UYCA 2GOKA 5CC7A 4HMCA 1WAWA 2ISWA 4NJHA 3GC2A 2DDXA 5AOUA 4JNYA 1W6TA 4E8GA 1S2WA 5AVHA 5JIPA 3P74A 2Z1XA 2Z2AA 4H8HA 1KBBA 1F6PA 3S1GA 3QR3A 2VURA 1KM1A 2ATMA 1SO6A 3G1XA 4GQRA 4AWUA 1XCFA 4LX4A 1DJHA 1BYDA 1EYEA 1WDQA 3GG1A 1IT8A 2PCQA 5IOBA 1VENA 2XDFA 5K4XA 1NQ6A 2E68A 3B3DA 3GU1A 2NUWA 2VDGA 1PTDA 4FNRA 1I1XA 3P6LA 2V3DA 5K3VA 4GI8A 1DWIM 2J7EA 2WMJA 4S3CA 1UOKA 3VX1A 1UWTA 1TWZA 3GIYA 4I9JA 2C13A 5FF2A 4AHPA 1JI2A 1W9PA 3CO8A 3OYZA 4AC7C 3N4EA 3TZFA 2W6RA 2BXZA 3KZPA 3SZ8A 1UUQA 3C2RA 1E73M 2OX1A 2YCEA 3DH7A 4PYSA 4A8RA 3SEPA 4DWDA 4W5ZA 1V3MA 5C71A 1J8VA 1E1FA 3P8IA 4A2RA 4JKKA 5XINA 3UT0A 8CGTA 1E4LA 2Z4GA 4PTMA 3VDHA 2WNZA 2H9AA 2SFPA 4EXBA 3WQ6A 1NF0A 1BGAA 1TPC1 5C2CA 3WLIA 4WDXA 1MQPA 1KXTA 4WIWA 5CBIA 4GFIA 1H2JA 3DKLA 1Z9AA 3QGAC 3VCNA 3HO8A 3W1AA 3UJRA 4XBJA 1YXCA 3KTCA 3T0DA 1GQJA 1Q6DA 5ABEA 1JRBA 3PZVA 1F8IA 3W7RA 3FAXA 4MZ8A 2Q02A 4JTHA 3E02A 3WK0A 1UD8A 3WEMA 3NDOA 4B2DA 5LHEA 1NJJA 2NXIA 3XIMA 3N73A 4LC6A 5I77A 1C93A 3GNNA 1T8XA 4CN1A 4IQEA 1GK8A 6PTDA 1KO0A 4LVDA 3VZXA 1JDDA 1QRQA 4GQQA 2E67A 1V77A 1FOBA 4DN1A 3QQ0A 3CH0A 2VOMA 4LEFA 2QV4A 1BGGA 1YPFA 4LF1A 3BXWA 5AHIA 4HPNA 2WPGA 4J2PA 1F6KA 1GW9A 3GDTA 4LALA 1OC6A 3ANUA 5A2AA 4B2DD 2YB4A 1XLFA 1DJZA 3AU6A 2PDMA 4CCEA 4DI9A 4QAWA 5HR7A 4TTUA 1VYRA 3WLRA 3CXOA 4MJZA 4QDPA 2EO7A 2VRQA 2PZNA 1SZGA 2NQ9A 5GVJA 1ZP3A 3IRSA 1CB7B 3NQFA 2V3GA 4W8AA 3DZ1A 3W7OA 4UTFA 1CGVA 2OGJA 2WV8A 1SJCA 3TJIA 1K1DA 4Z08A 3C2OA 3QN3A 2P88A 4K7YA 1NOWA 4I5RA 4HOZA 3WCZA 5XIAA 3PZGA 3FA4A 1E6QM 3E3HA 2XIQA 2EQDA 2QCGA 3WMLA 2A3EA 4HZ8A 3OHIA 3WK2A 2PTZA 5CKSA 1JJKA 4N9EA 4NAEA 3C52A 1Y0EA 3F5JA 5KMYA 3SFWA 1EWDA 3ELFA 3H2OA 3NA8A 4LW7A 2NT1A 3R12A 4YS1A 3R0DA 1ISYA 1UUOA 4CVWA 4HU8A 1P6BA 4D1JA 2XM2A 2O55A 3CWOX 5C54A 4NI3A 4H3DA 3M43A 4M1BA 4P61A 2NQHA 5JXQA 1JYVA 2ZZ1A 4PCTA 3WK1A 2I7GA 2FH8A 1K4GA 3M16A 3QV7A 2BXVA 3AIEA 3P0WA 2H3DA 2OKTA 2GK1A 1NELA 1EPVA 1H7RA 1XCWA 4HTBA 4KWOA 1PPIA 4HIBA 3R6IA 1XYMA 4V33A 3EWCA 1CTNA 4H2HA 2XH0A 4E4PA 1LBFA 1WXZA 1YKWA 2RDWA 1X6UA 3MUCA 3VUPA 4OV4A 3NL5A 5DCBA 3GB6A 3PTQA 2ZRZA 4CNTA 3PK7A 4F0MA 3S1VA 1K9FA 2IPFA 5I3HA 1ZZMA 1TYGA 1EEXA 1WBHA 3SGGA 3RM4A 4DWSC 3OLEA 3CJPA 2WNQA 4ZSTA 1AODA 2Y89A 1Q7ZA 3S2MA 2AL1A 4Q8TA 3DIPA 1OM0A 3LGGA 4EIVA 3N19B 3SQSA 3T0AA 4HOWA 3CHVA 4M29A 4NVTA 1MQRA 1G4SA 1R9ZA 1TA3A 4HNTA 2VX7A 3M0IA 1JULA 4PCFA 1CGXA 1OZQA 3CEPA 3SCSA 1NVMA 1DTNA 1E3ZA 1I45A 2VR5A 3I68A 1NP0A 3GYEA 2O56A 2QJMA 3B04A 5KTLA 4AZ7A 1HL2A 4NHVA 2JF7A 3VKBA 4I6VA 2GJNA 2YCKX 2XGZA 3AXMA 1W32A 4E3VA 1YTDA 1VHCA 4GZEA 3R0UA 1B3ZA 3HPZA 1FWNA 1K3UA 3TU9A 3DYOA 5CSUA 4N0RA 1ELSA 2QF7A 5KSWA 3TAKA 1XBYA 3PS7A 4LV9A 3I65A 1FXQA 2E9MA 4C6KA 4FNPA 3P2VA 2ZCGA 3FDGA 5DMNA 3KUMA 1EC7A 1JNEA 2YGYA 4P8VA 4UNIA 1N8WA 1QNRA 1IHIA 3T8QA 1I8JA 4EAMA 5IBXC 1FA2A 3DAQA 1HX0A 5HOSA 1RJQA 2WKLA 3L2MA 5I3IA 3HG2A 1IV8A 3TYBA 3T0CA 4XKMA 1JD9A 2ZRVA 1IGSA 1GVRA 5FKYA 5E5CA 3BO9A 3WNLA 3M5XA 4FNQA 4AD2A 1W91A 4O57A 3L2IA 2BVTA 1TCMA 4Z2JA 3W2MA 4WOZA 1UC4A 1DJWA 2GUUA 3TV8A 4PMXA 1A5MC 1SFLA 1MVYA 3LHYA 3BLLA 1DWAM 1I2PA 3UZYA 4QHRA 4H6RA 1KR1A 4CVUA 2ZRWA 2DUXA 1VLWA 1LQ2A 1TVNA 2H8ZA 2XYLA 1ICQA 2HNHA 1H5VA 1E1CA 2P3EA 4UZUA 4HMNA 3FXGA 4S3EA 1ZAIA 3EA2A 1MUWA 2VKZG 2FTPA 2R8WA 2AMGA 1BVZA 1QFEA 3G0XA 3QV8A 5F4SA 3LRKA 4JS3A 3LXCA 3RXZA 3PTMA 1CIUA 4PZVA 1W2PA 1AA1B 7TAAA 3M0LA 2AL2B 2J47A 3UXDA 3BAWA 4KS0A 2QQ6A 2EPMX 3DXIA 1XRSA 2OOGA 1GPFA 2OQYA 3GZ3A 4IGMA 1F8MA 4Z1AA 1ISZA 4WCJA 3KS6A 5BOEA 3B0UX 4H8UA 2C1IA 5AZ0A 2A3LA 3UETA 5F7UA 1DIEA 1DIKA 2PPGA 1XLAA 5AECA 2INEA 3QLLA 1PDZA 2VTFA 3PTKA 3TQVA 3LPOA 3S9IA 1IR2A 3XISA 2WZIA 2PDKA 3NGJA 4AFYA 4J4KA 4XD4A 3C6CA 3VZYA 2CZ5A 2O9OA 1SR9A 2OZ3A 2UV8G 4A3HA 3KLKA 1IXPA 3F03K 2G3IA 4ADSA 4ORMA 4GIAA 1JRCA 3ZVIA 4ILSA 1I1WA 1XIIA 3AIVA 1UA7A 2TPSA 4MM1A 3DYMA 5ECVA 1OZMA 4JIHA 2QVHA 2RJGA 3RPTA 2Y8VA 2E1WA 1Q4WA 3NQCA 1ITUA 2P1FA 1GORA 4LWWA 3FDKA 2DJLA 4MTVA 1ISVA 3BMWA 2ON3A 1OFAA 2V2CA 3DI0A 3WQEA 5KZMA 3H4XA 4ROPA 3UG8A 2HMCA 1TMHA 1UZ1A 5BW6A 1BXCA 2J7HA 3L4UA 3NIYA 4HT3A 3OZMA 1UD4A 2QPUA 4NNAA 3QR0A 1WDSA 1ZBWA 2BVWA 2WVVA 4RNJA 3ZR5A 3URQA 2ZC8A 4UNLA 3W37A 2IPWA 2RUSA 4UTHA 1REQB 3H4WA 2RHGA 2EPNA 3VDAA 5I3FA 2XIIA 5A8GA 1O5XA 4PUDA 4G7EA 4R53A 4J1OA 5BMXA 2OEMA 5HDRA 2Y0FA 1UR1A 1US2A 1PO9A 1UJQA 1OWQA 1EKOA 4ZTYA 5AN7A 1ISWA 4JTEA 1QJWA 1FHLA 2CPUA 4LBRA 4FLQA 3AMCA 2BTMA 2Z1BA 2XGBA 2NWSA 7A3HA 3LQLA 3FHQA 2GDUA 2IQ0A 2IPJA 5H6HA 2YBVA 2ZXDA 3WD3A 2YCLA 3LTPA 3AYVA 3DFNA 4L7ZA 1GQKA 3EDFA 4BWLC 1RXOB 5EL1A 1IGWA 4LV4A 3UWWA 1XP3A 3KHDA 5CLTA 2R1NA 2EBNA 3BK0A 3CEUA 2NQZA 3EA3A 4PCNA 1XFCA 3KTXA 4ZEPA 4NAFA 3O0KA 3MO7A 3GU2A 3PFMA 1K02A 1J18A 1X8CA 6ENLA 2IQTA 4AZ5A 4JFVA 3S2JA 1M01A 1FH7A 1NH6A 3EX4A 3H26A 4G1KA 1LRQA 2PDGA 2YZ5A 4BQ5A 4HNCA 2PWDA 5TIMA 1TPVA 4C6NA 4JYEA 3E0FA 1TKKA 3WELA 4TQTA 2OOFA 3FVDA 3ZM8A 4BF9A 1XSJA 4XO6A 1R3SA 2VQUA 2VC7A 1E9YB 4HHMA 3B8TA 4NRSA 3SCRA 2FB3A 1XQLA 1M7JA 3S0CA 1FWIC 1OGSA 4H7VA 1VKFA 3ZLHA 1H7XA 3LCXA 4IWWA 3NEHA 3KBJA 4RE0A 1QPQA 1HJUA 4AMAA 2QUTA 1OX5A 3RN6A 1SSDA 1LROA 3VVGA 5F2GA 1OQFA 1KQZA 1BF2A 4R9XA 2D2OA 2CERA 5HJLA 1JPHA 3TC3A 2CWXA 3W1MA 1IZKA 3B9DA 4GKTA 3A64A 1AFSA 5C7VA 4WDWA 1M41A 3ZLFA 1TWIA 3ECQA 1FDYA 4ZO8A 3WD2A 1OK6A 4ERAA 3W7CA 2E28A 2BHZA 3WJWA 1UD3A 2GDVA 3O6AA 2PLMA 3V1PA 4IFKA 5C9RA 4PFMA 4R7OA 1D3CA 3O8AA 4X9SA 1FP8A 2PA6A 4JN8A 3K30A 3CV6A 5HWNA 3EMCA 2GUYA 4CD8A 5F1VA 4QX4A 3K8LA 3NYDA 4RZ4A 1PKNA 3C56A 3GRIA 1TE6A 4NQ1A 4E2BA 4E8DA 2C79A 4MWAB 3NQMA 3W85A 1R0MA 2BB0A 2VWSA 3SM0A 3TN3A 1UD6A 4L65A 4FR1A 5HK4A 2OT0A 3MUAA 4OBRA 1GWJA 3NURA 5FF3A 1NWUA 2D20A 2PDUA 5XIMA 3DFYA 2PDPA 3EEGA 5KETA 5I24A 3S8HA 4A8IA 1W9XA 3W2JA 2VC9A 5I3DA 3NZQA 1QPRA 4OUEA 5M3WA 1CBGA 5LNWA 3QKEA 1KXHA 2ZVRA 4X63A 1XI3A 2X30A 4CD5A 4B3LA 1BQGA 3IIPA 2DZUA 1EQCA 3PPHA 1UZDA 3BCJA 2R1PA 2VI0A 1RK5A 1ZL1A 4Z2KA 1LWIA 4QG8A 2AAAA 3UR7A 2KZHA 3VIJA 1W8GA 2VHLA 3T1GA 2PBOA 1UA3A 4WX2A 3SADA 2C15A 1AQMA 2DVUA 5D9NA 3W28A 2ZDRA 4IP7A 4WKHA 1QI0A 2FJKA 4AY1A 4W7UA 4UIOA 3CLWA 1JFXA 1ZGDA 4US6A 1F3XA 1RJPA 2GQ8A 1AZ1A 3UWZA 6A3HA 1XUZA 4AG0A 2VGIA 3SCUA 3MA8A 4UFMA 1FBAA 4TMBA 2FH6A 2YJQA 3WENA 3IV8A 2RFGA 1G94A 4Q6JA 2DPEA 4E6MA 1B3OA 4JQ1A 4MLJA 5CZJA 1RUSA 3TK7A 5CJ5A 4I9MA 2NQJA 1S5WA 3DU0A 3W2LA 4BA0A 3GTNA 1V51A 1QXLA 1RHCA 1FHVA 5I2UA 1GZ1A 4KKXA 5JMUA 3WQ4A 4KCVA 1JZ4A 2DEPA 2XH7A 1B30A 2HK0A 1JPMA 1EBGA 4XB3A 7ENLA 4AXKA 4NSBA 1J96A 3OIHA 4JFUA 2PD9A 4RL3A 2KAUC 1TREA 1CXLA 2FVKA 3GFXA 1PTGA 3IIZA 4IMDA 3S9ZA 3LZ5A 3REQA 3E0LA 4J5NA 1WZAA 3ABOA 3POCA 1AZ2A 1OT2A 2YDSA 3B06A 3D5HA 1MI3A 3T55A 4LB4A 5C2GA 3VIOA 5I09A 1MNZA 4UOJA 1XBXA 5F2MA 1EGZA 3W27A 4QE5A 3RNDA 1ECEA 2TSYA 3GXIA 1DJNA 3IANA 4OT7A 1W9DM 3GHRA 4UUIA 1S1RA 1ZBKA 5MKGA 1HJWA 1TQXA 3WJYA 2WWCA 1R5YA 2XIJA 3V5CA 5A6TC 1XIGA 4ICCX 1L8NA 3VE7A 1YDOA 3EBVA 3UBPC 2POZA 3MT1A 2O92A 4GBUA 3QY6A 3WF3A 2ZX9A 3DOPA 4UOQA 3B8WA 2FIQA 5H8UA 1OINA 3U7VA 2OSXA 3M1ZA 3LK6A 4PRWA 3WL1A 3FSTA 2QEZA 2FDSA 5DANA 4DO7A 3GAYA 4V15A 2NUYA 4HNVA 3WBAA 4AWSA 4O19A 1V02A 4H83A 5HMDA 4LYPA 2VYOA 2ESCA 5BOOA 1M7OA 4PE8A 2OKOA 4S3GA 4L9XA 4DQWA 3T08A 5LKYA 3W7MA 4YYCA 2E1DA 1XX1A 2W62A 2UWFA 3CAVA 3GU9A 3BPWA 1FWTA 1JCMP 1J11A 4MY1A 2FGLA 2YA2A 3CHFA 5G1TA 2FDMA 4XZNX 4WR3A 3LERA 2F9RA 4PTNA 4GXWA 3HV9A 4A2SA 1ADSA 3STEA 4GVHA 4S3BA 3V36A 3BLKA 2WSPA 1CGUA 5HA7A 4HNLA 3USZA 3OP2A 2GPTA 5DMLA 5BXRA 4YN5A 4GI4A 3BW3A 3N34A 2WJZA 1MZHA 2I56A 5H2ZA 4UB9A 5DFAA 5CG7A 4GC3A 3W3OA 3WLLA 1LOSA 5CZTA 1DQXA 1SYTA 2DORA 1WKDA 2Y4SA 1X97A 4HA0A 4XIMA 1WQ5A 1KTBA 3GHUA 3WH7A 3GXFA 4DBDA 3C0SA 2JALA 3FIGA 3RX3A 3GS6A 1KGXA 3GVGA 2RDUA 2WAGA 1UR9A 2XISA 3SDOA 1OGGA 1KTCA 1E15A 1FKXA 1TTQA 5HQMA 1PV8A 3T09A 1UP3A 2EJ1A 4ASTA 2DSWA 4W5UA 3U48A 2BV9A 4HA4A 3UYIA 3HM7A 3W73A 4JTGA 4P7RA 4LH8A 3PSWA 5BRQA 3N9SA 3WQVA 6TIMA 2FJUB 1C9WA 3WD1A 2Y7DA 3QMTA 1MO0A 3QEZA 3WDIA 1H5YA 4A3UA 4C6JA 2QF8A 1LG1A 2OWWA 1OEPA 5BZAA 4KERA 1VFHA 3CTLA 1J5TA 3U5YA 1LJYA 3WBWA 3GKFA 3KHJA 3QYSA 4IIGA 1V03A 1FWHC 3CQIA 3LUTA 2QDDA 2Y7GA 3STGA 3T4WA 1H11A 2NXGA 3FKKA 5U4NA 3MMDA 2ZZ2A 2ZQ0A 3DC8A 7PTDA 3N2MA 1JPKA 1MRAA 3AIBA 3DBNA 5EMUA 1WCGA 4LRTA 6REQB 2PF0A 3I3DA 4M5PA 1NIUA 3QYQA 3NG3A 3O05A 3MANA 1NEYA 2ALDA 4NX5A 3DG3A 2EKGA 2RJHA 1ZAHA 4N9BA 1XLLA 2XN1A 4YVPA 2QJGA 3GXTA 3GW0A 3T2PA 3ZT6A 1KC7A 1VH7A 5CPOA 3VIPA 1KWKA 3W01A 3MC5A 1ME8A 3WFLA 4POCA 2EJAA 3RCYA 1HXJA 1UQYA 4C6DA 1JXKA 4K6AA 1YBQA 1CXEA 4FLSA 1VQTA 2VQTA 4DM2A 2P8CA 4C6EA 1PTAA 1E56A 3BGAA 3LDVA 1EEPA 3BARA 3OTRA 3FV9A 1JIBA 2YBTA 3SJNA 5F2IA 2INZA 5LIYX 5E1QA 3P7YA 4BS0A 3MHUA 3S42A 3VMPA 3BLDA 3UVAA 3VIMA 2Y5EA 1EA9C 3W1RA 2Y7EA 3RU6A 1MEIA 2R1KA 4DF2A 4UTWA 4OECA 1V3KA 4I8YA 4G9PA 4JBRA 4GVFA 4QTGA 3H2MA 1KGUA 1R8LA 1QNVA 2HS6A 2C3ZA 1TV2A 4PH6A 1WDRA 2PTDA 1EC8A 2A7RA 4XAFA 3SRDA 3IEBA 4KEMA 1QO2A 3M07A 1ZLPA 2P5NA 1VFUA 1QNSA 3EWDA 1QPKA 3EWYA 3SCTA 2TAAA 4O16A 4EP8C 4HK5A 1VP5A 5CXPA 1EHAA 3HPXA 1XLKA 1KCZA 2REQB 5HXMA 2FTYA 2DSUA 3OJGA 2X0YA 4HVXA 1IWPA 2F61A 2HNEA 3W74A 1V3HA 5DEZA 3UCDA 3DN5A 3H4GA 1F9CA 3SUSA 1YHTA 1E6SM 1F74A 5DMYA 3WL0A 1Z69A 3IRDA 1KB3A 3N13A 2HROA 2G3NA 3UZ5A 1XD1A 2E9BA 2PODA 4IP5A 3V7PA 3WYZA 3ZQ9A 3FAWA 2FZ9A 3I10A 2VO5A 1NAL1 3TP4A 3VO0A 1S5MA 3FY1A 4IMCA 3L4YA 2NT0A 3TOYA 4JEJA 1J2WA 4ZB0A 3T8LA 3OYXA 1F7BA 2X1SA 5IXEA 3H2NA 3UP8A 2J4GA 4FX8A 1KW1A 3TYEA 8XIMA 3VFLA 2J7BA 1B3YA 5A6BA 4NZ1A 1X8FA 1EA0A 1M5WA 4H4IA 1H60A 4WY0B 1NTHA 3DG6A 3UZWA 3U3HA 4PN2A 2RGLA 1ZJHA 4ZQMA 3CHCA 1PWLA 1UD5A 2VMFA 3L7RA 2Z26A 3LX9A 4D6CA 4R3UA 4LOCA 2CLKA 1IE7C 5FD0A 3MPGA 2QULA 3QOMA 4W7VA 5D2WA 1PIFA 3IIVA 3ITXA 1AMYA 3D6NA 5I78A 3GAKA 2GL5A 4AUBA 4FPSA 2JK2A 1EO5A 4DJDA 2IMRA 1P4CA 3GLCA 1S5NA 2O9PA 3CM4A 1Q13A 1UZ4A 1BPLB 5AFDA 3OBKA 3S47A 4K8HA 4O15A 3R2GA 4D6IA 4FOJA 3S46A 1UD2A 5BRBA 4L61A 1J12A 4IUOA 4IIHA 3SB0A 3CZGA 5ABFB 2YW3A 3B97A 3NO5A 2E40A 2NLYA 3Q65A 2VOTA 3NO3A 4O1DA 4I7VA 2R1LA 4AU0A 1O12A 2XWEA 4W8BA 2BMBA 1R9XA 2VGBA 4FXJA 1GQLA 1V79A 1E0WA 3RJYA 5A8MA 4RE4A 4GNJA 3ABRA 3M0JA 1VPYA 1JGMA 2X40A 3ITVA 4C6QA 4FLOA 2C14A 5M2FX 1JUEA 4FSAA 3N6JA 4DWSB 4JHZA 2ZBTA 4IPLA 3BOXA 1HQTA 2GGEA 4B3KA 1SPQA 4AZIA 1T5AA 3WBYA 1AJ0A 4UMBA 3VIIA 3EPOA 4CNOA 4GXMA 1Y5XA 3O7UA 4UWMA 4FB7A 4XUGA 1W37A 4RV8A 5CG0A 3W7IA 4Z0JA 4FAMA 1AH3A 3SR7A 4U2YA 3FN9A 3PJTA 3B8UA 4B5NA 2NZLA 4FLRA 5EU9A 4WGXA 4KCTA 3SBFA 1F4AA 3LGEA 1EQPA 1HIZA 2V5DA 3EXTA 3WQ8A 3GDMA 5A6LA 1O1HA 4LAZA 4Y9AA 4AEFA 1HKMA 3FOKA 1RPXA 4KETA 3NL6A 2CCRA 1IXQA 3C2YA 3LNPA 1CGWA 1QU4A 4C90A 1Q85A 3R79A 1EZ2A 3TCSA 4XVEA 3G1AA 4URIA 3CHDA 1M1BA 1TTIA 3IJ7A 4H9VA 3AIRA 4LNYA 2VDHA 1MMFA 4V28A 4Q4PA 3Q4DA 1YIXA 3AAMA 3ZVHA 1FX6A 3P67A 3VZZA 3ES7A 3TW7A 3R7MA 2GOUA 1V08A 4CD6A 2OXNA 1XYFA 1KFJA 4ML4A 3UA4A 4B5SA 3D3AA 4GFSA 1TWWA 3CMGA 2CZVA 2IW0A 4M19A 4J3ZA 1B4KA 3UXKA 3HQPA 2A6LA 4GWEA 4OWGA 2QVNA 3WFAA 1VJSA 1I2RA 1QNPA 2WLYA 4XX6A 3QFWA 3TJ4A 2F2HA 4B5UA 1JYWA 3A23A 2QCCA 1VYPX 9XIAA 1H1YA 3AZSA 4HP5A 4S1FA 4ALDA 2Y24A 4PSRA 3ISIX 5HNTA 1TQJA 1E55A 3VOCA 1ICSA 3INPA 3AWOA 3IK2A 1WV2A 1VBHA 3NM3A 1E6PA 3FJNA 2VFHA 2DUAA 3VDCA 3DDMA 3BQ5A 1KA9F 3ATYA 1THFD 3N2OA 4KFOA 1JCLA 4X2PA 4U4MA 4W89A 1A5LC 1HUVA 4GJJA 4P5UA 5BU9A 5HINA 4HCDA 4LUSA 2VM8A 3GG8A 1N2VA 4H04A 5HNNA 3U9IA 2PDYA 4IPIA 1J10A 2Z00A 4DJED 3RIKA 3NGFA 1GGOA 1PHWA 2J8TA 5CCZA 4O1BA 1WBJA 4GIEA 3CQKA 1T99A 3KXQA 5K4ZA 3S6TA 3VKCA 5I23A 3FEQA 4Y2WA 3FK4A 4XZBA 3WH6A 3NVTA 1DQUA 1OFOA 1PEZA 5DX7A 1XH0A 3CC1A 2ZX6A 3BC9A 3GUGA 4XG1A 5CPNA 3UY7A 5J5RA 5LNSA 1D7FA 1TG7A 4RPQA 3WMSA 3DECA 3OZYA 4ZFCA 4JTRA 3AHYA 3BICA 1W3HA 2PP3A 3W24A 3W7EA 4F0RA 3VOHA 2PBGA 3EPNA 3RX4A 5D9PA 2OELA 4F8XA 4GD0A 1ZPTA 2ONEA 1PE1A 5C2XA 1GVFA 3E38A 1X39A 2HV5A 4ZO9A 4GPNA 2PGWA 1W5MA 1ENUA 1PIGA 1K9TA 1HGWA 2H6RA 3CZEA 3C8NA 2QCMA 1TX0A 1K7FA 3MY9A 5FL0A 3W29A 3WUFA 1TVPA 2DZTA 4RE2A 5B7ZA 2GDQA 4Q7IA 1LG2A 4Q8PA 4DJFC 4NJJA 2X41A 1DWGM 4IJRA 4F0SA 4LGXA 3M44A 4FOUA 4HA3A 5D4YA 3B03A 4RZBA 2G50A 5JBEA 2V5KA 3O16A 3P82A 3K1DA 3NPUA 4M6VA 2Y63A 4BJHA 4KWWA 4W93A 3ZYZA 1E3XA 1FH8A 1LUCB 4GX9A 4UNKA 1OYAA 1A5OC 1L6YA 2WKJA 2WQDA 4S23A 1YW1A 2UY2A 3O6DA 3V4BA 5EPDA 4LUYA 1EOKA 3DG7A 3GTHA 4D71A 1AL7A 4QS6A 3W4RA 3CLMA 4HTYA 3CTTA 4DO5A 1K8ZA 1A0DA 1UH4A 3H2CA 3BLFA 5EMKA 4AD1A 1SMDA 5KZ6A 1JF6A 2Q3OA 2ZTJA 1A3XA 5C70A 1DXFA 3IVUA 1A49A 4KRZA 1O95A 2VXNA 2EAWA 4I8DA 4PMUA 1RH9A 4PTXA 4UFJA 4RDZA 3BGJA 5F2LA 2WC7A 5LA2A 1L6GA 3OVGA 2YFNA 3UWVA 1KM6A 5G2WA 3VNLA 2O7SA 1SFJA 3S1WA 4DPQA 3GM8A 1TV4A 2VWTA 3MV01 1FDZA 4QJ1A 3AQUA 3P0XA 2ZRXA 2EG8A 2E6FA 7REQB 3ZJ8A 1V6UA 3WBXA 4GACA 4HK6A 5LYRA 2VEMA 4ZFMA 4FX7A 3PPGA 1Q8AA 3G6MA 1Z89A 4FP1A 3UWQA 1OYBA 3GSMA 1C8VA 1GKPA 2IKHA 4E4FA 1KRBC 3TAOA 1RBLA 1XFBA 2FZ8A 2ZXAA 2VGFA 3RRXA 3B8DA 1EZWA 2A7PA 4AH7A 2PMQA 1V3JA 5SWUA 2I5IA 3W7KA 3WLJA 1MUMA 2VCCA 2YIHA 3UEQA 3WY1A 2PDXA 4WOQA 1EJVC 3RLGA 1DXEA 4W7WA 3VE9A 2D2GA 1RZMA 5FA5A 2GGJA 1X6NA 5HULA 4IMEA 2WHLA 1T8QA 3LHUA 1NQKA 3I6RA 3M64A 4QRNA 3TQ0A 3PAJA 2PRMA 2VX6A 4YHGA 1F61A 3HGRA 3TWBA 3KW3A 1DHPA 4IGNA 3TN5A 4WY0F 2V81A 3A12A 2NX9A 1Q45A 2XVKA 2CXEA 4XD6A 3TW9A 3PBGA 1HO4A 4AVNA 3QOKA 4M82A 4R33A 4GGHA 4CEXC 2Y2WA 3M41A 3MKCA 2BVYA 1A5NC 2J78A 5I3GA 1GQNA 3SY1A 2CZDA 1VAHA 1HKVA 3ZMRA 3TEVA 1BWVA 2CBIA 2TYSA 4PUMA 2R24A 1Z6KA 1GKQA 2Z25A 3GTFA 4Q32A 1EJXC 3C86A 2GWNA 1F3EA 3H6OA 4W85A 1ONXA 3TVAA 3T78A 2HK1A 3WKZA 2XFRA 2W67A 3GNOA 4JYFA 3CASA 3NR0A 4IGHA 1FCUA 2AKMA 3OEXA 5FIPA 1OF8A 4ZQOA 3R1ZA 3L5AA 3KFTA 3PNZA 4DVOA 3E2QA 3DGRA 2ICSA 1SJDA 3F2CA 3CL7A 5DELA 3B9AA 1Q6FA 1BKSA 1GPWA 1ZUAX 1WXJA 1F6YA 2DSVA 3AHVA 2HVMA 5CBJA 3R0KA 2XFFA 1QPOA 1VBUA 4RDYA 2PUZA 3LD5A 2ZUUA 1XM3A 1FWCC 1VB9A 3MQTA 5EY5A 4D8ZA 1RBAA 1YXYA 3QQ1A 3JZUA 5EKYA 3N14A 1EGVA 1SU5A 3M6YA 3ZFHA 4KRTA 2YA1A 3CWHA 3LTSA 1R7AA 1LOQA 1Q63A 4H9TA 1GCYA 2A0NA 4MB4A 3KOZA 4QQ3A 4DBWA 3EKLA 4CQDA 1CNVA 3F4CA 1JUKA 1VEOA 4YTQA 3RCMA 3CZJA 3LA4A 4QXIA 1OC5A 3UXLA 3SAZA 1W3KA 4Q8VA 3VYLA 3UY8A 1DL3A 3P61A 2WPBA 3OHMB 3WNPA 3THDA 1ZCCA 2CC0A 5A69A 2CLEA 3GY1A 4ZE5A 4TX8A 1G5AA 1GOKA 4REQB 5C9UA 3AMLA 3IV3A 1QHPA 2BWGA 2OODA 1AQ0A 4YNGA 3F4VA 5AYXA 2JKEA 3GHSA 3OVRA 2D0GA 5DQPA 1C29A 1Q6EA 4JOMA 3I3EA 3NZ1A 4LTSA 3U0HA 3WQCA 4C6OA 4BY3A 1QI4A 1P0KA 1XW8A 3ZT7A 1UIOA 3LPPA 3TLQA 3LEPA 2PEVA 2WKGA 3M0YA 3MKKA 4NT0A 4DZIA 2X1IA 4J2MA 1ZSXA 3T2QA 3KL5A 6TAAA 1PUDA 3CPRA 1TZ9A 4DBSA 1W5PA 4Q8MA 3TX9A 1KFKA 4WXZA 3WNNA 2OX4A 4IMFA 1LCOA 5H91A 3THCA 3WIJA 3P14A 3KDNA 3U6WA 4AW7A 3ITCA 3BMXA 2Y85A 4F79A 1YPXA 4MWAD 3ITOA 4LVAA 4XTIA 4HSHA 3RR4A 4UTTA 4IJCA 3LLDA 2V2DA 3N4AA 2PFHA 2V8ZA 5CZSA 1V3IA 1XYCA 1Q66A 3SSZA 3S5OA 3BURA 2YW4A 4GCAA 1XLHA 3RK8A 2HJPA 3RLVA 4D6GA 3L4WA 1WZKA 1XIDA 1IXNA 3W7HA 3SCWA 1GVOA 5FF7A 2FVMA 1OGBA 2YDQA 5CPQA 1A5KC 2CHRA 3A4JA 3HGJA 1ZJIA 1GTHA 4LQ1A 1K70A 3A4WA 4R5EA 3U7BA 3CS2A 3SRKA 1LDCA 5G4EA 4PMJA 2YLAA 3BVJA 1E51A 4IICA 1LL6A 4KW2A 1ZHAA 4AISA 2VJXA 1SZFA 5TNVA 3HPSA 5FJUA 4UTLA 2VX5A 3IACA 3M6DA 5GQBA 4IXXA 5HPOA 3SQMA 4QFUA 1XLCA 3URBA 4OOZA 1FWFC 4F2TA 3IUDA 3EB3A 4UR7A 2P0IA 3RDKA 4DXKA 2A1YA 2CWNA 3B4YA 4C60A 4XKYB 4GIRA 2WNNA 1OCNA 2ASHA 1Q6RA 1AQFA 3W53A 4Q8OA 3G1SA 3GVQA 4JX5A 2PB1A 1GHSA 1DORA 1W5NA 1YRRA 2E09A 4E5TA 4AD0A 3EX3A 2WMIA 1EJUC 2X8RA 2WVTA 1UWQA 2PP0A 1VR6A 4MWAE 3O9NA 4EKJA 3TH6A 3PHAA 2IPGA 1E4MM 4X22A 3DKJA 3IVSA 3T9PA 1LWHA 2OLAA 5CC3A 2ZTKA 1R9YA 4NZ3A 3U2EA 3WJSA 1XDLA 4ACZA 1WDWA 1Q6LA 3STFA 7TIMA 2CZEA 1E4IA 1U5HA 2OZ8A 3DEQA 4AF0B 2LLEA 4KRUA 2JIEA 4EXAA 1YTKA 2C6QA 3WF0A 2E5BA 3G24A 3KEHA 3BW2A 3P62A 4BI5A 3A24A 3S2CA 2PC8A 4KEVA 2DIKA 2ZXBA 3O6YX 5L9FA 2Y8UA 4F0HA 1RVKA 4D1IA 3ZXWA 2CETA 3VOJA 3WEZA 2DT1A 4CN6A 1UC5A 2GJRA 1V6TA 3ARXA 3EDDA 3OA5A 5BOFA 2PD5A 3R25A 3N2BA 3V0TA 3EXSA 3UU0A 4I7UA 4H41A 1R7OA 4FR6A 1QO5A 3EZ4A 4NUWA 2O9TA 3FFSA 4L6DA 2ABAA 2GUBA 3TMQA 2WANA 3MV11 1FP9A 3UG5A 3A4XA 3V5FA 2X1TA 2ZDSA 3T42A 1EDQA 3N6HA 4M6QA 1GVIA 2E6DA 4BQ4A 4KWVA 4IT1A 3CV1A 3AYTA 5DT7A 3WLTA 4C5ZA 3W22A 3WQ5A 1XIFA 2CLFA 3QZ6A 2BDQA 2VEPA 4A8NA 1Q6QA 3PM6A 4GUJA 1EYWA 2X42A 2J66A 3L67A 1RLCL 2XSBA 2A7NA 3N18A 1J79A 2VD9A 1AJZA 4UMAA 2Y70A 3BQ6A 2Z7GA 1V6WA 1E43A 4J28A 3FHAA 2QAPA 2GFTA 1UZHA 1B2YA 4OQVA 1YE6A 3EA1A 4IIBA 4Z2HA 5T26A 5IFPA 1BXBA 1TPB1 3NFUA 5D09A 1W1B1 1YDYA 1LBLA 2I16A 4W86A 1IT7A 4DM1A 1JQVA 4MNKA 1SZNA 2POTA 1TPFA 2W0UA 3D47A 3NPVA 2OSWA 1XIBA 3UXIA 4IIFA 4XSLA 2V0TA 1H41A 3P84A 3CPUA 1U30A 4AAJA 4DPPA 5TQLA 3OBAA 2V3EA 1BTCA 1Z32X 5LHFA 3W76A 2A85A 2CLPA 4XBSA 2Z28A 1TPH1 1TV8A 1RPKA 3SO7A 3LM3A 1GYNA 4B92A 3LYEA 4DNHA 2WJDA 4JFWA 4F40A 2GQ3A 2G8ZA 2DSKA 1KCLA 3MYOA 3C3UA 4AIUA 4B90A 3GTIA 1XYLA 1KM3A 3W1NA 3WQFA 3S6OA 2H9AB 4RE3A 3FYYA 1ZS2A 2FTWA 3W1TA 3MB9A 1U1HA 4O1AA 3JU2A 3ARRA 4WJ8A 4D6EA 4AD3A 3WZ0E 4UTWC 3KCLA 1FFQA 4GYPC 2V3FA 2ZIDA 1W1ZA 2NWRA 3BOLA 3FCPA 4QDMA 2P53A 5K9CA 3FLUA 3GR4A 5G1MA 2Z2UA 1MUCA 4ZMGA 3CHEA 3T2OA 1E70M 1EHNA 5AYYA 3F4DA 2BOFX 1T41A 2GYIA 3NXLA 3VKJA 5EYWA 1EDGA 4MDOA 2QHAA 3PSVA 4W4QA 4YJ5A 5LXEA 4ATWA 1ODUA 2VFEA 1PCKA 3EX2A 3LN3A 3SCNA 2FMOA 1RP9A 1KKRA 2QCDA 1OABA 2VZTA 3W84A 1BHGA 1TCDA 5GPRA 3B9EA 4QAIA 4L4LA 2XZ7A 1OF6A 3WDQA 2GWGA 2ZRYA 1T96A 2I9UA 3ZR6A 2BY0A 4MKVA 2J9YA 2XVLA 3TR2A 1JZ6A 1H09A 2PWGA 2QDEA 3M0MA 4K68A 3I6EA 3PPFA 2UY3A 3S9YA 2ACUA 1S38A 3QJAA 4CUCA 4U3CA 3CBWA 3FJLA 2VVSA 3TTOA 4US5A 2H3BA 4EF8A 3IJLA 5CC5A 1NWRA 1GEHA 4ZODA 3WF1A 1M7XA 3VIGA 1R2RA 3NOEA 3QC0A 3VU2A 3H24A 4ZOAA 2YXOA 5BXSA 4E8CA 4FNSA 1GW1A 2CZFA 2GJXA 5DO8A 5LIUX 1HVQA 2EXOA 3W6LA 2WMFA 2B4GA 2QCLA 4MAZA 3KOWA 1EIBA 2QMKA 4ML9A 3Q37A 2ZE3A 1JCTA 4RNHA 2G4FA 1O7AA 1S3TC 1SZEA 3H53A 1WDPA 2PS2A 3QV6A 2PGFA 2ZWYA 3W82A 8TIMA 2ZOXA 1Z48A 1RQEA 4LNCA 4I7WA 1GKRA 2Y62A 4IPNB 1RA0A 1SQ7A 1UPMB 4R7WA 1PZ2A 2FZMA 5EFFA 1MW1A 2NV1A 3I3BA 4AZ6A 4S2CA 2A4AA 3A3HA 4BI7A 2VC5A 4NF7A 2P76A 4ZA0A 3PJWA 3TOPA 4ACYA 3NAVA 3KRSA 2QDGA 3CK5A 4HHPA 4DJDC 4OJYA 2GK1B 1K9EA 2XN0A 5DY2A 1ME7A 3SCPA 3AMDA 1XPGA 5E93A 4WSJA 1KXVA 2J62A 1C90A 3RG6A 1GTEA 5CJNA 4IH3A 4IQJA 1AVAA 4Q8UA 2QNEA 3FEMA 2RDTA 3R13A 3OGRA 4IM4A 1LP6A 2OG9A 1EWEA 1L2UA 3TNBA 2ATSA 4DZHA 3I7SA 4Q4MA 2EPOA 3EB4A 2PGEA 1QATA 3VC6A 2QS8A 4UQAA 2OU4A 3OU8A 5JQ9A 3R4IA 1B31A 3AXKA 4WY0A 3E9AA 4C6MA 3QM3A 4L1WA 3HG5A 2XTKA 3LU2A 3IJIA 4HKPA 2GZXA 2FB2A 4NYUA 3EX1A 1MXSA 1Q7QA 5A2BA 1G7VA 1X1OA 2F6XA 1BSIA 4NJIA 4O28A 4U33A 1XPYA 4OUIA 4L4MA 3LENA 4N2YA 3LTYA 3AFBA 2V68A 1TA3B 3SGZA 3GUWA 1CT5A 3QXBA 4RDWA 4PR4A 3ZS4A 3BLOA 3OOQA 1ISXA 1QT1A 1KKOA 1XKJA 4LS0A 3AWNA 1B3VA 3QFEA 4GY0A 2BS9A 1D9EA 1XH1A 4GCXA 1XRVA 1ZJBA 1X7FA 3B0VC 2Z2BA 4HPGA 2I9EA 2QIIA 3PZNA 1QVBA 2D0FA 5ABFA 1ZJAA 5LA0A 4UCGA 1WUFA 3ABZA 3JRKA 4Y9PA 3WJXA 3PAOA 2OB3A 3M5YA 4TTGA 1JUBA 4X9YA 3SY5A 1XBVA 3TYUA 1GOMA 1BYCA 4XUYA 3NL2A 3AHZA 4EWJA 2VZOA 4UC5A 2AQOA 2HXTA 4FA3A 1OB0A 1QNOA 4QROA 1QCWA 3TSBA 3MTWA 3BUVA 1B54A 1M04A 1D3HA 2Z1WA 4CNNA 5G5IA 1U83A 4CEUC 2VT0A 2Q09A 3B8SA 4MUZA 1RP8A 2F6KA 2OZ0A 4GJIA 2NVCA 4N4PA 5FEPA 4RNIA 1OCBA 1WZMA 3CT7A 3WQDA 1TRIA 3H8AA 4CQBA 4IG2A 4RR4A 1B1YA 4M7SA 3BMVA 2WCSA 1W3TA 3HIJA 3IIOA 1HGYA 2XIOA 1A80A 2FPTA 3WNMA 4O52A 4DWSD 4HGXA 1KM4A 3GR8A 1XRFA 5LNVA 3AC0A 2GSHA 2BGQA 1KGWA 3HFTA 1KM2A 1LRNA 2VELA 5I5RA 3IGSA 5JH2A 2E5DA 1GZJA 2MUCA 1KWGA 3NZPA 3OGVA 1WAUA 5LIXX 2G96A 3D3FA 1A5CA 1J93A 3WLQA 4QCEA 2ALRA 2PC4A 1NM9A 4IQLA 3PANA 1E1CB 3DFHA 1A50A 2QUMA 4ZQPA 3DYPA 1KFCA 4YVVA 4QM1A 2GGIA 4AIBA 1NFBA 5FEWA 4BF7A 1B5TA 3BV4A 1EOMA 3E12A 1I0DA 2UY5A 2WVUA 4KEZA 1TUFA 3ARZA 3WH8A 1W54A 1HL8A 3E0VA 4RKAA 4AX7A 3RPDA 4XZLX 1R3VA 4YTRA 3H55A 4AHOA 5E9XA 4GYJA 3M0VA 4HK7A 4RDVA 1WOAA 5HUOA 3ZJ6A 2AGKA 4FK9A 2F38A 5DY3A 1NWTA 3GDBA 4A29A 4TV5A 3GC4A 4IGSA 2B81A 3OODA 3K4AA 2VFDA 2WQPA 5REQA 5JU6A 3UD6A 5E6ZA 4M1RA 4P7LA 3IS4A 3PPCA 2D2JA 4G5DA 3H23A 1SO5A 2F2KA 3M0XA 3MUXA 1W3IA 3RAOA 4JTTA 3TKFA 4XZIA 1UG6A 3SUWA 3MHFA 1OCQA 3VAVA 1B57A 1RA5A 1UR2A 4S3DA 2HZGA 3CQHA 5J5DA 4JQ3A 4ZOEA 3IAPA 5CPSA 3MVIA 2QKFA 3H7VA 4M80A 1FTXA 1A5AA 1WKFA 3W88A 4LVGA 3WJZA 4HYRA 4GGBA 3H2FA 1R6WA 2NV9A 3TTSA 1E9LA 1VZWA 3AIQA 1AH4A 3G77A 1YXDA 5D9OA 1NFGA 3KTSA 3QSRA 1W9VA 4JICA 3G1VA 4B15A 1PZ1A 4AWEA 1E5JA 8A3HA 1E71M 2A2IA 2RAGA 1OX4A 5C6MA 1DPMA 5HAOA 4LSBA 2P50A 2DFAA 1JVNA 2EF9A 4Z17A 1XH2A 4PMRA 2WVVB 1P1XA 1X38A 2V38A 4RPPA 1BVWA 2ZKMX 1V7YA 1CX9A 3MZ2A 4L1XA 4JCMA 3LHWA 2B0MA 1R2SA 3GVVA 4M0XA 4M81A 1P6CA 4G7EB 3G5EA 3TA9A 2WB5A 3MVTA 4LS2A 3UGRA 1NARA 4V27A 4IIDA 1PS9A 3J7HA 1UR3M 5F4WA 3HG4A 1PKLA 3UG4A 3F4WA 2CLHA 1M53A 3ZR4A 2Y1HA 2FPYA 2PTWA 4QLLA 4JTDA 3CL6A 4GC4A 2V5LA 5HUPA 2YX0A 2DZAA 3OG3A 3NDYA 1VEMA 2ZA2A 4P8UA 3Q58A 1FXPA 3Q67A 3GXNA 4R88A 2YCLB 3HBLA 3IJ8A 5EBUA 3A21A 3QLDA 1YYAA 5DCEA 3E6EA 4X2RA 3W2UA 4YPJA 1R85A 1DKWA 5FEZA 3AUOA 1S5VA 1ZRQA 3F2BA 3GD6A 3HJZA 3FKRA 3BOFA 1TPUA 3UNDA 3OLGA 4PUJA 3THQA 4NAFB 2OZTA 1V93A 1P7TA 3ATZA 4CNUA 2EPLX 3ITLA 4V1YA 1DWHM 1DE5A 3W38A 1UMYA 4NXKA 4HNOA 4QISA 1VC4A 3HQNA 4XD5A 3C0LA 1S46A 2EG6A 1POJA 1E6NA 4IL2A 3LHTA 2VEGA 5HMSA 4S2BA 2BLEA 3ORWA 2AQVA 2QPXA 3PZMA 5RUBA 2WJEA 3MI3A 4IF2A 4GISA 5A2CA 5DT5A 3BCDA 5FJRA 3AROA 2J7CA 3MI6A 5A6SA 2DV0A 3N11A 3PN8A 3CB3A 2VR2A 3CUXA 3K4DA 3ZT5A 2OYLA 2FKPA 2WYSA 3QPZA 2IUZA 5BXPA 1QI3A 3F7JA 3RJXA 5DXXA 4R34A 4AZBA 4FO4A 1NDVA 2PE4A 3AI0A 1K4HA 3W7NA 4AIEA 2ZUTA 4NRRA 3DHPA 1TPDA 4PB4A 2DW7A 3LLFA 4UTKA 2HE8A 1MXGA 2Z27A 3LOTA 1X98A 1KCKA 7REQA 3BTNA 4MG4A 2HPIA 2W92A 3CV2A 5LNRA 4CLMA 1W1PA 3RMEA 1OFBA 1XINA 4MYAA 2HDJA 4LANA 3KX6A 3UA3A 3DHDA 3KVLA 3C61A 3M0ZA 5H8PA 1TJPA 2V6AA 3PR2A 2OSYA 1CENA 3E96A 1LORA 3RF9A 3LLXA 2YL9A 5M1TA 5FJPA 1XYBA 1FFRA 3SUTA 2YYTA 4R9OA 5HQLA 4IFKB 2AOSA 4O1EA 4D72A 1HVXA 1O5RA 2EEXA 4G56A 3OO2A 1MW0A 3W81A 4NZCA 2CW6A 3GNPA 4G7FA 4PA8A 2A21A 3S5YA 4NXSA 3LG3A 1BRLB 3GH5A 4QG6A 1NOUA 4C1KA 1KM5A 2DZXA 1R47A 3TTYA 3AJXA 3ITYA 1MDLA 2WSYA 4JTJA 2XVPA 4OKDA 4GVGA 1HNYA 3WLKX 4EVZA 3PFRA 1ALDA 3UPMA 2V5BA 4N9CA 2DT0A 1HJSA 1RSCA 2YCJA 3R89A 3NWRA 3S1UA 1LLOA 5D04C 1W1A1 2OCZA 1IWBA 3E5BA 4L6HA 3MUZ1 2Z1KA 4BFAA 8RUCA 4D8AA 2B31A 4PFHA 3GYCA 1DTUA 1LM1A 3NM1A 4CCZA 2VGGA 2GSEA 4HHLA 4A8LA 2NSOA 4WVXA 2ZUVA 3NVDA 4TVUA 4AYSA 4JIQA 3DENA 1B3XA 1NSJA 2C0AA 2E0PA 1XF0A 2I14A 3JVAA 3CUHA 3VM7A 4QSFA 1BLIA 2WBKA 3EWZA 1QW7A 4KWSA 4E2OA 2HEJA 3KVJA 1JCJA 5MF5A 4O1CA 4F0LA 1EFZA 3M0KA 4PMQA 2CBJA 3LM7A 3WH9A 3C3NA 4HYWA 3Q2DA 4MY8A 4WZHA 5C0QA 3V3WA 1Q6OA 2WSQA 1FWAC 4UFHA 2JEPA 3QPYA 5KZDA 4HZ7A 3BSHA 2ZX7A 3ZIZA 3UJFA 2AGTA 5CGMA 4PL1A 3ALGA 2QIWA 3VI2A 1JF5A 3I7RA 4XAZA 4YXGA 4EXQA 1Z44A 1BVNP 3BAIA 3NSMA 4PMYA 4WLCA 1ICPA 2W79A 4MB5A 3PWAA 1T6MA 3LNMA 4GOAA 3U4AA 4EK7A 3WO8A 2FGBA 5FESA 3WD0A 4DO4A 1LWJA 1PBGA 1K8CA 4XO7A 1QHZA 4IXHA 1RY8A 1HG3A 1WOBA 4PEKA 1S5TA 3L0KA 3SURA 3VABA 4C6CA 4DUOA 4FIRA 4AZCA 3B9OA 2XVGA 3REQB 3PWGA 1UMLA 1V0LA 3MS8A 4GUFA 1US3A 3EKZA 1HP4A 1LOLA 2DH2A 4GG9A 3KDOA 5FSDC 4S3AA 1EP3A 3W0KA 4UTTC 1TRDA 3II1A 2FLIA 3EOSA 5E0CA 3P5ZA 2J75A 4A22A 3GBEA 5HNUA 4NKCA 3POHA 4REQA 2WOQA 1G01A 1ZY9A 2OLHA 3CUZA 5CJMA 5MKGB 1A53A 4J7RA 4Z1YA 2WMHA 4JX4A 1OFPA 1W9BM 3LMYA 5BU6A 3AS2A 3PJXA 1HFBA 1FWJC 3URAA 4HZMA 1CEOA 3TROA 3V16A 5BRPA 3A4AA 3S1XA 1UKSA 5I03A 3KCJA 3L5LA 4HSOA 4WJXA 2JKPA 3K8KA 3RHGA 3WLHA 3LBCA 3C2VA 4JAWA 4K36A 3L21A 3V0UA 4GYFA 3BH4A 3MZNA 4IL0A 1OHLA 1VLIA 1VBRA 2Y88A 3IVTA 1XGDA 2VEKA 1AW1A 5K9XA 5BROA 3BW4A 1KRMA 4GRSA 4UQCA 1TPWA 4R85A 3K4WA 1E9ZB 2ODOA 4NASA 4A3RA 2VUYA 2F8QA 1NF7A 2YL8A 4ZB5A 2YA0A 3TN6A 4AEOA 1JD7A 4OTKA 2AAMA 4N42A 4OV9A 3VD4A 3WQPA 3IGUA 3VILA 4CQCA 2FHCA 4G6CA 2P3ZA 3C4UA 3IPWA 5CZ0A 4MPQA 1KV8A 3NQ8A 1VPXA 2PZ0A 3D0CA 2A6NA 1CCWB 3N15A 5G4WA 2XFYA 2X16A 4Q4QA 4Q7BA 3W87A 2GQ9A 1U5JA 1WNOA 4DX3A 1D8WA 3A9IA 2FMNA 3LCGA 1HTIA 4A6GA 3BV7A 5AB3A 4RW3A 2WSRA 1J9YA 5KZEA 2XINA 3LXAA 2V5JA 4NX0A 3RILA 5BXTA 2QV5A 2PDNA 4HU3A 3U4FA 2CIPA 3TLLA 3AALA 5CSRA 2TRSA 3VOFA 1XKYA 4CN4A 5A8OA 3T40A 3IJ9A 1DV7A 3EOLA 4V1XA 5G2HA 3MWAA 4ADTA 4DUVA 1SVDA 4H8NA 5GNXA 3GDKA 1IWAA 3KBMA 4DLFA 2JF6A 1MQQA 3PZ9A 4QJ4B 4OZOA 1KRCC 1EF2A 2G97A 2KX9A 2PSNA 1EJ7L 2NXHA 4W84A 1EB3A 1RD6A 3W2KA 4S39A 2O4MA 1XC6A 1CW2A 4X60A 5T91A 2HRWA 2X0SA 3RUBL 2PRHA 4O8AA 4LEQA 1CGYA 1KNWA 4LUTA 4AY7A 3TFXA 1B9ZA 2E5CA 4H9ZA 4WKAA 4AZGA 3TYCA 5FJTA 1MW3A 1GOIA 1NY1A 4B5TA 3ARPA 1E0TA 3UZZA 4FXFA 2X2GA 2XVNA 5G4HC 4FALA 1C9DA 3EEZA 4NYYA 4IX0A 2QW5A 3HV8A 2ACQA 5AHFA 1U1UA 1W0MA 2J7GA 1KD0A 1IZCA 3T0BA 2GLKA 1UQZA 1RQHA 1B9BA 1G4EA 1PX3A 4C91A 3G1RA 5ECUA 3N9KA 3DHFA 2Z1SA 3H2AA 4F0KA 1E6ZA 2YDAA 1H49A 4MJ4A 5FF4A 3QY8A 2O7QA 5EMYA 1UH3A 1GYLA 1UBPC 3BJSA 1J0IA 2YL5A 1OIMA 2XZ9A 4PRRA 2PDFA 1AK5A 4CNSA 1MWOA 3NUKA 3NZGA 3QMRA 3E0WA 5H1WA 2WHKA 4EWND 4AWTA 1SM9A 1R3QA 6XIAA 5FJIA 4DBUA 2H8XA 1C8QA 1FVPA 2DZBA 4JEQA 3W70A 4YVXA 2X1RA 1BTMA 3GFYA 1I60A 2J9ZA 1WA3A 4F66A 2OWXA 4Y8EA 5HQEA 4AD4A 3S4TA 1OBAA 5E9AA 4CU7A 5IHSA 1FWDC 1EP2A 1OFQA 2OGYA 3RPMA 4W87A 4LB3A 5PTDA 3TSMA 4YCOA 4TUFA 4LYRA 2Z6JA 4TO8A 2OFJA 3JS3A 2Q8ZA 3BAXA 4WHBA 1FH9A 2WO5A 5CZKA 4LAKA 2GSJA 3ERPA 4QP0A 2R94A 1ML1A 3O1NA 2HWGA 4B9ZA 2ISVA 2WMGA 1XGZA 3OVPA 4AVOA 4DYKA 3N3MA 4O18A 3GDLA 4FXSA 3DI1A 3B40A 4QGCA 4TV6A 3ZJKA 1DE6A 1RJRA 4B5VA 4GKLA 1KFEA 1XD0A 4LBSA 1V0KA 1IF2A 3VFCA 4ZBCA 3O3RA 3RMJA 1UR4A 3WF4A 1C7SA 4H7ZA 5EB8A 1OSEA 1XDJA 4MB3A 4HPHA 1FWGC 5ABGA 3KAOA 1VGAA 4KIEA 1A4MA 1UP0A 1SW7A 4E2DA 2C19A 1CXFA 1V0MA 2ZVIA 3A9BA 3QW3A 3QMSA 2QLYA 2JKAA 4GZJA 1PX8A 2FYMA 2VDIA 2CITA 5FJJA 3LBMA 1G9HA 2H90A 4XSMA 4XZ9A 2PDJA 1QBBA 1VD6A 1S3HA 1XC4A 2IQDA 2J88A 1W1YA 2E6AA 2VFGA 4U31A 4MY9A 3UF9A 3GXMA 4H9MA 3BZJA 3U8GA 4CQ8A 1SGJA 3O15A 4EOUA 3ARSA 3RLUA 4UCFA 2XIBA 4PMOA 1FY6A 5EGRA 3GHTA 4GVIA 3BG5A 1C8XA 1QUMA 3M4HA 1XXXA 3NXFA 3QTPA 4JTKA 2C8NA 4FEZA 4H8VA 3KVMA 1KCXA 3QHMA 1I2QA 3TMLA 3VCCA 3KS5A 1BAGA 2J24A 3GQYA 5AC8A 4LYQA 4MGGA 4GLEA 3VMNA 1DIOA 2ACRA 4Q4OA 4ROQA 1UPPA 5FACA 4UFIA 3WQGA 2QXWA 3W7DA 3WNKA 3NOYA 5B80A 3T05A 4O8RA 4QE4A 4IJBA 2PURA 3DFTA 4H1ZA 1M65A 2GQAA 1RAKA 3QKZA 3ZLGA 2HTMA 3N25A 4O13A 2OEJA 4ZOCA 2J77A 1QBAA 2W61A 4E3TA 4QR6A 4CNPA 2Y7FA 3MHGA 3K13A 3ZWSA 3HGSA 5LNUA 6ALDA 2ZZ4A 4IFRA 4MADA 2DJXA 3FNDA 2VEFA 4GJ1A 1E6RA 4HOXA 3EWWA 4UXDA 4JPGA 1KR0A 3W25A 3VNDA 4DI8A 1MW2A 1OJXA 2NVDA 3B0YA 4DAFA 3LCLA 4RK8A 4RJEA 1YX1A 3TQKA 1K9DA 4MNMA 3IUIA 4U3AA 3FX4A 1QW9A 1WPCA 2CLOA 4HQVA 4C7GA 1EUAA 3BWWA 4MYXA 4ERIA 1K77A 5TF0A 1CLVA 1YNPA 1AUSL 4MVAA 1Z3NA 4CCDA 1XS2A 3SI9A 3U2OA 4GZIA 4ADUA 3AYRA 1JZ5A 3BZGA 1S2VA 4UBPC 4GO9A 2X2YA 1G1YA 1A3HA 2DH3A 3OVQA 3VNKA 4C7FA 2XGIA 5A3HA 5BYWA 2HVOA 4GINA 1PAMA 5CSSA 4EX4A 4XAYA 2JQXA 3TTEA 3P93A 4LAOA 2I5QA 2IXVA 1QW8A 5M17A 3NQAA 4JKMA 4NJGA 2PWVA 2P10A 1TIMA 4L80A 1KBKA 5AZ1A 4ZR8A 4W9TA 1VF8A 4IISA 4GYKA 3AJ7A 3SCQA 1RCQA 2V82A 1HZYA 3WUEA 1KTNA 3G6LA 1WDDA 2XHYA 2WZMA 2NQLA 5BWAA 4WDTA 3MI2A 3CUJA 5D2TA 4N4QA 1TMQA 2HPMA 1ZP4A 3EXRA 3RCNA 4PBGA 4CCCA 3P60A 2PLCA 2WBGA 3ZVHB 3KBWA 1TPEA 1TSIA 2YZRA 3LCHA 1V5XA 1JGIA 3TNOA 4NNBA 4PMDA 5BNKA 3AUJA 3T0TA 3SQLA 4JQ2A 1LF1A 2BFGA 3TDFA 4MLRA 1UBSA 1DP0A 3N6QA 4TX6A 1Z7AA 4YTSA 3B9NA 3WMCA 1UR8A 3W00A 1A47A 1FQ0A 3KOFA 3SCVA 1FCVA 5BWFA 3KP0A 3FYOA 5AHNA 5FJOA 1PZ3A 2V69A 4OVXA 4ZQCA 3USBA 2JGYA 3MBDA 4NIRA 3AHXA 5IDIA 1ZBCA 1US0A 2C16A 4B16A 1B4EA